data_2JNG
# 
_entry.id   2JNG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2JNG         pdb_00002jng 10.2210/pdb2jng/pdb 
RCSB  RCSB100052   ?            ?                   
WWPDB D_1000100052 ?            ?                   
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          HT1 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JNG 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-01-23 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lemak, A.'                                       1 
'Kaustov, L.'                                     2 
'Lukin, J.'                                       3 
'Duan, S.'                                        4 
'Arrowsmith, C.H.'                                5 
'Northeast Structural Genomics Consortium (NESG)' 6 
# 
_citation.id                        primary 
_citation.title                     
'The Conserved CPH Domains of Cul7 and PARC Are Protein-Protein Interaction Modules That Bind the Tetramerization Domain of p53' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            282 
_citation.page_first                11300 
_citation.page_last                 11307 
_citation.year                      2007 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17298945 
_citation.pdbx_database_id_DOI      10.1074/jbc.M611297200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kaustov, L.'      1 ? 
primary 'Lukin, J.'        2 ? 
primary 'Lemak, A.'        3 ? 
primary 'Duan, S.'         4 ? 
primary 'Ho, M.'           5 ? 
primary 'Doherty, R.'      6 ? 
primary 'Penn, L.Z.'       7 ? 
primary 'Arrowsmith, C.H.' 8 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Cullin-7 
_entity.formula_weight             12013.217 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'sequence database residues 360-460' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CUL-7 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSHMRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE
DIEDMVEADEYQGAVASRVLGRALP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSHMRSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEE
DIEDMVEADEYQGAVASRVLGRALP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         HT1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   ARG n 
1 6   SER n 
1 7   GLU n 
1 8   PHE n 
1 9   ALA n 
1 10  SER n 
1 11  GLY n 
1 12  ASN n 
1 13  THR n 
1 14  TYR n 
1 15  ALA n 
1 16  LEU n 
1 17  TYR n 
1 18  VAL n 
1 19  ARG n 
1 20  ASP n 
1 21  THR n 
1 22  LEU n 
1 23  GLN n 
1 24  PRO n 
1 25  GLY n 
1 26  MET n 
1 27  ARG n 
1 28  VAL n 
1 29  ARG n 
1 30  MET n 
1 31  LEU n 
1 32  ASP n 
1 33  ASP n 
1 34  TYR n 
1 35  GLU n 
1 36  GLU n 
1 37  ILE n 
1 38  SER n 
1 39  ALA n 
1 40  GLY n 
1 41  ASP n 
1 42  GLU n 
1 43  GLY n 
1 44  GLU n 
1 45  PHE n 
1 46  ARG n 
1 47  GLN n 
1 48  SER n 
1 49  ASN n 
1 50  ASN n 
1 51  GLY n 
1 52  VAL n 
1 53  PRO n 
1 54  PRO n 
1 55  VAL n 
1 56  GLN n 
1 57  VAL n 
1 58  PHE n 
1 59  TRP n 
1 60  GLU n 
1 61  SER n 
1 62  THR n 
1 63  GLY n 
1 64  ARG n 
1 65  THR n 
1 66  TYR n 
1 67  TRP n 
1 68  VAL n 
1 69  HIS n 
1 70  TRP n 
1 71  HIS n 
1 72  MET n 
1 73  LEU n 
1 74  GLU n 
1 75  ILE n 
1 76  LEU n 
1 77  GLY n 
1 78  PHE n 
1 79  GLU n 
1 80  GLU n 
1 81  ASP n 
1 82  ILE n 
1 83  GLU n 
1 84  ASP n 
1 85  MET n 
1 86  VAL n 
1 87  GLU n 
1 88  ALA n 
1 89  ASP n 
1 90  GLU n 
1 91  TYR n 
1 92  GLN n 
1 93  GLY n 
1 94  ALA n 
1 95  VAL n 
1 96  ALA n 
1 97  SER n 
1 98  ARG n 
1 99  VAL n 
1 100 LEU n 
1 101 GLY n 
1 102 ARG n 
1 103 ALA n 
1 104 LEU n 
1 105 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'CUL7, KIAA0076' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               'pet 15b' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CUL7_HUMAN 
_struct_ref.pdbx_db_accession          Q14999 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RSEFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNNGVPPVQVFWESTGRTYWVHWHMLEILGFEEDIED
MVEADEYQGAVASRVLGRALP
;
_struct_ref.pdbx_align_begin           360 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JNG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 5 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 105 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14999 
_struct_ref_seq.db_align_beg                  360 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  460 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       5 
_struct_ref_seq.pdbx_auth_seq_align_end       105 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JNG GLY A 1 ? UNP Q14999 ? ? 'cloning artifact' 1 1 
1 2JNG SER A 2 ? UNP Q14999 ? ? 'cloning artifact' 2 2 
1 2JNG HIS A 3 ? UNP Q14999 ? ? 'cloning artifact' 3 3 
1 2JNG MET A 4 ? UNP Q14999 ? ? 'cloning artifact' 4 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  1 '3D CBCA(CO)NH'   
1 4  1 '3D HNCO'         
1 5  1 '3D HNCACB'       
1 6  1 '3D HBHA(CO)NH'   
1 7  1 '3D H(CCO)NH'     
1 8  1 '3D HCCH-TOCSY'   
1 9  1 '3D 1H-15N NOESY' 
1 10 1 '3D 1H-13C NOESY' 
1 11 1 '3D H(CCO)NH'     
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      250 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298.15 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
'25 mM TRIS, 250 mM sodium chloride, 55 mM H2O, 0.5 mM PMSF, 0.5 mM TCEP, 1 mM Benzamidine, 90% H2O, 10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker AVANCE 1 'Bruker Avance' 
600 Bruker AVANCE 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.entry_id           2JNG 
_pdbx_nmr_refine.method             'molecular dynamics' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2JNG 
_pdbx_nmr_details.text       'The structure was determined using a combination of NOE and HN residual dipolar coupling data.' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JNG 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JNG 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution' CNS     1.1   1 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement           CNS     1.1   2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing           NMRPipe ?     3 
Goddard                                             'peak picking'       Sparky  3.106 4 
'Cornilescu, Delaglio and Bax'                      'data analysis'      TALOS   ?     5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JNG 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JNG 
_struct.title                     
'Solution structure of the CUL7-CPH domain from Homo Sapiens; Northeast Structural Genomics Consortium target HT1.' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JNG 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            
;p53 binding domain, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, GENE REGULATION
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 4  ? PHE A 8  ? MET A 4  PHE A 8  5 ? 5  
HELX_P HELX_P2 2 GLY A 11 ? LEU A 22 ? GLY A 11 LEU A 22 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 64 ? HIS A 69 ? ARG A 64 HIS A 69 
A 2 PRO A 54 ? TRP A 59 ? PRO A 54 TRP A 59 
A 3 GLU A 42 ? SER A 48 ? GLU A 42 SER A 48 
A 4 ARG A 27 ? MET A 30 ? ARG A 27 MET A 30 
A 5 LEU A 73 ? ILE A 75 ? LEU A 73 ILE A 75 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 66 ? O TYR A 66 N VAL A 57 ? N VAL A 57 
A 2 3 O PHE A 58 ? O PHE A 58 N GLU A 44 ? N GLU A 44 
A 3 4 O GLY A 43 ? O GLY A 43 N VAL A 28 ? N VAL A 28 
A 4 5 N ARG A 29 ? N ARG A 29 O GLU A 74 ? O GLU A 74 
# 
_atom_sites.entry_id                    2JNG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 4  ? 9.936  3.291   -17.084 1.00 0.00 ? 4  MET A N    1  
ATOM 2     C CA   . MET A 1 4  ? 9.887  2.569   -15.826 1.00 0.00 ? 4  MET A CA   1  
ATOM 3     C C    . MET A 1 4  ? 8.498  2.757   -15.214 1.00 0.00 ? 4  MET A C    1  
ATOM 4     O O    . MET A 1 4  ? 7.626  3.359   -15.839 1.00 0.00 ? 4  MET A O    1  
ATOM 5     C CB   . MET A 1 4  ? 11.011 3.097   -14.907 1.00 0.00 ? 4  MET A CB   1  
ATOM 6     C CG   . MET A 1 4  ? 11.226 2.302   -13.631 1.00 0.00 ? 4  MET A CG   1  
ATOM 7     S SD   . MET A 1 4  ? 10.508 3.113   -12.182 1.00 0.00 ? 4  MET A SD   1  
ATOM 8     C CE   . MET A 1 4  ? 11.481 4.608   -12.120 1.00 0.00 ? 4  MET A CE   1  
ATOM 9     H H    . MET A 1 4  ? 9.316  4.039   -17.227 1.00 0.00 ? 4  MET A H    1  
ATOM 10    H HA   . MET A 1 4  ? 10.057 1.525   -16.036 1.00 0.00 ? 4  MET A HA   1  
ATOM 11    H HB2  . MET A 1 4  ? 11.938 3.087   -15.455 1.00 0.00 ? 4  MET A HB2  1  
ATOM 12    H HB3  . MET A 1 4  ? 10.767 4.110   -14.635 1.00 0.00 ? 4  MET A HB3  1  
ATOM 13    H HG2  . MET A 1 4  ? 10.761 1.335   -13.756 1.00 0.00 ? 4  MET A HG2  1  
ATOM 14    H HG3  . MET A 1 4  ? 12.292 2.174   -13.471 1.00 0.00 ? 4  MET A HG3  1  
ATOM 15    H HE1  . MET A 1 4  ? 11.176 5.195   -11.277 1.00 0.00 ? 4  MET A HE1  1  
ATOM 16    H HE2  . MET A 1 4  ? 11.333 5.175   -13.034 1.00 0.00 ? 4  MET A HE2  1  
ATOM 17    H HE3  . MET A 1 4  ? 12.526 4.347   -12.023 1.00 0.00 ? 4  MET A HE3  1  
ATOM 18    N N    . ARG A 1 5  ? 8.268  2.224   -14.024 1.00 0.00 ? 5  ARG A N    1  
ATOM 19    C CA   . ARG A 1 5  ? 6.965  2.348   -13.352 1.00 0.00 ? 5  ARG A CA   1  
ATOM 20    C C    . ARG A 1 5  ? 6.570  3.826   -13.144 1.00 0.00 ? 5  ARG A C    1  
ATOM 21    O O    . ARG A 1 5  ? 5.390  4.159   -13.075 1.00 0.00 ? 5  ARG A O    1  
ATOM 22    C CB   . ARG A 1 5  ? 6.967  1.586   -12.024 1.00 0.00 ? 5  ARG A CB   1  
ATOM 23    C CG   . ARG A 1 5  ? 7.188  0.098   -12.178 1.00 0.00 ? 5  ARG A CG   1  
ATOM 24    C CD   . ARG A 1 5  ? 7.210  -0.619  -10.846 1.00 0.00 ? 5  ARG A CD   1  
ATOM 25    N NE   . ARG A 1 5  ? 7.631  -1.998  -10.997 1.00 0.00 ? 5  ARG A NE   1  
ATOM 26    C CZ   . ARG A 1 5  ? 8.401  -2.657  -10.118 1.00 0.00 ? 5  ARG A CZ   1  
ATOM 27    N NH1  . ARG A 1 5  ? 8.765  -2.065  -8.985  1.00 0.00 ? 5  ARG A NH1  1  
ATOM 28    N NH2  . ARG A 1 5  ? 8.780  -3.892  -10.376 1.00 0.00 ? 5  ARG A NH2  1  
ATOM 29    H H    . ARG A 1 5  ? 8.976  1.739   -13.563 1.00 0.00 ? 5  ARG A H    1  
ATOM 30    H HA   . ARG A 1 5  ? 6.230  1.900   -14.003 1.00 0.00 ? 5  ARG A HA   1  
ATOM 31    H HB2  . ARG A 1 5  ? 7.758  1.995   -11.403 1.00 0.00 ? 5  ARG A HB2  1  
ATOM 32    H HB3  . ARG A 1 5  ? 6.021  1.746   -11.537 1.00 0.00 ? 5  ARG A HB3  1  
ATOM 33    H HG2  . ARG A 1 5  ? 6.400  -0.312  -12.790 1.00 0.00 ? 5  ARG A HG2  1  
ATOM 34    H HG3  . ARG A 1 5  ? 8.142  -0.068  -12.667 1.00 0.00 ? 5  ARG A HG3  1  
ATOM 35    H HD2  . ARG A 1 5  ? 7.893  -0.103  -10.176 1.00 0.00 ? 5  ARG A HD2  1  
ATOM 36    H HD3  . ARG A 1 5  ? 6.212  -0.596  -10.413 1.00 0.00 ? 5  ARG A HD3  1  
ATOM 37    H HE   . ARG A 1 5  ? 7.356  -2.474  -11.816 1.00 0.00 ? 5  ARG A HE   1  
ATOM 38    H HH11 . ARG A 1 5  ? 8.463  -1.132  -8.771  1.00 0.00 ? 5  ARG A HH11 1  
ATOM 39    H HH12 . ARG A 1 5  ? 9.391  -2.547  -8.347  1.00 0.00 ? 5  ARG A HH12 1  
ATOM 40    H HH21 . ARG A 1 5  ? 8.508  -4.343  -11.222 1.00 0.00 ? 5  ARG A HH21 1  
ATOM 41    H HH22 . ARG A 1 5  ? 9.357  -4.385  -9.713  1.00 0.00 ? 5  ARG A HH22 1  
ATOM 42    N N    . SER A 1 6  ? 7.573  4.708   -13.054 1.00 0.00 ? 6  SER A N    1  
ATOM 43    C CA   . SER A 1 6  ? 7.357  6.150   -12.964 1.00 0.00 ? 6  SER A CA   1  
ATOM 44    C C    . SER A 1 6  ? 6.789  6.708   -14.293 1.00 0.00 ? 6  SER A C    1  
ATOM 45    O O    . SER A 1 6  ? 6.790  7.913   -14.534 1.00 0.00 ? 6  SER A O    1  
ATOM 46    C CB   . SER A 1 6  ? 8.672  6.849   -12.609 1.00 0.00 ? 6  SER A CB   1  
ATOM 47    O OG   . SER A 1 6  ? 8.465  8.195   -12.202 1.00 0.00 ? 6  SER A OG   1  
ATOM 48    H H    . SER A 1 6  ? 8.502  4.358   -13.035 1.00 0.00 ? 6  SER A H    1  
ATOM 49    H HA   . SER A 1 6  ? 6.642  6.336   -12.166 1.00 0.00 ? 6  SER A HA   1  
ATOM 50    H HB2  . SER A 1 6  ? 9.154  6.313   -11.817 1.00 0.00 ? 6  SER A HB2  1  
ATOM 51    H HB3  . SER A 1 6  ? 9.313  6.848   -13.480 1.00 0.00 ? 6  SER A HB3  1  
ATOM 52    H HG   . SER A 1 6  ? 8.415  8.770   -12.978 1.00 0.00 ? 6  SER A HG   1  
ATOM 53    N N    . GLU A 1 7  ? 6.318  5.796   -15.145 1.00 0.00 ? 7  GLU A N    1  
ATOM 54    C CA   . GLU A 1 7  ? 5.799  6.094   -16.469 1.00 0.00 ? 7  GLU A CA   1  
ATOM 55    C C    . GLU A 1 7  ? 4.716  7.166   -16.439 1.00 0.00 ? 7  GLU A C    1  
ATOM 56    O O    . GLU A 1 7  ? 4.437  7.799   -17.474 1.00 0.00 ? 7  GLU A O    1  
ATOM 57    C CB   . GLU A 1 7  ? 5.225  4.800   -17.046 1.00 0.00 ? 7  GLU A CB   1  
ATOM 58    C CG   . GLU A 1 7  ? 4.807  4.891   -18.491 1.00 0.00 ? 7  GLU A CG   1  
ATOM 59    C CD   . GLU A 1 7  ? 4.007  3.673   -18.909 1.00 0.00 ? 7  GLU A CD   1  
ATOM 60    O OE1  . GLU A 1 7  ? 4.629  2.651   -19.247 1.00 0.00 ? 7  GLU A OE1  1  
ATOM 61    O OE2  . GLU A 1 7  ? 2.763  3.727   -18.861 1.00 0.00 ? 7  GLU A OE2  1  
ATOM 62    H H    . GLU A 1 7  ? 6.332  4.858   -14.857 1.00 0.00 ? 7  GLU A H    1  
ATOM 63    H HA   . GLU A 1 7  ? 6.617  6.420   -17.106 1.00 0.00 ? 7  GLU A HA   1  
ATOM 64    H HB2  . GLU A 1 7  ? 5.975  4.031   -16.969 1.00 0.00 ? 7  GLU A HB2  1  
ATOM 65    H HB3  . GLU A 1 7  ? 4.365  4.518   -16.459 1.00 0.00 ? 7  GLU A HB3  1  
ATOM 66    H HG2  . GLU A 1 7  ? 4.208  5.775   -18.621 1.00 0.00 ? 7  GLU A HG2  1  
ATOM 67    H HG3  . GLU A 1 7  ? 5.686  4.960   -19.101 1.00 0.00 ? 7  GLU A HG3  1  
ATOM 68    N N    . PHE A 1 8  ? 4.098  7.369   -15.273 1.00 0.00 ? 8  PHE A N    1  
ATOM 69    C CA   . PHE A 1 8  ? 3.037  8.367   -15.109 1.00 0.00 ? 8  PHE A CA   1  
ATOM 70    C C    . PHE A 1 8  ? 3.503  9.745   -15.598 1.00 0.00 ? 8  PHE A C    1  
ATOM 71    O O    . PHE A 1 8  ? 4.702  10.003  -15.670 1.00 0.00 ? 8  PHE A O    1  
ATOM 72    C CB   . PHE A 1 8  ? 2.617  8.444   -13.644 1.00 0.00 ? 8  PHE A CB   1  
ATOM 73    C CG   . PHE A 1 8  ? 2.132  7.131   -13.111 1.00 0.00 ? 8  PHE A CG   1  
ATOM 74    C CD1  . PHE A 1 8  ? 0.831  6.706   -13.336 1.00 0.00 ? 8  PHE A CD1  1  
ATOM 75    C CD2  . PHE A 1 8  ? 2.977  6.313   -12.386 1.00 0.00 ? 8  PHE A CD2  1  
ATOM 76    C CE1  . PHE A 1 8  ? 0.391  5.502   -12.849 1.00 0.00 ? 8  PHE A CE1  1  
ATOM 77    C CE2  . PHE A 1 8  ? 2.541  5.100   -11.889 1.00 0.00 ? 8  PHE A CE2  1  
ATOM 78    C CZ   . PHE A 1 8  ? 1.237  4.691   -12.120 1.00 0.00 ? 8  PHE A CZ   1  
ATOM 79    H H    . PHE A 1 8  ? 4.363  6.829   -14.503 1.00 0.00 ? 8  PHE A H    1  
ATOM 80    H HA   . PHE A 1 8  ? 2.187  8.060   -15.705 1.00 0.00 ? 8  PHE A HA   1  
ATOM 81    H HB2  . PHE A 1 8  ? 3.468  8.755   -13.035 1.00 0.00 ? 8  PHE A HB2  1  
ATOM 82    H HB3  . PHE A 1 8  ? 1.831  9.163   -13.536 1.00 0.00 ? 8  PHE A HB3  1  
ATOM 83    H HD1  . PHE A 1 8  ? 0.161  7.340   -13.907 1.00 0.00 ? 8  PHE A HD1  1  
ATOM 84    H HD2  . PHE A 1 8  ? 4.003  6.640   -12.209 1.00 0.00 ? 8  PHE A HD2  1  
ATOM 85    H HE1  . PHE A 1 8  ? -0.627 5.183   -13.046 1.00 0.00 ? 8  PHE A HE1  1  
ATOM 86    H HE2  . PHE A 1 8  ? 3.209  4.474   -11.327 1.00 0.00 ? 8  PHE A HE2  1  
ATOM 87    H HZ   . PHE A 1 8  ? 0.884  3.739   -11.729 1.00 0.00 ? 8  PHE A HZ   1  
ATOM 88    N N    . ALA A 1 9  ? 2.547  10.619  -15.910 1.00 0.00 ? 9  ALA A N    1  
ATOM 89    C CA   . ALA A 1 9  ? 2.839  11.911  -16.560 1.00 0.00 ? 9  ALA A CA   1  
ATOM 90    C C    . ALA A 1 9  ? 3.928  12.685  -15.835 1.00 0.00 ? 9  ALA A C    1  
ATOM 91    O O    . ALA A 1 9  ? 4.854  13.201  -16.461 1.00 0.00 ? 9  ALA A O    1  
ATOM 92    C CB   . ALA A 1 9  ? 1.576  12.737  -16.644 1.00 0.00 ? 9  ALA A CB   1  
ATOM 93    H H    . ALA A 1 9  ? 1.615  10.382  -15.692 1.00 0.00 ? 9  ALA A H    1  
ATOM 94    H HA   . ALA A 1 9  ? 3.167  11.694  -17.563 1.00 0.00 ? 9  ALA A HA   1  
ATOM 95    H HB1  . ALA A 1 9  ? 0.805  12.150  -17.141 1.00 0.00 ? 9  ALA A HB1  1  
ATOM 96    H HB2  . ALA A 1 9  ? 1.767  13.634  -17.205 1.00 0.00 ? 9  ALA A HB2  1  
ATOM 97    H HB3  . ALA A 1 9  ? 1.248  12.982  -15.653 1.00 0.00 ? 9  ALA A HB3  1  
ATOM 98    N N    . SER A 1 10 ? 3.830  12.756  -14.519 1.00 0.00 ? 10 SER A N    1  
ATOM 99    C CA   . SER A 1 10 ? 4.841  13.424  -13.736 1.00 0.00 ? 10 SER A CA   1  
ATOM 100   C C    . SER A 1 10 ? 5.593  12.417  -12.870 1.00 0.00 ? 10 SER A C    1  
ATOM 101   O O    . SER A 1 10 ? 6.646  12.705  -12.310 1.00 0.00 ? 10 SER A O    1  
ATOM 102   C CB   . SER A 1 10 ? 4.182  14.508  -12.864 1.00 0.00 ? 10 SER A CB   1  
ATOM 103   O OG   . SER A 1 10 ? 3.410  15.377  -13.675 1.00 0.00 ? 10 SER A OG   1  
ATOM 104   H H    . SER A 1 10 ? 3.054  12.363  -14.090 1.00 0.00 ? 10 SER A H    1  
ATOM 105   H HA   . SER A 1 10 ? 5.553  13.888  -14.419 1.00 0.00 ? 10 SER A HA   1  
ATOM 106   H HB2  . SER A 1 10 ? 3.535  14.033  -12.136 1.00 0.00 ? 10 SER A HB2  1  
ATOM 107   H HB3  . SER A 1 10 ? 4.944  15.088  -12.345 1.00 0.00 ? 10 SER A HB3  1  
ATOM 108   H HG   . SER A 1 10 ? 3.968  15.745  -14.377 1.00 0.00 ? 10 SER A HG   1  
ATOM 109   N N    . GLY A 1 11 ? 5.059  11.197  -12.803 1.00 0.00 ? 11 GLY A N    1  
ATOM 110   C CA   . GLY A 1 11 ? 5.675  10.161  -12.000 1.00 0.00 ? 11 GLY A CA   1  
ATOM 111   C C    . GLY A 1 11 ? 5.296  10.265  -10.539 1.00 0.00 ? 11 GLY A C    1  
ATOM 112   O O    . GLY A 1 11 ? 5.681  9.428   -9.712  1.00 0.00 ? 11 GLY A O    1  
ATOM 113   H H    . GLY A 1 11 ? 4.261  10.996  -13.346 1.00 0.00 ? 11 GLY A H    1  
ATOM 114   H HA2  . GLY A 1 11 ? 5.353  9.192   -12.366 1.00 0.00 ? 11 GLY A HA2  1  
ATOM 115   H HA3  . GLY A 1 11 ? 6.741  10.235  -12.095 1.00 0.00 ? 11 GLY A HA3  1  
ATOM 116   N N    . ASN A 1 12 ? 4.526  11.304  -10.203 1.00 0.00 ? 12 ASN A N    1  
ATOM 117   C CA   . ASN A 1 12 ? 4.099  11.537  -8.829  1.00 0.00 ? 12 ASN A CA   1  
ATOM 118   C C    . ASN A 1 12 ? 3.095  10.479  -8.389  1.00 0.00 ? 12 ASN A C    1  
ATOM 119   O O    . ASN A 1 12 ? 3.012  10.147  -7.208  1.00 0.00 ? 12 ASN A O    1  
ATOM 120   C CB   . ASN A 1 12 ? 3.473  12.935  -8.647  1.00 0.00 ? 12 ASN A CB   1  
ATOM 121   C CG   . ASN A 1 12 ? 4.447  14.076  -8.960  1.00 0.00 ? 12 ASN A CG   1  
ATOM 122   O OD1  . ASN A 1 12 ? 5.292  13.965  -9.839  1.00 0.00 ? 12 ASN A OD1  1  
ATOM 123   N ND2  . ASN A 1 12 ? 4.336  15.158  -8.206  1.00 0.00 ? 12 ASN A ND2  1  
ATOM 124   H H    . ASN A 1 12 ? 4.260  11.938  -10.887 1.00 0.00 ? 12 ASN A H    1  
ATOM 125   H HA   . ASN A 1 12 ? 4.968  11.458  -8.203  1.00 0.00 ? 12 ASN A HA   1  
ATOM 126   H HB2  . ASN A 1 12 ? 2.634  13.032  -9.316  1.00 0.00 ? 12 ASN A HB2  1  
ATOM 127   H HB3  . ASN A 1 12 ? 3.143  13.047  -7.628  1.00 0.00 ? 12 ASN A HB3  1  
ATOM 128   H HD21 . ASN A 1 12 ? 3.652  15.173  -7.497  1.00 0.00 ? 12 ASN A HD21 1  
ATOM 129   H HD22 . ASN A 1 12 ? 4.947  15.906  -8.386  1.00 0.00 ? 12 ASN A HD22 1  
ATOM 130   N N    . THR A 1 13 ? 2.341  9.932   -9.341  1.00 0.00 ? 13 THR A N    1  
ATOM 131   C CA   . THR A 1 13 ? 1.396  8.870   -9.045  1.00 0.00 ? 13 THR A CA   1  
ATOM 132   C C    . THR A 1 13 ? 2.119  7.616   -8.586  1.00 0.00 ? 13 THR A C    1  
ATOM 133   O O    . THR A 1 13 ? 1.616  6.848   -7.777  1.00 0.00 ? 13 THR A O    1  
ATOM 134   C CB   . THR A 1 13 ? 0.557  8.541   -10.289 1.00 0.00 ? 13 THR A CB   1  
ATOM 135   O OG1  . THR A 1 13 ? 0.176  9.770   -10.949 1.00 0.00 ? 13 THR A OG1  1  
ATOM 136   C CG2  . THR A 1 13 ? -0.685 7.760   -9.904  1.00 0.00 ? 13 THR A CG2  1  
ATOM 137   H H    . THR A 1 13 ? 2.382  10.258  -10.258 1.00 0.00 ? 13 THR A H    1  
ATOM 138   H HA   . THR A 1 13 ? 0.735  9.221   -8.259  1.00 0.00 ? 13 THR A HA   1  
ATOM 139   H HB   . THR A 1 13 ? 1.141  7.945   -10.979 1.00 0.00 ? 13 THR A HB   1  
ATOM 140   H HG1  . THR A 1 13 ? -0.582 10.161  -10.477 1.00 0.00 ? 13 THR A HG1  1  
ATOM 141   H HG21 . THR A 1 13 ? -1.251 7.540   -10.798 1.00 0.00 ? 13 THR A HG21 1  
ATOM 142   H HG22 . THR A 1 13 ? -1.290 8.352   -9.230  1.00 0.00 ? 13 THR A HG22 1  
ATOM 143   H HG23 . THR A 1 13 ? -0.399 6.834   -9.422  1.00 0.00 ? 13 THR A HG23 1  
ATOM 144   N N    . TYR A 1 14 ? 3.322  7.434   -9.107  1.00 0.00 ? 14 TYR A N    1  
ATOM 145   C CA   . TYR A 1 14 ? 4.160  6.334   -8.712  1.00 0.00 ? 14 TYR A CA   1  
ATOM 146   C C    . TYR A 1 14 ? 4.565  6.503   -7.243  1.00 0.00 ? 14 TYR A C    1  
ATOM 147   O O    . TYR A 1 14 ? 4.511  5.557   -6.468  1.00 0.00 ? 14 TYR A O    1  
ATOM 148   C CB   . TYR A 1 14 ? 5.401  6.272   -9.614  1.00 0.00 ? 14 TYR A CB   1  
ATOM 149   C CG   . TYR A 1 14 ? 6.394  5.193   -9.246  1.00 0.00 ? 14 TYR A CG   1  
ATOM 150   C CD1  . TYR A 1 14 ? 6.033  3.858   -9.235  1.00 0.00 ? 14 TYR A CD1  1  
ATOM 151   C CD2  . TYR A 1 14 ? 7.701  5.522   -8.905  1.00 0.00 ? 14 TYR A CD2  1  
ATOM 152   C CE1  . TYR A 1 14 ? 6.959  2.866   -8.904  1.00 0.00 ? 14 TYR A CE1  1  
ATOM 153   C CE2  . TYR A 1 14 ? 8.620  4.546   -8.562  1.00 0.00 ? 14 TYR A CE2  1  
ATOM 154   C CZ   . TYR A 1 14 ? 8.241  3.220   -8.569  1.00 0.00 ? 14 TYR A CZ   1  
ATOM 155   O OH   . TYR A 1 14 ? 9.145  2.230   -8.233  1.00 0.00 ? 14 TYR A OH   1  
ATOM 156   H H    . TYR A 1 14 ? 3.657  8.071   -9.765  1.00 0.00 ? 14 TYR A H    1  
ATOM 157   H HA   . TYR A 1 14 ? 3.595  5.434   -8.815  1.00 0.00 ? 14 TYR A HA   1  
ATOM 158   H HB2  . TYR A 1 14 ? 5.096  6.110   -10.627 1.00 0.00 ? 14 TYR A HB2  1  
ATOM 159   H HB3  . TYR A 1 14 ? 5.915  7.224   -9.564  1.00 0.00 ? 14 TYR A HB3  1  
ATOM 160   H HD1  . TYR A 1 14 ? 5.023  3.577   -9.510  1.00 0.00 ? 14 TYR A HD1  1  
ATOM 161   H HD2  . TYR A 1 14 ? 8.004  6.557   -8.892  1.00 0.00 ? 14 TYR A HD2  1  
ATOM 162   H HE1  . TYR A 1 14 ? 6.661  1.835   -8.907  1.00 0.00 ? 14 TYR A HE1  1  
ATOM 163   H HE2  . TYR A 1 14 ? 9.633  4.819   -8.309  1.00 0.00 ? 14 TYR A HE2  1  
ATOM 164   H HH   . TYR A 1 14 ? 9.725  2.549   -7.514  1.00 0.00 ? 14 TYR A HH   1  
ATOM 165   N N    . ALA A 1 15 ? 4.951  7.728   -6.902  1.00 0.00 ? 15 ALA A N    1  
ATOM 166   C CA   . ALA A 1 15 ? 5.253  8.086   -5.525  1.00 0.00 ? 15 ALA A CA   1  
ATOM 167   C C    . ALA A 1 15 ? 4.081  7.797   -4.605  1.00 0.00 ? 15 ALA A C    1  
ATOM 168   O O    . ALA A 1 15 ? 4.262  7.372   -3.453  1.00 0.00 ? 15 ALA A O    1  
ATOM 169   C CB   . ALA A 1 15 ? 5.639  9.567   -5.429  1.00 0.00 ? 15 ALA A CB   1  
ATOM 170   H H    . ALA A 1 15 ? 5.070  8.411   -7.588  1.00 0.00 ? 15 ALA A H    1  
ATOM 171   H HA   . ALA A 1 15 ? 6.104  7.502   -5.207  1.00 0.00 ? 15 ALA A HA   1  
ATOM 172   H HB1  . ALA A 1 15 ? 4.806  10.175  -5.731  1.00 0.00 ? 15 ALA A HB1  1  
ATOM 173   H HB2  . ALA A 1 15 ? 6.486  9.754   -6.077  1.00 0.00 ? 15 ALA A HB2  1  
ATOM 174   H HB3  . ALA A 1 15 ? 5.909  9.791   -4.418  1.00 0.00 ? 15 ALA A HB3  1  
ATOM 175   N N    . LEU A 1 16 ? 2.881  8.000   -5.119  1.00 0.00 ? 16 LEU A N    1  
ATOM 176   C CA   . LEU A 1 16 ? 1.669  7.768   -4.357  1.00 0.00 ? 16 LEU A CA   1  
ATOM 177   C C    . LEU A 1 16 ? 1.415  6.271   -4.175  1.00 0.00 ? 16 LEU A C    1  
ATOM 178   O O    . LEU A 1 16 ? 1.136  5.790   -3.069  1.00 0.00 ? 16 LEU A O    1  
ATOM 179   C CB   . LEU A 1 16 ? 0.478  8.402   -5.064  1.00 0.00 ? 16 LEU A CB   1  
ATOM 180   C CG   . LEU A 1 16 ? -0.866 8.207   -4.385  1.00 0.00 ? 16 LEU A CG   1  
ATOM 181   C CD1  . LEU A 1 16 ? -0.913 8.945   -3.068  1.00 0.00 ? 16 LEU A CD1  1  
ATOM 182   C CD2  . LEU A 1 16 ? -1.975 8.655   -5.296  1.00 0.00 ? 16 LEU A CD2  1  
ATOM 183   H H    . LEU A 1 16 ? 2.798  8.267   -6.051  1.00 0.00 ? 16 LEU A H    1  
ATOM 184   H HA   . LEU A 1 16 ? 1.796  8.240   -3.403  1.00 0.00 ? 16 LEU A HA   1  
ATOM 185   H HB2  . LEU A 1 16 ? 0.658  9.467   -5.135  1.00 0.00 ? 16 LEU A HB2  1  
ATOM 186   H HB3  . LEU A 1 16 ? 0.422  7.988   -6.069  1.00 0.00 ? 16 LEU A HB3  1  
ATOM 187   H HG   . LEU A 1 16 ? -1.004 7.156   -4.187  1.00 0.00 ? 16 LEU A HG   1  
ATOM 188   H HD11 . LEU A 1 16 ? -0.785 10.008  -3.244  1.00 0.00 ? 16 LEU A HD11 1  
ATOM 189   H HD12 . LEU A 1 16 ? -0.127 8.577   -2.422  1.00 0.00 ? 16 LEU A HD12 1  
ATOM 190   H HD13 . LEU A 1 16 ? -1.881 8.776   -2.601  1.00 0.00 ? 16 LEU A HD13 1  
ATOM 191   H HD21 . LEU A 1 16 ? -2.925 8.530   -4.792  1.00 0.00 ? 16 LEU A HD21 1  
ATOM 192   H HD22 . LEU A 1 16 ? -1.957 8.067   -6.189  1.00 0.00 ? 16 LEU A HD22 1  
ATOM 193   H HD23 . LEU A 1 16 ? -1.849 9.698   -5.534  1.00 0.00 ? 16 LEU A HD23 1  
ATOM 194   N N    . TYR A 1 17 ? 1.551  5.538   -5.286  1.00 0.00 ? 17 TYR A N    1  
ATOM 195   C CA   . TYR A 1 17 ? 1.341  4.093   -5.324  1.00 0.00 ? 17 TYR A CA   1  
ATOM 196   C C    . TYR A 1 17 ? 2.256  3.401   -4.331  1.00 0.00 ? 17 TYR A C    1  
ATOM 197   O O    . TYR A 1 17 ? 1.803  2.631   -3.478  1.00 0.00 ? 17 TYR A O    1  
ATOM 198   C CB   . TYR A 1 17 ? 1.594  3.578   -6.738  1.00 0.00 ? 17 TYR A CB   1  
ATOM 199   C CG   . TYR A 1 17 ? 1.599  2.071   -6.867  1.00 0.00 ? 17 TYR A CG   1  
ATOM 200   C CD1  . TYR A 1 17 ? 0.414  1.348   -6.911  1.00 0.00 ? 17 TYR A CD1  1  
ATOM 201   C CD2  . TYR A 1 17 ? 2.805  1.366   -6.949  1.00 0.00 ? 17 TYR A CD2  1  
ATOM 202   C CE1  . TYR A 1 17 ? 0.407  -0.030  -7.030  1.00 0.00 ? 17 TYR A CE1  1  
ATOM 203   C CE2  . TYR A 1 17 ? 2.812  -0.009  -7.075  1.00 0.00 ? 17 TYR A CE2  1  
ATOM 204   C CZ   . TYR A 1 17 ? 1.614  -0.705  -7.114  1.00 0.00 ? 17 TYR A CZ   1  
ATOM 205   O OH   . TYR A 1 17 ? 1.633  -2.078  -7.241  1.00 0.00 ? 17 TYR A OH   1  
ATOM 206   H H    . TYR A 1 17 ? 1.775  5.999   -6.126  1.00 0.00 ? 17 TYR A H    1  
ATOM 207   H HA   . TYR A 1 17 ? 0.323  3.884   -5.053  1.00 0.00 ? 17 TYR A HA   1  
ATOM 208   H HB2  . TYR A 1 17 ? 0.829  3.960   -7.396  1.00 0.00 ? 17 TYR A HB2  1  
ATOM 209   H HB3  . TYR A 1 17 ? 2.563  3.960   -7.073  1.00 0.00 ? 17 TYR A HB3  1  
ATOM 210   H HD1  . TYR A 1 17 ? -0.522 1.876   -6.839  1.00 0.00 ? 17 TYR A HD1  1  
ATOM 211   H HD2  . TYR A 1 17 ? 3.728  1.910   -6.909  1.00 0.00 ? 17 TYR A HD2  1  
ATOM 212   H HE1  . TYR A 1 17 ? -0.515 -0.577  -7.064  1.00 0.00 ? 17 TYR A HE1  1  
ATOM 213   H HE2  . TYR A 1 17 ? 3.757  -0.546  -7.136  1.00 0.00 ? 17 TYR A HE2  1  
ATOM 214   H HH   . TYR A 1 17 ? 2.314  -2.448  -6.658  1.00 0.00 ? 17 TYR A HH   1  
ATOM 215   N N    . VAL A 1 18 ? 3.544  3.655   -4.456  1.00 0.00 ? 18 VAL A N    1  
ATOM 216   C CA   . VAL A 1 18 ? 4.533  3.046   -3.576  1.00 0.00 ? 18 VAL A CA   1  
ATOM 217   C C    . VAL A 1 18 ? 4.313  3.453   -2.107  1.00 0.00 ? 18 VAL A C    1  
ATOM 218   O O    . VAL A 1 18 ? 4.362  2.617   -1.213  1.00 0.00 ? 18 VAL A O    1  
ATOM 219   C CB   . VAL A 1 18 ? 5.981  3.345   -4.013  1.00 0.00 ? 18 VAL A CB   1  
ATOM 220   C CG1  . VAL A 1 18 ? 6.274  2.751   -5.378  1.00 0.00 ? 18 VAL A CG1  1  
ATOM 221   C CG2  . VAL A 1 18 ? 6.269  4.846   -4.010  1.00 0.00 ? 18 VAL A CG2  1  
ATOM 222   H H    . VAL A 1 18 ? 3.836  4.255   -5.188  1.00 0.00 ? 18 VAL A H    1  
ATOM 223   H HA   . VAL A 1 18 ? 4.383  1.978   -3.654  1.00 0.00 ? 18 VAL A HA   1  
ATOM 224   H HB   . VAL A 1 18 ? 6.647  2.872   -3.301  1.00 0.00 ? 18 VAL A HB   1  
ATOM 225   H HG11 . VAL A 1 18 ? 6.077  1.685   -5.356  1.00 0.00 ? 18 VAL A HG11 1  
ATOM 226   H HG12 . VAL A 1 18 ? 7.304  2.928   -5.632  1.00 0.00 ? 18 VAL A HG12 1  
ATOM 227   H HG13 . VAL A 1 18 ? 5.637  3.227   -6.118  1.00 0.00 ? 18 VAL A HG13 1  
ATOM 228   H HG21 . VAL A 1 18 ? 6.180  5.223   -2.995  1.00 0.00 ? 18 VAL A HG21 1  
ATOM 229   H HG22 . VAL A 1 18 ? 5.555  5.349   -4.644  1.00 0.00 ? 18 VAL A HG22 1  
ATOM 230   H HG23 . VAL A 1 18 ? 7.268  5.007   -4.360  1.00 0.00 ? 18 VAL A HG23 1  
ATOM 231   N N    . ARG A 1 19 ? 4.054  4.745   -1.869  1.00 0.00 ? 19 ARG A N    1  
ATOM 232   C CA   . ARG A 1 19 ? 3.884  5.244   -0.503  1.00 0.00 ? 19 ARG A CA   1  
ATOM 233   C C    . ARG A 1 19 ? 2.812  4.472   0.287   1.00 0.00 ? 19 ARG A C    1  
ATOM 234   O O    . ARG A 1 19 ? 2.960  4.231   1.462   1.00 0.00 ? 19 ARG A O    1  
ATOM 235   C CB   . ARG A 1 19 ? 3.564  6.757   -0.552  1.00 0.00 ? 19 ARG A CB   1  
ATOM 236   C CG   . ARG A 1 19 ? 3.594  7.473   0.806   1.00 0.00 ? 19 ARG A CG   1  
ATOM 237   C CD   . ARG A 1 19 ? 2.286  7.290   1.584   1.00 0.00 ? 19 ARG A CD   1  
ATOM 238   N NE   . ARG A 1 19 ? 1.151  7.877   0.877   1.00 0.00 ? 19 ARG A NE   1  
ATOM 239   C CZ   . ARG A 1 19 ? -0.068 7.375   0.880   1.00 0.00 ? 19 ARG A CZ   1  
ATOM 240   N NH1  . ARG A 1 19 ? -0.342 6.254   1.556   1.00 0.00 ? 19 ARG A NH1  1  
ATOM 241   N NH2  . ARG A 1 19 ? -1.029 7.986   0.214   1.00 0.00 ? 19 ARG A NH2  1  
ATOM 242   H H    . ARG A 1 19 ? 3.992  5.365   -2.622  1.00 0.00 ? 19 ARG A H    1  
ATOM 243   H HA   . ARG A 1 19 ? 4.828  5.123   0.007   1.00 0.00 ? 19 ARG A HA   1  
ATOM 244   H HB2  . ARG A 1 19 ? 4.274  7.243   -1.200  1.00 0.00 ? 19 ARG A HB2  1  
ATOM 245   H HB3  . ARG A 1 19 ? 2.563  6.887   -0.967  1.00 0.00 ? 19 ARG A HB3  1  
ATOM 246   H HG2  . ARG A 1 19 ? 4.408  7.060   1.395   1.00 0.00 ? 19 ARG A HG2  1  
ATOM 247   H HG3  . ARG A 1 19 ? 3.769  8.522   0.638   1.00 0.00 ? 19 ARG A HG3  1  
ATOM 248   H HD2  . ARG A 1 19 ? 2.123  6.233   1.731   1.00 0.00 ? 19 ARG A HD2  1  
ATOM 249   H HD3  . ARG A 1 19 ? 2.398  7.777   2.549   1.00 0.00 ? 19 ARG A HD3  1  
ATOM 250   H HE   . ARG A 1 19 ? 1.317  8.698   0.372   1.00 0.00 ? 19 ARG A HE   1  
ATOM 251   H HH11 . ARG A 1 19 ? 0.377  5.780   2.082   1.00 0.00 ? 19 ARG A HH11 1  
ATOM 252   H HH12 . ARG A 1 19 ? -1.273 5.870   1.544   1.00 0.00 ? 19 ARG A HH12 1  
ATOM 253   H HH21 . ARG A 1 19 ? -0.832 8.830   -0.272  1.00 0.00 ? 19 ARG A HH21 1  
ATOM 254   H HH22 . ARG A 1 19 ? -1.967 7.601   0.181   1.00 0.00 ? 19 ARG A HH22 1  
ATOM 255   N N    . ASP A 1 20 ? 1.732  4.086   -0.394  1.00 0.00 ? 20 ASP A N    1  
ATOM 256   C CA   . ASP A 1 20 ? 0.643  3.361   0.258   1.00 0.00 ? 20 ASP A CA   1  
ATOM 257   C C    . ASP A 1 20 ? 1.118  2.005   0.726   1.00 0.00 ? 20 ASP A C    1  
ATOM 258   O O    . ASP A 1 20 ? 0.811  1.572   1.847   1.00 0.00 ? 20 ASP A O    1  
ATOM 259   C CB   . ASP A 1 20 ? -0.558 3.212   -0.685  1.00 0.00 ? 20 ASP A CB   1  
ATOM 260   C CG   . ASP A 1 20 ? -1.719 2.505   -0.020  1.00 0.00 ? 20 ASP A CG   1  
ATOM 261   O OD1  . ASP A 1 20 ? -2.519 3.178   0.658   1.00 0.00 ? 20 ASP A OD1  1  
ATOM 262   O OD2  . ASP A 1 20 ? -1.846 1.270   -0.178  1.00 0.00 ? 20 ASP A OD2  1  
ATOM 263   H H    . ASP A 1 20 ? 1.674  4.303   -1.368  1.00 0.00 ? 20 ASP A H    1  
ATOM 264   H HA   . ASP A 1 20 ? 0.336  3.936   1.116   1.00 0.00 ? 20 ASP A HA   1  
ATOM 265   H HB2  . ASP A 1 20 ? -0.890 4.188   -1.010  1.00 0.00 ? 20 ASP A HB2  1  
ATOM 266   H HB3  . ASP A 1 20 ? -0.260 2.636   -1.553  1.00 0.00 ? 20 ASP A HB3  1  
ATOM 267   N N    . THR A 1 21 ? 1.891  1.315   -0.088  1.00 0.00 ? 21 THR A N    1  
ATOM 268   C CA   . THR A 1 21 ? 2.311  -0.041  0.240   1.00 0.00 ? 21 THR A CA   1  
ATOM 269   C C    . THR A 1 21 ? 3.606  -0.038  1.046   1.00 0.00 ? 21 THR A C    1  
ATOM 270   O O    . THR A 1 21 ? 3.850  -0.945  1.862   1.00 0.00 ? 21 THR A O    1  
ATOM 271   C CB   . THR A 1 21 ? 2.481  -0.870  -1.054  1.00 0.00 ? 21 THR A CB   1  
ATOM 272   O OG1  . THR A 1 21 ? 1.279  -0.801  -1.811  1.00 0.00 ? 21 THR A OG1  1  
ATOM 273   C CG2  . THR A 1 21 ? 2.812  -2.315  -0.747  1.00 0.00 ? 21 THR A CG2  1  
ATOM 274   H H    . THR A 1 21 ? 2.172  1.714   -0.939  1.00 0.00 ? 21 THR A H    1  
ATOM 275   H HA   . THR A 1 21 ? 1.538  -0.486  0.815   1.00 0.00 ? 21 THR A HA   1  
ATOM 276   H HB   . THR A 1 21 ? 3.297  -0.437  -1.633  1.00 0.00 ? 21 THR A HB   1  
ATOM 277   H HG1  . THR A 1 21 ? 0.525  -0.961  -1.216  1.00 0.00 ? 21 THR A HG1  1  
ATOM 278   H HG21 . THR A 1 21 ? 2.905  -2.877  -1.663  1.00 0.00 ? 21 THR A HG21 1  
ATOM 279   H HG22 . THR A 1 21 ? 2.025  -2.733  -0.153  1.00 0.00 ? 21 THR A HG22 1  
ATOM 280   H HG23 . THR A 1 21 ? 3.738  -2.369  -0.192  1.00 0.00 ? 21 THR A HG23 1  
ATOM 281   N N    . LEU A 1 22 ? 4.441  0.963   0.838   1.00 0.00 ? 22 LEU A N    1  
ATOM 282   C CA   . LEU A 1 22 ? 5.705  1.064   1.558   1.00 0.00 ? 22 LEU A CA   1  
ATOM 283   C C    . LEU A 1 22 ? 5.510  1.503   3.005   1.00 0.00 ? 22 LEU A C    1  
ATOM 284   O O    . LEU A 1 22 ? 5.496  2.694   3.307   1.00 0.00 ? 22 LEU A O    1  
ATOM 285   C CB   . LEU A 1 22 ? 6.682  2.020   0.848   1.00 0.00 ? 22 LEU A CB   1  
ATOM 286   C CG   . LEU A 1 22 ? 7.611  1.395   -0.204  1.00 0.00 ? 22 LEU A CG   1  
ATOM 287   C CD1  . LEU A 1 22 ? 8.584  0.429   0.457   1.00 0.00 ? 22 LEU A CD1  1  
ATOM 288   C CD2  . LEU A 1 22 ? 6.814  0.667   -1.269  1.00 0.00 ? 22 LEU A CD2  1  
ATOM 289   H H    . LEU A 1 22 ? 4.206  1.661   0.182   1.00 0.00 ? 22 LEU A H    1  
ATOM 290   H HA   . LEU A 1 22 ? 6.159  0.070   1.568   1.00 0.00 ? 22 LEU A HA   1  
ATOM 291   H HB2  . LEU A 1 22 ? 6.100  2.798   0.367   1.00 0.00 ? 22 LEU A HB2  1  
ATOM 292   H HB3  . LEU A 1 22 ? 7.307  2.485   1.598   1.00 0.00 ? 22 LEU A HB3  1  
ATOM 293   H HG   . LEU A 1 22 ? 8.187  2.171   -0.678  1.00 0.00 ? 22 LEU A HG   1  
ATOM 294   H HD11 . LEU A 1 22 ? 8.040  -0.384  0.901   1.00 0.00 ? 22 LEU A HD11 1  
ATOM 295   H HD12 . LEU A 1 22 ? 9.141  0.955   1.218   1.00 0.00 ? 22 LEU A HD12 1  
ATOM 296   H HD13 . LEU A 1 22 ? 9.265  0.047   -0.279  1.00 0.00 ? 22 LEU A HD13 1  
ATOM 297   H HD21 . LEU A 1 22 ? 6.106  1.357   -1.727  1.00 0.00 ? 22 LEU A HD21 1  
ATOM 298   H HD22 . LEU A 1 22 ? 6.278  -0.145  -0.822  1.00 0.00 ? 22 LEU A HD22 1  
ATOM 299   H HD23 . LEU A 1 22 ? 7.481  0.289   -2.028  1.00 0.00 ? 22 LEU A HD23 1  
ATOM 300   N N    . GLN A 1 23 ? 5.325  0.540   3.877   1.00 0.00 ? 23 GLN A N    1  
ATOM 301   C CA   . GLN A 1 23 ? 5.267  0.789   5.308   1.00 0.00 ? 23 GLN A CA   1  
ATOM 302   C C    . GLN A 1 23 ? 6.581  0.382   5.955   1.00 0.00 ? 23 GLN A C    1  
ATOM 303   O O    . GLN A 1 23 ? 7.324  -0.426  5.385   1.00 0.00 ? 23 GLN A O    1  
ATOM 304   C CB   . GLN A 1 23 ? 4.096  0.013   5.935   1.00 0.00 ? 23 GLN A CB   1  
ATOM 305   C CG   . GLN A 1 23 ? 2.877  0.852   6.276   1.00 0.00 ? 23 GLN A CG   1  
ATOM 306   C CD   . GLN A 1 23 ? 1.979  1.166   5.085   1.00 0.00 ? 23 GLN A CD   1  
ATOM 307   O OE1  . GLN A 1 23 ? 0.763  1.332   5.248   1.00 0.00 ? 23 GLN A OE1  1  
ATOM 308   N NE2  . GLN A 1 23 ? 2.547  1.243   3.901   1.00 0.00 ? 23 GLN A NE2  1  
ATOM 309   H H    . GLN A 1 23 ? 5.230  -0.386  3.557   1.00 0.00 ? 23 GLN A H    1  
ATOM 310   H HA   . GLN A 1 23 ? 5.106  1.839   5.459   1.00 0.00 ? 23 GLN A HA   1  
ATOM 311   H HB2  . GLN A 1 23 ? 3.772  -0.754  5.251   1.00 0.00 ? 23 GLN A HB2  1  
ATOM 312   H HB3  . GLN A 1 23 ? 4.437  -0.438  6.850   1.00 0.00 ? 23 GLN A HB3  1  
ATOM 313   H HG2  . GLN A 1 23 ? 2.284  0.300   7.007   1.00 0.00 ? 23 GLN A HG2  1  
ATOM 314   H HG3  . GLN A 1 23 ? 3.197  1.794   6.718   1.00 0.00 ? 23 GLN A HG3  1  
ATOM 315   H HE21 . GLN A 1 23 ? 3.523  1.126   3.842   1.00 0.00 ? 23 GLN A HE21 1  
ATOM 316   H HE22 . GLN A 1 23 ? 1.965  1.410   3.102   1.00 0.00 ? 23 GLN A HE22 1  
ATOM 317   N N    . PRO A 1 24 ? 6.898  0.941   7.135   1.00 0.00 ? 24 PRO A N    1  
ATOM 318   C CA   . PRO A 1 24 ? 8.093  0.556   7.882   1.00 0.00 ? 24 PRO A CA   1  
ATOM 319   C C    . PRO A 1 24 ? 8.235  -0.962  8.001   1.00 0.00 ? 24 PRO A C    1  
ATOM 320   O O    . PRO A 1 24 ? 7.411  -1.614  8.645   1.00 0.00 ? 24 PRO A O    1  
ATOM 321   C CB   . PRO A 1 24 ? 7.863  1.187   9.246   1.00 0.00 ? 24 PRO A CB   1  
ATOM 322   C CG   . PRO A 1 24 ? 6.988  2.351   9.009   1.00 0.00 ? 24 PRO A CG   1  
ATOM 323   C CD   . PRO A 1 24 ? 6.156  2.009   7.805   1.00 0.00 ? 24 PRO A CD   1  
ATOM 324   H HA   . PRO A 1 24 ? 8.985  0.960   7.427   1.00 0.00 ? 24 PRO A HA   1  
ATOM 325   H HB2  . PRO A 1 24 ? 7.387  0.466   9.905   1.00 0.00 ? 24 PRO A HB2  1  
ATOM 326   H HB3  . PRO A 1 24 ? 8.816  1.493   9.685   1.00 0.00 ? 24 PRO A HB3  1  
ATOM 327   H HG2  . PRO A 1 24 ? 6.356  2.509   9.860   1.00 0.00 ? 24 PRO A HG2  1  
ATOM 328   H HG3  . PRO A 1 24 ? 7.589  3.226   8.806   1.00 0.00 ? 24 PRO A HG3  1  
ATOM 329   H HD2  . PRO A 1 24 ? 5.166  1.667   8.106   1.00 0.00 ? 24 PRO A HD2  1  
ATOM 330   H HD3  . PRO A 1 24 ? 6.073  2.872   7.152   1.00 0.00 ? 24 PRO A HD3  1  
ATOM 331   N N    . GLY A 1 25 ? 9.262  -1.509  7.370   1.00 0.00 ? 25 GLY A N    1  
ATOM 332   C CA   . GLY A 1 25 ? 9.448  -2.945  7.359   1.00 0.00 ? 25 GLY A CA   1  
ATOM 333   C C    . GLY A 1 25 ? 9.486  -3.498  5.953   1.00 0.00 ? 25 GLY A C    1  
ATOM 334   O O    . GLY A 1 25 ? 9.889  -4.641  5.743   1.00 0.00 ? 25 GLY A O    1  
ATOM 335   H H    . GLY A 1 25 ? 9.914  -0.924  6.926   1.00 0.00 ? 25 GLY A H    1  
ATOM 336   H HA2  . GLY A 1 25 ? 10.375 -3.173  7.852   1.00 0.00 ? 25 GLY A HA2  1  
ATOM 337   H HA3  . GLY A 1 25 ? 8.645  -3.412  7.897   1.00 0.00 ? 25 GLY A HA3  1  
ATOM 338   N N    . MET A 1 26 ? 9.036  -2.701  4.971   1.00 0.00 ? 26 MET A N    1  
ATOM 339   C CA   . MET A 1 26 ? 9.149  -3.088  3.582   1.00 0.00 ? 26 MET A CA   1  
ATOM 340   C C    . MET A 1 26 ? 10.585 -2.880  3.098   1.00 0.00 ? 26 MET A C    1  
ATOM 341   O O    . MET A 1 26 ? 11.154 -1.795  3.229   1.00 0.00 ? 26 MET A O    1  
ATOM 342   C CB   . MET A 1 26 ? 8.207  -2.266  2.710   1.00 0.00 ? 26 MET A CB   1  
ATOM 343   C CG   . MET A 1 26 ? 6.744  -2.552  2.956   1.00 0.00 ? 26 MET A CG   1  
ATOM 344   S SD   . MET A 1 26 ? 6.275  -4.215  2.476   1.00 0.00 ? 26 MET A SD   1  
ATOM 345   C CE   . MET A 1 26 ? 4.498  -4.109  2.649   1.00 0.00 ? 26 MET A CE   1  
ATOM 346   H H    . MET A 1 26 ? 8.610  -1.837  5.205   1.00 0.00 ? 26 MET A H    1  
ATOM 347   H HA   . MET A 1 26 ? 8.900  -4.140  3.497   1.00 0.00 ? 26 MET A HA   1  
ATOM 348   H HB2  . MET A 1 26 ? 8.388  -1.229  2.887   1.00 0.00 ? 26 MET A HB2  1  
ATOM 349   H HB3  . MET A 1 26 ? 8.414  -2.494  1.678   1.00 0.00 ? 26 MET A HB3  1  
ATOM 350   H HG2  . MET A 1 26 ? 6.545  -2.431  4.018   1.00 0.00 ? 26 MET A HG2  1  
ATOM 351   H HG3  . MET A 1 26 ? 6.155  -1.840  2.398   1.00 0.00 ? 26 MET A HG3  1  
ATOM 352   H HE1  . MET A 1 26 ? 4.251  -3.882  3.678   1.00 0.00 ? 26 MET A HE1  1  
ATOM 353   H HE2  . MET A 1 26 ? 4.036  -5.045  2.347   1.00 0.00 ? 26 MET A HE2  1  
ATOM 354   H HE3  . MET A 1 26 ? 4.134  -3.315  2.014   1.00 0.00 ? 26 MET A HE3  1  
ATOM 355   N N    . ARG A 1 27 ? 11.177 -3.937  2.549   1.00 0.00 ? 27 ARG A N    1  
ATOM 356   C CA   . ARG A 1 27 ? 12.521 -3.858  2.035   1.00 0.00 ? 27 ARG A CA   1  
ATOM 357   C C    . ARG A 1 27 ? 12.523 -3.144  0.685   1.00 0.00 ? 27 ARG A C    1  
ATOM 358   O O    . ARG A 1 27 ? 11.546 -3.204  -0.074  1.00 0.00 ? 27 ARG A O    1  
ATOM 359   C CB   . ARG A 1 27 ? 13.105 -5.271  1.904   1.00 0.00 ? 27 ARG A CB   1  
ATOM 360   C CG   . ARG A 1 27 ? 14.613 -5.291  1.699   1.00 0.00 ? 27 ARG A CG   1  
ATOM 361   C CD   . ARG A 1 27 ? 15.182 -6.668  1.989   1.00 0.00 ? 27 ARG A CD   1  
ATOM 362   N NE   . ARG A 1 27 ? 14.844 -7.121  3.339   1.00 0.00 ? 27 ARG A NE   1  
ATOM 363   C CZ   . ARG A 1 27 ? 15.642 -7.857  4.087   1.00 0.00 ? 27 ARG A CZ   1  
ATOM 364   N NH1  . ARG A 1 27 ? 16.807 -8.294  3.627   1.00 0.00 ? 27 ARG A NH1  1  
ATOM 365   N NH2  . ARG A 1 27 ? 15.242 -8.228  5.310   1.00 0.00 ? 27 ARG A NH2  1  
ATOM 366   H H    . ARG A 1 27 ? 10.696 -4.778  2.500   1.00 0.00 ? 27 ARG A H    1  
ATOM 367   H HA   . ARG A 1 27 ? 13.114 -3.294  2.728   1.00 0.00 ? 27 ARG A HA   1  
ATOM 368   H HB2  . ARG A 1 27 ? 12.889 -5.823  2.803   1.00 0.00 ? 27 ARG A HB2  1  
ATOM 369   H HB3  . ARG A 1 27 ? 12.644 -5.760  1.053   1.00 0.00 ? 27 ARG A HB3  1  
ATOM 370   H HG2  . ARG A 1 27 ? 14.830 -5.027  0.665   1.00 0.00 ? 27 ARG A HG2  1  
ATOM 371   H HG3  . ARG A 1 27 ? 15.092 -4.580  2.355   1.00 0.00 ? 27 ARG A HG3  1  
ATOM 372   H HD2  . ARG A 1 27 ? 14.769 -7.358  1.279   1.00 0.00 ? 27 ARG A HD2  1  
ATOM 373   H HD3  . ARG A 1 27 ? 16.252 -6.645  1.890   1.00 0.00 ? 27 ARG A HD3  1  
ATOM 374   H HE   . ARG A 1 27 ? 13.972 -6.832  3.703   1.00 0.00 ? 27 ARG A HE   1  
ATOM 375   H HH11 . ARG A 1 27 ? 17.112 -8.037  2.699   1.00 0.00 ? 27 ARG A HH11 1  
ATOM 376   H HH12 . ARG A 1 27 ? 17.411 -8.847  4.205   1.00 0.00 ? 27 ARG A HH12 1  
ATOM 377   H HH21 . ARG A 1 27 ? 14.337 -7.911  5.650   1.00 0.00 ? 27 ARG A HH21 1  
ATOM 378   H HH22 . ARG A 1 27 ? 15.838 -8.777  5.905   1.00 0.00 ? 27 ARG A HH22 1  
ATOM 379   N N    . VAL A 1 28 ? 13.612 -2.456  0.392   1.00 0.00 ? 28 VAL A N    1  
ATOM 380   C CA   . VAL A 1 28 ? 13.699 -1.676  -0.839  1.00 0.00 ? 28 VAL A CA   1  
ATOM 381   C C    . VAL A 1 28 ? 15.034 -1.896  -1.535  1.00 0.00 ? 28 VAL A C    1  
ATOM 382   O O    . VAL A 1 28 ? 16.012 -2.318  -0.913  1.00 0.00 ? 28 VAL A O    1  
ATOM 383   C CB   . VAL A 1 28 ? 13.553 -0.162  -0.587  1.00 0.00 ? 28 VAL A CB   1  
ATOM 384   C CG1  . VAL A 1 28 ? 12.200 0.173   0.034   1.00 0.00 ? 28 VAL A CG1  1  
ATOM 385   C CG2  . VAL A 1 28 ? 14.680 0.342   0.290   1.00 0.00 ? 28 VAL A CG2  1  
ATOM 386   H H    . VAL A 1 28 ? 14.390 -2.476  0.997   1.00 0.00 ? 28 VAL A H    1  
ATOM 387   H HA   . VAL A 1 28 ? 12.903 -1.992  -1.490  1.00 0.00 ? 28 VAL A HA   1  
ATOM 388   H HB   . VAL A 1 28 ? 13.606 0.348   -1.534  1.00 0.00 ? 28 VAL A HB   1  
ATOM 389   H HG11 . VAL A 1 28 ? 11.420 -0.170  -0.617  1.00 0.00 ? 28 VAL A HG11 1  
ATOM 390   H HG12 . VAL A 1 28 ? 12.126 1.234   0.175   1.00 0.00 ? 28 VAL A HG12 1  
ATOM 391   H HG13 . VAL A 1 28 ? 12.112 -0.324  1.000   1.00 0.00 ? 28 VAL A HG13 1  
ATOM 392   H HG21 . VAL A 1 28 ? 14.662 1.425   0.323   1.00 0.00 ? 28 VAL A HG21 1  
ATOM 393   H HG22 . VAL A 1 28 ? 15.624 0.013   -0.117  1.00 0.00 ? 28 VAL A HG22 1  
ATOM 394   H HG23 . VAL A 1 28 ? 14.567 -0.044  1.294   1.00 0.00 ? 28 VAL A HG23 1  
ATOM 395   N N    . ARG A 1 29 ? 15.037 -1.667  -2.830  1.00 0.00 ? 29 ARG A N    1  
ATOM 396   C CA   . ARG A 1 29 ? 16.258 -1.710  -3.606  1.00 0.00 ? 29 ARG A CA   1  
ATOM 397   C C    . ARG A 1 29 ? 16.466 -0.393  -4.341  1.00 0.00 ? 29 ARG A C    1  
ATOM 398   O O    . ARG A 1 29 ? 15.510 0.188   -4.856  1.00 0.00 ? 29 ARG A O    1  
ATOM 399   C CB   . ARG A 1 29 ? 16.223 -2.872  -4.600  1.00 0.00 ? 29 ARG A CB   1  
ATOM 400   C CG   . ARG A 1 29 ? 17.492 -3.060  -5.400  1.00 0.00 ? 29 ARG A CG   1  
ATOM 401   C CD   . ARG A 1 29 ? 17.445 -4.332  -6.226  1.00 0.00 ? 29 ARG A CD   1  
ATOM 402   N NE   . ARG A 1 29 ? 18.601 -4.449  -7.107  1.00 0.00 ? 29 ARG A NE   1  
ATOM 403   C CZ   . ARG A 1 29 ? 19.678 -5.188  -6.822  1.00 0.00 ? 29 ARG A CZ   1  
ATOM 404   N NH1  . ARG A 1 29 ? 19.759 -5.854  -5.677  1.00 0.00 ? 29 ARG A NH1  1  
ATOM 405   N NH2  . ARG A 1 29 ? 20.689 -5.249  -7.695  1.00 0.00 ? 29 ARG A NH2  1  
ATOM 406   H H    . ARG A 1 29 ? 14.180 -1.494  -3.292  1.00 0.00 ? 29 ARG A H    1  
ATOM 407   H HA   . ARG A 1 29 ? 17.089 -1.856  -2.914  1.00 0.00 ? 29 ARG A HA   1  
ATOM 408   H HB2  . ARG A 1 29 ? 16.035 -3.789  -4.054  1.00 0.00 ? 29 ARG A HB2  1  
ATOM 409   H HB3  . ARG A 1 29 ? 15.414 -2.705  -5.292  1.00 0.00 ? 29 ARG A HB3  1  
ATOM 410   H HG2  . ARG A 1 29 ? 17.601 -2.223  -6.079  1.00 0.00 ? 29 ARG A HG2  1  
ATOM 411   H HG3  . ARG A 1 29 ? 18.325 -3.103  -4.722  1.00 0.00 ? 29 ARG A HG3  1  
ATOM 412   H HD2  . ARG A 1 29 ? 17.424 -5.177  -5.550  1.00 0.00 ? 29 ARG A HD2  1  
ATOM 413   H HD3  . ARG A 1 29 ? 16.543 -4.328  -6.820  1.00 0.00 ? 29 ARG A HD3  1  
ATOM 414   H HE   . ARG A 1 29 ? 18.570 -3.962  -7.964  1.00 0.00 ? 29 ARG A HE   1  
ATOM 415   H HH11 . ARG A 1 29 ? 19.009 -5.803  -5.021  1.00 0.00 ? 29 ARG A HH11 1  
ATOM 416   H HH12 . ARG A 1 29 ? 20.570 -6.400  -5.455  1.00 0.00 ? 29 ARG A HH12 1  
ATOM 417   H HH21 . ARG A 1 29 ? 20.633 -4.745  -8.578  1.00 0.00 ? 29 ARG A HH21 1  
ATOM 418   H HH22 . ARG A 1 29 ? 21.510 -5.788  -7.486  1.00 0.00 ? 29 ARG A HH22 1  
ATOM 419   N N    . MET A 1 30 ? 17.684 0.098   -4.343  1.00 0.00 ? 30 MET A N    1  
ATOM 420   C CA   . MET A 1 30 ? 18.027 1.339   -5.028  1.00 0.00 ? 30 MET A CA   1  
ATOM 421   C C    . MET A 1 30 ? 18.150 1.066   -6.512  1.00 0.00 ? 30 MET A C    1  
ATOM 422   O O    . MET A 1 30 ? 19.076 0.415   -6.958  1.00 0.00 ? 30 MET A O    1  
ATOM 423   C CB   . MET A 1 30 ? 19.338 1.907   -4.470  1.00 0.00 ? 30 MET A CB   1  
ATOM 424   C CG   . MET A 1 30 ? 19.641 3.313   -4.950  1.00 0.00 ? 30 MET A CG   1  
ATOM 425   S SD   . MET A 1 30 ? 18.465 4.523   -4.322  1.00 0.00 ? 30 MET A SD   1  
ATOM 426   C CE   . MET A 1 30 ? 19.236 6.049   -4.881  1.00 0.00 ? 30 MET A CE   1  
ATOM 427   H H    . MET A 1 30 ? 18.400 -0.402  -3.860  1.00 0.00 ? 30 MET A H    1  
ATOM 428   H HA   . MET A 1 30 ? 17.228 2.049   -4.877  1.00 0.00 ? 30 MET A HA   1  
ATOM 429   H HB2  . MET A 1 30 ? 19.265 1.924   -3.398  1.00 0.00 ? 30 MET A HB2  1  
ATOM 430   H HB3  . MET A 1 30 ? 20.151 1.264   -4.768  1.00 0.00 ? 30 MET A HB3  1  
ATOM 431   H HG2  . MET A 1 30 ? 20.639 3.581   -4.602  1.00 0.00 ? 30 MET A HG2  1  
ATOM 432   H HG3  . MET A 1 30 ? 19.626 3.330   -6.033  1.00 0.00 ? 30 MET A HG3  1  
ATOM 433   H HE1  . MET A 1 30 ? 20.245 6.098   -4.496  1.00 0.00 ? 30 MET A HE1  1  
ATOM 434   H HE2  . MET A 1 30 ? 18.671 6.901   -4.508  1.00 0.00 ? 30 MET A HE2  1  
ATOM 435   H HE3  . MET A 1 30 ? 19.251 6.058   -5.958  1.00 0.00 ? 30 MET A HE3  1  
ATOM 436   N N    . LEU A 1 31 ? 17.193 1.597   -7.237  1.00 0.00 ? 31 LEU A N    1  
ATOM 437   C CA   . LEU A 1 31 ? 17.030 1.299   -8.656  1.00 0.00 ? 31 LEU A CA   1  
ATOM 438   C C    . LEU A 1 31 ? 17.848 2.278   -9.511  1.00 0.00 ? 31 LEU A C    1  
ATOM 439   O O    . LEU A 1 31 ? 18.253 1.963   -10.626 1.00 0.00 ? 31 LEU A O    1  
ATOM 440   C CB   . LEU A 1 31 ? 15.555 1.359   -9.009  1.00 0.00 ? 31 LEU A CB   1  
ATOM 441   C CG   . LEU A 1 31 ? 15.258 1.058   -10.457 1.00 0.00 ? 31 LEU A CG   1  
ATOM 442   C CD1  . LEU A 1 31 ? 15.508 -0.416  -10.743 1.00 0.00 ? 31 LEU A CD1  1  
ATOM 443   C CD2  . LEU A 1 31 ? 13.840 1.458   -10.826 1.00 0.00 ? 31 LEU A CD2  1  
ATOM 444   H H    . LEU A 1 31 ? 16.543 2.201   -6.820  1.00 0.00 ? 31 LEU A H    1  
ATOM 445   H HA   . LEU A 1 31 ? 17.410 0.289   -8.833  1.00 0.00 ? 31 LEU A HA   1  
ATOM 446   H HB2  . LEU A 1 31 ? 15.027 0.640   -8.403  1.00 0.00 ? 31 LEU A HB2  1  
ATOM 447   H HB3  . LEU A 1 31 ? 15.195 2.350   -8.779  1.00 0.00 ? 31 LEU A HB3  1  
ATOM 448   H HG   . LEU A 1 31 ? 15.939 1.643   -11.047 1.00 0.00 ? 31 LEU A HG   1  
ATOM 449   H HD11 . LEU A 1 31 ? 16.528 -0.664  -10.513 1.00 0.00 ? 31 LEU A HD11 1  
ATOM 450   H HD12 . LEU A 1 31 ? 15.315 -0.624  -11.792 1.00 0.00 ? 31 LEU A HD12 1  
ATOM 451   H HD13 . LEU A 1 31 ? 14.836 -1.026  -10.135 1.00 0.00 ? 31 LEU A HD13 1  
ATOM 452   H HD21 . LEU A 1 31 ? 13.649 1.203   -11.855 1.00 0.00 ? 31 LEU A HD21 1  
ATOM 453   H HD22 . LEU A 1 31 ? 13.727 2.525   -10.696 1.00 0.00 ? 31 LEU A HD22 1  
ATOM 454   H HD23 . LEU A 1 31 ? 13.134 0.935   -10.189 1.00 0.00 ? 31 LEU A HD23 1  
ATOM 455   N N    . ASP A 1 32 ? 18.104 3.464   -8.961  1.00 0.00 ? 32 ASP A N    1  
ATOM 456   C CA   . ASP A 1 32 ? 18.870 4.490   -9.661  1.00 0.00 ? 32 ASP A CA   1  
ATOM 457   C C    . ASP A 1 32 ? 20.102 4.824   -8.838  1.00 0.00 ? 32 ASP A C    1  
ATOM 458   O O    . ASP A 1 32 ? 20.117 4.640   -7.634  1.00 0.00 ? 32 ASP A O    1  
ATOM 459   C CB   . ASP A 1 32 ? 18.013 5.741   -9.893  1.00 0.00 ? 32 ASP A CB   1  
ATOM 460   C CG   . ASP A 1 32 ? 18.643 6.730   -10.848 1.00 0.00 ? 32 ASP A CG   1  
ATOM 461   O OD1  . ASP A 1 32 ? 18.620 6.476   -12.065 1.00 0.00 ? 32 ASP A OD1  1  
ATOM 462   O OD2  . ASP A 1 32 ? 19.158 7.776   -10.385 1.00 0.00 ? 32 ASP A OD2  1  
ATOM 463   H H    . ASP A 1 32 ? 17.765 3.660   -8.058  1.00 0.00 ? 32 ASP A H    1  
ATOM 464   H HA   . ASP A 1 32 ? 19.179 4.091   -10.614 1.00 0.00 ? 32 ASP A HA   1  
ATOM 465   H HB2  . ASP A 1 32 ? 17.048 5.438   -10.298 1.00 0.00 ? 32 ASP A HB2  1  
ATOM 466   H HB3  . ASP A 1 32 ? 17.851 6.231   -8.945  1.00 0.00 ? 32 ASP A HB3  1  
ATOM 467   N N    . ASP A 1 33 ? 21.152 5.308   -9.500  1.00 0.00 ? 33 ASP A N    1  
ATOM 468   C CA   . ASP A 1 33 ? 22.378 5.670   -8.791  1.00 0.00 ? 33 ASP A CA   1  
ATOM 469   C C    . ASP A 1 33 ? 22.382 7.165   -8.488  1.00 0.00 ? 33 ASP A C    1  
ATOM 470   O O    . ASP A 1 33 ? 22.203 7.989   -9.397  1.00 0.00 ? 33 ASP A O    1  
ATOM 471   C CB   . ASP A 1 33 ? 23.596 5.322   -9.646  1.00 0.00 ? 33 ASP A CB   1  
ATOM 472   C CG   . ASP A 1 33 ? 24.902 5.781   -9.029  1.00 0.00 ? 33 ASP A CG   1  
ATOM 473   O OD1  . ASP A 1 33 ? 25.434 5.083   -8.146  1.00 0.00 ? 33 ASP A OD1  1  
ATOM 474   O OD2  . ASP A 1 33 ? 25.423 6.836   -9.446  1.00 0.00 ? 33 ASP A OD2  1  
ATOM 475   H H    . ASP A 1 33 ? 21.098 5.463   -10.463 1.00 0.00 ? 33 ASP A H    1  
ATOM 476   H HA   . ASP A 1 33 ? 22.417 5.115   -7.876  1.00 0.00 ? 33 ASP A HA   1  
ATOM 477   H HB2  . ASP A 1 33 ? 23.648 4.256   -9.766  1.00 0.00 ? 33 ASP A HB2  1  
ATOM 478   H HB3  . ASP A 1 33 ? 23.492 5.796   -10.609 1.00 0.00 ? 33 ASP A HB3  1  
ATOM 479   N N    . TYR A 1 34 ? 22.612 7.525   -7.219  1.00 0.00 ? 34 TYR A N    1  
ATOM 480   C CA   . TYR A 1 34 ? 22.430 8.897   -6.806  1.00 0.00 ? 34 TYR A CA   1  
ATOM 481   C C    . TYR A 1 34 ? 23.251 9.235   -5.557  1.00 0.00 ? 34 TYR A C    1  
ATOM 482   O O    . TYR A 1 34 ? 23.048 8.644   -4.484  1.00 0.00 ? 34 TYR A O    1  
ATOM 483   C CB   . TYR A 1 34 ? 20.945 9.183   -6.593  1.00 0.00 ? 34 TYR A CB   1  
ATOM 484   C CG   . TYR A 1 34 ? 20.628 10.580  -6.142  1.00 0.00 ? 34 TYR A CG   1  
ATOM 485   C CD1  . TYR A 1 34 ? 20.981 11.671  -6.936  1.00 0.00 ? 34 TYR A CD1  1  
ATOM 486   C CD2  . TYR A 1 34 ? 19.994 10.817  -4.938  1.00 0.00 ? 34 TYR A CD2  1  
ATOM 487   C CE1  . TYR A 1 34 ? 20.707 12.955  -6.524  1.00 0.00 ? 34 TYR A CE1  1  
ATOM 488   C CE2  . TYR A 1 34 ? 19.715 12.099  -4.519  1.00 0.00 ? 34 TYR A CE2  1  
ATOM 489   C CZ   . TYR A 1 34 ? 20.076 13.162  -5.319  1.00 0.00 ? 34 TYR A CZ   1  
ATOM 490   O OH   . TYR A 1 34 ? 19.807 14.453  -4.885  1.00 0.00 ? 34 TYR A OH   1  
ATOM 491   H H    . TYR A 1 34 ? 22.918 6.864   -6.563  1.00 0.00 ? 34 TYR A H    1  
ATOM 492   H HA   . TYR A 1 34 ? 22.777 9.525   -7.629  1.00 0.00 ? 34 TYR A HA   1  
ATOM 493   H HB2  . TYR A 1 34 ? 20.403 8.988   -7.518  1.00 0.00 ? 34 TYR A HB2  1  
ATOM 494   H HB3  . TYR A 1 34 ? 20.571 8.507   -5.814  1.00 0.00 ? 34 TYR A HB3  1  
ATOM 495   H HD1  . TYR A 1 34 ? 21.463 11.492  -7.880  1.00 0.00 ? 34 TYR A HD1  1  
ATOM 496   H HD2  . TYR A 1 34 ? 19.702 9.972   -4.310  1.00 0.00 ? 34 TYR A HD2  1  
ATOM 497   H HE1  . TYR A 1 34 ? 20.983 13.792  -7.149  1.00 0.00 ? 34 TYR A HE1  1  
ATOM 498   H HE2  . TYR A 1 34 ? 19.211 12.273  -3.585  1.00 0.00 ? 34 TYR A HE2  1  
ATOM 499   H HH   . TYR A 1 34 ? 20.155 14.560  -3.994  1.00 0.00 ? 34 TYR A HH   1  
ATOM 500   N N    . GLU A 1 35 ? 24.195 10.161  -5.714  1.00 0.00 ? 35 GLU A N    1  
ATOM 501   C CA   . GLU A 1 35 ? 24.996 10.713  -4.635  1.00 0.00 ? 35 GLU A CA   1  
ATOM 502   C C    . GLU A 1 35 ? 25.816 9.626   -3.941  1.00 0.00 ? 35 GLU A C    1  
ATOM 503   O O    . GLU A 1 35 ? 26.569 8.902   -4.597  1.00 0.00 ? 35 GLU A O    1  
ATOM 504   C CB   . GLU A 1 35 ? 24.115 11.433  -3.621  1.00 0.00 ? 35 GLU A CB   1  
ATOM 505   C CG   . GLU A 1 35 ? 23.393 12.663  -4.170  1.00 0.00 ? 35 GLU A CG   1  
ATOM 506   C CD   . GLU A 1 35 ? 24.356 13.734  -4.613  1.00 0.00 ? 35 GLU A CD   1  
ATOM 507   O OE1  . GLU A 1 35 ? 24.815 14.516  -3.752  1.00 0.00 ? 35 GLU A OE1  1  
ATOM 508   O OE2  . GLU A 1 35 ? 24.648 13.805  -5.839  1.00 0.00 ? 35 GLU A OE2  1  
ATOM 509   H H    . GLU A 1 35 ? 24.350 10.485  -6.642  1.00 0.00 ? 35 GLU A H    1  
ATOM 510   H HA   . GLU A 1 35 ? 25.682 11.438  -5.059  1.00 0.00 ? 35 GLU A HA   1  
ATOM 511   H HB2  . GLU A 1 35 ? 23.364 10.738  -3.258  1.00 0.00 ? 35 GLU A HB2  1  
ATOM 512   H HB3  . GLU A 1 35 ? 24.716 11.750  -2.773  1.00 0.00 ? 35 GLU A HB3  1  
ATOM 513   H HG2  . GLU A 1 35 ? 22.792 12.351  -5.005  1.00 0.00 ? 35 GLU A HG2  1  
ATOM 514   H HG3  . GLU A 1 35 ? 22.751 13.059  -3.412  1.00 0.00 ? 35 GLU A HG3  1  
ATOM 515   N N    . GLU A 1 36 ? 25.660 9.507   -2.619  1.00 0.00 ? 36 GLU A N    1  
ATOM 516   C CA   . GLU A 1 36 ? 26.387 8.517   -1.834  1.00 0.00 ? 36 GLU A CA   1  
ATOM 517   C C    . GLU A 1 36 ? 25.891 7.104   -2.119  1.00 0.00 ? 36 GLU A C    1  
ATOM 518   O O    . GLU A 1 36 ? 26.607 6.114   -1.945  1.00 0.00 ? 36 GLU A O    1  
ATOM 519   C CB   . GLU A 1 36 ? 26.260 8.831   -0.335  1.00 0.00 ? 36 GLU A CB   1  
ATOM 520   C CG   . GLU A 1 36 ? 26.869 10.149  0.074   1.00 0.00 ? 36 GLU A CG   1  
ATOM 521   C CD   . GLU A 1 36 ? 26.643 10.473  1.539   1.00 0.00 ? 36 GLU A CD   1  
ATOM 522   O OE1  . GLU A 1 36 ? 27.263 9.816   2.402   1.00 0.00 ? 36 GLU A OE1  1  
ATOM 523   O OE2  . GLU A 1 36 ? 25.831 11.383  1.835   1.00 0.00 ? 36 GLU A OE2  1  
ATOM 524   H H    . GLU A 1 36 ? 25.019 10.097  -2.171  1.00 0.00 ? 36 GLU A H    1  
ATOM 525   H HA   . GLU A 1 36 ? 27.420 8.592   -2.114  1.00 0.00 ? 36 GLU A HA   1  
ATOM 526   H HB2  . GLU A 1 36 ? 25.205 8.860   -0.076  1.00 0.00 ? 36 GLU A HB2  1  
ATOM 527   H HB3  . GLU A 1 36 ? 26.747 8.045   0.234   1.00 0.00 ? 36 GLU A HB3  1  
ATOM 528   H HG2  . GLU A 1 36 ? 27.927 10.120  -0.116  1.00 0.00 ? 36 GLU A HG2  1  
ATOM 529   H HG3  . GLU A 1 36 ? 26.430 10.937  -0.517  1.00 0.00 ? 36 GLU A HG3  1  
ATOM 530   N N    . ILE A 1 37 ? 24.647 7.013   -2.568  1.00 0.00 ? 37 ILE A N    1  
ATOM 531   C CA   . ILE A 1 37 ? 24.007 5.729   -2.777  1.00 0.00 ? 37 ILE A CA   1  
ATOM 532   C C    . ILE A 1 37 ? 24.247 5.286   -4.220  1.00 0.00 ? 37 ILE A C    1  
ATOM 533   O O    . ILE A 1 37 ? 24.299 6.119   -5.135  1.00 0.00 ? 37 ILE A O    1  
ATOM 534   C CB   . ILE A 1 37 ? 22.483 5.775   -2.485  1.00 0.00 ? 37 ILE A CB   1  
ATOM 535   C CG1  . ILE A 1 37 ? 22.228 6.464   -1.140  1.00 0.00 ? 37 ILE A CG1  1  
ATOM 536   C CG2  . ILE A 1 37 ? 21.898 4.372   -2.486  1.00 0.00 ? 37 ILE A CG2  1  
ATOM 537   C CD1  . ILE A 1 37 ? 22.939 5.804   0.035   1.00 0.00 ? 37 ILE A CD1  1  
ATOM 538   H H    . ILE A 1 37 ? 24.162 7.841   -2.788  1.00 0.00 ? 37 ILE A H    1  
ATOM 539   H HA   . ILE A 1 37 ? 24.455 5.005   -2.117  1.00 0.00 ? 37 ILE A HA   1  
ATOM 540   H HB   . ILE A 1 37 ? 22.004 6.332   -3.269  1.00 0.00 ? 37 ILE A HB   1  
ATOM 541   H HG12 . ILE A 1 37 ? 22.554 7.492   -1.198  1.00 0.00 ? 37 ILE A HG12 1  
ATOM 542   H HG13 . ILE A 1 37 ? 21.157 6.445   -0.935  1.00 0.00 ? 37 ILE A HG13 1  
ATOM 543   H HG21 . ILE A 1 37 ? 22.351 3.790   -1.694  1.00 0.00 ? 37 ILE A HG21 1  
ATOM 544   H HG22 . ILE A 1 37 ? 22.079 3.907   -3.434  1.00 0.00 ? 37 ILE A HG22 1  
ATOM 545   H HG23 . ILE A 1 37 ? 20.827 4.439   -2.314  1.00 0.00 ? 37 ILE A HG23 1  
ATOM 546   H HD11 . ILE A 1 37 ? 22.692 6.330   0.945   1.00 0.00 ? 37 ILE A HD11 1  
ATOM 547   H HD12 . ILE A 1 37 ? 24.003 5.854   -0.128  1.00 0.00 ? 37 ILE A HD12 1  
ATOM 548   H HD13 . ILE A 1 37 ? 22.642 4.765   0.116   1.00 0.00 ? 37 ILE A HD13 1  
ATOM 549   N N    . SER A 1 38 ? 24.390 3.994   -4.418  1.00 0.00 ? 38 SER A N    1  
ATOM 550   C CA   . SER A 1 38 ? 24.695 3.459   -5.724  1.00 0.00 ? 38 SER A CA   1  
ATOM 551   C C    . SER A 1 38 ? 23.611 2.499   -6.188  1.00 0.00 ? 38 SER A C    1  
ATOM 552   O O    . SER A 1 38 ? 22.957 1.860   -5.349  1.00 0.00 ? 38 SER A O    1  
ATOM 553   C CB   . SER A 1 38 ? 26.048 2.737   -5.706  1.00 0.00 ? 38 SER A CB   1  
ATOM 554   O OG   . SER A 1 38 ? 27.072 3.595   -5.222  1.00 0.00 ? 38 SER A OG   1  
ATOM 555   H H    . SER A 1 38 ? 24.240 3.367   -3.673  1.00 0.00 ? 38 SER A H    1  
ATOM 556   H HA   . SER A 1 38 ? 24.758 4.285   -6.430  1.00 0.00 ? 38 SER A HA   1  
ATOM 557   H HB2  . SER A 1 38 ? 25.985 1.870   -5.048  1.00 0.00 ? 38 SER A HB2  1  
ATOM 558   H HB3  . SER A 1 38 ? 26.311 2.410   -6.698  1.00 0.00 ? 38 SER A HB3  1  
ATOM 559   H HG   . SER A 1 38 ? 26.887 4.496   -5.510  1.00 0.00 ? 38 SER A HG   1  
ATOM 560   N N    . ALA A 1 39 ? 23.402 2.416   -7.498  1.00 0.00 ? 39 ALA A N    1  
ATOM 561   C CA   . ALA A 1 39 ? 22.411 1.520   -8.050  1.00 0.00 ? 39 ALA A CA   1  
ATOM 562   C C    . ALA A 1 39 ? 22.713 0.074   -7.686  1.00 0.00 ? 39 ALA A C    1  
ATOM 563   O O    . ALA A 1 39 ? 23.834 -0.392  -7.851  1.00 0.00 ? 39 ALA A O    1  
ATOM 564   C CB   . ALA A 1 39 ? 22.340 1.676   -9.564  1.00 0.00 ? 39 ALA A CB   1  
ATOM 565   H H    . ALA A 1 39 ? 23.943 2.960   -8.102  1.00 0.00 ? 39 ALA A H    1  
ATOM 566   H HA   . ALA A 1 39 ? 21.448 1.793   -7.641  1.00 0.00 ? 39 ALA A HA   1  
ATOM 567   H HB1  . ALA A 1 39 ? 21.555 1.043   -9.958  1.00 0.00 ? 39 ALA A HB1  1  
ATOM 568   H HB2  . ALA A 1 39 ? 23.277 1.391   -9.999  1.00 0.00 ? 39 ALA A HB2  1  
ATOM 569   H HB3  . ALA A 1 39 ? 22.120 2.706   -9.816  1.00 0.00 ? 39 ALA A HB3  1  
ATOM 570   N N    . GLY A 1 40 ? 21.713 -0.612  -7.173  1.00 0.00 ? 40 GLY A N    1  
ATOM 571   C CA   . GLY A 1 40 ? 21.890 -1.987  -6.738  1.00 0.00 ? 40 GLY A CA   1  
ATOM 572   C C    . GLY A 1 40 ? 21.938 -2.119  -5.233  1.00 0.00 ? 40 GLY A C    1  
ATOM 573   O O    . GLY A 1 40 ? 21.866 -3.236  -4.706  1.00 0.00 ? 40 GLY A O    1  
ATOM 574   H H    . GLY A 1 40 ? 20.819 -0.175  -7.079  1.00 0.00 ? 40 GLY A H    1  
ATOM 575   H HA2  . GLY A 1 40 ? 21.075 -2.588  -7.115  1.00 0.00 ? 40 GLY A HA2  1  
ATOM 576   H HA3  . GLY A 1 40 ? 22.828 -2.362  -7.154  1.00 0.00 ? 40 GLY A HA3  1  
ATOM 577   N N    . ASP A 1 41 ? 22.074 -0.995  -4.522  1.00 0.00 ? 41 ASP A N    1  
ATOM 578   C CA   . ASP A 1 41 ? 22.051 -1.017  -3.061  1.00 0.00 ? 41 ASP A CA   1  
ATOM 579   C C    . ASP A 1 41 ? 20.690 -1.510  -2.583  1.00 0.00 ? 41 ASP A C    1  
ATOM 580   O O    . ASP A 1 41 ? 19.663 -1.223  -3.204  1.00 0.00 ? 41 ASP A O    1  
ATOM 581   C CB   . ASP A 1 41 ? 22.327 0.387   -2.489  1.00 0.00 ? 41 ASP A CB   1  
ATOM 582   C CG   . ASP A 1 41 ? 22.740 0.387   -1.021  1.00 0.00 ? 41 ASP A CG   1  
ATOM 583   O OD1  . ASP A 1 41 ? 22.549 -0.642  -0.338  1.00 0.00 ? 41 ASP A OD1  1  
ATOM 584   O OD2  . ASP A 1 41 ? 23.302 1.409   -0.551  1.00 0.00 ? 41 ASP A OD2  1  
ATOM 585   H H    . ASP A 1 41 ? 22.216 -0.137  -4.983  1.00 0.00 ? 41 ASP A H    1  
ATOM 586   H HA   . ASP A 1 41 ? 22.800 -1.702  -2.728  1.00 0.00 ? 41 ASP A HA   1  
ATOM 587   H HB2  . ASP A 1 41 ? 23.102 0.834   -3.054  1.00 0.00 ? 41 ASP A HB2  1  
ATOM 588   H HB3  . ASP A 1 41 ? 21.437 0.995   -2.588  1.00 0.00 ? 41 ASP A HB3  1  
ATOM 589   N N    . GLU A 1 42 ? 20.679 -2.272  -1.512  1.00 0.00 ? 42 GLU A N    1  
ATOM 590   C CA   . GLU A 1 42 ? 19.432 -2.763  -0.954  1.00 0.00 ? 42 GLU A CA   1  
ATOM 591   C C    . GLU A 1 42 ? 19.318 -2.322  0.489   1.00 0.00 ? 42 GLU A C    1  
ATOM 592   O O    . GLU A 1 42 ? 20.324 -2.205  1.188   1.00 0.00 ? 42 GLU A O    1  
ATOM 593   C CB   . GLU A 1 42 ? 19.353 -4.288  -1.062  1.00 0.00 ? 42 GLU A CB   1  
ATOM 594   C CG   . GLU A 1 42 ? 19.445 -4.792  -2.495  1.00 0.00 ? 42 GLU A CG   1  
ATOM 595   C CD   . GLU A 1 42 ? 19.266 -6.280  -2.624  1.00 0.00 ? 42 GLU A CD   1  
ATOM 596   O OE1  . GLU A 1 42 ? 20.234 -7.033  -2.357  1.00 0.00 ? 42 GLU A OE1  1  
ATOM 597   O OE2  . GLU A 1 42 ? 18.164 -6.723  -2.993  1.00 0.00 ? 42 GLU A OE2  1  
ATOM 598   H H    . GLU A 1 42 ? 21.519 -2.471  -1.045  1.00 0.00 ? 42 GLU A H    1  
ATOM 599   H HA   . GLU A 1 42 ? 18.622 -2.327  -1.525  1.00 0.00 ? 42 GLU A HA   1  
ATOM 600   H HB2  . GLU A 1 42 ? 20.162 -4.727  -0.484  1.00 0.00 ? 42 GLU A HB2  1  
ATOM 601   H HB3  . GLU A 1 42 ? 18.413 -4.619  -0.654  1.00 0.00 ? 42 GLU A HB3  1  
ATOM 602   H HG2  . GLU A 1 42 ? 18.684 -4.301  -3.084  1.00 0.00 ? 42 GLU A HG2  1  
ATOM 603   H HG3  . GLU A 1 42 ? 20.426 -4.540  -2.888  1.00 0.00 ? 42 GLU A HG3  1  
ATOM 604   N N    . GLY A 1 43 ? 18.109 -2.069  0.933   1.00 0.00 ? 43 GLY A N    1  
ATOM 605   C CA   . GLY A 1 43 ? 17.903 -1.528  2.249   1.00 0.00 ? 43 GLY A CA   1  
ATOM 606   C C    . GLY A 1 43 ? 16.479 -1.728  2.719   1.00 0.00 ? 43 GLY A C    1  
ATOM 607   O O    . GLY A 1 43 ? 15.715 -2.429  2.078   1.00 0.00 ? 43 GLY A O    1  
ATOM 608   H H    . GLY A 1 43 ? 17.333 -2.278  0.373   1.00 0.00 ? 43 GLY A H    1  
ATOM 609   H HA2  . GLY A 1 43 ? 18.571 -2.017  2.944   1.00 0.00 ? 43 GLY A HA2  1  
ATOM 610   H HA3  . GLY A 1 43 ? 18.122 -0.460  2.237   1.00 0.00 ? 43 GLY A HA3  1  
ATOM 611   N N    . GLU A 1 44 ? 16.144 -1.114  3.830   1.00 0.00 ? 44 GLU A N    1  
ATOM 612   C CA   . GLU A 1 44 ? 14.818 -1.271  4.406   1.00 0.00 ? 44 GLU A CA   1  
ATOM 613   C C    . GLU A 1 44 ? 14.142 0.101   4.566   1.00 0.00 ? 44 GLU A C    1  
ATOM 614   O O    . GLU A 1 44 ? 14.810 1.105   4.807   1.00 0.00 ? 44 GLU A O    1  
ATOM 615   C CB   . GLU A 1 44 ? 14.897 -1.987  5.757   1.00 0.00 ? 44 GLU A CB   1  
ATOM 616   C CG   . GLU A 1 44 ? 13.551 -2.351  6.340   1.00 0.00 ? 44 GLU A CG   1  
ATOM 617   C CD   . GLU A 1 44 ? 13.672 -3.043  7.676   1.00 0.00 ? 44 GLU A CD   1  
ATOM 618   O OE1  . GLU A 1 44 ? 13.935 -4.267  7.692   1.00 0.00 ? 44 GLU A OE1  1  
ATOM 619   O OE2  . GLU A 1 44 ? 13.521 -2.370  8.717   1.00 0.00 ? 44 GLU A OE2  1  
ATOM 620   H H    . GLU A 1 44 ? 16.804 -0.524  4.265   1.00 0.00 ? 44 GLU A H    1  
ATOM 621   H HA   . GLU A 1 44 ? 14.226 -1.866  3.726   1.00 0.00 ? 44 GLU A HA   1  
ATOM 622   H HB2  . GLU A 1 44 ? 15.465 -2.895  5.647   1.00 0.00 ? 44 GLU A HB2  1  
ATOM 623   H HB3  . GLU A 1 44 ? 15.407 -1.340  6.472   1.00 0.00 ? 44 GLU A HB3  1  
ATOM 624   H HG2  . GLU A 1 44 ? 12.973 -1.441  6.468   1.00 0.00 ? 44 GLU A HG2  1  
ATOM 625   H HG3  . GLU A 1 44 ? 13.050 -3.016  5.651   1.00 0.00 ? 44 GLU A HG3  1  
ATOM 626   N N    . PHE A 1 45 ? 12.827 0.110   4.452   1.00 0.00 ? 45 PHE A N    1  
ATOM 627   C CA   . PHE A 1 45 ? 12.035 1.330   4.602   1.00 0.00 ? 45 PHE A CA   1  
ATOM 628   C C    . PHE A 1 45 ? 11.706 1.536   6.071   1.00 0.00 ? 45 PHE A C    1  
ATOM 629   O O    . PHE A 1 45 ? 10.981 0.751   6.686   1.00 0.00 ? 45 PHE A O    1  
ATOM 630   C CB   . PHE A 1 45 ? 10.752 1.201   3.769   1.00 0.00 ? 45 PHE A CB   1  
ATOM 631   C CG   . PHE A 1 45 ? 9.828  2.380   3.821   1.00 0.00 ? 45 PHE A CG   1  
ATOM 632   C CD1  . PHE A 1 45 ? 9.006  2.584   4.934   1.00 0.00 ? 45 PHE A CD1  1  
ATOM 633   C CD2  . PHE A 1 45 ? 9.750  3.266   2.774   1.00 0.00 ? 45 PHE A CD2  1  
ATOM 634   C CE1  . PHE A 1 45 ? 8.143  3.653   4.981   1.00 0.00 ? 45 PHE A CE1  1  
ATOM 635   C CE2  . PHE A 1 45 ? 8.896  4.340   2.805   1.00 0.00 ? 45 PHE A CE2  1  
ATOM 636   C CZ   . PHE A 1 45 ? 8.085  4.537   3.919   1.00 0.00 ? 45 PHE A CZ   1  
ATOM 637   H H    . PHE A 1 45 ? 12.340 -0.734  4.324   1.00 0.00 ? 45 PHE A H    1  
ATOM 638   H HA   . PHE A 1 45 ? 12.619 2.167   4.244   1.00 0.00 ? 45 PHE A HA   1  
ATOM 639   H HB2  . PHE A 1 45 ? 11.030 1.053   2.738   1.00 0.00 ? 45 PHE A HB2  1  
ATOM 640   H HB3  . PHE A 1 45 ? 10.191 0.339   4.103   1.00 0.00 ? 45 PHE A HB3  1  
ATOM 641   H HD1  . PHE A 1 45 ? 9.055  1.891   5.750   1.00 0.00 ? 45 PHE A HD1  1  
ATOM 642   H HD2  . PHE A 1 45 ? 10.373 3.114   1.907   1.00 0.00 ? 45 PHE A HD2  1  
ATOM 643   H HE1  . PHE A 1 45 ? 7.514  3.797   5.856   1.00 0.00 ? 45 PHE A HE1  1  
ATOM 644   H HE2  . PHE A 1 45 ? 8.845  5.022   1.973   1.00 0.00 ? 45 PHE A HE2  1  
ATOM 645   H HZ   . PHE A 1 45 ? 7.412  5.376   3.957   1.00 0.00 ? 45 PHE A HZ   1  
ATOM 646   N N    . ARG A 1 46 ? 12.255 2.596   6.648   1.00 0.00 ? 46 ARG A N    1  
ATOM 647   C CA   . ARG A 1 46 ? 12.041 2.909   8.059   1.00 0.00 ? 46 ARG A CA   1  
ATOM 648   C C    . ARG A 1 46 ? 10.840 3.824   8.244   1.00 0.00 ? 46 ARG A C    1  
ATOM 649   O O    . ARG A 1 46 ? 9.956  3.550   9.043   1.00 0.00 ? 46 ARG A O    1  
ATOM 650   C CB   . ARG A 1 46 ? 13.284 3.558   8.658   1.00 0.00 ? 46 ARG A CB   1  
ATOM 651   C CG   . ARG A 1 46 ? 14.553 2.729   8.503   1.00 0.00 ? 46 ARG A CG   1  
ATOM 652   C CD   . ARG A 1 46 ? 14.401 1.370   9.153   1.00 0.00 ? 46 ARG A CD   1  
ATOM 653   N NE   . ARG A 1 46 ? 14.165 1.470   10.596  1.00 0.00 ? 46 ARG A NE   1  
ATOM 654   C CZ   . ARG A 1 46 ? 13.700 0.474   11.351  1.00 0.00 ? 46 ARG A CZ   1  
ATOM 655   N NH1  . ARG A 1 46 ? 13.439 -0.714  10.834  1.00 0.00 ? 46 ARG A NH1  1  
ATOM 656   N NH2  . ARG A 1 46 ? 13.514 0.662   12.659  1.00 0.00 ? 46 ARG A NH2  1  
ATOM 657   H H    . ARG A 1 46 ? 12.819 3.198   6.116   1.00 0.00 ? 46 ARG A H    1  
ATOM 658   H HA   . ARG A 1 46 ? 11.852 1.976   8.579   1.00 0.00 ? 46 ARG A HA   1  
ATOM 659   H HB2  . ARG A 1 46 ? 13.431 4.516   8.192   1.00 0.00 ? 46 ARG A HB2  1  
ATOM 660   H HB3  . ARG A 1 46 ? 13.116 3.711   9.709   1.00 0.00 ? 46 ARG A HB3  1  
ATOM 661   H HG2  . ARG A 1 46 ? 14.755 2.606   7.451   1.00 0.00 ? 46 ARG A HG2  1  
ATOM 662   H HG3  . ARG A 1 46 ? 15.373 3.254   8.967   1.00 0.00 ? 46 ARG A HG3  1  
ATOM 663   H HD2  . ARG A 1 46 ? 13.569 0.855   8.702   1.00 0.00 ? 46 ARG A HD2  1  
ATOM 664   H HD3  . ARG A 1 46 ? 15.304 0.812   8.983   1.00 0.00 ? 46 ARG A HD3  1  
ATOM 665   H HE   . ARG A 1 46 ? 14.378 2.337   11.025  1.00 0.00 ? 46 ARG A HE   1  
ATOM 666   H HH11 . ARG A 1 46 ? 13.600 -0.886  9.858   1.00 0.00 ? 46 ARG A HH11 1  
ATOM 667   H HH12 . ARG A 1 46 ? 13.081 -1.447  11.421  1.00 0.00 ? 46 ARG A HH12 1  
ATOM 668   H HH21 . ARG A 1 46 ? 13.718 1.551   13.086  1.00 0.00 ? 46 ARG A HH21 1  
ATOM 669   H HH22 . ARG A 1 46 ? 13.175 -0.091  13.230  1.00 0.00 ? 46 ARG A HH22 1  
ATOM 670   N N    . GLN A 1 47 ? 10.816 4.911   7.484   1.00 0.00 ? 47 GLN A N    1  
ATOM 671   C CA   . GLN A 1 47 ? 9.746  5.896   7.593   1.00 0.00 ? 47 GLN A CA   1  
ATOM 672   C C    . GLN A 1 47 ? 9.807  6.850   6.403   1.00 0.00 ? 47 GLN A C    1  
ATOM 673   O O    . GLN A 1 47 ? 10.807 6.902   5.687   1.00 0.00 ? 47 GLN A O    1  
ATOM 674   C CB   . GLN A 1 47 ? 9.878  6.676   8.881   1.00 0.00 ? 47 GLN A CB   1  
ATOM 675   C CG   . GLN A 1 47 ? 11.205 7.396   9.056   1.00 0.00 ? 47 GLN A CG   1  
ATOM 676   C CD   . GLN A 1 47 ? 11.250 8.271   10.291  1.00 0.00 ? 47 GLN A CD   1  
ATOM 677   O OE1  . GLN A 1 47 ? 12.297 8.406   10.916  1.00 0.00 ? 47 GLN A OE1  1  
ATOM 678   N NE2  . GLN A 1 47 ? 10.130 8.891   10.624  1.00 0.00 ? 47 GLN A NE2  1  
ATOM 679   H H    . GLN A 1 47 ? 11.537 5.054   6.817   1.00 0.00 ? 47 GLN A H    1  
ATOM 680   H HA   . GLN A 1 47 ? 8.805  5.371   7.580   1.00 0.00 ? 47 GLN A HA   1  
ATOM 681   H HB2  . GLN A 1 47 ? 9.092  7.425   8.923   1.00 0.00 ? 47 GLN A HB2  1  
ATOM 682   H HB3  . GLN A 1 47 ? 9.758  6.007   9.731   1.00 0.00 ? 47 GLN A HB3  1  
ATOM 683   H HG2  . GLN A 1 47 ? 11.994 6.645   9.118   1.00 0.00 ? 47 GLN A HG2  1  
ATOM 684   H HG3  . GLN A 1 47 ? 11.379 8.006   8.177   1.00 0.00 ? 47 GLN A HG3  1  
ATOM 685   H HE21 . GLN A 1 47 ? 9.320  8.769   10.077  1.00 0.00 ? 47 GLN A HE21 1  
ATOM 686   H HE22 . GLN A 1 47 ? 10.124 9.455   11.439  1.00 0.00 ? 47 GLN A HE22 1  
ATOM 687   N N    . SER A 1 48 ? 8.752  7.616   6.195   1.00 0.00 ? 48 SER A N    1  
ATOM 688   C CA   . SER A 1 48 ? 8.728  8.579   5.115   1.00 0.00 ? 48 SER A CA   1  
ATOM 689   C C    . SER A 1 48 ? 8.062  9.864   5.540   1.00 0.00 ? 48 SER A C    1  
ATOM 690   O O    . SER A 1 48 ? 7.437  9.936   6.589   1.00 0.00 ? 48 SER A O    1  
ATOM 691   C CB   . SER A 1 48 ? 7.994  7.997   3.917   1.00 0.00 ? 48 SER A CB   1  
ATOM 692   O OG   . SER A 1 48 ? 6.721  7.483   4.305   1.00 0.00 ? 48 SER A OG   1  
ATOM 693   H H    . SER A 1 48 ? 7.944  7.502   6.759   1.00 0.00 ? 48 SER A H    1  
ATOM 694   H HA   . SER A 1 48 ? 9.745  8.785   4.818   1.00 0.00 ? 48 SER A HA   1  
ATOM 695   H HB2  . SER A 1 48 ? 7.842  8.759   3.159   1.00 0.00 ? 48 SER A HB2  1  
ATOM 696   H HB3  . SER A 1 48 ? 8.561  7.187   3.507   1.00 0.00 ? 48 SER A HB3  1  
ATOM 697   H HG   . SER A 1 48 ? 6.606  7.576   5.266   1.00 0.00 ? 48 SER A HG   1  
ATOM 698   N N    . ASN A 1 49 ? 8.202  10.900  4.729   1.00 0.00 ? 49 ASN A N    1  
ATOM 699   C CA   . ASN A 1 49 ? 7.439  12.115  4.929   1.00 0.00 ? 49 ASN A CA   1  
ATOM 700   C C    . ASN A 1 49 ? 6.201  12.049  4.051   1.00 0.00 ? 49 ASN A C    1  
ATOM 701   O O    . ASN A 1 49 ? 6.293  12.154  2.829   1.00 0.00 ? 49 ASN A O    1  
ATOM 702   C CB   . ASN A 1 49 ? 8.287  13.360  4.596   1.00 0.00 ? 49 ASN A CB   1  
ATOM 703   C CG   . ASN A 1 49 ? 9.474  13.533  5.524   1.00 0.00 ? 49 ASN A CG   1  
ATOM 704   O OD1  . ASN A 1 49 ? 10.518 14.036  5.131   1.00 0.00 ? 49 ASN A OD1  1  
ATOM 705   N ND2  . ASN A 1 49 ? 9.320  13.105  6.781   1.00 0.00 ? 49 ASN A ND2  1  
ATOM 706   H H    . ASN A 1 49 ? 8.805  10.830  3.965   1.00 0.00 ? 49 ASN A H    1  
ATOM 707   H HA   . ASN A 1 49 ? 7.127  12.154  5.962   1.00 0.00 ? 49 ASN A HA   1  
ATOM 708   H HB2  . ASN A 1 49 ? 8.651  13.277  3.589   1.00 0.00 ? 49 ASN A HB2  1  
ATOM 709   H HB3  . ASN A 1 49 ? 7.656  14.244  4.673   1.00 0.00 ? 49 ASN A HB3  1  
ATOM 710   H HD21 . ASN A 1 49 ? 8.454  12.712  7.021   1.00 0.00 ? 49 ASN A HD21 1  
ATOM 711   H HD22 . ASN A 1 49 ? 10.083 13.187  7.388   1.00 0.00 ? 49 ASN A HD22 1  
ATOM 712   N N    . ASN A 1 50 ? 5.046  11.819  4.680   1.00 0.00 ? 50 ASN A N    1  
ATOM 713   C CA   . ASN A 1 50 ? 3.814  11.460  3.972   1.00 0.00 ? 50 ASN A CA   1  
ATOM 714   C C    . ASN A 1 50 ? 3.192  12.647  3.243   1.00 0.00 ? 50 ASN A C    1  
ATOM 715   O O    . ASN A 1 50 ? 2.124  13.146  3.618   1.00 0.00 ? 50 ASN A O    1  
ATOM 716   C CB   . ASN A 1 50 ? 2.816  10.856  4.961   1.00 0.00 ? 50 ASN A CB   1  
ATOM 717   C CG   . ASN A 1 50 ? 1.534  10.397  4.285   1.00 0.00 ? 50 ASN A CG   1  
ATOM 718   O OD1  . ASN A 1 50 ? 1.538  9.984   3.129   1.00 0.00 ? 50 ASN A OD1  1  
ATOM 719   N ND2  . ASN A 1 50 ? 0.430  10.469  5.008   1.00 0.00 ? 50 ASN A ND2  1  
ATOM 720   H H    . ASN A 1 50 ? 5.022  11.892  5.660   1.00 0.00 ? 50 ASN A H    1  
ATOM 721   H HA   . ASN A 1 50 ? 4.069  10.698  3.239   1.00 0.00 ? 50 ASN A HA   1  
ATOM 722   H HB2  . ASN A 1 50 ? 3.288  10.004  5.444   1.00 0.00 ? 50 ASN A HB2  1  
ATOM 723   H HB3  . ASN A 1 50 ? 2.564  11.599  5.707   1.00 0.00 ? 50 ASN A HB3  1  
ATOM 724   H HD21 . ASN A 1 50 ? 0.502  10.810  5.924   1.00 0.00 ? 50 ASN A HD21 1  
ATOM 725   H HD22 . ASN A 1 50 ? -0.400 10.179  4.581   1.00 0.00 ? 50 ASN A HD22 1  
ATOM 726   N N    . GLY A 1 51 ? 3.889  13.154  2.233   1.00 0.00 ? 51 GLY A N    1  
ATOM 727   C CA   . GLY A 1 51 ? 3.321  14.156  1.362   1.00 0.00 ? 51 GLY A CA   1  
ATOM 728   C C    . GLY A 1 51 ? 4.358  14.755  0.443   1.00 0.00 ? 51 GLY A C    1  
ATOM 729   O O    . GLY A 1 51 ? 4.034  15.352  -0.586  1.00 0.00 ? 51 GLY A O    1  
ATOM 730   H H    . GLY A 1 51 ? 4.845  12.930  2.131   1.00 0.00 ? 51 GLY A H    1  
ATOM 731   H HA2  . GLY A 1 51 ? 2.540  13.694  0.763   1.00 0.00 ? 51 GLY A HA2  1  
ATOM 732   H HA3  . GLY A 1 51 ? 2.880  14.950  1.962   1.00 0.00 ? 51 GLY A HA3  1  
ATOM 733   N N    . VAL A 1 52 ? 5.635  14.588  0.797   1.00 0.00 ? 52 VAL A N    1  
ATOM 734   C CA   . VAL A 1 52 ? 6.738  15.096  -0.012  1.00 0.00 ? 52 VAL A CA   1  
ATOM 735   C C    . VAL A 1 52 ? 7.678  13.955  -0.418  1.00 0.00 ? 52 VAL A C    1  
ATOM 736   O O    . VAL A 1 52 ? 7.645  12.872  0.173   1.00 0.00 ? 52 VAL A O    1  
ATOM 737   C CB   . VAL A 1 52 ? 7.540  16.188  0.747   1.00 0.00 ? 52 VAL A CB   1  
ATOM 738   C CG1  . VAL A 1 52 ? 6.784  17.505  0.761   1.00 0.00 ? 52 VAL A CG1  1  
ATOM 739   C CG2  . VAL A 1 52 ? 7.849  15.733  2.162   1.00 0.00 ? 52 VAL A CG2  1  
ATOM 740   H H    . VAL A 1 52 ? 5.836  14.099  1.617   1.00 0.00 ? 52 VAL A H    1  
ATOM 741   H HA   . VAL A 1 52 ? 6.318  15.547  -0.907  1.00 0.00 ? 52 VAL A HA   1  
ATOM 742   H HB   . VAL A 1 52 ? 8.482  16.348  0.229   1.00 0.00 ? 52 VAL A HB   1  
ATOM 743   H HG11 . VAL A 1 52 ? 6.570  17.815  -0.257  1.00 0.00 ? 52 VAL A HG11 1  
ATOM 744   H HG12 . VAL A 1 52 ? 7.381  18.260  1.253   1.00 0.00 ? 52 VAL A HG12 1  
ATOM 745   H HG13 . VAL A 1 52 ? 5.848  17.375  1.294   1.00 0.00 ? 52 VAL A HG13 1  
ATOM 746   H HG21 . VAL A 1 52 ? 8.428  16.490  2.666   1.00 0.00 ? 52 VAL A HG21 1  
ATOM 747   H HG22 . VAL A 1 52 ? 8.413  14.810  2.135   1.00 0.00 ? 52 VAL A HG22 1  
ATOM 748   H HG23 . VAL A 1 52 ? 6.919  15.577  2.706   1.00 0.00 ? 52 VAL A HG23 1  
ATOM 749   N N    . PRO A 1 53 ? 8.494  14.177  -1.462  1.00 0.00 ? 53 PRO A N    1  
ATOM 750   C CA   . PRO A 1 53 ? 9.439  13.167  -1.996  1.00 0.00 ? 53 PRO A CA   1  
ATOM 751   C C    . PRO A 1 53 ? 10.395 12.520  -0.970  1.00 0.00 ? 53 PRO A C    1  
ATOM 752   O O    . PRO A 1 53 ? 10.632 11.305  -1.060  1.00 0.00 ? 53 PRO A O    1  
ATOM 753   C CB   . PRO A 1 53 ? 10.236 13.919  -3.068  1.00 0.00 ? 53 PRO A CB   1  
ATOM 754   C CG   . PRO A 1 53 ? 9.869  15.355  -2.923  1.00 0.00 ? 53 PRO A CG   1  
ATOM 755   C CD   . PRO A 1 53 ? 8.531  15.408  -2.248  1.00 0.00 ? 53 PRO A CD   1  
ATOM 756   H HA   . PRO A 1 53 ? 8.890  12.363  -2.468  1.00 0.00 ? 53 PRO A HA   1  
ATOM 757   H HB2  . PRO A 1 53 ? 11.295 13.769  -2.893  1.00 0.00 ? 53 PRO A HB2  1  
ATOM 758   H HB3  . PRO A 1 53 ? 9.962  13.536  -4.039  1.00 0.00 ? 53 PRO A HB3  1  
ATOM 759   H HG2  . PRO A 1 53 ? 10.612 15.868  -2.311  1.00 0.00 ? 53 PRO A HG2  1  
ATOM 760   H HG3  . PRO A 1 53 ? 9.823  15.821  -3.900  1.00 0.00 ? 53 PRO A HG3  1  
ATOM 761   H HD2  . PRO A 1 53 ? 8.462  16.269  -1.597  1.00 0.00 ? 53 PRO A HD2  1  
ATOM 762   H HD3  . PRO A 1 53 ? 7.729  15.419  -2.980  1.00 0.00 ? 53 PRO A HD3  1  
ATOM 763   N N    . PRO A 1 54 ? 10.992 13.268  0.007   1.00 0.00 ? 54 PRO A N    1  
ATOM 764   C CA   . PRO A 1 54 ? 11.954 12.685  0.971   1.00 0.00 ? 54 PRO A CA   1  
ATOM 765   C C    . PRO A 1 54 ? 11.416 11.474  1.740   1.00 0.00 ? 54 PRO A C    1  
ATOM 766   O O    . PRO A 1 54 ? 10.381 11.524  2.390   1.00 0.00 ? 54 PRO A O    1  
ATOM 767   C CB   . PRO A 1 54 ? 12.257 13.834  1.943   1.00 0.00 ? 54 PRO A CB   1  
ATOM 768   C CG   . PRO A 1 54 ? 11.220 14.871  1.671   1.00 0.00 ? 54 PRO A CG   1  
ATOM 769   C CD   . PRO A 1 54 ? 10.827 14.694  0.233   1.00 0.00 ? 54 PRO A CD   1  
ATOM 770   H HA   . PRO A 1 54 ? 12.871 12.393  0.479   1.00 0.00 ? 54 PRO A HA   1  
ATOM 771   H HB2  . PRO A 1 54 ? 12.169 13.463  2.951   1.00 0.00 ? 54 PRO A HB2  1  
ATOM 772   H HB3  . PRO A 1 54 ? 13.259 14.215  1.773   1.00 0.00 ? 54 PRO A HB3  1  
ATOM 773   H HG2  . PRO A 1 54 ? 10.366 14.733  2.311   1.00 0.00 ? 54 PRO A HG2  1  
ATOM 774   H HG3  . PRO A 1 54 ? 11.641 15.863  1.814   1.00 0.00 ? 54 PRO A HG3  1  
ATOM 775   H HD2  . PRO A 1 54 ? 9.796  14.994  0.086   1.00 0.00 ? 54 PRO A HD2  1  
ATOM 776   H HD3  . PRO A 1 54 ? 11.477 15.273  -0.402  1.00 0.00 ? 54 PRO A HD3  1  
ATOM 777   N N    . VAL A 1 55 ? 12.167 10.369  1.649   1.00 0.00 ? 55 VAL A N    1  
ATOM 778   C CA   . VAL A 1 55 ? 11.832 9.140   2.360   1.00 0.00 ? 55 VAL A CA   1  
ATOM 779   C C    . VAL A 1 55 ? 13.067 8.643   3.139   1.00 0.00 ? 55 VAL A C    1  
ATOM 780   O O    . VAL A 1 55 ? 14.176 8.664   2.626   1.00 0.00 ? 55 VAL A O    1  
ATOM 781   C CB   . VAL A 1 55 ? 11.335 8.059   1.380   1.00 0.00 ? 55 VAL A CB   1  
ATOM 782   C CG1  . VAL A 1 55 ? 12.319 7.823   0.249   1.00 0.00 ? 55 VAL A CG1  1  
ATOM 783   C CG2  . VAL A 1 55 ? 11.058 6.769   2.122   1.00 0.00 ? 55 VAL A CG2  1  
ATOM 784   H H    . VAL A 1 55 ? 12.967 10.391  1.087   1.00 0.00 ? 55 VAL A H    1  
ATOM 785   H HA   . VAL A 1 55 ? 11.049 9.376   3.077   1.00 0.00 ? 55 VAL A HA   1  
ATOM 786   H HB   . VAL A 1 55 ? 10.403 8.398   0.945   1.00 0.00 ? 55 VAL A HB   1  
ATOM 787   H HG11 . VAL A 1 55 ? 11.950 7.059   -0.398  1.00 0.00 ? 55 VAL A HG11 1  
ATOM 788   H HG12 . VAL A 1 55 ? 13.271 7.535   0.676   1.00 0.00 ? 55 VAL A HG12 1  
ATOM 789   H HG13 . VAL A 1 55 ? 12.441 8.748   -0.307  1.00 0.00 ? 55 VAL A HG13 1  
ATOM 790   H HG21 . VAL A 1 55 ? 10.772 5.984   1.418   1.00 0.00 ? 55 VAL A HG21 1  
ATOM 791   H HG22 . VAL A 1 55 ? 10.257 6.900   2.833   1.00 0.00 ? 55 VAL A HG22 1  
ATOM 792   H HG23 . VAL A 1 55 ? 11.953 6.448   2.644   1.00 0.00 ? 55 VAL A HG23 1  
ATOM 793   N N    . GLN A 1 56 ? 12.852 8.204   4.355   1.00 0.00 ? 56 GLN A N    1  
ATOM 794   C CA   . GLN A 1 56 ? 13.947 7.773   5.228   1.00 0.00 ? 56 GLN A CA   1  
ATOM 795   C C    . GLN A 1 56 ? 14.166 6.270   5.073   1.00 0.00 ? 56 GLN A C    1  
ATOM 796   O O    . GLN A 1 56 ? 13.366 5.462   5.558   1.00 0.00 ? 56 GLN A O    1  
ATOM 797   C CB   . GLN A 1 56 ? 13.647 8.127   6.685   1.00 0.00 ? 56 GLN A CB   1  
ATOM 798   C CG   . GLN A 1 56 ? 14.713 7.717   7.690   1.00 0.00 ? 56 GLN A CG   1  
ATOM 799   C CD   . GLN A 1 56 ? 15.930 8.625   7.694   1.00 0.00 ? 56 GLN A CD   1  
ATOM 800   O OE1  . GLN A 1 56 ? 16.524 8.859   8.740   1.00 0.00 ? 56 GLN A OE1  1  
ATOM 801   N NE2  . GLN A 1 56 ? 16.316 9.145   6.528   1.00 0.00 ? 56 GLN A NE2  1  
ATOM 802   H H    . GLN A 1 56 ? 11.927 8.117   4.686   1.00 0.00 ? 56 GLN A H    1  
ATOM 803   H HA   . GLN A 1 56 ? 14.831 8.295   4.908   1.00 0.00 ? 56 GLN A HA   1  
ATOM 804   H HB2  . GLN A 1 56 ? 13.513 9.195   6.751   1.00 0.00 ? 56 GLN A HB2  1  
ATOM 805   H HB3  . GLN A 1 56 ? 12.716 7.652   6.965   1.00 0.00 ? 56 GLN A HB3  1  
ATOM 806   H HG2  . GLN A 1 56 ? 14.264 7.738   8.680   1.00 0.00 ? 56 GLN A HG2  1  
ATOM 807   H HG3  . GLN A 1 56 ? 15.018 6.712   7.478   1.00 0.00 ? 56 GLN A HG3  1  
ATOM 808   H HE21 . GLN A 1 56 ? 15.803 8.916   5.734   1.00 0.00 ? 56 GLN A HE21 1  
ATOM 809   H HE22 . GLN A 1 56 ? 17.118 9.724   6.526   1.00 0.00 ? 56 GLN A HE22 1  
ATOM 810   N N    . VAL A 1 57 ? 15.250 5.909   4.415   1.00 0.00 ? 57 VAL A N    1  
ATOM 811   C CA   . VAL A 1 57 ? 15.559 4.516   4.154   1.00 0.00 ? 57 VAL A CA   1  
ATOM 812   C C    . VAL A 1 57 ? 16.931 4.162   4.676   1.00 0.00 ? 57 VAL A C    1  
ATOM 813   O O    . VAL A 1 57 ? 17.863 4.972   4.589   1.00 0.00 ? 57 VAL A O    1  
ATOM 814   C CB   . VAL A 1 57 ? 15.490 4.216   2.619   1.00 0.00 ? 57 VAL A CB   1  
ATOM 815   C CG1  . VAL A 1 57 ? 15.917 2.786   2.352   1.00 0.00 ? 57 VAL A CG1  1  
ATOM 816   C CG2  . VAL A 1 57 ? 14.122 4.486   2.058   1.00 0.00 ? 57 VAL A CG2  1  
ATOM 817   H H    . VAL A 1 57 ? 15.904 6.584   4.102   1.00 0.00 ? 57 VAL A H    1  
ATOM 818   H HA   . VAL A 1 57 ? 14.815 3.903   4.646   1.00 0.00 ? 57 VAL A HA   1  
ATOM 819   H HB   . VAL A 1 57 ? 16.200 4.870   2.132   1.00 0.00 ? 57 VAL A HB   1  
ATOM 820   H HG11 . VAL A 1 57 ? 15.917 2.612   1.279   1.00 0.00 ? 57 VAL A HG11 1  
ATOM 821   H HG12 . VAL A 1 57 ? 15.245 2.096   2.828   1.00 0.00 ? 57 VAL A HG12 1  
ATOM 822   H HG13 . VAL A 1 57 ? 16.920 2.631   2.721   1.00 0.00 ? 57 VAL A HG13 1  
ATOM 823   H HG21 . VAL A 1 57 ? 14.091 4.272   1.007   1.00 0.00 ? 57 VAL A HG21 1  
ATOM 824   H HG22 . VAL A 1 57 ? 13.889 5.529   2.233   1.00 0.00 ? 57 VAL A HG22 1  
ATOM 825   H HG23 . VAL A 1 57 ? 13.395 3.874   2.578   1.00 0.00 ? 57 VAL A HG23 1  
ATOM 826   N N    . PHE A 1 58 ? 17.057 2.989   5.258   1.00 0.00 ? 58 PHE A N    1  
ATOM 827   C CA   . PHE A 1 58 ? 18.331 2.504   5.732   1.00 0.00 ? 58 PHE A CA   1  
ATOM 828   C C    . PHE A 1 58 ? 18.948 1.574   4.687   1.00 0.00 ? 58 PHE A C    1  
ATOM 829   O O    . PHE A 1 58 ? 18.374 0.540   4.351   1.00 0.00 ? 58 PHE A O    1  
ATOM 830   C CB   . PHE A 1 58 ? 18.188 1.781   7.078   1.00 0.00 ? 58 PHE A CB   1  
ATOM 831   C CG   . PHE A 1 58 ? 19.467 1.196   7.610   1.00 0.00 ? 58 PHE A CG   1  
ATOM 832   C CD1  . PHE A 1 58 ? 20.443 2.003   8.166   1.00 0.00 ? 58 PHE A CD1  1  
ATOM 833   C CD2  . PHE A 1 58 ? 19.687 -0.165  7.532   1.00 0.00 ? 58 PHE A CD2  1  
ATOM 834   C CE1  . PHE A 1 58 ? 21.623 1.463   8.632   1.00 0.00 ? 58 PHE A CE1  1  
ATOM 835   C CE2  . PHE A 1 58 ? 20.874 -0.722  8.003   1.00 0.00 ? 58 PHE A CE2  1  
ATOM 836   C CZ   . PHE A 1 58 ? 21.837 0.094   8.548   1.00 0.00 ? 58 PHE A CZ   1  
ATOM 837   H H    . PHE A 1 58 ? 16.262 2.416   5.357   1.00 0.00 ? 58 PHE A H    1  
ATOM 838   H HA   . PHE A 1 58 ? 18.984 3.348   5.864   1.00 0.00 ? 58 PHE A HA   1  
ATOM 839   H HB2  . PHE A 1 58 ? 17.808 2.475   7.811   1.00 0.00 ? 58 PHE A HB2  1  
ATOM 840   H HB3  . PHE A 1 58 ? 17.467 0.975   6.963   1.00 0.00 ? 58 PHE A HB3  1  
ATOM 841   H HD1  . PHE A 1 58 ? 20.273 3.074   8.225   1.00 0.00 ? 58 PHE A HD1  1  
ATOM 842   H HD2  . PHE A 1 58 ? 18.943 -0.811  7.086   1.00 0.00 ? 58 PHE A HD2  1  
ATOM 843   H HE1  . PHE A 1 58 ? 22.378 2.102   9.071   1.00 0.00 ? 58 PHE A HE1  1  
ATOM 844   H HE2  . PHE A 1 58 ? 21.036 -1.781  7.944   1.00 0.00 ? 58 PHE A HE2  1  
ATOM 845   H HZ   . PHE A 1 58 ? 22.766 -0.331  8.927   1.00 0.00 ? 58 PHE A HZ   1  
ATOM 846   N N    . TRP A 1 59 ? 20.112 1.940   4.168   1.00 0.00 ? 59 TRP A N    1  
ATOM 847   C CA   . TRP A 1 59 ? 20.744 1.147   3.134   1.00 0.00 ? 59 TRP A CA   1  
ATOM 848   C C    . TRP A 1 59 ? 21.736 0.188   3.741   1.00 0.00 ? 59 TRP A C    1  
ATOM 849   O O    . TRP A 1 59 ? 22.666 0.579   4.433   1.00 0.00 ? 59 TRP A O    1  
ATOM 850   C CB   . TRP A 1 59 ? 21.419 2.043   2.099   1.00 0.00 ? 59 TRP A CB   1  
ATOM 851   C CG   . TRP A 1 59 ? 20.420 2.902   1.363   1.00 0.00 ? 59 TRP A CG   1  
ATOM 852   C CD1  . TRP A 1 59 ? 20.243 4.245   1.509   1.00 0.00 ? 59 TRP A CD1  1  
ATOM 853   C CD2  . TRP A 1 59 ? 19.453 2.465   0.404   1.00 0.00 ? 59 TRP A CD2  1  
ATOM 854   N NE1  . TRP A 1 59 ? 19.228 4.673   0.682   1.00 0.00 ? 59 TRP A NE1  1  
ATOM 855   C CE2  . TRP A 1 59 ? 18.729 3.600   0.004   1.00 0.00 ? 59 TRP A CE2  1  
ATOM 856   C CE3  . TRP A 1 59 ? 19.135 1.231   -0.151  1.00 0.00 ? 59 TRP A CE3  1  
ATOM 857   C CZ2  . TRP A 1 59 ? 17.699 3.538   -0.935  1.00 0.00 ? 59 TRP A CZ2  1  
ATOM 858   C CZ3  . TRP A 1 59 ? 18.117 1.167   -1.073  1.00 0.00 ? 59 TRP A CZ3  1  
ATOM 859   C CH2  . TRP A 1 59 ? 17.410 2.311   -1.465  1.00 0.00 ? 59 TRP A CH2  1  
ATOM 860   H H    . TRP A 1 59 ? 20.543 2.741   4.516   1.00 0.00 ? 59 TRP A H    1  
ATOM 861   H HA   . TRP A 1 59 ? 19.969 0.572   2.637   1.00 0.00 ? 59 TRP A HA   1  
ATOM 862   H HB2  . TRP A 1 59 ? 22.127 2.699   2.589   1.00 0.00 ? 59 TRP A HB2  1  
ATOM 863   H HB3  . TRP A 1 59 ? 21.926 1.431   1.362   1.00 0.00 ? 59 TRP A HB3  1  
ATOM 864   H HD1  . TRP A 1 59 ? 20.825 4.875   2.169   1.00 0.00 ? 59 TRP A HD1  1  
ATOM 865   H HE1  . TRP A 1 59 ? 18.917 5.602   0.597   1.00 0.00 ? 59 TRP A HE1  1  
ATOM 866   H HE3  . TRP A 1 59 ? 19.676 0.333   0.131   1.00 0.00 ? 59 TRP A HE3  1  
ATOM 867   H HZ2  . TRP A 1 59 ? 17.147 4.411   -1.239  1.00 0.00 ? 59 TRP A HZ2  1  
ATOM 868   H HZ3  . TRP A 1 59 ? 17.858 0.213   -1.512  1.00 0.00 ? 59 TRP A HZ3  1  
ATOM 869   H HH2  . TRP A 1 59 ? 16.613 2.212   -2.184  1.00 0.00 ? 59 TRP A HH2  1  
ATOM 870   N N    . GLU A 1 60 ? 21.504 -1.086  3.452   1.00 0.00 ? 60 GLU A N    1  
ATOM 871   C CA   . GLU A 1 60 ? 22.228 -2.167  4.072   1.00 0.00 ? 60 GLU A CA   1  
ATOM 872   C C    . GLU A 1 60 ? 23.682 -2.232  3.610   1.00 0.00 ? 60 GLU A C    1  
ATOM 873   O O    . GLU A 1 60 ? 24.582 -2.305  4.433   1.00 0.00 ? 60 GLU A O    1  
ATOM 874   C CB   . GLU A 1 60 ? 21.511 -3.468  3.767   1.00 0.00 ? 60 GLU A CB   1  
ATOM 875   C CG   . GLU A 1 60 ? 22.087 -4.682  4.479   1.00 0.00 ? 60 GLU A CG   1  
ATOM 876   C CD   . GLU A 1 60 ? 21.935 -4.620  5.989   1.00 0.00 ? 60 GLU A CD   1  
ATOM 877   O OE1  . GLU A 1 60 ? 20.868 -4.985  6.501   1.00 0.00 ? 60 GLU A OE1  1  
ATOM 878   O OE2  . GLU A 1 60 ? 22.896 -4.177  6.667   1.00 0.00 ? 60 GLU A OE2  1  
ATOM 879   H H    . GLU A 1 60 ? 20.800 -1.308  2.809   1.00 0.00 ? 60 GLU A H    1  
ATOM 880   H HA   . GLU A 1 60 ? 22.210 -2.005  5.128   1.00 0.00 ? 60 GLU A HA   1  
ATOM 881   H HB2  . GLU A 1 60 ? 20.488 -3.363  4.071   1.00 0.00 ? 60 GLU A HB2  1  
ATOM 882   H HB3  . GLU A 1 60 ? 21.545 -3.646  2.697   1.00 0.00 ? 60 GLU A HB3  1  
ATOM 883   H HG2  . GLU A 1 60 ? 21.571 -5.558  4.124   1.00 0.00 ? 60 GLU A HG2  1  
ATOM 884   H HG3  . GLU A 1 60 ? 23.132 -4.751  4.244   1.00 0.00 ? 60 GLU A HG3  1  
ATOM 885   N N    . SER A 1 61 ? 23.915 -2.198  2.300   1.00 0.00 ? 61 SER A N    1  
ATOM 886   C CA   . SER A 1 61 ? 25.262 -2.431  1.783   1.00 0.00 ? 61 SER A CA   1  
ATOM 887   C C    . SER A 1 61 ? 26.207 -1.309  2.210   1.00 0.00 ? 61 SER A C    1  
ATOM 888   O O    . SER A 1 61 ? 27.381 -1.546  2.475   1.00 0.00 ? 61 SER A O    1  
ATOM 889   C CB   . SER A 1 61 ? 25.247 -2.594  0.274   1.00 0.00 ? 61 SER A CB   1  
ATOM 890   O OG   . SER A 1 61 ? 24.996 -1.369  -0.395  1.00 0.00 ? 61 SER A OG   1  
ATOM 891   H H    . SER A 1 61 ? 23.167 -2.033  1.698   1.00 0.00 ? 61 SER A H    1  
ATOM 892   H HA   . SER A 1 61 ? 25.607 -3.345  2.233   1.00 0.00 ? 61 SER A HA   1  
ATOM 893   H HB2  . SER A 1 61 ? 26.201 -2.969  -0.053  1.00 0.00 ? 61 SER A HB2  1  
ATOM 894   H HB3  . SER A 1 61 ? 24.476 -3.292  -0.002  1.00 0.00 ? 61 SER A HB3  1  
ATOM 895   H HG   . SER A 1 61 ? 24.082 -1.073  -0.212  1.00 0.00 ? 61 SER A HG   1  
ATOM 896   N N    . THR A 1 62 ? 25.688 -0.096  2.285   1.00 0.00 ? 62 THR A N    1  
ATOM 897   C CA   . THR A 1 62 ? 26.475 1.043   2.745   1.00 0.00 ? 62 THR A CA   1  
ATOM 898   C C    . THR A 1 62 ? 26.477 1.087   4.268   1.00 0.00 ? 62 THR A C    1  
ATOM 899   O O    . THR A 1 62 ? 27.520 1.173   4.904   1.00 0.00 ? 62 THR A O    1  
ATOM 900   C CB   . THR A 1 62 ? 25.918 2.358   2.185   1.00 0.00 ? 62 THR A CB   1  
ATOM 901   O OG1  . THR A 1 62 ? 24.476 2.329   2.233   1.00 0.00 ? 62 THR A OG1  1  
ATOM 902   C CG2  . THR A 1 62 ? 26.365 2.592   0.752   1.00 0.00 ? 62 THR A CG2  1  
ATOM 903   H H    . THR A 1 62 ? 24.745 0.053   2.049   1.00 0.00 ? 62 THR A H    1  
ATOM 904   H HA   . THR A 1 62 ? 27.482 0.918   2.400   1.00 0.00 ? 62 THR A HA   1  
ATOM 905   H HB   . THR A 1 62 ? 26.269 3.161   2.798   1.00 0.00 ? 62 THR A HB   1  
ATOM 906   H HG1  . THR A 1 62 ? 24.118 2.231   1.336   1.00 0.00 ? 62 THR A HG1  1  
ATOM 907   H HG21 . THR A 1 62 ? 25.975 3.535   0.408   1.00 0.00 ? 62 THR A HG21 1  
ATOM 908   H HG22 . THR A 1 62 ? 26.016 1.794   0.136   1.00 0.00 ? 62 THR A HG22 1  
ATOM 909   H HG23 . THR A 1 62 ? 27.450 2.619   0.734   1.00 0.00 ? 62 THR A HG23 1  
ATOM 910   N N    . GLY A 1 63 ? 25.281 1.008   4.835   1.00 0.00 ? 63 GLY A N    1  
ATOM 911   C CA   . GLY A 1 63 ? 25.130 1.054   6.271   1.00 0.00 ? 63 GLY A CA   1  
ATOM 912   C C    . GLY A 1 63 ? 24.771 2.460   6.714   1.00 0.00 ? 63 GLY A C    1  
ATOM 913   O O    . GLY A 1 63 ? 24.989 2.822   7.876   1.00 0.00 ? 63 GLY A O    1  
ATOM 914   H H    . GLY A 1 63 ? 24.497 0.938   4.250   1.00 0.00 ? 63 GLY A H    1  
ATOM 915   H HA2  . GLY A 1 63 ? 24.332 0.386   6.553   1.00 0.00 ? 63 GLY A HA2  1  
ATOM 916   H HA3  . GLY A 1 63 ? 26.055 0.742   6.742   1.00 0.00 ? 63 GLY A HA3  1  
ATOM 917   N N    . ARG A 1 64 ? 24.234 3.244   5.803   1.00 0.00 ? 64 ARG A N    1  
ATOM 918   C CA   . ARG A 1 64 ? 23.883 4.623   6.092   1.00 0.00 ? 64 ARG A CA   1  
ATOM 919   C C    . ARG A 1 64 ? 22.391 4.803   5.876   1.00 0.00 ? 64 ARG A C    1  
ATOM 920   O O    . ARG A 1 64 ? 21.804 4.240   4.948   1.00 0.00 ? 64 ARG A O    1  
ATOM 921   C CB   . ARG A 1 64 ? 24.656 5.554   5.147   1.00 0.00 ? 64 ARG A CB   1  
ATOM 922   C CG   . ARG A 1 64 ? 26.139 5.207   5.014   1.00 0.00 ? 64 ARG A CG   1  
ATOM 923   C CD   . ARG A 1 64 ? 26.932 5.671   6.219   1.00 0.00 ? 64 ARG A CD   1  
ATOM 924   N NE   . ARG A 1 64 ? 27.197 7.095   6.169   1.00 0.00 ? 64 ARG A NE   1  
ATOM 925   C CZ   . ARG A 1 64 ? 27.304 7.887   7.240   1.00 0.00 ? 64 ARG A CZ   1  
ATOM 926   N NH1  . ARG A 1 64 ? 27.100 7.402   8.463   1.00 0.00 ? 64 ARG A NH1  1  
ATOM 927   N NH2  . ARG A 1 64 ? 27.607 9.183   7.096   1.00 0.00 ? 64 ARG A NH2  1  
ATOM 928   H H    . ARG A 1 64 ? 24.059 2.893   4.906   1.00 0.00 ? 64 ARG A H    1  
ATOM 929   H HA   . ARG A 1 64 ? 24.146 4.828   7.112   1.00 0.00 ? 64 ARG A HA   1  
ATOM 930   H HB2  . ARG A 1 64 ? 24.211 5.513   4.165   1.00 0.00 ? 64 ARG A HB2  1  
ATOM 931   H HB3  . ARG A 1 64 ? 24.582 6.574   5.528   1.00 0.00 ? 64 ARG A HB3  1  
ATOM 932   H HG2  . ARG A 1 64 ? 26.240 4.141   4.905   1.00 0.00 ? 64 ARG A HG2  1  
ATOM 933   H HG3  . ARG A 1 64 ? 26.531 5.706   4.133   1.00 0.00 ? 64 ARG A HG3  1  
ATOM 934   H HD2  . ARG A 1 64 ? 26.360 5.439   7.113   1.00 0.00 ? 64 ARG A HD2  1  
ATOM 935   H HD3  . ARG A 1 64 ? 27.868 5.137   6.245   1.00 0.00 ? 64 ARG A HD3  1  
ATOM 936   H HE   . ARG A 1 64 ? 27.354 7.490   5.285   1.00 0.00 ? 64 ARG A HE   1  
ATOM 937   H HH11 . ARG A 1 64 ? 26.882 6.444   8.588   1.00 0.00 ? 64 ARG A HH11 1  
ATOM 938   H HH12 . ARG A 1 64 ? 27.169 8.010   9.275   1.00 0.00 ? 64 ARG A HH12 1  
ATOM 939   H HH21 . ARG A 1 64 ? 27.752 9.557   6.181   1.00 0.00 ? 64 ARG A HH21 1  
ATOM 940   H HH22 . ARG A 1 64 ? 27.702 9.784   7.906   1.00 0.00 ? 64 ARG A HH22 1  
ATOM 941   N N    . THR A 1 65 ? 21.752 5.580   6.742   1.00 0.00 ? 65 THR A N    1  
ATOM 942   C CA   . THR A 1 65 ? 20.375 5.978   6.518   1.00 0.00 ? 65 THR A CA   1  
ATOM 943   C C    . THR A 1 65 ? 20.353 7.228   5.637   1.00 0.00 ? 65 THR A C    1  
ATOM 944   O O    . THR A 1 65 ? 21.138 8.155   5.852   1.00 0.00 ? 65 THR A O    1  
ATOM 945   C CB   . THR A 1 65 ? 19.646 6.243   7.842   1.00 0.00 ? 65 THR A CB   1  
ATOM 946   O OG1  . THR A 1 65 ? 20.083 5.303   8.828   1.00 0.00 ? 65 THR A OG1  1  
ATOM 947   C CG2  . THR A 1 65 ? 18.151 6.120   7.660   1.00 0.00 ? 65 THR A CG2  1  
ATOM 948   H H    . THR A 1 65 ? 22.178 5.847   7.592   1.00 0.00 ? 65 THR A H    1  
ATOM 949   H HA   . THR A 1 65 ? 19.882 5.164   6.002   1.00 0.00 ? 65 THR A HA   1  
ATOM 950   H HB   . THR A 1 65 ? 19.880 7.248   8.166   1.00 0.00 ? 65 THR A HB   1  
ATOM 951   H HG1  . THR A 1 65 ? 19.442 5.281   9.558   1.00 0.00 ? 65 THR A HG1  1  
ATOM 952   H HG21 . THR A 1 65 ? 17.810 6.833   6.923   1.00 0.00 ? 65 THR A HG21 1  
ATOM 953   H HG22 . THR A 1 65 ? 17.665 6.331   8.616   1.00 0.00 ? 65 THR A HG22 1  
ATOM 954   H HG23 . THR A 1 65 ? 17.907 5.117   7.354   1.00 0.00 ? 65 THR A HG23 1  
ATOM 955   N N    . TYR A 1 66 ? 19.456 7.250   4.677   1.00 0.00 ? 66 TYR A N    1  
ATOM 956   C CA   . TYR A 1 66 ? 19.456 8.301   3.670   1.00 0.00 ? 66 TYR A CA   1  
ATOM 957   C C    . TYR A 1 66 ? 18.033 8.679   3.300   1.00 0.00 ? 66 TYR A C    1  
ATOM 958   O O    . TYR A 1 66 ? 17.143 7.826   3.297   1.00 0.00 ? 66 TYR A O    1  
ATOM 959   C CB   . TYR A 1 66 ? 20.235 7.812   2.436   1.00 0.00 ? 66 TYR A CB   1  
ATOM 960   C CG   . TYR A 1 66 ? 20.375 8.834   1.334   1.00 0.00 ? 66 TYR A CG   1  
ATOM 961   C CD1  . TYR A 1 66 ? 21.182 9.948   1.472   1.00 0.00 ? 66 TYR A CD1  1  
ATOM 962   C CD2  . TYR A 1 66 ? 19.698 8.668   0.135   1.00 0.00 ? 66 TYR A CD2  1  
ATOM 963   C CE1  . TYR A 1 66 ? 21.310 10.873  0.457   1.00 0.00 ? 66 TYR A CE1  1  
ATOM 964   C CE2  . TYR A 1 66 ? 19.823 9.574   -0.889  1.00 0.00 ? 66 TYR A CE2  1  
ATOM 965   C CZ   . TYR A 1 66 ? 20.630 10.683  -0.726  1.00 0.00 ? 66 TYR A CZ   1  
ATOM 966   O OH   . TYR A 1 66 ? 20.752 11.614  -1.725  1.00 0.00 ? 66 TYR A OH   1  
ATOM 967   H H    . TYR A 1 66 ? 18.762 6.551   4.645   1.00 0.00 ? 66 TYR A H    1  
ATOM 968   H HA   . TYR A 1 66 ? 19.950 9.171   4.089   1.00 0.00 ? 66 TYR A HA   1  
ATOM 969   H HB2  . TYR A 1 66 ? 21.243 7.524   2.740   1.00 0.00 ? 66 TYR A HB2  1  
ATOM 970   H HB3  . TYR A 1 66 ? 19.726 6.947   2.024   1.00 0.00 ? 66 TYR A HB3  1  
ATOM 971   H HD1  . TYR A 1 66 ? 21.709 10.100  2.402   1.00 0.00 ? 66 TYR A HD1  1  
ATOM 972   H HD2  . TYR A 1 66 ? 19.066 7.800   0.011   1.00 0.00 ? 66 TYR A HD2  1  
ATOM 973   H HE1  . TYR A 1 66 ? 21.953 11.732  0.597   1.00 0.00 ? 66 TYR A HE1  1  
ATOM 974   H HE2  . TYR A 1 66 ? 19.297 9.428   -1.835  1.00 0.00 ? 66 TYR A HE2  1  
ATOM 975   H HH   . TYR A 1 66 ? 19.869 11.817  -2.098  1.00 0.00 ? 66 TYR A HH   1  
ATOM 976   N N    . TRP A 1 67 ? 17.809 9.956   2.989   1.00 0.00 ? 67 TRP A N    1  
ATOM 977   C CA   . TRP A 1 67 ? 16.527 10.366  2.454   1.00 0.00 ? 67 TRP A CA   1  
ATOM 978   C C    . TRP A 1 67 ? 16.563 10.242  0.939   1.00 0.00 ? 67 TRP A C    1  
ATOM 979   O O    . TRP A 1 67 ? 17.296 10.961  0.259   1.00 0.00 ? 67 TRP A O    1  
ATOM 980   C CB   . TRP A 1 67 ? 16.179 11.811  2.850   1.00 0.00 ? 67 TRP A CB   1  
ATOM 981   C CG   . TRP A 1 67 ? 15.840 11.960  4.294   1.00 0.00 ? 67 TRP A CG   1  
ATOM 982   C CD1  . TRP A 1 67 ? 14.702 11.554  4.924   1.00 0.00 ? 67 TRP A CD1  1  
ATOM 983   C CD2  . TRP A 1 67 ? 16.648 12.589  5.310   1.00 0.00 ? 67 TRP A CD2  1  
ATOM 984   N NE1  . TRP A 1 67 ? 14.759 11.854  6.257   1.00 0.00 ? 67 TRP A NE1  1  
ATOM 985   C CE2  . TRP A 1 67 ? 15.939 12.510  6.514   1.00 0.00 ? 67 TRP A CE2  1  
ATOM 986   C CE3  . TRP A 1 67 ? 17.903 13.216  5.304   1.00 0.00 ? 67 TRP A CE3  1  
ATOM 987   C CZ2  . TRP A 1 67 ? 16.440 13.022  7.705   1.00 0.00 ? 67 TRP A CZ2  1  
ATOM 988   C CZ3  . TRP A 1 67 ? 18.397 13.721  6.492   1.00 0.00 ? 67 TRP A CZ3  1  
ATOM 989   C CH2  . TRP A 1 67 ? 17.673 13.619  7.676   1.00 0.00 ? 67 TRP A CH2  1  
ATOM 990   H H    . TRP A 1 67 ? 18.531 10.613  3.100   1.00 0.00 ? 67 TRP A H    1  
ATOM 991   H HA   . TRP A 1 67 ? 15.767 9.712   2.843   1.00 0.00 ? 67 TRP A HA   1  
ATOM 992   H HB2  . TRP A 1 67 ? 17.021 12.448  2.631   1.00 0.00 ? 67 TRP A HB2  1  
ATOM 993   H HB3  . TRP A 1 67 ? 15.317 12.126  2.273   1.00 0.00 ? 67 TRP A HB3  1  
ATOM 994   H HD1  . TRP A 1 67 ? 13.896 11.033  4.426   1.00 0.00 ? 67 TRP A HD1  1  
ATOM 995   H HE1  . TRP A 1 67 ? 14.060 11.653  6.928   1.00 0.00 ? 67 TRP A HE1  1  
ATOM 996   H HE3  . TRP A 1 67 ? 18.486 13.276  4.405   1.00 0.00 ? 67 TRP A HE3  1  
ATOM 997   H HZ2  . TRP A 1 67 ? 15.895 12.956  8.636   1.00 0.00 ? 67 TRP A HZ2  1  
ATOM 998   H HZ3  . TRP A 1 67 ? 19.361 14.199  6.519   1.00 0.00 ? 67 TRP A HZ3  1  
ATOM 999   H HH2  . TRP A 1 67 ? 18.105 14.039  8.582   1.00 0.00 ? 67 TRP A HH2  1  
ATOM 1000  N N    . VAL A 1 68 ? 15.766 9.331   0.420   1.00 0.00 ? 68 VAL A N    1  
ATOM 1001  C CA   . VAL A 1 68 ? 15.807 8.960   -0.978  1.00 0.00 ? 68 VAL A CA   1  
ATOM 1002  C C    . VAL A 1 68 ? 14.621 9.583   -1.710  1.00 0.00 ? 68 VAL A C    1  
ATOM 1003  O O    . VAL A 1 68 ? 14.073 10.589  -1.257  1.00 0.00 ? 68 VAL A O    1  
ATOM 1004  C CB   . VAL A 1 68 ? 15.772 7.418   -1.144  1.00 0.00 ? 68 VAL A CB   1  
ATOM 1005  C CG1  . VAL A 1 68 ? 16.485 6.984   -2.426  1.00 0.00 ? 68 VAL A CG1  1  
ATOM 1006  C CG2  . VAL A 1 68 ? 16.399 6.729   0.069   1.00 0.00 ? 68 VAL A CG2  1  
ATOM 1007  H H    . VAL A 1 68 ? 15.127 8.836   0.974   1.00 0.00 ? 68 VAL A H    1  
ATOM 1008  H HA   . VAL A 1 68 ? 16.731 9.337   -1.413  1.00 0.00 ? 68 VAL A HA   1  
ATOM 1009  H HB   . VAL A 1 68 ? 14.739 7.108   -1.219  1.00 0.00 ? 68 VAL A HB   1  
ATOM 1010  H HG11 . VAL A 1 68 ? 17.527 7.269   -2.369  1.00 0.00 ? 68 VAL A HG11 1  
ATOM 1011  H HG12 . VAL A 1 68 ? 16.025 7.475   -3.267  1.00 0.00 ? 68 VAL A HG12 1  
ATOM 1012  H HG13 . VAL A 1 68 ? 16.410 5.914   -2.539  1.00 0.00 ? 68 VAL A HG13 1  
ATOM 1013  H HG21 . VAL A 1 68 ? 17.436 6.996   0.129   1.00 0.00 ? 68 VAL A HG21 1  
ATOM 1014  H HG22 . VAL A 1 68 ? 16.307 5.660   -0.033  1.00 0.00 ? 68 VAL A HG22 1  
ATOM 1015  H HG23 . VAL A 1 68 ? 15.887 7.044   0.954   1.00 0.00 ? 68 VAL A HG23 1  
ATOM 1016  N N    . HIS A 1 69 ? 14.223 8.984   -2.820  1.00 0.00 ? 69 HIS A N    1  
ATOM 1017  C CA   . HIS A 1 69 ? 13.208 9.575   -3.671  1.00 0.00 ? 69 HIS A CA   1  
ATOM 1018  C C    . HIS A 1 69 ? 12.283 8.453   -4.118  1.00 0.00 ? 69 HIS A C    1  
ATOM 1019  O O    . HIS A 1 69 ? 12.769 7.402   -4.528  1.00 0.00 ? 69 HIS A O    1  
ATOM 1020  C CB   . HIS A 1 69 ? 13.821 10.313  -4.865  1.00 0.00 ? 69 HIS A CB   1  
ATOM 1021  C CG   . HIS A 1 69 ? 14.305 11.693  -4.542  1.00 0.00 ? 69 HIS A CG   1  
ATOM 1022  N ND1  . HIS A 1 69 ? 13.574 12.824  -4.794  1.00 0.00 ? 69 HIS A ND1  1  
ATOM 1023  C CD2  . HIS A 1 69 ? 15.462 12.113  -3.987  1.00 0.00 ? 69 HIS A CD2  1  
ATOM 1024  C CE1  . HIS A 1 69 ? 14.262 13.893  -4.418  1.00 0.00 ? 69 HIS A CE1  1  
ATOM 1025  N NE2  . HIS A 1 69 ? 15.411 13.484  -3.922  1.00 0.00 ? 69 HIS A NE2  1  
ATOM 1026  H H    . HIS A 1 69 ? 14.379 8.032   -2.912  1.00 0.00 ? 69 HIS A H    1  
ATOM 1027  H HA   . HIS A 1 69 ? 12.636 10.270  -3.057  1.00 0.00 ? 69 HIS A HA   1  
ATOM 1028  H HB2  . HIS A 1 69 ? 14.648 9.737   -5.232  1.00 0.00 ? 69 HIS A HB2  1  
ATOM 1029  H HB3  . HIS A 1 69 ? 13.071 10.398  -5.649  1.00 0.00 ? 69 HIS A HB3  1  
ATOM 1030  H HD1  . HIS A 1 69 ? 12.685 12.862  -5.210  1.00 0.00 ? 69 HIS A HD1  1  
ATOM 1031  H HD2  . HIS A 1 69 ? 16.291 11.485  -3.671  1.00 0.00 ? 69 HIS A HD2  1  
ATOM 1032  H HE1  . HIS A 1 69 ? 13.952 14.916  -4.533  1.00 0.00 ? 69 HIS A HE1  1  
ATOM 1033  H HE2  . HIS A 1 69 ? 16.186 14.079  -3.737  1.00 0.00 ? 69 HIS A HE2  1  
ATOM 1034  N N    . TRP A 1 70 ? 10.982 8.664   -4.051  1.00 0.00 ? 70 TRP A N    1  
ATOM 1035  C CA   . TRP A 1 70 ? 10.013 7.627   -4.396  1.00 0.00 ? 70 TRP A CA   1  
ATOM 1036  C C    . TRP A 1 70 ? 10.266 7.005   -5.778  1.00 0.00 ? 70 TRP A C    1  
ATOM 1037  O O    . TRP A 1 70 ? 10.271 5.777   -5.919  1.00 0.00 ? 70 TRP A O    1  
ATOM 1038  C CB   . TRP A 1 70 ? 8.597  8.194   -4.334  1.00 0.00 ? 70 TRP A CB   1  
ATOM 1039  C CG   . TRP A 1 70 ? 8.220  8.703   -2.978  1.00 0.00 ? 70 TRP A CG   1  
ATOM 1040  C CD1  . TRP A 1 70 ? 8.038  9.997   -2.588  1.00 0.00 ? 70 TRP A CD1  1  
ATOM 1041  C CD2  . TRP A 1 70 ? 7.959  7.904   -1.819  1.00 0.00 ? 70 TRP A CD2  1  
ATOM 1042  N NE1  . TRP A 1 70 ? 7.704  10.044  -1.255  1.00 0.00 ? 70 TRP A NE1  1  
ATOM 1043  C CE2  . TRP A 1 70 ? 7.640  8.774   -0.764  1.00 0.00 ? 70 TRP A CE2  1  
ATOM 1044  C CE3  . TRP A 1 70 ? 7.967  6.520   -1.568  1.00 0.00 ? 70 TRP A CE3  1  
ATOM 1045  C CZ2  . TRP A 1 70 ? 7.331  8.319   0.515   1.00 0.00 ? 70 TRP A CZ2  1  
ATOM 1046  C CZ3  . TRP A 1 70 ? 7.659  6.072   -0.299  1.00 0.00 ? 70 TRP A CZ3  1  
ATOM 1047  C CH2  . TRP A 1 70 ? 7.343  6.967   0.727   1.00 0.00 ? 70 TRP A CH2  1  
ATOM 1048  H H    . TRP A 1 70 ? 10.649 9.513   -3.671  1.00 0.00 ? 70 TRP A H    1  
ATOM 1049  H HA   . TRP A 1 70 ? 10.106 6.860   -3.654  1.00 0.00 ? 70 TRP A HA   1  
ATOM 1050  H HB2  . TRP A 1 70 ? 8.507  8.999   -5.042  1.00 0.00 ? 70 TRP A HB2  1  
ATOM 1051  H HB3  . TRP A 1 70 ? 7.902  7.409   -4.593  1.00 0.00 ? 70 TRP A HB3  1  
ATOM 1052  H HD1  . TRP A 1 70 ? 8.164  10.861  -3.241  1.00 0.00 ? 70 TRP A HD1  1  
ATOM 1053  H HE1  . TRP A 1 70 ? 7.527  10.851  -0.725  1.00 0.00 ? 70 TRP A HE1  1  
ATOM 1054  H HE3  . TRP A 1 70 ? 8.209  5.818   -2.347  1.00 0.00 ? 70 TRP A HE3  1  
ATOM 1055  H HZ2  . TRP A 1 70 ? 7.083  8.999   1.320   1.00 0.00 ? 70 TRP A HZ2  1  
ATOM 1056  H HZ3  . TRP A 1 70 ? 7.659  5.002   -0.090  1.00 0.00 ? 70 TRP A HZ3  1  
ATOM 1057  H HH2  . TRP A 1 70 ? 7.115  6.565   1.696   1.00 0.00 ? 70 TRP A HH2  1  
ATOM 1058  N N    . HIS A 1 71 ? 10.524 7.842   -6.768  1.00 0.00 ? 71 HIS A N    1  
ATOM 1059  C CA   . HIS A 1 71 ? 10.636 7.377   -8.150  1.00 0.00 ? 71 HIS A CA   1  
ATOM 1060  C C    . HIS A 1 71 ? 11.877 6.519   -8.399  1.00 0.00 ? 71 HIS A C    1  
ATOM 1061  O O    . HIS A 1 71 ? 11.996 5.909   -9.445  1.00 0.00 ? 71 HIS A O    1  
ATOM 1062  C CB   . HIS A 1 71 ? 10.615 8.551   -9.143  1.00 0.00 ? 71 HIS A CB   1  
ATOM 1063  C CG   . HIS A 1 71 ? 11.886 9.323   -9.226  1.00 0.00 ? 71 HIS A CG   1  
ATOM 1064  N ND1  . HIS A 1 71 ? 12.741 9.257   -10.303 1.00 0.00 ? 71 HIS A ND1  1  
ATOM 1065  C CD2  . HIS A 1 71 ? 12.443 10.188  -8.350  1.00 0.00 ? 71 HIS A CD2  1  
ATOM 1066  C CE1  . HIS A 1 71 ? 13.777 10.049  -10.094 1.00 0.00 ? 71 HIS A CE1  1  
ATOM 1067  N NE2  . HIS A 1 71 ? 13.626 10.637  -8.910  1.00 0.00 ? 71 HIS A NE2  1  
ATOM 1068  H H    . HIS A 1 71 ? 10.614 8.808   -6.567  1.00 0.00 ? 71 HIS A H    1  
ATOM 1069  H HA   . HIS A 1 71 ? 9.762  6.753   -8.333  1.00 0.00 ? 71 HIS A HA   1  
ATOM 1070  H HB2  . HIS A 1 71 ? 10.394 8.158   -10.139 1.00 0.00 ? 71 HIS A HB2  1  
ATOM 1071  H HB3  . HIS A 1 71 ? 9.818  9.233   -8.849  1.00 0.00 ? 71 HIS A HB3  1  
ATOM 1072  H HD1  . HIS A 1 71 ? 12.599 8.726   -11.121 1.00 0.00 ? 71 HIS A HD1  1  
ATOM 1073  H HD2  . HIS A 1 71 ? 12.050 10.473  -7.387  1.00 0.00 ? 71 HIS A HD2  1  
ATOM 1074  H HE1  . HIS A 1 71 ? 14.608 10.190  -10.777 1.00 0.00 ? 71 HIS A HE1  1  
ATOM 1075  H HE2  . HIS A 1 71 ? 14.129 11.445  -8.604  1.00 0.00 ? 71 HIS A HE2  1  
ATOM 1076  N N    . MET A 1 72 ? 12.815 6.476   -7.453  1.00 0.00 ? 72 MET A N    1  
ATOM 1077  C CA   . MET A 1 72 ? 14.034 5.698   -7.647  1.00 0.00 ? 72 MET A CA   1  
ATOM 1078  C C    . MET A 1 72 ? 14.089 4.496   -6.704  1.00 0.00 ? 72 MET A C    1  
ATOM 1079  O O    . MET A 1 72 ? 15.112 3.841   -6.582  1.00 0.00 ? 72 MET A O    1  
ATOM 1080  C CB   . MET A 1 72 ? 15.274 6.570   -7.466  1.00 0.00 ? 72 MET A CB   1  
ATOM 1081  C CG   . MET A 1 72 ? 15.371 7.211   -6.101  1.00 0.00 ? 72 MET A CG   1  
ATOM 1082  S SD   . MET A 1 72 ? 16.834 8.242   -5.918  1.00 0.00 ? 72 MET A SD   1  
ATOM 1083  C CE   . MET A 1 72 ? 16.626 9.403   -7.269  1.00 0.00 ? 72 MET A CE   1  
ATOM 1084  H H    . MET A 1 72 ? 12.687 6.970   -6.606  1.00 0.00 ? 72 MET A H    1  
ATOM 1085  H HA   . MET A 1 72 ? 14.019 5.323   -8.671  1.00 0.00 ? 72 MET A HA   1  
ATOM 1086  H HB2  . MET A 1 72 ? 16.163 5.979   -7.625  1.00 0.00 ? 72 MET A HB2  1  
ATOM 1087  H HB3  . MET A 1 72 ? 15.245 7.365   -8.201  1.00 0.00 ? 72 MET A HB3  1  
ATOM 1088  H HG2  . MET A 1 72 ? 14.498 7.818   -5.922  1.00 0.00 ? 72 MET A HG2  1  
ATOM 1089  H HG3  . MET A 1 72 ? 15.416 6.430   -5.348  1.00 0.00 ? 72 MET A HG3  1  
ATOM 1090  H HE1  . MET A 1 72 ? 17.467 10.085  -7.298  1.00 0.00 ? 72 MET A HE1  1  
ATOM 1091  H HE2  . MET A 1 72 ? 15.714 9.973   -7.123  1.00 0.00 ? 72 MET A HE2  1  
ATOM 1092  H HE3  . MET A 1 72 ? 16.568 8.859   -8.201  1.00 0.00 ? 72 MET A HE3  1  
ATOM 1093  N N    . LEU A 1 73 ? 12.953 4.204   -6.088  1.00 0.00 ? 73 LEU A N    1  
ATOM 1094  C CA   . LEU A 1 73 ? 12.874 3.081   -5.154  1.00 0.00 ? 73 LEU A CA   1  
ATOM 1095  C C    . LEU A 1 73 ? 12.259 1.851   -5.812  1.00 0.00 ? 73 LEU A C    1  
ATOM 1096  O O    . LEU A 1 73 ? 11.176 1.910   -6.396  1.00 0.00 ? 73 LEU A O    1  
ATOM 1097  C CB   . LEU A 1 73 ? 12.046 3.466   -3.912  1.00 0.00 ? 73 LEU A CB   1  
ATOM 1098  C CG   . LEU A 1 73 ? 12.683 4.511   -3.007  1.00 0.00 ? 73 LEU A CG   1  
ATOM 1099  C CD1  . LEU A 1 73 ? 11.776 4.806   -1.834  1.00 0.00 ? 73 LEU A CD1  1  
ATOM 1100  C CD2  . LEU A 1 73 ? 14.057 4.045   -2.533  1.00 0.00 ? 73 LEU A CD2  1  
ATOM 1101  H H    . LEU A 1 73 ? 12.156 4.719   -6.282  1.00 0.00 ? 73 LEU A H    1  
ATOM 1102  H HA   . LEU A 1 73 ? 13.877 2.841   -4.843  1.00 0.00 ? 73 LEU A HA   1  
ATOM 1103  H HB2  . LEU A 1 73 ? 11.097 3.841   -4.249  1.00 0.00 ? 73 LEU A HB2  1  
ATOM 1104  H HB3  . LEU A 1 73 ? 11.864 2.573   -3.333  1.00 0.00 ? 73 LEU A HB3  1  
ATOM 1105  H HG   . LEU A 1 73 ? 12.810 5.425   -3.572  1.00 0.00 ? 73 LEU A HG   1  
ATOM 1106  H HD11 . LEU A 1 73 ? 10.814 5.133   -2.177  1.00 0.00 ? 73 LEU A HD11 1  
ATOM 1107  H HD12 . LEU A 1 73 ? 12.213 5.594   -1.224  1.00 0.00 ? 73 LEU A HD12 1  
ATOM 1108  H HD13 . LEU A 1 73 ? 11.664 3.922   -1.226  1.00 0.00 ? 73 LEU A HD13 1  
ATOM 1109  H HD21 . LEU A 1 73 ? 14.504 4.803   -1.914  1.00 0.00 ? 73 LEU A HD21 1  
ATOM 1110  H HD22 . LEU A 1 73 ? 14.701 3.859   -3.395  1.00 0.00 ? 73 LEU A HD22 1  
ATOM 1111  H HD23 . LEU A 1 73 ? 13.948 3.135   -1.972  1.00 0.00 ? 73 LEU A HD23 1  
ATOM 1112  N N    . GLU A 1 74 ? 12.961 0.725   -5.692  1.00 0.00 ? 74 GLU A N    1  
ATOM 1113  C CA   . GLU A 1 74 ? 12.445 -0.560  -6.147  1.00 0.00 ? 74 GLU A CA   1  
ATOM 1114  C C    . GLU A 1 74 ? 11.906 -1.331  -4.942  1.00 0.00 ? 74 GLU A C    1  
ATOM 1115  O O    . GLU A 1 74 ? 12.603 -1.506  -3.953  1.00 0.00 ? 74 GLU A O    1  
ATOM 1116  C CB   . GLU A 1 74 ? 13.559 -1.330  -6.826  1.00 0.00 ? 74 GLU A CB   1  
ATOM 1117  C CG   . GLU A 1 74 ? 13.168 -2.725  -7.291  1.00 0.00 ? 74 GLU A CG   1  
ATOM 1118  C CD   . GLU A 1 74 ? 11.927 -2.733  -8.162  1.00 0.00 ? 74 GLU A CD   1  
ATOM 1119  O OE1  . GLU A 1 74 ? 12.055 -2.604  -9.400  1.00 0.00 ? 74 GLU A OE1  1  
ATOM 1120  O OE2  . GLU A 1 74 ? 10.816 -2.903  -7.612  1.00 0.00 ? 74 GLU A OE2  1  
ATOM 1121  H H    . GLU A 1 74 ? 13.827 0.744   -5.240  1.00 0.00 ? 74 GLU A H    1  
ATOM 1122  H HA   . GLU A 1 74 ? 11.658 -0.391  -6.855  1.00 0.00 ? 74 GLU A HA   1  
ATOM 1123  H HB2  . GLU A 1 74 ? 13.874 -0.776  -7.698  1.00 0.00 ? 74 GLU A HB2  1  
ATOM 1124  H HB3  . GLU A 1 74 ? 14.395 -1.431  -6.149  1.00 0.00 ? 74 GLU A HB3  1  
ATOM 1125  H HG2  . GLU A 1 74 ? 13.980 -3.119  -7.862  1.00 0.00 ? 74 GLU A HG2  1  
ATOM 1126  H HG3  . GLU A 1 74 ? 12.983 -3.353  -6.417  1.00 0.00 ? 74 GLU A HG3  1  
ATOM 1127  N N    . ILE A 1 75 ? 10.660 -1.761  -5.014  1.00 0.00 ? 75 ILE A N    1  
ATOM 1128  C CA   . ILE A 1 75 ? 10.024 -2.403  -3.853  1.00 0.00 ? 75 ILE A CA   1  
ATOM 1129  C C    . ILE A 1 75 ? 10.378 -3.884  -3.756  1.00 0.00 ? 75 ILE A C    1  
ATOM 1130  O O    . ILE A 1 75 ? 10.239 -4.634  -4.712  1.00 0.00 ? 75 ILE A O    1  
ATOM 1131  C CB   . ILE A 1 75 ? 8.498  -2.210  -3.879  1.00 0.00 ? 75 ILE A CB   1  
ATOM 1132  C CG1  . ILE A 1 75 ? 7.846  -2.800  -2.607  1.00 0.00 ? 75 ILE A CG1  1  
ATOM 1133  C CG2  . ILE A 1 75 ? 7.874  -2.826  -5.130  1.00 0.00 ? 75 ILE A CG2  1  
ATOM 1134  C CD1  . ILE A 1 75 ? 6.326  -2.659  -2.567  1.00 0.00 ? 75 ILE A CD1  1  
ATOM 1135  H H    . ILE A 1 75 ? 10.164 -1.672  -5.857  1.00 0.00 ? 75 ILE A H    1  
ATOM 1136  H HA   . ILE A 1 75 ? 10.406 -1.902  -2.969  1.00 0.00 ? 75 ILE A HA   1  
ATOM 1137  H HB   . ILE A 1 75 ? 8.289  -1.155  -3.901  1.00 0.00 ? 75 ILE A HB   1  
ATOM 1138  H HG12 . ILE A 1 75 ? 8.083  -3.855  -2.554  1.00 0.00 ? 75 ILE A HG12 1  
ATOM 1139  H HG13 . ILE A 1 75 ? 8.252  -2.289  -1.739  1.00 0.00 ? 75 ILE A HG13 1  
ATOM 1140  H HG21 . ILE A 1 75 ? 7.992  -3.899  -5.095  1.00 0.00 ? 75 ILE A HG21 1  
ATOM 1141  H HG22 . ILE A 1 75 ? 8.374  -2.445  -6.009  1.00 0.00 ? 75 ILE A HG22 1  
ATOM 1142  H HG23 . ILE A 1 75 ? 6.826  -2.584  -5.175  1.00 0.00 ? 75 ILE A HG23 1  
ATOM 1143  H HD11 . ILE A 1 75 ? 6.055  -1.609  -2.642  1.00 0.00 ? 75 ILE A HD11 1  
ATOM 1144  H HD12 . ILE A 1 75 ? 5.957  -3.056  -1.640  1.00 0.00 ? 75 ILE A HD12 1  
ATOM 1145  H HD13 . ILE A 1 75 ? 5.890  -3.210  -3.391  1.00 0.00 ? 75 ILE A HD13 1  
ATOM 1146  N N    . LEU A 1 76 ? 10.856 -4.282  -2.583  1.00 0.00 ? 76 LEU A N    1  
ATOM 1147  C CA   . LEU A 1 76 ? 11.170 -5.679  -2.296  1.00 0.00 ? 76 LEU A CA   1  
ATOM 1148  C C    . LEU A 1 76 ? 10.453 -6.074  -1.020  1.00 0.00 ? 76 LEU A C    1  
ATOM 1149  O O    . LEU A 1 76 ? 10.930 -6.929  -0.262  1.00 0.00 ? 76 LEU A O    1  
ATOM 1150  C CB   . LEU A 1 76 ? 12.668 -5.871  -2.102  1.00 0.00 ? 76 LEU A CB   1  
ATOM 1151  C CG   . LEU A 1 76 ? 13.550 -5.468  -3.277  1.00 0.00 ? 76 LEU A CG   1  
ATOM 1152  C CD1  . LEU A 1 76 ? 15.011 -5.620  -2.912  1.00 0.00 ? 76 LEU A CD1  1  
ATOM 1153  C CD2  . LEU A 1 76 ? 13.211 -6.288  -4.529  1.00 0.00 ? 76 LEU A CD2  1  
ATOM 1154  H H    . LEU A 1 76 ? 11.011 -3.613  -1.890  1.00 0.00 ? 76 LEU A H    1  
ATOM 1155  H HA   . LEU A 1 76 ? 10.822 -6.284  -3.120  1.00 0.00 ? 76 LEU A HA   1  
ATOM 1156  H HB2  . LEU A 1 76 ? 12.977 -5.305  -1.235  1.00 0.00 ? 76 LEU A HB2  1  
ATOM 1157  H HB3  . LEU A 1 76 ? 12.856 -6.922  -1.888  1.00 0.00 ? 76 LEU A HB3  1  
ATOM 1158  H HG   . LEU A 1 76 ? 13.371 -4.423  -3.509  1.00 0.00 ? 76 LEU A HG   1  
ATOM 1159  H HD11 . LEU A 1 76 ? 15.218 -6.665  -2.678  1.00 0.00 ? 76 LEU A HD11 1  
ATOM 1160  H HD12 . LEU A 1 76 ? 15.254 -5.011  -2.075  1.00 0.00 ? 76 LEU A HD12 1  
ATOM 1161  H HD13 . LEU A 1 76 ? 15.617 -5.328  -3.766  1.00 0.00 ? 76 LEU A HD13 1  
ATOM 1162  H HD21 . LEU A 1 76 ? 13.852 -5.981  -5.346  1.00 0.00 ? 76 LEU A HD21 1  
ATOM 1163  H HD22 . LEU A 1 76 ? 12.190 -6.131  -4.793  1.00 0.00 ? 76 LEU A HD22 1  
ATOM 1164  H HD23 . LEU A 1 76 ? 13.375 -7.330  -4.315  1.00 0.00 ? 76 LEU A HD23 1  
ATOM 1165  N N    . GLY A 1 77 ? 9.300  -5.458  -0.795  1.00 0.00 ? 77 GLY A N    1  
ATOM 1166  C CA   . GLY A 1 77 ? 8.572  -5.618  0.444   1.00 0.00 ? 77 GLY A CA   1  
ATOM 1167  C C    . GLY A 1 77 ? 7.908  -6.967  0.555   1.00 0.00 ? 77 GLY A C    1  
ATOM 1168  O O    . GLY A 1 77 ? 8.084  -7.830  -0.318  1.00 0.00 ? 77 GLY A O    1  
ATOM 1169  H H    . GLY A 1 77 ? 8.928  -4.900  -1.510  1.00 0.00 ? 77 GLY A H    1  
ATOM 1170  H HA2  . GLY A 1 77 ? 9.265  -5.510  1.269   1.00 0.00 ? 77 GLY A HA2  1  
ATOM 1171  H HA3  . GLY A 1 77 ? 7.819  -4.848  0.511   1.00 0.00 ? 77 GLY A HA3  1  
ATOM 1172  N N    . PHE A 1 78 ? 7.151  -7.155  1.631   1.00 0.00 ? 78 PHE A N    1  
ATOM 1173  C CA   . PHE A 1 78 ? 6.474  -8.421  1.922   1.00 0.00 ? 78 PHE A CA   1  
ATOM 1174  C C    . PHE A 1 78 ? 7.505  -9.509  2.179   1.00 0.00 ? 78 PHE A C    1  
ATOM 1175  O O    . PHE A 1 78 ? 7.246  -10.689 1.915   1.00 0.00 ? 78 PHE A O    1  
ATOM 1176  C CB   . PHE A 1 78 ? 5.524  -8.821  0.777   1.00 0.00 ? 78 PHE A CB   1  
ATOM 1177  C CG   . PHE A 1 78 ? 4.396  -7.860  0.579   1.00 0.00 ? 78 PHE A CG   1  
ATOM 1178  C CD1  . PHE A 1 78 ? 3.266  -7.911  1.381   1.00 0.00 ? 78 PHE A CD1  1  
ATOM 1179  C CD2  . PHE A 1 78 ? 4.461  -6.899  -0.421  1.00 0.00 ? 78 PHE A CD2  1  
ATOM 1180  C CE1  . PHE A 1 78 ? 2.217  -7.014  1.170   1.00 0.00 ? 78 PHE A CE1  1  
ATOM 1181  C CE2  . PHE A 1 78 ? 3.421  -6.009  -0.626  1.00 0.00 ? 78 PHE A CE2  1  
ATOM 1182  C CZ   . PHE A 1 78 ? 2.301  -6.076  0.164   1.00 0.00 ? 78 PHE A CZ   1  
ATOM 1183  H H    . PHE A 1 78 ? 7.042  -6.409  2.265   1.00 0.00 ? 78 PHE A H    1  
ATOM 1184  H HA   . PHE A 1 78 ? 5.896  -8.280  2.832   1.00 0.00 ? 78 PHE A HA   1  
ATOM 1185  H HB2  . PHE A 1 78 ? 6.098  -8.866  -0.137  1.00 0.00 ? 78 PHE A HB2  1  
ATOM 1186  H HB3  . PHE A 1 78 ? 5.112  -9.790  0.996   1.00 0.00 ? 78 PHE A HB3  1  
ATOM 1187  H HD1  . PHE A 1 78 ? 3.200  -8.636  2.175   1.00 0.00 ? 78 PHE A HD1  1  
ATOM 1188  H HD2  . PHE A 1 78 ? 5.334  -6.850  -1.047  1.00 0.00 ? 78 PHE A HD2  1  
ATOM 1189  H HE1  . PHE A 1 78 ? 1.329  -7.070  1.788   1.00 0.00 ? 78 PHE A HE1  1  
ATOM 1190  H HE2  . PHE A 1 78 ? 3.472  -5.275  -1.417  1.00 0.00 ? 78 PHE A HE2  1  
ATOM 1191  H HZ   . PHE A 1 78 ? 1.487  -5.381  0.003   1.00 0.00 ? 78 PHE A HZ   1  
ATOM 1192  N N    . GLU A 1 79 ? 8.667  -9.117  2.708   1.00 0.00 ? 79 GLU A N    1  
ATOM 1193  C CA   . GLU A 1 79 ? 9.747  -10.038 2.989   1.00 0.00 ? 79 GLU A CA   1  
ATOM 1194  C C    . GLU A 1 79 ? 9.359  -11.029 4.098   1.00 0.00 ? 79 GLU A C    1  
ATOM 1195  O O    . GLU A 1 79 ? 9.889  -12.125 4.180   1.00 0.00 ? 79 GLU A O    1  
ATOM 1196  C CB   . GLU A 1 79 ? 10.999 -9.268  3.402   1.00 0.00 ? 79 GLU A CB   1  
ATOM 1197  C CG   . GLU A 1 79 ? 10.776 -8.342  4.594   1.00 0.00 ? 79 GLU A CG   1  
ATOM 1198  C CD   . GLU A 1 79 ? 12.047 -7.659  5.068   1.00 0.00 ? 79 GLU A CD   1  
ATOM 1199  O OE1  . GLU A 1 79 ? 12.480 -6.707  4.415   1.00 0.00 ? 79 GLU A OE1  1  
ATOM 1200  O OE2  . GLU A 1 79 ? 12.613 -8.087  6.091   1.00 0.00 ? 79 GLU A OE2  1  
ATOM 1201  H H    . GLU A 1 79 ? 8.781  -8.170  2.923   1.00 0.00 ? 79 GLU A H    1  
ATOM 1202  H HA   . GLU A 1 79 ? 9.965  -10.587 2.082   1.00 0.00 ? 79 GLU A HA   1  
ATOM 1203  H HB2  . GLU A 1 79 ? 11.781 -9.972  3.660   1.00 0.00 ? 79 GLU A HB2  1  
ATOM 1204  H HB3  . GLU A 1 79 ? 11.327 -8.666  2.562   1.00 0.00 ? 79 GLU A HB3  1  
ATOM 1205  H HG2  . GLU A 1 79 ? 10.064 -7.590  4.317   1.00 0.00 ? 79 GLU A HG2  1  
ATOM 1206  H HG3  . GLU A 1 79 ? 10.384 -8.938  5.409   1.00 0.00 ? 79 GLU A HG3  1  
ATOM 1207  N N    . GLU A 1 80 ? 8.421  -10.613 4.934   1.00 0.00 ? 80 GLU A N    1  
ATOM 1208  C CA   . GLU A 1 80 ? 7.939  -11.450 6.031   1.00 0.00 ? 80 GLU A CA   1  
ATOM 1209  C C    . GLU A 1 80 ? 6.903  -12.433 5.497   1.00 0.00 ? 80 GLU A C    1  
ATOM 1210  O O    . GLU A 1 80 ? 6.603  -13.452 6.140   1.00 0.00 ? 80 GLU A O    1  
ATOM 1211  C CB   . GLU A 1 80 ? 7.328  -10.584 7.118   1.00 0.00 ? 80 GLU A CB   1  
ATOM 1212  C CG   . GLU A 1 80 ? 7.677  -11.025 8.537   1.00 0.00 ? 80 GLU A CG   1  
ATOM 1213  C CD   . GLU A 1 80 ? 9.144  -10.831 8.859   1.00 0.00 ? 80 GLU A CD   1  
ATOM 1214  O OE1  . GLU A 1 80 ? 9.608  -9.672  8.878   1.00 0.00 ? 80 GLU A OE1  1  
ATOM 1215  O OE2  . GLU A 1 80 ? 9.850  -11.847 9.088   1.00 0.00 ? 80 GLU A OE2  1  
ATOM 1216  H H    . GLU A 1 80 ? 8.029  -9.720  4.816   1.00 0.00 ? 80 GLU A H    1  
ATOM 1217  H HA   . GLU A 1 80 ? 8.773  -12.005 6.431   1.00 0.00 ? 80 GLU A HA   1  
ATOM 1218  H HB2  . GLU A 1 80 ? 7.674  -9.567  6.991   1.00 0.00 ? 80 GLU A HB2  1  
ATOM 1219  H HB3  . GLU A 1 80 ? 6.256  -10.593 7.014   1.00 0.00 ? 80 GLU A HB3  1  
ATOM 1220  H HG2  . GLU A 1 80 ? 7.084  -10.444 9.242   1.00 0.00 ? 80 GLU A HG2  1  
ATOM 1221  H HG3  . GLU A 1 80 ? 7.429  -12.071 8.655   1.00 0.00 ? 80 GLU A HG3  1  
ATOM 1222  N N    . MET A 1 4  ? 10.071 1.022   -17.712 1.00 0.00 ? 4  MET A N    2  
ATOM 1223  C CA   . MET A 1 4  ? 10.394 1.236   -16.316 1.00 0.00 ? 4  MET A CA   2  
ATOM 1224  C C    . MET A 1 4  ? 9.689  2.460   -15.729 1.00 0.00 ? 4  MET A C    2  
ATOM 1225  O O    . MET A 1 4  ? 8.771  3.020   -16.334 1.00 0.00 ? 4  MET A O    2  
ATOM 1226  C CB   . MET A 1 4  ? 11.919 1.384   -16.143 1.00 0.00 ? 4  MET A CB   2  
ATOM 1227  C CG   . MET A 1 4  ? 12.519 2.552   -16.909 1.00 0.00 ? 4  MET A CG   2  
ATOM 1228  S SD   . MET A 1 4  ? 14.290 2.732   -16.590 1.00 0.00 ? 4  MET A SD   2  
ATOM 1229  C CE   . MET A 1 4  ? 14.281 3.072   -14.830 1.00 0.00 ? 4  MET A CE   2  
ATOM 1230  H H    . MET A 1 4  ? 10.563 1.528   -18.400 1.00 0.00 ? 4  MET A H    2  
ATOM 1231  H HA   . MET A 1 4  ? 10.069 0.372   -15.759 1.00 0.00 ? 4  MET A HA   2  
ATOM 1232  H HB2  . MET A 1 4  ? 12.150 1.522   -15.087 1.00 0.00 ? 4  MET A HB2  2  
ATOM 1233  H HB3  . MET A 1 4  ? 12.394 0.477   -16.488 1.00 0.00 ? 4  MET A HB3  2  
ATOM 1234  H HG2  . MET A 1 4  ? 12.366 2.383   -17.972 1.00 0.00 ? 4  MET A HG2  2  
ATOM 1235  H HG3  . MET A 1 4  ? 12.008 3.453   -16.619 1.00 0.00 ? 4  MET A HG3  2  
ATOM 1236  H HE1  . MET A 1 4  ? 13.797 2.259   -14.315 1.00 0.00 ? 4  MET A HE1  2  
ATOM 1237  H HE2  . MET A 1 4  ? 13.751 4.004   -14.639 1.00 0.00 ? 4  MET A HE2  2  
ATOM 1238  H HE3  . MET A 1 4  ? 15.302 3.156   -14.470 1.00 0.00 ? 4  MET A HE3  2  
ATOM 1239  N N    . ARG A 1 5  ? 10.128 2.858   -14.549 1.00 0.00 ? 5  ARG A N    2  
ATOM 1240  C CA   . ARG A 1 5  ? 9.575  3.980   -13.793 1.00 0.00 ? 5  ARG A CA   2  
ATOM 1241  C C    . ARG A 1 5  ? 9.310  5.226   -14.672 1.00 0.00 ? 5  ARG A C    2  
ATOM 1242  O O    . ARG A 1 5  ? 8.346  5.972   -14.430 1.00 0.00 ? 5  ARG A O    2  
ATOM 1243  C CB   . ARG A 1 5  ? 10.573 4.336   -12.689 1.00 0.00 ? 5  ARG A CB   2  
ATOM 1244  C CG   . ARG A 1 5  ? 10.162 5.512   -11.816 1.00 0.00 ? 5  ARG A CG   2  
ATOM 1245  C CD   . ARG A 1 5  ? 11.370 6.074   -11.069 1.00 0.00 ? 5  ARG A CD   2  
ATOM 1246  N NE   . ARG A 1 5  ? 12.336 6.722   -11.972 1.00 0.00 ? 5  ARG A NE   2  
ATOM 1247  C CZ   . ARG A 1 5  ? 13.656 6.670   -11.815 1.00 0.00 ? 5  ARG A CZ   2  
ATOM 1248  N NH1  . ARG A 1 5  ? 14.190 5.991   -10.804 1.00 0.00 ? 5  ARG A NH1  2  
ATOM 1249  N NH2  . ARG A 1 5  ? 14.437 7.294   -12.673 1.00 0.00 ? 5  ARG A NH2  2  
ATOM 1250  H H    . ARG A 1 5  ? 10.870 2.350   -14.139 1.00 0.00 ? 5  ARG A H    2  
ATOM 1251  H HA   . ARG A 1 5  ? 8.636  3.655   -13.338 1.00 0.00 ? 5  ARG A HA   2  
ATOM 1252  H HB2  . ARG A 1 5  ? 10.723 3.475   -12.054 1.00 0.00 ? 5  ARG A HB2  2  
ATOM 1253  H HB3  . ARG A 1 5  ? 11.511 4.586   -13.161 1.00 0.00 ? 5  ARG A HB3  2  
ATOM 1254  H HG2  . ARG A 1 5  ? 9.745  6.284   -12.435 1.00 0.00 ? 5  ARG A HG2  2  
ATOM 1255  H HG3  . ARG A 1 5  ? 9.427  5.171   -11.098 1.00 0.00 ? 5  ARG A HG3  2  
ATOM 1256  H HD2  . ARG A 1 5  ? 11.019 6.802   -10.361 1.00 0.00 ? 5  ARG A HD2  2  
ATOM 1257  H HD3  . ARG A 1 5  ? 11.858 5.261   -10.551 1.00 0.00 ? 5  ARG A HD3  2  
ATOM 1258  H HE   . ARG A 1 5  ? 11.961 7.221   -12.732 1.00 0.00 ? 5  ARG A HE   2  
ATOM 1259  H HH11 . ARG A 1 5  ? 13.595 5.503   -10.145 1.00 0.00 ? 5  ARG A HH11 2  
ATOM 1260  H HH12 . ARG A 1 5  ? 15.191 5.959   -10.671 1.00 0.00 ? 5  ARG A HH12 2  
ATOM 1261  H HH21 . ARG A 1 5  ? 14.033 7.809   -13.435 1.00 0.00 ? 5  ARG A HH21 2  
ATOM 1262  H HH22 . ARG A 1 5  ? 15.427 7.239   -12.572 1.00 0.00 ? 5  ARG A HH22 2  
ATOM 1263  N N    . SER A 1 6  ? 10.158 5.420   -15.670 1.00 0.00 ? 6  SER A N    2  
ATOM 1264  C CA   . SER A 1 6  ? 10.142 6.652   -16.465 1.00 0.00 ? 6  SER A CA   2  
ATOM 1265  C C    . SER A 1 6  ? 9.010  6.671   -17.495 1.00 0.00 ? 6  SER A C    2  
ATOM 1266  O O    . SER A 1 6  ? 8.911  7.622   -18.276 1.00 0.00 ? 6  SER A O    2  
ATOM 1267  C CB   . SER A 1 6  ? 11.481 6.807   -17.169 1.00 0.00 ? 6  SER A CB   2  
ATOM 1268  O OG   . SER A 1 6  ? 12.529 6.262   -16.393 1.00 0.00 ? 6  SER A OG   2  
ATOM 1269  H H    . SER A 1 6  ? 10.816 4.733   -15.879 1.00 0.00 ? 6  SER A H    2  
ATOM 1270  H HA   . SER A 1 6  ? 10.005 7.476   -15.786 1.00 0.00 ? 6  SER A HA   2  
ATOM 1271  H HB2  . SER A 1 6  ? 11.449 6.297   -18.130 1.00 0.00 ? 6  SER A HB2  2  
ATOM 1272  H HB3  . SER A 1 6  ? 11.668 7.853   -17.326 1.00 0.00 ? 6  SER A HB3  2  
ATOM 1273  H HG   . SER A 1 6  ? 13.053 6.977   -15.979 1.00 0.00 ? 6  SER A HG   2  
ATOM 1274  N N    . GLU A 1 7  ? 8.138  5.655   -17.503 1.00 0.00 ? 7  GLU A N    2  
ATOM 1275  C CA   . GLU A 1 7  ? 7.004  5.620   -18.418 1.00 0.00 ? 7  GLU A CA   2  
ATOM 1276  C C    . GLU A 1 7  ? 6.063  6.787   -18.164 1.00 0.00 ? 7  GLU A C    2  
ATOM 1277  O O    . GLU A 1 7  ? 5.361  7.248   -19.073 1.00 0.00 ? 7  GLU A O    2  
ATOM 1278  C CB   . GLU A 1 7  ? 6.229  4.310   -18.306 1.00 0.00 ? 7  GLU A CB   2  
ATOM 1279  C CG   . GLU A 1 7  ? 7.018  3.102   -18.778 1.00 0.00 ? 7  GLU A CG   2  
ATOM 1280  C CD   . GLU A 1 7  ? 7.479  3.247   -20.209 1.00 0.00 ? 7  GLU A CD   2  
ATOM 1281  O OE1  . GLU A 1 7  ? 6.609  3.192   -21.117 1.00 0.00 ? 7  GLU A OE1  2  
ATOM 1282  O OE2  . GLU A 1 7  ? 8.690  3.398   -20.441 1.00 0.00 ? 7  GLU A OE2  2  
ATOM 1283  H H    . GLU A 1 7  ? 8.288  4.889   -16.905 1.00 0.00 ? 7  GLU A H    2  
ATOM 1284  H HA   . GLU A 1 7  ? 7.396  5.708   -19.430 1.00 0.00 ? 7  GLU A HA   2  
ATOM 1285  H HB2  . GLU A 1 7  ? 5.962  4.150   -17.273 1.00 0.00 ? 7  GLU A HB2  2  
ATOM 1286  H HB3  . GLU A 1 7  ? 5.329  4.366   -18.898 1.00 0.00 ? 7  GLU A HB3  2  
ATOM 1287  H HG2  . GLU A 1 7  ? 7.883  2.998   -18.151 1.00 0.00 ? 7  GLU A HG2  2  
ATOM 1288  H HG3  . GLU A 1 7  ? 6.402  2.215   -18.701 1.00 0.00 ? 7  GLU A HG3  2  
ATOM 1289  N N    . PHE A 1 8  ? 6.046  7.270   -16.936 1.00 0.00 ? 8  PHE A N    2  
ATOM 1290  C CA   . PHE A 1 8  ? 5.187  8.384   -16.566 1.00 0.00 ? 8  PHE A CA   2  
ATOM 1291  C C    . PHE A 1 8  ? 5.840  9.704   -16.943 1.00 0.00 ? 8  PHE A C    2  
ATOM 1292  O O    . PHE A 1 8  ? 6.954  9.732   -17.462 1.00 0.00 ? 8  PHE A O    2  
ATOM 1293  C CB   . PHE A 1 8  ? 4.883  8.346   -15.062 1.00 0.00 ? 8  PHE A CB   2  
ATOM 1294  C CG   . PHE A 1 8  ? 4.262  7.069   -14.587 1.00 0.00 ? 8  PHE A CG   2  
ATOM 1295  C CD1  . PHE A 1 8  ? 2.966  6.740   -14.953 1.00 0.00 ? 8  PHE A CD1  2  
ATOM 1296  C CD2  . PHE A 1 8  ? 4.963  6.196   -13.770 1.00 0.00 ? 8  PHE A CD2  2  
ATOM 1297  C CE1  . PHE A 1 8  ? 2.386  5.563   -14.516 1.00 0.00 ? 8  PHE A CE1  2  
ATOM 1298  C CE2  . PHE A 1 8  ? 4.386  5.019   -13.328 1.00 0.00 ? 8  PHE A CE2  2  
ATOM 1299  C CZ   . PHE A 1 8  ? 3.101  4.701   -13.703 1.00 0.00 ? 8  PHE A CZ   2  
ATOM 1300  H H    . PHE A 1 8  ? 6.639  6.865   -16.270 1.00 0.00 ? 8  PHE A H    2  
ATOM 1301  H HA   . PHE A 1 8  ? 4.258  8.280   -17.116 1.00 0.00 ? 8  PHE A HA   2  
ATOM 1302  H HB2  . PHE A 1 8  ? 5.814  8.493   -14.527 1.00 0.00 ? 8  PHE A HB2  2  
ATOM 1303  H HB3  . PHE A 1 8  ? 4.213  9.159   -14.819 1.00 0.00 ? 8  PHE A HB3  2  
ATOM 1304  H HD1  . PHE A 1 8  ? 2.412  7.406   -15.579 1.00 0.00 ? 8  PHE A HD1  2  
ATOM 1305  H HD2  . PHE A 1 8  ? 5.978  6.435   -13.467 1.00 0.00 ? 8  PHE A HD2  2  
ATOM 1306  H HE1  . PHE A 1 8  ? 1.369  5.316   -14.812 1.00 0.00 ? 8  PHE A HE1  2  
ATOM 1307  H HE2  . PHE A 1 8  ? 4.951  4.350   -12.692 1.00 0.00 ? 8  PHE A HE2  2  
ATOM 1308  H HZ   . PHE A 1 8  ? 2.649  3.793   -13.352 1.00 0.00 ? 8  PHE A HZ   2  
ATOM 1309  N N    . ALA A 1 9  ? 5.134  10.801  -16.679 1.00 0.00 ? 9  ALA A N    2  
ATOM 1310  C CA   . ALA A 1 9  ? 5.633  12.132  -17.015 1.00 0.00 ? 9  ALA A CA   2  
ATOM 1311  C C    . ALA A 1 9  ? 6.977  12.402  -16.358 1.00 0.00 ? 9  ALA A C    2  
ATOM 1312  O O    . ALA A 1 9  ? 7.917  12.870  -16.987 1.00 0.00 ? 9  ALA A O    2  
ATOM 1313  C CB   . ALA A 1 9  ? 4.620  13.178  -16.600 1.00 0.00 ? 9  ALA A CB   2  
ATOM 1314  H H    . ALA A 1 9  ? 4.251  10.702  -16.232 1.00 0.00 ? 9  ALA A H    2  
ATOM 1315  H HA   . ALA A 1 9  ? 5.760  12.166  -18.098 1.00 0.00 ? 9  ALA A HA   2  
ATOM 1316  H HB1  . ALA A 1 9  ? 4.973  14.163  -16.875 1.00 0.00 ? 9  ALA A HB1  2  
ATOM 1317  H HB2  . ALA A 1 9  ? 4.490  13.139  -15.528 1.00 0.00 ? 9  ALA A HB2  2  
ATOM 1318  H HB3  . ALA A 1 9  ? 3.675  12.987  -17.074 1.00 0.00 ? 9  ALA A HB3  2  
ATOM 1319  N N    . SER A 1 10 ? 7.061  12.094  -15.078 1.00 0.00 ? 10 SER A N    2  
ATOM 1320  C CA   . SER A 1 10 ? 8.317  12.193  -14.343 1.00 0.00 ? 10 SER A CA   2  
ATOM 1321  C C    . SER A 1 10 ? 8.549  10.911  -13.560 1.00 0.00 ? 10 SER A C    2  
ATOM 1322  O O    . SER A 1 10 ? 9.555  10.761  -12.864 1.00 0.00 ? 10 SER A O    2  
ATOM 1323  C CB   . SER A 1 10 ? 8.273  13.399  -13.407 1.00 0.00 ? 10 SER A CB   2  
ATOM 1324  O OG   . SER A 1 10 ? 9.561  13.665  -12.855 1.00 0.00 ? 10 SER A OG   2  
ATOM 1325  H H    . SER A 1 10 ? 6.253  11.796  -14.600 1.00 0.00 ? 10 SER A H    2  
ATOM 1326  H HA   . SER A 1 10 ? 9.112  12.317  -15.072 1.00 0.00 ? 10 SER A HA   2  
ATOM 1327  H HB2  . SER A 1 10 ? 7.952  14.270  -13.958 1.00 0.00 ? 10 SER A HB2  2  
ATOM 1328  H HB3  . SER A 1 10 ? 7.577  13.195  -12.594 1.00 0.00 ? 10 SER A HB3  2  
ATOM 1329  H HG   . SER A 1 10 ? 10.093 14.160  -13.504 1.00 0.00 ? 10 SER A HG   2  
ATOM 1330  N N    . GLY A 1 11 ? 7.626  9.969   -13.707 1.00 0.00 ? 11 GLY A N    2  
ATOM 1331  C CA   . GLY A 1 11 ? 7.686  8.727   -12.962 1.00 0.00 ? 11 GLY A CA   2  
ATOM 1332  C C    . GLY A 1 11 ? 7.153  8.905   -11.557 1.00 0.00 ? 11 GLY A C    2  
ATOM 1333  O O    . GLY A 1 11 ? 7.441  8.104   -10.669 1.00 0.00 ? 11 GLY A O    2  
ATOM 1334  H H    . GLY A 1 11 ? 6.892  10.121  -14.337 1.00 0.00 ? 11 GLY A H    2  
ATOM 1335  H HA2  . GLY A 1 11 ? 7.111  7.977   -13.472 1.00 0.00 ? 11 GLY A HA2  2  
ATOM 1336  H HA3  . GLY A 1 11 ? 8.725  8.404   -12.908 1.00 0.00 ? 11 GLY A HA3  2  
ATOM 1337  N N    . ASN A 1 12 ? 6.329  9.937   -11.368 1.00 0.00 ? 12 ASN A N    2  
ATOM 1338  C CA   . ASN A 1 12 ? 5.842  10.298  -10.046 1.00 0.00 ? 12 ASN A CA   2  
ATOM 1339  C C    . ASN A 1 12 ? 4.716  9.382   -9.565  1.00 0.00 ? 12 ASN A C    2  
ATOM 1340  O O    . ASN A 1 12 ? 4.526  9.227   -8.350  1.00 0.00 ? 12 ASN A O    2  
ATOM 1341  C CB   . ASN A 1 12 ? 5.399  11.762  -10.005 1.00 0.00 ? 12 ASN A CB   2  
ATOM 1342  C CG   . ASN A 1 12 ? 6.564  12.713  -9.795  1.00 0.00 ? 12 ASN A CG   2  
ATOM 1343  O OD1  . ASN A 1 12 ? 7.546  12.378  -9.133  1.00 0.00 ? 12 ASN A OD1  2  
ATOM 1344  N ND2  . ASN A 1 12 ? 6.461  13.905  -10.353 1.00 0.00 ? 12 ASN A ND2  2  
ATOM 1345  H H    . ASN A 1 12 ? 6.052  10.469  -12.144 1.00 0.00 ? 12 ASN A H    2  
ATOM 1346  H HA   . ASN A 1 12 ? 6.673  10.177  -9.371  1.00 0.00 ? 12 ASN A HA   2  
ATOM 1347  H HB2  . ASN A 1 12 ? 4.909  12.017  -10.927 1.00 0.00 ? 12 ASN A HB2  2  
ATOM 1348  H HB3  . ASN A 1 12 ? 4.704  11.885  -9.181  1.00 0.00 ? 12 ASN A HB3  2  
ATOM 1349  H HD21 . ASN A 1 12 ? 5.661  14.123  -10.866 1.00 0.00 ? 12 ASN A HD21 2  
ATOM 1350  H HD22 . ASN A 1 12 ? 7.223  14.538  -10.232 1.00 0.00 ? 12 ASN A HD22 2  
ATOM 1351  N N    . THR A 1 13 ? 3.952  8.791   -10.468 1.00 0.00 ? 13 THR A N    2  
ATOM 1352  C CA   . THR A 1 13 ? 2.901  7.857   -10.094 1.00 0.00 ? 13 THR A CA   2  
ATOM 1353  C C    . THR A 1 13 ? 3.494  6.650   -9.374  1.00 0.00 ? 13 THR A C    2  
ATOM 1354  O O    . THR A 1 13 ? 2.839  6.025   -8.546  1.00 0.00 ? 13 THR A O    2  
ATOM 1355  C CB   . THR A 1 13 ? 2.101  7.402   -11.346 1.00 0.00 ? 13 THR A CB   2  
ATOM 1356  O OG1  . THR A 1 13 ? 1.800  8.529   -12.178 1.00 0.00 ? 13 THR A OG1  2  
ATOM 1357  C CG2  . THR A 1 13 ? 0.809  6.705   -10.926 1.00 0.00 ? 13 THR A CG2  2  
ATOM 1358  H H    . THR A 1 13 ? 4.075  8.956   -11.424 1.00 0.00 ? 13 THR A H    2  
ATOM 1359  H HA   . THR A 1 13 ? 2.228  8.373   -9.430  1.00 0.00 ? 13 THR A HA   2  
ATOM 1360  H HB   . THR A 1 13 ? 2.705  6.692   -11.895 1.00 0.00 ? 13 THR A HB   2  
ATOM 1361  H HG1  . THR A 1 13 ? 1.403  9.232   -11.636 1.00 0.00 ? 13 THR A HG1  2  
ATOM 1362  H HG21 . THR A 1 13 ? 0.175  7.418   -10.425 1.00 0.00 ? 13 THR A HG21 2  
ATOM 1363  H HG22 . THR A 1 13 ? 1.022  5.873   -10.286 1.00 0.00 ? 13 THR A HG22 2  
ATOM 1364  H HG23 . THR A 1 13 ? 0.303  6.347   -11.825 1.00 0.00 ? 13 THR A HG23 2  
ATOM 1365  N N    . TYR A 1 14 ? 4.749  6.335   -9.681  1.00 0.00 ? 14 TYR A N    2  
ATOM 1366  C CA   . TYR A 1 14 ? 5.455  5.270   -8.995  1.00 0.00 ? 14 TYR A CA   2  
ATOM 1367  C C    . TYR A 1 14 ? 5.549  5.600   -7.515  1.00 0.00 ? 14 TYR A C    2  
ATOM 1368  O O    . TYR A 1 14 ? 5.421  4.738   -6.658  1.00 0.00 ? 14 TYR A O    2  
ATOM 1369  C CB   . TYR A 1 14 ? 6.855  5.124   -9.594  1.00 0.00 ? 14 TYR A CB   2  
ATOM 1370  C CG   . TYR A 1 14 ? 7.412  3.709   -9.531  1.00 0.00 ? 14 TYR A CG   2  
ATOM 1371  C CD1  . TYR A 1 14 ? 7.042  2.750   -10.486 1.00 0.00 ? 14 TYR A CD1  2  
ATOM 1372  C CD2  . TYR A 1 14 ? 8.345  3.333   -8.552  1.00 0.00 ? 14 TYR A CD2  2  
ATOM 1373  C CE1  . TYR A 1 14 ? 7.565  1.489   -10.462 1.00 0.00 ? 14 TYR A CE1  2  
ATOM 1374  C CE2  . TYR A 1 14 ? 8.867  2.050   -8.544  1.00 0.00 ? 14 TYR A CE2  2  
ATOM 1375  C CZ   . TYR A 1 14 ? 8.471  1.140   -9.501  1.00 0.00 ? 14 TYR A CZ   2  
ATOM 1376  O OH   . TYR A 1 14 ? 8.999  -0.142  -9.491  1.00 0.00 ? 14 TYR A OH   2  
ATOM 1377  H H    . TYR A 1 14 ? 5.204  6.816   -10.397 1.00 0.00 ? 14 TYR A H    2  
ATOM 1378  H HA   . TYR A 1 14 ? 4.904  4.351   -9.121  1.00 0.00 ? 14 TYR A HA   2  
ATOM 1379  H HB2  . TYR A 1 14 ? 6.815  5.406   -10.631 1.00 0.00 ? 14 TYR A HB2  2  
ATOM 1380  H HB3  . TYR A 1 14 ? 7.526  5.775   -9.082  1.00 0.00 ? 14 TYR A HB3  2  
ATOM 1381  H HD1  . TYR A 1 14 ? 6.324  3.029   -11.241 1.00 0.00 ? 14 TYR A HD1  2  
ATOM 1382  H HD2  . TYR A 1 14 ? 8.640  4.054   -7.811  1.00 0.00 ? 14 TYR A HD2  2  
ATOM 1383  H HE1  . TYR A 1 14 ? 7.264  0.776   -11.211 1.00 0.00 ? 14 TYR A HE1  2  
ATOM 1384  H HE2  . TYR A 1 14 ? 9.580  1.773   -7.781  1.00 0.00 ? 14 TYR A HE2  2  
ATOM 1385  H HH   . TYR A 1 14 ? 9.006  -0.486  -8.584  1.00 0.00 ? 14 TYR A HH   2  
ATOM 1386  N N    . ALA A 1 15 ? 5.757  6.883   -7.226  1.00 0.00 ? 15 ALA A N    2  
ATOM 1387  C CA   . ALA A 1 15 ? 5.838  7.367   -5.843  1.00 0.00 ? 15 ALA A CA   2  
ATOM 1388  C C    . ALA A 1 15 ? 4.531  7.158   -5.103  1.00 0.00 ? 15 ALA A C    2  
ATOM 1389  O O    . ALA A 1 15 ? 4.519  6.941   -3.888  1.00 0.00 ? 15 ALA A O    2  
ATOM 1390  C CB   . ALA A 1 15 ? 6.217  8.835   -5.812  1.00 0.00 ? 15 ALA A CB   2  
ATOM 1391  H H    . ALA A 1 15 ? 5.873  7.529   -7.951  1.00 0.00 ? 15 ALA A H    2  
ATOM 1392  H HA   . ALA A 1 15 ? 6.610  6.815   -5.351  1.00 0.00 ? 15 ALA A HA   2  
ATOM 1393  H HB1  . ALA A 1 15 ? 5.457  9.417   -6.310  1.00 0.00 ? 15 ALA A HB1  2  
ATOM 1394  H HB2  . ALA A 1 15 ? 7.173  8.982   -6.307  1.00 0.00 ? 15 ALA A HB2  2  
ATOM 1395  H HB3  . ALA A 1 15 ? 6.299  9.158   -4.784  1.00 0.00 ? 15 ALA A HB3  2  
ATOM 1396  N N    . LEU A 1 16 ? 3.418  7.189   -5.823  1.00 0.00 ? 16 LEU A N    2  
ATOM 1397  C CA   . LEU A 1 16 ? 2.104  7.037   -5.244  1.00 0.00 ? 16 LEU A CA   2  
ATOM 1398  C C    . LEU A 1 16 ? 1.897  5.607   -4.787  1.00 0.00 ? 16 LEU A C    2  
ATOM 1399  O O    . LEU A 1 16 ? 1.418  5.345   -3.693  1.00 0.00 ? 16 LEU A O    2  
ATOM 1400  C CB   . LEU A 1 16 ? 1.039  7.409   -6.276  1.00 0.00 ? 16 LEU A CB   2  
ATOM 1401  C CG   . LEU A 1 16 ? -0.399 7.059   -5.908  1.00 0.00 ? 16 LEU A CG   2  
ATOM 1402  C CD1  . LEU A 1 16 ? -0.854 7.871   -4.702  1.00 0.00 ? 16 LEU A CD1  2  
ATOM 1403  C CD2  . LEU A 1 16 ? -1.332 7.298   -7.105  1.00 0.00 ? 16 LEU A CD2  2  
ATOM 1404  H H    . LEU A 1 16 ? 3.481  7.292   -6.806  1.00 0.00 ? 16 LEU A H    2  
ATOM 1405  H HA   . LEU A 1 16 ? 2.043  7.707   -4.402  1.00 0.00 ? 16 LEU A HA   2  
ATOM 1406  H HB2  . LEU A 1 16 ? 1.102  8.469   -6.444  1.00 0.00 ? 16 LEU A HB2  2  
ATOM 1407  H HB3  . LEU A 1 16 ? 1.278  6.906   -7.192  1.00 0.00 ? 16 LEU A HB3  2  
ATOM 1408  H HG   . LEU A 1 16 ? -0.471 6.015   -5.658  1.00 0.00 ? 16 LEU A HG   2  
ATOM 1409  H HD11 . LEU A 1 16 ? -0.183 7.694   -3.883  1.00 0.00 ? 16 LEU A HD11 2  
ATOM 1410  H HD12 . LEU A 1 16 ? -1.859 7.587   -4.424  1.00 0.00 ? 16 LEU A HD12 2  
ATOM 1411  H HD13 . LEU A 1 16 ? -0.838 8.922   -4.959  1.00 0.00 ? 16 LEU A HD13 2  
ATOM 1412  H HD21 . LEU A 1 16 ? -2.339 6.984   -6.850  1.00 0.00 ? 16 LEU A HD21 2  
ATOM 1413  H HD22 . LEU A 1 16 ? -0.968 6.742   -7.952  1.00 0.00 ? 16 LEU A HD22 2  
ATOM 1414  H HD23 . LEU A 1 16 ? -1.328 8.350   -7.335  1.00 0.00 ? 16 LEU A HD23 2  
ATOM 1415  N N    . TYR A 1 17 ? 2.295  4.687   -5.658  1.00 0.00 ? 17 TYR A N    2  
ATOM 1416  C CA   . TYR A 1 17 ? 2.213  3.271   -5.363  1.00 0.00 ? 17 TYR A CA   2  
ATOM 1417  C C    . TYR A 1 17 ? 3.133  2.910   -4.202  1.00 0.00 ? 17 TYR A C    2  
ATOM 1418  O O    . TYR A 1 17 ? 2.676  2.339   -3.213  1.00 0.00 ? 17 TYR A O    2  
ATOM 1419  C CB   . TYR A 1 17 ? 2.602  2.458   -6.603  1.00 0.00 ? 17 TYR A CB   2  
ATOM 1420  C CG   . TYR A 1 17 ? 2.589  0.962   -6.400  1.00 0.00 ? 17 TYR A CG   2  
ATOM 1421  C CD1  . TYR A 1 17 ? 1.396  0.259   -6.239  1.00 0.00 ? 17 TYR A CD1  2  
ATOM 1422  C CD2  . TYR A 1 17 ? 3.781  0.239   -6.394  1.00 0.00 ? 17 TYR A CD2  2  
ATOM 1423  C CE1  . TYR A 1 17 ? 1.384  -1.109  -6.061  1.00 0.00 ? 17 TYR A CE1  2  
ATOM 1424  C CE2  . TYR A 1 17 ? 3.771  -1.138  -6.215  1.00 0.00 ? 17 TYR A CE2  2  
ATOM 1425  C CZ   . TYR A 1 17 ? 2.584  -1.813  -6.043  1.00 0.00 ? 17 TYR A CZ   2  
ATOM 1426  O OH   . TYR A 1 17 ? 2.564  -3.180  -5.875  1.00 0.00 ? 17 TYR A OH   2  
ATOM 1427  H H    . TYR A 1 17 ? 2.634  4.963   -6.522  1.00 0.00 ? 17 TYR A H    2  
ATOM 1428  H HA   . TYR A 1 17 ? 1.198  3.041   -5.086  1.00 0.00 ? 17 TYR A HA   2  
ATOM 1429  H HB2  . TYR A 1 17 ? 1.915  2.679   -7.409  1.00 0.00 ? 17 TYR A HB2  2  
ATOM 1430  H HB3  . TYR A 1 17 ? 3.602  2.736   -6.902  1.00 0.00 ? 17 TYR A HB3  2  
ATOM 1431  H HD1  . TYR A 1 17 ? 0.462  0.798   -6.252  1.00 0.00 ? 17 TYR A HD1  2  
ATOM 1432  H HD2  . TYR A 1 17 ? 4.712  0.769   -6.509  1.00 0.00 ? 17 TYR A HD2  2  
ATOM 1433  H HE1  . TYR A 1 17 ? 0.448  -1.617  -5.916  1.00 0.00 ? 17 TYR A HE1  2  
ATOM 1434  H HE2  . TYR A 1 17 ? 4.708  -1.686  -6.202  1.00 0.00 ? 17 TYR A HE2  2  
ATOM 1435  H HH   . TYR A 1 17 ? 3.256  -3.417  -5.220  1.00 0.00 ? 17 TYR A HH   2  
ATOM 1436  N N    . VAL A 1 18 ? 4.391  3.269   -4.313  1.00 0.00 ? 18 VAL A N    2  
ATOM 1437  C CA   . VAL A 1 18 ? 5.369  2.883   -3.306  1.00 0.00 ? 18 VAL A CA   2  
ATOM 1438  C C    . VAL A 1 18 ? 5.050  3.480   -1.933  1.00 0.00 ? 18 VAL A C    2  
ATOM 1439  O O    . VAL A 1 18 ? 5.099  2.766   -0.939  1.00 0.00 ? 18 VAL A O    2  
ATOM 1440  C CB   . VAL A 1 18 ? 6.818  3.237   -3.710  1.00 0.00 ? 18 VAL A CB   2  
ATOM 1441  C CG1  . VAL A 1 18 ? 7.212  2.514   -4.986  1.00 0.00 ? 18 VAL A CG1  2  
ATOM 1442  C CG2  . VAL A 1 18 ? 7.020  4.738   -3.866  1.00 0.00 ? 18 VAL A CG2  2  
ATOM 1443  H H    . VAL A 1 18 ? 4.681  3.782   -5.097  1.00 0.00 ? 18 VAL A H    2  
ATOM 1444  H HA   . VAL A 1 18 ? 5.306  1.805   -3.207  1.00 0.00 ? 18 VAL A HA   2  
ATOM 1445  H HB   . VAL A 1 18 ? 7.482  2.891   -2.917  1.00 0.00 ? 18 VAL A HB   2  
ATOM 1446  H HG11 . VAL A 1 18 ? 8.228  2.766   -5.259  1.00 0.00 ? 18 VAL A HG11 2  
ATOM 1447  H HG12 . VAL A 1 18 ? 6.538  2.817   -5.784  1.00 0.00 ? 18 VAL A HG12 2  
ATOM 1448  H HG13 . VAL A 1 18 ? 7.128  1.442   -4.847  1.00 0.00 ? 18 VAL A HG13 2  
ATOM 1449  H HG21 . VAL A 1 18 ? 8.050  4.943   -4.125  1.00 0.00 ? 18 VAL A HG21 2  
ATOM 1450  H HG22 . VAL A 1 18 ? 6.775  5.233   -2.936  1.00 0.00 ? 18 VAL A HG22 2  
ATOM 1451  H HG23 . VAL A 1 18 ? 6.372  5.105   -4.650  1.00 0.00 ? 18 VAL A HG23 2  
ATOM 1452  N N    . ARG A 1 19 ? 4.700  4.753   -1.865  1.00 0.00 ? 19 ARG A N    2  
ATOM 1453  C CA   . ARG A 1 19 ? 4.413  5.400   -0.596  1.00 0.00 ? 19 ARG A CA   2  
ATOM 1454  C C    . ARG A 1 19 ? 3.266  4.713   0.147   1.00 0.00 ? 19 ARG A C    2  
ATOM 1455  O O    . ARG A 1 19 ? 3.173  4.776   1.367   1.00 0.00 ? 19 ARG A O    2  
ATOM 1456  C CB   . ARG A 1 19 ? 4.079  6.879   -0.780  1.00 0.00 ? 19 ARG A CB   2  
ATOM 1457  C CG   . ARG A 1 19 ? 2.711  7.154   -1.392  1.00 0.00 ? 19 ARG A CG   2  
ATOM 1458  C CD   . ARG A 1 19 ? 2.322  8.614   -1.259  1.00 0.00 ? 19 ARG A CD   2  
ATOM 1459  N NE   . ARG A 1 19 ? 0.960  8.875   -1.722  1.00 0.00 ? 19 ARG A NE   2  
ATOM 1460  C CZ   . ARG A 1 19 ? -0.144 8.567   -1.039  1.00 0.00 ? 19 ARG A CZ   2  
ATOM 1461  N NH1  . ARG A 1 19 ? -0.069 7.944   0.128   1.00 0.00 ? 19 ARG A NH1  2  
ATOM 1462  N NH2  . ARG A 1 19 ? -1.337 8.892   -1.509  1.00 0.00 ? 19 ARG A NH2  2  
ATOM 1463  H H    . ARG A 1 19 ? 4.652  5.290   -2.674  1.00 0.00 ? 19 ARG A H    2  
ATOM 1464  H HA   . ARG A 1 19 ? 5.294  5.321   0.013   1.00 0.00 ? 19 ARG A HA   2  
ATOM 1465  H HB2  . ARG A 1 19 ? 4.102  7.374   0.169   1.00 0.00 ? 19 ARG A HB2  2  
ATOM 1466  H HB3  . ARG A 1 19 ? 4.824  7.328   -1.422  1.00 0.00 ? 19 ARG A HB3  2  
ATOM 1467  H HG2  . ARG A 1 19 ? 2.743  6.895   -2.440  1.00 0.00 ? 19 ARG A HG2  2  
ATOM 1468  H HG3  . ARG A 1 19 ? 1.981  6.537   -0.885  1.00 0.00 ? 19 ARG A HG3  2  
ATOM 1469  H HD2  . ARG A 1 19 ? 2.406  8.901   -0.216  1.00 0.00 ? 19 ARG A HD2  2  
ATOM 1470  H HD3  . ARG A 1 19 ? 3.008  9.208   -1.854  1.00 0.00 ? 19 ARG A HD3  2  
ATOM 1471  H HE   . ARG A 1 19 ? 0.852  9.327   -2.601  1.00 0.00 ? 19 ARG A HE   2  
ATOM 1472  H HH11 . ARG A 1 19 ? 0.824  7.703   0.523   1.00 0.00 ? 19 ARG A HH11 2  
ATOM 1473  H HH12 . ARG A 1 19 ? -0.907 7.697   0.634   1.00 0.00 ? 19 ARG A HH12 2  
ATOM 1474  H HH21 . ARG A 1 19 ? -1.414 9.377   -2.395  1.00 0.00 ? 19 ARG A HH21 2  
ATOM 1475  H HH22 . ARG A 1 19 ? -2.171 8.677   -0.984  1.00 0.00 ? 19 ARG A HH22 2  
ATOM 1476  N N    . ASP A 1 20 ? 2.387  4.051   -0.589  1.00 0.00 ? 20 ASP A N    2  
ATOM 1477  C CA   . ASP A 1 20 ? 1.228  3.398   0.020   1.00 0.00 ? 20 ASP A CA   2  
ATOM 1478  C C    . ASP A 1 20 ? 1.551  1.983   0.472   1.00 0.00 ? 20 ASP A C    2  
ATOM 1479  O O    . ASP A 1 20 ? 1.176  1.575   1.571   1.00 0.00 ? 20 ASP A O    2  
ATOM 1480  C CB   . ASP A 1 20 ? 0.059  3.375   -0.962  1.00 0.00 ? 20 ASP A CB   2  
ATOM 1481  C CG   . ASP A 1 20 ? -1.155 2.652   -0.396  1.00 0.00 ? 20 ASP A CG   2  
ATOM 1482  O OD1  . ASP A 1 20 ? -1.914 3.279   0.373   1.00 0.00 ? 20 ASP A OD1  2  
ATOM 1483  O OD2  . ASP A 1 20 ? -1.346 1.460   -0.727  1.00 0.00 ? 20 ASP A OD2  2  
ATOM 1484  H H    . ASP A 1 20 ? 2.513  4.000   -1.555  1.00 0.00 ? 20 ASP A H    2  
ATOM 1485  H HA   . ASP A 1 20 ? 0.946  3.969   0.883   1.00 0.00 ? 20 ASP A HA   2  
ATOM 1486  H HB2  . ASP A 1 20 ? -0.233 4.391   -1.197  1.00 0.00 ? 20 ASP A HB2  2  
ATOM 1487  H HB3  . ASP A 1 20 ? 0.360  2.865   -1.870  1.00 0.00 ? 20 ASP A HB3  2  
ATOM 1488  N N    . THR A 1 21 ? 2.249  1.245   -0.371  1.00 0.00 ? 21 THR A N    2  
ATOM 1489  C CA   . THR A 1 21 ? 2.506  -0.166  -0.119  1.00 0.00 ? 21 THR A CA   2  
ATOM 1490  C C    . THR A 1 21 ? 3.690  -0.370  0.804   1.00 0.00 ? 21 THR A C    2  
ATOM 1491  O O    . THR A 1 21 ? 3.779  -1.365  1.516   1.00 0.00 ? 21 THR A O    2  
ATOM 1492  C CB   . THR A 1 21 ? 2.727  -0.926  -1.445  1.00 0.00 ? 21 THR A CB   2  
ATOM 1493  O OG1  . THR A 1 21 ? 1.639  -0.635  -2.345  1.00 0.00 ? 21 THR A OG1  2  
ATOM 1494  C CG2  . THR A 1 21 ? 2.796  -2.441  -1.222  1.00 0.00 ? 21 THR A CG2  2  
ATOM 1495  H H    . THR A 1 21 ? 2.593  1.658   -1.183  1.00 0.00 ? 21 THR A H    2  
ATOM 1496  H HA   . THR A 1 21 ? 1.626  -0.557  0.358   1.00 0.00 ? 21 THR A HA   2  
ATOM 1497  H HB   . THR A 1 21 ? 3.642  -0.596  -1.893  1.00 0.00 ? 21 THR A HB   2  
ATOM 1498  H HG1  . THR A 1 21 ? 0.799  -0.845  -1.902  1.00 0.00 ? 21 THR A HG1  2  
ATOM 1499  H HG21 . THR A 1 21 ? 1.875  -2.778  -0.762  1.00 0.00 ? 21 THR A HG21 2  
ATOM 1500  H HG22 . THR A 1 21 ? 3.630  -2.671  -0.585  1.00 0.00 ? 21 THR A HG22 2  
ATOM 1501  H HG23 . THR A 1 21 ? 2.927  -2.939  -2.190  1.00 0.00 ? 21 THR A HG23 2  
ATOM 1502  N N    . LEU A 1 22 ? 4.591  0.616   0.832   1.00 0.00 ? 22 LEU A N    2  
ATOM 1503  C CA   . LEU A 1 22 ? 5.812  0.522   1.611   1.00 0.00 ? 22 LEU A CA   2  
ATOM 1504  C C    . LEU A 1 22 ? 5.526  0.609   3.119   1.00 0.00 ? 22 LEU A C    2  
ATOM 1505  O O    . LEU A 1 22 ? 5.411  1.700   3.686   1.00 0.00 ? 22 LEU A O    2  
ATOM 1506  C CB   . LEU A 1 22 ? 6.794  1.612   1.180   1.00 0.00 ? 22 LEU A CB   2  
ATOM 1507  C CG   . LEU A 1 22 ? 8.212  1.461   1.702   1.00 0.00 ? 22 LEU A CG   2  
ATOM 1508  C CD1  . LEU A 1 22 ? 8.763  0.091   1.343   1.00 0.00 ? 22 LEU A CD1  2  
ATOM 1509  C CD2  . LEU A 1 22 ? 9.103  2.561   1.152   1.00 0.00 ? 22 LEU A CD2  2  
ATOM 1510  H H    . LEU A 1 22 ? 4.419  1.432   0.313   1.00 0.00 ? 22 LEU A H    2  
ATOM 1511  H HA   . LEU A 1 22 ? 6.266  -0.457  1.415   1.00 0.00 ? 22 LEU A HA   2  
ATOM 1512  H HB2  . LEU A 1 22 ? 6.830  1.623   0.098   1.00 0.00 ? 22 LEU A HB2  2  
ATOM 1513  H HB3  . LEU A 1 22 ? 6.418  2.568   1.513   1.00 0.00 ? 22 LEU A HB3  2  
ATOM 1514  H HG   . LEU A 1 22 ? 8.202  1.541   2.784   1.00 0.00 ? 22 LEU A HG   2  
ATOM 1515  H HD11 . LEU A 1 22 ? 8.732  -0.042  0.276   1.00 0.00 ? 22 LEU A HD11 2  
ATOM 1516  H HD12 . LEU A 1 22 ? 8.168  -0.676  1.802   1.00 0.00 ? 22 LEU A HD12 2  
ATOM 1517  H HD13 . LEU A 1 22 ? 9.780  0.008   1.679   1.00 0.00 ? 22 LEU A HD13 2  
ATOM 1518  H HD21 . LEU A 1 22 ? 8.727  3.524   1.461   1.00 0.00 ? 22 LEU A HD21 2  
ATOM 1519  H HD22 . LEU A 1 22 ? 9.115  2.515   0.077   1.00 0.00 ? 22 LEU A HD22 2  
ATOM 1520  H HD23 . LEU A 1 22 ? 10.114 2.441   1.530   1.00 0.00 ? 22 LEU A HD23 2  
ATOM 1521  N N    . GLN A 1 23 ? 5.392  -0.551  3.741   1.00 0.00 ? 23 GLN A N    2  
ATOM 1522  C CA   . GLN A 1 23 ? 5.139  -0.642  5.175   1.00 0.00 ? 23 GLN A CA   2  
ATOM 1523  C C    . GLN A 1 23 ? 6.429  -0.476  5.959   1.00 0.00 ? 23 GLN A C    2  
ATOM 1524  O O    . GLN A 1 23 ? 7.510  -0.769  5.471   1.00 0.00 ? 23 GLN A O    2  
ATOM 1525  C CB   . GLN A 1 23 ? 4.516  -2.017  5.499   1.00 0.00 ? 23 GLN A CB   2  
ATOM 1526  C CG   . GLN A 1 23 ? 3.198  -2.263  4.786   1.00 0.00 ? 23 GLN A CG   2  
ATOM 1527  C CD   . GLN A 1 23 ? 2.622  -3.641  5.058   1.00 0.00 ? 23 GLN A CD   2  
ATOM 1528  O OE1  . GLN A 1 23 ? 1.952  -4.231  4.212   1.00 0.00 ? 23 GLN A OE1  2  
ATOM 1529  N NE2  . GLN A 1 23 ? 2.866  -4.153  6.247   1.00 0.00 ? 23 GLN A NE2  2  
ATOM 1530  H H    . GLN A 1 23 ? 5.438  -1.375  3.216   1.00 0.00 ? 23 GLN A H    2  
ATOM 1531  H HA   . GLN A 1 23 ? 4.450  0.140   5.460   1.00 0.00 ? 23 GLN A HA   2  
ATOM 1532  H HB2  . GLN A 1 23 ? 5.206  -2.800  5.195   1.00 0.00 ? 23 GLN A HB2  2  
ATOM 1533  H HB3  . GLN A 1 23 ? 4.353  -2.091  6.564   1.00 0.00 ? 23 GLN A HB3  2  
ATOM 1534  H HG2  . GLN A 1 23 ? 2.484  -1.524  5.118   1.00 0.00 ? 23 GLN A HG2  2  
ATOM 1535  H HG3  . GLN A 1 23 ? 3.359  -2.163  3.716   1.00 0.00 ? 23 GLN A HG3  2  
ATOM 1536  H HE21 . GLN A 1 23 ? 3.400  -3.615  6.889   1.00 0.00 ? 23 GLN A HE21 2  
ATOM 1537  H HE22 . GLN A 1 23 ? 2.520  -5.058  6.455   1.00 0.00 ? 23 GLN A HE22 2  
ATOM 1538  N N    . PRO A 1 24 ? 6.331  0.027   7.208   1.00 0.00 ? 24 PRO A N    2  
ATOM 1539  C CA   . PRO A 1 24 ? 7.493  0.164   8.094   1.00 0.00 ? 24 PRO A CA   2  
ATOM 1540  C C    . PRO A 1 24 ? 8.196  -1.179  8.306   1.00 0.00 ? 24 PRO A C    2  
ATOM 1541  O O    . PRO A 1 24 ? 7.656  -2.086  8.942   1.00 0.00 ? 24 PRO A O    2  
ATOM 1542  C CB   . PRO A 1 24 ? 6.896  0.670   9.411   1.00 0.00 ? 24 PRO A CB   2  
ATOM 1543  C CG   . PRO A 1 24 ? 5.576  1.257   9.042   1.00 0.00 ? 24 PRO A CG   2  
ATOM 1544  C CD   . PRO A 1 24 ? 5.091  0.512   7.836   1.00 0.00 ? 24 PRO A CD   2  
ATOM 1545  H HA   . PRO A 1 24 ? 8.201  0.878   7.716   1.00 0.00 ? 24 PRO A HA   2  
ATOM 1546  H HB2  . PRO A 1 24 ? 6.778  -0.157  10.093  1.00 0.00 ? 24 PRO A HB2  2  
ATOM 1547  H HB3  . PRO A 1 24 ? 7.551  1.414   9.841   1.00 0.00 ? 24 PRO A HB3  2  
ATOM 1548  H HG2  . PRO A 1 24 ? 4.869  1.126   9.862   1.00 0.00 ? 24 PRO A HG2  2  
ATOM 1549  H HG3  . PRO A 1 24 ? 5.680  2.319   8.817   1.00 0.00 ? 24 PRO A HG3  2  
ATOM 1550  H HD2  . PRO A 1 24 ? 4.456  -0.315  8.119   1.00 0.00 ? 24 PRO A HD2  2  
ATOM 1551  H HD3  . PRO A 1 24 ? 4.562  1.181   7.156   1.00 0.00 ? 24 PRO A HD3  2  
ATOM 1552  N N    . GLY A 1 25 ? 9.395  -1.301  7.760   1.00 0.00 ? 25 GLY A N    2  
ATOM 1553  C CA   . GLY A 1 25 ? 10.158 -2.532  7.880   1.00 0.00 ? 25 GLY A CA   2  
ATOM 1554  C C    . GLY A 1 25 ? 10.326 -3.230  6.541   1.00 0.00 ? 25 GLY A C    2  
ATOM 1555  O O    . GLY A 1 25 ? 11.099 -4.183  6.410   1.00 0.00 ? 25 GLY A O    2  
ATOM 1556  H H    . GLY A 1 25 ? 9.775  -0.543  7.266   1.00 0.00 ? 25 GLY A H    2  
ATOM 1557  H HA2  . GLY A 1 25 ? 11.138 -2.308  8.293   1.00 0.00 ? 25 GLY A HA2  2  
ATOM 1558  H HA3  . GLY A 1 25 ? 9.640  -3.189  8.550   1.00 0.00 ? 25 GLY A HA3  2  
ATOM 1559  N N    . MET A 1 26 ? 9.613  -2.737  5.551   1.00 0.00 ? 26 MET A N    2  
ATOM 1560  C CA   . MET A 1 26 ? 9.656  -3.322  4.218   1.00 0.00 ? 26 MET A CA   2  
ATOM 1561  C C    . MET A 1 26 ? 10.930 -2.938  3.499   1.00 0.00 ? 26 MET A C    2  
ATOM 1562  O O    . MET A 1 26 ? 11.364 -1.776  3.530   1.00 0.00 ? 26 MET A O    2  
ATOM 1563  C CB   . MET A 1 26 ? 8.429  -2.885  3.402   1.00 0.00 ? 26 MET A CB   2  
ATOM 1564  C CG   . MET A 1 26 ? 8.343  -3.510  2.020   1.00 0.00 ? 26 MET A CG   2  
ATOM 1565  S SD   . MET A 1 26 ? 6.761  -3.194  1.225   1.00 0.00 ? 26 MET A SD   2  
ATOM 1566  C CE   . MET A 1 26 ? 5.648  -4.068  2.323   1.00 0.00 ? 26 MET A CE   2  
ATOM 1567  H H    . MET A 1 26 ? 9.018  -1.970  5.715   1.00 0.00 ? 26 MET A H    2  
ATOM 1568  H HA   . MET A 1 26 ? 9.641  -4.396  4.329   1.00 0.00 ? 26 MET A HA   2  
ATOM 1569  H HB2  . MET A 1 26 ? 7.541  -3.159  3.948   1.00 0.00 ? 26 MET A HB2  2  
ATOM 1570  H HB3  . MET A 1 26 ? 8.456  -1.810  3.292   1.00 0.00 ? 26 MET A HB3  2  
ATOM 1571  H HG2  . MET A 1 26 ? 9.128  -3.106  1.403   1.00 0.00 ? 26 MET A HG2  2  
ATOM 1572  H HG3  . MET A 1 26 ? 8.480  -4.573  2.115   1.00 0.00 ? 26 MET A HG3  2  
ATOM 1573  H HE1  . MET A 1 26 ? 5.757  -3.676  3.320   1.00 0.00 ? 26 MET A HE1  2  
ATOM 1574  H HE2  . MET A 1 26 ? 5.897  -5.120  2.327   1.00 0.00 ? 26 MET A HE2  2  
ATOM 1575  H HE3  . MET A 1 26 ? 4.630  -3.942  1.990   1.00 0.00 ? 26 MET A HE3  2  
ATOM 1576  N N    . ARG A 1 27 ? 11.558 -3.926  2.864   1.00 0.00 ? 27 ARG A N    2  
ATOM 1577  C CA   . ARG A 1 27 ? 12.810 -3.724  2.133   1.00 0.00 ? 27 ARG A CA   2  
ATOM 1578  C C    . ARG A 1 27 ? 12.566 -3.009  0.810   1.00 0.00 ? 27 ARG A C    2  
ATOM 1579  O O    . ARG A 1 27 ? 11.512 -3.161  0.184   1.00 0.00 ? 27 ARG A O    2  
ATOM 1580  C CB   . ARG A 1 27 ? 13.490 -5.053  1.884   1.00 0.00 ? 27 ARG A CB   2  
ATOM 1581  C CG   . ARG A 1 27 ? 14.970 -5.056  2.195   1.00 0.00 ? 27 ARG A CG   2  
ATOM 1582  C CD   . ARG A 1 27 ? 15.608 -6.361  1.767   1.00 0.00 ? 27 ARG A CD   2  
ATOM 1583  N NE   . ARG A 1 27 ? 16.936 -6.559  2.354   1.00 0.00 ? 27 ARG A NE   2  
ATOM 1584  C CZ   . ARG A 1 27 ? 17.618 -7.692  2.257   1.00 0.00 ? 27 ARG A CZ   2  
ATOM 1585  N NH1  . ARG A 1 27 ? 17.105 -8.744  1.638   1.00 0.00 ? 27 ARG A NH1  2  
ATOM 1586  N NH2  . ARG A 1 27 ? 18.815 -7.783  2.825   1.00 0.00 ? 27 ARG A NH2  2  
ATOM 1587  H H    . ARG A 1 27 ? 11.162 -4.821  2.905   1.00 0.00 ? 27 ARG A H    2  
ATOM 1588  H HA   . ARG A 1 27 ? 13.451 -3.116  2.750   1.00 0.00 ? 27 ARG A HA   2  
ATOM 1589  H HB2  . ARG A 1 27 ? 13.026 -5.817  2.505   1.00 0.00 ? 27 ARG A HB2  2  
ATOM 1590  H HB3  . ARG A 1 27 ? 13.368 -5.332  0.843   1.00 0.00 ? 27 ARG A HB3  2  
ATOM 1591  H HG2  . ARG A 1 27 ? 15.440 -4.237  1.668   1.00 0.00 ? 27 ARG A HG2  2  
ATOM 1592  H HG3  . ARG A 1 27 ? 15.120 -4.921  3.261   1.00 0.00 ? 27 ARG A HG3  2  
ATOM 1593  H HD2  . ARG A 1 27 ? 14.964 -7.166  2.085   1.00 0.00 ? 27 ARG A HD2  2  
ATOM 1594  H HD3  . ARG A 1 27 ? 15.698 -6.373  0.693   1.00 0.00 ? 27 ARG A HD3  2  
ATOM 1595  H HE   . ARG A 1 27 ? 17.326 -5.799  2.837   1.00 0.00 ? 27 ARG A HE   2  
ATOM 1596  H HH11 . ARG A 1 27 ? 16.186 -8.685  1.225   1.00 0.00 ? 27 ARG A HH11 2  
ATOM 1597  H HH12 . ARG A 1 27 ? 17.625 -9.596  1.563   1.00 0.00 ? 27 ARG A HH12 2  
ATOM 1598  H HH21 . ARG A 1 27 ? 19.201 -6.989  3.314   1.00 0.00 ? 27 ARG A HH21 2  
ATOM 1599  H HH22 . ARG A 1 27 ? 19.348 -8.640  2.758   1.00 0.00 ? 27 ARG A HH22 2  
ATOM 1600  N N    . VAL A 1 28 ? 13.563 -2.249  0.380   1.00 0.00 ? 28 VAL A N    2  
ATOM 1601  C CA   . VAL A 1 28 ? 13.491 -1.440  -0.831  1.00 0.00 ? 28 VAL A CA   2  
ATOM 1602  C C    . VAL A 1 28 ? 14.752 -1.596  -1.671  1.00 0.00 ? 28 VAL A C    2  
ATOM 1603  O O    . VAL A 1 28 ? 15.795 -2.001  -1.167  1.00 0.00 ? 28 VAL A O    2  
ATOM 1604  C CB   . VAL A 1 28 ? 13.291 0.060   -0.511  1.00 0.00 ? 28 VAL A CB   2  
ATOM 1605  C CG1  . VAL A 1 28 ? 12.029 0.277   0.306   1.00 0.00 ? 28 VAL A CG1  2  
ATOM 1606  C CG2  . VAL A 1 28 ? 14.506 0.625   0.192   1.00 0.00 ? 28 VAL A CG2  2  
ATOM 1607  H H    . VAL A 1 28 ? 14.399 -2.229  0.895   1.00 0.00 ? 28 VAL A H    2  
ATOM 1608  H HA   . VAL A 1 28 ? 12.627 -1.768  -1.396  1.00 0.00 ? 28 VAL A HA   2  
ATOM 1609  H HB   . VAL A 1 28 ? 13.174 0.577   -1.443  1.00 0.00 ? 28 VAL A HB   2  
ATOM 1610  H HG11 . VAL A 1 28 ? 12.089 -0.267  1.227   1.00 0.00 ? 28 VAL A HG11 2  
ATOM 1611  H HG12 . VAL A 1 28 ? 11.179 -0.074  -0.263  1.00 0.00 ? 28 VAL A HG12 2  
ATOM 1612  H HG13 . VAL A 1 28 ? 11.911 1.330   0.502   1.00 0.00 ? 28 VAL A HG13 2  
ATOM 1613  H HG21 . VAL A 1 28 ? 14.368 1.671   0.374   1.00 0.00 ? 28 VAL A HG21 2  
ATOM 1614  H HG22 . VAL A 1 28 ? 15.381 0.482   -0.443  1.00 0.00 ? 28 VAL A HG22 2  
ATOM 1615  H HG23 . VAL A 1 28 ? 14.661 0.110   1.131   1.00 0.00 ? 28 VAL A HG23 2  
ATOM 1616  N N    . ARG A 1 29 ? 14.621 -1.307  -2.963  1.00 0.00 ? 29 ARG A N    2  
ATOM 1617  C CA   . ARG A 1 29 ? 15.758 -1.365  -3.881  1.00 0.00 ? 29 ARG A CA   2  
ATOM 1618  C C    . ARG A 1 29 ? 15.904 -0.046  -4.641  1.00 0.00 ? 29 ARG A C    2  
ATOM 1619  O O    . ARG A 1 29 ? 14.916 0.608   -4.969  1.00 0.00 ? 29 ARG A O    2  
ATOM 1620  C CB   . ARG A 1 29 ? 15.574 -2.530  -4.855  1.00 0.00 ? 29 ARG A CB   2  
ATOM 1621  C CG   . ARG A 1 29 ? 16.792 -2.823  -5.717  1.00 0.00 ? 29 ARG A CG   2  
ATOM 1622  C CD   . ARG A 1 29 ? 16.518 -3.976  -6.685  1.00 0.00 ? 29 ARG A CD   2  
ATOM 1623  N NE   . ARG A 1 29 ? 15.665 -3.561  -7.819  1.00 0.00 ? 29 ARG A NE   2  
ATOM 1624  C CZ   . ARG A 1 29 ? 14.340 -3.748  -7.885  1.00 0.00 ? 29 ARG A CZ   2  
ATOM 1625  N NH1  . ARG A 1 29 ? 13.694 -4.339  -6.883  1.00 0.00 ? 29 ARG A NH1  2  
ATOM 1626  N NH2  . ARG A 1 29 ? 13.666 -3.363  -8.950  1.00 0.00 ? 29 ARG A NH2  2  
ATOM 1627  H H    . ARG A 1 29 ? 13.731 -1.088  -3.310  1.00 0.00 ? 29 ARG A H    2  
ATOM 1628  H HA   . ARG A 1 29 ? 16.640 -1.524  -3.295  1.00 0.00 ? 29 ARG A HA   2  
ATOM 1629  H HB2  . ARG A 1 29 ? 15.349 -3.426  -4.283  1.00 0.00 ? 29 ARG A HB2  2  
ATOM 1630  H HB3  . ARG A 1 29 ? 14.749 -2.311  -5.501  1.00 0.00 ? 29 ARG A HB3  2  
ATOM 1631  H HG2  . ARG A 1 29 ? 17.040 -1.946  -6.276  1.00 0.00 ? 29 ARG A HG2  2  
ATOM 1632  H HG3  . ARG A 1 29 ? 17.613 -3.096  -5.065  1.00 0.00 ? 29 ARG A HG3  2  
ATOM 1633  H HD2  . ARG A 1 29 ? 17.458 -4.325  -7.064  1.00 0.00 ? 29 ARG A HD2  2  
ATOM 1634  H HD3  . ARG A 1 29 ? 16.029 -4.771  -6.153  1.00 0.00 ? 29 ARG A HD3  2  
ATOM 1635  H HE   . ARG A 1 29 ? 16.118 -3.113  -8.577  1.00 0.00 ? 29 ARG A HE   2  
ATOM 1636  H HH11 . ARG A 1 29 ? 14.199 -4.656  -6.077  1.00 0.00 ? 29 ARG A HH11 2  
ATOM 1637  H HH12 . ARG A 1 29 ? 12.694 -4.467  -6.924  1.00 0.00 ? 29 ARG A HH12 2  
ATOM 1638  H HH21 . ARG A 1 29 ? 14.143 -2.931  -9.724  1.00 0.00 ? 29 ARG A HH21 2  
ATOM 1639  H HH22 . ARG A 1 29 ? 12.663 -3.479  -8.977  1.00 0.00 ? 29 ARG A HH22 2  
ATOM 1640  N N    . MET A 1 30 ? 17.148 0.340   -4.883  1.00 0.00 ? 30 MET A N    2  
ATOM 1641  C CA   . MET A 1 30 ? 17.440 1.562   -5.645  1.00 0.00 ? 30 MET A CA   2  
ATOM 1642  C C    . MET A 1 30 ? 17.471 1.256   -7.136  1.00 0.00 ? 30 MET A C    2  
ATOM 1643  O O    . MET A 1 30 ? 17.993 0.215   -7.553  1.00 0.00 ? 30 MET A O    2  
ATOM 1644  C CB   . MET A 1 30 ? 18.803 2.118   -5.212  1.00 0.00 ? 30 MET A CB   2  
ATOM 1645  C CG   . MET A 1 30 ? 19.062 3.536   -5.672  1.00 0.00 ? 30 MET A CG   2  
ATOM 1646  S SD   . MET A 1 30 ? 17.892 4.715   -4.951  1.00 0.00 ? 30 MET A SD   2  
ATOM 1647  C CE   . MET A 1 30 ? 18.576 6.266   -5.503  1.00 0.00 ? 30 MET A CE   2  
ATOM 1648  H H    . MET A 1 30 ? 17.896 -0.188  -4.534  1.00 0.00 ? 30 MET A H    2  
ATOM 1649  H HA   . MET A 1 30 ? 16.670 2.289   -5.436  1.00 0.00 ? 30 MET A HA   2  
ATOM 1650  H HB2  . MET A 1 30 ? 18.845 2.108   -4.129  1.00 0.00 ? 30 MET A HB2  2  
ATOM 1651  H HB3  . MET A 1 30 ? 19.572 1.484   -5.609  1.00 0.00 ? 30 MET A HB3  2  
ATOM 1652  H HG2  . MET A 1 30 ? 20.061 3.816   -5.376  1.00 0.00 ? 30 MET A HG2  2  
ATOM 1653  H HG3  . MET A 1 30 ? 18.966 3.578   -6.744  1.00 0.00 ? 30 MET A HG3  2  
ATOM 1654  H HE1  . MET A 1 30 ? 17.957 7.063   -5.141  1.00 0.00 ? 30 MET A HE1  2  
ATOM 1655  H HE2  . MET A 1 30 ? 18.617 6.289   -6.592  1.00 0.00 ? 30 MET A HE2  2  
ATOM 1656  H HE3  . MET A 1 30 ? 19.567 6.378   -5.103  1.00 0.00 ? 30 MET A HE3  2  
ATOM 1657  N N    . LEU A 1 31 ? 16.941 2.167   -7.965  1.00 0.00 ? 31 LEU A N    2  
ATOM 1658  C CA   . LEU A 1 31 ? 16.831 1.939   -9.395  1.00 0.00 ? 31 LEU A CA   2  
ATOM 1659  C C    . LEU A 1 31 ? 18.013 2.533   -10.142 1.00 0.00 ? 31 LEU A C    2  
ATOM 1660  O O    . LEU A 1 31 ? 18.575 1.922   -11.032 1.00 0.00 ? 31 LEU A O    2  
ATOM 1661  C CB   . LEU A 1 31 ? 15.533 2.526   -9.962  1.00 0.00 ? 31 LEU A CB   2  
ATOM 1662  C CG   . LEU A 1 31 ? 14.229 1.899   -9.463  1.00 0.00 ? 31 LEU A CG   2  
ATOM 1663  C CD1  . LEU A 1 31 ? 13.904 2.340   -8.050  1.00 0.00 ? 31 LEU A CD1  2  
ATOM 1664  C CD2  . LEU A 1 31 ? 13.083 2.244   -10.405 1.00 0.00 ? 31 LEU A CD2  2  
ATOM 1665  H H    . LEU A 1 31 ? 16.634 3.028   -7.597  1.00 0.00 ? 31 LEU A H    2  
ATOM 1666  H HA   . LEU A 1 31 ? 16.829 0.867   -9.559  1.00 0.00 ? 31 LEU A HA   2  
ATOM 1667  H HB2  . LEU A 1 31 ? 15.512 3.579   -9.716  1.00 0.00 ? 31 LEU A HB2  2  
ATOM 1668  H HB3  . LEU A 1 31 ? 15.564 2.423   -11.038 1.00 0.00 ? 31 LEU A HB3  2  
ATOM 1669  H HG   . LEU A 1 31 ? 14.333 0.826   -9.437  1.00 0.00 ? 31 LEU A HG   2  
ATOM 1670  H HD11 . LEU A 1 31 ? 12.994 1.861   -7.722  1.00 0.00 ? 31 LEU A HD11 2  
ATOM 1671  H HD12 . LEU A 1 31 ? 13.765 3.415   -8.038  1.00 0.00 ? 31 LEU A HD12 2  
ATOM 1672  H HD13 . LEU A 1 31 ? 14.714 2.076   -7.393  1.00 0.00 ? 31 LEU A HD13 2  
ATOM 1673  H HD21 . LEU A 1 31 ? 12.946 3.313   -10.442 1.00 0.00 ? 31 LEU A HD21 2  
ATOM 1674  H HD22 . LEU A 1 31 ? 12.178 1.785   -10.042 1.00 0.00 ? 31 LEU A HD22 2  
ATOM 1675  H HD23 . LEU A 1 31 ? 13.310 1.864   -11.395 1.00 0.00 ? 31 LEU A HD23 2  
ATOM 1676  N N    . ASP A 1 32 ? 18.373 3.749   -9.747  1.00 0.00 ? 32 ASP A N    2  
ATOM 1677  C CA   . ASP A 1 32 ? 19.442 4.470   -10.423 1.00 0.00 ? 32 ASP A CA   2  
ATOM 1678  C C    . ASP A 1 32 ? 20.399 5.118   -9.426  1.00 0.00 ? 32 ASP A C    2  
ATOM 1679  O O    . ASP A 1 32 ? 20.029 5.364   -8.288  1.00 0.00 ? 32 ASP A O    2  
ATOM 1680  C CB   . ASP A 1 32 ? 18.863 5.538   -11.368 1.00 0.00 ? 32 ASP A CB   2  
ATOM 1681  C CG   . ASP A 1 32 ? 17.991 6.577   -10.678 1.00 0.00 ? 32 ASP A CG   2  
ATOM 1682  O OD1  . ASP A 1 32 ? 16.831 6.264   -10.335 1.00 0.00 ? 32 ASP A OD1  2  
ATOM 1683  O OD2  . ASP A 1 32 ? 18.456 7.727   -10.516 1.00 0.00 ? 32 ASP A OD2  2  
ATOM 1684  H H    . ASP A 1 32 ? 17.911 4.161   -9.006  1.00 0.00 ? 32 ASP A H    2  
ATOM 1685  H HA   . ASP A 1 32 ? 20.005 3.769   -11.012 1.00 0.00 ? 32 ASP A HA   2  
ATOM 1686  H HB2  . ASP A 1 32 ? 19.668 6.056   -11.869 1.00 0.00 ? 32 ASP A HB2  2  
ATOM 1687  H HB3  . ASP A 1 32 ? 18.266 5.027   -12.105 1.00 0.00 ? 32 ASP A HB3  2  
ATOM 1688  N N    . ASP A 1 33 ? 21.632 5.363   -9.851  1.00 0.00 ? 33 ASP A N    2  
ATOM 1689  C CA   . ASP A 1 33 ? 22.675 5.883   -8.969  1.00 0.00 ? 33 ASP A CA   2  
ATOM 1690  C C    . ASP A 1 33 ? 22.437 7.350   -8.680  1.00 0.00 ? 33 ASP A C    2  
ATOM 1691  O O    . ASP A 1 33 ? 22.139 8.128   -9.605  1.00 0.00 ? 33 ASP A O    2  
ATOM 1692  C CB   . ASP A 1 33 ? 24.054 5.729   -9.637  1.00 0.00 ? 33 ASP A CB   2  
ATOM 1693  C CG   . ASP A 1 33 ? 24.257 4.360   -10.260 1.00 0.00 ? 33 ASP A CG   2  
ATOM 1694  O OD1  . ASP A 1 33 ? 24.447 3.380   -9.518  1.00 0.00 ? 33 ASP A OD1  2  
ATOM 1695  O OD2  . ASP A 1 33 ? 24.238 4.251   -11.514 1.00 0.00 ? 33 ASP A OD2  2  
ATOM 1696  H H    . ASP A 1 33 ? 21.861 5.201   -10.789 1.00 0.00 ? 33 ASP A H    2  
ATOM 1697  H HA   . ASP A 1 33 ? 22.650 5.323   -8.045  1.00 0.00 ? 33 ASP A HA   2  
ATOM 1698  H HB2  . ASP A 1 33 ? 24.153 6.478   -10.411 1.00 0.00 ? 33 ASP A HB2  2  
ATOM 1699  H HB3  . ASP A 1 33 ? 24.830 5.882   -8.894  1.00 0.00 ? 33 ASP A HB3  2  
ATOM 1700  N N    . TYR A 1 34 ? 22.562 7.771   -7.429  1.00 0.00 ? 34 TYR A N    2  
ATOM 1701  C CA   . TYR A 1 34 ? 22.181 9.111   -7.041  1.00 0.00 ? 34 TYR A CA   2  
ATOM 1702  C C    . TYR A 1 34 ? 22.910 9.595   -5.794  1.00 0.00 ? 34 TYR A C    2  
ATOM 1703  O O    . TYR A 1 34 ? 22.528 9.230   -4.668  1.00 0.00 ? 34 TYR A O    2  
ATOM 1704  C CB   . TYR A 1 34 ? 20.676 9.168   -6.833  1.00 0.00 ? 34 TYR A CB   2  
ATOM 1705  C CG   . TYR A 1 34 ? 20.128 10.557  -6.633  1.00 0.00 ? 34 TYR A CG   2  
ATOM 1706  C CD1  . TYR A 1 34 ? 19.961 11.411  -7.727  1.00 0.00 ? 34 TYR A CD1  2  
ATOM 1707  C CD2  . TYR A 1 34 ? 19.766 11.025  -5.379  1.00 0.00 ? 34 TYR A CD2  2  
ATOM 1708  C CE1  . TYR A 1 34 ? 19.446 12.679  -7.559  1.00 0.00 ? 34 TYR A CE1  2  
ATOM 1709  C CE2  . TYR A 1 34 ? 19.249 12.300  -5.209  1.00 0.00 ? 34 TYR A CE2  2  
ATOM 1710  C CZ   . TYR A 1 34 ? 19.092 13.114  -6.302  1.00 0.00 ? 34 TYR A CZ   2  
ATOM 1711  O OH   . TYR A 1 34 ? 18.557 14.373  -6.149  1.00 0.00 ? 34 TYR A OH   2  
ATOM 1712  H H    . TYR A 1 34 ? 22.902 7.129   -6.742  1.00 0.00 ? 34 TYR A H    2  
ATOM 1713  H HA   . TYR A 1 34 ? 22.430 9.775   -7.868  1.00 0.00 ? 34 TYR A HA   2  
ATOM 1714  H HB2  . TYR A 1 34 ? 20.180 8.741   -7.695  1.00 0.00 ? 34 TYR A HB2  2  
ATOM 1715  H HB3  . TYR A 1 34 ? 20.420 8.587   -5.954  1.00 0.00 ? 34 TYR A HB3  2  
ATOM 1716  H HD1  . TYR A 1 34 ? 20.230 11.059  -8.708  1.00 0.00 ? 34 TYR A HD1  2  
ATOM 1717  H HD2  . TYR A 1 34 ? 19.895 10.380  -4.518  1.00 0.00 ? 34 TYR A HD2  2  
ATOM 1718  H HE1  . TYR A 1 34 ? 19.328 13.327  -8.414  1.00 0.00 ? 34 TYR A HE1  2  
ATOM 1719  H HE2  . TYR A 1 34 ? 18.970 12.636  -4.231  1.00 0.00 ? 34 TYR A HE2  2  
ATOM 1720  H HH   . TYR A 1 34 ? 18.854 14.744  -5.300  1.00 0.00 ? 34 TYR A HH   2  
ATOM 1721  N N    . GLU A 1 35 ? 23.977 10.391  -5.987  1.00 0.00 ? 35 GLU A N    2  
ATOM 1722  C CA   . GLU A 1 35 ? 24.615 11.202  -4.925  1.00 0.00 ? 35 GLU A CA   2  
ATOM 1723  C C    . GLU A 1 35 ? 25.352 10.384  -3.871  1.00 0.00 ? 35 GLU A C    2  
ATOM 1724  O O    . GLU A 1 35 ? 26.392 10.824  -3.347  1.00 0.00 ? 35 GLU A O    2  
ATOM 1725  C CB   . GLU A 1 35 ? 23.556 12.098  -4.261  1.00 0.00 ? 35 GLU A CB   2  
ATOM 1726  C CG   . GLU A 1 35 ? 24.118 13.021  -3.192  1.00 0.00 ? 35 GLU A CG   2  
ATOM 1727  C CD   . GLU A 1 35 ? 23.085 13.986  -2.653  1.00 0.00 ? 35 GLU A CD   2  
ATOM 1728  O OE1  . GLU A 1 35 ? 22.308 13.601  -1.754  1.00 0.00 ? 35 GLU A OE1  2  
ATOM 1729  O OE2  . GLU A 1 35 ? 23.052 15.143  -3.114  1.00 0.00 ? 35 GLU A OE2  2  
ATOM 1730  H H    . GLU A 1 35 ? 24.362 10.420  -6.886  1.00 0.00 ? 35 GLU A H    2  
ATOM 1731  H HA   . GLU A 1 35 ? 25.325 11.839  -5.412  1.00 0.00 ? 35 GLU A HA   2  
ATOM 1732  H HB2  . GLU A 1 35 ? 23.087 12.697  -5.020  1.00 0.00 ? 35 GLU A HB2  2  
ATOM 1733  H HB3  . GLU A 1 35 ? 22.809 11.473  -3.797  1.00 0.00 ? 35 GLU A HB3  2  
ATOM 1734  H HG2  . GLU A 1 35 ? 24.494 12.427  -2.367  1.00 0.00 ? 35 GLU A HG2  2  
ATOM 1735  H HG3  . GLU A 1 35 ? 24.932 13.595  -3.619  1.00 0.00 ? 35 GLU A HG3  2  
ATOM 1736  N N    . GLU A 1 36 ? 24.882 9.181   -3.607  1.00 0.00 ? 36 GLU A N    2  
ATOM 1737  C CA   . GLU A 1 36 ? 25.336 8.386   -2.476  1.00 0.00 ? 36 GLU A CA   2  
ATOM 1738  C C    . GLU A 1 36 ? 24.936 6.936   -2.658  1.00 0.00 ? 36 GLU A C    2  
ATOM 1739  O O    . GLU A 1 36 ? 25.690 6.027   -2.330  1.00 0.00 ? 36 GLU A O    2  
ATOM 1740  C CB   . GLU A 1 36 ? 24.756 8.886   -1.147  1.00 0.00 ? 36 GLU A CB   2  
ATOM 1741  C CG   . GLU A 1 36 ? 25.312 10.216  -0.655  1.00 0.00 ? 36 GLU A CG   2  
ATOM 1742  C CD   . GLU A 1 36 ? 24.934 10.521  0.776   1.00 0.00 ? 36 GLU A CD   2  
ATOM 1743  O OE1  . GLU A 1 36 ? 23.861 11.094  1.009   1.00 0.00 ? 36 GLU A OE1  2  
ATOM 1744  O OE2  . GLU A 1 36 ? 25.735 10.190  1.684   1.00 0.00 ? 36 GLU A OE2  2  
ATOM 1745  H H    . GLU A 1 36 ? 24.286 8.801   -4.271  1.00 0.00 ? 36 GLU A H    2  
ATOM 1746  H HA   . GLU A 1 36 ? 26.403 8.444   -2.448  1.00 0.00 ? 36 GLU A HA   2  
ATOM 1747  H HB2  . GLU A 1 36 ? 23.693 9.004   -1.263  1.00 0.00 ? 36 GLU A HB2  2  
ATOM 1748  H HB3  . GLU A 1 36 ? 24.948 8.129   -0.383  1.00 0.00 ? 36 GLU A HB3  2  
ATOM 1749  H HG2  . GLU A 1 36 ? 26.393 10.193  -0.737  1.00 0.00 ? 36 GLU A HG2  2  
ATOM 1750  H HG3  . GLU A 1 36 ? 24.936 11.001  -1.287  1.00 0.00 ? 36 GLU A HG3  2  
ATOM 1751  N N    . ILE A 1 37 ? 23.745 6.742   -3.196  1.00 0.00 ? 37 ILE A N    2  
ATOM 1752  C CA   . ILE A 1 37 ? 23.213 5.404   -3.372  1.00 0.00 ? 37 ILE A CA   2  
ATOM 1753  C C    . ILE A 1 37 ? 23.384 4.993   -4.823  1.00 0.00 ? 37 ILE A C    2  
ATOM 1754  O O    . ILE A 1 37 ? 23.363 5.835   -5.720  1.00 0.00 ? 37 ILE A O    2  
ATOM 1755  C CB   . ILE A 1 37 ? 21.724 5.329   -2.964  1.00 0.00 ? 37 ILE A CB   2  
ATOM 1756  C CG1  . ILE A 1 37 ? 21.537 5.989   -1.587  1.00 0.00 ? 37 ILE A CG1  2  
ATOM 1757  C CG2  . ILE A 1 37 ? 21.240 3.882   -2.934  1.00 0.00 ? 37 ILE A CG2  2  
ATOM 1758  C CD1  . ILE A 1 37 ? 22.373 5.362   -0.483  1.00 0.00 ? 37 ILE A CD1  2  
ATOM 1759  H H    . ILE A 1 37 ? 23.205 7.520   -3.469  1.00 0.00 ? 37 ILE A H    2  
ATOM 1760  H HA   . ILE A 1 37 ? 23.779 4.727   -2.752  1.00 0.00 ? 37 ILE A HA   2  
ATOM 1761  H HB   . ILE A 1 37 ? 21.153 5.869   -3.702  1.00 0.00 ? 37 ILE A HB   2  
ATOM 1762  H HG12 . ILE A 1 37 ? 21.808 7.041   -1.654  1.00 0.00 ? 37 ILE A HG12 2  
ATOM 1763  H HG13 . ILE A 1 37 ? 20.496 5.907   -1.300  1.00 0.00 ? 37 ILE A HG13 2  
ATOM 1764  H HG21 . ILE A 1 37 ? 21.347 3.455   -3.923  1.00 0.00 ? 37 ILE A HG21 2  
ATOM 1765  H HG22 . ILE A 1 37 ? 20.203 3.877   -2.638  1.00 0.00 ? 37 ILE A HG22 2  
ATOM 1766  H HG23 . ILE A 1 37 ? 21.835 3.318   -2.224  1.00 0.00 ? 37 ILE A HG23 2  
ATOM 1767  H HD11 . ILE A 1 37 ? 23.425 5.468   -0.717  1.00 0.00 ? 37 ILE A HD11 2  
ATOM 1768  H HD12 . ILE A 1 37 ? 22.130 4.323   -0.406  1.00 0.00 ? 37 ILE A HD12 2  
ATOM 1769  H HD13 . ILE A 1 37 ? 22.159 5.868   0.443   1.00 0.00 ? 37 ILE A HD13 2  
ATOM 1770  N N    . SER A 1 38 ? 23.543 3.704   -5.055  1.00 0.00 ? 38 SER A N    2  
ATOM 1771  C CA   . SER A 1 38 ? 23.820 3.190   -6.381  1.00 0.00 ? 38 SER A CA   2  
ATOM 1772  C C    . SER A 1 38 ? 22.693 2.263   -6.836  1.00 0.00 ? 38 SER A C    2  
ATOM 1773  O O    . SER A 1 38 ? 21.973 1.702   -6.022  1.00 0.00 ? 38 SER A O    2  
ATOM 1774  C CB   . SER A 1 38 ? 25.159 2.469   -6.357  1.00 0.00 ? 38 SER A CB   2  
ATOM 1775  O OG   . SER A 1 38 ? 25.584 2.066   -7.646  1.00 0.00 ? 38 SER A OG   2  
ATOM 1776  H H    . SER A 1 38 ? 23.461 3.050   -4.303  1.00 0.00 ? 38 SER A H    2  
ATOM 1777  H HA   . SER A 1 38 ? 23.879 4.024   -7.059  1.00 0.00 ? 38 SER A HA   2  
ATOM 1778  H HB2  . SER A 1 38 ? 25.910 3.128   -5.951  1.00 0.00 ? 38 SER A HB2  2  
ATOM 1779  H HB3  . SER A 1 38 ? 25.082 1.587   -5.730  1.00 0.00 ? 38 SER A HB3  2  
ATOM 1780  H HG   . SER A 1 38 ? 25.150 2.618   -8.320  1.00 0.00 ? 38 SER A HG   2  
ATOM 1781  N N    . ALA A 1 39 ? 22.556 2.131   -8.150  1.00 0.00 ? 39 ALA A N    2  
ATOM 1782  C CA   . ALA A 1 39 ? 21.592 1.215   -8.735  1.00 0.00 ? 39 ALA A CA   2  
ATOM 1783  C C    . ALA A 1 39 ? 21.891 -0.206  -8.298  1.00 0.00 ? 39 ALA A C    2  
ATOM 1784  O O    . ALA A 1 39 ? 22.998 -0.712  -8.517  1.00 0.00 ? 39 ALA A O    2  
ATOM 1785  C CB   . ALA A 1 39 ? 21.611 1.338   -10.249 1.00 0.00 ? 39 ALA A CB   2  
ATOM 1786  H H    . ALA A 1 39 ? 23.121 2.667   -8.748  1.00 0.00 ? 39 ALA A H    2  
ATOM 1787  H HA   . ALA A 1 39 ? 20.616 1.498   -8.380  1.00 0.00 ? 39 ALA A HA   2  
ATOM 1788  H HB1  . ALA A 1 39 ? 20.851 0.685   -10.673 1.00 0.00 ? 39 ALA A HB1  2  
ATOM 1789  H HB2  . ALA A 1 39 ? 22.575 1.037   -10.619 1.00 0.00 ? 39 ALA A HB2  2  
ATOM 1790  H HB3  . ALA A 1 39 ? 21.410 2.369   -10.536 1.00 0.00 ? 39 ALA A HB3  2  
ATOM 1791  N N    . GLY A 1 40 ? 20.921 -0.876  -7.692  1.00 0.00 ? 40 GLY A N    2  
ATOM 1792  C CA   . GLY A 1 40 ? 21.149 -2.214  -7.184  1.00 0.00 ? 40 GLY A CA   2  
ATOM 1793  C C    . GLY A 1 40 ? 21.291 -2.255  -5.681  1.00 0.00 ? 40 GLY A C    2  
ATOM 1794  O O    . GLY A 1 40 ? 21.222 -3.333  -5.080  1.00 0.00 ? 40 GLY A O    2  
ATOM 1795  H H    . GLY A 1 40 ? 20.035 -0.461  -7.586  1.00 0.00 ? 40 GLY A H    2  
ATOM 1796  H HA2  . GLY A 1 40 ? 20.331 -2.845  -7.475  1.00 0.00 ? 40 GLY A HA2  2  
ATOM 1797  H HA3  . GLY A 1 40 ? 22.074 -2.594  -7.625  1.00 0.00 ? 40 GLY A HA3  2  
ATOM 1798  N N    . ASP A 1 41 ? 21.470 -1.102  -5.046  1.00 0.00 ? 41 ASP A N    2  
ATOM 1799  C CA   . ASP A 1 41 ? 21.521 -1.023  -3.603  1.00 0.00 ? 41 ASP A CA   2  
ATOM 1800  C C    . ASP A 1 41 ? 20.177 -1.379  -3.008  1.00 0.00 ? 41 ASP A C    2  
ATOM 1801  O O    . ASP A 1 41 ? 19.134 -1.142  -3.624  1.00 0.00 ? 41 ASP A O    2  
ATOM 1802  C CB   . ASP A 1 41 ? 21.920 0.375   -3.133  1.00 0.00 ? 41 ASP A CB   2  
ATOM 1803  C CG   . ASP A 1 41 ? 23.418 0.557   -3.001  1.00 0.00 ? 41 ASP A CG   2  
ATOM 1804  O OD1  . ASP A 1 41 ? 24.034 -0.145  -2.181  1.00 0.00 ? 41 ASP A OD1  2  
ATOM 1805  O OD2  . ASP A 1 41 ? 23.981 1.443   -3.682  1.00 0.00 ? 41 ASP A OD2  2  
ATOM 1806  H H    . ASP A 1 41 ? 21.578 -0.282  -5.570  1.00 0.00 ? 41 ASP A H    2  
ATOM 1807  H HA   . ASP A 1 41 ? 22.259 -1.730  -3.277  1.00 0.00 ? 41 ASP A HA   2  
ATOM 1808  H HB2  . ASP A 1 41 ? 21.551 1.101   -3.832  1.00 0.00 ? 41 ASP A HB2  2  
ATOM 1809  H HB3  . ASP A 1 41 ? 21.474 0.548   -2.162  1.00 0.00 ? 41 ASP A HB3  2  
ATOM 1810  N N    . GLU A 1 42 ? 20.206 -1.937  -1.806  1.00 0.00 ? 42 GLU A N    2  
ATOM 1811  C CA   . GLU A 1 42 ? 18.998 -2.377  -1.118  1.00 0.00 ? 42 GLU A CA   2  
ATOM 1812  C C    . GLU A 1 42 ? 18.976 -1.821  0.293   1.00 0.00 ? 42 GLU A C    2  
ATOM 1813  O O    . GLU A 1 42 ? 20.035 -1.604  0.909   1.00 0.00 ? 42 GLU A O    2  
ATOM 1814  C CB   . GLU A 1 42 ? 18.928 -3.909  -1.099  1.00 0.00 ? 42 GLU A CB   2  
ATOM 1815  C CG   . GLU A 1 42 ? 18.885 -4.537  -2.481  1.00 0.00 ? 42 GLU A CG   2  
ATOM 1816  C CD   . GLU A 1 42 ? 18.887 -6.052  -2.441  1.00 0.00 ? 42 GLU A CD   2  
ATOM 1817  O OE1  . GLU A 1 42 ? 19.964 -6.642  -2.212  1.00 0.00 ? 42 GLU A OE1  2  
ATOM 1818  O OE2  . GLU A 1 42 ? 17.806 -6.661  -2.615  1.00 0.00 ? 42 GLU A OE2  2  
ATOM 1819  H H    . GLU A 1 42 ? 21.069 -2.042  -1.346  1.00 0.00 ? 42 GLU A H    2  
ATOM 1820  H HA   . GLU A 1 42 ? 18.143 -1.988  -1.660  1.00 0.00 ? 42 GLU A HA   2  
ATOM 1821  H HB2  . GLU A 1 42 ? 19.798 -4.284  -0.583  1.00 0.00 ? 42 GLU A HB2  2  
ATOM 1822  H HB3  . GLU A 1 42 ? 18.034 -4.223  -0.553  1.00 0.00 ? 42 GLU A HB3  2  
ATOM 1823  H HG2  . GLU A 1 42 ? 17.981 -4.219  -2.978  1.00 0.00 ? 42 GLU A HG2  2  
ATOM 1824  H HG3  . GLU A 1 42 ? 19.740 -4.199  -3.039  1.00 0.00 ? 42 GLU A HG3  2  
ATOM 1825  N N    . GLY A 1 43 ? 17.787 -1.587  0.827   1.00 0.00 ? 43 GLY A N    2  
ATOM 1826  C CA   . GLY A 1 43 ? 17.673 -1.017  2.149   1.00 0.00 ? 43 GLY A CA   2  
ATOM 1827  C C    . GLY A 1 43 ? 16.339 -1.311  2.771   1.00 0.00 ? 43 GLY A C    2  
ATOM 1828  O O    . GLY A 1 43 ? 15.544 -2.077  2.226   1.00 0.00 ? 43 GLY A O    2  
ATOM 1829  H H    . GLY A 1 43 ? 16.988 -1.828  0.329   1.00 0.00 ? 43 GLY A H    2  
ATOM 1830  H HA2  . GLY A 1 43 ? 18.462 -1.423  2.774   1.00 0.00 ? 43 GLY A HA2  2  
ATOM 1831  H HA3  . GLY A 1 43 ? 17.809 0.059   2.071   1.00 0.00 ? 43 GLY A HA3  2  
ATOM 1832  N N    . GLU A 1 44 ? 16.072 -0.694  3.909   1.00 0.00 ? 44 GLU A N    2  
ATOM 1833  C CA   . GLU A 1 44 ? 14.828 -0.927  4.624   1.00 0.00 ? 44 GLU A CA   2  
ATOM 1834  C C    . GLU A 1 44 ? 14.141 0.416   4.901   1.00 0.00 ? 44 GLU A C    2  
ATOM 1835  O O    . GLU A 1 44 ? 14.781 1.443   5.106   1.00 0.00 ? 44 GLU A O    2  
ATOM 1836  C CB   . GLU A 1 44 ? 15.130 -1.654  5.941   1.00 0.00 ? 44 GLU A CB   2  
ATOM 1837  C CG   . GLU A 1 44 ? 13.860 -2.052  6.694   1.00 0.00 ? 44 GLU A CG   2  
ATOM 1838  C CD   . GLU A 1 44 ? 14.146 -2.621  8.054   1.00 0.00 ? 44 GLU A CD   2  
ATOM 1839  O OE1  . GLU A 1 44 ? 14.348 -3.846  8.166   1.00 0.00 ? 44 GLU A OE1  2  
ATOM 1840  O OE2  . GLU A 1 44 ? 14.183 -1.834  9.026   1.00 0.00 ? 44 GLU A OE2  2  
ATOM 1841  H H    . GLU A 1 44 ? 16.733 -0.054  4.269   1.00 0.00 ? 44 GLU A H    2  
ATOM 1842  H HA   . GLU A 1 44 ? 14.186 -1.527  4.017   1.00 0.00 ? 44 GLU A HA   2  
ATOM 1843  H HB2  . GLU A 1 44 ? 15.700 -2.546  5.736   1.00 0.00 ? 44 GLU A HB2  2  
ATOM 1844  H HB3  . GLU A 1 44 ? 15.704 -0.999  6.584   1.00 0.00 ? 44 GLU A HB3  2  
ATOM 1845  H HG2  . GLU A 1 44 ? 13.241 -1.180  6.800   1.00 0.00 ? 44 GLU A HG2  2  
ATOM 1846  H HG3  . GLU A 1 44 ? 13.342 -2.796  6.108   1.00 0.00 ? 44 GLU A HG3  2  
ATOM 1847  N N    . PHE A 1 45 ? 12.812 0.369   4.971   1.00 0.00 ? 45 PHE A N    2  
ATOM 1848  C CA   . PHE A 1 45 ? 12.010 1.554   5.214   1.00 0.00 ? 45 PHE A CA   2  
ATOM 1849  C C    . PHE A 1 45 ? 11.715 1.654   6.693   1.00 0.00 ? 45 PHE A C    2  
ATOM 1850  O O    . PHE A 1 45 ? 11.095 0.752   7.286   1.00 0.00 ? 45 PHE A O    2  
ATOM 1851  C CB   . PHE A 1 45 ? 10.726 1.483   4.404   1.00 0.00 ? 45 PHE A CB   2  
ATOM 1852  C CG   . PHE A 1 45 ? 9.695  2.516   4.789   1.00 0.00 ? 45 PHE A CG   2  
ATOM 1853  C CD1  . PHE A 1 45 ? 9.802  3.814   4.339   1.00 0.00 ? 45 PHE A CD1  2  
ATOM 1854  C CD2  . PHE A 1 45 ? 8.616  2.177   5.584   1.00 0.00 ? 45 PHE A CD2  2  
ATOM 1855  C CE1  . PHE A 1 45 ? 8.854  4.759   4.686   1.00 0.00 ? 45 PHE A CE1  2  
ATOM 1856  C CE2  . PHE A 1 45 ? 7.669  3.115   5.927   1.00 0.00 ? 45 PHE A CE2  2  
ATOM 1857  C CZ   . PHE A 1 45 ? 7.789  4.407   5.478   1.00 0.00 ? 45 PHE A CZ   2  
ATOM 1858  H H    . PHE A 1 45 ? 12.356 -0.498  4.890   1.00 0.00 ? 45 PHE A H    2  
ATOM 1859  H HA   . PHE A 1 45 ? 12.588 2.419   4.895   1.00 0.00 ? 45 PHE A HA   2  
ATOM 1860  H HB2  . PHE A 1 45 ? 10.959 1.644   3.362   1.00 0.00 ? 45 PHE A HB2  2  
ATOM 1861  H HB3  . PHE A 1 45 ? 10.273 0.513   4.527   1.00 0.00 ? 45 PHE A HB3  2  
ATOM 1862  H HD1  . PHE A 1 45 ? 10.651 4.094   3.717   1.00 0.00 ? 45 PHE A HD1  2  
ATOM 1863  H HD2  . PHE A 1 45 ? 8.531  1.161   5.960   1.00 0.00 ? 45 PHE A HD2  2  
ATOM 1864  H HE1  . PHE A 1 45 ? 8.958  5.773   4.327   1.00 0.00 ? 45 PHE A HE1  2  
ATOM 1865  H HE2  . PHE A 1 45 ? 6.828  2.831   6.551   1.00 0.00 ? 45 PHE A HE2  2  
ATOM 1866  H HZ   . PHE A 1 45 ? 7.045  5.156   5.750   1.00 0.00 ? 45 PHE A HZ   2  
ATOM 1867  N N    . ARG A 1 46 ? 12.169 2.726   7.319   1.00 0.00 ? 46 ARG A N    2  
ATOM 1868  C CA   . ARG A 1 46 ? 11.989 2.894   8.766   1.00 0.00 ? 46 ARG A CA   2  
ATOM 1869  C C    . ARG A 1 46 ? 10.961 3.959   9.082   1.00 0.00 ? 46 ARG A C    2  
ATOM 1870  O O    . ARG A 1 46 ? 10.002 3.715   9.813   1.00 0.00 ? 46 ARG A O    2  
ATOM 1871  C CB   . ARG A 1 46 ? 13.311 3.224   9.443   1.00 0.00 ? 46 ARG A CB   2  
ATOM 1872  C CG   . ARG A 1 46 ? 14.408 2.208   9.183   1.00 0.00 ? 46 ARG A CG   2  
ATOM 1873  C CD   . ARG A 1 46 ? 15.649 2.489   10.049  1.00 0.00 ? 46 ARG A CD   2  
ATOM 1874  N NE   . ARG A 1 46 ? 15.376 2.356   11.468  1.00 0.00 ? 46 ARG A NE   2  
ATOM 1875  C CZ   . ARG A 1 46 ? 15.775 1.320   12.219  1.00 0.00 ? 46 ARG A CZ   2  
ATOM 1876  N NH1  . ARG A 1 46 ? 16.431 0.304   11.652  1.00 0.00 ? 46 ARG A NH1  2  
ATOM 1877  N NH2  . ARG A 1 46 ? 15.518 1.289   13.513  1.00 0.00 ? 46 ARG A NH2  2  
ATOM 1878  H H    . ARG A 1 46 ? 12.662 3.403   6.799   1.00 0.00 ? 46 ARG A H    2  
ATOM 1879  H HA   . ARG A 1 46 ? 11.633 1.951   9.147   1.00 0.00 ? 46 ARG A HA   2  
ATOM 1880  H HB2  . ARG A 1 46 ? 13.654 4.185   9.085   1.00 0.00 ? 46 ARG A HB2  2  
ATOM 1881  H HB3  . ARG A 1 46 ? 13.154 3.291   10.514  1.00 0.00 ? 46 ARG A HB3  2  
ATOM 1882  H HG2  . ARG A 1 46 ? 14.032 1.220   9.435   1.00 0.00 ? 46 ARG A HG2  2  
ATOM 1883  H HG3  . ARG A 1 46 ? 14.685 2.238   8.145   1.00 0.00 ? 46 ARG A HG3  2  
ATOM 1884  H HD2  . ARG A 1 46 ? 16.414 1.792   9.769   1.00 0.00 ? 46 ARG A HD2  2  
ATOM 1885  H HD3  . ARG A 1 46 ? 15.980 3.500   9.841   1.00 0.00 ? 46 ARG A HD3  2  
ATOM 1886  H HE   . ARG A 1 46 ? 14.865 3.082   11.908  1.00 0.00 ? 46 ARG A HE   2  
ATOM 1887  H HH11 . ARG A 1 46 ? 16.612 0.298   10.665  1.00 0.00 ? 46 ARG A HH11 2  
ATOM 1888  H HH12 . ARG A 1 46 ? 16.730 -0.467  12.218  1.00 0.00 ? 46 ARG A HH12 2  
ATOM 1889  H HH21 . ARG A 1 46 ? 15.017 2.046   13.955  1.00 0.00 ? 46 ARG A HH21 2  
ATOM 1890  H HH22 . ARG A 1 46 ? 15.814 0.494   14.072  1.00 0.00 ? 46 ARG A HH22 2  
ATOM 1891  N N    . GLN A 1 47 ? 11.133 5.141   8.497   1.00 0.00 ? 47 GLN A N    2  
ATOM 1892  C CA   . GLN A 1 47 ? 10.275 6.273   8.792   1.00 0.00 ? 47 GLN A CA   2  
ATOM 1893  C C    . GLN A 1 47 ? 10.355 7.293   7.679   1.00 0.00 ? 47 GLN A C    2  
ATOM 1894  O O    . GLN A 1 47 ? 11.395 7.445   7.059   1.00 0.00 ? 47 GLN A O    2  
ATOM 1895  C CB   . GLN A 1 47 ? 10.646 6.926   10.123  1.00 0.00 ? 47 GLN A CB   2  
ATOM 1896  C CG   . GLN A 1 47 ? 12.148 7.156   10.298  1.00 0.00 ? 47 GLN A CG   2  
ATOM 1897  C CD   . GLN A 1 47 ? 12.475 8.104   11.444  1.00 0.00 ? 47 GLN A CD   2  
ATOM 1898  O OE1  . GLN A 1 47 ? 13.463 7.935   12.150  1.00 0.00 ? 47 GLN A OE1  2  
ATOM 1899  N NE2  . GLN A 1 47 ? 11.674 9.157   11.590  1.00 0.00 ? 47 GLN A NE2  2  
ATOM 1900  H H    . GLN A 1 47 ? 11.847 5.243   7.828   1.00 0.00 ? 47 GLN A H    2  
ATOM 1901  H HA   . GLN A 1 47 ? 9.254  5.906   8.845   1.00 0.00 ? 47 GLN A HA   2  
ATOM 1902  H HB2  . GLN A 1 47 ? 10.153 7.883   10.188  1.00 0.00 ? 47 GLN A HB2  2  
ATOM 1903  H HB3  . GLN A 1 47 ? 10.303 6.296   10.937  1.00 0.00 ? 47 GLN A HB3  2  
ATOM 1904  H HG2  . GLN A 1 47 ? 12.606 6.206   10.516  1.00 0.00 ? 47 GLN A HG2  2  
ATOM 1905  H HG3  . GLN A 1 47 ? 12.554 7.568   9.391   1.00 0.00 ? 47 GLN A HG3  2  
ATOM 1906  H HE21 . GLN A 1 47 ? 10.923 9.250   10.957  1.00 0.00 ? 47 GLN A HE21 2  
ATOM 1907  H HE22 . GLN A 1 47 ? 11.866 9.782   12.321  1.00 0.00 ? 47 GLN A HE22 2  
ATOM 1908  N N    . SER A 1 48 ? 9.263  8.007   7.434   1.00 0.00 ? 48 SER A N    2  
ATOM 1909  C CA   . SER A 1 48 ? 9.208  8.931   6.325   1.00 0.00 ? 48 SER A CA   2  
ATOM 1910  C C    . SER A 1 48 ? 8.030  9.885   6.445   1.00 0.00 ? 48 SER A C    2  
ATOM 1911  O O    . SER A 1 48 ? 7.327  9.913   7.460   1.00 0.00 ? 48 SER A O    2  
ATOM 1912  C CB   . SER A 1 48 ? 9.100  8.164   5.002   1.00 0.00 ? 48 SER A CB   2  
ATOM 1913  O OG   . SER A 1 48 ? 10.232 7.325   4.813   1.00 0.00 ? 48 SER A OG   2  
ATOM 1914  H H    . SER A 1 48 ? 8.468  7.908   8.025   1.00 0.00 ? 48 SER A H    2  
ATOM 1915  H HA   . SER A 1 48 ? 10.122 9.515   6.311   1.00 0.00 ? 48 SER A HA   2  
ATOM 1916  H HB2  . SER A 1 48 ? 8.206  7.550   5.012   1.00 0.00 ? 48 SER A HB2  2  
ATOM 1917  H HB3  . SER A 1 48 ? 9.047  8.870   4.183   1.00 0.00 ? 48 SER A HB3  2  
ATOM 1918  H HG   . SER A 1 48 ? 10.702 7.207   5.640   1.00 0.00 ? 48 SER A HG   2  
ATOM 1919  N N    . ASN A 1 49 ? 7.846  10.695  5.413   1.00 0.00 ? 49 ASN A N    2  
ATOM 1920  C CA   . ASN A 1 49 ? 6.751  11.650  5.332   1.00 0.00 ? 49 ASN A CA   2  
ATOM 1921  C C    . ASN A 1 49 ? 5.997  11.378  4.050   1.00 0.00 ? 49 ASN A C    2  
ATOM 1922  O O    . ASN A 1 49 ? 6.625  11.204  3.000   1.00 0.00 ? 49 ASN A O    2  
ATOM 1923  C CB   . ASN A 1 49 ? 7.271  13.085  5.344   1.00 0.00 ? 49 ASN A CB   2  
ATOM 1924  C CG   . ASN A 1 49 ? 7.515  13.640  6.729   1.00 0.00 ? 49 ASN A CG   2  
ATOM 1925  O OD1  . ASN A 1 49 ? 7.459  14.846  6.934   1.00 0.00 ? 49 ASN A OD1  2  
ATOM 1926  N ND2  . ASN A 1 49 ? 7.783  12.785  7.708   1.00 0.00 ? 49 ASN A ND2  2  
ATOM 1927  H H    . ASN A 1 49 ? 8.437  10.595  4.625   1.00 0.00 ? 49 ASN A H    2  
ATOM 1928  H HA   . ASN A 1 49 ? 6.083  11.485  6.171   1.00 0.00 ? 49 ASN A HA   2  
ATOM 1929  H HB2  . ASN A 1 49 ? 8.187  13.107  4.795   1.00 0.00 ? 49 ASN A HB2  2  
ATOM 1930  H HB3  . ASN A 1 49 ? 6.535  13.699  4.846   1.00 0.00 ? 49 ASN A HB3  2  
ATOM 1931  H HD21 . ASN A 1 49 ? 7.794  11.814  7.481   1.00 0.00 ? 49 ASN A HD21 2  
ATOM 1932  H HD22 . ASN A 1 49 ? 7.957  13.132  8.611   1.00 0.00 ? 49 ASN A HD22 2  
ATOM 1933  N N    . ASN A 1 50 ? 4.692  11.296  4.121   1.00 0.00 ? 50 ASN A N    2  
ATOM 1934  C CA   . ASN A 1 50 ? 3.890  10.940  2.941   1.00 0.00 ? 50 ASN A CA   2  
ATOM 1935  C C    . ASN A 1 50 ? 3.747  12.144  2.031   1.00 0.00 ? 50 ASN A C    2  
ATOM 1936  O O    . ASN A 1 50 ? 4.174  12.111  0.868   1.00 0.00 ? 50 ASN A O    2  
ATOM 1937  C CB   . ASN A 1 50 ? 2.529  10.396  3.372   1.00 0.00 ? 50 ASN A CB   2  
ATOM 1938  C CG   . ASN A 1 50 ? 1.731  9.833   2.214   1.00 0.00 ? 50 ASN A CG   2  
ATOM 1939  O OD1  . ASN A 1 50 ? 1.890  8.662   1.865   1.00 0.00 ? 50 ASN A OD1  2  
ATOM 1940  N ND2  . ASN A 1 50 ? 0.857  10.634  1.622   1.00 0.00 ? 50 ASN A ND2  2  
ATOM 1941  H H    . ASN A 1 50 ? 4.233  11.472  4.972   1.00 0.00 ? 50 ASN A H    2  
ATOM 1942  H HA   . ASN A 1 50 ? 4.434  10.167  2.420   1.00 0.00 ? 50 ASN A HA   2  
ATOM 1943  H HB2  . ASN A 1 50 ? 2.645  9.624   4.109   1.00 0.00 ? 50 ASN A HB2  2  
ATOM 1944  H HB3  . ASN A 1 50 ? 1.948  11.218  3.810   1.00 0.00 ? 50 ASN A HB3  2  
ATOM 1945  H HD21 . ASN A 1 50 ? 0.775  11.547  1.969   1.00 0.00 ? 50 ASN A HD21 2  
ATOM 1946  H HD22 . ASN A 1 50 ? 0.334  10.286  0.873   1.00 0.00 ? 50 ASN A HD22 2  
ATOM 1947  N N    . GLY A 1 51 ? 3.100  13.195  2.550   1.00 0.00 ? 51 GLY A N    2  
ATOM 1948  C CA   . GLY A 1 51 ? 2.906  14.428  1.804   1.00 0.00 ? 51 GLY A CA   2  
ATOM 1949  C C    . GLY A 1 51 ? 4.155  14.933  1.089   1.00 0.00 ? 51 GLY A C    2  
ATOM 1950  O O    . GLY A 1 51 ? 4.152  15.145  -0.131  1.00 0.00 ? 51 GLY A O    2  
ATOM 1951  H H    . GLY A 1 51 ? 2.681  13.078  3.430   1.00 0.00 ? 51 GLY A H    2  
ATOM 1952  H HA2  . GLY A 1 51 ? 2.137  14.262  1.051   1.00 0.00 ? 51 GLY A HA2  2  
ATOM 1953  H HA3  . GLY A 1 51 ? 2.565  15.192  2.481   1.00 0.00 ? 51 GLY A HA3  2  
ATOM 1954  N N    . VAL A 1 52 ? 5.220  15.128  1.838   1.00 0.00 ? 52 VAL A N    2  
ATOM 1955  C CA   . VAL A 1 52 ? 6.466  15.647  1.290   1.00 0.00 ? 52 VAL A CA   2  
ATOM 1956  C C    . VAL A 1 52 ? 7.407  14.514  0.853   1.00 0.00 ? 52 VAL A C    2  
ATOM 1957  O O    . VAL A 1 52 ? 7.426  13.427  1.438   1.00 0.00 ? 52 VAL A O    2  
ATOM 1958  C CB   . VAL A 1 52 ? 7.199  16.593  2.269   1.00 0.00 ? 52 VAL A CB   2  
ATOM 1959  C CG1  . VAL A 1 52 ? 6.377  17.854  2.472   1.00 0.00 ? 52 VAL A CG1  2  
ATOM 1960  C CG2  . VAL A 1 52 ? 7.457  15.912  3.612   1.00 0.00 ? 52 VAL A CG2  2  
ATOM 1961  H H    . VAL A 1 52 ? 5.177  14.930  2.807   1.00 0.00 ? 52 VAL A H    2  
ATOM 1962  H HA   . VAL A 1 52 ? 6.208  16.208  0.405   1.00 0.00 ? 52 VAL A HA   2  
ATOM 1963  H HB   . VAL A 1 52 ? 8.139  16.860  1.835   1.00 0.00 ? 52 VAL A HB   2  
ATOM 1964  H HG11 . VAL A 1 52 ? 6.263  18.360  1.530   1.00 0.00 ? 52 VAL A HG11 2  
ATOM 1965  H HG12 . VAL A 1 52 ? 6.878  18.507  3.166   1.00 0.00 ? 52 VAL A HG12 2  
ATOM 1966  H HG13 . VAL A 1 52 ? 5.400  17.596  2.858   1.00 0.00 ? 52 VAL A HG13 2  
ATOM 1967  H HG21 . VAL A 1 52 ? 6.515  15.596  4.044   1.00 0.00 ? 52 VAL A HG21 2  
ATOM 1968  H HG22 . VAL A 1 52 ? 7.939  16.619  4.261   1.00 0.00 ? 52 VAL A HG22 2  
ATOM 1969  H HG23 . VAL A 1 52 ? 8.096  15.065  3.452   1.00 0.00 ? 52 VAL A HG23 2  
ATOM 1970  N N    . PRO A 1 53 ? 8.184  14.750  -0.212  1.00 0.00 ? 53 PRO A N    2  
ATOM 1971  C CA   . PRO A 1 53 ? 9.072  13.741  -0.835  1.00 0.00 ? 53 PRO A CA   2  
ATOM 1972  C C    . PRO A 1 53 ? 10.091 13.033  0.095   1.00 0.00 ? 53 PRO A C    2  
ATOM 1973  O O    . PRO A 1 53 ? 10.354 11.856  -0.112  1.00 0.00 ? 53 PRO A O    2  
ATOM 1974  C CB   . PRO A 1 53 ? 9.815  14.512  -1.923  1.00 0.00 ? 53 PRO A CB   2  
ATOM 1975  C CG   . PRO A 1 53 ? 9.552  15.963  -1.668  1.00 0.00 ? 53 PRO A CG   2  
ATOM 1976  C CD   . PRO A 1 53 ? 8.256  16.034  -0.922  1.00 0.00 ? 53 PRO A CD   2  
ATOM 1977  H HA   . PRO A 1 53 ? 8.480  12.966  -1.308  1.00 0.00 ? 53 PRO A HA   2  
ATOM 1978  H HB2  . PRO A 1 53 ? 10.865 14.290  -1.883  1.00 0.00 ? 53 PRO A HB2  2  
ATOM 1979  H HB3  . PRO A 1 53 ? 9.419  14.210  -2.883  1.00 0.00 ? 53 PRO A HB3  2  
ATOM 1980  H HG2  . PRO A 1 53 ? 10.349 16.356  -1.043  1.00 0.00 ? 53 PRO A HG2  2  
ATOM 1981  H HG3  . PRO A 1 53 ? 9.500  16.500  -2.590  1.00 0.00 ? 53 PRO A HG3  2  
ATOM 1982  H HD2  . PRO A 1 53 ? 8.246  16.857  -0.234  1.00 0.00 ? 53 PRO A HD2  2  
ATOM 1983  H HD3  . PRO A 1 53 ? 7.436  16.132  -1.642  1.00 0.00 ? 53 PRO A HD3  2  
ATOM 1984  N N    . PRO A 1 54 ? 10.740 13.713  1.089   1.00 0.00 ? 54 PRO A N    2  
ATOM 1985  C CA   . PRO A 1 54 ? 11.786 13.088  1.907   1.00 0.00 ? 54 PRO A CA   2  
ATOM 1986  C C    . PRO A 1 54 ? 11.356 11.778  2.582   1.00 0.00 ? 54 PRO A C    2  
ATOM 1987  O O    . PRO A 1 54 ? 10.503 11.765  3.471   1.00 0.00 ? 54 PRO A O    2  
ATOM 1988  C CB   . PRO A 1 54 ? 12.106 14.151  2.972   1.00 0.00 ? 54 PRO A CB   2  
ATOM 1989  C CG   . PRO A 1 54 ? 10.983 15.134  2.913   1.00 0.00 ? 54 PRO A CG   2  
ATOM 1990  C CD   . PRO A 1 54 ? 10.544 15.129  1.481   1.00 0.00 ? 54 PRO A CD   2  
ATOM 1991  H HA   . PRO A 1 54 ? 12.675 12.891  1.317   1.00 0.00 ? 54 PRO A HA   2  
ATOM 1992  H HB2  . PRO A 1 54 ? 12.165 13.680  3.939   1.00 0.00 ? 54 PRO A HB2  2  
ATOM 1993  H HB3  . PRO A 1 54 ? 13.044 14.620  2.741   1.00 0.00 ? 54 PRO A HB3  2  
ATOM 1994  H HG2  . PRO A 1 54 ? 10.181 14.813  3.558   1.00 0.00 ? 54 PRO A HG2  2  
ATOM 1995  H HG3  . PRO A 1 54 ? 11.333 16.107  3.193   1.00 0.00 ? 54 PRO A HG3  2  
ATOM 1996  H HD2  . PRO A 1 54 ? 9.502  15.403  1.402   1.00 0.00 ? 54 PRO A HD2  2  
ATOM 1997  H HD3  . PRO A 1 54 ? 11.168 15.776  0.884   1.00 0.00 ? 54 PRO A HD3  2  
ATOM 1998  N N    . VAL A 1 55 ? 11.985 10.703  2.165   1.00 0.00 ? 55 VAL A N    2  
ATOM 1999  C CA   . VAL A 1 55 ? 11.758 9.394   2.744   1.00 0.00 ? 55 VAL A CA   2  
ATOM 2000  C C    . VAL A 1 55 ? 13.062 8.887   3.339   1.00 0.00 ? 55 VAL A C    2  
ATOM 2001  O O    . VAL A 1 55 ? 14.088 8.894   2.661   1.00 0.00 ? 55 VAL A O    2  
ATOM 2002  C CB   . VAL A 1 55 ? 11.218 8.403   1.671   1.00 0.00 ? 55 VAL A CB   2  
ATOM 2003  C CG1  . VAL A 1 55 ? 12.021 8.460   0.385   1.00 0.00 ? 55 VAL A CG1  2  
ATOM 2004  C CG2  . VAL A 1 55 ? 11.223 6.973   2.190   1.00 0.00 ? 55 VAL A CG2  2  
ATOM 2005  H H    . VAL A 1 55 ? 12.637 10.795  1.448   1.00 0.00 ? 55 VAL A H    2  
ATOM 2006  H HA   . VAL A 1 55 ? 11.026 9.490   3.532   1.00 0.00 ? 55 VAL A HA   2  
ATOM 2007  H HB   . VAL A 1 55 ? 10.199 8.675   1.445   1.00 0.00 ? 55 VAL A HB   2  
ATOM 2008  H HG11 . VAL A 1 55 ? 11.580 7.794   -0.341  1.00 0.00 ? 55 VAL A HG11 2  
ATOM 2009  H HG12 . VAL A 1 55 ? 13.051 8.151   0.592   1.00 0.00 ? 55 VAL A HG12 2  
ATOM 2010  H HG13 . VAL A 1 55 ? 12.023 9.473   0.018   1.00 0.00 ? 55 VAL A HG13 2  
ATOM 2011  H HG21 . VAL A 1 55 ? 12.241 6.678   2.415   1.00 0.00 ? 55 VAL A HG21 2  
ATOM 2012  H HG22 . VAL A 1 55 ? 10.812 6.325   1.427   1.00 0.00 ? 55 VAL A HG22 2  
ATOM 2013  H HG23 . VAL A 1 55 ? 10.629 6.906   3.080   1.00 0.00 ? 55 VAL A HG23 2  
ATOM 2014  N N    . GLN A 1 56 ? 13.036 8.478   4.587   1.00 0.00 ? 56 GLN A N    2  
ATOM 2015  C CA   . GLN A 1 56 ? 14.259 8.033   5.238   1.00 0.00 ? 56 GLN A CA   2  
ATOM 2016  C C    . GLN A 1 56 ? 14.420 6.525   5.103   1.00 0.00 ? 56 GLN A C    2  
ATOM 2017  O O    . GLN A 1 56 ? 13.638 5.754   5.667   1.00 0.00 ? 56 GLN A O    2  
ATOM 2018  C CB   . GLN A 1 56 ? 14.306 8.432   6.709   1.00 0.00 ? 56 GLN A CB   2  
ATOM 2019  C CG   . GLN A 1 56 ? 15.606 8.000   7.380   1.00 0.00 ? 56 GLN A CG   2  
ATOM 2020  C CD   . GLN A 1 56 ? 15.706 8.349   8.848   1.00 0.00 ? 56 GLN A CD   2  
ATOM 2021  O OE1  . GLN A 1 56 ? 15.305 7.583   9.708   1.00 0.00 ? 56 GLN A OE1  2  
ATOM 2022  N NE2  . GLN A 1 56 ? 16.267 9.505   9.126   1.00 0.00 ? 56 GLN A NE2  2  
ATOM 2023  H H    . GLN A 1 56 ? 12.176 8.377   5.058   1.00 0.00 ? 56 GLN A H    2  
ATOM 2024  H HA   . GLN A 1 56 ? 15.085 8.495   4.736   1.00 0.00 ? 56 GLN A HA   2  
ATOM 2025  H HB2  . GLN A 1 56 ? 14.220 9.501   6.775   1.00 0.00 ? 56 GLN A HB2  2  
ATOM 2026  H HB3  . GLN A 1 56 ? 13.481 7.976   7.251   1.00 0.00 ? 56 GLN A HB3  2  
ATOM 2027  H HG2  . GLN A 1 56 ? 15.696 6.929   7.290   1.00 0.00 ? 56 GLN A HG2  2  
ATOM 2028  H HG3  . GLN A 1 56 ? 16.427 8.470   6.849   1.00 0.00 ? 56 GLN A HG3  2  
ATOM 2029  H HE21 . GLN A 1 56 ? 16.566 10.080  8.381   1.00 0.00 ? 56 GLN A HE21 2  
ATOM 2030  H HE22 . GLN A 1 56 ? 16.397 9.748   10.087  1.00 0.00 ? 56 GLN A HE22 2  
ATOM 2031  N N    . VAL A 1 57 ? 15.414 6.123   4.364   1.00 0.00 ? 57 VAL A N    2  
ATOM 2032  C CA   . VAL A 1 57 ? 15.651 4.708   4.107   1.00 0.00 ? 57 VAL A CA   2  
ATOM 2033  C C    . VAL A 1 57 ? 17.028 4.306   4.586   1.00 0.00 ? 57 VAL A C    2  
ATOM 2034  O O    . VAL A 1 57 ? 18.018 4.984   4.313   1.00 0.00 ? 57 VAL A O    2  
ATOM 2035  C CB   . VAL A 1 57 ? 15.530 4.379   2.600   1.00 0.00 ? 57 VAL A CB   2  
ATOM 2036  C CG1  . VAL A 1 57 ? 15.854 2.909   2.348   1.00 0.00 ? 57 VAL A CG1  2  
ATOM 2037  C CG2  . VAL A 1 57 ? 14.143 4.709   2.076   1.00 0.00 ? 57 VAL A CG2  2  
ATOM 2038  H H    . VAL A 1 57 ? 16.050 6.788   3.985   1.00 0.00 ? 57 VAL A H    2  
ATOM 2039  H HA   . VAL A 1 57 ? 14.908 4.153   4.647   1.00 0.00 ? 57 VAL A HA   2  
ATOM 2040  H HB   . VAL A 1 57 ? 16.247 4.971   2.060   1.00 0.00 ? 57 VAL A HB   2  
ATOM 2041  H HG11 . VAL A 1 57 ? 16.886 2.708   2.591   1.00 0.00 ? 57 VAL A HG11 2  
ATOM 2042  H HG12 . VAL A 1 57 ? 15.687 2.674   1.308   1.00 0.00 ? 57 VAL A HG12 2  
ATOM 2043  H HG13 . VAL A 1 57 ? 15.207 2.290   2.956   1.00 0.00 ? 57 VAL A HG13 2  
ATOM 2044  H HG21 . VAL A 1 57 ? 13.959 5.773   2.161   1.00 0.00 ? 57 VAL A HG21 2  
ATOM 2045  H HG22 . VAL A 1 57 ? 13.409 4.177   2.668   1.00 0.00 ? 57 VAL A HG22 2  
ATOM 2046  H HG23 . VAL A 1 57 ? 14.063 4.410   1.047   1.00 0.00 ? 57 VAL A HG23 2  
ATOM 2047  N N    . PHE A 1 58 ? 17.081 3.212   5.322   1.00 0.00 ? 58 PHE A N    2  
ATOM 2048  C CA   . PHE A 1 58 ? 18.357 2.668   5.772   1.00 0.00 ? 58 PHE A CA   2  
ATOM 2049  C C    . PHE A 1 58 ? 18.874 1.720   4.720   1.00 0.00 ? 58 PHE A C    2  
ATOM 2050  O O    . PHE A 1 58 ? 18.286 0.681   4.464   1.00 0.00 ? 58 PHE A O    2  
ATOM 2051  C CB   . PHE A 1 58 ? 18.227 1.944   7.115   1.00 0.00 ? 58 PHE A CB   2  
ATOM 2052  C CG   . PHE A 1 58 ? 19.503 1.272   7.564   1.00 0.00 ? 58 PHE A CG   2  
ATOM 2053  C CD1  . PHE A 1 58 ? 20.616 2.006   7.959   1.00 0.00 ? 58 PHE A CD1  2  
ATOM 2054  C CD2  . PHE A 1 58 ? 19.602 -0.115  7.588   1.00 0.00 ? 58 PHE A CD2  2  
ATOM 2055  C CE1  . PHE A 1 58 ? 21.775 1.389   8.356   1.00 0.00 ? 58 PHE A CE1  2  
ATOM 2056  C CE2  . PHE A 1 58 ? 20.761 -0.745  7.983   1.00 0.00 ? 58 PHE A CE2  2  
ATOM 2057  C CZ   . PHE A 1 58 ? 21.848 0.006   8.367   1.00 0.00 ? 58 PHE A CZ   2  
ATOM 2058  H H    . PHE A 1 58 ? 16.253 2.744   5.560   1.00 0.00 ? 58 PHE A H    2  
ATOM 2059  H HA   . PHE A 1 58 ? 19.038 3.495   5.867   1.00 0.00 ? 58 PHE A HA   2  
ATOM 2060  H HB2  . PHE A 1 58 ? 17.951 2.664   7.872   1.00 0.00 ? 58 PHE A HB2  2  
ATOM 2061  H HB3  . PHE A 1 58 ? 17.464 1.184   7.041   1.00 0.00 ? 58 PHE A HB3  2  
ATOM 2062  H HD1  . PHE A 1 58 ? 20.568 3.095   7.948   1.00 0.00 ? 58 PHE A HD1  2  
ATOM 2063  H HD2  . PHE A 1 58 ? 18.761 -0.702  7.278   1.00 0.00 ? 58 PHE A HD2  2  
ATOM 2064  H HE1  . PHE A 1 58 ? 22.626 1.974   8.655   1.00 0.00 ? 58 PHE A HE1  2  
ATOM 2065  H HE2  . PHE A 1 58 ? 20.819 -1.821  7.999   1.00 0.00 ? 58 PHE A HE2  2  
ATOM 2066  H HZ   . PHE A 1 58 ? 22.766 -0.478  8.680   1.00 0.00 ? 58 PHE A HZ   2  
ATOM 2067  N N    . TRP A 1 59 ? 19.979 2.100   4.097   1.00 0.00 ? 59 TRP A N    2  
ATOM 2068  C CA   . TRP A 1 59 ? 20.542 1.304   3.031   1.00 0.00 ? 59 TRP A CA   2  
ATOM 2069  C C    . TRP A 1 59 ? 21.533 0.333   3.609   1.00 0.00 ? 59 TRP A C    2  
ATOM 2070  O O    . TRP A 1 59 ? 22.617 0.713   4.066   1.00 0.00 ? 59 TRP A O    2  
ATOM 2071  C CB   . TRP A 1 59 ? 21.182 2.185   1.952   1.00 0.00 ? 59 TRP A CB   2  
ATOM 2072  C CG   . TRP A 1 59 ? 20.203 3.100   1.292   1.00 0.00 ? 59 TRP A CG   2  
ATOM 2073  C CD1  . TRP A 1 59 ? 19.933 4.387   1.628   1.00 0.00 ? 59 TRP A CD1  2  
ATOM 2074  C CD2  . TRP A 1 59 ? 19.346 2.783   0.185   1.00 0.00 ? 59 TRP A CD2  2  
ATOM 2075  N NE1  . TRP A 1 59 ? 18.955 4.900   0.797   1.00 0.00 ? 59 TRP A NE1  2  
ATOM 2076  C CE2  . TRP A 1 59 ? 18.594 3.940   -0.098  1.00 0.00 ? 59 TRP A CE2  2  
ATOM 2077  C CE3  . TRP A 1 59 ? 19.156 1.650   -0.599  1.00 0.00 ? 59 TRP A CE3  2  
ATOM 2078  C CZ2  . TRP A 1 59 ? 17.651 3.984   -1.130  1.00 0.00 ? 59 TRP A CZ2  2  
ATOM 2079  C CZ3  . TRP A 1 59 ? 18.228 1.685   -1.627  1.00 0.00 ? 59 TRP A CZ3  2  
ATOM 2080  C CH2  . TRP A 1 59 ? 17.484 2.850   -1.875  1.00 0.00 ? 59 TRP A CH2  2  
ATOM 2081  H H    . TRP A 1 59 ? 20.430 2.922   4.411   1.00 0.00 ? 59 TRP A H    2  
ATOM 2082  H HA   . TRP A 1 59 ? 19.727 0.733   2.578   1.00 0.00 ? 59 TRP A HA   2  
ATOM 2083  H HB2  . TRP A 1 59 ? 21.953 2.790   2.391   1.00 0.00 ? 59 TRP A HB2  2  
ATOM 2084  H HB3  . TRP A 1 59 ? 21.627 1.551   1.198   1.00 0.00 ? 59 TRP A HB3  2  
ATOM 2085  H HD1  . TRP A 1 59 ? 20.401 4.910   2.436   1.00 0.00 ? 59 TRP A HD1  2  
ATOM 2086  H HE1  . TRP A 1 59 ? 18.589 5.813   0.836   1.00 0.00 ? 59 TRP A HE1  2  
ATOM 2087  H HE3  . TRP A 1 59 ? 19.718 0.742   -0.413  1.00 0.00 ? 59 TRP A HE3  2  
ATOM 2088  H HZ2  . TRP A 1 59 ? 17.080 4.874   -1.331  1.00 0.00 ? 59 TRP A HZ2  2  
ATOM 2089  H HZ3  . TRP A 1 59 ? 18.067 0.822   -2.237  1.00 0.00 ? 59 TRP A HZ3  2  
ATOM 2090  H HH2  . TRP A 1 59 ? 16.775 2.834   -2.684  1.00 0.00 ? 59 TRP A HH2  2  
ATOM 2091  N N    . GLU A 1 60 ? 21.191 -0.949  3.565   1.00 0.00 ? 60 GLU A N    2  
ATOM 2092  C CA   . GLU A 1 60 ? 21.939 -1.970  4.259   1.00 0.00 ? 60 GLU A CA   2  
ATOM 2093  C C    . GLU A 1 60 ? 23.122 -2.447  3.450   1.00 0.00 ? 60 GLU A C    2  
ATOM 2094  O O    . GLU A 1 60 ? 24.121 -2.918  3.996   1.00 0.00 ? 60 GLU A O    2  
ATOM 2095  C CB   . GLU A 1 60 ? 21.017 -3.113  4.658   1.00 0.00 ? 60 GLU A CB   2  
ATOM 2096  C CG   . GLU A 1 60 ? 20.320 -3.767  3.495   1.00 0.00 ? 60 GLU A CG   2  
ATOM 2097  C CD   . GLU A 1 60 ? 19.310 -4.787  3.945   1.00 0.00 ? 60 GLU A CD   2  
ATOM 2098  O OE1  . GLU A 1 60 ? 19.713 -5.838  4.492   1.00 0.00 ? 60 GLU A OE1  2  
ATOM 2099  O OE2  . GLU A 1 60 ? 18.089 -4.570  3.746   1.00 0.00 ? 60 GLU A OE2  2  
ATOM 2100  H H    . GLU A 1 60 ? 20.438 -1.216  2.991   1.00 0.00 ? 60 GLU A H    2  
ATOM 2101  H HA   . GLU A 1 60 ? 22.314 -1.512  5.156   1.00 0.00 ? 60 GLU A HA   2  
ATOM 2102  H HB2  . GLU A 1 60 ? 21.584 -3.869  5.179   1.00 0.00 ? 60 GLU A HB2  2  
ATOM 2103  H HB3  . GLU A 1 60 ? 20.262 -2.724  5.316   1.00 0.00 ? 60 GLU A HB3  2  
ATOM 2104  H HG2  . GLU A 1 60 ? 19.830 -3.011  2.913   1.00 0.00 ? 60 GLU A HG2  2  
ATOM 2105  H HG3  . GLU A 1 60 ? 21.070 -4.263  2.886   1.00 0.00 ? 60 GLU A HG3  2  
ATOM 2106  N N    . SER A 1 61 ? 23.006 -2.304  2.140   1.00 0.00 ? 61 SER A N    2  
ATOM 2107  C CA   . SER A 1 61 ? 24.079 -2.661  1.237   1.00 0.00 ? 61 SER A CA   2  
ATOM 2108  C C    . SER A 1 61 ? 25.255 -1.687  1.388   1.00 0.00 ? 61 SER A C    2  
ATOM 2109  O O    . SER A 1 61 ? 26.414 -2.073  1.262   1.00 0.00 ? 61 SER A O    2  
ATOM 2110  C CB   . SER A 1 61 ? 23.561 -2.677  -0.196  1.00 0.00 ? 61 SER A CB   2  
ATOM 2111  O OG   . SER A 1 61 ? 22.765 -1.536  -0.462  1.00 0.00 ? 61 SER A OG   2  
ATOM 2112  H H    . SER A 1 61 ? 22.172 -1.978  1.765   1.00 0.00 ? 61 SER A H    2  
ATOM 2113  H HA   . SER A 1 61 ? 24.419 -3.656  1.499   1.00 0.00 ? 61 SER A HA   2  
ATOM 2114  H HB2  . SER A 1 61 ? 24.400 -2.693  -0.886  1.00 0.00 ? 61 SER A HB2  2  
ATOM 2115  H HB3  . SER A 1 61 ? 22.963 -3.561  -0.343  1.00 0.00 ? 61 SER A HB3  2  
ATOM 2116  H HG   . SER A 1 61 ? 23.240 -0.942  -1.077  1.00 0.00 ? 61 SER A HG   2  
ATOM 2117  N N    . THR A 1 62 ? 24.935 -0.434  1.678   1.00 0.00 ? 62 THR A N    2  
ATOM 2118  C CA   . THR A 1 62 ? 25.952 0.560   1.958   1.00 0.00 ? 62 THR A CA   2  
ATOM 2119  C C    . THR A 1 62 ? 26.264 0.586   3.459   1.00 0.00 ? 62 THR A C    2  
ATOM 2120  O O    . THR A 1 62 ? 27.415 0.412   3.884   1.00 0.00 ? 62 THR A O    2  
ATOM 2121  C CB   . THR A 1 62 ? 25.505 1.956   1.504   1.00 0.00 ? 62 THR A CB   2  
ATOM 2122  O OG1  . THR A 1 62 ? 25.022 1.890   0.156   1.00 0.00 ? 62 THR A OG1  2  
ATOM 2123  C CG2  . THR A 1 62 ? 26.646 2.956   1.599   1.00 0.00 ? 62 THR A CG2  2  
ATOM 2124  H H    . THR A 1 62 ? 23.999 -0.175  1.715   1.00 0.00 ? 62 THR A H    2  
ATOM 2125  H HA   . THR A 1 62 ? 26.842 0.291   1.417   1.00 0.00 ? 62 THR A HA   2  
ATOM 2126  H HB   . THR A 1 62 ? 24.699 2.283   2.157   1.00 0.00 ? 62 THR A HB   2  
ATOM 2127  H HG1  . THR A 1 62 ? 25.069 0.990   -0.167  1.00 0.00 ? 62 THR A HG1  2  
ATOM 2128  H HG21 . THR A 1 62 ? 26.293 3.940   1.291   1.00 0.00 ? 62 THR A HG21 2  
ATOM 2129  H HG22 . THR A 1 62 ? 27.446 2.640   0.956   1.00 0.00 ? 62 THR A HG22 2  
ATOM 2130  H HG23 . THR A 1 62 ? 26.990 3.005   2.621   1.00 0.00 ? 62 THR A HG23 2  
ATOM 2131  N N    . GLY A 1 63 ? 25.229 0.760   4.256   1.00 0.00 ? 63 GLY A N    2  
ATOM 2132  C CA   . GLY A 1 63 ? 25.364 0.764   5.699   1.00 0.00 ? 63 GLY A CA   2  
ATOM 2133  C C    . GLY A 1 63 ? 25.122 2.137   6.299   1.00 0.00 ? 63 GLY A C    2  
ATOM 2134  O O    . GLY A 1 63 ? 25.593 2.437   7.399   1.00 0.00 ? 63 GLY A O    2  
ATOM 2135  H H    . GLY A 1 63 ? 24.343 0.926   3.852   1.00 0.00 ? 63 GLY A H    2  
ATOM 2136  H HA2  . GLY A 1 63 ? 24.641 0.071   6.124   1.00 0.00 ? 63 GLY A HA2  2  
ATOM 2137  H HA3  . GLY A 1 63 ? 26.358 0.437   5.955   1.00 0.00 ? 63 GLY A HA3  2  
ATOM 2138  N N    . ARG A 1 64 ? 24.405 2.974   5.576   1.00 0.00 ? 64 ARG A N    2  
ATOM 2139  C CA   . ARG A 1 64 ? 24.088 4.309   6.067   1.00 0.00 ? 64 ARG A CA   2  
ATOM 2140  C C    . ARG A 1 64 ? 22.627 4.642   5.760   1.00 0.00 ? 64 ARG A C    2  
ATOM 2141  O O    . ARG A 1 64 ? 22.074 4.138   4.775   1.00 0.00 ? 64 ARG A O    2  
ATOM 2142  C CB   . ARG A 1 64 ? 25.003 5.362   5.453   1.00 0.00 ? 64 ARG A CB   2  
ATOM 2143  C CG   . ARG A 1 64 ? 24.903 5.459   3.932   1.00 0.00 ? 64 ARG A CG   2  
ATOM 2144  C CD   . ARG A 1 64 ? 25.704 6.637   3.385   1.00 0.00 ? 64 ARG A CD   2  
ATOM 2145  N NE   . ARG A 1 64 ? 25.164 7.928   3.843   1.00 0.00 ? 64 ARG A NE   2  
ATOM 2146  C CZ   . ARG A 1 64 ? 25.887 8.868   4.461   1.00 0.00 ? 64 ARG A CZ   2  
ATOM 2147  N NH1  . ARG A 1 64 ? 27.196 8.684   4.632   1.00 0.00 ? 64 ARG A NH1  2  
ATOM 2148  N NH2  . ARG A 1 64 ? 25.320 9.991   4.859   1.00 0.00 ? 64 ARG A NH2  2  
ATOM 2149  H H    . ARG A 1 64 ? 24.077 2.700   4.694   1.00 0.00 ? 64 ARG A H    2  
ATOM 2150  H HA   . ARG A 1 64 ? 24.210 4.308   7.131   1.00 0.00 ? 64 ARG A HA   2  
ATOM 2151  H HB2  . ARG A 1 64 ? 24.735 6.322   5.873   1.00 0.00 ? 64 ARG A HB2  2  
ATOM 2152  H HB3  . ARG A 1 64 ? 26.026 5.137   5.722   1.00 0.00 ? 64 ARG A HB3  2  
ATOM 2153  H HG2  . ARG A 1 64 ? 25.302 4.548   3.508   1.00 0.00 ? 64 ARG A HG2  2  
ATOM 2154  H HG3  . ARG A 1 64 ? 23.875 5.572   3.646   1.00 0.00 ? 64 ARG A HG3  2  
ATOM 2155  H HD2  . ARG A 1 64 ? 26.736 6.556   3.725   1.00 0.00 ? 64 ARG A HD2  2  
ATOM 2156  H HD3  . ARG A 1 64 ? 25.682 6.593   2.303   1.00 0.00 ? 64 ARG A HD3  2  
ATOM 2157  H HE   . ARG A 1 64 ? 24.210 8.087   3.668   1.00 0.00 ? 64 ARG A HE   2  
ATOM 2158  H HH11 . ARG A 1 64 ? 27.648 7.848   4.293   1.00 0.00 ? 64 ARG A HH11 2  
ATOM 2159  H HH12 . ARG A 1 64 ? 27.739 9.379   5.097   1.00 0.00 ? 64 ARG A HH12 2  
ATOM 2160  H HH21 . ARG A 1 64 ? 24.340 10.151  4.698   1.00 0.00 ? 64 ARG A HH21 2  
ATOM 2161  H HH22 . ARG A 1 64 ? 25.868 10.688  5.332   1.00 0.00 ? 64 ARG A HH22 2  
ATOM 2162  N N    . THR A 1 65 ? 22.012 5.437   6.611   1.00 0.00 ? 65 THR A N    2  
ATOM 2163  C CA   . THR A 1 65 ? 20.660 5.896   6.380   1.00 0.00 ? 65 THR A CA   2  
ATOM 2164  C C    . THR A 1 65 ? 20.678 7.146   5.483   1.00 0.00 ? 65 THR A C    2  
ATOM 2165  O O    . THR A 1 65 ? 21.620 7.940   5.558   1.00 0.00 ? 65 THR A O    2  
ATOM 2166  C CB   . THR A 1 65 ? 19.958 6.220   7.712   1.00 0.00 ? 65 THR A CB   2  
ATOM 2167  O OG1  . THR A 1 65 ? 20.356 5.259   8.711   1.00 0.00 ? 65 THR A OG1  2  
ATOM 2168  C CG2  . THR A 1 65 ? 18.459 6.199   7.558   1.00 0.00 ? 65 THR A CG2  2  
ATOM 2169  H H    . THR A 1 65 ? 22.481 5.729   7.420   1.00 0.00 ? 65 THR A H    2  
ATOM 2170  H HA   . THR A 1 65 ? 20.107 5.107   5.875   1.00 0.00 ? 65 THR A HA   2  
ATOM 2171  H HB   . THR A 1 65 ? 20.259 7.197   8.036   1.00 0.00 ? 65 THR A HB   2  
ATOM 2172  H HG1  . THR A 1 65 ? 19.687 5.243   9.416   1.00 0.00 ? 65 THR A HG1  2  
ATOM 2173  H HG21 . THR A 1 65 ? 18.157 6.991   6.890   1.00 0.00 ? 65 THR A HG21 2  
ATOM 2174  H HG22 . THR A 1 65 ? 17.996 6.347   8.527   1.00 0.00 ? 65 THR A HG22 2  
ATOM 2175  H HG23 . THR A 1 65 ? 18.140 5.248   7.152   1.00 0.00 ? 65 THR A HG23 2  
ATOM 2176  N N    . TYR A 1 66 ? 19.676 7.286   4.636   1.00 0.00 ? 66 TYR A N    2  
ATOM 2177  C CA   . TYR A 1 66 ? 19.618 8.385   3.695   1.00 0.00 ? 66 TYR A CA   2  
ATOM 2178  C C    . TYR A 1 66 ? 18.176 8.779   3.433   1.00 0.00 ? 66 TYR A C    2  
ATOM 2179  O O    . TYR A 1 66 ? 17.276 7.942   3.479   1.00 0.00 ? 66 TYR A O    2  
ATOM 2180  C CB   . TYR A 1 66 ? 20.329 7.976   2.375   1.00 0.00 ? 66 TYR A CB   2  
ATOM 2181  C CG   . TYR A 1 66 ? 20.294 9.036   1.285   1.00 0.00 ? 66 TYR A CG   2  
ATOM 2182  C CD1  . TYR A 1 66 ? 20.801 10.308  1.501   1.00 0.00 ? 66 TYR A CD1  2  
ATOM 2183  C CD2  . TYR A 1 66 ? 19.766 8.745   0.033   1.00 0.00 ? 66 TYR A CD2  2  
ATOM 2184  C CE1  . TYR A 1 66 ? 20.780 11.266  0.495   1.00 0.00 ? 66 TYR A CE1  2  
ATOM 2185  C CE2  . TYR A 1 66 ? 19.731 9.692   -0.974  1.00 0.00 ? 66 TYR A CE2  2  
ATOM 2186  C CZ   . TYR A 1 66 ? 20.243 10.953  -0.731  1.00 0.00 ? 66 TYR A CZ   2  
ATOM 2187  O OH   . TYR A 1 66 ? 20.210 11.895  -1.729  1.00 0.00 ? 66 TYR A OH   2  
ATOM 2188  H H    . TYR A 1 66 ? 18.935 6.636   4.676   1.00 0.00 ? 66 TYR A H    2  
ATOM 2189  H HA   . TYR A 1 66 ? 20.140 9.217   4.133   1.00 0.00 ? 66 TYR A HA   2  
ATOM 2190  H HB2  . TYR A 1 66 ? 21.367 7.763   2.586   1.00 0.00 ? 66 TYR A HB2  2  
ATOM 2191  H HB3  . TYR A 1 66 ? 19.856 7.087   1.987   1.00 0.00 ? 66 TYR A HB3  2  
ATOM 2192  H HD1  . TYR A 1 66 ? 21.211 10.538  2.473   1.00 0.00 ? 66 TYR A HD1  2  
ATOM 2193  H HD2  . TYR A 1 66 ? 19.370 7.754   -0.149  1.00 0.00 ? 66 TYR A HD2  2  
ATOM 2194  H HE1  . TYR A 1 66 ? 21.188 12.245  0.702   1.00 0.00 ? 66 TYR A HE1  2  
ATOM 2195  H HE2  . TYR A 1 66 ? 19.317 9.455   -1.929  1.00 0.00 ? 66 TYR A HE2  2  
ATOM 2196  H HH   . TYR A 1 66 ? 21.063 12.390  -1.746  1.00 0.00 ? 66 TYR A HH   2  
ATOM 2197  N N    . TRP A 1 67 ? 17.954 10.059  3.171   1.00 0.00 ? 67 TRP A N    2  
ATOM 2198  C CA   . TRP A 1 67 ? 16.646 10.537  2.785   1.00 0.00 ? 67 TRP A CA   2  
ATOM 2199  C C    . TRP A 1 67 ? 16.578 10.608  1.279   1.00 0.00 ? 67 TRP A C    2  
ATOM 2200  O O    . TRP A 1 67 ? 17.313 11.361  0.659   1.00 0.00 ? 67 TRP A O    2  
ATOM 2201  C CB   . TRP A 1 67 ? 16.358 11.923  3.387   1.00 0.00 ? 67 TRP A CB   2  
ATOM 2202  C CG   . TRP A 1 67 ? 16.331 11.955  4.882   1.00 0.00 ? 67 TRP A CG   2  
ATOM 2203  C CD1  . TRP A 1 67 ? 15.221 11.897  5.666   1.00 0.00 ? 67 TRP A CD1  2  
ATOM 2204  C CD2  . TRP A 1 67 ? 17.458 12.065  5.763   1.00 0.00 ? 67 TRP A CD2  2  
ATOM 2205  N NE1  . TRP A 1 67 ? 15.582 11.980  6.992   1.00 0.00 ? 67 TRP A NE1  2  
ATOM 2206  C CE2  . TRP A 1 67 ? 16.951 12.087  7.074   1.00 0.00 ? 67 TRP A CE2  2  
ATOM 2207  C CE3  . TRP A 1 67 ? 18.838 12.159  5.560   1.00 0.00 ? 67 TRP A CE3  2  
ATOM 2208  C CZ2  . TRP A 1 67 ? 17.791 12.184  8.189   1.00 0.00 ? 67 TRP A CZ2  2  
ATOM 2209  C CZ3  . TRP A 1 67 ? 19.663 12.261  6.659   1.00 0.00 ? 67 TRP A CZ3  2  
ATOM 2210  C CH2  . TRP A 1 67 ? 19.134 12.264  7.962   1.00 0.00 ? 67 TRP A CH2  2  
ATOM 2211  H H    . TRP A 1 67 ? 18.705 10.698  3.218   1.00 0.00 ? 67 TRP A H    2  
ATOM 2212  H HA   . TRP A 1 67 ? 15.894 9.830   3.147   1.00 0.00 ? 67 TRP A HA   2  
ATOM 2213  H HB2  . TRP A 1 67 ? 17.130 12.601  3.056   1.00 0.00 ? 67 TRP A HB2  2  
ATOM 2214  H HB3  . TRP A 1 67 ? 15.391 12.269  3.025   1.00 0.00 ? 67 TRP A HB3  2  
ATOM 2215  H HD1  . TRP A 1 67 ? 14.209 11.816  5.300   1.00 0.00 ? 67 TRP A HD1  2  
ATOM 2216  H HE1  . TRP A 1 67 ? 14.956 11.978  7.745   1.00 0.00 ? 67 TRP A HE1  2  
ATOM 2217  H HE3  . TRP A 1 67 ? 19.262 12.164  4.564   1.00 0.00 ? 67 TRP A HE3  2  
ATOM 2218  H HZ2  . TRP A 1 67 ? 17.398 12.189  9.204   1.00 0.00 ? 67 TRP A HZ2  2  
ATOM 2219  H HZ3  . TRP A 1 67 ? 20.735 12.316  6.526   1.00 0.00 ? 67 TRP A HZ3  2  
ATOM 2220  H HH2  . TRP A 1 67 ? 19.820 12.340  8.788   1.00 0.00 ? 67 TRP A HH2  2  
ATOM 2221  N N    . VAL A 1 68 ? 15.707 9.808   0.700   1.00 0.00 ? 68 VAL A N    2  
ATOM 2222  C CA   . VAL A 1 68 ? 15.606 9.702   -0.744  1.00 0.00 ? 68 VAL A CA   2  
ATOM 2223  C C    . VAL A 1 68 ? 14.299 10.352  -1.194  1.00 0.00 ? 68 VAL A C    2  
ATOM 2224  O O    . VAL A 1 68 ? 13.564 10.910  -0.370  1.00 0.00 ? 68 VAL A O    2  
ATOM 2225  C CB   . VAL A 1 68 ? 15.641 8.218   -1.193  1.00 0.00 ? 68 VAL A CB   2  
ATOM 2226  C CG1  . VAL A 1 68 ? 16.294 8.071   -2.551  1.00 0.00 ? 68 VAL A CG1  2  
ATOM 2227  C CG2  . VAL A 1 68 ? 16.334 7.356   -0.160  1.00 0.00 ? 68 VAL A CG2  2  
ATOM 2228  H H    . VAL A 1 68 ? 15.109 9.272   1.265   1.00 0.00 ? 68 VAL A H    2  
ATOM 2229  H HA   . VAL A 1 68 ? 16.444 10.227  -1.189  1.00 0.00 ? 68 VAL A HA   2  
ATOM 2230  H HB   . VAL A 1 68 ? 14.622 7.865   -1.282  1.00 0.00 ? 68 VAL A HB   2  
ATOM 2231  H HG11 . VAL A 1 68 ? 16.415 7.027   -2.771  1.00 0.00 ? 68 VAL A HG11 2  
ATOM 2232  H HG12 . VAL A 1 68 ? 17.264 8.552   -2.531  1.00 0.00 ? 68 VAL A HG12 2  
ATOM 2233  H HG13 . VAL A 1 68 ? 15.691 8.540   -3.311  1.00 0.00 ? 68 VAL A HG13 2  
ATOM 2234  H HG21 . VAL A 1 68 ? 15.801 7.412   0.773   1.00 0.00 ? 68 VAL A HG21 2  
ATOM 2235  H HG22 . VAL A 1 68 ? 17.348 7.721   -0.017  1.00 0.00 ? 68 VAL A HG22 2  
ATOM 2236  H HG23 . VAL A 1 68 ? 16.365 6.332   -0.505  1.00 0.00 ? 68 VAL A HG23 2  
ATOM 2237  N N    . HIS A 1 69 ? 14.013 10.309  -2.492  1.00 0.00 ? 69 HIS A N    2  
ATOM 2238  C CA   . HIS A 1 69 ? 12.714 10.726  -3.005  1.00 0.00 ? 69 HIS A CA   2  
ATOM 2239  C C    . HIS A 1 69 ? 11.838 9.503   -3.263  1.00 0.00 ? 69 HIS A C    2  
ATOM 2240  O O    . HIS A 1 69 ? 12.314 8.495   -3.788  1.00 0.00 ? 69 HIS A O    2  
ATOM 2241  C CB   . HIS A 1 69 ? 12.884 11.523  -4.280  1.00 0.00 ? 69 HIS A CB   2  
ATOM 2242  C CG   . HIS A 1 69 ? 13.581 12.847  -4.088  1.00 0.00 ? 69 HIS A CG   2  
ATOM 2243  N ND1  . HIS A 1 69 ? 12.938 14.056  -4.124  1.00 0.00 ? 69 HIS A ND1  2  
ATOM 2244  C CD2  . HIS A 1 69 ? 14.889 13.120  -3.876  1.00 0.00 ? 69 HIS A CD2  2  
ATOM 2245  C CE1  . HIS A 1 69 ? 13.807 15.023  -3.927  1.00 0.00 ? 69 HIS A CE1  2  
ATOM 2246  N NE2  . HIS A 1 69 ? 14.998 14.496  -3.776  1.00 0.00 ? 69 HIS A NE2  2  
ATOM 2247  H H    . HIS A 1 69 ? 14.699 10.047  -3.118  1.00 0.00 ? 69 HIS A H    2  
ATOM 2248  H HA   . HIS A 1 69 ? 12.239 11.351  -2.257  1.00 0.00 ? 69 HIS A HA   2  
ATOM 2249  H HB2  . HIS A 1 69 ? 13.449 10.945  -4.986  1.00 0.00 ? 69 HIS A HB2  2  
ATOM 2250  H HB3  . HIS A 1 69 ? 11.911 11.742  -4.701  1.00 0.00 ? 69 HIS A HB3  2  
ATOM 2251  H HD1  . HIS A 1 69 ? 11.977 14.193  -4.287  1.00 0.00 ? 69 HIS A HD1  2  
ATOM 2252  H HD2  . HIS A 1 69 ? 15.696 12.405  -3.795  1.00 0.00 ? 69 HIS A HD2  2  
ATOM 2253  H HE1  . HIS A 1 69 ? 13.575 16.073  -3.915  1.00 0.00 ? 69 HIS A HE1  2  
ATOM 2254  H HE2  . HIS A 1 69 ? 15.850 14.998  -3.770  1.00 0.00 ? 69 HIS A HE2  2  
ATOM 2255  N N    . TRP A 1 70 ? 10.563 9.581   -2.863  1.00 0.00 ? 70 TRP A N    2  
ATOM 2256  C CA   . TRP A 1 70 ? 9.638  8.468   -3.009  1.00 0.00 ? 70 TRP A CA   2  
ATOM 2257  C C    . TRP A 1 70 ? 9.648  7.871   -4.411  1.00 0.00 ? 70 TRP A C    2  
ATOM 2258  O O    . TRP A 1 70 ? 9.682  6.651   -4.567  1.00 0.00 ? 70 TRP A O    2  
ATOM 2259  C CB   . TRP A 1 70 ? 8.198  8.893   -2.679  1.00 0.00 ? 70 TRP A CB   2  
ATOM 2260  C CG   . TRP A 1 70 ? 7.920  9.085   -1.230  1.00 0.00 ? 70 TRP A CG   2  
ATOM 2261  C CD1  . TRP A 1 70 ? 7.765  10.256  -0.560  1.00 0.00 ? 70 TRP A CD1  2  
ATOM 2262  C CD2  . TRP A 1 70 ? 7.740  8.042   -0.249  1.00 0.00 ? 70 TRP A CD2  2  
ATOM 2263  N NE1  . TRP A 1 70 ? 7.508  10.024  0.758   1.00 0.00 ? 70 TRP A NE1  2  
ATOM 2264  C CE2  . TRP A 1 70 ? 7.491  8.678   0.976   1.00 0.00 ? 70 TRP A CE2  2  
ATOM 2265  C CE3  . TRP A 1 70 ? 7.769  6.662   -0.298  1.00 0.00 ? 70 TRP A CE3  2  
ATOM 2266  C CZ2  . TRP A 1 70 ? 7.256  7.970   2.144   1.00 0.00 ? 70 TRP A CZ2  2  
ATOM 2267  C CZ3  . TRP A 1 70 ? 7.540  5.954   0.872   1.00 0.00 ? 70 TRP A CZ3  2  
ATOM 2268  C CH2  . TRP A 1 70 ? 7.271  6.621   2.084   1.00 0.00 ? 70 TRP A CH2  2  
ATOM 2269  H H    . TRP A 1 70 ? 10.260 10.399  -2.410  1.00 0.00 ? 70 TRP A H    2  
ATOM 2270  H HA   . TRP A 1 70 ? 9.928  7.708   -2.308  1.00 0.00 ? 70 TRP A HA   2  
ATOM 2271  H HB2  . TRP A 1 70 ? 7.993  9.849   -3.163  1.00 0.00 ? 70 TRP A HB2  2  
ATOM 2272  H HB3  . TRP A 1 70 ? 7.506  8.141   -3.041  1.00 0.00 ? 70 TRP A HB3  2  
ATOM 2273  H HD1  . TRP A 1 70 ? 7.857  11.242  -1.034  1.00 0.00 ? 70 TRP A HD1  2  
ATOM 2274  H HE1  . TRP A 1 70 ? 7.351  10.724  1.448   1.00 0.00 ? 70 TRP A HE1  2  
ATOM 2275  H HE3  . TRP A 1 70 ? 7.966  6.126   -1.209  1.00 0.00 ? 70 TRP A HE3  2  
ATOM 2276  H HZ2  . TRP A 1 70 ? 7.061  8.485   3.077   1.00 0.00 ? 70 TRP A HZ2  2  
ATOM 2277  H HZ3  . TRP A 1 70 ? 7.546  4.867   0.853   1.00 0.00 ? 70 TRP A HZ3  2  
ATOM 2278  H HH2  . TRP A 1 70 ? 7.102  6.029   2.973   1.00 0.00 ? 70 TRP A HH2  2  
ATOM 2279  N N    . HIS A 1 71 ? 9.634  8.719   -5.430  1.00 0.00 ? 71 HIS A N    2  
ATOM 2280  C CA   . HIS A 1 71 ? 9.468  8.256   -6.821  1.00 0.00 ? 71 HIS A CA   2  
ATOM 2281  C C    . HIS A 1 71 ? 10.662 7.446   -7.329  1.00 0.00 ? 71 HIS A C    2  
ATOM 2282  O O    . HIS A 1 71 ? 10.615 6.946   -8.433  1.00 0.00 ? 71 HIS A O    2  
ATOM 2283  C CB   . HIS A 1 71 ? 9.167  9.422   -7.778  1.00 0.00 ? 71 HIS A CB   2  
ATOM 2284  C CG   . HIS A 1 71 ? 10.231 10.486  -7.868  1.00 0.00 ? 71 HIS A CG   2  
ATOM 2285  N ND1  . HIS A 1 71 ? 9.937  11.822  -7.932  1.00 0.00 ? 71 HIS A ND1  2  
ATOM 2286  C CD2  . HIS A 1 71 ? 11.582 10.404  -7.941  1.00 0.00 ? 71 HIS A CD2  2  
ATOM 2287  C CE1  . HIS A 1 71 ? 11.055 12.522  -8.038  1.00 0.00 ? 71 HIS A CE1  2  
ATOM 2288  N NE2  . HIS A 1 71 ? 12.070 11.694  -8.051  1.00 0.00 ? 71 HIS A NE2  2  
ATOM 2289  H H    . HIS A 1 71 ? 9.715  9.682   -5.245  1.00 0.00 ? 71 HIS A H    2  
ATOM 2290  H HA   . HIS A 1 71 ? 8.618  7.599   -6.816  1.00 0.00 ? 71 HIS A HA   2  
ATOM 2291  H HB2  . HIS A 1 71 ? 9.038  9.024   -8.779  1.00 0.00 ? 71 HIS A HB2  2  
ATOM 2292  H HB3  . HIS A 1 71 ? 8.241  9.910   -7.466  1.00 0.00 ? 71 HIS A HB3  2  
ATOM 2293  H HD1  . HIS A 1 71 ? 9.027  12.223  -7.953  1.00 0.00 ? 71 HIS A HD1  2  
ATOM 2294  H HD2  . HIS A 1 71 ? 12.168 9.494   -7.947  1.00 0.00 ? 71 HIS A HD2  2  
ATOM 2295  H HE1  . HIS A 1 71 ? 11.119 13.597  -8.107  1.00 0.00 ? 71 HIS A HE1  2  
ATOM 2296  H HE2  . HIS A 1 71 ? 12.971 11.911  -8.406  1.00 0.00 ? 71 HIS A HE2  2  
ATOM 2297  N N    . MET A 1 72 ? 11.724 7.320   -6.544  1.00 0.00 ? 72 MET A N    2  
ATOM 2298  C CA   . MET A 1 72 ? 12.898 6.593   -6.997  1.00 0.00 ? 72 MET A CA   2  
ATOM 2299  C C    . MET A 1 72 ? 13.170 5.379   -6.123  1.00 0.00 ? 72 MET A C    2  
ATOM 2300  O O    . MET A 1 72 ? 14.287 4.856   -6.089  1.00 0.00 ? 72 MET A O    2  
ATOM 2301  C CB   . MET A 1 72 ? 14.110 7.541   -7.040  1.00 0.00 ? 72 MET A CB   2  
ATOM 2302  C CG   . MET A 1 72 ? 14.546 8.008   -5.660  1.00 0.00 ? 72 MET A CG   2  
ATOM 2303  S SD   . MET A 1 72 ? 15.486 9.551   -5.732  1.00 0.00 ? 72 MET A SD   2  
ATOM 2304  C CE   . MET A 1 72 ? 16.808 9.099   -6.845  1.00 0.00 ? 72 MET A CE   2  
ATOM 2305  H H    . MET A 1 72 ? 11.729 7.715   -5.648  1.00 0.00 ? 72 MET A H    2  
ATOM 2306  H HA   . MET A 1 72 ? 12.709 6.249   -8.010  1.00 0.00 ? 72 MET A HA   2  
ATOM 2307  H HB2  . MET A 1 72 ? 14.946 7.037   -7.505  1.00 0.00 ? 72 MET A HB2  2  
ATOM 2308  H HB3  . MET A 1 72 ? 13.851 8.404   -7.630  1.00 0.00 ? 72 MET A HB3  2  
ATOM 2309  H HG2  . MET A 1 72 ? 13.679 8.158   -5.063  1.00 0.00 ? 72 MET A HG2  2  
ATOM 2310  H HG3  . MET A 1 72 ? 15.172 7.250   -5.217  1.00 0.00 ? 72 MET A HG3  2  
ATOM 2311  H HE1  . MET A 1 72 ? 16.402 8.862   -7.827  1.00 0.00 ? 72 MET A HE1  2  
ATOM 2312  H HE2  . MET A 1 72 ? 17.333 8.243   -6.451  1.00 0.00 ? 72 MET A HE2  2  
ATOM 2313  H HE3  . MET A 1 72 ? 17.498 9.927   -6.929  1.00 0.00 ? 72 MET A HE3  2  
ATOM 2314  N N    . LEU A 1 73 ? 12.148 4.909   -5.412  1.00 0.00 ? 73 LEU A N    2  
ATOM 2315  C CA   . LEU A 1 73 ? 12.286 3.727   -4.564  1.00 0.00 ? 73 LEU A CA   2  
ATOM 2316  C C    . LEU A 1 73 ? 11.548 2.552   -5.161  1.00 0.00 ? 73 LEU A C    2  
ATOM 2317  O O    . LEU A 1 73 ? 10.420 2.701   -5.656  1.00 0.00 ? 73 LEU A O    2  
ATOM 2318  C CB   . LEU A 1 73 ? 11.769 3.991   -3.168  1.00 0.00 ? 73 LEU A CB   2  
ATOM 2319  C CG   . LEU A 1 73 ? 12.472 5.096   -2.382  1.00 0.00 ? 73 LEU A CG   2  
ATOM 2320  C CD1  . LEU A 1 73 ? 11.804 5.281   -1.040  1.00 0.00 ? 73 LEU A CD1  2  
ATOM 2321  C CD2  . LEU A 1 73 ? 13.948 4.781   -2.218  1.00 0.00 ? 73 LEU A CD2  2  
ATOM 2322  H H    . LEU A 1 73 ? 11.277 5.351   -5.481  1.00 0.00 ? 73 LEU A H    2  
ATOM 2323  H HA   . LEU A 1 73 ? 13.345 3.497   -4.512  1.00 0.00 ? 73 LEU A HA   2  
ATOM 2324  H HB2  . LEU A 1 73 ? 10.720 4.263   -3.256  1.00 0.00 ? 73 LEU A HB2  2  
ATOM 2325  H HB3  . LEU A 1 73 ? 11.844 3.084   -2.595  1.00 0.00 ? 73 LEU A HB3  2  
ATOM 2326  H HG   . LEU A 1 73 ? 12.388 6.036   -2.934  1.00 0.00 ? 73 LEU A HG   2  
ATOM 2327  H HD11 . LEU A 1 73 ? 12.296 6.077   -0.500  1.00 0.00 ? 73 LEU A HD11 2  
ATOM 2328  H HD12 . LEU A 1 73 ? 11.885 4.365   -0.472  1.00 0.00 ? 73 LEU A HD12 2  
ATOM 2329  H HD13 . LEU A 1 73 ? 10.766 5.519   -1.188  1.00 0.00 ? 73 LEU A HD13 2  
ATOM 2330  H HD21 . LEU A 1 73 ? 14.063 3.890   -1.627  1.00 0.00 ? 73 LEU A HD21 2  
ATOM 2331  H HD22 . LEU A 1 73 ? 14.434 5.609   -1.724  1.00 0.00 ? 73 LEU A HD22 2  
ATOM 2332  H HD23 . LEU A 1 73 ? 14.394 4.634   -3.192  1.00 0.00 ? 73 LEU A HD23 2  
ATOM 2333  N N    . GLU A 1 74 ? 12.180 1.387   -5.143  1.00 0.00 ? 74 GLU A N    2  
ATOM 2334  C CA   . GLU A 1 74 ? 11.560 0.162   -5.631  1.00 0.00 ? 74 GLU A CA   2  
ATOM 2335  C C    . GLU A 1 74 ? 11.186 -0.741  -4.455  1.00 0.00 ? 74 GLU A C    2  
ATOM 2336  O O    . GLU A 1 74 ? 11.990 -0.934  -3.535  1.00 0.00 ? 74 GLU A O    2  
ATOM 2337  C CB   . GLU A 1 74 ? 12.513 -0.556  -6.584  1.00 0.00 ? 74 GLU A CB   2  
ATOM 2338  C CG   . GLU A 1 74 ? 11.859 -0.968  -7.888  1.00 0.00 ? 74 GLU A CG   2  
ATOM 2339  C CD   . GLU A 1 74 ? 10.814 -2.036  -7.694  1.00 0.00 ? 74 GLU A CD   2  
ATOM 2340  O OE1  . GLU A 1 74 ? 9.667  -1.691  -7.359  1.00 0.00 ? 74 GLU A OE1  2  
ATOM 2341  O OE2  . GLU A 1 74 ? 11.149 -3.234  -7.884  1.00 0.00 ? 74 GLU A OE2  2  
ATOM 2342  H H    . GLU A 1 74 ? 13.108 1.358   -4.800  1.00 0.00 ? 74 GLU A H    2  
ATOM 2343  H HA   . GLU A 1 74 ? 10.668 0.425   -6.168  1.00 0.00 ? 74 GLU A HA   2  
ATOM 2344  H HB2  . GLU A 1 74 ? 13.340 0.103   -6.814  1.00 0.00 ? 74 GLU A HB2  2  
ATOM 2345  H HB3  . GLU A 1 74 ? 12.893 -1.454  -6.090  1.00 0.00 ? 74 GLU A HB3  2  
ATOM 2346  H HG2  . GLU A 1 74 ? 11.405 -0.096  -8.341  1.00 0.00 ? 74 GLU A HG2  2  
ATOM 2347  H HG3  . GLU A 1 74 ? 12.622 -1.344  -8.547  1.00 0.00 ? 74 GLU A HG3  2  
ATOM 2348  N N    . ILE A 1 75 ? 9.980  -1.283  -4.489  1.00 0.00 ? 75 ILE A N    2  
ATOM 2349  C CA   . ILE A 1 75 ? 9.459  -2.089  -3.377  1.00 0.00 ? 75 ILE A CA   2  
ATOM 2350  C C    . ILE A 1 75 ? 9.679  -3.585  -3.606  1.00 0.00 ? 75 ILE A C    2  
ATOM 2351  O O    . ILE A 1 75 ? 9.453  -4.096  -4.704  1.00 0.00 ? 75 ILE A O    2  
ATOM 2352  C CB   . ILE A 1 75 ? 7.950  -1.830  -3.152  1.00 0.00 ? 75 ILE A CB   2  
ATOM 2353  C CG1  . ILE A 1 75 ? 7.723  -0.421  -2.647  1.00 0.00 ? 75 ILE A CG1  2  
ATOM 2354  C CG2  . ILE A 1 75 ? 7.355  -2.862  -2.213  1.00 0.00 ? 75 ILE A CG2  2  
ATOM 2355  C CD1  . ILE A 1 75 ? 6.287  -0.155  -2.232  1.00 0.00 ? 75 ILE A CD1  2  
ATOM 2356  H H    . ILE A 1 75 ? 9.418  -1.145  -5.286  1.00 0.00 ? 75 ILE A H    2  
ATOM 2357  H HA   . ILE A 1 75 ? 9.985  -1.788  -2.469  1.00 0.00 ? 75 ILE A HA   2  
ATOM 2358  H HB   . ILE A 1 75 ? 7.449  -1.948  -4.112  1.00 0.00 ? 75 ILE A HB   2  
ATOM 2359  H HG12 . ILE A 1 75 ? 8.360  -0.234  -1.786  1.00 0.00 ? 75 ILE A HG12 2  
ATOM 2360  H HG13 . ILE A 1 75 ? 7.965  0.289   -3.429  1.00 0.00 ? 75 ILE A HG13 2  
ATOM 2361  H HG21 . ILE A 1 75 ? 6.297  -2.675  -2.093  1.00 0.00 ? 75 ILE A HG21 2  
ATOM 2362  H HG22 . ILE A 1 75 ? 7.839  -2.786  -1.255  1.00 0.00 ? 75 ILE A HG22 2  
ATOM 2363  H HG23 . ILE A 1 75 ? 7.503  -3.855  -2.620  1.00 0.00 ? 75 ILE A HG23 2  
ATOM 2364  H HD11 . ILE A 1 75 ? 5.991  -0.879  -1.486  1.00 0.00 ? 75 ILE A HD11 2  
ATOM 2365  H HD12 . ILE A 1 75 ? 5.642  -0.245  -3.091  1.00 0.00 ? 75 ILE A HD12 2  
ATOM 2366  H HD13 . ILE A 1 75 ? 6.203  0.841   -1.823  1.00 0.00 ? 75 ILE A HD13 2  
ATOM 2367  N N    . LEU A 1 76 ? 10.135 -4.264  -2.554  1.00 0.00 ? 76 LEU A N    2  
ATOM 2368  C CA   . LEU A 1 76 ? 10.224 -5.726  -2.565  1.00 0.00 ? 76 LEU A CA   2  
ATOM 2369  C C    . LEU A 1 76 ? 9.051  -6.289  -1.770  1.00 0.00 ? 76 LEU A C    2  
ATOM 2370  O O    . LEU A 1 76 ? 8.145  -6.915  -2.315  1.00 0.00 ? 76 LEU A O    2  
ATOM 2371  C CB   . LEU A 1 76 ? 11.547 -6.205  -1.960  1.00 0.00 ? 76 LEU A CB   2  
ATOM 2372  C CG   . LEU A 1 76 ? 12.785 -6.038  -2.843  1.00 0.00 ? 76 LEU A CG   2  
ATOM 2373  C CD1  . LEU A 1 76 ? 13.118 -4.584  -3.114  1.00 0.00 ? 76 LEU A CD1  2  
ATOM 2374  C CD2  . LEU A 1 76 ? 13.971 -6.742  -2.195  1.00 0.00 ? 76 LEU A CD2  2  
ATOM 2375  H H    . LEU A 1 76 ? 10.399 -3.773  -1.746  1.00 0.00 ? 76 LEU A H    2  
ATOM 2376  H HA   . LEU A 1 76 ? 10.138 -6.050  -3.586  1.00 0.00 ? 76 LEU A HA   2  
ATOM 2377  H HB2  . LEU A 1 76 ? 11.707 -5.649  -1.035  1.00 0.00 ? 76 LEU A HB2  2  
ATOM 2378  H HB3  . LEU A 1 76 ? 11.442 -7.248  -1.707  1.00 0.00 ? 76 LEU A HB3  2  
ATOM 2379  H HG   . LEU A 1 76 ? 12.597 -6.529  -3.796  1.00 0.00 ? 76 LEU A HG   2  
ATOM 2380  H HD11 . LEU A 1 76 ? 13.959 -4.512  -3.765  1.00 0.00 ? 76 LEU A HD11 2  
ATOM 2381  H HD12 . LEU A 1 76 ? 13.361 -4.111  -2.165  1.00 0.00 ? 76 LEU A HD12 2  
ATOM 2382  H HD13 . LEU A 1 76 ? 12.256 -4.093  -3.547  1.00 0.00 ? 76 LEU A HD13 2  
ATOM 2383  H HD21 . LEU A 1 76 ? 14.837 -6.633  -2.828  1.00 0.00 ? 76 LEU A HD21 2  
ATOM 2384  H HD22 . LEU A 1 76 ? 13.754 -7.791  -2.060  1.00 0.00 ? 76 LEU A HD22 2  
ATOM 2385  H HD23 . LEU A 1 76 ? 14.174 -6.272  -1.243  1.00 0.00 ? 76 LEU A HD23 2  
ATOM 2386  N N    . GLY A 1 77 ? 9.081  -6.026  -0.465  1.00 0.00 ? 77 GLY A N    2  
ATOM 2387  C CA   . GLY A 1 77 ? 8.014  -6.466  0.410   1.00 0.00 ? 77 GLY A CA   2  
ATOM 2388  C C    . GLY A 1 77 ? 7.882  -7.961  0.459   1.00 0.00 ? 77 GLY A C    2  
ATOM 2389  O O    . GLY A 1 77 ? 8.842  -8.688  0.212   1.00 0.00 ? 77 GLY A O    2  
ATOM 2390  H H    . GLY A 1 77 ? 9.842  -5.531  -0.096  1.00 0.00 ? 77 GLY A H    2  
ATOM 2391  H HA2  . GLY A 1 77 ? 8.213  -6.100  1.418   1.00 0.00 ? 77 GLY A HA2  2  
ATOM 2392  H HA3  . GLY A 1 77 ? 7.089  -6.034  0.056   1.00 0.00 ? 77 GLY A HA3  2  
ATOM 2393  N N    . PHE A 1 78 ? 6.690  -8.427  0.806   1.00 0.00 ? 78 PHE A N    2  
ATOM 2394  C CA   . PHE A 1 78 ? 6.400  -9.845  0.807   1.00 0.00 ? 78 PHE A CA   2  
ATOM 2395  C C    . PHE A 1 78 ? 5.079  -10.077 0.092   1.00 0.00 ? 78 PHE A C    2  
ATOM 2396  O O    . PHE A 1 78 ? 4.460  -11.130 0.223   1.00 0.00 ? 78 PHE A O    2  
ATOM 2397  C CB   . PHE A 1 78 ? 6.339  -10.389 2.244   1.00 0.00 ? 78 PHE A CB   2  
ATOM 2398  C CG   . PHE A 1 78 ? 7.636  -10.192 2.981   1.00 0.00 ? 78 PHE A CG   2  
ATOM 2399  C CD1  . PHE A 1 78 ? 8.704  -11.051 2.783   1.00 0.00 ? 78 PHE A CD1  2  
ATOM 2400  C CD2  . PHE A 1 78 ? 7.779  -9.144  3.870   1.00 0.00 ? 78 PHE A CD2  2  
ATOM 2401  C CE1  . PHE A 1 78 ? 9.890  -10.864 3.460   1.00 0.00 ? 78 PHE A CE1  2  
ATOM 2402  C CE2  . PHE A 1 78 ? 8.970  -8.948  4.546   1.00 0.00 ? 78 PHE A CE2  2  
ATOM 2403  C CZ   . PHE A 1 78 ? 10.034 -9.813  4.340   1.00 0.00 ? 78 PHE A CZ   2  
ATOM 2404  H H    . PHE A 1 78 ? 5.987  -7.788  1.089   1.00 0.00 ? 78 PHE A H    2  
ATOM 2405  H HA   . PHE A 1 78 ? 7.172  -10.344 0.262   1.00 0.00 ? 78 PHE A HA   2  
ATOM 2406  H HB2  . PHE A 1 78 ? 5.567  -9.879  2.785   1.00 0.00 ? 78 PHE A HB2  2  
ATOM 2407  H HB3  . PHE A 1 78 ? 6.129  -11.449 2.206   1.00 0.00 ? 78 PHE A HB3  2  
ATOM 2408  H HD1  . PHE A 1 78 ? 8.598  -11.872 2.085   1.00 0.00 ? 78 PHE A HD1  2  
ATOM 2409  H HD2  . PHE A 1 78 ? 6.949  -8.471  4.038   1.00 0.00 ? 78 PHE A HD2  2  
ATOM 2410  H HE1  . PHE A 1 78 ? 10.706 -11.541 3.293   1.00 0.00 ? 78 PHE A HE1  2  
ATOM 2411  H HE2  . PHE A 1 78 ? 9.064  -8.121  5.246   1.00 0.00 ? 78 PHE A HE2  2  
ATOM 2412  H HZ   . PHE A 1 78 ? 10.962 -9.660  4.865   1.00 0.00 ? 78 PHE A HZ   2  
ATOM 2413  N N    . GLU A 1 79 ? 4.667  -9.082  -0.692  1.00 0.00 ? 79 GLU A N    2  
ATOM 2414  C CA   . GLU A 1 79 ? 3.500  -9.187  -1.540  1.00 0.00 ? 79 GLU A CA   2  
ATOM 2415  C C    . GLU A 1 79 ? 3.679  -10.345 -2.510  1.00 0.00 ? 79 GLU A C    2  
ATOM 2416  O O    . GLU A 1 79 ? 2.749  -11.105 -2.782  1.00 0.00 ? 79 GLU A O    2  
ATOM 2417  C CB   . GLU A 1 79 ? 3.283  -7.884  -2.316  1.00 0.00 ? 79 GLU A CB   2  
ATOM 2418  C CG   . GLU A 1 79 ? 3.222  -6.667  -1.412  1.00 0.00 ? 79 GLU A CG   2  
ATOM 2419  C CD   . GLU A 1 79 ? 2.079  -6.733  -0.417  1.00 0.00 ? 79 GLU A CD   2  
ATOM 2420  O OE1  . GLU A 1 79 ? 2.282  -7.276  0.694   1.00 0.00 ? 79 GLU A OE1  2  
ATOM 2421  O OE2  . GLU A 1 79 ? 0.982  -6.241  -0.747  1.00 0.00 ? 79 GLU A OE2  2  
ATOM 2422  H H    . GLU A 1 79 ? 5.178  -8.236  -0.693  1.00 0.00 ? 79 GLU A H    2  
ATOM 2423  H HA   . GLU A 1 79 ? 2.636  -9.363  -0.913  1.00 0.00 ? 79 GLU A HA   2  
ATOM 2424  H HB2  . GLU A 1 79 ? 4.092  -7.761  -3.016  1.00 0.00 ? 79 GLU A HB2  2  
ATOM 2425  H HB3  . GLU A 1 79 ? 2.351  -7.951  -2.854  1.00 0.00 ? 79 GLU A HB3  2  
ATOM 2426  H HG2  . GLU A 1 79 ? 4.143  -6.583  -0.866  1.00 0.00 ? 79 GLU A HG2  2  
ATOM 2427  H HG3  . GLU A 1 79 ? 3.099  -5.787  -2.023  1.00 0.00 ? 79 GLU A HG3  2  
ATOM 2428  N N    . GLU A 1 80 ? 4.906  -10.479 -2.986  1.00 0.00 ? 80 GLU A N    2  
ATOM 2429  C CA   . GLU A 1 80 ? 5.285  -11.590 -3.849  1.00 0.00 ? 80 GLU A CA   2  
ATOM 2430  C C    . GLU A 1 80 ? 6.702  -12.016 -3.498  1.00 0.00 ? 80 GLU A C    2  
ATOM 2431  O O    . GLU A 1 80 ? 7.662  -11.604 -4.146  1.00 0.00 ? 80 GLU A O    2  
ATOM 2432  C CB   . GLU A 1 80 ? 5.184  -11.189 -5.316  1.00 0.00 ? 80 GLU A CB   2  
ATOM 2433  C CG   . GLU A 1 80 ? 5.397  -12.327 -6.276  1.00 0.00 ? 80 GLU A CG   2  
ATOM 2434  C CD   . GLU A 1 80 ? 5.127  -11.897 -7.701  1.00 0.00 ? 80 GLU A CD   2  
ATOM 2435  O OE1  . GLU A 1 80 ? 3.928  -11.765 -8.063  1.00 0.00 ? 80 GLU A OE1  2  
ATOM 2436  O OE2  . GLU A 1 80 ? 6.085  -11.667 -8.454  1.00 0.00 ? 80 GLU A OE2  2  
ATOM 2437  H H    . GLU A 1 80 ? 5.585  -9.820  -2.737  1.00 0.00 ? 80 GLU A H    2  
ATOM 2438  H HA   . GLU A 1 80 ? 4.609  -12.412 -3.663  1.00 0.00 ? 80 GLU A HA   2  
ATOM 2439  H HB2  . GLU A 1 80 ? 4.222  -10.773 -5.499  1.00 0.00 ? 80 GLU A HB2  2  
ATOM 2440  H HB3  . GLU A 1 80 ? 5.937  -10.426 -5.522  1.00 0.00 ? 80 GLU A HB3  2  
ATOM 2441  H HG2  . GLU A 1 80 ? 6.423  -12.672 -6.215  1.00 0.00 ? 80 GLU A HG2  2  
ATOM 2442  H HG3  . GLU A 1 80 ? 4.727  -13.136 -6.018  1.00 0.00 ? 80 GLU A HG3  2  
ATOM 2443  N N    . MET A 1 4  ? 5.991  1.582   -17.029 1.00 0.00 ? 4  MET A N    3  
ATOM 2444  C CA   . MET A 1 4  ? 7.267  2.223   -16.773 1.00 0.00 ? 4  MET A CA   3  
ATOM 2445  C C    . MET A 1 4  ? 7.131  3.243   -15.655 1.00 0.00 ? 4  MET A C    3  
ATOM 2446  O O    . MET A 1 4  ? 6.057  3.813   -15.456 1.00 0.00 ? 4  MET A O    3  
ATOM 2447  C CB   . MET A 1 4  ? 7.819  2.881   -18.025 1.00 0.00 ? 4  MET A CB   3  
ATOM 2448  C CG   . MET A 1 4  ? 8.221  1.893   -19.102 1.00 0.00 ? 4  MET A CG   3  
ATOM 2449  S SD   . MET A 1 4  ? 8.924  2.712   -20.554 1.00 0.00 ? 4  MET A SD   3  
ATOM 2450  C CE   . MET A 1 4  ? 9.328  1.304   -21.575 1.00 0.00 ? 4  MET A CE   3  
ATOM 2451  H H    . MET A 1 4  ? 5.514  1.783   -17.869 1.00 0.00 ? 4  MET A H    3  
ATOM 2452  H HA   . MET A 1 4  ? 7.948  1.450   -16.449 1.00 0.00 ? 4  MET A HA   3  
ATOM 2453  H HB2  . MET A 1 4  ? 7.067  3.538   -18.431 1.00 0.00 ? 4  MET A HB2  3  
ATOM 2454  H HB3  . MET A 1 4  ? 8.690  3.470   -17.756 1.00 0.00 ? 4  MET A HB3  3  
ATOM 2455  H HG2  . MET A 1 4  ? 8.956  1.209   -18.681 1.00 0.00 ? 4  MET A HG2  3  
ATOM 2456  H HG3  . MET A 1 4  ? 7.341  1.348   -19.417 1.00 0.00 ? 4  MET A HG3  3  
ATOM 2457  H HE1  . MET A 1 4  ? 8.432  0.719   -21.753 1.00 0.00 ? 4  MET A HE1  3  
ATOM 2458  H HE2  . MET A 1 4  ? 10.068 0.705   -21.073 1.00 0.00 ? 4  MET A HE2  3  
ATOM 2459  H HE3  . MET A 1 4  ? 9.725  1.643   -22.514 1.00 0.00 ? 4  MET A HE3  3  
ATOM 2460  N N    . ARG A 1 5  ? 8.232  3.459   -14.942 1.00 0.00 ? 5  ARG A N    3  
ATOM 2461  C CA   . ARG A 1 5  ? 8.262  4.248   -13.716 1.00 0.00 ? 5  ARG A CA   3  
ATOM 2462  C C    . ARG A 1 5  ? 7.658  5.634   -13.913 1.00 0.00 ? 5  ARG A C    3  
ATOM 2463  O O    . ARG A 1 5  ? 6.739  6.032   -13.195 1.00 0.00 ? 5  ARG A O    3  
ATOM 2464  C CB   . ARG A 1 5  ? 9.711  4.399   -13.258 1.00 0.00 ? 5  ARG A CB   3  
ATOM 2465  C CG   . ARG A 1 5  ? 9.852  4.877   -11.824 1.00 0.00 ? 5  ARG A CG   3  
ATOM 2466  C CD   . ARG A 1 5  ? 11.274 5.302   -11.537 1.00 0.00 ? 5  ARG A CD   3  
ATOM 2467  N NE   . ARG A 1 5  ? 12.251 4.303   -11.983 1.00 0.00 ? 5  ARG A NE   3  
ATOM 2468  C CZ   . ARG A 1 5  ? 13.537 4.324   -11.641 1.00 0.00 ? 5  ARG A CZ   3  
ATOM 2469  N NH1  . ARG A 1 5  ? 13.980 5.186   -10.736 1.00 0.00 ? 5  ARG A NH1  3  
ATOM 2470  N NH2  . ARG A 1 5  ? 14.386 3.451   -12.163 1.00 0.00 ? 5  ARG A NH2  3  
ATOM 2471  H H    . ARG A 1 5  ? 9.076  3.069   -15.257 1.00 0.00 ? 5  ARG A H    3  
ATOM 2472  H HA   . ARG A 1 5  ? 7.712  3.718   -12.961 1.00 0.00 ? 5  ARG A HA   3  
ATOM 2473  H HB2  . ARG A 1 5  ? 10.217 3.442   -13.339 1.00 0.00 ? 5  ARG A HB2  3  
ATOM 2474  H HB3  . ARG A 1 5  ? 10.198 5.121   -13.906 1.00 0.00 ? 5  ARG A HB3  3  
ATOM 2475  H HG2  . ARG A 1 5  ? 9.201  5.713   -11.669 1.00 0.00 ? 5  ARG A HG2  3  
ATOM 2476  H HG3  . ARG A 1 5  ? 9.578  4.071   -11.154 1.00 0.00 ? 5  ARG A HG3  3  
ATOM 2477  H HD2  . ARG A 1 5  ? 11.469 6.234   -12.047 1.00 0.00 ? 5  ARG A HD2  3  
ATOM 2478  H HD3  . ARG A 1 5  ? 11.380 5.440   -10.478 1.00 0.00 ? 5  ARG A HD3  3  
ATOM 2479  H HE   . ARG A 1 5  ? 11.941 3.599   -12.598 1.00 0.00 ? 5  ARG A HE   3  
ATOM 2480  H HH11 . ARG A 1 5  ? 13.354 5.832   -10.281 1.00 0.00 ? 5  ARG A HH11 3  
ATOM 2481  H HH12 . ARG A 1 5  ? 14.962 5.194   -10.505 1.00 0.00 ? 5  ARG A HH12 3  
ATOM 2482  H HH21 . ARG A 1 5  ? 14.062 2.764   -12.834 1.00 0.00 ? 5  ARG A HH21 3  
ATOM 2483  H HH22 . ARG A 1 5  ? 15.371 3.477   -11.905 1.00 0.00 ? 5  ARG A HH22 3  
ATOM 2484  N N    . SER A 1 6  ? 8.183  6.375   -14.876 1.00 0.00 ? 6  SER A N    3  
ATOM 2485  C CA   . SER A 1 6  ? 7.775  7.764   -15.080 1.00 0.00 ? 6  SER A CA   3  
ATOM 2486  C C    . SER A 1 6  ? 6.650  7.882   -16.101 1.00 0.00 ? 6  SER A C    3  
ATOM 2487  O O    . SER A 1 6  ? 6.307  8.976   -16.551 1.00 0.00 ? 6  SER A O    3  
ATOM 2488  C CB   . SER A 1 6  ? 8.986  8.602   -15.506 1.00 0.00 ? 6  SER A CB   3  
ATOM 2489  O OG   . SER A 1 6  ? 8.684  9.996   -15.463 1.00 0.00 ? 6  SER A OG   3  
ATOM 2490  H H    . SER A 1 6  ? 8.850  5.983   -15.480 1.00 0.00 ? 6  SER A H    3  
ATOM 2491  H HA   . SER A 1 6  ? 7.414  8.141   -14.129 1.00 0.00 ? 6  SER A HA   3  
ATOM 2492  H HB2  . SER A 1 6  ? 9.806  8.400   -14.839 1.00 0.00 ? 6  SER A HB2  3  
ATOM 2493  H HB3  . SER A 1 6  ? 9.263  8.332   -16.521 1.00 0.00 ? 6  SER A HB3  3  
ATOM 2494  H HG   . SER A 1 6  ? 8.278  10.263  -16.300 1.00 0.00 ? 6  SER A HG   3  
ATOM 2495  N N    . GLU A 1 7  ? 6.068  6.760   -16.480 1.00 0.00 ? 7  GLU A N    3  
ATOM 2496  C CA   . GLU A 1 7  ? 5.039  6.770   -17.509 1.00 0.00 ? 7  GLU A CA   3  
ATOM 2497  C C    . GLU A 1 7  ? 3.651  6.857   -16.919 1.00 0.00 ? 7  GLU A C    3  
ATOM 2498  O O    . GLU A 1 7  ? 2.650  6.682   -17.623 1.00 0.00 ? 7  GLU A O    3  
ATOM 2499  C CB   . GLU A 1 7  ? 5.157  5.546   -18.420 1.00 0.00 ? 7  GLU A CB   3  
ATOM 2500  C CG   . GLU A 1 7  ? 6.352  5.610   -19.345 1.00 0.00 ? 7  GLU A CG   3  
ATOM 2501  C CD   . GLU A 1 7  ? 6.415  6.900   -20.115 1.00 0.00 ? 7  GLU A CD   3  
ATOM 2502  O OE1  . GLU A 1 7  ? 5.632  7.054   -21.084 1.00 0.00 ? 7  GLU A OE1  3  
ATOM 2503  O OE2  . GLU A 1 7  ? 7.254  7.764   -19.782 1.00 0.00 ? 7  GLU A OE2  3  
ATOM 2504  H H    . GLU A 1 7  ? 6.326  5.907   -16.069 1.00 0.00 ? 7  GLU A H    3  
ATOM 2505  H HA   . GLU A 1 7  ? 5.198  7.650   -18.118 1.00 0.00 ? 7  GLU A HA   3  
ATOM 2506  H HB2  . GLU A 1 7  ? 5.239  4.665   -17.812 1.00 0.00 ? 7  GLU A HB2  3  
ATOM 2507  H HB3  . GLU A 1 7  ? 4.264  5.473   -19.015 1.00 0.00 ? 7  GLU A HB3  3  
ATOM 2508  H HG2  . GLU A 1 7  ? 7.247  5.511   -18.755 1.00 0.00 ? 7  GLU A HG2  3  
ATOM 2509  H HG3  . GLU A 1 7  ? 6.289  4.792   -20.049 1.00 0.00 ? 7  GLU A HG3  3  
ATOM 2510  N N    . PHE A 1 8  ? 3.576  7.149   -15.638 1.00 0.00 ? 8  PHE A N    3  
ATOM 2511  C CA   . PHE A 1 8  ? 2.291  7.375   -14.994 1.00 0.00 ? 8  PHE A CA   3  
ATOM 2512  C C    . PHE A 1 8  ? 1.743  8.738   -15.404 1.00 0.00 ? 8  PHE A C    3  
ATOM 2513  O O    . PHE A 1 8  ? 2.468  9.545   -15.988 1.00 0.00 ? 8  PHE A O    3  
ATOM 2514  C CB   . PHE A 1 8  ? 2.420  7.275   -13.459 1.00 0.00 ? 8  PHE A CB   3  
ATOM 2515  C CG   . PHE A 1 8  ? 2.436  5.851   -12.984 1.00 0.00 ? 8  PHE A CG   3  
ATOM 2516  C CD1  . PHE A 1 8  ? 3.491  4.995   -13.307 1.00 0.00 ? 8  PHE A CD1  3  
ATOM 2517  C CD2  . PHE A 1 8  ? 1.399  5.349   -12.218 1.00 0.00 ? 8  PHE A CD2  3  
ATOM 2518  C CE1  . PHE A 1 8  ? 3.508  3.687   -12.874 1.00 0.00 ? 8  PHE A CE1  3  
ATOM 2519  C CE2  . PHE A 1 8  ? 1.405  4.035   -11.773 1.00 0.00 ? 8  PHE A CE2  3  
ATOM 2520  C CZ   . PHE A 1 8  ? 2.456  3.205   -12.105 1.00 0.00 ? 8  PHE A CZ   3  
ATOM 2521  H H    . PHE A 1 8  ? 4.396  7.216   -15.109 1.00 0.00 ? 8  PHE A H    3  
ATOM 2522  H HA   . PHE A 1 8  ? 1.608  6.609   -15.353 1.00 0.00 ? 8  PHE A HA   3  
ATOM 2523  H HB2  . PHE A 1 8  ? 3.337  7.756   -13.138 1.00 0.00 ? 8  PHE A HB2  3  
ATOM 2524  H HB3  . PHE A 1 8  ? 1.566  7.771   -13.008 1.00 0.00 ? 8  PHE A HB3  3  
ATOM 2525  H HD1  . PHE A 1 8  ? 4.302  5.378   -13.906 1.00 0.00 ? 8  PHE A HD1  3  
ATOM 2526  H HD2  . PHE A 1 8  ? 0.575  5.993   -11.961 1.00 0.00 ? 8  PHE A HD2  3  
ATOM 2527  H HE1  . PHE A 1 8  ? 4.326  3.037   -13.137 1.00 0.00 ? 8  PHE A HE1  3  
ATOM 2528  H HE2  . PHE A 1 8  ? 0.592  3.663   -11.180 1.00 0.00 ? 8  PHE A HE2  3  
ATOM 2529  H HZ   . PHE A 1 8  ? 2.465  2.171   -11.762 1.00 0.00 ? 8  PHE A HZ   3  
ATOM 2530  N N    . ALA A 1 9  ? 0.482  9.001   -15.068 1.00 0.00 ? 9  ALA A N    3  
ATOM 2531  C CA   . ALA A 1 9  ? -0.218 10.213  -15.506 1.00 0.00 ? 9  ALA A CA   3  
ATOM 2532  C C    . ALA A 1 9  ? 0.583  11.490  -15.248 1.00 0.00 ? 9  ALA A C    3  
ATOM 2533  O O    . ALA A 1 9  ? 0.690  12.348  -16.124 1.00 0.00 ? 9  ALA A O    3  
ATOM 2534  C CB   . ALA A 1 9  ? -1.578 10.299  -14.832 1.00 0.00 ? 9  ALA A CB   3  
ATOM 2535  H H    . ALA A 1 9  ? -0.005 8.343   -14.512 1.00 0.00 ? 9  ALA A H    3  
ATOM 2536  H HA   . ALA A 1 9  ? -0.384 10.121  -16.566 1.00 0.00 ? 9  ALA A HA   3  
ATOM 2537  H HB1  . ALA A 1 9  ? -1.441 10.410  -13.762 1.00 0.00 ? 9  ALA A HB1  3  
ATOM 2538  H HB2  . ALA A 1 9  ? -2.121 9.396   -15.030 1.00 0.00 ? 9  ALA A HB2  3  
ATOM 2539  H HB3  . ALA A 1 9  ? -2.117 11.149  -15.230 1.00 0.00 ? 9  ALA A HB3  3  
ATOM 2540  N N    . SER A 1 10 ? 1.135  11.606  -14.067 1.00 0.00 ? 10 SER A N    3  
ATOM 2541  C CA   . SER A 1 10 ? 1.948  12.766  -13.725 1.00 0.00 ? 10 SER A CA   3  
ATOM 2542  C C    . SER A 1 10 ? 3.381  12.335  -13.431 1.00 0.00 ? 10 SER A C    3  
ATOM 2543  O O    . SER A 1 10 ? 4.210  13.118  -12.984 1.00 0.00 ? 10 SER A O    3  
ATOM 2544  C CB   . SER A 1 10 ? 1.333  13.490  -12.512 1.00 0.00 ? 10 SER A CB   3  
ATOM 2545  O OG   . SER A 1 10 ? 2.051  14.681  -12.203 1.00 0.00 ? 10 SER A OG   3  
ATOM 2546  H H    . SER A 1 10 ? 0.992  10.895  -13.385 1.00 0.00 ? 10 SER A H    3  
ATOM 2547  H HA   . SER A 1 10 ? 1.953  13.433  -14.582 1.00 0.00 ? 10 SER A HA   3  
ATOM 2548  H HB2  . SER A 1 10 ? 0.311  13.752  -12.755 1.00 0.00 ? 10 SER A HB2  3  
ATOM 2549  H HB3  . SER A 1 10 ? 1.351  12.834  -11.664 1.00 0.00 ? 10 SER A HB3  3  
ATOM 2550  H HG   . SER A 1 10 ? 2.802  14.464  -11.642 1.00 0.00 ? 10 SER A HG   3  
ATOM 2551  N N    . GLY A 1 11 ? 3.680  11.071  -13.733 1.00 0.00 ? 11 GLY A N    3  
ATOM 2552  C CA   . GLY A 1 11 ? 5.020  10.530  -13.494 1.00 0.00 ? 11 GLY A CA   3  
ATOM 2553  C C    . GLY A 1 11 ? 5.252  10.216  -12.021 1.00 0.00 ? 11 GLY A C    3  
ATOM 2554  O O    . GLY A 1 11 ? 5.535  9.070   -11.658 1.00 0.00 ? 11 GLY A O    3  
ATOM 2555  H H    . GLY A 1 11 ? 3.000  10.505  -14.172 1.00 0.00 ? 11 GLY A H    3  
ATOM 2556  H HA2  . GLY A 1 11 ? 5.129  9.620   -14.059 1.00 0.00 ? 11 GLY A HA2  3  
ATOM 2557  H HA3  . GLY A 1 11 ? 5.752  11.247  -13.813 1.00 0.00 ? 11 GLY A HA3  3  
ATOM 2558  N N    . ASN A 1 12 ? 5.123  11.240  -11.188 1.00 0.00 ? 12 ASN A N    3  
ATOM 2559  C CA   . ASN A 1 12 ? 5.273  11.115  -9.745  1.00 0.00 ? 12 ASN A CA   3  
ATOM 2560  C C    . ASN A 1 12 ? 4.269  10.138  -9.164  1.00 0.00 ? 12 ASN A C    3  
ATOM 2561  O O    . ASN A 1 12 ? 4.465  9.610   -8.070  1.00 0.00 ? 12 ASN A O    3  
ATOM 2562  C CB   . ASN A 1 12 ? 5.144  12.470  -9.044  1.00 0.00 ? 12 ASN A CB   3  
ATOM 2563  C CG   . ASN A 1 12 ? 3.765  13.085  -9.148  1.00 0.00 ? 12 ASN A CG   3  
ATOM 2564  O OD1  . ASN A 1 12 ? 3.456  13.789  -10.111 1.00 0.00 ? 12 ASN A OD1  3  
ATOM 2565  N ND2  . ASN A 1 12 ? 2.946  12.859  -8.144  1.00 0.00 ? 12 ASN A ND2  3  
ATOM 2566  H H    . ASN A 1 12 ? 4.939  12.127  -11.570 1.00 0.00 ? 12 ASN A H    3  
ATOM 2567  H HA   . ASN A 1 12 ? 6.258  10.733  -9.558  1.00 0.00 ? 12 ASN A HA   3  
ATOM 2568  H HB2  . ASN A 1 12 ? 5.382  12.342  -8.012  1.00 0.00 ? 12 ASN A HB2  3  
ATOM 2569  H HB3  . ASN A 1 12 ? 5.858  13.153  -9.494  1.00 0.00 ? 12 ASN A HB3  3  
ATOM 2570  H HD21 . ASN A 1 12 ? 3.257  12.309  -7.386  1.00 0.00 ? 12 ASN A HD21 3  
ATOM 2571  H HD22 . ASN A 1 12 ? 2.044  13.255  -8.179  1.00 0.00 ? 12 ASN A HD22 3  
ATOM 2572  N N    . THR A 1 13 ? 3.164  9.909   -9.893  1.00 0.00 ? 13 THR A N    3  
ATOM 2573  C CA   . THR A 1 13 ? 2.068  9.052   -9.445  1.00 0.00 ? 13 THR A CA   3  
ATOM 2574  C C    . THR A 1 13 ? 2.570  7.674   -8.992  1.00 0.00 ? 13 THR A C    3  
ATOM 2575  O O    . THR A 1 13 ? 1.993  7.071   -8.101  1.00 0.00 ? 13 THR A O    3  
ATOM 2576  C CB   . THR A 1 13 ? 1.073  8.851   -10.596 1.00 0.00 ? 13 THR A CB   3  
ATOM 2577  O OG1  . THR A 1 13 ? 1.016  10.041  -11.407 1.00 0.00 ? 13 THR A OG1  3  
ATOM 2578  C CG2  . THR A 1 13 ? -0.321 8.505   -10.067 1.00 0.00 ? 13 THR A CG2  3  
ATOM 2579  H H    . THR A 1 13 ? 3.080  10.322  -10.786 1.00 0.00 ? 13 THR A H    3  
ATOM 2580  H HA   . THR A 1 13 ? 1.570  9.548   -8.630  1.00 0.00 ? 13 THR A HA   3  
ATOM 2581  H HB   . THR A 1 13 ? 1.428  8.030   -11.200 1.00 0.00 ? 13 THR A HB   3  
ATOM 2582  H HG1  . THR A 1 13 ? 0.691  10.773  -10.852 1.00 0.00 ? 13 THR A HG1  3  
ATOM 2583  H HG21 . THR A 1 13 ? -0.669 9.319   -9.451  1.00 0.00 ? 13 THR A HG21 3  
ATOM 2584  H HG22 . THR A 1 13 ? -0.278 7.613   -9.485  1.00 0.00 ? 13 THR A HG22 3  
ATOM 2585  H HG23 . THR A 1 13 ? -0.984 8.370   -10.903 1.00 0.00 ? 13 THR A HG23 3  
ATOM 2586  N N    . TYR A 1 14 ? 3.653  7.203   -9.592  1.00 0.00 ? 14 TYR A N    3  
ATOM 2587  C CA   . TYR A 1 14 ? 4.260  5.943   -9.205  1.00 0.00 ? 14 TYR A CA   3  
ATOM 2588  C C    . TYR A 1 14 ? 4.749  6.020   -7.768  1.00 0.00 ? 14 TYR A C    3  
ATOM 2589  O O    . TYR A 1 14 ? 4.511  5.123   -6.959  1.00 0.00 ? 14 TYR A O    3  
ATOM 2590  C CB   . TYR A 1 14 ? 5.415  5.609   -10.149 1.00 0.00 ? 14 TYR A CB   3  
ATOM 2591  C CG   . TYR A 1 14 ? 6.068  4.273   -9.877  1.00 0.00 ? 14 TYR A CG   3  
ATOM 2592  C CD1  . TYR A 1 14 ? 5.392  3.082   -10.171 1.00 0.00 ? 14 TYR A CD1  3  
ATOM 2593  C CD2  . TYR A 1 14 ? 7.356  4.175   -9.351  1.00 0.00 ? 14 TYR A CD2  3  
ATOM 2594  C CE1  . TYR A 1 14 ? 5.971  1.861   -9.926  1.00 0.00 ? 14 TYR A CE1  3  
ATOM 2595  C CE2  . TYR A 1 14 ? 7.950  2.947   -9.116  1.00 0.00 ? 14 TYR A CE2  3  
ATOM 2596  C CZ   . TYR A 1 14 ? 7.243  1.799   -9.404  1.00 0.00 ? 14 TYR A CZ   3  
ATOM 2597  O OH   . TYR A 1 14 ? 7.829  0.566   -9.191  1.00 0.00 ? 14 TYR A OH   3  
ATOM 2598  H H    . TYR A 1 14 ? 4.062  7.736   -10.301 1.00 0.00 ? 14 TYR A H    3  
ATOM 2599  H HA   . TYR A 1 14 ? 3.506  5.189   -9.298  1.00 0.00 ? 14 TYR A HA   3  
ATOM 2600  H HB2  . TYR A 1 14 ? 5.048  5.592   -11.156 1.00 0.00 ? 14 TYR A HB2  3  
ATOM 2601  H HB3  . TYR A 1 14 ? 6.169  6.364   -10.058 1.00 0.00 ? 14 TYR A HB3  3  
ATOM 2602  H HD1  . TYR A 1 14 ? 4.393  3.140   -10.585 1.00 0.00 ? 14 TYR A HD1  3  
ATOM 2603  H HD2  . TYR A 1 14 ? 7.893  5.082   -9.118  1.00 0.00 ? 14 TYR A HD2  3  
ATOM 2604  H HE1  . TYR A 1 14 ? 5.425  0.952   -10.156 1.00 0.00 ? 14 TYR A HE1  3  
ATOM 2605  H HE2  . TYR A 1 14 ? 8.946  2.898   -8.716  1.00 0.00 ? 14 TYR A HE2  3  
ATOM 2606  H HH   . TYR A 1 14 ? 7.676  -0.016  -9.953  1.00 0.00 ? 14 TYR A HH   3  
ATOM 2607  N N    . ALA A 1 15 ? 5.404  7.119   -7.441  1.00 0.00 ? 15 ALA A N    3  
ATOM 2608  C CA   . ALA A 1 15 ? 5.947  7.341   -6.109  1.00 0.00 ? 15 ALA A CA   3  
ATOM 2609  C C    . ALA A 1 15 ? 4.845  7.461   -5.070  1.00 0.00 ? 15 ALA A C    3  
ATOM 2610  O O    . ALA A 1 15 ? 5.015  7.019   -3.938  1.00 0.00 ? 15 ALA A O    3  
ATOM 2611  C CB   . ALA A 1 15 ? 6.805  8.595   -6.116  1.00 0.00 ? 15 ALA A CB   3  
ATOM 2612  H H    . ALA A 1 15 ? 5.517  7.817   -8.119  1.00 0.00 ? 15 ALA A H    3  
ATOM 2613  H HA   . ALA A 1 15 ? 6.572  6.498   -5.860  1.00 0.00 ? 15 ALA A HA   3  
ATOM 2614  H HB1  . ALA A 1 15 ? 7.594  8.494   -6.856  1.00 0.00 ? 15 ALA A HB1  3  
ATOM 2615  H HB2  . ALA A 1 15 ? 7.254  8.731   -5.133  1.00 0.00 ? 15 ALA A HB2  3  
ATOM 2616  H HB3  . ALA A 1 15 ? 6.198  9.446   -6.355  1.00 0.00 ? 15 ALA A HB3  3  
ATOM 2617  N N    . LEU A 1 16 ? 3.724  8.042   -5.458  1.00 0.00 ? 16 LEU A N    3  
ATOM 2618  C CA   . LEU A 1 16 ? 2.615  8.215   -4.526  1.00 0.00 ? 16 LEU A CA   3  
ATOM 2619  C C    . LEU A 1 16 ? 1.884  6.898   -4.329  1.00 0.00 ? 16 LEU A C    3  
ATOM 2620  O O    . LEU A 1 16 ? 1.231  6.672   -3.315  1.00 0.00 ? 16 LEU A O    3  
ATOM 2621  C CB   . LEU A 1 16 ? 1.669  9.345   -4.957  1.00 0.00 ? 16 LEU A CB   3  
ATOM 2622  C CG   . LEU A 1 16 ? 0.887  9.159   -6.260  1.00 0.00 ? 16 LEU A CG   3  
ATOM 2623  C CD1  . LEU A 1 16 ? -0.304 8.258   -6.086  1.00 0.00 ? 16 LEU A CD1  3  
ATOM 2624  C CD2  . LEU A 1 16 ? 0.464  10.519  -6.804  1.00 0.00 ? 16 LEU A CD2  3  
ATOM 2625  H H    . LEU A 1 16 ? 3.625  8.329   -6.380  1.00 0.00 ? 16 LEU A H    3  
ATOM 2626  H HA   . LEU A 1 16 ? 3.058  8.487   -3.581  1.00 0.00 ? 16 LEU A HA   3  
ATOM 2627  H HB2  . LEU A 1 16 ? 0.944  9.495   -4.176  1.00 0.00 ? 16 LEU A HB2  3  
ATOM 2628  H HB3  . LEU A 1 16 ? 2.246  10.251  -5.053  1.00 0.00 ? 16 LEU A HB3  3  
ATOM 2629  H HG   . LEU A 1 16 ? 1.540  8.704   -7.006  1.00 0.00 ? 16 LEU A HG   3  
ATOM 2630  H HD11 . LEU A 1 16 ? 0.029  7.294   -5.714  1.00 0.00 ? 16 LEU A HD11 3  
ATOM 2631  H HD12 . LEU A 1 16 ? -0.813 8.117   -7.026  1.00 0.00 ? 16 LEU A HD12 3  
ATOM 2632  H HD13 . LEU A 1 16 ? -0.987 8.695   -5.375  1.00 0.00 ? 16 LEU A HD13 3  
ATOM 2633  H HD21 . LEU A 1 16 ? -0.099 10.384  -7.718  1.00 0.00 ? 16 LEU A HD21 3  
ATOM 2634  H HD22 . LEU A 1 16 ? 1.337  11.118  -7.006  1.00 0.00 ? 16 LEU A HD22 3  
ATOM 2635  H HD23 . LEU A 1 16 ? -0.152 11.012  -6.069  1.00 0.00 ? 16 LEU A HD23 3  
ATOM 2636  N N    . TYR A 1 17 ? 1.957  6.031   -5.334  1.00 0.00 ? 17 TYR A N    3  
ATOM 2637  C CA   . TYR A 1 17 ? 1.417  4.696   -5.237  1.00 0.00 ? 17 TYR A CA   3  
ATOM 2638  C C    . TYR A 1 17 ? 2.273  3.824   -4.332  1.00 0.00 ? 17 TYR A C    3  
ATOM 2639  O O    . TYR A 1 17 ? 1.782  3.211   -3.394  1.00 0.00 ? 17 TYR A O    3  
ATOM 2640  C CB   . TYR A 1 17 ? 1.280  4.076   -6.631  1.00 0.00 ? 17 TYR A CB   3  
ATOM 2641  C CG   . TYR A 1 17 ? 0.760  2.654   -6.623  1.00 0.00 ? 17 TYR A CG   3  
ATOM 2642  C CD1  . TYR A 1 17 ? -0.602 2.413   -6.443  1.00 0.00 ? 17 TYR A CD1  3  
ATOM 2643  C CD2  . TYR A 1 17 ? 1.606  1.573   -6.767  1.00 0.00 ? 17 TYR A CD2  3  
ATOM 2644  C CE1  . TYR A 1 17 ? -1.087 1.118   -6.416  1.00 0.00 ? 17 TYR A CE1  3  
ATOM 2645  C CE2  . TYR A 1 17 ? 1.129  0.262   -6.757  1.00 0.00 ? 17 TYR A CE2  3  
ATOM 2646  C CZ   . TYR A 1 17 ? -0.226 0.053   -6.581  1.00 0.00 ? 17 TYR A CZ   3  
ATOM 2647  O OH   . TYR A 1 17 ? -0.741 -1.227  -6.554  1.00 0.00 ? 17 TYR A OH   3  
ATOM 2648  H H    . TYR A 1 17 ? 2.358  6.315   -6.188  1.00 0.00 ? 17 TYR A H    3  
ATOM 2649  H HA   . TYR A 1 17 ? 0.438  4.791   -4.805  1.00 0.00 ? 17 TYR A HA   3  
ATOM 2650  H HB2  . TYR A 1 17 ? 0.594  4.675   -7.213  1.00 0.00 ? 17 TYR A HB2  3  
ATOM 2651  H HB3  . TYR A 1 17 ? 2.247  4.076   -7.119  1.00 0.00 ? 17 TYR A HB3  3  
ATOM 2652  H HD1  . TYR A 1 17 ? -1.266 3.247   -6.303  1.00 0.00 ? 17 TYR A HD1  3  
ATOM 2653  H HD2  . TYR A 1 17 ? 2.666  1.733   -6.916  1.00 0.00 ? 17 TYR A HD2  3  
ATOM 2654  H HE1  . TYR A 1 17 ? -2.149 0.955   -6.291  1.00 0.00 ? 17 TYR A HE1  3  
ATOM 2655  H HE2  . TYR A 1 17 ? 1.792  -0.568  -6.860  1.00 0.00 ? 17 TYR A HE2  3  
ATOM 2656  H HH   . TYR A 1 17 ? -0.133 -1.784  -6.033  1.00 0.00 ? 17 TYR A HH   3  
ATOM 2657  N N    . VAL A 1 18 ? 3.571  3.765   -4.628  1.00 0.00 ? 18 VAL A N    3  
ATOM 2658  C CA   . VAL A 1 18 ? 4.485  2.902   -3.886  1.00 0.00 ? 18 VAL A CA   3  
ATOM 2659  C C    . VAL A 1 18 ? 4.471  3.190   -2.387  1.00 0.00 ? 18 VAL A C    3  
ATOM 2660  O O    . VAL A 1 18 ? 4.654  2.269   -1.585  1.00 0.00 ? 18 VAL A O    3  
ATOM 2661  C CB   . VAL A 1 18 ? 5.944  2.975   -4.413  1.00 0.00 ? 18 VAL A CB   3  
ATOM 2662  C CG1  . VAL A 1 18 ? 6.000  2.546   -5.866  1.00 0.00 ? 18 VAL A CG1  3  
ATOM 2663  C CG2  . VAL A 1 18 ? 6.544  4.358   -4.246  1.00 0.00 ? 18 VAL A CG2  3  
ATOM 2664  H H    . VAL A 1 18 ? 3.910  4.286   -5.402  1.00 0.00 ? 18 VAL A H    3  
ATOM 2665  H HA   . VAL A 1 18 ? 4.138  1.886   -4.023  1.00 0.00 ? 18 VAL A HA   3  
ATOM 2666  H HB   . VAL A 1 18 ? 6.532  2.278   -3.835  1.00 0.00 ? 18 VAL A HB   3  
ATOM 2667  H HG11 . VAL A 1 18 ? 7.032  2.601   -6.224  1.00 0.00 ? 18 VAL A HG11 3  
ATOM 2668  H HG12 . VAL A 1 18 ? 5.397  3.208   -6.464  1.00 0.00 ? 18 VAL A HG12 3  
ATOM 2669  H HG13 . VAL A 1 18 ? 5.651  1.535   -5.962  1.00 0.00 ? 18 VAL A HG13 3  
ATOM 2670  H HG21 . VAL A 1 18 ? 5.945  5.071   -4.779  1.00 0.00 ? 18 VAL A HG21 3  
ATOM 2671  H HG22 . VAL A 1 18 ? 7.555  4.373   -4.632  1.00 0.00 ? 18 VAL A HG22 3  
ATOM 2672  H HG23 . VAL A 1 18 ? 6.546  4.607   -3.204  1.00 0.00 ? 18 VAL A HG23 3  
ATOM 2673  N N    . ARG A 1 19 ? 4.247  4.441   -1.995  1.00 0.00 ? 19 ARG A N    3  
ATOM 2674  C CA   . ARG A 1 19 ? 4.225  4.796   -0.582  1.00 0.00 ? 19 ARG A CA   3  
ATOM 2675  C C    . ARG A 1 19 ? 3.050  4.136   0.141   1.00 0.00 ? 19 ARG A C    3  
ATOM 2676  O O    . ARG A 1 19 ? 3.020  4.047   1.366   1.00 0.00 ? 19 ARG A O    3  
ATOM 2677  C CB   . ARG A 1 19 ? 4.211  6.332   -0.394  1.00 0.00 ? 19 ARG A CB   3  
ATOM 2678  C CG   . ARG A 1 19 ? 2.953  7.029   -0.910  1.00 0.00 ? 19 ARG A CG   3  
ATOM 2679  C CD   . ARG A 1 19 ? 1.796  6.956   0.082   1.00 0.00 ? 19 ARG A CD   3  
ATOM 2680  N NE   . ARG A 1 19 ? 1.957  7.862   1.220   1.00 0.00 ? 19 ARG A NE   3  
ATOM 2681  C CZ   . ARG A 1 19 ? 1.935  7.484   2.509   1.00 0.00 ? 19 ARG A CZ   3  
ATOM 2682  N NH1  . ARG A 1 19 ? 1.880  6.191   2.828   1.00 0.00 ? 19 ARG A NH1  3  
ATOM 2683  N NH2  . ARG A 1 19 ? 2.018  8.392   3.467   1.00 0.00 ? 19 ARG A NH2  3  
ATOM 2684  H H    . ARG A 1 19 ? 4.122  5.141   -2.655  1.00 0.00 ? 19 ARG A H    3  
ATOM 2685  H HA   . ARG A 1 19 ? 5.140  4.410   -0.156  1.00 0.00 ? 19 ARG A HA   3  
ATOM 2686  H HB2  . ARG A 1 19 ? 4.302  6.532   0.660   1.00 0.00 ? 19 ARG A HB2  3  
ATOM 2687  H HB3  . ARG A 1 19 ? 5.068  6.755   -0.903  1.00 0.00 ? 19 ARG A HB3  3  
ATOM 2688  H HG2  . ARG A 1 19 ? 3.189  8.075   -1.096  1.00 0.00 ? 19 ARG A HG2  3  
ATOM 2689  H HG3  . ARG A 1 19 ? 2.660  6.557   -1.843  1.00 0.00 ? 19 ARG A HG3  3  
ATOM 2690  H HD2  . ARG A 1 19 ? 0.887  7.208   -0.437  1.00 0.00 ? 19 ARG A HD2  3  
ATOM 2691  H HD3  . ARG A 1 19 ? 1.721  5.937   0.453   1.00 0.00 ? 19 ARG A HD3  3  
ATOM 2692  H HE   . ARG A 1 19 ? 2.049  8.829   1.028   1.00 0.00 ? 19 ARG A HE   3  
ATOM 2693  H HH11 . ARG A 1 19 ? 1.848  5.489   2.114   1.00 0.00 ? 19 ARG A HH11 3  
ATOM 2694  H HH12 . ARG A 1 19 ? 1.853  5.910   3.797   1.00 0.00 ? 19 ARG A HH12 3  
ATOM 2695  H HH21 . ARG A 1 19 ? 2.071  9.379   3.234   1.00 0.00 ? 19 ARG A HH21 3  
ATOM 2696  H HH22 . ARG A 1 19 ? 2.030  8.115   4.441   1.00 0.00 ? 19 ARG A HH22 3  
ATOM 2697  N N    . ASP A 1 20 ? 2.077  3.675   -0.619  1.00 0.00 ? 20 ASP A N    3  
ATOM 2698  C CA   . ASP A 1 20 ? 0.914  3.020   -0.060  1.00 0.00 ? 20 ASP A CA   3  
ATOM 2699  C C    . ASP A 1 20 ? 1.202  1.539   0.201   1.00 0.00 ? 20 ASP A C    3  
ATOM 2700  O O    . ASP A 1 20 ? 0.806  0.967   1.222   1.00 0.00 ? 20 ASP A O    3  
ATOM 2701  C CB   . ASP A 1 20 ? -0.287 3.164   -1.010  1.00 0.00 ? 20 ASP A CB   3  
ATOM 2702  C CG   . ASP A 1 20 ? -1.491 2.379   -0.531  1.00 0.00 ? 20 ASP A CG   3  
ATOM 2703  O OD1  . ASP A 1 20 ? -2.114 2.774   0.475   1.00 0.00 ? 20 ASP A OD1  3  
ATOM 2704  O OD2  . ASP A 1 20 ? -1.824 1.355   -1.174  1.00 0.00 ? 20 ASP A OD2  3  
ATOM 2705  H H    . ASP A 1 20 ? 2.146  3.781   -1.609  1.00 0.00 ? 20 ASP A H    3  
ATOM 2706  H HA   . ASP A 1 20 ? 0.689  3.501   0.878   1.00 0.00 ? 20 ASP A HA   3  
ATOM 2707  H HB2  . ASP A 1 20 ? -0.560 4.193   -1.063  1.00 0.00 ? 20 ASP A HB2  3  
ATOM 2708  H HB3  . ASP A 1 20 ? -0.001 2.806   -1.991  1.00 0.00 ? 20 ASP A HB3  3  
ATOM 2709  N N    . THR A 1 21 ? 1.914  0.930   -0.727  1.00 0.00 ? 21 THR A N    3  
ATOM 2710  C CA   . THR A 1 21 ? 2.235  -0.475  -0.631  1.00 0.00 ? 21 THR A CA   3  
ATOM 2711  C C    . THR A 1 21 ? 3.430  -0.725  0.287   1.00 0.00 ? 21 THR A C    3  
ATOM 2712  O O    . THR A 1 21 ? 3.407  -1.653  1.104   1.00 0.00 ? 21 THR A O    3  
ATOM 2713  C CB   . THR A 1 21 ? 2.549  -1.053  -2.020  1.00 0.00 ? 21 THR A CB   3  
ATOM 2714  O OG1  . THR A 1 21 ? 1.449  -0.801  -2.905  1.00 0.00 ? 21 THR A OG1  3  
ATOM 2715  C CG2  . THR A 1 21 ? 2.806  -2.539  -1.958  1.00 0.00 ? 21 THR A CG2  3  
ATOM 2716  H H    . THR A 1 21 ? 2.231  1.440   -1.491  1.00 0.00 ? 21 THR A H    3  
ATOM 2717  H HA   . THR A 1 21 ? 1.373  -0.992  -0.238  1.00 0.00 ? 21 THR A HA   3  
ATOM 2718  H HB   . THR A 1 21 ? 3.435  -0.560  -2.408  1.00 0.00 ? 21 THR A HB   3  
ATOM 2719  H HG1  . THR A 1 21 ? 0.620  -0.822  -2.386  1.00 0.00 ? 21 THR A HG1  3  
ATOM 2720  H HG21 . THR A 1 21 ? 3.016  -2.908  -2.948  1.00 0.00 ? 21 THR A HG21 3  
ATOM 2721  H HG22 . THR A 1 21 ? 1.940  -3.025  -1.569  1.00 0.00 ? 21 THR A HG22 3  
ATOM 2722  H HG23 . THR A 1 21 ? 3.657  -2.721  -1.315  1.00 0.00 ? 21 THR A HG23 3  
ATOM 2723  N N    . LEU A 1 22 ? 4.438  0.120   0.182   1.00 0.00 ? 22 LEU A N    3  
ATOM 2724  C CA   . LEU A 1 22 ? 5.654  -0.036  0.966   1.00 0.00 ? 22 LEU A CA   3  
ATOM 2725  C C    . LEU A 1 22 ? 5.472  0.560   2.347   1.00 0.00 ? 22 LEU A C    3  
ATOM 2726  O O    . LEU A 1 22 ? 5.560  1.768   2.550   1.00 0.00 ? 22 LEU A O    3  
ATOM 2727  C CB   . LEU A 1 22 ? 6.840  0.609   0.250   1.00 0.00 ? 22 LEU A CB   3  
ATOM 2728  C CG   . LEU A 1 22 ? 8.213  -0.011  0.526   1.00 0.00 ? 22 LEU A CG   3  
ATOM 2729  C CD1  . LEU A 1 22 ? 8.635  0.205   1.963   1.00 0.00 ? 22 LEU A CD1  3  
ATOM 2730  C CD2  . LEU A 1 22 ? 8.207  -1.484  0.187   1.00 0.00 ? 22 LEU A CD2  3  
ATOM 2731  H H    . LEU A 1 22 ? 4.356  0.898   -0.422  1.00 0.00 ? 22 LEU A H    3  
ATOM 2732  H HA   . LEU A 1 22 ? 5.845  -1.104  1.065   1.00 0.00 ? 22 LEU A HA   3  
ATOM 2733  H HB2  . LEU A 1 22 ? 6.655  0.560   -0.813  1.00 0.00 ? 22 LEU A HB2  3  
ATOM 2734  H HB3  . LEU A 1 22 ? 6.875  1.650   0.536   1.00 0.00 ? 22 LEU A HB3  3  
ATOM 2735  H HG   . LEU A 1 22 ? 8.938  0.467   -0.116  1.00 0.00 ? 22 LEU A HG   3  
ATOM 2736  H HD11 . LEU A 1 22 ? 9.621  -0.231  2.110   1.00 0.00 ? 22 LEU A HD11 3  
ATOM 2737  H HD12 . LEU A 1 22 ? 7.941  -0.262  2.620   1.00 0.00 ? 22 LEU A HD12 3  
ATOM 2738  H HD13 . LEU A 1 22 ? 8.679  1.260   2.181   1.00 0.00 ? 22 LEU A HD13 3  
ATOM 2739  H HD21 . LEU A 1 22 ? 7.460  -1.987  0.788   1.00 0.00 ? 22 LEU A HD21 3  
ATOM 2740  H HD22 . LEU A 1 22 ? 9.174  -1.905  0.383   1.00 0.00 ? 22 LEU A HD22 3  
ATOM 2741  H HD23 . LEU A 1 22 ? 7.964  -1.626  -0.867  1.00 0.00 ? 22 LEU A HD23 3  
ATOM 2742  N N    . GLN A 1 23 ? 5.183  -0.308  3.306   1.00 0.00 ? 23 GLN A N    3  
ATOM 2743  C CA   . GLN A 1 23 ? 4.966  0.105   4.690   1.00 0.00 ? 23 GLN A CA   3  
ATOM 2744  C C    . GLN A 1 23 ? 6.272  0.089   5.471   1.00 0.00 ? 23 GLN A C    3  
ATOM 2745  O O    . GLN A 1 23 ? 7.248  -0.551  5.058   1.00 0.00 ? 23 GLN A O    3  
ATOM 2746  C CB   . GLN A 1 23 ? 3.945  -0.829  5.364   1.00 0.00 ? 23 GLN A CB   3  
ATOM 2747  C CG   . GLN A 1 23 ? 4.426  -2.245  5.481   1.00 0.00 ? 23 GLN A CG   3  
ATOM 2748  C CD   . GLN A 1 23 ? 3.596  -3.054  6.462   1.00 0.00 ? 23 GLN A CD   3  
ATOM 2749  O OE1  . GLN A 1 23 ? 2.606  -3.693  6.083   1.00 0.00 ? 23 GLN A OE1  3  
ATOM 2750  N NE2  . GLN A 1 23 ? 3.984  -3.025  7.711   1.00 0.00 ? 23 GLN A NE2  3  
ATOM 2751  H H    . GLN A 1 23 ? 5.122  -1.269  3.088   1.00 0.00 ? 23 GLN A H    3  
ATOM 2752  H HA   . GLN A 1 23 ? 4.577  1.107   4.685   1.00 0.00 ? 23 GLN A HA   3  
ATOM 2753  H HB2  . GLN A 1 23 ? 3.772  -0.453  6.352   1.00 0.00 ? 23 GLN A HB2  3  
ATOM 2754  H HB3  . GLN A 1 23 ? 3.038  -0.809  4.786   1.00 0.00 ? 23 GLN A HB3  3  
ATOM 2755  H HG2  . GLN A 1 23 ? 4.379  -2.718  4.508   1.00 0.00 ? 23 GLN A HG2  3  
ATOM 2756  H HG3  . GLN A 1 23 ? 5.453  -2.247  5.823   1.00 0.00 ? 23 GLN A HG3  3  
ATOM 2757  H HE21 . GLN A 1 23 ? 4.780  -2.501  7.937   1.00 0.00 ? 23 GLN A HE21 3  
ATOM 2758  H HE22 . GLN A 1 23 ? 3.465  -3.543  8.375   1.00 0.00 ? 23 GLN A HE22 3  
ATOM 2759  N N    . PRO A 1 24 ? 6.310  0.791   6.618   1.00 0.00 ? 24 PRO A N    3  
ATOM 2760  C CA   . PRO A 1 24 ? 7.484  0.828   7.506   1.00 0.00 ? 24 PRO A CA   3  
ATOM 2761  C C    . PRO A 1 24 ? 7.963  -0.568  7.867   1.00 0.00 ? 24 PRO A C    3  
ATOM 2762  O O    . PRO A 1 24 ? 7.215  -1.375  8.420   1.00 0.00 ? 24 PRO A O    3  
ATOM 2763  C CB   . PRO A 1 24 ? 6.964  1.543   8.754   1.00 0.00 ? 24 PRO A CB   3  
ATOM 2764  C CG   . PRO A 1 24 ? 5.837  2.383   8.271   1.00 0.00 ? 24 PRO A CG   3  
ATOM 2765  C CD   . PRO A 1 24 ? 5.199  1.609   7.131   1.00 0.00 ? 24 PRO A CD   3  
ATOM 2766  H HA   . PRO A 1 24 ? 8.297  1.394   7.064   1.00 0.00 ? 24 PRO A HA   3  
ATOM 2767  H HB2  . PRO A 1 24 ? 6.618  0.831   9.487   1.00 0.00 ? 24 PRO A HB2  3  
ATOM 2768  H HB3  . PRO A 1 24 ? 7.749  2.164   9.192   1.00 0.00 ? 24 PRO A HB3  3  
ATOM 2769  H HG2  . PRO A 1 24 ? 5.124  2.551   9.065   1.00 0.00 ? 24 PRO A HG2  3  
ATOM 2770  H HG3  . PRO A 1 24 ? 6.213  3.316   7.907   1.00 0.00 ? 24 PRO A HG3  3  
ATOM 2771  H HD2  . PRO A 1 24 ? 4.403  0.982   7.497   1.00 0.00 ? 24 PRO A HD2  3  
ATOM 2772  H HD3  . PRO A 1 24 ? 4.843  2.281   6.366   1.00 0.00 ? 24 PRO A HD3  3  
ATOM 2773  N N    . GLY A 1 25 ? 9.209  -0.841  7.554   1.00 0.00 ? 25 GLY A N    3  
ATOM 2774  C CA   . GLY A 1 25 ? 9.770  -2.143  7.828   1.00 0.00 ? 25 GLY A CA   3  
ATOM 2775  C C    . GLY A 1 25 ? 10.089 -2.925  6.564   1.00 0.00 ? 25 GLY A C    3  
ATOM 2776  O O    . GLY A 1 25 ? 10.908 -3.826  6.592   1.00 0.00 ? 25 GLY A O    3  
ATOM 2777  H H    . GLY A 1 25 ? 9.759  -0.144  7.139   1.00 0.00 ? 25 GLY A H    3  
ATOM 2778  H HA2  . GLY A 1 25 ? 10.684 -2.006  8.398   1.00 0.00 ? 25 GLY A HA2  3  
ATOM 2779  H HA3  . GLY A 1 25 ? 9.063  -2.701  8.413   1.00 0.00 ? 25 GLY A HA3  3  
ATOM 2780  N N    . MET A 1 26 ? 9.420  -2.574  5.464   1.00 0.00 ? 26 MET A N    3  
ATOM 2781  C CA   . MET A 1 26 ? 9.615  -3.288  4.199   1.00 0.00 ? 26 MET A CA   3  
ATOM 2782  C C    . MET A 1 26 ? 10.926 -2.891  3.535   1.00 0.00 ? 26 MET A C    3  
ATOM 2783  O O    . MET A 1 26 ? 11.392 -1.753  3.669   1.00 0.00 ? 26 MET A O    3  
ATOM 2784  C CB   . MET A 1 26 ? 8.464  -3.057  3.235   1.00 0.00 ? 26 MET A CB   3  
ATOM 2785  C CG   . MET A 1 26 ? 7.162  -3.702  3.664   1.00 0.00 ? 26 MET A CG   3  
ATOM 2786  S SD   . MET A 1 26 ? 5.940  -3.705  2.339   1.00 0.00 ? 26 MET A SD   3  
ATOM 2787  C CE   . MET A 1 26 ? 4.700  -4.804  3.014   1.00 0.00 ? 26 MET A CE   3  
ATOM 2788  H H    . MET A 1 26 ? 8.786  -1.824  5.507   1.00 0.00 ? 26 MET A H    3  
ATOM 2789  H HA   . MET A 1 26 ? 9.661  -4.340  4.438   1.00 0.00 ? 26 MET A HA   3  
ATOM 2790  H HB2  . MET A 1 26 ? 8.301  -1.994  3.138   1.00 0.00 ? 26 MET A HB2  3  
ATOM 2791  H HB3  . MET A 1 26 ? 8.729  -3.457  2.278   1.00 0.00 ? 26 MET A HB3  3  
ATOM 2792  H HG2  . MET A 1 26 ? 7.352  -4.726  3.977   1.00 0.00 ? 26 MET A HG2  3  
ATOM 2793  H HG3  . MET A 1 26 ? 6.762  -3.144  4.503   1.00 0.00 ? 26 MET A HG3  3  
ATOM 2794  H HE1  . MET A 1 26 ? 3.890  -4.927  2.308   1.00 0.00 ? 26 MET A HE1  3  
ATOM 2795  H HE2  . MET A 1 26 ? 4.318  -4.387  3.932   1.00 0.00 ? 26 MET A HE2  3  
ATOM 2796  H HE3  . MET A 1 26 ? 5.152  -5.764  3.207   1.00 0.00 ? 26 MET A HE3  3  
ATOM 2797  N N    . ARG A 1 27 ? 11.504 -3.835  2.815   1.00 0.00 ? 27 ARG A N    3  
ATOM 2798  C CA   . ARG A 1 27 ? 12.768 -3.619  2.113   1.00 0.00 ? 27 ARG A CA   3  
ATOM 2799  C C    . ARG A 1 27 ? 12.575 -2.932  0.769   1.00 0.00 ? 27 ARG A C    3  
ATOM 2800  O O    . ARG A 1 27 ? 11.496 -2.958  0.174   1.00 0.00 ? 27 ARG A O    3  
ATOM 2801  C CB   . ARG A 1 27 ? 13.528 -4.926  1.920   1.00 0.00 ? 27 ARG A CB   3  
ATOM 2802  C CG   . ARG A 1 27 ? 14.648 -5.139  2.926   1.00 0.00 ? 27 ARG A CG   3  
ATOM 2803  C CD   . ARG A 1 27 ? 15.553 -6.284  2.508   1.00 0.00 ? 27 ARG A CD   3  
ATOM 2804  N NE   . ARG A 1 27 ? 16.681 -6.447  3.422   1.00 0.00 ? 27 ARG A NE   3  
ATOM 2805  C CZ   . ARG A 1 27 ? 17.258 -7.600  3.714   1.00 0.00 ? 27 ARG A CZ   3  
ATOM 2806  N NH1  . ARG A 1 27 ? 16.843 -8.724  3.129   1.00 0.00 ? 27 ARG A NH1  3  
ATOM 2807  N NH2  . ARG A 1 27 ? 18.296 -7.626  4.543   1.00 0.00 ? 27 ARG A NH2  3  
ATOM 2808  H H    . ARG A 1 27 ? 11.083 -4.716  2.801   1.00 0.00 ? 27 ARG A H    3  
ATOM 2809  H HA   . ARG A 1 27 ? 13.368 -2.964  2.739   1.00 0.00 ? 27 ARG A HA   3  
ATOM 2810  H HB2  . ARG A 1 27 ? 12.837 -5.739  2.001   1.00 0.00 ? 27 ARG A HB2  3  
ATOM 2811  H HB3  . ARG A 1 27 ? 13.963 -4.927  0.931   1.00 0.00 ? 27 ARG A HB3  3  
ATOM 2812  H HG2  . ARG A 1 27 ? 15.236 -4.225  3.006   1.00 0.00 ? 27 ARG A HG2  3  
ATOM 2813  H HG3  . ARG A 1 27 ? 14.209 -5.363  3.893   1.00 0.00 ? 27 ARG A HG3  3  
ATOM 2814  H HD2  . ARG A 1 27 ? 14.967 -7.185  2.499   1.00 0.00 ? 27 ARG A HD2  3  
ATOM 2815  H HD3  . ARG A 1 27 ? 15.929 -6.068  1.520   1.00 0.00 ? 27 ARG A HD3  3  
ATOM 2816  H HE   . ARG A 1 27 ? 17.033 -5.629  3.859   1.00 0.00 ? 27 ARG A HE   3  
ATOM 2817  H HH11 . ARG A 1 27 ? 16.073 -8.705  2.483   1.00 0.00 ? 27 ARG A HH11 3  
ATOM 2818  H HH12 . ARG A 1 27 ? 17.274 -9.619  3.352   1.00 0.00 ? 27 ARG A HH12 3  
ATOM 2819  H HH21 . ARG A 1 27 ? 18.622 -6.779  4.962   1.00 0.00 ? 27 ARG A HH21 3  
ATOM 2820  H HH22 . ARG A 1 27 ? 18.742 -8.508  4.761   1.00 0.00 ? 27 ARG A HH22 3  
ATOM 2821  N N    . VAL A 1 28 ? 13.663 -2.332  0.294   1.00 0.00 ? 28 VAL A N    3  
ATOM 2822  C CA   . VAL A 1 28 ? 13.665 -1.606  -0.967  1.00 0.00 ? 28 VAL A CA   3  
ATOM 2823  C C    . VAL A 1 28 ? 14.966 -1.823  -1.728  1.00 0.00 ? 28 VAL A C    3  
ATOM 2824  O O    . VAL A 1 28 ? 16.003 -2.145  -1.125  1.00 0.00 ? 28 VAL A O    3  
ATOM 2825  C CB   . VAL A 1 28 ? 13.478 -0.070  -0.759  1.00 0.00 ? 28 VAL A CB   3  
ATOM 2826  C CG1  . VAL A 1 28 ? 12.132 0.228   -0.090  1.00 0.00 ? 28 VAL A CG1  3  
ATOM 2827  C CG2  . VAL A 1 28 ? 14.644 0.493   0.040   1.00 0.00 ? 28 VAL A CG2  3  
ATOM 2828  H H    . VAL A 1 28 ? 14.494 -2.394  0.831   1.00 0.00 ? 28 VAL A H    3  
ATOM 2829  H HA   . VAL A 1 28 ? 12.848 -1.972  -1.561  1.00 0.00 ? 28 VAL A HA   3  
ATOM 2830  H HB   . VAL A 1 28 ? 13.466 0.391   -1.724  1.00 0.00 ? 28 VAL A HB   3  
ATOM 2831  H HG11 . VAL A 1 28 ? 11.323 -0.192  -0.683  1.00 0.00 ? 28 VAL A HG11 3  
ATOM 2832  H HG12 . VAL A 1 28 ? 12.001 1.295   -0.009  1.00 0.00 ? 28 VAL A HG12 3  
ATOM 2833  H HG13 . VAL A 1 28 ? 12.112 -0.212  0.899   1.00 0.00 ? 28 VAL A HG13 3  
ATOM 2834  H HG21 . VAL A 1 28 ? 14.663 0.033   1.022   1.00 0.00 ? 28 VAL A HG21 3  
ATOM 2835  H HG22 . VAL A 1 28 ? 14.500 1.567   0.151   1.00 0.00 ? 28 VAL A HG22 3  
ATOM 2836  H HG23 . VAL A 1 28 ? 15.568 0.297   -0.479  1.00 0.00 ? 28 VAL A HG23 3  
ATOM 2837  N N    . ARG A 1 29 ? 14.916 -1.670  -3.041  1.00 0.00 ? 29 ARG A N    3  
ATOM 2838  C CA   . ARG A 1 29 ? 16.115 -1.755  -3.883  1.00 0.00 ? 29 ARG A CA   3  
ATOM 2839  C C    . ARG A 1 29 ? 16.269 -0.492  -4.726  1.00 0.00 ? 29 ARG A C    3  
ATOM 2840  O O    . ARG A 1 29 ? 15.325 -0.039  -5.358  1.00 0.00 ? 29 ARG A O    3  
ATOM 2841  C CB   . ARG A 1 29 ? 16.051 -2.981  -4.797  1.00 0.00 ? 29 ARG A CB   3  
ATOM 2842  C CG   . ARG A 1 29 ? 17.313 -3.164  -5.652  1.00 0.00 ? 29 ARG A CG   3  
ATOM 2843  C CD   . ARG A 1 29 ? 17.236 -4.408  -6.522  1.00 0.00 ? 29 ARG A CD   3  
ATOM 2844  N NE   . ARG A 1 29 ? 16.186 -4.345  -7.520  1.00 0.00 ? 29 ARG A NE   3  
ATOM 2845  C CZ   . ARG A 1 29 ? 16.346 -4.653  -8.823  1.00 0.00 ? 29 ARG A CZ   3  
ATOM 2846  N NH1  . ARG A 1 29 ? 17.547 -5.024  -9.264  1.00 0.00 ? 29 ARG A NH1  3  
ATOM 2847  N NH2  . ARG A 1 29 ? 15.325 -4.591  -9.649  1.00 0.00 ? 29 ARG A NH2  3  
ATOM 2848  H H    . ARG A 1 29 ? 14.045 -1.505  -3.468  1.00 0.00 ? 29 ARG A H    3  
ATOM 2849  H HA   . ARG A 1 29 ? 16.968 -1.835  -3.229  1.00 0.00 ? 29 ARG A HA   3  
ATOM 2850  H HB2  . ARG A 1 29 ? 15.947 -3.869  -4.184  1.00 0.00 ? 29 ARG A HB2  3  
ATOM 2851  H HB3  . ARG A 1 29 ? 15.212 -2.894  -5.447  1.00 0.00 ? 29 ARG A HB3  3  
ATOM 2852  H HG2  . ARG A 1 29 ? 17.429 -2.298  -6.296  1.00 0.00 ? 29 ARG A HG2  3  
ATOM 2853  H HG3  . ARG A 1 29 ? 18.160 -3.244  -5.004  1.00 0.00 ? 29 ARG A HG3  3  
ATOM 2854  H HD2  . ARG A 1 29 ? 18.197 -4.538  -7.013  1.00 0.00 ? 29 ARG A HD2  3  
ATOM 2855  H HD3  . ARG A 1 29 ? 17.063 -5.268  -5.874  1.00 0.00 ? 29 ARG A HD3  3  
ATOM 2856  H HE   . ARG A 1 29 ? 15.294 -4.053  -7.235  1.00 0.00 ? 29 ARG A HE   3  
ATOM 2857  H HH11 . ARG A 1 29 ? 18.332 -5.063  -8.634  1.00 0.00 ? 29 ARG A HH11 3  
ATOM 2858  H HH12 . ARG A 1 29 ? 17.662 -5.256  -10.232 1.00 0.00 ? 29 ARG A HH12 3  
ATOM 2859  H HH21 . ARG A 1 29 ? 14.410 -4.293  -9.318  1.00 0.00 ? 29 ARG A HH21 3  
ATOM 2860  H HH22 . ARG A 1 29 ? 15.433 -4.836  -10.623 1.00 0.00 ? 29 ARG A HH22 3  
ATOM 2861  N N    . MET A 1 30 ? 17.469 0.064   -4.734  1.00 0.00 ? 30 MET A N    3  
ATOM 2862  C CA   . MET A 1 30 ? 17.743 1.286   -5.488  1.00 0.00 ? 30 MET A CA   3  
ATOM 2863  C C    . MET A 1 30 ? 17.984 0.980   -6.958  1.00 0.00 ? 30 MET A C    3  
ATOM 2864  O O    . MET A 1 30 ? 18.824 0.145   -7.305  1.00 0.00 ? 30 MET A O    3  
ATOM 2865  C CB   . MET A 1 30 ? 18.955 1.992   -4.888  1.00 0.00 ? 30 MET A CB   3  
ATOM 2866  C CG   . MET A 1 30 ? 19.248 3.345   -5.522  1.00 0.00 ? 30 MET A CG   3  
ATOM 2867  S SD   . MET A 1 30 ? 17.900 4.526   -5.287  1.00 0.00 ? 30 MET A SD   3  
ATOM 2868  C CE   . MET A 1 30 ? 18.585 5.959   -6.105  1.00 0.00 ? 30 MET A CE   3  
ATOM 2869  H H    . MET A 1 30 ? 18.204 -0.374  -4.239  1.00 0.00 ? 30 MET A H    3  
ATOM 2870  H HA   . MET A 1 30 ? 16.878 1.933   -5.408  1.00 0.00 ? 30 MET A HA   3  
ATOM 2871  H HB2  . MET A 1 30 ? 18.776 2.144   -3.830  1.00 0.00 ? 30 MET A HB2  3  
ATOM 2872  H HB3  . MET A 1 30 ? 19.826 1.372   -5.006  1.00 0.00 ? 30 MET A HB3  3  
ATOM 2873  H HG2  . MET A 1 30 ? 20.149 3.749   -5.078  1.00 0.00 ? 30 MET A HG2  3  
ATOM 2874  H HG3  . MET A 1 30 ? 19.402 3.189   -6.579  1.00 0.00 ? 30 MET A HG3  3  
ATOM 2875  H HE1  . MET A 1 30 ? 19.508 6.256   -5.616  1.00 0.00 ? 30 MET A HE1  3  
ATOM 2876  H HE2  . MET A 1 30 ? 17.887 6.779   -6.055  1.00 0.00 ? 30 MET A HE2  3  
ATOM 2877  H HE3  . MET A 1 30 ? 18.793 5.723   -7.132  1.00 0.00 ? 30 MET A HE3  3  
ATOM 2878  N N    . LEU A 1 31 ? 17.232 1.634   -7.828  1.00 0.00 ? 31 LEU A N    3  
ATOM 2879  C CA   . LEU A 1 31 ? 17.307 1.355   -9.258  1.00 0.00 ? 31 LEU A CA   3  
ATOM 2880  C C    . LEU A 1 31 ? 18.267 2.278   -9.997  1.00 0.00 ? 31 LEU A C    3  
ATOM 2881  O O    . LEU A 1 31 ? 18.671 1.997   -11.137 1.00 0.00 ? 31 LEU A O    3  
ATOM 2882  C CB   . LEU A 1 31 ? 15.910 1.457   -9.901  1.00 0.00 ? 31 LEU A CB   3  
ATOM 2883  C CG   . LEU A 1 31 ? 14.881 0.459   -9.362  1.00 0.00 ? 31 LEU A CG   3  
ATOM 2884  C CD1  . LEU A 1 31 ? 13.540 0.712   -10.002 1.00 0.00 ? 31 LEU A CD1  3  
ATOM 2885  C CD2  . LEU A 1 31 ? 15.338 -0.971  -9.617  1.00 0.00 ? 31 LEU A CD2  3  
ATOM 2886  H H    . LEU A 1 31 ? 16.610 2.335   -7.509  1.00 0.00 ? 31 LEU A H    3  
ATOM 2887  H HA   . LEU A 1 31 ? 17.666 0.347   -9.374  1.00 0.00 ? 31 LEU A HA   3  
ATOM 2888  H HB2  . LEU A 1 31 ? 15.536 2.450   -9.723  1.00 0.00 ? 31 LEU A HB2  3  
ATOM 2889  H HB3  . LEU A 1 31 ? 16.007 1.298   -10.963 1.00 0.00 ? 31 LEU A HB3  3  
ATOM 2890  H HG   . LEU A 1 31 ? 14.778 0.587   -8.296  1.00 0.00 ? 31 LEU A HG   3  
ATOM 2891  H HD11 . LEU A 1 31 ? 12.785 0.044   -9.599  1.00 0.00 ? 31 LEU A HD11 3  
ATOM 2892  H HD12 . LEU A 1 31 ? 13.605 0.553   -11.065 1.00 0.00 ? 31 LEU A HD12 3  
ATOM 2893  H HD13 . LEU A 1 31 ? 13.249 1.734   -9.817  1.00 0.00 ? 31 LEU A HD13 3  
ATOM 2894  H HD21 . LEU A 1 31 ? 16.303 -1.136  -9.135  1.00 0.00 ? 31 LEU A HD21 3  
ATOM 2895  H HD22 . LEU A 1 31 ? 15.452 -1.127  -10.683 1.00 0.00 ? 31 LEU A HD22 3  
ATOM 2896  H HD23 . LEU A 1 31 ? 14.622 -1.666  -9.218  1.00 0.00 ? 31 LEU A HD23 3  
ATOM 2897  N N    . ASP A 1 32 ? 18.627 3.397   -9.375  1.00 0.00 ? 32 ASP A N    3  
ATOM 2898  C CA   . ASP A 1 32 ? 19.468 4.387   -10.030 1.00 0.00 ? 32 ASP A CA   3  
ATOM 2899  C C    . ASP A 1 32 ? 20.671 4.748   -9.161  1.00 0.00 ? 32 ASP A C    3  
ATOM 2900  O O    . ASP A 1 32 ? 20.717 4.415   -7.984  1.00 0.00 ? 32 ASP A O    3  
ATOM 2901  C CB   . ASP A 1 32 ? 18.692 5.683   -10.322 1.00 0.00 ? 32 ASP A CB   3  
ATOM 2902  C CG   . ASP A 1 32 ? 17.634 5.484   -11.382 1.00 0.00 ? 32 ASP A CG   3  
ATOM 2903  O OD1  . ASP A 1 32 ? 16.545 4.973   -11.072 1.00 0.00 ? 32 ASP A OD1  3  
ATOM 2904  O OD2  . ASP A 1 32 ? 17.877 5.872   -12.547 1.00 0.00 ? 32 ASP A OD2  3  
ATOM 2905  H H    . ASP A 1 32 ? 18.331 3.548   -8.440  1.00 0.00 ? 32 ASP A H    3  
ATOM 2906  H HA   . ASP A 1 32 ? 19.825 3.976   -10.956 1.00 0.00 ? 32 ASP A HA   3  
ATOM 2907  H HB2  . ASP A 1 32 ? 18.201 6.002   -9.417  1.00 0.00 ? 32 ASP A HB2  3  
ATOM 2908  H HB3  . ASP A 1 32 ? 19.380 6.434   -10.659 1.00 0.00 ? 32 ASP A HB3  3  
ATOM 2909  N N    . ASP A 1 33 ? 21.655 5.398   -9.768  1.00 0.00 ? 33 ASP A N    3  
ATOM 2910  C CA   . ASP A 1 33 ? 22.810 5.911   -9.043  1.00 0.00 ? 33 ASP A CA   3  
ATOM 2911  C C    . ASP A 1 33 ? 22.468 7.279   -8.470  1.00 0.00 ? 33 ASP A C    3  
ATOM 2912  O O    . ASP A 1 33 ? 22.084 8.182   -9.213  1.00 0.00 ? 33 ASP A O    3  
ATOM 2913  C CB   . ASP A 1 33 ? 24.036 6.016   -9.941  1.00 0.00 ? 33 ASP A CB   3  
ATOM 2914  C CG   . ASP A 1 33 ? 25.285 6.385   -9.171  1.00 0.00 ? 33 ASP A CG   3  
ATOM 2915  O OD1  . ASP A 1 33 ? 25.965 5.475   -8.641  1.00 0.00 ? 33 ASP A OD1  3  
ATOM 2916  O OD2  . ASP A 1 33 ? 25.607 7.589   -9.104  1.00 0.00 ? 33 ASP A OD2  3  
ATOM 2917  H H    . ASP A 1 33 ? 21.610 5.539   -10.742 1.00 0.00 ? 33 ASP A H    3  
ATOM 2918  H HA   . ASP A 1 33 ? 23.021 5.249   -8.229  1.00 0.00 ? 33 ASP A HA   3  
ATOM 2919  H HB2  . ASP A 1 33 ? 24.197 5.061   -10.436 1.00 0.00 ? 33 ASP A HB2  3  
ATOM 2920  H HB3  . ASP A 1 33 ? 23.857 6.772   -10.693 1.00 0.00 ? 33 ASP A HB3  3  
ATOM 2921  N N    . TYR A 1 34 ? 22.610 7.454   -7.170  1.00 0.00 ? 34 TYR A N    3  
ATOM 2922  C CA   . TYR A 1 34 ? 22.207 8.685   -6.524  1.00 0.00 ? 34 TYR A CA   3  
ATOM 2923  C C    . TYR A 1 34 ? 23.128 8.995   -5.345  1.00 0.00 ? 34 TYR A C    3  
ATOM 2924  O O    . TYR A 1 34 ? 22.903 8.513   -4.221  1.00 0.00 ? 34 TYR A O    3  
ATOM 2925  C CB   . TYR A 1 34 ? 20.739 8.568   -6.085  1.00 0.00 ? 34 TYR A CB   3  
ATOM 2926  C CG   . TYR A 1 34 ? 20.093 9.857   -5.613  1.00 0.00 ? 34 TYR A CG   3  
ATOM 2927  C CD1  . TYR A 1 34 ? 19.990 10.951  -6.474  1.00 0.00 ? 34 TYR A CD1  3  
ATOM 2928  C CD2  . TYR A 1 34 ? 19.551 9.955   -4.348  1.00 0.00 ? 34 TYR A CD2  3  
ATOM 2929  C CE1  . TYR A 1 34 ? 19.371 12.107  -6.059  1.00 0.00 ? 34 TYR A CE1  3  
ATOM 2930  C CE2  . TYR A 1 34 ? 18.940 11.114  -3.922  1.00 0.00 ? 34 TYR A CE2  3  
ATOM 2931  C CZ   . TYR A 1 34 ? 18.854 12.198  -4.781  1.00 0.00 ? 34 TYR A CZ   3  
ATOM 2932  O OH   . TYR A 1 34 ? 18.214 13.347  -4.371  1.00 0.00 ? 34 TYR A OH   3  
ATOM 2933  H H    . TYR A 1 34 ? 23.009 6.722   -6.633  1.00 0.00 ? 34 TYR A H    3  
ATOM 2934  H HA   . TYR A 1 34 ? 22.292 9.485   -7.255  1.00 0.00 ? 34 TYR A HA   3  
ATOM 2935  H HB2  . TYR A 1 34 ? 20.148 8.186   -6.900  1.00 0.00 ? 34 TYR A HB2  3  
ATOM 2936  H HB3  . TYR A 1 34 ? 20.688 7.876   -5.260  1.00 0.00 ? 34 TYR A HB3  3  
ATOM 2937  H HD1  . TYR A 1 34 ? 20.410 10.889  -7.461  1.00 0.00 ? 34 TYR A HD1  3  
ATOM 2938  H HD2  . TYR A 1 34 ? 19.628 9.108   -3.676  1.00 0.00 ? 34 TYR A HD2  3  
ATOM 2939  H HE1  . TYR A 1 34 ? 19.292 12.949  -6.732  1.00 0.00 ? 34 TYR A HE1  3  
ATOM 2940  H HE2  . TYR A 1 34 ? 18.545 11.174  -2.912  1.00 0.00 ? 34 TYR A HE2  3  
ATOM 2941  H HH   . TYR A 1 34 ? 18.426 13.519  -3.446  1.00 0.00 ? 34 TYR A HH   3  
ATOM 2942  N N    . GLU A 1 35 ? 24.168 9.780   -5.618  1.00 0.00 ? 35 GLU A N    3  
ATOM 2943  C CA   . GLU A 1 35 ? 25.118 10.200  -4.607  1.00 0.00 ? 35 GLU A CA   3  
ATOM 2944  C C    . GLU A 1 35 ? 25.816 9.015   -3.946  1.00 0.00 ? 35 GLU A C    3  
ATOM 2945  O O    . GLU A 1 35 ? 26.581 8.287   -4.590  1.00 0.00 ? 35 GLU A O    3  
ATOM 2946  C CB   . GLU A 1 35 ? 24.437 11.080  -3.568  1.00 0.00 ? 35 GLU A CB   3  
ATOM 2947  C CG   . GLU A 1 35 ? 23.924 12.394  -4.148  1.00 0.00 ? 35 GLU A CG   3  
ATOM 2948  C CD   . GLU A 1 35 ? 25.017 13.189  -4.827  1.00 0.00 ? 35 GLU A CD   3  
ATOM 2949  O OE1  . GLU A 1 35 ? 25.878 13.767  -4.133  1.00 0.00 ? 35 GLU A OE1  3  
ATOM 2950  O OE2  . GLU A 1 35 ? 25.029 13.221  -6.083  1.00 0.00 ? 35 GLU A OE2  3  
ATOM 2951  H H    . GLU A 1 35 ? 24.317 10.103  -6.544  1.00 0.00 ? 35 GLU A H    3  
ATOM 2952  H HA   . GLU A 1 35 ? 25.872 10.790  -5.113  1.00 0.00 ? 35 GLU A HA   3  
ATOM 2953  H HB2  . GLU A 1 35 ? 23.605 10.547  -3.156  1.00 0.00 ? 35 GLU A HB2  3  
ATOM 2954  H HB3  . GLU A 1 35 ? 25.136 11.311  -2.780  1.00 0.00 ? 35 GLU A HB3  3  
ATOM 2955  H HG2  . GLU A 1 35 ? 23.151 12.171  -4.873  1.00 0.00 ? 35 GLU A HG2  3  
ATOM 2956  H HG3  . GLU A 1 35 ? 23.499 12.992  -3.346  1.00 0.00 ? 35 GLU A HG3  3  
ATOM 2957  N N    . GLU A 1 36 ? 25.542 8.821   -2.668  1.00 0.00 ? 36 GLU A N    3  
ATOM 2958  C CA   . GLU A 1 36 ? 26.191 7.774   -1.886  1.00 0.00 ? 36 GLU A CA   3  
ATOM 2959  C C    . GLU A 1 36 ? 25.623 6.409   -2.224  1.00 0.00 ? 36 GLU A C    3  
ATOM 2960  O O    . GLU A 1 36 ? 26.269 5.373   -1.996  1.00 0.00 ? 36 GLU A O    3  
ATOM 2961  C CB   . GLU A 1 36 ? 26.004 8.072   -0.400  1.00 0.00 ? 36 GLU A CB   3  
ATOM 2962  C CG   . GLU A 1 36 ? 26.650 9.371   0.034   1.00 0.00 ? 36 GLU A CG   3  
ATOM 2963  C CD   . GLU A 1 36 ? 26.214 9.816   1.402   1.00 0.00 ? 36 GLU A CD   3  
ATOM 2964  O OE1  . GLU A 1 36 ? 26.625 9.193   2.400   1.00 0.00 ? 36 GLU A OE1  3  
ATOM 2965  O OE2  . GLU A 1 36 ? 25.484 10.816  1.485   1.00 0.00 ? 36 GLU A OE2  3  
ATOM 2966  H H    . GLU A 1 36 ? 24.912 9.401   -2.228  1.00 0.00 ? 36 GLU A H    3  
ATOM 2967  H HA   . GLU A 1 36 ? 27.247 7.795   -2.117  1.00 0.00 ? 36 GLU A HA   3  
ATOM 2968  H HB2  . GLU A 1 36 ? 24.958 8.130   -0.181  1.00 0.00 ? 36 GLU A HB2  3  
ATOM 2969  H HB3  . GLU A 1 36 ? 26.454 7.269   0.173   1.00 0.00 ? 36 GLU A HB3  3  
ATOM 2970  H HG2  . GLU A 1 36 ? 27.726 9.233   0.037   1.00 0.00 ? 36 GLU A HG2  3  
ATOM 2971  H HG3  . GLU A 1 36 ? 26.395 10.144  -0.672  1.00 0.00 ? 36 GLU A HG3  3  
ATOM 2972  N N    . ILE A 1 37 ? 24.429 6.391   -2.775  1.00 0.00 ? 37 ILE A N    3  
ATOM 2973  C CA   . ILE A 1 37 ? 23.763 5.148   -3.108  1.00 0.00 ? 37 ILE A CA   3  
ATOM 2974  C C    . ILE A 1 37 ? 23.981 4.809   -4.571  1.00 0.00 ? 37 ILE A C    3  
ATOM 2975  O O    . ILE A 1 37 ? 24.004 5.700   -5.433  1.00 0.00 ? 37 ILE A O    3  
ATOM 2976  C CB   . ILE A 1 37 ? 22.250 5.228   -2.821  1.00 0.00 ? 37 ILE A CB   3  
ATOM 2977  C CG1  . ILE A 1 37 ? 22.010 5.804   -1.423  1.00 0.00 ? 37 ILE A CG1  3  
ATOM 2978  C CG2  . ILE A 1 37 ? 21.598 3.873   -2.962  1.00 0.00 ? 37 ILE A CG2  3  
ATOM 2979  C CD1  . ILE A 1 37 ? 22.706 5.028   -0.312  1.00 0.00 ? 37 ILE A CD1  3  
ATOM 2980  H H    . ILE A 1 37 ? 23.960 7.234   -2.957  1.00 0.00 ? 37 ILE A H    3  
ATOM 2981  H HA   . ILE A 1 37 ? 24.183 4.366   -2.502  1.00 0.00 ? 37 ILE A HA   3  
ATOM 2982  H HB   . ILE A 1 37 ? 21.804 5.890   -3.546  1.00 0.00 ? 37 ILE A HB   3  
ATOM 2983  H HG12 . ILE A 1 37 ? 22.367 6.818   -1.392  1.00 0.00 ? 37 ILE A HG12 3  
ATOM 2984  H HG13 . ILE A 1 37 ? 20.949 5.784   -1.217  1.00 0.00 ? 37 ILE A HG13 3  
ATOM 2985  H HG21 . ILE A 1 37 ? 21.717 3.526   -3.976  1.00 0.00 ? 37 ILE A HG21 3  
ATOM 2986  H HG22 . ILE A 1 37 ? 20.538 3.941   -2.735  1.00 0.00 ? 37 ILE A HG22 3  
ATOM 2987  H HG23 . ILE A 1 37 ? 22.065 3.161   -2.290  1.00 0.00 ? 37 ILE A HG23 3  
ATOM 2988  H HD11 . ILE A 1 37 ? 22.488 5.495   0.631   1.00 0.00 ? 37 ILE A HD11 3  
ATOM 2989  H HD12 . ILE A 1 37 ? 23.776 5.040   -0.478  1.00 0.00 ? 37 ILE A HD12 3  
ATOM 2990  H HD13 . ILE A 1 37 ? 22.357 4.017   -0.298  1.00 0.00 ? 37 ILE A HD13 3  
ATOM 2991  N N    . SER A 1 38 ? 24.140 3.538   -4.857  1.00 0.00 ? 38 SER A N    3  
ATOM 2992  C CA   . SER A 1 38 ? 24.385 3.072   -6.211  1.00 0.00 ? 38 SER A CA   3  
ATOM 2993  C C    . SER A 1 38 ? 23.252 2.182   -6.678  1.00 0.00 ? 38 SER A C    3  
ATOM 2994  O O    . SER A 1 38 ? 22.509 1.637   -5.864  1.00 0.00 ? 38 SER A O    3  
ATOM 2995  C CB   . SER A 1 38 ? 25.709 2.289   -6.256  1.00 0.00 ? 38 SER A CB   3  
ATOM 2996  O OG   . SER A 1 38 ? 26.772 3.052   -5.719  1.00 0.00 ? 38 SER A OG   3  
ATOM 2997  H H    . SER A 1 38 ? 24.034 2.853   -4.136  1.00 0.00 ? 38 SER A H    3  
ATOM 2998  H HA   . SER A 1 38 ? 24.464 3.936   -6.860  1.00 0.00 ? 38 SER A HA   3  
ATOM 2999  H HB2  . SER A 1 38 ? 25.606 1.381   -5.669  1.00 0.00 ? 38 SER A HB2  3  
ATOM 3000  H HB3  . SER A 1 38 ? 25.939 2.038   -7.274  1.00 0.00 ? 38 SER A HB3  3  
ATOM 3001  H HG   . SER A 1 38 ? 26.522 3.981   -5.686  1.00 0.00 ? 38 SER A HG   3  
ATOM 3002  N N    . ALA A 1 39 ? 23.095 2.053   -7.977  1.00 0.00 ? 39 ALA A N    3  
ATOM 3003  C CA   . ALA A 1 39 ? 22.085 1.173   -8.534  1.00 0.00 ? 39 ALA A CA   3  
ATOM 3004  C C    . ALA A 1 39 ? 22.368 -0.245  -8.098  1.00 0.00 ? 39 ALA A C    3  
ATOM 3005  O O    . ALA A 1 39 ? 23.480 -0.753  -8.283  1.00 0.00 ? 39 ALA A O    3  
ATOM 3006  C CB   . ALA A 1 39 ? 22.049 1.287   -10.054 1.00 0.00 ? 39 ALA A CB   3  
ATOM 3007  H H    . ALA A 1 39 ? 23.672 2.547   -8.581  1.00 0.00 ? 39 ALA A H    3  
ATOM 3008  H HA   . ALA A 1 39 ? 21.134 1.485   -8.147  1.00 0.00 ? 39 ALA A HA   3  
ATOM 3009  H HB1  . ALA A 1 39 ? 21.807 2.310   -10.324 1.00 0.00 ? 39 ALA A HB1  3  
ATOM 3010  H HB2  . ALA A 1 39 ? 21.304 0.613   -10.445 1.00 0.00 ? 39 ALA A HB2  3  
ATOM 3011  H HB3  . ALA A 1 39 ? 23.021 1.026   -10.449 1.00 0.00 ? 39 ALA A HB3  3  
ATOM 3012  N N    . GLY A 1 40 ? 21.377 -0.897  -7.493  1.00 0.00 ? 40 GLY A N    3  
ATOM 3013  C CA   . GLY A 1 40 ? 21.568 -2.239  -6.988  1.00 0.00 ? 40 GLY A CA   3  
ATOM 3014  C C    . GLY A 1 40 ? 21.670 -2.306  -5.481  1.00 0.00 ? 40 GLY A C    3  
ATOM 3015  O O    . GLY A 1 40 ? 21.579 -3.394  -4.896  1.00 0.00 ? 40 GLY A O    3  
ATOM 3016  H H    . GLY A 1 40 ? 20.496 -0.460  -7.410  1.00 0.00 ? 40 GLY A H    3  
ATOM 3017  H HA2  . GLY A 1 40 ? 20.737 -2.866  -7.316  1.00 0.00 ? 40 GLY A HA2  3  
ATOM 3018  H HA3  . GLY A 1 40 ? 22.487 -2.630  -7.417  1.00 0.00 ? 40 GLY A HA3  3  
ATOM 3019  N N    . ASP A 1 41 ? 21.831 -1.162  -4.825  1.00 0.00 ? 41 ASP A N    3  
ATOM 3020  C CA   . ASP A 1 41 ? 21.856 -1.102  -3.368  1.00 0.00 ? 41 ASP A CA   3  
ATOM 3021  C C    . ASP A 1 41 ? 20.502 -1.510  -2.801  1.00 0.00 ? 41 ASP A C    3  
ATOM 3022  O O    . ASP A 1 41 ? 19.466 -1.243  -3.418  1.00 0.00 ? 41 ASP A O    3  
ATOM 3023  C CB   . ASP A 1 41 ? 22.204 0.300   -2.861  1.00 0.00 ? 41 ASP A CB   3  
ATOM 3024  C CG   . ASP A 1 41 ? 23.710 0.536   -2.725  1.00 0.00 ? 41 ASP A CG   3  
ATOM 3025  O OD1  . ASP A 1 41 ? 24.430 -0.413  -2.333  1.00 0.00 ? 41 ASP A OD1  3  
ATOM 3026  O OD2  . ASP A 1 41 ? 24.168 1.653   -2.998  1.00 0.00 ? 41 ASP A OD2  3  
ATOM 3027  H H    . ASP A 1 41 ? 21.968 -0.332  -5.331  1.00 0.00 ? 41 ASP A H    3  
ATOM 3028  H HA   . ASP A 1 41 ? 22.599 -1.803  -3.033  1.00 0.00 ? 41 ASP A HA   3  
ATOM 3029  H HB2  . ASP A 1 41 ? 21.829 1.031   -3.551  1.00 0.00 ? 41 ASP A HB2  3  
ATOM 3030  H HB3  . ASP A 1 41 ? 21.752 0.464   -1.882  1.00 0.00 ? 41 ASP A HB3  3  
ATOM 3031  N N    . GLU A 1 42 ? 20.498 -2.144  -1.645  1.00 0.00 ? 42 GLU A N    3  
ATOM 3032  C CA   . GLU A 1 42 ? 19.261 -2.581  -0.998  1.00 0.00 ? 42 GLU A CA   3  
ATOM 3033  C C    . GLU A 1 42 ? 19.229 -2.112  0.450   1.00 0.00 ? 42 GLU A C    3  
ATOM 3034  O O    . GLU A 1 42 ? 20.279 -1.938  1.089   1.00 0.00 ? 42 GLU A O    3  
ATOM 3035  C CB   . GLU A 1 42 ? 19.120 -4.091  -1.060  1.00 0.00 ? 42 GLU A CB   3  
ATOM 3036  C CG   . GLU A 1 42 ? 18.795 -4.645  -2.461  1.00 0.00 ? 42 GLU A CG   3  
ATOM 3037  C CD   . GLU A 1 42 ? 18.618 -6.147  -2.454  1.00 0.00 ? 42 GLU A CD   3  
ATOM 3038  O OE1  . GLU A 1 42 ? 17.845 -6.675  -1.640  1.00 0.00 ? 42 GLU A OE1  3  
ATOM 3039  O OE2  . GLU A 1 42 ? 19.263 -6.804  -3.297  1.00 0.00 ? 42 GLU A OE2  3  
ATOM 3040  H H    . GLU A 1 42 ? 21.343 -2.340  -1.200  1.00 0.00 ? 42 GLU A H    3  
ATOM 3041  H HA   . GLU A 1 42 ? 18.433 -2.123  -1.522  1.00 0.00 ? 42 GLU A HA   3  
ATOM 3042  H HB2  . GLU A 1 42 ? 20.044 -4.542  -0.753  1.00 0.00 ? 42 GLU A HB2  3  
ATOM 3043  H HB3  . GLU A 1 42 ? 18.329 -4.394  -0.377  1.00 0.00 ? 42 GLU A HB3  3  
ATOM 3044  H HG2  . GLU A 1 42 ? 17.868 -4.181  -2.803  1.00 0.00 ? 42 GLU A HG2  3  
ATOM 3045  H HG3  . GLU A 1 42 ? 19.598 -4.377  -3.118  1.00 0.00 ? 42 GLU A HG3  3  
ATOM 3046  N N    . GLY A 1 43 ? 18.035 -1.902  0.972   1.00 0.00 ? 43 GLY A N    3  
ATOM 3047  C CA   . GLY A 1 43 ? 17.884 -1.426  2.318   1.00 0.00 ? 43 GLY A CA   3  
ATOM 3048  C C    . GLY A 1 43 ? 16.486 -1.614  2.853   1.00 0.00 ? 43 GLY A C    3  
ATOM 3049  O O    . GLY A 1 43 ? 15.643 -2.265  2.210   1.00 0.00 ? 43 GLY A O    3  
ATOM 3050  H H    . GLY A 1 43 ? 17.218 -2.081  0.431   1.00 0.00 ? 43 GLY A H    3  
ATOM 3051  H HA2  . GLY A 1 43 ? 18.579 -1.963  2.956   1.00 0.00 ? 43 GLY A HA2  3  
ATOM 3052  H HA3  . GLY A 1 43 ? 18.128 -0.371  2.338   1.00 0.00 ? 43 GLY A HA3  3  
ATOM 3053  N N    . GLU A 1 44 ? 16.235 -1.048  3.999   1.00 0.00 ? 44 GLU A N    3  
ATOM 3054  C CA   . GLU A 1 44 ? 14.929 -1.175  4.646   1.00 0.00 ? 44 GLU A CA   3  
ATOM 3055  C C    . GLU A 1 44 ? 14.294 0.203   4.849   1.00 0.00 ? 44 GLU A C    3  
ATOM 3056  O O    . GLU A 1 44 ? 14.998 1.162   5.150   1.00 0.00 ? 44 GLU A O    3  
ATOM 3057  C CB   . GLU A 1 44 ? 15.099 -1.880  5.988   1.00 0.00 ? 44 GLU A CB   3  
ATOM 3058  C CG   . GLU A 1 44 ? 13.780 -2.237  6.649   1.00 0.00 ? 44 GLU A CG   3  
ATOM 3059  C CD   . GLU A 1 44 ? 13.941 -2.873  8.020   1.00 0.00 ? 44 GLU A CD   3  
ATOM 3060  O OE1  . GLU A 1 44 ? 14.641 -3.897  8.136   1.00 0.00 ? 44 GLU A OE1  3  
ATOM 3061  O OE2  . GLU A 1 44 ? 13.348 -2.341  8.973   1.00 0.00 ? 44 GLU A OE2  3  
ATOM 3062  H H    . GLU A 1 44 ? 16.918 -0.486  4.412   1.00 0.00 ? 44 GLU A H    3  
ATOM 3063  H HA   . GLU A 1 44 ? 14.296 -1.771  4.002   1.00 0.00 ? 44 GLU A HA   3  
ATOM 3064  H HB2  . GLU A 1 44 ? 15.665 -2.793  5.848   1.00 0.00 ? 44 GLU A HB2  3  
ATOM 3065  H HB3  . GLU A 1 44 ? 15.653 -1.237  6.658   1.00 0.00 ? 44 GLU A HB3  3  
ATOM 3066  H HG2  . GLU A 1 44 ? 13.197 -1.334  6.772   1.00 0.00 ? 44 GLU A HG2  3  
ATOM 3067  H HG3  . GLU A 1 44 ? 13.260 -2.924  6.015   1.00 0.00 ? 44 GLU A HG3  3  
ATOM 3068  N N    . PHE A 1 45 ? 12.988 0.282   4.707   1.00 0.00 ? 45 PHE A N    3  
ATOM 3069  C CA   . PHE A 1 45 ? 12.288 1.540   4.860   1.00 0.00 ? 45 PHE A CA   3  
ATOM 3070  C C    . PHE A 1 45 ? 11.956 1.769   6.340   1.00 0.00 ? 45 PHE A C    3  
ATOM 3071  O O    . PHE A 1 45 ? 11.218 1.003   6.949   1.00 0.00 ? 45 PHE A O    3  
ATOM 3072  C CB   . PHE A 1 45 ? 11.010 1.554   4.016   1.00 0.00 ? 45 PHE A CB   3  
ATOM 3073  C CG   . PHE A 1 45 ? 10.101 2.716   4.291   1.00 0.00 ? 45 PHE A CG   3  
ATOM 3074  C CD1  . PHE A 1 45 ? 10.451 4.003   3.921   1.00 0.00 ? 45 PHE A CD1  3  
ATOM 3075  C CD2  . PHE A 1 45 ? 8.890  2.514   4.923   1.00 0.00 ? 45 PHE A CD2  3  
ATOM 3076  C CE1  . PHE A 1 45 ? 9.613  5.062   4.181   1.00 0.00 ? 45 PHE A CE1  3  
ATOM 3077  C CE2  . PHE A 1 45 ? 8.040  3.575   5.184   1.00 0.00 ? 45 PHE A CE2  3  
ATOM 3078  C CZ   . PHE A 1 45 ? 8.403  4.846   4.813   1.00 0.00 ? 45 PHE A CZ   3  
ATOM 3079  H H    . PHE A 1 45 ? 12.462 -0.536  4.549   1.00 0.00 ? 45 PHE A H    3  
ATOM 3080  H HA   . PHE A 1 45 ? 12.937 2.333   4.530   1.00 0.00 ? 45 PHE A HA   3  
ATOM 3081  H HB2  . PHE A 1 45 ? 11.292 1.600   2.968   1.00 0.00 ? 45 PHE A HB2  3  
ATOM 3082  H HB3  . PHE A 1 45 ? 10.450 0.646   4.196   1.00 0.00 ? 45 PHE A HB3  3  
ATOM 3083  H HD1  . PHE A 1 45 ? 11.394 4.175   3.411   1.00 0.00 ? 45 PHE A HD1  3  
ATOM 3084  H HD2  . PHE A 1 45 ? 8.599  1.512   5.194   1.00 0.00 ? 45 PHE A HD2  3  
ATOM 3085  H HE1  . PHE A 1 45 ? 9.901  6.060   3.892   1.00 0.00 ? 45 PHE A HE1  3  
ATOM 3086  H HE2  . PHE A 1 45 ? 7.094  3.407   5.683   1.00 0.00 ? 45 PHE A HE2  3  
ATOM 3087  H HZ   . PHE A 1 45 ? 7.750  5.685   5.012   1.00 0.00 ? 45 PHE A HZ   3  
ATOM 3088  N N    . ARG A 1 46 ? 12.552 2.804   6.913   1.00 0.00 ? 46 ARG A N    3  
ATOM 3089  C CA   . ARG A 1 46 ? 12.370 3.102   8.338   1.00 0.00 ? 46 ARG A CA   3  
ATOM 3090  C C    . ARG A 1 46 ? 11.099 3.895   8.593   1.00 0.00 ? 46 ARG A C    3  
ATOM 3091  O O    . ARG A 1 46 ? 10.230 3.466   9.354   1.00 0.00 ? 46 ARG A O    3  
ATOM 3092  C CB   . ARG A 1 46 ? 13.604 3.858   8.855   1.00 0.00 ? 46 ARG A CB   3  
ATOM 3093  C CG   . ARG A 1 46 ? 14.866 3.024   8.924   1.00 0.00 ? 46 ARG A CG   3  
ATOM 3094  C CD   . ARG A 1 46 ? 14.842 2.063   10.109  1.00 0.00 ? 46 ARG A CD   3  
ATOM 3095  N NE   . ARG A 1 46 ? 13.938 0.923   9.922   1.00 0.00 ? 46 ARG A NE   3  
ATOM 3096  C CZ   . ARG A 1 46 ? 12.964 0.604   10.788  1.00 0.00 ? 46 ARG A CZ   3  
ATOM 3097  N NH1  . ARG A 1 46 ? 12.668 1.394   11.815  1.00 0.00 ? 46 ARG A NH1  3  
ATOM 3098  N NH2  . ARG A 1 46 ? 12.285 -0.539  10.614  1.00 0.00 ? 46 ARG A NH2  3  
ATOM 3099  H H    . ARG A 1 46 ? 13.131 3.380   6.381   1.00 0.00 ? 46 ARG A H    3  
ATOM 3100  H HA   . ARG A 1 46 ? 12.307 2.158   8.856   1.00 0.00 ? 46 ARG A HA   3  
ATOM 3101  H HB2  . ARG A 1 46 ? 13.784 4.691   8.185   1.00 0.00 ? 46 ARG A HB2  3  
ATOM 3102  H HB3  . ARG A 1 46 ? 13.381 4.236   9.840   1.00 0.00 ? 46 ARG A HB3  3  
ATOM 3103  H HG2  . ARG A 1 46 ? 14.984 2.454   8.019   1.00 0.00 ? 46 ARG A HG2  3  
ATOM 3104  H HG3  . ARG A 1 46 ? 15.716 3.692   9.042   1.00 0.00 ? 46 ARG A HG3  3  
ATOM 3105  H HD2  . ARG A 1 46 ? 15.844 1.680   10.257  1.00 0.00 ? 46 ARG A HD2  3  
ATOM 3106  H HD3  . ARG A 1 46 ? 14.548 2.609   11.000  1.00 0.00 ? 46 ARG A HD3  3  
ATOM 3107  H HE   . ARG A 1 46 ? 14.093 0.341   9.146   1.00 0.00 ? 46 ARG A HE   3  
ATOM 3108  H HH11 . ARG A 1 46 ? 13.183 2.237   11.940  1.00 0.00 ? 46 ARG A HH11 3  
ATOM 3109  H HH12 . ARG A 1 46 ? 11.925 1.164   12.461  1.00 0.00 ? 46 ARG A HH12 3  
ATOM 3110  H HH21 . ARG A 1 46 ? 12.518 -1.152  9.845   1.00 0.00 ? 46 ARG A HH21 3  
ATOM 3111  H HH22 . ARG A 1 46 ? 11.545 -0.794  11.249  1.00 0.00 ? 46 ARG A HH22 3  
ATOM 3112  N N    . GLN A 1 47 ? 10.973 5.038   7.922   1.00 0.00 ? 47 GLN A N    3  
ATOM 3113  C CA   . GLN A 1 47 ? 9.849  5.943   8.152   1.00 0.00 ? 47 GLN A CA   3  
ATOM 3114  C C    . GLN A 1 47 ? 9.876  7.076   7.127   1.00 0.00 ? 47 GLN A C    3  
ATOM 3115  O O    . GLN A 1 47 ? 10.845 7.234   6.389   1.00 0.00 ? 47 GLN A O    3  
ATOM 3116  C CB   . GLN A 1 47 ? 9.837  6.522   9.582   1.00 0.00 ? 47 GLN A CB   3  
ATOM 3117  C CG   . GLN A 1 47 ? 11.031 7.418   9.936   1.00 0.00 ? 47 GLN A CG   3  
ATOM 3118  C CD   . GLN A 1 47 ? 12.229 6.626   10.427  1.00 0.00 ? 47 GLN A CD   3  
ATOM 3119  O OE1  . GLN A 1 47 ? 12.078 5.544   11.005  1.00 0.00 ? 47 GLN A OE1  3  
ATOM 3120  N NE2  . GLN A 1 47 ? 13.405 7.163   10.241  1.00 0.00 ? 47 GLN A NE2  3  
ATOM 3121  H H    . GLN A 1 47 ? 11.618 5.230   7.208   1.00 0.00 ? 47 GLN A H    3  
ATOM 3122  H HA   . GLN A 1 47 ? 8.942  5.367   7.994   1.00 0.00 ? 47 GLN A HA   3  
ATOM 3123  H HB2  . GLN A 1 47 ? 8.941  7.107   9.716   1.00 0.00 ? 47 GLN A HB2  3  
ATOM 3124  H HB3  . GLN A 1 47 ? 9.819  5.701   10.283  1.00 0.00 ? 47 GLN A HB3  3  
ATOM 3125  H HG2  . GLN A 1 47 ? 11.310 7.958   9.058   1.00 0.00 ? 47 GLN A HG2  3  
ATOM 3126  H HG3  . GLN A 1 47 ? 10.720 8.099   10.712  1.00 0.00 ? 47 GLN A HG3  3  
ATOM 3127  H HE21 . GLN A 1 47 ? 13.446 8.052   9.805   1.00 0.00 ? 47 GLN A HE21 3  
ATOM 3128  H HE22 . GLN A 1 47 ? 14.211 6.674   10.549  1.00 0.00 ? 47 GLN A HE22 3  
ATOM 3129  N N    . SER A 1 48 ? 8.797  7.850   7.086   1.00 0.00 ? 48 SER A N    3  
ATOM 3130  C CA   . SER A 1 48 ? 8.682  8.965   6.152   1.00 0.00 ? 48 SER A CA   3  
ATOM 3131  C C    . SER A 1 48 ? 7.762  10.022  6.749   1.00 0.00 ? 48 SER A C    3  
ATOM 3132  O O    . SER A 1 48 ? 7.167  9.806   7.804   1.00 0.00 ? 48 SER A O    3  
ATOM 3133  C CB   . SER A 1 48 ? 8.150  8.469   4.816   1.00 0.00 ? 48 SER A CB   3  
ATOM 3134  O OG   . SER A 1 48 ? 6.995  7.673   4.995   1.00 0.00 ? 48 SER A OG   3  
ATOM 3135  H H    . SER A 1 48 ? 8.069  7.683   7.717   1.00 0.00 ? 48 SER A H    3  
ATOM 3136  H HA   . SER A 1 48 ? 9.665  9.390   6.023   1.00 0.00 ? 48 SER A HA   3  
ATOM 3137  H HB2  . SER A 1 48 ? 7.898  9.323   4.191   1.00 0.00 ? 48 SER A HB2  3  
ATOM 3138  H HB3  . SER A 1 48 ? 8.911  7.884   4.324   1.00 0.00 ? 48 SER A HB3  3  
ATOM 3139  H HG   . SER A 1 48 ? 6.240  8.089   4.553   1.00 0.00 ? 48 SER A HG   3  
ATOM 3140  N N    . ASN A 1 49 ? 7.637  11.156  6.085   1.00 0.00 ? 49 ASN A N    3  
ATOM 3141  C CA   . ASN A 1 49 ? 6.867  12.266  6.615   1.00 0.00 ? 49 ASN A CA   3  
ATOM 3142  C C    . ASN A 1 49 ? 5.700  12.620  5.701   1.00 0.00 ? 49 ASN A C    3  
ATOM 3143  O O    . ASN A 1 49 ? 5.905  13.190  4.628   1.00 0.00 ? 49 ASN A O    3  
ATOM 3144  C CB   . ASN A 1 49 ? 7.760  13.477  6.817   1.00 0.00 ? 49 ASN A CB   3  
ATOM 3145  C CG   . ASN A 1 49 ? 8.851  13.250  7.835   1.00 0.00 ? 49 ASN A CG   3  
ATOM 3146  O OD1  . ASN A 1 49 ? 8.701  13.566  9.016   1.00 0.00 ? 49 ASN A OD1  3  
ATOM 3147  N ND2  . ASN A 1 49 ? 9.962  12.661  7.381   1.00 0.00 ? 49 ASN A ND2  3  
ATOM 3148  H H    . ASN A 1 49 ? 8.062  11.254  5.206   1.00 0.00 ? 49 ASN A H    3  
ATOM 3149  H HA   . ASN A 1 49 ? 6.464  11.962  7.578   1.00 0.00 ? 49 ASN A HA   3  
ATOM 3150  H HB2  . ASN A 1 49 ? 8.231  13.726  5.871   1.00 0.00 ? 49 ASN A HB2  3  
ATOM 3151  H HB3  . ASN A 1 49 ? 7.163  14.313  7.136   1.00 0.00 ? 49 ASN A HB3  3  
ATOM 3152  H HD21 . ASN A 1 49 ? 9.994  12.425  6.433   1.00 0.00 ? 49 ASN A HD21 3  
ATOM 3153  H HD22 . ASN A 1 49 ? 10.700 12.496  8.018   1.00 0.00 ? 49 ASN A HD22 3  
ATOM 3154  N N    . ASN A 1 50 ? 4.496  12.260  6.131   1.00 0.00 ? 50 ASN A N    3  
ATOM 3155  C CA   . ASN A 1 50 ? 3.256  12.610  5.420   1.00 0.00 ? 50 ASN A CA   3  
ATOM 3156  C C    . ASN A 1 50 ? 3.248  12.083  3.983   1.00 0.00 ? 50 ASN A C    3  
ATOM 3157  O O    . ASN A 1 50 ? 2.858  10.942  3.723   1.00 0.00 ? 50 ASN A O    3  
ATOM 3158  C CB   . ASN A 1 50 ? 3.016  14.128  5.448   1.00 0.00 ? 50 ASN A CB   3  
ATOM 3159  C CG   . ASN A 1 50 ? 2.977  14.702  6.855   1.00 0.00 ? 50 ASN A CG   3  
ATOM 3160  O OD1  . ASN A 1 50 ? 4.000  15.097  7.409   1.00 0.00 ? 50 ASN A OD1  3  
ATOM 3161  N ND2  . ASN A 1 50 ? 1.790  14.767  7.438   1.00 0.00 ? 50 ASN A ND2  3  
ATOM 3162  H H    . ASN A 1 50 ? 4.430  11.724  6.947   1.00 0.00 ? 50 ASN A H    3  
ATOM 3163  H HA   . ASN A 1 50 ? 2.443  12.135  5.945   1.00 0.00 ? 50 ASN A HA   3  
ATOM 3164  H HB2  . ASN A 1 50 ? 3.815  14.603  4.904   1.00 0.00 ? 50 ASN A HB2  3  
ATOM 3165  H HB3  . ASN A 1 50 ? 2.073  14.348  4.949   1.00 0.00 ? 50 ASN A HB3  3  
ATOM 3166  H HD21 . ASN A 1 50 ? 1.004  14.438  6.935   1.00 0.00 ? 50 ASN A HD21 3  
ATOM 3167  H HD22 . ASN A 1 50 ? 1.727  15.145  8.336   1.00 0.00 ? 50 ASN A HD22 3  
ATOM 3168  N N    . GLY A 1 51 ? 3.665  12.917  3.046   1.00 0.00 ? 51 GLY A N    3  
ATOM 3169  C CA   . GLY A 1 51 ? 3.755  12.501  1.662   1.00 0.00 ? 51 GLY A CA   3  
ATOM 3170  C C    . GLY A 1 51 ? 4.792  13.304  0.906   1.00 0.00 ? 51 GLY A C    3  
ATOM 3171  O O    . GLY A 1 51 ? 4.590  13.688  -0.250  1.00 0.00 ? 51 GLY A O    3  
ATOM 3172  H H    . GLY A 1 51 ? 3.899  13.831  3.304   1.00 0.00 ? 51 GLY A H    3  
ATOM 3173  H HA2  . GLY A 1 51 ? 4.015  11.450  1.620   1.00 0.00 ? 51 GLY A HA2  3  
ATOM 3174  H HA3  . GLY A 1 51 ? 2.797  12.650  1.194   1.00 0.00 ? 51 GLY A HA3  3  
ATOM 3175  N N    . VAL A 1 52 ? 5.905  13.556  1.569   1.00 0.00 ? 52 VAL A N    3  
ATOM 3176  C CA   . VAL A 1 52 ? 6.955  14.373  0.993   1.00 0.00 ? 52 VAL A CA   3  
ATOM 3177  C C    . VAL A 1 52 ? 7.863  13.541  0.097   1.00 0.00 ? 52 VAL A C    3  
ATOM 3178  O O    . VAL A 1 52 ? 8.104  12.361  0.369   1.00 0.00 ? 52 VAL A O    3  
ATOM 3179  C CB   . VAL A 1 52 ? 7.789  15.070  2.085   1.00 0.00 ? 52 VAL A CB   3  
ATOM 3180  C CG1  . VAL A 1 52 ? 6.914  15.998  2.914   1.00 0.00 ? 52 VAL A CG1  3  
ATOM 3181  C CG2  . VAL A 1 52 ? 8.491  14.070  2.972   1.00 0.00 ? 52 VAL A CG2  3  
ATOM 3182  H H    . VAL A 1 52 ? 6.017  13.159  2.465   1.00 0.00 ? 52 VAL A H    3  
ATOM 3183  H HA   . VAL A 1 52 ? 6.484  15.147  0.393   1.00 0.00 ? 52 VAL A HA   3  
ATOM 3184  H HB   . VAL A 1 52 ? 8.542  15.671  1.593   1.00 0.00 ? 52 VAL A HB   3  
ATOM 3185  H HG11 . VAL A 1 52 ? 7.521  16.509  3.652   1.00 0.00 ? 52 VAL A HG11 3  
ATOM 3186  H HG12 . VAL A 1 52 ? 6.155  15.409  3.414   1.00 0.00 ? 52 VAL A HG12 3  
ATOM 3187  H HG13 . VAL A 1 52 ? 6.444  16.717  2.275   1.00 0.00 ? 52 VAL A HG13 3  
ATOM 3188  H HG21 . VAL A 1 52 ? 9.146  13.454  2.376   1.00 0.00 ? 52 VAL A HG21 3  
ATOM 3189  H HG22 . VAL A 1 52 ? 7.752  13.449  3.462   1.00 0.00 ? 52 VAL A HG22 3  
ATOM 3190  H HG23 . VAL A 1 52 ? 9.080  14.593  3.713   1.00 0.00 ? 52 VAL A HG23 3  
ATOM 3191  N N    . PRO A 1 53 ? 8.344  14.141  -1.011  1.00 0.00 ? 53 PRO A N    3  
ATOM 3192  C CA   . PRO A 1 53 ? 9.260  13.482  -1.945  1.00 0.00 ? 53 PRO A CA   3  
ATOM 3193  C C    . PRO A 1 53 ? 10.461 12.801  -1.255  1.00 0.00 ? 53 PRO A C    3  
ATOM 3194  O O    . PRO A 1 53 ? 10.788 11.668  -1.601  1.00 0.00 ? 53 PRO A O    3  
ATOM 3195  C CB   . PRO A 1 53 ? 9.749  14.614  -2.861  1.00 0.00 ? 53 PRO A CB   3  
ATOM 3196  C CG   . PRO A 1 53 ? 8.766  15.728  -2.725  1.00 0.00 ? 53 PRO A CG   3  
ATOM 3197  C CD   . PRO A 1 53 ? 8.001  15.509  -1.449  1.00 0.00 ? 53 PRO A CD   3  
ATOM 3198  H HA   . PRO A 1 53 ? 8.750  12.744  -2.522  1.00 0.00 ? 53 PRO A HA   3  
ATOM 3199  H HB2  . PRO A 1 53 ? 10.735 14.922  -2.552  1.00 0.00 ? 53 PRO A HB2  3  
ATOM 3200  H HB3  . PRO A 1 53 ? 9.782  14.251  -3.869  1.00 0.00 ? 53 PRO A HB3  3  
ATOM 3201  H HG2  . PRO A 1 53 ? 9.308  16.660  -2.668  1.00 0.00 ? 53 PRO A HG2  3  
ATOM 3202  H HG3  . PRO A 1 53 ? 8.100  15.739  -3.573  1.00 0.00 ? 53 PRO A HG3  3  
ATOM 3203  H HD2  . PRO A 1 53 ? 8.302  16.238  -0.707  1.00 0.00 ? 53 PRO A HD2  3  
ATOM 3204  H HD3  . PRO A 1 53 ? 6.944  15.602  -1.641  1.00 0.00 ? 53 PRO A HD3  3  
ATOM 3205  N N    . PRO A 1 54 ? 11.150 13.479  -0.313  1.00 0.00 ? 54 PRO A N    3  
ATOM 3206  C CA   . PRO A 1 54 ? 12.240 12.860  0.435   1.00 0.00 ? 54 PRO A CA   3  
ATOM 3207  C C    . PRO A 1 54 ? 11.740 11.727  1.327   1.00 0.00 ? 54 PRO A C    3  
ATOM 3208  O O    . PRO A 1 54 ? 10.715 11.854  2.013   1.00 0.00 ? 54 PRO A O    3  
ATOM 3209  C CB   . PRO A 1 54 ? 12.818 13.987  1.271   1.00 0.00 ? 54 PRO A CB   3  
ATOM 3210  C CG   . PRO A 1 54 ? 11.722 14.993  1.370   1.00 0.00 ? 54 PRO A CG   3  
ATOM 3211  C CD   . PRO A 1 54 ? 10.987 14.899  0.068   1.00 0.00 ? 54 PRO A CD   3  
ATOM 3212  H HA   . PRO A 1 54 ? 12.997 12.468  -0.226  1.00 0.00 ? 54 PRO A HA   3  
ATOM 3213  H HB2  . PRO A 1 54 ? 13.099 13.612  2.243   1.00 0.00 ? 54 PRO A HB2  3  
ATOM 3214  H HB3  . PRO A 1 54 ? 13.679 14.401  0.778   1.00 0.00 ? 54 PRO A HB3  3  
ATOM 3215  H HG2  . PRO A 1 54 ? 11.079 14.740  2.190   1.00 0.00 ? 54 PRO A HG2  3  
ATOM 3216  H HG3  . PRO A 1 54 ? 12.142 15.987  1.501   1.00 0.00 ? 54 PRO A HG3  3  
ATOM 3217  H HD2  . PRO A 1 54 ? 9.942  15.151  0.207   1.00 0.00 ? 54 PRO A HD2  3  
ATOM 3218  H HD3  . PRO A 1 54 ? 11.425 15.557  -0.663  1.00 0.00 ? 54 PRO A HD3  3  
ATOM 3219  N N    . VAL A 1 55 ? 12.463 10.618  1.322   1.00 0.00 ? 55 VAL A N    3  
ATOM 3220  C CA   . VAL A 1 55 ? 12.082 9.435   2.076   1.00 0.00 ? 55 VAL A CA   3  
ATOM 3221  C C    . VAL A 1 55 ? 13.263 8.958   2.912   1.00 0.00 ? 55 VAL A C    3  
ATOM 3222  O O    . VAL A 1 55 ? 14.418 8.979   2.444   1.00 0.00 ? 55 VAL A O    3  
ATOM 3223  C CB   . VAL A 1 55 ? 11.596 8.293   1.136   1.00 0.00 ? 55 VAL A CB   3  
ATOM 3224  C CG1  . VAL A 1 55 ? 12.657 7.920   0.116   1.00 0.00 ? 55 VAL A CG1  3  
ATOM 3225  C CG2  . VAL A 1 55 ? 11.180 7.071   1.942   1.00 0.00 ? 55 VAL A CG2  3  
ATOM 3226  H H    . VAL A 1 55 ? 13.303 10.622  0.819   1.00 0.00 ? 55 VAL A H    3  
ATOM 3227  H HA   . VAL A 1 55 ? 11.273 9.710   2.728   1.00 0.00 ? 55 VAL A HA   3  
ATOM 3228  H HB   . VAL A 1 55 ? 10.736 8.648   0.594   1.00 0.00 ? 55 VAL A HB   3  
ATOM 3229  H HG11 . VAL A 1 55 ? 13.551 7.596   0.630   1.00 0.00 ? 55 VAL A HG11 3  
ATOM 3230  H HG12 . VAL A 1 55 ? 12.883 8.776   -0.495  1.00 0.00 ? 55 VAL A HG12 3  
ATOM 3231  H HG13 . VAL A 1 55 ? 12.286 7.121   -0.510  1.00 0.00 ? 55 VAL A HG13 3  
ATOM 3232  H HG21 . VAL A 1 55 ? 10.336 7.317   2.566   1.00 0.00 ? 55 VAL A HG21 3  
ATOM 3233  H HG22 . VAL A 1 55 ? 11.995 6.751   2.562   1.00 0.00 ? 55 VAL A HG22 3  
ATOM 3234  H HG23 . VAL A 1 55 ? 10.912 6.267   1.258   1.00 0.00 ? 55 VAL A HG23 3  
ATOM 3235  N N    . GLN A 1 56 ? 12.996 8.523   4.133   1.00 0.00 ? 56 GLN A N    3  
ATOM 3236  C CA   . GLN A 1 56 ? 14.065 8.094   5.024   1.00 0.00 ? 56 GLN A CA   3  
ATOM 3237  C C    . GLN A 1 56 ? 14.243 6.584   4.928   1.00 0.00 ? 56 GLN A C    3  
ATOM 3238  O O    . GLN A 1 56 ? 13.428 5.811   5.411   1.00 0.00 ? 56 GLN A O    3  
ATOM 3239  C CB   . GLN A 1 56 ? 13.755 8.502   6.464   1.00 0.00 ? 56 GLN A CB   3  
ATOM 3240  C CG   . GLN A 1 56 ? 14.881 8.201   7.428   1.00 0.00 ? 56 GLN A CG   3  
ATOM 3241  C CD   . GLN A 1 56 ? 16.075 9.110   7.219   1.00 0.00 ? 56 GLN A CD   3  
ATOM 3242  O OE1  . GLN A 1 56 ? 16.181 10.171  7.839   1.00 0.00 ? 56 GLN A OE1  3  
ATOM 3243  N NE2  . GLN A 1 56 ? 16.991 8.710   6.356   1.00 0.00 ? 56 GLN A NE2  3  
ATOM 3244  H H    . GLN A 1 56 ? 12.063 8.433   4.423   1.00 0.00 ? 56 GLN A H    3  
ATOM 3245  H HA   . GLN A 1 56 ? 14.980 8.586   4.706   1.00 0.00 ? 56 GLN A HA   3  
ATOM 3246  H HB2  . GLN A 1 56 ? 13.549 9.571   6.496   1.00 0.00 ? 56 GLN A HB2  3  
ATOM 3247  H HB3  . GLN A 1 56 ? 12.873 7.976   6.796   1.00 0.00 ? 56 GLN A HB3  3  
ATOM 3248  H HG2  . GLN A 1 56 ? 14.519 8.322   8.436   1.00 0.00 ? 56 GLN A HG2  3  
ATOM 3249  H HG3  . GLN A 1 56 ? 15.190 7.181   7.291   1.00 0.00 ? 56 GLN A HG3  3  
ATOM 3250  H HE21 . GLN A 1 56 ? 16.855 7.853   5.901   1.00 0.00 ? 56 GLN A HE21 3  
ATOM 3251  H HE22 . GLN A 1 56 ? 17.779 9.292   6.211   1.00 0.00 ? 56 GLN A HE22 3  
ATOM 3252  N N    . VAL A 1 57 ? 15.322 6.171   4.290   1.00 0.00 ? 57 VAL A N    3  
ATOM 3253  C CA   . VAL A 1 57 ? 15.591 4.764   4.057   1.00 0.00 ? 57 VAL A CA   3  
ATOM 3254  C C    . VAL A 1 57 ? 16.920 4.369   4.668   1.00 0.00 ? 57 VAL A C    3  
ATOM 3255  O O    . VAL A 1 57 ? 17.893 5.133   4.610   1.00 0.00 ? 57 VAL A O    3  
ATOM 3256  C CB   . VAL A 1 57 ? 15.617 4.447   2.541   1.00 0.00 ? 57 VAL A CB   3  
ATOM 3257  C CG1  . VAL A 1 57 ? 15.962 2.994   2.291   1.00 0.00 ? 57 VAL A CG1  3  
ATOM 3258  C CG2  . VAL A 1 57 ? 14.279 4.786   1.918   1.00 0.00 ? 57 VAL A CG2  3  
ATOM 3259  H H    . VAL A 1 57 ? 15.974 6.830   3.964   1.00 0.00 ? 57 VAL A H    3  
ATOM 3260  H HA   . VAL A 1 57 ? 14.807 4.196   4.512   1.00 0.00 ? 57 VAL A HA   3  
ATOM 3261  H HB   . VAL A 1 57 ? 16.365 5.057   2.074   1.00 0.00 ? 57 VAL A HB   3  
ATOM 3262  H HG11 . VAL A 1 57 ? 15.227 2.360   2.779   1.00 0.00 ? 57 VAL A HG11 3  
ATOM 3263  H HG12 . VAL A 1 57 ? 16.945 2.783   2.679   1.00 0.00 ? 57 VAL A HG12 3  
ATOM 3264  H HG13 . VAL A 1 57 ? 15.945 2.803   1.227   1.00 0.00 ? 57 VAL A HG13 3  
ATOM 3265  H HG21 . VAL A 1 57 ? 14.052 5.830   2.082   1.00 0.00 ? 57 VAL A HG21 3  
ATOM 3266  H HG22 . VAL A 1 57 ? 13.510 4.174   2.369   1.00 0.00 ? 57 VAL A HG22 3  
ATOM 3267  H HG23 . VAL A 1 57 ? 14.327 4.588   0.862   1.00 0.00 ? 57 VAL A HG23 3  
ATOM 3268  N N    . PHE A 1 58 ? 16.948 3.202   5.289   1.00 0.00 ? 58 PHE A N    3  
ATOM 3269  C CA   . PHE A 1 58 ? 18.189 2.657   5.804   1.00 0.00 ? 58 PHE A CA   3  
ATOM 3270  C C    . PHE A 1 58 ? 18.814 1.740   4.766   1.00 0.00 ? 58 PHE A C    3  
ATOM 3271  O O    . PHE A 1 58 ? 18.278 0.682   4.471   1.00 0.00 ? 58 PHE A O    3  
ATOM 3272  C CB   . PHE A 1 58 ? 17.950 1.920   7.115   1.00 0.00 ? 58 PHE A CB   3  
ATOM 3273  C CG   . PHE A 1 58 ? 19.195 1.271   7.661   1.00 0.00 ? 58 PHE A CG   3  
ATOM 3274  C CD1  . PHE A 1 58 ? 20.228 2.048   8.179   1.00 0.00 ? 58 PHE A CD1  3  
ATOM 3275  C CD2  . PHE A 1 58 ? 19.336 -0.110  7.669   1.00 0.00 ? 58 PHE A CD2  3  
ATOM 3276  C CE1  . PHE A 1 58 ? 21.366 1.451   8.687   1.00 0.00 ? 58 PHE A CE1  3  
ATOM 3277  C CE2  . PHE A 1 58 ? 20.476 -0.706  8.174   1.00 0.00 ? 58 PHE A CE2  3  
ATOM 3278  C CZ   . PHE A 1 58 ? 21.499 0.082   8.683   1.00 0.00 ? 58 PHE A CZ   3  
ATOM 3279  H H    . PHE A 1 58 ? 16.126 2.689   5.394   1.00 0.00 ? 58 PHE A H    3  
ATOM 3280  H HA   . PHE A 1 58 ? 18.864 3.492   5.979   1.00 0.00 ? 58 PHE A HA   3  
ATOM 3281  H HB2  . PHE A 1 58 ? 17.582 2.616   7.863   1.00 0.00 ? 58 PHE A HB2  3  
ATOM 3282  H HB3  . PHE A 1 58 ? 17.217 1.136   6.960   1.00 0.00 ? 58 PHE A HB3  3  
ATOM 3283  H HD1  . PHE A 1 58 ? 20.138 3.124   8.189   1.00 0.00 ? 58 PHE A HD1  3  
ATOM 3284  H HD2  . PHE A 1 58 ? 18.544 -0.711  7.273   1.00 0.00 ? 58 PHE A HD2  3  
ATOM 3285  H HE1  . PHE A 1 58 ? 22.160 2.063   9.089   1.00 0.00 ? 58 PHE A HE1  3  
ATOM 3286  H HE2  . PHE A 1 58 ? 20.562 -1.780  8.166   1.00 0.00 ? 58 PHE A HE2  3  
ATOM 3287  H HZ   . PHE A 1 58 ? 22.383 -0.378  9.075   1.00 0.00 ? 58 PHE A HZ   3  
ATOM 3288  N N    . TRP A 1 59 ? 19.926 2.146   4.227   1.00 0.00 ? 59 TRP A N    3  
ATOM 3289  C CA   . TRP A 1 59 ? 20.578 1.359   3.210   1.00 0.00 ? 59 TRP A CA   3  
ATOM 3290  C C    . TRP A 1 59 ? 21.567 0.419   3.866   1.00 0.00 ? 59 TRP A C    3  
ATOM 3291  O O    . TRP A 1 59 ? 22.575 0.850   4.420   1.00 0.00 ? 59 TRP A O    3  
ATOM 3292  C CB   . TRP A 1 59 ? 21.258 2.268   2.197   1.00 0.00 ? 59 TRP A CB   3  
ATOM 3293  C CG   . TRP A 1 59 ? 20.272 3.104   1.430   1.00 0.00 ? 59 TRP A CG   3  
ATOM 3294  C CD1  . TRP A 1 59 ? 19.958 4.412   1.659   1.00 0.00 ? 59 TRP A CD1  3  
ATOM 3295  C CD2  . TRP A 1 59 ? 19.454 2.673   0.340   1.00 0.00 ? 59 TRP A CD2  3  
ATOM 3296  N NE1  . TRP A 1 59 ? 18.996 4.824   0.760   1.00 0.00 ? 59 TRP A NE1  3  
ATOM 3297  C CE2  . TRP A 1 59 ? 18.667 3.768   -0.049  1.00 0.00 ? 59 TRP A CE2  3  
ATOM 3298  C CE3  . TRP A 1 59 ? 19.300 1.463   -0.340  1.00 0.00 ? 59 TRP A CE3  3  
ATOM 3299  C CZ2  . TRP A 1 59 ? 17.752 3.703   -1.077  1.00 0.00 ? 59 TRP A CZ2  3  
ATOM 3300  C CZ3  . TRP A 1 59 ? 18.384 1.389   -1.367  1.00 0.00 ? 59 TRP A CZ3  3  
ATOM 3301  C CH2  . TRP A 1 59 ? 17.623 2.509   -1.738  1.00 0.00 ? 59 TRP A CH2  3  
ATOM 3302  H H    . TRP A 1 59 ? 20.339 2.980   4.570   1.00 0.00 ? 59 TRP A H    3  
ATOM 3303  H HA   . TRP A 1 59 ? 19.826 0.773   2.710   1.00 0.00 ? 59 TRP A HA   3  
ATOM 3304  H HB2  . TRP A 1 59 ? 21.926 2.936   2.720   1.00 0.00 ? 59 TRP A HB2  3  
ATOM 3305  H HB3  . TRP A 1 59 ? 21.817 1.669   1.487   1.00 0.00 ? 59 TRP A HB3  3  
ATOM 3306  H HD1  . TRP A 1 59 ? 20.413 5.041   2.419   1.00 0.00 ? 59 TRP A HD1  3  
ATOM 3307  H HE1  . TRP A 1 59 ? 18.607 5.726   0.707   1.00 0.00 ? 59 TRP A HE1  3  
ATOM 3308  H HE3  . TRP A 1 59 ? 19.894 0.593   -0.071  1.00 0.00 ? 59 TRP A HE3  3  
ATOM 3309  H HZ2  . TRP A 1 59 ? 17.156 4.545   -1.367  1.00 0.00 ? 59 TRP A HZ2  3  
ATOM 3310  H HZ3  . TRP A 1 59 ? 18.265 0.462   -1.913  1.00 0.00 ? 59 TRP A HZ3  3  
ATOM 3311  H HH2  . TRP A 1 59 ? 16.915 2.405   -2.538  1.00 0.00 ? 59 TRP A HH2  3  
ATOM 3312  N N    . GLU A 1 60 ? 21.268 -0.874  3.786   1.00 0.00 ? 60 GLU A N    3  
ATOM 3313  C CA   . GLU A 1 60 ? 21.990 -1.895  4.519   1.00 0.00 ? 60 GLU A CA   3  
ATOM 3314  C C    . GLU A 1 60 ? 23.358 -2.180  3.906   1.00 0.00 ? 60 GLU A C    3  
ATOM 3315  O O    . GLU A 1 60 ? 24.307 -2.517  4.608   1.00 0.00 ? 60 GLU A O    3  
ATOM 3316  C CB   . GLU A 1 60 ? 21.154 -3.171  4.606   1.00 0.00 ? 60 GLU A CB   3  
ATOM 3317  C CG   . GLU A 1 60 ? 19.805 -2.971  5.273   1.00 0.00 ? 60 GLU A CG   3  
ATOM 3318  C CD   . GLU A 1 60 ? 18.978 -4.240  5.299   1.00 0.00 ? 60 GLU A CD   3  
ATOM 3319  O OE1  . GLU A 1 60 ? 18.459 -4.647  4.240   1.00 0.00 ? 60 GLU A OE1  3  
ATOM 3320  O OE2  . GLU A 1 60 ? 18.855 -4.831  6.386   1.00 0.00 ? 60 GLU A OE2  3  
ATOM 3321  H H    . GLU A 1 60 ? 20.561 -1.134  3.175   1.00 0.00 ? 60 GLU A H    3  
ATOM 3322  H HA   . GLU A 1 60 ? 22.130 -1.518  5.520   1.00 0.00 ? 60 GLU A HA   3  
ATOM 3323  H HB2  . GLU A 1 60 ? 20.968 -3.538  3.594   1.00 0.00 ? 60 GLU A HB2  3  
ATOM 3324  H HB3  . GLU A 1 60 ? 21.705 -3.918  5.158   1.00 0.00 ? 60 GLU A HB3  3  
ATOM 3325  H HG2  . GLU A 1 60 ? 19.961 -2.637  6.283   1.00 0.00 ? 60 GLU A HG2  3  
ATOM 3326  H HG3  . GLU A 1 60 ? 19.251 -2.217  4.727   1.00 0.00 ? 60 GLU A HG3  3  
ATOM 3327  N N    . SER A 1 61 ? 23.450 -2.031  2.602   1.00 0.00 ? 61 SER A N    3  
ATOM 3328  C CA   . SER A 1 61 ? 24.697 -2.234  1.891   1.00 0.00 ? 61 SER A CA   3  
ATOM 3329  C C    . SER A 1 61 ? 25.722 -1.162  2.255   1.00 0.00 ? 61 SER A C    3  
ATOM 3330  O O    . SER A 1 61 ? 26.929 -1.408  2.309   1.00 0.00 ? 61 SER A O    3  
ATOM 3331  C CB   . SER A 1 61 ? 24.430 -2.233  0.384   1.00 0.00 ? 61 SER A CB   3  
ATOM 3332  O OG   . SER A 1 61 ? 23.561 -1.179  0.036   1.00 0.00 ? 61 SER A OG   3  
ATOM 3333  H H    . SER A 1 61 ? 22.649 -1.787  2.096   1.00 0.00 ? 61 SER A H    3  
ATOM 3334  H HA   . SER A 1 61 ? 25.083 -3.191  2.167   1.00 0.00 ? 61 SER A HA   3  
ATOM 3335  H HB2  . SER A 1 61 ? 25.368 -2.098  -0.131  1.00 0.00 ? 61 SER A HB2  3  
ATOM 3336  H HB3  . SER A 1 61 ? 23.985 -3.176  0.093   1.00 0.00 ? 61 SER A HB3  3  
ATOM 3337  H HG   . SER A 1 61 ? 23.865 -0.778  -0.800  1.00 0.00 ? 61 SER A HG   3  
ATOM 3338  N N    . THR A 1 62 ? 25.241 0.050   2.484   1.00 0.00 ? 62 THR A N    3  
ATOM 3339  C CA   . THR A 1 62 ? 26.090 1.138   2.936   1.00 0.00 ? 62 THR A CA   3  
ATOM 3340  C C    . THR A 1 62 ? 26.241 1.092   4.455   1.00 0.00 ? 62 THR A C    3  
ATOM 3341  O O    . THR A 1 62 ? 27.351 1.139   4.994   1.00 0.00 ? 62 THR A O    3  
ATOM 3342  C CB   . THR A 1 62 ? 25.495 2.497   2.535   1.00 0.00 ? 62 THR A CB   3  
ATOM 3343  O OG1  . THR A 1 62 ? 24.605 2.308   1.419   1.00 0.00 ? 62 THR A OG1  3  
ATOM 3344  C CG2  . THR A 1 62 ? 26.582 3.487   2.163   1.00 0.00 ? 62 THR A CG2  3  
ATOM 3345  H H    . THR A 1 62 ? 24.285 0.230   2.332   1.00 0.00 ? 62 THR A H    3  
ATOM 3346  H HA   . THR A 1 62 ? 27.053 1.030   2.459   1.00 0.00 ? 62 THR A HA   3  
ATOM 3347  H HB   . THR A 1 62 ? 24.938 2.881   3.372   1.00 0.00 ? 62 THR A HB   3  
ATOM 3348  H HG1  . THR A 1 62 ? 25.083 2.466   0.588   1.00 0.00 ? 62 THR A HG1  3  
ATOM 3349  H HG21 . THR A 1 62 ? 26.117 4.430   1.909   1.00 0.00 ? 62 THR A HG21 3  
ATOM 3350  H HG22 . THR A 1 62 ? 27.132 3.112   1.307   1.00 0.00 ? 62 THR A HG22 3  
ATOM 3351  H HG23 . THR A 1 62 ? 27.246 3.623   2.993   1.00 0.00 ? 62 THR A HG23 3  
ATOM 3352  N N    . GLY A 1 63 ? 25.109 1.009   5.137   1.00 0.00 ? 63 GLY A N    3  
ATOM 3353  C CA   . GLY A 1 63 ? 25.085 0.862   6.569   1.00 0.00 ? 63 GLY A CA   3  
ATOM 3354  C C    . GLY A 1 63 ? 24.621 2.124   7.271   1.00 0.00 ? 63 GLY A C    3  
ATOM 3355  O O    . GLY A 1 63 ? 24.734 2.251   8.488   1.00 0.00 ? 63 GLY A O    3  
ATOM 3356  H H    . GLY A 1 63 ? 24.251 1.074   4.626   1.00 0.00 ? 63 GLY A H    3  
ATOM 3357  H HA2  . GLY A 1 63 ? 24.410 0.048   6.822   1.00 0.00 ? 63 GLY A HA2  3  
ATOM 3358  H HA3  . GLY A 1 63 ? 26.091 0.617   6.906   1.00 0.00 ? 63 GLY A HA3  3  
ATOM 3359  N N    . ARG A 1 64 ? 24.088 3.060   6.505   1.00 0.00 ? 64 ARG A N    3  
ATOM 3360  C CA   . ARG A 1 64 ? 23.612 4.316   7.052   1.00 0.00 ? 64 ARG A CA   3  
ATOM 3361  C C    . ARG A 1 64 ? 22.259 4.660   6.469   1.00 0.00 ? 64 ARG A C    3  
ATOM 3362  O O    . ARG A 1 64 ? 21.844 4.093   5.448   1.00 0.00 ? 64 ARG A O    3  
ATOM 3363  C CB   . ARG A 1 64 ? 24.585 5.474   6.769   1.00 0.00 ? 64 ARG A CB   3  
ATOM 3364  C CG   . ARG A 1 64 ? 25.884 5.399   7.557   1.00 0.00 ? 64 ARG A CG   3  
ATOM 3365  C CD   . ARG A 1 64 ? 26.972 4.668   6.792   1.00 0.00 ? 64 ARG A CD   3  
ATOM 3366  N NE   . ARG A 1 64 ? 27.374 5.395   5.585   1.00 0.00 ? 64 ARG A NE   3  
ATOM 3367  C CZ   . ARG A 1 64 ? 28.427 5.062   4.846   1.00 0.00 ? 64 ARG A CZ   3  
ATOM 3368  N NH1  . ARG A 1 64 ? 29.176 4.029   5.184   1.00 0.00 ? 64 ARG A NH1  3  
ATOM 3369  N NH2  . ARG A 1 64 ? 28.706 5.770   3.753   1.00 0.00 ? 64 ARG A NH2  3  
ATOM 3370  H H    . ARG A 1 64 ? 23.968 2.874   5.553   1.00 0.00 ? 64 ARG A H    3  
ATOM 3371  H HA   . ARG A 1 64 ? 23.504 4.207   8.126   1.00 0.00 ? 64 ARG A HA   3  
ATOM 3372  H HB2  . ARG A 1 64 ? 24.839 5.453   5.718   1.00 0.00 ? 64 ARG A HB2  3  
ATOM 3373  H HB3  . ARG A 1 64 ? 24.093 6.415   6.995   1.00 0.00 ? 64 ARG A HB3  3  
ATOM 3374  H HG2  . ARG A 1 64 ? 26.220 6.403   7.764   1.00 0.00 ? 64 ARG A HG2  3  
ATOM 3375  H HG3  . ARG A 1 64 ? 25.691 4.875   8.484   1.00 0.00 ? 64 ARG A HG3  3  
ATOM 3376  H HD2  . ARG A 1 64 ? 27.833 4.560   7.434   1.00 0.00 ? 64 ARG A HD2  3  
ATOM 3377  H HD3  . ARG A 1 64 ? 26.600 3.694   6.505   1.00 0.00 ? 64 ARG A HD3  3  
ATOM 3378  H HE   . ARG A 1 64 ? 26.833 6.196   5.324   1.00 0.00 ? 64 ARG A HE   3  
ATOM 3379  H HH11 . ARG A 1 64 ? 28.971 3.505   6.011   1.00 0.00 ? 64 ARG A HH11 3  
ATOM 3380  H HH12 . ARG A 1 64 ? 29.959 3.780   4.604   1.00 0.00 ? 64 ARG A HH12 3  
ATOM 3381  H HH21 . ARG A 1 64 ? 28.134 6.564   3.493   1.00 0.00 ? 64 ARG A HH21 3  
ATOM 3382  H HH22 . ARG A 1 64 ? 29.495 5.528   3.188   1.00 0.00 ? 64 ARG A HH22 3  
ATOM 3383  N N    . THR A 1 65 ? 21.557 5.585   7.119   1.00 0.00 ? 65 THR A N    3  
ATOM 3384  C CA   . THR A 1 65 ? 20.283 6.053   6.628   1.00 0.00 ? 65 THR A CA   3  
ATOM 3385  C C    . THR A 1 65 ? 20.488 7.206   5.641   1.00 0.00 ? 65 THR A C    3  
ATOM 3386  O O    . THR A 1 65 ? 21.454 7.954   5.749   1.00 0.00 ? 65 THR A O    3  
ATOM 3387  C CB   . THR A 1 65 ? 19.376 6.522   7.777   1.00 0.00 ? 65 THR A CB   3  
ATOM 3388  O OG1  . THR A 1 65 ? 20.159 7.163   8.795   1.00 0.00 ? 65 THR A OG1  3  
ATOM 3389  C CG2  . THR A 1 65 ? 18.611 5.352   8.369   1.00 0.00 ? 65 THR A CG2  3  
ATOM 3390  H H    . THR A 1 65 ? 21.908 5.962   7.958   1.00 0.00 ? 65 THR A H    3  
ATOM 3391  H HA   . THR A 1 65 ? 19.797 5.242   6.106   1.00 0.00 ? 65 THR A HA   3  
ATOM 3392  H HB   . THR A 1 65 ? 18.655 7.233   7.382   1.00 0.00 ? 65 THR A HB   3  
ATOM 3393  H HG1  . THR A 1 65 ? 19.848 8.070   8.910   1.00 0.00 ? 65 THR A HG1  3  
ATOM 3394  H HG21 . THR A 1 65 ? 18.016 4.898   7.603   1.00 0.00 ? 65 THR A HG21 3  
ATOM 3395  H HG22 . THR A 1 65 ? 17.961 5.694   9.164   1.00 0.00 ? 65 THR A HG22 3  
ATOM 3396  H HG23 . THR A 1 65 ? 19.312 4.625   8.763   1.00 0.00 ? 65 THR A HG23 3  
ATOM 3397  N N    . TYR A 1 66 ? 19.599 7.333   4.686   1.00 0.00 ? 66 TYR A N    3  
ATOM 3398  C CA   . TYR A 1 66 ? 19.716 8.385   3.678   1.00 0.00 ? 66 TYR A CA   3  
ATOM 3399  C C    . TYR A 1 66 ? 18.331 8.831   3.235   1.00 0.00 ? 66 TYR A C    3  
ATOM 3400  O O    . TYR A 1 66 ? 17.380 8.052   3.238   1.00 0.00 ? 66 TYR A O    3  
ATOM 3401  C CB   . TYR A 1 66 ? 20.547 7.887   2.489   1.00 0.00 ? 66 TYR A CB   3  
ATOM 3402  C CG   . TYR A 1 66 ? 20.758 8.928   1.411   1.00 0.00 ? 66 TYR A CG   3  
ATOM 3403  C CD1  . TYR A 1 66 ? 21.403 10.118  1.694   1.00 0.00 ? 66 TYR A CD1  3  
ATOM 3404  C CD2  . TYR A 1 66 ? 20.322 8.713   0.116   1.00 0.00 ? 66 TYR A CD2  3  
ATOM 3405  C CE1  . TYR A 1 66 ? 21.609 11.067  0.716   1.00 0.00 ? 66 TYR A CE1  3  
ATOM 3406  C CE2  . TYR A 1 66 ? 20.517 9.655   -0.871  1.00 0.00 ? 66 TYR A CE2  3  
ATOM 3407  C CZ   . TYR A 1 66 ? 21.167 10.838  -0.572  1.00 0.00 ? 66 TYR A CZ   3  
ATOM 3408  O OH   . TYR A 1 66 ? 21.367 11.767  -1.544  1.00 0.00 ? 66 TYR A OH   3  
ATOM 3409  H H    . TYR A 1 66 ? 18.835 6.706   4.658   1.00 0.00 ? 66 TYR A H    3  
ATOM 3410  H HA   . TYR A 1 66 ? 20.219 9.221   4.135   1.00 0.00 ? 66 TYR A HA   3  
ATOM 3411  H HB2  . TYR A 1 66 ? 21.518 7.573   2.847   1.00 0.00 ? 66 TYR A HB2  3  
ATOM 3412  H HB3  . TYR A 1 66 ? 20.036 7.044   2.037   1.00 0.00 ? 66 TYR A HB3  3  
ATOM 3413  H HD1  . TYR A 1 66 ? 21.768 10.292  2.703   1.00 0.00 ? 66 TYR A HD1  3  
ATOM 3414  H HD2  . TYR A 1 66 ? 19.829 7.792   -0.126  1.00 0.00 ? 66 TYR A HD2  3  
ATOM 3415  H HE1  . TYR A 1 66 ? 22.119 11.995  0.956   1.00 0.00 ? 66 TYR A HE1  3  
ATOM 3416  H HE2  . TYR A 1 66 ? 20.164 9.476   -1.885  1.00 0.00 ? 66 TYR A HE2  3  
ATOM 3417  H HH   . TYR A 1 66 ? 20.534 11.953  -1.998  1.00 0.00 ? 66 TYR A HH   3  
ATOM 3418  N N    . TRP A 1 67 ? 18.227 10.097  2.883   1.00 0.00 ? 67 TRP A N    3  
ATOM 3419  C CA   . TRP A 1 67 ? 16.999 10.641  2.337   1.00 0.00 ? 67 TRP A CA   3  
ATOM 3420  C C    . TRP A 1 67 ? 17.058 10.542  0.828   1.00 0.00 ? 67 TRP A C    3  
ATOM 3421  O O    . TRP A 1 67 ? 17.904 11.170  0.179   1.00 0.00 ? 67 TRP A O    3  
ATOM 3422  C CB   . TRP A 1 67 ? 16.826 12.115  2.754   1.00 0.00 ? 67 TRP A CB   3  
ATOM 3423  C CG   . TRP A 1 67 ? 16.877 12.351  4.234   1.00 0.00 ? 67 TRP A CG   3  
ATOM 3424  C CD1  . TRP A 1 67 ? 15.806 12.455  5.068   1.00 0.00 ? 67 TRP A CD1  3  
ATOM 3425  C CD2  . TRP A 1 67 ? 18.049 12.505  5.050   1.00 0.00 ? 67 TRP A CD2  3  
ATOM 3426  N NE1  . TRP A 1 67 ? 16.245 12.662  6.368   1.00 0.00 ? 67 TRP A NE1  3  
ATOM 3427  C CE2  . TRP A 1 67 ? 17.610 12.682  6.376   1.00 0.00 ? 67 TRP A CE2  3  
ATOM 3428  C CE3  . TRP A 1 67 ? 19.423 12.485  4.795   1.00 0.00 ? 67 TRP A CE3  3  
ATOM 3429  C CZ2  . TRP A 1 67 ? 18.492 12.860  7.439   1.00 0.00 ? 67 TRP A CZ2  3  
ATOM 3430  C CZ3  . TRP A 1 67 ? 20.299 12.648  5.856   1.00 0.00 ? 67 TRP A CZ3  3  
ATOM 3431  C CH2  . TRP A 1 67 ? 19.830 12.848  7.160   1.00 0.00 ? 67 TRP A CH2  3  
ATOM 3432  H H    . TRP A 1 67 ? 18.999 10.698  2.965   1.00 0.00 ? 67 TRP A H    3  
ATOM 3433  H HA   . TRP A 1 67 ? 16.172 10.050  2.721   1.00 0.00 ? 67 TRP A HA   3  
ATOM 3434  H HB2  . TRP A 1 67 ? 17.624 12.690  2.299   1.00 0.00 ? 67 TRP A HB2  3  
ATOM 3435  H HB3  . TRP A 1 67 ? 15.880 12.469  2.390   1.00 0.00 ? 67 TRP A HB3  3  
ATOM 3436  H HD1  . TRP A 1 67 ? 14.781 12.380  4.760   1.00 0.00 ? 67 TRP A HD1  3  
ATOM 3437  H HE1  . TRP A 1 67 ? 15.657 12.769  7.154   1.00 0.00 ? 67 TRP A HE1  3  
ATOM 3438  H HE3  . TRP A 1 67 ? 19.808 12.346  3.785   1.00 0.00 ? 67 TRP A HE3  3  
ATOM 3439  H HZ2  . TRP A 1 67 ? 18.146 12.985  8.451   1.00 0.00 ? 67 TRP A HZ2  3  
ATOM 3440  H HZ3  . TRP A 1 67 ? 21.365 12.648  5.676   1.00 0.00 ? 67 TRP A HZ3  3  
ATOM 3441  H HH2  . TRP A 1 67 ? 20.552 12.967  7.945   1.00 0.00 ? 67 TRP A HH2  3  
ATOM 3442  N N    . VAL A 1 68 ? 16.162 9.741   0.258   1.00 0.00 ? 68 VAL A N    3  
ATOM 3443  C CA   . VAL A 1 68 ? 16.087 9.568   -1.179  1.00 0.00 ? 68 VAL A CA   3  
ATOM 3444  C C    . VAL A 1 68 ? 14.777 10.144  -1.678  1.00 0.00 ? 68 VAL A C    3  
ATOM 3445  O O    . VAL A 1 68 ? 14.012 10.674  -0.883  1.00 0.00 ? 68 VAL A O    3  
ATOM 3446  C CB   . VAL A 1 68 ? 16.164 8.061   -1.528  1.00 0.00 ? 68 VAL A CB   3  
ATOM 3447  C CG1  . VAL A 1 68 ? 16.641 7.851   -2.960  1.00 0.00 ? 68 VAL A CG1  3  
ATOM 3448  C CG2  . VAL A 1 68 ? 17.042 7.297   -0.561  1.00 0.00 ? 68 VAL A CG2  3  
ATOM 3449  H H    . VAL A 1 68 ? 15.521 9.248   0.810   1.00 0.00 ? 68 VAL A H    3  
ATOM 3450  H HA   . VAL A 1 68 ? 16.923 10.074  -1.644  1.00 0.00 ? 68 VAL A HA   3  
ATOM 3451  H HB   . VAL A 1 68 ? 15.159 7.650   -1.444  1.00 0.00 ? 68 VAL A HB   3  
ATOM 3452  H HG11 . VAL A 1 68 ? 17.585 8.358   -3.101  1.00 0.00 ? 68 VAL A HG11 3  
ATOM 3453  H HG12 . VAL A 1 68 ? 15.898 8.225   -3.646  1.00 0.00 ? 68 VAL A HG12 3  
ATOM 3454  H HG13 . VAL A 1 68 ? 16.784 6.782   -3.134  1.00 0.00 ? 68 VAL A HG13 3  
ATOM 3455  H HG21 . VAL A 1 68 ? 18.063 7.656   -0.635  1.00 0.00 ? 68 VAL A HG21 3  
ATOM 3456  H HG22 . VAL A 1 68 ? 17.026 6.241   -0.786  1.00 0.00 ? 68 VAL A HG22 3  
ATOM 3457  H HG23 . VAL A 1 68 ? 16.693 7.454   0.453   1.00 0.00 ? 68 VAL A HG23 3  
ATOM 3458  N N    . HIS A 1 69 ? 14.516 10.086  -2.973  1.00 0.00 ? 69 HIS A N    3  
ATOM 3459  C CA   . HIS A 1 69 ? 13.192 10.397  -3.487  1.00 0.00 ? 69 HIS A CA   3  
ATOM 3460  C C    . HIS A 1 69 ? 12.481 9.094   -3.818  1.00 0.00 ? 69 HIS A C    3  
ATOM 3461  O O    . HIS A 1 69 ? 13.093 8.185   -4.389  1.00 0.00 ? 69 HIS A O    3  
ATOM 3462  C CB   . HIS A 1 69 ? 13.285 11.310  -4.714  1.00 0.00 ? 69 HIS A CB   3  
ATOM 3463  C CG   . HIS A 1 69 ? 13.726 12.705  -4.392  1.00 0.00 ? 69 HIS A CG   3  
ATOM 3464  N ND1  . HIS A 1 69 ? 12.943 13.809  -4.545  1.00 0.00 ? 69 HIS A ND1  3  
ATOM 3465  C CD2  . HIS A 1 69 ? 14.917 13.177  -3.915  1.00 0.00 ? 69 HIS A CD2  3  
ATOM 3466  C CE1  . HIS A 1 69 ? 13.577 14.896  -4.180  1.00 0.00 ? 69 HIS A CE1  3  
ATOM 3467  N NE2  . HIS A 1 69 ? 14.782 14.545  -3.792  1.00 0.00 ? 69 HIS A NE2  3  
ATOM 3468  H H    . HIS A 1 69 ? 15.232 9.837   -3.594  1.00 0.00 ? 69 HIS A H    3  
ATOM 3469  H HA   . HIS A 1 69 ? 12.643 10.909  -2.706  1.00 0.00 ? 69 HIS A HA   3  
ATOM 3470  H HB2  . HIS A 1 69 ? 13.991 10.898  -5.413  1.00 0.00 ? 69 HIS A HB2  3  
ATOM 3471  H HB3  . HIS A 1 69 ? 12.318 11.380  -5.179  1.00 0.00 ? 69 HIS A HB3  3  
ATOM 3472  H HD1  . HIS A 1 69 ? 12.009 13.794  -4.909  1.00 0.00 ? 69 HIS A HD1  3  
ATOM 3473  H HD2  . HIS A 1 69 ? 15.783 12.593  -3.695  1.00 0.00 ? 69 HIS A HD2  3  
ATOM 3474  H HE1  . HIS A 1 69 ? 13.179 15.890  -4.192  1.00 0.00 ? 69 HIS A HE1  3  
ATOM 3475  H HE2  . HIS A 1 69 ? 15.518 15.169  -3.566  1.00 0.00 ? 69 HIS A HE2  3  
ATOM 3476  N N    . TRP A 1 70 ? 11.206 8.996   -3.438  1.00 0.00 ? 70 TRP A N    3  
ATOM 3477  C CA   . TRP A 1 70 ? 10.425 7.759   -3.568  1.00 0.00 ? 70 TRP A CA   3  
ATOM 3478  C C    . TRP A 1 70 ? 10.612 7.067   -4.920  1.00 0.00 ? 70 TRP A C    3  
ATOM 3479  O O    . TRP A 1 70 ? 10.833 5.858   -4.982  1.00 0.00 ? 70 TRP A O    3  
ATOM 3480  C CB   . TRP A 1 70 ? 8.937  8.031   -3.349  1.00 0.00 ? 70 TRP A CB   3  
ATOM 3481  C CG   . TRP A 1 70 ? 8.578  8.412   -1.948  1.00 0.00 ? 70 TRP A CG   3  
ATOM 3482  C CD1  . TRP A 1 70 ? 8.490  9.673   -1.446  1.00 0.00 ? 70 TRP A CD1  3  
ATOM 3483  C CD2  . TRP A 1 70 ? 8.233  7.530   -0.875  1.00 0.00 ? 70 TRP A CD2  3  
ATOM 3484  N NE1  . TRP A 1 70 ? 8.127  9.627   -0.117  1.00 0.00 ? 70 TRP A NE1  3  
ATOM 3485  C CE2  . TRP A 1 70 ? 7.977  8.325   0.253   1.00 0.00 ? 70 TRP A CE2  3  
ATOM 3486  C CE3  . TRP A 1 70 ? 8.142  6.137   -0.744  1.00 0.00 ? 70 TRP A CE3  3  
ATOM 3487  C CZ2  . TRP A 1 70 ? 7.611  7.788   1.477   1.00 0.00 ? 70 TRP A CZ2  3  
ATOM 3488  C CZ3  . TRP A 1 70 ? 7.786  5.596   0.474   1.00 0.00 ? 70 TRP A CZ3  3  
ATOM 3489  C CH2  . TRP A 1 70 ? 7.513  6.420   1.569   1.00 0.00 ? 70 TRP A CH2  3  
ATOM 3490  H H    . TRP A 1 70 ? 10.785 9.778   -3.009  1.00 0.00 ? 70 TRP A H    3  
ATOM 3491  H HA   . TRP A 1 70 ? 10.774 7.096   -2.803  1.00 0.00 ? 70 TRP A HA   3  
ATOM 3492  H HB2  . TRP A 1 70 ? 8.626  8.849   -3.985  1.00 0.00 ? 70 TRP A HB2  3  
ATOM 3493  H HB3  . TRP A 1 70 ? 8.388  7.136   -3.607  1.00 0.00 ? 70 TRP A HB3  3  
ATOM 3494  H HD1  . TRP A 1 70 ? 8.674  10.570  -2.007  1.00 0.00 ? 70 TRP A HD1  3  
ATOM 3495  H HE1  . TRP A 1 70 ? 8.006  10.409  0.470   1.00 0.00 ? 70 TRP A HE1  3  
ATOM 3496  H HE3  . TRP A 1 70 ? 8.349  5.490   -1.590  1.00 0.00 ? 70 TRP A HE3  3  
ATOM 3497  H HZ2  . TRP A 1 70 ? 7.417  8.414   2.332   1.00 0.00 ? 70 TRP A HZ2  3  
ATOM 3498  H HZ3  . TRP A 1 70 ? 7.705  4.517   0.576   1.00 0.00 ? 70 TRP A HZ3  3  
ATOM 3499  H HH2  . TRP A 1 70 ? 7.247  5.965   2.508   1.00 0.00 ? 70 TRP A HH2  3  
ATOM 3500  N N    . HIS A 1 71 ? 10.542 7.832   -6.012  1.00 0.00 ? 71 HIS A N    3  
ATOM 3501  C CA   . HIS A 1 71 ? 10.543 7.212   -7.334  1.00 0.00 ? 71 HIS A CA   3  
ATOM 3502  C C    . HIS A 1 71 ? 11.913 6.678   -7.742  1.00 0.00 ? 71 HIS A C    3  
ATOM 3503  O O    . HIS A 1 71 ? 12.071 6.169   -8.840  1.00 0.00 ? 71 HIS A O    3  
ATOM 3504  C CB   . HIS A 1 71 ? 10.016 8.199   -8.404  1.00 0.00 ? 71 HIS A CB   3  
ATOM 3505  C CG   . HIS A 1 71 ? 10.937 9.323   -8.779  1.00 0.00 ? 71 HIS A CG   3  
ATOM 3506  N ND1  . HIS A 1 71 ? 10.599 10.651  -8.631  1.00 0.00 ? 71 HIS A ND1  3  
ATOM 3507  C CD2  . HIS A 1 71 ? 12.176 9.320   -9.351  1.00 0.00 ? 71 HIS A CD2  3  
ATOM 3508  C CE1  . HIS A 1 71 ? 11.579 11.406  -9.093  1.00 0.00 ? 71 HIS A CE1  3  
ATOM 3509  N NE2  . HIS A 1 71 ? 12.543 10.617  -9.532  1.00 0.00 ? 71 HIS A NE2  3  
ATOM 3510  H H    . HIS A 1 71 ? 10.511 8.813   -5.915  1.00 0.00 ? 71 HIS A H    3  
ATOM 3511  H HA   . HIS A 1 71 ? 9.858  6.377   -7.294  1.00 0.00 ? 71 HIS A HA   3  
ATOM 3512  H HB2  . HIS A 1 71 ? 9.796  7.654   -9.302  1.00 0.00 ? 71 HIS A HB2  3  
ATOM 3513  H HB3  . HIS A 1 71 ? 9.091  8.639   -8.045  1.00 0.00 ? 71 HIS A HB3  3  
ATOM 3514  H HD1  . HIS A 1 71 ? 9.747  10.996  -8.265  1.00 0.00 ? 71 HIS A HD1  3  
ATOM 3515  H HD2  . HIS A 1 71 ? 12.753 8.446   -9.618  1.00 0.00 ? 71 HIS A HD2  3  
ATOM 3516  H HE1  . HIS A 1 71 ? 11.578 12.487  -9.094  1.00 0.00 ? 71 HIS A HE1  3  
ATOM 3517  H HE2  . HIS A 1 71 ? 13.291 10.919  -10.114 1.00 0.00 ? 71 HIS A HE2  3  
ATOM 3518  N N    . MET A 1 72 ? 12.911 6.831   -6.883  1.00 0.00 ? 72 MET A N    3  
ATOM 3519  C CA   . MET A 1 72 ? 14.248 6.326   -7.172  1.00 0.00 ? 72 MET A CA   3  
ATOM 3520  C C    . MET A 1 72 ? 14.386 4.861   -6.803  1.00 0.00 ? 72 MET A C    3  
ATOM 3521  O O    . MET A 1 72 ? 15.239 4.141   -7.344  1.00 0.00 ? 72 MET A O    3  
ATOM 3522  C CB   . MET A 1 72 ? 15.304 7.132   -6.422  1.00 0.00 ? 72 MET A CB   3  
ATOM 3523  C CG   . MET A 1 72 ? 15.601 8.501   -7.028  1.00 0.00 ? 72 MET A CG   3  
ATOM 3524  S SD   . MET A 1 72 ? 16.299 8.337   -8.679  1.00 0.00 ? 72 MET A SD   3  
ATOM 3525  C CE   . MET A 1 72 ? 16.846 10.025  -8.983  1.00 0.00 ? 72 MET A CE   3  
ATOM 3526  H H    . MET A 1 72 ? 12.761 7.304   -6.026  1.00 0.00 ? 72 MET A H    3  
ATOM 3527  H HA   . MET A 1 72 ? 14.410 6.443   -8.240  1.00 0.00 ? 72 MET A HA   3  
ATOM 3528  H HB2  . MET A 1 72 ? 14.952 7.285   -5.406  1.00 0.00 ? 72 MET A HB2  3  
ATOM 3529  H HB3  . MET A 1 72 ? 16.224 6.568   -6.387  1.00 0.00 ? 72 MET A HB3  3  
ATOM 3530  H HG2  . MET A 1 72 ? 14.680 9.057   -7.083  1.00 0.00 ? 72 MET A HG2  3  
ATOM 3531  H HG3  . MET A 1 72 ? 16.301 9.007   -6.394  1.00 0.00 ? 72 MET A HG3  3  
ATOM 3532  H HE1  . MET A 1 72 ? 17.286 10.093  -9.964  1.00 0.00 ? 72 MET A HE1  3  
ATOM 3533  H HE2  . MET A 1 72 ? 17.572 10.310  -8.240  1.00 0.00 ? 72 MET A HE2  3  
ATOM 3534  H HE3  . MET A 1 72 ? 16.002 10.694  -8.921  1.00 0.00 ? 72 MET A HE3  3  
ATOM 3535  N N    . LEU A 1 73 ? 13.553 4.404   -5.881  1.00 0.00 ? 73 LEU A N    3  
ATOM 3536  C CA   . LEU A 1 73 ? 13.705 3.067   -5.327  1.00 0.00 ? 73 LEU A CA   3  
ATOM 3537  C C    . LEU A 1 73 ? 12.552 2.157   -5.760  1.00 0.00 ? 73 LEU A C    3  
ATOM 3538  O O    . LEU A 1 73 ? 11.446 2.591   -6.028  1.00 0.00 ? 73 LEU A O    3  
ATOM 3539  C CB   . LEU A 1 73 ? 13.806 3.149   -3.799  1.00 0.00 ? 73 LEU A CB   3  
ATOM 3540  C CG   . LEU A 1 73 ? 12.738 3.991   -3.093  1.00 0.00 ? 73 LEU A CG   3  
ATOM 3541  C CD1  . LEU A 1 73 ? 11.439 3.195   -2.860  1.00 0.00 ? 73 LEU A CD1  3  
ATOM 3542  C CD2  . LEU A 1 73 ? 13.278 4.529   -1.780  1.00 0.00 ? 73 LEU A CD2  3  
ATOM 3543  H H    . LEU A 1 73 ? 12.806 4.963   -5.598  1.00 0.00 ? 73 LEU A H    3  
ATOM 3544  H HA   . LEU A 1 73 ? 14.620 2.661   -5.714  1.00 0.00 ? 73 LEU A HA   3  
ATOM 3545  H HB2  . LEU A 1 73 ? 13.747 2.141   -3.406  1.00 0.00 ? 73 LEU A HB2  3  
ATOM 3546  H HB3  . LEU A 1 73 ? 14.772 3.559   -3.549  1.00 0.00 ? 73 LEU A HB3  3  
ATOM 3547  H HG   . LEU A 1 73 ? 12.482 4.840   -3.720  1.00 0.00 ? 73 LEU A HG   3  
ATOM 3548  H HD11 . LEU A 1 73 ? 11.075 2.813   -3.807  1.00 0.00 ? 73 LEU A HD11 3  
ATOM 3549  H HD12 . LEU A 1 73 ? 10.696 3.840   -2.429  1.00 0.00 ? 73 LEU A HD12 3  
ATOM 3550  H HD13 . LEU A 1 73 ? 11.634 2.369   -2.192  1.00 0.00 ? 73 LEU A HD13 3  
ATOM 3551  H HD21 . LEU A 1 73 ? 12.538 5.154   -1.313  1.00 0.00 ? 73 LEU A HD21 3  
ATOM 3552  H HD22 . LEU A 1 73 ? 14.173 5.106   -1.973  1.00 0.00 ? 73 LEU A HD22 3  
ATOM 3553  H HD23 . LEU A 1 73 ? 13.520 3.704   -1.126  1.00 0.00 ? 73 LEU A HD23 3  
ATOM 3554  N N    . GLU A 1 74 ? 12.881 0.869   -5.833  1.00 0.00 ? 74 GLU A N    3  
ATOM 3555  C CA   . GLU A 1 74 ? 11.910 -0.179  -6.140  1.00 0.00 ? 74 GLU A CA   3  
ATOM 3556  C C    . GLU A 1 74 ? 11.474 -0.839  -4.834  1.00 0.00 ? 74 GLU A C    3  
ATOM 3557  O O    . GLU A 1 74 ? 12.307 -1.083  -3.952  1.00 0.00 ? 74 GLU A O    3  
ATOM 3558  C CB   . GLU A 1 74 ? 12.551 -1.203  -7.079  1.00 0.00 ? 74 GLU A CB   3  
ATOM 3559  C CG   . GLU A 1 74 ? 11.663 -2.399  -7.378  1.00 0.00 ? 74 GLU A CG   3  
ATOM 3560  C CD   . GLU A 1 74 ? 12.322 -3.367  -8.330  1.00 0.00 ? 74 GLU A CD   3  
ATOM 3561  O OE1  . GLU A 1 74 ? 13.297 -4.036  -7.930  1.00 0.00 ? 74 GLU A OE1  3  
ATOM 3562  O OE2  . GLU A 1 74 ? 11.869 -3.462  -9.489  1.00 0.00 ? 74 GLU A OE2  3  
ATOM 3563  H H    . GLU A 1 74 ? 13.810 0.614   -5.668  1.00 0.00 ? 74 GLU A H    3  
ATOM 3564  H HA   . GLU A 1 74 ? 11.045 0.264   -6.621  1.00 0.00 ? 74 GLU A HA   3  
ATOM 3565  H HB2  . GLU A 1 74 ? 12.789 -0.708  -8.000  1.00 0.00 ? 74 GLU A HB2  3  
ATOM 3566  H HB3  . GLU A 1 74 ? 13.462 -1.561  -6.623  1.00 0.00 ? 74 GLU A HB3  3  
ATOM 3567  H HG2  . GLU A 1 74 ? 11.443 -2.917  -6.454  1.00 0.00 ? 74 GLU A HG2  3  
ATOM 3568  H HG3  . GLU A 1 74 ? 10.744 -2.050  -7.822  1.00 0.00 ? 74 GLU A HG3  3  
ATOM 3569  N N    . ILE A 1 75 ? 10.190 -1.146  -4.716  1.00 0.00 ? 75 ILE A N    3  
ATOM 3570  C CA   . ILE A 1 75 ? 9.679  -1.734  -3.509  1.00 0.00 ? 75 ILE A CA   3  
ATOM 3571  C C    . ILE A 1 75 ? 9.972  -3.229  -3.495  1.00 0.00 ? 75 ILE A C    3  
ATOM 3572  O O    . ILE A 1 75 ? 9.428  -3.990  -4.290  1.00 0.00 ? 75 ILE A O    3  
ATOM 3573  C CB   . ILE A 1 75 ? 8.162  -1.471  -3.330  1.00 0.00 ? 75 ILE A CB   3  
ATOM 3574  C CG1  . ILE A 1 75 ? 7.371  -1.924  -4.565  1.00 0.00 ? 75 ILE A CG1  3  
ATOM 3575  C CG2  . ILE A 1 75 ? 7.918  0.008   -3.058  1.00 0.00 ? 75 ILE A CG2  3  
ATOM 3576  C CD1  . ILE A 1 75 ? 5.868  -1.880  -4.355  1.00 0.00 ? 75 ILE A CD1  3  
ATOM 3577  H H    . ILE A 1 75 ? 9.610  -0.992  -5.491  1.00 0.00 ? 75 ILE A H    3  
ATOM 3578  H HA   . ILE A 1 75 ? 10.193 -1.281  -2.681  1.00 0.00 ? 75 ILE A HA   3  
ATOM 3579  H HB   . ILE A 1 75 ? 7.819  -2.015  -2.458  1.00 0.00 ? 75 ILE A HB   3  
ATOM 3580  H HG12 . ILE A 1 75 ? 7.604  -1.278  -5.393  1.00 0.00 ? 75 ILE A HG12 3  
ATOM 3581  H HG13 . ILE A 1 75 ? 7.643  -2.940  -4.801  1.00 0.00 ? 75 ILE A HG13 3  
ATOM 3582  H HG21 . ILE A 1 75 ? 6.862  0.184   -2.934  1.00 0.00 ? 75 ILE A HG21 3  
ATOM 3583  H HG22 . ILE A 1 75 ? 8.288  0.598   -3.879  1.00 0.00 ? 75 ILE A HG22 3  
ATOM 3584  H HG23 . ILE A 1 75 ? 8.431  0.301   -2.138  1.00 0.00 ? 75 ILE A HG23 3  
ATOM 3585  H HD11 . ILE A 1 75 ? 5.375  -2.250  -5.250  1.00 0.00 ? 75 ILE A HD11 3  
ATOM 3586  H HD12 . ILE A 1 75 ? 5.554  -0.870  -4.162  1.00 0.00 ? 75 ILE A HD12 3  
ATOM 3587  H HD13 . ILE A 1 75 ? 5.603  -2.511  -3.513  1.00 0.00 ? 75 ILE A HD13 3  
ATOM 3588  N N    . LEU A 1 76 ? 10.838 -3.641  -2.592  1.00 0.00 ? 76 LEU A N    3  
ATOM 3589  C CA   . LEU A 1 76 ? 11.277 -5.024  -2.547  1.00 0.00 ? 76 LEU A CA   3  
ATOM 3590  C C    . LEU A 1 76 ? 10.306 -5.864  -1.721  1.00 0.00 ? 76 LEU A C    3  
ATOM 3591  O O    . LEU A 1 76 ? 10.087 -7.030  -2.010  1.00 0.00 ? 76 LEU A O    3  
ATOM 3592  C CB   . LEU A 1 76 ? 12.689 -5.094  -1.962  1.00 0.00 ? 76 LEU A CB   3  
ATOM 3593  C CG   . LEU A 1 76 ? 13.358 -6.479  -2.021  1.00 0.00 ? 76 LEU A CG   3  
ATOM 3594  C CD1  . LEU A 1 76 ? 13.505 -6.962  -3.461  1.00 0.00 ? 76 LEU A CD1  3  
ATOM 3595  C CD2  . LEU A 1 76 ? 14.713 -6.432  -1.324  1.00 0.00 ? 76 LEU A CD2  3  
ATOM 3596  H H    . LEU A 1 76 ? 11.226 -2.995  -1.956  1.00 0.00 ? 76 LEU A H    3  
ATOM 3597  H HA   . LEU A 1 76 ? 11.298 -5.396  -3.560  1.00 0.00 ? 76 LEU A HA   3  
ATOM 3598  H HB2  . LEU A 1 76 ? 13.322 -4.391  -2.484  1.00 0.00 ? 76 LEU A HB2  3  
ATOM 3599  H HB3  . LEU A 1 76 ? 12.636 -4.796  -0.923  1.00 0.00 ? 76 LEU A HB3  3  
ATOM 3600  H HG   . LEU A 1 76 ? 12.751 -7.194  -1.492  1.00 0.00 ? 76 LEU A HG   3  
ATOM 3601  H HD11 . LEU A 1 76 ? 14.139 -6.267  -4.020  1.00 0.00 ? 76 LEU A HD11 3  
ATOM 3602  H HD12 . LEU A 1 76 ? 12.543 -7.026  -3.925  1.00 0.00 ? 76 LEU A HD12 3  
ATOM 3603  H HD13 . LEU A 1 76 ? 13.966 -7.943  -3.463  1.00 0.00 ? 76 LEU A HD13 3  
ATOM 3604  H HD21 . LEU A 1 76 ? 15.176 -7.418  -1.364  1.00 0.00 ? 76 LEU A HD21 3  
ATOM 3605  H HD22 . LEU A 1 76 ? 14.585 -6.137  -0.301  1.00 0.00 ? 76 LEU A HD22 3  
ATOM 3606  H HD23 . LEU A 1 76 ? 15.341 -5.728  -1.835  1.00 0.00 ? 76 LEU A HD23 3  
ATOM 3607  N N    . GLY A 1 77 ? 9.723  -5.248  -0.705  1.00 0.00 ? 77 GLY A N    3  
ATOM 3608  C CA   . GLY A 1 77 ? 8.694  -5.908  0.068   1.00 0.00 ? 77 GLY A CA   3  
ATOM 3609  C C    . GLY A 1 77 ? 9.222  -6.489  1.373   1.00 0.00 ? 77 GLY A C    3  
ATOM 3610  O O    . GLY A 1 77 ? 10.404 -6.350  1.706   1.00 0.00 ? 77 GLY A O    3  
ATOM 3611  H H    . GLY A 1 77 ? 10.008 -4.333  -0.472  1.00 0.00 ? 77 GLY A H    3  
ATOM 3612  H HA2  . GLY A 1 77 ? 7.919  -5.213  0.296   1.00 0.00 ? 77 GLY A HA2  3  
ATOM 3613  H HA3  . GLY A 1 77 ? 8.272  -6.709  -0.520  1.00 0.00 ? 77 GLY A HA3  3  
ATOM 3614  N N    . PHE A 1 78 ? 8.331  -7.169  2.092   1.00 0.00 ? 78 PHE A N    3  
ATOM 3615  C CA   . PHE A 1 78 ? 8.654  -7.773  3.374   1.00 0.00 ? 78 PHE A CA   3  
ATOM 3616  C C    . PHE A 1 78 ? 7.448  -8.540  3.867   1.00 0.00 ? 78 PHE A C    3  
ATOM 3617  O O    . PHE A 1 78 ? 6.323  -8.075  3.725   1.00 0.00 ? 78 PHE A O    3  
ATOM 3618  C CB   . PHE A 1 78 ? 9.030  -6.697  4.405   1.00 0.00 ? 78 PHE A CB   3  
ATOM 3619  C CG   . PHE A 1 78 ? 9.980  -7.184  5.457   1.00 0.00 ? 78 PHE A CG   3  
ATOM 3620  C CD1  . PHE A 1 78 ? 10.961 -8.117  5.142   1.00 0.00 ? 78 PHE A CD1  3  
ATOM 3621  C CD2  . PHE A 1 78 ? 9.919  -6.706  6.748   1.00 0.00 ? 78 PHE A CD2  3  
ATOM 3622  C CE1  . PHE A 1 78 ? 11.855 -8.561  6.105   1.00 0.00 ? 78 PHE A CE1  3  
ATOM 3623  C CE2  . PHE A 1 78 ? 10.813 -7.129  7.712   1.00 0.00 ? 78 PHE A CE2  3  
ATOM 3624  C CZ   . PHE A 1 78 ? 11.781 -8.055  7.389   1.00 0.00 ? 78 PHE A CZ   3  
ATOM 3625  H H    . PHE A 1 78 ? 7.407  -7.274  1.744   1.00 0.00 ? 78 PHE A H    3  
ATOM 3626  H HA   . PHE A 1 78 ? 9.472  -8.455  3.255   1.00 0.00 ? 78 PHE A HA   3  
ATOM 3627  H HB2  . PHE A 1 78 ? 9.500  -5.876  3.895   1.00 0.00 ? 78 PHE A HB2  3  
ATOM 3628  H HB3  . PHE A 1 78 ? 8.130  -6.349  4.910   1.00 0.00 ? 78 PHE A HB3  3  
ATOM 3629  H HD1  . PHE A 1 78 ? 11.012 -8.506  4.139   1.00 0.00 ? 78 PHE A HD1  3  
ATOM 3630  H HD2  . PHE A 1 78 ? 9.155  -5.981  7.006   1.00 0.00 ? 78 PHE A HD2  3  
ATOM 3631  H HE1  . PHE A 1 78 ? 12.601 -9.277  5.844   1.00 0.00 ? 78 PHE A HE1  3  
ATOM 3632  H HE2  . PHE A 1 78 ? 10.749 -6.740  8.715   1.00 0.00 ? 78 PHE A HE2  3  
ATOM 3633  H HZ   . PHE A 1 78 ? 12.479 -8.391  8.138   1.00 0.00 ? 78 PHE A HZ   3  
ATOM 3634  N N    . GLU A 1 79 ? 7.683  -9.734  4.423   1.00 0.00 ? 79 GLU A N    3  
ATOM 3635  C CA   . GLU A 1 79 ? 6.602  -10.544 4.962   1.00 0.00 ? 79 GLU A CA   3  
ATOM 3636  C C    . GLU A 1 79 ? 6.102  -9.956  6.279   1.00 0.00 ? 79 GLU A C    3  
ATOM 3637  O O    . GLU A 1 79 ? 6.131  -10.601 7.328   1.00 0.00 ? 79 GLU A O    3  
ATOM 3638  C CB   . GLU A 1 79 ? 7.093  -11.986 5.179   1.00 0.00 ? 79 GLU A CB   3  
ATOM 3639  C CG   . GLU A 1 79 ? 8.399  -12.081 5.951   1.00 0.00 ? 79 GLU A CG   3  
ATOM 3640  C CD   . GLU A 1 79 ? 8.805  -13.497 6.253   1.00 0.00 ? 79 GLU A CD   3  
ATOM 3641  O OE1  . GLU A 1 79 ? 8.196  -14.111 7.144   1.00 0.00 ? 79 GLU A OE1  3  
ATOM 3642  O OE2  . GLU A 1 79 ? 9.752  -13.992 5.609   1.00 0.00 ? 79 GLU A OE2  3  
ATOM 3643  H H    . GLU A 1 79 ? 8.598  -10.083 4.456   1.00 0.00 ? 79 GLU A H    3  
ATOM 3644  H HA   . GLU A 1 79 ? 5.789  -10.545 4.249   1.00 0.00 ? 79 GLU A HA   3  
ATOM 3645  H HB2  . GLU A 1 79 ? 6.330  -12.511 5.737   1.00 0.00 ? 79 GLU A HB2  3  
ATOM 3646  H HB3  . GLU A 1 79 ? 7.225  -12.454 4.224   1.00 0.00 ? 79 GLU A HB3  3  
ATOM 3647  H HG2  . GLU A 1 79 ? 9.185  -11.616 5.366   1.00 0.00 ? 79 GLU A HG2  3  
ATOM 3648  H HG3  . GLU A 1 79 ? 8.294  -11.548 6.894   1.00 0.00 ? 79 GLU A HG3  3  
ATOM 3649  N N    . GLU A 1 80 ? 5.675  -8.683  6.205   1.00 0.00 ? 80 GLU A N    3  
ATOM 3650  C CA   . GLU A 1 80 ? 5.152  -7.933  7.358   1.00 0.00 ? 80 GLU A CA   3  
ATOM 3651  C C    . GLU A 1 80 ? 6.264  -7.529  8.332   1.00 0.00 ? 80 GLU A C    3  
ATOM 3652  O O    . GLU A 1 80 ? 6.250  -6.417  8.865   1.00 0.00 ? 80 GLU A O    3  
ATOM 3653  C CB   . GLU A 1 80 ? 4.077  -8.735  8.070   1.00 0.00 ? 80 GLU A CB   3  
ATOM 3654  C CG   . GLU A 1 80 ? 3.360  -8.017  9.213   1.00 0.00 ? 80 GLU A CG   3  
ATOM 3655  C CD   . GLU A 1 80 ? 2.425  -8.937  9.958   1.00 0.00 ? 80 GLU A CD   3  
ATOM 3656  O OE1  . GLU A 1 80 ? 1.488  -9.460  9.343   1.00 0.00 ? 80 GLU A OE1  3  
ATOM 3657  O OE2  . GLU A 1 80 ? 2.636  -9.135  11.164  1.00 0.00 ? 80 GLU A OE2  3  
ATOM 3658  H H    . GLU A 1 80 ? 5.695  -8.242  5.335   1.00 0.00 ? 80 GLU A H    3  
ATOM 3659  H HA   . GLU A 1 80 ? 4.710  -7.034  6.963   1.00 0.00 ? 80 GLU A HA   3  
ATOM 3660  H HB2  . GLU A 1 80 ? 3.327  -9.040  7.354   1.00 0.00 ? 80 GLU A HB2  3  
ATOM 3661  H HB3  . GLU A 1 80 ? 4.528  -9.628  8.480   1.00 0.00 ? 80 GLU A HB3  3  
ATOM 3662  H HG2  . GLU A 1 80 ? 4.097  -7.619  9.896   1.00 0.00 ? 80 GLU A HG2  3  
ATOM 3663  H HG3  . GLU A 1 80 ? 2.779  -7.198  8.792   1.00 0.00 ? 80 GLU A HG3  3  
ATOM 3664  N N    . MET A 1 4  ? 9.836  2.353   -15.934 1.00 0.00 ? 4  MET A N    4  
ATOM 3665  C CA   . MET A 1 4  ? 10.224 3.749   -15.876 1.00 0.00 ? 4  MET A CA   4  
ATOM 3666  C C    . MET A 1 4  ? 9.115  4.544   -15.197 1.00 0.00 ? 4  MET A C    4  
ATOM 3667  O O    . MET A 1 4  ? 7.959  4.135   -15.239 1.00 0.00 ? 4  MET A O    4  
ATOM 3668  C CB   . MET A 1 4  ? 10.494 4.288   -17.286 1.00 0.00 ? 4  MET A CB   4  
ATOM 3669  C CG   . MET A 1 4  ? 11.161 5.642   -17.330 1.00 0.00 ? 4  MET A CG   4  
ATOM 3670  S SD   . MET A 1 4  ? 11.640 6.122   -18.992 1.00 0.00 ? 4  MET A SD   4  
ATOM 3671  C CE   . MET A 1 4  ? 12.481 7.658   -18.664 1.00 0.00 ? 4  MET A CE   4  
ATOM 3672  H H    . MET A 1 4  ? 8.977  2.118   -16.343 1.00 0.00 ? 4  MET A H    4  
ATOM 3673  H HA   . MET A 1 4  ? 11.127 3.839   -15.277 1.00 0.00 ? 4  MET A HA   4  
ATOM 3674  H HB2  . MET A 1 4  ? 11.165 3.597   -17.795 1.00 0.00 ? 4  MET A HB2  4  
ATOM 3675  H HB3  . MET A 1 4  ? 9.566  4.349   -17.842 1.00 0.00 ? 4  MET A HB3  4  
ATOM 3676  H HG2  . MET A 1 4  ? 10.465 6.385   -16.948 1.00 0.00 ? 4  MET A HG2  4  
ATOM 3677  H HG3  . MET A 1 4  ? 12.046 5.620   -16.695 1.00 0.00 ? 4  MET A HG3  4  
ATOM 3678  H HE1  . MET A 1 4  ? 11.770 8.374   -18.282 1.00 0.00 ? 4  MET A HE1  4  
ATOM 3679  H HE2  . MET A 1 4  ? 12.911 8.038   -19.579 1.00 0.00 ? 4  MET A HE2  4  
ATOM 3680  H HE3  . MET A 1 4  ? 13.263 7.497   -17.931 1.00 0.00 ? 4  MET A HE3  4  
ATOM 3681  N N    . ARG A 1 5  ? 9.459  5.634   -14.539 1.00 0.00 ? 5  ARG A N    4  
ATOM 3682  C CA   . ARG A 1 5  ? 8.503  6.395   -13.741 1.00 0.00 ? 5  ARG A CA   4  
ATOM 3683  C C    . ARG A 1 5  ? 7.411  6.993   -14.617 1.00 0.00 ? 5  ARG A C    4  
ATOM 3684  O O    . ARG A 1 5  ? 6.228  6.856   -14.341 1.00 0.00 ? 5  ARG A O    4  
ATOM 3685  C CB   . ARG A 1 5  ? 9.188  7.512   -12.963 1.00 0.00 ? 5  ARG A CB   4  
ATOM 3686  C CG   . ARG A 1 5  ? 9.924  7.081   -11.698 1.00 0.00 ? 5  ARG A CG   4  
ATOM 3687  C CD   . ARG A 1 5  ? 11.090 6.145   -11.987 1.00 0.00 ? 5  ARG A CD   4  
ATOM 3688  N NE   . ARG A 1 5  ? 10.679 4.735   -11.936 1.00 0.00 ? 5  ARG A NE   4  
ATOM 3689  C CZ   . ARG A 1 5  ? 11.484 3.706   -12.211 1.00 0.00 ? 5  ARG A CZ   4  
ATOM 3690  N NH1  . ARG A 1 5  ? 12.759 3.920   -12.568 1.00 0.00 ? 5  ARG A NH1  4  
ATOM 3691  N NH2  . ARG A 1 5  ? 11.016 2.460   -12.120 1.00 0.00 ? 5  ARG A NH2  4  
ATOM 3692  H H    . ARG A 1 5  ? 10.401 5.965   -14.592 1.00 0.00 ? 5  ARG A H    4  
ATOM 3693  H HA   . ARG A 1 5  ? 8.043  5.710   -13.033 1.00 0.00 ? 5  ARG A HA   4  
ATOM 3694  H HB2  . ARG A 1 5  ? 9.911  7.981   -13.612 1.00 0.00 ? 5  ARG A HB2  4  
ATOM 3695  H HB3  . ARG A 1 5  ? 8.450  8.252   -12.681 1.00 0.00 ? 5  ARG A HB3  4  
ATOM 3696  H HG2  . ARG A 1 5  ? 10.300 7.956   -11.199 1.00 0.00 ? 5  ARG A HG2  4  
ATOM 3697  H HG3  . ARG A 1 5  ? 9.228  6.577   -11.048 1.00 0.00 ? 5  ARG A HG3  4  
ATOM 3698  H HD2  . ARG A 1 5  ? 11.473 6.362   -12.976 1.00 0.00 ? 5  ARG A HD2  4  
ATOM 3699  H HD3  . ARG A 1 5  ? 11.856 6.299   -11.256 1.00 0.00 ? 5  ARG A HD3  4  
ATOM 3700  H HE   . ARG A 1 5  ? 9.760  4.550   -11.681 1.00 0.00 ? 5  ARG A HE   4  
ATOM 3701  H HH11 . ARG A 1 5  ? 13.121 4.860   -12.628 1.00 0.00 ? 5  ARG A HH11 4  
ATOM 3702  H HH12 . ARG A 1 5  ? 13.353 3.141   -12.797 1.00 0.00 ? 5  ARG A HH12 4  
ATOM 3703  H HH21 . ARG A 1 5  ? 10.066 2.283   -11.854 1.00 0.00 ? 5  ARG A HH21 4  
ATOM 3704  H HH22 . ARG A 1 5  ? 11.626 1.678   -12.328 1.00 0.00 ? 5  ARG A HH22 4  
ATOM 3705  N N    . SER A 1 6  ? 7.838  7.609   -15.705 1.00 0.00 ? 6  SER A N    4  
ATOM 3706  C CA   . SER A 1 6  ? 6.941  8.336   -16.590 1.00 0.00 ? 6  SER A CA   4  
ATOM 3707  C C    . SER A 1 6  ? 6.082  7.392   -17.436 1.00 0.00 ? 6  SER A C    4  
ATOM 3708  O O    . SER A 1 6  ? 5.312  7.839   -18.286 1.00 0.00 ? 6  SER A O    4  
ATOM 3709  C CB   . SER A 1 6  ? 7.773  9.260   -17.478 1.00 0.00 ? 6  SER A CB   4  
ATOM 3710  O OG   . SER A 1 6  ? 9.019  8.658   -17.788 1.00 0.00 ? 6  SER A OG   4  
ATOM 3711  H H    . SER A 1 6  ? 8.791  7.576   -15.940 1.00 0.00 ? 6  SER A H    4  
ATOM 3712  H HA   . SER A 1 6  ? 6.287  8.932   -15.981 1.00 0.00 ? 6  SER A HA   4  
ATOM 3713  H HB2  . SER A 1 6  ? 7.234  9.454   -18.395 1.00 0.00 ? 6  SER A HB2  4  
ATOM 3714  H HB3  . SER A 1 6  ? 7.954  10.187  -16.964 1.00 0.00 ? 6  SER A HB3  4  
ATOM 3715  H HG   . SER A 1 6  ? 9.215  8.794   -18.729 1.00 0.00 ? 6  SER A HG   4  
ATOM 3716  N N    . GLU A 1 7  ? 6.193  6.090   -17.186 1.00 0.00 ? 7  GLU A N    4  
ATOM 3717  C CA   . GLU A 1 7  ? 5.360  5.099   -17.877 1.00 0.00 ? 7  GLU A CA   4  
ATOM 3718  C C    . GLU A 1 7  ? 3.972  5.050   -17.251 1.00 0.00 ? 7  GLU A C    4  
ATOM 3719  O O    . GLU A 1 7  ? 3.009  4.609   -17.872 1.00 0.00 ? 7  GLU A O    4  
ATOM 3720  C CB   . GLU A 1 7  ? 6.014  3.714   -17.832 1.00 0.00 ? 7  GLU A CB   4  
ATOM 3721  C CG   . GLU A 1 7  ? 7.243  3.594   -18.727 1.00 0.00 ? 7  GLU A CG   4  
ATOM 3722  C CD   . GLU A 1 7  ? 6.899  3.751   -20.193 1.00 0.00 ? 7  GLU A CD   4  
ATOM 3723  O OE1  . GLU A 1 7  ? 6.587  2.730   -20.847 1.00 0.00 ? 7  GLU A OE1  4  
ATOM 3724  O OE2  . GLU A 1 7  ? 6.920  4.884   -20.697 1.00 0.00 ? 7  GLU A OE2  4  
ATOM 3725  H H    . GLU A 1 7  ? 6.857  5.790   -16.517 1.00 0.00 ? 7  GLU A H    4  
ATOM 3726  H HA   . GLU A 1 7  ? 5.256  5.416   -18.907 1.00 0.00 ? 7  GLU A HA   4  
ATOM 3727  H HB2  . GLU A 1 7  ? 6.305  3.499   -16.818 1.00 0.00 ? 7  GLU A HB2  4  
ATOM 3728  H HB3  . GLU A 1 7  ? 5.293  2.985   -18.154 1.00 0.00 ? 7  GLU A HB3  4  
ATOM 3729  H HG2  . GLU A 1 7  ? 7.949  4.363   -18.458 1.00 0.00 ? 7  GLU A HG2  4  
ATOM 3730  H HG3  . GLU A 1 7  ? 7.693  2.622   -18.581 1.00 0.00 ? 7  GLU A HG3  4  
ATOM 3731  N N    . PHE A 1 8  ? 3.880  5.538   -16.009 1.00 0.00 ? 8  PHE A N    4  
ATOM 3732  C CA   . PHE A 1 8  ? 2.609  5.597   -15.304 1.00 0.00 ? 8  PHE A CA   4  
ATOM 3733  C C    . PHE A 1 8  ? 1.783  6.782   -15.794 1.00 0.00 ? 8  PHE A C    4  
ATOM 3734  O O    . PHE A 1 8  ? 2.297  7.671   -16.479 1.00 0.00 ? 8  PHE A O    4  
ATOM 3735  C CB   . PHE A 1 8  ? 2.835  5.694   -13.802 1.00 0.00 ? 8  PHE A CB   4  
ATOM 3736  C CG   . PHE A 1 8  ? 3.399  4.439   -13.202 1.00 0.00 ? 8  PHE A CG   4  
ATOM 3737  C CD1  . PHE A 1 8  ? 4.746  4.119   -13.365 1.00 0.00 ? 8  PHE A CD1  4  
ATOM 3738  C CD2  . PHE A 1 8  ? 2.582  3.591   -12.471 1.00 0.00 ? 8  PHE A CD2  4  
ATOM 3739  C CE1  . PHE A 1 8  ? 5.258  2.973   -12.811 1.00 0.00 ? 8  PHE A CE1  4  
ATOM 3740  C CE2  . PHE A 1 8  ? 3.108  2.435   -11.921 1.00 0.00 ? 8  PHE A CE2  4  
ATOM 3741  C CZ   . PHE A 1 8  ? 4.440  2.126   -12.090 1.00 0.00 ? 8  PHE A CZ   4  
ATOM 3742  H H    . PHE A 1 8  ? 4.692  5.866   -15.560 1.00 0.00 ? 8  PHE A H    4  
ATOM 3743  H HA   . PHE A 1 8  ? 2.072  4.695   -15.529 1.00 0.00 ? 8  PHE A HA   4  
ATOM 3744  H HB2  . PHE A 1 8  ? 3.523  6.504   -13.599 1.00 0.00 ? 8  PHE A HB2  4  
ATOM 3745  H HB3  . PHE A 1 8  ? 1.890  5.910   -13.314 1.00 0.00 ? 8  PHE A HB3  4  
ATOM 3746  H HD1  . PHE A 1 8  ? 5.385  4.774   -13.927 1.00 0.00 ? 8  PHE A HD1  4  
ATOM 3747  H HD2  . PHE A 1 8  ? 1.541  3.825   -12.347 1.00 0.00 ? 8  PHE A HD2  4  
ATOM 3748  H HE1  . PHE A 1 8  ? 6.300  2.733   -12.948 1.00 0.00 ? 8  PHE A HE1  4  
ATOM 3749  H HE2  . PHE A 1 8  ? 2.462  1.771   -11.356 1.00 0.00 ? 8  PHE A HE2  4  
ATOM 3750  H HZ   . PHE A 1 8  ? 4.844  1.217   -11.660 1.00 0.00 ? 8  PHE A HZ   4  
ATOM 3751  N N    . ALA A 1 9  ? 0.499  6.808   -15.432 1.00 0.00 ? 9  ALA A N    4  
ATOM 3752  C CA   . ALA A 1 9  ? -0.430 7.830   -15.894 1.00 0.00 ? 9  ALA A CA   4  
ATOM 3753  C C    . ALA A 1 9  ? 0.092  9.243   -15.687 1.00 0.00 ? 9  ALA A C    4  
ATOM 3754  O O    . ALA A 1 9  ? 0.018  10.096  -16.572 1.00 0.00 ? 9  ALA A O    4  
ATOM 3755  C CB   . ALA A 1 9  ? -1.787 7.661   -15.223 1.00 0.00 ? 9  ALA A CB   4  
ATOM 3756  H H    . ALA A 1 9  ? 0.159  6.078   -14.846 1.00 0.00 ? 9  ALA A H    4  
ATOM 3757  H HA   . ALA A 1 9  ? -0.584 7.673   -16.955 1.00 0.00 ? 9  ALA A HA   4  
ATOM 3758  H HB1  . ALA A 1 9  ? -2.144 6.658   -15.360 1.00 0.00 ? 9  ALA A HB1  4  
ATOM 3759  H HB2  . ALA A 1 9  ? -2.489 8.356   -15.660 1.00 0.00 ? 9  ALA A HB2  4  
ATOM 3760  H HB3  . ALA A 1 9  ? -1.679 7.871   -14.162 1.00 0.00 ? 9  ALA A HB3  4  
ATOM 3761  N N    . SER A 1 10 ? 0.622  9.500   -14.510 1.00 0.00 ? 10 SER A N    4  
ATOM 3762  C CA   . SER A 1 10 ? 1.113  10.817  -14.162 1.00 0.00 ? 10 SER A CA   4  
ATOM 3763  C C    . SER A 1 10 ? 2.623  10.774  -13.888 1.00 0.00 ? 10 SER A C    4  
ATOM 3764  O O    . SER A 1 10 ? 3.242  11.804  -13.602 1.00 0.00 ? 10 SER A O    4  
ATOM 3765  C CB   . SER A 1 10 ? 0.347  11.339  -12.948 1.00 0.00 ? 10 SER A CB   4  
ATOM 3766  O OG   . SER A 1 10 ? 0.723  12.673  -12.624 1.00 0.00 ? 10 SER A OG   4  
ATOM 3767  H H    . SER A 1 10 ? 0.658  8.800   -13.833 1.00 0.00 ? 10 SER A H    4  
ATOM 3768  H HA   . SER A 1 10 ? 0.926  11.470  -14.998 1.00 0.00 ? 10 SER A HA   4  
ATOM 3769  H HB2  . SER A 1 10 ? -0.720 11.326  -13.158 1.00 0.00 ? 10 SER A HB2  4  
ATOM 3770  H HB3  . SER A 1 10 ? 0.551  10.707  -12.106 1.00 0.00 ? 10 SER A HB3  4  
ATOM 3771  H HG   . SER A 1 10 ? 0.858  13.171  -13.443 1.00 0.00 ? 10 SER A HG   4  
ATOM 3772  N N    . GLY A 1 11 ? 3.223  9.583   -14.006 1.00 0.00 ? 11 GLY A N    4  
ATOM 3773  C CA   . GLY A 1 11 ? 4.645  9.411   -13.674 1.00 0.00 ? 11 GLY A CA   4  
ATOM 3774  C C    . GLY A 1 11 ? 4.885  9.351   -12.179 1.00 0.00 ? 11 GLY A C    4  
ATOM 3775  O O    . GLY A 1 11 ? 5.461  8.393   -11.652 1.00 0.00 ? 11 GLY A O    4  
ATOM 3776  H H    . GLY A 1 11 ? 2.699  8.828   -14.331 1.00 0.00 ? 11 GLY A H    4  
ATOM 3777  H HA2  . GLY A 1 11 ? 4.991  8.482   -14.122 1.00 0.00 ? 11 GLY A HA2  4  
ATOM 3778  H HA3  . GLY A 1 11 ? 5.210  10.235  -14.104 1.00 0.00 ? 11 GLY A HA3  4  
ATOM 3779  N N    . ASN A 1 12 ? 4.414  10.388  -11.494 1.00 0.00 ? 12 ASN A N    4  
ATOM 3780  C CA   . ASN A 1 12 ? 4.461  10.460  -10.032 1.00 0.00 ? 12 ASN A CA   4  
ATOM 3781  C C    . ASN A 1 12 ? 3.711  9.276   -9.428  1.00 0.00 ? 12 ASN A C    4  
ATOM 3782  O O    . ASN A 1 12 ? 3.965  8.887   -8.289  1.00 0.00 ? 12 ASN A O    4  
ATOM 3783  C CB   . ASN A 1 12 ? 3.843  11.765  -9.528  1.00 0.00 ? 12 ASN A CB   4  
ATOM 3784  C CG   . ASN A 1 12 ? 4.510  12.998  -10.092 1.00 0.00 ? 12 ASN A CG   4  
ATOM 3785  O OD1  . ASN A 1 12 ? 5.012  13.014  -11.217 1.00 0.00 ? 12 ASN A OD1  4  
ATOM 3786  N ND2  . ASN A 1 12 ? 4.543  14.063  -9.303  1.00 0.00 ? 12 ASN A ND2  4  
ATOM 3787  H H    . ASN A 1 12 ? 4.034  11.154  -11.994 1.00 0.00 ? 12 ASN A H    4  
ATOM 3788  H HA   . ASN A 1 12 ? 5.488  10.409  -9.720  1.00 0.00 ? 12 ASN A HA   4  
ATOM 3789  H HB2  . ASN A 1 12 ? 2.800  11.781  -9.808  1.00 0.00 ? 12 ASN A HB2  4  
ATOM 3790  H HB3  . ASN A 1 12 ? 3.918  11.795  -8.450  1.00 0.00 ? 12 ASN A HB3  4  
ATOM 3791  H HD21 . ASN A 1 12 ? 4.141  13.988  -8.419  1.00 0.00 ? 12 ASN A HD21 4  
ATOM 3792  H HD22 . ASN A 1 12 ? 4.965  14.879  -9.642  1.00 0.00 ? 12 ASN A HD22 4  
ATOM 3793  N N    . THR A 1 13 ? 2.765  8.750   -10.220 1.00 0.00 ? 13 THR A N    4  
ATOM 3794  C CA   . THR A 1 13 ? 1.926  7.622   -9.829  1.00 0.00 ? 13 THR A CA   4  
ATOM 3795  C C    . THR A 1 13 ? 2.751  6.460   -9.278  1.00 0.00 ? 13 THR A C    4  
ATOM 3796  O O    . THR A 1 13 ? 2.294  5.708   -8.437  1.00 0.00 ? 13 THR A O    4  
ATOM 3797  C CB   . THR A 1 13 ? 1.086  7.140   -11.024 1.00 0.00 ? 13 THR A CB   4  
ATOM 3798  O OG1  . THR A 1 13 ? 0.613  8.284   -11.761 1.00 0.00 ? 13 THR A OG1  4  
ATOM 3799  C CG2  . THR A 1 13 ? -0.091 6.313   -10.550 1.00 0.00 ? 13 THR A CG2  4  
ATOM 3800  H H    . THR A 1 13 ? 2.642  9.138   -11.107 1.00 0.00 ? 13 THR A H    4  
ATOM 3801  H HA   . THR A 1 13 ? 1.242  7.963   -9.060  1.00 0.00 ? 13 THR A HA   4  
ATOM 3802  H HB   . THR A 1 13 ? 1.716  6.521   -11.661 1.00 0.00 ? 13 THR A HB   4  
ATOM 3803  H HG1  . THR A 1 13 ? 0.298  8.943   -11.129 1.00 0.00 ? 13 THR A HG1  4  
ATOM 3804  H HG21 . THR A 1 13 ? 0.263  5.444   -10.016 1.00 0.00 ? 13 THR A HG21 4  
ATOM 3805  H HG22 . THR A 1 13 ? -0.670 5.991   -11.419 1.00 0.00 ? 13 THR A HG22 4  
ATOM 3806  H HG23 . THR A 1 13 ? -0.709 6.899   -9.891  1.00 0.00 ? 13 THR A HG23 4  
ATOM 3807  N N    . TYR A 1 14 ? 3.975  6.318   -9.774  1.00 0.00 ? 14 TYR A N    4  
ATOM 3808  C CA   . TYR A 1 14 ? 4.885  5.295   -9.283  1.00 0.00 ? 14 TYR A CA   4  
ATOM 3809  C C    . TYR A 1 14 ? 5.197  5.535   -7.801  1.00 0.00 ? 14 TYR A C    4  
ATOM 3810  O O    . TYR A 1 14 ? 5.006  4.656   -6.952  1.00 0.00 ? 14 TYR A O    4  
ATOM 3811  C CB   . TYR A 1 14 ? 6.168  5.291   -10.114 1.00 0.00 ? 14 TYR A CB   4  
ATOM 3812  C CG   . TYR A 1 14 ? 7.177  4.268   -9.655  1.00 0.00 ? 14 TYR A CG   4  
ATOM 3813  C CD1  . TYR A 1 14 ? 6.951  2.908   -9.831  1.00 0.00 ? 14 TYR A CD1  4  
ATOM 3814  C CD2  . TYR A 1 14 ? 8.359  4.664   -9.056  1.00 0.00 ? 14 TYR A CD2  4  
ATOM 3815  C CE1  . TYR A 1 14 ? 7.879  1.979   -9.408  1.00 0.00 ? 14 TYR A CE1  4  
ATOM 3816  C CE2  . TYR A 1 14 ? 9.294  3.744   -8.629  1.00 0.00 ? 14 TYR A CE2  4  
ATOM 3817  C CZ   . TYR A 1 14 ? 9.043  2.402   -8.805  1.00 0.00 ? 14 TYR A CZ   4  
ATOM 3818  O OH   . TYR A 1 14 ? 9.952  1.469   -8.387  1.00 0.00 ? 14 TYR A OH   4  
ATOM 3819  H H    . TYR A 1 14 ? 4.285  6.914   -10.483 1.00 0.00 ? 14 TYR A H    4  
ATOM 3820  H HA   . TYR A 1 14 ? 4.397  4.336   -9.380  1.00 0.00 ? 14 TYR A HA   4  
ATOM 3821  H HB2  . TYR A 1 14 ? 5.917  5.063   -11.137 1.00 0.00 ? 14 TYR A HB2  4  
ATOM 3822  H HB3  . TYR A 1 14 ? 6.631  6.265   -10.074 1.00 0.00 ? 14 TYR A HB3  4  
ATOM 3823  H HD1  . TYR A 1 14 ? 6.030  2.586   -10.297 1.00 0.00 ? 14 TYR A HD1  4  
ATOM 3824  H HD2  . TYR A 1 14 ? 8.563  5.722   -8.925  1.00 0.00 ? 14 TYR A HD2  4  
ATOM 3825  H HE1  . TYR A 1 14 ? 7.686  0.927   -9.555  1.00 0.00 ? 14 TYR A HE1  4  
ATOM 3826  H HE2  . TYR A 1 14 ? 10.202 4.066   -8.146  1.00 0.00 ? 14 TYR A HE2  4  
ATOM 3827  H HH   . TYR A 1 14 ? 10.353 1.777   -7.554  1.00 0.00 ? 14 TYR A HH   4  
ATOM 3828  N N    . ALA A 1 15 ? 5.669  6.749   -7.513  1.00 0.00 ? 15 ALA A N    4  
ATOM 3829  C CA   . ALA A 1 15 ? 5.983  7.152   -6.144  1.00 0.00 ? 15 ALA A CA   4  
ATOM 3830  C C    . ALA A 1 15 ? 4.745  7.158   -5.274  1.00 0.00 ? 15 ALA A C    4  
ATOM 3831  O O    . ALA A 1 15 ? 4.816  6.929   -4.073  1.00 0.00 ? 15 ALA A O    4  
ATOM 3832  C CB   . ALA A 1 15 ? 6.616  8.547   -6.146  1.00 0.00 ? 15 ALA A CB   4  
ATOM 3833  H H    . ALA A 1 15 ? 5.815  7.375   -8.250  1.00 0.00 ? 15 ALA A H    4  
ATOM 3834  H HA   . ALA A 1 15 ? 6.704  6.463   -5.755  1.00 0.00 ? 15 ALA A HA   4  
ATOM 3835  H HB1  . ALA A 1 15 ? 5.887  9.267   -6.496  1.00 0.00 ? 15 ALA A HB1  4  
ATOM 3836  H HB2  . ALA A 1 15 ? 7.468  8.550   -6.801  1.00 0.00 ? 15 ALA A HB2  4  
ATOM 3837  H HB3  . ALA A 1 15 ? 6.922  8.802   -5.139  1.00 0.00 ? 15 ALA A HB3  4  
ATOM 3838  N N    . LEU A 1 16 ? 3.607  7.423   -5.894  1.00 0.00 ? 16 LEU A N    4  
ATOM 3839  C CA   . LEU A 1 16 ? 2.341  7.480   -5.193  1.00 0.00 ? 16 LEU A CA   4  
ATOM 3840  C C    . LEU A 1 16 ? 1.888  6.070   -4.827  1.00 0.00 ? 16 LEU A C    4  
ATOM 3841  O O    . LEU A 1 16 ? 1.357  5.831   -3.741  1.00 0.00 ? 16 LEU A O    4  
ATOM 3842  C CB   . LEU A 1 16 ? 1.272  8.168   -6.060  1.00 0.00 ? 16 LEU A CB   4  
ATOM 3843  C CG   . LEU A 1 16 ? -0.099 8.358   -5.383  1.00 0.00 ? 16 LEU A CG   4  
ATOM 3844  C CD1  . LEU A 1 16 ? 0.024  9.239   -4.156  1.00 0.00 ? 16 LEU A CD1  4  
ATOM 3845  C CD2  . LEU A 1 16 ? -1.090 8.954   -6.375  1.00 0.00 ? 16 LEU A CD2  4  
ATOM 3846  H H    . LEU A 1 16 ? 3.622  7.589   -6.853  1.00 0.00 ? 16 LEU A H    4  
ATOM 3847  H HA   . LEU A 1 16 ? 2.492  8.045   -4.288  1.00 0.00 ? 16 LEU A HA   4  
ATOM 3848  H HB2  . LEU A 1 16 ? 1.638  9.127   -6.359  1.00 0.00 ? 16 LEU A HB2  4  
ATOM 3849  H HB3  . LEU A 1 16 ? 1.126  7.566   -6.950  1.00 0.00 ? 16 LEU A HB3  4  
ATOM 3850  H HG   . LEU A 1 16 ? -0.477 7.393   -5.062  1.00 0.00 ? 16 LEU A HG   4  
ATOM 3851  H HD11 . LEU A 1 16 ? -0.946 9.347   -3.705  1.00 0.00 ? 16 LEU A HD11 4  
ATOM 3852  H HD12 . LEU A 1 16 ? 0.393  10.220  -4.453  1.00 0.00 ? 16 LEU A HD12 4  
ATOM 3853  H HD13 . LEU A 1 16 ? 0.716  8.809   -3.443  1.00 0.00 ? 16 LEU A HD13 4  
ATOM 3854  H HD21 . LEU A 1 16 ? -0.718 9.907   -6.740  1.00 0.00 ? 16 LEU A HD21 4  
ATOM 3855  H HD22 . LEU A 1 16 ? -2.050 9.118   -5.894  1.00 0.00 ? 16 LEU A HD22 4  
ATOM 3856  H HD23 . LEU A 1 16 ? -1.221 8.271   -7.196  1.00 0.00 ? 16 LEU A HD23 4  
ATOM 3857  N N    . TYR A 1 17 ? 2.118  5.135   -5.746  1.00 0.00 ? 17 TYR A N    4  
ATOM 3858  C CA   . TYR A 1 17 ? 1.780  3.737   -5.535  1.00 0.00 ? 17 TYR A CA   4  
ATOM 3859  C C    . TYR A 1 17 ? 2.618  3.146   -4.410  1.00 0.00 ? 17 TYR A C    4  
ATOM 3860  O O    . TYR A 1 17 ? 2.082  2.562   -3.459  1.00 0.00 ? 17 TYR A O    4  
ATOM 3861  C CB   . TYR A 1 17 ? 1.983  2.940   -6.839  1.00 0.00 ? 17 TYR A CB   4  
ATOM 3862  C CG   . TYR A 1 17 ? 1.615  1.471   -6.725  1.00 0.00 ? 17 TYR A CG   4  
ATOM 3863  C CD1  . TYR A 1 17 ? 2.533  0.540   -6.241  1.00 0.00 ? 17 TYR A CD1  4  
ATOM 3864  C CD2  . TYR A 1 17 ? 0.366  1.017   -7.099  1.00 0.00 ? 17 TYR A CD2  4  
ATOM 3865  C CE1  . TYR A 1 17 ? 2.196  -0.794  -6.143  1.00 0.00 ? 17 TYR A CE1  4  
ATOM 3866  C CE2  . TYR A 1 17 ? 0.027  -0.322  -7.004  1.00 0.00 ? 17 TYR A CE2  4  
ATOM 3867  C CZ   . TYR A 1 17 ? 0.949  -1.222  -6.517  1.00 0.00 ? 17 TYR A CZ   4  
ATOM 3868  O OH   . TYR A 1 17 ? 0.632  -2.552  -6.414  1.00 0.00 ? 17 TYR A OH   4  
ATOM 3869  H H    . TYR A 1 17 ? 2.521  5.396   -6.605  1.00 0.00 ? 17 TYR A H    4  
ATOM 3870  H HA   . TYR A 1 17 ? 0.742  3.696   -5.258  1.00 0.00 ? 17 TYR A HA   4  
ATOM 3871  H HB2  . TYR A 1 17 ? 1.370  3.377   -7.613  1.00 0.00 ? 17 TYR A HB2  4  
ATOM 3872  H HB3  . TYR A 1 17 ? 3.031  2.993   -7.126  1.00 0.00 ? 17 TYR A HB3  4  
ATOM 3873  H HD1  . TYR A 1 17 ? 3.517  0.872   -5.942  1.00 0.00 ? 17 TYR A HD1  4  
ATOM 3874  H HD2  . TYR A 1 17 ? -0.362 1.736   -7.472  1.00 0.00 ? 17 TYR A HD2  4  
ATOM 3875  H HE1  . TYR A 1 17 ? 2.930  -1.503  -5.765  1.00 0.00 ? 17 TYR A HE1  4  
ATOM 3876  H HE2  . TYR A 1 17 ? -0.952 -0.664  -7.306  1.00 0.00 ? 17 TYR A HE2  4  
ATOM 3877  H HH   . TYR A 1 17 ? 0.701  -2.829  -5.476  1.00 0.00 ? 17 TYR A HH   4  
ATOM 3878  N N    . VAL A 1 18 ? 3.931  3.297   -4.525  1.00 0.00 ? 18 VAL A N    4  
ATOM 3879  C CA   . VAL A 1 18 ? 4.853  2.717   -3.569  1.00 0.00 ? 18 VAL A CA   4  
ATOM 3880  C C    . VAL A 1 18 ? 4.609  3.260   -2.165  1.00 0.00 ? 18 VAL A C    4  
ATOM 3881  O O    . VAL A 1 18 ? 4.690  2.509   -1.190  1.00 0.00 ? 18 VAL A O    4  
ATOM 3882  C CB   . VAL A 1 18 ? 6.337  2.906   -3.988  1.00 0.00 ? 18 VAL A CB   4  
ATOM 3883  C CG1  . VAL A 1 18 ? 6.622  2.146   -5.268  1.00 0.00 ? 18 VAL A CG1  4  
ATOM 3884  C CG2  . VAL A 1 18 ? 6.694  4.374   -4.151  1.00 0.00 ? 18 VAL A CG2  4  
ATOM 3885  H H    . VAL A 1 18 ? 4.282  3.789   -5.303  1.00 0.00 ? 18 VAL A H    4  
ATOM 3886  H HA   . VAL A 1 18 ? 4.652  1.662   -3.541  1.00 0.00 ? 18 VAL A HA   4  
ATOM 3887  H HB   . VAL A 1 18 ? 6.967  2.495   -3.206  1.00 0.00 ? 18 VAL A HB   4  
ATOM 3888  H HG11 . VAL A 1 18 ? 7.648  2.285   -5.553  1.00 0.00 ? 18 VAL A HG11 4  
ATOM 3889  H HG12 . VAL A 1 18 ? 5.983  2.524   -6.056  1.00 0.00 ? 18 VAL A HG12 4  
ATOM 3890  H HG13 . VAL A 1 18 ? 6.422  1.095   -5.124  1.00 0.00 ? 18 VAL A HG13 4  
ATOM 3891  H HG21 . VAL A 1 18 ? 6.079  4.804   -4.931  1.00 0.00 ? 18 VAL A HG21 4  
ATOM 3892  H HG22 . VAL A 1 18 ? 7.725  4.455   -4.406  1.00 0.00 ? 18 VAL A HG22 4  
ATOM 3893  H HG23 . VAL A 1 18 ? 6.495  4.898   -3.220  1.00 0.00 ? 18 VAL A HG23 4  
ATOM 3894  N N    . ARG A 1 19 ? 4.281  4.545   -2.053  1.00 0.00 ? 19 ARG A N    4  
ATOM 3895  C CA   . ARG A 1 19 ? 4.019  5.171   -0.761  1.00 0.00 ? 19 ARG A CA   4  
ATOM 3896  C C    . ARG A 1 19 ? 2.889  4.446   -0.027  1.00 0.00 ? 19 ARG A C    4  
ATOM 3897  O O    . ARG A 1 19 ? 2.852  4.432   1.211   1.00 0.00 ? 19 ARG A O    4  
ATOM 3898  C CB   . ARG A 1 19 ? 3.672  6.655   -0.944  1.00 0.00 ? 19 ARG A CB   4  
ATOM 3899  C CG   . ARG A 1 19 ? 3.884  7.517   0.302   1.00 0.00 ? 19 ARG A CG   4  
ATOM 3900  C CD   . ARG A 1 19 ? 2.585  7.999   0.913   1.00 0.00 ? 19 ARG A CD   4  
ATOM 3901  N NE   . ARG A 1 19 ? 1.871  6.941   1.625   1.00 0.00 ? 19 ARG A NE   4  
ATOM 3902  C CZ   . ARG A 1 19 ? 0.800  7.140   2.383   1.00 0.00 ? 19 ARG A CZ   4  
ATOM 3903  N NH1  . ARG A 1 19 ? 0.255  8.347   2.470   1.00 0.00 ? 19 ARG A NH1  4  
ATOM 3904  N NH2  . ARG A 1 19 ? 0.242  6.104   3.007   1.00 0.00 ? 19 ARG A NH2  4  
ATOM 3905  H H    . ARG A 1 19 ? 4.243  5.105   -2.860  1.00 0.00 ? 19 ARG A H    4  
ATOM 3906  H HA   . ARG A 1 19 ? 4.928  5.104   -0.183  1.00 0.00 ? 19 ARG A HA   4  
ATOM 3907  H HB2  . ARG A 1 19 ? 4.273  7.051   -1.740  1.00 0.00 ? 19 ARG A HB2  4  
ATOM 3908  H HB3  . ARG A 1 19 ? 2.619  6.729   -1.229  1.00 0.00 ? 19 ARG A HB3  4  
ATOM 3909  H HG2  . ARG A 1 19 ? 4.419  6.934   1.032   1.00 0.00 ? 19 ARG A HG2  4  
ATOM 3910  H HG3  . ARG A 1 19 ? 4.485  8.376   0.022   1.00 0.00 ? 19 ARG A HG3  4  
ATOM 3911  H HD2  . ARG A 1 19 ? 2.809  8.812   1.598   1.00 0.00 ? 19 ARG A HD2  4  
ATOM 3912  H HD3  . ARG A 1 19 ? 1.942  8.363   0.124   1.00 0.00 ? 19 ARG A HD3  4  
ATOM 3913  H HE   . ARG A 1 19 ? 2.250  6.038   1.573   1.00 0.00 ? 19 ARG A HE   4  
ATOM 3914  H HH11 . ARG A 1 19 ? 0.685  9.136   1.993   1.00 0.00 ? 19 ARG A HH11 4  
ATOM 3915  H HH12 . ARG A 1 19 ? -0.556 8.507   3.047   1.00 0.00 ? 19 ARG A HH12 4  
ATOM 3916  H HH21 . ARG A 1 19 ? 0.655  5.193   2.933   1.00 0.00 ? 19 ARG A HH21 4  
ATOM 3917  H HH22 . ARG A 1 19 ? -0.584 6.236   3.583   1.00 0.00 ? 19 ARG A HH22 4  
ATOM 3918  N N    . ASP A 1 20 ? 1.977  3.853   -0.778  1.00 0.00 ? 20 ASP A N    4  
ATOM 3919  C CA   . ASP A 1 20 ? 0.837  3.159   -0.207  1.00 0.00 ? 20 ASP A CA   4  
ATOM 3920  C C    . ASP A 1 20 ? 1.230  1.816   0.391   1.00 0.00 ? 20 ASP A C    4  
ATOM 3921  O O    . ASP A 1 20 ? 0.930  1.528   1.551   1.00 0.00 ? 20 ASP A O    4  
ATOM 3922  C CB   . ASP A 1 20 ? -0.232 2.946   -1.283  1.00 0.00 ? 20 ASP A CB   4  
ATOM 3923  C CG   . ASP A 1 20 ? -1.282 1.931   -0.887  1.00 0.00 ? 20 ASP A CG   4  
ATOM 3924  O OD1  . ASP A 1 20 ? -2.296 2.335   -0.260  1.00 0.00 ? 20 ASP A OD1  4  
ATOM 3925  O OD2  . ASP A 1 20 ? -1.108 0.743   -1.205  1.00 0.00 ? 20 ASP A OD2  4  
ATOM 3926  H H    . ASP A 1 20 ? 2.090  3.872   -1.753  1.00 0.00 ? 20 ASP A H    4  
ATOM 3927  H HA   . ASP A 1 20 ? 0.428  3.775   0.565   1.00 0.00 ? 20 ASP A HA   4  
ATOM 3928  H HB2  . ASP A 1 20 ? -0.727 3.888   -1.464  1.00 0.00 ? 20 ASP A HB2  4  
ATOM 3929  H HB3  . ASP A 1 20 ? 0.244  2.611   -2.192  1.00 0.00 ? 20 ASP A HB3  4  
ATOM 3930  N N    . THR A 1 21 ? 1.906  1.001   -0.396  1.00 0.00 ? 21 THR A N    4  
ATOM 3931  C CA   . THR A 1 21 ? 2.217  -0.369  -0.006  1.00 0.00 ? 21 THR A CA   4  
ATOM 3932  C C    . THR A 1 21 ? 3.469  -0.439  0.861   1.00 0.00 ? 21 THR A C    4  
ATOM 3933  O O    . THR A 1 21 ? 3.583  -1.294  1.748   1.00 0.00 ? 21 THR A O    4  
ATOM 3934  C CB   . THR A 1 21 ? 2.386  -1.251  -1.261  1.00 0.00 ? 21 THR A CB   4  
ATOM 3935  O OG1  . THR A 1 21 ? 1.269  -1.062  -2.138  1.00 0.00 ? 21 THR A OG1  4  
ATOM 3936  C CG2  . THR A 1 21 ? 2.490  -2.719  -0.881  1.00 0.00 ? 21 THR A CG2  4  
ATOM 3937  H H    . THR A 1 21 ? 2.219  1.337   -1.258  1.00 0.00 ? 21 THR A H    4  
ATOM 3938  H HA   . THR A 1 21 ? 1.376  -0.740  0.558   1.00 0.00 ? 21 THR A HA   4  
ATOM 3939  H HB   . THR A 1 21 ? 3.283  -0.954  -1.774  1.00 0.00 ? 21 THR A HB   4  
ATOM 3940  H HG1  . THR A 1 21 ? 0.598  -0.524  -1.685  1.00 0.00 ? 21 THR A HG1  4  
ATOM 3941  H HG21 . THR A 1 21 ? 3.331  -2.852  -0.210  1.00 0.00 ? 21 THR A HG21 4  
ATOM 3942  H HG22 . THR A 1 21 ? 2.627  -3.314  -1.766  1.00 0.00 ? 21 THR A HG22 4  
ATOM 3943  H HG23 . THR A 1 21 ? 1.588  -3.021  -0.372  1.00 0.00 ? 21 THR A HG23 4  
ATOM 3944  N N    . LEU A 1 22 ? 4.409  0.464   0.617   1.00 0.00 ? 22 LEU A N    4  
ATOM 3945  C CA   . LEU A 1 22 ? 5.686  0.457   1.315   1.00 0.00 ? 22 LEU A CA   4  
ATOM 3946  C C    . LEU A 1 22 ? 5.501  0.815   2.791   1.00 0.00 ? 22 LEU A C    4  
ATOM 3947  O O    . LEU A 1 22 ? 5.377  1.982   3.146   1.00 0.00 ? 22 LEU A O    4  
ATOM 3948  C CB   . LEU A 1 22 ? 6.677  1.435   0.656   1.00 0.00 ? 22 LEU A CB   4  
ATOM 3949  C CG   . LEU A 1 22 ? 8.096  1.416   1.193   1.00 0.00 ? 22 LEU A CG   4  
ATOM 3950  C CD1  . LEU A 1 22 ? 8.710  0.044   1.025   1.00 0.00 ? 22 LEU A CD1  4  
ATOM 3951  C CD2  . LEU A 1 22 ? 8.939  2.475   0.496   1.00 0.00 ? 22 LEU A CD2  4  
ATOM 3952  H H    . LEU A 1 22 ? 4.256  1.152   -0.068  1.00 0.00 ? 22 LEU A H    4  
ATOM 3953  H HA   . LEU A 1 22 ? 6.090  -0.554  1.243   1.00 0.00 ? 22 LEU A HA   4  
ATOM 3954  H HB2  . LEU A 1 22 ? 6.709  1.213   -0.408  1.00 0.00 ? 22 LEU A HB2  4  
ATOM 3955  H HB3  . LEU A 1 22 ? 6.286  2.427   0.765   1.00 0.00 ? 22 LEU A HB3  4  
ATOM 3956  H HG   . LEU A 1 22 ? 8.087  1.642   2.245   1.00 0.00 ? 22 LEU A HG   4  
ATOM 3957  H HD11 . LEU A 1 22 ? 8.725  -0.232  -0.026  1.00 0.00 ? 22 LEU A HD11 4  
ATOM 3958  H HD12 . LEU A 1 22 ? 8.129  -0.686  1.571   1.00 0.00 ? 22 LEU A HD12 4  
ATOM 3959  H HD13 . LEU A 1 22 ? 9.708  0.050   1.414   1.00 0.00 ? 22 LEU A HD13 4  
ATOM 3960  H HD21 . LEU A 1 22 ? 9.934  2.444   0.876   1.00 0.00 ? 22 LEU A HD21 4  
ATOM 3961  H HD22 . LEU A 1 22 ? 8.505  3.447   0.677   1.00 0.00 ? 22 LEU A HD22 4  
ATOM 3962  H HD23 . LEU A 1 22 ? 8.946  2.281   -0.575  1.00 0.00 ? 22 LEU A HD23 4  
ATOM 3963  N N    . GLN A 1 23 ? 5.418  -0.215  3.621   1.00 0.00 ? 23 GLN A N    4  
ATOM 3964  C CA   . GLN A 1 23 ? 5.308  -0.050  5.048   1.00 0.00 ? 23 GLN A CA   4  
ATOM 3965  C C    . GLN A 1 23 ? 6.694  -0.097  5.686   1.00 0.00 ? 23 GLN A C    4  
ATOM 3966  O O    . GLN A 1 23 ? 7.665  -0.503  5.046   1.00 0.00 ? 23 GLN A O    4  
ATOM 3967  C CB   . GLN A 1 23 ? 4.430  -1.141  5.639   1.00 0.00 ? 23 GLN A CB   4  
ATOM 3968  C CG   . GLN A 1 23 ? 2.969  -1.050  5.230   1.00 0.00 ? 23 GLN A CG   4  
ATOM 3969  C CD   . GLN A 1 23 ? 2.106  -2.076  5.968   1.00 0.00 ? 23 GLN A CD   4  
ATOM 3970  O OE1  . GLN A 1 23 ? 0.911  -1.854  6.183   1.00 0.00 ? 23 GLN A OE1  4  
ATOM 3971  N NE2  . GLN A 1 23 ? 2.711  -3.169  6.369   1.00 0.00 ? 23 GLN A NE2  4  
ATOM 3972  H H    . GLN A 1 23 ? 5.426  -1.113  3.249   1.00 0.00 ? 23 GLN A H    4  
ATOM 3973  H HA   . GLN A 1 23 ? 4.868  0.922   5.240   1.00 0.00 ? 23 GLN A HA   4  
ATOM 3974  H HB2  . GLN A 1 23 ? 4.809  -2.092  5.303   1.00 0.00 ? 23 GLN A HB2  4  
ATOM 3975  H HB3  . GLN A 1 23 ? 4.490  -1.098  6.709   1.00 0.00 ? 23 GLN A HB3  4  
ATOM 3976  H HG2  . GLN A 1 23 ? 2.594  -0.061  5.460   1.00 0.00 ? 23 GLN A HG2  4  
ATOM 3977  H HG3  . GLN A 1 23 ? 2.890  -1.239  4.168   1.00 0.00 ? 23 GLN A HG3  4  
ATOM 3978  H HE21 . GLN A 1 23 ? 3.668  -3.264  6.179   1.00 0.00 ? 23 GLN A HE21 4  
ATOM 3979  H HE22 . GLN A 1 23 ? 2.182  -3.863  6.844   1.00 0.00 ? 23 GLN A HE22 4  
ATOM 3980  N N    . PRO A 1 24 ? 6.808  0.298   6.965   1.00 0.00 ? 24 PRO A N    4  
ATOM 3981  C CA   . PRO A 1 24 ? 8.070  0.214   7.708   1.00 0.00 ? 24 PRO A CA   4  
ATOM 3982  C C    . PRO A 1 24 ? 8.523  -1.231  7.846   1.00 0.00 ? 24 PRO A C    4  
ATOM 3983  O O    . PRO A 1 24 ? 7.739  -2.108  8.230   1.00 0.00 ? 24 PRO A O    4  
ATOM 3984  C CB   . PRO A 1 24 ? 7.724  0.827   9.088   1.00 0.00 ? 24 PRO A CB   4  
ATOM 3985  C CG   . PRO A 1 24 ? 6.448  1.569   8.879   1.00 0.00 ? 24 PRO A CG   4  
ATOM 3986  C CD   . PRO A 1 24 ? 5.716  0.840   7.784   1.00 0.00 ? 24 PRO A CD   4  
ATOM 3987  H HA   . PRO A 1 24 ? 8.852  0.795   7.237   1.00 0.00 ? 24 PRO A HA   4  
ATOM 3988  H HB2  . PRO A 1 24 ? 7.608  0.034   9.803   1.00 0.00 ? 24 PRO A HB2  4  
ATOM 3989  H HB3  . PRO A 1 24 ? 8.524  1.504   9.390   1.00 0.00 ? 24 PRO A HB3  4  
ATOM 3990  H HG2  . PRO A 1 24 ? 5.859  1.550   9.784   1.00 0.00 ? 24 PRO A HG2  4  
ATOM 3991  H HG3  . PRO A 1 24 ? 6.646  2.589   8.575   1.00 0.00 ? 24 PRO A HG3  4  
ATOM 3992  H HD2  . PRO A 1 24 ? 5.113  0.042   8.191   1.00 0.00 ? 24 PRO A HD2  4  
ATOM 3993  H HD3  . PRO A 1 24 ? 5.112  1.519   7.201   1.00 0.00 ? 24 PRO A HD3  4  
ATOM 3994  N N    . GLY A 1 25 ? 9.782  -1.476  7.523   1.00 0.00 ? 25 GLY A N    4  
ATOM 3995  C CA   . GLY A 1 25 ? 10.303 -2.825  7.587   1.00 0.00 ? 25 GLY A CA   4  
ATOM 3996  C C    . GLY A 1 25 ? 10.306 -3.488  6.230   1.00 0.00 ? 25 GLY A C    4  
ATOM 3997  O O    . GLY A 1 25 ? 10.873 -4.565  6.042   1.00 0.00 ? 25 GLY A O    4  
ATOM 3998  H H    . GLY A 1 25 ? 10.366 -0.730  7.265   1.00 0.00 ? 25 GLY A H    4  
ATOM 3999  H HA2  . GLY A 1 25 ? 11.322 -2.798  7.963   1.00 0.00 ? 25 GLY A HA2  4  
ATOM 4000  H HA3  . GLY A 1 25 ? 9.692  -3.400  8.256   1.00 0.00 ? 25 GLY A HA3  4  
ATOM 4001  N N    . MET A 1 26 ? 9.677  -2.839  5.260   1.00 0.00 ? 26 MET A N    4  
ATOM 4002  C CA   . MET A 1 26 ? 9.612  -3.365  3.898   1.00 0.00 ? 26 MET A CA   4  
ATOM 4003  C C    . MET A 1 26 ? 10.877 -2.996  3.129   1.00 0.00 ? 26 MET A C    4  
ATOM 4004  O O    . MET A 1 26 ? 11.320 -1.847  3.170   1.00 0.00 ? 26 MET A O    4  
ATOM 4005  C CB   . MET A 1 26 ? 8.365  -2.859  3.180   1.00 0.00 ? 26 MET A CB   4  
ATOM 4006  C CG   . MET A 1 26 ? 8.228  -3.370  1.754   1.00 0.00 ? 26 MET A CG   4  
ATOM 4007  S SD   . MET A 1 26 ? 6.650  -2.944  0.993   1.00 0.00 ? 26 MET A SD   4  
ATOM 4008  C CE   . MET A 1 26 ? 5.510  -3.879  2.003   1.00 0.00 ? 26 MET A CE   4  
ATOM 4009  H H    . MET A 1 26 ? 9.251  -1.985  5.456   1.00 0.00 ? 26 MET A H    4  
ATOM 4010  H HA   . MET A 1 26 ? 9.567  -4.437  3.976   1.00 0.00 ? 26 MET A HA   4  
ATOM 4011  H HB2  . MET A 1 26 ? 7.491  -3.177  3.728   1.00 0.00 ? 26 MET A HB2  4  
ATOM 4012  H HB3  . MET A 1 26 ? 8.392  -1.780  3.159   1.00 0.00 ? 26 MET A HB3  4  
ATOM 4013  H HG2  . MET A 1 26 ? 9.017  -2.950  1.164   1.00 0.00 ? 26 MET A HG2  4  
ATOM 4014  H HG3  . MET A 1 26 ? 8.309  -4.456  1.767   1.00 0.00 ? 26 MET A HG3  4  
ATOM 4015  H HE1  . MET A 1 26 ? 5.731  -4.933  1.916   1.00 0.00 ? 26 MET A HE1  4  
ATOM 4016  H HE2  . MET A 1 26 ? 4.511  -3.702  1.665   1.00 0.00 ? 26 MET A HE2  4  
ATOM 4017  H HE3  . MET A 1 26 ? 5.605  -3.561  3.028   1.00 0.00 ? 26 MET A HE3  4  
ATOM 4018  N N    . ARG A 1 27 ? 11.457 -3.978  2.461   1.00 0.00 ? 27 ARG A N    4  
ATOM 4019  C CA   . ARG A 1 27 ? 12.717 -3.792  1.748   1.00 0.00 ? 27 ARG A CA   4  
ATOM 4020  C C    . ARG A 1 27 ? 12.522 -3.149  0.389   1.00 0.00 ? 27 ARG A C    4  
ATOM 4021  O O    . ARG A 1 27 ? 11.500 -3.346  -0.271  1.00 0.00 ? 27 ARG A O    4  
ATOM 4022  C CB   . ARG A 1 27 ? 13.473 -5.115  1.628   1.00 0.00 ? 27 ARG A CB   4  
ATOM 4023  C CG   . ARG A 1 27 ? 13.855 -5.709  2.965   1.00 0.00 ? 27 ARG A CG   4  
ATOM 4024  C CD   . ARG A 1 27 ? 14.741 -6.930  2.806   1.00 0.00 ? 27 ARG A CD   4  
ATOM 4025  N NE   . ARG A 1 27 ? 14.156 -7.937  1.924   1.00 0.00 ? 27 ARG A NE   4  
ATOM 4026  C CZ   . ARG A 1 27 ? 14.880 -8.743  1.114   1.00 0.00 ? 27 ARG A CZ   4  
ATOM 4027  N NH1  . ARG A 1 27 ? 16.185 -8.570  1.024   1.00 0.00 ? 27 ARG A NH1  4  
ATOM 4028  N NH2  . ARG A 1 27 ? 14.273 -9.648  0.369   1.00 0.00 ? 27 ARG A NH2  4  
ATOM 4029  H H    . ARG A 1 27 ? 11.012 -4.850  2.454   1.00 0.00 ? 27 ARG A H    4  
ATOM 4030  H HA   . ARG A 1 27 ? 13.324 -3.121  2.359   1.00 0.00 ? 27 ARG A HA   4  
ATOM 4031  H HB2  . ARG A 1 27 ? 12.846 -5.827  1.083   1.00 0.00 ? 27 ARG A HB2  4  
ATOM 4032  H HB3  . ARG A 1 27 ? 14.369 -4.954  1.054   1.00 0.00 ? 27 ARG A HB3  4  
ATOM 4033  H HG2  . ARG A 1 27 ? 14.389 -4.964  3.549   1.00 0.00 ? 27 ARG A HG2  4  
ATOM 4034  H HG3  . ARG A 1 27 ? 12.948 -5.987  3.486   1.00 0.00 ? 27 ARG A HG3  4  
ATOM 4035  H HD2  . ARG A 1 27 ? 15.684 -6.613  2.388   1.00 0.00 ? 27 ARG A HD2  4  
ATOM 4036  H HD3  . ARG A 1 27 ? 14.901 -7.368  3.779   1.00 0.00 ? 27 ARG A HD3  4  
ATOM 4037  H HE   . ARG A 1 27 ? 13.170 -8.051  1.953   1.00 0.00 ? 27 ARG A HE   4  
ATOM 4038  H HH11 . ARG A 1 27 ? 16.646 -7.863  1.581   1.00 0.00 ? 27 ARG A HH11 4  
ATOM 4039  H HH12 . ARG A 1 27 ? 16.738 -9.163  0.411   1.00 0.00 ? 27 ARG A HH12 4  
ATOM 4040  H HH21 . ARG A 1 27 ? 13.262 -9.764  0.420   1.00 0.00 ? 27 ARG A HH21 4  
ATOM 4041  H HH22 . ARG A 1 27 ? 14.810 -10.253 -0.226  1.00 0.00 ? 27 ARG A HH22 4  
ATOM 4042  N N    . VAL A 1 28 ? 13.526 -2.393  -0.006  1.00 0.00 ? 28 VAL A N    4  
ATOM 4043  C CA   . VAL A 1 28 ? 13.510 -1.658  -1.267  1.00 0.00 ? 28 VAL A CA   4  
ATOM 4044  C C    . VAL A 1 28 ? 14.831 -1.859  -2.018  1.00 0.00 ? 28 VAL A C    4  
ATOM 4045  O O    . VAL A 1 28 ? 15.837 -2.234  -1.430  1.00 0.00 ? 28 VAL A O    4  
ATOM 4046  C CB   . VAL A 1 28 ? 13.304 -0.148  -1.013  1.00 0.00 ? 28 VAL A CB   4  
ATOM 4047  C CG1  . VAL A 1 28 ? 11.959 0.129   -0.368  1.00 0.00 ? 28 VAL A CG1  4  
ATOM 4048  C CG2  . VAL A 1 28 ? 14.428 0.390   -0.140  1.00 0.00 ? 28 VAL A CG2  4  
ATOM 4049  H H    . VAL A 1 28 ? 14.319 -2.325  0.586   1.00 0.00 ? 28 VAL A H    4  
ATOM 4050  H HA   . VAL A 1 28 ? 12.688 -2.024  -1.874  1.00 0.00 ? 28 VAL A HA   4  
ATOM 4051  H HB   . VAL A 1 28 ? 13.340 0.368   -1.955  1.00 0.00 ? 28 VAL A HB   4  
ATOM 4052  H HG11 . VAL A 1 28 ? 11.819 1.196   -0.287  1.00 0.00 ? 28 VAL A HG11 4  
ATOM 4053  H HG12 . VAL A 1 28 ? 11.944 -0.312  0.616   1.00 0.00 ? 28 VAL A HG12 4  
ATOM 4054  H HG13 . VAL A 1 28 ? 11.176 -0.304  -0.971  1.00 0.00 ? 28 VAL A HG13 4  
ATOM 4055  H HG21 . VAL A 1 28 ? 14.406 -0.122  0.811   1.00 0.00 ? 28 VAL A HG21 4  
ATOM 4056  H HG22 . VAL A 1 28 ? 14.284 1.452   0.012   1.00 0.00 ? 28 VAL A HG22 4  
ATOM 4057  H HG23 . VAL A 1 28 ? 15.373 0.221   -0.631  1.00 0.00 ? 28 VAL A HG23 4  
ATOM 4058  N N    . ARG A 1 29 ? 14.800 -1.621  -3.322  1.00 0.00 ? 29 ARG A N    4  
ATOM 4059  C CA   . ARG A 1 29 ? 16.014 -1.657  -4.131  1.00 0.00 ? 29 ARG A CA   4  
ATOM 4060  C C    . ARG A 1 29 ? 16.265 -0.308  -4.808  1.00 0.00 ? 29 ARG A C    4  
ATOM 4061  O O    . ARG A 1 29 ? 15.370 0.252   -5.424  1.00 0.00 ? 29 ARG A O    4  
ATOM 4062  C CB   . ARG A 1 29 ? 15.942 -2.757  -5.178  1.00 0.00 ? 29 ARG A CB   4  
ATOM 4063  C CG   . ARG A 1 29 ? 17.229 -2.881  -5.998  1.00 0.00 ? 29 ARG A CG   4  
ATOM 4064  C CD   . ARG A 1 29 ? 17.244 -4.114  -6.894  1.00 0.00 ? 29 ARG A CD   4  
ATOM 4065  N NE   . ARG A 1 29 ? 16.263 -4.040  -7.975  1.00 0.00 ? 29 ARG A NE   4  
ATOM 4066  C CZ   . ARG A 1 29 ? 16.564 -4.184  -9.270  1.00 0.00 ? 29 ARG A CZ   4  
ATOM 4067  N NH1  . ARG A 1 29 ? 17.822 -4.434  -9.645  1.00 0.00 ? 29 ARG A NH1  4  
ATOM 4068  N NH2  . ARG A 1 29 ? 15.605 -4.123  -10.186 1.00 0.00 ? 29 ARG A NH2  4  
ATOM 4069  H H    . ARG A 1 29 ? 13.930 -1.430  -3.760  1.00 0.00 ? 29 ARG A H    4  
ATOM 4070  H HA   . ARG A 1 29 ? 16.847 -1.853  -3.472  1.00 0.00 ? 29 ARG A HA   4  
ATOM 4071  H HB2  . ARG A 1 29 ? 15.767 -3.710  -4.684  1.00 0.00 ? 29 ARG A HB2  4  
ATOM 4072  H HB3  . ARG A 1 29 ? 15.128 -2.555  -5.863  1.00 0.00 ? 29 ARG A HB3  4  
ATOM 4073  H HG2  . ARG A 1 29 ? 17.322 -2.012  -6.619  1.00 0.00 ? 29 ARG A HG2  4  
ATOM 4074  H HG3  . ARG A 1 29 ? 18.056 -2.928  -5.314  1.00 0.00 ? 29 ARG A HG3  4  
ATOM 4075  H HD2  . ARG A 1 29 ? 18.240 -4.207  -7.322  1.00 0.00 ? 29 ARG A HD2  4  
ATOM 4076  H HD3  . ARG A 1 29 ? 17.036 -4.984  -6.278  1.00 0.00 ? 29 ARG A HD3  4  
ATOM 4077  H HE   . ARG A 1 29 ? 15.325 -3.863  -7.729  1.00 0.00 ? 29 ARG A HE   4  
ATOM 4078  H HH11 . ARG A 1 29 ? 18.559 -4.504  -8.964  1.00 0.00 ? 29 ARG A HH11 4  
ATOM 4079  H HH12 . ARG A 1 29 ? 18.036 -4.545  -10.627 1.00 0.00 ? 29 ARG A HH12 4  
ATOM 4080  H HH21 . ARG A 1 29 ? 14.652 -3.937  -9.917  1.00 0.00 ? 29 ARG A HH21 4  
ATOM 4081  H HH22 . ARG A 1 29 ? 15.822 -4.266  -11.157 1.00 0.00 ? 29 ARG A HH22 4  
ATOM 4082  N N    . MET A 1 30 ? 17.468 0.203   -4.659  1.00 0.00 ? 30 MET A N    4  
ATOM 4083  C CA   . MET A 1 30 ? 17.857 1.466   -5.268  1.00 0.00 ? 30 MET A CA   4  
ATOM 4084  C C    . MET A 1 30 ? 18.092 1.267   -6.758  1.00 0.00 ? 30 MET A C    4  
ATOM 4085  O O    . MET A 1 30 ? 18.919 0.457   -7.156  1.00 0.00 ? 30 MET A O    4  
ATOM 4086  C CB   . MET A 1 30 ? 19.116 2.007   -4.592  1.00 0.00 ? 30 MET A CB   4  
ATOM 4087  C CG   . MET A 1 30 ? 19.489 3.418   -5.034  1.00 0.00 ? 30 MET A CG   4  
ATOM 4088  S SD   . MET A 1 30 ? 18.257 4.651   -4.586  1.00 0.00 ? 30 MET A SD   4  
ATOM 4089  C CE   . MET A 1 30 ? 19.150 6.152   -4.965  1.00 0.00 ? 30 MET A CE   4  
ATOM 4090  H H    . MET A 1 30 ? 18.123 -0.289  -4.119  1.00 0.00 ? 30 MET A H    4  
ATOM 4091  H HA   . MET A 1 30 ? 17.055 2.171   -5.122  1.00 0.00 ? 30 MET A HA   4  
ATOM 4092  H HB2  . MET A 1 30 ? 18.962 2.027   -3.518  1.00 0.00 ? 30 MET A HB2  4  
ATOM 4093  H HB3  . MET A 1 30 ? 19.954 1.361   -4.818  1.00 0.00 ? 30 MET A HB3  4  
ATOM 4094  H HG2  . MET A 1 30 ? 20.426 3.698   -4.577  1.00 0.00 ? 30 MET A HG2  4  
ATOM 4095  H HG3  . MET A 1 30 ? 19.599 3.423   -6.106  1.00 0.00 ? 30 MET A HG3  4  
ATOM 4096  H HE1  . MET A 1 30 ? 19.398 6.160   -6.015  1.00 0.00 ? 30 MET A HE1  4  
ATOM 4097  H HE2  . MET A 1 30 ? 20.052 6.194   -4.379  1.00 0.00 ? 30 MET A HE2  4  
ATOM 4098  H HE3  . MET A 1 30 ? 18.532 7.022   -4.735  1.00 0.00 ? 30 MET A HE3  4  
ATOM 4099  N N    . LEU A 1 31 ? 17.348 2.002   -7.583  1.00 0.00 ? 31 LEU A N    4  
ATOM 4100  C CA   . LEU A 1 31 ? 17.407 1.811   -9.034  1.00 0.00 ? 31 LEU A CA   4  
ATOM 4101  C C    . LEU A 1 31 ? 18.420 2.722   -9.721  1.00 0.00 ? 31 LEU A C    4  
ATOM 4102  O O    . LEU A 1 31 ? 18.718 2.529   -10.902 1.00 0.00 ? 31 LEU A O    4  
ATOM 4103  C CB   . LEU A 1 31 ? 16.028 2.041   -9.653  1.00 0.00 ? 31 LEU A CB   4  
ATOM 4104  C CG   . LEU A 1 31 ? 14.966 1.058   -9.194  1.00 0.00 ? 31 LEU A CG   4  
ATOM 4105  C CD1  . LEU A 1 31 ? 13.624 1.403   -9.783  1.00 0.00 ? 31 LEU A CD1  4  
ATOM 4106  C CD2  . LEU A 1 31 ? 15.363 -0.362  -9.572  1.00 0.00 ? 31 LEU A CD2  4  
ATOM 4107  H H    . LEU A 1 31 ? 16.703 2.661   -7.205  1.00 0.00 ? 31 LEU A H    4  
ATOM 4108  H HA   . LEU A 1 31 ? 17.693 0.782   -9.209  1.00 0.00 ? 31 LEU A HA   4  
ATOM 4109  H HB2  . LEU A 1 31 ? 15.699 3.043   -9.397  1.00 0.00 ? 31 LEU A HB2  4  
ATOM 4110  H HB3  . LEU A 1 31 ? 16.102 1.971   -10.733 1.00 0.00 ? 31 LEU A HB3  4  
ATOM 4111  H HG   . LEU A 1 31 ? 14.882 1.104   -8.118  1.00 0.00 ? 31 LEU A HG   4  
ATOM 4112  H HD11 . LEU A 1 31 ? 12.881 0.711   -9.421  1.00 0.00 ? 31 LEU A HD11 4  
ATOM 4113  H HD12 . LEU A 1 31 ? 13.671 1.349   -10.857 1.00 0.00 ? 31 LEU A HD12 4  
ATOM 4114  H HD13 . LEU A 1 31 ? 13.342 2.412   -9.489  1.00 0.00 ? 31 LEU A HD13 4  
ATOM 4115  H HD21 . LEU A 1 31 ? 14.628 -1.066  -9.213  1.00 0.00 ? 31 LEU A HD21 4  
ATOM 4116  H HD22 . LEU A 1 31 ? 16.328 -0.599  -9.135  1.00 0.00 ? 31 LEU A HD22 4  
ATOM 4117  H HD23 . LEU A 1 31 ? 15.440 -0.449  -10.661 1.00 0.00 ? 31 LEU A HD23 4  
ATOM 4118  N N    . ASP A 1 32 ? 18.991 3.688   -9.012  1.00 0.00 ? 32 ASP A N    4  
ATOM 4119  C CA   . ASP A 1 32 ? 19.920 4.620   -9.626  1.00 0.00 ? 32 ASP A CA   4  
ATOM 4120  C C    . ASP A 1 32 ? 20.990 5.057   -8.633  1.00 0.00 ? 32 ASP A C    4  
ATOM 4121  O O    . ASP A 1 32 ? 20.783 4.988   -7.414  1.00 0.00 ? 32 ASP A O    4  
ATOM 4122  C CB   . ASP A 1 32 ? 19.138 5.842   -10.155 1.00 0.00 ? 32 ASP A CB   4  
ATOM 4123  C CG   . ASP A 1 32 ? 19.956 6.781   -11.018 1.00 0.00 ? 32 ASP A CG   4  
ATOM 4124  O OD1  . ASP A 1 32 ? 20.234 6.444   -12.184 1.00 0.00 ? 32 ASP A OD1  4  
ATOM 4125  O OD2  . ASP A 1 32 ? 20.298 7.879   -10.531 1.00 0.00 ? 32 ASP A OD2  4  
ATOM 4126  H H    . ASP A 1 32 ? 18.787 3.778   -8.058  1.00 0.00 ? 32 ASP A H    4  
ATOM 4127  H HA   . ASP A 1 32 ? 20.379 4.123   -10.463 1.00 0.00 ? 32 ASP A HA   4  
ATOM 4128  H HB2  . ASP A 1 32 ? 18.304 5.498   -10.738 1.00 0.00 ? 32 ASP A HB2  4  
ATOM 4129  H HB3  . ASP A 1 32 ? 18.762 6.402   -9.302  1.00 0.00 ? 32 ASP A HB3  4  
ATOM 4130  N N    . ASP A 1 33 ? 22.135 5.480   -9.137  1.00 0.00 ? 33 ASP A N    4  
ATOM 4131  C CA   . ASP A 1 33 ? 23.224 5.966   -8.285  1.00 0.00 ? 33 ASP A CA   4  
ATOM 4132  C C    . ASP A 1 33 ? 23.040 7.463   -8.013  1.00 0.00 ? 33 ASP A C    4  
ATOM 4133  O O    . ASP A 1 33 ? 22.855 8.249   -8.942  1.00 0.00 ? 33 ASP A O    4  
ATOM 4134  C CB   . ASP A 1 33 ? 24.578 5.701   -8.947  1.00 0.00 ? 33 ASP A CB   4  
ATOM 4135  C CG   . ASP A 1 33 ? 25.736 6.316   -8.180  1.00 0.00 ? 33 ASP A CG   4  
ATOM 4136  O OD1  . ASP A 1 33 ? 26.166 5.728   -7.174  1.00 0.00 ? 33 ASP A OD1  4  
ATOM 4137  O OD2  . ASP A 1 33 ? 26.243 7.377   -8.595  1.00 0.00 ? 33 ASP A OD2  4  
ATOM 4138  H H    . ASP A 1 33 ? 22.275 5.467   -10.124 1.00 0.00 ? 33 ASP A H    4  
ATOM 4139  H HA   . ASP A 1 33 ? 23.177 5.426   -7.347  1.00 0.00 ? 33 ASP A HA   4  
ATOM 4140  H HB2  . ASP A 1 33 ? 24.728 4.630   -9.016  1.00 0.00 ? 33 ASP A HB2  4  
ATOM 4141  H HB3  . ASP A 1 33 ? 24.565 6.123   -9.941  1.00 0.00 ? 33 ASP A HB3  4  
ATOM 4142  N N    . TYR A 1 34 ? 23.126 7.837   -6.737  1.00 0.00 ? 34 TYR A N    4  
ATOM 4143  C CA   . TYR A 1 34 ? 22.786 9.203   -6.340  1.00 0.00 ? 34 TYR A CA   4  
ATOM 4144  C C    . TYR A 1 34 ? 23.506 9.625   -5.046  1.00 0.00 ? 34 TYR A C    4  
ATOM 4145  O O    . TYR A 1 34 ? 23.096 9.248   -3.955  1.00 0.00 ? 34 TYR A O    4  
ATOM 4146  C CB   . TYR A 1 34 ? 21.272 9.307   -6.162  1.00 0.00 ? 34 TYR A CB   4  
ATOM 4147  C CG   . TYR A 1 34 ? 20.797 10.673  -5.736  1.00 0.00 ? 34 TYR A CG   4  
ATOM 4148  C CD1  . TYR A 1 34 ? 20.836 11.742  -6.623  1.00 0.00 ? 34 TYR A CD1  4  
ATOM 4149  C CD2  . TYR A 1 34 ? 20.302 10.876  -4.461  1.00 0.00 ? 34 TYR A CD2  4  
ATOM 4150  C CE1  . TYR A 1 34 ? 20.395 12.986  -6.227  1.00 0.00 ? 34 TYR A CE1  4  
ATOM 4151  C CE2  . TYR A 1 34 ? 19.859 12.132  -4.070  1.00 0.00 ? 34 TYR A CE2  4  
ATOM 4152  C CZ   . TYR A 1 34 ? 19.911 13.187  -4.949  1.00 0.00 ? 34 TYR A CZ   4  
ATOM 4153  O OH   . TYR A 1 34 ? 19.478 14.421  -4.551  1.00 0.00 ? 34 TYR A OH   4  
ATOM 4154  H H    . TYR A 1 34 ? 23.458 7.202   -6.065  1.00 0.00 ? 34 TYR A H    4  
ATOM 4155  H HA   . TYR A 1 34 ? 23.084 9.865   -7.126  1.00 0.00 ? 34 TYR A HA   4  
ATOM 4156  H HB2  . TYR A 1 34 ? 20.794 9.081   -7.109  1.00 0.00 ? 34 TYR A HB2  4  
ATOM 4157  H HB3  . TYR A 1 34 ? 20.950 8.594   -5.420  1.00 0.00 ? 34 TYR A HB3  4  
ATOM 4158  H HD1  . TYR A 1 34 ? 21.206 11.584  -7.627  1.00 0.00 ? 34 TYR A HD1  4  
ATOM 4159  H HD2  . TYR A 1 34 ? 20.271 10.052  -3.778  1.00 0.00 ? 34 TYR A HD2  4  
ATOM 4160  H HE1  . TYR A 1 34 ? 20.426 13.820  -6.924  1.00 0.00 ? 34 TYR A HE1  4  
ATOM 4161  H HE2  . TYR A 1 34 ? 19.482 12.276  -3.064  1.00 0.00 ? 34 TYR A HE2  4  
ATOM 4162  H HH   . TYR A 1 34 ? 19.812 14.601  -3.664  1.00 0.00 ? 34 TYR A HH   4  
ATOM 4163  N N    . GLU A 1 35 ? 24.608 10.367  -5.233  1.00 0.00 ? 35 GLU A N    4  
ATOM 4164  C CA   . GLU A 1 35 ? 25.302 11.114  -4.167  1.00 0.00 ? 35 GLU A CA   4  
ATOM 4165  C C    . GLU A 1 35 ? 25.788 10.291  -2.972  1.00 0.00 ? 35 GLU A C    4  
ATOM 4166  O O    . GLU A 1 35 ? 26.425 10.846  -2.070  1.00 0.00 ? 35 GLU A O    4  
ATOM 4167  C CB   . GLU A 1 35 ? 24.445 12.283  -3.687  1.00 0.00 ? 35 GLU A CB   4  
ATOM 4168  C CG   . GLU A 1 35 ? 24.128 13.275  -4.793  1.00 0.00 ? 35 GLU A CG   4  
ATOM 4169  C CD   . GLU A 1 35 ? 23.867 14.668  -4.276  1.00 0.00 ? 35 GLU A CD   4  
ATOM 4170  O OE1  . GLU A 1 35 ? 24.837 15.447  -4.122  1.00 0.00 ? 35 GLU A OE1  4  
ATOM 4171  O OE2  . GLU A 1 35 ? 22.686 15.010  -4.011  1.00 0.00 ? 35 GLU A OE2  4  
ATOM 4172  H H    . GLU A 1 35 ? 24.981 10.460  -6.133  1.00 0.00 ? 35 GLU A H    4  
ATOM 4173  H HA   . GLU A 1 35 ? 26.187 11.546  -4.642  1.00 0.00 ? 35 GLU A HA   4  
ATOM 4174  H HB2  . GLU A 1 35 ? 23.509 11.899  -3.285  1.00 0.00 ? 35 GLU A HB2  4  
ATOM 4175  H HB3  . GLU A 1 35 ? 24.980 12.784  -2.903  1.00 0.00 ? 35 GLU A HB3  4  
ATOM 4176  H HG2  . GLU A 1 35 ? 24.967 13.320  -5.482  1.00 0.00 ? 35 GLU A HG2  4  
ATOM 4177  H HG3  . GLU A 1 35 ? 23.246 12.941  -5.323  1.00 0.00 ? 35 GLU A HG3  4  
ATOM 4178  N N    . GLU A 1 36 ? 25.534 8.985   -2.972  1.00 0.00 ? 36 GLU A N    4  
ATOM 4179  C CA   . GLU A 1 36 ? 26.008 8.121   -1.893  1.00 0.00 ? 36 GLU A CA   4  
ATOM 4180  C C    . GLU A 1 36 ? 25.512 6.703   -2.132  1.00 0.00 ? 36 GLU A C    4  
ATOM 4181  O O    . GLU A 1 36 ? 26.258 5.729   -1.979  1.00 0.00 ? 36 GLU A O    4  
ATOM 4182  C CB   . GLU A 1 36 ? 25.514 8.617   -0.527  1.00 0.00 ? 36 GLU A CB   4  
ATOM 4183  C CG   . GLU A 1 36 ? 26.127 7.877   0.645   1.00 0.00 ? 36 GLU A CG   4  
ATOM 4184  C CD   . GLU A 1 36 ? 25.730 8.468   1.971   1.00 0.00 ? 36 GLU A CD   4  
ATOM 4185  O OE1  . GLU A 1 36 ? 26.351 9.453   2.394   1.00 0.00 ? 36 GLU A OE1  4  
ATOM 4186  O OE2  . GLU A 1 36 ? 24.783 7.934   2.595   1.00 0.00 ? 36 GLU A OE2  4  
ATOM 4187  H H    . GLU A 1 36 ? 25.003 8.591   -3.691  1.00 0.00 ? 36 GLU A H    4  
ATOM 4188  H HA   . GLU A 1 36 ? 27.083 8.127   -1.908  1.00 0.00 ? 36 GLU A HA   4  
ATOM 4189  H HB2  . GLU A 1 36 ? 25.757 9.660   -0.425  1.00 0.00 ? 36 GLU A HB2  4  
ATOM 4190  H HB3  . GLU A 1 36 ? 24.446 8.487   -0.474  1.00 0.00 ? 36 GLU A HB3  4  
ATOM 4191  H HG2  . GLU A 1 36 ? 25.812 6.842   0.611   1.00 0.00 ? 36 GLU A HG2  4  
ATOM 4192  H HG3  . GLU A 1 36 ? 27.200 7.928   0.544   1.00 0.00 ? 36 GLU A HG3  4  
ATOM 4193  N N    . ILE A 1 37 ? 24.250 6.601   -2.527  1.00 0.00 ? 37 ILE A N    4  
ATOM 4194  C CA   . ILE A 1 37 ? 23.638 5.303   -2.756  1.00 0.00 ? 37 ILE A CA   4  
ATOM 4195  C C    . ILE A 1 37 ? 23.729 4.958   -4.233  1.00 0.00 ? 37 ILE A C    4  
ATOM 4196  O O    . ILE A 1 37 ? 23.671 5.841   -5.078  1.00 0.00 ? 37 ILE A O    4  
ATOM 4197  C CB   . ILE A 1 37 ? 22.164 5.293   -2.296  1.00 0.00 ? 37 ILE A CB   4  
ATOM 4198  C CG1  . ILE A 1 37 ? 22.034 5.904   -0.882  1.00 0.00 ? 37 ILE A CG1  4  
ATOM 4199  C CG2  . ILE A 1 37 ? 21.612 3.879   -2.319  1.00 0.00 ? 37 ILE A CG2  4  
ATOM 4200  C CD1  . ILE A 1 37 ? 22.864 5.165   0.158   1.00 0.00 ? 37 ILE A CD1  4  
ATOM 4201  H H    . ILE A 1 37 ? 23.743 7.419   -2.703  1.00 0.00 ? 37 ILE A H    4  
ATOM 4202  H HA   . ILE A 1 37 ? 24.184 4.565   -2.180  1.00 0.00 ? 37 ILE A HA   4  
ATOM 4203  H HB   . ILE A 1 37 ? 21.584 5.890   -2.988  1.00 0.00 ? 37 ILE A HB   4  
ATOM 4204  H HG12 . ILE A 1 37 ? 22.358 6.932   -0.903  1.00 0.00 ? 37 ILE A HG12 4  
ATOM 4205  H HG13 . ILE A 1 37 ? 21.000 5.847   -0.570  1.00 0.00 ? 37 ILE A HG13 4  
ATOM 4206  H HG21 . ILE A 1 37 ? 21.727 3.471   -3.314  1.00 0.00 ? 37 ILE A HG21 4  
ATOM 4207  H HG22 . ILE A 1 37 ? 20.563 3.902   -2.063  1.00 0.00 ? 37 ILE A HG22 4  
ATOM 4208  H HG23 . ILE A 1 37 ? 22.157 3.266   -1.610  1.00 0.00 ? 37 ILE A HG23 4  
ATOM 4209  H HD11 . ILE A 1 37 ? 22.562 4.138   0.188   1.00 0.00 ? 37 ILE A HD11 4  
ATOM 4210  H HD12 . ILE A 1 37 ? 22.693 5.624   1.121   1.00 0.00 ? 37 ILE A HD12 4  
ATOM 4211  H HD13 . ILE A 1 37 ? 23.913 5.240   -0.106  1.00 0.00 ? 37 ILE A HD13 4  
ATOM 4212  N N    . SER A 1 38 ? 23.878 3.677   -4.539  1.00 0.00 ? 38 SER A N    4  
ATOM 4213  C CA   . SER A 1 38 ? 24.103 3.263   -5.905  1.00 0.00 ? 38 SER A CA   4  
ATOM 4214  C C    . SER A 1 38 ? 23.051 2.273   -6.365  1.00 0.00 ? 38 SER A C    4  
ATOM 4215  O O    . SER A 1 38 ? 22.368 1.651   -5.549  1.00 0.00 ? 38 SER A O    4  
ATOM 4216  C CB   . SER A 1 38 ? 25.506 2.660   -6.033  1.00 0.00 ? 38 SER A CB   4  
ATOM 4217  O OG   . SER A 1 38 ? 26.493 3.602   -5.654  1.00 0.00 ? 38 SER A OG   4  
ATOM 4218  H H    . SER A 1 38 ? 23.803 2.998   -3.838  1.00 0.00 ? 38 SER A H    4  
ATOM 4219  H HA   . SER A 1 38 ? 24.046 4.148   -6.529  1.00 0.00 ? 38 SER A HA   4  
ATOM 4220  H HB2  . SER A 1 38 ? 25.574 1.794   -5.394  1.00 0.00 ? 38 SER A HB2  4  
ATOM 4221  H HB3  . SER A 1 38 ? 25.666 2.363   -7.061  1.00 0.00 ? 38 SER A HB3  4  
ATOM 4222  H HG   . SER A 1 38 ? 26.341 4.440   -6.127  1.00 0.00 ? 38 SER A HG   4  
ATOM 4223  N N    . ALA A 1 39 ? 22.914 2.130   -7.676  1.00 0.00 ? 39 ALA A N    4  
ATOM 4224  C CA   . ALA A 1 39 ? 21.967 1.203   -8.259  1.00 0.00 ? 39 ALA A CA   4  
ATOM 4225  C C    . ALA A 1 39 ? 22.286 -0.219  -7.837  1.00 0.00 ? 39 ALA A C    4  
ATOM 4226  O O    . ALA A 1 39 ? 23.410 -0.708  -8.053  1.00 0.00 ? 39 ALA A O    4  
ATOM 4227  C CB   . ALA A 1 39 ? 21.969 1.339   -9.781  1.00 0.00 ? 39 ALA A CB   4  
ATOM 4228  H H    . ALA A 1 39 ? 23.497 2.652   -8.265  1.00 0.00 ? 39 ALA A H    4  
ATOM 4229  H HA   . ALA A 1 39 ? 20.980 1.460   -7.909  1.00 0.00 ? 39 ALA A HA   4  
ATOM 4230  H HB1  . ALA A 1 39 ? 21.238 0.667   -10.208 1.00 0.00 ? 39 ALA A HB1  4  
ATOM 4231  H HB2  . ALA A 1 39 ? 22.950 1.081   -10.160 1.00 0.00 ? 39 ALA A HB2  4  
ATOM 4232  H HB3  . ALA A 1 39 ? 21.734 2.358   -10.049 1.00 0.00 ? 39 ALA A HB3  4  
ATOM 4233  N N    . GLY A 1 40 ? 21.302 -0.899  -7.243  1.00 0.00 ? 40 GLY A N    4  
ATOM 4234  C CA   . GLY A 1 40 ? 21.529 -2.246  -6.761  1.00 0.00 ? 40 GLY A CA   4  
ATOM 4235  C C    . GLY A 1 40 ? 21.642 -2.313  -5.258  1.00 0.00 ? 40 GLY A C    4  
ATOM 4236  O O    . GLY A 1 40 ? 21.578 -3.401  -4.669  1.00 0.00 ? 40 GLY A O    4  
ATOM 4237  H H    . GLY A 1 40 ? 20.429 -0.479  -7.126  1.00 0.00 ? 40 GLY A H    4  
ATOM 4238  H HA2  . GLY A 1 40 ? 20.707 -2.869  -7.083  1.00 0.00 ? 40 GLY A HA2  4  
ATOM 4239  H HA3  . GLY A 1 40 ? 22.439 -2.618  -7.209  1.00 0.00 ? 40 GLY A HA3  4  
ATOM 4240  N N    . ASP A 1 41 ? 21.820 -1.172  -4.610  1.00 0.00 ? 41 ASP A N    4  
ATOM 4241  C CA   . ASP A 1 41 ? 21.841 -1.125  -3.157  1.00 0.00 ? 41 ASP A CA   4  
ATOM 4242  C C    . ASP A 1 41 ? 20.465 -1.525  -2.617  1.00 0.00 ? 41 ASP A C    4  
ATOM 4243  O O    . ASP A 1 41 ? 19.440 -1.162  -3.194  1.00 0.00 ? 41 ASP A O    4  
ATOM 4244  C CB   . ASP A 1 41 ? 22.205 0.283   -2.675  1.00 0.00 ? 41 ASP A CB   4  
ATOM 4245  C CG   . ASP A 1 41 ? 22.758 0.295   -1.251  1.00 0.00 ? 41 ASP A CG   4  
ATOM 4246  O OD1  . ASP A 1 41 ? 22.108 -0.255  -0.343  1.00 0.00 ? 41 ASP A OD1  4  
ATOM 4247  O OD2  . ASP A 1 41 ? 23.854 0.865   -1.060  1.00 0.00 ? 41 ASP A OD2  4  
ATOM 4248  H H    . ASP A 1 41 ? 21.938 -0.346  -5.117  1.00 0.00 ? 41 ASP A H    4  
ATOM 4249  H HA   . ASP A 1 41 ? 22.582 -1.829  -2.814  1.00 0.00 ? 41 ASP A HA   4  
ATOM 4250  H HB2  . ASP A 1 41 ? 22.946 0.702   -3.332  1.00 0.00 ? 41 ASP A HB2  4  
ATOM 4251  H HB3  . ASP A 1 41 ? 21.322 0.894   -2.700  1.00 0.00 ? 41 ASP A HB3  4  
ATOM 4252  N N    . GLU A 1 42 ? 20.453 -2.286  -1.541  1.00 0.00 ? 42 GLU A N    4  
ATOM 4253  C CA   . GLU A 1 42 ? 19.209 -2.748  -0.957  1.00 0.00 ? 42 GLU A CA   4  
ATOM 4254  C C    . GLU A 1 42 ? 18.985 -2.069  0.382   1.00 0.00 ? 42 GLU A C    4  
ATOM 4255  O O    . GLU A 1 42 ? 19.939 -1.806  1.121   1.00 0.00 ? 42 GLU A O    4  
ATOM 4256  C CB   . GLU A 1 42 ? 19.217 -4.267  -0.774  1.00 0.00 ? 42 GLU A CB   4  
ATOM 4257  C CG   . GLU A 1 42 ? 19.439 -5.040  -2.057  1.00 0.00 ? 42 GLU A CG   4  
ATOM 4258  C CD   . GLU A 1 42 ? 19.417 -6.539  -1.849  1.00 0.00 ? 42 GLU A CD   4  
ATOM 4259  O OE1  . GLU A 1 42 ? 20.414 -7.092  -1.334  1.00 0.00 ? 42 GLU A OE1  4  
ATOM 4260  O OE2  . GLU A 1 42 ? 18.404 -7.189  -2.200  1.00 0.00 ? 42 GLU A OE2  4  
ATOM 4261  H H    . GLU A 1 42 ? 21.296 -2.526  -1.108  1.00 0.00 ? 42 GLU A H    4  
ATOM 4262  H HA   . GLU A 1 42 ? 18.401 -2.479  -1.624  1.00 0.00 ? 42 GLU A HA   4  
ATOM 4263  H HB2  . GLU A 1 42 ? 20.011 -4.525  -0.070  1.00 0.00 ? 42 GLU A HB2  4  
ATOM 4264  H HB3  . GLU A 1 42 ? 18.269 -4.573  -0.342  1.00 0.00 ? 42 GLU A HB3  4  
ATOM 4265  H HG2  . GLU A 1 42 ? 18.639 -4.767  -2.743  1.00 0.00 ? 42 GLU A HG2  4  
ATOM 4266  H HG3  . GLU A 1 42 ? 20.389 -4.740  -2.478  1.00 0.00 ? 42 GLU A HG3  4  
ATOM 4267  N N    . GLY A 1 43 ? 17.734 -1.800  0.703   1.00 0.00 ? 43 GLY A N    4  
ATOM 4268  C CA   . GLY A 1 43 ? 17.458 -1.041  1.893   1.00 0.00 ? 43 GLY A CA   4  
ATOM 4269  C C    . GLY A 1 43 ? 16.126 -1.402  2.513   1.00 0.00 ? 43 GLY A C    4  
ATOM 4270  O O    . GLY A 1 43 ? 15.357 -2.182  1.954   1.00 0.00 ? 43 GLY A O    4  
ATOM 4271  H H    . GLY A 1 43 ? 17.004 -2.139  0.135   1.00 0.00 ? 43 GLY A H    4  
ATOM 4272  H HA2  . GLY A 1 43 ? 18.248 -1.232  2.604   1.00 0.00 ? 43 GLY A HA2  4  
ATOM 4273  H HA3  . GLY A 1 43 ? 17.462 0.006   1.639   1.00 0.00 ? 43 GLY A HA3  4  
ATOM 4274  N N    . GLU A 1 44 ? 15.865 -0.818  3.670   1.00 0.00 ? 44 GLU A N    4  
ATOM 4275  C CA   . GLU A 1 44 ? 14.621 -1.029  4.393   1.00 0.00 ? 44 GLU A CA   4  
ATOM 4276  C C    . GLU A 1 44 ? 13.942 0.314   4.615   1.00 0.00 ? 44 GLU A C    4  
ATOM 4277  O O    . GLU A 1 44 ? 14.616 1.313   4.859   1.00 0.00 ? 44 GLU A O    4  
ATOM 4278  C CB   . GLU A 1 44 ? 14.914 -1.688  5.734   1.00 0.00 ? 44 GLU A CB   4  
ATOM 4279  C CG   . GLU A 1 44 ? 13.670 -1.912  6.583   1.00 0.00 ? 44 GLU A CG   4  
ATOM 4280  C CD   . GLU A 1 44 ? 14.014 -2.392  7.970   1.00 0.00 ? 44 GLU A CD   4  
ATOM 4281  O OE1  . GLU A 1 44 ? 14.521 -1.579  8.770   1.00 0.00 ? 44 GLU A OE1  4  
ATOM 4282  O OE2  . GLU A 1 44 ? 13.767 -3.580  8.282   1.00 0.00 ? 44 GLU A OE2  4  
ATOM 4283  H H    . GLU A 1 44 ? 16.549 -0.232  4.072   1.00 0.00 ? 44 GLU A H    4  
ATOM 4284  H HA   . GLU A 1 44 ? 13.987 -1.671  3.810   1.00 0.00 ? 44 GLU A HA   4  
ATOM 4285  H HB2  . GLU A 1 44 ? 15.380 -2.646  5.559   1.00 0.00 ? 44 GLU A HB2  4  
ATOM 4286  H HB3  . GLU A 1 44 ? 15.592 -1.063  6.295   1.00 0.00 ? 44 GLU A HB3  4  
ATOM 4287  H HG2  . GLU A 1 44 ? 13.131 -0.985  6.660   1.00 0.00 ? 44 GLU A HG2  4  
ATOM 4288  H HG3  . GLU A 1 44 ? 13.055 -2.664  6.099   1.00 0.00 ? 44 GLU A HG3  4  
ATOM 4289  N N    . PHE A 1 45 ? 12.618 0.344   4.522   1.00 0.00 ? 45 PHE A N    4  
ATOM 4290  C CA   . PHE A 1 45 ? 11.884 1.566   4.689   1.00 0.00 ? 45 PHE A CA   4  
ATOM 4291  C C    . PHE A 1 45 ? 11.609 1.814   6.170   1.00 0.00 ? 45 PHE A C    4  
ATOM 4292  O O    . PHE A 1 45 ? 10.957 1.016   6.821   1.00 0.00 ? 45 PHE A O    4  
ATOM 4293  C CB   . PHE A 1 45 ? 10.572 1.505   3.905   1.00 0.00 ? 45 PHE A CB   4  
ATOM 4294  C CG   . PHE A 1 45 ? 9.664  2.686   4.127   1.00 0.00 ? 45 PHE A CG   4  
ATOM 4295  C CD1  . PHE A 1 45 ? 9.918  3.902   3.525   1.00 0.00 ? 45 PHE A CD1  4  
ATOM 4296  C CD2  . PHE A 1 45 ? 8.544  2.567   4.942   1.00 0.00 ? 45 PHE A CD2  4  
ATOM 4297  C CE1  . PHE A 1 45 ? 9.082  4.972   3.733   1.00 0.00 ? 45 PHE A CE1  4  
ATOM 4298  C CE2  . PHE A 1 45 ? 7.700  3.632   5.147   1.00 0.00 ? 45 PHE A CE2  4  
ATOM 4299  C CZ   . PHE A 1 45 ? 7.964  4.840   4.544   1.00 0.00 ? 45 PHE A CZ   4  
ATOM 4300  H H    . PHE A 1 45 ? 12.132 -0.504  4.393   1.00 0.00 ? 45 PHE A H    4  
ATOM 4301  H HA   . PHE A 1 45 ? 12.490 2.373   4.307   1.00 0.00 ? 45 PHE A HA   4  
ATOM 4302  H HB2  . PHE A 1 45 ? 10.796 1.447   2.842   1.00 0.00 ? 45 PHE A HB2  4  
ATOM 4303  H HB3  . PHE A 1 45 ? 10.045 0.604   4.206   1.00 0.00 ? 45 PHE A HB3  4  
ATOM 4304  H HD1  . PHE A 1 45 ? 10.778 4.002   2.894   1.00 0.00 ? 45 PHE A HD1  4  
ATOM 4305  H HD2  . PHE A 1 45 ? 8.331  1.615   5.417   1.00 0.00 ? 45 PHE A HD2  4  
ATOM 4306  H HE1  . PHE A 1 45 ? 9.285  5.921   3.257   1.00 0.00 ? 45 PHE A HE1  4  
ATOM 4307  H HE2  . PHE A 1 45 ? 6.824  3.532   5.777   1.00 0.00 ? 45 PHE A HE2  4  
ATOM 4308  H HZ   . PHE A 1 45 ? 7.317  5.686   4.703   1.00 0.00 ? 45 PHE A HZ   4  
ATOM 4309  N N    . ARG A 1 46 ? 12.164 2.903   6.694   1.00 0.00 ? 46 ARG A N    4  
ATOM 4310  C CA   . ARG A 1 46 ? 11.959 3.236   8.091   1.00 0.00 ? 46 ARG A CA   4  
ATOM 4311  C C    . ARG A 1 46 ? 10.759 4.155   8.269   1.00 0.00 ? 46 ARG A C    4  
ATOM 4312  O O    . ARG A 1 46 ? 9.855  3.856   9.044   1.00 0.00 ? 46 ARG A O    4  
ATOM 4313  C CB   . ARG A 1 46 ? 13.211 3.878   8.690   1.00 0.00 ? 46 ARG A CB   4  
ATOM 4314  C CG   . ARG A 1 46 ? 14.273 2.851   9.076   1.00 0.00 ? 46 ARG A CG   4  
ATOM 4315  C CD   . ARG A 1 46 ? 13.730 1.917   10.134  1.00 0.00 ? 46 ARG A CD   4  
ATOM 4316  N NE   . ARG A 1 46 ? 14.700 0.873   10.499  1.00 0.00 ? 46 ARG A NE   4  
ATOM 4317  C CZ   . ARG A 1 46 ? 14.615 0.181   11.633  1.00 0.00 ? 46 ARG A CZ   4  
ATOM 4318  N NH1  . ARG A 1 46 ? 13.641 0.432   12.501  1.00 0.00 ? 46 ARG A NH1  4  
ATOM 4319  N NH2  . ARG A 1 46 ? 15.487 -0.797  11.900  1.00 0.00 ? 46 ARG A NH2  4  
ATOM 4320  H H    . ARG A 1 46 ? 12.738 3.483   6.143   1.00 0.00 ? 46 ARG A H    4  
ATOM 4321  H HA   . ARG A 1 46 ? 11.758 2.315   8.611   1.00 0.00 ? 46 ARG A HA   4  
ATOM 4322  H HB2  . ARG A 1 46 ? 13.637 4.559   7.965   1.00 0.00 ? 46 ARG A HB2  4  
ATOM 4323  H HB3  . ARG A 1 46 ? 12.932 4.424   9.567   1.00 0.00 ? 46 ARG A HB3  4  
ATOM 4324  H HG2  . ARG A 1 46 ? 14.548 2.274   8.197   1.00 0.00 ? 46 ARG A HG2  4  
ATOM 4325  H HG3  . ARG A 1 46 ? 15.135 3.366   9.460   1.00 0.00 ? 46 ARG A HG3  4  
ATOM 4326  H HD2  . ARG A 1 46 ? 13.493 2.492   11.010  1.00 0.00 ? 46 ARG A HD2  4  
ATOM 4327  H HD3  . ARG A 1 46 ? 12.837 1.449   9.760   1.00 0.00 ? 46 ARG A HD3  4  
ATOM 4328  H HE   . ARG A 1 46 ? 15.410 0.679   9.861   1.00 0.00 ? 46 ARG A HE   4  
ATOM 4329  H HH11 . ARG A 1 46 ? 12.966 1.143   12.289  1.00 0.00 ? 46 ARG A HH11 4  
ATOM 4330  H HH12 . ARG A 1 46 ? 13.578 -0.058  13.378  1.00 0.00 ? 46 ARG A HH12 4  
ATOM 4331  H HH21 . ARG A 1 46 ? 16.222 -1.010  11.250  1.00 0.00 ? 46 ARG A HH21 4  
ATOM 4332  H HH22 . ARG A 1 46 ? 15.399 -1.340  12.749  1.00 0.00 ? 46 ARG A HH22 4  
ATOM 4333  N N    . GLN A 1 47 ? 10.746 5.265   7.542   1.00 0.00 ? 47 GLN A N    4  
ATOM 4334  C CA   . GLN A 1 47 ? 9.671  6.248   7.687   1.00 0.00 ? 47 GLN A CA   4  
ATOM 4335  C C    . GLN A 1 47 ? 9.739  7.276   6.567   1.00 0.00 ? 47 GLN A C    4  
ATOM 4336  O O    . GLN A 1 47 ? 10.759 7.390   5.877   1.00 0.00 ? 47 GLN A O    4  
ATOM 4337  C CB   . GLN A 1 47 ? 9.747  6.943   9.059   1.00 0.00 ? 47 GLN A CB   4  
ATOM 4338  C CG   . GLN A 1 47 ? 11.035 7.732   9.284   1.00 0.00 ? 47 GLN A CG   4  
ATOM 4339  C CD   . GLN A 1 47 ? 10.888 9.217   9.005   1.00 0.00 ? 47 GLN A CD   4  
ATOM 4340  O OE1  . GLN A 1 47 ? 10.506 9.989   9.877   1.00 0.00 ? 47 GLN A OE1  4  
ATOM 4341  N NE2  . GLN A 1 47 ? 11.212 9.634   7.785   1.00 0.00 ? 47 GLN A NE2  4  
ATOM 4342  H H    . GLN A 1 47 ? 11.442 5.403   6.865   1.00 0.00 ? 47 GLN A H    4  
ATOM 4343  H HA   . GLN A 1 47 ? 8.739  5.724   7.622   1.00 0.00 ? 47 GLN A HA   4  
ATOM 4344  H HB2  . GLN A 1 47 ? 8.915  7.629   9.140   1.00 0.00 ? 47 GLN A HB2  4  
ATOM 4345  H HB3  . GLN A 1 47 ? 9.667  6.197   9.824   1.00 0.00 ? 47 GLN A HB3  4  
ATOM 4346  H HG2  . GLN A 1 47 ? 11.356 7.598   10.305  1.00 0.00 ? 47 GLN A HG2  4  
ATOM 4347  H HG3  . GLN A 1 47 ? 11.789 7.335   8.628   1.00 0.00 ? 47 GLN A HG3  4  
ATOM 4348  H HE21 . GLN A 1 47 ? 11.525 8.981   7.132   1.00 0.00 ? 47 GLN A HE21 4  
ATOM 4349  H HE22 . GLN A 1 47 ? 11.129 10.598  7.603   1.00 0.00 ? 47 GLN A HE22 4  
ATOM 4350  N N    . SER A 1 48 ? 8.658  7.999   6.384   1.00 0.00 ? 48 SER A N    4  
ATOM 4351  C CA   . SER A 1 48 ? 8.563  9.008   5.359   1.00 0.00 ? 48 SER A CA   4  
ATOM 4352  C C    . SER A 1 48 ? 8.184  10.343  5.988   1.00 0.00 ? 48 SER A C    4  
ATOM 4353  O O    . SER A 1 48 ? 7.555  10.368  7.048   1.00 0.00 ? 48 SER A O    4  
ATOM 4354  C CB   . SER A 1 48 ? 7.527  8.603   4.300   1.00 0.00 ? 48 SER A CB   4  
ATOM 4355  O OG   . SER A 1 48 ? 6.282  8.301   4.898   1.00 0.00 ? 48 SER A OG   4  
ATOM 4356  H H    . SER A 1 48 ? 7.883  7.863   6.982   1.00 0.00 ? 48 SER A H    4  
ATOM 4357  H HA   . SER A 1 48 ? 9.539  9.106   4.891   1.00 0.00 ? 48 SER A HA   4  
ATOM 4358  H HB2  . SER A 1 48 ? 7.388  9.411   3.604   1.00 0.00 ? 48 SER A HB2  4  
ATOM 4359  H HB3  . SER A 1 48 ? 7.887  7.729   3.761   1.00 0.00 ? 48 SER A HB3  4  
ATOM 4360  H HG   . SER A 1 48 ? 5.598  8.894   4.537   1.00 0.00 ? 48 SER A HG   4  
ATOM 4361  N N    . ASN A 1 49 ? 8.603  11.439  5.394   1.00 0.00 ? 49 ASN A N    4  
ATOM 4362  C CA   . ASN A 1 49 ? 8.222  12.750  5.879   1.00 0.00 ? 49 ASN A CA   4  
ATOM 4363  C C    . ASN A 1 49 ? 6.885  13.148  5.263   1.00 0.00 ? 49 ASN A C    4  
ATOM 4364  O O    . ASN A 1 49 ? 6.722  13.150  4.037   1.00 0.00 ? 49 ASN A O    4  
ATOM 4365  C CB   . ASN A 1 49 ? 9.301  13.791  5.573   1.00 0.00 ? 49 ASN A CB   4  
ATOM 4366  C CG   . ASN A 1 49 ? 10.602 13.530  6.326   1.00 0.00 ? 49 ASN A CG   4  
ATOM 4367  O OD1  . ASN A 1 49 ? 11.692 13.826  5.825   1.00 0.00 ? 49 ASN A OD1  4  
ATOM 4368  N ND2  . ASN A 1 49 ? 10.502 13.016  7.546   1.00 0.00 ? 49 ASN A ND2  4  
ATOM 4369  H H    . ASN A 1 49 ? 9.190  11.383  4.607   1.00 0.00 ? 49 ASN A H    4  
ATOM 4370  H HA   . ASN A 1 49 ? 8.084  12.679  6.945   1.00 0.00 ? 49 ASN A HA   4  
ATOM 4371  H HB2  . ASN A 1 49 ? 9.528  13.767  4.510   1.00 0.00 ? 49 ASN A HB2  4  
ATOM 4372  H HB3  . ASN A 1 49 ? 8.934  14.766  5.860   1.00 0.00 ? 49 ASN A HB3  4  
ATOM 4373  H HD21 . ASN A 1 49 ? 9.611  12.824  7.904   1.00 0.00 ? 49 ASN A HD21 4  
ATOM 4374  H HD22 . ASN A 1 49 ? 11.337 12.843  8.047   1.00 0.00 ? 49 ASN A HD22 4  
ATOM 4375  N N    . ASN A 1 50 ? 5.940  13.454  6.123   1.00 0.00 ? 50 ASN A N    4  
ATOM 4376  C CA   . ASN A 1 50 ? 4.545  13.665  5.717   1.00 0.00 ? 50 ASN A CA   4  
ATOM 4377  C C    . ASN A 1 50 ? 4.414  14.844  4.779   1.00 0.00 ? 50 ASN A C    4  
ATOM 4378  O O    . ASN A 1 50 ? 4.820  15.952  5.091   1.00 0.00 ? 50 ASN A O    4  
ATOM 4379  C CB   . ASN A 1 50 ? 3.658  13.854  6.936   1.00 0.00 ? 50 ASN A CB   4  
ATOM 4380  C CG   . ASN A 1 50 ? 3.598  12.631  7.823   1.00 0.00 ? 50 ASN A CG   4  
ATOM 4381  O OD1  . ASN A 1 50 ? 4.442  12.452  8.723   1.00 0.00 ? 50 ASN A OD1  4  
ATOM 4382  N ND2  . ASN A 1 50 ? 2.626  11.767  7.579   1.00 0.00 ? 50 ASN A ND2  4  
ATOM 4383  H H    . ASN A 1 50 ? 6.165  13.562  7.068   1.00 0.00 ? 50 ASN A H    4  
ATOM 4384  H HA   . ASN A 1 50 ? 4.223  12.778  5.196   1.00 0.00 ? 50 ASN A HA   4  
ATOM 4385  H HB2  . ASN A 1 50 ? 4.024  14.691  7.511   1.00 0.00 ? 50 ASN A HB2  4  
ATOM 4386  H HB3  . ASN A 1 50 ? 2.652  14.072  6.597   1.00 0.00 ? 50 ASN A HB3  4  
ATOM 4387  H HD21 . ASN A 1 50 ? 2.006  11.975  6.851   1.00 0.00 ? 50 ASN A HD21 4  
ATOM 4388  H HD22 . ASN A 1 50 ? 2.560  10.962  8.137   1.00 0.00 ? 50 ASN A HD22 4  
ATOM 4389  N N    . GLY A 1 51 ? 3.866  14.587  3.602   1.00 0.00 ? 51 GLY A N    4  
ATOM 4390  C CA   . GLY A 1 51 ? 3.584  15.643  2.665   1.00 0.00 ? 51 GLY A CA   4  
ATOM 4391  C C    . GLY A 1 51 ? 4.724  15.922  1.714   1.00 0.00 ? 51 GLY A C    4  
ATOM 4392  O O    . GLY A 1 51 ? 4.511  16.230  0.544   1.00 0.00 ? 51 GLY A O    4  
ATOM 4393  H H    . GLY A 1 51 ? 3.659  13.665  3.367   1.00 0.00 ? 51 GLY A H    4  
ATOM 4394  H HA2  . GLY A 1 51 ? 2.701  15.362  2.078   1.00 0.00 ? 51 GLY A HA2  4  
ATOM 4395  H HA3  . GLY A 1 51 ? 3.369  16.542  3.219   1.00 0.00 ? 51 GLY A HA3  4  
ATOM 4396  N N    . VAL A 1 52 ? 5.952  15.790  2.207   1.00 0.00 ? 52 VAL A N    4  
ATOM 4397  C CA   . VAL A 1 52 ? 7.114  16.194  1.430   1.00 0.00 ? 52 VAL A CA   4  
ATOM 4398  C C    . VAL A 1 52 ? 7.875  14.991  0.852   1.00 0.00 ? 52 VAL A C    4  
ATOM 4399  O O    . VAL A 1 52 ? 7.725  13.871  1.336   1.00 0.00 ? 52 VAL A O    4  
ATOM 4400  C CB   . VAL A 1 52 ? 8.086  17.058  2.280   1.00 0.00 ? 52 VAL A CB   4  
ATOM 4401  C CG1  . VAL A 1 52 ? 7.502  18.440  2.565   1.00 0.00 ? 52 VAL A CG1  4  
ATOM 4402  C CG2  . VAL A 1 52 ? 8.433  16.348  3.582   1.00 0.00 ? 52 VAL A CG2  4  
ATOM 4403  H H    . VAL A 1 52 ? 6.090  15.401  3.092   1.00 0.00 ? 52 VAL A H    4  
ATOM 4404  H HA   . VAL A 1 52 ? 6.764  16.805  0.607   1.00 0.00 ? 52 VAL A HA   4  
ATOM 4405  H HB   . VAL A 1 52 ? 9.010  17.191  1.718   1.00 0.00 ? 52 VAL A HB   4  
ATOM 4406  H HG11 . VAL A 1 52 ? 6.598  18.328  3.138   1.00 0.00 ? 52 VAL A HG11 4  
ATOM 4407  H HG12 . VAL A 1 52 ? 7.278  18.925  1.626   1.00 0.00 ? 52 VAL A HG12 4  
ATOM 4408  H HG13 . VAL A 1 52 ? 8.220  19.019  3.116   1.00 0.00 ? 52 VAL A HG13 4  
ATOM 4409  H HG21 . VAL A 1 52 ? 8.947  15.428  3.355   1.00 0.00 ? 52 VAL A HG21 4  
ATOM 4410  H HG22 . VAL A 1 52 ? 7.530  16.148  4.126   1.00 0.00 ? 52 VAL A HG22 4  
ATOM 4411  H HG23 . VAL A 1 52 ? 9.081  16.989  4.173   1.00 0.00 ? 52 VAL A HG23 4  
ATOM 4412  N N    . PRO A 1 53 ? 8.631  15.225  -0.224  1.00 0.00 ? 53 PRO A N    4  
ATOM 4413  C CA   . PRO A 1 53 ? 9.407  14.185  -0.926  1.00 0.00 ? 53 PRO A CA   4  
ATOM 4414  C C    . PRO A 1 53 ? 10.369 13.356  -0.059  1.00 0.00 ? 53 PRO A C    4  
ATOM 4415  O O    . PRO A 1 53 ? 10.402 12.151  -0.241  1.00 0.00 ? 53 PRO A O    4  
ATOM 4416  C CB   . PRO A 1 53 ? 10.210 14.982  -1.960  1.00 0.00 ? 53 PRO A CB   4  
ATOM 4417  C CG   . PRO A 1 53 ? 9.437  16.236  -2.173  1.00 0.00 ? 53 PRO A CG   4  
ATOM 4418  C CD   . PRO A 1 53 ? 8.766  16.534  -0.865  1.00 0.00 ? 53 PRO A CD   4  
ATOM 4419  H HA   . PRO A 1 53 ? 8.741  13.517  -1.441  1.00 0.00 ? 53 PRO A HA   4  
ATOM 4420  H HB2  . PRO A 1 53 ? 11.193 15.186  -1.587  1.00 0.00 ? 53 PRO A HB2  4  
ATOM 4421  H HB3  . PRO A 1 53 ? 10.269 14.404  -2.878  1.00 0.00 ? 53 PRO A HB3  4  
ATOM 4422  H HG2  . PRO A 1 53 ? 10.133 17.038  -2.422  1.00 0.00 ? 53 PRO A HG2  4  
ATOM 4423  H HG3  . PRO A 1 53 ? 8.719  16.109  -2.949  1.00 0.00 ? 53 PRO A HG3  4  
ATOM 4424  H HD2  . PRO A 1 53 ? 9.373  17.199  -0.265  1.00 0.00 ? 53 PRO A HD2  4  
ATOM 4425  H HD3  . PRO A 1 53 ? 7.800  16.972  -1.047  1.00 0.00 ? 53 PRO A HD3  4  
ATOM 4426  N N    . PRO A 1 54 ? 11.190 13.961  0.841   1.00 0.00 ? 54 PRO A N    4  
ATOM 4427  C CA   . PRO A 1 54 ? 12.216 13.220  1.614   1.00 0.00 ? 54 PRO A CA   4  
ATOM 4428  C C    . PRO A 1 54 ? 11.681 11.966  2.306   1.00 0.00 ? 54 PRO A C    4  
ATOM 4429  O O    . PRO A 1 54 ? 10.674 12.000  3.024   1.00 0.00 ? 54 PRO A O    4  
ATOM 4430  C CB   . PRO A 1 54 ? 12.703 14.258  2.652   1.00 0.00 ? 54 PRO A CB   4  
ATOM 4431  C CG   . PRO A 1 54 ? 11.747 15.396  2.567   1.00 0.00 ? 54 PRO A CG   4  
ATOM 4432  C CD   . PRO A 1 54 ? 11.223 15.393  1.170   1.00 0.00 ? 54 PRO A CD   4  
ATOM 4433  H HA   . PRO A 1 54 ? 13.038 12.958  0.973   1.00 0.00 ? 54 PRO A HA   4  
ATOM 4434  H HB2  . PRO A 1 54 ? 12.693 13.804  3.643   1.00 0.00 ? 54 PRO A HB2  4  
ATOM 4435  H HB3  . PRO A 1 54 ? 13.708 14.561  2.403   1.00 0.00 ? 54 PRO A HB3  4  
ATOM 4436  H HG2  . PRO A 1 54 ? 10.936 15.244  3.274   1.00 0.00 ? 54 PRO A HG2  4  
ATOM 4437  H HG3  . PRO A 1 54 ? 12.257 16.317  2.779   1.00 0.00 ? 54 PRO A HG3  4  
ATOM 4438  H HD2  . PRO A 1 54 ? 10.228 15.821  1.147   1.00 0.00 ? 54 PRO A HD2  4  
ATOM 4439  H HD3  . PRO A 1 54 ? 11.896 15.929  0.520   1.00 0.00 ? 54 PRO A HD3  4  
ATOM 4440  N N    . VAL A 1 55 ? 12.365 10.852  2.068   1.00 0.00 ? 55 VAL A N    4  
ATOM 4441  C CA   . VAL A 1 55 ? 11.980 9.581   2.679   1.00 0.00 ? 55 VAL A CA   4  
ATOM 4442  C C    . VAL A 1 55 ? 13.194 8.955   3.348   1.00 0.00 ? 55 VAL A C    4  
ATOM 4443  O O    . VAL A 1 55 ? 14.298 8.972   2.815   1.00 0.00 ? 55 VAL A O    4  
ATOM 4444  C CB   . VAL A 1 55 ? 11.363 8.613   1.637   1.00 0.00 ? 55 VAL A CB   4  
ATOM 4445  C CG1  . VAL A 1 55 ? 12.331 8.303   0.508   1.00 0.00 ? 55 VAL A CG1  4  
ATOM 4446  C CG2  . VAL A 1 55 ? 10.893 7.330   2.316   1.00 0.00 ? 55 VAL A CG2  4  
ATOM 4447  H H    . VAL A 1 55 ? 13.161 10.891  1.485   1.00 0.00 ? 55 VAL A H    4  
ATOM 4448  H HA   . VAL A 1 55 ? 11.237 9.799   3.444   1.00 0.00 ? 55 VAL A HA   4  
ATOM 4449  H HB   . VAL A 1 55 ? 10.495 9.091   1.208   1.00 0.00 ? 55 VAL A HB   4  
ATOM 4450  H HG11 . VAL A 1 55 ? 12.573 9.226   -0.030  1.00 0.00 ? 55 VAL A HG11 4  
ATOM 4451  H HG12 . VAL A 1 55 ? 11.884 7.606   -0.182  1.00 0.00 ? 55 VAL A HG12 4  
ATOM 4452  H HG13 . VAL A 1 55 ? 13.231 7.880   0.917   1.00 0.00 ? 55 VAL A HG13 4  
ATOM 4453  H HG21 . VAL A 1 55 ? 11.736 6.874   2.810   1.00 0.00 ? 55 VAL A HG21 4  
ATOM 4454  H HG22 . VAL A 1 55 ? 10.500 6.650   1.574   1.00 0.00 ? 55 VAL A HG22 4  
ATOM 4455  H HG23 . VAL A 1 55 ? 10.131 7.569   3.036   1.00 0.00 ? 55 VAL A HG23 4  
ATOM 4456  N N    . GLN A 1 56 ? 13.003 8.395   4.540   1.00 0.00 ? 56 GLN A N    4  
ATOM 4457  C CA   . GLN A 1 56 ? 14.107 7.857   5.322   1.00 0.00 ? 56 GLN A CA   4  
ATOM 4458  C C    . GLN A 1 56 ? 14.198 6.351   5.130   1.00 0.00 ? 56 GLN A C    4  
ATOM 4459  O O    . GLN A 1 56 ? 13.329 5.591   5.575   1.00 0.00 ? 56 GLN A O    4  
ATOM 4460  C CB   . GLN A 1 56 ? 13.926 8.184   6.802   1.00 0.00 ? 56 GLN A CB   4  
ATOM 4461  C CG   . GLN A 1 56 ? 15.010 7.611   7.706   1.00 0.00 ? 56 GLN A CG   4  
ATOM 4462  C CD   . GLN A 1 56 ? 16.389 8.166   7.421   1.00 0.00 ? 56 GLN A CD   4  
ATOM 4463  O OE1  . GLN A 1 56 ? 16.735 8.502   6.297   1.00 0.00 ? 56 GLN A OE1  4  
ATOM 4464  N NE2  . GLN A 1 56 ? 17.186 8.274   8.465   1.00 0.00 ? 56 GLN A NE2  4  
ATOM 4465  H H    . GLN A 1 56 ? 12.091 8.301   4.883   1.00 0.00 ? 56 GLN A H    4  
ATOM 4466  H HA   . GLN A 1 56 ? 15.022 8.299   4.982   1.00 0.00 ? 56 GLN A HA   4  
ATOM 4467  H HB2  . GLN A 1 56 ? 13.924 9.255   6.917   1.00 0.00 ? 56 GLN A HB2  4  
ATOM 4468  H HB3  . GLN A 1 56 ? 12.984 7.789   7.134   1.00 0.00 ? 56 GLN A HB3  4  
ATOM 4469  H HG2  . GLN A 1 56 ? 14.762 7.841   8.728   1.00 0.00 ? 56 GLN A HG2  4  
ATOM 4470  H HG3  . GLN A 1 56 ? 15.033 6.533   7.568   1.00 0.00 ? 56 GLN A HG3  4  
ATOM 4471  H HE21 . GLN A 1 56 ? 16.847 8.003   9.349   1.00 0.00 ? 56 GLN A HE21 4  
ATOM 4472  H HE22 . GLN A 1 56 ? 18.090 8.619   8.315   1.00 0.00 ? 56 GLN A HE22 4  
ATOM 4473  N N    . VAL A 1 57 ? 15.246 5.931   4.439   1.00 0.00 ? 57 VAL A N    4  
ATOM 4474  C CA   . VAL A 1 57 ? 15.442 4.535   4.124   1.00 0.00 ? 57 VAL A CA   4  
ATOM 4475  C C    . VAL A 1 57 ? 16.814 4.070   4.643   1.00 0.00 ? 57 VAL A C    4  
ATOM 4476  O O    . VAL A 1 57 ? 17.824 4.746   4.450   1.00 0.00 ? 57 VAL A O    4  
ATOM 4477  C CB   . VAL A 1 57 ? 15.371 4.309   2.597   1.00 0.00 ? 57 VAL A CB   4  
ATOM 4478  C CG1  . VAL A 1 57 ? 15.624 2.854   2.235   1.00 0.00 ? 57 VAL A CG1  4  
ATOM 4479  C CG2  . VAL A 1 57 ? 14.013 4.761   2.084   1.00 0.00 ? 57 VAL A CG2  4  
ATOM 4480  H H    . VAL A 1 57 ? 15.899 6.588   4.118   1.00 0.00 ? 57 VAL A H    4  
ATOM 4481  H HA   . VAL A 1 57 ? 14.676 3.955   4.602   1.00 0.00 ? 57 VAL A HA   4  
ATOM 4482  H HB   . VAL A 1 57 ? 16.127 4.909   2.129   1.00 0.00 ? 57 VAL A HB   4  
ATOM 4483  H HG11 . VAL A 1 57 ? 15.609 2.730   1.162   1.00 0.00 ? 57 VAL A HG11 4  
ATOM 4484  H HG12 . VAL A 1 57 ? 14.855 2.236   2.673   1.00 0.00 ? 57 VAL A HG12 4  
ATOM 4485  H HG13 . VAL A 1 57 ? 16.590 2.567   2.623   1.00 0.00 ? 57 VAL A HG13 4  
ATOM 4486  H HG21 . VAL A 1 57 ? 13.865 5.798   2.306   1.00 0.00 ? 57 VAL A HG21 4  
ATOM 4487  H HG22 . VAL A 1 57 ? 13.234 4.177   2.540   1.00 0.00 ? 57 VAL A HG22 4  
ATOM 4488  H HG23 . VAL A 1 57 ? 13.978 4.627   1.006   1.00 0.00 ? 57 VAL A HG23 4  
ATOM 4489  N N    . PHE A 1 58 ? 16.819 2.935   5.310   1.00 0.00 ? 58 PHE A N    4  
ATOM 4490  C CA   . PHE A 1 58 ? 18.053 2.358   5.795   1.00 0.00 ? 58 PHE A CA   4  
ATOM 4491  C C    . PHE A 1 58 ? 18.651 1.416   4.755   1.00 0.00 ? 58 PHE A C    4  
ATOM 4492  O O    . PHE A 1 58 ? 18.072 0.374   4.452   1.00 0.00 ? 58 PHE A O    4  
ATOM 4493  C CB   . PHE A 1 58 ? 17.811 1.593   7.111   1.00 0.00 ? 58 PHE A CB   4  
ATOM 4494  C CG   . PHE A 1 58 ? 19.023 0.892   7.630   1.00 0.00 ? 58 PHE A CG   4  
ATOM 4495  C CD1  . PHE A 1 58 ? 20.075 1.623   8.164   1.00 0.00 ? 58 PHE A CD1  4  
ATOM 4496  C CD2  . PHE A 1 58 ? 19.111 -0.479  7.574   1.00 0.00 ? 58 PHE A CD2  4  
ATOM 4497  C CE1  . PHE A 1 58 ? 21.202 0.981   8.635   1.00 0.00 ? 58 PHE A CE1  4  
ATOM 4498  C CE2  . PHE A 1 58 ? 20.237 -1.127  8.042   1.00 0.00 ? 58 PHE A CE2  4  
ATOM 4499  C CZ   . PHE A 1 58 ? 21.299 -0.401  8.579   1.00 0.00 ? 58 PHE A CZ   4  
ATOM 4500  H H    . PHE A 1 58 ? 15.972 2.465   5.475   1.00 0.00 ? 58 PHE A H    4  
ATOM 4501  H HA   . PHE A 1 58 ? 18.759 3.157   5.987   1.00 0.00 ? 58 PHE A HA   4  
ATOM 4502  H HB2  . PHE A 1 58 ? 17.471 2.294   7.863   1.00 0.00 ? 58 PHE A HB2  4  
ATOM 4503  H HB3  . PHE A 1 58 ? 17.032 0.861   6.936   1.00 0.00 ? 58 PHE A HB3  4  
ATOM 4504  H HD1  . PHE A 1 58 ? 20.008 2.695   8.201   1.00 0.00 ? 58 PHE A HD1  4  
ATOM 4505  H HD2  . PHE A 1 58 ? 18.307 -1.051  7.145   1.00 0.00 ? 58 PHE A HD2  4  
ATOM 4506  H HE1  . PHE A 1 58 ? 22.021 1.563   9.052   1.00 0.00 ? 58 PHE A HE1  4  
ATOM 4507  H HE2  . PHE A 1 58 ? 20.295 -2.205  8.005   1.00 0.00 ? 58 PHE A HE2  4  
ATOM 4508  H HZ   . PHE A 1 58 ? 22.173 -0.903  8.942   1.00 0.00 ? 58 PHE A HZ   4  
ATOM 4509  N N    . TRP A 1 59 ? 19.782 1.786   4.205   1.00 0.00 ? 59 TRP A N    4  
ATOM 4510  C CA   . TRP A 1 59 ? 20.411 0.994   3.142   1.00 0.00 ? 59 TRP A CA   4  
ATOM 4511  C C    . TRP A 1 59 ? 21.465 0.062   3.739   1.00 0.00 ? 59 TRP A C    4  
ATOM 4512  O O    . TRP A 1 59 ? 22.379 0.509   4.411   1.00 0.00 ? 59 TRP A O    4  
ATOM 4513  C CB   . TRP A 1 59 ? 21.053 1.905   2.098   1.00 0.00 ? 59 TRP A CB   4  
ATOM 4514  C CG   . TRP A 1 59 ? 20.062 2.813   1.420   1.00 0.00 ? 59 TRP A CG   4  
ATOM 4515  C CD1  . TRP A 1 59 ? 19.818 4.124   1.708   1.00 0.00 ? 59 TRP A CD1  4  
ATOM 4516  C CD2  . TRP A 1 59 ? 19.153 2.475   0.352   1.00 0.00 ? 59 TRP A CD2  4  
ATOM 4517  N NE1  . TRP A 1 59 ? 18.840 4.619   0.879   1.00 0.00 ? 59 TRP A NE1  4  
ATOM 4518  C CE2  . TRP A 1 59 ? 18.415 3.629   0.044   1.00 0.00 ? 59 TRP A CE2  4  
ATOM 4519  C CE3  . TRP A 1 59 ? 18.905 1.314   -0.361  1.00 0.00 ? 59 TRP A CE3  4  
ATOM 4520  C CZ2  . TRP A 1 59 ? 17.449 3.655   -0.944  1.00 0.00 ? 59 TRP A CZ2  4  
ATOM 4521  C CZ3  . TRP A 1 59 ? 17.938 1.332   -1.342  1.00 0.00 ? 59 TRP A CZ3  4  
ATOM 4522  C CH2  . TRP A 1 59 ? 17.223 2.498   -1.626  1.00 0.00 ? 59 TRP A CH2  4  
ATOM 4523  H H    . TRP A 1 59 ? 20.227 2.600   4.546   1.00 0.00 ? 59 TRP A H    4  
ATOM 4524  H HA   . TRP A 1 59 ? 19.648 0.406   2.682   1.00 0.00 ? 59 TRP A HA   4  
ATOM 4525  H HB2  . TRP A 1 59 ? 21.803 2.532   2.572   1.00 0.00 ? 59 TRP A HB2  4  
ATOM 4526  H HB3  . TRP A 1 59 ? 21.528 1.293   1.340   1.00 0.00 ? 59 TRP A HB3  4  
ATOM 4527  H HD1  . TRP A 1 59 ? 20.340 4.682   2.472   1.00 0.00 ? 59 TRP A HD1  4  
ATOM 4528  H HE1  . TRP A 1 59 ? 18.495 5.537   0.881   1.00 0.00 ? 59 TRP A HE1  4  
ATOM 4529  H HE3  . TRP A 1 59 ? 19.443 0.404   -0.147  1.00 0.00 ? 59 TRP A HE3  4  
ATOM 4530  H HZ2  . TRP A 1 59 ? 16.884 4.544   -1.159  1.00 0.00 ? 59 TRP A HZ2  4  
ATOM 4531  H HZ3  . TRP A 1 59 ? 17.734 0.440   -1.910  1.00 0.00 ? 59 TRP A HZ3  4  
ATOM 4532  H HH2  . TRP A 1 59 ? 16.471 2.468   -2.395  1.00 0.00 ? 59 TRP A HH2  4  
ATOM 4533  N N    . GLU A 1 60 ? 21.310 -1.244  3.488   1.00 0.00 ? 60 GLU A N    4  
ATOM 4534  C CA   . GLU A 1 60 ? 22.130 -2.254  4.149   1.00 0.00 ? 60 GLU A CA   4  
ATOM 4535  C C    . GLU A 1 60 ? 23.475 -2.454  3.451   1.00 0.00 ? 60 GLU A C    4  
ATOM 4536  O O    . GLU A 1 60 ? 24.453 -2.879  4.080   1.00 0.00 ? 60 GLU A O    4  
ATOM 4537  C CB   . GLU A 1 60 ? 21.362 -3.591  4.233   1.00 0.00 ? 60 GLU A CB   4  
ATOM 4538  C CG   . GLU A 1 60 ? 20.889 -4.133  2.902   1.00 0.00 ? 60 GLU A CG   4  
ATOM 4539  C CD   . GLU A 1 60 ? 21.821 -5.161  2.294   1.00 0.00 ? 60 GLU A CD   4  
ATOM 4540  O OE1  . GLU A 1 60 ? 21.695 -6.351  2.628   1.00 0.00 ? 60 GLU A OE1  4  
ATOM 4541  O OE2  . GLU A 1 60 ? 22.676 -4.772  1.479   1.00 0.00 ? 60 GLU A OE2  4  
ATOM 4542  H H    . GLU A 1 60 ? 20.615 -1.527  2.864   1.00 0.00 ? 60 GLU A H    4  
ATOM 4543  H HA   . GLU A 1 60 ? 22.316 -1.895  5.135   1.00 0.00 ? 60 GLU A HA   4  
ATOM 4544  H HB2  . GLU A 1 60 ? 22.012 -4.329  4.679   1.00 0.00 ? 60 GLU A HB2  4  
ATOM 4545  H HB3  . GLU A 1 60 ? 20.499 -3.446  4.868   1.00 0.00 ? 60 GLU A HB3  4  
ATOM 4546  H HG2  . GLU A 1 60 ? 19.924 -4.599  3.046   1.00 0.00 ? 60 GLU A HG2  4  
ATOM 4547  H HG3  . GLU A 1 60 ? 20.787 -3.308  2.209   1.00 0.00 ? 60 GLU A HG3  4  
ATOM 4548  N N    . SER A 1 61 ? 23.544 -2.149  2.162   1.00 0.00 ? 61 SER A N    4  
ATOM 4549  C CA   . SER A 1 61 ? 24.764 -2.339  1.402   1.00 0.00 ? 61 SER A CA   4  
ATOM 4550  C C    . SER A 1 61 ? 25.801 -1.313  1.836   1.00 0.00 ? 61 SER A C    4  
ATOM 4551  O O    . SER A 1 61 ? 26.995 -1.594  1.897   1.00 0.00 ? 61 SER A O    4  
ATOM 4552  C CB   . SER A 1 61 ? 24.472 -2.242  -0.100  1.00 0.00 ? 61 SER A CB   4  
ATOM 4553  O OG   . SER A 1 61 ? 25.606 -2.573  -0.886  1.00 0.00 ? 61 SER A OG   4  
ATOM 4554  H H    . SER A 1 61 ? 22.737 -1.844  1.699   1.00 0.00 ? 61 SER A H    4  
ATOM 4555  H HA   . SER A 1 61 ? 25.128 -3.331  1.627   1.00 0.00 ? 61 SER A HA   4  
ATOM 4556  H HB2  . SER A 1 61 ? 23.674 -2.922  -0.359  1.00 0.00 ? 61 SER A HB2  4  
ATOM 4557  H HB3  . SER A 1 61 ? 24.174 -1.227  -0.324  1.00 0.00 ? 61 SER A HB3  4  
ATOM 4558  H HG   . SER A 1 61 ? 25.462 -3.449  -1.285  1.00 0.00 ? 61 SER A HG   4  
ATOM 4559  N N    . THR A 1 62 ? 25.342 -0.118  2.148   1.00 0.00 ? 62 THR A N    4  
ATOM 4560  C CA   . THR A 1 62 ? 26.220 0.928   2.668   1.00 0.00 ? 62 THR A CA   4  
ATOM 4561  C C    . THR A 1 62 ? 26.238 0.902   4.197   1.00 0.00 ? 62 THR A C    4  
ATOM 4562  O O    . THR A 1 62 ? 27.271 1.115   4.832   1.00 0.00 ? 62 THR A O    4  
ATOM 4563  C CB   . THR A 1 62 ? 25.755 2.303   2.161   1.00 0.00 ? 62 THR A CB   4  
ATOM 4564  O OG1  . THR A 1 62 ? 24.321 2.337   2.082   1.00 0.00 ? 62 THR A OG1  4  
ATOM 4565  C CG2  . THR A 1 62 ? 26.359 2.600   0.793   1.00 0.00 ? 62 THR A CG2  4  
ATOM 4566  H H    . THR A 1 62 ? 24.386 0.075   2.027   1.00 0.00 ? 62 THR A H    4  
ATOM 4567  H HA   . THR A 1 62 ? 27.223 0.742   2.289   1.00 0.00 ? 62 THR A HA   4  
ATOM 4568  H HB   . THR A 1 62 ? 26.081 3.054   2.860   1.00 0.00 ? 62 THR A HB   4  
ATOM 4569  H HG1  . THR A 1 62 ? 24.042 2.017   1.206   1.00 0.00 ? 62 THR A HG1  4  
ATOM 4570  H HG21 . THR A 1 62 ? 26.044 1.843   0.101   1.00 0.00 ? 62 THR A HG21 4  
ATOM 4571  H HG22 . THR A 1 62 ? 27.435 2.577   0.873   1.00 0.00 ? 62 THR A HG22 4  
ATOM 4572  H HG23 . THR A 1 62 ? 26.032 3.574   0.463   1.00 0.00 ? 62 THR A HG23 4  
ATOM 4573  N N    . GLY A 1 63 ? 25.076 0.673   4.779   1.00 0.00 ? 63 GLY A N    4  
ATOM 4574  C CA   . GLY A 1 63 ? 24.965 0.549   6.216   1.00 0.00 ? 63 GLY A CA   4  
ATOM 4575  C C    . GLY A 1 63 ? 24.613 1.875   6.868   1.00 0.00 ? 63 GLY A C    4  
ATOM 4576  O O    . GLY A 1 63 ? 24.994 2.143   8.015   1.00 0.00 ? 63 GLY A O    4  
ATOM 4577  H H    . GLY A 1 63 ? 24.278 0.621   4.218   1.00 0.00 ? 63 GLY A H    4  
ATOM 4578  H HA2  . GLY A 1 63 ? 24.191 -0.178  6.458   1.00 0.00 ? 63 GLY A HA2  4  
ATOM 4579  H HA3  . GLY A 1 63 ? 25.905 0.212   6.616   1.00 0.00 ? 63 GLY A HA3  4  
ATOM 4580  N N    . ARG A 1 64 ? 23.889 2.715   6.137   1.00 0.00 ? 64 ARG A N    4  
ATOM 4581  C CA   . ARG A 1 64 ? 23.506 4.039   6.617   1.00 0.00 ? 64 ARG A CA   4  
ATOM 4582  C C    . ARG A 1 64 ? 22.065 4.345   6.253   1.00 0.00 ? 64 ARG A C    4  
ATOM 4583  O O    . ARG A 1 64 ? 21.543 3.782   5.281   1.00 0.00 ? 64 ARG A O    4  
ATOM 4584  C CB   . ARG A 1 64 ? 24.388 5.114   5.991   1.00 0.00 ? 64 ARG A CB   4  
ATOM 4585  C CG   . ARG A 1 64 ? 25.883 4.909   6.164   1.00 0.00 ? 64 ARG A CG   4  
ATOM 4586  C CD   . ARG A 1 64 ? 26.677 6.021   5.496   1.00 0.00 ? 64 ARG A CD   4  
ATOM 4587  N NE   . ARG A 1 64 ? 28.107 5.786   5.520   1.00 0.00 ? 64 ARG A NE   4  
ATOM 4588  C CZ   . ARG A 1 64 ? 28.852 5.646   4.412   1.00 0.00 ? 64 ARG A CZ   4  
ATOM 4589  N NH1  . ARG A 1 64 ? 28.280 5.694   3.208   1.00 0.00 ? 64 ARG A NH1  4  
ATOM 4590  N NH2  . ARG A 1 64 ? 30.171 5.499   4.520   1.00 0.00 ? 64 ARG A NH2  4  
ATOM 4591  H H    . ARG A 1 64 ? 23.617 2.437   5.227   1.00 0.00 ? 64 ARG A H    4  
ATOM 4592  H HA   . ARG A 1 64 ? 23.637 4.052   7.691   1.00 0.00 ? 64 ARG A HA   4  
ATOM 4593  H HB2  . ARG A 1 64 ? 24.183 5.161   4.927   1.00 0.00 ? 64 ARG A HB2  4  
ATOM 4594  H HB3  . ARG A 1 64 ? 24.132 6.078   6.434   1.00 0.00 ? 64 ARG A HB3  4  
ATOM 4595  H HG2  . ARG A 1 64 ? 26.111 4.913   7.221   1.00 0.00 ? 64 ARG A HG2  4  
ATOM 4596  H HG3  . ARG A 1 64 ? 26.163 3.957   5.733   1.00 0.00 ? 64 ARG A HG3  4  
ATOM 4597  H HD2  . ARG A 1 64 ? 26.352 6.091   4.468   1.00 0.00 ? 64 ARG A HD2  4  
ATOM 4598  H HD3  . ARG A 1 64 ? 26.469 6.937   6.006   1.00 0.00 ? 64 ARG A HD3  4  
ATOM 4599  H HE   . ARG A 1 64 ? 28.546 5.707   6.411   1.00 0.00 ? 64 ARG A HE   4  
ATOM 4600  H HH11 . ARG A 1 64 ? 27.285 5.801   3.116   1.00 0.00 ? 64 ARG A HH11 4  
ATOM 4601  H HH12 . ARG A 1 64 ? 28.856 5.598   2.395   1.00 0.00 ? 64 ARG A HH12 4  
ATOM 4602  H HH21 . ARG A 1 64 ? 30.620 5.463   5.425   1.00 0.00 ? 64 ARG A HH21 4  
ATOM 4603  H HH22 . ARG A 1 64 ? 30.747 5.372   3.693   1.00 0.00 ? 64 ARG A HH22 4  
ATOM 4604  N N    . THR A 1 65 ? 21.430 5.198   7.015   1.00 0.00 ? 65 THR A N    4  
ATOM 4605  C CA   . THR A 1 65 ? 20.140 5.732   6.644   1.00 0.00 ? 65 THR A CA   4  
ATOM 4606  C C    . THR A 1 65 ? 20.336 6.907   5.694   1.00 0.00 ? 65 THR A C    4  
ATOM 4607  O O    . THR A 1 65 ? 21.308 7.652   5.806   1.00 0.00 ? 65 THR A O    4  
ATOM 4608  C CB   . THR A 1 65 ? 19.361 6.205   7.880   1.00 0.00 ? 65 THR A CB   4  
ATOM 4609  O OG1  . THR A 1 65 ? 20.192 7.032   8.696   1.00 0.00 ? 65 THR A OG1  4  
ATOM 4610  C CG2  . THR A 1 65 ? 18.865 5.024   8.702   1.00 0.00 ? 65 THR A CG2  4  
ATOM 4611  H H    . THR A 1 65 ? 21.841 5.474   7.870   1.00 0.00 ? 65 THR A H    4  
ATOM 4612  H HA   . THR A 1 65 ? 19.593 4.949   6.137   1.00 0.00 ? 65 THR A HA   4  
ATOM 4613  H HB   . THR A 1 65 ? 18.510 6.776   7.551   1.00 0.00 ? 65 THR A HB   4  
ATOM 4614  H HG1  . THR A 1 65 ? 21.042 7.195   8.232   1.00 0.00 ? 65 THR A HG1  4  
ATOM 4615  H HG21 . THR A 1 65 ? 18.204 4.422   8.097   1.00 0.00 ? 65 THR A HG21 4  
ATOM 4616  H HG22 . THR A 1 65 ? 18.328 5.388   9.571   1.00 0.00 ? 65 THR A HG22 4  
ATOM 4617  H HG23 . THR A 1 65 ? 19.701 4.427   9.018   1.00 0.00 ? 65 THR A HG23 4  
ATOM 4618  N N    . TYR A 1 66 ? 19.407 7.087   4.776   1.00 0.00 ? 66 TYR A N    4  
ATOM 4619  C CA   . TYR A 1 66 ? 19.524 8.162   3.810   1.00 0.00 ? 66 TYR A CA   4  
ATOM 4620  C C    . TYR A 1 66 ? 18.153 8.598   3.335   1.00 0.00 ? 66 TYR A C    4  
ATOM 4621  O O    . TYR A 1 66 ? 17.226 7.786   3.207   1.00 0.00 ? 66 TYR A O    4  
ATOM 4622  C CB   . TYR A 1 66 ? 20.392 7.714   2.634   1.00 0.00 ? 66 TYR A CB   4  
ATOM 4623  C CG   . TYR A 1 66 ? 20.832 8.845   1.729   1.00 0.00 ? 66 TYR A CG   4  
ATOM 4624  C CD1  . TYR A 1 66 ? 21.709 9.823   2.191   1.00 0.00 ? 66 TYR A CD1  4  
ATOM 4625  C CD2  . TYR A 1 66 ? 20.366 8.940   0.427   1.00 0.00 ? 66 TYR A CD2  4  
ATOM 4626  C CE1  . TYR A 1 66 ? 22.099 10.859  1.376   1.00 0.00 ? 66 TYR A CE1  4  
ATOM 4627  C CE2  . TYR A 1 66 ? 20.763 9.973   -0.400  1.00 0.00 ? 66 TYR A CE2  4  
ATOM 4628  C CZ   . TYR A 1 66 ? 21.625 10.929  0.082   1.00 0.00 ? 66 TYR A CZ   4  
ATOM 4629  O OH   . TYR A 1 66 ? 22.025 11.964  -0.731  1.00 0.00 ? 66 TYR A OH   4  
ATOM 4630  H H    . TYR A 1 66 ? 18.623 6.495   4.769   1.00 0.00 ? 66 TYR A H    4  
ATOM 4631  H HA   . TYR A 1 66 ? 19.993 9.004   4.293   1.00 0.00 ? 66 TYR A HA   4  
ATOM 4632  H HB2  . TYR A 1 66 ? 21.278 7.236   3.009   1.00 0.00 ? 66 TYR A HB2  4  
ATOM 4633  H HB3  . TYR A 1 66 ? 19.826 7.005   2.050   1.00 0.00 ? 66 TYR A HB3  4  
ATOM 4634  H HD1  . TYR A 1 66 ? 22.067 9.768   3.201   1.00 0.00 ? 66 TYR A HD1  4  
ATOM 4635  H HD2  . TYR A 1 66 ? 19.693 8.187   0.046   1.00 0.00 ? 66 TYR A HD2  4  
ATOM 4636  H HE1  . TYR A 1 66 ? 22.772 11.622  1.740   1.00 0.00 ? 66 TYR A HE1  4  
ATOM 4637  H HE2  . TYR A 1 66 ? 20.376 10.031  -1.409  1.00 0.00 ? 66 TYR A HE2  4  
ATOM 4638  H HH   . TYR A 1 66 ? 22.993 12.081  -0.644  1.00 0.00 ? 66 TYR A HH   4  
ATOM 4639  N N    . TRP A 1 67 ? 18.030 9.888   3.052   1.00 0.00 ? 67 TRP A N    4  
ATOM 4640  C CA   . TRP A 1 67 ? 16.793 10.442  2.559   1.00 0.00 ? 67 TRP A CA   4  
ATOM 4641  C C    . TRP A 1 67 ? 16.865 10.481  1.033   1.00 0.00 ? 67 TRP A C    4  
ATOM 4642  O O    . TRP A 1 67 ? 17.675 11.207  0.454   1.00 0.00 ? 67 TRP A O    4  
ATOM 4643  C CB   . TRP A 1 67 ? 16.545 11.842  3.114   1.00 0.00 ? 67 TRP A CB   4  
ATOM 4644  C CG   . TRP A 1 67 ? 16.241 11.850  4.592   1.00 0.00 ? 67 TRP A CG   4  
ATOM 4645  C CD1  . TRP A 1 67 ? 15.001 11.924  5.153   1.00 0.00 ? 67 TRP A CD1  4  
ATOM 4646  C CD2  . TRP A 1 67 ? 17.175 11.778  5.671   1.00 0.00 ? 67 TRP A CD2  4  
ATOM 4647  N NE1  . TRP A 1 67 ? 15.100 11.879  6.527   1.00 0.00 ? 67 TRP A NE1  4  
ATOM 4648  C CE2  . TRP A 1 67 ? 16.424 11.794  6.861   1.00 0.00 ? 67 TRP A CE2  4  
ATOM 4649  C CE3  . TRP A 1 67 ? 18.564 11.691  5.752   1.00 0.00 ? 67 TRP A CE3  4  
ATOM 4650  C CZ2  . TRP A 1 67 ? 17.034 11.738  8.120   1.00 0.00 ? 67 TRP A CZ2  4  
ATOM 4651  C CZ3  . TRP A 1 67 ? 19.157 11.615  6.994   1.00 0.00 ? 67 TRP A CZ3  4  
ATOM 4652  C CH2  . TRP A 1 67 ? 18.396 11.652  8.166   1.00 0.00 ? 67 TRP A CH2  4  
ATOM 4653  H H    . TRP A 1 67 ? 18.805 10.476  3.140   1.00 0.00 ? 67 TRP A H    4  
ATOM 4654  H HA   . TRP A 1 67 ? 15.994 9.789   2.860   1.00 0.00 ? 67 TRP A HA   4  
ATOM 4655  H HB2  . TRP A 1 67 ? 17.436 12.446  2.963   1.00 0.00 ? 67 TRP A HB2  4  
ATOM 4656  H HB3  . TRP A 1 67 ? 15.706 12.297  2.597   1.00 0.00 ? 67 TRP A HB3  4  
ATOM 4657  H HD1  . TRP A 1 67 ? 14.080 11.985  4.597   1.00 0.00 ? 67 TRP A HD1  4  
ATOM 4658  H HE1  . TRP A 1 67 ? 14.347 11.910  7.152   1.00 0.00 ? 67 TRP A HE1  4  
ATOM 4659  H HE3  . TRP A 1 67 ? 19.186 11.655  4.863   1.00 0.00 ? 67 TRP A HE3  4  
ATOM 4660  H HZ2  . TRP A 1 67 ? 16.455 11.762  9.032   1.00 0.00 ? 67 TRP A HZ2  4  
ATOM 4661  H HZ3  . TRP A 1 67 ? 20.231 11.554  7.074   1.00 0.00 ? 67 TRP A HZ3  4  
ATOM 4662  H HH2  . TRP A 1 67 ? 18.914 11.591  9.119   1.00 0.00 ? 67 TRP A HH2  4  
ATOM 4663  N N    . VAL A 1 68 ? 16.008 9.697   0.405   1.00 0.00 ? 68 VAL A N    4  
ATOM 4664  C CA   . VAL A 1 68 ? 16.045 9.538   -1.041  1.00 0.00 ? 68 VAL A CA   4  
ATOM 4665  C C    . VAL A 1 68 ? 14.771 10.098  -1.655  1.00 0.00 ? 68 VAL A C    4  
ATOM 4666  O O    . VAL A 1 68 ? 13.889 10.555  -0.941  1.00 0.00 ? 68 VAL A O    4  
ATOM 4667  C CB   . VAL A 1 68 ? 16.180 8.036   -1.414  1.00 0.00 ? 68 VAL A CB   4  
ATOM 4668  C CG1  . VAL A 1 68 ? 16.859 7.854   -2.761  1.00 0.00 ? 68 VAL A CG1  4  
ATOM 4669  C CG2  . VAL A 1 68 ? 16.922 7.270   -0.339  1.00 0.00 ? 68 VAL A CG2  4  
ATOM 4670  H H    . VAL A 1 68 ? 15.336 9.213   0.919   1.00 0.00 ? 68 VAL A H    4  
ATOM 4671  H HA   . VAL A 1 68 ? 16.908 10.074  -1.433  1.00 0.00 ? 68 VAL A HA   4  
ATOM 4672  H HB   . VAL A 1 68 ? 15.174 7.627   -1.479  1.00 0.00 ? 68 VAL A HB   4  
ATOM 4673  H HG11 . VAL A 1 68 ? 16.228 8.252   -3.536  1.00 0.00 ? 68 VAL A HG11 4  
ATOM 4674  H HG12 . VAL A 1 68 ? 17.020 6.802   -2.934  1.00 0.00 ? 68 VAL A HG12 4  
ATOM 4675  H HG13 . VAL A 1 68 ? 17.810 8.369   -2.763  1.00 0.00 ? 68 VAL A HG13 4  
ATOM 4676  H HG21 . VAL A 1 68 ? 16.375 7.342   0.594   1.00 0.00 ? 68 VAL A HG21 4  
ATOM 4677  H HG22 . VAL A 1 68 ? 17.911 7.684   -0.212  1.00 0.00 ? 68 VAL A HG22 4  
ATOM 4678  H HG23 . VAL A 1 68 ? 17.008 6.232   -0.615  1.00 0.00 ? 68 VAL A HG23 4  
ATOM 4679  N N    . HIS A 1 69 ? 14.684 10.075  -2.985  1.00 0.00 ? 69 HIS A N    4  
ATOM 4680  C CA   . HIS A 1 69 ? 13.456 10.432  -3.668  1.00 0.00 ? 69 HIS A CA   4  
ATOM 4681  C C    . HIS A 1 69 ? 12.662 9.137   -3.909  1.00 0.00 ? 69 HIS A C    4  
ATOM 4682  O O    . HIS A 1 69 ? 13.234 8.132   -4.354  1.00 0.00 ? 69 HIS A O    4  
ATOM 4683  C CB   . HIS A 1 69 ? 13.741 11.121  -5.015  1.00 0.00 ? 69 HIS A CB   4  
ATOM 4684  C CG   . HIS A 1 69 ? 14.384 12.470  -4.924  1.00 0.00 ? 69 HIS A CG   4  
ATOM 4685  N ND1  . HIS A 1 69 ? 15.420 12.787  -4.047  1.00 0.00 ? 69 HIS A ND1  4  
ATOM 4686  C CD2  . HIS A 1 69 ? 14.170 13.608  -5.648  1.00 0.00 ? 69 HIS A CD2  4  
ATOM 4687  C CE1  . HIS A 1 69 ? 15.802 14.032  -4.248  1.00 0.00 ? 69 HIS A CE1  4  
ATOM 4688  N NE2  . HIS A 1 69 ? 15.057 14.555  -5.212  1.00 0.00 ? 69 HIS A NE2  4  
ATOM 4689  H H    . HIS A 1 69 ? 15.463 9.805   -3.513  1.00 0.00 ? 69 HIS A H    4  
ATOM 4690  H HA   . HIS A 1 69 ? 12.892 11.091  -3.035  1.00 0.00 ? 69 HIS A HA   4  
ATOM 4691  H HB2  . HIS A 1 69 ? 14.404 10.483  -5.573  1.00 0.00 ? 69 HIS A HB2  4  
ATOM 4692  H HB3  . HIS A 1 69 ? 12.811 11.239  -5.562  1.00 0.00 ? 69 HIS A HB3  4  
ATOM 4693  H HD1  . HIS A 1 69 ? 15.813 12.181  -3.380  1.00 0.00 ? 69 HIS A HD1  4  
ATOM 4694  H HD2  . HIS A 1 69 ? 13.421 13.731  -6.403  1.00 0.00 ? 69 HIS A HD2  4  
ATOM 4695  H HE1  . HIS A 1 69 ? 16.589 14.535  -3.710  1.00 0.00 ? 69 HIS A HE1  4  
ATOM 4696  H HE2  . HIS A 1 69 ? 15.317 15.354  -5.733  1.00 0.00 ? 69 HIS A HE2  4  
ATOM 4697  N N    . TRP A 1 70 ? 11.365 9.173   -3.628  1.00 0.00 ? 70 TRP A N    4  
ATOM 4698  C CA   . TRP A 1 70 ? 10.495 8.008   -3.751  1.00 0.00 ? 70 TRP A CA   4  
ATOM 4699  C C    . TRP A 1 70 ? 10.645 7.278   -5.079  1.00 0.00 ? 70 TRP A C    4  
ATOM 4700  O O    . TRP A 1 70 ? 10.776 6.056   -5.103  1.00 0.00 ? 70 TRP A O    4  
ATOM 4701  C CB   . TRP A 1 70 ? 9.046  8.415   -3.549  1.00 0.00 ? 70 TRP A CB   4  
ATOM 4702  C CG   . TRP A 1 70 ? 8.675  8.614   -2.102  1.00 0.00 ? 70 TRP A CG   4  
ATOM 4703  C CD1  . TRP A 1 70 ? 8.747  9.776   -1.399  1.00 0.00 ? 70 TRP A CD1  4  
ATOM 4704  C CD2  . TRP A 1 70 ? 8.175  7.625   -1.220  1.00 0.00 ? 70 TRP A CD2  4  
ATOM 4705  N NE1  . TRP A 1 70 ? 8.326  9.558   -0.105  1.00 0.00 ? 70 TRP A NE1  4  
ATOM 4706  C CE2  . TRP A 1 70 ? 7.972  8.247   0.024   1.00 0.00 ? 70 TRP A CE2  4  
ATOM 4707  C CE3  . TRP A 1 70 ? 7.878  6.262   -1.340  1.00 0.00 ? 70 TRP A CE3  4  
ATOM 4708  C CZ2  . TRP A 1 70 ? 7.489  7.569   1.128   1.00 0.00 ? 70 TRP A CZ2  4  
ATOM 4709  C CZ3  . TRP A 1 70 ? 7.394  5.586   -0.231  1.00 0.00 ? 70 TRP A CZ3  4  
ATOM 4710  C CH2  . TRP A 1 70 ? 7.203  6.234   0.989   1.00 0.00 ? 70 TRP A CH2  4  
ATOM 4711  H H    . TRP A 1 70 ? 10.980 10.004  -3.265  1.00 0.00 ? 70 TRP A H    4  
ATOM 4712  H HA   . TRP A 1 70 ? 10.771 7.329   -2.971  1.00 0.00 ? 70 TRP A HA   4  
ATOM 4713  H HB2  . TRP A 1 70 ? 8.878  9.351   -4.075  1.00 0.00 ? 70 TRP A HB2  4  
ATOM 4714  H HB3  . TRP A 1 70 ? 8.388  7.652   -3.963  1.00 0.00 ? 70 TRP A HB3  4  
ATOM 4715  H HD1  . TRP A 1 70 ? 9.094  10.712  -1.802  1.00 0.00 ? 70 TRP A HD1  4  
ATOM 4716  H HE1  . TRP A 1 70 ? 8.282  10.244  0.607   1.00 0.00 ? 70 TRP A HE1  4  
ATOM 4717  H HE3  . TRP A 1 70 ? 8.015  5.747   -2.277  1.00 0.00 ? 70 TRP A HE3  4  
ATOM 4718  H HZ2  . TRP A 1 70 ? 7.347  8.066   2.065   1.00 0.00 ? 70 TRP A HZ2  4  
ATOM 4719  H HZ3  . TRP A 1 70 ? 7.161  4.534   -0.307  1.00 0.00 ? 70 TRP A HZ3  4  
ATOM 4720  H HH2  . TRP A 1 70 ? 6.834  5.663   1.820   1.00 0.00 ? 70 TRP A HH2  4  
ATOM 4721  N N    . HIS A 1 71 ? 10.632 8.026   -6.176  1.00 0.00 ? 71 HIS A N    4  
ATOM 4722  C CA   . HIS A 1 71 ? 10.619 7.403   -7.512  1.00 0.00 ? 71 HIS A CA   4  
ATOM 4723  C C    . HIS A 1 71 ? 11.961 6.765   -7.887  1.00 0.00 ? 71 HIS A C    4  
ATOM 4724  O O    . HIS A 1 71 ? 12.126 6.281   -9.003  1.00 0.00 ? 71 HIS A O    4  
ATOM 4725  C CB   . HIS A 1 71 ? 10.170 8.407   -8.584  1.00 0.00 ? 71 HIS A CB   4  
ATOM 4726  C CG   . HIS A 1 71 ? 11.029 9.632   -8.701  1.00 0.00 ? 71 HIS A CG   4  
ATOM 4727  N ND1  . HIS A 1 71 ? 10.523 10.911  -8.604  1.00 0.00 ? 71 HIS A ND1  4  
ATOM 4728  C CD2  . HIS A 1 71 ? 12.356 9.778   -8.958  1.00 0.00 ? 71 HIS A CD2  4  
ATOM 4729  C CE1  . HIS A 1 71 ? 11.489 11.784  -8.791  1.00 0.00 ? 71 HIS A CE1  4  
ATOM 4730  N NE2  . HIS A 1 71 ? 12.606 11.130  -9.020  1.00 0.00 ? 71 HIS A NE2  4  
ATOM 4731  H H    . HIS A 1 71 ? 10.609 9.016   -6.093  1.00 0.00 ? 71 HIS A H    4  
ATOM 4732  H HA   . HIS A 1 71 ? 9.879  6.599   -7.468  1.00 0.00 ? 71 HIS A HA   4  
ATOM 4733  H HB2  . HIS A 1 71 ? 10.180 7.919   -9.548  1.00 0.00 ? 71 HIS A HB2  4  
ATOM 4734  H HB3  . HIS A 1 71 ? 9.161  8.726   -8.372  1.00 0.00 ? 71 HIS A HB3  4  
ATOM 4735  H HD1  . HIS A 1 71 ? 9.575  11.136  -8.436  1.00 0.00 ? 71 HIS A HD1  4  
ATOM 4736  H HD2  . HIS A 1 71 ? 13.072 8.989   -9.105  1.00 0.00 ? 71 HIS A HD2  4  
ATOM 4737  H HE1  . HIS A 1 71 ? 11.372 12.854  -8.782  1.00 0.00 ? 71 HIS A HE1  4  
ATOM 4738  H HE2  . HIS A 1 71 ? 13.418 11.541  -9.431  1.00 0.00 ? 71 HIS A HE2  4  
ATOM 4739  N N    . MET A 1 72 ? 12.918 6.770   -6.968  1.00 0.00 ? 72 MET A N    4  
ATOM 4740  C CA   . MET A 1 72 ? 14.216 6.145   -7.223  1.00 0.00 ? 72 MET A CA   4  
ATOM 4741  C C    . MET A 1 72 ? 14.265 4.731   -6.628  1.00 0.00 ? 72 MET A C    4  
ATOM 4742  O O    . MET A 1 72 ? 15.220 3.989   -6.874  1.00 0.00 ? 72 MET A O    4  
ATOM 4743  C CB   . MET A 1 72 ? 15.330 6.974   -6.584  1.00 0.00 ? 72 MET A CB   4  
ATOM 4744  C CG   . MET A 1 72 ? 15.246 8.451   -6.911  1.00 0.00 ? 72 MET A CG   4  
ATOM 4745  S SD   . MET A 1 72 ? 16.615 9.391   -6.221  1.00 0.00 ? 72 MET A SD   4  
ATOM 4746  C CE   . MET A 1 72 ? 17.990 8.707   -7.157  1.00 0.00 ? 72 MET A CE   4  
ATOM 4747  H H    . MET A 1 72 ? 12.770 7.235   -6.113  1.00 0.00 ? 72 MET A H    4  
ATOM 4748  H HA   . MET A 1 72 ? 14.369 6.087   -8.279  1.00 0.00 ? 72 MET A HA   4  
ATOM 4749  H HB2  . MET A 1 72 ? 15.280 6.855   -5.514  1.00 0.00 ? 72 MET A HB2  4  
ATOM 4750  H HB3  . MET A 1 72 ? 16.280 6.602   -6.931  1.00 0.00 ? 72 MET A HB3  4  
ATOM 4751  H HG2  . MET A 1 72 ? 15.246 8.566   -7.987  1.00 0.00 ? 72 MET A HG2  4  
ATOM 4752  H HG3  . MET A 1 72 ? 14.317 8.844   -6.508  1.00 0.00 ? 72 MET A HG3  4  
ATOM 4753  H HE1  . MET A 1 72 ? 18.918 9.120   -6.781  1.00 0.00 ? 72 MET A HE1  4  
ATOM 4754  H HE2  . MET A 1 72 ? 17.867 8.964   -8.205  1.00 0.00 ? 72 MET A HE2  4  
ATOM 4755  H HE3  . MET A 1 72 ? 17.996 7.640   -7.059  1.00 0.00 ? 72 MET A HE3  4  
ATOM 4756  N N    . LEU A 1 73 ? 13.257 4.374   -5.849  1.00 0.00 ? 73 LEU A N    4  
ATOM 4757  C CA   . LEU A 1 73 ? 13.245 3.112   -5.143  1.00 0.00 ? 73 LEU A CA   4  
ATOM 4758  C C    . LEU A 1 73 ? 12.325 2.120   -5.826  1.00 0.00 ? 73 LEU A C    4  
ATOM 4759  O O    . LEU A 1 73 ? 11.228 2.468   -6.246  1.00 0.00 ? 73 LEU A O    4  
ATOM 4760  C CB   . LEU A 1 73 ? 12.825 3.285   -3.680  1.00 0.00 ? 73 LEU A CB   4  
ATOM 4761  C CG   . LEU A 1 73 ? 13.859 3.908   -2.731  1.00 0.00 ? 73 LEU A CG   4  
ATOM 4762  C CD1  . LEU A 1 73 ? 14.035 5.387   -3.010  1.00 0.00 ? 73 LEU A CD1  4  
ATOM 4763  C CD2  . LEU A 1 73 ? 13.446 3.700   -1.292  1.00 0.00 ? 73 LEU A CD2  4  
ATOM 4764  H H    . LEU A 1 73 ? 12.478 4.978   -5.758  1.00 0.00 ? 73 LEU A H    4  
ATOM 4765  H HA   . LEU A 1 73 ? 14.246 2.718   -5.161  1.00 0.00 ? 73 LEU A HA   4  
ATOM 4766  H HB2  . LEU A 1 73 ? 11.937 3.898   -3.664  1.00 0.00 ? 73 LEU A HB2  4  
ATOM 4767  H HB3  . LEU A 1 73 ? 12.560 2.304   -3.302  1.00 0.00 ? 73 LEU A HB3  4  
ATOM 4768  H HG   . LEU A 1 73 ? 14.807 3.417   -2.873  1.00 0.00 ? 73 LEU A HG   4  
ATOM 4769  H HD11 . LEU A 1 73 ? 13.106 5.906   -2.815  1.00 0.00 ? 73 LEU A HD11 4  
ATOM 4770  H HD12 . LEU A 1 73 ? 14.308 5.520   -4.051  1.00 0.00 ? 73 LEU A HD12 4  
ATOM 4771  H HD13 . LEU A 1 73 ? 14.813 5.786   -2.376  1.00 0.00 ? 73 LEU A HD13 4  
ATOM 4772  H HD21 . LEU A 1 73 ? 13.327 2.641   -1.103  1.00 0.00 ? 73 LEU A HD21 4  
ATOM 4773  H HD22 . LEU A 1 73 ? 12.501 4.207   -1.105  1.00 0.00 ? 73 LEU A HD22 4  
ATOM 4774  H HD23 . LEU A 1 73 ? 14.211 4.099   -0.633  1.00 0.00 ? 73 LEU A HD23 4  
ATOM 4775  N N    . GLU A 1 74 ? 12.789 0.886   -5.935  1.00 0.00 ? 74 GLU A N    4  
ATOM 4776  C CA   . GLU A 1 74 ? 11.973 -0.208  -6.405  1.00 0.00 ? 74 GLU A CA   4  
ATOM 4777  C C    . GLU A 1 74 ? 11.398 -0.943  -5.215  1.00 0.00 ? 74 GLU A C    4  
ATOM 4778  O O    . GLU A 1 74 ? 12.115 -1.234  -4.246  1.00 0.00 ? 74 GLU A O    4  
ATOM 4779  C CB   . GLU A 1 74 ? 12.801 -1.169  -7.250  1.00 0.00 ? 74 GLU A CB   4  
ATOM 4780  C CG   . GLU A 1 74 ? 12.015 -2.292  -7.892  1.00 0.00 ? 74 GLU A CG   4  
ATOM 4781  C CD   . GLU A 1 74 ? 12.909 -3.293  -8.602  1.00 0.00 ? 74 GLU A CD   4  
ATOM 4782  O OE1  . GLU A 1 74 ? 13.536 -4.121  -7.917  1.00 0.00 ? 74 GLU A OE1  4  
ATOM 4783  O OE2  . GLU A 1 74 ? 12.980 -3.254  -9.848  1.00 0.00 ? 74 GLU A OE2  4  
ATOM 4784  H H    . GLU A 1 74 ? 13.723 0.698   -5.679  1.00 0.00 ? 74 GLU A H    4  
ATOM 4785  H HA   . GLU A 1 74 ? 11.165 0.193   -7.000  1.00 0.00 ? 74 GLU A HA   4  
ATOM 4786  H HB2  . GLU A 1 74 ? 13.283 -0.604  -8.033  1.00 0.00 ? 74 GLU A HB2  4  
ATOM 4787  H HB3  . GLU A 1 74 ? 13.563 -1.612  -6.612  1.00 0.00 ? 74 GLU A HB3  4  
ATOM 4788  H HG2  . GLU A 1 74 ? 11.456 -2.806  -7.125  1.00 0.00 ? 74 GLU A HG2  4  
ATOM 4789  H HG3  . GLU A 1 74 ? 11.335 -1.870  -8.602  1.00 0.00 ? 74 GLU A HG3  4  
ATOM 4790  N N    . ILE A 1 75 ? 10.123 -1.257  -5.265  1.00 0.00 ? 75 ILE A N    4  
ATOM 4791  C CA   . ILE A 1 75 ? 9.455  -1.857  -4.124  1.00 0.00 ? 75 ILE A CA   4  
ATOM 4792  C C    . ILE A 1 75 ? 9.593  -3.380  -4.171  1.00 0.00 ? 75 ILE A C    4  
ATOM 4793  O O    . ILE A 1 75 ? 9.032  -4.067  -5.018  1.00 0.00 ? 75 ILE A O    4  
ATOM 4794  C CB   . ILE A 1 75 ? 7.954  -1.461  -4.032  1.00 0.00 ? 75 ILE A CB   4  
ATOM 4795  C CG1  . ILE A 1 75 ? 7.259  -2.201  -2.881  1.00 0.00 ? 75 ILE A CG1  4  
ATOM 4796  C CG2  . ILE A 1 75 ? 7.236  -1.727  -5.346  1.00 0.00 ? 75 ILE A CG2  4  
ATOM 4797  C CD1  . ILE A 1 75 ? 5.818  -1.805  -2.679  1.00 0.00 ? 75 ILE A CD1  4  
ATOM 4798  H H    . ILE A 1 75 ? 9.630  -1.122  -6.100  1.00 0.00 ? 75 ILE A H    4  
ATOM 4799  H HA   . ILE A 1 75 ? 9.950  -1.516  -3.231  1.00 0.00 ? 75 ILE A HA   4  
ATOM 4800  H HB   . ILE A 1 75 ? 7.897  -0.401  -3.842  1.00 0.00 ? 75 ILE A HB   4  
ATOM 4801  H HG12 . ILE A 1 75 ? 7.277  -3.259  -3.084  1.00 0.00 ? 75 ILE A HG12 4  
ATOM 4802  H HG13 . ILE A 1 75 ? 7.791  -2.002  -1.958  1.00 0.00 ? 75 ILE A HG13 4  
ATOM 4803  H HG21 . ILE A 1 75 ? 6.194  -1.408  -5.260  1.00 0.00 ? 75 ILE A HG21 4  
ATOM 4804  H HG22 . ILE A 1 75 ? 7.273  -2.776  -5.562  1.00 0.00 ? 75 ILE A HG22 4  
ATOM 4805  H HG23 . ILE A 1 75 ? 7.721  -1.177  -6.136  1.00 0.00 ? 75 ILE A HG23 4  
ATOM 4806  H HD11 . ILE A 1 75 ? 5.244  -2.055  -3.558  1.00 0.00 ? 75 ILE A HD11 4  
ATOM 4807  H HD12 . ILE A 1 75 ? 5.764  -0.749  -2.510  1.00 0.00 ? 75 ILE A HD12 4  
ATOM 4808  H HD13 . ILE A 1 75 ? 5.417  -2.324  -1.830  1.00 0.00 ? 75 ILE A HD13 4  
ATOM 4809  N N    . LEU A 1 76 ? 10.398 -3.909  -3.265  1.00 0.00 ? 76 LEU A N    4  
ATOM 4810  C CA   . LEU A 1 76 ? 10.564 -5.343  -3.162  1.00 0.00 ? 76 LEU A CA   4  
ATOM 4811  C C    . LEU A 1 76 ? 9.385  -5.929  -2.378  1.00 0.00 ? 76 LEU A C    4  
ATOM 4812  O O    . LEU A 1 76 ? 8.731  -6.855  -2.842  1.00 0.00 ? 76 LEU A O    4  
ATOM 4813  C CB   . LEU A 1 76 ? 11.885 -5.692  -2.471  1.00 0.00 ? 76 LEU A CB   4  
ATOM 4814  C CG   . LEU A 1 76 ? 13.149 -5.150  -3.162  1.00 0.00 ? 76 LEU A CG   4  
ATOM 4815  C CD1  . LEU A 1 76 ? 14.399 -5.570  -2.397  1.00 0.00 ? 76 LEU A CD1  4  
ATOM 4816  C CD2  . LEU A 1 76 ? 13.202 -5.627  -4.614  1.00 0.00 ? 76 LEU A CD2  4  
ATOM 4817  H H    . LEU A 1 76 ? 10.874 -3.319  -2.658  1.00 0.00 ? 76 LEU A H    4  
ATOM 4818  H HA   . LEU A 1 76 ? 10.555 -5.741  -4.166  1.00 0.00 ? 76 LEU A HA   4  
ATOM 4819  H HB2  . LEU A 1 76 ? 11.860 -5.295  -1.467  1.00 0.00 ? 76 LEU A HB2  4  
ATOM 4820  H HB3  . LEU A 1 76 ? 11.973 -6.761  -2.415  1.00 0.00 ? 76 LEU A HB3  4  
ATOM 4821  H HG   . LEU A 1 76 ? 13.112 -4.069  -3.174  1.00 0.00 ? 76 LEU A HG   4  
ATOM 4822  H HD11 . LEU A 1 76 ? 15.272 -5.134  -2.874  1.00 0.00 ? 76 LEU A HD11 4  
ATOM 4823  H HD12 . LEU A 1 76 ? 14.486 -6.646  -2.403  1.00 0.00 ? 76 LEU A HD12 4  
ATOM 4824  H HD13 . LEU A 1 76 ? 14.336 -5.219  -1.383  1.00 0.00 ? 76 LEU A HD13 4  
ATOM 4825  H HD21 . LEU A 1 76 ? 13.155 -6.703  -4.633  1.00 0.00 ? 76 LEU A HD21 4  
ATOM 4826  H HD22 . LEU A 1 76 ? 14.128 -5.308  -5.072  1.00 0.00 ? 76 LEU A HD22 4  
ATOM 4827  H HD23 . LEU A 1 76 ? 12.378 -5.217  -5.156  1.00 0.00 ? 76 LEU A HD23 4  
ATOM 4828  N N    . GLY A 1 77 ? 9.140  -5.355  -1.219  1.00 0.00 ? 77 GLY A N    4  
ATOM 4829  C CA   . GLY A 1 77 ? 8.032  -5.788  -0.401  1.00 0.00 ? 77 GLY A CA   4  
ATOM 4830  C C    . GLY A 1 77 ? 8.371  -7.015  0.408   1.00 0.00 ? 77 GLY A C    4  
ATOM 4831  O O    . GLY A 1 77 ? 9.362  -7.020  1.149   1.00 0.00 ? 77 GLY A O    4  
ATOM 4832  H H    . GLY A 1 77 ? 9.719  -4.623  -0.914  1.00 0.00 ? 77 GLY A H    4  
ATOM 4833  H HA2  . GLY A 1 77 ? 7.761  -4.999  0.273   1.00 0.00 ? 77 GLY A HA2  4  
ATOM 4834  H HA3  . GLY A 1 77 ? 7.194  -6.008  -1.046  1.00 0.00 ? 77 GLY A HA3  4  
ATOM 4835  N N    . PHE A 1 78 ? 7.557  -8.045  0.245   1.00 0.00 ? 78 PHE A N    4  
ATOM 4836  C CA   . PHE A 1 78 ? 7.765  -9.309  0.932   1.00 0.00 ? 78 PHE A CA   4  
ATOM 4837  C C    . PHE A 1 78 ? 7.405  -10.448 -0.011  1.00 0.00 ? 78 PHE A C    4  
ATOM 4838  O O    . PHE A 1 78 ? 7.182  -11.590 0.412   1.00 0.00 ? 78 PHE A O    4  
ATOM 4839  C CB   . PHE A 1 78 ? 6.890  -9.386  2.193   1.00 0.00 ? 78 PHE A CB   4  
ATOM 4840  C CG   . PHE A 1 78 ? 7.225  -8.346  3.225   1.00 0.00 ? 78 PHE A CG   4  
ATOM 4841  C CD1  . PHE A 1 78 ? 8.366  -8.439  4.000   1.00 0.00 ? 78 PHE A CD1  4  
ATOM 4842  C CD2  . PHE A 1 78 ? 6.367  -7.265  3.423   1.00 0.00 ? 78 PHE A CD2  4  
ATOM 4843  C CE1  . PHE A 1 78 ? 8.666  -7.486  4.948   1.00 0.00 ? 78 PHE A CE1  4  
ATOM 4844  C CE2  . PHE A 1 78 ? 6.664  -6.310  4.369   1.00 0.00 ? 78 PHE A CE2  4  
ATOM 4845  C CZ   . PHE A 1 78 ? 7.813  -6.409  5.135   1.00 0.00 ? 78 PHE A CZ   4  
ATOM 4846  H H    . PHE A 1 78 ? 6.781  -7.951  -0.368  1.00 0.00 ? 78 PHE A H    4  
ATOM 4847  H HA   . PHE A 1 78 ? 8.799  -9.392  1.200   1.00 0.00 ? 78 PHE A HA   4  
ATOM 4848  H HB2  . PHE A 1 78 ? 5.863  -9.249  1.907   1.00 0.00 ? 78 PHE A HB2  4  
ATOM 4849  H HB3  . PHE A 1 78 ? 7.005  -10.363 2.651   1.00 0.00 ? 78 PHE A HB3  4  
ATOM 4850  H HD1  . PHE A 1 78 ? 9.036  -9.281  3.865   1.00 0.00 ? 78 PHE A HD1  4  
ATOM 4851  H HD2  . PHE A 1 78 ? 5.474  -7.168  2.829   1.00 0.00 ? 78 PHE A HD2  4  
ATOM 4852  H HE1  . PHE A 1 78 ? 9.561  -7.560  5.538   1.00 0.00 ? 78 PHE A HE1  4  
ATOM 4853  H HE2  . PHE A 1 78 ? 5.995  -5.481  4.515   1.00 0.00 ? 78 PHE A HE2  4  
ATOM 4854  H HZ   . PHE A 1 78 ? 8.050  -5.662  5.876   1.00 0.00 ? 78 PHE A HZ   4  
ATOM 4855  N N    . GLU A 1 79 ? 7.382  -10.135 -1.308  1.00 0.00 ? 79 GLU A N    4  
ATOM 4856  C CA   . GLU A 1 79 ? 6.970  -11.096 -2.323  1.00 0.00 ? 79 GLU A CA   4  
ATOM 4857  C C    . GLU A 1 79 ? 7.987  -12.223 -2.448  1.00 0.00 ? 79 GLU A C    4  
ATOM 4858  O O    . GLU A 1 79 ? 7.689  -13.278 -3.003  1.00 0.00 ? 79 GLU A O    4  
ATOM 4859  C CB   . GLU A 1 79 ? 6.807  -10.391 -3.672  1.00 0.00 ? 79 GLU A CB   4  
ATOM 4860  C CG   . GLU A 1 79 ? 8.074  -9.720  -4.178  1.00 0.00 ? 79 GLU A CG   4  
ATOM 4861  C CD   . GLU A 1 79 ? 7.934  -9.208  -5.588  1.00 0.00 ? 79 GLU A CD   4  
ATOM 4862  O OE1  . GLU A 1 79 ? 7.942  -10.025 -6.526  1.00 0.00 ? 79 GLU A OE1  4  
ATOM 4863  O OE2  . GLU A 1 79 ? 7.825  -7.982  -5.768  1.00 0.00 ? 79 GLU A OE2  4  
ATOM 4864  H H    . GLU A 1 79 ? 7.645  -9.233  -1.593  1.00 0.00 ? 79 GLU A H    4  
ATOM 4865  H HA   . GLU A 1 79 ? 6.036  -11.509 -2.019  1.00 0.00 ? 79 GLU A HA   4  
ATOM 4866  H HB2  . GLU A 1 79 ? 6.512  -11.131 -4.394  1.00 0.00 ? 79 GLU A HB2  4  
ATOM 4867  H HB3  . GLU A 1 79 ? 6.037  -9.644  -3.589  1.00 0.00 ? 79 GLU A HB3  4  
ATOM 4868  H HG2  . GLU A 1 79 ? 8.294  -8.886  -3.514  1.00 0.00 ? 79 GLU A HG2  4  
ATOM 4869  H HG3  . GLU A 1 79 ? 8.889  -10.442 -4.141  1.00 0.00 ? 79 GLU A HG3  4  
ATOM 4870  N N    . GLU A 1 80 ? 9.195  -11.994 -1.945  1.00 0.00 ? 80 GLU A N    4  
ATOM 4871  C CA   . GLU A 1 80 ? 10.213 -13.016 -1.931  1.00 0.00 ? 80 GLU A CA   4  
ATOM 4872  C C    . GLU A 1 80 ? 9.698  -14.241 -1.205  1.00 0.00 ? 80 GLU A C    4  
ATOM 4873  O O    . GLU A 1 80 ? 9.981  -15.366 -1.589  1.00 0.00 ? 80 GLU A O    4  
ATOM 4874  C CB   . GLU A 1 80 ? 11.514 -12.529 -1.270  1.00 0.00 ? 80 GLU A CB   4  
ATOM 4875  C CG   . GLU A 1 80 ? 12.005 -11.176 -1.752  1.00 0.00 ? 80 GLU A CG   4  
ATOM 4876  C CD   . GLU A 1 80 ? 11.302 -10.020 -1.066  1.00 0.00 ? 80 GLU A CD   4  
ATOM 4877  O OE1  . GLU A 1 80 ? 11.659 -9.687  0.084   1.00 0.00 ? 80 GLU A OE1  4  
ATOM 4878  O OE2  . GLU A 1 80 ? 10.359 -9.470  -1.672  1.00 0.00 ? 80 GLU A OE2  4  
ATOM 4879  H H    . GLU A 1 80 ? 9.409  -11.093 -1.594  1.00 0.00 ? 80 GLU A H    4  
ATOM 4880  H HA   . GLU A 1 80 ? 10.424 -13.284 -2.957  1.00 0.00 ? 80 GLU A HA   4  
ATOM 4881  H HB2  . GLU A 1 80 ? 11.341 -12.458 -0.201  1.00 0.00 ? 80 GLU A HB2  4  
ATOM 4882  H HB3  . GLU A 1 80 ? 12.287 -13.259 -1.453  1.00 0.00 ? 80 GLU A HB3  4  
ATOM 4883  H HG2  . GLU A 1 80 ? 13.066 -11.105 -1.548  1.00 0.00 ? 80 GLU A HG2  4  
ATOM 4884  H HG3  . GLU A 1 80 ? 11.837 -11.113 -2.814  1.00 0.00 ? 80 GLU A HG3  4  
ATOM 4885  N N    . MET A 1 4  ? 10.341 5.044   -19.269 1.00 0.00 ? 4  MET A N    5  
ATOM 4886  C CA   . MET A 1 4  ? 10.563 6.252   -18.511 1.00 0.00 ? 4  MET A CA   5  
ATOM 4887  C C    . MET A 1 4  ? 9.810  6.209   -17.181 1.00 0.00 ? 4  MET A C    5  
ATOM 4888  O O    . MET A 1 4  ? 8.787  5.543   -17.063 1.00 0.00 ? 4  MET A O    5  
ATOM 4889  C CB   . MET A 1 4  ? 10.186 7.500   -19.304 1.00 0.00 ? 4  MET A CB   5  
ATOM 4890  C CG   . MET A 1 4  ? 8.736  7.524   -19.791 1.00 0.00 ? 4  MET A CG   5  
ATOM 4891  S SD   . MET A 1 4  ? 8.413  6.362   -21.137 1.00 0.00 ? 4  MET A SD   5  
ATOM 4892  C CE   . MET A 1 4  ? 6.694  6.703   -21.494 1.00 0.00 ? 4  MET A CE   5  
ATOM 4893  H H    . MET A 1 4  ? 9.698  5.076   -20.026 1.00 0.00 ? 4  MET A H    5  
ATOM 4894  H HA   . MET A 1 4  ? 11.609 6.282   -18.292 1.00 0.00 ? 4  MET A HA   5  
ATOM 4895  H HB2  . MET A 1 4  ? 10.327 8.369   -18.678 1.00 0.00 ? 4  MET A HB2  5  
ATOM 4896  H HB3  . MET A 1 4  ? 10.822 7.581   -20.167 1.00 0.00 ? 4  MET A HB3  5  
ATOM 4897  H HG2  . MET A 1 4  ? 8.091  7.281   -18.963 1.00 0.00 ? 4  MET A HG2  5  
ATOM 4898  H HG3  . MET A 1 4  ? 8.512  8.526   -20.134 1.00 0.00 ? 4  MET A HG3  5  
ATOM 4899  H HE1  . MET A 1 4  ? 6.361  6.073   -22.304 1.00 0.00 ? 4  MET A HE1  5  
ATOM 4900  H HE2  . MET A 1 4  ? 6.580  7.736   -21.779 1.00 0.00 ? 4  MET A HE2  5  
ATOM 4901  H HE3  . MET A 1 4  ? 6.090  6.506   -20.620 1.00 0.00 ? 4  MET A HE3  5  
ATOM 4902  N N    . ARG A 1 5  ? 10.334 6.912   -16.188 1.00 0.00 ? 5  ARG A N    5  
ATOM 4903  C CA   . ARG A 1 5  ? 9.710  7.003   -14.883 1.00 0.00 ? 5  ARG A CA   5  
ATOM 4904  C C    . ARG A 1 5  ? 8.370  7.742   -14.966 1.00 0.00 ? 5  ARG A C    5  
ATOM 4905  O O    . ARG A 1 5  ? 7.413  7.435   -14.272 1.00 0.00 ? 5  ARG A O    5  
ATOM 4906  C CB   . ARG A 1 5  ? 10.640 7.702   -13.888 1.00 0.00 ? 5  ARG A CB   5  
ATOM 4907  C CG   . ARG A 1 5  ? 10.236 7.554   -12.428 1.00 0.00 ? 5  ARG A CG   5  
ATOM 4908  C CD   . ARG A 1 5  ? 10.508 6.148   -11.918 1.00 0.00 ? 5  ARG A CD   5  
ATOM 4909  N NE   . ARG A 1 5  ? 11.943 5.883   -11.783 1.00 0.00 ? 5  ARG A NE   5  
ATOM 4910  C CZ   . ARG A 1 5  ? 12.505 4.685   -11.965 1.00 0.00 ? 5  ARG A CZ   5  
ATOM 4911  N NH1  . ARG A 1 5  ? 11.744 3.641   -12.311 1.00 0.00 ? 5  ARG A NH1  5  
ATOM 4912  N NH2  . ARG A 1 5  ? 13.807 4.527   -11.808 1.00 0.00 ? 5  ARG A NH2  5  
ATOM 4913  H H    . ARG A 1 5  ? 11.182 7.403   -16.348 1.00 0.00 ? 5  ARG A H    5  
ATOM 4914  H HA   . ARG A 1 5  ? 9.512  5.990   -14.529 1.00 0.00 ? 5  ARG A HA   5  
ATOM 4915  H HB2  . ARG A 1 5  ? 11.638 7.292   -13.990 1.00 0.00 ? 5  ARG A HB2  5  
ATOM 4916  H HB3  . ARG A 1 5  ? 10.668 8.763   -14.131 1.00 0.00 ? 5  ARG A HB3  5  
ATOM 4917  H HG2  . ARG A 1 5  ? 10.809 8.251   -11.818 1.00 0.00 ? 5  ARG A HG2  5  
ATOM 4918  H HG3  . ARG A 1 5  ? 9.181  7.766   -12.338 1.00 0.00 ? 5  ARG A HG3  5  
ATOM 4919  H HD2  . ARG A 1 5  ? 10.035 6.034   -10.942 1.00 0.00 ? 5  ARG A HD2  5  
ATOM 4920  H HD3  . ARG A 1 5  ? 10.095 5.431   -12.605 1.00 0.00 ? 5  ARG A HD3  5  
ATOM 4921  H HE   . ARG A 1 5  ? 12.520 6.651   -11.522 1.00 0.00 ? 5  ARG A HE   5  
ATOM 4922  H HH11 . ARG A 1 5  ? 10.759 3.760   -12.435 1.00 0.00 ? 5  ARG A HH11 5  
ATOM 4923  H HH12 . ARG A 1 5  ? 12.161 2.730   -12.430 1.00 0.00 ? 5  ARG A HH12 5  
ATOM 4924  H HH21 . ARG A 1 5  ? 14.394 5.315   -11.536 1.00 0.00 ? 5  ARG A HH21 5  
ATOM 4925  H HH22 . ARG A 1 5  ? 14.234 3.634   -11.968 1.00 0.00 ? 5  ARG A HH22 5  
ATOM 4926  N N    . SER A 1 6  ? 8.330  8.713   -15.897 1.00 0.00 ? 6  SER A N    5  
ATOM 4927  C CA   . SER A 1 6  ? 7.124  9.528   -16.114 1.00 0.00 ? 6  SER A CA   5  
ATOM 4928  C C    . SER A 1 6  ? 6.099  8.783   -16.965 1.00 0.00 ? 6  SER A C    5  
ATOM 4929  O O    . SER A 1 6  ? 5.151  9.382   -17.470 1.00 0.00 ? 6  SER A O    5  
ATOM 4930  C CB   . SER A 1 6  ? 7.525  10.835  -16.789 1.00 0.00 ? 6  SER A CB   5  
ATOM 4931  O OG   . SER A 1 6  ? 8.473  11.535  -16.008 1.00 0.00 ? 6  SER A OG   5  
ATOM 4932  H H    . SER A 1 6  ? 9.141  8.904   -16.418 1.00 0.00 ? 6  SER A H    5  
ATOM 4933  H HA   . SER A 1 6  ? 6.686  9.746   -15.152 1.00 0.00 ? 6  SER A HA   5  
ATOM 4934  H HB2  . SER A 1 6  ? 7.948  10.618  -17.761 1.00 0.00 ? 6  SER A HB2  5  
ATOM 4935  H HB3  . SER A 1 6  ? 6.639  11.448  -16.916 1.00 0.00 ? 6  SER A HB3  5  
ATOM 4936  H HG   . SER A 1 6  ? 9.187  10.928  -15.763 1.00 0.00 ? 6  SER A HG   5  
ATOM 4937  N N    . GLU A 1 7  ? 6.286  7.482   -17.137 1.00 0.00 ? 7  GLU A N    5  
ATOM 4938  C CA   . GLU A 1 7  ? 5.387  6.681   -17.951 1.00 0.00 ? 7  GLU A CA   5  
ATOM 4939  C C    . GLU A 1 7  ? 3.990  6.626   -17.336 1.00 0.00 ? 7  GLU A C    5  
ATOM 4940  O O    . GLU A 1 7  ? 3.001  6.419   -18.028 1.00 0.00 ? 7  GLU A O    5  
ATOM 4941  C CB   . GLU A 1 7  ? 5.929  5.253   -18.111 1.00 0.00 ? 7  GLU A CB   5  
ATOM 4942  C CG   . GLU A 1 7  ? 5.251  4.494   -19.245 1.00 0.00 ? 7  GLU A CG   5  
ATOM 4943  C CD   . GLU A 1 7  ? 5.545  3.011   -19.208 1.00 0.00 ? 7  GLU A CD   5  
ATOM 4944  O OE1  . GLU A 1 7  ? 4.806  2.274   -18.519 1.00 0.00 ? 7  GLU A OE1  5  
ATOM 4945  O OE2  . GLU A 1 7  ? 6.496  2.566   -19.884 1.00 0.00 ? 7  GLU A OE2  5  
ATOM 4946  H H    . GLU A 1 7  ? 7.068  7.039   -16.700 1.00 0.00 ? 7  GLU A H    5  
ATOM 4947  H HA   . GLU A 1 7  ? 5.321  7.139   -18.922 1.00 0.00 ? 7  GLU A HA   5  
ATOM 4948  H HB2  . GLU A 1 7  ? 6.990  5.312   -18.324 1.00 0.00 ? 7  GLU A HB2  5  
ATOM 4949  H HB3  . GLU A 1 7  ? 5.775  4.716   -17.209 1.00 0.00 ? 7  GLU A HB3  5  
ATOM 4950  H HG2  . GLU A 1 7  ? 4.184  4.642   -19.174 1.00 0.00 ? 7  GLU A HG2  5  
ATOM 4951  H HG3  . GLU A 1 7  ? 5.617  4.890   -20.179 1.00 0.00 ? 7  GLU A HG3  5  
ATOM 4952  N N    . PHE A 1 8  ? 3.920  6.801   -16.019 1.00 0.00 ? 8  PHE A N    5  
ATOM 4953  C CA   . PHE A 1 8  ? 2.663  6.742   -15.309 1.00 0.00 ? 8  PHE A CA   5  
ATOM 4954  C C    . PHE A 1 8  ? 1.915  8.071   -15.405 1.00 0.00 ? 8  PHE A C    5  
ATOM 4955  O O    . PHE A 1 8  ? 2.447  9.047   -15.932 1.00 0.00 ? 8  PHE A O    5  
ATOM 4956  C CB   . PHE A 1 8  ? 2.914  6.358   -13.848 1.00 0.00 ? 8  PHE A CB   5  
ATOM 4957  C CG   . PHE A 1 8  ? 3.444  4.957   -13.711 1.00 0.00 ? 8  PHE A CG   5  
ATOM 4958  C CD1  . PHE A 1 8  ? 4.787  4.681   -13.921 1.00 0.00 ? 8  PHE A CD1  5  
ATOM 4959  C CD2  . PHE A 1 8  ? 2.608  3.905   -13.367 1.00 0.00 ? 8  PHE A CD2  5  
ATOM 4960  C CE1  . PHE A 1 8  ? 5.284  3.401   -13.794 1.00 0.00 ? 8  PHE A CE1  5  
ATOM 4961  C CE2  . PHE A 1 8  ? 3.094  2.612   -13.244 1.00 0.00 ? 8  PHE A CE2  5  
ATOM 4962  C CZ   . PHE A 1 8  ? 4.433  2.370   -13.456 1.00 0.00 ? 8  PHE A CZ   5  
ATOM 4963  H H    . PHE A 1 8  ? 4.755  6.995   -15.524 1.00 0.00 ? 8  PHE A H    5  
ATOM 4964  H HA   . PHE A 1 8  ? 2.058  5.978   -15.778 1.00 0.00 ? 8  PHE A HA   5  
ATOM 4965  H HB2  . PHE A 1 8  ? 3.637  7.028   -13.405 1.00 0.00 ? 8  PHE A HB2  5  
ATOM 4966  H HB3  . PHE A 1 8  ? 1.991  6.422   -13.305 1.00 0.00 ? 8  PHE A HB3  5  
ATOM 4967  H HD1  . PHE A 1 8  ? 5.451  5.494   -14.190 1.00 0.00 ? 8  PHE A HD1  5  
ATOM 4968  H HD2  . PHE A 1 8  ? 1.557  4.097   -13.187 1.00 0.00 ? 8  PHE A HD2  5  
ATOM 4969  H HE1  . PHE A 1 8  ? 6.321  3.206   -13.971 1.00 0.00 ? 8  PHE A HE1  5  
ATOM 4970  H HE2  . PHE A 1 8  ? 2.421  1.809   -12.979 1.00 0.00 ? 8  PHE A HE2  5  
ATOM 4971  H HZ   . PHE A 1 8  ? 4.813  1.356   -13.353 1.00 0.00 ? 8  PHE A HZ   5  
ATOM 4972  N N    . ALA A 1 9  ? 0.708  8.114   -14.870 1.00 0.00 ? 9  ALA A N    5  
ATOM 4973  C CA   . ALA A 1 9  ? -0.223 9.232   -15.037 1.00 0.00 ? 9  ALA A CA   5  
ATOM 4974  C C    . ALA A 1 9  ? 0.425  10.597  -14.795 1.00 0.00 ? 9  ALA A C    5  
ATOM 4975  O O    . ALA A 1 9  ? 0.263  11.521  -15.589 1.00 0.00 ? 9  ALA A O    5  
ATOM 4976  C CB   . ALA A 1 9  ? -1.444 9.067   -14.138 1.00 0.00 ? 9  ALA A CB   5  
ATOM 4977  H H    . ALA A 1 9  ? 0.413  7.360   -14.302 1.00 0.00 ? 9  ALA A H    5  
ATOM 4978  H HA   . ALA A 1 9  ? -0.574 9.208   -16.053 1.00 0.00 ? 9  ALA A HA   5  
ATOM 4979  H HB1  . ALA A 1 9  ? -2.124 9.864   -14.326 1.00 0.00 ? 9  ALA A HB1  5  
ATOM 4980  H HB2  . ALA A 1 9  ? -1.128 9.083   -13.102 1.00 0.00 ? 9  ALA A HB2  5  
ATOM 4981  H HB3  . ALA A 1 9  ? -1.910 8.119   -14.360 1.00 0.00 ? 9  ALA A HB3  5  
ATOM 4982  N N    . SER A 1 10 ? 1.174  10.708  -13.708 1.00 0.00 ? 10 SER A N    5  
ATOM 4983  C CA   . SER A 1 10 ? 1.845  11.951  -13.388 1.00 0.00 ? 10 SER A CA   5  
ATOM 4984  C C    . SER A 1 10 ? 3.335  11.718  -13.133 1.00 0.00 ? 10 SER A C    5  
ATOM 4985  O O    . SER A 1 10 ? 4.042  12.567  -12.623 1.00 0.00 ? 10 SER A O    5  
ATOM 4986  C CB   . SER A 1 10 ? 1.179  12.606  -12.170 1.00 0.00 ? 10 SER A CB   5  
ATOM 4987  O OG   . SER A 1 10 ? -0.230 12.721  -12.355 1.00 0.00 ? 10 SER A OG   5  
ATOM 4988  H H    . SER A 1 10 ? 1.248  9.932   -13.101 1.00 0.00 ? 10 SER A H    5  
ATOM 4989  H HA   . SER A 1 10 ? 1.741  12.608  -14.233 1.00 0.00 ? 10 SER A HA   5  
ATOM 4990  H HB2  . SER A 1 10 ? 1.355  11.999  -11.292 1.00 0.00 ? 10 SER A HB2  5  
ATOM 4991  H HB3  . SER A 1 10 ? 1.590  13.585  -12.013 1.00 0.00 ? 10 SER A HB3  5  
ATOM 4992  H HG   . SER A 1 10 ? -0.400 13.139  -13.204 1.00 0.00 ? 10 SER A HG   5  
ATOM 4993  N N    . GLY A 1 11 ? 3.797  10.528  -13.520 1.00 0.00 ? 11 GLY A N    5  
ATOM 4994  C CA   . GLY A 1 11 ? 5.175  10.146  -13.257 1.00 0.00 ? 11 GLY A CA   5  
ATOM 4995  C C    . GLY A 1 11 ? 5.418  9.769   -11.804 1.00 0.00 ? 11 GLY A C    5  
ATOM 4996  O O    . GLY A 1 11 ? 5.721  8.614   -11.486 1.00 0.00 ? 11 GLY A O    5  
ATOM 4997  H H    . GLY A 1 11 ? 3.210  9.914   -14.005 1.00 0.00 ? 11 GLY A H    5  
ATOM 4998  H HA2  . GLY A 1 11 ? 5.411  9.305   -13.887 1.00 0.00 ? 11 GLY A HA2  5  
ATOM 4999  H HA3  . GLY A 1 11 ? 5.828  10.975  -13.510 1.00 0.00 ? 11 GLY A HA3  5  
ATOM 5000  N N    . ASN A 1 12 ? 5.257  10.765  -10.924 1.00 0.00 ? 12 ASN A N    5  
ATOM 5001  C CA   . ASN A 1 12 ? 5.385  10.571  -9.491  1.00 0.00 ? 12 ASN A CA   5  
ATOM 5002  C C    . ASN A 1 12 ? 4.426  9.491   -8.986  1.00 0.00 ? 12 ASN A C    5  
ATOM 5003  O O    . ASN A 1 12 ? 4.662  8.881   -7.941  1.00 0.00 ? 12 ASN A O    5  
ATOM 5004  C CB   . ASN A 1 12 ? 5.133  11.890  -8.740  1.00 0.00 ? 12 ASN A CB   5  
ATOM 5005  C CG   . ASN A 1 12 ? 3.701  12.399  -8.871  1.00 0.00 ? 12 ASN A CG   5  
ATOM 5006  O OD1  . ASN A 1 12 ? 3.356  13.084  -9.826  1.00 0.00 ? 12 ASN A OD1  5  
ATOM 5007  N ND2  . ASN A 1 12 ? 2.854  12.090  -7.888  1.00 0.00 ? 12 ASN A ND2  5  
ATOM 5008  H H    . ASN A 1 12 ? 5.051  11.674  -11.267 1.00 0.00 ? 12 ASN A H    5  
ATOM 5009  H HA   . ASN A 1 12 ? 6.398  10.254  -9.290  1.00 0.00 ? 12 ASN A HA   5  
ATOM 5010  H HB2  . ASN A 1 12 ? 5.341  11.733  -7.693  1.00 0.00 ? 12 ASN A HB2  5  
ATOM 5011  H HB3  . ASN A 1 12 ? 5.798  12.640  -9.116  1.00 0.00 ? 12 ASN A HB3  5  
ATOM 5012  H HD21 . ASN A 1 12 ? 3.195  11.555  -7.127  1.00 0.00 ? 12 ASN A HD21 5  
ATOM 5013  H HD22 . ASN A 1 12 ? 1.937  12.418  -7.950  1.00 0.00 ? 12 ASN A HD22 5  
ATOM 5014  N N    . THR A 1 13 ? 3.349  9.267   -9.735  1.00 0.00 ? 13 THR A N    5  
ATOM 5015  C CA   . THR A 1 13 ? 2.358  8.253   -9.389  1.00 0.00 ? 13 THR A CA   5  
ATOM 5016  C C    . THR A 1 13 ? 2.999  6.877   -9.138  1.00 0.00 ? 13 THR A C    5  
ATOM 5017  O O    . THR A 1 13 ? 2.518  6.093   -8.324  1.00 0.00 ? 13 THR A O    5  
ATOM 5018  C CB   . THR A 1 13 ? 1.335  8.145   -10.532 1.00 0.00 ? 13 THR A CB   5  
ATOM 5019  O OG1  . THR A 1 13 ? 1.127  9.434   -11.117 1.00 0.00 ? 13 THR A OG1  5  
ATOM 5020  C CG2  . THR A 1 13 ? 0.019  7.595   -10.006 1.00 0.00 ? 13 THR A CG2  5  
ATOM 5021  H H    . THR A 1 13 ? 3.197  9.802   -10.536 1.00 0.00 ? 13 THR A H    5  
ATOM 5022  H HA   . THR A 1 13 ? 1.846  8.567   -8.506  1.00 0.00 ? 13 THR A HA   5  
ATOM 5023  H HB   . THR A 1 13 ? 1.734  7.473   -11.286 1.00 0.00 ? 13 THR A HB   5  
ATOM 5024  H HG1  . THR A 1 13 ? 0.224  9.734   -10.902 1.00 0.00 ? 13 THR A HG1  5  
ATOM 5025  H HG21 . THR A 1 13 ? -0.318 8.206   -9.172  1.00 0.00 ? 13 THR A HG21 5  
ATOM 5026  H HG22 . THR A 1 13 ? 0.151  6.582   -9.683  1.00 0.00 ? 13 THR A HG22 5  
ATOM 5027  H HG23 . THR A 1 13 ? -0.715 7.631   -10.793 1.00 0.00 ? 13 THR A HG23 5  
ATOM 5028  N N    . TYR A 1 14 ? 4.109  6.598   -9.829  1.00 0.00 ? 14 TYR A N    5  
ATOM 5029  C CA   . TYR A 1 14 ? 4.851  5.367   -9.612  1.00 0.00 ? 14 TYR A CA   5  
ATOM 5030  C C    . TYR A 1 14 ? 5.432  5.354   -8.213  1.00 0.00 ? 14 TYR A C    5  
ATOM 5031  O O    . TYR A 1 14 ? 5.268  4.385   -7.455  1.00 0.00 ? 14 TYR A O    5  
ATOM 5032  C CB   . TYR A 1 14 ? 5.967  5.211   -10.652 1.00 0.00 ? 14 TYR A CB   5  
ATOM 5033  C CG   . TYR A 1 14 ? 6.826  3.985   -10.421 1.00 0.00 ? 14 TYR A CG   5  
ATOM 5034  C CD1  . TYR A 1 14 ? 6.297  2.696   -10.533 1.00 0.00 ? 14 TYR A CD1  5  
ATOM 5035  C CD2  . TYR A 1 14 ? 8.165  4.120   -10.097 1.00 0.00 ? 14 TYR A CD2  5  
ATOM 5036  C CE1  . TYR A 1 14 ? 7.084  1.585   -10.314 1.00 0.00 ? 14 TYR A CE1  5  
ATOM 5037  C CE2  . TYR A 1 14 ? 8.971  2.999   -9.888  1.00 0.00 ? 14 TYR A CE2  5  
ATOM 5038  C CZ   . TYR A 1 14 ? 8.418  1.740   -9.992  1.00 0.00 ? 14 TYR A CZ   5  
ATOM 5039  O OH   . TYR A 1 14 ? 9.219  0.632   -9.791  1.00 0.00 ? 14 TYR A OH   5  
ATOM 5040  H H    . TYR A 1 14 ? 4.408  7.212   -10.528 1.00 0.00 ? 14 TYR A H    5  
ATOM 5041  H HA   . TYR A 1 14 ? 4.161  4.555   -9.721  1.00 0.00 ? 14 TYR A HA   5  
ATOM 5042  H HB2  . TYR A 1 14 ? 5.527  5.136   -11.634 1.00 0.00 ? 14 TYR A HB2  5  
ATOM 5043  H HB3  . TYR A 1 14 ? 6.600  6.086   -10.620 1.00 0.00 ? 14 TYR A HB3  5  
ATOM 5044  H HD1  . TYR A 1 14 ? 5.245  2.591   -10.780 1.00 0.00 ? 14 TYR A HD1  5  
ATOM 5045  H HD2  . TYR A 1 14 ? 8.600  5.114   -10.004 1.00 0.00 ? 14 TYR A HD2  5  
ATOM 5046  H HE1  . TYR A 1 14 ? 6.653  0.589   -10.396 1.00 0.00 ? 14 TYR A HE1  5  
ATOM 5047  H HE2  . TYR A 1 14 ? 10.012 3.117   -9.639  1.00 0.00 ? 14 TYR A HE2  5  
ATOM 5048  H HH   . TYR A 1 14 ? 9.038  -0.025  -10.486 1.00 0.00 ? 14 TYR A HH   5  
ATOM 5049  N N    . ALA A 1 15 ? 6.106  6.440   -7.865  1.00 0.00 ? 15 ALA A N    5  
ATOM 5050  C CA   . ALA A 1 15 ? 6.659  6.649   -6.554  1.00 0.00 ? 15 ALA A CA   5  
ATOM 5051  C C    . ALA A 1 15 ? 5.559  6.623   -5.500  1.00 0.00 ? 15 ALA A C    5  
ATOM 5052  O O    . ALA A 1 15 ? 5.784  6.235   -4.348  1.00 0.00 ? 15 ALA A O    5  
ATOM 5053  C CB   . ALA A 1 15 ? 7.410  7.955   -6.508  1.00 0.00 ? 15 ALA A CB   5  
ATOM 5054  H H    . ALA A 1 15 ? 6.262  7.132   -8.538  1.00 0.00 ? 15 ALA A H    5  
ATOM 5055  H HA   . ALA A 1 15 ? 7.354  5.845   -6.347  1.00 0.00 ? 15 ALA A HA   5  
ATOM 5056  H HB1  . ALA A 1 15 ? 8.219  7.923   -7.221  1.00 0.00 ? 15 ALA A HB1  5  
ATOM 5057  H HB2  . ALA A 1 15 ? 7.809  8.120   -5.522  1.00 0.00 ? 15 ALA A HB2  5  
ATOM 5058  H HB3  . ALA A 1 15 ? 6.747  8.773   -6.766  1.00 0.00 ? 15 ALA A HB3  5  
ATOM 5059  N N    . LEU A 1 16 ? 4.374  7.061   -5.886  1.00 0.00 ? 16 LEU A N    5  
ATOM 5060  C CA   . LEU A 1 16 ? 3.223  7.033   -5.018  1.00 0.00 ? 16 LEU A CA   5  
ATOM 5061  C C    . LEU A 1 16 ? 2.767  5.598   -4.782  1.00 0.00 ? 16 LEU A C    5  
ATOM 5062  O O    . LEU A 1 16 ? 2.321  5.248   -3.699  1.00 0.00 ? 16 LEU A O    5  
ATOM 5063  C CB   . LEU A 1 16 ? 2.091  7.857   -5.620  1.00 0.00 ? 16 LEU A CB   5  
ATOM 5064  C CG   . LEU A 1 16 ? 0.827  7.945   -4.770  1.00 0.00 ? 16 LEU A CG   5  
ATOM 5065  C CD1  . LEU A 1 16 ? 1.127  8.555   -3.407  1.00 0.00 ? 16 LEU A CD1  5  
ATOM 5066  C CD2  . LEU A 1 16 ? -0.232 8.762   -5.500  1.00 0.00 ? 16 LEU A CD2  5  
ATOM 5067  H H    . LEU A 1 16 ? 4.266  7.406   -6.801  1.00 0.00 ? 16 LEU A H    5  
ATOM 5068  H HA   . LEU A 1 16 ? 3.509  7.469   -4.082  1.00 0.00 ? 16 LEU A HA   5  
ATOM 5069  H HB2  . LEU A 1 16 ? 2.458  8.858   -5.808  1.00 0.00 ? 16 LEU A HB2  5  
ATOM 5070  H HB3  . LEU A 1 16 ? 1.824  7.425   -6.571  1.00 0.00 ? 16 LEU A HB3  5  
ATOM 5071  H HG   . LEU A 1 16 ? 0.437  6.952   -4.608  1.00 0.00 ? 16 LEU A HG   5  
ATOM 5072  H HD11 . LEU A 1 16 ? 0.211  8.632   -2.835  1.00 0.00 ? 16 LEU A HD11 5  
ATOM 5073  H HD12 . LEU A 1 16 ? 1.560  9.537   -3.547  1.00 0.00 ? 16 LEU A HD12 5  
ATOM 5074  H HD13 . LEU A 1 16 ? 1.832  7.930   -2.889  1.00 0.00 ? 16 LEU A HD13 5  
ATOM 5075  H HD21 . LEU A 1 16 ? -1.125 8.786   -4.901  1.00 0.00 ? 16 LEU A HD21 5  
ATOM 5076  H HD22 . LEU A 1 16 ? -0.458 8.308   -6.462  1.00 0.00 ? 16 LEU A HD22 5  
ATOM 5077  H HD23 . LEU A 1 16 ? 0.120  9.776   -5.665  1.00 0.00 ? 16 LEU A HD23 5  
ATOM 5078  N N    . TYR A 1 17 ? 2.884  4.763   -5.822  1.00 0.00 ? 17 TYR A N    5  
ATOM 5079  C CA   . TYR A 1 17 ? 2.464  3.372   -5.729  1.00 0.00 ? 17 TYR A CA   5  
ATOM 5080  C C    . TYR A 1 17 ? 3.332  2.609   -4.745  1.00 0.00 ? 17 TYR A C    5  
ATOM 5081  O O    . TYR A 1 17 ? 2.825  1.913   -3.868  1.00 0.00 ? 17 TYR A O    5  
ATOM 5082  C CB   . TYR A 1 17 ? 2.514  2.702   -7.106  1.00 0.00 ? 17 TYR A CB   5  
ATOM 5083  C CG   . TYR A 1 17 ? 1.900  1.323   -7.120  1.00 0.00 ? 17 TYR A CG   5  
ATOM 5084  C CD1  . TYR A 1 17 ? 0.517  1.157   -7.212  1.00 0.00 ? 17 TYR A CD1  5  
ATOM 5085  C CD2  . TYR A 1 17 ? 2.682  0.172   -7.024  1.00 0.00 ? 17 TYR A CD2  5  
ATOM 5086  C CE1  . TYR A 1 17 ? -0.064 -0.099  -7.221  1.00 0.00 ? 17 TYR A CE1  5  
ATOM 5087  C CE2  . TYR A 1 17 ? 2.109  -1.093  -7.031  1.00 0.00 ? 17 TYR A CE2  5  
ATOM 5088  C CZ   . TYR A 1 17 ? 0.737  -1.218  -7.137  1.00 0.00 ? 17 TYR A CZ   5  
ATOM 5089  O OH   . TYR A 1 17 ? 0.159  -2.486  -7.142  1.00 0.00 ? 17 TYR A OH   5  
ATOM 5090  H H    . TYR A 1 17 ? 3.250  5.096   -6.654  1.00 0.00 ? 17 TYR A H    5  
ATOM 5091  H HA   . TYR A 1 17 ? 1.443  3.375   -5.376  1.00 0.00 ? 17 TYR A HA   5  
ATOM 5092  H HB2  . TYR A 1 17 ? 1.980  3.323   -7.820  1.00 0.00 ? 17 TYR A HB2  5  
ATOM 5093  H HB3  . TYR A 1 17 ? 3.547  2.613   -7.407  1.00 0.00 ? 17 TYR A HB3  5  
ATOM 5094  H HD1  . TYR A 1 17 ? -0.100 2.039   -7.279  1.00 0.00 ? 17 TYR A HD1  5  
ATOM 5095  H HD2  . TYR A 1 17 ? 3.755  0.279   -6.950  1.00 0.00 ? 17 TYR A HD2  5  
ATOM 5096  H HE1  . TYR A 1 17 ? -1.126 -0.194  -7.305  1.00 0.00 ? 17 TYR A HE1  5  
ATOM 5097  H HE2  . TYR A 1 17 ? 2.742  -1.963  -6.966  1.00 0.00 ? 17 TYR A HE2  5  
ATOM 5098  H HH   . TYR A 1 17 ? 0.547  -3.023  -6.428  1.00 0.00 ? 17 TYR A HH   5  
ATOM 5099  N N    . VAL A 1 18 ? 4.644  2.747   -4.885  1.00 0.00 ? 18 VAL A N    5  
ATOM 5100  C CA   . VAL A 1 18 ? 5.559  2.094   -3.965  1.00 0.00 ? 18 VAL A CA   5  
ATOM 5101  C C    . VAL A 1 18 ? 5.364  2.632   -2.547  1.00 0.00 ? 18 VAL A C    5  
ATOM 5102  O O    . VAL A 1 18 ? 5.300  1.861   -1.594  1.00 0.00 ? 18 VAL A O    5  
ATOM 5103  C CB   . VAL A 1 18 ? 7.045  2.232   -4.408  1.00 0.00 ? 18 VAL A CB   5  
ATOM 5104  C CG1  . VAL A 1 18 ? 7.226  1.694   -5.810  1.00 0.00 ? 18 VAL A CG1  5  
ATOM 5105  C CG2  . VAL A 1 18 ? 7.547  3.665   -4.320  1.00 0.00 ? 18 VAL A CG2  5  
ATOM 5106  H H    . VAL A 1 18 ? 4.990  3.285   -5.626  1.00 0.00 ? 18 VAL A H    5  
ATOM 5107  H HA   . VAL A 1 18 ? 5.310  1.046   -3.964  1.00 0.00 ? 18 VAL A HA   5  
ATOM 5108  H HB   . VAL A 1 18 ? 7.650  1.627   -3.734  1.00 0.00 ? 18 VAL A HB   5  
ATOM 5109  H HG11 . VAL A 1 18 ? 6.915  0.658   -5.848  1.00 0.00 ? 18 VAL A HG11 5  
ATOM 5110  H HG12 . VAL A 1 18 ? 8.270  1.739   -6.080  1.00 0.00 ? 18 VAL A HG12 5  
ATOM 5111  H HG13 . VAL A 1 18 ? 6.644  2.275   -6.516  1.00 0.00 ? 18 VAL A HG13 5  
ATOM 5112  H HG21 . VAL A 1 18 ? 7.430  4.040   -3.311  1.00 0.00 ? 18 VAL A HG21 5  
ATOM 5113  H HG22 . VAL A 1 18 ? 6.944  4.283   -4.984  1.00 0.00 ? 18 VAL A HG22 5  
ATOM 5114  H HG23 . VAL A 1 18 ? 8.583  3.717   -4.610  1.00 0.00 ? 18 VAL A HG23 5  
ATOM 5115  N N    . ARG A 1 19 ? 5.210  3.950   -2.426  1.00 0.00 ? 19 ARG A N    5  
ATOM 5116  C CA   . ARG A 1 19 ? 4.954  4.595   -1.140  1.00 0.00 ? 19 ARG A CA   5  
ATOM 5117  C C    . ARG A 1 19 ? 3.687  4.039   -0.490  1.00 0.00 ? 19 ARG A C    5  
ATOM 5118  O O    . ARG A 1 19 ? 3.648  3.764   0.716   1.00 0.00 ? 19 ARG A O    5  
ATOM 5119  C CB   . ARG A 1 19 ? 4.798  6.104   -1.348  1.00 0.00 ? 19 ARG A CB   5  
ATOM 5120  C CG   . ARG A 1 19 ? 4.187  6.855   -0.186  1.00 0.00 ? 19 ARG A CG   5  
ATOM 5121  C CD   . ARG A 1 19 ? 3.936  8.311   -0.540  1.00 0.00 ? 19 ARG A CD   5  
ATOM 5122  N NE   . ARG A 1 19 ? 2.895  8.909   0.307   1.00 0.00 ? 19 ARG A NE   5  
ATOM 5123  C CZ   . ARG A 1 19 ? 2.333  10.079  0.045   1.00 0.00 ? 19 ARG A CZ   5  
ATOM 5124  N NH1  . ARG A 1 19 ? 2.725  10.802  -0.986  1.00 0.00 ? 19 ARG A NH1  5  
ATOM 5125  N NH2  . ARG A 1 19 ? 1.357  10.542  0.836   1.00 0.00 ? 19 ARG A NH2  5  
ATOM 5126  H H    . ARG A 1 19 ? 5.264  4.510   -3.232  1.00 0.00 ? 19 ARG A H    5  
ATOM 5127  H HA   . ARG A 1 19 ? 5.796  4.403   -0.503  1.00 0.00 ? 19 ARG A HA   5  
ATOM 5128  H HB2  . ARG A 1 19 ? 5.788  6.522   -1.529  1.00 0.00 ? 19 ARG A HB2  5  
ATOM 5129  H HB3  . ARG A 1 19 ? 4.189  6.283   -2.231  1.00 0.00 ? 19 ARG A HB3  5  
ATOM 5130  H HG2  . ARG A 1 19 ? 3.240  6.395   0.072   1.00 0.00 ? 19 ARG A HG2  5  
ATOM 5131  H HG3  . ARG A 1 19 ? 4.860  6.804   0.659   1.00 0.00 ? 19 ARG A HG3  5  
ATOM 5132  H HD2  . ARG A 1 19 ? 4.860  8.861   -0.412  1.00 0.00 ? 19 ARG A HD2  5  
ATOM 5133  H HD3  . ARG A 1 19 ? 3.616  8.367   -1.565  1.00 0.00 ? 19 ARG A HD3  5  
ATOM 5134  H HE   . ARG A 1 19 ? 2.600  8.370   1.097   1.00 0.00 ? 19 ARG A HE   5  
ATOM 5135  H HH11 . ARG A 1 19 ? 3.469  10.475  -1.600  1.00 0.00 ? 19 ARG A HH11 5  
ATOM 5136  H HH12 . ARG A 1 19 ? 2.281  11.683  -1.169  1.00 0.00 ? 19 ARG A HH12 5  
ATOM 5137  H HH21 . ARG A 1 19 ? 1.043  9.997   1.629   1.00 0.00 ? 19 ARG A HH21 5  
ATOM 5138  H HH22 . ARG A 1 19 ? 0.930  11.436  0.636   1.00 0.00 ? 19 ARG A HH22 5  
ATOM 5139  N N    . ASP A 1 20 ? 2.660  3.839   -1.311  1.00 0.00 ? 20 ASP A N    5  
ATOM 5140  C CA   . ASP A 1 20 ? 1.353  3.378   -0.858  1.00 0.00 ? 20 ASP A CA   5  
ATOM 5141  C C    . ASP A 1 20 ? 1.460  2.056   -0.111  1.00 0.00 ? 20 ASP A C    5  
ATOM 5142  O O    . ASP A 1 20 ? 0.724  1.807   0.838   1.00 0.00 ? 20 ASP A O    5  
ATOM 5143  C CB   . ASP A 1 20 ? 0.420  3.221   -2.067  1.00 0.00 ? 20 ASP A CB   5  
ATOM 5144  C CG   . ASP A 1 20 ? -0.985 2.766   -1.682  1.00 0.00 ? 20 ASP A CG   5  
ATOM 5145  O OD1  . ASP A 1 20 ? -1.829 3.637   -1.354  1.00 0.00 ? 20 ASP A OD1  5  
ATOM 5146  O OD2  . ASP A 1 20 ? -1.260 1.549   -1.744  1.00 0.00 ? 20 ASP A OD2  5  
ATOM 5147  H H    . ASP A 1 20 ? 2.786  4.021   -2.272  1.00 0.00 ? 20 ASP A H    5  
ATOM 5148  H HA   . ASP A 1 20 ? 0.942  4.116   -0.194  1.00 0.00 ? 20 ASP A HA   5  
ATOM 5149  H HB2  . ASP A 1 20 ? 0.338  4.178   -2.571  1.00 0.00 ? 20 ASP A HB2  5  
ATOM 5150  H HB3  . ASP A 1 20 ? 0.836  2.483   -2.739  1.00 0.00 ? 20 ASP A HB3  5  
ATOM 5151  N N    . THR A 1 21 ? 2.384  1.210   -0.541  1.00 0.00 ? 21 THR A N    5  
ATOM 5152  C CA   . THR A 1 21 ? 2.493  -0.134  0.032   1.00 0.00 ? 21 THR A CA   5  
ATOM 5153  C C    . THR A 1 21 ? 3.755  -0.287  0.892   1.00 0.00 ? 21 THR A C    5  
ATOM 5154  O O    . THR A 1 21 ? 3.978  -1.344  1.498   1.00 0.00 ? 21 THR A O    5  
ATOM 5155  C CB   . THR A 1 21 ? 2.471  -1.199  -1.077  1.00 0.00 ? 21 THR A CB   5  
ATOM 5156  O OG1  . THR A 1 21 ? 1.498  -0.826  -2.074  1.00 0.00 ? 21 THR A OG1  5  
ATOM 5157  C CG2  . THR A 1 21 ? 2.087  -2.560  -0.519  1.00 0.00 ? 21 THR A CG2  5  
ATOM 5158  H H    . THR A 1 21 ? 3.017  1.479   -1.246  1.00 0.00 ? 21 THR A H    5  
ATOM 5159  H HA   . THR A 1 21 ? 1.620  -0.281  0.673   1.00 0.00 ? 21 THR A HA   5  
ATOM 5160  H HB   . THR A 1 21 ? 3.451  -1.263  -1.531  1.00 0.00 ? 21 THR A HB   5  
ATOM 5161  H HG1  . THR A 1 21 ? 1.149  0.055   -1.872  1.00 0.00 ? 21 THR A HG1  5  
ATOM 5162  H HG21 . THR A 1 21 ? 1.084  -2.515  -0.109  1.00 0.00 ? 21 THR A HG21 5  
ATOM 5163  H HG22 . THR A 1 21 ? 2.774  -2.832  0.260   1.00 0.00 ? 21 THR A HG22 5  
ATOM 5164  H HG23 . THR A 1 21 ? 2.131  -3.286  -1.311  1.00 0.00 ? 21 THR A HG23 5  
ATOM 5165  N N    . LEU A 1 22 ? 4.590  0.753   0.960   1.00 0.00 ? 22 LEU A N    5  
ATOM 5166  C CA   . LEU A 1 22 ? 5.780  0.691   1.805   1.00 0.00 ? 22 LEU A CA   5  
ATOM 5167  C C    . LEU A 1 22 ? 5.385  0.996   3.248   1.00 0.00 ? 22 LEU A C    5  
ATOM 5168  O O    . LEU A 1 22 ? 5.212  2.156   3.633   1.00 0.00 ? 22 LEU A O    5  
ATOM 5169  C CB   . LEU A 1 22 ? 6.878  1.647   1.327   1.00 0.00 ? 22 LEU A CB   5  
ATOM 5170  C CG   . LEU A 1 22 ? 7.611  1.201   0.068   1.00 0.00 ? 22 LEU A CG   5  
ATOM 5171  C CD1  . LEU A 1 22 ? 8.814  2.089   -0.187  1.00 0.00 ? 22 LEU A CD1  5  
ATOM 5172  C CD2  . LEU A 1 22 ? 8.060  -0.252  0.191   1.00 0.00 ? 22 LEU A CD2  5  
ATOM 5173  H H    . LEU A 1 22 ? 4.406  1.564   0.450   1.00 0.00 ? 22 LEU A H    5  
ATOM 5174  H HA   . LEU A 1 22 ? 6.152  -0.311  1.779   1.00 0.00 ? 22 LEU A HA   5  
ATOM 5175  H HB2  . LEU A 1 22 ? 6.411  2.602   1.112   1.00 0.00 ? 22 LEU A HB2  5  
ATOM 5176  H HB3  . LEU A 1 22 ? 7.597  1.776   2.124   1.00 0.00 ? 22 LEU A HB3  5  
ATOM 5177  H HG   . LEU A 1 22 ? 6.952  1.275   -0.788  1.00 0.00 ? 22 LEU A HG   5  
ATOM 5178  H HD11 . LEU A 1 22 ? 9.293  1.792   -1.107  1.00 0.00 ? 22 LEU A HD11 5  
ATOM 5179  H HD12 . LEU A 1 22 ? 9.515  1.973   0.622   1.00 0.00 ? 22 LEU A HD12 5  
ATOM 5180  H HD13 . LEU A 1 22 ? 8.499  3.120   -0.256  1.00 0.00 ? 22 LEU A HD13 5  
ATOM 5181  H HD21 . LEU A 1 22 ? 7.186  -0.889  0.307   1.00 0.00 ? 22 LEU A HD21 5  
ATOM 5182  H HD22 . LEU A 1 22 ? 8.703  -0.359  1.051   1.00 0.00 ? 22 LEU A HD22 5  
ATOM 5183  H HD23 . LEU A 1 22 ? 8.592  -0.537  -0.702  1.00 0.00 ? 22 LEU A HD23 5  
ATOM 5184  N N    . GLN A 1 23 ? 5.247  -0.054  4.017   1.00 0.00 ? 23 GLN A N    5  
ATOM 5185  C CA   . GLN A 1 23 ? 4.989  0.044   5.443   1.00 0.00 ? 23 GLN A CA   5  
ATOM 5186  C C    . GLN A 1 23 ? 6.302  0.029   6.215   1.00 0.00 ? 23 GLN A C    5  
ATOM 5187  O O    . GLN A 1 23 ? 7.331  -0.376  5.688   1.00 0.00 ? 23 GLN A O    5  
ATOM 5188  C CB   . GLN A 1 23 ? 4.108  -1.112  5.892   1.00 0.00 ? 23 GLN A CB   5  
ATOM 5189  C CG   . GLN A 1 23 ? 2.720  -1.114  5.279   1.00 0.00 ? 23 GLN A CG   5  
ATOM 5190  C CD   . GLN A 1 23 ? 1.958  -2.390  5.564   1.00 0.00 ? 23 GLN A CD   5  
ATOM 5191  O OE1  . GLN A 1 23 ? 1.094  -2.796  4.786   1.00 0.00 ? 23 GLN A OE1  5  
ATOM 5192  N NE2  . GLN A 1 23 ? 2.273  -3.029  6.679   1.00 0.00 ? 23 GLN A NE2  5  
ATOM 5193  H H    . GLN A 1 23 ? 5.323  -0.945  3.619   1.00 0.00 ? 23 GLN A H    5  
ATOM 5194  H HA   . GLN A 1 23 ? 4.468  0.980   5.628   1.00 0.00 ? 23 GLN A HA   5  
ATOM 5195  H HB2  . GLN A 1 23 ? 4.592  -2.045  5.618   1.00 0.00 ? 23 GLN A HB2  5  
ATOM 5196  H HB3  . GLN A 1 23 ? 4.003  -1.078  6.973   1.00 0.00 ? 23 GLN A HB3  5  
ATOM 5197  H HG2  . GLN A 1 23 ? 2.165  -0.287  5.692   1.00 0.00 ? 23 GLN A HG2  5  
ATOM 5198  H HG3  . GLN A 1 23 ? 2.822  -0.980  4.213   1.00 0.00 ? 23 GLN A HG3  5  
ATOM 5199  H HE21 . GLN A 1 23 ? 2.979  -2.654  7.259   1.00 0.00 ? 23 GLN A HE21 5  
ATOM 5200  H HE22 . GLN A 1 23 ? 1.786  -3.871  6.882   1.00 0.00 ? 23 GLN A HE22 5  
ATOM 5201  N N    . PRO A 1 24 ? 6.293  0.482   7.475   1.00 0.00 ? 24 PRO A N    5  
ATOM 5202  C CA   . PRO A 1 24 ? 7.474  0.390   8.347   1.00 0.00 ? 24 PRO A CA   5  
ATOM 5203  C C    . PRO A 1 24 ? 8.017  -1.035  8.417   1.00 0.00 ? 24 PRO A C    5  
ATOM 5204  O O    . PRO A 1 24 ? 7.369  -1.934  8.956   1.00 0.00 ? 24 PRO A O    5  
ATOM 5205  C CB   . PRO A 1 24 ? 6.946  0.853   9.720   1.00 0.00 ? 24 PRO A CB   5  
ATOM 5206  C CG   . PRO A 1 24 ? 5.761  1.689   9.404   1.00 0.00 ? 24 PRO A CG   5  
ATOM 5207  C CD   . PRO A 1 24 ? 5.152  1.115   8.155   1.00 0.00 ? 24 PRO A CD   5  
ATOM 5208  H HA   . PRO A 1 24 ? 8.252  1.060   8.015   1.00 0.00 ? 24 PRO A HA   5  
ATOM 5209  H HB2  . PRO A 1 24 ? 6.680  -0.015  10.305  1.00 0.00 ? 24 PRO A HB2  5  
ATOM 5210  H HB3  . PRO A 1 24 ? 7.717  1.420   10.232  1.00 0.00 ? 24 PRO A HB3  5  
ATOM 5211  H HG2  . PRO A 1 24 ? 5.055  1.641   10.220  1.00 0.00 ? 24 PRO A HG2  5  
ATOM 5212  H HG3  . PRO A 1 24 ? 6.065  2.710   9.242   1.00 0.00 ? 24 PRO A HG3  5  
ATOM 5213  H HD2  . PRO A 1 24 ? 4.401  0.391   8.407   1.00 0.00 ? 24 PRO A HD2  5  
ATOM 5214  H HD3  . PRO A 1 24 ? 4.732  1.899   7.545   1.00 0.00 ? 24 PRO A HD3  5  
ATOM 5215  N N    . GLY A 1 25 ? 9.184  -1.246  7.833   1.00 0.00 ? 25 GLY A N    5  
ATOM 5216  C CA   . GLY A 1 25 ? 9.754  -2.573  7.783   1.00 0.00 ? 25 GLY A CA   5  
ATOM 5217  C C    . GLY A 1 25 ? 9.803  -3.136  6.383   1.00 0.00 ? 25 GLY A C    5  
ATOM 5218  O O    . GLY A 1 25 ? 10.387 -4.202  6.154   1.00 0.00 ? 25 GLY A O    5  
ATOM 5219  H H    . GLY A 1 25 ? 9.659  -0.496  7.424   1.00 0.00 ? 25 GLY A H    5  
ATOM 5220  H HA2  . GLY A 1 25 ? 10.760 -2.537  8.180   1.00 0.00 ? 25 GLY A HA2  5  
ATOM 5221  H HA3  . GLY A 1 25 ? 9.156  -3.228  8.403   1.00 0.00 ? 25 GLY A HA3  5  
ATOM 5222  N N    . MET A 1 26 ? 9.175  -2.445  5.426   1.00 0.00 ? 26 MET A N    5  
ATOM 5223  C CA   . MET A 1 26 ? 9.186  -2.884  4.043   1.00 0.00 ? 26 MET A CA   5  
ATOM 5224  C C    . MET A 1 26 ? 10.567 -2.645  3.426   1.00 0.00 ? 26 MET A C    5  
ATOM 5225  O O    . MET A 1 26 ? 11.180 -1.596  3.622   1.00 0.00 ? 26 MET A O    5  
ATOM 5226  C CB   . MET A 1 26 ? 8.127  -2.160  3.228   1.00 0.00 ? 26 MET A CB   5  
ATOM 5227  C CG   . MET A 1 26 ? 7.309  -3.066  2.331   1.00 0.00 ? 26 MET A CG   5  
ATOM 5228  S SD   . MET A 1 26 ? 6.354  -4.277  3.271   1.00 0.00 ? 26 MET A SD   5  
ATOM 5229  C CE   . MET A 1 26 ? 5.181  -4.808  2.036   1.00 0.00 ? 26 MET A CE   5  
ATOM 5230  H H    . MET A 1 26 ? 8.697  -1.616  5.670   1.00 0.00 ? 26 MET A H    5  
ATOM 5231  H HA   . MET A 1 26 ? 8.987  -3.949  4.018   1.00 0.00 ? 26 MET A HA   5  
ATOM 5232  H HB2  . MET A 1 26 ? 7.451  -1.671  3.893   1.00 0.00 ? 26 MET A HB2  5  
ATOM 5233  H HB3  . MET A 1 26 ? 8.609  -1.426  2.602   1.00 0.00 ? 26 MET A HB3  5  
ATOM 5234  H HG2  . MET A 1 26 ? 6.636  -2.458  1.752   1.00 0.00 ? 26 MET A HG2  5  
ATOM 5235  H HG3  . MET A 1 26 ? 7.974  -3.589  1.667   1.00 0.00 ? 26 MET A HG3  5  
ATOM 5236  H HE1  . MET A 1 26 ? 4.554  -3.978  1.752   1.00 0.00 ? 26 MET A HE1  5  
ATOM 5237  H HE2  . MET A 1 26 ? 4.562  -5.596  2.453   1.00 0.00 ? 26 MET A HE2  5  
ATOM 5238  H HE3  . MET A 1 26 ? 5.702  -5.178  1.171   1.00 0.00 ? 26 MET A HE3  5  
ATOM 5239  N N    . ARG A 1 27 ? 11.041 -3.629  2.695   1.00 0.00 ? 27 ARG A N    5  
ATOM 5240  C CA   . ARG A 1 27 ? 12.353 -3.540  2.073   1.00 0.00 ? 27 ARG A CA   5  
ATOM 5241  C C    . ARG A 1 27 ? 12.263 -2.776  0.755   1.00 0.00 ? 27 ARG A C    5  
ATOM 5242  O O    . ARG A 1 27 ? 11.212 -2.741  0.120   1.00 0.00 ? 27 ARG A O    5  
ATOM 5243  C CB   . ARG A 1 27 ? 12.905 -4.942  1.837   1.00 0.00 ? 27 ARG A CB   5  
ATOM 5244  C CG   . ARG A 1 27 ? 14.415 -4.978  1.692   1.00 0.00 ? 27 ARG A CG   5  
ATOM 5245  C CD   . ARG A 1 27 ? 14.892 -6.414  1.605   1.00 0.00 ? 27 ARG A CD   5  
ATOM 5246  N NE   . ARG A 1 27 ? 16.349 -6.511  1.637   1.00 0.00 ? 27 ARG A NE   5  
ATOM 5247  C CZ   . ARG A 1 27 ? 17.011 -7.564  1.174   1.00 0.00 ? 27 ARG A CZ   5  
ATOM 5248  N NH1  . ARG A 1 27 ? 16.370 -8.579  0.588   1.00 0.00 ? 27 ARG A NH1  5  
ATOM 5249  N NH2  . ARG A 1 27 ? 18.331 -7.624  1.339   1.00 0.00 ? 27 ARG A NH2  5  
ATOM 5250  H H    . ARG A 1 27 ? 10.519 -4.443  2.608   1.00 0.00 ? 27 ARG A H    5  
ATOM 5251  H HA   . ARG A 1 27 ? 13.001 -3.012  2.749   1.00 0.00 ? 27 ARG A HA   5  
ATOM 5252  H HB2  . ARG A 1 27 ? 12.630 -5.576  2.666   1.00 0.00 ? 27 ARG A HB2  5  
ATOM 5253  H HB3  . ARG A 1 27 ? 12.478 -5.348  0.929   1.00 0.00 ? 27 ARG A HB3  5  
ATOM 5254  H HG2  . ARG A 1 27 ? 14.699 -4.447  0.803   1.00 0.00 ? 27 ARG A HG2  5  
ATOM 5255  H HG3  . ARG A 1 27 ? 14.867 -4.524  2.566   1.00 0.00 ? 27 ARG A HG3  5  
ATOM 5256  H HD2  . ARG A 1 27 ? 14.484 -6.961  2.438   1.00 0.00 ? 27 ARG A HD2  5  
ATOM 5257  H HD3  . ARG A 1 27 ? 14.520 -6.836  0.680   1.00 0.00 ? 27 ARG A HD3  5  
ATOM 5258  H HE   . ARG A 1 27 ? 16.851 -5.774  2.032   1.00 0.00 ? 27 ARG A HE   5  
ATOM 5259  H HH11 . ARG A 1 27 ? 15.378 -8.534  0.464   1.00 0.00 ? 27 ARG A HH11 5  
ATOM 5260  H HH12 . ARG A 1 27 ? 16.877 -9.370  0.231   1.00 0.00 ? 27 ARG A HH12 5  
ATOM 5261  H HH21 . ARG A 1 27 ? 18.814 -6.856  1.778   1.00 0.00 ? 27 ARG A HH21 5  
ATOM 5262  H HH22 . ARG A 1 27 ? 18.832 -8.421  1.013   1.00 0.00 ? 27 ARG A HH22 5  
ATOM 5263  N N    . VAL A 1 28 ? 13.354 -2.114  0.381   1.00 0.00 ? 28 VAL A N    5  
ATOM 5264  C CA   . VAL A 1 28 ? 13.379 -1.302  -0.826  1.00 0.00 ? 28 VAL A CA   5  
ATOM 5265  C C    . VAL A 1 28 ? 14.686 -1.503  -1.597  1.00 0.00 ? 28 VAL A C    5  
ATOM 5266  O O    . VAL A 1 28 ? 15.693 -1.943  -1.055  1.00 0.00 ? 28 VAL A O    5  
ATOM 5267  C CB   . VAL A 1 28 ? 13.239 0.215   -0.502  1.00 0.00 ? 28 VAL A CB   5  
ATOM 5268  C CG1  . VAL A 1 28 ? 11.913 0.498   0.183   1.00 0.00 ? 28 VAL A CG1  5  
ATOM 5269  C CG2  . VAL A 1 28 ? 14.405 0.681   0.345   1.00 0.00 ? 28 VAL A CG2  5  
ATOM 5270  H H    . VAL A 1 28 ? 14.167 -2.181  0.931   1.00 0.00 ? 28 VAL A H    5  
ATOM 5271  H HA   . VAL A 1 28 ? 12.554 -1.596  -1.452  1.00 0.00 ? 28 VAL A HA   5  
ATOM 5272  H HB   . VAL A 1 28 ? 13.263 0.757   -1.446  1.00 0.00 ? 28 VAL A HB   5  
ATOM 5273  H HG11 . VAL A 1 28 ? 11.838 1.555   0.387   1.00 0.00 ? 28 VAL A HG11 5  
ATOM 5274  H HG12 . VAL A 1 28 ? 11.868 -0.049  1.117   1.00 0.00 ? 28 VAL A HG12 5  
ATOM 5275  H HG13 . VAL A 1 28 ? 11.096 0.189   -0.456  1.00 0.00 ? 28 VAL A HG13 5  
ATOM 5276  H HG21 . VAL A 1 28 ? 14.389 0.174   1.302   1.00 0.00 ? 28 VAL A HG21 5  
ATOM 5277  H HG22 . VAL A 1 28 ? 14.340 1.754   0.507   1.00 0.00 ? 28 VAL A HG22 5  
ATOM 5278  H HG23 . VAL A 1 28 ? 15.341 0.451   -0.161  1.00 0.00 ? 28 VAL A HG23 5  
ATOM 5279  N N    . ARG A 1 29 ? 14.645 -1.207  -2.890  1.00 0.00 ? 29 ARG A N    5  
ATOM 5280  C CA   . ARG A 1 29 ? 15.842 -1.242  -3.722  1.00 0.00 ? 29 ARG A CA   5  
ATOM 5281  C C    . ARG A 1 29 ? 16.011 0.057   -4.498  1.00 0.00 ? 29 ARG A C    5  
ATOM 5282  O O    . ARG A 1 29 ? 15.030 0.670   -4.912  1.00 0.00 ? 29 ARG A O    5  
ATOM 5283  C CB   . ARG A 1 29 ? 15.785 -2.452  -4.669  1.00 0.00 ? 29 ARG A CB   5  
ATOM 5284  C CG   . ARG A 1 29 ? 17.009 -2.620  -5.540  1.00 0.00 ? 29 ARG A CG   5  
ATOM 5285  C CD   . ARG A 1 29 ? 17.084 -4.032  -6.092  1.00 0.00 ? 29 ARG A CD   5  
ATOM 5286  N NE   . ARG A 1 29 ? 15.868 -4.417  -6.789  1.00 0.00 ? 29 ARG A NE   5  
ATOM 5287  C CZ   . ARG A 1 29 ? 15.566 -5.680  -7.138  1.00 0.00 ? 29 ARG A CZ   5  
ATOM 5288  N NH1  . ARG A 1 29 ? 16.423 -6.653  -6.914  1.00 0.00 ? 29 ARG A NH1  5  
ATOM 5289  N NH2  . ARG A 1 29 ? 14.423 -5.930  -7.759  1.00 0.00 ? 29 ARG A NH2  5  
ATOM 5290  H H    . ARG A 1 29 ? 13.777 -0.973  -3.284  1.00 0.00 ? 29 ARG A H    5  
ATOM 5291  H HA   . ARG A 1 29 ? 16.697 -1.362  -3.063  1.00 0.00 ? 29 ARG A HA   5  
ATOM 5292  H HB2  . ARG A 1 29 ? 15.670 -3.343  -4.070  1.00 0.00 ? 29 ARG A HB2  5  
ATOM 5293  H HB3  . ARG A 1 29 ? 14.919 -2.338  -5.317  1.00 0.00 ? 29 ARG A HB3  5  
ATOM 5294  H HG2  . ARG A 1 29 ? 16.959 -1.918  -6.352  1.00 0.00 ? 29 ARG A HG2  5  
ATOM 5295  H HG3  . ARG A 1 29 ? 17.891 -2.429  -4.951  1.00 0.00 ? 29 ARG A HG3  5  
ATOM 5296  H HD2  . ARG A 1 29 ? 17.913 -4.089  -6.775  1.00 0.00 ? 29 ARG A HD2  5  
ATOM 5297  H HD3  . ARG A 1 29 ? 17.252 -4.717  -5.272  1.00 0.00 ? 29 ARG A HD3  5  
ATOM 5298  H HE   . ARG A 1 29 ? 15.223 -3.692  -7.016  1.00 0.00 ? 29 ARG A HE   5  
ATOM 5299  H HH11 . ARG A 1 29 ? 17.305 -6.451  -6.482  1.00 0.00 ? 29 ARG A HH11 5  
ATOM 5300  H HH12 . ARG A 1 29 ? 16.196 -7.607  -7.165  1.00 0.00 ? 29 ARG A HH12 5  
ATOM 5301  H HH21 . ARG A 1 29 ? 13.780 -5.166  -7.955  1.00 0.00 ? 29 ARG A HH21 5  
ATOM 5302  H HH22 . ARG A 1 29 ? 14.176 -6.867  -8.031  1.00 0.00 ? 29 ARG A HH22 5  
ATOM 5303  N N    . MET A 1 30 ? 17.257 0.477   -4.660  1.00 0.00 ? 30 MET A N    5  
ATOM 5304  C CA   . MET A 1 30 ? 17.587 1.709   -5.353  1.00 0.00 ? 30 MET A CA   5  
ATOM 5305  C C    . MET A 1 30 ? 17.556 1.498   -6.876  1.00 0.00 ? 30 MET A C    5  
ATOM 5306  O O    . MET A 1 30 ? 18.307 0.685   -7.395  1.00 0.00 ? 30 MET A O    5  
ATOM 5307  C CB   . MET A 1 30 ? 18.956 2.204   -4.924  1.00 0.00 ? 30 MET A CB   5  
ATOM 5308  C CG   . MET A 1 30 ? 19.355 3.550   -5.485  1.00 0.00 ? 30 MET A CG   5  
ATOM 5309  S SD   . MET A 1 30 ? 18.268 4.872   -4.911  1.00 0.00 ? 30 MET A SD   5  
ATOM 5310  C CE   . MET A 1 30 ? 19.146 6.291   -5.554  1.00 0.00 ? 30 MET A CE   5  
ATOM 5311  H H    . MET A 1 30 ? 17.984 -0.059  -4.283  1.00 0.00 ? 30 MET A H    5  
ATOM 5312  H HA   . MET A 1 30 ? 16.838 2.450   -5.094  1.00 0.00 ? 30 MET A HA   5  
ATOM 5313  H HB2  . MET A 1 30 ? 18.980 2.267   -3.844  1.00 0.00 ? 30 MET A HB2  5  
ATOM 5314  H HB3  . MET A 1 30 ? 19.706 1.477   -5.240  1.00 0.00 ? 30 MET A HB3  5  
ATOM 5315  H HG2  . MET A 1 30 ? 20.362 3.780   -5.179  1.00 0.00 ? 30 MET A HG2  5  
ATOM 5316  H HG3  . MET A 1 30 ? 19.300 3.500   -6.568  1.00 0.00 ? 30 MET A HG3  5  
ATOM 5317  H HE1  . MET A 1 30 ? 20.130 6.333   -5.115  1.00 0.00 ? 30 MET A HE1  5  
ATOM 5318  H HE2  . MET A 1 30 ? 18.602 7.186   -5.308  1.00 0.00 ? 30 MET A HE2  5  
ATOM 5319  H HE3  . MET A 1 30 ? 19.237 6.200   -6.635  1.00 0.00 ? 30 MET A HE3  5  
ATOM 5320  N N    . LEU A 1 31 ? 16.695 2.226   -7.568  1.00 0.00 ? 31 LEU A N    5  
ATOM 5321  C CA   . LEU A 1 31 ? 16.544 2.075   -9.016  1.00 0.00 ? 31 LEU A CA   5  
ATOM 5322  C C    . LEU A 1 31 ? 17.470 3.012   -9.788  1.00 0.00 ? 31 LEU A C    5  
ATOM 5323  O O    . LEU A 1 31 ? 17.869 2.703   -10.924 1.00 0.00 ? 31 LEU A O    5  
ATOM 5324  C CB   . LEU A 1 31 ? 15.103 2.377   -9.422  1.00 0.00 ? 31 LEU A CB   5  
ATOM 5325  C CG   . LEU A 1 31 ? 14.066 1.353   -8.946  1.00 0.00 ? 31 LEU A CG   5  
ATOM 5326  C CD1  . LEU A 1 31 ? 12.656 1.873   -9.228  1.00 0.00 ? 31 LEU A CD1  5  
ATOM 5327  C CD2  . LEU A 1 31 ? 14.295 0.036   -9.665  1.00 0.00 ? 31 LEU A CD2  5  
ATOM 5328  H H    . LEU A 1 31 ? 16.123 2.885   -7.096  1.00 0.00 ? 31 LEU A H    5  
ATOM 5329  H HA   . LEU A 1 31 ? 16.781 1.053   -9.275  1.00 0.00 ? 31 LEU A HA   5  
ATOM 5330  H HB2  . LEU A 1 31 ? 14.837 3.340   -9.016  1.00 0.00 ? 31 LEU A HB2  5  
ATOM 5331  H HB3  . LEU A 1 31 ? 15.066 2.432   -10.489 1.00 0.00 ? 31 LEU A HB3  5  
ATOM 5332  H HG   . LEU A 1 31 ? 14.176 1.202   -7.890  1.00 0.00 ? 31 LEU A HG   5  
ATOM 5333  H HD11 . LEU A 1 31 ? 12.559 2.096   -10.283 1.00 0.00 ? 31 LEU A HD11 5  
ATOM 5334  H HD12 . LEU A 1 31 ? 12.482 2.762   -8.638  1.00 0.00 ? 31 LEU A HD12 5  
ATOM 5335  H HD13 . LEU A 1 31 ? 11.939 1.114   -8.953  1.00 0.00 ? 31 LEU A HD13 5  
ATOM 5336  H HD21 . LEU A 1 31 ? 13.561 -0.693  -9.322  1.00 0.00 ? 31 LEU A HD21 5  
ATOM 5337  H HD22 . LEU A 1 31 ? 15.284 -0.330  -9.446  1.00 0.00 ? 31 LEU A HD22 5  
ATOM 5338  H HD23 . LEU A 1 31 ? 14.183 0.166   -10.725 1.00 0.00 ? 31 LEU A HD23 5  
ATOM 5339  N N    . ASP A 1 32 ? 17.832 4.135   -9.194  1.00 0.00 ? 32 ASP A N    5  
ATOM 5340  C CA   . ASP A 1 32 ? 18.619 5.153   -9.891  1.00 0.00 ? 32 ASP A CA   5  
ATOM 5341  C C    . ASP A 1 32 ? 20.001 5.283   -9.263  1.00 0.00 ? 32 ASP A C    5  
ATOM 5342  O O    . ASP A 1 32 ? 20.249 4.766   -8.174  1.00 0.00 ? 32 ASP A O    5  
ATOM 5343  C CB   . ASP A 1 32 ? 17.905 6.498   -9.869  1.00 0.00 ? 32 ASP A CB   5  
ATOM 5344  C CG   . ASP A 1 32 ? 16.810 6.611   -10.916 1.00 0.00 ? 32 ASP A CG   5  
ATOM 5345  O OD1  . ASP A 1 32 ? 15.688 6.122   -10.678 1.00 0.00 ? 32 ASP A OD1  5  
ATOM 5346  O OD2  . ASP A 1 32 ? 17.068 7.224   -11.975 1.00 0.00 ? 32 ASP A OD2  5  
ATOM 5347  H H    . ASP A 1 32 ? 17.560 4.297   -8.264  1.00 0.00 ? 32 ASP A H    5  
ATOM 5348  H HA   . ASP A 1 32 ? 18.737 4.824   -10.917 1.00 0.00 ? 32 ASP A HA   5  
ATOM 5349  H HB2  . ASP A 1 32 ? 17.453 6.642   -8.904  1.00 0.00 ? 32 ASP A HB2  5  
ATOM 5350  H HB3  . ASP A 1 32 ? 18.626 7.289   -10.048 1.00 0.00 ? 32 ASP A HB3  5  
ATOM 5351  N N    . ASP A 1 33 ? 20.890 5.987   -9.948  1.00 0.00 ? 33 ASP A N    5  
ATOM 5352  C CA   . ASP A 1 33 ? 22.216 6.227   -9.417  1.00 0.00 ? 33 ASP A CA   5  
ATOM 5353  C C    . ASP A 1 33 ? 22.280 7.610   -8.776  1.00 0.00 ? 33 ASP A C    5  
ATOM 5354  O O    . ASP A 1 33 ? 21.906 8.607   -9.379  1.00 0.00 ? 33 ASP A O    5  
ATOM 5355  C CB   . ASP A 1 33 ? 23.270 6.094   -10.531 1.00 0.00 ? 33 ASP A CB   5  
ATOM 5356  C CG   . ASP A 1 33 ? 24.693 6.083   -9.990  1.00 0.00 ? 33 ASP A CG   5  
ATOM 5357  O OD1  . ASP A 1 33 ? 25.175 5.000   -9.596  1.00 0.00 ? 33 ASP A OD1  5  
ATOM 5358  O OD2  . ASP A 1 33 ? 25.327 7.155   -9.981  1.00 0.00 ? 33 ASP A OD2  5  
ATOM 5359  H H    . ASP A 1 33 ? 20.636 6.374   -10.821 1.00 0.00 ? 33 ASP A H    5  
ATOM 5360  H HA   . ASP A 1 33 ? 22.405 5.472   -8.666  1.00 0.00 ? 33 ASP A HA   5  
ATOM 5361  H HB2  . ASP A 1 33 ? 23.099 5.172   -11.065 1.00 0.00 ? 33 ASP A HB2  5  
ATOM 5362  H HB3  . ASP A 1 33 ? 23.175 6.932   -11.210 1.00 0.00 ? 33 ASP A HB3  5  
ATOM 5363  N N    . TYR A 1 34 ? 22.724 7.647   -7.530  1.00 0.00 ? 34 TYR A N    5  
ATOM 5364  C CA   . TYR A 1 34 ? 22.675 8.856   -6.731  1.00 0.00 ? 34 TYR A CA   5  
ATOM 5365  C C    . TYR A 1 34 ? 24.069 9.284   -6.261  1.00 0.00 ? 34 TYR A C    5  
ATOM 5366  O O    . TYR A 1 34 ? 25.053 8.603   -6.506  1.00 0.00 ? 34 TYR A O    5  
ATOM 5367  C CB   . TYR A 1 34 ? 21.722 8.644   -5.533  1.00 0.00 ? 34 TYR A CB   5  
ATOM 5368  C CG   . TYR A 1 34 ? 21.305 9.913   -4.812  1.00 0.00 ? 34 TYR A CG   5  
ATOM 5369  C CD1  . TYR A 1 34 ? 20.488 10.860  -5.434  1.00 0.00 ? 34 TYR A CD1  5  
ATOM 5370  C CD2  . TYR A 1 34 ? 21.721 10.171  -3.521  1.00 0.00 ? 34 TYR A CD2  5  
ATOM 5371  C CE1  . TYR A 1 34 ? 20.103 12.015  -4.772  1.00 0.00 ? 34 TYR A CE1  5  
ATOM 5372  C CE2  . TYR A 1 34 ? 21.334 11.320  -2.851  1.00 0.00 ? 34 TYR A CE2  5  
ATOM 5373  C CZ   . TYR A 1 34 ? 20.527 12.231  -3.483  1.00 0.00 ? 34 TYR A CZ   5  
ATOM 5374  O OH   . TYR A 1 34 ? 20.143 13.378  -2.818  1.00 0.00 ? 34 TYR A OH   5  
ATOM 5375  H H    . TYR A 1 34 ? 23.110 6.828   -7.135  1.00 0.00 ? 34 TYR A H    5  
ATOM 5376  H HA   . TYR A 1 34 ? 22.265 9.640   -7.348  1.00 0.00 ? 34 TYR A HA   5  
ATOM 5377  H HB2  . TYR A 1 34 ? 20.827 8.158   -5.882  1.00 0.00 ? 34 TYR A HB2  5  
ATOM 5378  H HB3  . TYR A 1 34 ? 22.226 8.003   -4.813  1.00 0.00 ? 34 TYR A HB3  5  
ATOM 5379  H HD1  . TYR A 1 34 ? 20.142 10.671  -6.449  1.00 0.00 ? 34 TYR A HD1  5  
ATOM 5380  H HD2  . TYR A 1 34 ? 22.360 9.445   -3.017  1.00 0.00 ? 34 TYR A HD2  5  
ATOM 5381  H HE1  . TYR A 1 34 ? 19.471 12.745  -5.276  1.00 0.00 ? 34 TYR A HE1  5  
ATOM 5382  H HE2  . TYR A 1 34 ? 21.676 11.495  -1.840  1.00 0.00 ? 34 TYR A HE2  5  
ATOM 5383  H HH   . TYR A 1 34 ? 20.881 13.722  -2.296  1.00 0.00 ? 34 TYR A HH   5  
ATOM 5384  N N    . GLU A 1 35 ? 24.117 10.396  -5.562  1.00 0.00 ? 35 GLU A N    5  
ATOM 5385  C CA   . GLU A 1 35 ? 25.365 10.997  -5.126  1.00 0.00 ? 35 GLU A CA   5  
ATOM 5386  C C    . GLU A 1 35 ? 25.844 10.359  -3.820  1.00 0.00 ? 35 GLU A C    5  
ATOM 5387  O O    . GLU A 1 35 ? 26.538 11.010  -3.020  1.00 0.00 ? 35 GLU A O    5  
ATOM 5388  C CB   . GLU A 1 35 ? 25.201 12.493  -4.960  1.00 0.00 ? 35 GLU A CB   5  
ATOM 5389  C CG   . GLU A 1 35 ? 24.667 13.187  -6.201  1.00 0.00 ? 35 GLU A CG   5  
ATOM 5390  C CD   . GLU A 1 35 ? 25.569 12.990  -7.406  1.00 0.00 ? 35 GLU A CD   5  
ATOM 5391  O OE1  . GLU A 1 35 ? 25.376 11.991  -8.133  1.00 0.00 ? 35 GLU A OE1  5  
ATOM 5392  O OE2  . GLU A 1 35 ? 26.452 13.830  -7.637  1.00 0.00 ? 35 GLU A OE2  5  
ATOM 5393  H H    . GLU A 1 35 ? 23.276 10.778  -5.276  1.00 0.00 ? 35 GLU A H    5  
ATOM 5394  H HA   . GLU A 1 35 ? 26.091 10.810  -5.892  1.00 0.00 ? 35 GLU A HA   5  
ATOM 5395  H HB2  . GLU A 1 35 ? 24.497 12.670  -4.151  1.00 0.00 ? 35 GLU A HB2  5  
ATOM 5396  H HB3  . GLU A 1 35 ? 26.152 12.938  -4.700  1.00 0.00 ? 35 GLU A HB3  5  
ATOM 5397  H HG2  . GLU A 1 35 ? 23.689 12.794  -6.427  1.00 0.00 ? 35 GLU A HG2  5  
ATOM 5398  H HG3  . GLU A 1 35 ? 24.586 14.251  -6.000  1.00 0.00 ? 35 GLU A HG3  5  
ATOM 5399  N N    . GLU A 1 36 ? 25.488 9.097   -3.611  1.00 0.00 ? 36 GLU A N    5  
ATOM 5400  C CA   . GLU A 1 36 ? 25.792 8.401   -2.369  1.00 0.00 ? 36 GLU A CA   5  
ATOM 5401  C C    . GLU A 1 36 ? 25.397 6.925   -2.504  1.00 0.00 ? 36 GLU A C    5  
ATOM 5402  O O    . GLU A 1 36 ? 26.108 6.027   -2.073  1.00 0.00 ? 36 GLU A O    5  
ATOM 5403  C CB   . GLU A 1 36 ? 25.023 9.029   -1.194  1.00 0.00 ? 36 GLU A CB   5  
ATOM 5404  C CG   . GLU A 1 36 ? 25.628 8.748   0.159   1.00 0.00 ? 36 GLU A CG   5  
ATOM 5405  C CD   . GLU A 1 36 ? 26.978 9.415   0.320   1.00 0.00 ? 36 GLU A CD   5  
ATOM 5406  O OE1  . GLU A 1 36 ? 27.010 10.616  0.673   1.00 0.00 ? 36 GLU A OE1  5  
ATOM 5407  O OE2  . GLU A 1 36 ? 28.013 8.757   0.090   1.00 0.00 ? 36 GLU A OE2  5  
ATOM 5408  H H    . GLU A 1 36 ? 25.041 8.608   -4.322  1.00 0.00 ? 36 GLU A H    5  
ATOM 5409  H HA   . GLU A 1 36 ? 26.857 8.470   -2.186  1.00 0.00 ? 36 GLU A HA   5  
ATOM 5410  H HB2  . GLU A 1 36 ? 24.988 10.103  -1.340  1.00 0.00 ? 36 GLU A HB2  5  
ATOM 5411  H HB3  . GLU A 1 36 ? 24.011 8.648   -1.208  1.00 0.00 ? 36 GLU A HB3  5  
ATOM 5412  H HG2  . GLU A 1 36 ? 24.958 9.109   0.926   1.00 0.00 ? 36 GLU A HG2  5  
ATOM 5413  H HG3  . GLU A 1 36 ? 25.759 7.679   0.261   1.00 0.00 ? 36 GLU A HG3  5  
ATOM 5414  N N    . ILE A 1 37 ? 24.246 6.736   -3.132  1.00 0.00 ? 37 ILE A N    5  
ATOM 5415  C CA   . ILE A 1 37 ? 23.689 5.410   -3.343  1.00 0.00 ? 37 ILE A CA   5  
ATOM 5416  C C    . ILE A 1 37 ? 23.678 5.114   -4.837  1.00 0.00 ? 37 ILE A C    5  
ATOM 5417  O O    . ILE A 1 37 ? 23.691 6.045   -5.644  1.00 0.00 ? 37 ILE A O    5  
ATOM 5418  C CB   . ILE A 1 37 ? 22.259 5.327   -2.759  1.00 0.00 ? 37 ILE A CB   5  
ATOM 5419  C CG1  . ILE A 1 37 ? 22.222 5.844   -1.320  1.00 0.00 ? 37 ILE A CG1  5  
ATOM 5420  C CG2  . ILE A 1 37 ? 21.733 3.900   -2.806  1.00 0.00 ? 37 ILE A CG2  5  
ATOM 5421  C CD1  . ILE A 1 37 ? 23.101 5.048   -0.364  1.00 0.00 ? 37 ILE A CD1  5  
ATOM 5422  H H    . ILE A 1 37 ? 23.772 7.503   -3.482  1.00 0.00 ? 37 ILE A H    5  
ATOM 5423  H HA   . ILE A 1 37 ? 24.315 4.691   -2.838  1.00 0.00 ? 37 ILE A HA   5  
ATOM 5424  H HB   . ILE A 1 37 ? 21.611 5.937   -3.362  1.00 0.00 ? 37 ILE A HB   5  
ATOM 5425  H HG12 . ILE A 1 37 ? 22.550 6.863   -1.317  1.00 0.00 ? 37 ILE A HG12 5  
ATOM 5426  H HG13 . ILE A 1 37 ? 21.197 5.792   -0.967  1.00 0.00 ? 37 ILE A HG13 5  
ATOM 5427  H HG21 . ILE A 1 37 ? 20.724 3.878   -2.429  1.00 0.00 ? 37 ILE A HG21 5  
ATOM 5428  H HG22 . ILE A 1 37 ? 22.358 3.265   -2.211  1.00 0.00 ? 37 ILE A HG22 5  
ATOM 5429  H HG23 . ILE A 1 37 ? 21.731 3.549   -3.829  1.00 0.00 ? 37 ILE A HG23 5  
ATOM 5430  H HD11 . ILE A 1 37 ? 22.801 4.005   -0.388  1.00 0.00 ? 37 ILE A HD11 5  
ATOM 5431  H HD12 . ILE A 1 37 ? 22.990 5.427   0.651   1.00 0.00 ? 37 ILE A HD12 5  
ATOM 5432  H HD13 . ILE A 1 37 ? 24.129 5.125   -0.668  1.00 0.00 ? 37 ILE A HD13 5  
ATOM 5433  N N    . SER A 1 38 ? 23.659 3.861   -5.207  1.00 0.00 ? 38 SER A N    5  
ATOM 5434  C CA   . SER A 1 38 ? 23.721 3.494   -6.616  1.00 0.00 ? 38 SER A CA   5  
ATOM 5435  C C    . SER A 1 38 ? 22.630 2.490   -6.939  1.00 0.00 ? 38 SER A C    5  
ATOM 5436  O O    . SER A 1 38 ? 22.056 1.866   -6.025  1.00 0.00 ? 38 SER A O    5  
ATOM 5437  C CB   . SER A 1 38 ? 25.101 2.935   -6.947  1.00 0.00 ? 38 SER A CB   5  
ATOM 5438  O OG   . SER A 1 38 ? 25.215 2.648   -8.330  1.00 0.00 ? 38 SER A OG   5  
ATOM 5439  H H    . SER A 1 38 ? 23.545 3.140   -4.531  1.00 0.00 ? 38 SER A H    5  
ATOM 5440  H HA   . SER A 1 38 ? 23.546 4.384   -7.202  1.00 0.00 ? 38 SER A HA   5  
ATOM 5441  H HB2  . SER A 1 38 ? 25.864 3.654   -6.674  1.00 0.00 ? 38 SER A HB2  5  
ATOM 5442  H HB3  . SER A 1 38 ? 25.255 2.015   -6.386  1.00 0.00 ? 38 SER A HB3  5  
ATOM 5443  H HG   . SER A 1 38 ? 25.287 3.487   -8.819  1.00 0.00 ? 38 SER A HG   5  
ATOM 5444  N N    . ALA A 1 39 ? 22.331 2.311   -8.223  1.00 0.00 ? 39 ALA A N    5  
ATOM 5445  C CA   . ALA A 1 39 ? 21.297 1.398   -8.650  1.00 0.00 ? 39 ALA A CA   5  
ATOM 5446  C C    . ALA A 1 39 ? 21.638 -0.019  -8.222  1.00 0.00 ? 39 ALA A C    5  
ATOM 5447  O O    . ALA A 1 39 ? 22.748 -0.509  -8.465  1.00 0.00 ? 39 ALA A O    5  
ATOM 5448  C CB   . ALA A 1 39 ? 21.119 1.455   -10.162 1.00 0.00 ? 39 ALA A CB   5  
ATOM 5449  H H    . ALA A 1 39 ? 22.834 2.817   -8.897  1.00 0.00 ? 39 ALA A H    5  
ATOM 5450  H HA   . ALA A 1 39 ? 20.374 1.704   -8.191  1.00 0.00 ? 39 ALA A HA   5  
ATOM 5451  H HB1  . ALA A 1 39 ? 22.041 1.171   -10.655 1.00 0.00 ? 39 ALA A HB1  5  
ATOM 5452  H HB2  . ALA A 1 39 ? 20.857 2.472   -10.461 1.00 0.00 ? 39 ALA A HB2  5  
ATOM 5453  H HB3  . ALA A 1 39 ? 20.329 0.779   -10.457 1.00 0.00 ? 39 ALA A HB3  5  
ATOM 5454  N N    . GLY A 1 40 ? 20.679 -0.673  -7.567  1.00 0.00 ? 40 GLY A N    5  
ATOM 5455  C CA   . GLY A 1 40 ? 20.858 -2.049  -7.121  1.00 0.00 ? 40 GLY A CA   5  
ATOM 5456  C C    . GLY A 1 40 ? 21.090 -2.171  -5.623  1.00 0.00 ? 40 GLY A C    5  
ATOM 5457  O O    . GLY A 1 40 ? 20.927 -3.256  -5.056  1.00 0.00 ? 40 GLY A O    5  
ATOM 5458  H H    . GLY A 1 40 ? 19.825 -0.212  -7.406  1.00 0.00 ? 40 GLY A H    5  
ATOM 5459  H HA2  . GLY A 1 40 ? 19.971 -2.613  -7.380  1.00 0.00 ? 40 GLY A HA2  5  
ATOM 5460  H HA3  . GLY A 1 40 ? 21.704 -2.467  -7.646  1.00 0.00 ? 40 GLY A HA3  5  
ATOM 5461  N N    . ASP A 1 41 ? 21.472 -1.073  -4.975  1.00 0.00 ? 41 ASP A N    5  
ATOM 5462  C CA   . ASP A 1 41 ? 21.602 -1.063  -3.530  1.00 0.00 ? 41 ASP A CA   5  
ATOM 5463  C C    . ASP A 1 41 ? 20.249 -1.332  -2.886  1.00 0.00 ? 41 ASP A C    5  
ATOM 5464  O O    . ASP A 1 41 ? 19.243 -0.810  -3.340  1.00 0.00 ? 41 ASP A O    5  
ATOM 5465  C CB   . ASP A 1 41 ? 22.151 0.274   -3.013  1.00 0.00 ? 41 ASP A CB   5  
ATOM 5466  C CG   . ASP A 1 41 ? 23.624 0.502   -3.343  1.00 0.00 ? 41 ASP A CG   5  
ATOM 5467  O OD1  . ASP A 1 41 ? 24.414 -0.456  -3.205  1.00 0.00 ? 41 ASP A OD1  5  
ATOM 5468  O OD2  . ASP A 1 41 ? 23.989 1.633   -3.706  1.00 0.00 ? 41 ASP A OD2  5  
ATOM 5469  H H    . ASP A 1 41 ? 21.648 -0.255  -5.475  1.00 0.00 ? 41 ASP A H    5  
ATOM 5470  H HA   . ASP A 1 41 ? 22.285 -1.849  -3.260  1.00 0.00 ? 41 ASP A HA   5  
ATOM 5471  H HB2  . ASP A 1 41 ? 21.589 1.090   -3.450  1.00 0.00 ? 41 ASP A HB2  5  
ATOM 5472  H HB3  . ASP A 1 41 ? 22.030 0.303   -1.949  1.00 0.00 ? 41 ASP A HB3  5  
ATOM 5473  N N    . GLU A 1 42 ? 20.225 -2.148  -1.838  1.00 0.00 ? 42 GLU A N    5  
ATOM 5474  C CA   . GLU A 1 42 ? 18.978 -2.451  -1.164  1.00 0.00 ? 42 GLU A CA   5  
ATOM 5475  C C    . GLU A 1 42 ? 19.011 -1.943  0.270   1.00 0.00 ? 42 GLU A C    5  
ATOM 5476  O O    . GLU A 1 42 ? 20.082 -1.705  0.843   1.00 0.00 ? 42 GLU A O    5  
ATOM 5477  C CB   . GLU A 1 42 ? 18.718 -3.954  -1.199  1.00 0.00 ? 42 GLU A CB   5  
ATOM 5478  C CG   . GLU A 1 42 ? 18.412 -4.458  -2.598  1.00 0.00 ? 42 GLU A CG   5  
ATOM 5479  C CD   . GLU A 1 42 ? 18.334 -5.970  -2.671  1.00 0.00 ? 42 GLU A CD   5  
ATOM 5480  O OE1  . GLU A 1 42 ? 17.328 -6.565  -2.207  1.00 0.00 ? 42 GLU A OE1  5  
ATOM 5481  O OE2  . GLU A 1 42 ? 19.276 -6.574  -3.202  1.00 0.00 ? 42 GLU A OE2  5  
ATOM 5482  H H    . GLU A 1 42 ? 21.060 -2.555  -1.531  1.00 0.00 ? 42 GLU A H    5  
ATOM 5483  H HA   . GLU A 1 42 ? 18.187 -1.945  -1.682  1.00 0.00 ? 42 GLU A HA   5  
ATOM 5484  H HB2  . GLU A 1 42 ? 19.594 -4.470  -0.829  1.00 0.00 ? 42 GLU A HB2  5  
ATOM 5485  H HB3  . GLU A 1 42 ? 17.884 -4.188  -0.560  1.00 0.00 ? 42 GLU A HB3  5  
ATOM 5486  H HG2  . GLU A 1 42 ? 17.456 -4.057  -2.916  1.00 0.00 ? 42 GLU A HG2  5  
ATOM 5487  H HG3  . GLU A 1 42 ? 19.182 -4.129  -3.264  1.00 0.00 ? 42 GLU A HG3  5  
ATOM 5488  N N    . GLY A 1 43 ? 17.837 -1.734  0.837   1.00 0.00 ? 43 GLY A N    5  
ATOM 5489  C CA   . GLY A 1 43 ? 17.714 -1.284  2.213   1.00 0.00 ? 43 GLY A CA   5  
ATOM 5490  C C    . GLY A 1 43 ? 16.330 -1.516  2.758   1.00 0.00 ? 43 GLY A C    5  
ATOM 5491  O O    . GLY A 1 43 ? 15.492 -2.153  2.119   1.00 0.00 ? 43 GLY A O    5  
ATOM 5492  H H    . GLY A 1 43 ? 17.011 -1.869  0.297   1.00 0.00 ? 43 GLY A H    5  
ATOM 5493  H HA2  . GLY A 1 43 ? 18.437 -1.835  2.817   1.00 0.00 ? 43 GLY A HA2  5  
ATOM 5494  H HA3  . GLY A 1 43 ? 17.940 -0.225  2.249   1.00 0.00 ? 43 GLY A HA3  5  
ATOM 5495  N N    . GLU A 1 44 ? 16.069 -0.981  3.939   1.00 0.00 ? 44 GLU A N    5  
ATOM 5496  C CA   . GLU A 1 44 ? 14.776 -1.153  4.581   1.00 0.00 ? 44 GLU A CA   5  
ATOM 5497  C C    . GLU A 1 44 ? 14.141 0.207   4.857   1.00 0.00 ? 44 GLU A C    5  
ATOM 5498  O O    . GLU A 1 44 ? 14.827 1.200   5.111   1.00 0.00 ? 44 GLU A O    5  
ATOM 5499  C CB   . GLU A 1 44 ? 14.926 -1.938  5.879   1.00 0.00 ? 44 GLU A CB   5  
ATOM 5500  C CG   . GLU A 1 44 ? 13.604 -2.273  6.547   1.00 0.00 ? 44 GLU A CG   5  
ATOM 5501  C CD   . GLU A 1 44 ? 13.776 -3.086  7.811   1.00 0.00 ? 44 GLU A CD   5  
ATOM 5502  O OE1  . GLU A 1 44 ? 13.860 -4.326  7.722   1.00 0.00 ? 44 GLU A OE1  5  
ATOM 5503  O OE2  . GLU A 1 44 ? 13.839 -2.489  8.912   1.00 0.00 ? 44 GLU A OE2  5  
ATOM 5504  H H    . GLU A 1 44 ? 16.759 -0.434  4.364   1.00 0.00 ? 44 GLU A H    5  
ATOM 5505  H HA   . GLU A 1 44 ? 14.136 -1.707  3.903   1.00 0.00 ? 44 GLU A HA   5  
ATOM 5506  H HB2  . GLU A 1 44 ? 15.443 -2.865  5.670   1.00 0.00 ? 44 GLU A HB2  5  
ATOM 5507  H HB3  . GLU A 1 44 ? 15.511 -1.363  6.572   1.00 0.00 ? 44 GLU A HB3  5  
ATOM 5508  H HG2  . GLU A 1 44 ? 13.099 -1.369  6.797   1.00 0.00 ? 44 GLU A HG2  5  
ATOM 5509  H HG3  . GLU A 1 44 ? 13.001 -2.845  5.854   1.00 0.00 ? 44 GLU A HG3  5  
ATOM 5510  N N    . PHE A 1 45 ? 12.823 0.245   4.815   1.00 0.00 ? 45 PHE A N    5  
ATOM 5511  C CA   . PHE A 1 45 ? 12.075 1.470   5.026   1.00 0.00 ? 45 PHE A CA   5  
ATOM 5512  C C    . PHE A 1 45 ? 11.721 1.620   6.497   1.00 0.00 ? 45 PHE A C    5  
ATOM 5513  O O    . PHE A 1 45 ? 11.068 0.752   7.086   1.00 0.00 ? 45 PHE A O    5  
ATOM 5514  C CB   . PHE A 1 45 ? 10.806 1.452   4.170   1.00 0.00 ? 45 PHE A CB   5  
ATOM 5515  C CG   . PHE A 1 45 ? 9.850  2.559   4.458   1.00 0.00 ? 45 PHE A CG   5  
ATOM 5516  C CD1  . PHE A 1 45 ? 10.036 3.813   3.903   1.00 0.00 ? 45 PHE A CD1  5  
ATOM 5517  C CD2  . PHE A 1 45 ? 8.763  2.356   5.283   1.00 0.00 ? 45 PHE A CD2  5  
ATOM 5518  C CE1  . PHE A 1 45 ? 9.156  4.832   4.166   1.00 0.00 ? 45 PHE A CE1  5  
ATOM 5519  C CE2  . PHE A 1 45 ? 7.871  3.372   5.545   1.00 0.00 ? 45 PHE A CE2  5  
ATOM 5520  C CZ   . PHE A 1 45 ? 8.066  4.615   4.986   1.00 0.00 ? 45 PHE A CZ   5  
ATOM 5521  H H    . PHE A 1 45 ? 12.316 -0.603  4.668   1.00 0.00 ? 45 PHE A H    5  
ATOM 5522  H HA   . PHE A 1 45 ? 12.694 2.301   4.721   1.00 0.00 ? 45 PHE A HA   5  
ATOM 5523  H HB2  . PHE A 1 45 ? 11.087 1.516   3.120   1.00 0.00 ? 45 PHE A HB2  5  
ATOM 5524  H HB3  . PHE A 1 45 ? 10.295 0.520   4.337   1.00 0.00 ? 45 PHE A HB3  5  
ATOM 5525  H HD1  . PHE A 1 45 ? 10.884 3.983   3.247   1.00 0.00 ? 45 PHE A HD1  5  
ATOM 5526  H HD2  . PHE A 1 45 ? 8.612  1.388   5.731   1.00 0.00 ? 45 PHE A HD2  5  
ATOM 5527  H HE1  . PHE A 1 45 ? 9.319  5.800   3.731   1.00 0.00 ? 45 PHE A HE1  5  
ATOM 5528  H HE2  . PHE A 1 45 ? 7.014  3.195   6.189   1.00 0.00 ? 45 PHE A HE2  5  
ATOM 5529  H HZ   . PHE A 1 45 ? 7.371  5.417   5.193   1.00 0.00 ? 45 PHE A HZ   5  
ATOM 5530  N N    . ARG A 1 46 ? 12.172 2.689   7.116   1.00 0.00 ? 46 ARG A N    5  
ATOM 5531  C CA   . ARG A 1 46 ? 11.879 2.951   8.521   1.00 0.00 ? 46 ARG A CA   5  
ATOM 5532  C C    . ARG A 1 46 ? 10.741 3.940   8.677   1.00 0.00 ? 46 ARG A C    5  
ATOM 5533  O O    . ARG A 1 46 ? 9.771  3.681   9.398   1.00 0.00 ? 46 ARG A O    5  
ATOM 5534  C CB   . ARG A 1 46 ? 13.118 3.464   9.245   1.00 0.00 ? 46 ARG A CB   5  
ATOM 5535  C CG   . ARG A 1 46 ? 14.203 2.428   9.407   1.00 0.00 ? 46 ARG A CG   5  
ATOM 5536  C CD   . ARG A 1 46 ? 15.401 2.976   10.162  1.00 0.00 ? 46 ARG A CD   5  
ATOM 5537  N NE   . ARG A 1 46 ? 16.396 1.932   10.428  1.00 0.00 ? 46 ARG A NE   5  
ATOM 5538  C CZ   . ARG A 1 46 ? 17.573 2.154   11.017  1.00 0.00 ? 46 ARG A CZ   5  
ATOM 5539  N NH1  . ARG A 1 46 ? 17.881 3.364   11.475  1.00 0.00 ? 46 ARG A NH1  5  
ATOM 5540  N NH2  . ARG A 1 46 ? 18.414 1.154   11.203  1.00 0.00 ? 46 ARG A NH2  5  
ATOM 5541  H H    . ARG A 1 46 ? 12.732 3.331   6.623   1.00 0.00 ? 46 ARG A H    5  
ATOM 5542  H HA   . ARG A 1 46 ? 11.587 2.015   8.968   1.00 0.00 ? 46 ARG A HA   5  
ATOM 5543  H HB2  . ARG A 1 46 ? 13.535 4.303   8.688   1.00 0.00 ? 46 ARG A HB2  5  
ATOM 5544  H HB3  . ARG A 1 46 ? 12.850 3.818   10.225  1.00 0.00 ? 46 ARG A HB3  5  
ATOM 5545  H HG2  . ARG A 1 46 ? 13.808 1.586   9.962   1.00 0.00 ? 46 ARG A HG2  5  
ATOM 5546  H HG3  . ARG A 1 46 ? 14.526 2.094   8.434   1.00 0.00 ? 46 ARG A HG3  5  
ATOM 5547  H HD2  . ARG A 1 46 ? 15.876 3.747   9.564   1.00 0.00 ? 46 ARG A HD2  5  
ATOM 5548  H HD3  . ARG A 1 46 ? 15.070 3.383   11.095  1.00 0.00 ? 46 ARG A HD3  5  
ATOM 5549  H HE   . ARG A 1 46 ? 16.173 1.018   10.127  1.00 0.00 ? 46 ARG A HE   5  
ATOM 5550  H HH11 . ARG A 1 46 ? 17.232 4.129   11.350  1.00 0.00 ? 46 ARG A HH11 5  
ATOM 5551  H HH12 . ARG A 1 46 ? 18.776 3.527   11.907  1.00 0.00 ? 46 ARG A HH12 5  
ATOM 5552  H HH21 . ARG A 1 46 ? 18.185 0.229   10.871  1.00 0.00 ? 46 ARG A HH21 5  
ATOM 5553  H HH22 . ARG A 1 46 ? 19.296 1.314   11.650  1.00 0.00 ? 46 ARG A HH22 5  
ATOM 5554  N N    . GLN A 1 47 ? 10.832 5.068   7.989   1.00 0.00 ? 47 GLN A N    5  
ATOM 5555  C CA   . GLN A 1 47 ? 9.852  6.133   8.118   1.00 0.00 ? 47 GLN A CA   5  
ATOM 5556  C C    . GLN A 1 47 ? 9.992  7.128   6.987   1.00 0.00 ? 47 GLN A C    5  
ATOM 5557  O O    . GLN A 1 47 ? 11.028 7.210   6.330   1.00 0.00 ? 47 GLN A O    5  
ATOM 5558  C CB   . GLN A 1 47 ? 10.000 6.835   9.461   1.00 0.00 ? 47 GLN A CB   5  
ATOM 5559  C CG   . GLN A 1 47 ? 11.353 7.484   9.672   1.00 0.00 ? 47 GLN A CG   5  
ATOM 5560  C CD   . GLN A 1 47 ? 11.449 8.174   10.999  1.00 0.00 ? 47 GLN A CD   5  
ATOM 5561  O OE1  . GLN A 1 47 ? 11.841 7.595   12.016  1.00 0.00 ? 47 GLN A OE1  5  
ATOM 5562  N NE2  . GLN A 1 47 ? 11.055 9.440   11.026  1.00 0.00 ? 47 GLN A NE2  5  
ATOM 5563  H H    . GLN A 1 47 ? 11.577 5.169   7.343   1.00 0.00 ? 47 GLN A H    5  
ATOM 5564  H HA   . GLN A 1 47 ? 8.874  5.688   8.070   1.00 0.00 ? 47 GLN A HA   5  
ATOM 5565  H HB2  . GLN A 1 47 ? 9.244  7.622   9.514   1.00 0.00 ? 47 GLN A HB2  5  
ATOM 5566  H HB3  . GLN A 1 47 ? 9.812  6.131   10.258  1.00 0.00 ? 47 GLN A HB3  5  
ATOM 5567  H HG2  . GLN A 1 47 ? 12.109 6.708   9.629   1.00 0.00 ? 47 GLN A HG2  5  
ATOM 5568  H HG3  . GLN A 1 47 ? 11.523 8.187   8.891   1.00 0.00 ? 47 GLN A HG3  5  
ATOM 5569  H HE21 . GLN A 1 47 ? 10.735 9.844   10.181  1.00 0.00 ? 47 GLN A HE21 5  
ATOM 5570  H HE22 . GLN A 1 47 ? 11.089 9.912   11.872  1.00 0.00 ? 47 GLN A HE22 5  
ATOM 5571  N N    . SER A 1 48 ? 8.944  7.882   6.750   1.00 0.00 ? 48 SER A N    5  
ATOM 5572  C CA   . SER A 1 48 ? 8.942  8.828   5.660   1.00 0.00 ? 48 SER A CA   5  
ATOM 5573  C C    . SER A 1 48 ? 8.150  10.072  6.002   1.00 0.00 ? 48 SER A C    5  
ATOM 5574  O O    . SER A 1 48 ? 7.579  10.175  7.085   1.00 0.00 ? 48 SER A O    5  
ATOM 5575  C CB   . SER A 1 48 ? 8.296  8.167   4.442   1.00 0.00 ? 48 SER A CB   5  
ATOM 5576  O OG   . SER A 1 48 ? 7.055  7.569   4.791   1.00 0.00 ? 48 SER A OG   5  
ATOM 5577  H H    . SER A 1 48 ? 8.135  7.794   7.310   1.00 0.00 ? 48 SER A H    5  
ATOM 5578  H HA   . SER A 1 48 ? 9.962  9.088   5.416   1.00 0.00 ? 48 SER A HA   5  
ATOM 5579  H HB2  . SER A 1 48 ? 8.120  8.916   3.687   1.00 0.00 ? 48 SER A HB2  5  
ATOM 5580  H HB3  . SER A 1 48 ? 8.951  7.400   4.051   1.00 0.00 ? 48 SER A HB3  5  
ATOM 5581  H HG   . SER A 1 48 ? 6.377  7.806   4.137   1.00 0.00 ? 48 SER A HG   5  
ATOM 5582  N N    . ASN A 1 49 ? 8.138  11.002  5.076   1.00 0.00 ? 49 ASN A N    5  
ATOM 5583  C CA   . ASN A 1 49 ? 7.234  12.114  5.139   1.00 0.00 ? 49 ASN A CA   5  
ATOM 5584  C C    . ASN A 1 49 ? 6.241  11.937  4.013   1.00 0.00 ? 49 ASN A C    5  
ATOM 5585  O O    . ASN A 1 49 ? 6.548  12.145  2.837   1.00 0.00 ? 49 ASN A O    5  
ATOM 5586  C CB   . ASN A 1 49 ? 7.970  13.445  4.985   1.00 0.00 ? 49 ASN A CB   5  
ATOM 5587  C CG   . ASN A 1 49 ? 9.120  13.610  5.963   1.00 0.00 ? 49 ASN A CG   5  
ATOM 5588  O OD1  . ASN A 1 49 ? 8.944  14.098  7.079   1.00 0.00 ? 49 ASN A OD1  5  
ATOM 5589  N ND2  . ASN A 1 49 ? 10.302 13.212  5.531   1.00 0.00 ? 49 ASN A ND2  5  
ATOM 5590  H H    . ASN A 1 49 ? 8.754  10.908  4.312   1.00 0.00 ? 49 ASN A H    5  
ATOM 5591  H HA   . ASN A 1 49 ? 6.716  12.093  6.085   1.00 0.00 ? 49 ASN A HA   5  
ATOM 5592  H HB2  . ASN A 1 49 ? 8.366  13.517  3.985   1.00 0.00 ? 49 ASN A HB2  5  
ATOM 5593  H HB3  . ASN A 1 49 ? 7.275  14.258  5.161   1.00 0.00 ? 49 ASN A HB3  5  
ATOM 5594  H HD21 . ASN A 1 49 ? 10.370 12.854  4.629   1.00 0.00 ? 49 ASN A HD21 5  
ATOM 5595  H HD22 . ASN A 1 49 ? 11.083 13.311  6.152   1.00 0.00 ? 49 ASN A HD22 5  
ATOM 5596  N N    . ASN A 1 50 ? 5.039  11.523  4.366   1.00 0.00 ? 50 ASN A N    5  
ATOM 5597  C CA   . ASN A 1 50 ? 4.056  11.108  3.373   1.00 0.00 ? 50 ASN A CA   5  
ATOM 5598  C C    . ASN A 1 50 ? 3.343  12.303  2.762   1.00 0.00 ? 50 ASN A C    5  
ATOM 5599  O O    . ASN A 1 50 ? 2.228  12.666  3.148   1.00 0.00 ? 50 ASN A O    5  
ATOM 5600  C CB   . ASN A 1 50 ? 3.047  10.130  3.972   1.00 0.00 ? 50 ASN A CB   5  
ATOM 5601  C CG   . ASN A 1 50 ? 3.684  8.776   4.279   1.00 0.00 ? 50 ASN A CG   5  
ATOM 5602  O OD1  . ASN A 1 50 ? 4.659  8.367   3.643   1.00 0.00 ? 50 ASN A OD1  5  
ATOM 5603  N ND2  . ASN A 1 50 ? 3.151  8.087   5.275   1.00 0.00 ? 50 ASN A ND2  5  
ATOM 5604  H H    . ASN A 1 50 ? 4.790  11.516  5.327   1.00 0.00 ? 50 ASN A H    5  
ATOM 5605  H HA   . ASN A 1 50 ? 4.600  10.603  2.593   1.00 0.00 ? 50 ASN A HA   5  
ATOM 5606  H HB2  . ASN A 1 50 ? 2.651  10.537  4.884   1.00 0.00 ? 50 ASN A HB2  5  
ATOM 5607  H HB3  . ASN A 1 50 ? 2.241  9.977   3.258   1.00 0.00 ? 50 ASN A HB3  5  
ATOM 5608  H HD21 . ASN A 1 50 ? 2.396  8.480   5.762   1.00 0.00 ? 50 ASN A HD21 5  
ATOM 5609  H HD22 . ASN A 1 50 ? 3.522  7.199   5.486   1.00 0.00 ? 50 ASN A HD22 5  
ATOM 5610  N N    . GLY A 1 51 ? 4.022  12.948  1.825   1.00 0.00 ? 51 GLY A N    5  
ATOM 5611  C CA   . GLY A 1 51 ? 3.461  14.062  1.106   1.00 0.00 ? 51 GLY A CA   5  
ATOM 5612  C C    . GLY A 1 51 ? 4.559  14.788  0.336   1.00 0.00 ? 51 GLY A C    5  
ATOM 5613  O O    . GLY A 1 51 ? 4.319  15.390  -0.705  1.00 0.00 ? 51 GLY A O    5  
ATOM 5614  H H    . GLY A 1 51 ? 4.962  12.687  1.655   1.00 0.00 ? 51 GLY A H    5  
ATOM 5615  H HA2  . GLY A 1 51 ? 2.714  13.707  0.399   1.00 0.00 ? 51 GLY A HA2  5  
ATOM 5616  H HA3  . GLY A 1 51 ? 3.008  14.747  1.798   1.00 0.00 ? 51 GLY A HA3  5  
ATOM 5617  N N    . VAL A 1 52 ? 5.771  14.709  0.865   1.00 0.00 ? 52 VAL A N    5  
ATOM 5618  C CA   . VAL A 1 52 ? 6.944  15.305  0.240   1.00 0.00 ? 52 VAL A CA   5  
ATOM 5619  C C    . VAL A 1 52 ? 7.960  14.231  -0.138  1.00 0.00 ? 52 VAL A C    5  
ATOM 5620  O O    . VAL A 1 52 ? 7.831  13.077  0.292   1.00 0.00 ? 52 VAL A O    5  
ATOM 5621  C CB   . VAL A 1 52 ? 7.598  16.343  1.163   1.00 0.00 ? 52 VAL A CB   5  
ATOM 5622  C CG1  . VAL A 1 52 ? 6.748  17.593  1.246   1.00 0.00 ? 52 VAL A CG1  5  
ATOM 5623  C CG2  . VAL A 1 52 ? 7.829  15.771  2.555   1.00 0.00 ? 52 VAL A CG2  5  
ATOM 5624  H H    . VAL A 1 52 ? 5.905  14.224  1.705   1.00 0.00 ? 52 VAL A H    5  
ATOM 5625  H HA   . VAL A 1 52 ? 6.618  15.806  -0.653  1.00 0.00 ? 52 VAL A HA   5  
ATOM 5626  H HB   . VAL A 1 52 ? 8.559  16.611  0.755   1.00 0.00 ? 52 VAL A HB   5  
ATOM 5627  H HG11 . VAL A 1 52 ? 6.646  18.013  0.256   1.00 0.00 ? 52 VAL A HG11 5  
ATOM 5628  H HG12 . VAL A 1 52 ? 7.228  18.317  1.887   1.00 0.00 ? 52 VAL A HG12 5  
ATOM 5629  H HG13 . VAL A 1 52 ? 5.775  17.347  1.639   1.00 0.00 ? 52 VAL A HG13 5  
ATOM 5630  H HG21 . VAL A 1 52 ? 8.268  16.517  3.190   1.00 0.00 ? 52 VAL A HG21 5  
ATOM 5631  H HG22 . VAL A 1 52 ? 8.495  14.927  2.487   1.00 0.00 ? 52 VAL A HG22 5  
ATOM 5632  H HG23 . VAL A 1 52 ? 6.888  15.453  2.972   1.00 0.00 ? 52 VAL A HG23 5  
ATOM 5633  N N    . PRO A 1 53 ? 8.949  14.569  -0.999  1.00 0.00 ? 53 PRO A N    5  
ATOM 5634  C CA   . PRO A 1 53 ? 9.993  13.627  -1.458  1.00 0.00 ? 53 PRO A CA   5  
ATOM 5635  C C    . PRO A 1 53 ? 10.811 12.936  -0.337  1.00 0.00 ? 53 PRO A C    5  
ATOM 5636  O O    . PRO A 1 53 ? 10.985 11.725  -0.378  1.00 0.00 ? 53 PRO A O    5  
ATOM 5637  C CB   . PRO A 1 53 ? 10.911 14.488  -2.320  1.00 0.00 ? 53 PRO A CB   5  
ATOM 5638  C CG   . PRO A 1 53 ? 10.074 15.660  -2.728  1.00 0.00 ? 53 PRO A CG   5  
ATOM 5639  C CD   . PRO A 1 53 ? 9.110  15.908  -1.602  1.00 0.00 ? 53 PRO A CD   5  
ATOM 5640  H HA   . PRO A 1 53 ? 9.564  12.863  -2.073  1.00 0.00 ? 53 PRO A HA   5  
ATOM 5641  H HB2  . PRO A 1 53 ? 11.768 14.795  -1.739  1.00 0.00 ? 53 PRO A HB2  5  
ATOM 5642  H HB3  . PRO A 1 53 ? 11.237 13.921  -3.190  1.00 0.00 ? 53 PRO A HB3  5  
ATOM 5643  H HG2  . PRO A 1 53 ? 10.710 16.527  -2.875  1.00 0.00 ? 53 PRO A HG2  5  
ATOM 5644  H HG3  . PRO A 1 53 ? 9.535  15.434  -3.635  1.00 0.00 ? 53 PRO A HG3  5  
ATOM 5645  H HD2  . PRO A 1 53 ? 9.529  16.598  -0.882  1.00 0.00 ? 53 PRO A HD2  5  
ATOM 5646  H HD3  . PRO A 1 53 ? 8.168  16.270  -1.983  1.00 0.00 ? 53 PRO A HD3  5  
ATOM 5647  N N    . PRO A 1 54 ? 11.336 13.679  0.672   1.00 0.00 ? 54 PRO A N    5  
ATOM 5648  C CA   . PRO A 1 54 ? 12.233 13.099  1.688   1.00 0.00 ? 54 PRO A CA   5  
ATOM 5649  C C    . PRO A 1 54 ? 11.684 11.854  2.377   1.00 0.00 ? 54 PRO A C    5  
ATOM 5650  O O    . PRO A 1 54 ? 10.659 11.899  3.073   1.00 0.00 ? 54 PRO A O    5  
ATOM 5651  C CB   . PRO A 1 54 ? 12.433 14.231  2.713   1.00 0.00 ? 54 PRO A CB   5  
ATOM 5652  C CG   . PRO A 1 54 ? 11.397 15.249  2.393   1.00 0.00 ? 54 PRO A CG   5  
ATOM 5653  C CD   . PRO A 1 54 ? 11.130 15.119  0.912   1.00 0.00 ? 54 PRO A CD   5  
ATOM 5654  H HA   . PRO A 1 54 ? 13.185 12.852  1.246   1.00 0.00 ? 54 PRO A HA   5  
ATOM 5655  H HB2  . PRO A 1 54 ? 12.314 13.855  3.716   1.00 0.00 ? 54 PRO A HB2  5  
ATOM 5656  H HB3  . PRO A 1 54 ? 13.433 14.643  2.598   1.00 0.00 ? 54 PRO A HB3  5  
ATOM 5657  H HG2  . PRO A 1 54 ? 10.499 15.042  2.955   1.00 0.00 ? 54 PRO A HG2  5  
ATOM 5658  H HG3  . PRO A 1 54 ? 11.770 16.231  2.622   1.00 0.00 ? 54 PRO A HG3  5  
ATOM 5659  H HD2  . PRO A 1 54 ? 10.118 15.409  0.683   1.00 0.00 ? 54 PRO A HD2  5  
ATOM 5660  H HD3  . PRO A 1 54 ? 11.845 15.708  0.349   1.00 0.00 ? 54 PRO A HD3  5  
ATOM 5661  N N    . VAL A 1 55 ? 12.378 10.729  2.190   1.00 0.00 ? 55 VAL A N    5  
ATOM 5662  C CA   . VAL A 1 55 ? 12.045 9.486   2.872   1.00 0.00 ? 55 VAL A CA   5  
ATOM 5663  C C    . VAL A 1 55 ? 13.286 8.903   3.516   1.00 0.00 ? 55 VAL A C    5  
ATOM 5664  O O    . VAL A 1 55 ? 14.353 8.897   2.913   1.00 0.00 ? 55 VAL A O    5  
ATOM 5665  C CB   . VAL A 1 55 ? 11.436 8.451   1.889   1.00 0.00 ? 55 VAL A CB   5  
ATOM 5666  C CG1  . VAL A 1 55 ? 12.285 8.292   0.655   1.00 0.00 ? 55 VAL A CG1  5  
ATOM 5667  C CG2  . VAL A 1 55 ? 11.221 7.106   2.571   1.00 0.00 ? 55 VAL A CG2  5  
ATOM 5668  H H    . VAL A 1 55 ? 13.150 10.749  1.588   1.00 0.00 ? 55 VAL A H    5  
ATOM 5669  H HA   . VAL A 1 55 ? 11.315 9.706   3.638   1.00 0.00 ? 55 VAL A HA   5  
ATOM 5670  H HB   . VAL A 1 55 ? 10.466 8.813   1.571   1.00 0.00 ? 55 VAL A HB   5  
ATOM 5671  H HG11 . VAL A 1 55 ? 11.824 7.581   -0.029  1.00 0.00 ? 55 VAL A HG11 5  
ATOM 5672  H HG12 . VAL A 1 55 ? 13.263 7.908   0.931   1.00 0.00 ? 55 VAL A HG12 5  
ATOM 5673  H HG13 . VAL A 1 55 ? 12.403 9.234   0.168   1.00 0.00 ? 55 VAL A HG13 5  
ATOM 5674  H HG21 . VAL A 1 55 ? 12.170 6.689   2.819   1.00 0.00 ? 55 VAL A HG21 5  
ATOM 5675  H HG22 . VAL A 1 55 ? 10.691 6.444   1.907   1.00 0.00 ? 55 VAL A HG22 5  
ATOM 5676  H HG23 . VAL A 1 55 ? 10.644 7.253   3.475   1.00 0.00 ? 55 VAL A HG23 5  
ATOM 5677  N N    . GLN A 1 56 ? 13.155 8.427   4.751   1.00 0.00 ? 56 GLN A N    5  
ATOM 5678  C CA   . GLN A 1 56 ? 14.288 7.925   5.512   1.00 0.00 ? 56 GLN A CA   5  
ATOM 5679  C C    . GLN A 1 56 ? 14.401 6.410   5.382   1.00 0.00 ? 56 GLN A C    5  
ATOM 5680  O O    . GLN A 1 56 ? 13.560 5.658   5.866   1.00 0.00 ? 56 GLN A O    5  
ATOM 5681  C CB   . GLN A 1 56 ? 14.155 8.326   6.984   1.00 0.00 ? 56 GLN A CB   5  
ATOM 5682  C CG   . GLN A 1 56 ? 15.267 7.808   7.882   1.00 0.00 ? 56 GLN A CG   5  
ATOM 5683  C CD   . GLN A 1 56 ? 15.298 8.472   9.247   1.00 0.00 ? 56 GLN A CD   5  
ATOM 5684  O OE1  . GLN A 1 56 ? 14.273 8.900   9.753   1.00 0.00 ? 56 GLN A OE1  5  
ATOM 5685  N NE2  . GLN A 1 56 ? 16.482 8.589   9.820   1.00 0.00 ? 56 GLN A NE2  5  
ATOM 5686  H H    . GLN A 1 56 ? 12.263 8.376   5.156   1.00 0.00 ? 56 GLN A H    5  
ATOM 5687  H HA   . GLN A 1 56 ? 15.191 8.375   5.101   1.00 0.00 ? 56 GLN A HA   5  
ATOM 5688  H HB2  . GLN A 1 56 ? 14.163 9.409   7.045   1.00 0.00 ? 56 GLN A HB2  5  
ATOM 5689  H HB3  . GLN A 1 56 ? 13.211 7.962   7.350   1.00 0.00 ? 56 GLN A HB3  5  
ATOM 5690  H HG2  . GLN A 1 56 ? 15.132 6.732   8.028   1.00 0.00 ? 56 GLN A HG2  5  
ATOM 5691  H HG3  . GLN A 1 56 ? 16.209 7.989   7.399   1.00 0.00 ? 56 GLN A HG3  5  
ATOM 5692  H HE21 . GLN A 1 56 ? 17.267 8.242   9.344   1.00 0.00 ? 56 GLN A HE21 5  
ATOM 5693  H HE22 . GLN A 1 56 ? 16.529 9.007   10.712  1.00 0.00 ? 56 GLN A HE22 5  
ATOM 5694  N N    . VAL A 1 57 ? 15.452 5.978   4.711   1.00 0.00 ? 57 VAL A N    5  
ATOM 5695  C CA   . VAL A 1 57 ? 15.665 4.567   4.428   1.00 0.00 ? 57 VAL A CA   5  
ATOM 5696  C C    . VAL A 1 57 ? 17.017 4.127   4.988   1.00 0.00 ? 57 VAL A C    5  
ATOM 5697  O O    . VAL A 1 57 ? 18.000 4.860   4.927   1.00 0.00 ? 57 VAL A O    5  
ATOM 5698  C CB   . VAL A 1 57 ? 15.654 4.323   2.896   1.00 0.00 ? 57 VAL A CB   5  
ATOM 5699  C CG1  . VAL A 1 57 ? 15.946 2.858   2.564   1.00 0.00 ? 57 VAL A CG1  5  
ATOM 5700  C CG2  . VAL A 1 57 ? 14.315 4.755   2.299   1.00 0.00 ? 57 VAL A CG2  5  
ATOM 5701  H H    . VAL A 1 57 ? 16.136 6.618   4.405   1.00 0.00 ? 57 VAL A H    5  
ATOM 5702  H HA   . VAL A 1 57 ? 14.876 3.997   4.885   1.00 0.00 ? 57 VAL A HA   5  
ATOM 5703  H HB   . VAL A 1 57 ? 16.430 4.928   2.451   1.00 0.00 ? 57 VAL A HB   5  
ATOM 5704  H HG11 . VAL A 1 57 ? 16.922 2.605   2.923   1.00 0.00 ? 57 VAL A HG11 5  
ATOM 5705  H HG12 . VAL A 1 57 ? 15.902 2.718   1.500   1.00 0.00 ? 57 VAL A HG12 5  
ATOM 5706  H HG13 . VAL A 1 57 ? 15.202 2.224   3.037   1.00 0.00 ? 57 VAL A HG13 5  
ATOM 5707  H HG21 . VAL A 1 57 ? 14.316 4.525   1.243   1.00 0.00 ? 57 VAL A HG21 5  
ATOM 5708  H HG22 . VAL A 1 57 ? 14.180 5.823   2.443   1.00 0.00 ? 57 VAL A HG22 5  
ATOM 5709  H HG23 . VAL A 1 57 ? 13.522 4.221   2.779   1.00 0.00 ? 57 VAL A HG23 5  
ATOM 5710  N N    . PHE A 1 58 ? 17.067 2.915   5.545   1.00 0.00 ? 58 PHE A N    5  
ATOM 5711  C CA   . PHE A 1 58 ? 18.329 2.361   5.996   1.00 0.00 ? 58 PHE A CA   5  
ATOM 5712  C C    . PHE A 1 58 ? 18.901 1.471   4.898   1.00 0.00 ? 58 PHE A C    5  
ATOM 5713  O O    . PHE A 1 58 ? 18.367 0.405   4.605   1.00 0.00 ? 58 PHE A O    5  
ATOM 5714  C CB   . PHE A 1 58 ? 18.131 1.560   7.284   1.00 0.00 ? 58 PHE A CB   5  
ATOM 5715  C CG   . PHE A 1 58 ? 19.426 1.041   7.854   1.00 0.00 ? 58 PHE A CG   5  
ATOM 5716  C CD1  . PHE A 1 58 ? 20.273 1.880   8.576   1.00 0.00 ? 58 PHE A CD1  5  
ATOM 5717  C CD2  . PHE A 1 58 ? 19.803 -0.281  7.672   1.00 0.00 ? 58 PHE A CD2  5  
ATOM 5718  C CE1  . PHE A 1 58 ? 21.458 1.400   9.094   1.00 0.00 ? 58 PHE A CE1  5  
ATOM 5719  C CE2  . PHE A 1 58 ? 20.984 -0.758  8.200   1.00 0.00 ? 58 PHE A CE2  5  
ATOM 5720  C CZ   . PHE A 1 58 ? 21.817 0.081   8.916   1.00 0.00 ? 58 PHE A CZ   5  
ATOM 5721  H H    . PHE A 1 58 ? 16.248 2.389   5.629   1.00 0.00 ? 58 PHE A H    5  
ATOM 5722  H HA   . PHE A 1 58 ? 19.009 3.179   6.192   1.00 0.00 ? 58 PHE A HA   5  
ATOM 5723  H HB2  . PHE A 1 58 ? 17.663 2.182   8.040   1.00 0.00 ? 58 PHE A HB2  5  
ATOM 5724  H HB3  . PHE A 1 58 ? 17.496 0.710   7.083   1.00 0.00 ? 58 PHE A HB3  5  
ATOM 5725  H HD1  . PHE A 1 58 ? 19.999 2.901   8.726   1.00 0.00 ? 58 PHE A HD1  5  
ATOM 5726  H HD2  . PHE A 1 58 ? 19.157 -0.943  7.107   1.00 0.00 ? 58 PHE A HD2  5  
ATOM 5727  H HE1  . PHE A 1 58 ? 22.113 2.070   9.652   1.00 0.00 ? 58 PHE A HE1  5  
ATOM 5728  H HE2  . PHE A 1 58 ? 21.262 -1.785  8.047   1.00 0.00 ? 58 PHE A HE2  5  
ATOM 5729  H HZ   . PHE A 1 58 ? 22.737 -0.288  9.330   1.00 0.00 ? 58 PHE A HZ   5  
ATOM 5730  N N    . TRP A 1 59 ? 19.984 1.922   4.309   1.00 0.00 ? 59 TRP A N    5  
ATOM 5731  C CA   . TRP A 1 59 ? 20.622 1.188   3.226   1.00 0.00 ? 59 TRP A CA   5  
ATOM 5732  C C    . TRP A 1 59 ? 21.530 0.122   3.796   1.00 0.00 ? 59 TRP A C    5  
ATOM 5733  O O    . TRP A 1 59 ? 22.523 0.428   4.433   1.00 0.00 ? 59 TRP A O    5  
ATOM 5734  C CB   . TRP A 1 59 ? 21.387 2.141   2.304   1.00 0.00 ? 59 TRP A CB   5  
ATOM 5735  C CG   . TRP A 1 59 ? 20.473 3.068   1.571   1.00 0.00 ? 59 TRP A CG   5  
ATOM 5736  C CD1  . TRP A 1 59 ? 20.280 4.404   1.810   1.00 0.00 ? 59 TRP A CD1  5  
ATOM 5737  C CD2  . TRP A 1 59 ? 19.624 2.732   0.473   1.00 0.00 ? 59 TRP A CD2  5  
ATOM 5738  N NE1  . TRP A 1 59 ? 19.370 4.915   0.915   1.00 0.00 ? 59 TRP A NE1  5  
ATOM 5739  C CE2  . TRP A 1 59 ? 18.947 3.913   0.097   1.00 0.00 ? 59 TRP A CE2  5  
ATOM 5740  C CE3  . TRP A 1 59 ? 19.364 1.550   -0.228  1.00 0.00 ? 59 TRP A CE3  5  
ATOM 5741  C CZ2  . TRP A 1 59 ? 18.043 3.937   -0.954  1.00 0.00 ? 59 TRP A CZ2  5  
ATOM 5742  C CZ3  . TRP A 1 59 ? 18.453 1.579   -1.274  1.00 0.00 ? 59 TRP A CZ3  5  
ATOM 5743  C CH2  . TRP A 1 59 ? 17.813 2.769   -1.626  1.00 0.00 ? 59 TRP A CH2  5  
ATOM 5744  H H    . TRP A 1 59 ? 20.377 2.768   4.629   1.00 0.00 ? 59 TRP A H    5  
ATOM 5745  H HA   . TRP A 1 59 ? 19.833 0.705   2.664   1.00 0.00 ? 59 TRP A HA   5  
ATOM 5746  H HB2  . TRP A 1 59 ? 22.059 2.736   2.905   1.00 0.00 ? 59 TRP A HB2  5  
ATOM 5747  H HB3  . TRP A 1 59 ? 21.942 1.571   1.578   1.00 0.00 ? 59 TRP A HB3  5  
ATOM 5748  H HD1  . TRP A 1 59 ? 20.793 4.967   2.575   1.00 0.00 ? 59 TRP A HD1  5  
ATOM 5749  H HE1  . TRP A 1 59 ? 19.068 5.843   0.887   1.00 0.00 ? 59 TRP A HE1  5  
ATOM 5750  H HE3  . TRP A 1 59 ? 19.853 0.621   0.043   1.00 0.00 ? 59 TRP A HE3  5  
ATOM 5751  H HZ2  . TRP A 1 59 ? 17.532 4.834   -1.239  1.00 0.00 ? 59 TRP A HZ2  5  
ATOM 5752  H HZ3  . TRP A 1 59 ? 18.242 0.679   -1.835  1.00 0.00 ? 59 TRP A HZ3  5  
ATOM 5753  H HH2  . TRP A 1 59 ? 17.096 2.742   -2.446  1.00 0.00 ? 59 TRP A HH2  5  
ATOM 5754  N N    . GLU A 1 60 ? 21.182 -1.138  3.576   1.00 0.00 ? 60 GLU A N    5  
ATOM 5755  C CA   . GLU A 1 60 ? 21.911 -2.250  4.148   1.00 0.00 ? 60 GLU A CA   5  
ATOM 5756  C C    . GLU A 1 60 ? 23.186 -2.493  3.373   1.00 0.00 ? 60 GLU A C    5  
ATOM 5757  O O    . GLU A 1 60 ? 24.148 -3.090  3.883   1.00 0.00 ? 60 GLU A O    5  
ATOM 5758  C CB   . GLU A 1 60 ? 21.045 -3.517  4.188   1.00 0.00 ? 60 GLU A CB   5  
ATOM 5759  C CG   . GLU A 1 60 ? 20.684 -4.055  2.806   1.00 0.00 ? 60 GLU A CG   5  
ATOM 5760  C CD   . GLU A 1 60 ? 19.874 -5.334  2.899   1.00 0.00 ? 60 GLU A CD   5  
ATOM 5761  O OE1  . GLU A 1 60 ? 20.468 -6.422  2.981   1.00 0.00 ? 60 GLU A OE1  5  
ATOM 5762  O OE2  . GLU A 1 60 ? 18.635 -5.250  2.859   1.00 0.00 ? 60 GLU A OE2  5  
ATOM 5763  H H    . GLU A 1 60 ? 20.443 -1.326  2.967   1.00 0.00 ? 60 GLU A H    5  
ATOM 5764  H HA   . GLU A 1 60 ? 22.171 -1.973  5.156   1.00 0.00 ? 60 GLU A HA   5  
ATOM 5765  H HB2  . GLU A 1 60 ? 21.567 -4.263  4.729   1.00 0.00 ? 60 GLU A HB2  5  
ATOM 5766  H HB3  . GLU A 1 60 ? 20.119 -3.287  4.711   1.00 0.00 ? 60 GLU A HB3  5  
ATOM 5767  H HG2  . GLU A 1 60 ? 20.100 -3.312  2.271   1.00 0.00 ? 60 GLU A HG2  5  
ATOM 5768  H HG3  . GLU A 1 60 ? 21.607 -4.250  2.269   1.00 0.00 ? 60 GLU A HG3  5  
ATOM 5769  N N    . SER A 1 61 ? 23.220 -2.001  2.134   1.00 0.00 ? 61 SER A N    5  
ATOM 5770  C CA   . SER A 1 61 ? 24.392 -2.107  1.284   1.00 0.00 ? 61 SER A CA   5  
ATOM 5771  C C    . SER A 1 61 ? 25.556 -1.300  1.863   1.00 0.00 ? 61 SER A C    5  
ATOM 5772  O O    . SER A 1 61 ? 26.699 -1.771  1.917   1.00 0.00 ? 61 SER A O    5  
ATOM 5773  C CB   . SER A 1 61 ? 24.036 -1.598  -0.119  1.00 0.00 ? 61 SER A CB   5  
ATOM 5774  O OG   . SER A 1 61 ? 25.136 -1.697  -1.018  1.00 0.00 ? 61 SER A OG   5  
ATOM 5775  H H    . SER A 1 61 ? 22.415 -1.572  1.780   1.00 0.00 ? 61 SER A H    5  
ATOM 5776  H HA   . SER A 1 61 ? 24.661 -3.148  1.220   1.00 0.00 ? 61 SER A HA   5  
ATOM 5777  H HB2  . SER A 1 61 ? 23.222 -2.183  -0.508  1.00 0.00 ? 61 SER A HB2  5  
ATOM 5778  H HB3  . SER A 1 61 ? 23.740 -0.566  -0.053  1.00 0.00 ? 61 SER A HB3  5  
ATOM 5779  H HG   . SER A 1 61 ? 24.882 -1.326  -1.878  1.00 0.00 ? 61 SER A HG   5  
ATOM 5780  N N    . THR A 1 62 ? 25.247 -0.105  2.320   1.00 0.00 ? 62 THR A N    5  
ATOM 5781  C CA   . THR A 1 62 ? 26.258 0.792   2.882   1.00 0.00 ? 62 THR A CA   5  
ATOM 5782  C C    . THR A 1 62 ? 26.278 0.675   4.400   1.00 0.00 ? 62 THR A C    5  
ATOM 5783  O O    . THR A 1 62 ? 27.315 0.809   5.049   1.00 0.00 ? 62 THR A O    5  
ATOM 5784  C CB   . THR A 1 62 ? 25.960 2.252   2.484   1.00 0.00 ? 62 THR A CB   5  
ATOM 5785  O OG1  . THR A 1 62 ? 25.470 2.289   1.144   1.00 0.00 ? 62 THR A OG1  5  
ATOM 5786  C CG2  . THR A 1 62 ? 27.211 3.120   2.606   1.00 0.00 ? 62 THR A CG2  5  
ATOM 5787  H H    . THR A 1 62 ? 24.317 0.189   2.293   1.00 0.00 ? 62 THR A H    5  
ATOM 5788  H HA   . THR A 1 62 ? 27.219 0.508   2.478   1.00 0.00 ? 62 THR A HA   5  
ATOM 5789  H HB   . THR A 1 62 ? 25.203 2.641   3.147   1.00 0.00 ? 62 THR A HB   5  
ATOM 5790  H HG1  . THR A 1 62 ? 26.020 1.709   0.581   1.00 0.00 ? 62 THR A HG1  5  
ATOM 5791  H HG21 . THR A 1 62 ? 27.945 2.764   1.912   1.00 0.00 ? 62 THR A HG21 5  
ATOM 5792  H HG22 . THR A 1 62 ? 27.599 3.071   3.617   1.00 0.00 ? 62 THR A HG22 5  
ATOM 5793  H HG23 . THR A 1 62 ? 26.957 4.141   2.363   1.00 0.00 ? 62 THR A HG23 5  
ATOM 5794  N N    . GLY A 1 63 ? 25.105 0.429   4.970   1.00 0.00 ? 63 GLY A N    5  
ATOM 5795  C CA   . GLY A 1 63 ? 24.993 0.253   6.413   1.00 0.00 ? 63 GLY A CA   5  
ATOM 5796  C C    . GLY A 1 63 ? 24.662 1.561   7.116   1.00 0.00 ? 63 GLY A C    5  
ATOM 5797  O O    . GLY A 1 63 ? 24.944 1.718   8.305   1.00 0.00 ? 63 GLY A O    5  
ATOM 5798  H H    . GLY A 1 63 ? 24.309 0.390   4.408   1.00 0.00 ? 63 GLY A H    5  
ATOM 5799  H HA2  . GLY A 1 63 ? 24.206 -0.464  6.611   1.00 0.00 ? 63 GLY A HA2  5  
ATOM 5800  H HA3  . GLY A 1 63 ? 25.927 -0.127  6.794   1.00 0.00 ? 63 GLY A HA3  5  
ATOM 5801  N N    . ARG A 1 64 ? 24.064 2.485   6.380   1.00 0.00 ? 64 ARG A N    5  
ATOM 5802  C CA   . ARG A 1 64 ? 23.750 3.801   6.936   1.00 0.00 ? 64 ARG A CA   5  
ATOM 5803  C C    . ARG A 1 64 ? 22.312 4.216   6.606   1.00 0.00 ? 64 ARG A C    5  
ATOM 5804  O O    . ARG A 1 64 ? 21.737 3.794   5.598   1.00 0.00 ? 64 ARG A O    5  
ATOM 5805  C CB   . ARG A 1 64 ? 24.711 4.852   6.403   1.00 0.00 ? 64 ARG A CB   5  
ATOM 5806  C CG   . ARG A 1 64 ? 24.664 5.011   4.890   1.00 0.00 ? 64 ARG A CG   5  
ATOM 5807  C CD   . ARG A 1 64 ? 25.357 6.286   4.428   1.00 0.00 ? 64 ARG A CD   5  
ATOM 5808  N NE   . ARG A 1 64 ? 26.786 6.325   4.779   1.00 0.00 ? 64 ARG A NE   5  
ATOM 5809  C CZ   . ARG A 1 64 ? 27.416 7.436   5.134   1.00 0.00 ? 64 ARG A CZ   5  
ATOM 5810  N NH1  . ARG A 1 64 ? 26.755 8.567   5.306   1.00 0.00 ? 64 ARG A NH1  5  
ATOM 5811  N NH2  . ARG A 1 64 ? 28.730 7.399   5.358   1.00 0.00 ? 64 ARG A NH2  5  
ATOM 5812  H H    . ARG A 1 64 ? 23.818 2.278   5.448   1.00 0.00 ? 64 ARG A H    5  
ATOM 5813  H HA   . ARG A 1 64 ? 23.857 3.726   8.012   1.00 0.00 ? 64 ARG A HA   5  
ATOM 5814  H HB2  . ARG A 1 64 ? 24.465 5.810   6.846   1.00 0.00 ? 64 ARG A HB2  5  
ATOM 5815  H HB3  . ARG A 1 64 ? 25.720 4.581   6.685   1.00 0.00 ? 64 ARG A HB3  5  
ATOM 5816  H HG2  . ARG A 1 64 ? 25.154 4.163   4.433   1.00 0.00 ? 64 ARG A HG2  5  
ATOM 5817  H HG3  . ARG A 1 64 ? 23.631 5.038   4.582   1.00 0.00 ? 64 ARG A HG3  5  
ATOM 5818  H HD2  . ARG A 1 64 ? 25.276 6.349   3.358   1.00 0.00 ? 64 ARG A HD2  5  
ATOM 5819  H HD3  . ARG A 1 64 ? 24.872 7.140   4.883   1.00 0.00 ? 64 ARG A HD3  5  
ATOM 5820  H HE   . ARG A 1 64 ? 27.304 5.483   4.718   1.00 0.00 ? 64 ARG A HE   5  
ATOM 5821  H HH11 . ARG A 1 64 ? 25.753 8.580   5.174   1.00 0.00 ? 64 ARG A HH11 5  
ATOM 5822  H HH12 . ARG A 1 64 ? 27.233 9.419   5.554   1.00 0.00 ? 64 ARG A HH12 5  
ATOM 5823  H HH21 . ARG A 1 64 ? 29.240 6.528   5.263   1.00 0.00 ? 64 ARG A HH21 5  
ATOM 5824  H HH22 . ARG A 1 64 ? 29.231 8.247   5.620   1.00 0.00 ? 64 ARG A HH22 5  
ATOM 5825  N N    . THR A 1 65 ? 21.744 5.024   7.480   1.00 0.00 ? 65 THR A N    5  
ATOM 5826  C CA   . THR A 1 65 ? 20.450 5.618   7.246   1.00 0.00 ? 65 THR A CA   5  
ATOM 5827  C C    . THR A 1 65 ? 20.605 6.841   6.347   1.00 0.00 ? 65 THR A C    5  
ATOM 5828  O O    . THR A 1 65 ? 21.564 7.613   6.500   1.00 0.00 ? 65 THR A O    5  
ATOM 5829  C CB   . THR A 1 65 ? 19.798 6.039   8.576   1.00 0.00 ? 65 THR A CB   5  
ATOM 5830  O OG1  . THR A 1 65 ? 20.121 5.087   9.605   1.00 0.00 ? 65 THR A OG1  5  
ATOM 5831  C CG2  . THR A 1 65 ? 18.291 6.146   8.437   1.00 0.00 ? 65 THR A CG2  5  
ATOM 5832  H H    . THR A 1 65 ? 22.192 5.209   8.332   1.00 0.00 ? 65 THR A H    5  
ATOM 5833  H HA   . THR A 1 65 ? 19.811 4.888   6.766   1.00 0.00 ? 65 THR A HA   5  
ATOM 5834  H HB   . THR A 1 65 ? 20.183 7.005   8.858   1.00 0.00 ? 65 THR A HB   5  
ATOM 5835  H HG1  . THR A 1 65 ? 20.014 5.510   10.472  1.00 0.00 ? 65 THR A HG1  5  
ATOM 5836  H HG21 . THR A 1 65 ? 17.866 6.456   9.374   1.00 0.00 ? 65 THR A HG21 5  
ATOM 5837  H HG22 . THR A 1 65 ? 17.902 5.181   8.170   1.00 0.00 ? 65 THR A HG22 5  
ATOM 5838  H HG23 . THR A 1 65 ? 18.045 6.863   7.670   1.00 0.00 ? 65 THR A HG23 5  
ATOM 5839  N N    . TYR A 1 66 ? 19.697 7.010   5.400   1.00 0.00 ? 66 TYR A N    5  
ATOM 5840  C CA   . TYR A 1 66 ? 19.783 8.109   4.451   1.00 0.00 ? 66 TYR A CA   5  
ATOM 5841  C C    . TYR A 1 66 ? 18.400 8.519   3.945   1.00 0.00 ? 66 TYR A C    5  
ATOM 5842  O O    . TYR A 1 66 ? 17.494 7.702   3.890   1.00 0.00 ? 66 TYR A O    5  
ATOM 5843  C CB   . TYR A 1 66 ? 20.699 7.714   3.286   1.00 0.00 ? 66 TYR A CB   5  
ATOM 5844  C CG   . TYR A 1 66 ? 21.110 8.874   2.393   1.00 0.00 ? 66 TYR A CG   5  
ATOM 5845  C CD1  . TYR A 1 66 ? 21.951 9.878   2.878   1.00 0.00 ? 66 TYR A CD1  5  
ATOM 5846  C CD2  . TYR A 1 66 ? 20.659 8.970   1.081   1.00 0.00 ? 66 TYR A CD2  5  
ATOM 5847  C CE1  . TYR A 1 66 ? 22.323 10.935  2.060   1.00 0.00 ? 66 TYR A CE1  5  
ATOM 5848  C CE2  . TYR A 1 66 ? 21.027 10.021  0.275   1.00 0.00 ? 66 TYR A CE2  5  
ATOM 5849  C CZ   . TYR A 1 66 ? 21.865 10.998  0.769   1.00 0.00 ? 66 TYR A CZ   5  
ATOM 5850  O OH   . TYR A 1 66 ? 22.232 12.049  -0.031  1.00 0.00 ? 66 TYR A OH   5  
ATOM 5851  H H    . TYR A 1 66 ? 18.922 6.391   5.363   1.00 0.00 ? 66 TYR A H    5  
ATOM 5852  H HA   . TYR A 1 66 ? 20.215 8.951   4.964   1.00 0.00 ? 66 TYR A HA   5  
ATOM 5853  H HB2  . TYR A 1 66 ? 21.606 7.267   3.677   1.00 0.00 ? 66 TYR A HB2  5  
ATOM 5854  H HB3  . TYR A 1 66 ? 20.179 6.992   2.664   1.00 0.00 ? 66 TYR A HB3  5  
ATOM 5855  H HD1  . TYR A 1 66 ? 22.296 9.832   3.898   1.00 0.00 ? 66 TYR A HD1  5  
ATOM 5856  H HD2  . TYR A 1 66 ? 19.998 8.199   0.703   1.00 0.00 ? 66 TYR A HD2  5  
ATOM 5857  H HE1  . TYR A 1 66 ? 22.980 11.706  2.454   1.00 0.00 ? 66 TYR A HE1  5  
ATOM 5858  H HE2  . TYR A 1 66 ? 20.665 10.064  -0.742  1.00 0.00 ? 66 TYR A HE2  5  
ATOM 5859  H HH   . TYR A 1 66 ? 23.174 12.242  0.104   1.00 0.00 ? 66 TYR A HH   5  
ATOM 5860  N N    . TRP A 1 67 ? 18.255 9.799   3.620   1.00 0.00 ? 67 TRP A N    5  
ATOM 5861  C CA   . TRP A 1 67 ? 17.000 10.330  3.098   1.00 0.00 ? 67 TRP A CA   5  
ATOM 5862  C C    . TRP A 1 67 ? 17.063 10.387  1.577   1.00 0.00 ? 67 TRP A C    5  
ATOM 5863  O O    . TRP A 1 67 ? 17.908 11.079  1.020   1.00 0.00 ? 67 TRP A O    5  
ATOM 5864  C CB   . TRP A 1 67 ? 16.707 11.723  3.666   1.00 0.00 ? 67 TRP A CB   5  
ATOM 5865  C CG   . TRP A 1 67 ? 16.496 11.728  5.155   1.00 0.00 ? 67 TRP A CG   5  
ATOM 5866  C CD1  . TRP A 1 67 ? 15.295 11.740  5.808   1.00 0.00 ? 67 TRP A CD1  5  
ATOM 5867  C CD2  . TRP A 1 67 ? 17.501 11.703  6.176   1.00 0.00 ? 67 TRP A CD2  5  
ATOM 5868  N NE1  . TRP A 1 67 ? 15.493 11.740  7.160   1.00 0.00 ? 67 TRP A NE1  5  
ATOM 5869  C CE2  . TRP A 1 67 ? 16.837 11.707  7.412   1.00 0.00 ? 67 TRP A CE2  5  
ATOM 5870  C CE3  . TRP A 1 67 ? 18.911 11.667  6.161   1.00 0.00 ? 67 TRP A CE3  5  
ATOM 5871  C CZ2  . TRP A 1 67 ? 17.525 11.683  8.629   1.00 0.00 ? 67 TRP A CZ2  5  
ATOM 5872  C CZ3  . TRP A 1 67 ? 19.588 11.642  7.367   1.00 0.00 ? 67 TRP A CZ3  5  
ATOM 5873  C CH2  . TRP A 1 67 ? 18.900 11.655  8.591   1.00 0.00 ? 67 TRP A CH2  5  
ATOM 5874  H H    . TRP A 1 67 ? 19.015 10.411  3.726   1.00 0.00 ? 67 TRP A H    5  
ATOM 5875  H HA   . TRP A 1 67 ? 16.211 9.649   3.389   1.00 0.00 ? 67 TRP A HA   5  
ATOM 5876  H HB2  . TRP A 1 67 ? 17.529 12.381  3.449   1.00 0.00 ? 67 TRP A HB2  5  
ATOM 5877  H HB3  . TRP A 1 67 ? 15.803 12.118  3.205   1.00 0.00 ? 67 TRP A HB3  5  
ATOM 5878  H HD1  . TRP A 1 67 ? 14.326 11.773  5.318   1.00 0.00 ? 67 TRP A HD1  5  
ATOM 5879  H HE1  . TRP A 1 67 ? 14.783 11.750  7.849   1.00 0.00 ? 67 TRP A HE1  5  
ATOM 5880  H HE3  . TRP A 1 67 ? 19.458 11.663  5.224   1.00 0.00 ? 67 TRP A HE3  5  
ATOM 5881  H HZ2  . TRP A 1 67 ? 17.011 11.689  9.586   1.00 0.00 ? 67 TRP A HZ2  5  
ATOM 5882  H HZ3  . TRP A 1 67 ? 20.666 11.615  7.376   1.00 0.00 ? 67 TRP A HZ3  5  
ATOM 5883  H HH2  . TRP A 1 67 ? 19.467 11.621  9.507   1.00 0.00 ? 67 TRP A HH2  5  
ATOM 5884  N N    . VAL A 1 68 ? 16.198 9.659   0.929   1.00 0.00 ? 68 VAL A N    5  
ATOM 5885  C CA   . VAL A 1 68 ? 16.234 9.532   -0.529  1.00 0.00 ? 68 VAL A CA   5  
ATOM 5886  C C    . VAL A 1 68 ? 14.954 10.106  -1.131  1.00 0.00 ? 68 VAL A C    5  
ATOM 5887  O O    . VAL A 1 68 ? 14.088 10.595  -0.398  1.00 0.00 ? 68 VAL A O    5  
ATOM 5888  C CB   . VAL A 1 68 ? 16.384 8.042   -0.935  1.00 0.00 ? 68 VAL A CB   5  
ATOM 5889  C CG1  . VAL A 1 68 ? 17.145 7.918   -2.250  1.00 0.00 ? 68 VAL A CG1  5  
ATOM 5890  C CG2  . VAL A 1 68 ? 17.074 7.244   0.153   1.00 0.00 ? 68 VAL A CG2  5  
ATOM 5891  H H    . VAL A 1 68 ? 15.492 9.169   1.419   1.00 0.00 ? 68 VAL A H    5  
ATOM 5892  H HA   . VAL A 1 68 ? 17.080 10.091  -0.899  1.00 0.00 ? 68 VAL A HA   5  
ATOM 5893  H HB   . VAL A 1 68 ? 15.393 7.639   -1.084  1.00 0.00 ? 68 VAL A HB   5  
ATOM 5894  H HG11 . VAL A 1 68 ? 16.536 8.278   -3.061  1.00 0.00 ? 68 VAL A HG11 5  
ATOM 5895  H HG12 . VAL A 1 68 ? 17.398 6.879   -2.419  1.00 0.00 ? 68 VAL A HG12 5  
ATOM 5896  H HG13 . VAL A 1 68 ? 18.056 8.511   -2.197  1.00 0.00 ? 68 VAL A HG13 5  
ATOM 5897  H HG21 . VAL A 1 68 ? 16.475 7.282   1.047   1.00 0.00 ? 68 VAL A HG21 5  
ATOM 5898  H HG22 . VAL A 1 68 ? 18.047 7.664   0.359   1.00 0.00 ? 68 VAL A HG22 5  
ATOM 5899  H HG23 . VAL A 1 68 ? 17.182 6.214   -0.159  1.00 0.00 ? 68 VAL A HG23 5  
ATOM 5900  N N    . HIS A 1 69 ? 14.821 10.062  -2.445  1.00 0.00 ? 69 HIS A N    5  
ATOM 5901  C CA   . HIS A 1 69 ? 13.595 10.481  -3.104  1.00 0.00 ? 69 HIS A CA   5  
ATOM 5902  C C    . HIS A 1 69 ? 12.795 9.254   -3.541  1.00 0.00 ? 69 HIS A C    5  
ATOM 5903  O O    . HIS A 1 69 ? 13.340 8.297   -4.066  1.00 0.00 ? 69 HIS A O    5  
ATOM 5904  C CB   . HIS A 1 69 ? 13.901 11.362  -4.328  1.00 0.00 ? 69 HIS A CB   5  
ATOM 5905  C CG   . HIS A 1 69 ? 14.565 12.664  -4.023  1.00 0.00 ? 69 HIS A CG   5  
ATOM 5906  N ND1  . HIS A 1 69 ? 13.963 13.896  -4.220  1.00 0.00 ? 69 HIS A ND1  5  
ATOM 5907  C CD2  . HIS A 1 69 ? 15.803 12.952  -3.554  1.00 0.00 ? 69 HIS A CD2  5  
ATOM 5908  C CE1  . HIS A 1 69 ? 14.799 14.854  -3.900  1.00 0.00 ? 69 HIS A CE1  5  
ATOM 5909  N NE2  . HIS A 1 69 ? 15.925 14.308  -3.486  1.00 0.00 ? 69 HIS A NE2  5  
ATOM 5910  H H    . HIS A 1 69 ? 15.585 9.751   -2.989  1.00 0.00 ? 69 HIS A H    5  
ATOM 5911  H HA   . HIS A 1 69 ? 13.005 11.053  -2.399  1.00 0.00 ? 69 HIS A HA   5  
ATOM 5912  H HB2  . HIS A 1 69 ? 14.549 10.824  -4.998  1.00 0.00 ? 69 HIS A HB2  5  
ATOM 5913  H HB3  . HIS A 1 69 ? 12.984 11.587  -4.852  1.00 0.00 ? 69 HIS A HB3  5  
ATOM 5914  H HD1  . HIS A 1 69 ? 13.054 14.030  -4.582  1.00 0.00 ? 69 HIS A HD1  5  
ATOM 5915  H HD2  . HIS A 1 69 ? 16.563 12.230  -3.273  1.00 0.00 ? 69 HIS A HD2  5  
ATOM 5916  H HE1  . HIS A 1 69 ? 14.614 15.912  -3.980  1.00 0.00 ? 69 HIS A HE1  5  
ATOM 5917  H HE2  . HIS A 1 69 ? 16.790 14.806  -3.391  1.00 0.00 ? 69 HIS A HE2  5  
ATOM 5918  N N    . TRP A 1 70 ? 11.481 9.299   -3.314  1.00 0.00 ? 70 TRP A N    5  
ATOM 5919  C CA   . TRP A 1 70 ? 10.582 8.189   -3.665  1.00 0.00 ? 70 TRP A CA   5  
ATOM 5920  C C    . TRP A 1 70 ? 10.728 7.734   -5.114  1.00 0.00 ? 70 TRP A C    5  
ATOM 5921  O O    . TRP A 1 70 ? 10.618 6.539   -5.404  1.00 0.00 ? 70 TRP A O    5  
ATOM 5922  C CB   . TRP A 1 70 ? 9.118  8.575   -3.423  1.00 0.00 ? 70 TRP A CB   5  
ATOM 5923  C CG   . TRP A 1 70 ? 8.734  8.743   -1.982  1.00 0.00 ? 70 TRP A CG   5  
ATOM 5924  C CD1  . TRP A 1 70 ? 8.583  9.913   -1.291  1.00 0.00 ? 70 TRP A CD1  5  
ATOM 5925  C CD2  . TRP A 1 70 ? 8.431  7.698   -1.037  1.00 0.00 ? 70 TRP A CD2  5  
ATOM 5926  N NE1  . TRP A 1 70 ? 8.210  9.660   -0.006  1.00 0.00 ? 70 TRP A NE1  5  
ATOM 5927  C CE2  . TRP A 1 70 ? 8.098  8.316   0.172   1.00 0.00 ? 70 TRP A CE2  5  
ATOM 5928  C CE3  . TRP A 1 70 ? 8.393  6.308   -1.131  1.00 0.00 ? 70 TRP A CE3  5  
ATOM 5929  C CZ2  . TRP A 1 70 ? 7.751  7.580   1.297   1.00 0.00 ? 70 TRP A CZ2  5  
ATOM 5930  C CZ3  . TRP A 1 70 ? 8.040  5.580   -0.003  1.00 0.00 ? 70 TRP A CZ3  5  
ATOM 5931  C CH2  . TRP A 1 70 ? 7.736  6.215   1.201   1.00 0.00 ? 70 TRP A CH2  5  
ATOM 5932  H H    . TRP A 1 70 ? 11.108 10.082  -2.865  1.00 0.00 ? 70 TRP A H    5  
ATOM 5933  H HA   . TRP A 1 70 ? 10.818 7.377   -3.011  1.00 0.00 ? 70 TRP A HA   5  
ATOM 5934  H HB2  . TRP A 1 70 ? 8.907  9.506   -3.927  1.00 0.00 ? 70 TRP A HB2  5  
ATOM 5935  H HB3  . TRP A 1 70 ? 8.482  7.801   -3.840  1.00 0.00 ? 70 TRP A HB3  5  
ATOM 5936  H HD1  . TRP A 1 70 ? 8.760  10.887  -1.731  1.00 0.00 ? 70 TRP A HD1  5  
ATOM 5937  H HE1  . TRP A 1 70 ? 8.040  10.344  0.688   1.00 0.00 ? 70 TRP A HE1  5  
ATOM 5938  H HE3  . TRP A 1 70 ? 8.632  5.797   -2.049  1.00 0.00 ? 70 TRP A HE3  5  
ATOM 5939  H HZ2  . TRP A 1 70 ? 7.498  8.065   2.215   1.00 0.00 ? 70 TRP A HZ2  5  
ATOM 5940  H HZ3  . TRP A 1 70 ? 8.016  4.506   -0.042  1.00 0.00 ? 70 TRP A HZ3  5  
ATOM 5941  H HH2  . TRP A 1 70 ? 7.468  5.616   2.056   1.00 0.00 ? 70 TRP A HH2  5  
ATOM 5942  N N    . HIS A 1 71 ? 10.968 8.669   -6.037  1.00 0.00 ? 71 HIS A N    5  
ATOM 5943  C CA   . HIS A 1 71 ? 10.936 8.356   -7.464  1.00 0.00 ? 71 HIS A CA   5  
ATOM 5944  C C    . HIS A 1 71 ? 12.020 7.343   -7.874  1.00 0.00 ? 71 HIS A C    5  
ATOM 5945  O O    . HIS A 1 71 ? 11.978 6.799   -8.973  1.00 0.00 ? 71 HIS A O    5  
ATOM 5946  C CB   . HIS A 1 71 ? 11.086 9.633   -8.310  1.00 0.00 ? 71 HIS A CB   5  
ATOM 5947  C CG   . HIS A 1 71 ? 12.488 10.176  -8.387  1.00 0.00 ? 71 HIS A CG   5  
ATOM 5948  N ND1  . HIS A 1 71 ? 13.337 9.917   -9.438  1.00 0.00 ? 71 HIS A ND1  5  
ATOM 5949  C CD2  . HIS A 1 71 ? 13.193 10.979  -7.536  1.00 0.00 ? 71 HIS A CD2  5  
ATOM 5950  C CE1  . HIS A 1 71 ? 14.496 10.522  -9.246  1.00 0.00 ? 71 HIS A CE1  5  
ATOM 5951  N NE2  . HIS A 1 71 ? 14.435 11.181  -8.089  1.00 0.00 ? 71 HIS A NE2  5  
ATOM 5952  H H    . HIS A 1 71 ? 11.164 9.587   -5.742  1.00 0.00 ? 71 HIS A H    5  
ATOM 5953  H HA   . HIS A 1 71 ? 9.970  7.931   -7.684  1.00 0.00 ? 71 HIS A HA   5  
ATOM 5954  H HB2  . HIS A 1 71 ? 10.765 9.419   -9.320  1.00 0.00 ? 71 HIS A HB2  5  
ATOM 5955  H HB3  . HIS A 1 71 ? 10.462 10.407  -7.904  1.00 0.00 ? 71 HIS A HB3  5  
ATOM 5956  H HD1  . HIS A 1 71 ? 13.123 9.365   -10.229 1.00 0.00 ? 71 HIS A HD1  5  
ATOM 5957  H HD2  . HIS A 1 71 ? 12.816 11.383  -6.600  1.00 0.00 ? 71 HIS A HD2  5  
ATOM 5958  H HE1  . HIS A 1 71 ? 15.342 10.483  -9.901  1.00 0.00 ? 71 HIS A HE1  5  
ATOM 5959  H HE2  . HIS A 1 71 ? 15.079 11.867  -7.802  1.00 0.00 ? 71 HIS A HE2  5  
ATOM 5960  N N    . MET A 1 72 ? 12.996 7.107   -7.013  1.00 0.00 ? 72 MET A N    5  
ATOM 5961  C CA   . MET A 1 72 ? 14.095 6.230   -7.368  1.00 0.00 ? 72 MET A CA   5  
ATOM 5962  C C    . MET A 1 72 ? 14.109 4.983   -6.482  1.00 0.00 ? 72 MET A C    5  
ATOM 5963  O O    . MET A 1 72 ? 15.086 4.228   -6.468  1.00 0.00 ? 72 MET A O    5  
ATOM 5964  C CB   . MET A 1 72 ? 15.433 6.975   -7.227  1.00 0.00 ? 72 MET A CB   5  
ATOM 5965  C CG   . MET A 1 72 ? 15.751 7.418   -5.822  1.00 0.00 ? 72 MET A CG   5  
ATOM 5966  S SD   . MET A 1 72 ? 16.214 9.161   -5.718  1.00 0.00 ? 72 MET A SD   5  
ATOM 5967  C CE   . MET A 1 72 ? 17.523 9.259   -6.936  1.00 0.00 ? 72 MET A CE   5  
ATOM 5968  H H    . MET A 1 72 ? 12.965 7.526   -6.130  1.00 0.00 ? 72 MET A H    5  
ATOM 5969  H HA   . MET A 1 72 ? 13.977 5.923   -8.392  1.00 0.00 ? 72 MET A HA   5  
ATOM 5970  H HB2  . MET A 1 72 ? 16.234 6.343   -7.572  1.00 0.00 ? 72 MET A HB2  5  
ATOM 5971  H HB3  . MET A 1 72 ? 15.396 7.856   -7.861  1.00 0.00 ? 72 MET A HB3  5  
ATOM 5972  H HG2  . MET A 1 72 ? 14.875 7.271   -5.210  1.00 0.00 ? 72 MET A HG2  5  
ATOM 5973  H HG3  . MET A 1 72 ? 16.566 6.820   -5.441  1.00 0.00 ? 72 MET A HG3  5  
ATOM 5974  H HE1  . MET A 1 72 ? 17.951 10.249  -6.912  1.00 0.00 ? 72 MET A HE1  5  
ATOM 5975  H HE2  . MET A 1 72 ? 17.124 9.067   -7.923  1.00 0.00 ? 72 MET A HE2  5  
ATOM 5976  H HE3  . MET A 1 72 ? 18.291 8.533   -6.708  1.00 0.00 ? 72 MET A HE3  5  
ATOM 5977  N N    . LEU A 1 73 ? 13.016 4.760   -5.758  1.00 0.00 ? 73 LEU A N    5  
ATOM 5978  C CA   . LEU A 1 73 ? 12.929 3.622   -4.859  1.00 0.00 ? 73 LEU A CA   5  
ATOM 5979  C C    . LEU A 1 73 ? 12.006 2.525   -5.404  1.00 0.00 ? 73 LEU A C    5  
ATOM 5980  O O    . LEU A 1 73 ? 10.897 2.808   -5.864  1.00 0.00 ? 73 LEU A O    5  
ATOM 5981  C CB   . LEU A 1 73 ? 12.445 4.069   -3.469  1.00 0.00 ? 73 LEU A CB   5  
ATOM 5982  C CG   . LEU A 1 73 ? 13.326 5.089   -2.763  1.00 0.00 ? 73 LEU A CG   5  
ATOM 5983  C CD1  . LEU A 1 73 ? 12.791 5.392   -1.370  1.00 0.00 ? 73 LEU A CD1  5  
ATOM 5984  C CD2  . LEU A 1 73 ? 14.775 4.582   -2.657  1.00 0.00 ? 73 LEU A CD2  5  
ATOM 5985  H H    . LEU A 1 73 ? 12.248 5.361   -5.839  1.00 0.00 ? 73 LEU A H    5  
ATOM 5986  H HA   . LEU A 1 73 ? 13.923 3.204   -4.754  1.00 0.00 ? 73 LEU A HA   5  
ATOM 5987  H HB2  . LEU A 1 73 ? 11.459 4.507   -3.589  1.00 0.00 ? 73 LEU A HB2  5  
ATOM 5988  H HB3  . LEU A 1 73 ? 12.355 3.200   -2.850  1.00 0.00 ? 73 LEU A HB3  5  
ATOM 5989  H HG   . LEU A 1 73 ? 13.336 6.008   -3.325  1.00 0.00 ? 73 LEU A HG   5  
ATOM 5990  H HD11 . LEU A 1 73 ? 12.704 4.491   -0.794  1.00 0.00 ? 73 LEU A HD11 5  
ATOM 5991  H HD12 . LEU A 1 73 ? 11.813 5.859   -1.458  1.00 0.00 ? 73 LEU A HD12 5  
ATOM 5992  H HD13 . LEU A 1 73 ? 13.454 6.084   -0.869  1.00 0.00 ? 73 LEU A HD13 5  
ATOM 5993  H HD21 . LEU A 1 73 ? 15.383 5.325   -2.160  1.00 0.00 ? 73 LEU A HD21 5  
ATOM 5994  H HD22 . LEU A 1 73 ? 15.171 4.415   -3.661  1.00 0.00 ? 73 LEU A HD22 5  
ATOM 5995  H HD23 . LEU A 1 73 ? 14.807 3.652   -2.111  1.00 0.00 ? 73 LEU A HD23 5  
ATOM 5996  N N    . GLU A 1 74 ? 12.478 1.294   -5.345  1.00 0.00 ? 74 GLU A N    5  
ATOM 5997  C CA   . GLU A 1 74 ? 11.688 0.138   -5.753  1.00 0.00 ? 74 GLU A CA   5  
ATOM 5998  C C    . GLU A 1 74 ? 11.105 -0.551  -4.527  1.00 0.00 ? 74 GLU A C    5  
ATOM 5999  O O    . GLU A 1 74 ? 11.808 -0.780  -3.552  1.00 0.00 ? 74 GLU A O    5  
ATOM 6000  C CB   . GLU A 1 74 ? 12.554 -0.855  -6.529  1.00 0.00 ? 74 GLU A CB   5  
ATOM 6001  C CG   . GLU A 1 74 ? 11.786 -2.065  -7.035  1.00 0.00 ? 74 GLU A CG   5  
ATOM 6002  C CD   . GLU A 1 74 ? 12.697 -3.157  -7.599  1.00 0.00 ? 74 GLU A CD   5  
ATOM 6003  O OE1  . GLU A 1 74 ? 13.902 -2.901  -7.789  1.00 0.00 ? 74 GLU A OE1  5  
ATOM 6004  O OE2  . GLU A 1 74 ? 12.192 -4.270  -7.863  1.00 0.00 ? 74 GLU A OE2  5  
ATOM 6005  H H    . GLU A 1 74 ? 13.392 1.156   -5.013  1.00 0.00 ? 74 GLU A H    5  
ATOM 6006  H HA   . GLU A 1 74 ? 10.885 0.478   -6.384  1.00 0.00 ? 74 GLU A HA   5  
ATOM 6007  H HB2  . GLU A 1 74 ? 12.979 -0.348  -7.377  1.00 0.00 ? 74 GLU A HB2  5  
ATOM 6008  H HB3  . GLU A 1 74 ? 13.361 -1.203  -5.881  1.00 0.00 ? 74 GLU A HB3  5  
ATOM 6009  H HG2  . GLU A 1 74 ? 11.232 -2.501  -6.219  1.00 0.00 ? 74 GLU A HG2  5  
ATOM 6010  H HG3  . GLU A 1 74 ? 11.110 -1.742  -7.811  1.00 0.00 ? 74 GLU A HG3  5  
ATOM 6011  N N    . ILE A 1 75 ? 9.829  -0.902  -4.610  1.00 0.00 ? 75 ILE A N    5  
ATOM 6012  C CA   . ILE A 1 75 ? 9.175  -1.619  -3.534  1.00 0.00 ? 75 ILE A CA   5  
ATOM 6013  C C    . ILE A 1 75 ? 9.568  -3.095  -3.511  1.00 0.00 ? 75 ILE A C    5  
ATOM 6014  O O    . ILE A 1 75 ? 9.448  -3.789  -4.528  1.00 0.00 ? 75 ILE A O    5  
ATOM 6015  C CB   . ILE A 1 75 ? 7.641  -1.483  -3.610  1.00 0.00 ? 75 ILE A CB   5  
ATOM 6016  C CG1  . ILE A 1 75 ? 6.979  -2.354  -2.537  1.00 0.00 ? 75 ILE A CG1  5  
ATOM 6017  C CG2  . ILE A 1 75 ? 7.121  -1.858  -4.994  1.00 0.00 ? 75 ILE A CG2  5  
ATOM 6018  C CD1  . ILE A 1 75 ? 5.467  -2.255  -2.518  1.00 0.00 ? 75 ILE A CD1  5  
ATOM 6019  H H    . ILE A 1 75 ? 9.327  -0.661  -5.426  1.00 0.00 ? 75 ILE A H    5  
ATOM 6020  H HA   . ILE A 1 75 ? 9.487  -1.156  -2.601  1.00 0.00 ? 75 ILE A HA   5  
ATOM 6021  H HB   . ILE A 1 75 ? 7.381  -0.452  -3.423  1.00 0.00 ? 75 ILE A HB   5  
ATOM 6022  H HG12 . ILE A 1 75 ? 7.245  -3.384  -2.710  1.00 0.00 ? 75 ILE A HG12 5  
ATOM 6023  H HG13 . ILE A 1 75 ? 7.345  -2.046  -1.571  1.00 0.00 ? 75 ILE A HG13 5  
ATOM 6024  H HG21 . ILE A 1 75 ? 7.536  -1.181  -5.733  1.00 0.00 ? 75 ILE A HG21 5  
ATOM 6025  H HG22 . ILE A 1 75 ? 6.040  -1.770  -5.017  1.00 0.00 ? 75 ILE A HG22 5  
ATOM 6026  H HG23 . ILE A 1 75 ? 7.399  -2.868  -5.222  1.00 0.00 ? 75 ILE A HG23 5  
ATOM 6027  H HD11 . ILE A 1 75 ? 5.166  -1.222  -2.378  1.00 0.00 ? 75 ILE A HD11 5  
ATOM 6028  H HD12 . ILE A 1 75 ? 5.083  -2.864  -1.717  1.00 0.00 ? 75 ILE A HD12 5  
ATOM 6029  H HD13 . ILE A 1 75 ? 5.080  -2.617  -3.465  1.00 0.00 ? 75 ILE A HD13 5  
ATOM 6030  N N    . LEU A 1 76 ? 10.069 -3.551  -2.379  1.00 0.00 ? 76 LEU A N    5  
ATOM 6031  C CA   . LEU A 1 76 ? 10.338 -4.973  -2.174  1.00 0.00 ? 76 LEU A CA   5  
ATOM 6032  C C    . LEU A 1 76 ? 9.508  -5.487  -0.998  1.00 0.00 ? 76 LEU A C    5  
ATOM 6033  O O    . LEU A 1 76 ? 9.989  -5.606  0.114   1.00 0.00 ? 76 LEU A O    5  
ATOM 6034  C CB   . LEU A 1 76 ? 11.829 -5.205  -1.903  1.00 0.00 ? 76 LEU A CB   5  
ATOM 6035  C CG   . LEU A 1 76 ? 12.792 -4.834  -3.034  1.00 0.00 ? 76 LEU A CG   5  
ATOM 6036  C CD1  . LEU A 1 76 ? 14.230 -5.122  -2.615  1.00 0.00 ? 76 LEU A CD1  5  
ATOM 6037  C CD2  . LEU A 1 76 ? 12.444 -5.549  -4.330  1.00 0.00 ? 76 LEU A CD2  5  
ATOM 6038  H H    . LEU A 1 76 ? 10.257 -2.919  -1.648  1.00 0.00 ? 76 LEU A H    5  
ATOM 6039  H HA   . LEU A 1 76 ? 10.035 -5.505  -3.065  1.00 0.00 ? 76 LEU A HA   5  
ATOM 6040  H HB2  . LEU A 1 76 ? 12.098 -4.647  -1.020  1.00 0.00 ? 76 LEU A HB2  5  
ATOM 6041  H HB3  . LEU A 1 76 ? 11.966 -6.255  -1.685  1.00 0.00 ? 76 LEU A HB3  5  
ATOM 6042  H HG   . LEU A 1 76 ? 12.714 -3.764  -3.207  1.00 0.00 ? 76 LEU A HG   5  
ATOM 6043  H HD11 . LEU A 1 76 ? 14.900 -4.872  -3.422  1.00 0.00 ? 76 LEU A HD11 5  
ATOM 6044  H HD12 . LEU A 1 76 ? 14.324 -6.186  -2.390  1.00 0.00 ? 76 LEU A HD12 5  
ATOM 6045  H HD13 . LEU A 1 76 ? 14.481 -4.548  -1.748  1.00 0.00 ? 76 LEU A HD13 5  
ATOM 6046  H HD21 . LEU A 1 76 ? 13.124 -5.257  -5.114  1.00 0.00 ? 76 LEU A HD21 5  
ATOM 6047  H HD22 . LEU A 1 76 ? 11.429 -5.286  -4.622  1.00 0.00 ? 76 LEU A HD22 5  
ATOM 6048  H HD23 . LEU A 1 76 ? 12.509 -6.615  -4.178  1.00 0.00 ? 76 LEU A HD23 5  
ATOM 6049  N N    . GLY A 1 77 ? 8.244  -5.766  -1.261  1.00 0.00 ? 77 GLY A N    5  
ATOM 6050  C CA   . GLY A 1 77 ? 7.355  -6.245  -0.219  1.00 0.00 ? 77 GLY A CA   5  
ATOM 6051  C C    . GLY A 1 77 ? 7.455  -7.749  -0.051  1.00 0.00 ? 77 GLY A C    5  
ATOM 6052  O O    . GLY A 1 77 ? 6.889  -8.506  -0.844  1.00 0.00 ? 77 GLY A O    5  
ATOM 6053  H H    . GLY A 1 77 ? 7.893  -5.670  -2.187  1.00 0.00 ? 77 GLY A H    5  
ATOM 6054  H HA2  . GLY A 1 77 ? 7.646  -5.771  0.698   1.00 0.00 ? 77 GLY A HA2  5  
ATOM 6055  H HA3  . GLY A 1 77 ? 6.348  -5.970  -0.454  1.00 0.00 ? 77 GLY A HA3  5  
ATOM 6056  N N    . PHE A 1 78 ? 8.189  -8.185  0.962   1.00 0.00 ? 78 PHE A N    5  
ATOM 6057  C CA   . PHE A 1 78 ? 8.320  -9.609  1.235   1.00 0.00 ? 78 PHE A CA   5  
ATOM 6058  C C    . PHE A 1 78 ? 7.144  -10.109 2.075   1.00 0.00 ? 78 PHE A C    5  
ATOM 6059  O O    . PHE A 1 78 ? 7.120  -11.268 2.499   1.00 0.00 ? 78 PHE A O    5  
ATOM 6060  C CB   . PHE A 1 78 ? 9.643  -9.913  1.938   1.00 0.00 ? 78 PHE A CB   5  
ATOM 6061  C CG   . PHE A 1 78 ? 10.852 -9.745  1.054   1.00 0.00 ? 78 PHE A CG   5  
ATOM 6062  C CD1  . PHE A 1 78 ? 11.491 -8.507  0.933   1.00 0.00 ? 78 PHE A CD1  5  
ATOM 6063  C CD2  . PHE A 1 78 ? 11.343 -10.812 0.317   1.00 0.00 ? 78 PHE A CD2  5  
ATOM 6064  C CE1  . PHE A 1 78 ? 12.588 -8.353  0.102   1.00 0.00 ? 78 PHE A CE1  5  
ATOM 6065  C CE2  . PHE A 1 78 ? 12.441 -10.658 -0.520  1.00 0.00 ? 78 PHE A CE2  5  
ATOM 6066  C CZ   . PHE A 1 78 ? 13.064 -9.424  -0.624  1.00 0.00 ? 78 PHE A CZ   5  
ATOM 6067  H H    . PHE A 1 78 ? 8.660  -7.545  1.536   1.00 0.00 ? 78 PHE A H    5  
ATOM 6068  H HA   . PHE A 1 78 ? 8.299  -10.123 0.292   1.00 0.00 ? 78 PHE A HA   5  
ATOM 6069  H HB2  . PHE A 1 78 ? 9.759  -9.230  2.781   1.00 0.00 ? 78 PHE A HB2  5  
ATOM 6070  H HB3  . PHE A 1 78 ? 9.637  -10.926 2.305   1.00 0.00 ? 78 PHE A HB3  5  
ATOM 6071  H HD1  . PHE A 1 78 ? 11.122 -7.661  1.488   1.00 0.00 ? 78 PHE A HD1  5  
ATOM 6072  H HD2  . PHE A 1 78 ? 10.860 -11.776 0.392   1.00 0.00 ? 78 PHE A HD2  5  
ATOM 6073  H HE1  . PHE A 1 78 ? 13.079 -7.391  0.034   1.00 0.00 ? 78 PHE A HE1  5  
ATOM 6074  H HE2  . PHE A 1 78 ? 12.813 -11.495 -1.084  1.00 0.00 ? 78 PHE A HE2  5  
ATOM 6075  H HZ   . PHE A 1 78 ? 13.920 -9.289  -1.271  1.00 0.00 ? 78 PHE A HZ   5  
ATOM 6076  N N    . GLU A 1 79 ? 6.191  -9.230  2.295   1.00 0.00 ? 79 GLU A N    5  
ATOM 6077  C CA   . GLU A 1 79 ? 4.961  -9.616  2.947   1.00 0.00 ? 79 GLU A CA   5  
ATOM 6078  C C    . GLU A 1 79 ? 4.006  -10.247 1.934   1.00 0.00 ? 79 GLU A C    5  
ATOM 6079  O O    . GLU A 1 79 ? 3.216  -9.546  1.302   1.00 0.00 ? 79 GLU A O    5  
ATOM 6080  C CB   . GLU A 1 79 ? 4.297  -8.415  3.622   1.00 0.00 ? 79 GLU A CB   5  
ATOM 6081  C CG   . GLU A 1 79 ? 2.997  -8.757  4.329   1.00 0.00 ? 79 GLU A CG   5  
ATOM 6082  C CD   . GLU A 1 79 ? 2.386  -7.555  5.023   1.00 0.00 ? 79 GLU A CD   5  
ATOM 6083  O OE1  . GLU A 1 79 ? 1.781  -6.721  4.331   1.00 0.00 ? 79 GLU A OE1  5  
ATOM 6084  O OE2  . GLU A 1 79 ? 2.528  -7.435  6.264   1.00 0.00 ? 79 GLU A OE2  5  
ATOM 6085  H H    . GLU A 1 79 ? 6.306  -8.304  2.010   1.00 0.00 ? 79 GLU A H    5  
ATOM 6086  H HA   . GLU A 1 79 ? 5.200  -10.353 3.712   1.00 0.00 ? 79 GLU A HA   5  
ATOM 6087  H HB2  . GLU A 1 79 ? 4.988  -8.003  4.355   1.00 0.00 ? 79 GLU A HB2  5  
ATOM 6088  H HB3  . GLU A 1 79 ? 4.096  -7.655  2.868   1.00 0.00 ? 79 GLU A HB3  5  
ATOM 6089  H HG2  . GLU A 1 79 ? 2.291  -9.124  3.602   1.00 0.00 ? 79 GLU A HG2  5  
ATOM 6090  H HG3  . GLU A 1 79 ? 3.178  -9.515  5.065   1.00 0.00 ? 79 GLU A HG3  5  
ATOM 6091  N N    . GLU A 1 80 ? 4.132  -11.561 1.776   1.00 0.00 ? 80 GLU A N    5  
ATOM 6092  C CA   . GLU A 1 80 ? 3.345  -12.358 0.817   1.00 0.00 ? 80 GLU A CA   5  
ATOM 6093  C C    . GLU A 1 80 ? 3.094  -11.592 -0.488  1.00 0.00 ? 80 GLU A C    5  
ATOM 6094  O O    . GLU A 1 80 ? 2.014  -11.066 -0.719  1.00 0.00 ? 80 GLU A O    5  
ATOM 6095  C CB   . GLU A 1 80 ? 2.027  -12.849 1.457   1.00 0.00 ? 80 GLU A CB   5  
ATOM 6096  C CG   . GLU A 1 80 ? 1.199  -11.761 2.119   1.00 0.00 ? 80 GLU A CG   5  
ATOM 6097  C CD   . GLU A 1 80 ? -0.044 -12.320 2.793   1.00 0.00 ? 80 GLU A CD   5  
ATOM 6098  O OE1  . GLU A 1 80 ? -1.029 -12.613 2.096   1.00 0.00 ? 80 GLU A OE1  5  
ATOM 6099  O OE2  . GLU A 1 80 ? -0.016 -12.463 4.049   1.00 0.00 ? 80 GLU A OE2  5  
ATOM 6100  H H    . GLU A 1 80 ? 4.811  -12.034 2.305   1.00 0.00 ? 80 GLU A H    5  
ATOM 6101  H HA   . GLU A 1 80 ? 3.939  -13.218 0.570   1.00 0.00 ? 80 GLU A HA   5  
ATOM 6102  H HB2  . GLU A 1 80 ? 1.437  -13.304 0.683   1.00 0.00 ? 80 GLU A HB2  5  
ATOM 6103  H HB3  . GLU A 1 80 ? 2.265  -13.596 2.201   1.00 0.00 ? 80 GLU A HB3  5  
ATOM 6104  H HG2  . GLU A 1 80 ? 1.794  -11.255 2.848   1.00 0.00 ? 80 GLU A HG2  5  
ATOM 6105  H HG3  . GLU A 1 80 ? 0.865  -11.058 1.357   1.00 0.00 ? 80 GLU A HG3  5  
ATOM 6106  N N    . MET A 1 4  ? 12.242 -0.779  -15.424 1.00 0.00 ? 4  MET A N    6  
ATOM 6107  C CA   . MET A 1 4  ? 11.824 -0.921  -14.024 1.00 0.00 ? 4  MET A CA   6  
ATOM 6108  C C    . MET A 1 4  ? 10.442 -0.315  -13.798 1.00 0.00 ? 4  MET A C    6  
ATOM 6109  O O    . MET A 1 4  ? 9.930  0.427   -14.640 1.00 0.00 ? 4  MET A O    6  
ATOM 6110  C CB   . MET A 1 4  ? 12.841 -0.273  -13.092 1.00 0.00 ? 4  MET A CB   6  
ATOM 6111  C CG   . MET A 1 4  ? 13.978 -1.191  -12.658 1.00 0.00 ? 4  MET A CG   6  
ATOM 6112  S SD   . MET A 1 4  ? 15.095 -1.605  -14.010 1.00 0.00 ? 4  MET A SD   6  
ATOM 6113  C CE   . MET A 1 4  ? 16.285 -2.632  -13.158 1.00 0.00 ? 4  MET A CE   6  
ATOM 6114  H H    . MET A 1 4  ? 12.228 0.124   -15.841 1.00 0.00 ? 4  MET A H    6  
ATOM 6115  H HA   . MET A 1 4  ? 11.775 -1.991  -13.819 1.00 0.00 ? 4  MET A HA   6  
ATOM 6116  H HB2  . MET A 1 4  ? 13.269 0.588   -13.574 1.00 0.00 ? 4  MET A HB2  6  
ATOM 6117  H HB3  . MET A 1 4  ? 12.326 0.059   -12.192 1.00 0.00 ? 4  MET A HB3  6  
ATOM 6118  H HG2  . MET A 1 4  ? 14.555 -0.700  -11.894 1.00 0.00 ? 4  MET A HG2  6  
ATOM 6119  H HG3  . MET A 1 4  ? 13.554 -2.109  -12.256 1.00 0.00 ? 4  MET A HG3  6  
ATOM 6120  H HE1  . MET A 1 4  ? 15.780 -3.461  -12.708 1.00 0.00 ? 4  MET A HE1  6  
ATOM 6121  H HE2  . MET A 1 4  ? 16.800 -2.055  -12.411 1.00 0.00 ? 4  MET A HE2  6  
ATOM 6122  H HE3  . MET A 1 4  ? 17.006 -3.002  -13.876 1.00 0.00 ? 4  MET A HE3  6  
ATOM 6123  N N    . ARG A 1 5  ? 9.839  -0.656  -12.676 1.00 0.00 ? 5  ARG A N    6  
ATOM 6124  C CA   . ARG A 1 5  ? 8.470  -0.234  -12.363 1.00 0.00 ? 5  ARG A CA   6  
ATOM 6125  C C    . ARG A 1 5  ? 8.395  1.273   -12.099 1.00 0.00 ? 5  ARG A C    6  
ATOM 6126  O O    . ARG A 1 5  ? 7.417  1.925   -12.459 1.00 0.00 ? 5  ARG A O    6  
ATOM 6127  C CB   . ARG A 1 5  ? 7.962  -1.007  -11.146 1.00 0.00 ? 5  ARG A CB   6  
ATOM 6128  C CG   . ARG A 1 5  ? 8.292  -2.486  -11.194 1.00 0.00 ? 5  ARG A CG   6  
ATOM 6129  C CD   . ARG A 1 5  ? 7.668  -3.251  -10.039 1.00 0.00 ? 5  ARG A CD   6  
ATOM 6130  N NE   . ARG A 1 5  ? 8.171  -4.620  -9.926  1.00 0.00 ? 5  ARG A NE   6  
ATOM 6131  C CZ   . ARG A 1 5  ? 7.782  -5.627  -10.720 1.00 0.00 ? 5  ARG A CZ   6  
ATOM 6132  N NH1  . ARG A 1 5  ? 6.861  -5.424  -11.651 1.00 0.00 ? 5  ARG A NH1  6  
ATOM 6133  N NH2  . ARG A 1 5  ? 8.286  -6.848  -10.540 1.00 0.00 ? 5  ARG A NH2  6  
ATOM 6134  H H    . ARG A 1 5  ? 10.322 -1.191  -12.008 1.00 0.00 ? 5  ARG A H    6  
ATOM 6135  H HA   . ARG A 1 5  ? 7.851  -0.471  -13.218 1.00 0.00 ? 5  ARG A HA   6  
ATOM 6136  H HB2  . ARG A 1 5  ? 8.405  -0.583  -10.252 1.00 0.00 ? 5  ARG A HB2  6  
ATOM 6137  H HB3  . ARG A 1 5  ? 6.889  -0.901  -11.088 1.00 0.00 ? 5  ARG A HB3  6  
ATOM 6138  H HG2  . ARG A 1 5  ? 7.909  -2.900  -12.113 1.00 0.00 ? 5  ARG A HG2  6  
ATOM 6139  H HG3  . ARG A 1 5  ? 9.387  -2.619  -11.160 1.00 0.00 ? 5  ARG A HG3  6  
ATOM 6140  H HD2  . ARG A 1 5  ? 7.891  -2.729  -9.117  1.00 0.00 ? 5  ARG A HD2  6  
ATOM 6141  H HD3  . ARG A 1 5  ? 6.591  -3.279  -10.175 1.00 0.00 ? 5  ARG A HD3  6  
ATOM 6142  H HE   . ARG A 1 5  ? 8.860  -4.784  -9.243  1.00 0.00 ? 5  ARG A HE   6  
ATOM 6143  H HH11 . ARG A 1 5  ? 6.469  -4.500  -11.797 1.00 0.00 ? 5  ARG A HH11 6  
ATOM 6144  H HH12 . ARG A 1 5  ? 6.558  -6.194  -12.243 1.00 0.00 ? 5  ARG A HH12 6  
ATOM 6145  H HH21 . ARG A 1 5  ? 8.989  -7.007  -9.833  1.00 0.00 ? 5  ARG A HH21 6  
ATOM 6146  H HH22 . ARG A 1 5  ? 7.999  -7.604  -11.134 1.00 0.00 ? 5  ARG A HH22 6  
ATOM 6147  N N    . SER A 1 6  ? 9.448  1.806   -11.478 1.00 0.00 ? 6  SER A N    6  
ATOM 6148  C CA   . SER A 1 6  ? 9.469  3.180   -10.993 1.00 0.00 ? 6  SER A CA   6  
ATOM 6149  C C    . SER A 1 6  ? 9.499  4.231   -12.116 1.00 0.00 ? 6  SER A C    6  
ATOM 6150  O O    . SER A 1 6  ? 9.540  5.430   -11.844 1.00 0.00 ? 6  SER A O    6  
ATOM 6151  C CB   . SER A 1 6  ? 10.676 3.379   -10.079 1.00 0.00 ? 6  SER A CB   6  
ATOM 6152  O OG   . SER A 1 6  ? 10.749 2.357   -9.115  1.00 0.00 ? 6  SER A OG   6  
ATOM 6153  H H    . SER A 1 6  ? 10.241 1.241   -11.335 1.00 0.00 ? 6  SER A H    6  
ATOM 6154  H HA   . SER A 1 6  ? 8.574  3.330   -10.414 1.00 0.00 ? 6  SER A HA   6  
ATOM 6155  H HB2  . SER A 1 6  ? 11.579 3.366   -10.677 1.00 0.00 ? 6  SER A HB2  6  
ATOM 6156  H HB3  . SER A 1 6  ? 10.593 4.321   -9.575  1.00 0.00 ? 6  SER A HB3  6  
ATOM 6157  H HG   . SER A 1 6  ? 10.936 1.514   -9.552  1.00 0.00 ? 6  SER A HG   6  
ATOM 6158  N N    . GLU A 1 7  ? 9.476  3.788   -13.371 1.00 0.00 ? 7  GLU A N    6  
ATOM 6159  C CA   . GLU A 1 7  ? 9.594  4.721   -14.504 1.00 0.00 ? 7  GLU A CA   6  
ATOM 6160  C C    . GLU A 1 7  ? 8.314  5.512   -14.727 1.00 0.00 ? 7  GLU A C    6  
ATOM 6161  O O    . GLU A 1 7  ? 8.286  6.703   -14.487 1.00 0.00 ? 7  GLU A O    6  
ATOM 6162  C CB   . GLU A 1 7  ? 9.989  3.981   -15.761 1.00 0.00 ? 7  GLU A CB   6  
ATOM 6163  C CG   . GLU A 1 7  ? 11.434 3.484   -15.741 1.00 0.00 ? 7  GLU A CG   6  
ATOM 6164  C CD   . GLU A 1 7  ? 11.795 2.762   -16.999 1.00 0.00 ? 7  GLU A CD   6  
ATOM 6165  O OE1  . GLU A 1 7  ? 12.148 3.421   -18.000 1.00 0.00 ? 7  GLU A OE1  6  
ATOM 6166  O OE2  . GLU A 1 7  ? 11.700 1.527   -17.015 1.00 0.00 ? 7  GLU A OE2  6  
ATOM 6167  H H    . GLU A 1 7  ? 9.377  2.838   -13.542 1.00 0.00 ? 7  GLU A H    6  
ATOM 6168  H HA   . GLU A 1 7  ? 10.369 5.427   -14.251 1.00 0.00 ? 7  GLU A HA   6  
ATOM 6169  H HB2  . GLU A 1 7  ? 9.350  3.120   -15.893 1.00 0.00 ? 7  GLU A HB2  6  
ATOM 6170  H HB3  . GLU A 1 7  ? 9.877  4.624   -16.607 1.00 0.00 ? 7  GLU A HB3  6  
ATOM 6171  H HG2  . GLU A 1 7  ? 12.088 4.338   -15.618 1.00 0.00 ? 7  GLU A HG2  6  
ATOM 6172  H HG3  . GLU A 1 7  ? 11.558 2.799   -14.902 1.00 0.00 ? 7  GLU A HG3  6  
ATOM 6173  N N    . PHE A 1 8  ? 7.265  4.826   -15.200 1.00 0.00 ? 8  PHE A N    6  
ATOM 6174  C CA   . PHE A 1 8  ? 6.005  5.485   -15.537 1.00 0.00 ? 8  PHE A CA   6  
ATOM 6175  C C    . PHE A 1 8  ? 6.228  6.639   -16.508 1.00 0.00 ? 8  PHE A C    6  
ATOM 6176  O O    . PHE A 1 8  ? 7.217  6.669   -17.228 1.00 0.00 ? 8  PHE A O    6  
ATOM 6177  C CB   . PHE A 1 8  ? 5.302  5.988   -14.268 1.00 0.00 ? 8  PHE A CB   6  
ATOM 6178  C CG   . PHE A 1 8  ? 4.533  4.922   -13.538 1.00 0.00 ? 8  PHE A CG   6  
ATOM 6179  C CD1  . PHE A 1 8  ? 5.167  4.102   -12.620 1.00 0.00 ? 8  PHE A CD1  6  
ATOM 6180  C CD2  . PHE A 1 8  ? 3.187  4.748   -13.771 1.00 0.00 ? 8  PHE A CD2  6  
ATOM 6181  C CE1  . PHE A 1 8  ? 4.456  3.121   -11.948 1.00 0.00 ? 8  PHE A CE1  6  
ATOM 6182  C CE2  . PHE A 1 8  ? 2.480  3.775   -13.118 1.00 0.00 ? 8  PHE A CE2  6  
ATOM 6183  C CZ   . PHE A 1 8  ? 3.111  2.953   -12.203 1.00 0.00 ? 8  PHE A CZ   6  
ATOM 6184  H H    . PHE A 1 8  ? 7.348  3.855   -15.316 1.00 0.00 ? 8  PHE A H    6  
ATOM 6185  H HA   . PHE A 1 8  ? 5.362  4.744   -16.010 1.00 0.00 ? 8  PHE A HA   6  
ATOM 6186  H HB2  . PHE A 1 8  ? 6.051  6.378   -13.591 1.00 0.00 ? 8  PHE A HB2  6  
ATOM 6187  H HB3  . PHE A 1 8  ? 4.606  6.785   -14.520 1.00 0.00 ? 8  PHE A HB3  6  
ATOM 6188  H HD1  . PHE A 1 8  ? 6.226  4.237   -12.408 1.00 0.00 ? 8  PHE A HD1  6  
ATOM 6189  H HD2  . PHE A 1 8  ? 2.691  5.381   -14.488 1.00 0.00 ? 8  PHE A HD2  6  
ATOM 6190  H HE1  . PHE A 1 8  ? 4.959  2.478   -11.227 1.00 0.00 ? 8  PHE A HE1  6  
ATOM 6191  H HE2  . PHE A 1 8  ? 1.409  3.654   -13.294 1.00 0.00 ? 8  PHE A HE2  6  
ATOM 6192  H HZ   . PHE A 1 8  ? 2.559  2.183   -11.686 1.00 0.00 ? 8  PHE A HZ   6  
ATOM 6193  N N    . ALA A 1 9  ? 5.279  7.566   -16.545 1.00 0.00 ? 9  ALA A N    6  
ATOM 6194  C CA   . ALA A 1 9  ? 5.424  8.779   -17.335 1.00 0.00 ? 9  ALA A CA   6  
ATOM 6195  C C    . ALA A 1 9  ? 6.422  9.719   -16.686 1.00 0.00 ? 9  ALA A C    6  
ATOM 6196  O O    . ALA A 1 9  ? 7.328  10.238  -17.349 1.00 0.00 ? 9  ALA A O    6  
ATOM 6197  C CB   . ALA A 1 9  ? 4.082  9.475   -17.517 1.00 0.00 ? 9  ALA A CB   6  
ATOM 6198  H H    . ALA A 1 9  ? 4.445  7.422   -16.029 1.00 0.00 ? 9  ALA A H    6  
ATOM 6199  H HA   . ALA A 1 9  ? 5.798  8.492   -18.306 1.00 0.00 ? 9  ALA A HA   6  
ATOM 6200  H HB1  . ALA A 1 9  ? 4.215  10.364  -18.121 1.00 0.00 ? 9  ALA A HB1  6  
ATOM 6201  H HB2  . ALA A 1 9  ? 3.680  9.747   -16.550 1.00 0.00 ? 9  ALA A HB2  6  
ATOM 6202  H HB3  . ALA A 1 9  ? 3.398  8.793   -18.012 1.00 0.00 ? 9  ALA A HB3  6  
ATOM 6203  N N    . SER A 1 10 ? 6.276  9.920   -15.390 1.00 0.00 ? 10 SER A N    6  
ATOM 6204  C CA   . SER A 1 10 ? 7.179  10.768  -14.634 1.00 0.00 ? 10 SER A CA   6  
ATOM 6205  C C    . SER A 1 10 ? 7.617  10.104  -13.343 1.00 0.00 ? 10 SER A C    6  
ATOM 6206  O O    . SER A 1 10 ? 8.354  10.685  -12.540 1.00 0.00 ? 10 SER A O    6  
ATOM 6207  C CB   . SER A 1 10 ? 6.509  12.107  -14.334 1.00 0.00 ? 10 SER A CB   6  
ATOM 6208  O OG   . SER A 1 10 ? 6.005  12.691  -15.529 1.00 0.00 ? 10 SER A OG   6  
ATOM 6209  H H    . SER A 1 10 ? 5.513  9.510   -14.938 1.00 0.00 ? 10 SER A H    6  
ATOM 6210  H HA   . SER A 1 10 ? 8.054  10.948  -15.249 1.00 0.00 ? 10 SER A HA   6  
ATOM 6211  H HB2  . SER A 1 10 ? 5.677  11.948  -13.652 1.00 0.00 ? 10 SER A HB2  6  
ATOM 6212  H HB3  . SER A 1 10 ? 7.222  12.787  -13.892 1.00 0.00 ? 10 SER A HB3  6  
ATOM 6213  H HG   . SER A 1 10 ? 6.682  13.269  -15.900 1.00 0.00 ? 10 SER A HG   6  
ATOM 6214  N N    . GLY A 1 11 ? 7.145  8.879   -13.143 1.00 0.00 ? 11 GLY A N    6  
ATOM 6215  C CA   . GLY A 1 11 ? 7.465  8.119   -11.952 1.00 0.00 ? 11 GLY A CA   6  
ATOM 6216  C C    . GLY A 1 11 ? 6.684  8.600   -10.762 1.00 0.00 ? 11 GLY A C    6  
ATOM 6217  O O    . GLY A 1 11 ? 6.716  7.992   -9.682  1.00 0.00 ? 11 GLY A O    6  
ATOM 6218  H H    . GLY A 1 11 ? 6.583  8.478   -13.833 1.00 0.00 ? 11 GLY A H    6  
ATOM 6219  H HA2  . GLY A 1 11 ? 7.235  7.077   -12.130 1.00 0.00 ? 11 GLY A HA2  6  
ATOM 6220  H HA3  . GLY A 1 11 ? 8.513  8.226   -11.738 1.00 0.00 ? 11 GLY A HA3  6  
ATOM 6221  N N    . ASN A 1 12 ? 5.937  9.678   -10.963 1.00 0.00 ? 12 ASN A N    6  
ATOM 6222  C CA   . ASN A 1 12 ? 5.171  10.298  -9.898  1.00 0.00 ? 12 ASN A CA   6  
ATOM 6223  C C    . ASN A 1 12 ? 3.993  9.426   -9.503  1.00 0.00 ? 12 ASN A C    6  
ATOM 6224  O O    . ASN A 1 12 ? 3.529  9.459   -8.363  1.00 0.00 ? 12 ASN A O    6  
ATOM 6225  C CB   . ASN A 1 12 ? 4.696  11.696  -10.265 1.00 0.00 ? 12 ASN A CB   6  
ATOM 6226  C CG   . ASN A 1 12 ? 5.833  12.637  -10.544 1.00 0.00 ? 12 ASN A CG   6  
ATOM 6227  O OD1  . ASN A 1 12 ? 6.925  12.491  -10.008 1.00 0.00 ? 12 ASN A OD1  6  
ATOM 6228  N ND2  . ASN A 1 12 ? 5.598  13.614  -11.393 1.00 0.00 ? 12 ASN A ND2  6  
ATOM 6229  H H    . ASN A 1 12 ? 5.893  10.063  -11.858 1.00 0.00 ? 12 ASN A H    6  
ATOM 6230  H HA   . ASN A 1 12 ? 5.831  10.375  -9.030  1.00 0.00 ? 12 ASN A HA   6  
ATOM 6231  H HB2  . ASN A 1 12 ? 4.084  11.635  -11.156 1.00 0.00 ? 12 ASN A HB2  6  
ATOM 6232  H HB3  . ASN A 1 12 ? 4.106  12.103  -9.455  1.00 0.00 ? 12 ASN A HB3  6  
ATOM 6233  H HD21 . ASN A 1 12 ? 4.699  13.680  -11.793 1.00 0.00 ? 12 ASN A HD21 6  
ATOM 6234  H HD22 . ASN A 1 12 ? 6.325  14.244  -11.589 1.00 0.00 ? 12 ASN A HD22 6  
ATOM 6235  N N    . THR A 1 13 ? 3.507  8.627   -10.451 1.00 0.00 ? 13 THR A N    6  
ATOM 6236  C CA   . THR A 1 13 ? 2.412  7.720   -10.180 1.00 0.00 ? 13 THR A CA   6  
ATOM 6237  C C    . THR A 1 13 ? 2.902  6.592   -9.282  1.00 0.00 ? 13 THR A C    6  
ATOM 6238  O O    . THR A 1 13 ? 2.165  6.090   -8.429  1.00 0.00 ? 13 THR A O    6  
ATOM 6239  C CB   . THR A 1 13 ? 1.865  7.130   -11.497 1.00 0.00 ? 13 THR A CB   6  
ATOM 6240  O OG1  . THR A 1 13 ? 1.730  8.186   -12.470 1.00 0.00 ? 13 THR A OG1  6  
ATOM 6241  C CG2  . THR A 1 13 ? 0.506  6.502   -11.259 1.00 0.00 ? 13 THR A CG2  6  
ATOM 6242  H H    . THR A 1 13 ? 3.890  8.623   -11.350 1.00 0.00 ? 13 THR A H    6  
ATOM 6243  H HA   . THR A 1 13 ? 1.631  8.275   -9.690  1.00 0.00 ? 13 THR A HA   6  
ATOM 6244  H HB   . THR A 1 13 ? 2.543  6.384   -11.853 1.00 0.00 ? 13 THR A HB   6  
ATOM 6245  H HG1  . THR A 1 13 ? 1.513  9.020   -12.033 1.00 0.00 ? 13 THR A HG1  6  
ATOM 6246  H HG21 . THR A 1 13 ? 0.134  6.103   -12.194 1.00 0.00 ? 13 THR A HG21 6  
ATOM 6247  H HG22 . THR A 1 13 ? -0.178 7.230   -10.874 1.00 0.00 ? 13 THR A HG22 6  
ATOM 6248  H HG23 . THR A 1 13 ? 0.619  5.690   -10.545 1.00 0.00 ? 13 THR A HG23 6  
ATOM 6249  N N    . TYR A 1 14 ? 4.152  6.193   -9.496  1.00 0.00 ? 14 TYR A N    6  
ATOM 6250  C CA   . TYR A 1 14 ? 4.771  5.177   -8.675  1.00 0.00 ? 14 TYR A CA   6  
ATOM 6251  C C    . TYR A 1 14 ? 4.991  5.724   -7.261  1.00 0.00 ? 14 TYR A C    6  
ATOM 6252  O O    . TYR A 1 14 ? 4.765  5.027   -6.280  1.00 0.00 ? 14 TYR A O    6  
ATOM 6253  C CB   . TYR A 1 14 ? 6.113  4.748   -9.300  1.00 0.00 ? 14 TYR A CB   6  
ATOM 6254  C CG   . TYR A 1 14 ? 6.758  3.581   -8.564  1.00 0.00 ? 14 TYR A CG   6  
ATOM 6255  C CD1  . TYR A 1 14 ? 6.292  2.293   -8.742  1.00 0.00 ? 14 TYR A CD1  6  
ATOM 6256  C CD2  . TYR A 1 14 ? 7.837  3.785   -7.719  1.00 0.00 ? 14 TYR A CD2  6  
ATOM 6257  C CE1  . TYR A 1 14 ? 6.866  1.225   -8.097  1.00 0.00 ? 14 TYR A CE1  6  
ATOM 6258  C CE2  . TYR A 1 14 ? 8.425  2.720   -7.062  1.00 0.00 ? 14 TYR A CE2  6  
ATOM 6259  C CZ   . TYR A 1 14 ? 7.937  1.447   -7.240  1.00 0.00 ? 14 TYR A CZ   6  
ATOM 6260  O OH   . TYR A 1 14 ? 8.512  0.391   -6.573  1.00 0.00 ? 14 TYR A OH   6  
ATOM 6261  H H    . TYR A 1 14 ? 4.668  6.588   -10.226 1.00 0.00 ? 14 TYR A H    6  
ATOM 6262  H HA   . TYR A 1 14 ? 4.116  4.326   -8.624  1.00 0.00 ? 14 TYR A HA   6  
ATOM 6263  H HB2  . TYR A 1 14 ? 5.951  4.451   -10.309 1.00 0.00 ? 14 TYR A HB2  6  
ATOM 6264  H HB3  . TYR A 1 14 ? 6.794  5.570   -9.273  1.00 0.00 ? 14 TYR A HB3  6  
ATOM 6265  H HD1  . TYR A 1 14 ? 5.454  2.122   -9.403  1.00 0.00 ? 14 TYR A HD1  6  
ATOM 6266  H HD2  . TYR A 1 14 ? 8.214  4.795   -7.576  1.00 0.00 ? 14 TYR A HD2  6  
ATOM 6267  H HE1  . TYR A 1 14 ? 6.495  0.224   -8.243  1.00 0.00 ? 14 TYR A HE1  6  
ATOM 6268  H HE2  . TYR A 1 14 ? 9.266  2.891   -6.396  1.00 0.00 ? 14 TYR A HE2  6  
ATOM 6269  H HH   . TYR A 1 14 ? 8.753  -0.293  -7.206  1.00 0.00 ? 14 TYR A HH   6  
ATOM 6270  N N    . ALA A 1 15 ? 5.422  6.976   -7.193  1.00 0.00 ? 15 ALA A N    6  
ATOM 6271  C CA   . ALA A 1 15 ? 5.583  7.680   -5.923  1.00 0.00 ? 15 ALA A CA   6  
ATOM 6272  C C    . ALA A 1 15 ? 4.263  7.710   -5.139  1.00 0.00 ? 15 ALA A C    6  
ATOM 6273  O O    . ALA A 1 15 ? 4.257  7.643   -3.927  1.00 0.00 ? 15 ALA A O    6  
ATOM 6274  C CB   . ALA A 1 15 ? 6.080  9.099   -6.166  1.00 0.00 ? 15 ALA A CB   6  
ATOM 6275  H H    . ALA A 1 15 ? 5.675  7.439   -8.000  1.00 0.00 ? 15 ALA A H    6  
ATOM 6276  H HA   . ALA A 1 15 ? 6.326  7.148   -5.331  1.00 0.00 ? 15 ALA A HA   6  
ATOM 6277  H HB1  . ALA A 1 15 ? 5.343  9.650   -6.751  1.00 0.00 ? 15 ALA A HB1  6  
ATOM 6278  H HB2  . ALA A 1 15 ? 7.008  9.070   -6.700  1.00 0.00 ? 15 ALA A HB2  6  
ATOM 6279  H HB3  . ALA A 1 15 ? 6.212  9.597   -5.218  1.00 0.00 ? 15 ALA A HB3  6  
ATOM 6280  N N    . LEU A 1 16 ? 3.160  7.793   -5.863  1.00 0.00 ? 16 LEU A N    6  
ATOM 6281  C CA   . LEU A 1 16 ? 1.837  7.747   -5.262  1.00 0.00 ? 16 LEU A CA   6  
ATOM 6282  C C    . LEU A 1 16 ? 1.506  6.331   -4.795  1.00 0.00 ? 16 LEU A C    6  
ATOM 6283  O O    . LEU A 1 16 ? 0.968  6.138   -3.696  1.00 0.00 ? 16 LEU A O    6  
ATOM 6284  C CB   . LEU A 1 16 ? 0.793  8.228   -6.278  1.00 0.00 ? 16 LEU A CB   6  
ATOM 6285  C CG   . LEU A 1 16 ? -0.641 8.280   -5.769  1.00 0.00 ? 16 LEU A CG   6  
ATOM 6286  C CD1  . LEU A 1 16 ? -0.775 9.261   -4.620  1.00 0.00 ? 16 LEU A CD1  6  
ATOM 6287  C CD2  . LEU A 1 16 ? -1.600 8.651   -6.904  1.00 0.00 ? 16 LEU A CD2  6  
ATOM 6288  H H    . LEU A 1 16 ? 3.227  7.868   -6.832  1.00 0.00 ? 16 LEU A H    6  
ATOM 6289  H HA   . LEU A 1 16 ? 1.834  8.413   -4.424  1.00 0.00 ? 16 LEU A HA   6  
ATOM 6290  H HB2  . LEU A 1 16 ? 1.080  9.217   -6.606  1.00 0.00 ? 16 LEU A HB2  6  
ATOM 6291  H HB3  . LEU A 1 16 ? 0.829  7.571   -7.135  1.00 0.00 ? 16 LEU A HB3  6  
ATOM 6292  H HG   . LEU A 1 16 ? -0.913 7.300   -5.405  1.00 0.00 ? 16 LEU A HG   6  
ATOM 6293  H HD11 . LEU A 1 16 ? -0.474 10.250  -4.949  1.00 0.00 ? 16 LEU A HD11 6  
ATOM 6294  H HD12 . LEU A 1 16 ? -0.144 8.949   -3.806  1.00 0.00 ? 16 LEU A HD12 6  
ATOM 6295  H HD13 . LEU A 1 16 ? -1.793 9.286   -4.279  1.00 0.00 ? 16 LEU A HD13 6  
ATOM 6296  H HD21 . LEU A 1 16 ? -1.346 9.633   -7.278  1.00 0.00 ? 16 LEU A HD21 6  
ATOM 6297  H HD22 . LEU A 1 16 ? -2.611 8.666   -6.524  1.00 0.00 ? 16 LEU A HD22 6  
ATOM 6298  H HD23 . LEU A 1 16 ? -1.516 7.929   -7.695  1.00 0.00 ? 16 LEU A HD23 6  
ATOM 6299  N N    . TYR A 1 17 ? 1.847  5.364   -5.626  1.00 0.00 ? 17 TYR A N    6  
ATOM 6300  C CA   . TYR A 1 17 ? 1.597  3.965   -5.318  1.00 0.00 ? 17 TYR A CA   6  
ATOM 6301  C C    . TYR A 1 17 ? 2.342  3.527   -4.081  1.00 0.00 ? 17 TYR A C    6  
ATOM 6302  O O    . TYR A 1 17 ? 1.733  3.018   -3.123  1.00 0.00 ? 17 TYR A O    6  
ATOM 6303  C CB   . TYR A 1 17 ? 2.000  3.105   -6.524  1.00 0.00 ? 17 TYR A CB   6  
ATOM 6304  C CG   . TYR A 1 17 ? 1.864  1.611   -6.312  1.00 0.00 ? 17 TYR A CG   6  
ATOM 6305  C CD1  . TYR A 1 17 ? 0.631  0.986   -6.423  1.00 0.00 ? 17 TYR A CD1  6  
ATOM 6306  C CD2  . TYR A 1 17 ? 2.969  0.824   -6.018  1.00 0.00 ? 17 TYR A CD2  6  
ATOM 6307  C CE1  . TYR A 1 17 ? 0.507  -0.376  -6.247  1.00 0.00 ? 17 TYR A CE1  6  
ATOM 6308  C CE2  . TYR A 1 17 ? 2.854  -0.538  -5.838  1.00 0.00 ? 17 TYR A CE2  6  
ATOM 6309  C CZ   . TYR A 1 17 ? 1.616  -1.140  -5.950  1.00 0.00 ? 17 TYR A CZ   6  
ATOM 6310  O OH   . TYR A 1 17 ? 1.481  -2.502  -5.775  1.00 0.00 ? 17 TYR A OH   6  
ATOM 6311  H H    . TYR A 1 17 ? 2.281  5.590   -6.453  1.00 0.00 ? 17 TYR A H    6  
ATOM 6312  H HA   . TYR A 1 17 ? 0.546  3.855   -5.159  1.00 0.00 ? 17 TYR A HA   6  
ATOM 6313  H HB2  . TYR A 1 17 ? 1.374  3.378   -7.371  1.00 0.00 ? 17 TYR A HB2  6  
ATOM 6314  H HB3  . TYR A 1 17 ? 3.029  3.308   -6.767  1.00 0.00 ? 17 TYR A HB3  6  
ATOM 6315  H HD1  . TYR A 1 17 ? -0.238 1.578   -6.656  1.00 0.00 ? 17 TYR A HD1  6  
ATOM 6316  H HD2  . TYR A 1 17 ? 3.936  1.310   -5.913  1.00 0.00 ? 17 TYR A HD2  6  
ATOM 6317  H HE1  . TYR A 1 17 ? -0.453 -0.845  -6.329  1.00 0.00 ? 17 TYR A HE1  6  
ATOM 6318  H HE2  . TYR A 1 17 ? 3.728  -1.131  -5.607  1.00 0.00 ? 17 TYR A HE2  6  
ATOM 6319  H HH   . TYR A 1 17 ? 2.158  -2.808  -5.144  1.00 0.00 ? 17 TYR A HH   6  
ATOM 6320  N N    . VAL A 1 18 ? 3.650  3.725   -4.069  1.00 0.00 ? 18 VAL A N    6  
ATOM 6321  C CA   . VAL A 1 18 ? 4.484  3.301   -2.958  1.00 0.00 ? 18 VAL A CA   6  
ATOM 6322  C C    . VAL A 1 18 ? 4.041  3.902   -1.613  1.00 0.00 ? 18 VAL A C    6  
ATOM 6323  O O    . VAL A 1 18 ? 4.223  3.283   -0.579  1.00 0.00 ? 18 VAL A O    6  
ATOM 6324  C CB   . VAL A 1 18 ? 5.974  3.623   -3.198  1.00 0.00 ? 18 VAL A CB   6  
ATOM 6325  C CG1  . VAL A 1 18 ? 6.504  2.798   -4.359  1.00 0.00 ? 18 VAL A CG1  6  
ATOM 6326  C CG2  . VAL A 1 18 ? 6.185  5.090   -3.477  1.00 0.00 ? 18 VAL A CG2  6  
ATOM 6327  H H    . VAL A 1 18 ? 4.069  4.128   -4.858  1.00 0.00 ? 18 VAL A H    6  
ATOM 6328  H HA   . VAL A 1 18 ? 4.387  2.232   -2.887  1.00 0.00 ? 18 VAL A HA   6  
ATOM 6329  H HB   . VAL A 1 18 ? 6.524  3.361   -2.315  1.00 0.00 ? 18 VAL A HB   6  
ATOM 6330  H HG11 . VAL A 1 18 ? 6.428  1.758   -4.110  1.00 0.00 ? 18 VAL A HG11 6  
ATOM 6331  H HG12 . VAL A 1 18 ? 7.539  3.051   -4.536  1.00 0.00 ? 18 VAL A HG12 6  
ATOM 6332  H HG13 . VAL A 1 18 ? 5.923  3.003   -5.245  1.00 0.00 ? 18 VAL A HG13 6  
ATOM 6333  H HG21 . VAL A 1 18 ? 7.238  5.286   -3.625  1.00 0.00 ? 18 VAL A HG21 6  
ATOM 6334  H HG22 . VAL A 1 18 ? 5.840  5.667   -2.628  1.00 0.00 ? 18 VAL A HG22 6  
ATOM 6335  H HG23 . VAL A 1 18 ? 5.638  5.379   -4.354  1.00 0.00 ? 18 VAL A HG23 6  
ATOM 6336  N N    . ARG A 1 19 ? 3.448  5.095   -1.656  1.00 0.00 ? 19 ARG A N    6  
ATOM 6337  C CA   . ARG A 1 19 ? 2.967  5.767   -0.452  1.00 0.00 ? 19 ARG A CA   6  
ATOM 6338  C C    . ARG A 1 19 ? 2.148  4.836   0.449   1.00 0.00 ? 19 ARG A C    6  
ATOM 6339  O O    . ARG A 1 19 ? 2.401  4.746   1.645   1.00 0.00 ? 19 ARG A O    6  
ATOM 6340  C CB   . ARG A 1 19 ? 2.127  6.981   -0.827  1.00 0.00 ? 19 ARG A CB   6  
ATOM 6341  C CG   . ARG A 1 19 ? 2.685  8.303   -0.341  1.00 0.00 ? 19 ARG A CG   6  
ATOM 6342  C CD   . ARG A 1 19 ? 2.687  8.409   1.178   1.00 0.00 ? 19 ARG A CD   6  
ATOM 6343  N NE   . ARG A 1 19 ? 3.773  7.663   1.813   1.00 0.00 ? 19 ARG A NE   6  
ATOM 6344  C CZ   . ARG A 1 19 ? 3.749  7.257   3.079   1.00 0.00 ? 19 ARG A CZ   6  
ATOM 6345  N NH1  . ARG A 1 19 ? 2.667  7.449   3.834   1.00 0.00 ? 19 ARG A NH1  6  
ATOM 6346  N NH2  . ARG A 1 19 ? 4.809  6.646   3.590   1.00 0.00 ? 19 ARG A NH2  6  
ATOM 6347  H H    . ARG A 1 19 ? 3.400  5.574   -2.517  1.00 0.00 ? 19 ARG A H    6  
ATOM 6348  H HA   . ARG A 1 19 ? 3.825  6.100   0.097   1.00 0.00 ? 19 ARG A HA   6  
ATOM 6349  H HB2  . ARG A 1 19 ? 2.060  7.035   -1.913  1.00 0.00 ? 19 ARG A HB2  6  
ATOM 6350  H HB3  . ARG A 1 19 ? 1.136  6.857   -0.421  1.00 0.00 ? 19 ARG A HB3  6  
ATOM 6351  H HG2  . ARG A 1 19 ? 3.705  8.393   -0.688  1.00 0.00 ? 19 ARG A HG2  6  
ATOM 6352  H HG3  . ARG A 1 19 ? 2.094  9.106   -0.748  1.00 0.00 ? 19 ARG A HG3  6  
ATOM 6353  H HD2  . ARG A 1 19 ? 2.782  9.443   1.452   1.00 0.00 ? 19 ARG A HD2  6  
ATOM 6354  H HD3  . ARG A 1 19 ? 1.735  8.023   1.552   1.00 0.00 ? 19 ARG A HD3  6  
ATOM 6355  H HE   . ARG A 1 19 ? 4.579  7.494   1.272   1.00 0.00 ? 19 ARG A HE   6  
ATOM 6356  H HH11 . ARG A 1 19 ? 1.850  7.895   3.444   1.00 0.00 ? 19 ARG A HH11 6  
ATOM 6357  H HH12 . ARG A 1 19 ? 2.654  7.165   4.805   1.00 0.00 ? 19 ARG A HH12 6  
ATOM 6358  H HH21 . ARG A 1 19 ? 5.624  6.493   3.037   1.00 0.00 ? 19 ARG A HH21 6  
ATOM 6359  H HH22 . ARG A 1 19 ? 4.804  6.332   4.553   1.00 0.00 ? 19 ARG A HH22 6  
ATOM 6360  N N    . ASP A 1 20 ? 1.186  4.140   -0.115  1.00 0.00 ? 20 ASP A N    6  
ATOM 6361  C CA   . ASP A 1 20 ? 0.325  3.258   0.686   1.00 0.00 ? 20 ASP A CA   6  
ATOM 6362  C C    . ASP A 1 20 ? 0.955  1.869   0.834   1.00 0.00 ? 20 ASP A C    6  
ATOM 6363  O O    . ASP A 1 20 ? 0.657  1.141   1.778   1.00 0.00 ? 20 ASP A O    6  
ATOM 6364  C CB   . ASP A 1 20 ? -1.085 3.143   0.085   1.00 0.00 ? 20 ASP A CB   6  
ATOM 6365  C CG   . ASP A 1 20 ? -1.130 2.385   -1.228  1.00 0.00 ? 20 ASP A CG   6  
ATOM 6366  O OD1  . ASP A 1 20 ? -1.055 1.129   -1.218  1.00 0.00 ? 20 ASP A OD1  6  
ATOM 6367  O OD2  . ASP A 1 20 ? -1.267 3.027   -2.274  1.00 0.00 ? 20 ASP A OD2  6  
ATOM 6368  H H    . ASP A 1 20 ? 1.046  4.194   -1.089  1.00 0.00 ? 20 ASP A H    6  
ATOM 6369  H HA   . ASP A 1 20 ? 0.235  3.702   1.672   1.00 0.00 ? 20 ASP A HA   6  
ATOM 6370  H HB2  . ASP A 1 20 ? -1.717 2.625   0.796   1.00 0.00 ? 20 ASP A HB2  6  
ATOM 6371  H HB3  . ASP A 1 20 ? -1.487 4.126   -0.085  1.00 0.00 ? 20 ASP A HB3  6  
ATOM 6372  N N    . THR A 1 21 ? 1.845  1.519   -0.082  1.00 0.00 ? 21 THR A N    6  
ATOM 6373  C CA   . THR A 1 21 ? 2.398  0.167   -0.144  1.00 0.00 ? 21 THR A CA   6  
ATOM 6374  C C    . THR A 1 21 ? 3.617  0.034   0.766   1.00 0.00 ? 21 THR A C    6  
ATOM 6375  O O    . THR A 1 21 ? 3.945  -1.050  1.225   1.00 0.00 ? 21 THR A O    6  
ATOM 6376  C CB   . THR A 1 21 ? 2.790  -0.188  -1.592  1.00 0.00 ? 21 THR A CB   6  
ATOM 6377  O OG1  . THR A 1 21 ? 1.692  0.116   -2.475  1.00 0.00 ? 21 THR A OG1  6  
ATOM 6378  C CG2  . THR A 1 21 ? 3.132  -1.666  -1.728  1.00 0.00 ? 21 THR A CG2  6  
ATOM 6379  H H    . THR A 1 21 ? 2.137  2.175   -0.744  1.00 0.00 ? 21 THR A H    6  
ATOM 6380  H HA   . THR A 1 21 ? 1.633  -0.520  0.186   1.00 0.00 ? 21 THR A HA   6  
ATOM 6381  H HB   . THR A 1 21 ? 3.663  0.395   -1.893  1.00 0.00 ? 21 THR A HB   6  
ATOM 6382  H HG1  . THR A 1 21 ? 1.005  0.570   -1.982  1.00 0.00 ? 21 THR A HG1  6  
ATOM 6383  H HG21 . THR A 1 21 ? 3.423  -1.871  -2.749  1.00 0.00 ? 21 THR A HG21 6  
ATOM 6384  H HG22 . THR A 1 21 ? 2.263  -2.256  -1.466  1.00 0.00 ? 21 THR A HG22 6  
ATOM 6385  H HG23 . THR A 1 21 ? 3.952  -1.917  -1.071  1.00 0.00 ? 21 THR A HG23 6  
ATOM 6386  N N    . LEU A 1 22 ? 4.285  1.142   1.016   1.00 0.00 ? 22 LEU A N    6  
ATOM 6387  C CA   . LEU A 1 22 ? 5.480  1.149   1.847   1.00 0.00 ? 22 LEU A CA   6  
ATOM 6388  C C    . LEU A 1 22 ? 5.124  1.092   3.324   1.00 0.00 ? 22 LEU A C    6  
ATOM 6389  O O    . LEU A 1 22 ? 4.736  2.083   3.926   1.00 0.00 ? 22 LEU A O    6  
ATOM 6390  C CB   . LEU A 1 22 ? 6.351  2.362   1.567   1.00 0.00 ? 22 LEU A CB   6  
ATOM 6391  C CG   . LEU A 1 22 ? 7.487  2.137   0.544   1.00 0.00 ? 22 LEU A CG   6  
ATOM 6392  C CD1  . LEU A 1 22 ? 8.513  1.165   1.107   1.00 0.00 ? 22 LEU A CD1  6  
ATOM 6393  C CD2  . LEU A 1 22 ? 6.923  1.604   -0.748  1.00 0.00 ? 22 LEU A CD2  6  
ATOM 6394  H H    . LEU A 1 22 ? 3.955  1.993   0.634   1.00 0.00 ? 22 LEU A H    6  
ATOM 6395  H HA   . LEU A 1 22 ? 6.036  0.258   1.609   1.00 0.00 ? 22 LEU A HA   6  
ATOM 6396  H HB2  . LEU A 1 22 ? 5.725  3.166   1.201   1.00 0.00 ? 22 LEU A HB2  6  
ATOM 6397  H HB3  . LEU A 1 22 ? 6.804  2.681   2.502   1.00 0.00 ? 22 LEU A HB3  6  
ATOM 6398  H HG   . LEU A 1 22 ? 7.991  3.076   0.349   1.00 0.00 ? 22 LEU A HG   6  
ATOM 6399  H HD11 . LEU A 1 22 ? 9.309  1.034   0.391   1.00 0.00 ? 22 LEU A HD11 6  
ATOM 6400  H HD12 . LEU A 1 22 ? 8.046  0.202   1.303   1.00 0.00 ? 22 LEU A HD12 6  
ATOM 6401  H HD13 . LEU A 1 22 ? 8.913  1.556   2.031   1.00 0.00 ? 22 LEU A HD13 6  
ATOM 6402  H HD21 . LEU A 1 22 ? 7.729  1.457   -1.446  1.00 0.00 ? 22 LEU A HD21 6  
ATOM 6403  H HD22 . LEU A 1 22 ? 6.231  2.322   -1.151  1.00 0.00 ? 22 LEU A HD22 6  
ATOM 6404  H HD23 . LEU A 1 22 ? 6.420  0.675   -0.560  1.00 0.00 ? 22 LEU A HD23 6  
ATOM 6405  N N    . GLN A 1 23 ? 5.243  -0.106  3.869   1.00 0.00 ? 23 GLN A N    6  
ATOM 6406  C CA   . GLN A 1 23 ? 5.108  -0.329  5.295   1.00 0.00 ? 23 GLN A CA   6  
ATOM 6407  C C    . GLN A 1 23 ? 6.487  -0.396  5.919   1.00 0.00 ? 23 GLN A C    6  
ATOM 6408  O O    . GLN A 1 23 ? 7.399  -0.993  5.336   1.00 0.00 ? 23 GLN A O    6  
ATOM 6409  C CB   . GLN A 1 23 ? 4.325  -1.609  5.586   1.00 0.00 ? 23 GLN A CB   6  
ATOM 6410  C CG   . GLN A 1 23 ? 2.899  -1.369  6.099   1.00 0.00 ? 23 GLN A CG   6  
ATOM 6411  C CD   . GLN A 1 23 ? 2.029  -0.530  5.182   1.00 0.00 ? 23 GLN A CD   6  
ATOM 6412  O OE1  . GLN A 1 23 ? 1.103  0.152   5.633   1.00 0.00 ? 23 GLN A OE1  6  
ATOM 6413  N NE2  . GLN A 1 23 ? 2.328  -0.567  3.897   1.00 0.00 ? 23 GLN A NE2  6  
ATOM 6414  H H    . GLN A 1 23 ? 5.435  -0.870  3.285   1.00 0.00 ? 23 GLN A H    6  
ATOM 6415  H HA   . GLN A 1 23 ? 4.576  0.518   5.713   1.00 0.00 ? 23 GLN A HA   6  
ATOM 6416  H HB2  . GLN A 1 23 ? 4.265  -2.191  4.677   1.00 0.00 ? 23 GLN A HB2  6  
ATOM 6417  H HB3  . GLN A 1 23 ? 4.858  -2.180  6.328   1.00 0.00 ? 23 GLN A HB3  6  
ATOM 6418  H HG2  . GLN A 1 23 ? 2.416  -2.330  6.228   1.00 0.00 ? 23 GLN A HG2  6  
ATOM 6419  H HG3  . GLN A 1 23 ? 2.962  -0.882  7.065   1.00 0.00 ? 23 GLN A HG3  6  
ATOM 6420  H HE21 . GLN A 1 23 ? 3.084  -1.119  3.619   1.00 0.00 ? 23 GLN A HE21 6  
ATOM 6421  H HE22 . GLN A 1 23 ? 1.779  -0.041  3.286   1.00 0.00 ? 23 GLN A HE22 6  
ATOM 6422  N N    . PRO A 1 24 ? 6.662  0.251   7.078   1.00 0.00 ? 24 PRO A N    6  
ATOM 6423  C CA   . PRO A 1 24 ? 7.912  0.202   7.839   1.00 0.00 ? 24 PRO A CA   6  
ATOM 6424  C C    . PRO A 1 24 ? 8.405  -1.240  8.034   1.00 0.00 ? 24 PRO A C    6  
ATOM 6425  O O    . PRO A 1 24 ? 7.882  -1.979  8.862   1.00 0.00 ? 24 PRO A O    6  
ATOM 6426  C CB   . PRO A 1 24 ? 7.539  0.834   9.171   1.00 0.00 ? 24 PRO A CB   6  
ATOM 6427  C CG   . PRO A 1 24 ? 6.396  1.740   8.855   1.00 0.00 ? 24 PRO A CG   6  
ATOM 6428  C CD   . PRO A 1 24 ? 5.652  1.090   7.716   1.00 0.00 ? 24 PRO A CD   6  
ATOM 6429  H HA   . PRO A 1 24 ? 8.688  0.775   7.362   1.00 0.00 ? 24 PRO A HA   6  
ATOM 6430  H HB2  . PRO A 1 24 ? 7.256  0.073   9.889   1.00 0.00 ? 24 PRO A HB2  6  
ATOM 6431  H HB3  . PRO A 1 24 ? 8.382  1.397   9.549   1.00 0.00 ? 24 PRO A HB3  6  
ATOM 6432  H HG2  . PRO A 1 24 ? 5.749  1.841   9.709   1.00 0.00 ? 24 PRO A HG2  6  
ATOM 6433  H HG3  . PRO A 1 24 ? 6.780  2.701   8.537   1.00 0.00 ? 24 PRO A HG3  6  
ATOM 6434  H HD2  . PRO A 1 24 ? 4.825  0.500   8.084   1.00 0.00 ? 24 PRO A HD2  6  
ATOM 6435  H HD3  . PRO A 1 24 ? 5.287  1.849   7.027   1.00 0.00 ? 24 PRO A HD3  6  
ATOM 6436  N N    . GLY A 1 25 ? 9.388  -1.630  7.238   1.00 0.00 ? 25 GLY A N    6  
ATOM 6437  C CA   . GLY A 1 25 ? 9.870  -2.991  7.268   1.00 0.00 ? 25 GLY A CA   6  
ATOM 6438  C C    . GLY A 1 25 ? 9.935  -3.621  5.889   1.00 0.00 ? 25 GLY A C    6  
ATOM 6439  O O    . GLY A 1 25 ? 10.490 -4.708  5.720   1.00 0.00 ? 25 GLY A O    6  
ATOM 6440  H H    . GLY A 1 25 ? 9.779  -0.969  6.627   1.00 0.00 ? 25 GLY A H    6  
ATOM 6441  H HA2  . GLY A 1 25 ? 10.862 -3.007  7.687   1.00 0.00 ? 25 GLY A HA2  6  
ATOM 6442  H HA3  . GLY A 1 25 ? 9.211  -3.582  7.884   1.00 0.00 ? 25 GLY A HA3  6  
ATOM 6443  N N    . MET A 1 26 ? 9.380  -2.931  4.887   1.00 0.00 ? 26 MET A N    6  
ATOM 6444  C CA   . MET A 1 26 ? 9.395  -3.428  3.524   1.00 0.00 ? 26 MET A CA   6  
ATOM 6445  C C    . MET A 1 26 ? 10.734 -3.098  2.859   1.00 0.00 ? 26 MET A C    6  
ATOM 6446  O O    . MET A 1 26 ? 11.197 -1.962  2.916   1.00 0.00 ? 26 MET A O    6  
ATOM 6447  C CB   . MET A 1 26 ? 8.242  -2.830  2.711   1.00 0.00 ? 26 MET A CB   6  
ATOM 6448  C CG   . MET A 1 26 ? 8.137  -3.372  1.291   1.00 0.00 ? 26 MET A CG   6  
ATOM 6449  S SD   . MET A 1 26 ? 7.700  -5.116  1.242   1.00 0.00 ? 26 MET A SD   6  
ATOM 6450  C CE   . MET A 1 26 ? 6.096  -5.087  2.037   1.00 0.00 ? 26 MET A CE   6  
ATOM 6451  H H    . MET A 1 26 ? 8.974  -2.057  5.062   1.00 0.00 ? 26 MET A H    6  
ATOM 6452  H HA   . MET A 1 26 ? 9.286  -4.508  3.560   1.00 0.00 ? 26 MET A HA   6  
ATOM 6453  H HB2  . MET A 1 26 ? 7.320  -3.051  3.227   1.00 0.00 ? 26 MET A HB2  6  
ATOM 6454  H HB3  . MET A 1 26 ? 8.360  -1.764  2.662   1.00 0.00 ? 26 MET A HB3  6  
ATOM 6455  H HG2  . MET A 1 26 ? 7.387  -2.825  0.758   1.00 0.00 ? 26 MET A HG2  6  
ATOM 6456  H HG3  . MET A 1 26 ? 9.093  -3.240  0.804   1.00 0.00 ? 26 MET A HG3  6  
ATOM 6457  H HE1  . MET A 1 26 ? 5.440  -4.420  1.503   1.00 0.00 ? 26 MET A HE1  6  
ATOM 6458  H HE2  . MET A 1 26 ? 6.198  -4.737  3.060   1.00 0.00 ? 26 MET A HE2  6  
ATOM 6459  H HE3  . MET A 1 26 ? 5.677  -6.083  2.028   1.00 0.00 ? 26 MET A HE3  6  
ATOM 6460  N N    . ARG A 1 27 ? 11.371 -4.113  2.275   1.00 0.00 ? 27 ARG A N    6  
ATOM 6461  C CA   . ARG A 1 27 ? 12.671 -3.913  1.661   1.00 0.00 ? 27 ARG A CA   6  
ATOM 6462  C C    . ARG A 1 27 ? 12.565 -3.273  0.265   1.00 0.00 ? 27 ARG A C    6  
ATOM 6463  O O    . ARG A 1 27 ? 11.661 -3.588  -0.521  1.00 0.00 ? 27 ARG A O    6  
ATOM 6464  C CB   . ARG A 1 27 ? 13.442 -5.241  1.580   1.00 0.00 ? 27 ARG A CB   6  
ATOM 6465  C CG   . ARG A 1 27 ? 14.730 -5.132  0.781   1.00 0.00 ? 27 ARG A CG   6  
ATOM 6466  C CD   . ARG A 1 27 ? 15.698 -6.237  1.118   1.00 0.00 ? 27 ARG A CD   6  
ATOM 6467  N NE   . ARG A 1 27 ? 16.250 -6.060  2.458   1.00 0.00 ? 27 ARG A NE   6  
ATOM 6468  C CZ   . ARG A 1 27 ? 17.421 -6.548  2.873   1.00 0.00 ? 27 ARG A CZ   6  
ATOM 6469  N NH1  . ARG A 1 27 ? 18.195 -7.223  2.042   1.00 0.00 ? 27 ARG A NH1  6  
ATOM 6470  N NH2  . ARG A 1 27 ? 17.823 -6.291  4.112   1.00 0.00 ? 27 ARG A NH2  6  
ATOM 6471  H H    . ARG A 1 27 ? 10.954 -5.002  2.274   1.00 0.00 ? 27 ARG A H    6  
ATOM 6472  H HA   . ARG A 1 27 ? 13.227 -3.233  2.281   1.00 0.00 ? 27 ARG A HA   6  
ATOM 6473  H HB2  . ARG A 1 27 ? 13.698 -5.541  2.590   1.00 0.00 ? 27 ARG A HB2  6  
ATOM 6474  H HB3  . ARG A 1 27 ? 12.822 -5.994  1.127   1.00 0.00 ? 27 ARG A HB3  6  
ATOM 6475  H HG2  . ARG A 1 27 ? 14.490 -5.187  -0.260  1.00 0.00 ? 27 ARG A HG2  6  
ATOM 6476  H HG3  . ARG A 1 27 ? 15.192 -4.180  1.001   1.00 0.00 ? 27 ARG A HG3  6  
ATOM 6477  H HD2  . ARG A 1 27 ? 15.187 -7.174  1.060   1.00 0.00 ? 27 ARG A HD2  6  
ATOM 6478  H HD3  . ARG A 1 27 ? 16.519 -6.215  0.402   1.00 0.00 ? 27 ARG A HD3  6  
ATOM 6479  H HE   . ARG A 1 27 ? 15.700 -5.559  3.112   1.00 0.00 ? 27 ARG A HE   6  
ATOM 6480  H HH11 . ARG A 1 27 ? 17.894 -7.402  1.096   1.00 0.00 ? 27 ARG A HH11 6  
ATOM 6481  H HH12 . ARG A 1 27 ? 19.090 -7.579  2.353   1.00 0.00 ? 27 ARG A HH12 6  
ATOM 6482  H HH21 . ARG A 1 27 ? 17.240 -5.748  4.734   1.00 0.00 ? 27 ARG A HH21 6  
ATOM 6483  H HH22 . ARG A 1 27 ? 18.713 -6.645  4.460   1.00 0.00 ? 27 ARG A HH22 6  
ATOM 6484  N N    . VAL A 1 28 ? 13.494 -2.383  -0.027  1.00 0.00 ? 28 VAL A N    6  
ATOM 6485  C CA   . VAL A 1 28 ? 13.491 -1.637  -1.281  1.00 0.00 ? 28 VAL A CA   6  
ATOM 6486  C C    . VAL A 1 28 ? 14.783 -1.829  -2.048  1.00 0.00 ? 28 VAL A C    6  
ATOM 6487  O O    . VAL A 1 28 ? 15.793 -2.246  -1.475  1.00 0.00 ? 28 VAL A O    6  
ATOM 6488  C CB   . VAL A 1 28 ? 13.299 -0.122  -1.030  1.00 0.00 ? 28 VAL A CB   6  
ATOM 6489  C CG1  . VAL A 1 28 ? 11.979 0.148   -0.348  1.00 0.00 ? 28 VAL A CG1  6  
ATOM 6490  C CG2  . VAL A 1 28 ? 14.461 0.425   -0.214  1.00 0.00 ? 28 VAL A CG2  6  
ATOM 6491  H H    . VAL A 1 28 ? 14.211 -2.226  0.624   1.00 0.00 ? 28 VAL A H    6  
ATOM 6492  H HA   . VAL A 1 28 ? 12.665 -1.984  -1.891  1.00 0.00 ? 28 VAL A HA   6  
ATOM 6493  H HB   . VAL A 1 28 ? 13.294 0.375   -1.989  1.00 0.00 ? 28 VAL A HB   6  
ATOM 6494  H HG11 . VAL A 1 28 ? 11.937 -0.384  0.590   1.00 0.00 ? 28 VAL A HG11 6  
ATOM 6495  H HG12 . VAL A 1 28 ? 11.163 -0.170  -0.975  1.00 0.00 ? 28 VAL A HG12 6  
ATOM 6496  H HG13 . VAL A 1 28 ? 11.879 1.205   -0.148  1.00 0.00 ? 28 VAL A HG13 6  
ATOM 6497  H HG21 . VAL A 1 28 ? 14.323 1.494   -0.082  1.00 0.00 ? 28 VAL A HG21 6  
ATOM 6498  H HG22 . VAL A 1 28 ? 15.391 0.244   -0.718  1.00 0.00 ? 28 VAL A HG22 6  
ATOM 6499  H HG23 . VAL A 1 28 ? 14.466 -0.047  0.754   1.00 0.00 ? 28 VAL A HG23 6  
ATOM 6500  N N    . ARG A 1 29 ? 14.740 -1.551  -3.333  1.00 0.00 ? 29 ARG A N    6  
ATOM 6501  C CA   . ARG A 1 29 ? 15.935 -1.584  -4.172  1.00 0.00 ? 29 ARG A CA   6  
ATOM 6502  C C    . ARG A 1 29 ? 16.152 -0.239  -4.845  1.00 0.00 ? 29 ARG A C    6  
ATOM 6503  O O    . ARG A 1 29 ? 15.226 0.345   -5.411  1.00 0.00 ? 29 ARG A O    6  
ATOM 6504  C CB   . ARG A 1 29 ? 15.802 -2.667  -5.243  1.00 0.00 ? 29 ARG A CB   6  
ATOM 6505  C CG   . ARG A 1 29 ? 17.110 -2.998  -5.923  1.00 0.00 ? 29 ARG A CG   6  
ATOM 6506  C CD   . ARG A 1 29 ? 16.990 -4.227  -6.802  1.00 0.00 ? 29 ARG A CD   6  
ATOM 6507  N NE   . ARG A 1 29 ? 18.259 -4.565  -7.428  1.00 0.00 ? 29 ARG A NE   6  
ATOM 6508  C CZ   . ARG A 1 29 ? 18.979 -5.649  -7.131  1.00 0.00 ? 29 ARG A CZ   6  
ATOM 6509  N NH1  . ARG A 1 29 ? 18.544 -6.495  -6.189  1.00 0.00 ? 29 ARG A NH1  6  
ATOM 6510  N NH2  . ARG A 1 29 ? 20.154 -5.861  -7.711  1.00 0.00 ? 29 ARG A NH2  6  
ATOM 6511  H H    . ARG A 1 29 ? 13.869 -1.369  -3.750  1.00 0.00 ? 29 ARG A H    6  
ATOM 6512  H HA   . ARG A 1 29 ? 16.796 -1.806  -3.530  1.00 0.00 ? 29 ARG A HA   6  
ATOM 6513  H HB2  . ARG A 1 29 ? 15.406 -3.565  -4.788  1.00 0.00 ? 29 ARG A HB2  6  
ATOM 6514  H HB3  . ARG A 1 29 ? 15.124 -2.309  -6.000  1.00 0.00 ? 29 ARG A HB3  6  
ATOM 6515  H HG2  . ARG A 1 29 ? 17.400 -2.163  -6.537  1.00 0.00 ? 29 ARG A HG2  6  
ATOM 6516  H HG3  . ARG A 1 29 ? 17.869 -3.177  -5.170  1.00 0.00 ? 29 ARG A HG3  6  
ATOM 6517  H HD2  . ARG A 1 29 ? 16.660 -5.055  -6.182  1.00 0.00 ? 29 ARG A HD2  6  
ATOM 6518  H HD3  . ARG A 1 29 ? 16.254 -4.030  -7.556  1.00 0.00 ? 29 ARG A HD3  6  
ATOM 6519  H HE   . ARG A 1 29 ? 18.589 -3.980  -8.128  1.00 0.00 ? 29 ARG A HE   6  
ATOM 6520  H HH11 . ARG A 1 29 ? 17.674 -6.343  -5.727  1.00 0.00 ? 29 ARG A HH11 6  
ATOM 6521  H HH12 . ARG A 1 29 ? 19.094 -7.326  -5.975  1.00 0.00 ? 29 ARG A HH12 6  
ATOM 6522  H HH21 . ARG A 1 29 ? 20.505 -5.224  -8.411  1.00 0.00 ? 29 ARG A HH21 6  
ATOM 6523  H HH22 . ARG A 1 29 ? 20.690 -6.689  -7.474  1.00 0.00 ? 29 ARG A HH22 6  
ATOM 6524  N N    . MET A 1 30 ? 17.383 0.257   -4.787  1.00 0.00 ? 30 MET A N    6  
ATOM 6525  C CA   . MET A 1 30 ? 17.739 1.452   -5.532  1.00 0.00 ? 30 MET A CA   6  
ATOM 6526  C C    . MET A 1 30 ? 17.992 1.065   -6.984  1.00 0.00 ? 30 MET A C    6  
ATOM 6527  O O    . MET A 1 30 ? 19.020 0.451   -7.298  1.00 0.00 ? 30 MET A O    6  
ATOM 6528  C CB   . MET A 1 30 ? 18.991 2.092   -4.936  1.00 0.00 ? 30 MET A CB   6  
ATOM 6529  C CG   . MET A 1 30 ? 19.297 3.479   -5.471  1.00 0.00 ? 30 MET A CG   6  
ATOM 6530  S SD   . MET A 1 30 ? 18.122 4.722   -4.882  1.00 0.00 ? 30 MET A SD   6  
ATOM 6531  C CE   . MET A 1 30 ? 18.824 6.202   -5.590  1.00 0.00 ? 30 MET A CE   6  
ATOM 6532  H H    . MET A 1 30 ? 18.067 -0.183  -4.223  1.00 0.00 ? 30 MET A H    6  
ATOM 6533  H HA   . MET A 1 30 ? 16.904 2.151   -5.488  1.00 0.00 ? 30 MET A HA   6  
ATOM 6534  H HB2  . MET A 1 30 ? 18.865 2.164   -3.858  1.00 0.00 ? 30 MET A HB2  6  
ATOM 6535  H HB3  . MET A 1 30 ? 19.845 1.451   -5.151  1.00 0.00 ? 30 MET A HB3  6  
ATOM 6536  H HG2  . MET A 1 30 ? 20.288 3.767   -5.157  1.00 0.00 ? 30 MET A HG2  6  
ATOM 6537  H HG3  . MET A 1 30 ? 19.259 3.450   -6.546  1.00 0.00 ? 30 MET A HG3  6  
ATOM 6538  H HE1  . MET A 1 30 ? 18.853 6.103   -6.667  1.00 0.00 ? 30 MET A HE1  6  
ATOM 6539  H HE2  . MET A 1 30 ? 19.815 6.369   -5.196  1.00 0.00 ? 30 MET A HE2  6  
ATOM 6540  H HE3  . MET A 1 30 ? 18.198 7.048   -5.331  1.00 0.00 ? 30 MET A HE3  6  
ATOM 6541  N N    . LEU A 1 31 ? 17.062 1.380   -7.870  1.00 0.00 ? 31 LEU A N    6  
ATOM 6542  C CA   . LEU A 1 31 ? 17.149 0.938   -9.256  1.00 0.00 ? 31 LEU A CA   6  
ATOM 6543  C C    . LEU A 1 31 ? 17.779 1.999   -10.147 1.00 0.00 ? 31 LEU A C    6  
ATOM 6544  O O    . LEU A 1 31 ? 18.136 1.727   -11.293 1.00 0.00 ? 31 LEU A O    6  
ATOM 6545  C CB   . LEU A 1 31 ? 15.776 0.453   -9.789  1.00 0.00 ? 31 LEU A CB   6  
ATOM 6546  C CG   . LEU A 1 31 ? 14.653 1.502   -10.046 1.00 0.00 ? 31 LEU A CG   6  
ATOM 6547  C CD1  . LEU A 1 31 ? 14.473 2.480   -8.901  1.00 0.00 ? 31 LEU A CD1  6  
ATOM 6548  C CD2  . LEU A 1 31 ? 14.893 2.245   -11.349 1.00 0.00 ? 31 LEU A CD2  6  
ATOM 6549  H H    . LEU A 1 31 ? 16.288 1.908   -7.586  1.00 0.00 ? 31 LEU A H    6  
ATOM 6550  H HA   . LEU A 1 31 ? 17.812 0.082   -9.241  1.00 0.00 ? 31 LEU A HA   6  
ATOM 6551  H HB2  . LEU A 1 31 ? 15.957 -0.059  -10.726 1.00 0.00 ? 31 LEU A HB2  6  
ATOM 6552  H HB3  . LEU A 1 31 ? 15.384 -0.271  -9.090  1.00 0.00 ? 31 LEU A HB3  6  
ATOM 6553  H HG   . LEU A 1 31 ? 13.706 0.977   -10.154 1.00 0.00 ? 31 LEU A HG   6  
ATOM 6554  H HD11 . LEU A 1 31 ? 13.658 3.149   -9.116  1.00 0.00 ? 31 LEU A HD11 6  
ATOM 6555  H HD12 . LEU A 1 31 ? 15.383 3.056   -8.785  1.00 0.00 ? 31 LEU A HD12 6  
ATOM 6556  H HD13 . LEU A 1 31 ? 14.272 1.937   -7.993  1.00 0.00 ? 31 LEU A HD13 6  
ATOM 6557  H HD21 . LEU A 1 31 ? 14.880 1.545   -12.170 1.00 0.00 ? 31 LEU A HD21 6  
ATOM 6558  H HD22 . LEU A 1 31 ? 15.850 2.727   -11.285 1.00 0.00 ? 31 LEU A HD22 6  
ATOM 6559  H HD23 . LEU A 1 31 ? 14.126 2.990   -11.489 1.00 0.00 ? 31 LEU A HD23 6  
ATOM 6560  N N    . ASP A 1 32 ? 17.929 3.202   -9.610  1.00 0.00 ? 32 ASP A N    6  
ATOM 6561  C CA   . ASP A 1 32 ? 18.604 4.267   -10.342 1.00 0.00 ? 32 ASP A CA   6  
ATOM 6562  C C    . ASP A 1 32 ? 19.845 4.692   -9.553  1.00 0.00 ? 32 ASP A C    6  
ATOM 6563  O O    . ASP A 1 32 ? 19.804 4.787   -8.330  1.00 0.00 ? 32 ASP A O    6  
ATOM 6564  C CB   . ASP A 1 32 ? 17.687 5.456   -10.572 1.00 0.00 ? 32 ASP A CB   6  
ATOM 6565  C CG   . ASP A 1 32 ? 18.284 6.457   -11.543 1.00 0.00 ? 32 ASP A CG   6  
ATOM 6566  O OD1  . ASP A 1 32 ? 18.712 6.031   -12.634 1.00 0.00 ? 32 ASP A OD1  6  
ATOM 6567  O OD2  . ASP A 1 32 ? 18.338 7.669   -11.223 1.00 0.00 ? 32 ASP A OD2  6  
ATOM 6568  H H    . ASP A 1 32 ? 17.593 3.380   -8.717  1.00 0.00 ? 32 ASP A H    6  
ATOM 6569  H HA   . ASP A 1 32 ? 18.926 3.865   -11.301 1.00 0.00 ? 32 ASP A HA   6  
ATOM 6570  H HB2  . ASP A 1 32 ? 16.734 5.116   -10.985 1.00 0.00 ? 32 ASP A HB2  6  
ATOM 6571  H HB3  . ASP A 1 32 ? 17.497 5.964   -9.635  1.00 0.00 ? 32 ASP A HB3  6  
ATOM 6572  N N    . ASP A 1 33 ? 20.951 4.943   -10.242 1.00 0.00 ? 33 ASP A N    6  
ATOM 6573  C CA   . ASP A 1 33 ? 22.217 5.202   -9.567  1.00 0.00 ? 33 ASP A CA   6  
ATOM 6574  C C    . ASP A 1 33 ? 22.330 6.679   -9.162  1.00 0.00 ? 33 ASP A C    6  
ATOM 6575  O O    . ASP A 1 33 ? 21.842 7.563   -9.860  1.00 0.00 ? 33 ASP A O    6  
ATOM 6576  C CB   . ASP A 1 33 ? 23.391 4.797   -10.457 1.00 0.00 ? 33 ASP A CB   6  
ATOM 6577  C CG   . ASP A 1 33 ? 24.688 4.711   -9.694  1.00 0.00 ? 33 ASP A CG   6  
ATOM 6578  O OD1  . ASP A 1 33 ? 24.864 3.731   -8.926  1.00 0.00 ? 33 ASP A OD1  6  
ATOM 6579  O OD2  . ASP A 1 33 ? 25.547 5.590   -9.851  1.00 0.00 ? 33 ASP A OD2  6  
ATOM 6580  H H    . ASP A 1 33 ? 20.911 4.992   -11.222 1.00 0.00 ? 33 ASP A H    6  
ATOM 6581  H HA   . ASP A 1 33 ? 22.236 4.604   -8.675  1.00 0.00 ? 33 ASP A HA   6  
ATOM 6582  H HB2  . ASP A 1 33 ? 23.191 3.829   -10.897 1.00 0.00 ? 33 ASP A HB2  6  
ATOM 6583  H HB3  . ASP A 1 33 ? 23.512 5.529   -11.244 1.00 0.00 ? 33 ASP A HB3  6  
ATOM 6584  N N    . TYR A 1 34 ? 22.994 6.906   -8.044  1.00 0.00 ? 34 TYR A N    6  
ATOM 6585  C CA   . TYR A 1 34 ? 23.092 8.243   -7.461  1.00 0.00 ? 34 TYR A CA   6  
ATOM 6586  C C    . TYR A 1 34 ? 24.380 8.330   -6.639  1.00 0.00 ? 34 TYR A C    6  
ATOM 6587  O O    . TYR A 1 34 ? 24.904 7.322   -6.225  1.00 0.00 ? 34 TYR A O    6  
ATOM 6588  C CB   . TYR A 1 34 ? 21.866 8.491   -6.567  1.00 0.00 ? 34 TYR A CB   6  
ATOM 6589  C CG   . TYR A 1 34 ? 21.699 9.908   -6.081  1.00 0.00 ? 34 TYR A CG   6  
ATOM 6590  C CD1  . TYR A 1 34 ? 21.359 10.929  -6.974  1.00 0.00 ? 34 TYR A CD1  6  
ATOM 6591  C CD2  . TYR A 1 34 ? 21.857 10.238  -4.745  1.00 0.00 ? 34 TYR A CD2  6  
ATOM 6592  C CE1  . TYR A 1 34 ? 21.190 12.229  -6.533  1.00 0.00 ? 34 TYR A CE1  6  
ATOM 6593  C CE2  . TYR A 1 34 ? 21.685 11.531  -4.298  1.00 0.00 ? 34 TYR A CE2  6  
ATOM 6594  C CZ   . TYR A 1 34 ? 21.350 12.527  -5.187  1.00 0.00 ? 34 TYR A CZ   6  
ATOM 6595  O OH   . TYR A 1 34 ? 21.166 13.809  -4.741  1.00 0.00 ? 34 TYR A OH   6  
ATOM 6596  H H    . TYR A 1 34 ? 23.447 6.174   -7.593  1.00 0.00 ? 34 TYR A H    6  
ATOM 6597  H HA   . TYR A 1 34 ? 23.125 8.974   -8.248  1.00 0.00 ? 34 TYR A HA   6  
ATOM 6598  H HB2  . TYR A 1 34 ? 20.979 8.227   -7.131  1.00 0.00 ? 34 TYR A HB2  6  
ATOM 6599  H HB3  . TYR A 1 34 ? 21.942 7.846   -5.702  1.00 0.00 ? 34 TYR A HB3  6  
ATOM 6600  H HD1  . TYR A 1 34 ? 21.233 10.696  -8.023  1.00 0.00 ? 34 TYR A HD1  6  
ATOM 6601  H HD2  . TYR A 1 34 ? 22.105 9.457   -4.047  1.00 0.00 ? 34 TYR A HD2  6  
ATOM 6602  H HE1  . TYR A 1 34 ? 20.921 13.009  -7.238  1.00 0.00 ? 34 TYR A HE1  6  
ATOM 6603  H HE2  . TYR A 1 34 ? 21.821 11.754  -3.246  1.00 0.00 ? 34 TYR A HE2  6  
ATOM 6604  H HH   . TYR A 1 34 ? 21.909 14.050  -4.135  1.00 0.00 ? 34 TYR A HH   6  
ATOM 6605  N N    . GLU A 1 35 ? 24.912 9.552   -6.488  1.00 0.00 ? 35 GLU A N    6  
ATOM 6606  C CA   . GLU A 1 35 ? 26.127 9.781   -5.693  1.00 0.00 ? 35 GLU A CA   6  
ATOM 6607  C C    . GLU A 1 35 ? 26.193 8.943   -4.418  1.00 0.00 ? 35 GLU A C    6  
ATOM 6608  O O    . GLU A 1 35 ? 26.996 8.017   -4.327  1.00 0.00 ? 35 GLU A O    6  
ATOM 6609  C CB   . GLU A 1 35 ? 26.239 11.257  -5.319  1.00 0.00 ? 35 GLU A CB   6  
ATOM 6610  C CG   . GLU A 1 35 ? 26.319 12.207  -6.509  1.00 0.00 ? 35 GLU A CG   6  
ATOM 6611  C CD   . GLU A 1 35 ? 24.967 12.445  -7.161  1.00 0.00 ? 35 GLU A CD   6  
ATOM 6612  O OE1  . GLU A 1 35 ? 24.597 11.652  -8.061  1.00 0.00 ? 35 GLU A OE1  6  
ATOM 6613  O OE2  . GLU A 1 35 ? 24.270 13.405  -6.790  1.00 0.00 ? 35 GLU A OE2  6  
ATOM 6614  H H    . GLU A 1 35 ? 24.550 10.314  -6.986  1.00 0.00 ? 35 GLU A H    6  
ATOM 6615  H HA   . GLU A 1 35 ? 26.967 9.522   -6.310  1.00 0.00 ? 35 GLU A HA   6  
ATOM 6616  H HB2  . GLU A 1 35 ? 25.372 11.534  -4.735  1.00 0.00 ? 35 GLU A HB2  6  
ATOM 6617  H HB3  . GLU A 1 35 ? 27.126 11.399  -4.716  1.00 0.00 ? 35 GLU A HB3  6  
ATOM 6618  H HG2  . GLU A 1 35 ? 26.704 13.148  -6.159  1.00 0.00 ? 35 GLU A HG2  6  
ATOM 6619  H HG3  . GLU A 1 35 ? 26.995 11.797  -7.233  1.00 0.00 ? 35 GLU A HG3  6  
ATOM 6620  N N    . GLU A 1 36 ? 25.373 9.275   -3.435  1.00 0.00 ? 36 GLU A N    6  
ATOM 6621  C CA   . GLU A 1 36 ? 25.424 8.641   -2.133  1.00 0.00 ? 36 GLU A CA   6  
ATOM 6622  C C    . GLU A 1 36 ? 25.007 7.173   -2.213  1.00 0.00 ? 36 GLU A C    6  
ATOM 6623  O O    . GLU A 1 36 ? 25.754 6.293   -1.758  1.00 0.00 ? 36 GLU A O    6  
ATOM 6624  C CB   . GLU A 1 36 ? 24.514 9.400   -1.150  1.00 0.00 ? 36 GLU A CB   6  
ATOM 6625  C CG   . GLU A 1 36 ? 25.071 10.734  -0.683  1.00 0.00 ? 36 GLU A CG   6  
ATOM 6626  C CD   . GLU A 1 36 ? 25.280 11.705  -1.828  1.00 0.00 ? 36 GLU A CD   6  
ATOM 6627  O OE1  . GLU A 1 36 ? 24.318 12.017  -2.552  1.00 0.00 ? 36 GLU A OE1  6  
ATOM 6628  O OE2  . GLU A 1 36 ? 26.425 12.178  -2.006  1.00 0.00 ? 36 GLU A OE2  6  
ATOM 6629  H H    . GLU A 1 36 ? 24.711 9.986   -3.581  1.00 0.00 ? 36 GLU A H    6  
ATOM 6630  H HA   . GLU A 1 36 ? 26.429 8.696   -1.776  1.00 0.00 ? 36 GLU A HA   6  
ATOM 6631  H HB2  . GLU A 1 36 ? 23.563 9.569   -1.621  1.00 0.00 ? 36 GLU A HB2  6  
ATOM 6632  H HB3  . GLU A 1 36 ? 24.367 8.776   -0.276  1.00 0.00 ? 36 GLU A HB3  6  
ATOM 6633  H HG2  . GLU A 1 36 ? 24.372 11.179  0.022   1.00 0.00 ? 36 GLU A HG2  6  
ATOM 6634  H HG3  . GLU A 1 36 ? 26.012 10.571  -0.199  1.00 0.00 ? 36 GLU A HG3  6  
ATOM 6635  N N    . ILE A 1 37 ? 23.826 6.929   -2.747  1.00 0.00 ? 37 ILE A N    6  
ATOM 6636  C CA   . ILE A 1 37 ? 23.277 5.585   -2.848  1.00 0.00 ? 37 ILE A CA   6  
ATOM 6637  C C    . ILE A 1 37 ? 23.365 5.103   -4.290  1.00 0.00 ? 37 ILE A C    6  
ATOM 6638  O O    . ILE A 1 37 ? 23.013 5.836   -5.207  1.00 0.00 ? 37 ILE A O    6  
ATOM 6639  C CB   . ILE A 1 37 ? 21.807 5.540   -2.378  1.00 0.00 ? 37 ILE A CB   6  
ATOM 6640  C CG1  . ILE A 1 37 ? 21.684 6.153   -0.968  1.00 0.00 ? 37 ILE A CG1  6  
ATOM 6641  C CG2  . ILE A 1 37 ? 21.281 4.119   -2.387  1.00 0.00 ? 37 ILE A CG2  6  
ATOM 6642  C CD1  . ILE A 1 37 ? 22.574 5.497   0.071   1.00 0.00 ? 37 ILE A CD1  6  
ATOM 6643  H H    . ILE A 1 37 ? 23.299 7.683   -3.088  1.00 0.00 ? 37 ILE A H    6  
ATOM 6644  H HA   . ILE A 1 37 ? 23.853 4.923   -2.217  1.00 0.00 ? 37 ILE A HA   6  
ATOM 6645  H HB   . ILE A 1 37 ? 21.211 6.124   -3.063  1.00 0.00 ? 37 ILE A HB   6  
ATOM 6646  H HG12 . ILE A 1 37 ? 21.943 7.198   -1.029  1.00 0.00 ? 37 ILE A HG12 6  
ATOM 6647  H HG13 . ILE A 1 37 ? 20.657 6.059   -0.638  1.00 0.00 ? 37 ILE A HG13 6  
ATOM 6648  H HG21 . ILE A 1 37 ? 21.880 3.504   -1.742  1.00 0.00 ? 37 ILE A HG21 6  
ATOM 6649  H HG22 . ILE A 1 37 ? 21.309 3.724   -3.393  1.00 0.00 ? 37 ILE A HG22 6  
ATOM 6650  H HG23 . ILE A 1 37 ? 20.258 4.114   -2.035  1.00 0.00 ? 37 ILE A HG23 6  
ATOM 6651  H HD11 . ILE A 1 37 ? 22.383 5.936   1.031   1.00 0.00 ? 37 ILE A HD11 6  
ATOM 6652  H HD12 . ILE A 1 37 ? 23.603 5.643   -0.200  1.00 0.00 ? 37 ILE A HD12 6  
ATOM 6653  H HD13 . ILE A 1 37 ? 22.357 4.444   0.115   1.00 0.00 ? 37 ILE A HD13 6  
ATOM 6654  N N    . SER A 1 38 ? 23.771 3.862   -4.495  1.00 0.00 ? 38 SER A N    6  
ATOM 6655  C CA   . SER A 1 38 ? 24.105 3.413   -5.827  1.00 0.00 ? 38 SER A CA   6  
ATOM 6656  C C    . SER A 1 38 ? 23.069 2.416   -6.340  1.00 0.00 ? 38 SER A C    6  
ATOM 6657  O O    . SER A 1 38 ? 22.392 1.756   -5.553  1.00 0.00 ? 38 SER A O    6  
ATOM 6658  C CB   . SER A 1 38 ? 25.505 2.786   -5.814  1.00 0.00 ? 38 SER A CB   6  
ATOM 6659  O OG   . SER A 1 38 ? 26.462 3.679   -5.274  1.00 0.00 ? 38 SER A OG   6  
ATOM 6660  H H    . SER A 1 38 ? 23.759 3.213   -3.754  1.00 0.00 ? 38 SER A H    6  
ATOM 6661  H HA   . SER A 1 38 ? 24.112 4.276   -6.473  1.00 0.00 ? 38 SER A HA   6  
ATOM 6662  H HB2  . SER A 1 38 ? 25.487 1.886   -5.210  1.00 0.00 ? 38 SER A HB2  6  
ATOM 6663  H HB3  . SER A 1 38 ? 25.788 2.531   -6.835  1.00 0.00 ? 38 SER A HB3  6  
ATOM 6664  H HG   . SER A 1 38 ? 26.583 4.436   -5.882  1.00 0.00 ? 38 SER A HG   6  
ATOM 6665  N N    . ALA A 1 39 ? 22.960 2.315   -7.653  1.00 0.00 ? 39 ALA A N    6  
ATOM 6666  C CA   . ALA A 1 39 ? 22.078 1.354   -8.279  1.00 0.00 ? 39 ALA A CA   6  
ATOM 6667  C C    . ALA A 1 39 ? 22.473 -0.046  -7.850  1.00 0.00 ? 39 ALA A C    6  
ATOM 6668  O O    . ALA A 1 39 ? 23.636 -0.440  -7.979  1.00 0.00 ? 39 ALA A O    6  
ATOM 6669  C CB   . ALA A 1 39 ? 22.125 1.482   -9.781  1.00 0.00 ? 39 ALA A CB   6  
ATOM 6670  H H    . ALA A 1 39 ? 23.493 2.915   -8.226  1.00 0.00 ? 39 ALA A H    6  
ATOM 6671  H HA   . ALA A 1 39 ? 21.085 1.565   -7.949  1.00 0.00 ? 39 ALA A HA   6  
ATOM 6672  H HB1  . ALA A 1 39 ? 21.846 2.489   -10.065 1.00 0.00 ? 39 ALA A HB1  6  
ATOM 6673  H HB2  . ALA A 1 39 ? 21.427 0.782   -10.219 1.00 0.00 ? 39 ALA A HB2  6  
ATOM 6674  H HB3  . ALA A 1 39 ? 23.126 1.265   -10.139 1.00 0.00 ? 39 ALA A HB3  6  
ATOM 6675  N N    . GLY A 1 40 ? 21.502 -0.798  -7.348  1.00 0.00 ? 40 GLY A N    6  
ATOM 6676  C CA   . GLY A 1 40 ? 21.792 -2.125  -6.849  1.00 0.00 ? 40 GLY A CA   6  
ATOM 6677  C C    . GLY A 1 40 ? 21.778 -2.179  -5.334  1.00 0.00 ? 40 GLY A C    6  
ATOM 6678  O O    . GLY A 1 40 ? 21.776 -3.273  -4.763  1.00 0.00 ? 40 GLY A O    6  
ATOM 6679  H H    . GLY A 1 40 ? 20.576 -0.461  -7.314  1.00 0.00 ? 40 GLY A H    6  
ATOM 6680  H HA2  . GLY A 1 40 ? 21.058 -2.796  -7.236  1.00 0.00 ? 40 GLY A HA2  6  
ATOM 6681  H HA3  . GLY A 1 40 ? 22.774 -2.417  -7.201  1.00 0.00 ? 40 GLY A HA3  6  
ATOM 6682  N N    . ASP A 1 41 ? 21.803 -1.019  -4.672  1.00 0.00 ? 41 ASP A N    6  
ATOM 6683  C CA   . ASP A 1 41 ? 21.737 -0.982  -3.211  1.00 0.00 ? 41 ASP A CA   6  
ATOM 6684  C C    . ASP A 1 41 ? 20.349 -1.372  -2.757  1.00 0.00 ? 41 ASP A C    6  
ATOM 6685  O O    . ASP A 1 41 ? 19.349 -1.072  -3.406  1.00 0.00 ? 41 ASP A O    6  
ATOM 6686  C CB   . ASP A 1 41 ? 22.102 0.419   -2.680  1.00 0.00 ? 41 ASP A CB   6  
ATOM 6687  C CG   . ASP A 1 41 ? 22.575 0.418   -1.230  1.00 0.00 ? 41 ASP A CG   6  
ATOM 6688  O OD1  . ASP A 1 41 ? 22.292 -0.562  -0.489  1.00 0.00 ? 41 ASP A OD1  6  
ATOM 6689  O OD2  . ASP A 1 41 ? 23.257 1.378   -0.826  1.00 0.00 ? 41 ASP A OD2  6  
ATOM 6690  H H    . ASP A 1 41 ? 21.877 -0.182  -5.176  1.00 0.00 ? 41 ASP A H    6  
ATOM 6691  H HA   . ASP A 1 41 ? 22.448 -1.686  -2.850  1.00 0.00 ? 41 ASP A HA   6  
ATOM 6692  H HB2  . ASP A 1 41 ? 22.896 0.834   -3.294  1.00 0.00 ? 41 ASP A HB2  6  
ATOM 6693  H HB3  . ASP A 1 41 ? 21.231 1.060   -2.758  1.00 0.00 ? 41 ASP A HB3  6  
ATOM 6694  N N    . GLU A 1 42 ? 20.279 -2.065  -1.649  1.00 0.00 ? 42 GLU A N    6  
ATOM 6695  C CA   . GLU A 1 42 ? 19.030 -2.575  -1.135  1.00 0.00 ? 42 GLU A CA   6  
ATOM 6696  C C    . GLU A 1 42 ? 18.925 -2.224  0.343   1.00 0.00 ? 42 GLU A C    6  
ATOM 6697  O O    . GLU A 1 42 ? 19.940 -2.141  1.026   1.00 0.00 ? 42 GLU A O    6  
ATOM 6698  C CB   . GLU A 1 42 ? 18.954 -4.092  -1.341  1.00 0.00 ? 42 GLU A CB   6  
ATOM 6699  C CG   . GLU A 1 42 ? 19.126 -4.516  -2.796  1.00 0.00 ? 42 GLU A CG   6  
ATOM 6700  C CD   . GLU A 1 42 ? 19.245 -6.015  -2.955  1.00 0.00 ? 42 GLU A CD   6  
ATOM 6701  O OE1  . GLU A 1 42 ? 18.196 -6.688  -3.042  1.00 0.00 ? 42 GLU A OE1  6  
ATOM 6702  O OE2  . GLU A 1 42 ? 20.380 -6.534  -2.990  1.00 0.00 ? 42 GLU A OE2  6  
ATOM 6703  H H    . GLU A 1 42 ? 21.102 -2.217  -1.135  1.00 0.00 ? 42 GLU A H    6  
ATOM 6704  H HA   . GLU A 1 42 ? 18.223 -2.096  -1.668  1.00 0.00 ? 42 GLU A HA   6  
ATOM 6705  H HB2  . GLU A 1 42 ? 19.730 -4.561  -0.750  1.00 0.00 ? 42 GLU A HB2  6  
ATOM 6706  H HB3  . GLU A 1 42 ? 17.991 -4.438  -1.009  1.00 0.00 ? 42 GLU A HB3  6  
ATOM 6707  H HG2  . GLU A 1 42 ? 18.272 -4.179  -3.352  1.00 0.00 ? 42 GLU A HG2  6  
ATOM 6708  H HG3  . GLU A 1 42 ? 20.017 -4.049  -3.178  1.00 0.00 ? 42 GLU A HG3  6  
ATOM 6709  N N    . GLY A 1 43 ? 17.716 -2.024  0.838   1.00 0.00 ? 43 GLY A N    6  
ATOM 6710  C CA   . GLY A 1 43 ? 17.573 -1.631  2.210   1.00 0.00 ? 43 GLY A CA   6  
ATOM 6711  C C    . GLY A 1 43 ? 16.152 -1.758  2.715   1.00 0.00 ? 43 GLY A C    6  
ATOM 6712  O O    . GLY A 1 43 ? 15.288 -2.289  2.028   1.00 0.00 ? 43 GLY A O    6  
ATOM 6713  H H    . GLY A 1 43 ? 16.913 -2.171  0.278   1.00 0.00 ? 43 GLY A H    6  
ATOM 6714  H HA2  . GLY A 1 43 ? 18.220 -2.234  2.829   1.00 0.00 ? 43 GLY A HA2  6  
ATOM 6715  H HA3  . GLY A 1 43 ? 17.865 -0.602  2.306   1.00 0.00 ? 43 GLY A HA3  6  
ATOM 6716  N N    . GLU A 1 44 ? 15.923 -1.248  3.911   1.00 0.00 ? 44 GLU A N    6  
ATOM 6717  C CA   . GLU A 1 44 ? 14.619 -1.329  4.540   1.00 0.00 ? 44 GLU A CA   6  
ATOM 6718  C C    . GLU A 1 44 ? 13.952 0.031   4.612   1.00 0.00 ? 44 GLU A C    6  
ATOM 6719  O O    . GLU A 1 44 ? 14.638 1.048   4.752   1.00 0.00 ? 44 GLU A O    6  
ATOM 6720  C CB   . GLU A 1 44 ? 14.695 -1.892  5.967   1.00 0.00 ? 44 GLU A CB   6  
ATOM 6721  C CG   . GLU A 1 44 ? 14.369 -3.374  6.060   1.00 0.00 ? 44 GLU A CG   6  
ATOM 6722  C CD   . GLU A 1 44 ? 15.465 -4.247  5.528   1.00 0.00 ? 44 GLU A CD   6  
ATOM 6723  O OE1  . GLU A 1 44 ? 16.557 -4.300  6.129   1.00 0.00 ? 44 GLU A OE1  6  
ATOM 6724  O OE2  . GLU A 1 44 ? 15.227 -4.953  4.528   1.00 0.00 ? 44 GLU A OE2  6  
ATOM 6725  H H    . GLU A 1 44 ? 16.635 -0.723  4.343   1.00 0.00 ? 44 GLU A H    6  
ATOM 6726  H HA   . GLU A 1 44 ? 14.010 -1.988  3.931   1.00 0.00 ? 44 GLU A HA   6  
ATOM 6727  H HB2  . GLU A 1 44 ? 15.699 -1.754  6.336   1.00 0.00 ? 44 GLU A HB2  6  
ATOM 6728  H HB3  . GLU A 1 44 ? 14.005 -1.359  6.594   1.00 0.00 ? 44 GLU A HB3  6  
ATOM 6729  H HG2  . GLU A 1 44 ? 14.204 -3.633  7.102   1.00 0.00 ? 44 GLU A HG2  6  
ATOM 6730  H HG3  . GLU A 1 44 ? 13.464 -3.563  5.503   1.00 0.00 ? 44 GLU A HG3  6  
ATOM 6731  N N    . PHE A 1 45 ? 12.633 0.046   4.539   1.00 0.00 ? 45 PHE A N    6  
ATOM 6732  C CA   . PHE A 1 45 ? 11.873 1.273   4.676   1.00 0.00 ? 45 PHE A CA   6  
ATOM 6733  C C    . PHE A 1 45 ? 11.596 1.532   6.152   1.00 0.00 ? 45 PHE A C    6  
ATOM 6734  O O    . PHE A 1 45 ? 10.928 0.731   6.811   1.00 0.00 ? 45 PHE A O    6  
ATOM 6735  C CB   . PHE A 1 45 ? 10.563 1.171   3.906   1.00 0.00 ? 45 PHE A CB   6  
ATOM 6736  C CG   . PHE A 1 45 ? 9.628  2.319   4.131   1.00 0.00 ? 45 PHE A CG   6  
ATOM 6737  C CD1  . PHE A 1 45 ? 9.842  3.538   3.517   1.00 0.00 ? 45 PHE A CD1  6  
ATOM 6738  C CD2  . PHE A 1 45 ? 8.533  2.174   4.961   1.00 0.00 ? 45 PHE A CD2  6  
ATOM 6739  C CE1  . PHE A 1 45 ? 8.990  4.591   3.718   1.00 0.00 ? 45 PHE A CE1  6  
ATOM 6740  C CE2  . PHE A 1 45 ? 7.668  3.231   5.169   1.00 0.00 ? 45 PHE A CE2  6  
ATOM 6741  C CZ   . PHE A 1 45 ? 7.891  4.443   4.550   1.00 0.00 ? 45 PHE A CZ   6  
ATOM 6742  H H    . PHE A 1 45 ? 12.143 -0.802  4.397   1.00 0.00 ? 45 PHE A H    6  
ATOM 6743  H HA   . PHE A 1 45 ? 12.465 2.085   4.276   1.00 0.00 ? 45 PHE A HA   6  
ATOM 6744  H HB2  . PHE A 1 45 ? 10.774 1.137   2.842   1.00 0.00 ? 45 PHE A HB2  6  
ATOM 6745  H HB3  . PHE A 1 45 ? 10.055 0.262   4.191   1.00 0.00 ? 45 PHE A HB3  6  
ATOM 6746  H HD1  . PHE A 1 45 ? 10.714 3.655   2.863   1.00 0.00 ? 45 PHE A HD1  6  
ATOM 6747  H HD2  . PHE A 1 45 ? 8.360  1.235   5.451   1.00 0.00 ? 45 PHE A HD2  6  
ATOM 6748  H HE1  . PHE A 1 45 ? 9.169  5.534   3.227   1.00 0.00 ? 45 PHE A HE1  6  
ATOM 6749  H HE2  . PHE A 1 45 ? 6.816  3.112   5.815   1.00 0.00 ? 45 PHE A HE2  6  
ATOM 6750  H HZ   . PHE A 1 45 ? 7.210  5.266   4.718   1.00 0.00 ? 45 PHE A HZ   6  
ATOM 6751  N N    . ARG A 1 46 ? 12.106 2.643   6.672   1.00 0.00 ? 46 ARG A N    6  
ATOM 6752  C CA   . ARG A 1 46 ? 11.907 2.973   8.073   1.00 0.00 ? 46 ARG A CA   6  
ATOM 6753  C C    . ARG A 1 46 ? 10.658 3.815   8.277   1.00 0.00 ? 46 ARG A C    6  
ATOM 6754  O O    . ARG A 1 46 ? 9.761  3.424   9.025   1.00 0.00 ? 46 ARG A O    6  
ATOM 6755  C CB   . ARG A 1 46 ? 13.139 3.690   8.617   1.00 0.00 ? 46 ARG A CB   6  
ATOM 6756  C CG   . ARG A 1 46 ? 14.380 2.821   8.692   1.00 0.00 ? 46 ARG A CG   6  
ATOM 6757  C CD   . ARG A 1 46 ? 15.535 3.559   9.334   1.00 0.00 ? 46 ARG A CD   6  
ATOM 6758  N NE   . ARG A 1 46 ? 15.202 4.070   10.667  1.00 0.00 ? 46 ARG A NE   6  
ATOM 6759  C CZ   . ARG A 1 46 ? 16.019 4.798   11.415  1.00 0.00 ? 46 ARG A CZ   6  
ATOM 6760  N NH1  . ARG A 1 46 ? 17.280 5.011   11.036  1.00 0.00 ? 46 ARG A NH1  6  
ATOM 6761  N NH2  . ARG A 1 46 ? 15.600 5.281   12.572  1.00 0.00 ? 46 ARG A NH2  6  
ATOM 6762  H H    . ARG A 1 46 ? 12.631 3.244   6.100   1.00 0.00 ? 46 ARG A H    6  
ATOM 6763  H HA   . ARG A 1 46 ? 11.791 2.044   8.615   1.00 0.00 ? 46 ARG A HA   6  
ATOM 6764  H HB2  . ARG A 1 46 ? 13.363 4.542   7.974   1.00 0.00 ? 46 ARG A HB2  6  
ATOM 6765  H HB3  . ARG A 1 46 ? 12.925 4.056   9.603   1.00 0.00 ? 46 ARG A HB3  6  
ATOM 6766  H HG2  . ARG A 1 46 ? 14.144 1.957   9.303   1.00 0.00 ? 46 ARG A HG2  6  
ATOM 6767  H HG3  . ARG A 1 46 ? 14.650 2.496   7.702   1.00 0.00 ? 46 ARG A HG3  6  
ATOM 6768  H HD2  . ARG A 1 46 ? 16.370 2.883   9.415   1.00 0.00 ? 46 ARG A HD2  6  
ATOM 6769  H HD3  . ARG A 1 46 ? 15.814 4.389   8.694   1.00 0.00 ? 46 ARG A HD3  6  
ATOM 6770  H HE   . ARG A 1 46 ? 14.302 3.864   11.016  1.00 0.00 ? 46 ARG A HE   6  
ATOM 6771  H HH11 . ARG A 1 46 ? 17.634 4.632   10.184  1.00 0.00 ? 46 ARG A HH11 6  
ATOM 6772  H HH12 . ARG A 1 46 ? 17.876 5.570   11.624  1.00 0.00 ? 46 ARG A HH12 6  
ATOM 6773  H HH21 . ARG A 1 46 ? 14.664 5.095   12.902  1.00 0.00 ? 46 ARG A HH21 6  
ATOM 6774  H HH22 . ARG A 1 46 ? 16.217 5.850   13.145  1.00 0.00 ? 46 ARG A HH22 6  
ATOM 6775  N N    . GLN A 1 47 ? 10.586 4.940   7.588   1.00 0.00 ? 47 GLN A N    6  
ATOM 6776  C CA   . GLN A 1 47 ? 9.470  5.864   7.737   1.00 0.00 ? 47 GLN A CA   6  
ATOM 6777  C C    . GLN A 1 47 ? 9.525  6.982   6.707   1.00 0.00 ? 47 GLN A C    6  
ATOM 6778  O O    . GLN A 1 47 ? 10.524 7.169   6.030   1.00 0.00 ? 47 GLN A O    6  
ATOM 6779  C CB   . GLN A 1 47 ? 9.396  6.465   9.158   1.00 0.00 ? 47 GLN A CB   6  
ATOM 6780  C CG   . GLN A 1 47 ? 10.593 7.332   9.549   1.00 0.00 ? 47 GLN A CG   6  
ATOM 6781  C CD   . GLN A 1 47 ? 11.748 6.535   10.118  1.00 0.00 ? 47 GLN A CD   6  
ATOM 6782  O OE1  . GLN A 1 47 ? 11.554 5.495   10.738  1.00 0.00 ? 47 GLN A OE1  6  
ATOM 6783  N NE2  . GLN A 1 47 ? 12.966 7.021   9.924   1.00 0.00 ? 47 GLN A NE2  6  
ATOM 6784  H H    . GLN A 1 47 ? 11.285 5.130   6.924   1.00 0.00 ? 47 GLN A H    6  
ATOM 6785  H HA   . GLN A 1 47 ? 8.559  5.290   7.572   1.00 0.00 ? 47 GLN A HA   6  
ATOM 6786  H HB2  . GLN A 1 47 ? 8.516  7.076   9.226   1.00 0.00 ? 47 GLN A HB2  6  
ATOM 6787  H HB3  . GLN A 1 47 ? 9.317  5.655   9.869   1.00 0.00 ? 47 GLN A HB3  6  
ATOM 6788  H HG2  . GLN A 1 47 ? 10.942 7.856   8.680   1.00 0.00 ? 47 GLN A HG2  6  
ATOM 6789  H HG3  . GLN A 1 47 ? 10.267 8.049   10.289  1.00 0.00 ? 47 GLN A HG3  6  
ATOM 6790  H HE21 . GLN A 1 47 ? 13.045 7.881   9.435   1.00 0.00 ? 47 GLN A HE21 6  
ATOM 6791  H HE22 . GLN A 1 47 ? 13.726 6.515   10.277  1.00 0.00 ? 47 GLN A HE22 6  
ATOM 6792  N N    . SER A 1 48 ? 8.434  7.736   6.611   1.00 0.00 ? 48 SER A N    6  
ATOM 6793  C CA   . SER A 1 48 ? 8.357  8.868   5.691   1.00 0.00 ? 48 SER A CA   6  
ATOM 6794  C C    . SER A 1 48 ? 7.962  10.129  6.454   1.00 0.00 ? 48 SER A C    6  
ATOM 6795  O O    . SER A 1 48 ? 7.280  10.049  7.460   1.00 0.00 ? 48 SER A O    6  
ATOM 6796  C CB   . SER A 1 48 ? 7.332  8.584   4.597   1.00 0.00 ? 48 SER A CB   6  
ATOM 6797  O OG   . SER A 1 48 ? 7.597  7.330   3.976   1.00 0.00 ? 48 SER A OG   6  
ATOM 6798  H H    . SER A 1 48 ? 7.653  7.546   7.187   1.00 0.00 ? 48 SER A H    6  
ATOM 6799  H HA   . SER A 1 48 ? 9.333  9.017   5.260   1.00 0.00 ? 48 SER A HA   6  
ATOM 6800  H HB2  . SER A 1 48 ? 6.342  8.555   5.022   1.00 0.00 ? 48 SER A HB2  6  
ATOM 6801  H HB3  . SER A 1 48 ? 7.389  9.351   3.836   1.00 0.00 ? 48 SER A HB3  6  
ATOM 6802  H HG   . SER A 1 48 ? 8.289  6.875   4.470   1.00 0.00 ? 48 SER A HG   6  
ATOM 6803  N N    . ASN A 1 49 ? 8.417  11.272  5.977   1.00 0.00 ? 49 ASN A N    6  
ATOM 6804  C CA   . ASN A 1 49 ? 8.135  12.527  6.641   1.00 0.00 ? 49 ASN A CA   6  
ATOM 6805  C C    . ASN A 1 49 ? 6.784  13.080  6.179   1.00 0.00 ? 49 ASN A C    6  
ATOM 6806  O O    . ASN A 1 49 ? 6.669  13.570  5.054   1.00 0.00 ? 49 ASN A O    6  
ATOM 6807  C CB   . ASN A 1 49 ? 9.233  13.536  6.352   1.00 0.00 ? 49 ASN A CB   6  
ATOM 6808  C CG   . ASN A 1 49 ? 10.607 13.071  6.787   1.00 0.00 ? 49 ASN A CG   6  
ATOM 6809  O OD1  . ASN A 1 49 ? 11.028 13.305  7.912   1.00 0.00 ? 49 ASN A OD1  6  
ATOM 6810  N ND2  . ASN A 1 49 ? 11.338 12.430  5.868   1.00 0.00 ? 49 ASN A ND2  6  
ATOM 6811  H H    . ASN A 1 49 ? 8.956  11.281  5.158   1.00 0.00 ? 49 ASN A H    6  
ATOM 6812  H HA   . ASN A 1 49 ? 8.084  12.339  7.709   1.00 0.00 ? 49 ASN A HA   6  
ATOM 6813  H HB2  . ASN A 1 49 ? 9.265  13.734  5.279   1.00 0.00 ? 49 ASN A HB2  6  
ATOM 6814  H HB3  . ASN A 1 49 ? 9.004  14.452  6.876   1.00 0.00 ? 49 ASN A HB3  6  
ATOM 6815  H HD21 . ASN A 1 49 ? 10.942 12.298  4.975   1.00 0.00 ? 49 ASN A HD21 6  
ATOM 6816  H HD22 . ASN A 1 49 ? 12.248 12.119  6.119   1.00 0.00 ? 49 ASN A HD22 6  
ATOM 6817  N N    . ASN A 1 50 ? 5.788  12.974  7.041   1.00 0.00 ? 50 ASN A N    6  
ATOM 6818  C CA   . ASN A 1 50 ? 4.433  13.463  6.758   1.00 0.00 ? 50 ASN A CA   6  
ATOM 6819  C C    . ASN A 1 50 ? 3.941  13.039  5.366   1.00 0.00 ? 50 ASN A C    6  
ATOM 6820  O O    . ASN A 1 50 ? 3.616  11.867  5.146   1.00 0.00 ? 50 ASN A O    6  
ATOM 6821  C CB   . ASN A 1 50 ? 4.385  14.986  6.902   1.00 0.00 ? 50 ASN A CB   6  
ATOM 6822  C CG   . ASN A 1 50 ? 4.618  15.446  8.329   1.00 0.00 ? 50 ASN A CG   6  
ATOM 6823  O OD1  . ASN A 1 50 ? 4.173  14.792  9.281   1.00 0.00 ? 50 ASN A OD1  6  
ATOM 6824  N ND2  . ASN A 1 50 ? 5.337  16.553  8.497   1.00 0.00 ? 50 ASN A ND2  6  
ATOM 6825  H H    . ASN A 1 50 ? 5.955  12.538  7.900   1.00 0.00 ? 50 ASN A H    6  
ATOM 6826  H HA   . ASN A 1 50 ? 3.775  13.032  7.492   1.00 0.00 ? 50 ASN A HA   6  
ATOM 6827  H HB2  . ASN A 1 50 ? 5.154  15.421  6.267   1.00 0.00 ? 50 ASN A HB2  6  
ATOM 6828  H HB3  . ASN A 1 50 ? 3.411  15.340  6.581   1.00 0.00 ? 50 ASN A HB3  6  
ATOM 6829  H HD21 . ASN A 1 50 ? 5.668  17.021  7.695   1.00 0.00 ? 50 ASN A HD21 6  
ATOM 6830  H HD22 . ASN A 1 50 ? 5.513  16.859  9.413   1.00 0.00 ? 50 ASN A HD22 6  
ATOM 6831  N N    . GLY A 1 51 ? 3.891  13.990  4.438   1.00 0.00 ? 51 GLY A N    6  
ATOM 6832  C CA   . GLY A 1 51 ? 3.487  13.683  3.090   1.00 0.00 ? 51 GLY A CA   6  
ATOM 6833  C C    . GLY A 1 51 ? 4.271  14.469  2.063   1.00 0.00 ? 51 GLY A C    6  
ATOM 6834  O O    . GLY A 1 51 ? 3.707  15.035  1.113   1.00 0.00 ? 51 GLY A O    6  
ATOM 6835  H H    . GLY A 1 51 ? 4.131  14.900  4.692   1.00 0.00 ? 51 GLY A H    6  
ATOM 6836  H HA2  . GLY A 1 51 ? 3.644  12.636  2.907   1.00 0.00 ? 51 GLY A HA2  6  
ATOM 6837  H HA3  . GLY A 1 51 ? 2.440  13.914  2.962   1.00 0.00 ? 51 GLY A HA3  6  
ATOM 6838  N N    . VAL A 1 52 ? 5.584  14.542  2.266   1.00 0.00 ? 52 VAL A N    6  
ATOM 6839  C CA   . VAL A 1 52 ? 6.461  15.281  1.380   1.00 0.00 ? 52 VAL A CA   6  
ATOM 6840  C C    . VAL A 1 52 ? 7.466  14.341  0.691   1.00 0.00 ? 52 VAL A C    6  
ATOM 6841  O O    . VAL A 1 52 ? 7.505  13.163  0.986   1.00 0.00 ? 52 VAL A O    6  
ATOM 6842  C CB   . VAL A 1 52 ? 7.211  16.400  2.160   1.00 0.00 ? 52 VAL A CB   6  
ATOM 6843  C CG1  . VAL A 1 52 ? 6.236  17.491  2.573   1.00 0.00 ? 52 VAL A CG1  6  
ATOM 6844  C CG2  . VAL A 1 52 ? 7.932  15.837  3.361   1.00 0.00 ? 52 VAL A CG2  6  
ATOM 6845  H H    . VAL A 1 52 ? 5.963  14.064  3.033   1.00 0.00 ? 52 VAL A H    6  
ATOM 6846  H HA   . VAL A 1 52 ? 5.858  15.740  0.622   1.00 0.00 ? 52 VAL A HA   6  
ATOM 6847  H HB   . VAL A 1 52 ? 7.943  16.835  1.504   1.00 0.00 ? 52 VAL A HB   6  
ATOM 6848  H HG11 . VAL A 1 52 ? 5.754  17.894  1.706   1.00 0.00 ? 52 VAL A HG11 6  
ATOM 6849  H HG12 . VAL A 1 52 ? 6.775  18.293  3.080   1.00 0.00 ? 52 VAL A HG12 6  
ATOM 6850  H HG13 . VAL A 1 52 ? 5.502  17.085  3.240   1.00 0.00 ? 52 VAL A HG13 6  
ATOM 6851  H HG21 . VAL A 1 52 ? 8.630  15.086  3.036   1.00 0.00 ? 52 VAL A HG21 6  
ATOM 6852  H HG22 . VAL A 1 52 ? 7.219  15.395  4.037   1.00 0.00 ? 52 VAL A HG22 6  
ATOM 6853  H HG23 . VAL A 1 52 ? 8.465  16.632  3.873   1.00 0.00 ? 52 VAL A HG23 6  
ATOM 6854  N N    . PRO A 1 53 ? 8.288  14.867  -0.251  1.00 0.00 ? 53 PRO A N    6  
ATOM 6855  C CA   . PRO A 1 53 ? 9.309  14.071  -0.966  1.00 0.00 ? 53 PRO A CA   6  
ATOM 6856  C C    . PRO A 1 53 ? 10.267 13.279  -0.058  1.00 0.00 ? 53 PRO A C    6  
ATOM 6857  O O    . PRO A 1 53 ? 10.472 12.097  -0.298  1.00 0.00 ? 53 PRO A O    6  
ATOM 6858  C CB   . PRO A 1 53 ? 10.076 15.086  -1.796  1.00 0.00 ? 53 PRO A CB   6  
ATOM 6859  C CG   . PRO A 1 53 ? 9.168  16.260  -1.940  1.00 0.00 ? 53 PRO A CG   6  
ATOM 6860  C CD   . PRO A 1 53 ? 8.252  16.251  -0.737  1.00 0.00 ? 53 PRO A CD   6  
ATOM 6861  H HA   . PRO A 1 53 ? 8.831  13.357  -1.638  1.00 0.00 ? 53 PRO A HA   6  
ATOM 6862  H HB2  . PRO A 1 53 ? 10.984 15.364  -1.289  1.00 0.00 ? 53 PRO A HB2  6  
ATOM 6863  H HB3  . PRO A 1 53 ? 10.316 14.661  -2.771  1.00 0.00 ? 53 PRO A HB3  6  
ATOM 6864  H HG2  . PRO A 1 53 ? 9.745  17.160  -1.961  1.00 0.00 ? 53 PRO A HG2  6  
ATOM 6865  H HG3  . PRO A 1 53 ? 8.581  16.164  -2.854  1.00 0.00 ? 53 PRO A HG3  6  
ATOM 6866  H HD2  . PRO A 1 53 ? 8.632  16.928  0.013   1.00 0.00 ? 53 PRO A HD2  6  
ATOM 6867  H HD3  . PRO A 1 53 ? 7.256  16.551  -1.032  1.00 0.00 ? 53 PRO A HD3  6  
ATOM 6868  N N    . PRO A 1 54 ? 10.892 13.913  0.964   1.00 0.00 ? 54 PRO A N    6  
ATOM 6869  C CA   . PRO A 1 54 ? 11.851 13.217  1.817   1.00 0.00 ? 54 PRO A CA   6  
ATOM 6870  C C    . PRO A 1 54 ? 11.290 11.949  2.464   1.00 0.00 ? 54 PRO A C    6  
ATOM 6871  O O    . PRO A 1 54 ? 10.331 11.982  3.241   1.00 0.00 ? 54 PRO A O    6  
ATOM 6872  C CB   . PRO A 1 54 ? 12.244 14.235  2.898   1.00 0.00 ? 54 PRO A CB   6  
ATOM 6873  C CG   . PRO A 1 54 ? 11.249 15.332  2.774   1.00 0.00 ? 54 PRO A CG   6  
ATOM 6874  C CD   . PRO A 1 54 ? 10.761 15.325  1.353   1.00 0.00 ? 54 PRO A CD   6  
ATOM 6875  H HA   . PRO A 1 54 ? 12.741 12.954  1.253   1.00 0.00 ? 54 PRO A HA   6  
ATOM 6876  H HB2  . PRO A 1 54 ? 12.202 13.770  3.866   1.00 0.00 ? 54 PRO A HB2  6  
ATOM 6877  H HB3  . PRO A 1 54 ? 13.260 14.592  2.714   1.00 0.00 ? 54 PRO A HB3  6  
ATOM 6878  H HG2  . PRO A 1 54 ? 10.428 15.150  3.452   1.00 0.00 ? 54 PRO A HG2  6  
ATOM 6879  H HG3  . PRO A 1 54 ? 11.723 16.274  3.007   1.00 0.00 ? 54 PRO A HG3  6  
ATOM 6880  H HD2  . PRO A 1 54 ? 9.730  15.645  1.308   1.00 0.00 ? 54 PRO A HD2  6  
ATOM 6881  H HD3  . PRO A 1 54 ? 11.378 15.961  0.744   1.00 0.00 ? 54 PRO A HD3  6  
ATOM 6882  N N    . VAL A 1 55 ? 11.930 10.840  2.156   1.00 0.00 ? 55 VAL A N    6  
ATOM 6883  C CA   . VAL A 1 55 ? 11.554 9.540   2.664   1.00 0.00 ? 55 VAL A CA   6  
ATOM 6884  C C    . VAL A 1 55 ? 12.775 8.886   3.289   1.00 0.00 ? 55 VAL A C    6  
ATOM 6885  O O    . VAL A 1 55 ? 13.859 8.898   2.707   1.00 0.00 ? 55 VAL A O    6  
ATOM 6886  C CB   . VAL A 1 55 ? 10.957 8.623   1.574   1.00 0.00 ? 55 VAL A CB   6  
ATOM 6887  C CG1  . VAL A 1 55 ? 11.948 8.358   0.436   1.00 0.00 ? 55 VAL A CG1  6  
ATOM 6888  C CG2  . VAL A 1 55 ? 10.490 7.313   2.172   1.00 0.00 ? 55 VAL A CG2  6  
ATOM 6889  H H    . VAL A 1 55 ? 12.723 10.922  1.568   1.00 0.00 ? 55 VAL A H    6  
ATOM 6890  H HA   . VAL A 1 55 ? 10.805 9.697   3.425   1.00 0.00 ? 55 VAL A HA   6  
ATOM 6891  H HB   . VAL A 1 55 ? 10.107 9.126   1.149   1.00 0.00 ? 55 VAL A HB   6  
ATOM 6892  H HG11 . VAL A 1 55 ? 12.853 7.928   0.848   1.00 0.00 ? 55 VAL A HG11 6  
ATOM 6893  H HG12 . VAL A 1 55 ? 12.181 9.288   -0.063  1.00 0.00 ? 55 VAL A HG12 6  
ATOM 6894  H HG13 . VAL A 1 55 ? 11.502 7.666   -0.263  1.00 0.00 ? 55 VAL A HG13 6  
ATOM 6895  H HG21 . VAL A 1 55 ? 10.094 6.682   1.397   1.00 0.00 ? 55 VAL A HG21 6  
ATOM 6896  H HG22 . VAL A 1 55 ? 9.723  7.517   2.910   1.00 0.00 ? 55 VAL A HG22 6  
ATOM 6897  H HG23 . VAL A 1 55 ? 11.326 6.821   2.650   1.00 0.00 ? 55 VAL A HG23 6  
ATOM 6898  N N    . GLN A 1 56 ? 12.621 8.327   4.481   1.00 0.00 ? 56 GLN A N    6  
ATOM 6899  C CA   . GLN A 1 56 ? 13.776 7.863   5.221   1.00 0.00 ? 56 GLN A CA   6  
ATOM 6900  C C    . GLN A 1 56 ? 13.932 6.354   5.063   1.00 0.00 ? 56 GLN A C    6  
ATOM 6901  O O    . GLN A 1 56 ? 13.136 5.561   5.591   1.00 0.00 ? 56 GLN A O    6  
ATOM 6902  C CB   . GLN A 1 56 ? 13.645 8.248   6.705   1.00 0.00 ? 56 GLN A CB   6  
ATOM 6903  C CG   . GLN A 1 56 ? 14.945 8.115   7.471   1.00 0.00 ? 56 GLN A CG   6  
ATOM 6904  C CD   . GLN A 1 56 ? 15.976 9.155   7.081   1.00 0.00 ? 56 GLN A CD   6  
ATOM 6905  O OE1  . GLN A 1 56 ? 15.979 9.654   5.963   1.00 0.00 ? 56 GLN A OE1  6  
ATOM 6906  N NE2  . GLN A 1 56 ? 16.861 9.477   7.993   1.00 0.00 ? 56 GLN A NE2  6  
ATOM 6907  H H    . GLN A 1 56 ? 11.732 8.172   4.835   1.00 0.00 ? 56 GLN A H    6  
ATOM 6908  H HA   . GLN A 1 56 ? 14.653 8.356   4.814   1.00 0.00 ? 56 GLN A HA   6  
ATOM 6909  H HB2  . GLN A 1 56 ? 13.319 9.274   6.764   1.00 0.00 ? 56 GLN A HB2  6  
ATOM 6910  H HB3  . GLN A 1 56 ? 12.904 7.600   7.162   1.00 0.00 ? 56 GLN A HB3  6  
ATOM 6911  H HG2  . GLN A 1 56 ? 14.754 8.216   8.537   1.00 0.00 ? 56 GLN A HG2  6  
ATOM 6912  H HG3  . GLN A 1 56 ? 15.376 7.131   7.283   1.00 0.00 ? 56 GLN A HG3  6  
ATOM 6913  H HE21 . GLN A 1 56 ? 16.806 9.033   8.869   1.00 0.00 ? 56 GLN A HE21 6  
ATOM 6914  H HE22 . GLN A 1 56 ? 17.558 10.149  7.762   1.00 0.00 ? 56 GLN A HE22 6  
ATOM 6915  N N    . VAL A 1 57 ? 14.954 5.975   4.318   1.00 0.00 ? 57 VAL A N    6  
ATOM 6916  C CA   . VAL A 1 57 ? 15.223 4.578   4.017   1.00 0.00 ? 57 VAL A CA   6  
ATOM 6917  C C    . VAL A 1 57 ? 16.620 4.206   4.473   1.00 0.00 ? 57 VAL A C    6  
ATOM 6918  O O    . VAL A 1 57 ? 17.550 4.990   4.315   1.00 0.00 ? 57 VAL A O    6  
ATOM 6919  C CB   . VAL A 1 57 ? 15.088 4.298   2.503   1.00 0.00 ? 57 VAL A CB   6  
ATOM 6920  C CG1  . VAL A 1 57 ? 15.368 2.826   2.168   1.00 0.00 ? 57 VAL A CG1  6  
ATOM 6921  C CG2  . VAL A 1 57 ? 13.692 4.698   2.007   1.00 0.00 ? 57 VAL A CG2  6  
ATOM 6922  H H    . VAL A 1 57 ? 15.566 6.648   3.964   1.00 0.00 ? 57 VAL A H    6  
ATOM 6923  H HA   . VAL A 1 57 ? 14.487 3.967   4.548   1.00 0.00 ? 57 VAL A HA   6  
ATOM 6924  H HB   . VAL A 1 57 ? 15.815 4.908   1.974   1.00 0.00 ? 57 VAL A HB   6  
ATOM 6925  H HG11 . VAL A 1 57 ? 14.679 2.180   2.701   1.00 0.00 ? 57 VAL A HG11 6  
ATOM 6926  H HG12 . VAL A 1 57 ? 16.378 2.587   2.484   1.00 0.00 ? 57 VAL A HG12 6  
ATOM 6927  H HG13 . VAL A 1 57 ? 15.288 2.676   1.105   1.00 0.00 ? 57 VAL A HG13 6  
ATOM 6928  H HG21 . VAL A 1 57 ? 12.947 4.152   2.569   1.00 0.00 ? 57 VAL A HG21 6  
ATOM 6929  H HG22 . VAL A 1 57 ? 13.606 4.471   0.953   1.00 0.00 ? 57 VAL A HG22 6  
ATOM 6930  H HG23 . VAL A 1 57 ? 13.562 5.753   2.179   1.00 0.00 ? 57 VAL A HG23 6  
ATOM 6931  N N    . PHE A 1 58 ? 16.768 3.033   5.062   1.00 0.00 ? 58 PHE A N    6  
ATOM 6932  C CA   . PHE A 1 58 ? 18.075 2.557   5.494   1.00 0.00 ? 58 PHE A CA   6  
ATOM 6933  C C    . PHE A 1 58 ? 18.647 1.613   4.439   1.00 0.00 ? 58 PHE A C    6  
ATOM 6934  O O    . PHE A 1 58 ? 18.060 0.597   4.110   1.00 0.00 ? 58 PHE A O    6  
ATOM 6935  C CB   . PHE A 1 58 ? 17.975 1.839   6.854   1.00 0.00 ? 58 PHE A CB   6  
ATOM 6936  C CG   . PHE A 1 58 ? 19.318 1.558   7.481   1.00 0.00 ? 58 PHE A CG   6  
ATOM 6937  C CD1  . PHE A 1 58 ? 19.985 0.371   7.210   1.00 0.00 ? 58 PHE A CD1  6  
ATOM 6938  C CD2  . PHE A 1 58 ? 19.904 2.469   8.331   1.00 0.00 ? 58 PHE A CD2  6  
ATOM 6939  C CE1  . PHE A 1 58 ? 21.217 0.105   7.789   1.00 0.00 ? 58 PHE A CE1  6  
ATOM 6940  C CE2  . PHE A 1 58 ? 21.127 2.210   8.900   1.00 0.00 ? 58 PHE A CE2  6  
ATOM 6941  C CZ   . PHE A 1 58 ? 21.790 1.027   8.640   1.00 0.00 ? 58 PHE A CZ   6  
ATOM 6942  H H    . PHE A 1 58 ? 15.994 2.451   5.183   1.00 0.00 ? 58 PHE A H    6  
ATOM 6943  H HA   . PHE A 1 58 ? 18.723 3.407   5.584   1.00 0.00 ? 58 PHE A HA   6  
ATOM 6944  H HB2  . PHE A 1 58 ? 17.398 2.442   7.541   1.00 0.00 ? 58 PHE A HB2  6  
ATOM 6945  H HB3  . PHE A 1 58 ? 17.472 0.887   6.704   1.00 0.00 ? 58 PHE A HB3  6  
ATOM 6946  H HD1  . PHE A 1 58 ? 19.537 -0.349  6.546   1.00 0.00 ? 58 PHE A HD1  6  
ATOM 6947  H HD2  . PHE A 1 58 ? 19.382 3.398   8.548   1.00 0.00 ? 58 PHE A HD2  6  
ATOM 6948  H HE1  . PHE A 1 58 ? 21.719 -0.825  7.578   1.00 0.00 ? 58 PHE A HE1  6  
ATOM 6949  H HE2  . PHE A 1 58 ? 21.578 2.932   9.563   1.00 0.00 ? 58 PHE A HE2  6  
ATOM 6950  H HZ   . PHE A 1 58 ? 22.753 0.820   9.101   1.00 0.00 ? 58 PHE A HZ   6  
ATOM 6951  N N    . TRP A 1 59 ? 19.809 1.986   3.920   1.00 0.00 ? 59 TRP A N    6  
ATOM 6952  C CA   . TRP A 1 59 ? 20.429 1.221   2.842   1.00 0.00 ? 59 TRP A CA   6  
ATOM 6953  C C    . TRP A 1 59 ? 21.545 0.325   3.395   1.00 0.00 ? 59 TRP A C    6  
ATOM 6954  O O    . TRP A 1 59 ? 22.443 0.801   4.085   1.00 0.00 ? 59 TRP A O    6  
ATOM 6955  C CB   . TRP A 1 59 ? 20.977 2.179   1.793   1.00 0.00 ? 59 TRP A CB   6  
ATOM 6956  C CG   . TRP A 1 59 ? 19.910 3.014   1.144   1.00 0.00 ? 59 TRP A CG   6  
ATOM 6957  C CD1  . TRP A 1 59 ? 19.604 4.299   1.454   1.00 0.00 ? 59 TRP A CD1  6  
ATOM 6958  C CD2  . TRP A 1 59 ? 19.020 2.608   0.097   1.00 0.00 ? 59 TRP A CD2  6  
ATOM 6959  N NE1  . TRP A 1 59 ? 18.556 4.726   0.646   1.00 0.00 ? 59 TRP A NE1  6  
ATOM 6960  C CE2  . TRP A 1 59 ? 18.194 3.702   -0.184  1.00 0.00 ? 59 TRP A CE2  6  
ATOM 6961  C CE3  . TRP A 1 59 ? 18.858 1.428   -0.630  1.00 0.00 ? 59 TRP A CE3  6  
ATOM 6962  C CZ2  . TRP A 1 59 ? 17.209 3.655   -1.159  1.00 0.00 ? 59 TRP A CZ2  6  
ATOM 6963  C CZ3  . TRP A 1 59 ? 17.877 1.386   -1.606  1.00 0.00 ? 59 TRP A CZ3  6  
ATOM 6964  C CH2  . TRP A 1 59 ? 17.056 2.491   -1.862  1.00 0.00 ? 59 TRP A CH2  6  
ATOM 6965  H H    . TRP A 1 59 ? 20.260 2.762   4.283   1.00 0.00 ? 59 TRP A H    6  
ATOM 6966  H HA   . TRP A 1 59 ? 19.679 0.609   2.386   1.00 0.00 ? 59 TRP A HA   6  
ATOM 6967  H HB2  . TRP A 1 59 ? 21.698 2.839   2.245   1.00 0.00 ? 59 TRP A HB2  6  
ATOM 6968  H HB3  . TRP A 1 59 ? 21.476 1.620   1.022   1.00 0.00 ? 59 TRP A HB3  6  
ATOM 6969  H HD1  . TRP A 1 59 ? 20.091 4.885   2.208   1.00 0.00 ? 59 TRP A HD1  6  
ATOM 6970  H HE1  . TRP A 1 59 ? 18.153 5.612   0.675   1.00 0.00 ? 59 TRP A HE1  6  
ATOM 6971  H HE3  . TRP A 1 59 ? 19.487 0.568   -0.451  1.00 0.00 ? 59 TRP A HE3  6  
ATOM 6972  H HZ2  . TRP A 1 59 ? 16.579 4.502   -1.361  1.00 0.00 ? 59 TRP A HZ2  6  
ATOM 6973  H HZ3  . TRP A 1 59 ? 17.733 0.480   -2.174  1.00 0.00 ? 59 TRP A HZ3  6  
ATOM 6974  H HH2  . TRP A 1 59 ? 16.308 2.406   -2.627  1.00 0.00 ? 59 TRP A HH2  6  
ATOM 6975  N N    . GLU A 1 60 ? 21.479 -0.956  3.061   1.00 0.00 ? 60 GLU A N    6  
ATOM 6976  C CA   . GLU A 1 60 ? 22.342 -1.969  3.656   1.00 0.00 ? 60 GLU A CA   6  
ATOM 6977  C C    . GLU A 1 60 ? 23.795 -1.825  3.193   1.00 0.00 ? 60 GLU A C    6  
ATOM 6978  O O    . GLU A 1 60 ? 24.710 -1.963  3.996   1.00 0.00 ? 60 GLU A O    6  
ATOM 6979  C CB   . GLU A 1 60 ? 21.814 -3.373  3.364   1.00 0.00 ? 60 GLU A CB   6  
ATOM 6980  C CG   . GLU A 1 60 ? 20.451 -3.664  3.978   1.00 0.00 ? 60 GLU A CG   6  
ATOM 6981  C CD   . GLU A 1 60 ? 20.502 -3.698  5.501   1.00 0.00 ? 60 GLU A CD   6  
ATOM 6982  O OE1  . GLU A 1 60 ? 20.474 -2.619  6.128   1.00 0.00 ? 60 GLU A OE1  6  
ATOM 6983  O OE2  . GLU A 1 60 ? 20.574 -4.799  6.080   1.00 0.00 ? 60 GLU A OE2  6  
ATOM 6984  H H    . GLU A 1 60 ? 20.811 -1.243  2.397   1.00 0.00 ? 60 GLU A H    6  
ATOM 6985  H HA   . GLU A 1 60 ? 22.321 -1.800  4.715   1.00 0.00 ? 60 GLU A HA   6  
ATOM 6986  H HB2  . GLU A 1 60 ? 21.720 -3.483  2.286   1.00 0.00 ? 60 GLU A HB2  6  
ATOM 6987  H HB3  . GLU A 1 60 ? 22.517 -4.092  3.731   1.00 0.00 ? 60 GLU A HB3  6  
ATOM 6988  H HG2  . GLU A 1 60 ? 19.758 -2.891  3.665   1.00 0.00 ? 60 GLU A HG2  6  
ATOM 6989  H HG3  . GLU A 1 60 ? 20.102 -4.632  3.626   1.00 0.00 ? 60 GLU A HG3  6  
ATOM 6990  N N    . SER A 1 61 ? 24.003 -1.522  1.906   1.00 0.00 ? 61 SER A N    6  
ATOM 6991  C CA   . SER A 1 61 ? 25.339 -1.456  1.359   1.00 0.00 ? 61 SER A CA   6  
ATOM 6992  C C    . SER A 1 61 ? 26.120 -0.291  1.950   1.00 0.00 ? 61 SER A C    6  
ATOM 6993  O O    . SER A 1 61 ? 27.303 -0.397  2.254   1.00 0.00 ? 61 SER A O    6  
ATOM 6994  C CB   . SER A 1 61 ? 25.282 -1.350  -0.161  1.00 0.00 ? 61 SER A CB   6  
ATOM 6995  O OG   . SER A 1 61 ? 24.316 -2.252  -0.679  1.00 0.00 ? 61 SER A OG   6  
ATOM 6996  H H    . SER A 1 61 ? 23.236 -1.335  1.321   1.00 0.00 ? 61 SER A H    6  
ATOM 6997  H HA   . SER A 1 61 ? 25.844 -2.375  1.628   1.00 0.00 ? 61 SER A HA   6  
ATOM 6998  H HB2  . SER A 1 61 ? 25.009 -0.344  -0.430  1.00 0.00 ? 61 SER A HB2  6  
ATOM 6999  H HB3  . SER A 1 61 ? 26.247 -1.596  -0.571  1.00 0.00 ? 61 SER A HB3  6  
ATOM 7000  H HG   . SER A 1 61 ? 23.479 -1.780  -0.792  1.00 0.00 ? 61 SER A HG   6  
ATOM 7001  N N    . THR A 1 62 ? 25.442 0.826   2.129   1.00 0.00 ? 62 THR A N    6  
ATOM 7002  C CA   . THR A 1 62 ? 26.052 2.005   2.742   1.00 0.00 ? 62 THR A CA   6  
ATOM 7003  C C    . THR A 1 62 ? 26.010 1.901   4.267   1.00 0.00 ? 62 THR A C    6  
ATOM 7004  O O    . THR A 1 62 ? 26.903 2.403   4.952   1.00 0.00 ? 62 THR A O    6  
ATOM 7005  C CB   . THR A 1 62 ? 25.326 3.279   2.286   1.00 0.00 ? 62 THR A CB   6  
ATOM 7006  O OG1  . THR A 1 62 ? 25.091 3.221   0.864   1.00 0.00 ? 62 THR A OG1  6  
ATOM 7007  C CG2  . THR A 1 62 ? 26.149 4.522   2.606   1.00 0.00 ? 62 THR A CG2  6  
ATOM 7008  H H    . THR A 1 62 ? 24.493 0.863   1.838   1.00 0.00 ? 62 THR A H    6  
ATOM 7009  H HA   . THR A 1 62 ? 27.077 2.061   2.415   1.00 0.00 ? 62 THR A HA   6  
ATOM 7010  H HB   . THR A 1 62 ? 24.380 3.350   2.793   1.00 0.00 ? 62 THR A HB   6  
ATOM 7011  H HG1  . THR A 1 62 ? 24.201 2.888   0.692   1.00 0.00 ? 62 THR A HG1  6  
ATOM 7012  H HG21 . THR A 1 62 ? 25.607 5.408   2.317   1.00 0.00 ? 62 THR A HG21 6  
ATOM 7013  H HG22 . THR A 1 62 ? 27.091 4.482   2.085   1.00 0.00 ? 62 THR A HG22 6  
ATOM 7014  H HG23 . THR A 1 62 ? 26.333 4.551   3.674   1.00 0.00 ? 62 THR A HG23 6  
ATOM 7015  N N    . GLY A 1 63 ? 24.976 1.239   4.756   1.00 0.00 ? 63 GLY A N    6  
ATOM 7016  C CA   . GLY A 1 63 ? 24.804 1.045   6.179   1.00 0.00 ? 63 GLY A CA   6  
ATOM 7017  C C    . GLY A 1 63 ? 24.401 2.330   6.893   1.00 0.00 ? 63 GLY A C    6  
ATOM 7018  O O    . GLY A 1 63 ? 24.655 2.507   8.084   1.00 0.00 ? 63 GLY A O    6  
ATOM 7019  H H    . GLY A 1 63 ? 24.346 0.858   4.116   1.00 0.00 ? 63 GLY A H    6  
ATOM 7020  H HA2  . GLY A 1 63 ? 24.020 0.305   6.346   1.00 0.00 ? 63 GLY A HA2  6  
ATOM 7021  H HA3  . GLY A 1 63 ? 25.736 0.671   6.614   1.00 0.00 ? 63 GLY A HA3  6  
ATOM 7022  N N    . ARG A 1 64 ? 23.803 3.231   6.130   1.00 0.00 ? 64 ARG A N    6  
ATOM 7023  C CA   . ARG A 1 64 ? 23.367 4.524   6.640   1.00 0.00 ? 64 ARG A CA   6  
ATOM 7024  C C    . ARG A 1 64 ? 21.945 4.793   6.209   1.00 0.00 ? 64 ARG A C    6  
ATOM 7025  O O    . ARG A 1 64 ? 21.511 4.321   5.148   1.00 0.00 ? 64 ARG A O    6  
ATOM 7026  C CB   . ARG A 1 64 ? 24.258 5.671   6.132   1.00 0.00 ? 64 ARG A CB   6  
ATOM 7027  C CG   . ARG A 1 64 ? 25.526 5.908   6.952   1.00 0.00 ? 64 ARG A CG   6  
ATOM 7028  C CD   . ARG A 1 64 ? 26.537 4.790   6.775   1.00 0.00 ? 64 ARG A CD   6  
ATOM 7029  N NE   . ARG A 1 64 ? 27.791 5.046   7.493   1.00 0.00 ? 64 ARG A NE   6  
ATOM 7030  C CZ   . ARG A 1 64 ? 28.949 4.479   7.198   1.00 0.00 ? 64 ARG A CZ   6  
ATOM 7031  N NH1  . ARG A 1 64 ? 29.035 3.589   6.222   1.00 0.00 ? 64 ARG A NH1  6  
ATOM 7032  N NH2  . ARG A 1 64 ? 30.045 4.794   7.905   1.00 0.00 ? 64 ARG A NH2  6  
ATOM 7033  H H    . ARG A 1 64 ? 23.615 2.990   5.204   1.00 0.00 ? 64 ARG A H    6  
ATOM 7034  H HA   . ARG A 1 64 ? 23.416 4.484   7.717   1.00 0.00 ? 64 ARG A HA   6  
ATOM 7035  H HB2  . ARG A 1 64 ? 24.561 5.448   5.115   1.00 0.00 ? 64 ARG A HB2  6  
ATOM 7036  H HB3  . ARG A 1 64 ? 23.680 6.580   6.142   1.00 0.00 ? 64 ARG A HB3  6  
ATOM 7037  H HG2  . ARG A 1 64 ? 25.979 6.832   6.640   1.00 0.00 ? 64 ARG A HG2  6  
ATOM 7038  H HG3  . ARG A 1 64 ? 25.250 5.978   7.991   1.00 0.00 ? 64 ARG A HG3  6  
ATOM 7039  H HD2  . ARG A 1 64 ? 26.104 3.868   7.150   1.00 0.00 ? 64 ARG A HD2  6  
ATOM 7040  H HD3  . ARG A 1 64 ? 26.757 4.676   5.723   1.00 0.00 ? 64 ARG A HD3  6  
ATOM 7041  H HE   . ARG A 1 64 ? 27.752 5.692   8.238   1.00 0.00 ? 64 ARG A HE   6  
ATOM 7042  H HH11 . ARG A 1 64 ? 28.215 3.331   5.697   1.00 0.00 ? 64 ARG A HH11 6  
ATOM 7043  H HH12 . ARG A 1 64 ? 29.917 3.168   6.005   1.00 0.00 ? 64 ARG A HH12 6  
ATOM 7044  H HH21 . ARG A 1 64 ? 29.991 5.451   8.665   1.00 0.00 ? 64 ARG A HH21 6  
ATOM 7045  H HH22 . ARG A 1 64 ? 30.922 4.366   7.674   1.00 0.00 ? 64 ARG A HH22 6  
ATOM 7046  N N    . THR A 1 65 ? 21.198 5.524   7.019   1.00 0.00 ? 65 THR A N    6  
ATOM 7047  C CA   . THR A 1 65 ? 19.878 5.933   6.635   1.00 0.00 ? 65 THR A CA   6  
ATOM 7048  C C    . THR A 1 65 ? 19.967 7.160   5.745   1.00 0.00 ? 65 THR A C    6  
ATOM 7049  O O    . THR A 1 65 ? 20.810 8.052   5.981   1.00 0.00 ? 65 THR A O    6  
ATOM 7050  C CB   . THR A 1 65 ? 19.019 6.255   7.889   1.00 0.00 ? 65 THR A CB   6  
ATOM 7051  O OG1  . THR A 1 65 ? 19.418 5.443   8.994   1.00 0.00 ? 65 THR A OG1  6  
ATOM 7052  C CG2  . THR A 1 65 ? 17.544 6.004   7.596   1.00 0.00 ? 65 THR A CG2  6  
ATOM 7053  H H    . THR A 1 65 ? 21.525 5.781   7.908   1.00 0.00 ? 65 THR A H    6  
ATOM 7054  H HA   . THR A 1 65 ? 19.413 5.115   6.089   1.00 0.00 ? 65 THR A HA   6  
ATOM 7055  H HB   . THR A 1 65 ? 19.143 7.300   8.142   1.00 0.00 ? 65 THR A HB   6  
ATOM 7056  H HG1  . THR A 1 65 ? 19.892 5.998   9.629   1.00 0.00 ? 65 THR A HG1  6  
ATOM 7057  H HG21 . THR A 1 65 ? 16.946 6.263   8.461   1.00 0.00 ? 65 THR A HG21 6  
ATOM 7058  H HG22 . THR A 1 65 ? 17.402 4.950   7.373   1.00 0.00 ? 65 THR A HG22 6  
ATOM 7059  H HG23 . THR A 1 65 ? 17.231 6.599   6.744   1.00 0.00 ? 65 THR A HG23 6  
ATOM 7060  N N    . TYR A 1 66 ? 19.091 7.251   4.762   1.00 0.00 ? 66 TYR A N    6  
ATOM 7061  C CA   . TYR A 1 66 ? 19.157 8.307   3.789   1.00 0.00 ? 66 TYR A CA   6  
ATOM 7062  C C    . TYR A 1 66 ? 17.756 8.687   3.317   1.00 0.00 ? 66 TYR A C    6  
ATOM 7063  O O    . TYR A 1 66 ? 16.872 7.836   3.269   1.00 0.00 ? 66 TYR A O    6  
ATOM 7064  C CB   . TYR A 1 66 ? 20.021 7.873   2.594   1.00 0.00 ? 66 TYR A CB   6  
ATOM 7065  C CG   . TYR A 1 66 ? 20.162 8.922   1.528   1.00 0.00 ? 66 TYR A CG   6  
ATOM 7066  C CD1  . TYR A 1 66 ? 20.874 10.098  1.749   1.00 0.00 ? 66 TYR A CD1  6  
ATOM 7067  C CD2  . TYR A 1 66 ? 19.579 8.753   0.278   1.00 0.00 ? 66 TYR A CD2  6  
ATOM 7068  C CE1  . TYR A 1 66 ? 20.993 11.054  0.780   1.00 0.00 ? 66 TYR A CE1  6  
ATOM 7069  C CE2  . TYR A 1 66 ? 19.705 9.706   -0.697  1.00 0.00 ? 66 TYR A CE2  6  
ATOM 7070  C CZ   . TYR A 1 66 ? 20.407 10.863  -0.450  1.00 0.00 ? 66 TYR A CZ   6  
ATOM 7071  O OH   . TYR A 1 66 ? 20.521 11.824  -1.417  1.00 0.00 ? 66 TYR A OH   6  
ATOM 7072  H H    . TYR A 1 66 ? 18.355 6.571   4.750   1.00 0.00 ? 66 TYR A H    6  
ATOM 7073  H HA   . TYR A 1 66 ? 19.608 9.164   4.249   1.00 0.00 ? 66 TYR A HA   6  
ATOM 7074  H HB2  . TYR A 1 66 ? 21.012 7.635   2.964   1.00 0.00 ? 66 TYR A HB2  6  
ATOM 7075  H HB3  . TYR A 1 66 ? 19.590 6.990   2.137   1.00 0.00 ? 66 TYR A HB3  6  
ATOM 7076  H HD1  . TYR A 1 66 ? 21.339 10.255  2.718   1.00 0.00 ? 66 TYR A HD1  6  
ATOM 7077  H HD2  . TYR A 1 66 ? 19.028 7.847   0.074   1.00 0.00 ? 66 TYR A HD2  6  
ATOM 7078  H HE1  . TYR A 1 66 ? 21.556 11.954  0.974   1.00 0.00 ? 66 TYR A HE1  6  
ATOM 7079  H HE2  . TYR A 1 66 ? 19.233 9.552   -1.665  1.00 0.00 ? 66 TYR A HE2  6  
ATOM 7080  H HH   . TYR A 1 66 ? 19.642 12.011  -1.808  1.00 0.00 ? 66 TYR A HH   6  
ATOM 7081  N N    . TRP A 1 67 ? 17.585 9.970   2.998   1.00 0.00 ? 67 TRP A N    6  
ATOM 7082  C CA   . TRP A 1 67 ? 16.312 10.446  2.485   1.00 0.00 ? 67 TRP A CA   6  
ATOM 7083  C C    . TRP A 1 67 ? 16.356 10.499  0.963   1.00 0.00 ? 67 TRP A C    6  
ATOM 7084  O O    . TRP A 1 67 ? 17.119 11.283  0.377   1.00 0.00 ? 67 TRP A O    6  
ATOM 7085  C CB   . TRP A 1 67 ? 15.977 11.824  3.051   1.00 0.00 ? 67 TRP A CB   6  
ATOM 7086  C CG   . TRP A 1 67 ? 17.139 12.529  3.684   1.00 0.00 ? 67 TRP A CG   6  
ATOM 7087  C CD1  . TRP A 1 67 ? 17.478 12.496  5.014   1.00 0.00 ? 67 TRP A CD1  6  
ATOM 7088  C CD2  . TRP A 1 67 ? 18.098 13.368  3.035   1.00 0.00 ? 67 TRP A CD2  6  
ATOM 7089  N NE1  . TRP A 1 67 ? 18.610 13.267  5.207   1.00 0.00 ? 67 TRP A NE1  6  
ATOM 7090  C CE2  . TRP A 1 67 ? 19.000 13.804  4.015   1.00 0.00 ? 67 TRP A CE2  6  
ATOM 7091  C CE3  . TRP A 1 67 ? 18.289 13.782  1.721   1.00 0.00 ? 67 TRP A CE3  6  
ATOM 7092  C CZ2  . TRP A 1 67 ? 20.081 14.647  3.726   1.00 0.00 ? 67 TRP A CZ2  6  
ATOM 7093  C CZ3  . TRP A 1 67 ? 19.350 14.620  1.432   1.00 0.00 ? 67 TRP A CZ3  6  
ATOM 7094  C CH2  . TRP A 1 67 ? 20.227 15.046  2.428   1.00 0.00 ? 67 TRP A CH2  6  
ATOM 7095  H H    . TRP A 1 67 ? 18.346 10.591  3.084   1.00 0.00 ? 67 TRP A H    6  
ATOM 7096  H HA   . TRP A 1 67 ? 15.555 9.736   2.794   1.00 0.00 ? 67 TRP A HA   6  
ATOM 7097  H HB2  . TRP A 1 67 ? 15.602 12.447  2.254   1.00 0.00 ? 67 TRP A HB2  6  
ATOM 7098  H HB3  . TRP A 1 67 ? 15.211 11.714  3.804   1.00 0.00 ? 67 TRP A HB3  6  
ATOM 7099  H HD1  . TRP A 1 67 ? 16.945 11.938  5.775   1.00 0.00 ? 67 TRP A HD1  6  
ATOM 7100  H HE1  . TRP A 1 67 ? 19.053 13.401  6.083   1.00 0.00 ? 67 TRP A HE1  6  
ATOM 7101  H HE3  . TRP A 1 67 ? 17.610 13.487  0.934   1.00 0.00 ? 67 TRP A HE3  6  
ATOM 7102  H HZ2  . TRP A 1 67 ? 20.771 14.978  4.486   1.00 0.00 ? 67 TRP A HZ2  6  
ATOM 7103  H HZ3  . TRP A 1 67 ? 19.499 14.957  0.414   1.00 0.00 ? 67 TRP A HZ3  6  
ATOM 7104  H HH2  . TRP A 1 67 ? 21.041 15.695  2.151   1.00 0.00 ? 67 TRP A HH2  6  
ATOM 7105  N N    . VAL A 1 68 ? 15.540 9.674   0.330   1.00 0.00 ? 68 VAL A N    6  
ATOM 7106  C CA   . VAL A 1 68 ? 15.563 9.526   -1.104  1.00 0.00 ? 68 VAL A CA   6  
ATOM 7107  C C    . VAL A 1 68 ? 14.349 10.238  -1.697  1.00 0.00 ? 68 VAL A C    6  
ATOM 7108  O O    . VAL A 1 68 ? 13.473 10.685  -0.954  1.00 0.00 ? 68 VAL A O    6  
ATOM 7109  C CB   . VAL A 1 68 ? 15.518 8.024   -1.488  1.00 0.00 ? 68 VAL A CB   6  
ATOM 7110  C CG1  . VAL A 1 68 ? 15.974 7.806   -2.923  1.00 0.00 ? 68 VAL A CG1  6  
ATOM 7111  C CG2  . VAL A 1 68 ? 16.374 7.199   -0.539  1.00 0.00 ? 68 VAL A CG2  6  
ATOM 7112  H H    . VAL A 1 68 ? 14.893 9.163   0.856   1.00 0.00 ? 68 VAL A H    6  
ATOM 7113  H HA   . VAL A 1 68 ? 16.466 9.963   -1.491  1.00 0.00 ? 68 VAL A HA   6  
ATOM 7114  H HB   . VAL A 1 68 ? 14.504 7.673   -1.408  1.00 0.00 ? 68 VAL A HB   6  
ATOM 7115  H HG11 . VAL A 1 68 ? 16.979 8.179   -3.033  1.00 0.00 ? 68 VAL A HG11 6  
ATOM 7116  H HG12 . VAL A 1 68 ? 15.318 8.333   -3.605  1.00 0.00 ? 68 VAL A HG12 6  
ATOM 7117  H HG13 . VAL A 1 68 ? 15.956 6.753   -3.154  1.00 0.00 ? 68 VAL A HG13 6  
ATOM 7118  H HG21 . VAL A 1 68 ? 16.026 7.336   0.476   1.00 0.00 ? 68 VAL A HG21 6  
ATOM 7119  H HG22 . VAL A 1 68 ? 17.412 7.501   -0.622  1.00 0.00 ? 68 VAL A HG22 6  
ATOM 7120  H HG23 . VAL A 1 68 ? 16.285 6.157   -0.814  1.00 0.00 ? 68 VAL A HG23 6  
ATOM 7121  N N    . HIS A 1 69 ? 14.322 10.396  -3.018  1.00 0.00 ? 69 HIS A N    6  
ATOM 7122  C CA   . HIS A 1 69 ? 13.095 10.830  -3.690  1.00 0.00 ? 69 HIS A CA   6  
ATOM 7123  C C    . HIS A 1 69 ? 12.284 9.585   -4.027  1.00 0.00 ? 69 HIS A C    6  
ATOM 7124  O O    . HIS A 1 69 ? 12.847 8.591   -4.461  1.00 0.00 ? 69 HIS A O    6  
ATOM 7125  C CB   . HIS A 1 69 ? 13.410 11.637  -4.964  1.00 0.00 ? 69 HIS A CB   6  
ATOM 7126  C CG   . HIS A 1 69 ? 13.945 13.015  -4.676  1.00 0.00 ? 69 HIS A CG   6  
ATOM 7127  N ND1  . HIS A 1 69 ? 13.202 14.166  -4.830  1.00 0.00 ? 69 HIS A ND1  6  
ATOM 7128  C CD2  . HIS A 1 69 ? 15.171 13.425  -4.242  1.00 0.00 ? 69 HIS A CD2  6  
ATOM 7129  C CE1  . HIS A 1 69 ? 13.945 15.213  -4.523  1.00 0.00 ? 69 HIS A CE1  6  
ATOM 7130  N NE2  . HIS A 1 69 ? 15.136 14.785  -4.157  1.00 0.00 ? 69 HIS A NE2  6  
ATOM 7131  H H    . HIS A 1 69 ? 15.120 10.197  -3.557  1.00 0.00 ? 69 HIS A H    6  
ATOM 7132  H HA   . HIS A 1 69 ? 12.542 11.441  -3.002  1.00 0.00 ? 69 HIS A HA   6  
ATOM 7133  H HB2  . HIS A 1 69 ? 14.162 11.114  -5.538  1.00 0.00 ? 69 HIS A HB2  6  
ATOM 7134  H HB3  . HIS A 1 69 ? 12.509 11.756  -5.548  1.00 0.00 ? 69 HIS A HB3  6  
ATOM 7135  H HD1  . HIS A 1 69 ? 12.261 14.201  -5.136  1.00 0.00 ? 69 HIS A HD1  6  
ATOM 7136  H HD2  . HIS A 1 69 ? 16.007 12.783  -4.007  1.00 0.00 ? 69 HIS A HD2  6  
ATOM 7137  H HE1  . HIS A 1 69 ? 13.623 16.241  -4.574  1.00 0.00 ? 69 HIS A HE1  6  
ATOM 7138  H HE2  . HIS A 1 69 ? 15.905 15.374  -3.932  1.00 0.00 ? 69 HIS A HE2  6  
ATOM 7139  N N    . TRP A 1 70 ? 10.978 9.635   -3.803  1.00 0.00 ? 70 TRP A N    6  
ATOM 7140  C CA   . TRP A 1 70 ? 10.108 8.458   -3.931  1.00 0.00 ? 70 TRP A CA   6  
ATOM 7141  C C    . TRP A 1 70 ? 10.366 7.620   -5.186  1.00 0.00 ? 70 TRP A C    6  
ATOM 7142  O O    . TRP A 1 70 ? 10.531 6.403   -5.115  1.00 0.00 ? 70 TRP A O    6  
ATOM 7143  C CB   . TRP A 1 70 ? 8.650  8.897   -3.875  1.00 0.00 ? 70 TRP A CB   6  
ATOM 7144  C CG   . TRP A 1 70 ? 8.216  9.395   -2.534  1.00 0.00 ? 70 TRP A CG   6  
ATOM 7145  C CD1  . TRP A 1 70 ? 8.151  10.681  -2.099  1.00 0.00 ? 70 TRP A CD1  6  
ATOM 7146  C CD2  . TRP A 1 70 ? 7.782  8.590   -1.417  1.00 0.00 ? 70 TRP A CD2  6  
ATOM 7147  N NE1  . TRP A 1 70 ? 7.703  10.740  -0.810  1.00 0.00 ? 70 TRP A NE1  6  
ATOM 7148  C CE2  . TRP A 1 70 ? 7.477  9.472   -0.359  1.00 0.00 ? 70 TRP A CE2  6  
ATOM 7149  C CE3  . TRP A 1 70 ? 7.635  7.221   -1.221  1.00 0.00 ? 70 TRP A CE3  6  
ATOM 7150  C CZ2  . TRP A 1 70 ? 7.032  9.016   0.879   1.00 0.00 ? 70 TRP A CZ2  6  
ATOM 7151  C CZ3  . TRP A 1 70 ? 7.191  6.770   0.014   1.00 0.00 ? 70 TRP A CZ3  6  
ATOM 7152  C CH2  . TRP A 1 70 ? 6.895  7.667   1.047   1.00 0.00 ? 70 TRP A CH2  6  
ATOM 7153  H H    . TRP A 1 70 ? 10.579 10.483  -3.528  1.00 0.00 ? 70 TRP A H    6  
ATOM 7154  H HA   . TRP A 1 70 ? 10.303 7.836   -3.063  1.00 0.00 ? 70 TRP A HA   6  
ATOM 7155  H HB2  . TRP A 1 70 ? 8.484  9.683   -4.596  1.00 0.00 ? 70 TRP A HB2  6  
ATOM 7156  H HB3  . TRP A 1 70 ? 8.017  8.056   -4.132  1.00 0.00 ? 70 TRP A HB3  6  
ATOM 7157  H HD1  . TRP A 1 70 ? 8.403  11.537  -2.710  1.00 0.00 ? 70 TRP A HD1  6  
ATOM 7158  H HE1  . TRP A 1 70 ? 7.570  11.556  -0.268  1.00 0.00 ? 70 TRP A HE1  6  
ATOM 7159  H HE3  . TRP A 1 70 ? 7.867  6.502   -2.003  1.00 0.00 ? 70 TRP A HE3  6  
ATOM 7160  H HZ2  . TRP A 1 70 ? 6.813  9.693   1.680   1.00 0.00 ? 70 TRP A HZ2  6  
ATOM 7161  H HZ3  . TRP A 1 70 ? 7.055  5.711   0.174   1.00 0.00 ? 70 TRP A HZ3  6  
ATOM 7162  H HH2  . TRP A 1 70 ? 6.554  7.261   1.981   1.00 0.00 ? 70 TRP A HH2  6  
ATOM 7163  N N    . HIS A 1 71 ? 10.422 8.283   -6.339  1.00 0.00 ? 71 HIS A N    6  
ATOM 7164  C CA   . HIS A 1 71 ? 10.545 7.570   -7.616  1.00 0.00 ? 71 HIS A CA   6  
ATOM 7165  C C    . HIS A 1 71 ? 11.951 7.004   -7.814  1.00 0.00 ? 71 HIS A C    6  
ATOM 7166  O O    . HIS A 1 71 ? 12.241 6.413   -8.856  1.00 0.00 ? 71 HIS A O    6  
ATOM 7167  C CB   . HIS A 1 71 ? 10.178 8.481   -8.795  1.00 0.00 ? 71 HIS A CB   6  
ATOM 7168  C CG   . HIS A 1 71 ? 11.290 9.420   -9.210  1.00 0.00 ? 71 HIS A CG   6  
ATOM 7169  N ND1  . HIS A 1 71 ? 12.046 9.225   -10.340 1.00 0.00 ? 71 HIS A ND1  6  
ATOM 7170  C CD2  . HIS A 1 71 ? 11.766 10.550  -8.632  1.00 0.00 ? 71 HIS A CD2  6  
ATOM 7171  C CE1  . HIS A 1 71 ? 12.945 10.190  -10.442 1.00 0.00 ? 71 HIS A CE1  6  
ATOM 7172  N NE2  . HIS A 1 71 ? 12.793 11.005  -9.414  1.00 0.00 ? 71 HIS A NE2  6  
ATOM 7173  H H    . HIS A 1 71 ? 10.327 9.263   -6.324  1.00 0.00 ? 71 HIS A H    6  
ATOM 7174  H HA   . HIS A 1 71 ? 9.834  6.746   -7.601  1.00 0.00 ? 71 HIS A HA   6  
ATOM 7175  H HB2  . HIS A 1 71 ? 9.917  7.874   -9.653  1.00 0.00 ? 71 HIS A HB2  6  
ATOM 7176  H HB3  . HIS A 1 71 ? 9.323  9.080   -8.519  1.00 0.00 ? 71 HIS A HB3  6  
ATOM 7177  H HD1  . HIS A 1 71 ? 11.948 8.474   -10.978 1.00 0.00 ? 71 HIS A HD1  6  
ATOM 7178  H HD2  . HIS A 1 71 ? 11.409 11.010  -7.720  1.00 0.00 ? 71 HIS A HD2  6  
ATOM 7179  H HE1  . HIS A 1 71 ? 13.661 10.297  -11.227 1.00 0.00 ? 71 HIS A HE1  6  
ATOM 7180  H HE2  . HIS A 1 71 ? 13.451 11.692  -9.138  1.00 0.00 ? 71 HIS A HE2  6  
ATOM 7181  N N    . MET A 1 72 ? 12.832 7.169   -6.831  1.00 0.00 ? 72 MET A N    6  
ATOM 7182  C CA   . MET A 1 72 ? 14.202 6.682   -6.938  1.00 0.00 ? 72 MET A CA   6  
ATOM 7183  C C    . MET A 1 72 ? 14.327 5.284   -6.365  1.00 0.00 ? 72 MET A C    6  
ATOM 7184  O O    . MET A 1 72 ? 15.290 4.575   -6.651  1.00 0.00 ? 72 MET A O    6  
ATOM 7185  C CB   . MET A 1 72 ? 15.175 7.618   -6.230  1.00 0.00 ? 72 MET A CB   6  
ATOM 7186  C CG   . MET A 1 72 ? 15.165 9.045   -6.765  1.00 0.00 ? 72 MET A CG   6  
ATOM 7187  S SD   . MET A 1 72 ? 15.744 9.168   -8.472  1.00 0.00 ? 72 MET A SD   6  
ATOM 7188  C CE   . MET A 1 72 ? 17.417 8.556   -8.282  1.00 0.00 ? 72 MET A CE   6  
ATOM 7189  H H    . MET A 1 72 ? 12.571 7.682   -6.019  1.00 0.00 ? 72 MET A H    6  
ATOM 7190  H HA   . MET A 1 72 ? 14.449 6.651   -7.987  1.00 0.00 ? 72 MET A HA   6  
ATOM 7191  H HB2  . MET A 1 72 ? 14.912 7.659   -5.177  1.00 0.00 ? 72 MET A HB2  6  
ATOM 7192  H HB3  . MET A 1 72 ? 16.171 7.217   -6.325  1.00 0.00 ? 72 MET A HB3  6  
ATOM 7193  H HG2  . MET A 1 72 ? 14.155 9.423   -6.705  1.00 0.00 ? 72 MET A HG2  6  
ATOM 7194  H HG3  . MET A 1 72 ? 15.803 9.657   -6.136  1.00 0.00 ? 72 MET A HG3  6  
ATOM 7195  H HE1  . MET A 1 72 ? 17.397 7.568   -7.848  1.00 0.00 ? 72 MET A HE1  6  
ATOM 7196  H HE2  . MET A 1 72 ? 17.967 9.225   -7.628  1.00 0.00 ? 72 MET A HE2  6  
ATOM 7197  H HE3  . MET A 1 72 ? 17.902 8.516   -9.238  1.00 0.00 ? 72 MET A HE3  6  
ATOM 7198  N N    . LEU A 1 73 ? 13.363 4.875   -5.546  1.00 0.00 ? 73 LEU A N    6  
ATOM 7199  C CA   . LEU A 1 73 ? 13.423 3.584   -4.886  1.00 0.00 ? 73 LEU A CA   6  
ATOM 7200  C C    . LEU A 1 73 ? 12.296 2.677   -5.363  1.00 0.00 ? 73 LEU A C    6  
ATOM 7201  O O    . LEU A 1 73 ? 11.149 3.088   -5.480  1.00 0.00 ? 73 LEU A O    6  
ATOM 7202  C CB   . LEU A 1 73 ? 13.398 3.780   -3.359  1.00 0.00 ? 73 LEU A CB   6  
ATOM 7203  C CG   . LEU A 1 73 ? 12.246 4.629   -2.819  1.00 0.00 ? 73 LEU A CG   6  
ATOM 7204  C CD1  . LEU A 1 73 ? 11.019 3.773   -2.509  1.00 0.00 ? 73 LEU A CD1  6  
ATOM 7205  C CD2  . LEU A 1 73 ? 12.695 5.388   -1.582  1.00 0.00 ? 73 LEU A CD2  6  
ATOM 7206  H H    . LEU A 1 73 ? 12.560 5.443   -5.418  1.00 0.00 ? 73 LEU A H    6  
ATOM 7207  H HA   . LEU A 1 73 ? 14.373 3.140   -5.156  1.00 0.00 ? 73 LEU A HA   6  
ATOM 7208  H HB2  . LEU A 1 73 ? 13.324 2.811   -2.922  1.00 0.00 ? 73 LEU A HB2  6  
ATOM 7209  H HB3  . LEU A 1 73 ? 14.327 4.233   -3.056  1.00 0.00 ? 73 LEU A HB3  6  
ATOM 7210  H HG   . LEU A 1 73 ? 11.952 5.356   -3.559  1.00 0.00 ? 73 LEU A HG   6  
ATOM 7211  H HD11 . LEU A 1 73 ? 11.289 2.985   -1.819  1.00 0.00 ? 73 LEU A HD11 6  
ATOM 7212  H HD12 . LEU A 1 73 ? 10.651 3.327   -3.423  1.00 0.00 ? 73 LEU A HD12 6  
ATOM 7213  H HD13 . LEU A 1 73 ? 10.251 4.380   -2.075  1.00 0.00 ? 73 LEU A HD13 6  
ATOM 7214  H HD21 . LEU A 1 73 ? 12.959 4.686   -0.802  1.00 0.00 ? 73 LEU A HD21 6  
ATOM 7215  H HD22 . LEU A 1 73 ? 11.880 6.017   -1.237  1.00 0.00 ? 73 LEU A HD22 6  
ATOM 7216  H HD23 . LEU A 1 73 ? 13.541 6.002   -1.818  1.00 0.00 ? 73 LEU A HD23 6  
ATOM 7217  N N    . GLU A 1 74 ? 12.665 1.443   -5.667  1.00 0.00 ? 74 GLU A N    6  
ATOM 7218  C CA   . GLU A 1 74 ? 11.695 0.456   -6.135  1.00 0.00 ? 74 GLU A CA   6  
ATOM 7219  C C    . GLU A 1 74 ? 11.659 -0.734  -5.192  1.00 0.00 ? 74 GLU A C    6  
ATOM 7220  O O    . GLU A 1 74 ? 12.617 -1.492  -5.100  1.00 0.00 ? 74 GLU A O    6  
ATOM 7221  C CB   . GLU A 1 74 ? 12.072 0.009   -7.543  1.00 0.00 ? 74 GLU A CB   6  
ATOM 7222  C CG   . GLU A 1 74 ? 11.041 -0.895  -8.197  1.00 0.00 ? 74 GLU A CG   6  
ATOM 7223  C CD   . GLU A 1 74 ? 11.307 -1.032  -9.674  1.00 0.00 ? 74 GLU A CD   6  
ATOM 7224  O OE1  . GLU A 1 74 ? 11.197 -0.025  -10.395 1.00 0.00 ? 74 GLU A OE1  6  
ATOM 7225  O OE2  . GLU A 1 74 ? 11.627 -2.154  -10.119 1.00 0.00 ? 74 GLU A OE2  6  
ATOM 7226  H H    . GLU A 1 74 ? 13.615 1.192   -5.595  1.00 0.00 ? 74 GLU A H    6  
ATOM 7227  H HA   . GLU A 1 74 ? 10.723 0.926   -6.157  1.00 0.00 ? 74 GLU A HA   6  
ATOM 7228  H HB2  . GLU A 1 74 ? 12.213 0.886   -8.166  1.00 0.00 ? 74 GLU A HB2  6  
ATOM 7229  H HB3  . GLU A 1 74 ? 13.015 -0.534  -7.498  1.00 0.00 ? 74 GLU A HB3  6  
ATOM 7230  H HG2  . GLU A 1 74 ? 11.091 -1.871  -7.737  1.00 0.00 ? 74 GLU A HG2  6  
ATOM 7231  H HG3  . GLU A 1 74 ? 10.052 -0.453  -8.060  1.00 0.00 ? 74 GLU A HG3  6  
ATOM 7232  N N    . ILE A 1 75 ? 10.573 -0.837  -4.436  1.00 0.00 ? 75 ILE A N    6  
ATOM 7233  C CA   . ILE A 1 75 ? 10.380 -1.950  -3.507  1.00 0.00 ? 75 ILE A CA   6  
ATOM 7234  C C    . ILE A 1 75 ? 10.605 -3.315  -4.126  1.00 0.00 ? 75 ILE A C    6  
ATOM 7235  O O    . ILE A 1 75 ? 10.108 -3.630  -5.209  1.00 0.00 ? 75 ILE A O    6  
ATOM 7236  C CB   . ILE A 1 75 ? 8.969  -1.926  -2.882  1.00 0.00 ? 75 ILE A CB   6  
ATOM 7237  C CG1  . ILE A 1 75 ? 7.894  -1.773  -3.966  1.00 0.00 ? 75 ILE A CG1  6  
ATOM 7238  C CG2  . ILE A 1 75 ? 8.866  -0.806  -1.865  1.00 0.00 ? 75 ILE A CG2  6  
ATOM 7239  C CD1  . ILE A 1 75 ? 6.476  -1.719  -3.420  1.00 0.00 ? 75 ILE A CD1  6  
ATOM 7240  H H    . ILE A 1 75 ? 9.910  -0.121  -4.421  1.00 0.00 ? 75 ILE A H    6  
ATOM 7241  H HA   . ILE A 1 75 ? 11.085 -1.824  -2.701  1.00 0.00 ? 75 ILE A HA   6  
ATOM 7242  H HB   . ILE A 1 75 ? 8.832  -2.853  -2.359  1.00 0.00 ? 75 ILE A HB   6  
ATOM 7243  H HG12 . ILE A 1 75 ? 8.065  -0.865  -4.531  1.00 0.00 ? 75 ILE A HG12 6  
ATOM 7244  H HG13 . ILE A 1 75 ? 7.949  -2.624  -4.637  1.00 0.00 ? 75 ILE A HG13 6  
ATOM 7245  H HG21 . ILE A 1 75 ? 9.033  0.145   -2.354  1.00 0.00 ? 75 ILE A HG21 6  
ATOM 7246  H HG22 . ILE A 1 75 ? 9.614  -0.951  -1.103  1.00 0.00 ? 75 ILE A HG22 6  
ATOM 7247  H HG23 . ILE A 1 75 ? 7.881  -0.820  -1.425  1.00 0.00 ? 75 ILE A HG23 6  
ATOM 7248  H HD11 . ILE A 1 75 ? 6.267  -2.629  -2.879  1.00 0.00 ? 75 ILE A HD11 6  
ATOM 7249  H HD12 . ILE A 1 75 ? 5.778  -1.613  -4.242  1.00 0.00 ? 75 ILE A HD12 6  
ATOM 7250  H HD13 . ILE A 1 75 ? 6.380  -0.871  -2.755  1.00 0.00 ? 75 ILE A HD13 6  
ATOM 7251  N N    . LEU A 1 76 ? 11.380 -4.119  -3.417  1.00 0.00 ? 76 LEU A N    6  
ATOM 7252  C CA   . LEU A 1 76 ? 11.632 -5.488  -3.796  1.00 0.00 ? 76 LEU A CA   6  
ATOM 7253  C C    . LEU A 1 76 ? 10.796 -6.393  -2.886  1.00 0.00 ? 76 LEU A C    6  
ATOM 7254  O O    . LEU A 1 76 ? 10.363 -7.475  -3.295  1.00 0.00 ? 76 LEU A O    6  
ATOM 7255  C CB   . LEU A 1 76 ? 13.126 -5.780  -3.656  1.00 0.00 ? 76 LEU A CB   6  
ATOM 7256  C CG   . LEU A 1 76 ? 13.640 -6.995  -4.422  1.00 0.00 ? 76 LEU A CG   6  
ATOM 7257  C CD1  . LEU A 1 76 ? 13.375 -6.841  -5.913  1.00 0.00 ? 76 LEU A CD1  6  
ATOM 7258  C CD2  . LEU A 1 76 ? 15.125 -7.163  -4.171  1.00 0.00 ? 76 LEU A CD2  6  
ATOM 7259  H H    . LEU A 1 76 ? 11.791 -3.776  -2.584  1.00 0.00 ? 76 LEU A H    6  
ATOM 7260  H HA   . LEU A 1 76 ? 11.331 -5.613  -4.819  1.00 0.00 ? 76 LEU A HA   6  
ATOM 7261  H HB2  . LEU A 1 76 ? 13.667 -4.911  -4.005  1.00 0.00 ? 76 LEU A HB2  6  
ATOM 7262  H HB3  . LEU A 1 76 ? 13.345 -5.918  -2.610  1.00 0.00 ? 76 LEU A HB3  6  
ATOM 7263  H HG   . LEU A 1 76 ? 13.136 -7.873  -4.082  1.00 0.00 ? 76 LEU A HG   6  
ATOM 7264  H HD11 . LEU A 1 76 ? 12.305 -6.749  -6.087  1.00 0.00 ? 76 LEU A HD11 6  
ATOM 7265  H HD12 . LEU A 1 76 ? 13.750 -7.715  -6.432  1.00 0.00 ? 76 LEU A HD12 6  
ATOM 7266  H HD13 . LEU A 1 76 ? 13.877 -5.960  -6.269  1.00 0.00 ? 76 LEU A HD13 6  
ATOM 7267  H HD21 . LEU A 1 76 ? 15.494 -7.989  -4.763  1.00 0.00 ? 76 LEU A HD21 6  
ATOM 7268  H HD22 . LEU A 1 76 ? 15.302 -7.359  -3.121  1.00 0.00 ? 76 LEU A HD22 6  
ATOM 7269  H HD23 . LEU A 1 76 ? 15.634 -6.261  -4.461  1.00 0.00 ? 76 LEU A HD23 6  
ATOM 7270  N N    . GLY A 1 77 ? 10.580 -5.932  -1.651  1.00 0.00 ? 77 GLY A N    6  
ATOM 7271  C CA   . GLY A 1 77 ? 9.705  -6.602  -0.712  1.00 0.00 ? 77 GLY A CA   6  
ATOM 7272  C C    . GLY A 1 77 ? 10.055 -8.060  -0.493  1.00 0.00 ? 77 GLY A C    6  
ATOM 7273  O O    . GLY A 1 77 ? 11.223 -8.443  -0.535  1.00 0.00 ? 77 GLY A O    6  
ATOM 7274  H H    . GLY A 1 77 ? 11.019 -5.095  -1.387  1.00 0.00 ? 77 GLY A H    6  
ATOM 7275  H HA2  . GLY A 1 77 ? 9.761  -6.071  0.233   1.00 0.00 ? 77 GLY A HA2  6  
ATOM 7276  H HA3  . GLY A 1 77 ? 8.695  -6.541  -1.090  1.00 0.00 ? 77 GLY A HA3  6  
ATOM 7277  N N    . PHE A 1 78 ? 9.025  -8.868  -0.238  1.00 0.00 ? 78 PHE A N    6  
ATOM 7278  C CA   . PHE A 1 78 ? 9.212  -10.293 -0.074  1.00 0.00 ? 78 PHE A CA   6  
ATOM 7279  C C    . PHE A 1 78 ? 9.086  -10.991 -1.419  1.00 0.00 ? 78 PHE A C    6  
ATOM 7280  O O    . PHE A 1 78 ? 8.889  -12.217 -1.485  1.00 0.00 ? 78 PHE A O    6  
ATOM 7281  C CB   . PHE A 1 78 ? 8.189  -10.870 0.917   1.00 0.00 ? 78 PHE A CB   6  
ATOM 7282  C CG   . PHE A 1 78 ? 8.303  -10.315 2.312   1.00 0.00 ? 78 PHE A CG   6  
ATOM 7283  C CD1  . PHE A 1 78 ? 9.228  -10.822 3.204   1.00 0.00 ? 78 PHE A CD1  6  
ATOM 7284  C CD2  . PHE A 1 78 ? 7.483  -9.274  2.729   1.00 0.00 ? 78 PHE A CD2  6  
ATOM 7285  C CE1  . PHE A 1 78 ? 9.334  -10.313 4.476   1.00 0.00 ? 78 PHE A CE1  6  
ATOM 7286  C CE2  . PHE A 1 78 ? 7.583  -8.757  4.000   1.00 0.00 ? 78 PHE A CE2  6  
ATOM 7287  C CZ   . PHE A 1 78 ? 8.511  -9.279  4.871   1.00 0.00 ? 78 PHE A CZ   6  
ATOM 7288  H H    . PHE A 1 78 ? 8.129  -8.479  -0.159  1.00 0.00 ? 78 PHE A H    6  
ATOM 7289  H HA   . PHE A 1 78 ? 10.204 -10.460 0.322   1.00 0.00 ? 78 PHE A HA   6  
ATOM 7290  H HB2  . PHE A 1 78 ? 7.184  -10.654 0.555   1.00 0.00 ? 78 PHE A HB2  6  
ATOM 7291  H HB3  . PHE A 1 78 ? 8.323  -11.933 0.974   1.00 0.00 ? 78 PHE A HB3  6  
ATOM 7292  H HD1  . PHE A 1 78 ? 9.881  -11.630 2.879   1.00 0.00 ? 78 PHE A HD1  6  
ATOM 7293  H HD2  . PHE A 1 78 ? 6.756  -8.860  2.043   1.00 0.00 ? 78 PHE A HD2  6  
ATOM 7294  H HE1  . PHE A 1 78 ? 10.070 -10.715 5.168   1.00 0.00 ? 78 PHE A HE1  6  
ATOM 7295  H HE2  . PHE A 1 78 ? 6.952  -7.940  4.309   1.00 0.00 ? 78 PHE A HE2  6  
ATOM 7296  H HZ   . PHE A 1 78 ? 8.588  -8.889  5.871   1.00 0.00 ? 78 PHE A HZ   6  
ATOM 7297  N N    . GLU A 1 79 ? 9.230  -10.210 -2.485  1.00 0.00 ? 79 GLU A N    6  
ATOM 7298  C CA   . GLU A 1 79 ? 9.156  -10.733 -3.843  1.00 0.00 ? 79 GLU A CA   6  
ATOM 7299  C C    . GLU A 1 79 ? 10.532 -11.173 -4.328  1.00 0.00 ? 79 GLU A C    6  
ATOM 7300  O O    . GLU A 1 79 ? 10.708 -11.514 -5.494  1.00 0.00 ? 79 GLU A O    6  
ATOM 7301  C CB   . GLU A 1 79 ? 8.589  -9.682  -4.805  1.00 0.00 ? 79 GLU A CB   6  
ATOM 7302  C CG   . GLU A 1 79 ? 7.107  -9.392  -4.606  1.00 0.00 ? 79 GLU A CG   6  
ATOM 7303  C CD   . GLU A 1 79 ? 6.795  -8.682  -3.304  1.00 0.00 ? 79 GLU A CD   6  
ATOM 7304  O OE1  . GLU A 1 79 ? 7.088  -7.476  -3.175  1.00 0.00 ? 79 GLU A OE1  6  
ATOM 7305  O OE2  . GLU A 1 79 ? 6.225  -9.323  -2.396  1.00 0.00 ? 79 GLU A OE2  6  
ATOM 7306  H H    . GLU A 1 79 ? 9.370  -9.255  -2.349  1.00 0.00 ? 79 GLU A H    6  
ATOM 7307  H HA   . GLU A 1 79 ? 8.501  -11.586 -3.832  1.00 0.00 ? 79 GLU A HA   6  
ATOM 7308  H HB2  . GLU A 1 79 ? 9.141  -8.762  -4.675  1.00 0.00 ? 79 GLU A HB2  6  
ATOM 7309  H HB3  . GLU A 1 79 ? 8.732  -10.037 -5.818  1.00 0.00 ? 79 GLU A HB3  6  
ATOM 7310  H HG2  . GLU A 1 79 ? 6.762  -8.777  -5.425  1.00 0.00 ? 79 GLU A HG2  6  
ATOM 7311  H HG3  . GLU A 1 79 ? 6.571  -10.329 -4.625  1.00 0.00 ? 79 GLU A HG3  6  
ATOM 7312  N N    . GLU A 1 80 ? 11.493 -11.178 -3.417  1.00 0.00 ? 80 GLU A N    6  
ATOM 7313  C CA   . GLU A 1 80 ? 12.843 -11.627 -3.737  1.00 0.00 ? 80 GLU A CA   6  
ATOM 7314  C C    . GLU A 1 80 ? 12.844 -13.113 -4.064  1.00 0.00 ? 80 GLU A C    6  
ATOM 7315  O O    . GLU A 1 80 ? 13.465 -13.547 -5.040  1.00 0.00 ? 80 GLU A O    6  
ATOM 7316  C CB   . GLU A 1 80 ? 13.814 -11.362 -2.580  1.00 0.00 ? 80 GLU A CB   6  
ATOM 7317  C CG   . GLU A 1 80 ? 13.933 -9.899  -2.198  1.00 0.00 ? 80 GLU A CG   6  
ATOM 7318  C CD   . GLU A 1 80 ? 15.017 -9.669  -1.157  1.00 0.00 ? 80 GLU A CD   6  
ATOM 7319  O OE1  . GLU A 1 80 ? 16.210 -9.674  -1.526  1.00 0.00 ? 80 GLU A OE1  6  
ATOM 7320  O OE2  . GLU A 1 80 ? 14.686 -9.492  0.036   1.00 0.00 ? 80 GLU A OE2  6  
ATOM 7321  H H    . GLU A 1 80 ? 11.305 -10.857 -2.510  1.00 0.00 ? 80 GLU A H    6  
ATOM 7322  H HA   . GLU A 1 80 ? 13.181 -11.070 -4.610  1.00 0.00 ? 80 GLU A HA   6  
ATOM 7323  H HB2  . GLU A 1 80 ? 13.485 -11.905 -1.711  1.00 0.00 ? 80 GLU A HB2  6  
ATOM 7324  H HB3  . GLU A 1 80 ? 14.791 -11.714 -2.870  1.00 0.00 ? 80 GLU A HB3  6  
ATOM 7325  H HG2  . GLU A 1 80 ? 14.171 -9.334  -3.087  1.00 0.00 ? 80 GLU A HG2  6  
ATOM 7326  H HG3  . GLU A 1 80 ? 12.988 -9.565  -1.798  1.00 0.00 ? 80 GLU A HG3  6  
ATOM 7327  N N    . MET A 1 4  ? 8.808  0.487   -15.769 1.00 0.00 ? 4  MET A N    7  
ATOM 7328  C CA   . MET A 1 4  ? 9.315  1.853   -15.937 1.00 0.00 ? 4  MET A CA   7  
ATOM 7329  C C    . MET A 1 4  ? 8.527  2.815   -15.068 1.00 0.00 ? 4  MET A C    7  
ATOM 7330  O O    . MET A 1 4  ? 7.291  2.844   -15.092 1.00 0.00 ? 4  MET A O    7  
ATOM 7331  C CB   . MET A 1 4  ? 9.225  2.278   -17.406 1.00 0.00 ? 4  MET A CB   7  
ATOM 7332  C CG   . MET A 1 4  ? 10.131 1.502   -18.332 1.00 0.00 ? 4  MET A CG   7  
ATOM 7333  S SD   . MET A 1 4  ? 10.000 2.040   -20.059 1.00 0.00 ? 4  MET A SD   7  
ATOM 7334  C CE   . MET A 1 4  ? 8.313  1.581   -20.438 1.00 0.00 ? 4  MET A CE   7  
ATOM 7335  H H    . MET A 1 4  ? 8.061  0.180   -16.335 1.00 0.00 ? 4  MET A H    7  
ATOM 7336  H HA   . MET A 1 4  ? 10.347 1.859   -15.634 1.00 0.00 ? 4  MET A HA   7  
ATOM 7337  H HB2  . MET A 1 4  ? 8.199  2.155   -17.740 1.00 0.00 ? 4  MET A HB2  7  
ATOM 7338  H HB3  . MET A 1 4  ? 9.491  3.325   -17.479 1.00 0.00 ? 4  MET A HB3  7  
ATOM 7339  H HG2  . MET A 1 4  ? 11.156 1.643   -18.014 1.00 0.00 ? 4  MET A HG2  7  
ATOM 7340  H HG3  . MET A 1 4  ? 9.874  0.449   -18.277 1.00 0.00 ? 4  MET A HG3  7  
ATOM 7341  H HE1  . MET A 1 4  ? 8.200  0.508   -20.343 1.00 0.00 ? 4  MET A HE1  7  
ATOM 7342  H HE2  . MET A 1 4  ? 8.084  1.890   -21.447 1.00 0.00 ? 4  MET A HE2  7  
ATOM 7343  H HE3  . MET A 1 4  ? 7.658  2.085   -19.744 1.00 0.00 ? 4  MET A HE3  7  
ATOM 7344  N N    . ARG A 1 5  ? 9.254  3.620   -14.305 1.00 0.00 ? 5  ARG A N    7  
ATOM 7345  C CA   . ARG A 1 5  ? 8.646  4.641   -13.466 1.00 0.00 ? 5  ARG A CA   7  
ATOM 7346  C C    . ARG A 1 5  ? 7.966  5.706   -14.308 1.00 0.00 ? 5  ARG A C    7  
ATOM 7347  O O    . ARG A 1 5  ? 6.946  6.279   -13.929 1.00 0.00 ? 5  ARG A O    7  
ATOM 7348  C CB   . ARG A 1 5  ? 9.690  5.281   -12.557 1.00 0.00 ? 5  ARG A CB   7  
ATOM 7349  C CG   . ARG A 1 5  ? 10.873 5.890   -13.302 1.00 0.00 ? 5  ARG A CG   7  
ATOM 7350  C CD   . ARG A 1 5  ? 11.853 6.539   -12.348 1.00 0.00 ? 5  ARG A CD   7  
ATOM 7351  N NE   . ARG A 1 5  ? 13.051 7.036   -13.031 1.00 0.00 ? 5  ARG A NE   7  
ATOM 7352  C CZ   . ARG A 1 5  ? 14.234 7.185   -12.452 1.00 0.00 ? 5  ARG A CZ   7  
ATOM 7353  N NH1  . ARG A 1 5  ? 14.370 6.894   -11.165 1.00 0.00 ? 5  ARG A NH1  7  
ATOM 7354  N NH2  . ARG A 1 5  ? 15.276 7.618   -13.140 1.00 0.00 ? 5  ARG A NH2  7  
ATOM 7355  H H    . ARG A 1 5  ? 10.220 3.512   -14.273 1.00 0.00 ? 5  ARG A H    7  
ATOM 7356  H HA   . ARG A 1 5  ? 7.893  4.153   -12.858 1.00 0.00 ? 5  ARG A HA   7  
ATOM 7357  H HB2  . ARG A 1 5  ? 9.210  6.069   -11.993 1.00 0.00 ? 5  ARG A HB2  7  
ATOM 7358  H HB3  . ARG A 1 5  ? 10.073 4.544   -11.882 1.00 0.00 ? 5  ARG A HB3  7  
ATOM 7359  H HG2  . ARG A 1 5  ? 11.384 5.102   -13.856 1.00 0.00 ? 5  ARG A HG2  7  
ATOM 7360  H HG3  . ARG A 1 5  ? 10.506 6.637   -14.007 1.00 0.00 ? 5  ARG A HG3  7  
ATOM 7361  H HD2  . ARG A 1 5  ? 11.361 7.371   -11.856 1.00 0.00 ? 5  ARG A HD2  7  
ATOM 7362  H HD3  . ARG A 1 5  ? 12.144 5.814   -11.597 1.00 0.00 ? 5  ARG A HD3  7  
ATOM 7363  H HE   . ARG A 1 5  ? 12.972 7.239   -14.003 1.00 0.00 ? 5  ARG A HE   7  
ATOM 7364  H HH11 . ARG A 1 5  ? 13.582 6.575   -10.630 1.00 0.00 ? 5  ARG A HH11 7  
ATOM 7365  H HH12 . ARG A 1 5  ? 15.270 6.990   -10.721 1.00 0.00 ? 5  ARG A HH12 7  
ATOM 7366  H HH21 . ARG A 1 5  ? 15.191 7.849   -14.112 1.00 0.00 ? 5  ARG A HH21 7  
ATOM 7367  H HH22 . ARG A 1 5  ? 16.188 7.706   -12.695 1.00 0.00 ? 5  ARG A HH22 7  
ATOM 7368  N N    . SER A 1 6  ? 8.535  5.964   -15.489 1.00 0.00 ? 6  SER A N    7  
ATOM 7369  C CA   . SER A 1 6  ? 8.014  6.979   -16.390 1.00 0.00 ? 6  SER A CA   7  
ATOM 7370  C C    . SER A 1 6  ? 7.010  6.380   -17.365 1.00 0.00 ? 6  SER A C    7  
ATOM 7371  O O    . SER A 1 6  ? 6.612  7.028   -18.333 1.00 0.00 ? 6  SER A O    7  
ATOM 7372  C CB   . SER A 1 6  ? 9.179  7.644   -17.133 1.00 0.00 ? 6  SER A CB   7  
ATOM 7373  O OG   . SER A 1 6  ? 10.119 8.201   -16.226 1.00 0.00 ? 6  SER A OG   7  
ATOM 7374  H H    . SER A 1 6  ? 9.349  5.469   -15.733 1.00 0.00 ? 6  SER A H    7  
ATOM 7375  H HA   . SER A 1 6  ? 7.515  7.728   -15.784 1.00 0.00 ? 6  SER A HA   7  
ATOM 7376  H HB2  . SER A 1 6  ? 9.675  6.930   -17.761 1.00 0.00 ? 6  SER A HB2  7  
ATOM 7377  H HB3  . SER A 1 6  ? 8.793  8.443   -17.755 1.00 0.00 ? 6  SER A HB3  7  
ATOM 7378  H HG   . SER A 1 6  ? 10.913 7.657   -16.209 1.00 0.00 ? 6  SER A HG   7  
ATOM 7379  N N    . GLU A 1 7  ? 6.572  5.156   -17.097 1.00 0.00 ? 7  GLU A N    7  
ATOM 7380  C CA   . GLU A 1 7  ? 5.552  4.506   -17.932 1.00 0.00 ? 7  GLU A CA   7  
ATOM 7381  C C    . GLU A 1 7  ? 4.170  5.070   -17.590 1.00 0.00 ? 7  GLU A C    7  
ATOM 7382  O O    . GLU A 1 7  ? 3.245  5.033   -18.404 1.00 0.00 ? 7  GLU A O    7  
ATOM 7383  C CB   . GLU A 1 7  ? 5.545  2.995   -17.702 1.00 0.00 ? 7  GLU A CB   7  
ATOM 7384  C CG   . GLU A 1 7  ? 4.740  2.233   -18.739 1.00 0.00 ? 7  GLU A CG   7  
ATOM 7385  C CD   . GLU A 1 7  ? 4.233  0.907   -18.222 1.00 0.00 ? 7  GLU A CD   7  
ATOM 7386  O OE1  . GLU A 1 7  ? 4.991  -0.100  -18.290 1.00 0.00 ? 7  GLU A OE1  7  
ATOM 7387  O OE2  . GLU A 1 7  ? 3.077  0.854   -17.747 1.00 0.00 ? 7  GLU A OE2  7  
ATOM 7388  H H    . GLU A 1 7  ? 6.938  4.672   -16.325 1.00 0.00 ? 7  GLU A H    7  
ATOM 7389  H HA   . GLU A 1 7  ? 5.774  4.711   -18.970 1.00 0.00 ? 7  GLU A HA   7  
ATOM 7390  H HB2  . GLU A 1 7  ? 6.563  2.630   -17.723 1.00 0.00 ? 7  GLU A HB2  7  
ATOM 7391  H HB3  . GLU A 1 7  ? 5.126  2.794   -16.721 1.00 0.00 ? 7  GLU A HB3  7  
ATOM 7392  H HG2  . GLU A 1 7  ? 3.885  2.839   -19.013 1.00 0.00 ? 7  GLU A HG2  7  
ATOM 7393  H HG3  . GLU A 1 7  ? 5.367  2.054   -19.604 1.00 0.00 ? 7  GLU A HG3  7  
ATOM 7394  N N    . PHE A 1 8  ? 4.051  5.593   -16.376 1.00 0.00 ? 8  PHE A N    7  
ATOM 7395  C CA   . PHE A 1 8  ? 2.804  6.143   -15.886 1.00 0.00 ? 8  PHE A CA   7  
ATOM 7396  C C    . PHE A 1 8  ? 2.507  7.485   -16.549 1.00 0.00 ? 8  PHE A C    7  
ATOM 7397  O O    . PHE A 1 8  ? 3.345  8.022   -17.259 1.00 0.00 ? 8  PHE A O    7  
ATOM 7398  C CB   . PHE A 1 8  ? 2.866  6.312   -14.356 1.00 0.00 ? 8  PHE A CB   7  
ATOM 7399  C CG   . PHE A 1 8  ? 3.016  5.010   -13.614 1.00 0.00 ? 8  PHE A CG   7  
ATOM 7400  C CD1  . PHE A 1 8  ? 1.887  4.289   -13.230 1.00 0.00 ? 8  PHE A CD1  7  
ATOM 7401  C CD2  . PHE A 1 8  ? 4.269  4.516   -13.282 1.00 0.00 ? 8  PHE A CD2  7  
ATOM 7402  C CE1  . PHE A 1 8  ? 2.019  3.096   -12.547 1.00 0.00 ? 8  PHE A CE1  7  
ATOM 7403  C CE2  . PHE A 1 8  ? 4.396  3.334   -12.603 1.00 0.00 ? 8  PHE A CE2  7  
ATOM 7404  C CZ   . PHE A 1 8  ? 3.278  2.614   -12.235 1.00 0.00 ? 8  PHE A CZ   7  
ATOM 7405  H H    . PHE A 1 8  ? 4.844  5.623   -15.804 1.00 0.00 ? 8  PHE A H    7  
ATOM 7406  H HA   . PHE A 1 8  ? 2.007  5.454   -16.130 1.00 0.00 ? 8  PHE A HA   7  
ATOM 7407  H HB2  . PHE A 1 8  ? 3.714  6.928   -14.112 1.00 0.00 ? 8  PHE A HB2  7  
ATOM 7408  H HB3  . PHE A 1 8  ? 1.954  6.789   -14.015 1.00 0.00 ? 8  PHE A HB3  7  
ATOM 7409  H HD1  . PHE A 1 8  ? 0.905  4.662   -13.487 1.00 0.00 ? 8  PHE A HD1  7  
ATOM 7410  H HD2  . PHE A 1 8  ? 5.149  5.078   -13.558 1.00 0.00 ? 8  PHE A HD2  7  
ATOM 7411  H HE1  . PHE A 1 8  ? 1.134  2.542   -12.248 1.00 0.00 ? 8  PHE A HE1  7  
ATOM 7412  H HE2  . PHE A 1 8  ? 5.385  2.959   -12.361 1.00 0.00 ? 8  PHE A HE2  7  
ATOM 7413  H HZ   . PHE A 1 8  ? 3.386  1.682   -11.687 1.00 0.00 ? 8  PHE A HZ   7  
ATOM 7414  N N    . ALA A 1 9  ? 1.314  8.035   -16.285 1.00 0.00 ? 9  ALA A N    7  
ATOM 7415  C CA   . ALA A 1 9  ? 0.869  9.255   -16.961 1.00 0.00 ? 9  ALA A CA   7  
ATOM 7416  C C    . ALA A 1 9  ? 1.778  10.430  -16.636 1.00 0.00 ? 9  ALA A C    7  
ATOM 7417  O O    . ALA A 1 9  ? 2.190  11.174  -17.533 1.00 0.00 ? 9  ALA A O    7  
ATOM 7418  C CB   . ALA A 1 9  ? -0.559 9.586   -16.559 1.00 0.00 ? 9  ALA A CB   7  
ATOM 7419  H H    . ALA A 1 9  ? 0.729  7.615   -15.616 1.00 0.00 ? 9  ALA A H    7  
ATOM 7420  H HA   . ALA A 1 9  ? 0.893  9.070   -18.033 1.00 0.00 ? 9  ALA A HA   7  
ATOM 7421  H HB1  . ALA A 1 9  ? -0.909 10.416  -17.142 1.00 0.00 ? 9  ALA A HB1  7  
ATOM 7422  H HB2  . ALA A 1 9  ? -0.580 9.848   -15.514 1.00 0.00 ? 9  ALA A HB2  7  
ATOM 7423  H HB3  . ALA A 1 9  ? -1.185 8.721   -16.728 1.00 0.00 ? 9  ALA A HB3  7  
ATOM 7424  N N    . SER A 1 10 ? 2.103  10.599  -15.375 1.00 0.00 ? 10 SER A N    7  
ATOM 7425  C CA   . SER A 1 10 ? 2.980  11.683  -14.944 1.00 0.00 ? 10 SER A CA   7  
ATOM 7426  C C    . SER A 1 10 ? 4.282  11.143  -14.358 1.00 0.00 ? 10 SER A C    7  
ATOM 7427  O O    . SER A 1 10 ? 5.225  11.903  -14.087 1.00 0.00 ? 10 SER A O    7  
ATOM 7428  C CB   . SER A 1 10 ? 2.268  12.560  -13.910 1.00 0.00 ? 10 SER A CB   7  
ATOM 7429  O OG   . SER A 1 10 ? 1.101  13.144  -14.463 1.00 0.00 ? 10 SER A OG   7  
ATOM 7430  H H    . SER A 1 10 ? 1.725  10.001  -14.702 1.00 0.00 ? 10 SER A H    7  
ATOM 7431  H HA   . SER A 1 10 ? 3.215  12.279  -15.803 1.00 0.00 ? 10 SER A HA   7  
ATOM 7432  H HB2  . SER A 1 10 ? 1.984  11.947  -13.065 1.00 0.00 ? 10 SER A HB2  7  
ATOM 7433  H HB3  . SER A 1 10 ? 2.937  13.349  -13.582 1.00 0.00 ? 10 SER A HB3  7  
ATOM 7434  H HG   . SER A 1 10 ? 0.403  12.461  -14.538 1.00 0.00 ? 10 SER A HG   7  
ATOM 7435  N N    . GLY A 1 11 ? 4.332  9.834   -14.115 1.00 0.00 ? 11 GLY A N    7  
ATOM 7436  C CA   . GLY A 1 11 ? 5.497  9.247   -13.492 1.00 0.00 ? 11 GLY A CA   7  
ATOM 7437  C C    . GLY A 1 11 ? 5.457  9.396   -11.991 1.00 0.00 ? 11 GLY A C    7  
ATOM 7438  O O    . GLY A 1 11 ? 5.905  8.505   -11.263 1.00 0.00 ? 11 GLY A O    7  
ATOM 7439  H H    . GLY A 1 11 ? 3.562  9.270   -14.352 1.00 0.00 ? 11 GLY A H    7  
ATOM 7440  H HA2  . GLY A 1 11 ? 5.547  8.197   -13.742 1.00 0.00 ? 11 GLY A HA2  7  
ATOM 7441  H HA3  . GLY A 1 11 ? 6.386  9.742   -13.878 1.00 0.00 ? 11 GLY A HA3  7  
ATOM 7442  N N    . ASN A 1 12 ? 4.923  10.511  -11.512 1.00 0.00 ? 12 ASN A N    7  
ATOM 7443  C CA   . ASN A 1 12 ? 4.736  10.743  -10.079 1.00 0.00 ? 12 ASN A CA   7  
ATOM 7444  C C    . ASN A 1 12 ? 3.850  9.665   -9.467  1.00 0.00 ? 12 ASN A C    7  
ATOM 7445  O O    . ASN A 1 12 ? 3.917  9.375   -8.282  1.00 0.00 ? 12 ASN A O    7  
ATOM 7446  C CB   . ASN A 1 12 ? 4.118  12.128  -9.834  1.00 0.00 ? 12 ASN A CB   7  
ATOM 7447  C CG   . ASN A 1 12 ? 5.030  13.273  -10.240 1.00 0.00 ? 12 ASN A CG   7  
ATOM 7448  O OD1  . ASN A 1 12 ? 5.834  13.148  -11.164 1.00 0.00 ? 12 ASN A OD1  7  
ATOM 7449  N ND2  . ASN A 1 12 ? 4.922  14.389  -9.545  1.00 0.00 ? 12 ASN A ND2  7  
ATOM 7450  H H    . ASN A 1 12 ? 4.639  11.210  -12.139 1.00 0.00 ? 12 ASN A H    7  
ATOM 7451  H HA   . ASN A 1 12 ? 5.702  10.704  -9.612  1.00 0.00 ? 12 ASN A HA   7  
ATOM 7452  H HB2  . ASN A 1 12 ? 3.197  12.211  -10.400 1.00 0.00 ? 12 ASN A HB2  7  
ATOM 7453  H HB3  . ASN A 1 12 ? 3.896  12.235  -8.778  1.00 0.00 ? 12 ASN A HB3  7  
ATOM 7454  H HD21 . ASN A 1 12 ? 4.266  14.417  -8.817  1.00 0.00 ? 12 ASN A HD21 7  
ATOM 7455  H HD22 . ASN A 1 12 ? 5.499  15.151  -9.788  1.00 0.00 ? 12 ASN A HD22 7  
ATOM 7456  N N    . THR A 1 13 ? 3.009  9.074   -10.317 1.00 0.00 ? 13 THR A N    7  
ATOM 7457  C CA   . THR A 1 13 ? 2.174  7.946   -9.943  1.00 0.00 ? 13 THR A CA   7  
ATOM 7458  C C    . THR A 1 13 ? 3.002  6.831   -9.323  1.00 0.00 ? 13 THR A C    7  
ATOM 7459  O O    . THR A 1 13 ? 2.559  6.132   -8.418  1.00 0.00 ? 13 THR A O    7  
ATOM 7460  C CB   . THR A 1 13 ? 1.452  7.412   -11.190 1.00 0.00 ? 13 THR A CB   7  
ATOM 7461  O OG1  . THR A 1 13 ? 1.713  8.281   -12.303 1.00 0.00 ? 13 THR A OG1  7  
ATOM 7462  C CG2  . THR A 1 13 ? -0.055 7.294   -10.954 1.00 0.00 ? 13 THR A CG2  7  
ATOM 7463  H H    . THR A 1 13 ? 2.945  9.397   -11.224 1.00 0.00 ? 13 THR A H    7  
ATOM 7464  H HA   . THR A 1 13 ? 1.444  8.288   -9.244  1.00 0.00 ? 13 THR A HA   7  
ATOM 7465  H HB   . THR A 1 13 ? 1.843  6.428   -11.416 1.00 0.00 ? 13 THR A HB   7  
ATOM 7466  H HG1  . THR A 1 13 ? 0.896  8.715   -12.566 1.00 0.00 ? 13 THR A HG1  7  
ATOM 7467  H HG21 . THR A 1 13 ? -0.527 6.909   -11.843 1.00 0.00 ? 13 THR A HG21 7  
ATOM 7468  H HG22 . THR A 1 13 ? -0.456 8.267   -10.721 1.00 0.00 ? 13 THR A HG22 7  
ATOM 7469  H HG23 . THR A 1 13 ? -0.239 6.611   -10.130 1.00 0.00 ? 13 THR A HG23 7  
ATOM 7470  N N    . TYR A 1 14 ? 4.216  6.655   -9.824  1.00 0.00 ? 14 TYR A N    7  
ATOM 7471  C CA   . TYR A 1 14 ? 5.118  5.652   -9.303  1.00 0.00 ? 14 TYR A CA   7  
ATOM 7472  C C    . TYR A 1 14 ? 5.485  5.971   -7.858  1.00 0.00 ? 14 TYR A C    7  
ATOM 7473  O O    . TYR A 1 14 ? 5.402  5.106   -6.987  1.00 0.00 ? 14 TYR A O    7  
ATOM 7474  C CB   . TYR A 1 14 ? 6.376  5.582   -10.174 1.00 0.00 ? 14 TYR A CB   7  
ATOM 7475  C CG   . TYR A 1 14 ? 7.365  4.524   -9.751  1.00 0.00 ? 14 TYR A CG   7  
ATOM 7476  C CD1  . TYR A 1 14 ? 7.090  3.184   -9.981  1.00 0.00 ? 14 TYR A CD1  7  
ATOM 7477  C CD2  . TYR A 1 14 ? 8.555  4.861   -9.135  1.00 0.00 ? 14 TYR A CD2  7  
ATOM 7478  C CE1  . TYR A 1 14 ? 7.984  2.205   -9.609  1.00 0.00 ? 14 TYR A CE1  7  
ATOM 7479  C CE2  . TYR A 1 14 ? 9.455  3.896   -8.759  1.00 0.00 ? 14 TYR A CE2  7  
ATOM 7480  C CZ   . TYR A 1 14 ? 9.162  2.567   -9.002  1.00 0.00 ? 14 TYR A CZ   7  
ATOM 7481  O OH   . TYR A 1 14 ? 10.057 1.594   -8.605  1.00 0.00 ? 14 TYR A OH   7  
ATOM 7482  H H    . TYR A 1 14 ? 4.519  7.215   -10.557 1.00 0.00 ? 14 TYR A H    7  
ATOM 7483  H HA   . TYR A 1 14 ? 4.619  4.697   -9.339  1.00 0.00 ? 14 TYR A HA   7  
ATOM 7484  H HB2  . TYR A 1 14 ? 6.101  5.386   -11.194 1.00 0.00 ? 14 TYR A HB2  7  
ATOM 7485  H HB3  . TYR A 1 14 ? 6.882  6.542   -10.135 1.00 0.00 ? 14 TYR A HB3  7  
ATOM 7486  H HD1  . TYR A 1 14 ? 6.165  2.907   -10.462 1.00 0.00 ? 14 TYR A HD1  7  
ATOM 7487  H HD2  . TYR A 1 14 ? 8.762  5.906   -8.952  1.00 0.00 ? 14 TYR A HD2  7  
ATOM 7488  H HE1  . TYR A 1 14 ? 7.760  1.156   -9.784  1.00 0.00 ? 14 TYR A HE1  7  
ATOM 7489  H HE2  . TYR A 1 14 ? 10.378 4.175   -8.278  1.00 0.00 ? 14 TYR A HE2  7  
ATOM 7490  H HH   . TYR A 1 14 ? 10.352 1.777   -7.707  1.00 0.00 ? 14 TYR A HH   7  
ATOM 7491  N N    . ALA A 1 15 ? 5.896  7.205   -7.626  1.00 0.00 ? 15 ALA A N    7  
ATOM 7492  C CA   . ALA A 1 15 ? 6.215  7.691   -6.304  1.00 0.00 ? 15 ALA A CA   7  
ATOM 7493  C C    . ALA A 1 15 ? 5.038  7.554   -5.349  1.00 0.00 ? 15 ALA A C    7  
ATOM 7494  O O    . ALA A 1 15 ? 5.212  7.323   -4.153  1.00 0.00 ? 15 ALA A O    7  
ATOM 7495  C CB   . ALA A 1 15 ? 6.676  9.131   -6.388  1.00 0.00 ? 15 ALA A CB   7  
ATOM 7496  H H    . ALA A 1 15 ? 6.018  7.811   -8.384  1.00 0.00 ? 15 ALA A H    7  
ATOM 7497  H HA   . ALA A 1 15 ? 7.045  7.102   -5.929  1.00 0.00 ? 15 ALA A HA   7  
ATOM 7498  H HB1  . ALA A 1 15 ? 6.961  9.473   -5.419  1.00 0.00 ? 15 ALA A HB1  7  
ATOM 7499  H HB2  . ALA A 1 15 ? 5.850  9.744   -6.766  1.00 0.00 ? 15 ALA A HB2  7  
ATOM 7500  H HB3  . ALA A 1 15 ? 7.513  9.216   -7.072  1.00 0.00 ? 15 ALA A HB3  7  
ATOM 7501  N N    . LEU A 1 16 ? 3.827  7.695   -5.881  1.00 0.00 ? 16 LEU A N    7  
ATOM 7502  C CA   . LEU A 1 16 ? 2.622  7.551   -5.078  1.00 0.00 ? 16 LEU A CA   7  
ATOM 7503  C C    . LEU A 1 16 ? 2.397  6.086   -4.750  1.00 0.00 ? 16 LEU A C    7  
ATOM 7504  O O    . LEU A 1 16 ? 2.040  5.736   -3.620  1.00 0.00 ? 16 LEU A O    7  
ATOM 7505  C CB   . LEU A 1 16 ? 1.414  8.127   -5.824  1.00 0.00 ? 16 LEU A CB   7  
ATOM 7506  C CG   . LEU A 1 16 ? 0.090  8.009   -5.061  1.00 0.00 ? 16 LEU A CG   7  
ATOM 7507  C CD1  . LEU A 1 16 ? 0.129  8.829   -3.781  1.00 0.00 ? 16 LEU A CD1  7  
ATOM 7508  C CD2  . LEU A 1 16 ? -1.063 8.457   -5.955  1.00 0.00 ? 16 LEU A CD2  7  
ATOM 7509  H H    . LEU A 1 16 ? 3.749  7.902   -6.822  1.00 0.00 ? 16 LEU A H    7  
ATOM 7510  H HA   . LEU A 1 16 ? 2.787  8.100   -4.167  1.00 0.00 ? 16 LEU A HA   7  
ATOM 7511  H HB2  . LEU A 1 16 ? 1.613  9.162   -6.026  1.00 0.00 ? 16 LEU A HB2  7  
ATOM 7512  H HB3  . LEU A 1 16 ? 1.304  7.595   -6.756  1.00 0.00 ? 16 LEU A HB3  7  
ATOM 7513  H HG   . LEU A 1 16 ? -0.069 6.976   -4.787  1.00 0.00 ? 16 LEU A HG   7  
ATOM 7514  H HD11 . LEU A 1 16 ? 0.910  8.437   -3.140  1.00 0.00 ? 16 LEU A HD11 7  
ATOM 7515  H HD12 . LEU A 1 16 ? -0.819 8.763   -3.277  1.00 0.00 ? 16 LEU A HD12 7  
ATOM 7516  H HD13 . LEU A 1 16 ? 0.343  9.853   -4.033  1.00 0.00 ? 16 LEU A HD13 7  
ATOM 7517  H HD21 . LEU A 1 16 ? -1.981 8.435   -5.377  1.00 0.00 ? 16 LEU A HD21 7  
ATOM 7518  H HD22 . LEU A 1 16 ? -1.139 7.780   -6.791  1.00 0.00 ? 16 LEU A HD22 7  
ATOM 7519  H HD23 . LEU A 1 16 ? -0.878 9.453   -6.300  1.00 0.00 ? 16 LEU A HD23 7  
ATOM 7520  N N    . TYR A 1 17 ? 2.630  5.234   -5.737  1.00 0.00 ? 17 TYR A N    7  
ATOM 7521  C CA   . TYR A 1 17 ? 2.492  3.790   -5.577  1.00 0.00 ? 17 TYR A CA   7  
ATOM 7522  C C    . TYR A 1 17 ? 3.417  3.274   -4.481  1.00 0.00 ? 17 TYR A C    7  
ATOM 7523  O O    . TYR A 1 17 ? 2.972  2.595   -3.556  1.00 0.00 ? 17 TYR A O    7  
ATOM 7524  C CB   . TYR A 1 17 ? 2.796  3.093   -6.901  1.00 0.00 ? 17 TYR A CB   7  
ATOM 7525  C CG   . TYR A 1 17 ? 2.685  1.590   -6.845  1.00 0.00 ? 17 TYR A CG   7  
ATOM 7526  C CD1  . TYR A 1 17 ? 1.457  0.973   -6.676  1.00 0.00 ? 17 TYR A CD1  7  
ATOM 7527  C CD2  . TYR A 1 17 ? 3.818  0.784   -6.973  1.00 0.00 ? 17 TYR A CD2  7  
ATOM 7528  C CE1  . TYR A 1 17 ? 1.355  -0.405  -6.635  1.00 0.00 ? 17 TYR A CE1  7  
ATOM 7529  C CE2  . TYR A 1 17 ? 3.717  -0.590  -6.929  1.00 0.00 ? 17 TYR A CE2  7  
ATOM 7530  C CZ   . TYR A 1 17 ? 2.476  -1.180  -6.757  1.00 0.00 ? 17 TYR A CZ   7  
ATOM 7531  O OH   . TYR A 1 17 ? 2.352  -2.542  -6.727  1.00 0.00 ? 17 TYR A OH   7  
ATOM 7532  H H    . TYR A 1 17 ? 2.915  5.579   -6.613  1.00 0.00 ? 17 TYR A H    7  
ATOM 7533  H HA   . TYR A 1 17 ? 1.479  3.605   -5.307  1.00 0.00 ? 17 TYR A HA   7  
ATOM 7534  H HB2  . TYR A 1 17 ? 2.108  3.442   -7.642  1.00 0.00 ? 17 TYR A HB2  7  
ATOM 7535  H HB3  . TYR A 1 17 ? 3.807  3.342   -7.214  1.00 0.00 ? 17 TYR A HB3  7  
ATOM 7536  H HD1  . TYR A 1 17 ? 0.570  1.576   -6.577  1.00 0.00 ? 17 TYR A HD1  7  
ATOM 7537  H HD2  . TYR A 1 17 ? 4.777  1.241   -7.101  1.00 0.00 ? 17 TYR A HD2  7  
ATOM 7538  H HE1  . TYR A 1 17 ? 0.371  -0.863  -6.501  1.00 0.00 ? 17 TYR A HE1  7  
ATOM 7539  H HE2  . TYR A 1 17 ? 4.600  -1.200  -7.031  1.00 0.00 ? 17 TYR A HE2  7  
ATOM 7540  H HH   . TYR A 1 17 ? 3.107  -2.930  -6.259  1.00 0.00 ? 17 TYR A HH   7  
ATOM 7541  N N    . VAL A 1 18 ? 4.700  3.606   -4.606  1.00 0.00 ? 18 VAL A N    7  
ATOM 7542  C CA   . VAL A 1 18 ? 5.708  3.162   -3.631  1.00 0.00 ? 18 VAL A CA   7  
ATOM 7543  C C    . VAL A 1 18 ? 5.428  3.716   -2.229  1.00 0.00 ? 18 VAL A C    7  
ATOM 7544  O O    . VAL A 1 18 ? 5.627  3.011   -1.239  1.00 0.00 ? 18 VAL A O    7  
ATOM 7545  C CB   . VAL A 1 18 ? 7.152  3.525   -4.075  1.00 0.00 ? 18 VAL A CB   7  
ATOM 7546  C CG1  . VAL A 1 18 ? 7.471  2.860   -5.409  1.00 0.00 ? 18 VAL A CG1  7  
ATOM 7547  C CG2  . VAL A 1 18 ? 7.354  5.027   -4.151  1.00 0.00 ? 18 VAL A CG2  7  
ATOM 7548  H H    . VAL A 1 18 ? 4.981  4.146   -5.382  1.00 0.00 ? 18 VAL A H    7  
ATOM 7549  H HA   . VAL A 1 18 ? 5.640  2.085   -3.571  1.00 0.00 ? 18 VAL A HA   7  
ATOM 7550  H HB   . VAL A 1 18 ? 7.844  3.124   -3.342  1.00 0.00 ? 18 VAL A HB   7  
ATOM 7551  H HG11 . VAL A 1 18 ? 8.448  3.175   -5.737  1.00 0.00 ? 18 VAL A HG11 7  
ATOM 7552  H HG12 . VAL A 1 18 ? 6.729  3.159   -6.138  1.00 0.00 ? 18 VAL A HG12 7  
ATOM 7553  H HG13 . VAL A 1 18 ? 7.458  1.785   -5.291  1.00 0.00 ? 18 VAL A HG13 7  
ATOM 7554  H HG21 . VAL A 1 18 ? 8.383  5.238   -4.426  1.00 0.00 ? 18 VAL A HG21 7  
ATOM 7555  H HG22 . VAL A 1 18 ? 7.150  5.468   -3.190  1.00 0.00 ? 18 VAL A HG22 7  
ATOM 7556  H HG23 . VAL A 1 18 ? 6.696  5.449   -4.888  1.00 0.00 ? 18 VAL A HG23 7  
ATOM 7557  N N    . ARG A 1 19 ? 4.963  4.965   -2.160  1.00 0.00 ? 19 ARG A N    7  
ATOM 7558  C CA   . ARG A 1 19 ? 4.604  5.597   -0.894  1.00 0.00 ? 19 ARG A CA   7  
ATOM 7559  C C    . ARG A 1 19 ? 3.633  4.740   -0.087  1.00 0.00 ? 19 ARG A C    7  
ATOM 7560  O O    . ARG A 1 19 ? 3.874  4.435   1.090   1.00 0.00 ? 19 ARG A O    7  
ATOM 7561  C CB   . ARG A 1 19 ? 3.968  6.980   -1.149  1.00 0.00 ? 19 ARG A CB   7  
ATOM 7562  C CG   . ARG A 1 19 ? 3.514  7.667   0.128   1.00 0.00 ? 19 ARG A CG   7  
ATOM 7563  C CD   . ARG A 1 19 ? 2.711  8.908   -0.179  1.00 0.00 ? 19 ARG A CD   7  
ATOM 7564  N NE   . ARG A 1 19 ? 3.482  9.947   -0.860  1.00 0.00 ? 19 ARG A NE   7  
ATOM 7565  C CZ   . ARG A 1 19 ? 2.992  11.135  -1.222  1.00 0.00 ? 19 ARG A CZ   7  
ATOM 7566  N NH1  . ARG A 1 19 ? 1.714  11.402  -1.009  1.00 0.00 ? 19 ARG A NH1  7  
ATOM 7567  N NH2  . ARG A 1 19 ? 3.774  12.020  -1.815  1.00 0.00 ? 19 ARG A NH2  7  
ATOM 7568  H H    . ARG A 1 19 ? 4.913  5.505   -2.984  1.00 0.00 ? 19 ARG A H    7  
ATOM 7569  H HA   . ARG A 1 19 ? 5.507  5.722   -0.336  1.00 0.00 ? 19 ARG A HA   7  
ATOM 7570  H HB2  . ARG A 1 19 ? 4.693  7.611   -1.637  1.00 0.00 ? 19 ARG A HB2  7  
ATOM 7571  H HB3  . ARG A 1 19 ? 3.105  6.861   -1.796  1.00 0.00 ? 19 ARG A HB3  7  
ATOM 7572  H HG2  . ARG A 1 19 ? 2.907  6.977   0.685   1.00 0.00 ? 19 ARG A HG2  7  
ATOM 7573  H HG3  . ARG A 1 19 ? 4.392  7.935   0.700   1.00 0.00 ? 19 ARG A HG3  7  
ATOM 7574  H HD2  . ARG A 1 19 ? 1.872  8.649   -0.812  1.00 0.00 ? 19 ARG A HD2  7  
ATOM 7575  H HD3  . ARG A 1 19 ? 2.338  9.317   0.750   1.00 0.00 ? 19 ARG A HD3  7  
ATOM 7576  H HE   . ARG A 1 19 ? 4.432  9.762   -1.035  1.00 0.00 ? 19 ARG A HE   7  
ATOM 7577  H HH11 . ARG A 1 19 ? 1.107  10.726  -0.578  1.00 0.00 ? 19 ARG A HH11 7  
ATOM 7578  H HH12 . ARG A 1 19 ? 1.340  12.298  -1.280  1.00 0.00 ? 19 ARG A HH12 7  
ATOM 7579  H HH21 . ARG A 1 19 ? 4.742  11.823  -1.995  1.00 0.00 ? 19 ARG A HH21 7  
ATOM 7580  H HH22 . ARG A 1 19 ? 3.402  12.914  -2.111  1.00 0.00 ? 19 ARG A HH22 7  
ATOM 7581  N N    . ASP A 1 20 ? 2.543  4.323   -0.720  1.00 0.00 ? 20 ASP A N    7  
ATOM 7582  C CA   . ASP A 1 20 ? 1.485  3.594   -0.029  1.00 0.00 ? 20 ASP A CA   7  
ATOM 7583  C C    . ASP A 1 20 ? 1.839  2.127   0.166   1.00 0.00 ? 20 ASP A C    7  
ATOM 7584  O O    . ASP A 1 20 ? 1.357  1.505   1.127   1.00 0.00 ? 20 ASP A O    7  
ATOM 7585  C CB   . ASP A 1 20 ? 0.167  3.703   -0.813  1.00 0.00 ? 20 ASP A CB   7  
ATOM 7586  C CG   . ASP A 1 20 ? -0.460 5.081   -0.715  1.00 0.00 ? 20 ASP A CG   7  
ATOM 7587  O OD1  . ASP A 1 20 ? -0.964 5.433   0.378   1.00 0.00 ? 20 ASP A OD1  7  
ATOM 7588  O OD2  . ASP A 1 20 ? -0.455 5.817   -1.716  1.00 0.00 ? 20 ASP A OD2  7  
ATOM 7589  H H    . ASP A 1 20 ? 2.454  4.521   -1.672  1.00 0.00 ? 20 ASP A H    7  
ATOM 7590  H HA   . ASP A 1 20 ? 1.340  4.055   0.929   1.00 0.00 ? 20 ASP A HA   7  
ATOM 7591  H HB2  . ASP A 1 20 ? 0.352  3.477   -1.840  1.00 0.00 ? 20 ASP A HB2  7  
ATOM 7592  H HB3  . ASP A 1 20 ? -0.544 2.989   -0.419  1.00 0.00 ? 20 ASP A HB3  7  
ATOM 7593  N N    . THR A 1 21 ? 2.671  1.578   -0.693  1.00 0.00 ? 21 THR A N    7  
ATOM 7594  C CA   . THR A 1 21 ? 3.011  0.170   -0.628  1.00 0.00 ? 21 THR A CA   7  
ATOM 7595  C C    . THR A 1 21 ? 4.097  -0.101  0.388   1.00 0.00 ? 21 THR A C    7  
ATOM 7596  O O    . THR A 1 21 ? 4.086  -1.138  1.059   1.00 0.00 ? 21 THR A O    7  
ATOM 7597  C CB   . THR A 1 21 ? 3.449  -0.369  -2.008  1.00 0.00 ? 21 THR A CB   7  
ATOM 7598  O OG1  . THR A 1 21 ? 4.340  0.546   -2.627  1.00 0.00 ? 21 THR A OG1  7  
ATOM 7599  C CG2  . THR A 1 21 ? 2.249  -0.627  -2.896  1.00 0.00 ? 21 THR A CG2  7  
ATOM 7600  H H    . THR A 1 21 ? 3.107  2.145   -1.366  1.00 0.00 ? 21 THR A H    7  
ATOM 7601  H HA   . THR A 1 21 ? 2.121  -0.355  -0.337  1.00 0.00 ? 21 THR A HA   7  
ATOM 7602  H HB   . THR A 1 21 ? 3.961  -1.310  -1.830  1.00 0.00 ? 21 THR A HB   7  
ATOM 7603  H HG1  . THR A 1 21 ? 3.820  1.196   -3.136  1.00 0.00 ? 21 THR A HG1  7  
ATOM 7604  H HG21 . THR A 1 21 ? 1.570  -1.306  -2.418  1.00 0.00 ? 21 THR A HG21 7  
ATOM 7605  H HG22 . THR A 1 21 ? 2.579  -1.056  -3.836  1.00 0.00 ? 21 THR A HG22 7  
ATOM 7606  H HG23 . THR A 1 21 ? 1.745  0.310   -3.093  1.00 0.00 ? 21 THR A HG23 7  
ATOM 7607  N N    . LEU A 1 22 ? 5.047  0.819   0.509   1.00 0.00 ? 22 LEU A N    7  
ATOM 7608  C CA   . LEU A 1 22 ? 6.143  0.640   1.447   1.00 0.00 ? 22 LEU A CA   7  
ATOM 7609  C C    . LEU A 1 22 ? 5.773  1.045   2.864   1.00 0.00 ? 22 LEU A C    7  
ATOM 7610  O O    . LEU A 1 22 ? 5.663  2.226   3.209   1.00 0.00 ? 22 LEU A O    7  
ATOM 7611  C CB   . LEU A 1 22 ? 7.380  1.399   0.978   1.00 0.00 ? 22 LEU A CB   7  
ATOM 7612  C CG   . LEU A 1 22 ? 8.150  0.724   -0.172  1.00 0.00 ? 22 LEU A CG   7  
ATOM 7613  C CD1  . LEU A 1 22 ? 9.369  1.539   -0.563  1.00 0.00 ? 22 LEU A CD1  7  
ATOM 7614  C CD2  . LEU A 1 22 ? 8.572  -0.692  0.251   1.00 0.00 ? 22 LEU A CD2  7  
ATOM 7615  H H    . LEU A 1 22 ? 5.000  1.630   -0.035  1.00 0.00 ? 22 LEU A H    7  
ATOM 7616  H HA   . LEU A 1 22 ? 6.383  -0.410  1.442   1.00 0.00 ? 22 LEU A HA   7  
ATOM 7617  H HB2  . LEU A 1 22 ? 7.068  2.377   0.639   1.00 0.00 ? 22 LEU A HB2  7  
ATOM 7618  H HB3  . LEU A 1 22 ? 8.059  1.525   1.805   1.00 0.00 ? 22 LEU A HB3  7  
ATOM 7619  H HG   . LEU A 1 22 ? 7.502  0.638   -1.029  1.00 0.00 ? 22 LEU A HG   7  
ATOM 7620  H HD11 . LEU A 1 22 ? 9.901  1.007   -1.334  1.00 0.00 ? 22 LEU A HD11 7  
ATOM 7621  H HD12 . LEU A 1 22 ? 9.999  1.646   0.301   1.00 0.00 ? 22 LEU A HD12 7  
ATOM 7622  H HD13 . LEU A 1 22 ? 9.049  2.504   -0.914  1.00 0.00 ? 22 LEU A HD13 7  
ATOM 7623  H HD21 . LEU A 1 22 ? 7.689  -1.276  0.466   1.00 0.00 ? 22 LEU A HD21 7  
ATOM 7624  H HD22 . LEU A 1 22 ? 9.186  -0.628  1.120   1.00 0.00 ? 22 LEU A HD22 7  
ATOM 7625  H HD23 . LEU A 1 22 ? 9.118  -1.137  -0.562  1.00 0.00 ? 22 LEU A HD23 7  
ATOM 7626  N N    . GLN A 1 23 ? 5.534  0.021   3.678   1.00 0.00 ? 23 GLN A N    7  
ATOM 7627  C CA   . GLN A 1 23 ? 5.331  0.198   5.101   1.00 0.00 ? 23 GLN A CA   7  
ATOM 7628  C C    . GLN A 1 23 ? 6.670  0.114   5.849   1.00 0.00 ? 23 GLN A C    7  
ATOM 7629  O O    . GLN A 1 23 ? 7.628  -0.483  5.351   1.00 0.00 ? 23 GLN A O    7  
ATOM 7630  C CB   . GLN A 1 23 ? 4.365  -0.866  5.634   1.00 0.00 ? 23 GLN A CB   7  
ATOM 7631  C CG   . GLN A 1 23 ? 2.933  -0.395  5.800   1.00 0.00 ? 23 GLN A CG   7  
ATOM 7632  C CD   . GLN A 1 23 ? 2.130  -0.354  4.504   1.00 0.00 ? 23 GLN A CD   7  
ATOM 7633  O OE1  . GLN A 1 23 ? 0.910  -0.547  4.524   1.00 0.00 ? 23 GLN A OE1  7  
ATOM 7634  N NE2  . GLN A 1 23 ? 2.780  -0.093  3.399   1.00 0.00 ? 23 GLN A NE2  7  
ATOM 7635  H H    . GLN A 1 23 ? 5.511  -0.889  3.293   1.00 0.00 ? 23 GLN A H    7  
ATOM 7636  H HA   . GLN A 1 23 ? 4.907  1.171   5.274   1.00 0.00 ? 23 GLN A HA   7  
ATOM 7637  H HB2  . GLN A 1 23 ? 4.370  -1.705  4.947   1.00 0.00 ? 23 GLN A HB2  7  
ATOM 7638  H HB3  . GLN A 1 23 ? 4.716  -1.209  6.596   1.00 0.00 ? 23 GLN A HB3  7  
ATOM 7639  H HG2  . GLN A 1 23 ? 2.430  -1.077  6.498   1.00 0.00 ? 23 GLN A HG2  7  
ATOM 7640  H HG3  . GLN A 1 23 ? 2.950  0.599   6.227   1.00 0.00 ? 23 GLN A HG3  7  
ATOM 7641  H HE21 . GLN A 1 23 ? 3.753  0.065   3.467   1.00 0.00 ? 23 GLN A HE21 7  
ATOM 7642  H HE22 . GLN A 1 23 ? 2.272  -0.070  2.559   1.00 0.00 ? 23 GLN A HE22 7  
ATOM 7643  N N    . PRO A 1 24 ? 6.737  0.711   7.052   1.00 0.00 ? 24 PRO A N    7  
ATOM 7644  C CA   . PRO A 1 24 ? 7.924  0.613   7.905   1.00 0.00 ? 24 PRO A CA   7  
ATOM 7645  C C    . PRO A 1 24 ? 8.346  -0.836  8.128   1.00 0.00 ? 24 PRO A C    7  
ATOM 7646  O O    . PRO A 1 24 ? 7.559  -1.660  8.610   1.00 0.00 ? 24 PRO A O    7  
ATOM 7647  C CB   . PRO A 1 24 ? 7.464  1.246   9.212   1.00 0.00 ? 24 PRO A CB   7  
ATOM 7648  C CG   . PRO A 1 24 ? 6.347  2.160   8.839   1.00 0.00 ? 24 PRO A CG   7  
ATOM 7649  C CD   . PRO A 1 24 ? 5.669  1.523   7.653   1.00 0.00 ? 24 PRO A CD   7  
ATOM 7650  H HA   . PRO A 1 24 ? 8.758  1.156   7.499   1.00 0.00 ? 24 PRO A HA   7  
ATOM 7651  H HB2  . PRO A 1 24 ? 7.134  0.462   9.897   1.00 0.00 ? 24 PRO A HB2  7  
ATOM 7652  H HB3  . PRO A 1 24 ? 8.280  1.787   9.658   1.00 0.00 ? 24 PRO A HB3  7  
ATOM 7653  H HG2  . PRO A 1 24 ? 5.645  2.248   9.660   1.00 0.00 ? 24 PRO A HG2  7  
ATOM 7654  H HG3  . PRO A 1 24 ? 6.752  3.130   8.567   1.00 0.00 ? 24 PRO A HG3  7  
ATOM 7655  H HD2  . PRO A 1 24 ? 4.851  0.899   7.977   1.00 0.00 ? 24 PRO A HD2  7  
ATOM 7656  H HD3  . PRO A 1 24 ? 5.321  2.286   6.953   1.00 0.00 ? 24 PRO A HD3  7  
ATOM 7657  N N    . GLY A 1 25 ? 9.578  -1.150  7.766   1.00 0.00 ? 25 GLY A N    7  
ATOM 7658  C CA   . GLY A 1 25 ? 10.072 -2.499  7.930   1.00 0.00 ? 25 GLY A CA   7  
ATOM 7659  C C    . GLY A 1 25 ? 10.138 -3.247  6.613   1.00 0.00 ? 25 GLY A C    7  
ATOM 7660  O O    . GLY A 1 25 ? 10.692 -4.354  6.537   1.00 0.00 ? 25 GLY A O    7  
ATOM 7661  H H    . GLY A 1 25 ? 10.162 -0.459  7.378   1.00 0.00 ? 25 GLY A H    7  
ATOM 7662  H HA2  . GLY A 1 25 ? 11.068 -2.453  8.363   1.00 0.00 ? 25 GLY A HA2  7  
ATOM 7663  H HA3  . GLY A 1 25 ? 9.421  -3.030  8.606   1.00 0.00 ? 25 GLY A HA3  7  
ATOM 7664  N N    . MET A 1 26 ? 9.545  -2.679  5.574   1.00 0.00 ? 26 MET A N    7  
ATOM 7665  C CA   . MET A 1 26 ? 9.568  -3.302  4.258   1.00 0.00 ? 26 MET A CA   7  
ATOM 7666  C C    . MET A 1 26 ? 10.858 -2.952  3.514   1.00 0.00 ? 26 MET A C    7  
ATOM 7667  O O    . MET A 1 26 ? 11.341 -1.823  3.570   1.00 0.00 ? 26 MET A O    7  
ATOM 7668  C CB   . MET A 1 26 ? 8.333  -2.891  3.457   1.00 0.00 ? 26 MET A CB   7  
ATOM 7669  C CG   . MET A 1 26 ? 7.046  -3.439  4.049   1.00 0.00 ? 26 MET A CG   7  
ATOM 7670  S SD   . MET A 1 26 ? 5.568  -2.938  3.157   1.00 0.00 ? 26 MET A SD   7  
ATOM 7671  C CE   . MET A 1 26 ? 5.883  -3.606  1.542   1.00 0.00 ? 26 MET A CE   7  
ATOM 7672  H H    . MET A 1 26 ? 9.065  -1.841  5.695   1.00 0.00 ? 26 MET A H    7  
ATOM 7673  H HA   . MET A 1 26 ? 9.546  -4.368  4.403   1.00 0.00 ? 26 MET A HA   7  
ATOM 7674  H HB2  . MET A 1 26 ? 8.271  -1.809  3.440   1.00 0.00 ? 26 MET A HB2  7  
ATOM 7675  H HB3  . MET A 1 26 ? 8.430  -3.264  2.444   1.00 0.00 ? 26 MET A HB3  7  
ATOM 7676  H HG2  . MET A 1 26 ? 7.097  -4.521  4.042   1.00 0.00 ? 26 MET A HG2  7  
ATOM 7677  H HG3  . MET A 1 26 ? 6.962  -3.108  5.078   1.00 0.00 ? 26 MET A HG3  7  
ATOM 7678  H HE1  . MET A 1 26 ? 5.067  -3.355  0.890   1.00 0.00 ? 26 MET A HE1  7  
ATOM 7679  H HE2  . MET A 1 26 ? 5.967  -4.683  1.615   1.00 0.00 ? 26 MET A HE2  7  
ATOM 7680  H HE3  . MET A 1 26 ? 6.800  -3.192  1.148   1.00 0.00 ? 26 MET A HE3  7  
ATOM 7681  N N    . ARG A 1 27 ? 11.420 -3.943  2.843   1.00 0.00 ? 27 ARG A N    7  
ATOM 7682  C CA   . ARG A 1 27 ? 12.709 -3.781  2.167   1.00 0.00 ? 27 ARG A CA   7  
ATOM 7683  C C    . ARG A 1 27 ? 12.554 -3.126  0.801   1.00 0.00 ? 27 ARG A C    7  
ATOM 7684  O O    . ARG A 1 27 ? 11.559 -3.292  0.107   1.00 0.00 ? 27 ARG A O    7  
ATOM 7685  C CB   . ARG A 1 27 ? 13.451 -5.115  2.040   1.00 0.00 ? 27 ARG A CB   7  
ATOM 7686  C CG   . ARG A 1 27 ? 13.712 -5.772  3.388   1.00 0.00 ? 27 ARG A CG   7  
ATOM 7687  C CD   . ARG A 1 27 ? 14.867 -6.762  3.343   1.00 0.00 ? 27 ARG A CD   7  
ATOM 7688  N NE   . ARG A 1 27 ? 14.761 -7.743  2.267   1.00 0.00 ? 27 ARG A NE   7  
ATOM 7689  C CZ   . ARG A 1 27 ? 15.221 -8.992  2.350   1.00 0.00 ? 27 ARG A CZ   7  
ATOM 7690  N NH1  . ARG A 1 27 ? 15.691 -9.446  3.509   1.00 0.00 ? 27 ARG A NH1  7  
ATOM 7691  N NH2  . ARG A 1 27 ? 15.217 -9.805  1.286   1.00 0.00 ? 27 ARG A NH2  7  
ATOM 7692  H H    . ARG A 1 27 ? 10.952 -4.805  2.817   1.00 0.00 ? 27 ARG A H    7  
ATOM 7693  H HA   . ARG A 1 27 ? 13.302 -3.131  2.800   1.00 0.00 ? 27 ARG A HA   7  
ATOM 7694  H HB2  . ARG A 1 27 ? 12.868 -5.788  1.444   1.00 0.00 ? 27 ARG A HB2  7  
ATOM 7695  H HB3  . ARG A 1 27 ? 14.403 -4.941  1.560   1.00 0.00 ? 27 ARG A HB3  7  
ATOM 7696  H HG2  . ARG A 1 27 ? 13.944 -5.004  4.108   1.00 0.00 ? 27 ARG A HG2  7  
ATOM 7697  H HG3  . ARG A 1 27 ? 12.821 -6.295  3.681   1.00 0.00 ? 27 ARG A HG3  7  
ATOM 7698  H HD2  . ARG A 1 27 ? 15.785 -6.213  3.214   1.00 0.00 ? 27 ARG A HD2  7  
ATOM 7699  H HD3  . ARG A 1 27 ? 14.893 -7.291  4.294   1.00 0.00 ? 27 ARG A HD3  7  
ATOM 7700  H HE   . ARG A 1 27 ? 14.373 -7.439  1.421   1.00 0.00 ? 27 ARG A HE   7  
ATOM 7701  H HH11 . ARG A 1 27 ? 15.688 -8.858  4.320   1.00 0.00 ? 27 ARG A HH11 7  
ATOM 7702  H HH12 . ARG A 1 27 ? 16.055 -10.386 3.580   1.00 0.00 ? 27 ARG A HH12 7  
ATOM 7703  H HH21 . ARG A 1 27 ? 14.871 -9.475  0.403   1.00 0.00 ? 27 ARG A HH21 7  
ATOM 7704  H HH22 . ARG A 1 27 ? 15.550 -10.749 1.368   1.00 0.00 ? 27 ARG A HH22 7  
ATOM 7705  N N    . VAL A 1 28 ? 13.586 -2.388  0.431   1.00 0.00 ? 28 VAL A N    7  
ATOM 7706  C CA   . VAL A 1 28 ? 13.552 -1.551  -0.749  1.00 0.00 ? 28 VAL A CA   7  
ATOM 7707  C C    . VAL A 1 28 ? 14.794 -1.775  -1.619  1.00 0.00 ? 28 VAL A C    7  
ATOM 7708  O O    . VAL A 1 28 ? 15.830 -2.238  -1.151  1.00 0.00 ? 28 VAL A O    7  
ATOM 7709  C CB   . VAL A 1 28 ? 13.487 -0.065  -0.350  1.00 0.00 ? 28 VAL A CB   7  
ATOM 7710  C CG1  . VAL A 1 28 ? 12.218 0.224   0.440   1.00 0.00 ? 28 VAL A CG1  7  
ATOM 7711  C CG2  . VAL A 1 28 ? 14.712 0.309   0.457   1.00 0.00 ? 28 VAL A CG2  7  
ATOM 7712  H H    . VAL A 1 28 ? 14.391 -2.406  0.976   1.00 0.00 ? 28 VAL A H    7  
ATOM 7713  H HA   . VAL A 1 28 ? 12.663 -1.798  -1.326  1.00 0.00 ? 28 VAL A HA   7  
ATOM 7714  H HB   . VAL A 1 28 ? 13.476 0.535   -1.248  1.00 0.00 ? 28 VAL A HB   7  
ATOM 7715  H HG11 . VAL A 1 28 ? 12.198 1.265   0.722   1.00 0.00 ? 28 VAL A HG11 7  
ATOM 7716  H HG12 . VAL A 1 28 ? 12.175 -0.394  1.325   1.00 0.00 ? 28 VAL A HG12 7  
ATOM 7717  H HG13 . VAL A 1 28 ? 11.357 0.013   -0.177  1.00 0.00 ? 28 VAL A HG13 7  
ATOM 7718  H HG21 . VAL A 1 28 ? 15.599 0.165   -0.155  1.00 0.00 ? 28 VAL A HG21 7  
ATOM 7719  H HG22 . VAL A 1 28 ? 14.779 -0.330  1.339   1.00 0.00 ? 28 VAL A HG22 7  
ATOM 7720  H HG23 . VAL A 1 28 ? 14.648 1.332   0.766   1.00 0.00 ? 28 VAL A HG23 7  
ATOM 7721  N N    . ARG A 1 29 ? 14.656 -1.422  -2.881  1.00 0.00 ? 29 ARG A N    7  
ATOM 7722  C CA   . ARG A 1 29 ? 15.773 -1.465  -3.823  1.00 0.00 ? 29 ARG A CA   7  
ATOM 7723  C C    . ARG A 1 29 ? 15.959 -0.091  -4.458  1.00 0.00 ? 29 ARG A C    7  
ATOM 7724  O O    . ARG A 1 29 ? 14.977 0.564   -4.843  1.00 0.00 ? 29 ARG A O    7  
ATOM 7725  C CB   . ARG A 1 29 ? 15.515 -2.517  -4.897  1.00 0.00 ? 29 ARG A CB   7  
ATOM 7726  C CG   . ARG A 1 29 ? 16.610 -2.593  -5.943  1.00 0.00 ? 29 ARG A CG   7  
ATOM 7727  C CD   . ARG A 1 29 ? 16.299 -3.615  -7.013  1.00 0.00 ? 29 ARG A CD   7  
ATOM 7728  N NE   . ARG A 1 29 ? 16.277 -4.957  -6.465  1.00 0.00 ? 29 ARG A NE   7  
ATOM 7729  C CZ   . ARG A 1 29 ? 15.834 -6.027  -7.136  1.00 0.00 ? 29 ARG A CZ   7  
ATOM 7730  N NH1  . ARG A 1 29 ? 15.375 -5.894  -8.374  1.00 0.00 ? 29 ARG A NH1  7  
ATOM 7731  N NH2  . ARG A 1 29 ? 15.878 -7.214  -6.569  1.00 0.00 ? 29 ARG A NH2  7  
ATOM 7732  H H    . ARG A 1 29 ? 13.776 -1.132  -3.201  1.00 0.00 ? 29 ARG A H    7  
ATOM 7733  H HA   . ARG A 1 29 ? 16.670 -1.733  -3.278  1.00 0.00 ? 29 ARG A HA   7  
ATOM 7734  H HB2  . ARG A 1 29 ? 15.440 -3.478  -4.424  1.00 0.00 ? 29 ARG A HB2  7  
ATOM 7735  H HB3  . ARG A 1 29 ? 14.578 -2.292  -5.406  1.00 0.00 ? 29 ARG A HB3  7  
ATOM 7736  H HG2  . ARG A 1 29 ? 16.722 -1.615  -6.408  1.00 0.00 ? 29 ARG A HG2  7  
ATOM 7737  H HG3  . ARG A 1 29 ? 17.536 -2.873  -5.458  1.00 0.00 ? 29 ARG A HG3  7  
ATOM 7738  H HD2  . ARG A 1 29 ? 15.325 -3.395  -7.432  1.00 0.00 ? 29 ARG A HD2  7  
ATOM 7739  H HD3  . ARG A 1 29 ? 17.050 -3.543  -7.799  1.00 0.00 ? 29 ARG A HD3  7  
ATOM 7740  H HE   . ARG A 1 29 ? 16.633 -5.090  -5.544  1.00 0.00 ? 29 ARG A HE   7  
ATOM 7741  H HH11 . ARG A 1 29 ? 15.371 -5.000  -8.829  1.00 0.00 ? 29 ARG A HH11 7  
ATOM 7742  H HH12 . ARG A 1 29 ? 15.006 -6.698  -8.859  1.00 0.00 ? 29 ARG A HH12 7  
ATOM 7743  H HH21 . ARG A 1 29 ? 16.253 -7.311  -5.635  1.00 0.00 ? 29 ARG A HH21 7  
ATOM 7744  H HH22 . ARG A 1 29 ? 15.562 -8.044  -7.070  1.00 0.00 ? 29 ARG A HH22 7  
ATOM 7745  N N    . MET A 1 30 ? 17.203 0.337   -4.562  1.00 0.00 ? 30 MET A N    7  
ATOM 7746  C CA   . MET A 1 30 ? 17.539 1.610   -5.199  1.00 0.00 ? 30 MET A CA   7  
ATOM 7747  C C    . MET A 1 30 ? 17.521 1.461   -6.700  1.00 0.00 ? 30 MET A C    7  
ATOM 7748  O O    . MET A 1 30 ? 18.396 0.824   -7.292  1.00 0.00 ? 30 MET A O    7  
ATOM 7749  C CB   . MET A 1 30 ? 18.903 2.089   -4.732  1.00 0.00 ? 30 MET A CB   7  
ATOM 7750  C CG   . MET A 1 30 ? 19.206 3.527   -5.100  1.00 0.00 ? 30 MET A CG   7  
ATOM 7751  S SD   . MET A 1 30 ? 18.084 4.704   -4.322  1.00 0.00 ? 30 MET A SD   7  
ATOM 7752  C CE   . MET A 1 30 ? 18.864 6.235   -4.803  1.00 0.00 ? 30 MET A CE   7  
ATOM 7753  H H    . MET A 1 30 ? 17.933 -0.213  -4.197  1.00 0.00 ? 30 MET A H    7  
ATOM 7754  H HA   . MET A 1 30 ? 16.789 2.328   -4.933  1.00 0.00 ? 30 MET A HA   7  
ATOM 7755  H HB2  . MET A 1 30 ? 18.954 1.996   -3.662  1.00 0.00 ? 30 MET A HB2  7  
ATOM 7756  H HB3  . MET A 1 30 ? 19.656 1.453   -5.197  1.00 0.00 ? 30 MET A HB3  7  
ATOM 7757  H HG2  . MET A 1 30 ? 20.224 3.754   -4.780  1.00 0.00 ? 30 MET A HG2  7  
ATOM 7758  H HG3  . MET A 1 30 ? 19.142 3.643   -6.180  1.00 0.00 ? 30 MET A HG3  7  
ATOM 7759  H HE1  . MET A 1 30 ? 18.863 6.324   -5.884  1.00 0.00 ? 30 MET A HE1  7  
ATOM 7760  H HE2  . MET A 1 30 ? 19.882 6.252   -4.438  1.00 0.00 ? 30 MET A HE2  7  
ATOM 7761  H HE3  . MET A 1 30 ? 18.324 7.060   -4.373  1.00 0.00 ? 30 MET A HE3  7  
ATOM 7762  N N    . LEU A 1 31 ? 16.517 2.056   -7.307  1.00 0.00 ? 31 LEU A N    7  
ATOM 7763  C CA   . LEU A 1 31 ? 16.256 1.917   -8.728  1.00 0.00 ? 31 LEU A CA   7  
ATOM 7764  C C    . LEU A 1 31 ? 16.962 3.003   -9.539  1.00 0.00 ? 31 LEU A C    7  
ATOM 7765  O O    . LEU A 1 31 ? 16.959 2.976   -10.772 1.00 0.00 ? 31 LEU A O    7  
ATOM 7766  C CB   . LEU A 1 31 ? 14.750 1.974   -8.947  1.00 0.00 ? 31 LEU A CB   7  
ATOM 7767  C CG   . LEU A 1 31 ? 14.316 1.874   -10.405 1.00 0.00 ? 31 LEU A CG   7  
ATOM 7768  C CD1  . LEU A 1 31 ? 14.458 0.452   -10.922 1.00 0.00 ? 31 LEU A CD1  7  
ATOM 7769  C CD2  . LEU A 1 31 ? 12.895 2.373   -10.564 1.00 0.00 ? 31 LEU A CD2  7  
ATOM 7770  H H    . LEU A 1 31 ? 15.900 2.604   -6.772  1.00 0.00 ? 31 LEU A H    7  
ATOM 7771  H HA   . LEU A 1 31 ? 16.624 0.949   -9.020  1.00 0.00 ? 31 LEU A HA   7  
ATOM 7772  H HB2  . LEU A 1 31 ? 14.311 1.151   -8.389  1.00 0.00 ? 31 LEU A HB2  7  
ATOM 7773  H HB3  . LEU A 1 31 ? 14.377 2.893   -8.545  1.00 0.00 ? 31 LEU A HB3  7  
ATOM 7774  H HG   . LEU A 1 31 ? 14.966 2.513   -10.981 1.00 0.00 ? 31 LEU A HG   7  
ATOM 7775  H HD11 . LEU A 1 31 ? 14.126 0.416   -11.950 1.00 0.00 ? 31 LEU A HD11 7  
ATOM 7776  H HD12 . LEU A 1 31 ? 13.856 -0.207  -10.326 1.00 0.00 ? 31 LEU A HD12 7  
ATOM 7777  H HD13 . LEU A 1 31 ? 15.500 0.155   -10.878 1.00 0.00 ? 31 LEU A HD13 7  
ATOM 7778  H HD21 . LEU A 1 31 ? 12.619 2.341   -11.608 1.00 0.00 ? 31 LEU A HD21 7  
ATOM 7779  H HD22 . LEU A 1 31 ? 12.827 3.393   -10.220 1.00 0.00 ? 31 LEU A HD22 7  
ATOM 7780  H HD23 . LEU A 1 31 ? 12.221 1.753   -9.990  1.00 0.00 ? 31 LEU A HD23 7  
ATOM 7781  N N    . ASP A 1 32 ? 17.573 3.960   -8.852  1.00 0.00 ? 32 ASP A N    7  
ATOM 7782  C CA   . ASP A 1 32 ? 18.259 5.060   -9.504  1.00 0.00 ? 32 ASP A CA   7  
ATOM 7783  C C    . ASP A 1 32 ? 19.574 5.350   -8.791  1.00 0.00 ? 32 ASP A C    7  
ATOM 7784  O O    . ASP A 1 32 ? 19.692 5.094   -7.603  1.00 0.00 ? 32 ASP A O    7  
ATOM 7785  C CB   . ASP A 1 32 ? 17.351 6.311   -9.504  1.00 0.00 ? 32 ASP A CB   7  
ATOM 7786  C CG   . ASP A 1 32 ? 17.835 7.409   -10.399 1.00 0.00 ? 32 ASP A CG   7  
ATOM 7787  O OD1  . ASP A 1 32 ? 18.617 8.268   -9.960  1.00 0.00 ? 32 ASP A OD1  7  
ATOM 7788  O OD2  . ASP A 1 32 ? 17.398 7.454   -11.576 1.00 0.00 ? 32 ASP A OD2  7  
ATOM 7789  H H    . ASP A 1 32 ? 17.558 3.932   -7.869  1.00 0.00 ? 32 ASP A H    7  
ATOM 7790  H HA   . ASP A 1 32 ? 18.459 4.776   -10.529 1.00 0.00 ? 32 ASP A HA   7  
ATOM 7791  H HB2  . ASP A 1 32 ? 16.366 6.007   -9.830  1.00 0.00 ? 32 ASP A HB2  7  
ATOM 7792  H HB3  . ASP A 1 32 ? 17.281 6.691   -8.494  1.00 0.00 ? 32 ASP A HB3  7  
ATOM 7793  N N    . ASP A 1 33 ? 20.562 5.844   -9.504  1.00 0.00 ? 33 ASP A N    7  
ATOM 7794  C CA   . ASP A 1 33 ? 21.814 6.232   -8.855  1.00 0.00 ? 33 ASP A CA   7  
ATOM 7795  C C    . ASP A 1 33 ? 21.683 7.669   -8.351  1.00 0.00 ? 33 ASP A C    7  
ATOM 7796  O O    . ASP A 1 33 ? 21.315 8.572   -9.111  1.00 0.00 ? 33 ASP A O    7  
ATOM 7797  C CB   . ASP A 1 33 ? 23.021 6.104   -9.800  1.00 0.00 ? 33 ASP A CB   7  
ATOM 7798  C CG   . ASP A 1 33 ? 23.024 7.104   -10.933 1.00 0.00 ? 33 ASP A CG   7  
ATOM 7799  O OD1  . ASP A 1 33 ? 22.300 6.881   -11.922 1.00 0.00 ? 33 ASP A OD1  7  
ATOM 7800  O OD2  . ASP A 1 33 ? 23.746 8.119   -10.834 1.00 0.00 ? 33 ASP A OD2  7  
ATOM 7801  H H    . ASP A 1 33 ? 20.471 5.970   -10.473 1.00 0.00 ? 33 ASP A H    7  
ATOM 7802  H HA   . ASP A 1 33 ? 21.955 5.583   -7.998  1.00 0.00 ? 33 ASP A HA   7  
ATOM 7803  H HB2  . ASP A 1 33 ? 23.929 6.250   -9.237  1.00 0.00 ? 33 ASP A HB2  7  
ATOM 7804  H HB3  . ASP A 1 33 ? 23.037 5.108   -10.217 1.00 0.00 ? 33 ASP A HB3  7  
ATOM 7805  N N    . TYR A 1 34 ? 21.966 7.865   -7.075  1.00 0.00 ? 34 TYR A N    7  
ATOM 7806  C CA   . TYR A 1 34 ? 21.708 9.169   -6.446  1.00 0.00 ? 34 TYR A CA   7  
ATOM 7807  C C    . TYR A 1 34 ? 22.678 9.412   -5.308  1.00 0.00 ? 34 TYR A C    7  
ATOM 7808  O O    . TYR A 1 34 ? 22.543 8.861   -4.220  1.00 0.00 ? 34 TYR A O    7  
ATOM 7809  C CB   . TYR A 1 34 ? 20.264 9.192   -5.935  1.00 0.00 ? 34 TYR A CB   7  
ATOM 7810  C CG   . TYR A 1 34 ? 19.838 10.531  -5.377  1.00 0.00 ? 34 TYR A CG   7  
ATOM 7811  C CD1  . TYR A 1 34 ? 19.867 11.689  -6.149  1.00 0.00 ? 34 TYR A CD1  7  
ATOM 7812  C CD2  . TYR A 1 34 ? 19.400 10.642  -4.052  1.00 0.00 ? 34 TYR A CD2  7  
ATOM 7813  C CE1  . TYR A 1 34 ? 19.477 12.909  -5.638  1.00 0.00 ? 34 TYR A CE1  7  
ATOM 7814  C CE2  . TYR A 1 34 ? 19.010 11.868  -3.539  1.00 0.00 ? 34 TYR A CE2  7  
ATOM 7815  C CZ   . TYR A 1 34 ? 19.047 12.992  -4.332  1.00 0.00 ? 34 TYR A CZ   7  
ATOM 7816  O OH   . TYR A 1 34 ? 18.645 14.193  -3.812  1.00 0.00 ? 34 TYR A OH   7  
ATOM 7817  H H    . TYR A 1 34 ? 22.376 7.161   -6.547  1.00 0.00 ? 34 TYR A H    7  
ATOM 7818  H HA   . TYR A 1 34 ? 21.821 9.913   -7.200  1.00 0.00 ? 34 TYR A HA   7  
ATOM 7819  H HB2  . TYR A 1 34 ? 19.594 8.942   -6.756  1.00 0.00 ? 34 TYR A HB2  7  
ATOM 7820  H HB3  . TYR A 1 34 ? 20.167 8.464   -5.141  1.00 0.00 ? 34 TYR A HB3  7  
ATOM 7821  H HD1  . TYR A 1 34 ? 20.208 11.618  -7.171  1.00 0.00 ? 34 TYR A HD1  7  
ATOM 7822  H HD2  . TYR A 1 34 ? 19.377 9.763   -3.424  1.00 0.00 ? 34 TYR A HD2  7  
ATOM 7823  H HE1  . TYR A 1 34 ? 19.512 13.806  -6.250  1.00 0.00 ? 34 TYR A HE1  7  
ATOM 7824  H HE2  . TYR A 1 34 ? 18.672 11.928  -2.523  1.00 0.00 ? 34 TYR A HE2  7  
ATOM 7825  H HH   . TYR A 1 34 ? 19.033 14.306  -2.926  1.00 0.00 ? 34 TYR A HH   7  
ATOM 7826  N N    . GLU A 1 35 ? 23.714 10.201  -5.612  1.00 0.00 ? 35 GLU A N    7  
ATOM 7827  C CA   . GLU A 1 35 ? 24.693 10.621  -4.613  1.00 0.00 ? 35 GLU A CA   7  
ATOM 7828  C C    . GLU A 1 35 ? 25.396 9.426   -3.969  1.00 0.00 ? 35 GLU A C    7  
ATOM 7829  O O    . GLU A 1 35 ? 26.145 8.705   -4.631  1.00 0.00 ? 35 GLU A O    7  
ATOM 7830  C CB   . GLU A 1 35 ? 24.018 11.489  -3.559  1.00 0.00 ? 35 GLU A CB   7  
ATOM 7831  C CG   . GLU A 1 35 ? 23.292 12.693  -4.132  1.00 0.00 ? 35 GLU A CG   7  
ATOM 7832  C CD   . GLU A 1 35 ? 22.611 13.528  -3.074  1.00 0.00 ? 35 GLU A CD   7  
ATOM 7833  O OE1  . GLU A 1 35 ? 21.685 13.017  -2.409  1.00 0.00 ? 35 GLU A OE1  7  
ATOM 7834  O OE2  . GLU A 1 35 ? 22.993 14.697  -2.879  1.00 0.00 ? 35 GLU A OE2  7  
ATOM 7835  H H    . GLU A 1 35 ? 23.832 10.498  -6.542  1.00 0.00 ? 35 GLU A H    7  
ATOM 7836  H HA   . GLU A 1 35 ? 25.424 11.209  -5.125  1.00 0.00 ? 35 GLU A HA   7  
ATOM 7837  H HB2  . GLU A 1 35 ? 23.296 10.889  -3.026  1.00 0.00 ? 35 GLU A HB2  7  
ATOM 7838  H HB3  . GLU A 1 35 ? 24.768 11.838  -2.870  1.00 0.00 ? 35 GLU A HB3  7  
ATOM 7839  H HG2  . GLU A 1 35 ? 24.004 13.313  -4.644  1.00 0.00 ? 35 GLU A HG2  7  
ATOM 7840  H HG3  . GLU A 1 35 ? 22.540 12.350  -4.830  1.00 0.00 ? 35 GLU A HG3  7  
ATOM 7841  N N    . GLU A 1 36 ? 25.133 9.194   -2.674  1.00 0.00 ? 36 GLU A N    7  
ATOM 7842  C CA   . GLU A 1 36 ? 25.798 8.159   -1.924  1.00 0.00 ? 36 GLU A CA   7  
ATOM 7843  C C    . GLU A 1 36 ? 25.323 6.771   -2.338  1.00 0.00 ? 36 GLU A C    7  
ATOM 7844  O O    . GLU A 1 36 ? 26.057 5.790   -2.181  1.00 0.00 ? 36 GLU A O    7  
ATOM 7845  C CB   . GLU A 1 36 ? 25.550 8.358   -0.434  1.00 0.00 ? 36 GLU A CB   7  
ATOM 7846  C CG   . GLU A 1 36 ? 25.852 9.767   0.032   1.00 0.00 ? 36 GLU A CG   7  
ATOM 7847  C CD   . GLU A 1 36 ? 27.264 10.204  -0.303  1.00 0.00 ? 36 GLU A CD   7  
ATOM 7848  O OE1  . GLU A 1 36 ? 28.221 9.600   0.219   1.00 0.00 ? 36 GLU A OE1  7  
ATOM 7849  O OE2  . GLU A 1 36 ? 27.415 11.160  -1.089  1.00 0.00 ? 36 GLU A OE2  7  
ATOM 7850  H H    . GLU A 1 36 ? 24.491 9.762   -2.211  1.00 0.00 ? 36 GLU A H    7  
ATOM 7851  H HA   . GLU A 1 36 ? 26.853 8.247   -2.112  1.00 0.00 ? 36 GLU A HA   7  
ATOM 7852  H HB2  . GLU A 1 36 ? 24.507 8.150   -0.222  1.00 0.00 ? 36 GLU A HB2  7  
ATOM 7853  H HB3  . GLU A 1 36 ? 26.169 7.678   0.120   1.00 0.00 ? 36 GLU A HB3  7  
ATOM 7854  H HG2  . GLU A 1 36 ? 25.166 10.454  -0.436  1.00 0.00 ? 36 GLU A HG2  7  
ATOM 7855  H HG3  . GLU A 1 36 ? 25.721 9.803   1.110   1.00 0.00 ? 36 GLU A HG3  7  
ATOM 7856  N N    . ILE A 1 37 ? 24.105 6.694   -2.850  1.00 0.00 ? 37 ILE A N    7  
ATOM 7857  C CA   . ILE A 1 37 ? 23.497 5.417   -3.165  1.00 0.00 ? 37 ILE A CA   7  
ATOM 7858  C C    . ILE A 1 37 ? 23.473 5.234   -4.687  1.00 0.00 ? 37 ILE A C    7  
ATOM 7859  O O    . ILE A 1 37 ? 23.448 6.216   -5.431  1.00 0.00 ? 37 ILE A O    7  
ATOM 7860  C CB   . ILE A 1 37 ? 22.062 5.325   -2.600  1.00 0.00 ? 37 ILE A CB   7  
ATOM 7861  C CG1  . ILE A 1 37 ? 22.026 5.858   -1.174  1.00 0.00 ? 37 ILE A CG1  7  
ATOM 7862  C CG2  . ILE A 1 37 ? 21.592 3.874   -2.630  1.00 0.00 ? 37 ILE A CG2  7  
ATOM 7863  C CD1  . ILE A 1 37 ? 22.898 5.104   -0.177  1.00 0.00 ? 37 ILE A CD1  7  
ATOM 7864  H H    . ILE A 1 37 ? 23.616 7.521   -3.038  1.00 0.00 ? 37 ILE A H    7  
ATOM 7865  H HA   . ILE A 1 37 ? 24.105 4.641   -2.728  1.00 0.00 ? 37 ILE A HA   7  
ATOM 7866  H HB   . ILE A 1 37 ? 21.418 5.910   -3.215  1.00 0.00 ? 37 ILE A HB   7  
ATOM 7867  H HG12 . ILE A 1 37 ? 22.367 6.881   -1.171  1.00 0.00 ? 37 ILE A HG12 7  
ATOM 7868  H HG13 . ILE A 1 37 ? 21.004 5.816   -0.818  1.00 0.00 ? 37 ILE A HG13 7  
ATOM 7869  H HG21 . ILE A 1 37 ? 22.247 3.256   -2.036  1.00 0.00 ? 37 ILE A HG21 7  
ATOM 7870  H HG22 . ILE A 1 37 ? 21.596 3.510   -3.648  1.00 0.00 ? 37 ILE A HG22 7  
ATOM 7871  H HG23 . ILE A 1 37 ? 20.588 3.821   -2.229  1.00 0.00 ? 37 ILE A HG23 7  
ATOM 7872  H HD11 . ILE A 1 37 ? 22.564 4.071   -0.131  1.00 0.00 ? 37 ILE A HD11 7  
ATOM 7873  H HD12 . ILE A 1 37 ? 22.806 5.554   0.799   1.00 0.00 ? 37 ILE A HD12 7  
ATOM 7874  H HD13 . ILE A 1 37 ? 23.916 5.130   -0.503  1.00 0.00 ? 37 ILE A HD13 7  
ATOM 7875  N N    . SER A 1 38 ? 23.516 3.990   -5.133  1.00 0.00 ? 38 SER A N    7  
ATOM 7876  C CA   . SER A 1 38 ? 23.556 3.694   -6.557  1.00 0.00 ? 38 SER A CA   7  
ATOM 7877  C C    . SER A 1 38 ? 22.546 2.609   -6.894  1.00 0.00 ? 38 SER A C    7  
ATOM 7878  O O    . SER A 1 38 ? 22.054 1.929   -5.993  1.00 0.00 ? 38 SER A O    7  
ATOM 7879  C CB   . SER A 1 38 ? 24.964 3.265   -6.962  1.00 0.00 ? 38 SER A CB   7  
ATOM 7880  O OG   . SER A 1 38 ? 25.914 4.258   -6.612  1.00 0.00 ? 38 SER A OG   7  
ATOM 7881  H H    . SER A 1 38 ? 23.505 3.235   -4.504  1.00 0.00 ? 38 SER A H    7  
ATOM 7882  H HA   . SER A 1 38 ? 23.292 4.594   -7.101  1.00 0.00 ? 38 SER A HA   7  
ATOM 7883  H HB2  . SER A 1 38 ? 25.219 2.354   -6.433  1.00 0.00 ? 38 SER A HB2  7  
ATOM 7884  H HB3  . SER A 1 38 ? 25.017 3.094   -8.032  1.00 0.00 ? 38 SER A HB3  7  
ATOM 7885  H HG   . SER A 1 38 ? 25.475 4.971   -6.138  1.00 0.00 ? 38 SER A HG   7  
ATOM 7886  N N    . ALA A 1 39 ? 22.209 2.478   -8.175  1.00 0.00 ? 39 ALA A N    7  
ATOM 7887  C CA   . ALA A 1 39 ? 21.235 1.496   -8.601  1.00 0.00 ? 39 ALA A CA   7  
ATOM 7888  C C    . ALA A 1 39 ? 21.691 0.076   -8.255  1.00 0.00 ? 39 ALA A C    7  
ATOM 7889  O O    . ALA A 1 39 ? 22.808 -0.341  -8.588  1.00 0.00 ? 39 ALA A O    7  
ATOM 7890  C CB   . ALA A 1 39 ? 20.997 1.636   -10.112 1.00 0.00 ? 39 ALA A CB   7  
ATOM 7891  H H    . ALA A 1 39 ? 22.644 3.057   -8.831  1.00 0.00 ? 39 ALA A H    7  
ATOM 7892  H HA   . ALA A 1 39 ? 20.301 1.710   -8.099  1.00 0.00 ? 39 ALA A HA   7  
ATOM 7893  H HB1  . ALA A 1 39 ? 20.250 0.932   -10.418 1.00 0.00 ? 39 ALA A HB1  7  
ATOM 7894  H HB2  . ALA A 1 39 ? 21.920 1.456   -10.646 1.00 0.00 ? 39 ALA A HB2  7  
ATOM 7895  H HB3  . ALA A 1 39 ? 20.647 2.641   -10.322 1.00 0.00 ? 39 ALA A HB3  7  
ATOM 7896  N N    . GLY A 1 40 ? 20.810 -0.651  -7.584  1.00 0.00 ? 40 GLY A N    7  
ATOM 7897  C CA   . GLY A 1 40 ? 21.123 -1.995  -7.166  1.00 0.00 ? 40 GLY A CA   7  
ATOM 7898  C C    . GLY A 1 40 ? 21.374 -2.107  -5.681  1.00 0.00 ? 40 GLY A C    7  
ATOM 7899  O O    . GLY A 1 40 ? 21.349 -3.206  -5.118  1.00 0.00 ? 40 GLY A O    7  
ATOM 7900  H H    . GLY A 1 40 ? 19.940 -0.238  -7.356  1.00 0.00 ? 40 GLY A H    7  
ATOM 7901  H HA2  . GLY A 1 40 ? 20.312 -2.661  -7.448  1.00 0.00 ? 40 GLY A HA2  7  
ATOM 7902  H HA3  . GLY A 1 40 ? 22.014 -2.329  -7.683  1.00 0.00 ? 40 GLY A HA3  7  
ATOM 7903  N N    . ASP A 1 41 ? 21.639 -0.971  -5.027  1.00 0.00 ? 41 ASP A N    7  
ATOM 7904  C CA   . ASP A 1 41 ? 21.733 -0.927  -3.580  1.00 0.00 ? 41 ASP A CA   7  
ATOM 7905  C C    . ASP A 1 41 ? 20.384 -1.268  -2.984  1.00 0.00 ? 41 ASP A C    7  
ATOM 7906  O O    . ASP A 1 41 ? 19.360 -0.854  -3.507  1.00 0.00 ? 41 ASP A O    7  
ATOM 7907  C CB   . ASP A 1 41 ? 22.183 0.450   -3.080  1.00 0.00 ? 41 ASP A CB   7  
ATOM 7908  C CG   . ASP A 1 41 ? 23.684 0.643   -3.128  1.00 0.00 ? 41 ASP A CG   7  
ATOM 7909  O OD1  . ASP A 1 41 ? 24.402 -0.119  -2.453  1.00 0.00 ? 41 ASP A OD1  7  
ATOM 7910  O OD2  . ASP A 1 41 ? 24.154 1.576   -3.837  1.00 0.00 ? 41 ASP A OD2  7  
ATOM 7911  H H    . ASP A 1 41 ? 21.746 -0.146  -5.528  1.00 0.00 ? 41 ASP A H    7  
ATOM 7912  H HA   . ASP A 1 41 ? 22.461 -1.669  -3.292  1.00 0.00 ? 41 ASP A HA   7  
ATOM 7913  H HB2  . ASP A 1 41 ? 21.718 1.218   -3.681  1.00 0.00 ? 41 ASP A HB2  7  
ATOM 7914  H HB3  . ASP A 1 41 ? 21.865 0.558   -2.056  1.00 0.00 ? 41 ASP A HB3  7  
ATOM 7915  N N    . GLU A 1 42 ? 20.375 -2.049  -1.896  1.00 0.00 ? 42 GLU A N    7  
ATOM 7916  C CA   . GLU A 1 42 ? 19.127 -2.423  -1.258  1.00 0.00 ? 42 GLU A CA   7  
ATOM 7917  C C    . GLU A 1 42 ? 19.168 -2.119  0.224   1.00 0.00 ? 42 GLU A C    7  
ATOM 7918  O O    . GLU A 1 42 ? 20.247 -2.035  0.821   1.00 0.00 ? 42 GLU A O    7  
ATOM 7919  C CB   . GLU A 1 42 ? 18.816 -3.904  -1.524  1.00 0.00 ? 42 GLU A CB   7  
ATOM 7920  C CG   . GLU A 1 42 ? 18.660 -4.222  -2.996  1.00 0.00 ? 42 GLU A CG   7  
ATOM 7921  C CD   . GLU A 1 42 ? 18.130 -5.624  -3.235  1.00 0.00 ? 42 GLU A CD   7  
ATOM 7922  O OE1  . GLU A 1 42 ? 18.337 -6.500  -2.386  1.00 0.00 ? 42 GLU A OE1  7  
ATOM 7923  O OE2  . GLU A 1 42 ? 17.507 -5.844  -4.293  1.00 0.00 ? 42 GLU A OE2  7  
ATOM 7924  H H    . GLU A 1 42 ? 21.224 -2.345  -1.523  1.00 0.00 ? 42 GLU A H    7  
ATOM 7925  H HA   . GLU A 1 42 ? 18.348 -1.824  -1.706  1.00 0.00 ? 42 GLU A HA   7  
ATOM 7926  H HB2  . GLU A 1 42 ? 19.621 -4.515  -1.137  1.00 0.00 ? 42 GLU A HB2  7  
ATOM 7927  H HB3  . GLU A 1 42 ? 17.894 -4.163  -1.023  1.00 0.00 ? 42 GLU A HB3  7  
ATOM 7928  H HG2  . GLU A 1 42 ? 17.964 -3.524  -3.423  1.00 0.00 ? 42 GLU A HG2  7  
ATOM 7929  H HG3  . GLU A 1 42 ? 19.634 -4.122  -3.473  1.00 0.00 ? 42 GLU A HG3  7  
ATOM 7930  N N    . GLY A 1 43 ? 17.987 -1.932  0.793   1.00 0.00 ? 43 GLY A N    7  
ATOM 7931  C CA   . GLY A 1 43 ? 17.896 -1.499  2.154   1.00 0.00 ? 43 GLY A CA   7  
ATOM 7932  C C    . GLY A 1 43 ? 16.526 -1.724  2.742   1.00 0.00 ? 43 GLY A C    7  
ATOM 7933  O O    . GLY A 1 43 ? 15.692 -2.420  2.154   1.00 0.00 ? 43 GLY A O    7  
ATOM 7934  H H    . GLY A 1 43 ? 17.170 -2.098  0.271   1.00 0.00 ? 43 GLY A H    7  
ATOM 7935  H HA2  . GLY A 1 43 ? 18.611 -2.058  2.744   1.00 0.00 ? 43 GLY A HA2  7  
ATOM 7936  H HA3  . GLY A 1 43 ? 18.140 -0.448  2.200   1.00 0.00 ? 43 GLY A HA3  7  
ATOM 7937  N N    . GLU A 1 44 ? 16.283 -1.142  3.912   1.00 0.00 ? 44 GLU A N    7  
ATOM 7938  C CA   . GLU A 1 44 ? 15.012 -1.288  4.586   1.00 0.00 ? 44 GLU A CA   7  
ATOM 7939  C C    . GLU A 1 44 ? 14.365 0.082   4.770   1.00 0.00 ? 44 GLU A C    7  
ATOM 7940  O O    . GLU A 1 44 ? 15.046 1.084   4.961   1.00 0.00 ? 44 GLU A O    7  
ATOM 7941  C CB   . GLU A 1 44 ? 15.190 -1.962  5.940   1.00 0.00 ? 44 GLU A CB   7  
ATOM 7942  C CG   . GLU A 1 44 ? 13.878 -2.285  6.624   1.00 0.00 ? 44 GLU A CG   7  
ATOM 7943  C CD   . GLU A 1 44 ? 14.018 -2.421  8.123   1.00 0.00 ? 44 GLU A CD   7  
ATOM 7944  O OE1  . GLU A 1 44 ? 14.052 -1.376  8.803   1.00 0.00 ? 44 GLU A OE1  7  
ATOM 7945  O OE2  . GLU A 1 44 ? 14.072 -3.556  8.639   1.00 0.00 ? 44 GLU A OE2  7  
ATOM 7946  H H    . GLU A 1 44 ? 16.974 -0.575  4.307   1.00 0.00 ? 44 GLU A H    7  
ATOM 7947  H HA   . GLU A 1 44 ? 14.389 -1.914  3.962   1.00 0.00 ? 44 GLU A HA   7  
ATOM 7948  H HB2  . GLU A 1 44 ? 15.747 -2.877  5.797   1.00 0.00 ? 44 GLU A HB2  7  
ATOM 7949  H HB3  . GLU A 1 44 ? 15.756 -1.309  6.580   1.00 0.00 ? 44 GLU A HB3  7  
ATOM 7950  H HG2  . GLU A 1 44 ? 13.177 -1.495  6.421   1.00 0.00 ? 44 GLU A HG2  7  
ATOM 7951  H HG3  . GLU A 1 44 ? 13.498 -3.219  6.221   1.00 0.00 ? 44 GLU A HG3  7  
ATOM 7952  N N    . PHE A 1 45 ? 13.042 0.105   4.723   1.00 0.00 ? 45 PHE A N    7  
ATOM 7953  C CA   . PHE A 1 45 ? 12.278 1.338   4.861   1.00 0.00 ? 45 PHE A CA   7  
ATOM 7954  C C    . PHE A 1 45 ? 12.035 1.628   6.344   1.00 0.00 ? 45 PHE A C    7  
ATOM 7955  O O    . PHE A 1 45 ? 11.358 0.876   7.038   1.00 0.00 ? 45 PHE A O    7  
ATOM 7956  C CB   . PHE A 1 45 ? 10.933 1.134   4.128   1.00 0.00 ? 45 PHE A CB   7  
ATOM 7957  C CG   . PHE A 1 45 ? 10.049 2.340   4.071   1.00 0.00 ? 45 PHE A CG   7  
ATOM 7958  C CD1  . PHE A 1 45 ? 9.204  2.634   5.123   1.00 0.00 ? 45 PHE A CD1  7  
ATOM 7959  C CD2  . PHE A 1 45 ? 10.046 3.156   2.961   1.00 0.00 ? 45 PHE A CD2  7  
ATOM 7960  C CE1  . PHE A 1 45 ? 8.367  3.717   5.086   1.00 0.00 ? 45 PHE A CE1  7  
ATOM 7961  C CE2  . PHE A 1 45 ? 9.207  4.244   2.913   1.00 0.00 ? 45 PHE A CE2  7  
ATOM 7962  C CZ   . PHE A 1 45 ? 8.367  4.533   3.966   1.00 0.00 ? 45 PHE A CZ   7  
ATOM 7963  H H    . PHE A 1 45 ? 12.548 -0.738  4.617   1.00 0.00 ? 45 PHE A H    7  
ATOM 7964  H HA   . PHE A 1 45 ? 12.813 2.154   4.417   1.00 0.00 ? 45 PHE A HA   7  
ATOM 7965  H HB2  . PHE A 1 45 ? 11.142 0.834   3.110   1.00 0.00 ? 45 PHE A HB2  7  
ATOM 7966  H HB3  . PHE A 1 45 ? 10.394 0.341   4.619   1.00 0.00 ? 45 PHE A HB3  7  
ATOM 7967  H HD1  . PHE A 1 45 ? 9.192  1.998   5.995   1.00 0.00 ? 45 PHE A HD1  7  
ATOM 7968  H HD2  . PHE A 1 45 ? 10.705 2.939   2.131   1.00 0.00 ? 45 PHE A HD2  7  
ATOM 7969  H HE1  . PHE A 1 45 ? 7.714  3.940   5.917   1.00 0.00 ? 45 PHE A HE1  7  
ATOM 7970  H HE2  . PHE A 1 45 ? 9.198  4.881   2.039   1.00 0.00 ? 45 PHE A HE2  7  
ATOM 7971  H HZ   . PHE A 1 45 ? 7.697  5.387   3.930   1.00 0.00 ? 45 PHE A HZ   7  
ATOM 7972  N N    . ARG A 1 46 ? 12.617 2.704   6.837   1.00 0.00 ? 46 ARG A N    7  
ATOM 7973  C CA   . ARG A 1 46 ? 12.499 3.071   8.258   1.00 0.00 ? 46 ARG A CA   7  
ATOM 7974  C C    . ARG A 1 46 ? 11.262 3.950   8.506   1.00 0.00 ? 46 ARG A C    7  
ATOM 7975  O O    . ARG A 1 46 ? 10.379 3.594   9.288   1.00 0.00 ? 46 ARG A O    7  
ATOM 7976  C CB   . ARG A 1 46 ? 13.736 3.834   8.705   1.00 0.00 ? 46 ARG A CB   7  
ATOM 7977  C CG   . ARG A 1 46 ? 15.013 3.001   8.804   1.00 0.00 ? 46 ARG A CG   7  
ATOM 7978  C CD   . ARG A 1 46 ? 15.019 2.133   10.046  1.00 0.00 ? 46 ARG A CD   7  
ATOM 7979  N NE   . ARG A 1 46 ? 14.073 1.018   9.973   1.00 0.00 ? 46 ARG A NE   7  
ATOM 7980  C CZ   . ARG A 1 46 ? 13.117 0.785   10.875  1.00 0.00 ? 46 ARG A CZ   7  
ATOM 7981  N NH1  . ARG A 1 46 ? 12.960 1.592   11.927  1.00 0.00 ? 46 ARG A NH1  7  
ATOM 7982  N NH2  . ARG A 1 46 ? 12.314 -0.265  10.719  1.00 0.00 ? 46 ARG A NH2  7  
ATOM 7983  H H    . ARG A 1 46 ? 13.188 3.271   6.262   1.00 0.00 ? 46 ARG A H    7  
ATOM 7984  H HA   . ARG A 1 46 ? 12.409 2.157   8.833   1.00 0.00 ? 46 ARG A HA   7  
ATOM 7985  H HB2  . ARG A 1 46 ? 13.920 4.651   8.022   1.00 0.00 ? 46 ARG A HB2  7  
ATOM 7986  H HB3  . ARG A 1 46 ? 13.548 4.252   9.692   1.00 0.00 ? 46 ARG A HB3  7  
ATOM 7987  H HG2  . ARG A 1 46 ? 15.062 2.356   7.939   1.00 0.00 ? 46 ARG A HG2  7  
ATOM 7988  H HG3  . ARG A 1 46 ? 15.871 3.661   8.817   1.00 0.00 ? 46 ARG A HG3  7  
ATOM 7989  H HD2  . ARG A 1 46 ? 16.018 1.735   10.166  1.00 0.00 ? 46 ARG A HD2  7  
ATOM 7990  H HD3  . ARG A 1 46 ? 14.779 2.756   10.898  1.00 0.00 ? 46 ARG A HD3  7  
ATOM 7991  H HE   . ARG A 1 46 ? 14.168 0.385   9.223   1.00 0.00 ? 46 ARG A HE   7  
ATOM 7992  H HH11 . ARG A 1 46 ? 13.587 2.371   12.063  1.00 0.00 ? 46 ARG A HH11 7  
ATOM 7993  H HH12 . ARG A 1 46 ? 12.233 1.424   12.584  1.00 0.00 ? 46 ARG A HH12 7  
ATOM 7994  H HH21 . ARG A 1 46 ? 12.444 -0.886  9.947   1.00 0.00 ? 46 ARG A HH21 7  
ATOM 7995  H HH22 . ARG A 1 46 ? 11.586 -0.448  11.388  1.00 0.00 ? 46 ARG A HH22 7  
ATOM 7996  N N    . GLN A 1 47 ? 11.208 5.086   7.808   1.00 0.00 ? 47 GLN A N    7  
ATOM 7997  C CA   . GLN A 1 47 ? 10.154 6.081   8.027   1.00 0.00 ? 47 GLN A CA   7  
ATOM 7998  C C    . GLN A 1 47 ? 9.937  6.884   6.760   1.00 0.00 ? 47 GLN A C    7  
ATOM 7999  O O    . GLN A 1 47 ? 10.823 7.000   5.911   1.00 0.00 ? 47 GLN A O    7  
ATOM 8000  C CB   . GLN A 1 47 ? 10.500 7.034   9.176   1.00 0.00 ? 47 GLN A CB   7  
ATOM 8001  C CG   . GLN A 1 47 ? 10.309 6.434   10.572  1.00 0.00 ? 47 GLN A CG   7  
ATOM 8002  C CD   . GLN A 1 47 ? 10.520 7.450   11.690  1.00 0.00 ? 47 GLN A CD   7  
ATOM 8003  O OE1  . GLN A 1 47 ? 9.876  7.379   12.737  1.00 0.00 ? 47 GLN A OE1  7  
ATOM 8004  N NE2  . GLN A 1 47 ? 11.451 8.361   11.488  1.00 0.00 ? 47 GLN A NE2  7  
ATOM 8005  H H    . GLN A 1 47 ? 11.876 5.244   7.097   1.00 0.00 ? 47 GLN A H    7  
ATOM 8006  H HA   . GLN A 1 47 ? 9.239  5.551   8.272   1.00 0.00 ? 47 GLN A HA   7  
ATOM 8007  H HB2  . GLN A 1 47 ? 11.543 7.332   9.083   1.00 0.00 ? 47 GLN A HB2  7  
ATOM 8008  H HB3  . GLN A 1 47 ? 9.885  7.910   9.096   1.00 0.00 ? 47 GLN A HB3  7  
ATOM 8009  H HG2  . GLN A 1 47 ? 9.309  6.044   10.643  1.00 0.00 ? 47 GLN A HG2  7  
ATOM 8010  H HG3  . GLN A 1 47 ? 11.030 5.628   10.696  1.00 0.00 ? 47 GLN A HG3  7  
ATOM 8011  H HE21 . GLN A 1 47 ? 11.958 8.340   10.629  1.00 0.00 ? 47 GLN A HE21 7  
ATOM 8012  H HE22 . GLN A 1 47 ? 11.596 9.053   12.176  1.00 0.00 ? 47 GLN A HE22 7  
ATOM 8013  N N    . SER A 1 48 ? 8.734  7.435   6.636   1.00 0.00 ? 48 SER A N    7  
ATOM 8014  C CA   . SER A 1 48 ? 8.405  8.249   5.491   1.00 0.00 ? 48 SER A CA   7  
ATOM 8015  C C    . SER A 1 48 ? 7.894  9.611   5.915   1.00 0.00 ? 48 SER A C    7  
ATOM 8016  O O    . SER A 1 48 ? 7.378  9.764   7.022   1.00 0.00 ? 48 SER A O    7  
ATOM 8017  C CB   . SER A 1 48 ? 7.329  7.551   4.667   1.00 0.00 ? 48 SER A CB   7  
ATOM 8018  O OG   . SER A 1 48 ? 6.274  7.048   5.500   1.00 0.00 ? 48 SER A OG   7  
ATOM 8019  H H    . SER A 1 48 ? 8.048  7.255   7.316   1.00 0.00 ? 48 SER A H    7  
ATOM 8020  H HA   . SER A 1 48 ? 9.285  8.376   4.876   1.00 0.00 ? 48 SER A HA   7  
ATOM 8021  H HB2  . SER A 1 48 ? 6.907  8.247   3.953   1.00 0.00 ? 48 SER A HB2  7  
ATOM 8022  H HB3  . SER A 1 48 ? 7.772  6.716   4.128   1.00 0.00 ? 48 SER A HB3  7  
ATOM 8023  H HG   . SER A 1 48 ? 5.500  7.604   5.417   1.00 0.00 ? 48 SER A HG   7  
ATOM 8024  N N    . ASN A 1 49 ? 8.054  10.606  5.043   1.00 0.00 ? 49 ASN A N    7  
ATOM 8025  C CA   . ASN A 1 49 ? 7.399  11.878  5.224   1.00 0.00 ? 49 ASN A CA   7  
ATOM 8026  C C    . ASN A 1 49 ? 5.976  11.768  4.698   1.00 0.00 ? 49 ASN A C    7  
ATOM 8027  O O    . ASN A 1 49 ? 5.698  10.931  3.829   1.00 0.00 ? 49 ASN A O    7  
ATOM 8028  C CB   . ASN A 1 49 ? 8.158  12.993  4.495   1.00 0.00 ? 49 ASN A CB   7  
ATOM 8029  C CG   . ASN A 1 49 ? 9.385  13.464  5.266   1.00 0.00 ? 49 ASN A CG   7  
ATOM 8030  O OD1  . ASN A 1 49 ? 9.769  14.630  5.180   1.00 0.00 ? 49 ASN A OD1  7  
ATOM 8031  N ND2  . ASN A 1 49 ? 10.010 12.575  6.010   1.00 0.00 ? 49 ASN A ND2  7  
ATOM 8032  H H    . ASN A 1 49 ? 8.667  10.494  4.285   1.00 0.00 ? 49 ASN A H    7  
ATOM 8033  H HA   . ASN A 1 49 ? 7.361  12.095  6.285   1.00 0.00 ? 49 ASN A HA   7  
ATOM 8034  H HB2  . ASN A 1 49 ? 8.473  12.638  3.532   1.00 0.00 ? 49 ASN A HB2  7  
ATOM 8035  H HB3  . ASN A 1 49 ? 7.490  13.837  4.359   1.00 0.00 ? 49 ASN A HB3  7  
ATOM 8036  H HD21 . ASN A 1 49 ? 9.631  11.669  6.061   1.00 0.00 ? 49 ASN A HD21 7  
ATOM 8037  H HD22 . ASN A 1 49 ? 10.819 12.856  6.486   1.00 0.00 ? 49 ASN A HD22 7  
ATOM 8038  N N    . ASN A 1 50 ? 5.082  12.574  5.211   1.00 0.00 ? 50 ASN A N    7  
ATOM 8039  C CA   . ASN A 1 50 ? 3.655  12.400  4.965   1.00 0.00 ? 50 ASN A CA   7  
ATOM 8040  C C    . ASN A 1 50 ? 3.221  12.867  3.576   1.00 0.00 ? 50 ASN A C    7  
ATOM 8041  O O    . ASN A 1 50 ? 2.198  12.400  3.081   1.00 0.00 ? 50 ASN A O    7  
ATOM 8042  C CB   . ASN A 1 50 ? 2.813  13.098  6.036   1.00 0.00 ? 50 ASN A CB   7  
ATOM 8043  C CG   . ASN A 1 50 ? 3.090  14.582  6.148   1.00 0.00 ? 50 ASN A CG   7  
ATOM 8044  O OD1  . ASN A 1 50 ? 2.512  15.397  5.431   1.00 0.00 ? 50 ASN A OD1  7  
ATOM 8045  N ND2  . ASN A 1 50 ? 3.967  14.950  7.069   1.00 0.00 ? 50 ASN A ND2  7  
ATOM 8046  H H    . ASN A 1 50 ? 5.376  13.307  5.798   1.00 0.00 ? 50 ASN A H    7  
ATOM 8047  H HA   . ASN A 1 50 ? 3.471  11.342  5.041   1.00 0.00 ? 50 ASN A HA   7  
ATOM 8048  H HB2  . ASN A 1 50 ? 1.759  12.980  5.800   1.00 0.00 ? 50 ASN A HB2  7  
ATOM 8049  H HB3  . ASN A 1 50 ? 3.015  12.649  6.999   1.00 0.00 ? 50 ASN A HB3  7  
ATOM 8050  H HD21 . ASN A 1 50 ? 4.364  14.246  7.631   1.00 0.00 ? 50 ASN A HD21 7  
ATOM 8051  H HD22 . ASN A 1 50 ? 4.186  15.899  7.148   1.00 0.00 ? 50 ASN A HD22 7  
ATOM 8052  N N    . GLY A 1 51 ? 3.957  13.767  2.947   1.00 0.00 ? 51 GLY A N    7  
ATOM 8053  C CA   . GLY A 1 51 ? 3.525  14.260  1.666   1.00 0.00 ? 51 GLY A CA   7  
ATOM 8054  C C    . GLY A 1 51 ? 4.641  14.808  0.794   1.00 0.00 ? 51 GLY A C    7  
ATOM 8055  O O    . GLY A 1 51 ? 4.386  15.303  -0.296  1.00 0.00 ? 51 GLY A O    7  
ATOM 8056  H H    . GLY A 1 51 ? 4.794  14.114  3.351   1.00 0.00 ? 51 GLY A H    7  
ATOM 8057  H HA2  . GLY A 1 51 ? 3.041  13.456  1.123   1.00 0.00 ? 51 GLY A HA2  7  
ATOM 8058  H HA3  . GLY A 1 51 ? 2.795  15.047  1.811   1.00 0.00 ? 51 GLY A HA3  7  
ATOM 8059  N N    . VAL A 1 52 ? 5.882  14.711  1.247   1.00 0.00 ? 52 VAL A N    7  
ATOM 8060  C CA   . VAL A 1 52 ? 7.002  15.234  0.462   1.00 0.00 ? 52 VAL A CA   7  
ATOM 8061  C C    . VAL A 1 52 ? 7.958  14.117  0.036   1.00 0.00 ? 52 VAL A C    7  
ATOM 8062  O O    . VAL A 1 52 ? 7.975  13.034  0.642   1.00 0.00 ? 52 VAL A O    7  
ATOM 8063  C CB   . VAL A 1 52 ? 7.765  16.342  1.231   1.00 0.00 ? 52 VAL A CB   7  
ATOM 8064  C CG1  . VAL A 1 52 ? 6.924  17.593  1.343   1.00 0.00 ? 52 VAL A CG1  7  
ATOM 8065  C CG2  . VAL A 1 52 ? 8.184  15.866  2.601   1.00 0.00 ? 52 VAL A CG2  7  
ATOM 8066  H H    . VAL A 1 52 ? 6.047  14.310  2.106   1.00 0.00 ? 52 VAL A H    7  
ATOM 8067  H HA   . VAL A 1 52 ? 6.580  15.684  -0.434  1.00 0.00 ? 52 VAL A HA   7  
ATOM 8068  H HB   . VAL A 1 52 ? 8.655  16.588  0.664   1.00 0.00 ? 52 VAL A HB   7  
ATOM 8069  H HG11 . VAL A 1 52 ? 6.694  17.963  0.356   1.00 0.00 ? 52 VAL A HG11 7  
ATOM 8070  H HG12 . VAL A 1 52 ? 7.466  18.345  1.888   1.00 0.00 ? 52 VAL A HG12 7  
ATOM 8071  H HG13 . VAL A 1 52 ? 6.004  17.359  1.872   1.00 0.00 ? 52 VAL A HG13 7  
ATOM 8072  H HG21 . VAL A 1 52 ? 8.775  14.971  2.515   1.00 0.00 ? 52 VAL A HG21 7  
ATOM 8073  H HG22 . VAL A 1 52 ? 7.298  15.652  3.187   1.00 0.00 ? 52 VAL A HG22 7  
ATOM 8074  H HG23 . VAL A 1 52 ? 8.768  16.633  3.093   1.00 0.00 ? 52 VAL A HG23 7  
ATOM 8075  N N    . PRO A 1 53 ? 8.749  14.358  -1.035  1.00 0.00 ? 53 PRO A N    7  
ATOM 8076  C CA   . PRO A 1 53 ? 9.690  13.377  -1.599  1.00 0.00 ? 53 PRO A CA   7  
ATOM 8077  C C    . PRO A 1 53 ? 10.658 12.693  -0.601  1.00 0.00 ? 53 PRO A C    7  
ATOM 8078  O O    . PRO A 1 53 ? 10.894 11.490  -0.741  1.00 0.00 ? 53 PRO A O    7  
ATOM 8079  C CB   . PRO A 1 53 ? 10.491 14.180  -2.640  1.00 0.00 ? 53 PRO A CB   7  
ATOM 8080  C CG   . PRO A 1 53 ? 10.077 15.614  -2.479  1.00 0.00 ? 53 PRO A CG   7  
ATOM 8081  C CD   . PRO A 1 53 ? 8.734  15.597  -1.815  1.00 0.00 ? 53 PRO A CD   7  
ATOM 8082  H HA   . PRO A 1 53 ? 9.147  12.608  -2.124  1.00 0.00 ? 53 PRO A HA   7  
ATOM 8083  H HB2  . PRO A 1 53 ? 11.549 14.051  -2.442  1.00 0.00 ? 53 PRO A HB2  7  
ATOM 8084  H HB3  . PRO A 1 53 ? 10.259 13.814  -3.624  1.00 0.00 ? 53 PRO A HB3  7  
ATOM 8085  H HG2  . PRO A 1 53 ? 10.792 16.143  -1.872  1.00 0.00 ? 53 PRO A HG2  7  
ATOM 8086  H HG3  . PRO A 1 53 ? 10.000 16.065  -3.456  1.00 0.00 ? 53 PRO A HG3  7  
ATOM 8087  H HD2  . PRO A 1 53 ? 8.625  16.459  -1.176  1.00 0.00 ? 53 PRO A HD2  7  
ATOM 8088  H HD3  . PRO A 1 53 ? 7.937  15.575  -2.547  1.00 0.00 ? 53 PRO A HD3  7  
ATOM 8089  N N    . PRO A 1 54 ? 11.273 13.427  0.375   1.00 0.00 ? 54 PRO A N    7  
ATOM 8090  C CA   . PRO A 1 54 ? 12.226 12.827  1.308   1.00 0.00 ? 54 PRO A CA   7  
ATOM 8091  C C    . PRO A 1 54 ? 11.661 11.627  2.082   1.00 0.00 ? 54 PRO A C    7  
ATOM 8092  O O    . PRO A 1 54 ? 10.610 11.717  2.723   1.00 0.00 ? 54 PRO A O    7  
ATOM 8093  C CB   . PRO A 1 54 ? 12.585 13.968  2.277   1.00 0.00 ? 54 PRO A CB   7  
ATOM 8094  C CG   . PRO A 1 54 ? 11.570 15.036  2.033   1.00 0.00 ? 54 PRO A CG   7  
ATOM 8095  C CD   . PRO A 1 54 ? 11.121 14.864  0.610   1.00 0.00 ? 54 PRO A CD   7  
ATOM 8096  H HA   . PRO A 1 54 ? 13.125 12.508  0.803   1.00 0.00 ? 54 PRO A HA   7  
ATOM 8097  H HB2  . PRO A 1 54 ? 12.521 13.599  3.298   1.00 0.00 ? 54 PRO A HB2  7  
ATOM 8098  H HB3  . PRO A 1 54 ? 13.586 14.311  2.076   1.00 0.00 ? 54 PRO A HB3  7  
ATOM 8099  H HG2  . PRO A 1 54 ? 10.737 14.914  2.711   1.00 0.00 ? 54 PRO A HG2  7  
ATOM 8100  H HG3  . PRO A 1 54 ? 12.021 16.013  2.169   1.00 0.00 ? 54 PRO A HG3  7  
ATOM 8101  H HD2  . PRO A 1 54 ? 10.087 15.157  0.496   1.00 0.00 ? 54 PRO A HD2  7  
ATOM 8102  H HD3  . PRO A 1 54 ? 11.756 15.431  -0.046  1.00 0.00 ? 54 PRO A HD3  7  
ATOM 8103  N N    . VAL A 1 55 ? 12.388 10.508  2.007   1.00 0.00 ? 55 VAL A N    7  
ATOM 8104  C CA   . VAL A 1 55 ? 12.043 9.285   2.710   1.00 0.00 ? 55 VAL A CA   7  
ATOM 8105  C C    . VAL A 1 55 ? 13.255 8.751   3.466   1.00 0.00 ? 55 VAL A C    7  
ATOM 8106  O O    . VAL A 1 55 ? 14.383 8.805   2.969   1.00 0.00 ? 55 VAL A O    7  
ATOM 8107  C CB   . VAL A 1 55 ? 11.489 8.207   1.735   1.00 0.00 ? 55 VAL A CB   7  
ATOM 8108  C CG1  . VAL A 1 55 ? 12.523 7.793   0.712   1.00 0.00 ? 55 VAL A CG1  7  
ATOM 8109  C CG2  . VAL A 1 55 ? 11.002 7.004   2.517   1.00 0.00 ? 55 VAL A CG2  7  
ATOM 8110  H H    . VAL A 1 55 ? 13.202 10.522  1.456   1.00 0.00 ? 55 VAL A H    7  
ATOM 8111  H HA   . VAL A 1 55 ? 11.270 9.528   3.422   1.00 0.00 ? 55 VAL A HA   7  
ATOM 8112  H HB   . VAL A 1 55 ? 10.648 8.617   1.210   1.00 0.00 ? 55 VAL A HB   7  
ATOM 8113  H HG11 . VAL A 1 55 ? 13.405 7.412   1.226   1.00 0.00 ? 55 VAL A HG11 7  
ATOM 8114  H HG12 . VAL A 1 55 ? 12.792 8.649   0.112   1.00 0.00 ? 55 VAL A HG12 7  
ATOM 8115  H HG13 . VAL A 1 55 ? 12.114 7.024   0.093   1.00 0.00 ? 55 VAL A HG13 7  
ATOM 8116  H HG21 . VAL A 1 55 ? 10.219 7.296   3.182   1.00 0.00 ? 55 VAL A HG21 7  
ATOM 8117  H HG22 . VAL A 1 55 ? 11.825 6.576   3.063   1.00 0.00 ? 55 VAL A HG22 7  
ATOM 8118  H HG23 . VAL A 1 55 ? 10.616 6.271   1.822   1.00 0.00 ? 55 VAL A HG23 7  
ATOM 8119  N N    . GLN A 1 56 ? 13.036 8.242   4.664   1.00 0.00 ? 56 GLN A N    7  
ATOM 8120  C CA   . GLN A 1 56 ? 14.126 7.746   5.491   1.00 0.00 ? 56 GLN A CA   7  
ATOM 8121  C C    . GLN A 1 56 ? 14.312 6.241   5.271   1.00 0.00 ? 56 GLN A C    7  
ATOM 8122  O O    . GLN A 1 56 ? 13.467 5.438   5.691   1.00 0.00 ? 56 GLN A O    7  
ATOM 8123  C CB   . GLN A 1 56 ? 13.852 8.035   6.963   1.00 0.00 ? 56 GLN A CB   7  
ATOM 8124  C CG   . GLN A 1 56 ? 14.891 7.423   7.907   1.00 0.00 ? 56 GLN A CG   7  
ATOM 8125  C CD   . GLN A 1 56 ? 14.726 7.881   9.325   1.00 0.00 ? 56 GLN A CD   7  
ATOM 8126  O OE1  . GLN A 1 56 ? 13.628 8.157   9.785   1.00 0.00 ? 56 GLN A OE1  7  
ATOM 8127  N NE2  . GLN A 1 56 ? 15.845 7.971   10.042  1.00 0.00 ? 56 GLN A NE2  7  
ATOM 8128  H H    . GLN A 1 56 ? 12.118 8.154   4.992   1.00 0.00 ? 56 GLN A H    7  
ATOM 8129  H HA   . GLN A 1 56 ? 15.028 8.243   5.189   1.00 0.00 ? 56 GLN A HA   7  
ATOM 8130  H HB2  . GLN A 1 56 ? 13.850 9.104   7.118   1.00 0.00 ? 56 GLN A HB2  7  
ATOM 8131  H HB3  . GLN A 1 56 ? 12.882 7.628   7.230   1.00 0.00 ? 56 GLN A HB3  7  
ATOM 8132  H HG2  . GLN A 1 56 ? 14.766 6.356   7.885   1.00 0.00 ? 56 GLN A HG2  7  
ATOM 8133  H HG3  . GLN A 1 56 ? 15.877 7.684   7.558   1.00 0.00 ? 56 GLN A HG3  7  
ATOM 8134  H HE21 . GLN A 1 56 ? 16.694 7.731   9.605   1.00 0.00 ? 56 GLN A HE21 7  
ATOM 8135  H HE22 . GLN A 1 56 ? 15.769 8.268   10.972  1.00 0.00 ? 56 GLN A HE22 7  
ATOM 8136  N N    . VAL A 1 57 ? 15.378 5.874   4.587   1.00 0.00 ? 57 VAL A N    7  
ATOM 8137  C CA   . VAL A 1 57 ? 15.654 4.474   4.269   1.00 0.00 ? 57 VAL A CA   7  
ATOM 8138  C C    . VAL A 1 57 ? 17.022 4.070   4.798   1.00 0.00 ? 57 VAL A C    7  
ATOM 8139  O O    . VAL A 1 57 ? 18.014 4.781   4.619   1.00 0.00 ? 57 VAL A O    7  
ATOM 8140  C CB   . VAL A 1 57 ? 15.608 4.213   2.748   1.00 0.00 ? 57 VAL A CB   7  
ATOM 8141  C CG1  . VAL A 1 57 ? 15.993 2.783   2.418   1.00 0.00 ? 57 VAL A CG1  7  
ATOM 8142  C CG2  . VAL A 1 57 ? 14.214 4.514   2.191   1.00 0.00 ? 57 VAL A CG2  7  
ATOM 8143  H H    . VAL A 1 57 ? 16.014 6.552   4.263   1.00 0.00 ? 57 VAL A H    7  
ATOM 8144  H HA   . VAL A 1 57 ? 14.901 3.858   4.751   1.00 0.00 ? 57 VAL A HA   7  
ATOM 8145  H HB   . VAL A 1 57 ? 16.316 4.871   2.277   1.00 0.00 ? 57 VAL A HB   7  
ATOM 8146  H HG11 . VAL A 1 57 ? 16.994 2.592   2.792   1.00 0.00 ? 57 VAL A HG11 7  
ATOM 8147  H HG12 . VAL A 1 57 ? 15.982 2.630   1.352   1.00 0.00 ? 57 VAL A HG12 7  
ATOM 8148  H HG13 . VAL A 1 57 ? 15.303 2.093   2.894   1.00 0.00 ? 57 VAL A HG13 7  
ATOM 8149  H HG21 . VAL A 1 57 ? 13.959 5.534   2.424   1.00 0.00 ? 57 VAL A HG21 7  
ATOM 8150  H HG22 . VAL A 1 57 ? 13.482 3.839   2.637   1.00 0.00 ? 57 VAL A HG22 7  
ATOM 8151  H HG23 . VAL A 1 57 ? 14.223 4.377   1.132   1.00 0.00 ? 57 VAL A HG23 7  
ATOM 8152  N N    . PHE A 1 58 ? 17.071 2.925   5.463   1.00 0.00 ? 58 PHE A N    7  
ATOM 8153  C CA   . PHE A 1 58 ? 18.317 2.367   5.953   1.00 0.00 ? 58 PHE A CA   7  
ATOM 8154  C C    . PHE A 1 58 ? 18.908 1.448   4.888   1.00 0.00 ? 58 PHE A C    7  
ATOM 8155  O O    . PHE A 1 58 ? 18.346 0.394   4.593   1.00 0.00 ? 58 PHE A O    7  
ATOM 8156  C CB   . PHE A 1 58 ? 18.088 1.585   7.252   1.00 0.00 ? 58 PHE A CB   7  
ATOM 8157  C CG   . PHE A 1 58 ? 19.331 0.916   7.787   1.00 0.00 ? 58 PHE A CG   7  
ATOM 8158  C CD1  . PHE A 1 58 ? 20.245 1.627   8.536   1.00 0.00 ? 58 PHE A CD1  7  
ATOM 8159  C CD2  . PHE A 1 58 ? 19.576 -0.430  7.544   1.00 0.00 ? 58 PHE A CD2  7  
ATOM 8160  C CE1  . PHE A 1 58 ? 21.383 1.013   9.033   1.00 0.00 ? 58 PHE A CE1  7  
ATOM 8161  C CE2  . PHE A 1 58 ? 20.697 -1.046  8.029   1.00 0.00 ? 58 PHE A CE2  7  
ATOM 8162  C CZ   . PHE A 1 58 ? 21.604 -0.323  8.773   1.00 0.00 ? 58 PHE A CZ   7  
ATOM 8163  H H    . PHE A 1 58 ? 16.245 2.428   5.617   1.00 0.00 ? 58 PHE A H    7  
ATOM 8164  H HA   . PHE A 1 58 ? 18.998 3.172   6.139   1.00 0.00 ? 58 PHE A HA   7  
ATOM 8165  H HB2  . PHE A 1 58 ? 17.723 2.264   8.005   1.00 0.00 ? 58 PHE A HB2  7  
ATOM 8166  H HB3  . PHE A 1 58 ? 17.351 0.817   7.069   1.00 0.00 ? 58 PHE A HB3  7  
ATOM 8167  H HD1  . PHE A 1 58 ? 20.074 2.667   8.726   1.00 0.00 ? 58 PHE A HD1  7  
ATOM 8168  H HD2  . PHE A 1 58 ? 18.856 -0.999  6.956   1.00 0.00 ? 58 PHE A HD2  7  
ATOM 8169  H HE1  . PHE A 1 58 ? 22.086 1.576   9.627   1.00 0.00 ? 58 PHE A HE1  7  
ATOM 8170  H HE2  . PHE A 1 58 ? 20.869 -2.095  7.824   1.00 0.00 ? 58 PHE A HE2  7  
ATOM 8171  H HZ   . PHE A 1 58 ? 22.485 -0.814  9.175   1.00 0.00 ? 58 PHE A HZ   7  
ATOM 8172  N N    . TRP A 1 59 ? 20.035 1.836   4.320   1.00 0.00 ? 59 TRP A N    7  
ATOM 8173  C CA   . TRP A 1 59 ? 20.640 1.039   3.271   1.00 0.00 ? 59 TRP A CA   7  
ATOM 8174  C C    . TRP A 1 59 ? 21.621 0.043   3.867   1.00 0.00 ? 59 TRP A C    7  
ATOM 8175  O O    . TRP A 1 59 ? 22.599 0.418   4.481   1.00 0.00 ? 59 TRP A O    7  
ATOM 8176  C CB   . TRP A 1 59 ? 21.321 1.956   2.249   1.00 0.00 ? 59 TRP A CB   7  
ATOM 8177  C CG   . TRP A 1 59 ? 20.348 2.837   1.530   1.00 0.00 ? 59 TRP A CG   7  
ATOM 8178  C CD1  . TRP A 1 59 ? 20.127 4.170   1.740   1.00 0.00 ? 59 TRP A CD1  7  
ATOM 8179  C CD2  . TRP A 1 59 ? 19.447 2.442   0.486   1.00 0.00 ? 59 TRP A CD2  7  
ATOM 8180  N NE1  . TRP A 1 59 ? 19.142 4.631   0.891   1.00 0.00 ? 59 TRP A NE1  7  
ATOM 8181  C CE2  . TRP A 1 59 ? 18.719 3.587   0.120   1.00 0.00 ? 59 TRP A CE2  7  
ATOM 8182  C CE3  . TRP A 1 59 ? 19.187 1.238   -0.175  1.00 0.00 ? 59 TRP A CE3  7  
ATOM 8183  C CZ2  . TRP A 1 59 ? 17.739 3.556   -0.874  1.00 0.00 ? 59 TRP A CZ2  7  
ATOM 8184  C CZ3  . TRP A 1 59 ? 18.217 1.214   -1.158  1.00 0.00 ? 59 TRP A CZ3  7  
ATOM 8185  C CH2  . TRP A 1 59 ? 17.502 2.370   -1.497  1.00 0.00 ? 59 TRP A CH2  7  
ATOM 8186  H H    . TRP A 1 59 ? 20.475 2.651   4.638   1.00 0.00 ? 59 TRP A H    7  
ATOM 8187  H HA   . TRP A 1 59 ? 19.847 0.487   2.774   1.00 0.00 ? 59 TRP A HA   7  
ATOM 8188  H HB2  . TRP A 1 59 ? 22.038 2.576   2.739   1.00 0.00 ? 59 TRP A HB2  7  
ATOM 8189  H HB3  . TRP A 1 59 ? 21.806 1.336   1.515   1.00 0.00 ? 59 TRP A HB3  7  
ATOM 8190  H HD1  . TRP A 1 59 ? 20.654 4.776   2.467   1.00 0.00 ? 59 TRP A HD1  7  
ATOM 8191  H HE1  . TRP A 1 59 ? 18.802 5.549   0.842   1.00 0.00 ? 59 TRP A HE1  7  
ATOM 8192  H HE3  . TRP A 1 59 ? 19.730 0.330   0.075   1.00 0.00 ? 59 TRP A HE3  7  
ATOM 8193  H HZ2  . TRP A 1 59 ? 17.184 4.438   -1.157  1.00 0.00 ? 59 TRP A HZ2  7  
ATOM 8194  H HZ3  . TRP A 1 59 ? 17.999 0.299   -1.688  1.00 0.00 ? 59 TRP A HZ3  7  
ATOM 8195  H HH2  . TRP A 1 59 ? 16.756 2.306   -2.278  1.00 0.00 ? 59 TRP A HH2  7  
ATOM 8196  N N    . GLU A 1 60 ? 21.333 -1.243  3.661   1.00 0.00 ? 60 GLU A N    7  
ATOM 8197  C CA   . GLU A 1 60 ? 22.077 -2.327  4.296   1.00 0.00 ? 60 GLU A CA   7  
ATOM 8198  C C    . GLU A 1 60 ? 23.481 -2.442  3.714   1.00 0.00 ? 60 GLU A C    7  
ATOM 8199  O O    . GLU A 1 60 ? 24.440 -2.754  4.438   1.00 0.00 ? 60 GLU A O    7  
ATOM 8200  C CB   . GLU A 1 60 ? 21.336 -3.655  4.121   1.00 0.00 ? 60 GLU A CB   7  
ATOM 8201  C CG   . GLU A 1 60 ? 19.910 -3.630  4.661   1.00 0.00 ? 60 GLU A CG   7  
ATOM 8202  C CD   . GLU A 1 60 ? 19.172 -4.930  4.427   1.00 0.00 ? 60 GLU A CD   7  
ATOM 8203  O OE1  . GLU A 1 60 ? 18.721 -5.162  3.288   1.00 0.00 ? 60 GLU A OE1  7  
ATOM 8204  O OE2  . GLU A 1 60 ? 19.074 -5.724  5.378   1.00 0.00 ? 60 GLU A OE2  7  
ATOM 8205  H H    . GLU A 1 60 ? 20.599 -1.475  3.061   1.00 0.00 ? 60 GLU A H    7  
ATOM 8206  H HA   . GLU A 1 60 ? 22.137 -2.098  5.346   1.00 0.00 ? 60 GLU A HA   7  
ATOM 8207  H HB2  . GLU A 1 60 ? 21.302 -3.896  3.076   1.00 0.00 ? 60 GLU A HB2  7  
ATOM 8208  H HB3  . GLU A 1 60 ? 21.885 -4.426  4.646   1.00 0.00 ? 60 GLU A HB3  7  
ATOM 8209  H HG2  . GLU A 1 60 ? 19.939 -3.434  5.722   1.00 0.00 ? 60 GLU A HG2  7  
ATOM 8210  H HG3  . GLU A 1 60 ? 19.360 -2.840  4.174   1.00 0.00 ? 60 GLU A HG3  7  
ATOM 8211  N N    . SER A 1 61 ? 23.602 -2.195  2.428   1.00 0.00 ? 61 SER A N    7  
ATOM 8212  C CA   . SER A 1 61 ? 24.861 -2.296  1.732   1.00 0.00 ? 61 SER A CA   7  
ATOM 8213  C C    . SER A 1 61 ? 25.876 -1.287  2.271   1.00 0.00 ? 61 SER A C    7  
ATOM 8214  O O    . SER A 1 61 ? 27.059 -1.582  2.392   1.00 0.00 ? 61 SER A O    7  
ATOM 8215  C CB   . SER A 1 61 ? 24.636 -2.104  0.236   1.00 0.00 ? 61 SER A CB   7  
ATOM 8216  O OG   . SER A 1 61 ? 23.696 -1.053  0.007   1.00 0.00 ? 61 SER A OG   7  
ATOM 8217  H H    . SER A 1 61 ? 22.802 -1.949  1.911   1.00 0.00 ? 61 SER A H    7  
ATOM 8218  H HA   . SER A 1 61 ? 25.250 -3.290  1.907   1.00 0.00 ? 61 SER A HA   7  
ATOM 8219  H HB2  . SER A 1 61 ? 25.567 -1.845  -0.242  1.00 0.00 ? 61 SER A HB2  7  
ATOM 8220  H HB3  . SER A 1 61 ? 24.250 -3.019  -0.194  1.00 0.00 ? 61 SER A HB3  7  
ATOM 8221  H HG   . SER A 1 61 ? 23.903 -0.609  -0.832  1.00 0.00 ? 61 SER A HG   7  
ATOM 8222  N N    . THR A 1 62 ? 25.400 -0.087  2.578   1.00 0.00 ? 62 THR A N    7  
ATOM 8223  C CA   . THR A 1 62 ? 26.264 0.943   3.113   1.00 0.00 ? 62 THR A CA   7  
ATOM 8224  C C    . THR A 1 62 ? 26.353 0.807   4.638   1.00 0.00 ? 62 THR A C    7  
ATOM 8225  O O    . THR A 1 62 ? 27.402 0.973   5.228   1.00 0.00 ? 62 THR A O    7  
ATOM 8226  C CB   . THR A 1 62 ? 25.711 2.338   2.761   1.00 0.00 ? 62 THR A CB   7  
ATOM 8227  O OG1  . THR A 1 62 ? 25.224 2.322   1.406   1.00 0.00 ? 62 THR A OG1  7  
ATOM 8228  C CG2  . THR A 1 62 ? 26.774 3.419   2.918   1.00 0.00 ? 62 THR A CG2  7  
ATOM 8229  H H    . THR A 1 62 ? 24.439 0.100   2.433   1.00 0.00 ? 62 THR A H    7  
ATOM 8230  H HA   . THR A 1 62 ? 27.245 0.836   2.682   1.00 0.00 ? 62 THR A HA   7  
ATOM 8231  H HB   . THR A 1 62 ? 24.897 2.562   3.439   1.00 0.00 ? 62 THR A HB   7  
ATOM 8232  H HG1  . THR A 1 62 ? 25.788 1.767   0.857   1.00 0.00 ? 62 THR A HG1  7  
ATOM 8233  H HG21 . THR A 1 62 ? 27.610 3.196   2.275   1.00 0.00 ? 62 THR A HG21 7  
ATOM 8234  H HG22 . THR A 1 62 ? 27.101 3.460   3.939   1.00 0.00 ? 62 THR A HG22 7  
ATOM 8235  H HG23 . THR A 1 62 ? 26.346 4.380   2.643   1.00 0.00 ? 62 THR A HG23 7  
ATOM 8236  N N    . GLY A 1 63 ? 25.214 0.494   5.239   1.00 0.00 ? 63 GLY A N    7  
ATOM 8237  C CA   . GLY A 1 63 ? 25.149 0.281   6.662   1.00 0.00 ? 63 GLY A CA   7  
ATOM 8238  C C    . GLY A 1 63 ? 24.751 1.525   7.411   1.00 0.00 ? 63 GLY A C    7  
ATOM 8239  O O    . GLY A 1 63 ? 25.075 1.687   8.588   1.00 0.00 ? 63 GLY A O    7  
ATOM 8240  H H    . GLY A 1 63 ? 24.405 0.444   4.695   1.00 0.00 ? 63 GLY A H    7  
ATOM 8241  H HA2  . GLY A 1 63 ? 24.427 -0.491  6.868   1.00 0.00 ? 63 GLY A HA2  7  
ATOM 8242  H HA3  . GLY A 1 63 ? 26.116 -0.038  7.015   1.00 0.00 ? 63 GLY A HA3  7  
ATOM 8243  N N    . ARG A 1 64 ? 24.041 2.423   6.740   1.00 0.00 ? 64 ARG A N    7  
ATOM 8244  C CA   . ARG A 1 64 ? 23.621 3.666   7.354   1.00 0.00 ? 64 ARG A CA   7  
ATOM 8245  C C    . ARG A 1 64 ? 22.336 4.146   6.717   1.00 0.00 ? 64 ARG A C    7  
ATOM 8246  O O    . ARG A 1 64 ? 21.939 3.658   5.659   1.00 0.00 ? 64 ARG A O    7  
ATOM 8247  C CB   . ARG A 1 64 ? 24.720 4.727   7.235   1.00 0.00 ? 64 ARG A CB   7  
ATOM 8248  C CG   . ARG A 1 64 ? 25.237 4.951   5.819   1.00 0.00 ? 64 ARG A CG   7  
ATOM 8249  C CD   . ARG A 1 64 ? 26.275 6.053   5.777   1.00 0.00 ? 64 ARG A CD   7  
ATOM 8250  N NE   . ARG A 1 64 ? 27.362 5.821   6.746   1.00 0.00 ? 64 ARG A NE   7  
ATOM 8251  C CZ   . ARG A 1 64 ? 28.628 5.586   6.398   1.00 0.00 ? 64 ARG A CZ   7  
ATOM 8252  N NH1  . ARG A 1 64 ? 28.995 5.530   5.115   1.00 0.00 ? 64 ARG A NH1  7  
ATOM 8253  N NH2  . ARG A 1 64 ? 29.548 5.410   7.349   1.00 0.00 ? 64 ARG A NH2  7  
ATOM 8254  H H    . ARG A 1 64 ? 23.773 2.229   5.819   1.00 0.00 ? 64 ARG A H    7  
ATOM 8255  H HA   . ARG A 1 64 ? 23.450 3.461   8.404   1.00 0.00 ? 64 ARG A HA   7  
ATOM 8256  H HB2  . ARG A 1 64 ? 24.347 5.670   7.601   1.00 0.00 ? 64 ARG A HB2  7  
ATOM 8257  H HB3  . ARG A 1 64 ? 25.563 4.420   7.849   1.00 0.00 ? 64 ARG A HB3  7  
ATOM 8258  H HG2  . ARG A 1 64 ? 25.684 4.032   5.461   1.00 0.00 ? 64 ARG A HG2  7  
ATOM 8259  H HG3  . ARG A 1 64 ? 24.413 5.228   5.186   1.00 0.00 ? 64 ARG A HG3  7  
ATOM 8260  H HD2  . ARG A 1 64 ? 26.694 6.102   4.777   1.00 0.00 ? 64 ARG A HD2  7  
ATOM 8261  H HD3  . ARG A 1 64 ? 25.795 6.989   6.007   1.00 0.00 ? 64 ARG A HD3  7  
ATOM 8262  H HE   . ARG A 1 64 ? 27.129 5.865   7.698   1.00 0.00 ? 64 ARG A HE   7  
ATOM 8263  H HH11 . ARG A 1 64 ? 28.306 5.679   4.405   1.00 0.00 ? 64 ARG A HH11 7  
ATOM 8264  H HH12 . ARG A 1 64 ? 29.958 5.340   4.859   1.00 0.00 ? 64 ARG A HH12 7  
ATOM 8265  H HH21 . ARG A 1 64 ? 29.284 5.464   8.317   1.00 0.00 ? 64 ARG A HH21 7  
ATOM 8266  H HH22 . ARG A 1 64 ? 30.513 5.231   7.106   1.00 0.00 ? 64 ARG A HH22 7  
ATOM 8267  N N    . THR A 1 65 ? 21.674 5.090   7.360   1.00 0.00 ? 65 THR A N    7  
ATOM 8268  C CA   . THR A 1 65 ? 20.409 5.594   6.868   1.00 0.00 ? 65 THR A CA   7  
ATOM 8269  C C    . THR A 1 65 ? 20.628 6.801   5.957   1.00 0.00 ? 65 THR A C    7  
ATOM 8270  O O    . THR A 1 65 ? 21.585 7.559   6.124   1.00 0.00 ? 65 THR A O    7  
ATOM 8271  C CB   . THR A 1 65 ? 19.500 5.987   8.057   1.00 0.00 ? 65 THR A CB   7  
ATOM 8272  O OG1  . THR A 1 65 ? 19.548 4.961   9.074   1.00 0.00 ? 65 THR A OG1  7  
ATOM 8273  C CG2  . THR A 1 65 ? 18.056 6.160   7.608   1.00 0.00 ? 65 THR A CG2  7  
ATOM 8274  H H    . THR A 1 65 ? 22.042 5.450   8.197   1.00 0.00 ? 65 THR A H    7  
ATOM 8275  H HA   . THR A 1 65 ? 19.920 4.817   6.308   1.00 0.00 ? 65 THR A HA   7  
ATOM 8276  H HB   . THR A 1 65 ? 19.849 6.912   8.475   1.00 0.00 ? 65 THR A HB   7  
ATOM 8277  H HG1  . THR A 1 65 ? 19.840 5.347   9.907   1.00 0.00 ? 65 THR A HG1  7  
ATOM 8278  H HG21 . THR A 1 65 ? 17.452 6.440   8.462   1.00 0.00 ? 65 THR A HG21 7  
ATOM 8279  H HG22 . THR A 1 65 ? 17.689 5.219   7.216   1.00 0.00 ? 65 THR A HG22 7  
ATOM 8280  H HG23 . THR A 1 65 ? 17.989 6.926   6.838   1.00 0.00 ? 65 THR A HG23 7  
ATOM 8281  N N    . TYR A 1 66 ? 19.735 6.962   4.998   1.00 0.00 ? 66 TYR A N    7  
ATOM 8282  C CA   . TYR A 1 66 ? 19.834 8.027   4.008   1.00 0.00 ? 66 TYR A CA   7  
ATOM 8283  C C    . TYR A 1 66 ? 18.438 8.452   3.574   1.00 0.00 ? 66 TYR A C    7  
ATOM 8284  O O    . TYR A 1 66 ? 17.526 7.629   3.514   1.00 0.00 ? 66 TYR A O    7  
ATOM 8285  C CB   . TYR A 1 66 ? 20.637 7.535   2.782   1.00 0.00 ? 66 TYR A CB   7  
ATOM 8286  C CG   . TYR A 1 66 ? 21.199 8.645   1.915   1.00 0.00 ? 66 TYR A CG   7  
ATOM 8287  C CD1  . TYR A 1 66 ? 22.181 9.497   2.392   1.00 0.00 ? 66 TYR A CD1  7  
ATOM 8288  C CD2  . TYR A 1 66 ? 20.750 8.835   0.609   1.00 0.00 ? 66 TYR A CD2  7  
ATOM 8289  C CE1  . TYR A 1 66 ? 22.699 10.501  1.600   1.00 0.00 ? 66 TYR A CE1  7  
ATOM 8290  C CE2  . TYR A 1 66 ? 21.263 9.838   -0.188  1.00 0.00 ? 66 TYR A CE2  7  
ATOM 8291  C CZ   . TYR A 1 66 ? 22.237 10.668  0.312   1.00 0.00 ? 66 TYR A CZ   7  
ATOM 8292  O OH   . TYR A 1 66 ? 22.778 11.660  -0.467  1.00 0.00 ? 66 TYR A OH   7  
ATOM 8293  H H    . TYR A 1 66 ? 18.961 6.362   4.981   1.00 0.00 ? 66 TYR A H    7  
ATOM 8294  H HA   . TYR A 1 66 ? 20.346 8.861   4.466   1.00 0.00 ? 66 TYR A HA   7  
ATOM 8295  H HB2  . TYR A 1 66 ? 21.469 6.935   3.129   1.00 0.00 ? 66 TYR A HB2  7  
ATOM 8296  H HB3  . TYR A 1 66 ? 19.990 6.924   2.167   1.00 0.00 ? 66 TYR A HB3  7  
ATOM 8297  H HD1  . TYR A 1 66 ? 22.541 9.368   3.408   1.00 0.00 ? 66 TYR A HD1  7  
ATOM 8298  H HD2  . TYR A 1 66 ? 19.992 8.177   0.214   1.00 0.00 ? 66 TYR A HD2  7  
ATOM 8299  H HE1  . TYR A 1 66 ? 23.463 11.152  1.990   1.00 0.00 ? 66 TYR A HE1  7  
ATOM 8300  H HE2  . TYR A 1 66 ? 20.894 9.964   -1.196  1.00 0.00 ? 66 TYR A HE2  7  
ATOM 8301  H HH   . TYR A 1 66 ? 22.093 12.035  -1.058  1.00 0.00 ? 66 TYR A HH   7  
ATOM 8302  N N    . TRP A 1 67 ? 18.263 9.742   3.279   1.00 0.00 ? 67 TRP A N    7  
ATOM 8303  C CA   . TRP A 1 67 ? 16.989 10.250  2.825   1.00 0.00 ? 67 TRP A CA   7  
ATOM 8304  C C    . TRP A 1 67 ? 16.967 10.279  1.311   1.00 0.00 ? 67 TRP A C    7  
ATOM 8305  O O    . TRP A 1 67 ? 17.712 11.033  0.676   1.00 0.00 ? 67 TRP A O    7  
ATOM 8306  C CB   . TRP A 1 67 ? 16.723 11.644  3.408   1.00 0.00 ? 67 TRP A CB   7  
ATOM 8307  C CG   . TRP A 1 67 ? 16.538 11.634  4.890   1.00 0.00 ? 67 TRP A CG   7  
ATOM 8308  C CD1  . TRP A 1 67 ? 15.416 11.297  5.580   1.00 0.00 ? 67 TRP A CD1  7  
ATOM 8309  C CD2  . TRP A 1 67 ? 17.523 11.967  5.879   1.00 0.00 ? 67 TRP A CD2  7  
ATOM 8310  N NE1  . TRP A 1 67 ? 15.635 11.395  6.935   1.00 0.00 ? 67 TRP A NE1  7  
ATOM 8311  C CE2  . TRP A 1 67 ? 16.924 11.808  7.148   1.00 0.00 ? 67 TRP A CE2  7  
ATOM 8312  C CE3  . TRP A 1 67 ? 18.853 12.380  5.820   1.00 0.00 ? 67 TRP A CE3  7  
ATOM 8313  C CZ2  . TRP A 1 67 ? 17.605 12.048  8.333   1.00 0.00 ? 67 TRP A CZ2  7  
ATOM 8314  C CZ3  . TRP A 1 67 ? 19.525 12.622  7.001   1.00 0.00 ? 67 TRP A CZ3  7  
ATOM 8315  C CH2  . TRP A 1 67 ? 18.902 12.458  8.238   1.00 0.00 ? 67 TRP A CH2  7  
ATOM 8316  H H    . TRP A 1 67 ? 19.026 10.354  3.349   1.00 0.00 ? 67 TRP A H    7  
ATOM 8317  H HA   . TRP A 1 67 ? 16.215 9.577   3.151   1.00 0.00 ? 67 TRP A HA   7  
ATOM 8318  H HB2  . TRP A 1 67 ? 17.556 12.292  3.169   1.00 0.00 ? 67 TRP A HB2  7  
ATOM 8319  H HB3  . TRP A 1 67 ? 15.819 12.040  2.961   1.00 0.00 ? 67 TRP A HB3  7  
ATOM 8320  H HD1  . TRP A 1 67 ? 14.487 10.996  5.108   1.00 0.00 ? 67 TRP A HD1  7  
ATOM 8321  H HE1  . TRP A 1 67 ? 14.968 11.207  7.638   1.00 0.00 ? 67 TRP A HE1  7  
ATOM 8322  H HE3  . TRP A 1 67 ? 19.358 12.520  4.864   1.00 0.00 ? 67 TRP A HE3  7  
ATOM 8323  H HZ2  . TRP A 1 67 ? 17.139 11.930  9.296   1.00 0.00 ? 67 TRP A HZ2  7  
ATOM 8324  H HZ3  . TRP A 1 67 ? 20.555 12.949  6.970   1.00 0.00 ? 67 TRP A HZ3  7  
ATOM 8325  H HH2  . TRP A 1 67 ? 19.462 12.666  9.130   1.00 0.00 ? 67 TRP A HH2  7  
ATOM 8326  N N    . VAL A 1 68 ? 16.100 9.468   0.738   1.00 0.00 ? 68 VAL A N    7  
ATOM 8327  C CA   . VAL A 1 68 ? 15.998 9.306   -0.695  1.00 0.00 ? 68 VAL A CA   7  
ATOM 8328  C C    . VAL A 1 68 ? 14.692 9.917   -1.176  1.00 0.00 ? 68 VAL A C    7  
ATOM 8329  O O    . VAL A 1 68 ? 13.911 10.423  -0.366  1.00 0.00 ? 68 VAL A O    7  
ATOM 8330  C CB   . VAL A 1 68 ? 16.071 7.801   -1.067  1.00 0.00 ? 68 VAL A CB   7  
ATOM 8331  C CG1  . VAL A 1 68 ? 16.447 7.586   -2.514  1.00 0.00 ? 68 VAL A CG1  7  
ATOM 8332  C CG2  . VAL A 1 68 ? 17.038 7.082   -0.153  1.00 0.00 ? 68 VAL A CG2  7  
ATOM 8333  H H    . VAL A 1 68 ? 15.494 8.946   1.304   1.00 0.00 ? 68 VAL A H    7  
ATOM 8334  H HA   . VAL A 1 68 ? 16.835 9.820   -1.154  1.00 0.00 ? 68 VAL A HA   7  
ATOM 8335  H HB   . VAL A 1 68 ? 15.085 7.376   -0.909  1.00 0.00 ? 68 VAL A HB   7  
ATOM 8336  H HG11 . VAL A 1 68 ? 15.649 7.936   -3.151  1.00 0.00 ? 68 VAL A HG11 7  
ATOM 8337  H HG12 . VAL A 1 68 ? 16.606 6.532   -2.687  1.00 0.00 ? 68 VAL A HG12 7  
ATOM 8338  H HG13 . VAL A 1 68 ? 17.356 8.126   -2.745  1.00 0.00 ? 68 VAL A HG13 7  
ATOM 8339  H HG21 . VAL A 1 68 ? 17.082 6.046   -0.430  1.00 0.00 ? 68 VAL A HG21 7  
ATOM 8340  H HG22 . VAL A 1 68 ? 16.694 7.159   0.867   1.00 0.00 ? 68 VAL A HG22 7  
ATOM 8341  H HG23 . VAL A 1 68 ? 18.014 7.521   -0.234  1.00 0.00 ? 68 VAL A HG23 7  
ATOM 8342  N N    . HIS A 1 69 ? 14.468 9.932   -2.476  1.00 0.00 ? 69 HIS A N    7  
ATOM 8343  C CA   . HIS A 1 69 ? 13.189 10.379  -3.037  1.00 0.00 ? 69 HIS A CA   7  
ATOM 8344  C C    . HIS A 1 69 ? 12.381 9.213   -3.597  1.00 0.00 ? 69 HIS A C    7  
ATOM 8345  O O    . HIS A 1 69 ? 12.959 8.243   -4.108  1.00 0.00 ? 69 HIS A O    7  
ATOM 8346  C CB   . HIS A 1 69 ? 13.425 11.451  -4.111  1.00 0.00 ? 69 HIS A CB   7  
ATOM 8347  C CG   . HIS A 1 69 ? 14.118 12.676  -3.578  1.00 0.00 ? 69 HIS A CG   7  
ATOM 8348  N ND1  . HIS A 1 69 ? 15.094 13.349  -4.291  1.00 0.00 ? 69 HIS A ND1  7  
ATOM 8349  C CD2  . HIS A 1 69 ? 13.969 13.347  -2.422  1.00 0.00 ? 69 HIS A CD2  7  
ATOM 8350  C CE1  . HIS A 1 69 ? 15.507 14.388  -3.573  1.00 0.00 ? 69 HIS A CE1  7  
ATOM 8351  N NE2  . HIS A 1 69 ? 14.837 14.407  -2.439  1.00 0.00 ? 69 HIS A NE2  7  
ATOM 8352  H H    . HIS A 1 69 ? 15.194 9.685   -3.097  1.00 0.00 ? 69 HIS A H    7  
ATOM 8353  H HA   . HIS A 1 69 ? 12.628 10.822  -2.233  1.00 0.00 ? 69 HIS A HA   7  
ATOM 8354  H HB2  . HIS A 1 69 ? 14.029 11.031  -4.897  1.00 0.00 ? 69 HIS A HB2  7  
ATOM 8355  H HB3  . HIS A 1 69 ? 12.471 11.765  -4.514  1.00 0.00 ? 69 HIS A HB3  7  
ATOM 8356  H HD1  . HIS A 1 69 ? 15.422 13.116  -5.187  1.00 0.00 ? 69 HIS A HD1  7  
ATOM 8357  H HD2  . HIS A 1 69 ? 13.277 13.096  -1.627  1.00 0.00 ? 69 HIS A HD2  7  
ATOM 8358  H HE1  . HIS A 1 69 ? 16.266 15.094  -3.867  1.00 0.00 ? 69 HIS A HE1  7  
ATOM 8359  H HE2  . HIS A 1 69 ? 15.040 14.994  -1.683  1.00 0.00 ? 69 HIS A HE2  7  
ATOM 8360  N N    . TRP A 1 70 ? 11.061 9.307   -3.499  1.00 0.00 ? 70 TRP A N    7  
ATOM 8361  C CA   . TRP A 1 70 ? 10.157 8.217   -3.850  1.00 0.00 ? 70 TRP A CA   7  
ATOM 8362  C C    . TRP A 1 70 ? 10.336 7.705   -5.273  1.00 0.00 ? 70 TRP A C    7  
ATOM 8363  O O    . TRP A 1 70 ? 10.282 6.486   -5.505  1.00 0.00 ? 70 TRP A O    7  
ATOM 8364  C CB   . TRP A 1 70 ? 8.706  8.665   -3.670  1.00 0.00 ? 70 TRP A CB   7  
ATOM 8365  C CG   . TRP A 1 70 ? 8.355  9.073   -2.266  1.00 0.00 ? 70 TRP A CG   7  
ATOM 8366  C CD1  . TRP A 1 70 ? 8.191  10.353  -1.807  1.00 0.00 ? 70 TRP A CD1  7  
ATOM 8367  C CD2  . TRP A 1 70 ? 8.117  8.202   -1.162  1.00 0.00 ? 70 TRP A CD2  7  
ATOM 8368  N NE1  . TRP A 1 70 ? 7.896  10.318  -0.474  1.00 0.00 ? 70 TRP A NE1  7  
ATOM 8369  C CE2  . TRP A 1 70 ? 7.833  9.018   -0.059  1.00 0.00 ? 70 TRP A CE2  7  
ATOM 8370  C CE3  . TRP A 1 70 ? 8.122  6.824   -0.994  1.00 0.00 ? 70 TRP A CE3  7  
ATOM 8371  C CZ2  . TRP A 1 70 ? 7.558  8.503   1.199   1.00 0.00 ? 70 TRP A CZ2  7  
ATOM 8372  C CZ3  . TRP A 1 70 ? 7.847  6.307   0.255   1.00 0.00 ? 70 TRP A CZ3  7  
ATOM 8373  C CH2  . TRP A 1 70 ? 7.565  7.141   1.337   1.00 0.00 ? 70 TRP A CH2  7  
ATOM 8374  H H    . TRP A 1 70 ? 10.678 10.139  -3.136  1.00 0.00 ? 70 TRP A H    7  
ATOM 8375  H HA   . TRP A 1 70 ? 10.361 7.414   -3.167  1.00 0.00 ? 70 TRP A HA   7  
ATOM 8376  H HB2  . TRP A 1 70 ? 8.502  9.502   -4.322  1.00 0.00 ? 70 TRP A HB2  7  
ATOM 8377  H HB3  . TRP A 1 70 ? 8.066  7.830   -3.946  1.00 0.00 ? 70 TRP A HB3  7  
ATOM 8378  H HD1  . TRP A 1 70 ? 8.314  11.238  -2.410  1.00 0.00 ? 70 TRP A HD1  7  
ATOM 8379  H HE1  . TRP A 1 70 ? 7.734  11.111  0.094   1.00 0.00 ? 70 TRP A HE1  7  
ATOM 8380  H HE3  . TRP A 1 70 ? 8.325  6.155   -1.818  1.00 0.00 ? 70 TRP A HE3  7  
ATOM 8381  H HZ2  . TRP A 1 70 ? 7.354  9.139   2.043   1.00 0.00 ? 70 TRP A HZ2  7  
ATOM 8382  H HZ3  . TRP A 1 70 ? 7.834  5.229   0.402   1.00 0.00 ? 70 TRP A HZ3  7  
ATOM 8383  H HH2  . TRP A 1 70 ? 7.355  6.703   2.303   1.00 0.00 ? 70 TRP A HH2  7  
ATOM 8384  N N    . HIS A 1 71 ? 10.540 8.586   -6.236  1.00 0.00 ? 71 HIS A N    7  
ATOM 8385  C CA   . HIS A 1 71 ? 10.512 8.204   -7.660  1.00 0.00 ? 71 HIS A CA   7  
ATOM 8386  C C    . HIS A 1 71 ? 11.689 7.305   -8.057  1.00 0.00 ? 71 HIS A C    7  
ATOM 8387  O O    . HIS A 1 71 ? 11.733 6.789   -9.164  1.00 0.00 ? 71 HIS A O    7  
ATOM 8388  C CB   . HIS A 1 71 ? 10.441 9.434   -8.585  1.00 0.00 ? 71 HIS A CB   7  
ATOM 8389  C CG   . HIS A 1 71 ? 11.655 10.317  -8.590  1.00 0.00 ? 71 HIS A CG   7  
ATOM 8390  N ND1  . HIS A 1 71 ? 11.569 11.676  -8.412  1.00 0.00 ? 71 HIS A ND1  7  
ATOM 8391  C CD2  . HIS A 1 71 ? 12.974 10.049  -8.828  1.00 0.00 ? 71 HIS A CD2  7  
ATOM 8392  C CE1  . HIS A 1 71 ? 12.778 12.209  -8.529  1.00 0.00 ? 71 HIS A CE1  7  
ATOM 8393  N NE2  . HIS A 1 71 ? 13.641 11.251  -8.783  1.00 0.00 ? 71 HIS A NE2  7  
ATOM 8394  H H    . HIS A 1 71 ? 10.701 9.529   -6.001  1.00 0.00 ? 71 HIS A H    7  
ATOM 8395  H HA   . HIS A 1 71 ? 9.610  7.628   -7.796  1.00 0.00 ? 71 HIS A HA   7  
ATOM 8396  H HB2  . HIS A 1 71 ? 10.276 9.092   -9.594  1.00 0.00 ? 71 HIS A HB2  7  
ATOM 8397  H HB3  . HIS A 1 71 ? 9.593  10.046  -8.269  1.00 0.00 ? 71 HIS A HB3  7  
ATOM 8398  H HD1  . HIS A 1 71 ? 10.744 12.187  -8.219  1.00 0.00 ? 71 HIS A HD1  7  
ATOM 8399  H HD2  . HIS A 1 71 ? 13.407 9.074   -9.001  1.00 0.00 ? 71 HIS A HD2  7  
ATOM 8400  H HE1  . HIS A 1 71 ? 13.012 13.259  -8.436  1.00 0.00 ? 71 HIS A HE1  7  
ATOM 8401  H HE2  . HIS A 1 71 ? 14.543 11.393  -9.164  1.00 0.00 ? 71 HIS A HE2  7  
ATOM 8402  N N    . MET A 1 72 ? 12.633 7.125   -7.158  1.00 0.00 ? 72 MET A N    7  
ATOM 8403  C CA   . MET A 1 72 ? 13.786 6.265   -7.417  1.00 0.00 ? 72 MET A CA   7  
ATOM 8404  C C    . MET A 1 72 ? 13.791 5.054   -6.496  1.00 0.00 ? 72 MET A C    7  
ATOM 8405  O O    . MET A 1 72 ? 14.805 4.364   -6.363  1.00 0.00 ? 72 MET A O    7  
ATOM 8406  C CB   . MET A 1 72 ? 15.083 7.082   -7.247  1.00 0.00 ? 72 MET A CB   7  
ATOM 8407  C CG   . MET A 1 72 ? 15.210 7.732   -5.881  1.00 0.00 ? 72 MET A CG   7  
ATOM 8408  S SD   . MET A 1 72 ? 16.706 8.731   -5.740  1.00 0.00 ? 72 MET A SD   7  
ATOM 8409  C CE   . MET A 1 72 ? 16.546 9.824   -7.142  1.00 0.00 ? 72 MET A CE   7  
ATOM 8410  H H    . MET A 1 72 ? 12.559 7.568   -6.288  1.00 0.00 ? 72 MET A H    7  
ATOM 8411  H HA   . MET A 1 72 ? 13.727 5.928   -8.435  1.00 0.00 ? 72 MET A HA   7  
ATOM 8412  H HB2  . MET A 1 72 ? 15.920 6.419   -7.389  1.00 0.00 ? 72 MET A HB2  7  
ATOM 8413  H HB3  . MET A 1 72 ? 15.104 7.855   -7.995  1.00 0.00 ? 72 MET A HB3  7  
ATOM 8414  H HG2  . MET A 1 72 ? 14.350 8.355   -5.710  1.00 0.00 ? 72 MET A HG2  7  
ATOM 8415  H HG3  . MET A 1 72 ? 15.241 6.958   -5.135  1.00 0.00 ? 72 MET A HG3  7  
ATOM 8416  H HE1  . MET A 1 72 ? 16.536 9.245   -8.049  1.00 0.00 ? 72 MET A HE1  7  
ATOM 8417  H HE2  . MET A 1 72 ? 17.379 10.505  -7.156  1.00 0.00 ? 72 MET A HE2  7  
ATOM 8418  H HE3  . MET A 1 72 ? 15.626 10.384  -7.059  1.00 0.00 ? 72 MET A HE3  7  
ATOM 8419  N N    . LEU A 1 73 ? 12.645 4.779   -5.868  1.00 0.00 ? 73 LEU A N    7  
ATOM 8420  C CA   . LEU A 1 73 ? 12.521 3.653   -4.968  1.00 0.00 ? 73 LEU A CA   7  
ATOM 8421  C C    . LEU A 1 73 ? 11.831 2.485   -5.616  1.00 0.00 ? 73 LEU A C    7  
ATOM 8422  O O    . LEU A 1 73 ? 10.749 2.624   -6.193  1.00 0.00 ? 73 LEU A O    7  
ATOM 8423  C CB   . LEU A 1 73 ? 11.771 4.060   -3.703  1.00 0.00 ? 73 LEU A CB   7  
ATOM 8424  C CG   . LEU A 1 73 ? 12.475 5.101   -2.830  1.00 0.00 ? 73 LEU A CG   7  
ATOM 8425  C CD1  . LEU A 1 73 ? 11.622 5.446   -1.640  1.00 0.00 ? 73 LEU A CD1  7  
ATOM 8426  C CD2  . LEU A 1 73 ? 13.836 4.619   -2.371  1.00 0.00 ? 73 LEU A CD2  7  
ATOM 8427  H H    . LEU A 1 73 ? 11.864 5.364   -6.039  1.00 0.00 ? 73 LEU A H    7  
ATOM 8428  H HA   . LEU A 1 73 ? 13.532 3.344   -4.686  1.00 0.00 ? 73 LEU A HA   7  
ATOM 8429  H HB2  . LEU A 1 73 ? 10.799 4.439   -3.985  1.00 0.00 ? 73 LEU A HB2  7  
ATOM 8430  H HB3  . LEU A 1 73 ? 11.627 3.174   -3.103  1.00 0.00 ? 73 LEU A HB3  7  
ATOM 8431  H HG   . LEU A 1 73 ? 12.615 6.006   -3.410  1.00 0.00 ? 73 LEU A HG   7  
ATOM 8432  H HD11 . LEU A 1 73 ? 12.135 6.165   -1.006  1.00 0.00 ? 73 LEU A HD11 7  
ATOM 8433  H HD12 . LEU A 1 73 ? 11.420 4.554   -1.067  1.00 0.00 ? 73 LEU A HD12 7  
ATOM 8434  H HD13 . LEU A 1 73 ? 10.685 5.880   -1.964  1.00 0.00 ? 73 LEU A HD13 7  
ATOM 8435  H HD21 . LEU A 1 73 ? 14.319 5.369   -1.772  1.00 0.00 ? 73 LEU A HD21 7  
ATOM 8436  H HD22 . LEU A 1 73 ? 14.447 4.388   -3.235  1.00 0.00 ? 73 LEU A HD22 7  
ATOM 8437  H HD23 . LEU A 1 73 ? 13.711 3.710   -1.787  1.00 0.00 ? 73 LEU A HD23 7  
ATOM 8438  N N    . GLU A 1 74 ? 12.448 1.318   -5.533  1.00 0.00 ? 74 GLU A N    7  
ATOM 8439  C CA   . GLU A 1 74 ? 11.847 0.092   -5.980  1.00 0.00 ? 74 GLU A CA   7  
ATOM 8440  C C    . GLU A 1 74 ? 11.454 -0.727  -4.760  1.00 0.00 ? 74 GLU A C    7  
ATOM 8441  O O    . GLU A 1 74 ? 12.219 -0.839  -3.802  1.00 0.00 ? 74 GLU A O    7  
ATOM 8442  C CB   . GLU A 1 74 ? 12.830 -0.677  -6.841  1.00 0.00 ? 74 GLU A CB   7  
ATOM 8443  C CG   . GLU A 1 74 ? 12.281 -1.990  -7.360  1.00 0.00 ? 74 GLU A CG   7  
ATOM 8444  C CD   . GLU A 1 74 ? 10.971 -1.858  -8.111  1.00 0.00 ? 74 GLU A CD   7  
ATOM 8445  O OE1  . GLU A 1 74 ? 9.914  -1.765  -7.470  1.00 0.00 ? 74 GLU A OE1  7  
ATOM 8446  O OE2  . GLU A 1 74 ? 11.021 -1.882  -9.356  1.00 0.00 ? 74 GLU A OE2  7  
ATOM 8447  H H    . GLU A 1 74 ? 13.339 1.297   -5.147  1.00 0.00 ? 74 GLU A H    7  
ATOM 8448  H HA   . GLU A 1 74 ? 10.974 0.314   -6.556  1.00 0.00 ? 74 GLU A HA   7  
ATOM 8449  H HB2  . GLU A 1 74 ? 13.091 -0.070  -7.699  1.00 0.00 ? 74 GLU A HB2  7  
ATOM 8450  H HB3  . GLU A 1 74 ? 13.717 -0.885  -6.273  1.00 0.00 ? 74 GLU A HB3  7  
ATOM 8451  H HG2  . GLU A 1 74 ? 13.014 -2.411  -8.029  1.00 0.00 ? 74 GLU A HG2  7  
ATOM 8452  H HG3  . GLU A 1 74 ? 12.134 -2.665  -6.521  1.00 0.00 ? 74 GLU A HG3  7  
ATOM 8453  N N    . ILE A 1 75 ? 10.251 -1.288  -4.764  1.00 0.00 ? 75 ILE A N    7  
ATOM 8454  C CA   . ILE A 1 75 ? 9.735  -1.974  -3.607  1.00 0.00 ? 75 ILE A CA   7  
ATOM 8455  C C    . ILE A 1 75 ? 9.975  -3.484  -3.698  1.00 0.00 ? 75 ILE A C    7  
ATOM 8456  O O    . ILE A 1 75 ? 9.780  -4.105  -4.746  1.00 0.00 ? 75 ILE A O    7  
ATOM 8457  C CB   . ILE A 1 75 ? 8.227  -1.695  -3.371  1.00 0.00 ? 75 ILE A CB   7  
ATOM 8458  C CG1  . ILE A 1 75 ? 7.353  -2.347  -4.435  1.00 0.00 ? 75 ILE A CG1  7  
ATOM 8459  C CG2  . ILE A 1 75 ? 7.984  -0.187  -3.379  1.00 0.00 ? 75 ILE A CG2  7  
ATOM 8460  C CD1  . ILE A 1 75 ? 5.879  -2.182  -4.155  1.00 0.00 ? 75 ILE A CD1  7  
ATOM 8461  H H    . ILE A 1 75 ? 9.717  -1.233  -5.588  1.00 0.00 ? 75 ILE A H    7  
ATOM 8462  H HA   . ILE A 1 75 ? 10.281 -1.604  -2.734  1.00 0.00 ? 75 ILE A HA   7  
ATOM 8463  H HB   . ILE A 1 75 ? 7.964  -2.075  -2.401  1.00 0.00 ? 75 ILE A HB   7  
ATOM 8464  H HG12 . ILE A 1 75 ? 7.549  -1.896  -5.392  1.00 0.00 ? 75 ILE A HG12 7  
ATOM 8465  H HG13 . ILE A 1 75 ? 7.568  -3.406  -4.482  1.00 0.00 ? 75 ILE A HG13 7  
ATOM 8466  H HG21 . ILE A 1 75 ? 8.321  0.243   -4.310  1.00 0.00 ? 75 ILE A HG21 7  
ATOM 8467  H HG22 . ILE A 1 75 ? 8.527  0.269   -2.561  1.00 0.00 ? 75 ILE A HG22 7  
ATOM 8468  H HG23 . ILE A 1 75 ? 6.934  0.004   -3.250  1.00 0.00 ? 75 ILE A HG23 7  
ATOM 8469  H HD11 . ILE A 1 75 ? 5.633  -1.130  -4.152  1.00 0.00 ? 75 ILE A HD11 7  
ATOM 8470  H HD12 . ILE A 1 75 ? 5.634  -2.607  -3.192  1.00 0.00 ? 75 ILE A HD12 7  
ATOM 8471  H HD13 . ILE A 1 75 ? 5.303  -2.681  -4.922  1.00 0.00 ? 75 ILE A HD13 7  
ATOM 8472  N N    . LEU A 1 76 ? 10.437 -4.059  -2.610  1.00 0.00 ? 76 LEU A N    7  
ATOM 8473  C CA   . LEU A 1 76 ? 10.686 -5.494  -2.543  1.00 0.00 ? 76 LEU A CA   7  
ATOM 8474  C C    . LEU A 1 76 ? 9.733  -6.137  -1.553  1.00 0.00 ? 76 LEU A C    7  
ATOM 8475  O O    . LEU A 1 76 ? 9.793  -7.341  -1.321  1.00 0.00 ? 76 LEU A O    7  
ATOM 8476  C CB   . LEU A 1 76 ? 12.138 -5.757  -2.100  1.00 0.00 ? 76 LEU A CB   7  
ATOM 8477  C CG   . LEU A 1 76 ? 13.212 -5.265  -3.060  1.00 0.00 ? 76 LEU A CG   7  
ATOM 8478  C CD1  . LEU A 1 76 ? 14.584 -5.548  -2.486  1.00 0.00 ? 76 LEU A CD1  7  
ATOM 8479  C CD2  . LEU A 1 76 ? 13.040 -5.922  -4.440  1.00 0.00 ? 76 LEU A CD2  7  
ATOM 8480  H H    . LEU A 1 76 ? 10.633 -3.495  -1.805  1.00 0.00 ? 76 LEU A H    7  
ATOM 8481  H HA   . LEU A 1 76 ? 10.525 -5.919  -3.528  1.00 0.00 ? 76 LEU A HA   7  
ATOM 8482  H HB2  . LEU A 1 76 ? 12.299 -5.298  -1.143  1.00 0.00 ? 76 LEU A HB2  7  
ATOM 8483  H HB3  . LEU A 1 76 ? 12.260 -6.824  -1.988  1.00 0.00 ? 76 LEU A HB3  7  
ATOM 8484  H HG   . LEU A 1 76 ? 13.116 -4.197  -3.182  1.00 0.00 ? 76 LEU A HG   7  
ATOM 8485  H HD11 . LEU A 1 76 ? 15.337 -5.220  -3.200  1.00 0.00 ? 76 LEU A HD11 7  
ATOM 8486  H HD12 . LEU A 1 76 ? 14.691 -6.614  -2.328  1.00 0.00 ? 76 LEU A HD12 7  
ATOM 8487  H HD13 . LEU A 1 76 ? 14.703 -5.021  -1.570  1.00 0.00 ? 76 LEU A HD13 7  
ATOM 8488  H HD21 . LEU A 1 76 ? 13.830 -5.580  -5.094  1.00 0.00 ? 76 LEU A HD21 7  
ATOM 8489  H HD22 . LEU A 1 76 ? 12.087 -5.643  -4.845  1.00 0.00 ? 76 LEU A HD22 7  
ATOM 8490  H HD23 . LEU A 1 76 ? 13.095 -6.992  -4.341  1.00 0.00 ? 76 LEU A HD23 7  
ATOM 8491  N N    . GLY A 1 77 ? 8.857  -5.335  -0.963  1.00 0.00 ? 77 GLY A N    7  
ATOM 8492  C CA   . GLY A 1 77 ? 7.976  -5.855  0.061   1.00 0.00 ? 77 GLY A CA   7  
ATOM 8493  C C    . GLY A 1 77 ? 8.742  -6.287  1.291   1.00 0.00 ? 77 GLY A C    7  
ATOM 8494  O O    . GLY A 1 77 ? 9.394  -5.461  1.944   1.00 0.00 ? 77 GLY A O    7  
ATOM 8495  H H    . GLY A 1 77 ? 8.812  -4.405  -1.219  1.00 0.00 ? 77 GLY A H    7  
ATOM 8496  H HA2  . GLY A 1 77 ? 7.252  -5.091  0.319   1.00 0.00 ? 77 GLY A HA2  7  
ATOM 8497  H HA3  . GLY A 1 77 ? 7.449  -6.712  -0.339  1.00 0.00 ? 77 GLY A HA3  7  
ATOM 8498  N N    . PHE A 1 78 ? 8.690  -7.555  1.612   1.00 0.00 ? 78 PHE A N    7  
ATOM 8499  C CA   . PHE A 1 78 ? 9.525  -8.107  2.673   1.00 0.00 ? 78 PHE A CA   7  
ATOM 8500  C C    . PHE A 1 78 ? 10.608 -8.962  2.063   1.00 0.00 ? 78 PHE A C    7  
ATOM 8501  O O    . PHE A 1 78 ? 11.757 -8.948  2.517   1.00 0.00 ? 78 PHE A O    7  
ATOM 8502  C CB   . PHE A 1 78 ? 8.662  -8.921  3.656   1.00 0.00 ? 78 PHE A CB   7  
ATOM 8503  C CG   . PHE A 1 78 ? 7.660  -8.074  4.392   1.00 0.00 ? 78 PHE A CG   7  
ATOM 8504  C CD1  . PHE A 1 78 ? 8.075  -7.155  5.340   1.00 0.00 ? 78 PHE A CD1  7  
ATOM 8505  C CD2  . PHE A 1 78 ? 6.321  -8.189  4.113   1.00 0.00 ? 78 PHE A CD2  7  
ATOM 8506  C CE1  . PHE A 1 78 ? 7.157  -6.364  6.004   1.00 0.00 ? 78 PHE A CE1  7  
ATOM 8507  C CE2  . PHE A 1 78 ? 5.389  -7.414  4.772   1.00 0.00 ? 78 PHE A CE2  7  
ATOM 8508  C CZ   . PHE A 1 78 ? 5.806  -6.498  5.726   1.00 0.00 ? 78 PHE A CZ   7  
ATOM 8509  H H    . PHE A 1 78 ? 8.094  -8.165  1.106   1.00 0.00 ? 78 PHE A H    7  
ATOM 8510  H HA   . PHE A 1 78 ? 9.983  -7.291  3.203   1.00 0.00 ? 78 PHE A HA   7  
ATOM 8511  H HB2  . PHE A 1 78 ? 8.121  -9.688  3.114   1.00 0.00 ? 78 PHE A HB2  7  
ATOM 8512  H HB3  . PHE A 1 78 ? 9.307  -9.371  4.372   1.00 0.00 ? 78 PHE A HB3  7  
ATOM 8513  H HD1  . PHE A 1 78 ? 9.134  -7.053  5.548   1.00 0.00 ? 78 PHE A HD1  7  
ATOM 8514  H HD2  . PHE A 1 78 ? 5.999  -8.896  3.355   1.00 0.00 ? 78 PHE A HD2  7  
ATOM 8515  H HE1  . PHE A 1 78 ? 7.489  -5.655  6.749   1.00 0.00 ? 78 PHE A HE1  7  
ATOM 8516  H HE2  . PHE A 1 78 ? 4.343  -7.518  4.552   1.00 0.00 ? 78 PHE A HE2  7  
ATOM 8517  H HZ   . PHE A 1 78 ? 5.085  -5.884  6.247   1.00 0.00 ? 78 PHE A HZ   7  
ATOM 8518  N N    . GLU A 1 79 ? 10.236 -9.694  1.015   1.00 0.00 ? 79 GLU A N    7  
ATOM 8519  C CA   . GLU A 1 79 ? 11.186 -10.482 0.191   1.00 0.00 ? 79 GLU A CA   7  
ATOM 8520  C C    . GLU A 1 79 ? 11.960 -11.494 1.024   1.00 0.00 ? 79 GLU A C    7  
ATOM 8521  O O    . GLU A 1 79 ? 12.985 -12.017 0.568   1.00 0.00 ? 79 GLU A O    7  
ATOM 8522  C CB   . GLU A 1 79 ? 12.136 -9.522  -0.530  1.00 0.00 ? 79 GLU A CB   7  
ATOM 8523  C CG   . GLU A 1 79 ? 11.995 -9.581  -2.052  1.00 0.00 ? 79 GLU A CG   7  
ATOM 8524  C CD   . GLU A 1 79 ? 12.420 -10.932 -2.599  1.00 0.00 ? 79 GLU A CD   7  
ATOM 8525  O OE1  . GLU A 1 79 ? 13.636 -11.140 -2.821  1.00 0.00 ? 79 GLU A OE1  7  
ATOM 8526  O OE2  . GLU A 1 79 ? 11.546 -11.807 -2.781  1.00 0.00 ? 79 GLU A OE2  7  
ATOM 8527  H H    . GLU A 1 79 ? 9.286  -9.713  0.768   1.00 0.00 ? 79 GLU A H    7  
ATOM 8528  H HA   . GLU A 1 79 ? 10.599 -11.004 -0.544  1.00 0.00 ? 79 GLU A HA   7  
ATOM 8529  H HB2  . GLU A 1 79 ? 11.925 -8.506  -0.221  1.00 0.00 ? 79 GLU A HB2  7  
ATOM 8530  H HB3  . GLU A 1 79 ? 13.160 -9.769  -0.268  1.00 0.00 ? 79 GLU A HB3  7  
ATOM 8531  H HG2  . GLU A 1 79 ? 10.960 -9.402  -2.330  1.00 0.00 ? 79 GLU A HG2  7  
ATOM 8532  H HG3  . GLU A 1 79 ? 12.621 -8.820  -2.481  1.00 0.00 ? 79 GLU A HG3  7  
ATOM 8533  N N    . GLU A 1 80 ? 11.442 -11.822 2.201   1.00 0.00 ? 80 GLU A N    7  
ATOM 8534  C CA   . GLU A 1 80 ? 12.113 -12.755 3.101   1.00 0.00 ? 80 GLU A CA   7  
ATOM 8535  C C    . GLU A 1 80 ? 11.095 -13.334 4.079   1.00 0.00 ? 80 GLU A C    7  
ATOM 8536  O O    . GLU A 1 80 ? 10.543 -14.401 3.836   1.00 0.00 ? 80 GLU A O    7  
ATOM 8537  C CB   . GLU A 1 80 ? 13.262 -12.053 3.826   1.00 0.00 ? 80 GLU A CB   7  
ATOM 8538  C CG   . GLU A 1 80 ? 14.155 -12.960 4.629   1.00 0.00 ? 80 GLU A CG   7  
ATOM 8539  C CD   . GLU A 1 80 ? 15.382 -12.233 5.162   1.00 0.00 ? 80 GLU A CD   7  
ATOM 8540  O OE1  . GLU A 1 80 ? 16.332 -12.020 4.382   1.00 0.00 ? 80 GLU A OE1  7  
ATOM 8541  O OE2  . GLU A 1 80 ? 15.386 -11.840 6.349   1.00 0.00 ? 80 GLU A OE2  7  
ATOM 8542  H H    . GLU A 1 80 ? 10.607 -11.416 2.475   1.00 0.00 ? 80 GLU A H    7  
ATOM 8543  H HA   . GLU A 1 80 ? 12.508 -13.558 2.517   1.00 0.00 ? 80 GLU A HA   7  
ATOM 8544  H HB2  . GLU A 1 80 ? 13.876 -11.540 3.093   1.00 0.00 ? 80 GLU A HB2  7  
ATOM 8545  H HB3  . GLU A 1 80 ? 12.845 -11.317 4.490   1.00 0.00 ? 80 GLU A HB3  7  
ATOM 8546  H HG2  . GLU A 1 80 ? 13.595 -13.371 5.469   1.00 0.00 ? 80 GLU A HG2  7  
ATOM 8547  H HG3  . GLU A 1 80 ? 14.494 -13.774 3.992   1.00 0.00 ? 80 GLU A HG3  7  
ATOM 8548  N N    . MET A 1 4  ? 11.041 4.875   -17.018 1.00 0.00 ? 4  MET A N    8  
ATOM 8549  C CA   . MET A 1 4  ? 11.443 5.914   -16.102 1.00 0.00 ? 4  MET A CA   8  
ATOM 8550  C C    . MET A 1 4  ? 10.255 6.504   -15.356 1.00 0.00 ? 4  MET A C    8  
ATOM 8551  O O    . MET A 1 4  ? 9.143  6.007   -15.487 1.00 0.00 ? 4  MET A O    8  
ATOM 8552  C CB   . MET A 1 4  ? 12.213 7.014   -16.841 1.00 0.00 ? 4  MET A CB   8  
ATOM 8553  C CG   . MET A 1 4  ? 13.496 6.514   -17.496 1.00 0.00 ? 4  MET A CG   8  
ATOM 8554  S SD   . MET A 1 4  ? 14.352 7.792   -18.448 1.00 0.00 ? 4  MET A SD   8  
ATOM 8555  C CE   . MET A 1 4  ? 14.788 8.955   -17.157 1.00 0.00 ? 4  MET A CE   8  
ATOM 8556  H H    . MET A 1 4  ? 10.767 5.130   -17.928 1.00 0.00 ? 4  MET A H    8  
ATOM 8557  H HA   . MET A 1 4  ? 12.099 5.464   -15.381 1.00 0.00 ? 4  MET A HA   8  
ATOM 8558  H HB2  . MET A 1 4  ? 11.577 7.431   -17.616 1.00 0.00 ? 4  MET A HB2  8  
ATOM 8559  H HB3  . MET A 1 4  ? 12.475 7.806   -16.148 1.00 0.00 ? 4  MET A HB3  8  
ATOM 8560  H HG2  . MET A 1 4  ? 14.166 6.171   -16.721 1.00 0.00 ? 4  MET A HG2  8  
ATOM 8561  H HG3  . MET A 1 4  ? 13.258 5.697   -18.152 1.00 0.00 ? 4  MET A HG3  8  
ATOM 8562  H HE1  . MET A 1 4  ? 13.893 9.287   -16.652 1.00 0.00 ? 4  MET A HE1  8  
ATOM 8563  H HE2  . MET A 1 4  ? 15.314 9.809   -17.594 1.00 0.00 ? 4  MET A HE2  8  
ATOM 8564  H HE3  . MET A 1 4  ? 15.426 8.469   -16.457 1.00 0.00 ? 4  MET A HE3  8  
ATOM 8565  N N    . ARG A 1 5  ? 10.488 7.566   -14.588 1.00 0.00 ? 5  ARG A N    8  
ATOM 8566  C CA   . ARG A 1 5  ? 9.479  8.149   -13.713 1.00 0.00 ? 5  ARG A CA   8  
ATOM 8567  C C    . ARG A 1 5  ? 8.201  8.532   -14.464 1.00 0.00 ? 5  ARG A C    8  
ATOM 8568  O O    . ARG A 1 5  ? 7.099  8.418   -13.920 1.00 0.00 ? 5  ARG A O    8  
ATOM 8569  C CB   . ARG A 1 5  ? 10.067 9.383   -13.000 1.00 0.00 ? 5  ARG A CB   8  
ATOM 8570  C CG   . ARG A 1 5  ? 9.195  9.951   -11.885 1.00 0.00 ? 5  ARG A CG   8  
ATOM 8571  C CD   . ARG A 1 5  ? 8.194  10.974  -12.396 1.00 0.00 ? 5  ARG A CD   8  
ATOM 8572  N NE   . ARG A 1 5  ? 8.828  12.203  -12.859 1.00 0.00 ? 5  ARG A NE   8  
ATOM 8573  C CZ   . ARG A 1 5  ? 8.154  13.222  -13.405 1.00 0.00 ? 5  ARG A CZ   8  
ATOM 8574  N NH1  . ARG A 1 5  ? 6.852  13.110  -13.606 1.00 0.00 ? 5  ARG A NH1  8  
ATOM 8575  N NH2  . ARG A 1 5  ? 8.779  14.335  -13.747 1.00 0.00 ? 5  ARG A NH2  8  
ATOM 8576  H H    . ARG A 1 5  ? 11.382 7.965   -14.606 1.00 0.00 ? 5  ARG A H    8  
ATOM 8577  H HA   . ARG A 1 5  ? 9.233  7.411   -12.964 1.00 0.00 ? 5  ARG A HA   8  
ATOM 8578  H HB2  . ARG A 1 5  ? 11.028 9.115   -12.572 1.00 0.00 ? 5  ARG A HB2  8  
ATOM 8579  H HB3  . ARG A 1 5  ? 10.210 10.164  -13.734 1.00 0.00 ? 5  ARG A HB3  8  
ATOM 8580  H HG2  . ARG A 1 5  ? 8.669  9.142   -11.422 1.00 0.00 ? 5  ARG A HG2  8  
ATOM 8581  H HG3  . ARG A 1 5  ? 9.836  10.432  -11.149 1.00 0.00 ? 5  ARG A HG3  8  
ATOM 8582  H HD2  . ARG A 1 5  ? 7.642  10.541  -13.222 1.00 0.00 ? 5  ARG A HD2  8  
ATOM 8583  H HD3  . ARG A 1 5  ? 7.508  11.212  -11.596 1.00 0.00 ? 5  ARG A HD3  8  
ATOM 8584  H HE   . ARG A 1 5  ? 9.810  12.278  -12.734 1.00 0.00 ? 5  ARG A HE   8  
ATOM 8585  H HH11 . ARG A 1 5  ? 6.370  12.275  -13.342 1.00 0.00 ? 5  ARG A HH11 8  
ATOM 8586  H HH12 . ARG A 1 5  ? 6.358  13.869  -14.039 1.00 0.00 ? 5  ARG A HH12 8  
ATOM 8587  H HH21 . ARG A 1 5  ? 9.773  14.427  -13.610 1.00 0.00 ? 5  ARG A HH21 8  
ATOM 8588  H HH22 . ARG A 1 5  ? 8.261  15.100  -14.138 1.00 0.00 ? 5  ARG A HH22 8  
ATOM 8589  N N    . SER A 1 6  ? 8.338  8.967   -15.706 1.00 0.00 ? 6  SER A N    8  
ATOM 8590  C CA   . SER A 1 6  ? 7.189  9.394   -16.500 1.00 0.00 ? 6  SER A CA   8  
ATOM 8591  C C    . SER A 1 6  ? 6.445  8.203   -17.119 1.00 0.00 ? 6  SER A C    8  
ATOM 8592  O O    . SER A 1 6  ? 5.608  8.376   -18.004 1.00 0.00 ? 6  SER A O    8  
ATOM 8593  C CB   . SER A 1 6  ? 7.633  10.344  -17.599 1.00 0.00 ? 6  SER A CB   8  
ATOM 8594  O OG   . SER A 1 6  ? 8.414  11.415  -17.073 1.00 0.00 ? 6  SER A OG   8  
ATOM 8595  H H    . SER A 1 6  ? 9.243  9.041   -16.089 1.00 0.00 ? 6  SER A H    8  
ATOM 8596  H HA   . SER A 1 6  ? 6.515  9.917   -15.837 1.00 0.00 ? 6  SER A HA   8  
ATOM 8597  H HB2  . SER A 1 6  ? 8.237  9.811   -18.320 1.00 0.00 ? 6  SER A HB2  8  
ATOM 8598  H HB3  . SER A 1 6  ? 6.764  10.760  -18.085 1.00 0.00 ? 6  SER A HB3  8  
ATOM 8599  H HG   . SER A 1 6  ? 7.998  12.248  -17.305 1.00 0.00 ? 6  SER A HG   8  
ATOM 8600  N N    . GLU A 1 7  ? 6.774  6.991   -16.658 1.00 0.00 ? 7  GLU A N    8  
ATOM 8601  C CA   . GLU A 1 7  ? 6.121  5.770   -17.129 1.00 0.00 ? 7  GLU A CA   8  
ATOM 8602  C C    . GLU A 1 7  ? 4.618  5.846   -16.877 1.00 0.00 ? 7  GLU A C    8  
ATOM 8603  O O    . GLU A 1 7  ? 3.796  5.587   -17.762 1.00 0.00 ? 7  GLU A O    8  
ATOM 8604  C CB   . GLU A 1 7  ? 6.704  4.549   -16.417 1.00 0.00 ? 7  GLU A CB   8  
ATOM 8605  C CG   . GLU A 1 7  ? 6.264  3.207   -16.993 1.00 0.00 ? 7  GLU A CG   8  
ATOM 8606  C CD   . GLU A 1 7  ? 6.820  2.019   -16.231 1.00 0.00 ? 7  GLU A CD   8  
ATOM 8607  O OE1  . GLU A 1 7  ? 6.514  1.877   -15.033 1.00 0.00 ? 7  GLU A OE1  8  
ATOM 8608  O OE2  . GLU A 1 7  ? 7.557  1.210   -16.837 1.00 0.00 ? 7  GLU A OE2  8  
ATOM 8609  H H    . GLU A 1 7  ? 7.483  6.914   -15.977 1.00 0.00 ? 7  GLU A H    8  
ATOM 8610  H HA   . GLU A 1 7  ? 6.293  5.676   -18.195 1.00 0.00 ? 7  GLU A HA   8  
ATOM 8611  H HB2  . GLU A 1 7  ? 7.780  4.601   -16.468 1.00 0.00 ? 7  GLU A HB2  8  
ATOM 8612  H HB3  . GLU A 1 7  ? 6.397  4.588   -15.380 1.00 0.00 ? 7  GLU A HB3  8  
ATOM 8613  H HG2  . GLU A 1 7  ? 5.194  3.157   -16.977 1.00 0.00 ? 7  GLU A HG2  8  
ATOM 8614  H HG3  . GLU A 1 7  ? 6.618  3.153   -18.019 1.00 0.00 ? 7  GLU A HG3  8  
ATOM 8615  N N    . PHE A 1 8  ? 4.263  6.234   -15.657 1.00 0.00 ? 8  PHE A N    8  
ATOM 8616  C CA   . PHE A 1 8  ? 2.874  6.441   -15.297 1.00 0.00 ? 8  PHE A CA   8  
ATOM 8617  C C    . PHE A 1 8  ? 2.435  7.826   -15.766 1.00 0.00 ? 8  PHE A C    8  
ATOM 8618  O O    . PHE A 1 8  ? 3.256  8.689   -16.028 1.00 0.00 ? 8  PHE A O    8  
ATOM 8619  C CB   . PHE A 1 8  ? 2.668  6.295   -13.785 1.00 0.00 ? 8  PHE A CB   8  
ATOM 8620  C CG   . PHE A 1 8  ? 2.793  4.891   -13.302 1.00 0.00 ? 8  PHE A CG   8  
ATOM 8621  C CD1  . PHE A 1 8  ? 1.717  4.011   -13.386 1.00 0.00 ? 8  PHE A CD1  8  
ATOM 8622  C CD2  . PHE A 1 8  ? 3.969  4.438   -12.727 1.00 0.00 ? 8  PHE A CD2  8  
ATOM 8623  C CE1  . PHE A 1 8  ? 1.819  2.712   -12.927 1.00 0.00 ? 8  PHE A CE1  8  
ATOM 8624  C CE2  . PHE A 1 8  ? 4.087  3.141   -12.257 1.00 0.00 ? 8  PHE A CE2  8  
ATOM 8625  C CZ   . PHE A 1 8  ? 3.011  2.282   -12.364 1.00 0.00 ? 8  PHE A CZ   8  
ATOM 8626  H H    . PHE A 1 8  ? 4.962  6.367   -14.982 1.00 0.00 ? 8  PHE A H    8  
ATOM 8627  H HA   . PHE A 1 8  ? 2.294  5.699   -15.805 1.00 0.00 ? 8  PHE A HA   8  
ATOM 8628  H HB2  . PHE A 1 8  ? 3.414  6.896   -13.275 1.00 0.00 ? 8  PHE A HB2  8  
ATOM 8629  H HB3  . PHE A 1 8  ? 1.679  6.660   -13.525 1.00 0.00 ? 8  PHE A HB3  8  
ATOM 8630  H HD1  . PHE A 1 8  ? 0.786  4.353   -13.826 1.00 0.00 ? 8  PHE A HD1  8  
ATOM 8631  H HD2  . PHE A 1 8  ? 4.812  5.104   -12.654 1.00 0.00 ? 8  PHE A HD2  8  
ATOM 8632  H HE1  . PHE A 1 8  ? 0.980  2.042   -13.002 1.00 0.00 ? 8  PHE A HE1  8  
ATOM 8633  H HE2  . PHE A 1 8  ? 5.015  2.815   -11.827 1.00 0.00 ? 8  PHE A HE2  8  
ATOM 8634  H HZ   . PHE A 1 8  ? 3.087  1.257   -11.993 1.00 0.00 ? 8  PHE A HZ   8  
ATOM 8635  N N    . ALA A 1 9  ? 1.119  8.016   -15.860 1.00 0.00 ? 9  ALA A N    8  
ATOM 8636  C CA   . ALA A 1 9  ? 0.552  9.243   -16.411 1.00 0.00 ? 9  ALA A CA   8  
ATOM 8637  C C    . ALA A 1 9  ? 0.928  10.482  -15.602 1.00 0.00 ? 9  ALA A C    8  
ATOM 8638  O O    . ALA A 1 9  ? 1.066  11.578  -16.147 1.00 0.00 ? 9  ALA A O    8  
ATOM 8639  C CB   . ALA A 1 9  ? -0.956 9.142   -16.492 1.00 0.00 ? 9  ALA A CB   8  
ATOM 8640  H H    . ALA A 1 9  ? 0.515  7.314   -15.549 1.00 0.00 ? 9  ALA A H    8  
ATOM 8641  H HA   . ALA A 1 9  ? 0.931  9.354   -17.409 1.00 0.00 ? 9  ALA A HA   8  
ATOM 8642  H HB1  . ALA A 1 9  ? -1.367 10.018  -16.963 1.00 0.00 ? 9  ALA A HB1  8  
ATOM 8643  H HB2  . ALA A 1 9  ? -1.376 9.039   -15.500 1.00 0.00 ? 9  ALA A HB2  8  
ATOM 8644  H HB3  . ALA A 1 9  ? -1.224 8.274   -17.077 1.00 0.00 ? 9  ALA A HB3  8  
ATOM 8645  N N    . SER A 1 10 ? 1.084  10.308  -14.309 1.00 0.00 ? 10 SER A N    8  
ATOM 8646  C CA   . SER A 1 10 ? 1.439  11.433  -13.450 1.00 0.00 ? 10 SER A CA   8  
ATOM 8647  C C    . SER A 1 10 ? 2.901  11.350  -13.020 1.00 0.00 ? 10 SER A C    8  
ATOM 8648  O O    . SER A 1 10 ? 3.517  12.365  -12.709 1.00 0.00 ? 10 SER A O    8  
ATOM 8649  C CB   . SER A 1 10 ? 0.532  11.453  -12.234 1.00 0.00 ? 10 SER A CB   8  
ATOM 8650  O OG   . SER A 1 10 ? -0.834 11.528  -12.630 1.00 0.00 ? 10 SER A OG   8  
ATOM 8651  H H    . SER A 1 10 ? 0.919  9.427   -13.913 1.00 0.00 ? 10 SER A H    8  
ATOM 8652  H HA   . SER A 1 10 ? 1.301  12.339  -14.013 1.00 0.00 ? 10 SER A HA   8  
ATOM 8653  H HB2  . SER A 1 10 ? 0.668  10.539  -11.665 1.00 0.00 ? 10 SER A HB2  8  
ATOM 8654  H HB3  . SER A 1 10 ? 0.772  12.305  -11.620 1.00 0.00 ? 10 SER A HB3  8  
ATOM 8655  H HG   . SER A 1 10 ? -0.938 12.241  -13.273 1.00 0.00 ? 10 SER A HG   8  
ATOM 8656  N N    . GLY A 1 11 ? 3.455  10.145  -13.005 1.00 0.00 ? 11 GLY A N    8  
ATOM 8657  C CA   . GLY A 1 11 ? 4.822  9.962   -12.534 1.00 0.00 ? 11 GLY A CA   8  
ATOM 8658  C C    . GLY A 1 11 ? 4.885  9.892   -11.020 1.00 0.00 ? 11 GLY A C    8  
ATOM 8659  O O    . GLY A 1 11 ? 5.554  9.012   -10.471 1.00 0.00 ? 11 GLY A O    8  
ATOM 8660  H H    . GLY A 1 11 ? 2.945  9.367   -13.330 1.00 0.00 ? 11 GLY A H    8  
ATOM 8661  H HA2  . GLY A 1 11 ? 5.214  9.046   -12.940 1.00 0.00 ? 11 GLY A HA2  8  
ATOM 8662  H HA3  . GLY A 1 11 ? 5.435  10.789  -12.872 1.00 0.00 ? 11 GLY A HA3  8  
ATOM 8663  N N    . ASN A 1 12 ? 4.184  10.813  -10.353 1.00 0.00 ? 12 ASN A N    8  
ATOM 8664  C CA   . ASN A 1 12 ? 4.008  10.796  -8.890  1.00 0.00 ? 12 ASN A CA   8  
ATOM 8665  C C    . ASN A 1 12 ? 3.384  9.476   -8.439  1.00 0.00 ? 12 ASN A C    8  
ATOM 8666  O O    . ASN A 1 12 ? 3.476  9.085   -7.277  1.00 0.00 ? 12 ASN A O    8  
ATOM 8667  C CB   . ASN A 1 12 ? 3.131  11.957  -8.434  1.00 0.00 ? 12 ASN A CB   8  
ATOM 8668  C CG   . ASN A 1 12 ? 3.715  13.333  -8.741  1.00 0.00 ? 12 ASN A CG   8  
ATOM 8669  O OD1  . ASN A 1 12 ? 4.453  13.510  -9.705  1.00 0.00 ? 12 ASN A OD1  8  
ATOM 8670  N ND2  . ASN A 1 12 ? 3.375  14.310  -7.918  1.00 0.00 ? 12 ASN A ND2  8  
ATOM 8671  H H    . ASN A 1 12 ? 3.790  11.549  -10.865 1.00 0.00 ? 12 ASN A H    8  
ATOM 8672  H HA   . ASN A 1 12 ? 4.983  10.887  -8.459  1.00 0.00 ? 12 ASN A HA   8  
ATOM 8673  H HB2  . ASN A 1 12 ? 2.171  11.889  -8.932  1.00 0.00 ? 12 ASN A HB2  8  
ATOM 8674  H HB3  . ASN A 1 12 ? 2.990  11.887  -7.367  1.00 0.00 ? 12 ASN A HB3  8  
ATOM 8675  H HD21 . ASN A 1 12 ? 2.778  14.108  -7.160  1.00 0.00 ? 12 ASN A HD21 8  
ATOM 8676  H HD22 . ASN A 1 12 ? 3.731  15.202  -8.103  1.00 0.00 ? 12 ASN A HD22 8  
ATOM 8677  N N    . THR A 1 13 ? 2.715  8.824   -9.381  1.00 0.00 ? 13 THR A N    8  
ATOM 8678  C CA   . THR A 1 13 ? 2.042  7.558   -9.163  1.00 0.00 ? 13 THR A CA   8  
ATOM 8679  C C    . THR A 1 13 ? 2.970  6.534   -8.504  1.00 0.00 ? 13 THR A C    8  
ATOM 8680  O O    . THR A 1 13 ? 2.504  5.679   -7.746  1.00 0.00 ? 13 THR A O    8  
ATOM 8681  C CB   . THR A 1 13 ? 1.523  7.011   -10.512 1.00 0.00 ? 13 THR A CB   8  
ATOM 8682  O OG1  . THR A 1 13 ? 0.979  8.085   -11.282 1.00 0.00 ? 13 THR A OG1  8  
ATOM 8683  C CG2  . THR A 1 13 ? 0.460  5.949   -10.286 1.00 0.00 ? 13 THR A CG2  8  
ATOM 8684  H H    . THR A 1 13 ? 2.678  9.228   -10.261 1.00 0.00 ? 13 THR A H    8  
ATOM 8685  H HA   . THR A 1 13 ? 1.191  7.733   -8.524  1.00 0.00 ? 13 THR A HA   8  
ATOM 8686  H HB   . THR A 1 13 ? 2.357  6.559   -11.034 1.00 0.00 ? 13 THR A HB   8  
ATOM 8687  H HG1  . THR A 1 13 ? 0.484  8.688   -10.706 1.00 0.00 ? 13 THR A HG1  8  
ATOM 8688  H HG21 . THR A 1 13 ? 0.885  5.131   -9.725  1.00 0.00 ? 13 THR A HG21 8  
ATOM 8689  H HG22 . THR A 1 13 ? 0.098  5.591   -11.242 1.00 0.00 ? 13 THR A HG22 8  
ATOM 8690  H HG23 . THR A 1 13 ? -0.364 6.375   -9.732  1.00 0.00 ? 13 THR A HG23 8  
ATOM 8691  N N    . TYR A 1 14 ? 4.277  6.627   -8.771  1.00 0.00 ? 14 TYR A N    8  
ATOM 8692  C CA   . TYR A 1 14 ? 5.244  5.773   -8.107  1.00 0.00 ? 14 TYR A CA   8  
ATOM 8693  C C    . TYR A 1 14 ? 5.182  5.998   -6.597  1.00 0.00 ? 14 TYR A C    8  
ATOM 8694  O O    . TYR A 1 14 ? 4.971  5.062   -5.833  1.00 0.00 ? 14 TYR A O    8  
ATOM 8695  C CB   . TYR A 1 14 ? 6.651  6.035   -8.585  1.00 0.00 ? 14 TYR A CB   8  
ATOM 8696  C CG   . TYR A 1 14 ? 6.983  5.439   -9.930  1.00 0.00 ? 14 TYR A CG   8  
ATOM 8697  C CD1  . TYR A 1 14 ? 7.249  4.072   -10.055 1.00 0.00 ? 14 TYR A CD1  8  
ATOM 8698  C CD2  . TYR A 1 14 ? 7.022  6.217   -11.076 1.00 0.00 ? 14 TYR A CD2  8  
ATOM 8699  C CE1  . TYR A 1 14 ? 7.552  3.534   -11.290 1.00 0.00 ? 14 TYR A CE1  8  
ATOM 8700  C CE2  . TYR A 1 14 ? 7.319  5.688   -12.306 1.00 0.00 ? 14 TYR A CE2  8  
ATOM 8701  C CZ   . TYR A 1 14 ? 7.596  4.334   -12.408 1.00 0.00 ? 14 TYR A CZ   8  
ATOM 8702  O OH   . TYR A 1 14 ? 7.902  3.789   -13.635 1.00 0.00 ? 14 TYR A OH   8  
ATOM 8703  H H    . TYR A 1 14 ? 4.592  7.298   -9.407  1.00 0.00 ? 14 TYR A H    8  
ATOM 8704  H HA   . TYR A 1 14 ? 4.978  4.746   -8.322  1.00 0.00 ? 14 TYR A HA   8  
ATOM 8705  H HB2  . TYR A 1 14 ? 6.800  7.114   -8.668  1.00 0.00 ? 14 TYR A HB2  8  
ATOM 8706  H HB3  . TYR A 1 14 ? 7.363  5.643   -7.872  1.00 0.00 ? 14 TYR A HB3  8  
ATOM 8707  H HD1  . TYR A 1 14 ? 7.218  3.453   -9.182  1.00 0.00 ? 14 TYR A HD1  8  
ATOM 8708  H HD2  . TYR A 1 14 ? 6.815  7.282   -10.981 1.00 0.00 ? 14 TYR A HD2  8  
ATOM 8709  H HE1  . TYR A 1 14 ? 7.768  2.478   -11.380 1.00 0.00 ? 14 TYR A HE1  8  
ATOM 8710  H HE2  . TYR A 1 14 ? 7.354  6.321   -13.174 1.00 0.00 ? 14 TYR A HE2  8  
ATOM 8711  H HH   . TYR A 1 14 ? 7.283  3.082   -13.840 1.00 0.00 ? 14 TYR A HH   8  
ATOM 8712  N N    . ALA A 1 15 ? 5.359  7.263   -6.218  1.00 0.00 ? 15 ALA A N    8  
ATOM 8713  C CA   . ALA A 1 15 ? 5.344  7.664   -4.821  1.00 0.00 ? 15 ALA A CA   8  
ATOM 8714  C C    . ALA A 1 15 ? 4.025  7.317   -4.144  1.00 0.00 ? 15 ALA A C    8  
ATOM 8715  O O    . ALA A 1 15 ? 3.970  6.992   -2.959  1.00 0.00 ? 15 ALA A O    8  
ATOM 8716  C CB   . ALA A 1 15 ? 5.603  9.157   -4.713  1.00 0.00 ? 15 ALA A CB   8  
ATOM 8717  H H    . ALA A 1 15 ? 5.521  7.951   -6.900  1.00 0.00 ? 15 ALA A H    8  
ATOM 8718  H HA   . ALA A 1 15 ? 6.155  7.152   -4.317  1.00 0.00 ? 15 ALA A HA   8  
ATOM 8719  H HB1  . ALA A 1 15 ? 4.794  9.686   -5.180  1.00 0.00 ? 15 ALA A HB1  8  
ATOM 8720  H HB2  . ALA A 1 15 ? 6.535  9.398   -5.208  1.00 0.00 ? 15 ALA A HB2  8  
ATOM 8721  H HB3  . ALA A 1 15 ? 5.662  9.441   -3.678  1.00 0.00 ? 15 ALA A HB3  8  
ATOM 8722  N N    . LEU A 1 16 ? 2.954  7.362   -4.920  1.00 0.00 ? 16 LEU A N    8  
ATOM 8723  C CA   . LEU A 1 16 ? 1.631  7.107   -4.403  1.00 0.00 ? 16 LEU A CA   8  
ATOM 8724  C C    . LEU A 1 16 ? 1.442  5.612   -4.116  1.00 0.00 ? 16 LEU A C    8  
ATOM 8725  O O    . LEU A 1 16 ? 0.874  5.213   -3.101  1.00 0.00 ? 16 LEU A O    8  
ATOM 8726  C CB   . LEU A 1 16 ? 0.586  7.611   -5.408  1.00 0.00 ? 16 LEU A CB   8  
ATOM 8727  C CG   . LEU A 1 16 ? -0.872 7.542   -4.944  1.00 0.00 ? 16 LEU A CG   8  
ATOM 8728  C CD1  . LEU A 1 16 ? -1.122 8.454   -3.748  1.00 0.00 ? 16 LEU A CD1  8  
ATOM 8729  C CD2  . LEU A 1 16 ? -1.802 7.920   -6.087  1.00 0.00 ? 16 LEU A CD2  8  
ATOM 8730  H H    . LEU A 1 16 ? 3.059  7.531   -5.879  1.00 0.00 ? 16 LEU A H    8  
ATOM 8731  H HA   . LEU A 1 16 ? 1.530  7.655   -3.491  1.00 0.00 ? 16 LEU A HA   8  
ATOM 8732  H HB2  . LEU A 1 16 ? 0.828  8.636   -5.633  1.00 0.00 ? 16 LEU A HB2  8  
ATOM 8733  H HB3  . LEU A 1 16 ? 0.687  7.015   -6.316  1.00 0.00 ? 16 LEU A HB3  8  
ATOM 8734  H HG   . LEU A 1 16 ? -1.103 6.526   -4.650  1.00 0.00 ? 16 LEU A HG   8  
ATOM 8735  H HD11 . LEU A 1 16 ? -2.146 8.344   -3.417  1.00 0.00 ? 16 LEU A HD11 8  
ATOM 8736  H HD12 . LEU A 1 16 ? -0.944 9.484   -4.030  1.00 0.00 ? 16 LEU A HD12 8  
ATOM 8737  H HD13 . LEU A 1 16 ? -0.455 8.177   -2.940  1.00 0.00 ? 16 LEU A HD13 8  
ATOM 8738  H HD21 . LEU A 1 16 ? -1.678 7.216   -6.884  1.00 0.00 ? 16 LEU A HD21 8  
ATOM 8739  H HD22 . LEU A 1 16 ? -1.555 8.913   -6.444  1.00 0.00 ? 16 LEU A HD22 8  
ATOM 8740  H HD23 . LEU A 1 16 ? -2.826 7.905   -5.746  1.00 0.00 ? 16 LEU A HD23 8  
ATOM 8741  N N    . TYR A 1 17 ? 1.922  4.795   -5.058  1.00 0.00 ? 17 TYR A N    8  
ATOM 8742  C CA   . TYR A 1 17 ? 1.897  3.348   -4.902  1.00 0.00 ? 17 TYR A CA   8  
ATOM 8743  C C    . TYR A 1 17 ? 2.763  2.895   -3.742  1.00 0.00 ? 17 TYR A C    8  
ATOM 8744  O O    . TYR A 1 17 ? 2.288  2.170   -2.855  1.00 0.00 ? 17 TYR A O    8  
ATOM 8745  C CB   . TYR A 1 17 ? 2.387  2.698   -6.206  1.00 0.00 ? 17 TYR A CB   8  
ATOM 8746  C CG   . TYR A 1 17 ? 2.473  1.199   -6.148  1.00 0.00 ? 17 TYR A CG   8  
ATOM 8747  C CD1  . TYR A 1 17 ? 1.340  0.417   -6.132  1.00 0.00 ? 17 TYR A CD1  8  
ATOM 8748  C CD2  . TYR A 1 17 ? 3.708  0.549   -6.126  1.00 0.00 ? 17 TYR A CD2  8  
ATOM 8749  C CE1  . TYR A 1 17 ? 1.408  -0.964  -6.102  1.00 0.00 ? 17 TYR A CE1  8  
ATOM 8750  C CE2  . TYR A 1 17 ? 3.788  -0.820  -6.085  1.00 0.00 ? 17 TYR A CE2  8  
ATOM 8751  C CZ   . TYR A 1 17 ? 2.644  -1.575  -6.077  1.00 0.00 ? 17 TYR A CZ   8  
ATOM 8752  O OH   . TYR A 1 17 ? 2.723  -2.957  -6.069  1.00 0.00 ? 17 TYR A OH   8  
ATOM 8753  H H    . TYR A 1 17 ? 2.265  5.174   -5.898  1.00 0.00 ? 17 TYR A H    8  
ATOM 8754  H HA   . TYR A 1 17 ? 0.877  3.052   -4.724  1.00 0.00 ? 17 TYR A HA   8  
ATOM 8755  H HB2  . TYR A 1 17 ? 1.715  2.964   -7.019  1.00 0.00 ? 17 TYR A HB2  8  
ATOM 8756  H HB3  . TYR A 1 17 ? 3.371  3.086   -6.427  1.00 0.00 ? 17 TYR A HB3  8  
ATOM 8757  H HD1  . TYR A 1 17 ? 0.375  0.908   -6.160  1.00 0.00 ? 17 TYR A HD1  8  
ATOM 8758  H HD2  . TYR A 1 17 ? 4.607  1.142   -6.139  1.00 0.00 ? 17 TYR A HD2  8  
ATOM 8759  H HE1  . TYR A 1 17 ? 0.516  -1.549  -6.097  1.00 0.00 ? 17 TYR A HE1  8  
ATOM 8760  H HE2  . TYR A 1 17 ? 4.756  -1.294  -6.083  1.00 0.00 ? 17 TYR A HE2  8  
ATOM 8761  H HH   . TYR A 1 17 ? 3.317  -3.238  -5.361  1.00 0.00 ? 17 TYR A HH   8  
ATOM 8762  N N    . VAL A 1 18 ? 4.023  3.296   -3.749  1.00 0.00 ? 18 VAL A N    8  
ATOM 8763  C CA   . VAL A 1 18 ? 4.951  2.859   -2.722  1.00 0.00 ? 18 VAL A CA   8  
ATOM 8764  C C    . VAL A 1 18 ? 4.500  3.304   -1.323  1.00 0.00 ? 18 VAL A C    8  
ATOM 8765  O O    . VAL A 1 18 ? 4.540  2.517   -0.400  1.00 0.00 ? 18 VAL A O    8  
ATOM 8766  C CB   . VAL A 1 18 ? 6.402  3.317   -2.999  1.00 0.00 ? 18 VAL A CB   8  
ATOM 8767  C CG1  . VAL A 1 18 ? 6.917  2.728   -4.299  1.00 0.00 ? 18 VAL A CG1  8  
ATOM 8768  C CG2  . VAL A 1 18 ? 6.546  4.833   -3.011  1.00 0.00 ? 18 VAL A CG2  8  
ATOM 8769  H H    . VAL A 1 18 ? 4.313  3.895   -4.474  1.00 0.00 ? 18 VAL A H    8  
ATOM 8770  H HA   . VAL A 1 18 ? 4.935  1.779   -2.749  1.00 0.00 ? 18 VAL A HA   8  
ATOM 8771  H HB   . VAL A 1 18 ? 7.020  2.924   -2.200  1.00 0.00 ? 18 VAL A HB   8  
ATOM 8772  H HG11 . VAL A 1 18 ? 6.314  3.094   -5.126  1.00 0.00 ? 18 VAL A HG11 8  
ATOM 8773  H HG12 . VAL A 1 18 ? 6.843  1.650   -4.243  1.00 0.00 ? 18 VAL A HG12 8  
ATOM 8774  H HG13 . VAL A 1 18 ? 7.937  3.020   -4.449  1.00 0.00 ? 18 VAL A HG13 8  
ATOM 8775  H HG21 . VAL A 1 18 ? 7.587  5.100   -3.211  1.00 0.00 ? 18 VAL A HG21 8  
ATOM 8776  H HG22 . VAL A 1 18 ? 6.250  5.234   -2.053  1.00 0.00 ? 18 VAL A HG22 8  
ATOM 8777  H HG23 . VAL A 1 18 ? 5.925  5.255   -3.786  1.00 0.00 ? 18 VAL A HG23 8  
ATOM 8778  N N    . ARG A 1 19 ? 4.050  4.542   -1.168  1.00 0.00 ? 19 ARG A N    8  
ATOM 8779  C CA   . ARG A 1 19 ? 3.579  5.020   0.129   1.00 0.00 ? 19 ARG A CA   8  
ATOM 8780  C C    . ARG A 1 19 ? 2.452  4.157   0.692   1.00 0.00 ? 19 ARG A C    8  
ATOM 8781  O O    . ARG A 1 19 ? 2.335  3.993   1.893   1.00 0.00 ? 19 ARG A O    8  
ATOM 8782  C CB   . ARG A 1 19 ? 3.099  6.461   0.011   1.00 0.00 ? 19 ARG A CB   8  
ATOM 8783  C CG   . ARG A 1 19 ? 2.543  7.018   1.308   1.00 0.00 ? 19 ARG A CG   8  
ATOM 8784  C CD   . ARG A 1 19 ? 2.075  8.456   1.152   1.00 0.00 ? 19 ARG A CD   8  
ATOM 8785  N NE   . ARG A 1 19 ? 1.362  8.907   2.339   1.00 0.00 ? 19 ARG A NE   8  
ATOM 8786  C CZ   . ARG A 1 19 ? 0.804  10.105  2.449   1.00 0.00 ? 19 ARG A CZ   8  
ATOM 8787  N NH1  . ARG A 1 19 ? 0.931  11.007  1.465   1.00 0.00 ? 19 ARG A NH1  8  
ATOM 8788  N NH2  . ARG A 1 19 ? 0.152  10.422  3.557   1.00 0.00 ? 19 ARG A NH2  8  
ATOM 8789  H H    . ARG A 1 19 ? 4.039  5.144   -1.933  1.00 0.00 ? 19 ARG A H    8  
ATOM 8790  H HA   . ARG A 1 19 ? 4.400  4.997   0.815   1.00 0.00 ? 19 ARG A HA   8  
ATOM 8791  H HB2  . ARG A 1 19 ? 3.927  7.079   -0.299  1.00 0.00 ? 19 ARG A HB2  8  
ATOM 8792  H HB3  . ARG A 1 19 ? 2.315  6.502   -0.738  1.00 0.00 ? 19 ARG A HB3  8  
ATOM 8793  H HG2  . ARG A 1 19 ? 1.706  6.417   1.630   1.00 0.00 ? 19 ARG A HG2  8  
ATOM 8794  H HG3  . ARG A 1 19 ? 3.326  6.994   2.068   1.00 0.00 ? 19 ARG A HG3  8  
ATOM 8795  H HD2  . ARG A 1 19 ? 2.936  9.087   1.001   1.00 0.00 ? 19 ARG A HD2  8  
ATOM 8796  H HD3  . ARG A 1 19 ? 1.421  8.513   0.294   1.00 0.00 ? 19 ARG A HD3  8  
ATOM 8797  H HE   . ARG A 1 19 ? 1.260  8.268   3.089   1.00 0.00 ? 19 ARG A HE   8  
ATOM 8798  H HH11 . ARG A 1 19 ? 1.418  10.776  0.619   1.00 0.00 ? 19 ARG A HH11 8  
ATOM 8799  H HH12 . ARG A 1 19 ? 0.491  11.903  1.555   1.00 0.00 ? 19 ARG A HH12 8  
ATOM 8800  H HH21 . ARG A 1 19 ? 0.057  9.741   4.291   1.00 0.00 ? 19 ARG A HH21 8  
ATOM 8801  H HH22 . ARG A 1 19 ? -0.254 11.339  3.667   1.00 0.00 ? 19 ARG A HH22 8  
ATOM 8802  N N    . ASP A 1 20 ? 1.658  3.573   -0.216  1.00 0.00 ? 20 ASP A N    8  
ATOM 8803  C CA   . ASP A 1 20 ? 0.510  2.778   0.182   1.00 0.00 ? 20 ASP A CA   8  
ATOM 8804  C C    . ASP A 1 20 ? 0.921  1.375   0.583   1.00 0.00 ? 20 ASP A C    8  
ATOM 8805  O O    . ASP A 1 20 ? 0.597  0.903   1.668   1.00 0.00 ? 20 ASP A O    8  
ATOM 8806  C CB   . ASP A 1 20 ? -0.508 2.726   -0.954  1.00 0.00 ? 20 ASP A CB   8  
ATOM 8807  C CG   . ASP A 1 20 ? -1.759 1.967   -0.567  1.00 0.00 ? 20 ASP A CG   8  
ATOM 8808  O OD1  . ASP A 1 20 ? -2.626 2.541   0.129   1.00 0.00 ? 20 ASP A OD1  8  
ATOM 8809  O OD2  . ASP A 1 20 ? -1.903 0.806   -0.979  1.00 0.00 ? 20 ASP A OD2  8  
ATOM 8810  H H    . ASP A 1 20 ? 1.851  3.682   -1.174  1.00 0.00 ? 20 ASP A H    8  
ATOM 8811  H HA   . ASP A 1 20 ? 0.057  3.263   1.033   1.00 0.00 ? 20 ASP A HA   8  
ATOM 8812  H HB2  . ASP A 1 20 ? -0.784 3.739   -1.223  1.00 0.00 ? 20 ASP A HB2  8  
ATOM 8813  H HB3  . ASP A 1 20 ? -0.070 2.251   -1.812  1.00 0.00 ? 20 ASP A HB3  8  
ATOM 8814  N N    . THR A 1 21 ? 1.645  0.704   -0.292  1.00 0.00 ? 21 THR A N    8  
ATOM 8815  C CA   . THR A 1 21 ? 1.967  -0.703  -0.095  1.00 0.00 ? 21 THR A CA   8  
ATOM 8816  C C    . THR A 1 21 ? 3.228  -0.907  0.749   1.00 0.00 ? 21 THR A C    8  
ATOM 8817  O O    . THR A 1 21 ? 3.289  -1.815  1.592   1.00 0.00 ? 21 THR A O    8  
ATOM 8818  C CB   . THR A 1 21 ? 2.139  -1.425  -1.444  1.00 0.00 ? 21 THR A CB   8  
ATOM 8819  O OG1  . THR A 1 21 ? 0.947  -1.233  -2.238  1.00 0.00 ? 21 THR A OG1  8  
ATOM 8820  C CG2  . THR A 1 21 ? 2.394  -2.915  -1.257  1.00 0.00 ? 21 THR A CG2  8  
ATOM 8821  H H    . THR A 1 21 ? 1.969  1.156   -1.094  1.00 0.00 ? 21 THR A H    8  
ATOM 8822  H HA   . THR A 1 21 ? 1.139  -1.160  0.420   1.00 0.00 ? 21 THR A HA   8  
ATOM 8823  H HB   . THR A 1 21 ? 2.981  -0.993  -1.963  1.00 0.00 ? 21 THR A HB   8  
ATOM 8824  H HG1  . THR A 1 21 ? 0.169  -1.393  -1.684  1.00 0.00 ? 21 THR A HG1  8  
ATOM 8825  H HG21 . THR A 1 21 ? 1.552  -3.360  -0.758  1.00 0.00 ? 21 THR A HG21 8  
ATOM 8826  H HG22 . THR A 1 21 ? 3.282  -3.044  -0.651  1.00 0.00 ? 21 THR A HG22 8  
ATOM 8827  H HG23 . THR A 1 21 ? 2.533  -3.386  -2.213  1.00 0.00 ? 21 THR A HG23 8  
ATOM 8828  N N    . LEU A 1 22 ? 4.224  -0.055  0.527   1.00 0.00 ? 22 LEU A N    8  
ATOM 8829  C CA   . LEU A 1 22 ? 5.531  -0.189  1.180   1.00 0.00 ? 22 LEU A CA   8  
ATOM 8830  C C    . LEU A 1 22 ? 5.437  0.190   2.656   1.00 0.00 ? 22 LEU A C    8  
ATOM 8831  O O    . LEU A 1 22 ? 5.435  1.366   3.025   1.00 0.00 ? 22 LEU A O    8  
ATOM 8832  C CB   . LEU A 1 22 ? 6.535  0.707   0.447   1.00 0.00 ? 22 LEU A CB   8  
ATOM 8833  C CG   . LEU A 1 22 ? 7.987  0.641   0.957   1.00 0.00 ? 22 LEU A CG   8  
ATOM 8834  C CD1  . LEU A 1 22 ? 8.580  -0.754  0.787   1.00 0.00 ? 22 LEU A CD1  8  
ATOM 8835  C CD2  . LEU A 1 22 ? 8.838  1.669   0.224   1.00 0.00 ? 22 LEU A CD2  8  
ATOM 8836  H H    . LEU A 1 22 ? 4.079  0.708   -0.065  1.00 0.00 ? 22 LEU A H    8  
ATOM 8837  H HA   . LEU A 1 22 ? 5.833  -1.214  1.103   1.00 0.00 ? 22 LEU A HA   8  
ATOM 8838  H HB2  . LEU A 1 22 ? 6.542  0.421   -0.587  1.00 0.00 ? 22 LEU A HB2  8  
ATOM 8839  H HB3  . LEU A 1 22 ? 6.197  1.728   0.526   1.00 0.00 ? 22 LEU A HB3  8  
ATOM 8840  H HG   . LEU A 1 22 ? 8.011  0.892   2.010   1.00 0.00 ? 22 LEU A HG   8  
ATOM 8841  H HD11 . LEU A 1 22 ? 7.981  -1.465  1.347   1.00 0.00 ? 22 LEU A HD11 8  
ATOM 8842  H HD12 . LEU A 1 22 ? 9.601  -0.762  1.143   1.00 0.00 ? 22 LEU A HD12 8  
ATOM 8843  H HD13 . LEU A 1 22 ? 8.553  -1.012  -0.257  1.00 0.00 ? 22 LEU A HD13 8  
ATOM 8844  H HD21 . LEU A 1 22 ? 8.425  2.649   0.398   1.00 0.00 ? 22 LEU A HD21 8  
ATOM 8845  H HD22 . LEU A 1 22 ? 8.818  1.443   -0.825  1.00 0.00 ? 22 LEU A HD22 8  
ATOM 8846  H HD23 . LEU A 1 22 ? 9.851  1.626   0.597   1.00 0.00 ? 22 LEU A HD23 8  
ATOM 8847  N N    . GLN A 1 23 ? 5.284  -0.825  3.495   1.00 0.00 ? 23 GLN A N    8  
ATOM 8848  C CA   . GLN A 1 23 ? 5.208  -0.645  4.936   1.00 0.00 ? 23 GLN A CA   8  
ATOM 8849  C C    . GLN A 1 23 ? 6.604  -0.535  5.515   1.00 0.00 ? 23 GLN A C    8  
ATOM 8850  O O    . GLN A 1 23 ? 7.575  -1.059  4.961   1.00 0.00 ? 23 GLN A O    8  
ATOM 8851  C CB   . GLN A 1 23 ? 4.492  -1.816  5.579   1.00 0.00 ? 23 GLN A CB   8  
ATOM 8852  C CG   . GLN A 1 23 ? 3.018  -1.941  5.238   1.00 0.00 ? 23 GLN A CG   8  
ATOM 8853  C CD   . GLN A 1 23 ? 2.336  -3.085  5.980   1.00 0.00 ? 23 GLN A CD   8  
ATOM 8854  O OE1  . GLN A 1 23 ? 1.393  -3.685  5.486   1.00 0.00 ? 23 GLN A OE1  8  
ATOM 8855  N NE2  . GLN A 1 23 ? 2.817  -3.386  7.192   1.00 0.00 ? 23 GLN A NE2  8  
ATOM 8856  H H    . GLN A 1 23 ? 5.210  -1.727  3.136   1.00 0.00 ? 23 GLN A H    8  
ATOM 8857  H HA   . GLN A 1 23 ? 4.667  0.273   5.126   1.00 0.00 ? 23 GLN A HA   8  
ATOM 8858  H HB2  . GLN A 1 23 ? 4.988  -2.728  5.273   1.00 0.00 ? 23 GLN A HB2  8  
ATOM 8859  H HB3  . GLN A 1 23 ? 4.594  -1.722  6.660   1.00 0.00 ? 23 GLN A HB3  8  
ATOM 8860  H HG2  . GLN A 1 23 ? 2.514  -1.017  5.500   1.00 0.00 ? 23 GLN A HG2  8  
ATOM 8861  H HG3  . GLN A 1 23 ? 2.923  -2.109  4.173   1.00 0.00 ? 23 GLN A HG3  8  
ATOM 8862  H HE21 . GLN A 1 23 ? 3.563  -2.859  7.532   1.00 0.00 ? 23 GLN A HE21 8  
ATOM 8863  H HE22 . GLN A 1 23 ? 2.406  -4.132  7.677   1.00 0.00 ? 23 GLN A HE22 8  
ATOM 8864  N N    . PRO A 1 24 ? 6.734  0.146   6.661   1.00 0.00 ? 24 PRO A N    8  
ATOM 8865  C CA   . PRO A 1 24 ? 7.993  0.212   7.417   1.00 0.00 ? 24 PRO A CA   8  
ATOM 8866  C C    . PRO A 1 24 ? 8.505  -1.187  7.773   1.00 0.00 ? 24 PRO A C    8  
ATOM 8867  O O    . PRO A 1 24 ? 7.861  -1.921  8.523   1.00 0.00 ? 24 PRO A O    8  
ATOM 8868  C CB   . PRO A 1 24 ? 7.616  0.973   8.687   1.00 0.00 ? 24 PRO A CB   8  
ATOM 8869  C CG   . PRO A 1 24 ? 6.397  1.746   8.329   1.00 0.00 ? 24 PRO A CG   8  
ATOM 8870  C CD   . PRO A 1 24 ? 5.665  0.915   7.310   1.00 0.00 ? 24 PRO A CD   8  
ATOM 8871  H HA   . PRO A 1 24 ? 8.760  0.746   6.872   1.00 0.00 ? 24 PRO A HA   8  
ATOM 8872  H HB2  . PRO A 1 24 ? 7.420  0.262   9.477   1.00 0.00 ? 24 PRO A HB2  8  
ATOM 8873  H HB3  . PRO A 1 24 ? 8.431  1.631   8.980   1.00 0.00 ? 24 PRO A HB3  8  
ATOM 8874  H HG2  . PRO A 1 24 ? 5.788  1.899   9.202   1.00 0.00 ? 24 PRO A HG2  8  
ATOM 8875  H HG3  . PRO A 1 24 ? 6.687  2.698   7.900   1.00 0.00 ? 24 PRO A HG3  8  
ATOM 8876  H HD2  . PRO A 1 24 ? 4.953  0.260   7.784   1.00 0.00 ? 24 PRO A HD2  8  
ATOM 8877  H HD3  . PRO A 1 24 ? 5.164  1.563   6.606   1.00 0.00 ? 24 PRO A HD3  8  
ATOM 8878  N N    . GLY A 1 25 ? 9.649  -1.532  7.243   1.00 0.00 ? 25 GLY A N    8  
ATOM 8879  C CA   . GLY A 1 25 ? 10.178 -2.858  7.426   1.00 0.00 ? 25 GLY A CA   8  
ATOM 8880  C C    . GLY A 1 25 ? 10.280 -3.608  6.115   1.00 0.00 ? 25 GLY A C    8  
ATOM 8881  O O    . GLY A 1 25 ? 10.917 -4.658  6.042   1.00 0.00 ? 25 GLY A O    8  
ATOM 8882  H H    . GLY A 1 25 ? 10.153 -0.877  6.707   1.00 0.00 ? 25 GLY A H    8  
ATOM 8883  H HA2  . GLY A 1 25 ? 11.164 -2.785  7.875   1.00 0.00 ? 25 GLY A HA2  8  
ATOM 8884  H HA3  . GLY A 1 25 ? 9.529  -3.405  8.090   1.00 0.00 ? 25 GLY A HA3  8  
ATOM 8885  N N    . MET A 1 26 ? 9.635  -3.084  5.095   1.00 0.00 ? 26 MET A N    8  
ATOM 8886  C CA   . MET A 1 26 ? 9.726  -3.671  3.767   1.00 0.00 ? 26 MET A CA   8  
ATOM 8887  C C    . MET A 1 26 ? 11.033 -3.258  3.093   1.00 0.00 ? 26 MET A C    8  
ATOM 8888  O O    . MET A 1 26 ? 11.497 -2.126  3.232   1.00 0.00 ? 26 MET A O    8  
ATOM 8889  C CB   . MET A 1 26 ? 8.549  -3.262  2.879   1.00 0.00 ? 26 MET A CB   8  
ATOM 8890  C CG   . MET A 1 26 ? 7.265  -4.029  3.147   1.00 0.00 ? 26 MET A CG   8  
ATOM 8891  S SD   . MET A 1 26 ? 5.960  -3.573  1.999   1.00 0.00 ? 26 MET A SD   8  
ATOM 8892  C CE   . MET A 1 26 ? 4.701  -4.768  2.441   1.00 0.00 ? 26 MET A CE   8  
ATOM 8893  H H    . MET A 1 26 ? 9.076  -2.285  5.236   1.00 0.00 ? 26 MET A H    8  
ATOM 8894  H HA   . MET A 1 26 ? 9.707  -4.743  3.882   1.00 0.00 ? 26 MET A HA   8  
ATOM 8895  H HB2  . MET A 1 26 ? 8.354  -2.218  3.026   1.00 0.00 ? 26 MET A HB2  8  
ATOM 8896  H HB3  . MET A 1 26 ? 8.816  -3.424  1.838   1.00 0.00 ? 26 MET A HB3  8  
ATOM 8897  H HG2  . MET A 1 26 ? 7.456  -5.081  3.054   1.00 0.00 ? 26 MET A HG2  8  
ATOM 8898  H HG3  . MET A 1 26 ? 6.932  -3.809  4.158   1.00 0.00 ? 26 MET A HG3  8  
ATOM 8899  H HE1  . MET A 1 26 ? 5.086  -5.770  2.281   1.00 0.00 ? 26 MET A HE1  8  
ATOM 8900  H HE2  . MET A 1 26 ? 3.821  -4.612  1.830   1.00 0.00 ? 26 MET A HE2  8  
ATOM 8901  H HE3  . MET A 1 26 ? 4.447  -4.635  3.479   1.00 0.00 ? 26 MET A HE3  8  
ATOM 8902  N N    . ARG A 1 27 ? 11.626 -4.199  2.378   1.00 0.00 ? 27 ARG A N    8  
ATOM 8903  C CA   . ARG A 1 27 ? 12.890 -3.973  1.714   1.00 0.00 ? 27 ARG A CA   8  
ATOM 8904  C C    . ARG A 1 27 ? 12.712 -3.213  0.410   1.00 0.00 ? 27 ARG A C    8  
ATOM 8905  O O    . ARG A 1 27 ? 11.690 -3.358  -0.282  1.00 0.00 ? 27 ARG A O    8  
ATOM 8906  C CB   . ARG A 1 27 ? 13.606 -5.305  1.468   1.00 0.00 ? 27 ARG A CB   8  
ATOM 8907  C CG   . ARG A 1 27 ? 15.101 -5.168  1.331   1.00 0.00 ? 27 ARG A CG   8  
ATOM 8908  C CD   . ARG A 1 27 ? 15.748 -6.516  1.072   1.00 0.00 ? 27 ARG A CD   8  
ATOM 8909  N NE   . ARG A 1 27 ? 17.205 -6.503  1.168   1.00 0.00 ? 27 ARG A NE   8  
ATOM 8910  C CZ   . ARG A 1 27 ? 17.995 -7.459  0.672   1.00 0.00 ? 27 ARG A CZ   8  
ATOM 8911  N NH1  . ARG A 1 27 ? 17.454 -8.419  -0.079  1.00 0.00 ? 27 ARG A NH1  8  
ATOM 8912  N NH2  . ARG A 1 27 ? 19.292 -7.433  0.893   1.00 0.00 ? 27 ARG A NH2  8  
ATOM 8913  H H    . ARG A 1 27 ? 11.199 -5.079  2.333   1.00 0.00 ? 27 ARG A H    8  
ATOM 8914  H HA   . ARG A 1 27 ? 13.510 -3.362  2.372   1.00 0.00 ? 27 ARG A HA   8  
ATOM 8915  H HB2  . ARG A 1 27 ? 13.398 -5.962  2.291   1.00 0.00 ? 27 ARG A HB2  8  
ATOM 8916  H HB3  . ARG A 1 27 ? 13.221 -5.744  0.551   1.00 0.00 ? 27 ARG A HB3  8  
ATOM 8917  H HG2  . ARG A 1 27 ? 15.333 -4.506  0.495   1.00 0.00 ? 27 ARG A HG2  8  
ATOM 8918  H HG3  . ARG A 1 27 ? 15.528 -4.744  2.231   1.00 0.00 ? 27 ARG A HG3  8  
ATOM 8919  H HD2  . ARG A 1 27 ? 15.353 -7.221  1.801   1.00 0.00 ? 27 ARG A HD2  8  
ATOM 8920  H HD3  . ARG A 1 27 ? 15.471 -6.835  0.093   1.00 0.00 ? 27 ARG A HD3  8  
ATOM 8921  H HE   . ARG A 1 27 ? 17.633 -5.761  1.672   1.00 0.00 ? 27 ARG A HE   8  
ATOM 8922  H HH11 . ARG A 1 27 ? 16.469 -8.417  -0.261  1.00 0.00 ? 27 ARG A HH11 8  
ATOM 8923  H HH12 . ARG A 1 27 ? 18.036 -9.151  -0.453  1.00 0.00 ? 27 ARG A HH12 8  
ATOM 8924  H HH21 . ARG A 1 27 ? 19.693 -6.699  1.447   1.00 0.00 ? 27 ARG A HH21 8  
ATOM 8925  H HH22 . ARG A 1 27 ? 19.897 -8.154  0.503   1.00 0.00 ? 27 ARG A HH22 8  
ATOM 8926  N N    . VAL A 1 28 ? 13.700 -2.399  0.081   1.00 0.00 ? 28 VAL A N    8  
ATOM 8927  C CA   . VAL A 1 28 ? 13.674 -1.588  -1.138  1.00 0.00 ? 28 VAL A CA   8  
ATOM 8928  C C    . VAL A 1 28 ? 14.953 -1.766  -1.937  1.00 0.00 ? 28 VAL A C    8  
ATOM 8929  O O    . VAL A 1 28 ? 15.985 -2.168  -1.401  1.00 0.00 ? 28 VAL A O    8  
ATOM 8930  C CB   . VAL A 1 28 ? 13.472 -0.089  -0.827  1.00 0.00 ? 28 VAL A CB   8  
ATOM 8931  C CG1  . VAL A 1 28 ? 12.135 0.149   -0.161  1.00 0.00 ? 28 VAL A CG1  8  
ATOM 8932  C CG2  . VAL A 1 28 ? 14.604 0.436   0.046   1.00 0.00 ? 28 VAL A CG2  8  
ATOM 8933  H H    . VAL A 1 28 ? 14.478 -2.342  0.688   1.00 0.00 ? 28 VAL A H    8  
ATOM 8934  H HA   . VAL A 1 28 ? 12.831 -1.914  -1.743  1.00 0.00 ? 28 VAL A HA   8  
ATOM 8935  H HB   . VAL A 1 28 ? 13.493 0.466   -1.761  1.00 0.00 ? 28 VAL A HB   8  
ATOM 8936  H HG11 . VAL A 1 28 ? 12.086 -0.437  0.759   1.00 0.00 ? 28 VAL A HG11 8  
ATOM 8937  H HG12 . VAL A 1 28 ? 11.351 -0.167  -0.823  1.00 0.00 ? 28 VAL A HG12 8  
ATOM 8938  H HG13 . VAL A 1 28 ? 12.014 1.201   0.064   1.00 0.00 ? 28 VAL A HG13 8  
ATOM 8939  H HG21 . VAL A 1 28 ? 14.443 1.483   0.250   1.00 0.00 ? 28 VAL A HG21 8  
ATOM 8940  H HG22 . VAL A 1 28 ? 15.546 0.305   -0.457  1.00 0.00 ? 28 VAL A HG22 8  
ATOM 8941  H HG23 . VAL A 1 28 ? 14.625 -0.113  0.989   1.00 0.00 ? 28 VAL A HG23 8  
ATOM 8942  N N    . ARG A 1 29 ? 14.866 -1.485  -3.231  1.00 0.00 ? 29 ARG A N    8  
ATOM 8943  C CA   . ARG A 1 29 ? 16.020 -1.638  -4.117  1.00 0.00 ? 29 ARG A CA   8  
ATOM 8944  C C    . ARG A 1 29 ? 16.270 -0.346  -4.880  1.00 0.00 ? 29 ARG A C    8  
ATOM 8945  O O    . ARG A 1 29 ? 15.355 0.252   -5.426  1.00 0.00 ? 29 ARG A O    8  
ATOM 8946  C CB   . ARG A 1 29 ? 15.773 -2.795  -5.087  1.00 0.00 ? 29 ARG A CB   8  
ATOM 8947  C CG   . ARG A 1 29 ? 16.926 -3.068  -6.039  1.00 0.00 ? 29 ARG A CG   8  
ATOM 8948  C CD   . ARG A 1 29 ? 16.735 -4.390  -6.769  1.00 0.00 ? 29 ARG A CD   8  
ATOM 8949  N NE   . ARG A 1 29 ? 16.697 -5.527  -5.828  1.00 0.00 ? 29 ARG A NE   8  
ATOM 8950  C CZ   . ARG A 1 29 ? 16.172 -6.721  -6.102  1.00 0.00 ? 29 ARG A CZ   8  
ATOM 8951  N NH1  . ARG A 1 29 ? 15.566 -6.966  -7.264  1.00 0.00 ? 29 ARG A NH1  8  
ATOM 8952  N NH2  . ARG A 1 29 ? 16.212 -7.667  -5.178  1.00 0.00 ? 29 ARG A NH2  8  
ATOM 8953  H H    . ARG A 1 29 ? 14.013 -1.183  -3.596  1.00 0.00 ? 29 ARG A H    8  
ATOM 8954  H HA   . ARG A 1 29 ? 16.879 -1.849  -3.507  1.00 0.00 ? 29 ARG A HA   8  
ATOM 8955  H HB2  . ARG A 1 29 ? 15.598 -3.701  -4.511  1.00 0.00 ? 29 ARG A HB2  8  
ATOM 8956  H HB3  . ARG A 1 29 ? 14.912 -2.577  -5.679  1.00 0.00 ? 29 ARG A HB3  8  
ATOM 8957  H HG2  . ARG A 1 29 ? 16.973 -2.270  -6.777  1.00 0.00 ? 29 ARG A HG2  8  
ATOM 8958  H HG3  . ARG A 1 29 ? 17.850 -3.098  -5.479  1.00 0.00 ? 29 ARG A HG3  8  
ATOM 8959  H HD2  . ARG A 1 29 ? 15.813 -4.363  -7.319  1.00 0.00 ? 29 ARG A HD2  8  
ATOM 8960  H HD3  . ARG A 1 29 ? 17.554 -4.533  -7.447  1.00 0.00 ? 29 ARG A HD3  8  
ATOM 8961  H HE   . ARG A 1 29 ? 17.113 -5.390  -4.943  1.00 0.00 ? 29 ARG A HE   8  
ATOM 8962  H HH11 . ARG A 1 29 ? 15.526 -6.247  -7.966  1.00 0.00 ? 29 ARG A HH11 8  
ATOM 8963  H HH12 . ARG A 1 29 ? 15.146 -7.855  -7.447  1.00 0.00 ? 29 ARG A HH12 8  
ATOM 8964  H HH21 . ARG A 1 29 ? 16.660 -7.484  -4.292  1.00 0.00 ? 29 ARG A HH21 8  
ATOM 8965  H HH22 . ARG A 1 29 ? 15.831 -8.574  -5.372  1.00 0.00 ? 29 ARG A HH22 8  
ATOM 8966  N N    . MET A 1 30 ? 17.515 0.083   -4.900  1.00 0.00 ? 30 MET A N    8  
ATOM 8967  C CA   . MET A 1 30 ? 17.916 1.305   -5.586  1.00 0.00 ? 30 MET A CA   8  
ATOM 8968  C C    . MET A 1 30 ? 18.231 0.996   -7.051  1.00 0.00 ? 30 MET A C    8  
ATOM 8969  O O    . MET A 1 30 ? 18.995 0.082   -7.331  1.00 0.00 ? 30 MET A O    8  
ATOM 8970  C CB   . MET A 1 30 ? 19.138 1.906   -4.907  1.00 0.00 ? 30 MET A CB   8  
ATOM 8971  C CG   . MET A 1 30 ? 19.506 3.300   -5.416  1.00 0.00 ? 30 MET A CG   8  
ATOM 8972  S SD   . MET A 1 30 ? 18.277 4.549   -4.990  1.00 0.00 ? 30 MET A SD   8  
ATOM 8973  C CE   . MET A 1 30 ? 19.063 6.022   -5.628  1.00 0.00 ? 30 MET A CE   8  
ATOM 8974  H H    . MET A 1 30 ? 18.202 -0.444  -4.441  1.00 0.00 ? 30 MET A H    8  
ATOM 8975  H HA   . MET A 1 30 ? 17.097 1.994   -5.539  1.00 0.00 ? 30 MET A HA   8  
ATOM 8976  H HB2  . MET A 1 30 ? 18.959 1.979   -3.854  1.00 0.00 ? 30 MET A HB2  8  
ATOM 8977  H HB3  . MET A 1 30 ? 19.988 1.260   -5.076  1.00 0.00 ? 30 MET A HB3  8  
ATOM 8978  H HG2  . MET A 1 30 ? 20.456 3.587   -4.976  1.00 0.00 ? 30 MET A HG2  8  
ATOM 8979  H HG3  . MET A 1 30 ? 19.605 3.267   -6.496  1.00 0.00 ? 30 MET A HG3  8  
ATOM 8980  H HE1  . MET A 1 30 ? 19.248 5.893   -6.681  1.00 0.00 ? 30 MET A HE1  8  
ATOM 8981  H HE2  . MET A 1 30 ? 20.000 6.168   -5.113  1.00 0.00 ? 30 MET A HE2  8  
ATOM 8982  H HE3  . MET A 1 30 ? 18.416 6.874   -5.471  1.00 0.00 ? 30 MET A HE3  8  
ATOM 8983  N N    . LEU A 1 31 ? 17.640 1.736   -7.958  1.00 0.00 ? 31 LEU A N    8  
ATOM 8984  C CA   . LEU A 1 31 ? 17.882 1.506   -9.364  1.00 0.00 ? 31 LEU A CA   8  
ATOM 8985  C C    . LEU A 1 31 ? 18.587 2.704   -10.014 1.00 0.00 ? 31 LEU A C    8  
ATOM 8986  O O    . LEU A 1 31 ? 18.640 2.815   -11.230 1.00 0.00 ? 31 LEU A O    8  
ATOM 8987  C CB   . LEU A 1 31 ? 16.568 1.190   -10.100 1.00 0.00 ? 31 LEU A CB   8  
ATOM 8988  C CG   . LEU A 1 31 ? 15.316 2.002   -9.727  1.00 0.00 ? 31 LEU A CG   8  
ATOM 8989  C CD1  . LEU A 1 31 ? 15.529 3.487   -9.877  1.00 0.00 ? 31 LEU A CD1  8  
ATOM 8990  C CD2  . LEU A 1 31 ? 14.144 1.554   -10.570 1.00 0.00 ? 31 LEU A CD2  8  
ATOM 8991  H H    . LEU A 1 31 ? 17.026 2.448   -7.671  1.00 0.00 ? 31 LEU A H    8  
ATOM 8992  H HA   . LEU A 1 31 ? 18.526 0.654   -9.441  1.00 0.00 ? 31 LEU A HA   8  
ATOM 8993  H HB2  . LEU A 1 31 ? 16.740 1.315   -11.162 1.00 0.00 ? 31 LEU A HB2  8  
ATOM 8994  H HB3  . LEU A 1 31 ? 16.349 0.143   -9.919  1.00 0.00 ? 31 LEU A HB3  8  
ATOM 8995  H HG   . LEU A 1 31 ? 15.068 1.800   -8.683  1.00 0.00 ? 31 LEU A HG   8  
ATOM 8996  H HD11 . LEU A 1 31 ? 15.737 3.728   -10.908 1.00 0.00 ? 31 LEU A HD11 8  
ATOM 8997  H HD12 . LEU A 1 31 ? 16.341 3.816   -9.250  1.00 0.00 ? 31 LEU A HD12 8  
ATOM 8998  H HD13 . LEU A 1 31 ? 14.621 3.999   -9.572  1.00 0.00 ? 31 LEU A HD13 8  
ATOM 8999  H HD21 . LEU A 1 31 ? 14.369 1.711   -11.624 1.00 0.00 ? 31 LEU A HD21 8  
ATOM 9000  H HD22 . LEU A 1 31 ? 13.267 2.144   -10.316 1.00 0.00 ? 31 LEU A HD22 8  
ATOM 9001  H HD23 . LEU A 1 31 ? 13.938 0.505   -10.403 1.00 0.00 ? 31 LEU A HD23 8  
ATOM 9002  N N    . ASP A 1 32 ? 19.122 3.589   -9.177  1.00 0.00 ? 32 ASP A N    8  
ATOM 9003  C CA   . ASP A 1 32 ? 19.787 4.787   -9.696  1.00 0.00 ? 32 ASP A CA   8  
ATOM 9004  C C    . ASP A 1 32 ? 21.045 5.084   -8.883  1.00 0.00 ? 32 ASP A C    8  
ATOM 9005  O O    . ASP A 1 32 ? 21.159 4.654   -7.717  1.00 0.00 ? 32 ASP A O    8  
ATOM 9006  C CB   . ASP A 1 32 ? 18.824 5.971   -9.669  1.00 0.00 ? 32 ASP A CB   8  
ATOM 9007  C CG   . ASP A 1 32 ? 19.382 7.184   -10.380 1.00 0.00 ? 32 ASP A CG   8  
ATOM 9008  O OD1  . ASP A 1 32 ? 19.590 7.101   -11.605 1.00 0.00 ? 32 ASP A OD1  8  
ATOM 9009  O OD2  . ASP A 1 32 ? 19.630 8.225   -9.728  1.00 0.00 ? 32 ASP A OD2  8  
ATOM 9010  H H    . ASP A 1 32 ? 19.110 3.435   -8.212  1.00 0.00 ? 32 ASP A H    8  
ATOM 9011  H HA   . ASP A 1 32 ? 20.069 4.588   -10.712 1.00 0.00 ? 32 ASP A HA   8  
ATOM 9012  H HB2  . ASP A 1 32 ? 17.912 5.677   -10.145 1.00 0.00 ? 32 ASP A HB2  8  
ATOM 9013  H HB3  . ASP A 1 32 ? 18.619 6.245   -8.643  1.00 0.00 ? 32 ASP A HB3  8  
ATOM 9014  N N    . ASP A 1 33 ? 21.991 5.798   -9.485  1.00 0.00 ? 33 ASP A N    8  
ATOM 9015  C CA   . ASP A 1 33 ? 23.225 6.161   -8.824  1.00 0.00 ? 33 ASP A CA   8  
ATOM 9016  C C    . ASP A 1 33 ? 23.093 7.563   -8.230  1.00 0.00 ? 33 ASP A C    8  
ATOM 9017  O O    . ASP A 1 33 ? 22.808 8.512   -8.962  1.00 0.00 ? 33 ASP A O    8  
ATOM 9018  C CB   . ASP A 1 33 ? 24.384 6.110   -9.827  1.00 0.00 ? 33 ASP A CB   8  
ATOM 9019  C CG   . ASP A 1 33 ? 25.727 6.416   -9.208  1.00 0.00 ? 33 ASP A CG   8  
ATOM 9020  O OD1  . ASP A 1 33 ? 26.037 7.607   -8.987  1.00 0.00 ? 33 ASP A OD1  8  
ATOM 9021  O OD2  . ASP A 1 33 ? 26.491 5.460   -8.941  1.00 0.00 ? 33 ASP A OD2  8  
ATOM 9022  H H    . ASP A 1 33 ? 21.839 6.097   -10.408 1.00 0.00 ? 33 ASP A H    8  
ATOM 9023  H HA   . ASP A 1 33 ? 23.416 5.460   -8.033  1.00 0.00 ? 33 ASP A HA   8  
ATOM 9024  H HB2  . ASP A 1 33 ? 24.445 5.125   -10.269 1.00 0.00 ? 33 ASP A HB2  8  
ATOM 9025  H HB3  . ASP A 1 33 ? 24.204 6.837   -10.612 1.00 0.00 ? 33 ASP A HB3  8  
ATOM 9026  N N    . TYR A 1 34 ? 23.310 7.711   -6.926  1.00 0.00 ? 34 TYR A N    8  
ATOM 9027  C CA   . TYR A 1 34 ? 23.098 9.003   -6.274  1.00 0.00 ? 34 TYR A CA   8  
ATOM 9028  C C    . TYR A 1 34 ? 23.848 9.141   -4.946  1.00 0.00 ? 34 TYR A C    8  
ATOM 9029  O O    . TYR A 1 34 ? 23.446 8.554   -3.936  1.00 0.00 ? 34 TYR A O    8  
ATOM 9030  C CB   . TYR A 1 34 ? 21.603 9.247   -6.036  1.00 0.00 ? 34 TYR A CB   8  
ATOM 9031  C CG   . TYR A 1 34 ? 21.289 10.591  -5.413  1.00 0.00 ? 34 TYR A CG   8  
ATOM 9032  C CD1  . TYR A 1 34 ? 21.362 11.759  -6.154  1.00 0.00 ? 34 TYR A CD1  8  
ATOM 9033  C CD2  . TYR A 1 34 ? 20.918 10.707  -4.076  1.00 0.00 ? 34 TYR A CD2  8  
ATOM 9034  C CE1  . TYR A 1 34 ? 21.069 13.000  -5.590  1.00 0.00 ? 34 TYR A CE1  8  
ATOM 9035  C CE2  . TYR A 1 34 ? 20.626 11.918  -3.502  1.00 0.00 ? 34 TYR A CE2  8  
ATOM 9036  C CZ   . TYR A 1 34 ? 20.703 13.071  -4.272  1.00 0.00 ? 34 TYR A CZ   8  
ATOM 9037  O OH   . TYR A 1 34 ? 20.426 14.299  -3.721  1.00 0.00 ? 34 TYR A OH   8  
ATOM 9038  H H    . TYR A 1 34 ? 23.661 6.951   -6.399  1.00 0.00 ? 34 TYR A H    8  
ATOM 9039  H HA   . TYR A 1 34 ? 23.456 9.766   -6.952  1.00 0.00 ? 34 TYR A HA   8  
ATOM 9040  H HB2  . TYR A 1 34 ? 21.087 9.191   -6.983  1.00 0.00 ? 34 TYR A HB2  8  
ATOM 9041  H HB3  . TYR A 1 34 ? 21.222 8.469   -5.373  1.00 0.00 ? 34 TYR A HB3  8  
ATOM 9042  H HD1  . TYR A 1 34 ? 21.649 11.706  -7.191  1.00 0.00 ? 34 TYR A HD1  8  
ATOM 9043  H HD2  . TYR A 1 34 ? 20.860 9.804   -3.468  1.00 0.00 ? 34 TYR A HD2  8  
ATOM 9044  H HE1  . TYR A 1 34 ? 21.137 13.881  -6.194  1.00 0.00 ? 34 TYR A HE1  8  
ATOM 9045  H HE2  . TYR A 1 34 ? 20.341 11.977  -2.467  1.00 0.00 ? 34 TYR A HE2  8  
ATOM 9046  H HH   . TYR A 1 34 ? 20.928 14.405  -2.892  1.00 0.00 ? 34 TYR A HH   8  
ATOM 9047  N N    . GLU A 1 35 ? 24.967 9.883   -4.993  1.00 0.00 ? 35 GLU A N    8  
ATOM 9048  C CA   . GLU A 1 35 ? 25.591 10.494  -3.812  1.00 0.00 ? 35 GLU A CA   8  
ATOM 9049  C C    . GLU A 1 35 ? 26.311 9.495   -2.901  1.00 0.00 ? 35 GLU A C    8  
ATOM 9050  O O    . GLU A 1 35 ? 27.265 9.858   -2.206  1.00 0.00 ? 35 GLU A O    8  
ATOM 9051  C CB   . GLU A 1 35 ? 24.507 11.253  -3.018  1.00 0.00 ? 35 GLU A CB   8  
ATOM 9052  C CG   . GLU A 1 35 ? 25.016 12.426  -2.181  1.00 0.00 ? 35 GLU A CG   8  
ATOM 9053  C CD   . GLU A 1 35 ? 25.487 12.017  -0.799  1.00 0.00 ? 35 GLU A CD   8  
ATOM 9054  O OE1  . GLU A 1 35 ? 24.626 11.712  0.058   1.00 0.00 ? 35 GLU A OE1  8  
ATOM 9055  O OE2  . GLU A 1 35 ? 26.705 12.046  -0.546  1.00 0.00 ? 35 GLU A OE2  8  
ATOM 9056  H H    . GLU A 1 35 ? 25.392 9.999   -5.867  1.00 0.00 ? 35 GLU A H    8  
ATOM 9057  H HA   . GLU A 1 35 ? 26.312 11.207  -4.168  1.00 0.00 ? 35 GLU A HA   8  
ATOM 9058  H HB2  . GLU A 1 35 ? 23.779 11.635  -3.718  1.00 0.00 ? 35 GLU A HB2  8  
ATOM 9059  H HB3  . GLU A 1 35 ? 24.019 10.550  -2.355  1.00 0.00 ? 35 GLU A HB3  8  
ATOM 9060  H HG2  . GLU A 1 35 ? 25.852 12.897  -2.707  1.00 0.00 ? 35 GLU A HG2  8  
ATOM 9061  H HG3  . GLU A 1 35 ? 24.213 13.147  -2.072  1.00 0.00 ? 35 GLU A HG3  8  
ATOM 9062  N N    . GLU A 1 36 ? 25.895 8.252   -2.917  1.00 0.00 ? 36 GLU A N    8  
ATOM 9063  C CA   . GLU A 1 36 ? 26.340 7.248   -1.953  1.00 0.00 ? 36 GLU A CA   8  
ATOM 9064  C C    . GLU A 1 36 ? 25.756 5.893   -2.318  1.00 0.00 ? 36 GLU A C    8  
ATOM 9065  O O    . GLU A 1 36 ? 26.409 4.870   -2.206  1.00 0.00 ? 36 GLU A O    8  
ATOM 9066  C CB   . GLU A 1 36 ? 25.921 7.654   -0.531  1.00 0.00 ? 36 GLU A CB   8  
ATOM 9067  C CG   . GLU A 1 36 ? 26.268 6.640   0.546   1.00 0.00 ? 36 GLU A CG   8  
ATOM 9068  C CD   . GLU A 1 36 ? 27.759 6.522   0.806   1.00 0.00 ? 36 GLU A CD   8  
ATOM 9069  O OE1  . GLU A 1 36 ? 28.305 7.377   1.524   1.00 0.00 ? 36 GLU A OE1  8  
ATOM 9070  O OE2  . GLU A 1 36 ? 28.394 5.577   0.290   1.00 0.00 ? 36 GLU A OE2  8  
ATOM 9071  H H    . GLU A 1 36 ? 25.307 7.963   -3.653  1.00 0.00 ? 36 GLU A H    8  
ATOM 9072  H HA   . GLU A 1 36 ? 27.412 7.189   -1.999  1.00 0.00 ? 36 GLU A HA   8  
ATOM 9073  H HB2  . GLU A 1 36 ? 26.407 8.585   -0.280  1.00 0.00 ? 36 GLU A HB2  8  
ATOM 9074  H HB3  . GLU A 1 36 ? 24.844 7.803   -0.504  1.00 0.00 ? 36 GLU A HB3  8  
ATOM 9075  H HG2  . GLU A 1 36 ? 25.783 6.945   1.469   1.00 0.00 ? 36 GLU A HG2  8  
ATOM 9076  H HG3  . GLU A 1 36 ? 25.887 5.670   0.244   1.00 0.00 ? 36 GLU A HG3  8  
ATOM 9077  N N    . ILE A 1 37 ? 24.510 5.919   -2.767  1.00 0.00 ? 37 ILE A N    8  
ATOM 9078  C CA   . ILE A 1 37 ? 23.833 4.692   -3.156  1.00 0.00 ? 37 ILE A CA   8  
ATOM 9079  C C    . ILE A 1 37 ? 23.957 4.475   -4.658  1.00 0.00 ? 37 ILE A C    8  
ATOM 9080  O O    . ILE A 1 37 ? 23.978 5.441   -5.443  1.00 0.00 ? 37 ILE A O    8  
ATOM 9081  C CB   . ILE A 1 37 ? 22.336 4.728   -2.757  1.00 0.00 ? 37 ILE A CB   8  
ATOM 9082  C CG1  . ILE A 1 37 ? 22.180 5.284   -1.339  1.00 0.00 ? 37 ILE A CG1  8  
ATOM 9083  C CG2  . ILE A 1 37 ? 21.742 3.331   -2.864  1.00 0.00 ? 37 ILE A CG2  8  
ATOM 9084  C CD1  . ILE A 1 37 ? 22.911 4.473   -0.286  1.00 0.00 ? 37 ILE A CD1  8  
ATOM 9085  H H    . ILE A 1 37 ? 24.052 6.781   -2.875  1.00 0.00 ? 37 ILE A H    8  
ATOM 9086  H HA   . ILE A 1 37 ? 24.307 3.874   -2.646  1.00 0.00 ? 37 ILE A HA   8  
ATOM 9087  H HB   . ILE A 1 37 ? 21.812 5.366   -3.449  1.00 0.00 ? 37 ILE A HB   8  
ATOM 9088  H HG12 . ILE A 1 37 ? 22.568 6.290   -1.311  1.00 0.00 ? 37 ILE A HG12 8  
ATOM 9089  H HG13 . ILE A 1 37 ? 21.131 5.306   -1.073  1.00 0.00 ? 37 ILE A HG13 8  
ATOM 9090  H HG21 . ILE A 1 37 ? 20.690 3.360   -2.604  1.00 0.00 ? 37 ILE A HG21 8  
ATOM 9091  H HG22 . ILE A 1 37 ? 22.258 2.677   -2.181  1.00 0.00 ? 37 ILE A HG22 8  
ATOM 9092  H HG23 . ILE A 1 37 ? 21.852 2.973   -3.876  1.00 0.00 ? 37 ILE A HG23 8  
ATOM 9093  H HD11 . ILE A 1 37 ? 22.528 3.457   -0.284  1.00 0.00 ? 37 ILE A HD11 8  
ATOM 9094  H HD12 . ILE A 1 37 ? 22.755 4.921   0.679   1.00 0.00 ? 37 ILE A HD12 8  
ATOM 9095  H HD13 . ILE A 1 37 ? 23.965 4.460   -0.520  1.00 0.00 ? 37 ILE A HD13 8  
ATOM 9096  N N    . SER A 1 38 ? 24.034 3.225   -5.070  1.00 0.00 ? 38 SER A N    8  
ATOM 9097  C CA   . SER A 1 38 ? 24.228 2.907   -6.468  1.00 0.00 ? 38 SER A CA   8  
ATOM 9098  C C    . SER A 1 38 ? 23.116 2.001   -6.961  1.00 0.00 ? 38 SER A C    8  
ATOM 9099  O O    . SER A 1 38 ? 22.343 1.462   -6.171  1.00 0.00 ? 38 SER A O    8  
ATOM 9100  C CB   . SER A 1 38 ? 25.590 2.232   -6.660  1.00 0.00 ? 38 SER A CB   8  
ATOM 9101  O OG   . SER A 1 38 ? 26.623 2.968   -6.020  1.00 0.00 ? 38 SER A OG   8  
ATOM 9102  H H    . SER A 1 38 ? 23.932 2.490   -4.424  1.00 0.00 ? 38 SER A H    8  
ATOM 9103  H HA   . SER A 1 38 ? 24.203 3.833   -7.033  1.00 0.00 ? 38 SER A HA   8  
ATOM 9104  H HB2  . SER A 1 38 ? 25.566 1.242   -6.226  1.00 0.00 ? 38 SER A HB2  8  
ATOM 9105  H HB3  . SER A 1 38 ? 25.822 2.164   -7.722  1.00 0.00 ? 38 SER A HB3  8  
ATOM 9106  H HG   . SER A 1 38 ? 26.709 2.665   -5.095  1.00 0.00 ? 38 SER A HG   8  
ATOM 9107  N N    . ALA A 1 39 ? 23.031 1.849   -8.281  1.00 0.00 ? 39 ALA A N    8  
ATOM 9108  C CA   . ALA A 1 39 ? 22.029 0.984   -8.871  1.00 0.00 ? 39 ALA A CA   8  
ATOM 9109  C C    . ALA A 1 39 ? 22.325 -0.472  -8.535  1.00 0.00 ? 39 ALA A C    8  
ATOM 9110  O O    . ALA A 1 39 ? 23.414 -0.965  -8.799  1.00 0.00 ? 39 ALA A O    8  
ATOM 9111  C CB   . ALA A 1 39 ? 21.970 1.195   -10.369 1.00 0.00 ? 39 ALA A CB   8  
ATOM 9112  H H    . ALA A 1 39 ? 23.648 2.317   -8.858  1.00 0.00 ? 39 ALA A H    8  
ATOM 9113  H HA   . ALA A 1 39 ? 21.075 1.262   -8.453  1.00 0.00 ? 39 ALA A HA   8  
ATOM 9114  H HB1  . ALA A 1 39 ? 21.816 2.239   -10.590 1.00 0.00 ? 39 ALA A HB1  8  
ATOM 9115  H HB2  . ALA A 1 39 ? 21.158 0.621   -10.788 1.00 0.00 ? 39 ALA A HB2  8  
ATOM 9116  H HB3  . ALA A 1 39 ? 22.907 0.868   -10.821 1.00 0.00 ? 39 ALA A HB3  8  
ATOM 9117  N N    . GLY A 1 40 ? 21.338 -1.144  -7.971  1.00 0.00 ? 40 GLY A N    8  
ATOM 9118  C CA   . GLY A 1 40 ? 21.514 -2.540  -7.581  1.00 0.00 ? 40 GLY A CA   8  
ATOM 9119  C C    . GLY A 1 40 ? 21.641 -2.700  -6.082  1.00 0.00 ? 40 GLY A C    8  
ATOM 9120  O O    . GLY A 1 40 ? 21.505 -3.805  -5.572  1.00 0.00 ? 40 GLY A O    8  
ATOM 9121  H H    . GLY A 1 40 ? 20.481 -0.704  -7.804  1.00 0.00 ? 40 GLY A H    8  
ATOM 9122  H HA2  . GLY A 1 40 ? 20.669 -3.106  -7.920  1.00 0.00 ? 40 GLY A HA2  8  
ATOM 9123  H HA3  . GLY A 1 40 ? 22.403 -2.917  -8.043  1.00 0.00 ? 40 GLY A HA3  8  
ATOM 9124  N N    . ASP A 1 41 ? 21.917 -1.599  -5.381  1.00 0.00 ? 41 ASP A N    8  
ATOM 9125  C CA   . ASP A 1 41 ? 21.995 -1.623  -3.927  1.00 0.00 ? 41 ASP A CA   8  
ATOM 9126  C C    . ASP A 1 41 ? 20.595 -1.730  -3.337  1.00 0.00 ? 41 ASP A C    8  
ATOM 9127  O O    . ASP A 1 41 ? 19.629 -1.298  -3.929  1.00 0.00 ? 41 ASP A O    8  
ATOM 9128  C CB   . ASP A 1 41 ? 22.704 -0.375  -3.396  1.00 0.00 ? 41 ASP A CB   8  
ATOM 9129  C CG   . ASP A 1 41 ? 24.218 -0.477  -3.509  1.00 0.00 ? 41 ASP A CG   8  
ATOM 9130  O OD1  . ASP A 1 41 ? 24.839 -1.195  -2.690  1.00 0.00 ? 41 ASP A OD1  8  
ATOM 9131  O OD2  . ASP A 1 41 ? 24.787 0.148   -4.417  1.00 0.00 ? 41 ASP A OD2  8  
ATOM 9132  H H    . ASP A 1 41 ? 22.077 -0.759  -5.845  1.00 0.00 ? 41 ASP A H    8  
ATOM 9133  H HA   . ASP A 1 41 ? 22.561 -2.486  -3.648  1.00 0.00 ? 41 ASP A HA   8  
ATOM 9134  H HB2  . ASP A 1 41 ? 22.366 0.483   -3.955  1.00 0.00 ? 41 ASP A HB2  8  
ATOM 9135  H HB3  . ASP A 1 41 ? 22.448 -0.249  -2.347  1.00 0.00 ? 41 ASP A HB3  8  
ATOM 9136  N N    . GLU A 1 42 ? 20.520 -2.304  -2.141  1.00 0.00 ? 42 GLU A N    8  
ATOM 9137  C CA   . GLU A 1 42 ? 19.234 -2.520  -1.483  1.00 0.00 ? 42 GLU A CA   8  
ATOM 9138  C C    . GLU A 1 42 ? 19.282 -2.035  -0.032  1.00 0.00 ? 42 GLU A C    8  
ATOM 9139  O O    . GLU A 1 42 ? 20.354 -1.836  0.540   1.00 0.00 ? 42 GLU A O    8  
ATOM 9140  C CB   . GLU A 1 42 ? 18.849 -3.995  -1.550  1.00 0.00 ? 42 GLU A CB   8  
ATOM 9141  C CG   . GLU A 1 42 ? 18.502 -4.463  -2.947  1.00 0.00 ? 42 GLU A CG   8  
ATOM 9142  C CD   . GLU A 1 42 ? 18.289 -5.969  -3.048  1.00 0.00 ? 42 GLU A CD   8  
ATOM 9143  O OE1  . GLU A 1 42 ? 19.269 -6.685  -3.279  1.00 0.00 ? 42 GLU A OE1  8  
ATOM 9144  O OE2  . GLU A 1 42 ? 17.122 -6.424  -2.932  1.00 0.00 ? 42 GLU A OE2  8  
ATOM 9145  H H    . GLU A 1 42 ? 21.334 -2.593  -1.697  1.00 0.00 ? 42 GLU A H    8  
ATOM 9146  H HA   . GLU A 1 42 ? 18.507 -1.938  -2.017  1.00 0.00 ? 42 GLU A HA   8  
ATOM 9147  H HB2  . GLU A 1 42 ? 19.675 -4.581  -1.180  1.00 0.00 ? 42 GLU A HB2  8  
ATOM 9148  H HB3  . GLU A 1 42 ? 17.984 -4.159  -0.921  1.00 0.00 ? 42 GLU A HB3  8  
ATOM 9149  H HG2  . GLU A 1 42 ? 17.589 -3.970  -3.264  1.00 0.00 ? 42 GLU A HG2  8  
ATOM 9150  H HG3  . GLU A 1 42 ? 19.307 -4.177  -3.612  1.00 0.00 ? 42 GLU A HG3  8  
ATOM 9151  N N    . GLY A 1 43 ? 18.095 -1.828  0.527   1.00 0.00 ? 43 GLY A N    8  
ATOM 9152  C CA   . GLY A 1 43 ? 17.972 -1.400  1.910   1.00 0.00 ? 43 GLY A CA   8  
ATOM 9153  C C    . GLY A 1 43 ? 16.573 -1.634  2.442   1.00 0.00 ? 43 GLY A C    8  
ATOM 9154  O O    . GLY A 1 43 ? 15.753 -2.269  1.780   1.00 0.00 ? 43 GLY A O    8  
ATOM 9155  H H    . GLY A 1 43 ? 17.283 -1.932  -0.016  1.00 0.00 ? 43 GLY A H    8  
ATOM 9156  H HA2  . GLY A 1 43 ? 18.674 -1.958  2.511   1.00 0.00 ? 43 GLY A HA2  8  
ATOM 9157  H HA3  . GLY A 1 43 ? 18.197 -0.347  1.970   1.00 0.00 ? 43 GLY A HA3  8  
ATOM 9158  N N    . GLU A 1 44 ? 16.291 -1.130  3.630   1.00 0.00 ? 44 GLU A N    8  
ATOM 9159  C CA   . GLU A 1 44 ? 14.984 -1.317  4.250   1.00 0.00 ? 44 GLU A CA   8  
ATOM 9160  C C    . GLU A 1 44 ? 14.278 0.024   4.417   1.00 0.00 ? 44 GLU A C    8  
ATOM 9161  O O    . GLU A 1 44 ? 14.923 1.025   4.732   1.00 0.00 ? 44 GLU A O    8  
ATOM 9162  C CB   . GLU A 1 44 ? 15.127 -2.021  5.607   1.00 0.00 ? 44 GLU A CB   8  
ATOM 9163  C CG   . GLU A 1 44 ? 13.783 -2.331  6.261   1.00 0.00 ? 44 GLU A CG   8  
ATOM 9164  C CD   . GLU A 1 44 ? 13.932 -2.968  7.621   1.00 0.00 ? 44 GLU A CD   8  
ATOM 9165  O OE1  . GLU A 1 44 ? 14.038 -2.232  8.612   1.00 0.00 ? 44 GLU A OE1  8  
ATOM 9166  O OE2  . GLU A 1 44 ? 13.931 -4.216  7.691   1.00 0.00 ? 44 GLU A OE2  8  
ATOM 9167  H H    . GLU A 1 44 ? 16.972 -0.571  4.093   1.00 0.00 ? 44 GLU A H    8  
ATOM 9168  H HA   . GLU A 1 44 ? 14.404 -1.952  3.585   1.00 0.00 ? 44 GLU A HA   8  
ATOM 9169  H HB2  . GLU A 1 44 ? 15.661 -2.959  5.476   1.00 0.00 ? 44 GLU A HB2  8  
ATOM 9170  H HB3  . GLU A 1 44 ? 15.694 -1.390  6.273   1.00 0.00 ? 44 GLU A HB3  8  
ATOM 9171  H HG2  . GLU A 1 44 ? 13.231 -1.413  6.389   1.00 0.00 ? 44 GLU A HG2  8  
ATOM 9172  H HG3  . GLU A 1 44 ? 13.230 -3.006  5.622   1.00 0.00 ? 44 GLU A HG3  8  
ATOM 9173  N N    . PHE A 1 45 ? 12.980 0.021   4.209   1.00 0.00 ? 45 PHE A N    8  
ATOM 9174  C CA   . PHE A 1 45 ? 12.205 1.242   4.301   1.00 0.00 ? 45 PHE A CA   8  
ATOM 9175  C C    . PHE A 1 45 ? 11.729 1.472   5.738   1.00 0.00 ? 45 PHE A C    8  
ATOM 9176  O O    . PHE A 1 45 ? 11.089 0.601   6.339   1.00 0.00 ? 45 PHE A O    8  
ATOM 9177  C CB   . PHE A 1 45 ? 10.997 1.155   3.368   1.00 0.00 ? 45 PHE A CB   8  
ATOM 9178  C CG   . PHE A 1 45 ? 9.946  2.192   3.631   1.00 0.00 ? 45 PHE A CG   8  
ATOM 9179  C CD1  . PHE A 1 45 ? 10.124 3.498   3.223   1.00 0.00 ? 45 PHE A CD1  8  
ATOM 9180  C CD2  . PHE A 1 45 ? 8.765  1.849   4.286   1.00 0.00 ? 45 PHE A CD2  8  
ATOM 9181  C CE1  . PHE A 1 45 ? 9.155  4.447   3.468   1.00 0.00 ? 45 PHE A CE1  8  
ATOM 9182  C CE2  . PHE A 1 45 ? 7.796  2.794   4.538   1.00 0.00 ? 45 PHE A CE2  8  
ATOM 9183  C CZ   . PHE A 1 45 ? 7.995  4.097   4.128   1.00 0.00 ? 45 PHE A CZ   8  
ATOM 9184  H H    . PHE A 1 45 ? 12.506 -0.835  4.054   1.00 0.00 ? 45 PHE A H    8  
ATOM 9185  H HA   . PHE A 1 45 ? 12.827 2.070   3.986   1.00 0.00 ? 45 PHE A HA   8  
ATOM 9186  H HB2  . PHE A 1 45 ? 11.336 1.282   2.341   1.00 0.00 ? 45 PHE A HB2  8  
ATOM 9187  H HB3  . PHE A 1 45 ? 10.540 0.181   3.463   1.00 0.00 ? 45 PHE A HB3  8  
ATOM 9188  H HD1  . PHE A 1 45 ? 11.034 3.777   2.708   1.00 0.00 ? 45 PHE A HD1  8  
ATOM 9189  H HD2  . PHE A 1 45 ? 8.608  0.841   4.608   1.00 0.00 ? 45 PHE A HD2  8  
ATOM 9190  H HE1  . PHE A 1 45 ? 9.306  5.465   3.151   1.00 0.00 ? 45 PHE A HE1  8  
ATOM 9191  H HE2  . PHE A 1 45 ? 6.886  2.517   5.041   1.00 0.00 ? 45 PHE A HE2  8  
ATOM 9192  H HZ   . PHE A 1 45 ? 7.234  4.850   4.321   1.00 0.00 ? 45 PHE A HZ   8  
ATOM 9193  N N    . ARG A 1 46 ? 12.053 2.631   6.307   1.00 0.00 ? 46 ARG A N    8  
ATOM 9194  C CA   . ARG A 1 46 ? 11.649 2.929   7.665   1.00 0.00 ? 46 ARG A CA   8  
ATOM 9195  C C    . ARG A 1 46 ? 10.516 3.956   7.731   1.00 0.00 ? 46 ARG A C    8  
ATOM 9196  O O    . ARG A 1 46 ? 9.466  3.693   8.340   1.00 0.00 ? 46 ARG A O    8  
ATOM 9197  C CB   . ARG A 1 46 ? 12.847 3.449   8.448   1.00 0.00 ? 46 ARG A CB   8  
ATOM 9198  C CG   . ARG A 1 46 ? 13.889 2.371   8.745   1.00 0.00 ? 46 ARG A CG   8  
ATOM 9199  C CD   . ARG A 1 46 ? 15.145 2.970   9.330   1.00 0.00 ? 46 ARG A CD   8  
ATOM 9200  N NE   . ARG A 1 46 ? 14.904 3.827   10.479  1.00 0.00 ? 46 ARG A NE   8  
ATOM 9201  C CZ   . ARG A 1 46 ? 15.704 3.906   11.541  1.00 0.00 ? 46 ARG A CZ   8  
ATOM 9202  N NH1  . ARG A 1 46 ? 16.711 3.041   11.685  1.00 0.00 ? 46 ARG A NH1  8  
ATOM 9203  N NH2  . ARG A 1 46 ? 15.502 4.828   12.453  1.00 0.00 ? 46 ARG A NH2  8  
ATOM 9204  H H    . ARG A 1 46 ? 12.607 3.278   5.816   1.00 0.00 ? 46 ARG A H    8  
ATOM 9205  H HA   . ARG A 1 46 ? 11.317 2.014   8.116   1.00 0.00 ? 46 ARG A HA   8  
ATOM 9206  H HB2  . ARG A 1 46 ? 13.340 4.240   7.886   1.00 0.00 ? 46 ARG A HB2  8  
ATOM 9207  H HB3  . ARG A 1 46 ? 12.504 3.852   9.385   1.00 0.00 ? 46 ARG A HB3  8  
ATOM 9208  H HG2  . ARG A 1 46 ? 13.461 1.678   9.462   1.00 0.00 ? 46 ARG A HG2  8  
ATOM 9209  H HG3  . ARG A 1 46 ? 14.126 1.851   7.834   1.00 0.00 ? 46 ARG A HG3  8  
ATOM 9210  H HD2  . ARG A 1 46 ? 15.796 2.156   9.616   1.00 0.00 ? 46 ARG A HD2  8  
ATOM 9211  H HD3  . ARG A 1 46 ? 15.639 3.560   8.556   1.00 0.00 ? 46 ARG A HD3  8  
ATOM 9212  H HE   . ARG A 1 46 ? 14.105 4.415   10.448  1.00 0.00 ? 46 ARG A HE   8  
ATOM 9213  H HH11 . ARG A 1 46 ? 16.852 2.295   11.016  1.00 0.00 ? 46 ARG A HH11 8  
ATOM 9214  H HH12 . ARG A 1 46 ? 17.336 3.115   12.474  1.00 0.00 ? 46 ARG A HH12 8  
ATOM 9215  H HH21 . ARG A 1 46 ? 14.722 5.457   12.372  1.00 0.00 ? 46 ARG A HH21 8  
ATOM 9216  H HH22 . ARG A 1 46 ? 16.122 4.914   13.246  1.00 0.00 ? 46 ARG A HH22 8  
ATOM 9217  N N    . GLN A 1 47 ? 10.719 5.112   7.118   1.00 0.00 ? 47 GLN A N    8  
ATOM 9218  C CA   . GLN A 1 47 ? 9.798  6.223   7.315   1.00 0.00 ? 47 GLN A CA   8  
ATOM 9219  C C    . GLN A 1 47 ? 9.688  7.106   6.071   1.00 0.00 ? 47 GLN A C    8  
ATOM 9220  O O    . GLN A 1 47 ? 10.614 7.192   5.272   1.00 0.00 ? 47 GLN A O    8  
ATOM 9221  C CB   . GLN A 1 47 ? 10.272 7.055   8.512   1.00 0.00 ? 47 GLN A CB   8  
ATOM 9222  C CG   . GLN A 1 47 ? 9.342  8.212   8.849   1.00 0.00 ? 47 GLN A CG   8  
ATOM 9223  C CD   . GLN A 1 47 ? 9.815  8.995   10.058  1.00 0.00 ? 47 GLN A CD   8  
ATOM 9224  O OE1  . GLN A 1 47 ? 9.007  9.535   10.805  1.00 0.00 ? 47 GLN A OE1  8  
ATOM 9225  N NE2  . GLN A 1 47 ? 11.119 9.066   10.257  1.00 0.00 ? 47 GLN A NE2  8  
ATOM 9226  H H    . GLN A 1 47 ? 11.491 5.200   6.523   1.00 0.00 ? 47 GLN A H    8  
ATOM 9227  H HA   . GLN A 1 47 ? 8.833  5.811   7.531   1.00 0.00 ? 47 GLN A HA   8  
ATOM 9228  H HB2  . GLN A 1 47 ? 10.353 6.411   9.370   1.00 0.00 ? 47 GLN A HB2  8  
ATOM 9229  H HB3  . GLN A 1 47 ? 11.251 7.460   8.290   1.00 0.00 ? 47 GLN A HB3  8  
ATOM 9230  H HG2  . GLN A 1 47 ? 9.305  8.878   8.000   1.00 0.00 ? 47 GLN A HG2  8  
ATOM 9231  H HG3  . GLN A 1 47 ? 8.361  7.815   9.052   1.00 0.00 ? 47 GLN A HG3  8  
ATOM 9232  H HE21 . GLN A 1 47 ? 11.721 8.606   9.634   1.00 0.00 ? 47 GLN A HE21 8  
ATOM 9233  H HE22 . GLN A 1 47 ? 11.429 9.577   11.032  1.00 0.00 ? 47 GLN A HE22 8  
ATOM 9234  N N    . SER A 1 48 ? 8.542  7.754   5.927   1.00 0.00 ? 48 SER A N    8  
ATOM 9235  C CA   . SER A 1 48 ? 8.343  8.752   4.895   1.00 0.00 ? 48 SER A CA   8  
ATOM 9236  C C    . SER A 1 48 ? 7.840  10.051  5.520   1.00 0.00 ? 48 SER A C    8  
ATOM 9237  O O    . SER A 1 48 ? 7.250  10.039  6.594   1.00 0.00 ? 48 SER A O    8  
ATOM 9238  C CB   . SER A 1 48 ? 7.320  8.248   3.873   1.00 0.00 ? 48 SER A CB   8  
ATOM 9239  O OG   . SER A 1 48 ? 7.739  7.029   3.318   1.00 0.00 ? 48 SER A OG   8  
ATOM 9240  H H    . SER A 1 48 ? 7.812  7.567   6.559   1.00 0.00 ? 48 SER A H    8  
ATOM 9241  H HA   . SER A 1 48 ? 9.292  8.928   4.404   1.00 0.00 ? 48 SER A HA   8  
ATOM 9242  H HB2  . SER A 1 48 ? 6.361  8.111   4.359   1.00 0.00 ? 48 SER A HB2  8  
ATOM 9243  H HB3  . SER A 1 48 ? 7.221  8.983   3.084   1.00 0.00 ? 48 SER A HB3  8  
ATOM 9244  H HG   . SER A 1 48 ? 7.894  6.398   4.024   1.00 0.00 ? 48 SER A HG   8  
ATOM 9245  N N    . ASN A 1 49 ? 8.081  11.173  4.861   1.00 0.00 ? 49 ASN A N    8  
ATOM 9246  C CA   . ASN A 1 49 ? 7.557  12.446  5.335   1.00 0.00 ? 49 ASN A CA   8  
ATOM 9247  C C    . ASN A 1 49 ? 6.123  12.627  4.840   1.00 0.00 ? 49 ASN A C    8  
ATOM 9248  O O    . ASN A 1 49 ? 5.590  11.756  4.148   1.00 0.00 ? 49 ASN A O    8  
ATOM 9249  C CB   . ASN A 1 49 ? 8.438  13.610  4.863   1.00 0.00 ? 49 ASN A CB   8  
ATOM 9250  C CG   . ASN A 1 49 ? 9.846  13.542  5.433   1.00 0.00 ? 49 ASN A CG   8  
ATOM 9251  O OD1  . ASN A 1 49 ? 10.804 13.927  4.785   1.00 0.00 ? 49 ASN A OD1  8  
ATOM 9252  N ND2  . ASN A 1 49 ? 9.978  13.061  6.671   1.00 0.00 ? 49 ASN A ND2  8  
ATOM 9253  H H    . ASN A 1 49 ? 8.653  11.147  4.050   1.00 0.00 ? 49 ASN A H    8  
ATOM 9254  H HA   . ASN A 1 49 ? 7.555  12.433  6.421   1.00 0.00 ? 49 ASN A HA   8  
ATOM 9255  H HB2  . ASN A 1 49 ? 8.490  13.593  3.787   1.00 0.00 ? 49 ASN A HB2  8  
ATOM 9256  H HB3  . ASN A 1 49 ? 7.990  14.542  5.172   1.00 0.00 ? 49 ASN A HB3  8  
ATOM 9257  H HD21 . ASN A 1 49 ? 9.162  12.785  7.159   1.00 0.00 ? 49 ASN A HD21 8  
ATOM 9258  H HD22 . ASN A 1 49 ? 10.879 13.014  7.059   1.00 0.00 ? 49 ASN A HD22 8  
ATOM 9259  N N    . ASN A 1 50 ? 5.506  13.752  5.211   1.00 0.00 ? 50 ASN A N    8  
ATOM 9260  C CA   . ASN A 1 50 ? 4.095  13.974  4.904   1.00 0.00 ? 50 ASN A CA   8  
ATOM 9261  C C    . ASN A 1 50 ? 3.857  13.998  3.393   1.00 0.00 ? 50 ASN A C    8  
ATOM 9262  O O    . ASN A 1 50 ? 3.129  13.159  2.870   1.00 0.00 ? 50 ASN A O    8  
ATOM 9263  C CB   . ASN A 1 50 ? 3.596  15.284  5.523   1.00 0.00 ? 50 ASN A CB   8  
ATOM 9264  C CG   . ASN A 1 50 ? 2.100  15.446  5.418   1.00 0.00 ? 50 ASN A CG   8  
ATOM 9265  O OD1  . ASN A 1 50 ? 1.349  14.466  5.470   1.00 0.00 ? 50 ASN A OD1  8  
ATOM 9266  N ND2  . ASN A 1 50 ? 1.642  16.674  5.273   1.00 0.00 ? 50 ASN A ND2  8  
ATOM 9267  H H    . ASN A 1 50 ? 6.010  14.436  5.706   1.00 0.00 ? 50 ASN A H    8  
ATOM 9268  H HA   . ASN A 1 50 ? 3.538  13.151  5.326   1.00 0.00 ? 50 ASN A HA   8  
ATOM 9269  H HB2  . ASN A 1 50 ? 3.874  15.309  6.560   1.00 0.00 ? 50 ASN A HB2  8  
ATOM 9270  H HB3  . ASN A 1 50 ? 4.058  16.125  5.027   1.00 0.00 ? 50 ASN A HB3  8  
ATOM 9271  H HD21 . ASN A 1 50 ? 2.283  17.409  5.243   1.00 0.00 ? 50 ASN A HD21 8  
ATOM 9272  H HD22 . ASN A 1 50 ? 0.673  16.797  5.192   1.00 0.00 ? 50 ASN A HD22 8  
ATOM 9273  N N    . GLY A 1 51 ? 4.453  14.955  2.706   1.00 0.00 ? 51 GLY A N    8  
ATOM 9274  C CA   . GLY A 1 51 ? 4.208  15.070  1.276   1.00 0.00 ? 51 GLY A CA   8  
ATOM 9275  C C    . GLY A 1 51 ? 5.351  15.722  0.532   1.00 0.00 ? 51 GLY A C    8  
ATOM 9276  O O    . GLY A 1 51 ? 5.134  16.358  -0.511  1.00 0.00 ? 51 GLY A O    8  
ATOM 9277  H H    . GLY A 1 51 ? 5.048  15.595  3.172   1.00 0.00 ? 51 GLY A H    8  
ATOM 9278  H HA2  . GLY A 1 51 ? 4.051  14.087  0.871   1.00 0.00 ? 51 GLY A HA2  8  
ATOM 9279  H HA3  . GLY A 1 51 ? 3.314  15.665  1.126   1.00 0.00 ? 51 GLY A HA3  8  
ATOM 9280  N N    . VAL A 1 52 ? 6.572  15.565  1.033   1.00 0.00 ? 52 VAL A N    8  
ATOM 9281  C CA   . VAL A 1 52 ? 7.739  16.115  0.370   1.00 0.00 ? 52 VAL A CA   8  
ATOM 9282  C C    . VAL A 1 52 ? 8.581  15.012  -0.287  1.00 0.00 ? 52 VAL A C    8  
ATOM 9283  O O    . VAL A 1 52 ? 8.417  13.832  0.036   1.00 0.00 ? 52 VAL A O    8  
ATOM 9284  C CB   . VAL A 1 52 ? 8.613  16.939  1.335   1.00 0.00 ? 52 VAL A CB   8  
ATOM 9285  C CG1  . VAL A 1 52 ? 7.904  18.229  1.713   1.00 0.00 ? 52 VAL A CG1  8  
ATOM 9286  C CG2  . VAL A 1 52 ? 8.959  16.132  2.568   1.00 0.00 ? 52 VAL A CG2  8  
ATOM 9287  H H    . VAL A 1 52 ? 6.689  15.085  1.878   1.00 0.00 ? 52 VAL A H    8  
ATOM 9288  H HA   . VAL A 1 52 ? 7.394  16.772  -0.413  1.00 0.00 ? 52 VAL A HA   8  
ATOM 9289  H HB   . VAL A 1 52 ? 9.538  17.197  0.824   1.00 0.00 ? 52 VAL A HB   8  
ATOM 9290  H HG11 . VAL A 1 52 ? 7.735  18.822  0.835   1.00 0.00 ? 52 VAL A HG11 8  
ATOM 9291  H HG12 . VAL A 1 52 ? 8.517  18.790  2.419   1.00 0.00 ? 52 VAL A HG12 8  
ATOM 9292  H HG13 . VAL A 1 52 ? 6.961  18.005  2.168   1.00 0.00 ? 52 VAL A HG13 8  
ATOM 9293  H HG21 . VAL A 1 52 ? 9.474  15.229  2.280   1.00 0.00 ? 52 VAL A HG21 8  
ATOM 9294  H HG22 . VAL A 1 52 ? 8.055  15.863  3.102   1.00 0.00 ? 52 VAL A HG22 8  
ATOM 9295  H HG23 . VAL A 1 52 ? 9.597  16.715  3.224   1.00 0.00 ? 52 VAL A HG23 8  
ATOM 9296  N N    . PRO A 1 53 ? 9.470  15.388  -1.233  1.00 0.00 ? 53 PRO A N    8  
ATOM 9297  C CA   . PRO A 1 53 ? 10.346 14.439  -1.922  1.00 0.00 ? 53 PRO A CA   8  
ATOM 9298  C C    . PRO A 1 53 ? 11.161 13.517  -1.000  1.00 0.00 ? 53 PRO A C    8  
ATOM 9299  O O    . PRO A 1 53 ? 11.267 12.319  -1.282  1.00 0.00 ? 53 PRO A O    8  
ATOM 9300  C CB   . PRO A 1 53 ? 11.283 15.319  -2.737  1.00 0.00 ? 53 PRO A CB   8  
ATOM 9301  C CG   . PRO A 1 53 ? 10.586 16.641  -2.874  1.00 0.00 ? 53 PRO A CG   8  
ATOM 9302  C CD   . PRO A 1 53 ? 9.635  16.769  -1.729  1.00 0.00 ? 53 PRO A CD   8  
ATOM 9303  H HA   . PRO A 1 53 ? 9.775  13.816  -2.600  1.00 0.00 ? 53 PRO A HA   8  
ATOM 9304  H HB2  . PRO A 1 53 ? 12.233 15.428  -2.223  1.00 0.00 ? 53 PRO A HB2  8  
ATOM 9305  H HB3  . PRO A 1 53 ? 11.453 14.860  -3.704  1.00 0.00 ? 53 PRO A HB3  8  
ATOM 9306  H HG2  . PRO A 1 53 ? 11.317 17.425  -2.842  1.00 0.00 ? 53 PRO A HG2  8  
ATOM 9307  H HG3  . PRO A 1 53 ? 10.050 16.658  -3.818  1.00 0.00 ? 53 PRO A HG3  8  
ATOM 9308  H HD2  . PRO A 1 53 ? 10.061 17.401  -0.962  1.00 0.00 ? 53 PRO A HD2  8  
ATOM 9309  H HD3  . PRO A 1 53 ? 8.689  17.182  -2.071  1.00 0.00 ? 53 PRO A HD3  8  
ATOM 9310  N N    . PRO A 1 54 ? 11.792 14.032  0.086   1.00 0.00 ? 54 PRO A N    8  
ATOM 9311  C CA   . PRO A 1 54 ? 12.601 13.196  0.984   1.00 0.00 ? 54 PRO A CA   8  
ATOM 9312  C C    . PRO A 1 54 ? 11.840 11.974  1.548   1.00 0.00 ? 54 PRO A C    8  
ATOM 9313  O O    . PRO A 1 54 ? 10.731 12.099  2.081   1.00 0.00 ? 54 PRO A O    8  
ATOM 9314  C CB   . PRO A 1 54 ? 12.984 14.134  2.115   1.00 0.00 ? 54 PRO A CB   8  
ATOM 9315  C CG   . PRO A 1 54 ? 12.935 15.502  1.517   1.00 0.00 ? 54 PRO A CG   8  
ATOM 9316  C CD   . PRO A 1 54 ? 11.841 15.448  0.493   1.00 0.00 ? 54 PRO A CD   8  
ATOM 9317  H HA   . PRO A 1 54 ? 13.479 12.840  0.491   1.00 0.00 ? 54 PRO A HA   8  
ATOM 9318  H HB2  . PRO A 1 54 ? 12.277 14.036  2.930   1.00 0.00 ? 54 PRO A HB2  8  
ATOM 9319  H HB3  . PRO A 1 54 ? 13.974 13.884  2.473   1.00 0.00 ? 54 PRO A HB3  8  
ATOM 9320  H HG2  . PRO A 1 54 ? 12.713 16.226  2.277   1.00 0.00 ? 54 PRO A HG2  8  
ATOM 9321  H HG3  . PRO A 1 54 ? 13.887 15.727  1.049   1.00 0.00 ? 54 PRO A HG3  8  
ATOM 9322  H HD2  . PRO A 1 54 ? 10.910 15.761  0.927   1.00 0.00 ? 54 PRO A HD2  8  
ATOM 9323  H HD3  . PRO A 1 54 ? 12.089 16.080  -0.349  1.00 0.00 ? 54 PRO A HD3  8  
ATOM 9324  N N    . VAL A 1 55 ? 12.471 10.824  1.436   1.00 0.00 ? 55 VAL A N    8  
ATOM 9325  C CA   . VAL A 1 55 ? 11.976 9.596   2.034   1.00 0.00 ? 55 VAL A CA   8  
ATOM 9326  C C    . VAL A 1 55 ? 13.109 8.930   2.809   1.00 0.00 ? 55 VAL A C    8  
ATOM 9327  O O    . VAL A 1 55 ? 14.235 8.868   2.342   1.00 0.00 ? 55 VAL A O    8  
ATOM 9328  C CB   . VAL A 1 55 ? 11.378 8.620   0.985   1.00 0.00 ? 55 VAL A CB   8  
ATOM 9329  C CG1  . VAL A 1 55 ? 12.424 8.136   -0.008  1.00 0.00 ? 55 VAL A CG1  8  
ATOM 9330  C CG2  . VAL A 1 55 ? 10.689 7.438   1.659   1.00 0.00 ? 55 VAL A CG2  8  
ATOM 9331  H H    . VAL A 1 55 ? 13.324 10.809  0.947   1.00 0.00 ? 55 VAL A H    8  
ATOM 9332  H HA   . VAL A 1 55 ? 11.199 9.864   2.734   1.00 0.00 ? 55 VAL A HA   8  
ATOM 9333  H HB   . VAL A 1 55 ? 10.618 9.160   0.422   1.00 0.00 ? 55 VAL A HB   8  
ATOM 9334  H HG11 . VAL A 1 55 ? 12.826 8.967   -0.556  1.00 0.00 ? 55 VAL A HG11 8  
ATOM 9335  H HG12 . VAL A 1 55 ? 11.979 7.434   -0.716  1.00 0.00 ? 55 VAL A HG12 8  
ATOM 9336  H HG13 . VAL A 1 55 ? 13.232 7.629   0.523   1.00 0.00 ? 55 VAL A HG13 8  
ATOM 9337  H HG21 . VAL A 1 55 ? 10.278 6.794   0.904   1.00 0.00 ? 55 VAL A HG21 8  
ATOM 9338  H HG22 . VAL A 1 55 ? 9.900  7.805   2.298   1.00 0.00 ? 55 VAL A HG22 8  
ATOM 9339  H HG23 . VAL A 1 55 ? 11.415 6.903   2.247   1.00 0.00 ? 55 VAL A HG23 8  
ATOM 9340  N N    . GLN A 1 56 ? 12.813 8.437   3.999   1.00 0.00 ? 56 GLN A N    8  
ATOM 9341  C CA   . GLN A 1 56 ? 13.857 7.956   4.894   1.00 0.00 ? 56 GLN A CA   8  
ATOM 9342  C C    . GLN A 1 56 ? 13.994 6.439   4.798   1.00 0.00 ? 56 GLN A C    8  
ATOM 9343  O O    . GLN A 1 56 ? 13.127 5.681   5.248   1.00 0.00 ? 56 GLN A O    8  
ATOM 9344  C CB   . GLN A 1 56 ? 13.521 8.348   6.323   1.00 0.00 ? 56 GLN A CB   8  
ATOM 9345  C CG   . GLN A 1 56 ? 14.551 7.884   7.326   1.00 0.00 ? 56 GLN A CG   8  
ATOM 9346  C CD   . GLN A 1 56 ? 14.241 8.368   8.725   1.00 0.00 ? 56 GLN A CD   8  
ATOM 9347  O OE1  . GLN A 1 56 ? 13.509 7.717   9.476   1.00 0.00 ? 56 GLN A OE1  8  
ATOM 9348  N NE2  . GLN A 1 56 ? 14.791 9.508   9.098   1.00 0.00 ? 56 GLN A NE2  8  
ATOM 9349  H H    . GLN A 1 56 ? 11.875 8.362   4.266   1.00 0.00 ? 56 GLN A H    8  
ATOM 9350  H HA   . GLN A 1 56 ? 14.790 8.416   4.610   1.00 0.00 ? 56 GLN A HA   8  
ATOM 9351  H HB2  . GLN A 1 56 ? 13.436 9.431   6.380   1.00 0.00 ? 56 GLN A HB2  8  
ATOM 9352  H HB3  . GLN A 1 56 ? 12.574 7.903   6.584   1.00 0.00 ? 56 GLN A HB3  8  
ATOM 9353  H HG2  . GLN A 1 56 ? 14.566 6.800   7.336   1.00 0.00 ? 56 GLN A HG2  8  
ATOM 9354  H HG3  . GLN A 1 56 ? 15.516 8.262   7.043   1.00 0.00 ? 56 GLN A HG3  8  
ATOM 9355  H HE21 . GLN A 1 56 ? 15.366 9.972   8.454   1.00 0.00 ? 56 GLN A HE21 8  
ATOM 9356  H HE22 . GLN A 1 56 ? 14.605 9.849   10.007  1.00 0.00 ? 56 GLN A HE22 8  
ATOM 9357  N N    . VAL A 1 57 ? 15.094 6.016   4.210   1.00 0.00 ? 57 VAL A N    8  
ATOM 9358  C CA   . VAL A 1 57 ? 15.370 4.613   3.989   1.00 0.00 ? 57 VAL A CA   8  
ATOM 9359  C C    . VAL A 1 57 ? 16.672 4.211   4.678   1.00 0.00 ? 57 VAL A C    8  
ATOM 9360  O O    . VAL A 1 57 ? 17.642 4.978   4.672   1.00 0.00 ? 57 VAL A O    8  
ATOM 9361  C CB   . VAL A 1 57 ? 15.461 4.291   2.479   1.00 0.00 ? 57 VAL A CB   8  
ATOM 9362  C CG1  . VAL A 1 57 ? 15.829 2.845   2.217   1.00 0.00 ? 57 VAL A CG1  8  
ATOM 9363  C CG2  . VAL A 1 57 ? 14.166 4.652   1.787   1.00 0.00 ? 57 VAL A CG2  8  
ATOM 9364  H H    . VAL A 1 57 ? 15.769 6.679   3.929   1.00 0.00 ? 57 VAL A H    8  
ATOM 9365  H HA   . VAL A 1 57 ? 14.550 4.030   4.403   1.00 0.00 ? 57 VAL A HA   8  
ATOM 9366  H HB   . VAL A 1 57 ? 16.238 4.897   2.059   1.00 0.00 ? 57 VAL A HB   8  
ATOM 9367  H HG11 . VAL A 1 57 ? 15.060 2.189   2.607   1.00 0.00 ? 57 VAL A HG11 8  
ATOM 9368  H HG12 . VAL A 1 57 ? 16.780 2.626   2.704   1.00 0.00 ? 57 VAL A HG12 8  
ATOM 9369  H HG13 . VAL A 1 57 ? 15.923 2.690   1.158   1.00 0.00 ? 57 VAL A HG13 8  
ATOM 9370  H HG21 . VAL A 1 57 ? 14.249 4.450   0.728   1.00 0.00 ? 57 VAL A HG21 8  
ATOM 9371  H HG22 . VAL A 1 57 ? 13.965 5.711   1.932   1.00 0.00 ? 57 VAL A HG22 8  
ATOM 9372  H HG23 . VAL A 1 57 ? 13.354 4.075   2.202   1.00 0.00 ? 57 VAL A HG23 8  
ATOM 9373  N N    . PHE A 1 58 ? 16.684 3.044   5.300   1.00 0.00 ? 58 PHE A N    8  
ATOM 9374  C CA   . PHE A 1 58 ? 17.895 2.525   5.928   1.00 0.00 ? 58 PHE A CA   8  
ATOM 9375  C C    . PHE A 1 58 ? 18.621 1.644   4.923   1.00 0.00 ? 58 PHE A C    8  
ATOM 9376  O O    . PHE A 1 58 ? 18.152 0.555   4.591   1.00 0.00 ? 58 PHE A O    8  
ATOM 9377  C CB   . PHE A 1 58 ? 17.566 1.735   7.209   1.00 0.00 ? 58 PHE A CB   8  
ATOM 9378  C CG   . PHE A 1 58 ? 18.780 1.180   7.890   1.00 0.00 ? 58 PHE A CG   8  
ATOM 9379  C CD1  . PHE A 1 58 ? 19.562 1.994   8.693   1.00 0.00 ? 58 PHE A CD1  8  
ATOM 9380  C CD2  . PHE A 1 58 ? 19.144 -0.157  7.747   1.00 0.00 ? 58 PHE A CD2  8  
ATOM 9381  C CE1  . PHE A 1 58 ? 20.687 1.503   9.341   1.00 0.00 ? 58 PHE A CE1  8  
ATOM 9382  C CE2  . PHE A 1 58 ? 20.267 -0.657  8.384   1.00 0.00 ? 58 PHE A CE2  8  
ATOM 9383  C CZ   . PHE A 1 58 ? 21.036 0.177   9.176   1.00 0.00 ? 58 PHE A CZ   8  
ATOM 9384  H H    . PHE A 1 58 ? 15.867 2.498   5.348   1.00 0.00 ? 58 PHE A H    8  
ATOM 9385  H HA   . PHE A 1 58 ? 18.521 3.366   6.179   1.00 0.00 ? 58 PHE A HA   8  
ATOM 9386  H HB2  . PHE A 1 58 ? 17.068 2.400   7.898   1.00 0.00 ? 58 PHE A HB2  8  
ATOM 9387  H HB3  . PHE A 1 58 ? 16.908 0.918   6.959   1.00 0.00 ? 58 PHE A HB3  8  
ATOM 9388  H HD1  . PHE A 1 58 ? 19.287 3.032   8.817   1.00 0.00 ? 58 PHE A HD1  8  
ATOM 9389  H HD2  . PHE A 1 58 ? 18.542 -0.796  7.112   1.00 0.00 ? 58 PHE A HD2  8  
ATOM 9390  H HE1  . PHE A 1 58 ? 21.284 2.150   9.960   1.00 0.00 ? 58 PHE A HE1  8  
ATOM 9391  H HE2  . PHE A 1 58 ? 20.543 -1.697  8.271   1.00 0.00 ? 58 PHE A HE2  8  
ATOM 9392  H HZ   . PHE A 1 58 ? 21.912 -0.207  9.679   1.00 0.00 ? 58 PHE A HZ   8  
ATOM 9393  N N    . TRP A 1 59 ? 19.741 2.114   4.445   1.00 0.00 ? 59 TRP A N    8  
ATOM 9394  C CA   . TRP A 1 59 ? 20.474 1.385   3.426   1.00 0.00 ? 59 TRP A CA   8  
ATOM 9395  C C    . TRP A 1 59 ? 21.442 0.428   4.095   1.00 0.00 ? 59 TRP A C    8  
ATOM 9396  O O    . TRP A 1 59 ? 22.370 0.843   4.777   1.00 0.00 ? 59 TRP A O    8  
ATOM 9397  C CB   . TRP A 1 59 ? 21.189 2.348   2.490   1.00 0.00 ? 59 TRP A CB   8  
ATOM 9398  C CG   . TRP A 1 59 ? 20.234 3.146   1.650   1.00 0.00 ? 59 TRP A CG   8  
ATOM 9399  C CD1  . TRP A 1 59 ? 19.842 4.429   1.853   1.00 0.00 ? 59 TRP A CD1  8  
ATOM 9400  C CD2  . TRP A 1 59 ? 19.542 2.685   0.484   1.00 0.00 ? 59 TRP A CD2  8  
ATOM 9401  N NE1  . TRP A 1 59 ? 18.946 4.800   0.875   1.00 0.00 ? 59 TRP A NE1  8  
ATOM 9402  C CE2  . TRP A 1 59 ? 18.745 3.743   0.030   1.00 0.00 ? 59 TRP A CE2  8  
ATOM 9403  C CE3  . TRP A 1 59 ? 19.515 1.476   -0.212  1.00 0.00 ? 59 TRP A CE3  8  
ATOM 9404  C CZ2  . TRP A 1 59 ? 17.936 3.647   -1.088  1.00 0.00 ? 59 TRP A CZ2  8  
ATOM 9405  C CZ3  . TRP A 1 59 ? 18.706 1.373   -1.320  1.00 0.00 ? 59 TRP A CZ3  8  
ATOM 9406  C CH2  . TRP A 1 59 ? 17.930 2.455   -1.756  1.00 0.00 ? 59 TRP A CH2  8  
ATOM 9407  H H    . TRP A 1 59 ? 20.094 2.959   4.792   1.00 0.00 ? 59 TRP A H    8  
ATOM 9408  H HA   . TRP A 1 59 ? 19.753 0.802   2.868   1.00 0.00 ? 59 TRP A HA   8  
ATOM 9409  H HB2  . TRP A 1 59 ? 21.771 3.038   3.087   1.00 0.00 ? 59 TRP A HB2  8  
ATOM 9410  H HB3  . TRP A 1 59 ? 21.850 1.784   1.836   1.00 0.00 ? 59 TRP A HB3  8  
ATOM 9411  H HD1  . TRP A 1 59 ? 20.192 5.051   2.666   1.00 0.00 ? 59 TRP A HD1  8  
ATOM 9412  H HE1  . TRP A 1 59 ? 18.528 5.679   0.797   1.00 0.00 ? 59 TRP A HE1  8  
ATOM 9413  H HE3  . TRP A 1 59 ? 20.103 0.621   0.108   1.00 0.00 ? 59 TRP A HE3  8  
ATOM 9414  H HZ2  . TRP A 1 59 ? 17.331 4.467   -1.420  1.00 0.00 ? 59 TRP A HZ2  8  
ATOM 9415  H HZ3  . TRP A 1 59 ? 18.669 0.435   -1.878  1.00 0.00 ? 59 TRP A HZ3  8  
ATOM 9416  H HH2  . TRP A 1 59 ? 17.310 2.334   -2.619  1.00 0.00 ? 59 TRP A HH2  8  
ATOM 9417  N N    . GLU A 1 60 ? 21.220 -0.856  3.850   1.00 0.00 ? 60 GLU A N    8  
ATOM 9418  C CA   . GLU A 1 60 ? 22.004 -1.901  4.479   1.00 0.00 ? 60 GLU A CA   8  
ATOM 9419  C C    . GLU A 1 60 ? 23.402 -1.932  3.884   1.00 0.00 ? 60 GLU A C    8  
ATOM 9420  O O    . GLU A 1 60 ? 24.341 -2.444  4.496   1.00 0.00 ? 60 GLU A O    8  
ATOM 9421  C CB   . GLU A 1 60 ? 21.319 -3.263  4.281   1.00 0.00 ? 60 GLU A CB   8  
ATOM 9422  C CG   . GLU A 1 60 ? 21.045 -3.589  2.821   1.00 0.00 ? 60 GLU A CG   8  
ATOM 9423  C CD   . GLU A 1 60 ? 20.287 -4.881  2.643   1.00 0.00 ? 60 GLU A CD   8  
ATOM 9424  O OE1  . GLU A 1 60 ? 19.043 -4.857  2.608   1.00 0.00 ? 60 GLU A OE1  8  
ATOM 9425  O OE2  . GLU A 1 60 ? 20.936 -5.939  2.494   1.00 0.00 ? 60 GLU A OE2  8  
ATOM 9426  H H    . GLU A 1 60 ? 20.524 -1.092  3.209   1.00 0.00 ? 60 GLU A H    8  
ATOM 9427  H HA   . GLU A 1 60 ? 22.062 -1.682  5.533   1.00 0.00 ? 60 GLU A HA   8  
ATOM 9428  H HB2  . GLU A 1 60 ? 21.959 -4.035  4.698   1.00 0.00 ? 60 GLU A HB2  8  
ATOM 9429  H HB3  . GLU A 1 60 ? 20.382 -3.267  4.818   1.00 0.00 ? 60 GLU A HB3  8  
ATOM 9430  H HG2  . GLU A 1 60 ? 20.454 -2.783  2.404   1.00 0.00 ? 60 GLU A HG2  8  
ATOM 9431  H HG3  . GLU A 1 60 ? 21.983 -3.657  2.299   1.00 0.00 ? 60 GLU A HG3  8  
ATOM 9432  N N    . SER A 1 61 ? 23.526 -1.350  2.706   1.00 0.00 ? 61 SER A N    8  
ATOM 9433  C CA   . SER A 1 61 ? 24.809 -1.263  2.005   1.00 0.00 ? 61 SER A CA   8  
ATOM 9434  C C    . SER A 1 61 ? 25.766 -0.342  2.756   1.00 0.00 ? 61 SER A C    8  
ATOM 9435  O O    . SER A 1 61 ? 26.924 -0.683  2.977   1.00 0.00 ? 61 SER A O    8  
ATOM 9436  C CB   . SER A 1 61 ? 24.572 -0.761  0.582   1.00 0.00 ? 61 SER A CB   8  
ATOM 9437  O OG   . SER A 1 61 ? 25.738 -0.921  -0.212  1.00 0.00 ? 61 SER A OG   8  
ATOM 9438  H H    . SER A 1 61 ? 22.744 -0.986  2.278   1.00 0.00 ? 61 SER A H    8  
ATOM 9439  H HA   . SER A 1 61 ? 25.234 -2.258  1.972   1.00 0.00 ? 61 SER A HA   8  
ATOM 9440  H HB2  . SER A 1 61 ? 23.774 -1.332  0.129   1.00 0.00 ? 61 SER A HB2  8  
ATOM 9441  H HB3  . SER A 1 61 ? 24.307 0.281   0.604   1.00 0.00 ? 61 SER A HB3  8  
ATOM 9442  H HG   . SER A 1 61 ? 25.476 -0.956  -1.150  1.00 0.00 ? 61 SER A HG   8  
ATOM 9443  N N    . THR A 1 62 ? 25.265 0.817   3.177   1.00 0.00 ? 62 THR A N    8  
ATOM 9444  C CA   . THR A 1 62 ? 26.079 1.793   3.891   1.00 0.00 ? 62 THR A CA   8  
ATOM 9445  C C    . THR A 1 62 ? 25.945 1.608   5.400   1.00 0.00 ? 62 THR A C    8  
ATOM 9446  O O    . THR A 1 62 ? 26.849 1.946   6.151   1.00 0.00 ? 62 THR A O    8  
ATOM 9447  C CB   . THR A 1 62 ? 25.654 3.227   3.528   1.00 0.00 ? 62 THR A CB   8  
ATOM 9448  O OG1  . THR A 1 62 ? 25.336 3.290   2.138   1.00 0.00 ? 62 THR A OG1  8  
ATOM 9449  C CG2  . THR A 1 62 ? 26.773 4.223   3.841   1.00 0.00 ? 62 THR A CG2  8  
ATOM 9450  H H    . THR A 1 62 ? 24.323 1.023   2.995   1.00 0.00 ? 62 THR A H    8  
ATOM 9451  H HA   . THR A 1 62 ? 27.108 1.657   3.608   1.00 0.00 ? 62 THR A HA   8  
ATOM 9452  H HB   . THR A 1 62 ? 24.781 3.505   4.115   1.00 0.00 ? 62 THR A HB   8  
ATOM 9453  H HG1  . THR A 1 62 ? 26.143 3.228   1.616   1.00 0.00 ? 62 THR A HG1  8  
ATOM 9454  H HG21 . THR A 1 62 ? 26.477 5.215   3.530   1.00 0.00 ? 62 THR A HG21 8  
ATOM 9455  H HG22 . THR A 1 62 ? 27.663 3.931   3.304   1.00 0.00 ? 62 THR A HG22 8  
ATOM 9456  H HG23 . THR A 1 62 ? 26.975 4.218   4.906   1.00 0.00 ? 62 THR A HG23 8  
ATOM 9457  N N    . GLY A 1 63 ? 24.834 1.058   5.833   1.00 0.00 ? 63 GLY A N    8  
ATOM 9458  C CA   . GLY A 1 63 ? 24.569 0.910   7.238   1.00 0.00 ? 63 GLY A CA   8  
ATOM 9459  C C    . GLY A 1 63 ? 24.103 2.198   7.862   1.00 0.00 ? 63 GLY A C    8  
ATOM 9460  O O    . GLY A 1 63 ? 24.311 2.434   9.055   1.00 0.00 ? 63 GLY A O    8  
ATOM 9461  H H    . GLY A 1 63 ? 24.162 0.753   5.173   1.00 0.00 ? 63 GLY A H    8  
ATOM 9462  H HA2  . GLY A 1 63 ? 23.825 0.132   7.386   1.00 0.00 ? 63 GLY A HA2  8  
ATOM 9463  H HA3  . GLY A 1 63 ? 25.498 0.597   7.726   1.00 0.00 ? 63 GLY A HA3  8  
ATOM 9464  N N    . ARG A 1 64 ? 23.475 3.024   7.050   1.00 0.00 ? 64 ARG A N    8  
ATOM 9465  C CA   . ARG A 1 64 ? 23.034 4.355   7.477   1.00 0.00 ? 64 ARG A CA   8  
ATOM 9466  C C    . ARG A 1 64 ? 21.632 4.657   6.999   1.00 0.00 ? 64 ARG A C    8  
ATOM 9467  O O    . ARG A 1 64 ? 21.162 4.073   6.029   1.00 0.00 ? 64 ARG A O    8  
ATOM 9468  C CB   . ARG A 1 64 ? 23.989 5.430   6.943   1.00 0.00 ? 64 ARG A CB   8  
ATOM 9469  C CG   . ARG A 1 64 ? 25.373 5.416   7.588   1.00 0.00 ? 64 ARG A CG   8  
ATOM 9470  C CD   . ARG A 1 64 ? 25.287 5.763   9.057   1.00 0.00 ? 64 ARG A CD   8  
ATOM 9471  N NE   . ARG A 1 64 ? 26.605 5.940   9.663   1.00 0.00 ? 64 ARG A NE   8  
ATOM 9472  C CZ   . ARG A 1 64 ? 26.786 6.391   10.905  1.00 0.00 ? 64 ARG A CZ   8  
ATOM 9473  N NH1  . ARG A 1 64 ? 25.766 6.682   11.681  1.00 0.00 ? 64 ARG A NH1  8  
ATOM 9474  N NH2  . ARG A 1 64 ? 28.023 6.566   11.382  1.00 0.00 ? 64 ARG A NH2  8  
ATOM 9475  H H    . ARG A 1 64 ? 23.272 2.737   6.135   1.00 0.00 ? 64 ARG A H    8  
ATOM 9476  H HA   . ARG A 1 64 ? 23.046 4.375   8.561   1.00 0.00 ? 64 ARG A HA   8  
ATOM 9477  H HB2  . ARG A 1 64 ? 24.124 5.303   5.871   1.00 0.00 ? 64 ARG A HB2  8  
ATOM 9478  H HB3  . ARG A 1 64 ? 23.553 6.401   7.122   1.00 0.00 ? 64 ARG A HB3  8  
ATOM 9479  H HG2  . ARG A 1 64 ? 25.807 4.436   7.470   1.00 0.00 ? 64 ARG A HG2  8  
ATOM 9480  H HG3  . ARG A 1 64 ? 25.996 6.138   7.091   1.00 0.00 ? 64 ARG A HG3  8  
ATOM 9481  H HD2  . ARG A 1 64 ? 24.729 6.679   9.165   1.00 0.00 ? 64 ARG A HD2  8  
ATOM 9482  H HD3  . ARG A 1 64 ? 24.767 4.962   9.587   1.00 0.00 ? 64 ARG A HD3  8  
ATOM 9483  H HE   . ARG A 1 64 ? 27.391 5.713   9.104   1.00 0.00 ? 64 ARG A HE   8  
ATOM 9484  H HH11 . ARG A 1 64 ? 24.822 6.564   11.343  1.00 0.00 ? 64 ARG A HH11 8  
ATOM 9485  H HH12 . ARG A 1 64 ? 25.916 7.003   12.626  1.00 0.00 ? 64 ARG A HH12 8  
ATOM 9486  H HH21 . ARG A 1 64 ? 28.821 6.363   10.807  1.00 0.00 ? 64 ARG A HH21 8  
ATOM 9487  H HH22 . ARG A 1 64 ? 28.158 6.897   12.324  1.00 0.00 ? 64 ARG A HH22 8  
ATOM 9488  N N    . THR A 1 65 ? 20.953 5.560   7.688   1.00 0.00 ? 65 THR A N    8  
ATOM 9489  C CA   . THR A 1 65 ? 19.679 6.082   7.243   1.00 0.00 ? 65 THR A CA   8  
ATOM 9490  C C    . THR A 1 65 ? 19.912 7.224   6.242   1.00 0.00 ? 65 THR A C    8  
ATOM 9491  O O    . THR A 1 65 ? 20.769 8.074   6.433   1.00 0.00 ? 65 THR A O    8  
ATOM 9492  C CB   . THR A 1 65 ? 18.826 6.584   8.425   1.00 0.00 ? 65 THR A CB   8  
ATOM 9493  O OG1  . THR A 1 65 ? 19.665 7.203   9.407   1.00 0.00 ? 65 THR A OG1  8  
ATOM 9494  C CG2  . THR A 1 65 ? 18.057 5.426   9.050   1.00 0.00 ? 65 THR A CG2  8  
ATOM 9495  H H    . THR A 1 65 ? 21.317 5.881   8.547   1.00 0.00 ? 65 THR A H    8  
ATOM 9496  H HA   . THR A 1 65 ? 19.159 5.275   6.750   1.00 0.00 ? 65 THR A HA   8  
ATOM 9497  H HB   . THR A 1 65 ? 18.119 7.309   8.069   1.00 0.00 ? 65 THR A HB   8  
ATOM 9498  H HG1  . THR A 1 65 ? 20.382 7.665   8.967   1.00 0.00 ? 65 THR A HG1  8  
ATOM 9499  H HG21 . THR A 1 65 ? 18.744 4.685   9.415   1.00 0.00 ? 65 THR A HG21 8  
ATOM 9500  H HG22 . THR A 1 65 ? 17.399 4.988   8.323   1.00 0.00 ? 65 THR A HG22 8  
ATOM 9501  H HG23 . THR A 1 65 ? 17.463 5.804   9.880   1.00 0.00 ? 65 THR A HG23 8  
ATOM 9502  N N    . TYR A 1 66 ? 19.149 7.212   5.165   1.00 0.00 ? 66 TYR A N    8  
ATOM 9503  C CA   . TYR A 1 66 ? 19.344 8.193   4.110   1.00 0.00 ? 66 TYR A CA   8  
ATOM 9504  C C    . TYR A 1 66 ? 18.004 8.642   3.542   1.00 0.00 ? 66 TYR A C    8  
ATOM 9505  O O    . TYR A 1 66 ? 17.053 7.863   3.502   1.00 0.00 ? 66 TYR A O    8  
ATOM 9506  C CB   . TYR A 1 66 ? 20.241 7.602   3.017   1.00 0.00 ? 66 TYR A CB   8  
ATOM 9507  C CG   . TYR A 1 66 ? 20.723 8.620   2.017   1.00 0.00 ? 66 TYR A CG   8  
ATOM 9508  C CD1  . TYR A 1 66 ? 21.629 9.604   2.399   1.00 0.00 ? 66 TYR A CD1  8  
ATOM 9509  C CD2  . TYR A 1 66 ? 20.283 8.611   0.703   1.00 0.00 ? 66 TYR A CD2  8  
ATOM 9510  C CE1  . TYR A 1 66 ? 22.077 10.543  1.510   1.00 0.00 ? 66 TYR A CE1  8  
ATOM 9511  C CE2  . TYR A 1 66 ? 20.725 9.562   -0.200  1.00 0.00 ? 66 TYR A CE2  8  
ATOM 9512  C CZ   . TYR A 1 66 ? 21.627 10.520  0.209   1.00 0.00 ? 66 TYR A CZ   8  
ATOM 9513  O OH   . TYR A 1 66 ? 22.075 11.465  -0.676  1.00 0.00 ? 66 TYR A OH   8  
ATOM 9514  H H    . TYR A 1 66 ? 18.428 6.544   5.101   1.00 0.00 ? 66 TYR A H    8  
ATOM 9515  H HA   . TYR A 1 66 ? 19.842 9.049   4.542   1.00 0.00 ? 66 TYR A HA   8  
ATOM 9516  H HB2  . TYR A 1 66 ? 21.112 7.150   3.472   1.00 0.00 ? 66 TYR A HB2  8  
ATOM 9517  H HB3  . TYR A 1 66 ? 19.683 6.841   2.477   1.00 0.00 ? 66 TYR A HB3  8  
ATOM 9518  H HD1  . TYR A 1 66 ? 21.978 9.620   3.426   1.00 0.00 ? 66 TYR A HD1  8  
ATOM 9519  H HD2  . TYR A 1 66 ? 19.580 7.863   0.391   1.00 0.00 ? 66 TYR A HD2  8  
ATOM 9520  H HE1  . TYR A 1 66 ? 22.774 11.312  1.838   1.00 0.00 ? 66 TYR A HE1  8  
ATOM 9521  H HE2  . TYR A 1 66 ? 20.365 9.537   -1.226  1.00 0.00 ? 66 TYR A HE2  8  
ATOM 9522  H HH   . TYR A 1 66 ? 23.042 11.557  -0.585  1.00 0.00 ? 66 TYR A HH   8  
ATOM 9523  N N    . TRP A 1 67 ? 17.939 9.899   3.127   1.00 0.00 ? 67 TRP A N    8  
ATOM 9524  C CA   . TRP A 1 67 ? 16.746 10.439  2.498   1.00 0.00 ? 67 TRP A CA   8  
ATOM 9525  C C    . TRP A 1 67 ? 16.895 10.425  0.989   1.00 0.00 ? 67 TRP A C    8  
ATOM 9526  O O    . TRP A 1 67 ? 17.740 11.122  0.427   1.00 0.00 ? 67 TRP A O    8  
ATOM 9527  C CB   . TRP A 1 67 ? 16.463 11.856  3.010   1.00 0.00 ? 67 TRP A CB   8  
ATOM 9528  C CG   . TRP A 1 67 ? 16.061 11.894  4.451   1.00 0.00 ? 67 TRP A CG   8  
ATOM 9529  C CD1  . TRP A 1 67 ? 14.794 11.863  4.948   1.00 0.00 ? 67 TRP A CD1  8  
ATOM 9530  C CD2  . TRP A 1 67 ? 16.934 11.981  5.581   1.00 0.00 ? 67 TRP A CD2  8  
ATOM 9531  N NE1  . TRP A 1 67 ? 14.832 11.918  6.331   1.00 0.00 ? 67 TRP A NE1  8  
ATOM 9532  C CE2  . TRP A 1 67 ? 16.136 11.991  6.739   1.00 0.00 ? 67 TRP A CE2  8  
ATOM 9533  C CE3  . TRP A 1 67 ? 18.330 12.028  5.735   1.00 0.00 ? 67 TRP A CE3  8  
ATOM 9534  C CZ2  . TRP A 1 67 ? 16.676 12.062  8.017   1.00 0.00 ? 67 TRP A CZ2  8  
ATOM 9535  C CZ3  . TRP A 1 67 ? 18.859 12.100  7.002   1.00 0.00 ? 67 TRP A CZ3  8  
ATOM 9536  C CH2  . TRP A 1 67 ? 18.032 12.130  8.124   1.00 0.00 ? 67 TRP A CH2  8  
ATOM 9537  H H    . TRP A 1 67 ? 18.713 10.500  3.264   1.00 0.00 ? 67 TRP A H    8  
ATOM 9538  H HA   . TRP A 1 67 ? 15.928 9.793   2.771   1.00 0.00 ? 67 TRP A HA   8  
ATOM 9539  H HB2  . TRP A 1 67 ? 17.356 12.470  2.884   1.00 0.00 ? 67 TRP A HB2  8  
ATOM 9540  H HB3  . TRP A 1 67 ? 15.663 12.283  2.422   1.00 0.00 ? 67 TRP A HB3  8  
ATOM 9541  H HD1  . TRP A 1 67 ? 13.905 11.802  4.354   1.00 0.00 ? 67 TRP A HD1  8  
ATOM 9542  H HE1  . TRP A 1 67 ? 14.050 11.916  6.929   1.00 0.00 ? 67 TRP A HE1  8  
ATOM 9543  H HE3  . TRP A 1 67 ? 18.984 12.019  4.878   1.00 0.00 ? 67 TRP A HE3  8  
ATOM 9544  H HZ2  . TRP A 1 67 ? 16.053 12.076  8.902   1.00 0.00 ? 67 TRP A HZ2  8  
ATOM 9545  H HZ3  . TRP A 1 67 ? 19.932 12.154  7.137   1.00 0.00 ? 67 TRP A HZ3  8  
ATOM 9546  H HH2  . TRP A 1 67 ? 18.490 12.181  9.097   1.00 0.00 ? 67 TRP A HH2  8  
ATOM 9547  N N    . VAL A 1 68 ? 16.058 9.641   0.331   1.00 0.00 ? 68 VAL A N    8  
ATOM 9548  C CA   . VAL A 1 68 ? 16.112 9.487   -1.114  1.00 0.00 ? 68 VAL A CA   8  
ATOM 9549  C C    . VAL A 1 68 ? 14.838 10.059  -1.728  1.00 0.00 ? 68 VAL A C    8  
ATOM 9550  O O    . VAL A 1 68 ? 14.002 10.590  -1.023  1.00 0.00 ? 68 VAL A O    8  
ATOM 9551  C CB   . VAL A 1 68 ? 16.251 7.996   -1.503  1.00 0.00 ? 68 VAL A CB   8  
ATOM 9552  C CG1  . VAL A 1 68 ? 17.022 7.820   -2.801  1.00 0.00 ? 68 VAL A CG1  8  
ATOM 9553  C CG2  . VAL A 1 68 ? 16.913 7.200   -0.397  1.00 0.00 ? 68 VAL A CG2  8  
ATOM 9554  H H    . VAL A 1 68 ? 15.390 9.131   0.828   1.00 0.00 ? 68 VAL A H    8  
ATOM 9555  H HA   . VAL A 1 68 ? 16.973 10.038  -1.497  1.00 0.00 ? 68 VAL A HA   8  
ATOM 9556  H HB   . VAL A 1 68 ? 15.247 7.596   -1.657  1.00 0.00 ? 68 VAL A HB   8  
ATOM 9557  H HG11 . VAL A 1 68 ? 16.459 8.253   -3.618  1.00 0.00 ? 68 VAL A HG11 8  
ATOM 9558  H HG12 . VAL A 1 68 ? 17.163 6.775   -2.993  1.00 0.00 ? 68 VAL A HG12 8  
ATOM 9559  H HG13 . VAL A 1 68 ? 17.976 8.317   -2.716  1.00 0.00 ? 68 VAL A HG13 8  
ATOM 9560  H HG21 . VAL A 1 68 ? 16.279 7.181   0.474   1.00 0.00 ? 68 VAL A HG21 8  
ATOM 9561  H HG22 . VAL A 1 68 ? 17.867 7.643   -0.146  1.00 0.00 ? 68 VAL A HG22 8  
ATOM 9562  H HG23 . VAL A 1 68 ? 17.068 6.184   -0.737  1.00 0.00 ? 68 VAL A HG23 8  
ATOM 9563  N N    . HIS A 1 69 ? 14.697 9.975   -3.050  1.00 0.00 ? 69 HIS A N    8  
ATOM 9564  C CA   . HIS A 1 69 ? 13.435 10.359  -3.683  1.00 0.00 ? 69 HIS A CA   8  
ATOM 9565  C C    . HIS A 1 69 ? 12.593 9.118   -3.962  1.00 0.00 ? 69 HIS A C    8  
ATOM 9566  O O    . HIS A 1 69 ? 13.116 8.098   -4.417  1.00 0.00 ? 69 HIS A O    8  
ATOM 9567  C CB   . HIS A 1 69 ? 13.704 11.115  -4.995  1.00 0.00 ? 69 HIS A CB   8  
ATOM 9568  C CG   . HIS A 1 69 ? 14.522 12.358  -4.830  1.00 0.00 ? 69 HIS A CG   8  
ATOM 9569  N ND1  . HIS A 1 69 ? 15.488 12.765  -5.743  1.00 0.00 ? 69 HIS A ND1  8  
ATOM 9570  C CD2  . HIS A 1 69 ? 14.508 13.301  -3.865  1.00 0.00 ? 69 HIS A CD2  8  
ATOM 9571  C CE1  . HIS A 1 69 ? 16.017 13.890  -5.345  1.00 0.00 ? 69 HIS A CE1  8  
ATOM 9572  N NE2  . HIS A 1 69 ? 15.444 14.255  -4.213  1.00 0.00 ? 69 HIS A NE2  8  
ATOM 9573  H H    . HIS A 1 69 ? 15.455 9.706   -3.594  1.00 0.00 ? 69 HIS A H    8  
ATOM 9574  H HA   . HIS A 1 69 ? 12.894 11.001  -3.003  1.00 0.00 ? 69 HIS A HA   8  
ATOM 9575  H HB2  . HIS A 1 69 ? 14.222 10.471  -5.683  1.00 0.00 ? 69 HIS A HB2  8  
ATOM 9576  H HB3  . HIS A 1 69 ? 12.756 11.402  -5.432  1.00 0.00 ? 69 HIS A HB3  8  
ATOM 9577  H HD1  . HIS A 1 69 ? 15.742 12.283  -6.566  1.00 0.00 ? 69 HIS A HD1  8  
ATOM 9578  H HD2  . HIS A 1 69 ? 13.880 13.304  -2.979  1.00 0.00 ? 69 HIS A HD2  8  
ATOM 9579  H HE1  . HIS A 1 69 ? 16.799 14.446  -5.864  1.00 0.00 ? 69 HIS A HE1  8  
ATOM 9580  H HE2  . HIS A 1 69 ? 15.558 15.127  -3.768  1.00 0.00 ? 69 HIS A HE2  8  
ATOM 9581  N N    . TRP A 1 70 ? 11.303 9.208   -3.670  1.00 0.00 ? 70 TRP A N    8  
ATOM 9582  C CA   . TRP A 1 70 ? 10.342 8.118   -3.903  1.00 0.00 ? 70 TRP A CA   8  
ATOM 9583  C C    . TRP A 1 70 ? 10.507 7.473   -5.285  1.00 0.00 ? 70 TRP A C    8  
ATOM 9584  O O    . TRP A 1 70 ? 10.628 6.265   -5.405  1.00 0.00 ? 70 TRP A O    8  
ATOM 9585  C CB   . TRP A 1 70 ? 8.907  8.640   -3.801  1.00 0.00 ? 70 TRP A CB   8  
ATOM 9586  C CG   . TRP A 1 70 ? 8.604  9.381   -2.538  1.00 0.00 ? 70 TRP A CG   8  
ATOM 9587  C CD1  . TRP A 1 70 ? 9.047  10.611  -2.185  1.00 0.00 ? 70 TRP A CD1  8  
ATOM 9588  C CD2  . TRP A 1 70 ? 7.746  8.950   -1.483  1.00 0.00 ? 70 TRP A CD2  8  
ATOM 9589  N NE1  . TRP A 1 70 ? 8.547  10.962  -0.965  1.00 0.00 ? 70 TRP A NE1  8  
ATOM 9590  C CE2  . TRP A 1 70 ? 7.748  9.962   -0.516  1.00 0.00 ? 70 TRP A CE2  8  
ATOM 9591  C CE3  . TRP A 1 70 ? 6.983  7.804   -1.250  1.00 0.00 ? 70 TRP A CE3  8  
ATOM 9592  C CZ2  . TRP A 1 70 ? 7.011  9.875   0.663   1.00 0.00 ? 70 TRP A CZ2  8  
ATOM 9593  C CZ3  . TRP A 1 70 ? 6.250  7.715   -0.079  1.00 0.00 ? 70 TRP A CZ3  8  
ATOM 9594  C CH2  . TRP A 1 70 ? 6.271  8.747   0.863   1.00 0.00 ? 70 TRP A CH2  8  
ATOM 9595  H H    . TRP A 1 70 ? 10.968 10.021  -3.227  1.00 0.00 ? 70 TRP A H    8  
ATOM 9596  H HA   . TRP A 1 70 ? 10.494 7.366   -3.148  1.00 0.00 ? 70 TRP A HA   8  
ATOM 9597  H HB2  . TRP A 1 70 ? 8.732  9.316   -4.623  1.00 0.00 ? 70 TRP A HB2  8  
ATOM 9598  H HB3  . TRP A 1 70 ? 8.219  7.797   -3.880  1.00 0.00 ? 70 TRP A HB3  8  
ATOM 9599  H HD1  . TRP A 1 70 ? 9.711  11.203  -2.788  1.00 0.00 ? 70 TRP A HD1  8  
ATOM 9600  H HE1  . TRP A 1 70 ? 8.735  11.814  -0.489  1.00 0.00 ? 70 TRP A HE1  8  
ATOM 9601  H HE3  . TRP A 1 70 ? 6.954  6.988   -1.963  1.00 0.00 ? 70 TRP A HE3  8  
ATOM 9602  H HZ2  . TRP A 1 70 ? 7.016  10.672  1.399   1.00 0.00 ? 70 TRP A HZ2  8  
ATOM 9603  H HZ3  . TRP A 1 70 ? 5.649  6.827   0.113   1.00 0.00 ? 70 TRP A HZ3  8  
ATOM 9604  H HH2  . TRP A 1 70 ? 5.692  8.635   1.768   1.00 0.00 ? 70 TRP A HH2  8  
ATOM 9605  N N    . HIS A 1 71 ? 10.513 8.310   -6.319  1.00 0.00 ? 71 HIS A N    8  
ATOM 9606  C CA   . HIS A 1 71 ? 10.457 7.816   -7.701  1.00 0.00 ? 71 HIS A CA   8  
ATOM 9607  C C    . HIS A 1 71 ? 11.767 7.154   -8.160  1.00 0.00 ? 71 HIS A C    8  
ATOM 9608  O O    . HIS A 1 71 ? 11.833 6.621   -9.266  1.00 0.00 ? 71 HIS A O    8  
ATOM 9609  C CB   . HIS A 1 71 ? 10.089 8.955   -8.652  1.00 0.00 ? 71 HIS A CB   8  
ATOM 9610  C CG   . HIS A 1 71 ? 11.184 9.985   -8.842  1.00 0.00 ? 71 HIS A CG   8  
ATOM 9611  N ND1  . HIS A 1 71 ? 12.189 9.850   -9.780  1.00 0.00 ? 71 HIS A ND1  8  
ATOM 9612  C CD2  . HIS A 1 71 ? 11.407 11.162  -8.222  1.00 0.00 ? 71 HIS A CD2  8  
ATOM 9613  C CE1  . HIS A 1 71 ? 12.982 10.910  -9.728  1.00 0.00 ? 71 HIS A CE1  8  
ATOM 9614  N NE2  . HIS A 1 71 ? 12.528 11.719  -8.783  1.00 0.00 ? 71 HIS A NE2  8  
ATOM 9615  H H    . HIS A 1 71 ? 10.541 9.277   -6.134  1.00 0.00 ? 71 HIS A H    8  
ATOM 9616  H HA   . HIS A 1 71 ? 9.677  7.067   -7.738  1.00 0.00 ? 71 HIS A HA   8  
ATOM 9617  H HB2  . HIS A 1 71 ? 9.836  8.542   -9.620  1.00 0.00 ? 71 HIS A HB2  8  
ATOM 9618  H HB3  . HIS A 1 71 ? 9.231  9.474   -8.256  1.00 0.00 ? 71 HIS A HB3  8  
ATOM 9619  H HD1  . HIS A 1 71 ? 12.328 9.084   -10.397 1.00 0.00 ? 71 HIS A HD1  8  
ATOM 9620  H HD2  . HIS A 1 71 ? 10.835 11.577  -7.401  1.00 0.00 ? 71 HIS A HD2  8  
ATOM 9621  H HE1  . HIS A 1 71 ? 13.839 11.088  -10.354 1.00 0.00 ? 71 HIS A HE1  8  
ATOM 9622  H HE2  . HIS A 1 71 ? 12.913 12.607  -8.554  1.00 0.00 ? 71 HIS A HE2  8  
ATOM 9623  N N    . MET A 1 72 ? 12.816 7.206   -7.349  1.00 0.00 ? 72 MET A N    8  
ATOM 9624  C CA   . MET A 1 72 ? 14.113 6.672   -7.761  1.00 0.00 ? 72 MET A CA   8  
ATOM 9625  C C    . MET A 1 72 ? 14.431 5.375   -7.020  1.00 0.00 ? 72 MET A C    8  
ATOM 9626  O O    . MET A 1 72 ? 15.588 4.929   -6.993  1.00 0.00 ? 72 MET A O    8  
ATOM 9627  C CB   . MET A 1 72 ? 15.213 7.707   -7.531  1.00 0.00 ? 72 MET A CB   8  
ATOM 9628  C CG   . MET A 1 72 ? 15.572 7.928   -6.077  1.00 0.00 ? 72 MET A CG   8  
ATOM 9629  S SD   . MET A 1 72 ? 16.507 9.449   -5.817  1.00 0.00 ? 72 MET A SD   8  
ATOM 9630  C CE   . MET A 1 72 ? 17.879 9.213   -6.942  1.00 0.00 ? 72 MET A CE   8  
ATOM 9631  H H    . MET A 1 72 ? 12.731 7.610   -6.445  1.00 0.00 ? 72 MET A H    8  
ATOM 9632  H HA   . MET A 1 72 ? 14.046 6.456   -8.821  1.00 0.00 ? 72 MET A HA   8  
ATOM 9633  H HB2  . MET A 1 72 ? 16.110 7.385   -8.048  1.00 0.00 ? 72 MET A HB2  8  
ATOM 9634  H HB3  . MET A 1 72 ? 14.900 8.655   -7.954  1.00 0.00 ? 72 MET A HB3  8  
ATOM 9635  H HG2  . MET A 1 72 ? 14.660 7.993   -5.507  1.00 0.00 ? 72 MET A HG2  8  
ATOM 9636  H HG3  . MET A 1 72 ? 16.170 7.099   -5.732  1.00 0.00 ? 72 MET A HG3  8  
ATOM 9637  H HE1  . MET A 1 72 ? 17.509 9.124   -7.951  1.00 0.00 ? 72 MET A HE1  8  
ATOM 9638  H HE2  . MET A 1 72 ? 18.416 8.320   -6.670  1.00 0.00 ? 72 MET A HE2  8  
ATOM 9639  H HE3  . MET A 1 72 ? 18.534 10.062  -6.878  1.00 0.00 ? 72 MET A HE3  8  
ATOM 9640  N N    . LEU A 1 73 ? 13.405 4.731   -6.469  1.00 0.00 ? 73 LEU A N    8  
ATOM 9641  C CA   . LEU A 1 73 ? 13.612 3.468   -5.783  1.00 0.00 ? 73 LEU A CA   8  
ATOM 9642  C C    . LEU A 1 73 ? 12.534 2.449   -6.156  1.00 0.00 ? 73 LEU A C    8  
ATOM 9643  O O    . LEU A 1 73 ? 11.424 2.818   -6.560  1.00 0.00 ? 73 LEU A O    8  
ATOM 9644  C CB   . LEU A 1 73 ? 13.648 3.694   -4.260  1.00 0.00 ? 73 LEU A CB   8  
ATOM 9645  C CG   . LEU A 1 73 ? 12.453 4.422   -3.654  1.00 0.00 ? 73 LEU A CG   8  
ATOM 9646  C CD1  . LEU A 1 73 ? 11.290 3.484   -3.378  1.00 0.00 ? 73 LEU A CD1  8  
ATOM 9647  C CD2  . LEU A 1 73 ? 12.873 5.142   -2.359  1.00 0.00 ? 73 LEU A CD2  8  
ATOM 9648  H H    . LEU A 1 73 ? 12.502 5.106   -6.529  1.00 0.00 ? 73 LEU A H    8  
ATOM 9649  H HA   . LEU A 1 73 ? 14.569 3.081   -6.109  1.00 0.00 ? 73 LEU A HA   8  
ATOM 9650  H HB2  . LEU A 1 73 ? 13.734 2.724   -3.779  1.00 0.00 ? 73 LEU A HB2  8  
ATOM 9651  H HB3  . LEU A 1 73 ? 14.547 4.239   -4.026  1.00 0.00 ? 73 LEU A HB3  8  
ATOM 9652  H HG   . LEU A 1 73 ? 12.107 5.179   -4.344  1.00 0.00 ? 73 LEU A HG   8  
ATOM 9653  H HD11 . LEU A 1 73 ? 10.457 4.027   -2.989  1.00 0.00 ? 73 LEU A HD11 8  
ATOM 9654  H HD12 . LEU A 1 73 ? 11.600 2.716   -2.685  1.00 0.00 ? 73 LEU A HD12 8  
ATOM 9655  H HD13 . LEU A 1 73 ? 11.004 3.010   -4.311  1.00 0.00 ? 73 LEU A HD13 8  
ATOM 9656  H HD21 . LEU A 1 73 ? 13.631 5.873   -2.589  1.00 0.00 ? 73 LEU A HD21 8  
ATOM 9657  H HD22 . LEU A 1 73 ? 13.258 4.417   -1.668  1.00 0.00 ? 73 LEU A HD22 8  
ATOM 9658  H HD23 . LEU A 1 73 ? 12.017 5.634   -1.930  1.00 0.00 ? 73 LEU A HD23 8  
ATOM 9659  N N    . GLU A 1 74 ? 12.878 1.172   -6.033  1.00 0.00 ? 74 GLU A N    8  
ATOM 9660  C CA   . GLU A 1 74 ? 11.969 0.077   -6.312  1.00 0.00 ? 74 GLU A CA   8  
ATOM 9661  C C    . GLU A 1 74 ? 11.410 -0.509  -5.022  1.00 0.00 ? 74 GLU A C    8  
ATOM 9662  O O    . GLU A 1 74 ? 12.133 -0.654  -4.030  1.00 0.00 ? 74 GLU A O    8  
ATOM 9663  C CB   . GLU A 1 74 ? 12.693 -0.998  -7.108  1.00 0.00 ? 74 GLU A CB   8  
ATOM 9664  C CG   . GLU A 1 74 ? 12.761 -0.716  -8.588  1.00 0.00 ? 74 GLU A CG   8  
ATOM 9665  C CD   . GLU A 1 74 ? 11.441 -0.952  -9.296  1.00 0.00 ? 74 GLU A CD   8  
ATOM 9666  O OE1  . GLU A 1 74 ? 10.478 -0.199  -9.051  1.00 0.00 ? 74 GLU A OE1  8  
ATOM 9667  O OE2  . GLU A 1 74 ? 11.359 -1.898  -10.110 1.00 0.00 ? 74 GLU A OE2  8  
ATOM 9668  H H    . GLU A 1 74 ? 13.802 0.950   -5.729  1.00 0.00 ? 74 GLU A H    8  
ATOM 9669  H HA   . GLU A 1 74 ? 11.154 0.463   -6.908  1.00 0.00 ? 74 GLU A HA   8  
ATOM 9670  H HB2  . GLU A 1 74 ? 13.709 -1.091  -6.739  1.00 0.00 ? 74 GLU A HB2  8  
ATOM 9671  H HB3  . GLU A 1 74 ? 12.184 -1.941  -6.962  1.00 0.00 ? 74 GLU A HB3  8  
ATOM 9672  H HG2  . GLU A 1 74 ? 13.053 0.312   -8.719  1.00 0.00 ? 74 GLU A HG2  8  
ATOM 9673  H HG3  . GLU A 1 74 ? 13.517 -1.364  -9.025  1.00 0.00 ? 74 GLU A HG3  8  
ATOM 9674  N N    . ILE A 1 75 ? 10.144 -0.851  -5.028  1.00 0.00 ? 75 ILE A N    8  
ATOM 9675  C CA   . ILE A 1 75 ? 9.500  -1.445  -3.867  1.00 0.00 ? 75 ILE A CA   8  
ATOM 9676  C C    . ILE A 1 75 ? 9.521  -2.963  -3.982  1.00 0.00 ? 75 ILE A C    8  
ATOM 9677  O O    . ILE A 1 75 ? 9.061  -3.549  -4.957  1.00 0.00 ? 75 ILE A O    8  
ATOM 9678  C CB   . ILE A 1 75 ? 8.039  -0.902  -3.706  1.00 0.00 ? 75 ILE A CB   8  
ATOM 9679  C CG1  . ILE A 1 75 ? 7.403  -1.382  -2.393  1.00 0.00 ? 75 ILE A CG1  8  
ATOM 9680  C CG2  . ILE A 1 75 ? 7.157  -1.261  -4.890  1.00 0.00 ? 75 ILE A CG2  8  
ATOM 9681  C CD1  . ILE A 1 75 ? 6.818  -2.798  -2.447  1.00 0.00 ? 75 ILE A CD1  8  
ATOM 9682  H H    . ILE A 1 75 ? 9.624  -0.710  -5.849  1.00 0.00 ? 75 ILE A H    8  
ATOM 9683  H HA   . ILE A 1 75 ? 10.065 -1.158  -3.003  1.00 0.00 ? 75 ILE A HA   8  
ATOM 9684  H HB   . ILE A 1 75 ? 8.109  0.172   -3.669  1.00 0.00 ? 75 ILE A HB   8  
ATOM 9685  H HG12 . ILE A 1 75 ? 8.143  -1.354  -1.613  1.00 0.00 ? 75 ILE A HG12 8  
ATOM 9686  H HG13 . ILE A 1 75 ? 6.597  -0.706  -2.138  1.00 0.00 ? 75 ILE A HG13 8  
ATOM 9687  H HG21 . ILE A 1 75 ? 7.609  -0.877  -5.796  1.00 0.00 ? 75 ILE A HG21 8  
ATOM 9688  H HG22 . ILE A 1 75 ? 6.185  -0.822  -4.761  1.00 0.00 ? 75 ILE A HG22 8  
ATOM 9689  H HG23 . ILE A 1 75 ? 7.061  -2.335  -4.961  1.00 0.00 ? 75 ILE A HG23 8  
ATOM 9690  H HD11 . ILE A 1 75 ? 6.434  -3.053  -1.474  1.00 0.00 ? 75 ILE A HD11 8  
ATOM 9691  H HD12 . ILE A 1 75 ? 7.597  -3.498  -2.725  1.00 0.00 ? 75 ILE A HD12 8  
ATOM 9692  H HD13 . ILE A 1 75 ? 6.026  -2.830  -3.174  1.00 0.00 ? 75 ILE A HD13 8  
ATOM 9693  N N    . LEU A 1 76 ? 10.135 -3.607  -2.997  1.00 0.00 ? 76 LEU A N    8  
ATOM 9694  C CA   . LEU A 1 76 ? 10.183 -5.070  -2.961  1.00 0.00 ? 76 LEU A CA   8  
ATOM 9695  C C    . LEU A 1 76 ? 9.064  -5.610  -2.094  1.00 0.00 ? 76 LEU A C    8  
ATOM 9696  O O    . LEU A 1 76 ? 8.248  -6.418  -2.540  1.00 0.00 ? 76 LEU A O    8  
ATOM 9697  C CB   . LEU A 1 76 ? 11.527 -5.578  -2.434  1.00 0.00 ? 76 LEU A CB   8  
ATOM 9698  C CG   . LEU A 1 76 ? 12.660 -5.626  -3.470  1.00 0.00 ? 76 LEU A CG   8  
ATOM 9699  C CD1  . LEU A 1 76 ? 12.291 -6.526  -4.619  1.00 0.00 ? 76 LEU A CD1  8  
ATOM 9700  C CD2  . LEU A 1 76 ? 12.995 -4.229  -3.964  1.00 0.00 ? 76 LEU A CD2  8  
ATOM 9701  H H    . LEU A 1 76 ? 10.555 -3.104  -2.273  1.00 0.00 ? 76 LEU A H    8  
ATOM 9702  H HA   . LEU A 1 76 ? 10.025 -5.435  -3.963  1.00 0.00 ? 76 LEU A HA   8  
ATOM 9703  H HB2  . LEU A 1 76 ? 11.841 -4.931  -1.624  1.00 0.00 ? 76 LEU A HB2  8  
ATOM 9704  H HB3  . LEU A 1 76 ? 11.385 -6.561  -2.047  1.00 0.00 ? 76 LEU A HB3  8  
ATOM 9705  H HG   . LEU A 1 76 ? 13.560 -6.024  -2.998  1.00 0.00 ? 76 LEU A HG   8  
ATOM 9706  H HD11 . LEU A 1 76 ? 12.080 -7.522  -4.254  1.00 0.00 ? 76 LEU A HD11 8  
ATOM 9707  H HD12 . LEU A 1 76 ? 13.113 -6.575  -5.328  1.00 0.00 ? 76 LEU A HD12 8  
ATOM 9708  H HD13 . LEU A 1 76 ? 11.417 -6.132  -5.116  1.00 0.00 ? 76 LEU A HD13 8  
ATOM 9709  H HD21 . LEU A 1 76 ? 13.774 -4.289  -4.703  1.00 0.00 ? 76 LEU A HD21 8  
ATOM 9710  H HD22 . LEU A 1 76 ? 13.329 -3.615  -3.126  1.00 0.00 ? 76 LEU A HD22 8  
ATOM 9711  H HD23 . LEU A 1 76 ? 12.114 -3.778  -4.394  1.00 0.00 ? 76 LEU A HD23 8  
ATOM 9712  N N    . GLY A 1 77 ? 9.024  -5.154  -0.845  1.00 0.00 ? 77 GLY A N    8  
ATOM 9713  C CA   . GLY A 1 77 ? 8.021  -5.651  0.078   1.00 0.00 ? 77 GLY A CA   8  
ATOM 9714  C C    . GLY A 1 77 ? 8.479  -6.907  0.782   1.00 0.00 ? 77 GLY A C    8  
ATOM 9715  O O    . GLY A 1 77 ? 9.503  -6.911  1.466   1.00 0.00 ? 77 GLY A O    8  
ATOM 9716  H H    . GLY A 1 77 ? 9.663  -4.489  -0.561  1.00 0.00 ? 77 GLY A H    8  
ATOM 9717  H HA2  . GLY A 1 77 ? 7.824  -4.880  0.835   1.00 0.00 ? 77 GLY A HA2  8  
ATOM 9718  H HA3  . GLY A 1 77 ? 7.124  -5.851  -0.463  1.00 0.00 ? 77 GLY A HA3  8  
ATOM 9719  N N    . PHE A 1 78 ? 7.729  -7.978  0.619   1.00 0.00 ? 78 PHE A N    8  
ATOM 9720  C CA   . PHE A 1 78 ? 8.071  -9.289  1.164   1.00 0.00 ? 78 PHE A CA   8  
ATOM 9721  C C    . PHE A 1 78 ? 7.775  -10.379 0.140   1.00 0.00 ? 78 PHE A C    8  
ATOM 9722  O O    . PHE A 1 78 ? 8.584  -10.641 -0.742  1.00 0.00 ? 78 PHE A O    8  
ATOM 9723  C CB   . PHE A 1 78 ? 7.323  -9.571  2.483   1.00 0.00 ? 78 PHE A CB   8  
ATOM 9724  C CG   . PHE A 1 78 ? 7.773  -8.732  3.648   1.00 0.00 ? 78 PHE A CG   8  
ATOM 9725  C CD1  . PHE A 1 78 ? 8.990  -8.980  4.256   1.00 0.00 ? 78 PHE A CD1  8  
ATOM 9726  C CD2  . PHE A 1 78 ? 6.981  -7.699  4.119   1.00 0.00 ? 78 PHE A CD2  8  
ATOM 9727  C CE1  . PHE A 1 78 ? 9.417  -8.204  5.321   1.00 0.00 ? 78 PHE A CE1  8  
ATOM 9728  C CE2  . PHE A 1 78 ? 7.407  -6.931  5.185   1.00 0.00 ? 78 PHE A CE2  8  
ATOM 9729  C CZ   . PHE A 1 78 ? 8.624  -7.177  5.791   1.00 0.00 ? 78 PHE A CZ   8  
ATOM 9730  H H    . PHE A 1 78 ? 6.889  -7.905  0.086   1.00 0.00 ? 78 PHE A H    8  
ATOM 9731  H HA   . PHE A 1 78 ? 9.134  -9.274  1.363   1.00 0.00 ? 78 PHE A HA   8  
ATOM 9732  H HB2  . PHE A 1 78 ? 6.259  -9.390  2.331   1.00 0.00 ? 78 PHE A HB2  8  
ATOM 9733  H HB3  . PHE A 1 78 ? 7.456  -10.613 2.748   1.00 0.00 ? 78 PHE A HB3  8  
ATOM 9734  H HD1  . PHE A 1 78 ? 9.620  -9.785  3.899   1.00 0.00 ? 78 PHE A HD1  8  
ATOM 9735  H HD2  . PHE A 1 78 ? 6.021  -7.507  3.660   1.00 0.00 ? 78 PHE A HD2  8  
ATOM 9736  H HE1  . PHE A 1 78 ? 10.364 -8.420  5.787   1.00 0.00 ? 78 PHE A HE1  8  
ATOM 9737  H HE2  . PHE A 1 78 ? 6.782  -6.119  5.544   1.00 0.00 ? 78 PHE A HE2  8  
ATOM 9738  H HZ   . PHE A 1 78 ? 8.963  -6.571  6.621   1.00 0.00 ? 78 PHE A HZ   8  
ATOM 9739  N N    . GLU A 1 79 ? 6.564  -10.965 0.252   1.00 0.00 ? 79 GLU A N    8  
ATOM 9740  C CA   . GLU A 1 79 ? 6.069  -11.957 -0.692  1.00 0.00 ? 79 GLU A CA   8  
ATOM 9741  C C    . GLU A 1 79 ? 6.870  -13.258 -0.676  1.00 0.00 ? 79 GLU A C    8  
ATOM 9742  O O    . GLU A 1 79 ? 6.353  -14.318 -0.324  1.00 0.00 ? 79 GLU A O    8  
ATOM 9743  C CB   . GLU A 1 79 ? 6.000  -11.382 -2.108  1.00 0.00 ? 79 GLU A CB   8  
ATOM 9744  C CG   . GLU A 1 79 ? 4.872  -10.357 -2.333  1.00 0.00 ? 79 GLU A CG   8  
ATOM 9745  C CD   . GLU A 1 79 ? 4.962  -9.169  -1.395  1.00 0.00 ? 79 GLU A CD   8  
ATOM 9746  O OE1  . GLU A 1 79 ? 5.889  -8.347  -1.554  1.00 0.00 ? 79 GLU A OE1  8  
ATOM 9747  O OE2  . GLU A 1 79 ? 4.108  -9.042  -0.488  1.00 0.00 ? 79 GLU A OE2  8  
ATOM 9748  H H    . GLU A 1 79 ? 6.006  -10.719 1.012   1.00 0.00 ? 79 GLU A H    8  
ATOM 9749  H HA   . GLU A 1 79 ? 5.065  -12.194 -0.385  1.00 0.00 ? 79 GLU A HA   8  
ATOM 9750  H HB2  . GLU A 1 79 ? 6.943  -10.894 -2.328  1.00 0.00 ? 79 GLU A HB2  8  
ATOM 9751  H HB3  . GLU A 1 79 ? 5.853  -12.197 -2.806  1.00 0.00 ? 79 GLU A HB3  8  
ATOM 9752  H HG2  . GLU A 1 79 ? 4.938  -10.002 -3.341  1.00 0.00 ? 79 GLU A HG2  8  
ATOM 9753  H HG3  . GLU A 1 79 ? 3.927  -10.855 -2.186  1.00 0.00 ? 79 GLU A HG3  8  
ATOM 9754  N N    . GLU A 1 80 ? 8.146  -13.150 -1.046  1.00 0.00 ? 80 GLU A N    8  
ATOM 9755  C CA   . GLU A 1 80 ? 9.043  -14.291 -1.067  1.00 0.00 ? 80 GLU A CA   8  
ATOM 9756  C C    . GLU A 1 80 ? 9.185  -14.883 0.327   1.00 0.00 ? 80 GLU A C    8  
ATOM 9757  O O    . GLU A 1 80 ? 8.959  -16.071 0.542   1.00 0.00 ? 80 GLU A O    8  
ATOM 9758  C CB   . GLU A 1 80 ? 10.406 -13.877 -1.613  1.00 0.00 ? 80 GLU A CB   8  
ATOM 9759  C CG   . GLU A 1 80 ? 11.345 -15.033 -1.901  1.00 0.00 ? 80 GLU A CG   8  
ATOM 9760  C CD   . GLU A 1 80 ? 12.624 -14.564 -2.548  1.00 0.00 ? 80 GLU A CD   8  
ATOM 9761  O OE1  . GLU A 1 80 ? 12.554 -13.816 -3.559  1.00 0.00 ? 80 GLU A OE1  8  
ATOM 9762  O OE2  . GLU A 1 80 ? 13.709 -14.959 -2.086  1.00 0.00 ? 80 GLU A OE2  8  
ATOM 9763  H H    . GLU A 1 80 ? 8.490  -12.272 -1.286  1.00 0.00 ? 80 GLU A H    8  
ATOM 9764  H HA   . GLU A 1 80 ? 8.608  -15.042 -1.718  1.00 0.00 ? 80 GLU A HA   8  
ATOM 9765  H HB2  . GLU A 1 80 ? 10.246 -13.333 -2.522  1.00 0.00 ? 80 GLU A HB2  8  
ATOM 9766  H HB3  . GLU A 1 80 ? 10.886 -13.214 -0.902  1.00 0.00 ? 80 GLU A HB3  8  
ATOM 9767  H HG2  . GLU A 1 80 ? 11.584 -15.519 -0.980  1.00 0.00 ? 80 GLU A HG2  8  
ATOM 9768  H HG3  . GLU A 1 80 ? 10.853 -15.722 -2.564  1.00 0.00 ? 80 GLU A HG3  8  
ATOM 9769  N N    . MET A 1 4  ? 14.169 5.038   -16.257 1.00 0.00 ? 4  MET A N    9  
ATOM 9770  C CA   . MET A 1 4  ? 13.616 4.297   -15.138 1.00 0.00 ? 4  MET A CA   9  
ATOM 9771  C C    . MET A 1 4  ? 12.194 3.870   -15.460 1.00 0.00 ? 4  MET A C    9  
ATOM 9772  O O    . MET A 1 4  ? 11.613 4.348   -16.427 1.00 0.00 ? 4  MET A O    9  
ATOM 9773  C CB   . MET A 1 4  ? 13.611 5.157   -13.858 1.00 0.00 ? 4  MET A CB   9  
ATOM 9774  C CG   . MET A 1 4  ? 14.985 5.576   -13.384 1.00 0.00 ? 4  MET A CG   9  
ATOM 9775  S SD   . MET A 1 4  ? 14.937 6.741   -12.014 1.00 0.00 ? 4  MET A SD   9  
ATOM 9776  C CE   . MET A 1 4  ? 14.114 5.768   -10.764 1.00 0.00 ? 4  MET A CE   9  
ATOM 9777  H H    . MET A 1 4  ? 13.562 5.610   -16.777 1.00 0.00 ? 4  MET A H    9  
ATOM 9778  H HA   . MET A 1 4  ? 14.226 3.422   -14.970 1.00 0.00 ? 4  MET A HA   9  
ATOM 9779  H HB2  . MET A 1 4  ? 13.036 6.063   -14.050 1.00 0.00 ? 4  MET A HB2  9  
ATOM 9780  H HB3  . MET A 1 4  ? 13.138 4.608   -13.062 1.00 0.00 ? 4  MET A HB3  9  
ATOM 9781  H HG2  . MET A 1 4  ? 15.529 4.700   -13.076 1.00 0.00 ? 4  MET A HG2  9  
ATOM 9782  H HG3  . MET A 1 4  ? 15.517 6.040   -14.209 1.00 0.00 ? 4  MET A HG3  9  
ATOM 9783  H HE1  . MET A 1 4  ? 13.129 5.468   -11.119 1.00 0.00 ? 4  MET A HE1  9  
ATOM 9784  H HE2  . MET A 1 4  ? 14.008 6.353   -9.861  1.00 0.00 ? 4  MET A HE2  9  
ATOM 9785  H HE3  . MET A 1 4  ? 14.704 4.884   -10.552 1.00 0.00 ? 4  MET A HE3  9  
ATOM 9786  N N    . ARG A 1 5  ? 11.630 2.987   -14.639 1.00 0.00 ? 5  ARG A N    9  
ATOM 9787  C CA   . ARG A 1 5  ? 10.232 2.604   -14.787 1.00 0.00 ? 5  ARG A CA   9  
ATOM 9788  C C    . ARG A 1 5  ? 9.340  3.803   -14.510 1.00 0.00 ? 5  ARG A C    9  
ATOM 9789  O O    . ARG A 1 5  ? 8.238  3.924   -15.040 1.00 0.00 ? 5  ARG A O    9  
ATOM 9790  C CB   . ARG A 1 5  ? 9.866  1.445   -13.857 1.00 0.00 ? 5  ARG A CB   9  
ATOM 9791  C CG   . ARG A 1 5  ? 10.555 0.129   -14.190 1.00 0.00 ? 5  ARG A CG   9  
ATOM 9792  C CD   . ARG A 1 5  ? 11.967 0.078   -13.632 1.00 0.00 ? 5  ARG A CD   9  
ATOM 9793  N NE   . ARG A 1 5  ? 12.682 -1.119  -14.044 1.00 0.00 ? 5  ARG A NE   9  
ATOM 9794  C CZ   . ARG A 1 5  ? 13.443 -1.854  -13.224 1.00 0.00 ? 5  ARG A CZ   9  
ATOM 9795  N NH1  . ARG A 1 5  ? 13.483 -1.590  -11.927 1.00 0.00 ? 5  ARG A NH1  9  
ATOM 9796  N NH2  . ARG A 1 5  ? 14.122 -2.878  -13.705 1.00 0.00 ? 5  ARG A NH2  9  
ATOM 9797  H H    . ARG A 1 5  ? 12.158 2.575   -13.933 1.00 0.00 ? 5  ARG A H    9  
ATOM 9798  H HA   . ARG A 1 5  ? 10.080 2.295   -15.814 1.00 0.00 ? 5  ARG A HA   9  
ATOM 9799  H HB2  . ARG A 1 5  ? 10.153 1.710   -12.860 1.00 0.00 ? 5  ARG A HB2  9  
ATOM 9800  H HB3  . ARG A 1 5  ? 8.803  1.288   -13.905 1.00 0.00 ? 5  ARG A HB3  9  
ATOM 9801  H HG2  . ARG A 1 5  ? 9.979  -0.688  -13.765 1.00 0.00 ? 5  ARG A HG2  9  
ATOM 9802  H HG3  . ARG A 1 5  ? 10.602 0.018   -15.266 1.00 0.00 ? 5  ARG A HG3  9  
ATOM 9803  H HD2  . ARG A 1 5  ? 12.506 0.937   -13.985 1.00 0.00 ? 5  ARG A HD2  9  
ATOM 9804  H HD3  . ARG A 1 5  ? 11.896 0.103   -12.550 1.00 0.00 ? 5  ARG A HD3  9  
ATOM 9805  H HE   . ARG A 1 5  ? 12.631 -1.378  -15.000 1.00 0.00 ? 5  ARG A HE   9  
ATOM 9806  H HH11 . ARG A 1 5  ? 12.940 -0.835  -11.550 1.00 0.00 ? 5  ARG A HH11 9  
ATOM 9807  H HH12 . ARG A 1 5  ? 14.079 -2.129  -11.314 1.00 0.00 ? 5  ARG A HH12 9  
ATOM 9808  H HH21 . ARG A 1 5  ? 14.083 -3.097  -14.664 1.00 0.00 ? 5  ARG A HH21 9  
ATOM 9809  H HH22 . ARG A 1 5  ? 14.697 -3.436  -13.086 1.00 0.00 ? 5  ARG A HH22 9  
ATOM 9810  N N    . SER A 1 6  ? 9.839  4.701   -13.665 1.00 0.00 ? 6  SER A N    9  
ATOM 9811  C CA   . SER A 1 6  ? 9.119  5.896   -13.228 1.00 0.00 ? 6  SER A CA   9  
ATOM 9812  C C    . SER A 1 6  ? 8.989  6.935   -14.352 1.00 0.00 ? 6  SER A C    9  
ATOM 9813  O O    . SER A 1 6  ? 8.632  8.083   -14.088 1.00 0.00 ? 6  SER A O    9  
ATOM 9814  C CB   . SER A 1 6  ? 9.885  6.493   -12.055 1.00 0.00 ? 6  SER A CB   9  
ATOM 9815  O OG   . SER A 1 6  ? 10.386 5.461   -11.210 1.00 0.00 ? 6  SER A OG   9  
ATOM 9816  H H    . SER A 1 6  ? 10.735 4.554   -13.320 1.00 0.00 ? 6  SER A H    9  
ATOM 9817  H HA   . SER A 1 6  ? 8.142  5.598   -12.906 1.00 0.00 ? 6  SER A HA   9  
ATOM 9818  H HB2  . SER A 1 6  ? 10.710 7.089   -12.422 1.00 0.00 ? 6  SER A HB2  9  
ATOM 9819  H HB3  . SER A 1 6  ? 9.217  7.119   -11.462 1.00 0.00 ? 6  SER A HB3  9  
ATOM 9820  H HG   . SER A 1 6  ? 10.748 5.850   -10.397 1.00 0.00 ? 6  SER A HG   9  
ATOM 9821  N N    . GLU A 1 7  ? 9.270  6.534   -15.597 1.00 0.00 ? 7  GLU A N    9  
ATOM 9822  C CA   . GLU A 1 7  ? 9.225  7.452   -16.732 1.00 0.00 ? 7  GLU A CA   9  
ATOM 9823  C C    . GLU A 1 7  ? 7.805  7.834   -17.134 1.00 0.00 ? 7  GLU A C    9  
ATOM 9824  O O    . GLU A 1 7  ? 7.583  8.305   -18.257 1.00 0.00 ? 7  GLU A O    9  
ATOM 9825  C CB   . GLU A 1 7  ? 9.944  6.835   -17.935 1.00 0.00 ? 7  GLU A CB   9  
ATOM 9826  C CG   . GLU A 1 7  ? 9.301  5.565   -18.456 1.00 0.00 ? 7  GLU A CG   9  
ATOM 9827  C CD   . GLU A 1 7  ? 9.982  5.062   -19.711 1.00 0.00 ? 7  GLU A CD   9  
ATOM 9828  O OE1  . GLU A 1 7  ? 9.626  5.521   -20.811 1.00 0.00 ? 7  GLU A OE1  9  
ATOM 9829  O OE2  . GLU A 1 7  ? 10.886 4.207   -19.595 1.00 0.00 ? 7  GLU A OE2  9  
ATOM 9830  H H    . GLU A 1 7  ? 9.518  5.592   -15.755 1.00 0.00 ? 7  GLU A H    9  
ATOM 9831  H HA   . GLU A 1 7  ? 9.743  8.353   -16.452 1.00 0.00 ? 7  GLU A HA   9  
ATOM 9832  H HB2  . GLU A 1 7  ? 9.949  7.559   -18.738 1.00 0.00 ? 7  GLU A HB2  9  
ATOM 9833  H HB3  . GLU A 1 7  ? 10.950 6.608   -17.659 1.00 0.00 ? 7  GLU A HB3  9  
ATOM 9834  H HG2  . GLU A 1 7  ? 9.369  4.798   -17.695 1.00 0.00 ? 7  GLU A HG2  9  
ATOM 9835  H HG3  . GLU A 1 7  ? 8.257  5.761   -18.667 1.00 0.00 ? 7  GLU A HG3  9  
ATOM 9836  N N    . PHE A 1 8  ? 6.847  7.626   -16.229 1.00 0.00 ? 8  PHE A N    9  
ATOM 9837  C CA   . PHE A 1 8  ? 5.460  8.026   -16.465 1.00 0.00 ? 8  PHE A CA   9  
ATOM 9838  C C    . PHE A 1 8  ? 5.352  9.527   -16.726 1.00 0.00 ? 8  PHE A C    9  
ATOM 9839  O O    . PHE A 1 8  ? 6.354  10.237  -16.745 1.00 0.00 ? 8  PHE A O    9  
ATOM 9840  C CB   . PHE A 1 8  ? 4.593  7.666   -15.257 1.00 0.00 ? 8  PHE A CB   9  
ATOM 9841  C CG   . PHE A 1 8  ? 4.527  6.188   -14.952 1.00 0.00 ? 8  PHE A CG   9  
ATOM 9842  C CD1  . PHE A 1 8  ? 3.731  5.336   -15.689 1.00 0.00 ? 8  PHE A CD1  9  
ATOM 9843  C CD2  . PHE A 1 8  ? 5.264  5.657   -13.906 1.00 0.00 ? 8  PHE A CD2  9  
ATOM 9844  C CE1  . PHE A 1 8  ? 3.674  3.986   -15.397 1.00 0.00 ? 8  PHE A CE1  9  
ATOM 9845  C CE2  . PHE A 1 8  ? 5.210  4.310   -13.601 1.00 0.00 ? 8  PHE A CE2  9  
ATOM 9846  C CZ   . PHE A 1 8  ? 4.408  3.472   -14.354 1.00 0.00 ? 8  PHE A CZ   9  
ATOM 9847  H H    . PHE A 1 8  ? 7.086  7.200   -15.385 1.00 0.00 ? 8  PHE A H    9  
ATOM 9848  H HA   . PHE A 1 8  ? 5.092  7.491   -17.326 1.00 0.00 ? 8  PHE A HA   9  
ATOM 9849  H HB2  . PHE A 1 8  ? 4.983  8.167   -14.376 1.00 0.00 ? 8  PHE A HB2  9  
ATOM 9850  H HB3  . PHE A 1 8  ? 3.578  8.000   -15.441 1.00 0.00 ? 8  PHE A HB3  9  
ATOM 9851  H HD1  . PHE A 1 8  ? 3.147  5.728   -16.514 1.00 0.00 ? 8  PHE A HD1  9  
ATOM 9852  H HD2  . PHE A 1 8  ? 5.896  6.319   -13.310 1.00 0.00 ? 8  PHE A HD2  9  
ATOM 9853  H HE1  . PHE A 1 8  ? 3.040  3.329   -15.995 1.00 0.00 ? 8  PHE A HE1  9  
ATOM 9854  H HE2  . PHE A 1 8  ? 5.785  3.909   -12.775 1.00 0.00 ? 8  PHE A HE2  9  
ATOM 9855  H HZ   . PHE A 1 8  ? 4.369  2.413   -14.132 1.00 0.00 ? 8  PHE A HZ   9  
ATOM 9856  N N    . ALA A 1 9  ? 4.120  10.011  -16.918 1.00 0.00 ? 9  ALA A N    9  
ATOM 9857  C CA   . ALA A 1 9  ? 3.881  11.413  -17.272 1.00 0.00 ? 9  ALA A CA   9  
ATOM 9858  C C    . ALA A 1 9  ? 4.677  12.382  -16.401 1.00 0.00 ? 9  ALA A C    9  
ATOM 9859  O O    . ALA A 1 9  ? 5.308  13.316  -16.911 1.00 0.00 ? 9  ALA A O    9  
ATOM 9860  C CB   . ALA A 1 9  ? 2.399  11.764  -17.179 1.00 0.00 ? 9  ALA A CB   9  
ATOM 9861  H H    . ALA A 1 9  ? 3.341  9.405   -16.834 1.00 0.00 ? 9  ALA A H    9  
ATOM 9862  H HA   . ALA A 1 9  ? 4.178  11.547  -18.300 1.00 0.00 ? 9  ALA A HA   9  
ATOM 9863  H HB1  . ALA A 1 9  ? 2.072  11.665  -16.152 1.00 0.00 ? 9  ALA A HB1  9  
ATOM 9864  H HB2  . ALA A 1 9  ? 1.843  11.099  -17.809 1.00 0.00 ? 9  ALA A HB2  9  
ATOM 9865  H HB3  . ALA A 1 9  ? 2.239  12.778  -17.512 1.00 0.00 ? 9  ALA A HB3  9  
ATOM 9866  N N    . SER A 1 10 ? 4.639  12.168  -15.104 1.00 0.00 ? 10 SER A N    9  
ATOM 9867  C CA   . SER A 1 10 ? 5.450  12.950  -14.171 1.00 0.00 ? 10 SER A CA   9  
ATOM 9868  C C    . SER A 1 10 ? 6.155  11.994  -13.189 1.00 0.00 ? 10 SER A C    9  
ATOM 9869  O O    . SER A 1 10 ? 6.760  12.417  -12.211 1.00 0.00 ? 10 SER A O    9  
ATOM 9870  C CB   . SER A 1 10 ? 4.572  13.968  -13.439 1.00 0.00 ? 10 SER A CB   9  
ATOM 9871  O OG   . SER A 1 10 ? 5.353  14.875  -12.680 1.00 0.00 ? 10 SER A OG   9  
ATOM 9872  H H    . SER A 1 10 ? 4.057  11.471  -14.760 1.00 0.00 ? 10 SER A H    9  
ATOM 9873  H HA   . SER A 1 10 ? 6.205  13.470  -14.752 1.00 0.00 ? 10 SER A HA   9  
ATOM 9874  H HB2  . SER A 1 10 ? 4.007  14.526  -14.156 1.00 0.00 ? 10 SER A HB2  9  
ATOM 9875  H HB3  . SER A 1 10 ? 3.893  13.449  -12.765 1.00 0.00 ? 10 SER A HB3  9  
ATOM 9876  H HG   . SER A 1 10 ? 6.215  14.985  -13.098 1.00 0.00 ? 10 SER A HG   9  
ATOM 9877  N N    . GLY A 1 11 ? 6.072  10.700  -13.490 1.00 0.00 ? 11 GLY A N    9  
ATOM 9878  C CA   . GLY A 1 11 ? 6.595  9.704   -12.590 1.00 0.00 ? 11 GLY A CA   9  
ATOM 9879  C C    . GLY A 1 11 ? 5.707  9.524   -11.372 1.00 0.00 ? 11 GLY A C    9  
ATOM 9880  O O    . GLY A 1 11 ? 6.063  8.819   -10.425 1.00 0.00 ? 11 GLY A O    9  
ATOM 9881  H H    . GLY A 1 11 ? 5.672  10.434  -14.352 1.00 0.00 ? 11 GLY A H    9  
ATOM 9882  H HA2  . GLY A 1 11 ? 6.672  8.763   -13.112 1.00 0.00 ? 11 GLY A HA2  9  
ATOM 9883  H HA3  . GLY A 1 11 ? 7.578  9.999   -12.257 1.00 0.00 ? 11 GLY A HA3  9  
ATOM 9884  N N    . ASN A 1 12 ? 4.538  10.159  -11.419 1.00 0.00 ? 12 ASN A N    9  
ATOM 9885  C CA   . ASN A 1 12 ? 3.637  10.221  -10.274 1.00 0.00 ? 12 ASN A CA   9  
ATOM 9886  C C    . ASN A 1 12 ? 3.032  8.857   -9.959  1.00 0.00 ? 12 ASN A C    9  
ATOM 9887  O O    . ASN A 1 12 ? 2.949  8.495   -8.791  1.00 0.00 ? 12 ASN A O    9  
ATOM 9888  C CB   . ASN A 1 12 ? 2.530  11.249  -10.486 1.00 0.00 ? 12 ASN A CB   9  
ATOM 9889  C CG   . ASN A 1 12 ? 1.713  11.001  -11.741 1.00 0.00 ? 12 ASN A CG   9  
ATOM 9890  O OD1  . ASN A 1 12 ? 2.233  10.528  -12.760 1.00 0.00 ? 12 ASN A OD1  9  
ATOM 9891  N ND2  . ASN A 1 12 ? 0.430  11.311  -11.676 1.00 0.00 ? 12 ASN A ND2  9  
ATOM 9892  H H    . ASN A 1 12 ? 4.285  10.596  -12.261 1.00 0.00 ? 12 ASN A H    9  
ATOM 9893  H HA   . ASN A 1 12 ? 4.227  10.513  -9.431  1.00 0.00 ? 12 ASN A HA   9  
ATOM 9894  H HB2  . ASN A 1 12 ? 1.865  11.215  -9.638  1.00 0.00 ? 12 ASN A HB2  9  
ATOM 9895  H HB3  . ASN A 1 12 ? 2.971  12.243  -10.565 1.00 0.00 ? 12 ASN A HB3  9  
ATOM 9896  H HD21 . ASN A 1 12 ? 0.090  11.676  -10.833 1.00 0.00 ? 12 ASN A HD21 9  
ATOM 9897  H HD22 . ASN A 1 12 ? -0.130 11.160  -12.475 1.00 0.00 ? 12 ASN A HD22 9  
ATOM 9898  N N    . THR A 1 13 ? 2.598  8.110   -10.966 1.00 0.00 ? 13 THR A N    9  
ATOM 9899  C CA   . THR A 1 13 ? 2.044  6.770   -10.764 1.00 0.00 ? 13 THR A CA   9  
ATOM 9900  C C    . THR A 1 13 ? 2.982  5.894   -9.920  1.00 0.00 ? 13 THR A C    9  
ATOM 9901  O O    . THR A 1 13 ? 2.535  5.174   -9.016  1.00 0.00 ? 13 THR A O    9  
ATOM 9902  C CB   . THR A 1 13 ? 1.799  6.076   -12.117 1.00 0.00 ? 13 THR A CB   9  
ATOM 9903  O OG1  . THR A 1 13 ? 1.116  6.987   -13.008 1.00 0.00 ? 13 THR A OG1  9  
ATOM 9904  C CG2  . THR A 1 13 ? 0.987  4.810   -11.955 1.00 0.00 ? 13 THR A CG2  9  
ATOM 9905  H H    . THR A 1 13 ? 2.546  8.479   -11.879 1.00 0.00 ? 13 THR A H    9  
ATOM 9906  H HA   . THR A 1 13 ? 1.101  6.858   -10.252 1.00 0.00 ? 13 THR A HA   9  
ATOM 9907  H HB   . THR A 1 13 ? 2.760  5.823   -12.578 1.00 0.00 ? 13 THR A HB   9  
ATOM 9908  H HG1  . THR A 1 13 ? 0.276  7.269   -12.588 1.00 0.00 ? 13 THR A HG1  9  
ATOM 9909  H HG21 . THR A 1 13 ? 0.022  5.055   -11.548 1.00 0.00 ? 13 THR A HG21 9  
ATOM 9910  H HG22 . THR A 1 13 ? 1.507  4.137   -11.290 1.00 0.00 ? 13 THR A HG22 9  
ATOM 9911  H HG23 . THR A 1 13 ? 0.866  4.327   -12.922 1.00 0.00 ? 13 THR A HG23 9  
ATOM 9912  N N    . TYR A 1 14 ? 4.272  5.972   -10.203 1.00 0.00 ? 14 TYR A N    9  
ATOM 9913  C CA   . TYR A 1 14 ? 5.263  5.198   -9.459  1.00 0.00 ? 14 TYR A CA   9  
ATOM 9914  C C    . TYR A 1 14 ? 5.330  5.689   -8.031  1.00 0.00 ? 14 TYR A C    9  
ATOM 9915  O O    . TYR A 1 14 ? 5.286  4.870   -7.095  1.00 0.00 ? 14 TYR A O    9  
ATOM 9916  C CB   . TYR A 1 14 ? 6.623  5.317   -10.133 1.00 0.00 ? 14 TYR A CB   9  
ATOM 9917  C CG   . TYR A 1 14 ? 7.614  4.272   -9.654  1.00 0.00 ? 14 TYR A CG   9  
ATOM 9918  C CD1  . TYR A 1 14 ? 7.547  2.962   -10.113 1.00 0.00 ? 14 TYR A CD1  9  
ATOM 9919  C CD2  . TYR A 1 14 ? 8.599  4.594   -8.732  1.00 0.00 ? 14 TYR A CD2  9  
ATOM 9920  C CE1  . TYR A 1 14 ? 8.427  1.992   -9.662  1.00 0.00 ? 14 TYR A CE1  9  
ATOM 9921  C CE2  . TYR A 1 14 ? 9.486  3.640   -8.289  1.00 0.00 ? 14 TYR A CE2  9  
ATOM 9922  C CZ   . TYR A 1 14 ? 9.398  2.335   -8.747  1.00 0.00 ? 14 TYR A CZ   9  
ATOM 9923  O OH   . TYR A 1 14 ? 10.268 1.376   -8.307  1.00 0.00 ? 14 TYR A OH   9  
ATOM 9924  H H    . TYR A 1 14 ? 4.564  6.580   -10.916 1.00 0.00 ? 14 TYR A H    9  
ATOM 9925  H HA   . TYR A 1 14 ? 4.948  4.185   -9.467  1.00 0.00 ? 14 TYR A HA   9  
ATOM 9926  H HB2  . TYR A 1 14 ? 6.513  5.188   -11.196 1.00 0.00 ? 14 TYR A HB2  9  
ATOM 9927  H HB3  . TYR A 1 14 ? 7.050  6.280   -9.934  1.00 0.00 ? 14 TYR A HB3  9  
ATOM 9928  H HD1  . TYR A 1 14 ? 6.776  2.707   -10.826 1.00 0.00 ? 14 TYR A HD1  9  
ATOM 9929  H HD2  . TYR A 1 14 ? 8.651  5.606   -8.377  1.00 0.00 ? 14 TYR A HD2  9  
ATOM 9930  H HE1  . TYR A 1 14 ? 8.359  0.983   -10.030 1.00 0.00 ? 14 TYR A HE1  9  
ATOM 9931  H HE2  . TYR A 1 14 ? 10.245 3.911   -7.572  1.00 0.00 ? 14 TYR A HE2  9  
ATOM 9932  H HH   . TYR A 1 14 ? 10.461 1.539   -7.360  1.00 0.00 ? 14 TYR A HH   9  
ATOM 9933  N N    . ALA A 1 15 ? 5.445  7.002   -7.861  1.00 0.00 ? 15 ALA A N    9  
ATOM 9934  C CA   . ALA A 1 15 ? 5.425  7.629   -6.541  1.00 0.00 ? 15 ALA A CA   9  
ATOM 9935  C C    . ALA A 1 15 ? 4.172  7.255   -5.746  1.00 0.00 ? 15 ALA A C    9  
ATOM 9936  O O    . ALA A 1 15 ? 4.237  7.007   -4.549  1.00 0.00 ? 15 ALA A O    9  
ATOM 9937  C CB   . ALA A 1 15 ? 5.494  9.147   -6.705  1.00 0.00 ? 15 ALA A CB   9  
ATOM 9938  H H    . ALA A 1 15 ? 5.594  7.573   -8.625  1.00 0.00 ? 15 ALA A H    9  
ATOM 9939  H HA   . ALA A 1 15 ? 6.307  7.299   -6.002  1.00 0.00 ? 15 ALA A HA   9  
ATOM 9940  H HB1  . ALA A 1 15 ? 4.645  9.484   -7.255  1.00 0.00 ? 15 ALA A HB1  9  
ATOM 9941  H HB2  . ALA A 1 15 ? 6.401  9.385   -7.236  1.00 0.00 ? 15 ALA A HB2  9  
ATOM 9942  H HB3  . ALA A 1 15 ? 5.513  9.605   -5.736  1.00 0.00 ? 15 ALA A HB3  9  
ATOM 9943  N N    . LEU A 1 16 ? 3.043  7.184   -6.437  1.00 0.00 ? 16 LEU A N    9  
ATOM 9944  C CA   . LEU A 1 16 ? 1.776  6.862   -5.819  1.00 0.00 ? 16 LEU A CA   9  
ATOM 9945  C C    . LEU A 1 16 ? 1.777  5.424   -5.311  1.00 0.00 ? 16 LEU A C    9  
ATOM 9946  O O    . LEU A 1 16 ? 1.379  5.137   -4.174  1.00 0.00 ? 16 LEU A O    9  
ATOM 9947  C CB   . LEU A 1 16 ? 0.644  7.074   -6.822  1.00 0.00 ? 16 LEU A CB   9  
ATOM 9948  C CG   . LEU A 1 16 ? -0.779 6.863   -6.279  1.00 0.00 ? 16 LEU A CG   9  
ATOM 9949  C CD1  . LEU A 1 16 ? -1.123 7.910   -5.246  1.00 0.00 ? 16 LEU A CD1  9  
ATOM 9950  C CD2  . LEU A 1 16 ? -1.780 6.859   -7.415  1.00 0.00 ? 16 LEU A CD2  9  
ATOM 9951  H H    . LEU A 1 16 ? 3.069  7.340   -7.401  1.00 0.00 ? 16 LEU A H    9  
ATOM 9952  H HA   . LEU A 1 16 ? 1.640  7.525   -4.991  1.00 0.00 ? 16 LEU A HA   9  
ATOM 9953  H HB2  . LEU A 1 16 ? 0.702  8.088   -7.200  1.00 0.00 ? 16 LEU A HB2  9  
ATOM 9954  H HB3  . LEU A 1 16 ? 0.785  6.390   -7.635  1.00 0.00 ? 16 LEU A HB3  9  
ATOM 9955  H HG   . LEU A 1 16 ? -0.823 5.886   -5.810  1.00 0.00 ? 16 LEU A HG   9  
ATOM 9956  H HD11 . LEU A 1 16 ? -2.135 7.752   -4.888  1.00 0.00 ? 16 LEU A HD11 9  
ATOM 9957  H HD12 . LEU A 1 16 ? -1.061 8.892   -5.693  1.00 0.00 ? 16 LEU A HD12 9  
ATOM 9958  H HD13 . LEU A 1 16 ? -0.437 7.852   -4.421  1.00 0.00 ? 16 LEU A HD13 9  
ATOM 9959  H HD21 . LEU A 1 16 ? -2.772 6.763   -7.000  1.00 0.00 ? 16 LEU A HD21 9  
ATOM 9960  H HD22 . LEU A 1 16 ? -1.580 6.042   -8.096  1.00 0.00 ? 16 LEU A HD22 9  
ATOM 9961  H HD23 . LEU A 1 16 ? -1.705 7.798   -7.940  1.00 0.00 ? 16 LEU A HD23 9  
ATOM 9962  N N    . TYR A 1 17 ? 2.248  4.538   -6.166  1.00 0.00 ? 17 TYR A N    9  
ATOM 9963  C CA   . TYR A 1 17 ? 2.305  3.114   -5.874  1.00 0.00 ? 17 TYR A CA   9  
ATOM 9964  C C    . TYR A 1 17 ? 3.148  2.851   -4.629  1.00 0.00 ? 17 TYR A C    9  
ATOM 9965  O O    . TYR A 1 17 ? 2.685  2.236   -3.674  1.00 0.00 ? 17 TYR A O    9  
ATOM 9966  C CB   . TYR A 1 17 ? 2.843  2.340   -7.063  1.00 0.00 ? 17 TYR A CB   9  
ATOM 9967  C CG   . TYR A 1 17 ? 2.790  0.828   -6.905  1.00 0.00 ? 17 TYR A CG   9  
ATOM 9968  C CD1  . TYR A 1 17 ? 1.674  0.121   -7.325  1.00 0.00 ? 17 TYR A CD1  9  
ATOM 9969  C CD2  . TYR A 1 17 ? 3.852  0.120   -6.355  1.00 0.00 ? 17 TYR A CD2  9  
ATOM 9970  C CE1  . TYR A 1 17 ? 1.612  -1.254  -7.195  1.00 0.00 ? 17 TYR A CE1  9  
ATOM 9971  C CE2  . TYR A 1 17 ? 3.801  -1.243  -6.225  1.00 0.00 ? 17 TYR A CE2  9  
ATOM 9972  C CZ   . TYR A 1 17 ? 2.681  -1.928  -6.640  1.00 0.00 ? 17 TYR A CZ   9  
ATOM 9973  O OH   . TYR A 1 17 ? 2.612  -3.308  -6.507  1.00 0.00 ? 17 TYR A OH   9  
ATOM 9974  H H    . TYR A 1 17 ? 2.590  4.844   -7.033  1.00 0.00 ? 17 TYR A H    9  
ATOM 9975  H HA   . TYR A 1 17 ? 1.295  2.794   -5.676  1.00 0.00 ? 17 TYR A HA   9  
ATOM 9976  H HB2  . TYR A 1 17 ? 2.283  2.603   -7.956  1.00 0.00 ? 17 TYR A HB2  9  
ATOM 9977  H HB3  . TYR A 1 17 ? 3.886  2.613   -7.216  1.00 0.00 ? 17 TYR A HB3  9  
ATOM 9978  H HD1  . TYR A 1 17 ? 0.849  0.657   -7.757  1.00 0.00 ? 17 TYR A HD1  9  
ATOM 9979  H HD2  . TYR A 1 17 ? 4.721  0.661   -6.029  1.00 0.00 ? 17 TYR A HD2  9  
ATOM 9980  H HE1  . TYR A 1 17 ? 0.730  -1.788  -7.524  1.00 0.00 ? 17 TYR A HE1  9  
ATOM 9981  H HE2  . TYR A 1 17 ? 4.622  -1.784  -5.796  1.00 0.00 ? 17 TYR A HE2  9  
ATOM 9982  H HH   . TYR A 1 17 ? 2.341  -3.684  -7.351  1.00 0.00 ? 17 TYR A HH   9  
ATOM 9983  N N    . VAL A 1 18 ? 4.372  3.360   -4.644  1.00 0.00 ? 18 VAL A N    9  
ATOM 9984  C CA   . VAL A 1 18 ? 5.325  3.098   -3.585  1.00 0.00 ? 18 VAL A CA   9  
ATOM 9985  C C    . VAL A 1 18 ? 4.830  3.599   -2.212  1.00 0.00 ? 18 VAL A C    9  
ATOM 9986  O O    . VAL A 1 18 ? 4.980  2.883   -1.222  1.00 0.00 ? 18 VAL A O    9  
ATOM 9987  C CB   . VAL A 1 18 ? 6.720  3.677   -3.888  1.00 0.00 ? 18 VAL A CB   9  
ATOM 9988  C CG1  . VAL A 1 18 ? 7.321  2.966   -5.100  1.00 0.00 ? 18 VAL A CG1  9  
ATOM 9989  C CG2  . VAL A 1 18 ? 6.677  5.175   -4.118  1.00 0.00 ? 18 VAL A CG2  9  
ATOM 9990  H H    . VAL A 1 18 ? 4.651  3.909   -5.425  1.00 0.00 ? 18 VAL A H    9  
ATOM 9991  H HA   . VAL A 1 18 ? 5.437  2.022   -3.515  1.00 0.00 ? 18 VAL A HA   9  
ATOM 9992  H HB   . VAL A 1 18 ? 7.351  3.492   -3.042  1.00 0.00 ? 18 VAL A HB   9  
ATOM 9993  H HG11 . VAL A 1 18 ? 7.432  1.908   -4.888  1.00 0.00 ? 18 VAL A HG11 9  
ATOM 9994  H HG12 . VAL A 1 18 ? 8.299  3.383   -5.312  1.00 0.00 ? 18 VAL A HG12 9  
ATOM 9995  H HG13 . VAL A 1 18 ? 6.683  3.096   -5.953  1.00 0.00 ? 18 VAL A HG13 9  
ATOM 9996  H HG21 . VAL A 1 18 ? 5.997  5.394   -4.938  1.00 0.00 ? 18 VAL A HG21 9  
ATOM 9997  H HG22 . VAL A 1 18 ? 7.656  5.531   -4.364  1.00 0.00 ? 18 VAL A HG22 9  
ATOM 9998  H HG23 . VAL A 1 18 ? 6.327  5.662   -3.220  1.00 0.00 ? 18 VAL A HG23 9  
ATOM 9999  N N    . ARG A 1 19 ? 4.233  4.793   -2.150  1.00 0.00 ? 19 ARG A N    9  
ATOM 10000 C CA   . ARG A 1 19 ? 3.728  5.317   -0.892  1.00 0.00 ? 19 ARG A CA   9  
ATOM 10001 C C    . ARG A 1 19 ? 2.750  4.350   -0.225  1.00 0.00 ? 19 ARG A C    9  
ATOM 10002 O O    . ARG A 1 19 ? 2.774  4.155   0.982   1.00 0.00 ? 19 ARG A O    9  
ATOM 10003 C CB   . ARG A 1 19 ? 3.022  6.646   -1.098  1.00 0.00 ? 19 ARG A CB   9  
ATOM 10004 C CG   . ARG A 1 19 ? 3.882  7.722   -1.740  1.00 0.00 ? 19 ARG A CG   9  
ATOM 10005 C CD   . ARG A 1 19 ? 3.170  9.062   -1.715  1.00 0.00 ? 19 ARG A CD   9  
ATOM 10006 N NE   . ARG A 1 19 ? 1.768  8.951   -2.122  1.00 0.00 ? 19 ARG A NE   9  
ATOM 10007 C CZ   . ARG A 1 19 ? 0.956  9.995   -2.261  1.00 0.00 ? 19 ARG A CZ   9  
ATOM 10008 N NH1  . ARG A 1 19 ? 1.397  11.215  -2.060  1.00 0.00 ? 19 ARG A NH1  9  
ATOM 10009 N NH2  . ARG A 1 19 ? -0.317 9.796   -2.619  1.00 0.00 ? 19 ARG A NH2  9  
ATOM 10010 H H    . ARG A 1 19 ? 4.183  5.347   -2.961  1.00 0.00 ? 19 ARG A H    9  
ATOM 10011 H HA   . ARG A 1 19 ? 4.563  5.462   -0.235  1.00 0.00 ? 19 ARG A HA   9  
ATOM 10012 H HB2  . ARG A 1 19 ? 2.161  6.505   -1.737  1.00 0.00 ? 19 ARG A HB2  9  
ATOM 10013 H HB3  . ARG A 1 19 ? 2.698  7.012   -0.137  1.00 0.00 ? 19 ARG A HB3  9  
ATOM 10014 H HG2  . ARG A 1 19 ? 4.808  7.801   -1.194  1.00 0.00 ? 19 ARG A HG2  9  
ATOM 10015 H HG3  . ARG A 1 19 ? 4.087  7.446   -2.765  1.00 0.00 ? 19 ARG A HG3  9  
ATOM 10016 H HD2  . ARG A 1 19 ? 3.221  9.453   -0.724  1.00 0.00 ? 19 ARG A HD2  9  
ATOM 10017 H HD3  . ARG A 1 19 ? 3.680  9.730   -2.402  1.00 0.00 ? 19 ARG A HD3  9  
ATOM 10018 H HE   . ARG A 1 19 ? 1.399  8.034   -2.272  1.00 0.00 ? 19 ARG A HE   9  
ATOM 10019 H HH11 . ARG A 1 19 ? 2.356  11.367  -1.782  1.00 0.00 ? 19 ARG A HH11 9  
ATOM 10020 H HH12 . ARG A 1 19 ? 0.785  12.005  -2.173  1.00 0.00 ? 19 ARG A HH12 9  
ATOM 10021 H HH21 . ARG A 1 19 ? -0.656 8.855   -2.764  1.00 0.00 ? 19 ARG A HH21 9  
ATOM 10022 H HH22 . ARG A 1 19 ? -0.927 10.568  -2.754  1.00 0.00 ? 19 ARG A HH22 9  
ATOM 10023 N N    . ASP A 1 20 ? 1.877  3.750   -1.027  1.00 0.00 ? 20 ASP A N    9  
ATOM 10024 C CA   . ASP A 1 20 ? 0.831  2.888   -0.507  1.00 0.00 ? 20 ASP A CA   9  
ATOM 10025 C C    . ASP A 1 20 ? 1.342  1.467   -0.265  1.00 0.00 ? 20 ASP A C    9  
ATOM 10026 O O    . ASP A 1 20 ? 1.051  0.855   0.777   1.00 0.00 ? 20 ASP A O    9  
ATOM 10027 C CB   . ASP A 1 20 ? -0.361 2.868   -1.456  1.00 0.00 ? 20 ASP A CB   9  
ATOM 10028 C CG   . ASP A 1 20 ? -1.531 2.096   -0.884  1.00 0.00 ? 20 ASP A CG   9  
ATOM 10029 O OD1  . ASP A 1 20 ? -2.196 2.607   0.044   1.00 0.00 ? 20 ASP A OD1  9  
ATOM 10030 O OD2  . ASP A 1 20 ? -1.802 0.982   -1.373  1.00 0.00 ? 20 ASP A OD2  9  
ATOM 10031 H H    . ASP A 1 20 ? 1.940  3.934   -1.982  1.00 0.00 ? 20 ASP A H    9  
ATOM 10032 H HA   . ASP A 1 20 ? 0.520  3.302   0.436   1.00 0.00 ? 20 ASP A HA   9  
ATOM 10033 H HB2  . ASP A 1 20 ? -0.686 3.884   -1.654  1.00 0.00 ? 20 ASP A HB2  9  
ATOM 10034 H HB3  . ASP A 1 20 ? -0.066 2.401   -2.390  1.00 0.00 ? 20 ASP A HB3  9  
ATOM 10035 N N    . THR A 1 21 ? 2.082  0.930   -1.221  1.00 0.00 ? 21 THR A N    9  
ATOM 10036 C CA   . THR A 1 21 ? 2.493  -0.462  -1.179  1.00 0.00 ? 21 THR A CA   9  
ATOM 10037 C C    . THR A 1 21 ? 3.705  -0.674  -0.289  1.00 0.00 ? 21 THR A C    9  
ATOM 10038 O O    . THR A 1 21 ? 3.823  -1.693  0.385   1.00 0.00 ? 21 THR A O    9  
ATOM 10039 C CB   . THR A 1 21 ? 2.773  -0.980  -2.599  1.00 0.00 ? 21 THR A CB   9  
ATOM 10040 O OG1  . THR A 1 21 ? 1.635  -0.741  -3.424  1.00 0.00 ? 21 THR A OG1  9  
ATOM 10041 C CG2  . THR A 1 21 ? 3.091  -2.474  -2.583  1.00 0.00 ? 21 THR A CG2  9  
ATOM 10042 H H    . THR A 1 21 ? 2.355  1.487   -1.994  1.00 0.00 ? 21 THR A H    9  
ATOM 10043 H HA   . THR A 1 21 ? 1.658  -1.025  -0.782  1.00 0.00 ? 21 THR A HA   9  
ATOM 10044 H HB   . THR A 1 21 ? 3.634  -0.451  -2.999  1.00 0.00 ? 21 THR A HB   9  
ATOM 10045 H HG1  . THR A 1 21 ? 0.846  -1.079  -2.989  1.00 0.00 ? 21 THR A HG1  9  
ATOM 10046 H HG21 . THR A 1 21 ? 3.247  -2.814  -3.593  1.00 0.00 ? 21 THR A HG21 9  
ATOM 10047 H HG22 . THR A 1 21 ? 2.266  -2.998  -2.144  1.00 0.00 ? 21 THR A HG22 9  
ATOM 10048 H HG23 . THR A 1 21 ? 3.991  -2.643  -2.001  1.00 0.00 ? 21 THR A HG23 9  
ATOM 10049 N N    . LEU A 1 22 ? 4.592  0.303   -0.246  1.00 0.00 ? 22 LEU A N    9  
ATOM 10050 C CA   . LEU A 1 22 ? 5.830  0.147   0.505   1.00 0.00 ? 22 LEU A CA   9  
ATOM 10051 C C    . LEU A 1 22 ? 5.659  0.741   1.890   1.00 0.00 ? 22 LEU A C    9  
ATOM 10052 O O    . LEU A 1 22 ? 5.792  1.950   2.096   1.00 0.00 ? 22 LEU A O    9  
ATOM 10053 C CB   . LEU A 1 22 ? 6.974  0.816   -0.243  1.00 0.00 ? 22 LEU A CB   9  
ATOM 10054 C CG   . LEU A 1 22 ? 8.358  0.179   -0.045  1.00 0.00 ? 22 LEU A CG   9  
ATOM 10055 C CD1  . LEU A 1 22 ? 9.346  0.739   -1.033  1.00 0.00 ? 22 LEU A CD1  9  
ATOM 10056 C CD2  . LEU A 1 22 ? 8.873  0.382   1.369   1.00 0.00 ? 22 LEU A CD2  9  
ATOM 10057 H H    . LEU A 1 22 ? 4.408  1.140   -0.713  1.00 0.00 ? 22 LEU A H    9  
ATOM 10058 H HA   . LEU A 1 22 ? 6.027  -0.897  0.592   1.00 0.00 ? 22 LEU A HA   9  
ATOM 10059 H HB2  . LEU A 1 22 ? 6.761  0.834   -1.293  1.00 0.00 ? 22 LEU A HB2  9  
ATOM 10060 H HB3  . LEU A 1 22 ? 7.050  1.848   0.110   1.00 0.00 ? 22 LEU A HB3  9  
ATOM 10061 H HG   . LEU A 1 22 ? 8.269  -0.890  -0.215  1.00 0.00 ? 22 LEU A HG   9  
ATOM 10062 H HD11 . LEU A 1 22 ? 9.029  0.506   -2.040  1.00 0.00 ? 22 LEU A HD11 9  
ATOM 10063 H HD12 . LEU A 1 22 ? 10.321 0.289   -0.867  1.00 0.00 ? 22 LEU A HD12 9  
ATOM 10064 H HD13 . LEU A 1 22 ? 9.405  1.805   -0.908  1.00 0.00 ? 22 LEU A HD13 9  
ATOM 10065 H HD21 . LEU A 1 22 ? 9.840  -0.067  1.478   1.00 0.00 ? 22 LEU A HD21 9  
ATOM 10066 H HD22 . LEU A 1 22 ? 8.174  -0.069  2.072   1.00 0.00 ? 22 LEU A HD22 9  
ATOM 10067 H HD23 . LEU A 1 22 ? 8.935  1.437   1.576   1.00 0.00 ? 22 LEU A HD23 9  
ATOM 10068 N N    . GLN A 1 23 ? 5.324  -0.115  2.841   1.00 0.00 ? 23 GLN A N    9  
ATOM 10069 C CA   . GLN A 1 23 ? 5.105  0.303   4.222   1.00 0.00 ? 23 GLN A CA   9  
ATOM 10070 C C    . GLN A 1 23 ? 6.403  0.193   5.030   1.00 0.00 ? 23 GLN A C    9  
ATOM 10071 O O    . GLN A 1 23 ? 7.321  -0.539  4.659   1.00 0.00 ? 23 GLN A O    9  
ATOM 10072 C CB   . GLN A 1 23 ? 4.029  -0.589  4.869   1.00 0.00 ? 23 GLN A CB   9  
ATOM 10073 C CG   . GLN A 1 23 ? 4.359  -2.064  4.825   1.00 0.00 ? 23 GLN A CG   9  
ATOM 10074 C CD   . GLN A 1 23 ? 3.324  -2.921  5.530   1.00 0.00 ? 23 GLN A CD   9  
ATOM 10075 O OE1  . GLN A 1 23 ? 3.094  -4.069  5.149   1.00 0.00 ? 23 GLN A OE1  9  
ATOM 10076 N NE2  . GLN A 1 23 ? 2.683  -2.364  6.543   1.00 0.00 ? 23 GLN A NE2  9  
ATOM 10077 H H    . GLN A 1 23 ? 5.213  -1.066  2.620   1.00 0.00 ? 23 GLN A H    9  
ATOM 10078 H HA   . GLN A 1 23 ? 4.765  1.320   4.230   1.00 0.00 ? 23 GLN A HA   9  
ATOM 10079 H HB2  . GLN A 1 23 ? 3.923  -0.289  5.886   1.00 0.00 ? 23 GLN A HB2  9  
ATOM 10080 H HB3  . GLN A 1 23 ? 3.089  -0.435  4.351   1.00 0.00 ? 23 GLN A HB3  9  
ATOM 10081 H HG2  . GLN A 1 23 ? 4.423  -2.375  3.799   1.00 0.00 ? 23 GLN A HG2  9  
ATOM 10082 H HG3  . GLN A 1 23 ? 5.318  -2.212  5.317   1.00 0.00 ? 23 GLN A HG3  9  
ATOM 10083 H HE21 . GLN A 1 23 ? 2.924  -1.454  6.805   1.00 0.00 ? 23 GLN A HE21 9  
ATOM 10084 H HE22 . GLN A 1 23 ? 1.982  -2.895  7.011   1.00 0.00 ? 23 GLN A HE22 9  
ATOM 10085 N N    . PRO A 1 24 ? 6.490  0.934   6.143   1.00 0.00 ? 24 PRO A N    9  
ATOM 10086 C CA   . PRO A 1 24 ? 7.627  0.855   7.070   1.00 0.00 ? 24 PRO A CA   9  
ATOM 10087 C C    . PRO A 1 24 ? 7.923  -0.590  7.475   1.00 0.00 ? 24 PRO A C    9  
ATOM 10088 O O    . PRO A 1 24 ? 7.048  -1.295  8.000   1.00 0.00 ? 24 PRO A O    9  
ATOM 10089 C CB   . PRO A 1 24 ? 7.189  1.667   8.277   1.00 0.00 ? 24 PRO A CB   9  
ATOM 10090 C CG   . PRO A 1 24 ? 6.177  2.628   7.749   1.00 0.00 ? 24 PRO A CG   9  
ATOM 10091 C CD   . PRO A 1 24 ? 5.501  1.919   6.587   1.00 0.00 ? 24 PRO A CD   9  
ATOM 10092 H HA   . PRO A 1 24 ? 8.524  1.278   6.639   1.00 0.00 ? 24 PRO A HA   9  
ATOM 10093 H HB2  . PRO A 1 24 ? 6.744  1.012   9.021   1.00 0.00 ? 24 PRO A HB2  9  
ATOM 10094 H HB3  . PRO A 1 24 ? 8.049  2.185   8.700   1.00 0.00 ? 24 PRO A HB3  9  
ATOM 10095 H HG2  . PRO A 1 24 ? 5.455  2.852   8.513   1.00 0.00 ? 24 PRO A HG2  9  
ATOM 10096 H HG3  . PRO A 1 24 ? 6.656  3.524   7.409   1.00 0.00 ? 24 PRO A HG3  9  
ATOM 10097 H HD2  . PRO A 1 24 ? 4.594  1.443   6.917   1.00 0.00 ? 24 PRO A HD2  9  
ATOM 10098 H HD3  . PRO A 1 24 ? 5.283  2.635   5.803   1.00 0.00 ? 24 PRO A HD3  9  
ATOM 10099 N N    . GLY A 1 25 ? 9.149  -1.036  7.237   1.00 0.00 ? 25 GLY A N    9  
ATOM 10100 C CA   . GLY A 1 25 ? 9.497  -2.411  7.507   1.00 0.00 ? 25 GLY A CA   9  
ATOM 10101 C C    . GLY A 1 25 ? 9.879  -3.137  6.235   1.00 0.00 ? 25 GLY A C    9  
ATOM 10102 O O    . GLY A 1 25 ? 10.655 -4.098  6.260   1.00 0.00 ? 25 GLY A O    9  
ATOM 10103 H H    . GLY A 1 25 ? 9.818  -0.423  6.864   1.00 0.00 ? 25 GLY A H    9  
ATOM 10104 H HA2  . GLY A 1 25 ? 10.337 -2.435  8.197   1.00 0.00 ? 25 GLY A HA2  9  
ATOM 10105 H HA3  . GLY A 1 25 ? 8.658  -2.902  7.970   1.00 0.00 ? 25 GLY A HA3  9  
ATOM 10106 N N    . MET A 1 26 ? 9.335  -2.673  5.112   1.00 0.00 ? 26 MET A N    9  
ATOM 10107 C CA   . MET A 1 26 ? 9.645  -3.257  3.817   1.00 0.00 ? 26 MET A CA   9  
ATOM 10108 C C    . MET A 1 26 ? 11.046 -2.888  3.352   1.00 0.00 ? 26 MET A C    9  
ATOM 10109 O O    . MET A 1 26 ? 11.475 -1.744  3.510   1.00 0.00 ? 26 MET A O    9  
ATOM 10110 C CB   . MET A 1 26 ? 8.639  -2.824  2.758   1.00 0.00 ? 26 MET A CB   9  
ATOM 10111 C CG   . MET A 1 26 ? 7.229  -3.313  3.015   1.00 0.00 ? 26 MET A CG   9  
ATOM 10112 S SD   . MET A 1 26 ? 7.121  -5.097  3.170   1.00 0.00 ? 26 MET A SD   9  
ATOM 10113 C CE   . MET A 1 26 ? 5.355  -5.340  3.031   1.00 0.00 ? 26 MET A CE   9  
ATOM 10114 H H    . MET A 1 26 ? 8.700  -1.925  5.170   1.00 0.00 ? 26 MET A H    9  
ATOM 10115 H HA   . MET A 1 26 ? 9.597  -4.334  3.928   1.00 0.00 ? 26 MET A HA   9  
ATOM 10116 H HB2  . MET A 1 26 ? 8.619  -1.745  2.712   1.00 0.00 ? 26 MET A HB2  9  
ATOM 10117 H HB3  . MET A 1 26 ? 8.947  -3.202  1.800   1.00 0.00 ? 26 MET A HB3  9  
ATOM 10118 H HG2  . MET A 1 26 ? 6.876  -2.853  3.914   1.00 0.00 ? 26 MET A HG2  9  
ATOM 10119 H HG3  . MET A 1 26 ? 6.604  -2.999  2.184   1.00 0.00 ? 26 MET A HG3  9  
ATOM 10120 H HE1  . MET A 1 26 ? 4.855  -4.836  3.847   1.00 0.00 ? 26 MET A HE1  9  
ATOM 10121 H HE2  . MET A 1 26 ? 5.136  -6.393  3.061   1.00 0.00 ? 26 MET A HE2  9  
ATOM 10122 H HE3  . MET A 1 26 ? 5.017  -4.926  2.087   1.00 0.00 ? 26 MET A HE3  9  
ATOM 10123 N N    . ARG A 1 27 ? 11.752 -3.868  2.798   1.00 0.00 ? 27 ARG A N    9  
ATOM 10124 C CA   . ARG A 1 27 ? 13.050 -3.635  2.189   1.00 0.00 ? 27 ARG A CA   9  
ATOM 10125 C C    . ARG A 1 27 ? 12.872 -2.952  0.830   1.00 0.00 ? 27 ARG A C    9  
ATOM 10126 O O    . ARG A 1 27 ? 11.883 -3.210  0.124   1.00 0.00 ? 27 ARG A O    9  
ATOM 10127 C CB   . ARG A 1 27 ? 13.802 -4.966  2.047   1.00 0.00 ? 27 ARG A CB   9  
ATOM 10128 C CG   . ARG A 1 27 ? 15.101 -4.846  1.290   1.00 0.00 ? 27 ARG A CG   9  
ATOM 10129 C CD   . ARG A 1 27 ? 15.881 -6.153  1.304   1.00 0.00 ? 27 ARG A CD   9  
ATOM 10130 N NE   . ARG A 1 27 ? 16.550 -6.379  2.590   1.00 0.00 ? 27 ARG A NE   9  
ATOM 10131 C CZ   . ARG A 1 27 ? 16.649 -7.555  3.185   1.00 0.00 ? 27 ARG A CZ   9  
ATOM 10132 N NH1  . ARG A 1 27 ? 16.108 -8.642  2.635   1.00 0.00 ? 27 ARG A NH1  9  
ATOM 10133 N NH2  . ARG A 1 27 ? 17.301 -7.652  4.341   1.00 0.00 ? 27 ARG A NH2  9  
ATOM 10134 H H    . ARG A 1 27 ? 11.387 -4.779  2.841   1.00 0.00 ? 27 ARG A H    9  
ATOM 10135 H HA   . ARG A 1 27 ? 13.601 -2.984  2.837   1.00 0.00 ? 27 ARG A HA   9  
ATOM 10136 H HB2  . ARG A 1 27 ? 14.009 -5.345  3.044   1.00 0.00 ? 27 ARG A HB2  9  
ATOM 10137 H HB3  . ARG A 1 27 ? 13.159 -5.666  1.535   1.00 0.00 ? 27 ARG A HB3  9  
ATOM 10138 H HG2  . ARG A 1 27 ? 14.878 -4.582  0.270   1.00 0.00 ? 27 ARG A HG2  9  
ATOM 10139 H HG3  . ARG A 1 27 ? 15.707 -4.070  1.751   1.00 0.00 ? 27 ARG A HG3  9  
ATOM 10140 H HD2  . ARG A 1 27 ? 15.190 -6.957  1.114   1.00 0.00 ? 27 ARG A HD2  9  
ATOM 10141 H HD3  . ARG A 1 27 ? 16.621 -6.107  0.530   1.00 0.00 ? 27 ARG A HD3  9  
ATOM 10142 H HE   . ARG A 1 27 ? 16.938 -5.589  3.031   1.00 0.00 ? 27 ARG A HE   9  
ATOM 10143 H HH11 . ARG A 1 27 ? 15.598 -8.562  1.772   1.00 0.00 ? 27 ARG A HH11 9  
ATOM 10144 H HH12 . ARG A 1 27 ? 16.220 -9.532  3.073   1.00 0.00 ? 27 ARG A HH12 9  
ATOM 10145 H HH21 . ARG A 1 27 ? 17.714 -6.833  4.768   1.00 0.00 ? 27 ARG A HH21 9  
ATOM 10146 H HH22 . ARG A 1 27 ? 17.381 -8.545  4.798   1.00 0.00 ? 27 ARG A HH22 9  
ATOM 10147 N N    . VAL A 1 28 ? 13.825 -2.113  0.468   1.00 0.00 ? 28 VAL A N    9  
ATOM 10148 C CA   . VAL A 1 28 ? 13.756 -1.344  -0.764  1.00 0.00 ? 28 VAL A CA   9  
ATOM 10149 C C    . VAL A 1 28 ? 14.982 -1.633  -1.636  1.00 0.00 ? 28 VAL A C    9  
ATOM 10150 O O    . VAL A 1 28 ? 16.011 -2.052  -1.121  1.00 0.00 ? 28 VAL A O    9  
ATOM 10151 C CB   . VAL A 1 28 ? 13.708 0.172   -0.492  1.00 0.00 ? 28 VAL A CB   9  
ATOM 10152 C CG1  . VAL A 1 28 ? 12.534 0.538   0.413   1.00 0.00 ? 28 VAL A CG1  9  
ATOM 10153 C CG2  . VAL A 1 28 ? 15.015 0.647   0.122   1.00 0.00 ? 28 VAL A CG2  9  
ATOM 10154 H H    . VAL A 1 28 ? 14.616 -2.018  1.035   1.00 0.00 ? 28 VAL A H    9  
ATOM 10155 H HA   . VAL A 1 28 ? 12.858 -1.641  -1.286  1.00 0.00 ? 28 VAL A HA   9  
ATOM 10156 H HB   . VAL A 1 28 ? 13.569 0.690   -1.439  1.00 0.00 ? 28 VAL A HB   9  
ATOM 10157 H HG11 . VAL A 1 28 ? 12.549 1.595   0.614   1.00 0.00 ? 28 VAL A HG11 9  
ATOM 10158 H HG12 . VAL A 1 28 ? 12.620 -0.021  1.337   1.00 0.00 ? 28 VAL A HG12 9  
ATOM 10159 H HG13 . VAL A 1 28 ? 11.610 0.280   -0.080  1.00 0.00 ? 28 VAL A HG13 9  
ATOM 10160 H HG21 . VAL A 1 28 ? 14.995 1.719   0.234   1.00 0.00 ? 28 VAL A HG21 9  
ATOM 10161 H HG22 . VAL A 1 28 ? 15.842 0.357   -0.521  1.00 0.00 ? 28 VAL A HG22 9  
ATOM 10162 H HG23 . VAL A 1 28 ? 15.132 0.193   1.080   1.00 0.00 ? 28 VAL A HG23 9  
ATOM 10163 N N    . ARG A 1 29 ? 14.851 -1.420  -2.932  1.00 0.00 ? 29 ARG A N    9  
ATOM 10164 C CA   . ARG A 1 29 ? 16.008 -1.475  -3.810  1.00 0.00 ? 29 ARG A CA   9  
ATOM 10165 C C    . ARG A 1 29 ? 16.110 -0.183  -4.628  1.00 0.00 ? 29 ARG A C    9  
ATOM 10166 O O    . ARG A 1 29 ? 15.100 0.379   -5.073  1.00 0.00 ? 29 ARG A O    9  
ATOM 10167 C CB   . ARG A 1 29 ? 15.945 -2.711  -4.718  1.00 0.00 ? 29 ARG A CB   9  
ATOM 10168 C CG   . ARG A 1 29 ? 17.073 -2.786  -5.735  1.00 0.00 ? 29 ARG A CG   9  
ATOM 10169 C CD   . ARG A 1 29 ? 17.259 -4.198  -6.282  1.00 0.00 ? 29 ARG A CD   9  
ATOM 10170 N NE   . ARG A 1 29 ? 15.997 -4.762  -6.764  1.00 0.00 ? 29 ARG A NE   9  
ATOM 10171 C CZ   . ARG A 1 29 ? 15.722 -6.070  -6.786  1.00 0.00 ? 29 ARG A CZ   9  
ATOM 10172 N NH1  . ARG A 1 29 ? 16.655 -6.959  -6.426  1.00 0.00 ? 29 ARG A NH1  9  
ATOM 10173 N NH2  . ARG A 1 29 ? 14.544 -6.499  -7.197  1.00 0.00 ? 29 ARG A NH2  9  
ATOM 10174 H H    . ARG A 1 29 ? 13.950 -1.272  -3.297  1.00 0.00 ? 29 ARG A H    9  
ATOM 10175 H HA   . ARG A 1 29 ? 16.889 -1.561  -3.192  1.00 0.00 ? 29 ARG A HA   9  
ATOM 10176 H HB2  . ARG A 1 29 ? 15.970 -3.607  -4.107  1.00 0.00 ? 29 ARG A HB2  9  
ATOM 10177 H HB3  . ARG A 1 29 ? 14.995 -2.693  -5.258  1.00 0.00 ? 29 ARG A HB3  9  
ATOM 10178 H HG2  . ARG A 1 29 ? 16.869 -2.118  -6.549  1.00 0.00 ? 29 ARG A HG2  9  
ATOM 10179 H HG3  . ARG A 1 29 ? 17.990 -2.484  -5.252  1.00 0.00 ? 29 ARG A HG3  9  
ATOM 10180 H HD2  . ARG A 1 29 ? 17.959 -4.149  -7.106  1.00 0.00 ? 29 ARG A HD2  9  
ATOM 10181 H HD3  . ARG A 1 29 ? 17.650 -4.826  -5.507  1.00 0.00 ? 29 ARG A HD3  9  
ATOM 10182 H HE   . ARG A 1 29 ? 15.307 -4.119  -7.075  1.00 0.00 ? 29 ARG A HE   9  
ATOM 10183 H HH11 . ARG A 1 29 ? 17.572 -6.639  -6.144  1.00 0.00 ? 29 ARG A HH11 9  
ATOM 10184 H HH12 . ARG A 1 29 ? 16.445 -7.927  -6.429  1.00 0.00 ? 29 ARG A HH12 9  
ATOM 10185 H HH21 . ARG A 1 29 ? 13.845 -5.839  -7.502  1.00 0.00 ? 29 ARG A HH21 9  
ATOM 10186 H HH22 . ARG A 1 29 ? 14.336 -7.486  -7.196  1.00 0.00 ? 29 ARG A HH22 9  
ATOM 10187 N N    . MET A 1 30 ? 17.342 0.297   -4.790  1.00 0.00 ? 30 MET A N    9  
ATOM 10188 C CA   . MET A 1 30 ? 17.612 1.537   -5.485  1.00 0.00 ? 30 MET A CA   9  
ATOM 10189 C C    . MET A 1 30 ? 17.707 1.313   -6.982  1.00 0.00 ? 30 MET A C    9  
ATOM 10190 O O    . MET A 1 30 ? 18.515 0.512   -7.445  1.00 0.00 ? 30 MET A O    9  
ATOM 10191 C CB   . MET A 1 30 ? 18.905 2.170   -4.961  1.00 0.00 ? 30 MET A CB   9  
ATOM 10192 C CG   . MET A 1 30 ? 19.128 3.601   -5.398  1.00 0.00 ? 30 MET A CG   9  
ATOM 10193 S SD   . MET A 1 30 ? 17.803 4.691   -4.841  1.00 0.00 ? 30 MET A SD   9  
ATOM 10194 C CE   . MET A 1 30 ? 18.383 6.260   -5.458  1.00 0.00 ? 30 MET A CE   9  
ATOM 10195 H H    . MET A 1 30 ? 18.100 -0.216  -4.418  1.00 0.00 ? 30 MET A H    9  
ATOM 10196 H HA   . MET A 1 30 ? 16.789 2.217   -5.302  1.00 0.00 ? 30 MET A HA   9  
ATOM 10197 H HB2  . MET A 1 30 ? 18.885 2.156   -3.879  1.00 0.00 ? 30 MET A HB2  9  
ATOM 10198 H HB3  . MET A 1 30 ? 19.739 1.566   -5.308  1.00 0.00 ? 30 MET A HB3  9  
ATOM 10199 H HG2  . MET A 1 30 ? 20.061 3.947   -4.988  1.00 0.00 ? 30 MET A HG2  9  
ATOM 10200 H HG3  . MET A 1 30 ? 19.170 3.634   -6.475  1.00 0.00 ? 30 MET A HG3  9  
ATOM 10201 H HE1  . MET A 1 30 ? 17.658 7.033   -5.216  1.00 0.00 ? 30 MET A HE1  9  
ATOM 10202 H HE2  . MET A 1 30 ? 18.499 6.203   -6.526  1.00 0.00 ? 30 MET A HE2  9  
ATOM 10203 H HE3  . MET A 1 30 ? 19.332 6.497   -5.007  1.00 0.00 ? 30 MET A HE3  9  
ATOM 10204 N N    . LEU A 1 31 ? 16.873 2.022   -7.737  1.00 0.00 ? 31 LEU A N    9  
ATOM 10205 C CA   . LEU A 1 31 ? 16.796 1.836   -9.180  1.00 0.00 ? 31 LEU A CA   9  
ATOM 10206 C C    . LEU A 1 31 ? 17.928 2.541   -9.913  1.00 0.00 ? 31 LEU A C    9  
ATOM 10207 O O    . LEU A 1 31 ? 18.486 2.001   -10.883 1.00 0.00 ? 31 LEU A O    9  
ATOM 10208 C CB   . LEU A 1 31 ? 15.464 2.376   -9.694  1.00 0.00 ? 31 LEU A CB   9  
ATOM 10209 C CG   . LEU A 1 31 ? 14.229 1.786   -9.032  1.00 0.00 ? 31 LEU A CG   9  
ATOM 10210 C CD1  . LEU A 1 31 ? 12.965 2.437   -9.582  1.00 0.00 ? 31 LEU A CD1  9  
ATOM 10211 C CD2  . LEU A 1 31 ? 14.177 0.278   -9.207  1.00 0.00 ? 31 LEU A CD2  9  
ATOM 10212 H H    . LEU A 1 31 ? 16.269 2.678   -7.318  1.00 0.00 ? 31 LEU A H    9  
ATOM 10213 H HA   . LEU A 1 31 ? 16.848 0.783   -9.389  1.00 0.00 ? 31 LEU A HA   9  
ATOM 10214 H HB2  . LEU A 1 31 ? 15.448 3.442   -9.541  1.00 0.00 ? 31 LEU A HB2  9  
ATOM 10215 H HB3  . LEU A 1 31 ? 15.415 2.173   -10.757 1.00 0.00 ? 31 LEU A HB3  9  
ATOM 10216 H HG   . LEU A 1 31 ? 14.262 2.003   -7.972  1.00 0.00 ? 31 LEU A HG   9  
ATOM 10217 H HD11 . LEU A 1 31 ? 12.108 2.002   -9.114  1.00 0.00 ? 31 LEU A HD11 9  
ATOM 10218 H HD12 . LEU A 1 31 ? 12.913 2.258   -10.661 1.00 0.00 ? 31 LEU A HD12 9  
ATOM 10219 H HD13 . LEU A 1 31 ? 13.006 3.491   -9.393  1.00 0.00 ? 31 LEU A HD13 9  
ATOM 10220 H HD21 . LEU A 1 31 ? 14.162 0.038   -10.260 1.00 0.00 ? 31 LEU A HD21 9  
ATOM 10221 H HD22 . LEU A 1 31 ? 13.281 -0.114  -8.727  1.00 0.00 ? 31 LEU A HD22 9  
ATOM 10222 H HD23 . LEU A 1 31 ? 15.053 -0.164  -8.750  1.00 0.00 ? 31 LEU A HD23 9  
ATOM 10223 N N    . ASP A 1 32 ? 18.275 3.734   -9.457  1.00 0.00 ? 32 ASP A N    9  
ATOM 10224 C CA   . ASP A 1 32 ? 19.241 4.564   -10.154 1.00 0.00 ? 32 ASP A CA   9  
ATOM 10225 C C    . ASP A 1 32 ? 20.337 5.064   -9.209  1.00 0.00 ? 32 ASP A C    9  
ATOM 10226 O O    . ASP A 1 32 ? 20.155 5.053   -7.985  1.00 0.00 ? 32 ASP A O    9  
ATOM 10227 C CB   . ASP A 1 32 ? 18.510 5.737   -10.811 1.00 0.00 ? 32 ASP A CB   9  
ATOM 10228 C CG   . ASP A 1 32 ? 19.409 6.605   -11.685 1.00 0.00 ? 32 ASP A CG   9  
ATOM 10229 O OD1  . ASP A 1 32 ? 20.391 6.083   -12.246 1.00 0.00 ? 32 ASP A OD1  9  
ATOM 10230 O OD2  . ASP A 1 32 ? 19.122 7.804   -11.838 1.00 0.00 ? 32 ASP A OD2  9  
ATOM 10231 H H    . ASP A 1 32 ? 17.872 4.058   -8.619  1.00 0.00 ? 32 ASP A H    9  
ATOM 10232 H HA   . ASP A 1 32 ? 19.681 3.966   -10.934 1.00 0.00 ? 32 ASP A HA   9  
ATOM 10233 H HB2  . ASP A 1 32 ? 17.707 5.359   -11.427 1.00 0.00 ? 32 ASP A HB2  9  
ATOM 10234 H HB3  . ASP A 1 32 ? 18.095 6.361   -10.031 1.00 0.00 ? 32 ASP A HB3  9  
ATOM 10235 N N    . ASP A 1 33 ? 21.459 5.464   -9.772  1.00 0.00 ? 33 ASP A N    9  
ATOM 10236 C CA   . ASP A 1 33 ? 22.584 5.963   -8.993  1.00 0.00 ? 33 ASP A CA   9  
ATOM 10237 C C    . ASP A 1 33 ? 22.318 7.415   -8.577  1.00 0.00 ? 33 ASP A C    9  
ATOM 10238 O O    . ASP A 1 33 ? 22.065 8.256   -9.441  1.00 0.00 ? 33 ASP A O    9  
ATOM 10239 C CB   . ASP A 1 33 ? 23.874 5.885   -9.810  1.00 0.00 ? 33 ASP A CB   9  
ATOM 10240 C CG   . ASP A 1 33 ? 24.157 4.498   -10.356 1.00 0.00 ? 33 ASP A CG   9  
ATOM 10241 O OD1  . ASP A 1 33 ? 24.737 3.683   -9.615  1.00 0.00 ? 33 ASP A OD1  9  
ATOM 10242 O OD2  . ASP A 1 33 ? 23.809 4.217   -11.525 1.00 0.00 ? 33 ASP A OD2  9  
ATOM 10243 H H    . ASP A 1 33 ? 21.545 5.485   -10.752 1.00 0.00 ? 33 ASP A H    9  
ATOM 10244 H HA   . ASP A 1 33 ? 22.682 5.345   -8.108  1.00 0.00 ? 33 ASP A HA   9  
ATOM 10245 H HB2  . ASP A 1 33 ? 23.785 6.557   -10.664 1.00 0.00 ? 33 ASP A HB2  9  
ATOM 10246 H HB3  . ASP A 1 33 ? 24.701 6.186   -9.197  1.00 0.00 ? 33 ASP A HB3  9  
ATOM 10247 N N    . TYR A 1 34 ? 22.389 7.696   -7.298  1.00 0.00 ? 34 TYR A N    9  
ATOM 10248 C CA   . TYR A 1 34 ? 21.924 8.989   -6.816  1.00 0.00 ? 34 TYR A CA   9  
ATOM 10249 C C    . TYR A 1 34 ? 22.668 9.442   -5.560  1.00 0.00 ? 34 TYR A C    9  
ATOM 10250 O O    . TYR A 1 34 ? 22.407 8.963   -4.464  1.00 0.00 ? 34 TYR A O    9  
ATOM 10251 C CB   . TYR A 1 34 ? 20.420 8.916   -6.547  1.00 0.00 ? 34 TYR A CB   9  
ATOM 10252 C CG   . TYR A 1 34 ? 19.819 10.192  -6.020  1.00 0.00 ? 34 TYR A CG   9  
ATOM 10253 C CD1  . TYR A 1 34 ? 19.592 11.268  -6.861  1.00 0.00 ? 34 TYR A CD1  9  
ATOM 10254 C CD2  . TYR A 1 34 ? 19.479 10.324  -4.695  1.00 0.00 ? 34 TYR A CD2  9  
ATOM 10255 C CE1  . TYR A 1 34 ? 19.039 12.429  -6.374  1.00 0.00 ? 34 TYR A CE1  9  
ATOM 10256 C CE2  . TYR A 1 34 ? 18.928 11.486  -4.184  1.00 0.00 ? 34 TYR A CE2  9  
ATOM 10257 C CZ   . TYR A 1 34 ? 18.711 12.539  -5.063  1.00 0.00 ? 34 TYR A CZ   9  
ATOM 10258 O OH   . TYR A 1 34 ? 18.172 13.706  -4.568  1.00 0.00 ? 34 TYR A OH   9  
ATOM 10259 H H    . TYR A 1 34 ? 22.766 7.045   -6.668  1.00 0.00 ? 34 TYR A H    9  
ATOM 10260 H HA   . TYR A 1 34 ? 22.103 9.704   -7.598  1.00 0.00 ? 34 TYR A HA   9  
ATOM 10261 H HB2  . TYR A 1 34 ? 19.903 8.667   -7.472  1.00 0.00 ? 34 TYR A HB2  9  
ATOM 10262 H HB3  . TYR A 1 34 ? 20.232 8.136   -5.821  1.00 0.00 ? 34 TYR A HB3  9  
ATOM 10263 H HD1  . TYR A 1 34 ? 19.850 11.175  -7.901  1.00 0.00 ? 34 TYR A HD1  9  
ATOM 10264 H HD2  . TYR A 1 34 ? 19.653 9.489   -4.016  1.00 0.00 ? 34 TYR A HD2  9  
ATOM 10265 H HE1  . TYR A 1 34 ? 18.860 13.246  -7.064  1.00 0.00 ? 34 TYR A HE1  9  
ATOM 10266 H HE2  . TYR A 1 34 ? 18.666 11.574  -3.146  1.00 0.00 ? 34 TYR A HE2  9  
ATOM 10267 H HH   . TYR A 1 34 ? 18.566 13.907  -3.706  1.00 0.00 ? 34 TYR A HH   9  
ATOM 10268 N N    . GLU A 1 35 ? 23.633 10.347  -5.764  1.00 0.00 ? 35 GLU A N    9  
ATOM 10269 C CA   . GLU A 1 35 ? 24.238 11.166  -4.691  1.00 0.00 ? 35 GLU A CA   9  
ATOM 10270 C C    . GLU A 1 35 ? 25.113 10.380  -3.699  1.00 0.00 ? 35 GLU A C    9  
ATOM 10271 O O    . GLU A 1 35 ? 26.057 10.944  -3.147  1.00 0.00 ? 35 GLU A O    9  
ATOM 10272 C CB   . GLU A 1 35 ? 23.151 11.913  -3.921  1.00 0.00 ? 35 GLU A CB   9  
ATOM 10273 C CG   . GLU A 1 35 ? 22.290 12.820  -4.789  1.00 0.00 ? 35 GLU A CG   9  
ATOM 10274 C CD   . GLU A 1 35 ? 23.084 13.886  -5.505  1.00 0.00 ? 35 GLU A CD   9  
ATOM 10275 O OE1  . GLU A 1 35 ? 23.464 14.875  -4.846  1.00 0.00 ? 35 GLU A OE1  9  
ATOM 10276 O OE2  . GLU A 1 35 ? 23.331 13.736  -6.718  1.00 0.00 ? 35 GLU A OE2  9  
ATOM 10277 H H    . GLU A 1 35 ? 23.959 10.483  -6.683  1.00 0.00 ? 35 GLU A H    9  
ATOM 10278 H HA   . GLU A 1 35 ? 24.868 11.909  -5.180  1.00 0.00 ? 35 GLU A HA   9  
ATOM 10279 H HB2  . GLU A 1 35 ? 22.496 11.195  -3.450  1.00 0.00 ? 35 GLU A HB2  9  
ATOM 10280 H HB3  . GLU A 1 35 ? 23.613 12.517  -3.160  1.00 0.00 ? 35 GLU A HB3  9  
ATOM 10281 H HG2  . GLU A 1 35 ? 21.799 12.213  -5.533  1.00 0.00 ? 35 GLU A HG2  9  
ATOM 10282 H HG3  . GLU A 1 35 ? 21.545 13.297  -4.175  1.00 0.00 ? 35 GLU A HG3  9  
ATOM 10283 N N    . GLU A 1 36 ? 24.837 9.104   -3.549  1.00 0.00 ? 36 GLU A N    9  
ATOM 10284 C CA   . GLU A 1 36 ? 25.425 8.290   -2.480  1.00 0.00 ? 36 GLU A CA   9  
ATOM 10285 C C    . GLU A 1 36 ? 25.164 6.816   -2.750  1.00 0.00 ? 36 GLU A C    9  
ATOM 10286 O O    . GLU A 1 36 ? 26.026 5.964   -2.545  1.00 0.00 ? 36 GLU A O    9  
ATOM 10287 C CB   . GLU A 1 36 ? 24.825 8.628   -1.103  1.00 0.00 ? 36 GLU A CB   9  
ATOM 10288 C CG   . GLU A 1 36 ? 25.287 9.952   -0.487  1.00 0.00 ? 36 GLU A CG   9  
ATOM 10289 C CD   . GLU A 1 36 ? 26.779 9.992   -0.221  1.00 0.00 ? 36 GLU A CD   9  
ATOM 10290 O OE1  . GLU A 1 36 ? 27.407 8.920   -0.093  1.00 0.00 ? 36 GLU A OE1  9  
ATOM 10291 O OE2  . GLU A 1 36 ? 27.326 11.102  -0.122  1.00 0.00 ? 36 GLU A OE2  9  
ATOM 10292 H H    . GLU A 1 36 ? 24.288 8.675   -4.227  1.00 0.00 ? 36 GLU A H    9  
ATOM 10293 H HA   . GLU A 1 36 ? 26.488 8.455   -2.462  1.00 0.00 ? 36 GLU A HA   9  
ATOM 10294 H HB2  . GLU A 1 36 ? 23.753 8.669   -1.206  1.00 0.00 ? 36 GLU A HB2  9  
ATOM 10295 H HB3  . GLU A 1 36 ? 25.075 7.833   -0.400  1.00 0.00 ? 36 GLU A HB3  9  
ATOM 10296 H HG2  . GLU A 1 36 ? 25.035 10.749  -1.164  1.00 0.00 ? 36 GLU A HG2  9  
ATOM 10297 H HG3  . GLU A 1 36 ? 24.772 10.105  0.457   1.00 0.00 ? 36 GLU A HG3  9  
ATOM 10298 N N    . ILE A 1 37 ? 23.967 6.566   -3.215  1.00 0.00 ? 37 ILE A N    9  
ATOM 10299 C CA   . ILE A 1 37 ? 23.506 5.199   -3.430  1.00 0.00 ? 37 ILE A CA   9  
ATOM 10300 C C    . ILE A 1 37 ? 23.601 4.886   -4.908  1.00 0.00 ? 37 ILE A C    9  
ATOM 10301 O O    . ILE A 1 37 ? 23.532 5.786   -5.741  1.00 0.00 ? 37 ILE A O    9  
ATOM 10302 C CB   . ILE A 1 37 ? 22.063 5.013   -2.932  1.00 0.00 ? 37 ILE A CB   9  
ATOM 10303 C CG1  . ILE A 1 37 ? 21.920 5.577   -1.521  1.00 0.00 ? 37 ILE A CG1  9  
ATOM 10304 C CG2  . ILE A 1 37 ? 21.669 3.547   -2.946  1.00 0.00 ? 37 ILE A CG2  9  
ATOM 10305 C CD1  . ILE A 1 37 ? 22.844 4.941   -0.492  1.00 0.00 ? 37 ILE A CD1  9  
ATOM 10306 H H    . ILE A 1 37 ? 23.385 7.310   -3.457  1.00 0.00 ? 37 ILE A H    9  
ATOM 10307 H HA   . ILE A 1 37 ? 24.161 4.535   -2.873  1.00 0.00 ? 37 ILE A HA   9  
ATOM 10308 H HB   . ILE A 1 37 ? 21.407 5.537   -3.600  1.00 0.00 ? 37 ILE A HB   9  
ATOM 10309 H HG12 . ILE A 1 37 ? 22.130 6.639   -1.542  1.00 0.00 ? 37 ILE A HG12 9  
ATOM 10310 H HG13 . ILE A 1 37 ? 20.893 5.437   -1.171  1.00 0.00 ? 37 ILE A HG13 9  
ATOM 10311 H HG21 . ILE A 1 37 ? 20.644 3.460   -2.593  1.00 0.00 ? 37 ILE A HG21 9  
ATOM 10312 H HG22 . ILE A 1 37 ? 22.325 2.997   -2.296  1.00 0.00 ? 37 ILE A HG22 9  
ATOM 10313 H HG23 . ILE A 1 37 ? 21.736 3.158   -3.954  1.00 0.00 ? 37 ILE A HG23 9  
ATOM 10314 H HD11 . ILE A 1 37 ? 22.632 5.354   0.482   1.00 0.00 ? 37 ILE A HD11 9  
ATOM 10315 H HD12 . ILE A 1 37 ? 23.868 5.141   -0.760  1.00 0.00 ? 37 ILE A HD12 9  
ATOM 10316 H HD13 . ILE A 1 37 ? 22.668 3.866   -0.471  1.00 0.00 ? 37 ILE A HD13 9  
ATOM 10317 N N    . SER A 1 38 ? 23.762 3.616   -5.234  1.00 0.00 ? 38 SER A N    9  
ATOM 10318 C CA   . SER A 1 38 ? 23.922 3.215   -6.619  1.00 0.00 ? 38 SER A CA   9  
ATOM 10319 C C    . SER A 1 38 ? 22.830 2.243   -7.014  1.00 0.00 ? 38 SER A C    9  
ATOM 10320 O O    . SER A 1 38 ? 22.125 1.711   -6.154  1.00 0.00 ? 38 SER A O    9  
ATOM 10321 C CB   . SER A 1 38 ? 25.315 2.606   -6.837  1.00 0.00 ? 38 SER A CB   9  
ATOM 10322 O OG   . SER A 1 38 ? 25.814 1.996   -5.648  1.00 0.00 ? 38 SER A OG   9  
ATOM 10323 H H    . SER A 1 38 ? 23.731 2.928   -4.531  1.00 0.00 ? 38 SER A H    9  
ATOM 10324 H HA   . SER A 1 38 ? 23.827 4.102   -7.231  1.00 0.00 ? 38 SER A HA   9  
ATOM 10325 H HB2  . SER A 1 38 ? 25.258 1.847   -7.610  1.00 0.00 ? 38 SER A HB2  9  
ATOM 10326 H HB3  . SER A 1 38 ? 25.994 3.380   -7.142  1.00 0.00 ? 38 SER A HB3  9  
ATOM 10327 H HG   . SER A 1 38 ? 25.116 1.433   -5.247  1.00 0.00 ? 38 SER A HG   9  
ATOM 10328 N N    . ALA A 1 39 ? 22.650 2.035   -8.318  1.00 0.00 ? 39 ALA A N    9  
ATOM 10329 C CA   . ALA A 1 39 ? 21.656 1.118   -8.814  1.00 0.00 ? 39 ALA A CA   9  
ATOM 10330 C C    . ALA A 1 39 ? 21.973 -0.300  -8.350  1.00 0.00 ? 39 ALA A C    9  
ATOM 10331 O O    . ALA A 1 39 ? 23.107 -0.762  -8.485  1.00 0.00 ? 39 ALA A O    9  
ATOM 10332 C CB   . ALA A 1 39 ? 21.601 1.172   -10.324 1.00 0.00 ? 39 ALA A CB   9  
ATOM 10333 H H    . ALA A 1 39 ? 23.215 2.526   -8.951  1.00 0.00 ? 39 ALA A H    9  
ATOM 10334 H HA   . ALA A 1 39 ? 20.701 1.417   -8.429  1.00 0.00 ? 39 ALA A HA   9  
ATOM 10335 H HB1  . ALA A 1 39 ? 21.372 2.183   -10.629 1.00 0.00 ? 39 ALA A HB1  9  
ATOM 10336 H HB2  . ALA A 1 39 ? 20.827 0.499   -10.679 1.00 0.00 ? 39 ALA A HB2  9  
ATOM 10337 H HB3  . ALA A 1 39 ? 22.556 0.875   -10.741 1.00 0.00 ? 39 ALA A HB3  9  
ATOM 10338 N N    . GLY A 1 40 ? 20.986 -0.973  -7.796  1.00 0.00 ? 40 GLY A N    9  
ATOM 10339 C CA   . GLY A 1 40 ? 21.195 -2.333  -7.341  1.00 0.00 ? 40 GLY A CA   9  
ATOM 10340 C C    . GLY A 1 40 ? 21.279 -2.434  -5.819  1.00 0.00 ? 40 GLY A C    9  
ATOM 10341 O O    . GLY A 1 40 ? 21.118 -3.514  -5.265  1.00 0.00 ? 40 GLY A O    9  
ATOM 10342 H H    . GLY A 1 40 ? 20.095 -0.565  -7.714  1.00 0.00 ? 40 GLY A H    9  
ATOM 10343 H HA2  . GLY A 1 40 ? 20.371 -2.945  -7.677  1.00 0.00 ? 40 GLY A HA2  9  
ATOM 10344 H HA3  . GLY A 1 40 ? 22.110 -2.701  -7.761  1.00 0.00 ? 40 GLY A HA3  9  
ATOM 10345 N N    . ASP A 1 41 ? 21.507 -1.303  -5.161  1.00 0.00 ? 41 ASP A N    9  
ATOM 10346 C CA   . ASP A 1 41 ? 21.615 -1.281  -3.711  1.00 0.00 ? 41 ASP A CA   9  
ATOM 10347 C C    . ASP A 1 41 ? 20.249 -1.496  -3.074  1.00 0.00 ? 41 ASP A C    9  
ATOM 10348 O O    . ASP A 1 41 ? 19.215 -1.233  -3.674  1.00 0.00 ? 41 ASP A O    9  
ATOM 10349 C CB   . ASP A 1 41 ? 22.220 0.036   -3.229  1.00 0.00 ? 41 ASP A CB   9  
ATOM 10350 C CG   . ASP A 1 41 ? 23.729 0.064   -3.369  1.00 0.00 ? 41 ASP A CG   9  
ATOM 10351 O OD1  . ASP A 1 41 ? 24.218 0.454   -4.442  1.00 0.00 ? 41 ASP A OD1  9  
ATOM 10352 O OD2  . ASP A 1 41 ? 24.419 -0.298  -2.402  1.00 0.00 ? 41 ASP A OD2  9  
ATOM 10353 H H    . ASP A 1 41 ? 21.598 -0.473  -5.658  1.00 0.00 ? 41 ASP A H    9  
ATOM 10354 H HA   . ASP A 1 41 ? 22.260 -2.079  -3.437  1.00 0.00 ? 41 ASP A HA   9  
ATOM 10355 H HB2  . ASP A 1 41 ? 21.807 0.857   -3.785  1.00 0.00 ? 41 ASP A HB2  9  
ATOM 10356 H HB3  . ASP A 1 41 ? 21.969 0.177   -2.178  1.00 0.00 ? 41 ASP A HB3  9  
ATOM 10357 N N    . GLU A 1 42 ? 20.268 -1.998  -1.844  1.00 0.00 ? 42 GLU A N    9  
ATOM 10358 C CA   . GLU A 1 42 ? 19.026 -2.262  -1.129  1.00 0.00 ? 42 GLU A CA   9  
ATOM 10359 C C    . GLU A 1 42 ? 19.118 -1.822  0.316   1.00 0.00 ? 42 GLU A C    9  
ATOM 10360 O O    . GLU A 1 42 ? 20.213 -1.639  0.865   1.00 0.00 ? 42 GLU A O    9  
ATOM 10361 C CB   . GLU A 1 42 ? 18.647 -3.733  -1.219  1.00 0.00 ? 42 GLU A CB   9  
ATOM 10362 C CG   . GLU A 1 42 ? 19.745 -4.654  -0.734  1.00 0.00 ? 42 GLU A CG   9  
ATOM 10363 C CD   . GLU A 1 42 ? 19.486 -6.101  -1.103  1.00 0.00 ? 42 GLU A CD   9  
ATOM 10364 O OE1  . GLU A 1 42 ? 19.668 -6.459  -2.281  1.00 0.00 ? 42 GLU A OE1  9  
ATOM 10365 O OE2  . GLU A 1 42 ? 19.093 -6.891  -0.225  1.00 0.00 ? 42 GLU A OE2  9  
ATOM 10366 H H    . GLU A 1 42 ? 21.136 -2.174  -1.412  1.00 0.00 ? 42 GLU A H    9  
ATOM 10367 H HA   . GLU A 1 42 ? 18.254 -1.680  -1.609  1.00 0.00 ? 42 GLU A HA   9  
ATOM 10368 H HB2  . GLU A 1 42 ? 17.767 -3.907  -0.615  1.00 0.00 ? 42 GLU A HB2  9  
ATOM 10369 H HB3  . GLU A 1 42 ? 18.423 -3.989  -2.243  1.00 0.00 ? 42 GLU A HB3  9  
ATOM 10370 H HG2  . GLU A 1 42 ? 20.674 -4.341  -1.178  1.00 0.00 ? 42 GLU A HG2  9  
ATOM 10371 H HG3  . GLU A 1 42 ? 19.811 -4.583  0.349   1.00 0.00 ? 42 GLU A HG3  9  
ATOM 10372 N N    . GLY A 1 43 ? 17.964 -1.637  0.916   1.00 0.00 ? 43 GLY A N    9  
ATOM 10373 C CA   . GLY A 1 43 ? 17.901 -1.165  2.278   1.00 0.00 ? 43 GLY A CA   9  
ATOM 10374 C C    . GLY A 1 43 ? 16.546 -1.433  2.892   1.00 0.00 ? 43 GLY A C    9  
ATOM 10375 O O    . GLY A 1 43 ? 15.729 -2.120  2.302   1.00 0.00 ? 43 GLY A O    9  
ATOM 10376 H H    . GLY A 1 43 ? 17.135 -1.836  0.436   1.00 0.00 ? 43 GLY A H    9  
ATOM 10377 H HA2  . GLY A 1 43 ? 18.659 -1.663  2.870   1.00 0.00 ? 43 GLY A HA2  9  
ATOM 10378 H HA3  . GLY A 1 43 ? 18.085 -0.107  2.294   1.00 0.00 ? 43 GLY A HA3  9  
ATOM 10379 N N    . GLU A 1 44 ? 16.288 -0.893  4.057   1.00 0.00 ? 44 GLU A N    9  
ATOM 10380 C CA   . GLU A 1 44 ? 15.029 -1.100  4.724   1.00 0.00 ? 44 GLU A CA   9  
ATOM 10381 C C    . GLU A 1 44 ? 14.329 0.237   4.939   1.00 0.00 ? 44 GLU A C    9  
ATOM 10382 O O    . GLU A 1 44 ? 14.964 1.242   5.272   1.00 0.00 ? 44 GLU A O    9  
ATOM 10383 C CB   . GLU A 1 44 ? 15.254 -1.811  6.056   1.00 0.00 ? 44 GLU A CB   9  
ATOM 10384 C CG   . GLU A 1 44 ? 13.982 -2.372  6.657   1.00 0.00 ? 44 GLU A CG   9  
ATOM 10385 C CD   . GLU A 1 44 ? 14.227 -3.162  7.925   1.00 0.00 ? 44 GLU A CD   9  
ATOM 10386 O OE1  . GLU A 1 44 ? 14.574 -4.357  7.821   1.00 0.00 ? 44 GLU A OE1  9  
ATOM 10387 O OE2  . GLU A 1 44 ? 14.097 -2.582  9.026   1.00 0.00 ? 44 GLU A OE2  9  
ATOM 10388 H H    . GLU A 1 44 ? 16.963 -0.274  4.445   1.00 0.00 ? 44 GLU A H    9  
ATOM 10389 H HA   . GLU A 1 44 ? 14.417 -1.733  4.088   1.00 0.00 ? 44 GLU A HA   9  
ATOM 10390 H HB2  . GLU A 1 44 ? 15.957 -2.630  5.902   1.00 0.00 ? 44 GLU A HB2  9  
ATOM 10391 H HB3  . GLU A 1 44 ? 15.680 -1.108  6.757   1.00 0.00 ? 44 GLU A HB3  9  
ATOM 10392 H HG2  . GLU A 1 44 ? 13.305 -1.546  6.884   1.00 0.00 ? 44 GLU A HG2  9  
ATOM 10393 H HG3  . GLU A 1 44 ? 13.522 -3.025  5.931   1.00 0.00 ? 44 GLU A HG3  9  
ATOM 10394 N N    . PHE A 1 45 ? 13.015 0.255   4.766   1.00 0.00 ? 45 PHE A N    9  
ATOM 10395 C CA   . PHE A 1 45 ? 12.247 1.480   4.851   1.00 0.00 ? 45 PHE A CA   9  
ATOM 10396 C C    . PHE A 1 45 ? 11.873 1.715   6.313   1.00 0.00 ? 45 PHE A C    9  
ATOM 10397 O O    . PHE A 1 45 ? 11.231 0.869   6.940   1.00 0.00 ? 45 PHE A O    9  
ATOM 10398 C CB   . PHE A 1 45 ? 10.995 1.376   3.982   1.00 0.00 ? 45 PHE A CB   9  
ATOM 10399 C CG   . PHE A 1 45 ? 10.146 2.627   3.920   1.00 0.00 ? 45 PHE A CG   9  
ATOM 10400 C CD1  . PHE A 1 45 ? 9.466  3.089   5.024   1.00 0.00 ? 45 PHE A CD1  9  
ATOM 10401 C CD2  . PHE A 1 45 ? 10.007 3.314   2.722   1.00 0.00 ? 45 PHE A CD2  9  
ATOM 10402 C CE1  . PHE A 1 45 ? 8.666  4.217   4.955   1.00 0.00 ? 45 PHE A CE1  9  
ATOM 10403 C CE2  . PHE A 1 45 ? 9.209  4.438   2.646   1.00 0.00 ? 45 PHE A CE2  9  
ATOM 10404 C CZ   . PHE A 1 45 ? 8.543  4.887   3.759   1.00 0.00 ? 45 PHE A CZ   9  
ATOM 10405 H H    . PHE A 1 45 ? 12.533 -0.600  4.632   1.00 0.00 ? 45 PHE A H    9  
ATOM 10406 H HA   . PHE A 1 45 ? 12.866 2.299   4.505   1.00 0.00 ? 45 PHE A HA   9  
ATOM 10407 H HB2  . PHE A 1 45 ? 11.292 1.147   2.985   1.00 0.00 ? 45 PHE A HB2  9  
ATOM 10408 H HB3  . PHE A 1 45 ? 10.377 0.583   4.382   1.00 0.00 ? 45 PHE A HB3  9  
ATOM 10409 H HD1  . PHE A 1 45 ? 9.564  2.569   5.963   1.00 0.00 ? 45 PHE A HD1  9  
ATOM 10410 H HD2  . PHE A 1 45 ? 10.529 2.964   1.847   1.00 0.00 ? 45 PHE A HD2  9  
ATOM 10411 H HE1  . PHE A 1 45 ? 8.148  4.562   5.834   1.00 0.00 ? 45 PHE A HE1  9  
ATOM 10412 H HE2  . PHE A 1 45 ? 9.115  4.963   1.697   1.00 0.00 ? 45 PHE A HE2  9  
ATOM 10413 H HZ   . PHE A 1 45 ? 7.912  5.771   3.707   1.00 0.00 ? 45 PHE A HZ   9  
ATOM 10414 N N    . ARG A 1 46 ? 12.278 2.858   6.863   1.00 0.00 ? 46 ARG A N    9  
ATOM 10415 C CA   . ARG A 1 46 ? 11.992 3.145   8.260   1.00 0.00 ? 46 ARG A CA   9  
ATOM 10416 C C    . ARG A 1 46 ? 10.872 4.170   8.401   1.00 0.00 ? 46 ARG A C    9  
ATOM 10417 O O    . ARG A 1 46 ? 9.845  3.902   9.029   1.00 0.00 ? 46 ARG A O    9  
ATOM 10418 C CB   . ARG A 1 46 ? 13.234 3.671   8.968   1.00 0.00 ? 46 ARG A CB   9  
ATOM 10419 C CG   . ARG A 1 46 ? 14.428 2.750   8.860   1.00 0.00 ? 46 ARG A CG   9  
ATOM 10420 C CD   . ARG A 1 46 ? 15.444 3.014   9.945   1.00 0.00 ? 46 ARG A CD   9  
ATOM 10421 N NE   . ARG A 1 46 ? 14.848 2.812   11.281  1.00 0.00 ? 46 ARG A NE   9  
ATOM 10422 C CZ   . ARG A 1 46 ? 14.978 1.701   11.994  1.00 0.00 ? 46 ARG A CZ   9  
ATOM 10423 N NH1  . ARG A 1 46 ? 15.625 0.644   11.530  1.00 0.00 ? 46 ARG A NH1  9  
ATOM 10424 N NH2  . ARG A 1 46 ? 14.414 1.633   13.213  1.00 0.00 ? 46 ARG A NH2  9  
ATOM 10425 H H    . ARG A 1 46 ? 12.788 3.481   6.322   1.00 0.00 ? 46 ARG A H    9  
ATOM 10426 H HA   . ARG A 1 46 ? 11.678 2.227   8.723   1.00 0.00 ? 46 ARG A HA   9  
ATOM 10427 H HB2  . ARG A 1 46 ? 13.500 4.648   8.561   1.00 0.00 ? 46 ARG A HB2  9  
ATOM 10428 H HB3  . ARG A 1 46 ? 13.008 3.800   10.015  1.00 0.00 ? 46 ARG A HB3  9  
ATOM 10429 H HG2  . ARG A 1 46 ? 14.095 1.726   8.924   1.00 0.00 ? 46 ARG A HG2  9  
ATOM 10430 H HG3  . ARG A 1 46 ? 14.916 2.908   7.896   1.00 0.00 ? 46 ARG A HG3  9  
ATOM 10431 H HD2  . ARG A 1 46 ? 16.266 2.343   9.823   1.00 0.00 ? 46 ARG A HD2  9  
ATOM 10432 H HD3  . ARG A 1 46 ? 15.775 4.042   9.868   1.00 0.00 ? 46 ARG A HD3  9  
ATOM 10433 H HE   . ARG A 1 46 ? 14.334 3.566   11.652  1.00 0.00 ? 46 ARG A HE   9  
ATOM 10434 H HH11 . ARG A 1 46 ? 16.034 0.684   10.609  1.00 0.00 ? 46 ARG A HH11 9  
ATOM 10435 H HH12 . ARG A 1 46 ? 15.717 -0.184  12.076  1.00 0.00 ? 46 ARG A HH12 9  
ATOM 10436 H HH21 . ARG A 1 46 ? 13.894 2.424   13.577  1.00 0.00 ? 46 ARG A HH21 9  
ATOM 10437 H HH22 . ARG A 1 46 ? 14.514 0.803   13.768  1.00 0.00 ? 46 ARG A HH22 9  
ATOM 10438 N N    . GLN A 1 47 ? 11.065 5.327   7.801   1.00 0.00 ? 47 GLN A N    9  
ATOM 10439 C CA   . GLN A 1 47 ? 10.201 6.456   8.068   1.00 0.00 ? 47 GLN A CA   9  
ATOM 10440 C C    . GLN A 1 47 ? 10.042 7.335   6.831   1.00 0.00 ? 47 GLN A C    9  
ATOM 10441 O O    . GLN A 1 47 ? 10.943 7.431   5.986   1.00 0.00 ? 47 GLN A O    9  
ATOM 10442 C CB   . GLN A 1 47 ? 10.812 7.259   9.221   1.00 0.00 ? 47 GLN A CB   9  
ATOM 10443 C CG   . GLN A 1 47 ? 10.057 8.519   9.621   1.00 0.00 ? 47 GLN A CG   9  
ATOM 10444 C CD   . GLN A 1 47 ? 10.773 9.251   10.737  1.00 0.00 ? 47 GLN A CD   9  
ATOM 10445 O OE1  . GLN A 1 47 ? 10.510 9.017   11.908  1.00 0.00 ? 47 GLN A OE1  9  
ATOM 10446 N NE2  . GLN A 1 47 ? 11.666 10.168  10.381  1.00 0.00 ? 47 GLN A NE2  9  
ATOM 10447 H H    . GLN A 1 47 ? 11.816 5.428   7.177   1.00 0.00 ? 47 GLN A H    9  
ATOM 10448 H HA   . GLN A 1 47 ? 9.233  6.085   8.357   1.00 0.00 ? 47 GLN A HA   9  
ATOM 10449 H HB2  . GLN A 1 47 ? 10.862 6.621   10.085  1.00 0.00 ? 47 GLN A HB2  9  
ATOM 10450 H HB3  . GLN A 1 47 ? 11.802 7.543   8.944   1.00 0.00 ? 47 GLN A HB3  9  
ATOM 10451 H HG2  . GLN A 1 47 ? 9.980  9.181   8.764   1.00 0.00 ? 47 GLN A HG2  9  
ATOM 10452 H HG3  . GLN A 1 47 ? 9.064  8.238   9.971   1.00 0.00 ? 47 GLN A HG3  9  
ATOM 10453 H HE21 . GLN A 1 47 ? 11.810 10.328  9.420   1.00 0.00 ? 47 GLN A HE21 9  
ATOM 10454 H HE22 . GLN A 1 47 ? 12.160 10.638  11.093  1.00 0.00 ? 47 GLN A HE22 9  
ATOM 10455 N N    . SER A 1 48 ? 8.898  7.976   6.724   1.00 0.00 ? 48 SER A N    9  
ATOM 10456 C CA   . SER A 1 48 ? 8.679  8.986   5.708   1.00 0.00 ? 48 SER A CA   9  
ATOM 10457 C C    . SER A 1 48 ? 8.424  10.311  6.409   1.00 0.00 ? 48 SER A C    9  
ATOM 10458 O O    . SER A 1 48 ? 7.587  10.382  7.314   1.00 0.00 ? 48 SER A O    9  
ATOM 10459 C CB   . SER A 1 48 ? 7.514  8.619   4.783   1.00 0.00 ? 48 SER A CB   9  
ATOM 10460 O OG   . SER A 1 48 ? 6.322  8.365   5.526   1.00 0.00 ? 48 SER A OG   9  
ATOM 10461 H H    . SER A 1 48 ? 8.182  7.795   7.373   1.00 0.00 ? 48 SER A H    9  
ATOM 10462 H HA   . SER A 1 48 ? 9.586  9.078   5.129   1.00 0.00 ? 48 SER A HA   9  
ATOM 10463 H HB2  . SER A 1 48 ? 7.332  9.438   4.104   1.00 0.00 ? 48 SER A HB2  9  
ATOM 10464 H HB3  . SER A 1 48 ? 7.769  7.740   4.227   1.00 0.00 ? 48 SER A HB3  9  
ATOM 10465 H HG   . SER A 1 48 ? 6.108  7.438   5.470   1.00 0.00 ? 48 SER A HG   9  
ATOM 10466 N N    . ASN A 1 49 ? 9.139  11.351  6.032   1.00 0.00 ? 49 ASN A N    9  
ATOM 10467 C CA   . ASN A 1 49 ? 9.109  12.586  6.800   1.00 0.00 ? 49 ASN A CA   9  
ATOM 10468 C C    . ASN A 1 49 ? 7.915  13.437  6.425   1.00 0.00 ? 49 ASN A C    9  
ATOM 10469 O O    . ASN A 1 49 ? 7.871  14.023  5.339   1.00 0.00 ? 49 ASN A O    9  
ATOM 10470 C CB   . ASN A 1 49 ? 10.405 13.384  6.612   1.00 0.00 ? 49 ASN A CB   9  
ATOM 10471 C CG   . ASN A 1 49 ? 11.607 12.683  7.207   1.00 0.00 ? 49 ASN A CG   9  
ATOM 10472 O OD1  . ASN A 1 49 ? 11.491 11.867  8.117   1.00 0.00 ? 49 ASN A OD1  9  
ATOM 10473 N ND2  . ASN A 1 49 ? 12.793 12.993  6.707   1.00 0.00 ? 49 ASN A ND2  9  
ATOM 10474 H H    . ASN A 1 49 ? 9.700  11.303  5.226   1.00 0.00 ? 49 ASN A H    9  
ATOM 10475 H HA   . ASN A 1 49 ? 9.022  12.319  7.847   1.00 0.00 ? 49 ASN A HA   9  
ATOM 10476 H HB2  . ASN A 1 49 ? 10.582 13.525  5.566   1.00 0.00 ? 49 ASN A HB2  9  
ATOM 10477 H HB3  . ASN A 1 49 ? 10.306 14.355  7.091   1.00 0.00 ? 49 ASN A HB3  9  
ATOM 10478 H HD21 . ASN A 1 49 ? 12.833 13.660  5.977   1.00 0.00 ? 49 ASN A HD21 9  
ATOM 10479 H HD22 . ASN A 1 49 ? 13.582 12.552  7.086   1.00 0.00 ? 49 ASN A HD22 9  
ATOM 10480 N N    . ASN A 1 50 ? 6.927  13.459  7.333   1.00 0.00 ? 50 ASN A N    9  
ATOM 10481 C CA   . ASN A 1 50 ? 5.770  14.362  7.257   1.00 0.00 ? 50 ASN A CA   9  
ATOM 10482 C C    . ASN A 1 50 ? 4.779  13.967  6.158   1.00 0.00 ? 50 ASN A C    9  
ATOM 10483 O O    . ASN A 1 50 ? 3.560  14.017  6.358   1.00 0.00 ? 50 ASN A O    9  
ATOM 10484 C CB   . ASN A 1 50 ? 6.225  15.813  7.056   1.00 0.00 ? 50 ASN A CB   9  
ATOM 10485 C CG   . ASN A 1 50 ? 6.937  16.420  8.263   1.00 0.00 ? 50 ASN A CG   9  
ATOM 10486 O OD1  . ASN A 1 50 ? 6.904  17.639  8.474   1.00 0.00 ? 50 ASN A OD1  9  
ATOM 10487 N ND2  . ASN A 1 50 ? 7.580  15.593  9.061   1.00 0.00 ? 50 ASN A ND2  9  
ATOM 10488 H H    . ASN A 1 50 ? 6.988  12.837  8.105   1.00 0.00 ? 50 ASN A H    9  
ATOM 10489 H HA   . ASN A 1 50 ? 5.270  14.322  8.193   1.00 0.00 ? 50 ASN A HA   9  
ATOM 10490 H HB2  . ASN A 1 50 ? 6.902  15.855  6.201   1.00 0.00 ? 50 ASN A HB2  9  
ATOM 10491 H HB3  . ASN A 1 50 ? 5.360  16.441  6.837   1.00 0.00 ? 50 ASN A HB3  9  
ATOM 10492 H HD21 . ASN A 1 50 ? 7.575  14.642  8.823   1.00 0.00 ? 50 ASN A HD21 9  
ATOM 10493 H HD22 . ASN A 1 50 ? 8.062  15.959  9.838   1.00 0.00 ? 50 ASN A HD22 9  
ATOM 10494 N N    . GLY A 1 51 ? 5.288  13.539  5.008   1.00 0.00 ? 51 GLY A N    9  
ATOM 10495 C CA   . GLY A 1 51 ? 4.411  13.243  3.896   1.00 0.00 ? 51 GLY A CA   9  
ATOM 10496 C C    . GLY A 1 51 ? 4.836  13.987  2.647   1.00 0.00 ? 51 GLY A C    9  
ATOM 10497 O O    . GLY A 1 51 ? 4.050  14.729  2.052   1.00 0.00 ? 51 GLY A O    9  
ATOM 10498 H H    . GLY A 1 51 ? 6.255  13.429  4.930   1.00 0.00 ? 51 GLY A H    9  
ATOM 10499 H HA2  . GLY A 1 51 ? 4.444  12.181  3.698   1.00 0.00 ? 51 GLY A HA2  9  
ATOM 10500 H HA3  . GLY A 1 51 ? 3.406  13.534  4.141   1.00 0.00 ? 51 GLY A HA3  9  
ATOM 10501 N N    . VAL A 1 52 ? 6.070  13.748  2.235   1.00 0.00 ? 52 VAL A N    9  
ATOM 10502 C CA   . VAL A 1 52 ? 6.668  14.447  1.117   1.00 0.00 ? 52 VAL A CA   9  
ATOM 10503 C C    . VAL A 1 52 ? 7.715  13.561  0.450   1.00 0.00 ? 52 VAL A C    9  
ATOM 10504 O O    . VAL A 1 52 ? 8.071  12.521  0.996   1.00 0.00 ? 52 VAL A O    9  
ATOM 10505 C CB   . VAL A 1 52 ? 7.310  15.802  1.543   1.00 0.00 ? 52 VAL A CB   9  
ATOM 10506 C CG1  . VAL A 1 52 ? 6.243  16.869  1.773   1.00 0.00 ? 52 VAL A CG1  9  
ATOM 10507 C CG2  . VAL A 1 52 ? 8.167  15.632  2.790   1.00 0.00 ? 52 VAL A CG2  9  
ATOM 10508 H H    . VAL A 1 52 ? 6.572  13.027  2.676   1.00 0.00 ? 52 VAL A H    9  
ATOM 10509 H HA   . VAL A 1 52 ? 5.890  14.656  0.412   1.00 0.00 ? 52 VAL A HA   9  
ATOM 10510 H HB   . VAL A 1 52 ? 7.946  16.123  0.743   1.00 0.00 ? 52 VAL A HB   9  
ATOM 10511 H HG11 . VAL A 1 52 ? 5.596  16.563  2.579   1.00 0.00 ? 52 VAL A HG11 9  
ATOM 10512 H HG12 . VAL A 1 52 ? 5.666  17.008  0.878   1.00 0.00 ? 52 VAL A HG12 9  
ATOM 10513 H HG13 . VAL A 1 52 ? 6.726  17.795  2.035   1.00 0.00 ? 52 VAL A HG13 9  
ATOM 10514 H HG21 . VAL A 1 52 ? 8.897  14.864  2.636   1.00 0.00 ? 52 VAL A HG21 9  
ATOM 10515 H HG22 . VAL A 1 52 ? 7.533  15.381  3.623   1.00 0.00 ? 52 VAL A HG22 9  
ATOM 10516 H HG23 . VAL A 1 52 ? 8.669  16.569  3.009   1.00 0.00 ? 52 VAL A HG23 9  
ATOM 10517 N N    . PRO A 1 53 ? 8.182  13.943  -0.762  1.00 0.00 ? 53 PRO A N    9  
ATOM 10518 C CA   . PRO A 1 53 ? 9.202  13.216  -1.510  1.00 0.00 ? 53 PRO A CA   9  
ATOM 10519 C C    . PRO A 1 53 ? 10.374 12.651  -0.672  1.00 0.00 ? 53 PRO A C    9  
ATOM 10520 O O    . PRO A 1 53 ? 10.717 11.488  -0.820  1.00 0.00 ? 53 PRO A O    9  
ATOM 10521 C CB   . PRO A 1 53 ? 9.734  14.247  -2.537  1.00 0.00 ? 53 PRO A CB   9  
ATOM 10522 C CG   . PRO A 1 53 ? 8.881  15.469  -2.371  1.00 0.00 ? 53 PRO A CG   9  
ATOM 10523 C CD   . PRO A 1 53 ? 7.704  15.101  -1.523  1.00 0.00 ? 53 PRO A CD   9  
ATOM 10524 H HA   . PRO A 1 53 ? 8.753  12.392  -2.058  1.00 0.00 ? 53 PRO A HA   9  
ATOM 10525 H HB2  . PRO A 1 53 ? 10.768 14.461  -2.314  1.00 0.00 ? 53 PRO A HB2  9  
ATOM 10526 H HB3  . PRO A 1 53 ? 9.641  13.841  -3.525  1.00 0.00 ? 53 PRO A HB3  9  
ATOM 10527 H HG2  . PRO A 1 53 ? 9.454  16.251  -1.881  1.00 0.00 ? 53 PRO A HG2  9  
ATOM 10528 H HG3  . PRO A 1 53 ? 8.559  15.824  -3.344  1.00 0.00 ? 53 PRO A HG3  9  
ATOM 10529 H HD2  . PRO A 1 53 ? 7.443  15.913  -0.858  1.00 0.00 ? 53 PRO A HD2  9  
ATOM 10530 H HD3  . PRO A 1 53 ? 6.854  14.840  -2.150  1.00 0.00 ? 53 PRO A HD3  9  
ATOM 10531 N N    . PRO A 1 54 ? 11.015 13.460  0.215   1.00 0.00 ? 54 PRO A N    9  
ATOM 10532 C CA   . PRO A 1 54 ? 12.096 12.959  1.069   1.00 0.00 ? 54 PRO A CA   9  
ATOM 10533 C C    . PRO A 1 54 ? 11.653 11.829  1.991   1.00 0.00 ? 54 PRO A C    9  
ATOM 10534 O O    . PRO A 1 54 ? 10.698 11.958  2.753   1.00 0.00 ? 54 PRO A O    9  
ATOM 10535 C CB   . PRO A 1 54 ? 12.528 14.182  1.884   1.00 0.00 ? 54 PRO A CB   9  
ATOM 10536 C CG   . PRO A 1 54 ? 11.426 15.170  1.750   1.00 0.00 ? 54 PRO A CG   9  
ATOM 10537 C CD   . PRO A 1 54 ? 10.795 14.897  0.407   1.00 0.00 ? 54 PRO A CD   9  
ATOM 10538 H HA   . PRO A 1 54 ? 12.949 12.622  0.473   1.00 0.00 ? 54 PRO A HA   9  
ATOM 10539 H HB2  . PRO A 1 54 ? 12.670 13.882  2.909   1.00 0.00 ? 54 PRO A HB2  9  
ATOM 10540 H HB3  . PRO A 1 54 ? 13.464 14.574  1.490   1.00 0.00 ? 54 PRO A HB3  9  
ATOM 10541 H HG2  . PRO A 1 54 ? 10.701 15.026  2.531   1.00 0.00 ? 54 PRO A HG2  9  
ATOM 10542 H HG3  . PRO A 1 54 ? 11.830 16.171  1.775   1.00 0.00 ? 54 PRO A HG3  9  
ATOM 10543 H HD2  . PRO A 1 54 ? 9.744  15.127  0.453   1.00 0.00 ? 54 PRO A HD2  9  
ATOM 10544 H HD3  . PRO A 1 54 ? 11.268 15.486  -0.357  1.00 0.00 ? 54 PRO A HD3  9  
ATOM 10545 N N    . VAL A 1 55 ? 12.388 10.740  1.925   1.00 0.00 ? 55 VAL A N    9  
ATOM 10546 C CA   . VAL A 1 55 ? 12.061 9.537   2.690   1.00 0.00 ? 55 VAL A CA   9  
ATOM 10547 C C    . VAL A 1 55 ? 13.301 9.037   3.430   1.00 0.00 ? 55 VAL A C    9  
ATOM 10548 O O    . VAL A 1 55 ? 14.401 9.085   2.894   1.00 0.00 ? 55 VAL A O    9  
ATOM 10549 C CB   . VAL A 1 55 ? 11.456 8.430   1.790   1.00 0.00 ? 55 VAL A CB   9  
ATOM 10550 C CG1  . VAL A 1 55 ? 12.413 8.027   0.674   1.00 0.00 ? 55 VAL A CG1  9  
ATOM 10551 C CG2  . VAL A 1 55 ? 11.043 7.227   2.620   1.00 0.00 ? 55 VAL A CG2  9  
ATOM 10552 H H    . VAL A 1 55 ? 13.204 10.757  1.370   1.00 0.00 ? 55 VAL A H    9  
ATOM 10553 H HA   . VAL A 1 55 ? 11.316 9.834   3.426   1.00 0.00 ? 55 VAL A HA   9  
ATOM 10554 H HB   . VAL A 1 55 ? 10.575 8.830   1.321   1.00 0.00 ? 55 VAL A HB   9  
ATOM 10555 H HG11 . VAL A 1 55 ? 11.965 7.244   0.076   1.00 0.00 ? 55 VAL A HG11 9  
ATOM 10556 H HG12 . VAL A 1 55 ? 13.339 7.667   1.103   1.00 0.00 ? 55 VAL A HG12 9  
ATOM 10557 H HG13 . VAL A 1 55 ? 12.611 8.887   0.057   1.00 0.00 ? 55 VAL A HG13 9  
ATOM 10558 H HG21 . VAL A 1 55 ? 10.603 6.475   1.969   1.00 0.00 ? 55 VAL A HG21 9  
ATOM 10559 H HG22 . VAL A 1 55 ? 10.324 7.529   3.355   1.00 0.00 ? 55 VAL A HG22 9  
ATOM 10560 H HG23 . VAL A 1 55 ? 11.906 6.822   3.113   1.00 0.00 ? 55 VAL A HG23 9  
ATOM 10561 N N    . GLN A 1 56 ? 13.110 8.566   4.661   1.00 0.00 ? 56 GLN A N    9  
ATOM 10562 C CA   . GLN A 1 56 ? 14.217 8.122   5.486   1.00 0.00 ? 56 GLN A CA   9  
ATOM 10563 C C    . GLN A 1 56 ? 14.386 6.609   5.367   1.00 0.00 ? 56 GLN A C    9  
ATOM 10564 O O    . GLN A 1 56 ? 13.563 5.841   5.859   1.00 0.00 ? 56 GLN A O    9  
ATOM 10565 C CB   . GLN A 1 56 ? 14.002 8.522   6.951   1.00 0.00 ? 56 GLN A CB   9  
ATOM 10566 C CG   . GLN A 1 56 ? 15.130 8.095   7.875   1.00 0.00 ? 56 GLN A CG   9  
ATOM 10567 C CD   . GLN A 1 56 ? 16.451 8.767   7.533   1.00 0.00 ? 56 GLN A CD   9  
ATOM 10568 O OE1  . GLN A 1 56 ? 17.221 8.261   6.713   1.00 0.00 ? 56 GLN A OE1  9  
ATOM 10569 N NE2  . GLN A 1 56 ? 16.728 9.907   8.165   1.00 0.00 ? 56 GLN A NE2  9  
ATOM 10570 H H    . GLN A 1 56 ? 12.197 8.443   5.008   1.00 0.00 ? 56 GLN A H    9  
ATOM 10571 H HA   . GLN A 1 56 ? 15.125 8.591   5.120   1.00 0.00 ? 56 GLN A HA   9  
ATOM 10572 H HB2  . GLN A 1 56 ? 13.903 9.595   7.004   1.00 0.00 ? 56 GLN A HB2  9  
ATOM 10573 H HB3  . GLN A 1 56 ? 13.092 8.055   7.307   1.00 0.00 ? 56 GLN A HB3  9  
ATOM 10574 H HG2  . GLN A 1 56 ? 14.875 8.344   8.891   1.00 0.00 ? 56 GLN A HG2  9  
ATOM 10575 H HG3  . GLN A 1 56 ? 15.264 7.032   7.791   1.00 0.00 ? 56 GLN A HG3  9  
ATOM 10576 H HE21 . GLN A 1 56 ? 16.068 10.246  8.810   1.00 0.00 ? 56 GLN A HE21 9  
ATOM 10577 H HE22 . GLN A 1 56 ? 17.582 10.361  7.960   1.00 0.00 ? 56 GLN A HE22 9  
ATOM 10578 N N    . VAL A 1 57 ? 15.439 6.189   4.686   1.00 0.00 ? 57 VAL A N    9  
ATOM 10579 C CA   . VAL A 1 57 ? 15.685 4.778   4.444   1.00 0.00 ? 57 VAL A CA   9  
ATOM 10580 C C    . VAL A 1 57 ? 17.029 4.358   5.009   1.00 0.00 ? 57 VAL A C    9  
ATOM 10581 O O    . VAL A 1 57 ? 18.024 5.053   4.822   1.00 0.00 ? 57 VAL A O    9  
ATOM 10582 C CB   . VAL A 1 57 ? 15.624 4.457   2.930   1.00 0.00 ? 57 VAL A CB   9  
ATOM 10583 C CG1  . VAL A 1 57 ? 15.960 2.994   2.672   1.00 0.00 ? 57 VAL A CG1  9  
ATOM 10584 C CG2  . VAL A 1 57 ? 14.245 4.802   2.378   1.00 0.00 ? 57 VAL A CG2  9  
ATOM 10585 H H    . VAL A 1 57 ? 16.088 6.851   4.346   1.00 0.00 ? 57 VAL A H    9  
ATOM 10586 H HA   . VAL A 1 57 ? 14.908 4.211   4.951   1.00 0.00 ? 57 VAL A HA   9  
ATOM 10587 H HB   . VAL A 1 57 ? 16.358 5.063   2.437   1.00 0.00 ? 57 VAL A HB   9  
ATOM 10588 H HG11 . VAL A 1 57 ? 16.971 2.793   2.996   1.00 0.00 ? 57 VAL A HG11 9  
ATOM 10589 H HG12 . VAL A 1 57 ? 15.871 2.787   1.608   1.00 0.00 ? 57 VAL A HG12 9  
ATOM 10590 H HG13 . VAL A 1 57 ? 15.277 2.364   3.217   1.00 0.00 ? 57 VAL A HG13 9  
ATOM 10591 H HG21 . VAL A 1 57 ? 14.207 4.550   1.321   1.00 0.00 ? 57 VAL A HG21 9  
ATOM 10592 H HG22 . VAL A 1 57 ? 14.063 5.861   2.488   1.00 0.00 ? 57 VAL A HG22 9  
ATOM 10593 H HG23 . VAL A 1 57 ? 13.485 4.253   2.908   1.00 0.00 ? 57 VAL A HG23 9  
ATOM 10594 N N    . PHE A 1 58 ? 17.057 3.248   5.719   1.00 0.00 ? 58 PHE A N    9  
ATOM 10595 C CA   . PHE A 1 58 ? 18.311 2.692   6.195   1.00 0.00 ? 58 PHE A CA   9  
ATOM 10596 C C    . PHE A 1 58 ? 18.861 1.743   5.130   1.00 0.00 ? 58 PHE A C    9  
ATOM 10597 O O    . PHE A 1 58 ? 18.240 0.746   4.788   1.00 0.00 ? 58 PHE A O    9  
ATOM 10598 C CB   . PHE A 1 58 ? 18.131 1.936   7.513   1.00 0.00 ? 58 PHE A CB   9  
ATOM 10599 C CG   . PHE A 1 58 ? 19.416 1.350   8.044   1.00 0.00 ? 58 PHE A CG   9  
ATOM 10600 C CD1  . PHE A 1 58 ? 20.379 2.157   8.628   1.00 0.00 ? 58 PHE A CD1  9  
ATOM 10601 C CD2  . PHE A 1 58 ? 19.646 -0.019  7.952   1.00 0.00 ? 58 PHE A CD2  9  
ATOM 10602 C CE1  . PHE A 1 58 ? 21.554 1.609   9.109   1.00 0.00 ? 58 PHE A CE1  9  
ATOM 10603 C CE2  . PHE A 1 58 ? 20.823 -0.561  8.435   1.00 0.00 ? 58 PHE A CE2  9  
ATOM 10604 C CZ   . PHE A 1 58 ? 21.776 0.249   9.012   1.00 0.00 ? 58 PHE A CZ   9  
ATOM 10605 H H    . PHE A 1 58 ? 16.226 2.758   5.898   1.00 0.00 ? 58 PHE A H    9  
ATOM 10606 H HA   . PHE A 1 58 ? 19.007 3.507   6.329   1.00 0.00 ? 58 PHE A HA   9  
ATOM 10607 H HB2  . PHE A 1 58 ? 17.733 2.615   8.270   1.00 0.00 ? 58 PHE A HB2  9  
ATOM 10608 H HB3  . PHE A 1 58 ? 17.433 1.141   7.370   1.00 0.00 ? 58 PHE A HB3  9  
ATOM 10609 H HD1  . PHE A 1 58 ? 20.206 3.222   8.688   1.00 0.00 ? 58 PHE A HD1  9  
ATOM 10610 H HD2  . PHE A 1 58 ? 18.897 -0.666  7.495   1.00 0.00 ? 58 PHE A HD2  9  
ATOM 10611 H HE1  . PHE A 1 58 ? 22.299 2.250   9.565   1.00 0.00 ? 58 PHE A HE1  9  
ATOM 10612 H HE2  . PHE A 1 58 ? 20.992 -1.634  8.361   1.00 0.00 ? 58 PHE A HE2  9  
ATOM 10613 H HZ   . PHE A 1 58 ? 22.698 -0.176  9.378   1.00 0.00 ? 58 PHE A HZ   9  
ATOM 10614 N N    . TRP A 1 59 ? 20.026 2.061   4.609   1.00 0.00 ? 59 TRP A N    9  
ATOM 10615 C CA   . TRP A 1 59 ? 20.612 1.268   3.544   1.00 0.00 ? 59 TRP A CA   9  
ATOM 10616 C C    . TRP A 1 59 ? 21.501 0.181   4.124   1.00 0.00 ? 59 TRP A C    9  
ATOM 10617 O O    . TRP A 1 59 ? 22.547 0.470   4.712   1.00 0.00 ? 59 TRP A O    9  
ATOM 10618 C CB   . TRP A 1 59 ? 21.384 2.155   2.567   1.00 0.00 ? 59 TRP A CB   9  
ATOM 10619 C CG   . TRP A 1 59 ? 20.483 3.109   1.847   1.00 0.00 ? 59 TRP A CG   9  
ATOM 10620 C CD1  . TRP A 1 59 ? 20.229 4.408   2.166   1.00 0.00 ? 59 TRP A CD1  9  
ATOM 10621 C CD2  . TRP A 1 59 ? 19.725 2.821   0.666   1.00 0.00 ? 59 TRP A CD2  9  
ATOM 10622 N NE1  . TRP A 1 59 ? 19.329 4.944   1.271   1.00 0.00 ? 59 TRP A NE1  9  
ATOM 10623 C CE2  . TRP A 1 59 ? 19.013 3.991   0.339   1.00 0.00 ? 59 TRP A CE2  9  
ATOM 10624 C CE3  . TRP A 1 59 ? 19.565 1.689   -0.136  1.00 0.00 ? 59 TRP A CE3  9  
ATOM 10625 C CZ2  . TRP A 1 59 ? 18.165 4.063   -0.757  1.00 0.00 ? 59 TRP A CZ2  9  
ATOM 10626 C CZ3  . TRP A 1 59 ? 18.715 1.762   -1.220  1.00 0.00 ? 59 TRP A CZ3  9  
ATOM 10627 C CH2  . TRP A 1 59 ? 18.029 2.947   -1.530  1.00 0.00 ? 59 TRP A CH2  9  
ATOM 10628 H H    . TRP A 1 59 ? 20.515 2.830   4.970   1.00 0.00 ? 59 TRP A H    9  
ATOM 10629 H HA   . TRP A 1 59 ? 19.807 0.782   3.013   1.00 0.00 ? 59 TRP A HA   9  
ATOM 10630 H HB2  . TRP A 1 59 ? 22.123 2.716   3.124   1.00 0.00 ? 59 TRP A HB2  9  
ATOM 10631 H HB3  . TRP A 1 59 ? 21.879 1.538   1.831   1.00 0.00 ? 59 TRP A HB3  9  
ATOM 10632 H HD1  . TRP A 1 59 ? 20.657 4.914   3.024   1.00 0.00 ? 59 TRP A HD1  9  
ATOM 10633 H HE1  . TRP A 1 59 ? 18.984 5.864   1.296   1.00 0.00 ? 59 TRP A HE1  9  
ATOM 10634 H HE3  . TRP A 1 59 ? 20.094 0.771   0.068   1.00 0.00 ? 59 TRP A HE3  9  
ATOM 10635 H HZ2  . TRP A 1 59 ? 17.622 4.971   -0.992  1.00 0.00 ? 59 TRP A HZ2  9  
ATOM 10636 H HZ3  . TRP A 1 59 ? 18.596 0.900   -1.864  1.00 0.00 ? 59 TRP A HZ3  9  
ATOM 10637 H HH2  . TRP A 1 59 ? 17.373 2.960   -2.390  1.00 0.00 ? 59 TRP A HH2  9  
ATOM 10638 N N    . GLU A 1 60 ? 21.077 -1.079  3.955   1.00 0.00 ? 60 GLU A N    9  
ATOM 10639 C CA   . GLU A 1 60 ? 21.779 -2.217  4.517   1.00 0.00 ? 60 GLU A CA   9  
ATOM 10640 C C    . GLU A 1 60 ? 23.119 -2.418  3.826   1.00 0.00 ? 60 GLU A C    9  
ATOM 10641 O O    . GLU A 1 60 ? 24.111 -2.797  4.450   1.00 0.00 ? 60 GLU A O    9  
ATOM 10642 C CB   . GLU A 1 60 ? 20.921 -3.466  4.363   1.00 0.00 ? 60 GLU A CB   9  
ATOM 10643 C CG   . GLU A 1 60 ? 19.529 -3.326  4.963   1.00 0.00 ? 60 GLU A CG   9  
ATOM 10644 C CD   . GLU A 1 60 ? 18.628 -4.491  4.607   1.00 0.00 ? 60 GLU A CD   9  
ATOM 10645 O OE1  . GLU A 1 60 ? 18.114 -4.508  3.475   1.00 0.00 ? 60 GLU A OE1  9  
ATOM 10646 O OE2  . GLU A 1 60 ? 18.422 -5.387  5.462   1.00 0.00 ? 60 GLU A OE2  9  
ATOM 10647 H H    . GLU A 1 60 ? 20.279 -1.236  3.408   1.00 0.00 ? 60 GLU A H    9  
ATOM 10648 H HA   . GLU A 1 60 ? 21.935 -2.020  5.558   1.00 0.00 ? 60 GLU A HA   9  
ATOM 10649 H HB2  . GLU A 1 60 ? 20.820 -3.699  3.318   1.00 0.00 ? 60 GLU A HB2  9  
ATOM 10650 H HB3  . GLU A 1 60 ? 21.416 -4.300  4.859   1.00 0.00 ? 60 GLU A HB3  9  
ATOM 10651 H HG2  . GLU A 1 60 ? 19.617 -3.267  6.045   1.00 0.00 ? 60 GLU A HG2  9  
ATOM 10652 H HG3  . GLU A 1 60 ? 19.083 -2.411  4.597   1.00 0.00 ? 60 GLU A HG3  9  
ATOM 10653 N N    . SER A 1 61 ? 23.125 -2.170  2.525   1.00 0.00 ? 61 SER A N    9  
ATOM 10654 C CA   . SER A 1 61 ? 24.323 -2.273  1.719   1.00 0.00 ? 61 SER A CA   9  
ATOM 10655 C C    . SER A 1 61 ? 25.414 -1.285  2.190   1.00 0.00 ? 61 SER A C    9  
ATOM 10656 O O    . SER A 1 61 ? 26.591 -1.636  2.241   1.00 0.00 ? 61 SER A O    9  
ATOM 10657 C CB   . SER A 1 61 ? 23.962 -2.012  0.247   1.00 0.00 ? 61 SER A CB   9  
ATOM 10658 O OG   . SER A 1 61 ? 25.092 -2.098  -0.603  1.00 0.00 ? 61 SER A OG   9  
ATOM 10659 H H    . SER A 1 61 ? 22.296 -1.906  2.087   1.00 0.00 ? 61 SER A H    9  
ATOM 10660 H HA   . SER A 1 61 ? 24.714 -3.287  1.805   1.00 0.00 ? 61 SER A HA   9  
ATOM 10661 H HB2  . SER A 1 61 ? 23.237 -2.746  -0.070  1.00 0.00 ? 61 SER A HB2  9  
ATOM 10662 H HB3  . SER A 1 61 ? 23.537 -1.026  0.161   1.00 0.00 ? 61 SER A HB3  9  
ATOM 10663 H HG   . SER A 1 61 ? 24.967 -1.492  -1.344  1.00 0.00 ? 61 SER A HG   9  
ATOM 10664 N N    . THR A 1 62 ? 24.999 -0.094  2.558   1.00 0.00 ? 62 THR A N    9  
ATOM 10665 C CA   . THR A 1 62 ? 25.928 0.944   2.982   1.00 0.00 ? 62 THR A CA   9  
ATOM 10666 C C    . THR A 1 62 ? 26.177 0.892   4.490   1.00 0.00 ? 62 THR A C    9  
ATOM 10667 O O    . THR A 1 62 ? 27.314 0.823   4.945   1.00 0.00 ? 62 THR A O    9  
ATOM 10668 C CB   . THR A 1 62 ? 25.381 2.332   2.615   1.00 0.00 ? 62 THR A CB   9  
ATOM 10669 O OG1  . THR A 1 62 ? 24.910 2.323   1.260   1.00 0.00 ? 62 THR A OG1  9  
ATOM 10670 C CG2  . THR A 1 62 ? 26.444 3.406   2.781   1.00 0.00 ? 62 THR A CG2  9  
ATOM 10671 H H    . THR A 1 62 ? 24.036 0.100   2.549   1.00 0.00 ? 62 THR A H    9  
ATOM 10672 H HA   . THR A 1 62 ? 26.865 0.813   2.468   1.00 0.00 ? 62 THR A HA   9  
ATOM 10673 H HB   . THR A 1 62 ? 24.542 2.560   3.268   1.00 0.00 ? 62 THR A HB   9  
ATOM 10674 H HG1  . THR A 1 62 ? 25.582 1.938   0.693   1.00 0.00 ? 62 THR A HG1  9  
ATOM 10675 H HG21 . THR A 1 62 ? 26.046 4.366   2.492   1.00 0.00 ? 62 THR A HG21 9  
ATOM 10676 H HG22 . THR A 1 62 ? 27.291 3.170   2.160   1.00 0.00 ? 62 THR A HG22 9  
ATOM 10677 H HG23 . THR A 1 62 ? 26.759 3.452   3.821   1.00 0.00 ? 62 THR A HG23 9  
ATOM 10678 N N    . GLY A 1 63 ? 25.089 0.942   5.243   1.00 0.00 ? 63 GLY A N    9  
ATOM 10679 C CA   . GLY A 1 63 ? 25.166 0.893   6.681   1.00 0.00 ? 63 GLY A CA   9  
ATOM 10680 C C    . GLY A 1 63 ? 24.775 2.209   7.322   1.00 0.00 ? 63 GLY A C    9  
ATOM 10681 O O    . GLY A 1 63 ? 25.144 2.495   8.460   1.00 0.00 ? 63 GLY A O    9  
ATOM 10682 H H    . GLY A 1 63 ? 24.232 1.012   4.805   1.00 0.00 ? 63 GLY A H    9  
ATOM 10683 H HA2  . GLY A 1 63 ? 24.491 0.123   7.035   1.00 0.00 ? 63 GLY A HA2  9  
ATOM 10684 H HA3  . GLY A 1 63 ? 26.176 0.650   6.988   1.00 0.00 ? 63 GLY A HA3  9  
ATOM 10685 N N    . ARG A 1 64 ? 24.043 3.015   6.576   1.00 0.00 ? 64 ARG A N    9  
ATOM 10686 C CA   . ARG A 1 64 ? 23.625 4.327   7.036   1.00 0.00 ? 64 ARG A CA   9  
ATOM 10687 C C    . ARG A 1 64 ? 22.212 4.620   6.575   1.00 0.00 ? 64 ARG A C    9  
ATOM 10688 O O    . ARG A 1 64 ? 21.698 3.995   5.645   1.00 0.00 ? 64 ARG A O    9  
ATOM 10689 C CB   . ARG A 1 64 ? 24.556 5.420   6.484   1.00 0.00 ? 64 ARG A CB   9  
ATOM 10690 C CG   . ARG A 1 64 ? 24.531 5.526   4.969   1.00 0.00 ? 64 ARG A CG   9  
ATOM 10691 C CD   . ARG A 1 64 ? 25.231 6.783   4.468   1.00 0.00 ? 64 ARG A CD   9  
ATOM 10692 N NE   . ARG A 1 64 ? 24.462 7.998   4.712   1.00 0.00 ? 64 ARG A NE   9  
ATOM 10693 C CZ   . ARG A 1 64 ? 24.767 9.192   4.194   1.00 0.00 ? 64 ARG A CZ   9  
ATOM 10694 N NH1  . ARG A 1 64 ? 25.802 9.314   3.368   1.00 0.00 ? 64 ARG A NH1  9  
ATOM 10695 N NH2  . ARG A 1 64 ? 24.040 10.258  4.485   1.00 0.00 ? 64 ARG A NH2  9  
ATOM 10696 H H    . ARG A 1 64 ? 23.768 2.713   5.696   1.00 0.00 ? 64 ARG A H    9  
ATOM 10697 H HA   . ARG A 1 64 ? 23.667 4.335   8.119   1.00 0.00 ? 64 ARG A HA   9  
ATOM 10698 H HB2  . ARG A 1 64 ? 24.247 6.370   6.909   1.00 0.00 ? 64 ARG A HB2  9  
ATOM 10699 H HB3  . ARG A 1 64 ? 25.569 5.213   6.801   1.00 0.00 ? 64 ARG A HB3  9  
ATOM 10700 H HG2  . ARG A 1 64 ? 25.025 4.671   4.553   1.00 0.00 ? 64 ARG A HG2  9  
ATOM 10701 H HG3  . ARG A 1 64 ? 23.496 5.535   4.640   1.00 0.00 ? 64 ARG A HG3  9  
ATOM 10702 H HD2  . ARG A 1 64 ? 26.190 6.860   4.966   1.00 0.00 ? 64 ARG A HD2  9  
ATOM 10703 H HD3  . ARG A 1 64 ? 25.386 6.669   3.407   1.00 0.00 ? 64 ARG A HD3  9  
ATOM 10704 H HE   . ARG A 1 64 ? 23.681 7.929   5.305   1.00 0.00 ? 64 ARG A HE   9  
ATOM 10705 H HH11 . ARG A 1 64 ? 26.368 8.512   3.121   1.00 0.00 ? 64 ARG A HH11 9  
ATOM 10706 H HH12 . ARG A 1 64 ? 26.025 10.220  2.982   1.00 0.00 ? 64 ARG A HH12 9  
ATOM 10707 H HH21 . ARG A 1 64 ? 23.240 10.176  5.109   1.00 0.00 ? 64 ARG A HH21 9  
ATOM 10708 H HH22 . ARG A 1 64 ? 24.265 11.146  4.097   1.00 0.00 ? 64 ARG A HH22 9  
ATOM 10709 N N    . THR A 1 65 ? 21.591 5.580   7.243   1.00 0.00 ? 65 THR A N    9  
ATOM 10710 C CA   . THR A 1 65 ? 20.320 6.111   6.817   1.00 0.00 ? 65 THR A CA   9  
ATOM 10711 C C    . THR A 1 65 ? 20.558 7.237   5.805   1.00 0.00 ? 65 THR A C    9  
ATOM 10712 O O    . THR A 1 65 ? 21.632 7.836   5.772   1.00 0.00 ? 65 THR A O    9  
ATOM 10713 C CB   . THR A 1 65 ? 19.511 6.647   8.018   1.00 0.00 ? 65 THR A CB   9  
ATOM 10714 O OG1  . THR A 1 65 ? 20.365 7.429   8.863   1.00 0.00 ? 65 THR A OG1  9  
ATOM 10715 C CG2  . THR A 1 65 ? 18.914 5.498   8.825   1.00 0.00 ? 65 THR A CG2  9  
ATOM 10716 H H    . THR A 1 65 ? 21.992 5.930   8.079   1.00 0.00 ? 65 THR A H    9  
ATOM 10717 H HA   . THR A 1 65 ? 19.766 5.309   6.340   1.00 0.00 ? 65 THR A HA   9  
ATOM 10718 H HB   . THR A 1 65 ? 18.713 7.264   7.654   1.00 0.00 ? 65 THR A HB   9  
ATOM 10719 H HG1  . THR A 1 65 ? 20.994 6.834   9.310   1.00 0.00 ? 65 THR A HG1  9  
ATOM 10720 H HG21 . THR A 1 65 ? 19.708 4.893   9.226   1.00 0.00 ? 65 THR A HG21 9  
ATOM 10721 H HG22 . THR A 1 65 ? 18.299 4.897   8.174   1.00 0.00 ? 65 THR A HG22 9  
ATOM 10722 H HG23 . THR A 1 65 ? 18.307 5.905   9.630   1.00 0.00 ? 65 THR A HG23 9  
ATOM 10723 N N    . TYR A 1 66 ? 19.559 7.501   4.974   1.00 0.00 ? 66 TYR A N    9  
ATOM 10724 C CA   . TYR A 1 66 ? 19.665 8.535   3.970   1.00 0.00 ? 66 TYR A CA   9  
ATOM 10725 C C    . TYR A 1 66 ? 18.272 8.970   3.530   1.00 0.00 ? 66 TYR A C    9  
ATOM 10726 O O    . TYR A 1 66 ? 17.345 8.150   3.505   1.00 0.00 ? 66 TYR A O    9  
ATOM 10727 C CB   . TYR A 1 66 ? 20.467 8.031   2.762   1.00 0.00 ? 66 TYR A CB   9  
ATOM 10728 C CG   . TYR A 1 66 ? 20.708 9.068   1.701   1.00 0.00 ? 66 TYR A CG   9  
ATOM 10729 C CD1  . TYR A 1 66 ? 21.543 10.166  1.945   1.00 0.00 ? 66 TYR A CD1  9  
ATOM 10730 C CD2  . TYR A 1 66 ? 20.117 8.969   0.447   1.00 0.00 ? 66 TYR A CD2  9  
ATOM 10731 C CE1  . TYR A 1 66 ? 21.762 11.119  0.974   1.00 0.00 ? 66 TYR A CE1  9  
ATOM 10732 C CE2  . TYR A 1 66 ? 20.333 9.929   -0.525  1.00 0.00 ? 66 TYR A CE2  9  
ATOM 10733 C CZ   . TYR A 1 66 ? 21.157 11.001  -0.250  1.00 0.00 ? 66 TYR A CZ   9  
ATOM 10734 O OH   . TYR A 1 66 ? 21.367 11.968  -1.221  1.00 0.00 ? 66 TYR A OH   9  
ATOM 10735 H H    . TYR A 1 66 ? 18.725 6.984   5.050   1.00 0.00 ? 66 TYR A H    9  
ATOM 10736 H HA   . TYR A 1 66 ? 20.179 9.379   4.410   1.00 0.00 ? 66 TYR A HA   9  
ATOM 10737 H HB2  . TYR A 1 66 ? 21.422 7.678   3.102   1.00 0.00 ? 66 TYR A HB2  9  
ATOM 10738 H HB3  . TYR A 1 66 ? 19.930 7.210   2.301   1.00 0.00 ? 66 TYR A HB3  9  
ATOM 10739 H HD1  . TYR A 1 66 ? 22.015 10.271  2.906   1.00 0.00 ? 66 TYR A HD1  9  
ATOM 10740 H HD2  . TYR A 1 66 ? 19.474 8.134   0.237   1.00 0.00 ? 66 TYR A HD2  9  
ATOM 10741 H HE1  . TYR A 1 66 ? 22.416 11.947  1.185   1.00 0.00 ? 66 TYR A HE1  9  
ATOM 10742 H HE2  . TYR A 1 66 ? 19.863 9.827   -1.494  1.00 0.00 ? 66 TYR A HE2  9  
ATOM 10743 H HH   . TYR A 1 66 ? 22.284 12.274  -1.179  1.00 0.00 ? 66 TYR A HH   9  
ATOM 10744 N N    . TRP A 1 67 ? 18.109 10.247  3.197   1.00 0.00 ? 67 TRP A N    9  
ATOM 10745 C CA   . TRP A 1 67 ? 16.836 10.736  2.709   1.00 0.00 ? 67 TRP A CA   9  
ATOM 10746 C C    . TRP A 1 67 ? 16.795 10.593  1.202   1.00 0.00 ? 67 TRP A C    9  
ATOM 10747 O O    . TRP A 1 67 ? 17.563 11.246  0.487   1.00 0.00 ? 67 TRP A O    9  
ATOM 10748 C CB   . TRP A 1 67 ? 16.619 12.209  3.098   1.00 0.00 ? 67 TRP A CB   9  
ATOM 10749 C CG   . TRP A 1 67 ? 16.672 12.444  4.576   1.00 0.00 ? 67 TRP A CG   9  
ATOM 10750 C CD1  . TRP A 1 67 ? 15.689 12.192  5.488   1.00 0.00 ? 67 TRP A CD1  9  
ATOM 10751 C CD2  . TRP A 1 67 ? 17.772 12.997  5.324   1.00 0.00 ? 67 TRP A CD2  9  
ATOM 10752 N NE1  . TRP A 1 67 ? 16.104 12.541  6.748   1.00 0.00 ? 67 TRP A NE1  9  
ATOM 10753 C CE2  . TRP A 1 67 ? 17.386 13.038  6.677   1.00 0.00 ? 67 TRP A CE2  9  
ATOM 10754 C CE3  . TRP A 1 67 ? 19.053 13.458  4.967   1.00 0.00 ? 67 TRP A CE3  9  
ATOM 10755 C CZ2  . TRP A 1 67 ? 18.224 13.526  7.666   1.00 0.00 ? 67 TRP A CZ2  9  
ATOM 10756 C CZ3  . TRP A 1 67 ? 19.884 13.934  5.953   1.00 0.00 ? 67 TRP A CZ3  9  
ATOM 10757 C CH2  . TRP A 1 67 ? 19.465 13.968  7.296   1.00 0.00 ? 67 TRP A CH2  9  
ATOM 10758 H H    . TRP A 1 67 ? 18.869 10.869  3.267   1.00 0.00 ? 67 TRP A H    9  
ATOM 10759 H HA   . TRP A 1 67 ? 16.037 10.129  3.153   1.00 0.00 ? 67 TRP A HA   9  
ATOM 10760 H HB2  . TRP A 1 67 ? 17.394 12.809  2.642   1.00 0.00 ? 67 TRP A HB2  9  
ATOM 10761 H HB3  . TRP A 1 67 ? 15.644 12.525  2.740   1.00 0.00 ? 67 TRP A HB3  9  
ATOM 10762 H HD1  . TRP A 1 67 ? 14.712 11.773  5.242   1.00 0.00 ? 67 TRP A HD1  9  
ATOM 10763 H HE1  . TRP A 1 67 ? 15.572 12.455  7.572   1.00 0.00 ? 67 TRP A HE1  9  
ATOM 10764 H HE3  . TRP A 1 67 ? 19.389 13.438  3.943   1.00 0.00 ? 67 TRP A HE3  9  
ATOM 10765 H HZ2  . TRP A 1 67 ? 17.922 13.559  8.703   1.00 0.00 ? 67 TRP A HZ2  9  
ATOM 10766 H HZ3  . TRP A 1 67 ? 20.877 14.298  5.702   1.00 0.00 ? 67 TRP A HZ3  9  
ATOM 10767 H HH2  . TRP A 1 67 ? 20.149 14.345  8.045   1.00 0.00 ? 67 TRP A HH2  9  
ATOM 10768 N N    . VAL A 1 68 ? 15.905 9.743   0.718   1.00 0.00 ? 68 VAL A N    9  
ATOM 10769 C CA   . VAL A 1 68 ? 15.823 9.415   -0.692  1.00 0.00 ? 68 VAL A CA   9  
ATOM 10770 C C    . VAL A 1 68 ? 14.525 9.970   -1.283  1.00 0.00 ? 68 VAL A C    9  
ATOM 10771 O O    . VAL A 1 68 ? 13.961 10.931  -0.768  1.00 0.00 ? 68 VAL A O    9  
ATOM 10772 C CB   . VAL A 1 68 ? 15.914 7.883   -0.921  1.00 0.00 ? 68 VAL A CB   9  
ATOM 10773 C CG1  . VAL A 1 68 ? 16.521 7.561   -2.278  1.00 0.00 ? 68 VAL A CG1  9  
ATOM 10774 C CG2  . VAL A 1 68 ? 16.703 7.215   0.193   1.00 0.00 ? 68 VAL A CG2  9  
ATOM 10775 H H    . VAL A 1 68 ? 15.293 9.252   1.305   1.00 0.00 ? 68 VAL A H    9  
ATOM 10776 H HA   . VAL A 1 68 ? 16.662 9.883   -1.208  1.00 0.00 ? 68 VAL A HA   9  
ATOM 10777 H HB   . VAL A 1 68 ? 14.904 7.473   -0.901  1.00 0.00 ? 68 VAL A HB   9  
ATOM 10778 H HG11 . VAL A 1 68 ? 17.523 7.972   -2.334  1.00 0.00 ? 68 VAL A HG11 9  
ATOM 10779 H HG12 . VAL A 1 68 ? 15.911 7.992   -3.059  1.00 0.00 ? 68 VAL A HG12 9  
ATOM 10780 H HG13 . VAL A 1 68 ? 16.564 6.493   -2.404  1.00 0.00 ? 68 VAL A HG13 9  
ATOM 10781 H HG21 . VAL A 1 68 ? 17.722 7.561   0.174   1.00 0.00 ? 68 VAL A HG21 9  
ATOM 10782 H HG22 . VAL A 1 68 ? 16.688 6.145   0.048   1.00 0.00 ? 68 VAL A HG22 9  
ATOM 10783 H HG23 . VAL A 1 68 ? 16.257 7.465   1.145   1.00 0.00 ? 68 VAL A HG23 9  
ATOM 10784 N N    . HIS A 1 69 ? 14.057 9.349   -2.366  1.00 0.00 ? 69 HIS A N    9  
ATOM 10785 C CA   . HIS A 1 69 ? 12.918 9.879   -3.103  1.00 0.00 ? 69 HIS A CA   9  
ATOM 10786 C C    . HIS A 1 69 ? 11.999 8.727   -3.512  1.00 0.00 ? 69 HIS A C    9  
ATOM 10787 O O    . HIS A 1 69 ? 12.488 7.688   -3.971  1.00 0.00 ? 69 HIS A O    9  
ATOM 10788 C CB   . HIS A 1 69 ? 13.371 10.666  -4.328  1.00 0.00 ? 69 HIS A CB   9  
ATOM 10789 C CG   . HIS A 1 69 ? 13.845 12.039  -4.012  1.00 0.00 ? 69 HIS A CG   9  
ATOM 10790 N ND1  . HIS A 1 69 ? 15.135 12.456  -4.211  1.00 0.00 ? 69 HIS A ND1  9  
ATOM 10791 C CD2  . HIS A 1 69 ? 13.195 13.111  -3.495  1.00 0.00 ? 69 HIS A CD2  9  
ATOM 10792 C CE1  . HIS A 1 69 ? 15.264 13.718  -3.837  1.00 0.00 ? 69 HIS A CE1  9  
ATOM 10793 N NE2  . HIS A 1 69 ? 14.081 14.127  -3.395  1.00 0.00 ? 69 HIS A NE2  9  
ATOM 10794 H H    . HIS A 1 69 ? 14.271 8.411   -2.486  1.00 0.00 ? 69 HIS A H    9  
ATOM 10795 H HA   . HIS A 1 69 ? 12.367 10.537  -2.445  1.00 0.00 ? 69 HIS A HA   9  
ATOM 10796 H HB2  . HIS A 1 69 ? 14.187 10.134  -4.813  1.00 0.00 ? 69 HIS A HB2  9  
ATOM 10797 H HB3  . HIS A 1 69 ? 12.545 10.755  -5.018  1.00 0.00 ? 69 HIS A HB3  9  
ATOM 10798 H HD1  . HIS A 1 69 ? 15.879 11.908  -4.549  1.00 0.00 ? 69 HIS A HD1  9  
ATOM 10799 H HD2  . HIS A 1 69 ? 12.144 13.139  -3.220  1.00 0.00 ? 69 HIS A HD2  9  
ATOM 10800 H HE1  . HIS A 1 69 ? 16.161 14.318  -3.889  1.00 0.00 ? 69 HIS A HE1  9  
ATOM 10801 H HE2  . HIS A 1 69 ? 13.866 15.072  -3.196  1.00 0.00 ? 69 HIS A HE2  9  
ATOM 10802 N N    . TRP A 1 70 ? 10.702 8.906   -3.333  1.00 0.00 ? 70 TRP A N    9  
ATOM 10803 C CA   . TRP A 1 70 ? 9.714  7.876   -3.669  1.00 0.00 ? 70 TRP A CA   9  
ATOM 10804 C C    . TRP A 1 70 ? 9.883  7.345   -5.101  1.00 0.00 ? 70 TRP A C    9  
ATOM 10805 O O    . TRP A 1 70 ? 9.911  6.141   -5.304  1.00 0.00 ? 70 TRP A O    9  
ATOM 10806 C CB   . TRP A 1 70 ? 8.302  8.436   -3.498  1.00 0.00 ? 70 TRP A CB   9  
ATOM 10807 C CG   . TRP A 1 70 ? 7.975  8.829   -2.099  1.00 0.00 ? 70 TRP A CG   9  
ATOM 10808 C CD1  . TRP A 1 70 ? 7.995  10.086  -1.589  1.00 0.00 ? 70 TRP A CD1  9  
ATOM 10809 C CD2  . TRP A 1 70 ? 7.585  7.969   -1.026  1.00 0.00 ? 70 TRP A CD2  9  
ATOM 10810 N NE1  . TRP A 1 70 ? 7.636  10.067  -0.259  1.00 0.00 ? 70 TRP A NE1  9  
ATOM 10811 C CE2  . TRP A 1 70 ? 7.375  8.781   0.111   1.00 0.00 ? 70 TRP A CE2  9  
ATOM 10812 C CE3  . TRP A 1 70 ? 7.388  6.593   -0.905  1.00 0.00 ? 70 TRP A CE3  9  
ATOM 10813 C CZ2  . TRP A 1 70 ? 6.986  8.274   1.333   1.00 0.00 ? 70 TRP A CZ2  9  
ATOM 10814 C CZ3  . TRP A 1 70 ? 6.994  6.089   0.318   1.00 0.00 ? 70 TRP A CZ3  9  
ATOM 10815 C CH2  . TRP A 1 70 ? 6.797  6.924   1.426   1.00 0.00 ? 70 TRP A CH2  9  
ATOM 10816 H H    . TRP A 1 70 ? 10.379 9.721   -2.886  1.00 0.00 ? 70 TRP A H    9  
ATOM 10817 H HA   . TRP A 1 70 ? 9.849  7.064   -2.979  1.00 0.00 ? 70 TRP A HA   9  
ATOM 10818 H HB2  . TRP A 1 70 ? 8.183  9.311   -4.113  1.00 0.00 ? 70 TRP A HB2  9  
ATOM 10819 H HB3  . TRP A 1 70 ? 7.579  7.688   -3.805  1.00 0.00 ? 70 TRP A HB3  9  
ATOM 10820 H HD1  . TRP A 1 70 ? 8.260  10.965  -2.151  1.00 0.00 ? 70 TRP A HD1  9  
ATOM 10821 H HE1  . TRP A 1 70 ? 7.569  10.853  0.337   1.00 0.00 ? 70 TRP A HE1  9  
ATOM 10822 H HE3  . TRP A 1 70 ? 7.534  5.931   -1.748  1.00 0.00 ? 70 TRP A HE3  9  
ATOM 10823 H HZ2  . TRP A 1 70 ? 6.833  8.903   2.193   1.00 0.00 ? 70 TRP A HZ2  9  
ATOM 10824 H HZ3  . TRP A 1 70 ? 6.825  5.022   0.427   1.00 0.00 ? 70 TRP A HZ3  9  
ATOM 10825 H HH2  . TRP A 1 70 ? 6.477  6.483   2.358   1.00 0.00 ? 70 TRP A HH2  9  
ATOM 10826 N N    . HIS A 1 71 ? 10.001 8.237   -6.066  1.00 0.00 ? 71 HIS A N    9  
ATOM 10827 C CA   . HIS A 1 71 ? 9.983  7.829   -7.470  1.00 0.00 ? 71 HIS A CA   9  
ATOM 10828 C C    . HIS A 1 71 ? 11.244 7.075   -7.895  1.00 0.00 ? 71 HIS A C    9  
ATOM 10829 O O    . HIS A 1 71 ? 11.346 6.665   -9.054  1.00 0.00 ? 71 HIS A O    9  
ATOM 10830 C CB   . HIS A 1 71 ? 9.753  9.026   -8.407  1.00 0.00 ? 71 HIS A CB   9  
ATOM 10831 C CG   . HIS A 1 71 ? 10.896 9.988   -8.509  1.00 0.00 ? 71 HIS A CG   9  
ATOM 10832 N ND1  . HIS A 1 71 ? 11.825 9.982   -9.532  1.00 0.00 ? 71 HIS A ND1  9  
ATOM 10833 C CD2  . HIS A 1 71 ? 11.231 11.041  -7.740  1.00 0.00 ? 71 HIS A CD2  9  
ATOM 10834 C CE1  . HIS A 1 71 ? 12.674 10.972  -9.386  1.00 0.00 ? 71 HIS A CE1  9  
ATOM 10835 N NE2  . HIS A 1 71 ? 12.345 11.639  -8.296  1.00 0.00 ? 71 HIS A NE2  9  
ATOM 10836 H H    . HIS A 1 71 ? 10.075 9.189   -5.836  1.00 0.00 ? 71 HIS A H    9  
ATOM 10837 H HA   . HIS A 1 71 ? 9.146  7.153   -7.578  1.00 0.00 ? 71 HIS A HA   9  
ATOM 10838 H HB2  . HIS A 1 71 ? 9.563  8.650   -9.405  1.00 0.00 ? 71 HIS A HB2  9  
ATOM 10839 H HB3  . HIS A 1 71 ? 8.894  9.573   -8.061  1.00 0.00 ? 71 HIS A HB3  9  
ATOM 10840 H HD1  . HIS A 1 71 ? 11.848 9.333   -10.286 1.00 0.00 ? 71 HIS A HD1  9  
ATOM 10841 H HD2  . HIS A 1 71 ? 10.713 11.357  -6.835  1.00 0.00 ? 71 HIS A HD2  9  
ATOM 10842 H HE1  . HIS A 1 71 ? 13.497 11.195  -10.038 1.00 0.00 ? 71 HIS A HE1  9  
ATOM 10843 H HE2  . HIS A 1 71 ? 12.667 12.552  -8.085  1.00 0.00 ? 71 HIS A HE2  9  
ATOM 10844 N N    . MET A 1 72 ? 12.205 6.864   -6.998  1.00 0.00 ? 72 MET A N    9  
ATOM 10845 C CA   . MET A 1 72 ? 13.418 6.135   -7.349  1.00 0.00 ? 72 MET A CA   9  
ATOM 10846 C C    . MET A 1 72 ? 13.649 4.899   -6.468  1.00 0.00 ? 72 MET A C    9  
ATOM 10847 O O    . MET A 1 72 ? 14.740 4.330   -6.490  1.00 0.00 ? 72 MET A O    9  
ATOM 10848 C CB   . MET A 1 72 ? 14.639 7.065   -7.306  1.00 0.00 ? 72 MET A CB   9  
ATOM 10849 C CG   . MET A 1 72 ? 14.851 7.749   -5.962  1.00 0.00 ? 72 MET A CG   9  
ATOM 10850 S SD   . MET A 1 72 ? 16.195 8.946   -5.968  1.00 0.00 ? 72 MET A SD   9  
ATOM 10851 C CE   . MET A 1 72 ? 15.736 10.020  -7.313  1.00 0.00 ? 72 MET A CE   9  
ATOM 10852 H H    . MET A 1 72 ? 12.130 7.260   -6.089  1.00 0.00 ? 72 MET A H    9  
ATOM 10853 H HA   . MET A 1 72 ? 13.287 5.797   -8.380  1.00 0.00 ? 72 MET A HA   9  
ATOM 10854 H HB2  . MET A 1 72 ? 15.526 6.487   -7.529  1.00 0.00 ? 72 MET A HB2  9  
ATOM 10855 H HB3  . MET A 1 72 ? 14.519 7.835   -8.051  1.00 0.00 ? 72 MET A HB3  9  
ATOM 10856 H HG2  . MET A 1 72 ? 13.930 8.259   -5.698  1.00 0.00 ? 72 MET A HG2  9  
ATOM 10857 H HG3  . MET A 1 72 ? 15.064 6.988   -5.224  1.00 0.00 ? 72 MET A HG3  9  
ATOM 10858 H HE1  . MET A 1 72 ? 14.786 10.489  -7.095  1.00 0.00 ? 72 MET A HE1  9  
ATOM 10859 H HE2  . MET A 1 72 ? 15.648 9.438   -8.218  1.00 0.00 ? 72 MET A HE2  9  
ATOM 10860 H HE3  . MET A 1 72 ? 16.490 10.785  -7.446  1.00 0.00 ? 72 MET A HE3  9  
ATOM 10861 N N    . LEU A 1 73 ? 12.629 4.475   -5.737  1.00 0.00 ? 73 LEU A N    9  
ATOM 10862 C CA   . LEU A 1 73 ? 12.752 3.327   -4.844  1.00 0.00 ? 73 LEU A CA   9  
ATOM 10863 C C    . LEU A 1 73 ? 11.918 2.172   -5.345  1.00 0.00 ? 73 LEU A C    9  
ATOM 10864 O O    . LEU A 1 73 ? 10.769 2.357   -5.751  1.00 0.00 ? 73 LEU A O    9  
ATOM 10865 C CB   . LEU A 1 73 ? 12.319 3.704   -3.423  1.00 0.00 ? 73 LEU A CB   9  
ATOM 10866 C CG   . LEU A 1 73 ? 13.210 4.707   -2.726  1.00 0.00 ? 73 LEU A CG   9  
ATOM 10867 C CD1  . LEU A 1 73 ? 12.668 5.023   -1.328  1.00 0.00 ? 73 LEU A CD1  9  
ATOM 10868 C CD2  . LEU A 1 73 ? 14.645 4.180   -2.616  1.00 0.00 ? 73 LEU A CD2  9  
ATOM 10869 H H    . LEU A 1 73 ? 11.766 4.928   -5.799  1.00 0.00 ? 73 LEU A H    9  
ATOM 10870 H HA   . LEU A 1 73 ? 13.793 3.025   -4.827  1.00 0.00 ? 73 LEU A HA   9  
ATOM 10871 H HB2  . LEU A 1 73 ? 11.321 4.106   -3.485  1.00 0.00 ? 73 LEU A HB2  9  
ATOM 10872 H HB3  . LEU A 1 73 ? 12.279 2.808   -2.839  1.00 0.00 ? 73 LEU A HB3  9  
ATOM 10873 H HG   . LEU A 1 73 ? 13.234 5.620   -3.281  1.00 0.00 ? 73 LEU A HG   9  
ATOM 10874 H HD11 . LEU A 1 73 ? 12.619 4.107   -0.749  1.00 0.00 ? 73 LEU A HD11 9  
ATOM 10875 H HD12 . LEU A 1 73 ? 11.670 5.440   -1.430  1.00 0.00 ? 73 LEU A HD12 9  
ATOM 10876 H HD13 . LEU A 1 73 ? 13.308 5.737   -0.852  1.00 0.00 ? 73 LEU A HD13 9  
ATOM 10877 H HD21 . LEU A 1 73 ? 15.254 4.924   -2.135  1.00 0.00 ? 73 LEU A HD21 9  
ATOM 10878 H HD22 . LEU A 1 73 ? 15.020 3.991   -3.607  1.00 0.00 ? 73 LEU A HD22 9  
ATOM 10879 H HD23 . LEU A 1 73 ? 14.651 3.276   -2.038  1.00 0.00 ? 73 LEU A HD23 9  
ATOM 10880 N N    . GLU A 1 74 ? 12.499 0.967   -5.343  1.00 0.00 ? 74 GLU A N    9  
ATOM 10881 C CA   . GLU A 1 74 ? 11.774 -0.230  -5.736  1.00 0.00 ? 74 GLU A CA   9  
ATOM 10882 C C    . GLU A 1 74 ? 11.193 -0.904  -4.511  1.00 0.00 ? 74 GLU A C    9  
ATOM 10883 O O    . GLU A 1 74 ? 11.900 -1.131  -3.522  1.00 0.00 ? 74 GLU A O    9  
ATOM 10884 C CB   . GLU A 1 74 ? 12.692 -1.216  -6.459  1.00 0.00 ? 74 GLU A CB   9  
ATOM 10885 C CG   . GLU A 1 74 ? 11.990 -2.478  -6.945  1.00 0.00 ? 74 GLU A CG   9  
ATOM 10886 C CD   . GLU A 1 74 ? 12.937 -3.520  -7.554  1.00 0.00 ? 74 GLU A CD   9  
ATOM 10887 O OE1  . GLU A 1 74 ? 14.090 -3.162  -7.830  1.00 0.00 ? 74 GLU A OE1  9  
ATOM 10888 O OE2  . GLU A 1 74 ? 12.528 -4.688  -7.745  1.00 0.00 ? 74 GLU A OE2  9  
ATOM 10889 H H    . GLU A 1 74 ? 13.437 0.880   -5.060  1.00 0.00 ? 74 GLU A H    9  
ATOM 10890 H HA   . GLU A 1 74 ? 10.968 0.062   -6.393  1.00 0.00 ? 74 GLU A HA   9  
ATOM 10891 H HB2  . GLU A 1 74 ? 13.128 -0.726  -7.317  1.00 0.00 ? 74 GLU A HB2  9  
ATOM 10892 H HB3  . GLU A 1 74 ? 13.492 -1.521  -5.786  1.00 0.00 ? 74 GLU A HB3  9  
ATOM 10893 H HG2  . GLU A 1 74 ? 11.489 -2.932  -6.101  1.00 0.00 ? 74 GLU A HG2  9  
ATOM 10894 H HG3  . GLU A 1 74 ? 11.256 -2.206  -7.690  1.00 0.00 ? 74 GLU A HG3  9  
ATOM 10895 N N    . ILE A 1 75 ? 9.921  -1.229  -4.564  1.00 0.00 ? 75 ILE A N    9  
ATOM 10896 C CA   . ILE A 1 75 ? 9.285  -1.944  -3.474  1.00 0.00 ? 75 ILE A CA   9  
ATOM 10897 C C    . ILE A 1 75 ? 9.649  -3.429  -3.558  1.00 0.00 ? 75 ILE A C    9  
ATOM 10898 O O    . ILE A 1 75 ? 9.368  -4.105  -4.548  1.00 0.00 ? 75 ILE A O    9  
ATOM 10899 C CB   . ILE A 1 75 ? 7.737  -1.720  -3.471  1.00 0.00 ? 75 ILE A CB   9  
ATOM 10900 C CG1  . ILE A 1 75 ? 7.068  -2.375  -2.239  1.00 0.00 ? 75 ILE A CG1  9  
ATOM 10901 C CG2  . ILE A 1 75 ? 7.101  -2.226  -4.768  1.00 0.00 ? 75 ILE A CG2  9  
ATOM 10902 C CD1  . ILE A 1 75 ? 6.836  -3.865  -2.350  1.00 0.00 ? 75 ILE A CD1  9  
ATOM 10903 H H    . ILE A 1 75 ? 9.411  -1.007  -5.364  1.00 0.00 ? 75 ILE A H    9  
ATOM 10904 H HA   . ILE A 1 75 ? 9.678  -1.543  -2.550  1.00 0.00 ? 75 ILE A HA   9  
ATOM 10905 H HB   . ILE A 1 75 ? 7.571  -0.652  -3.419  1.00 0.00 ? 75 ILE A HB   9  
ATOM 10906 H HG12 . ILE A 1 75 ? 7.702  -2.207  -1.383  1.00 0.00 ? 75 ILE A HG12 9  
ATOM 10907 H HG13 . ILE A 1 75 ? 6.117  -1.899  -2.077  1.00 0.00 ? 75 ILE A HG13 9  
ATOM 10908 H HG21 . ILE A 1 75 ? 6.037  -2.094  -4.716  1.00 0.00 ? 75 ILE A HG21 9  
ATOM 10909 H HG22 . ILE A 1 75 ? 7.329  -3.271  -4.908  1.00 0.00 ? 75 ILE A HG22 9  
ATOM 10910 H HG23 . ILE A 1 75 ? 7.488  -1.658  -5.611  1.00 0.00 ? 75 ILE A HG23 9  
ATOM 10911 H HD11 . ILE A 1 75 ? 6.371  -4.226  -1.443  1.00 0.00 ? 75 ILE A HD11 9  
ATOM 10912 H HD12 . ILE A 1 75 ? 7.791  -4.363  -2.489  1.00 0.00 ? 75 ILE A HD12 9  
ATOM 10913 H HD13 . ILE A 1 75 ? 6.201  -4.066  -3.196  1.00 0.00 ? 75 ILE A HD13 9  
ATOM 10914 N N    . LEU A 1 76 ? 10.313 -3.914  -2.537  1.00 0.00 ? 76 LEU A N    9  
ATOM 10915 C CA   . LEU A 1 76 ? 10.724 -5.304  -2.489  1.00 0.00 ? 76 LEU A CA   9  
ATOM 10916 C C    . LEU A 1 76 ? 9.891  -6.041  -1.455  1.00 0.00 ? 76 LEU A C    9  
ATOM 10917 O O    . LEU A 1 76 ? 9.242  -7.035  -1.759  1.00 0.00 ? 76 LEU A O    9  
ATOM 10918 C CB   . LEU A 1 76 ? 12.209 -5.398  -2.167  1.00 0.00 ? 76 LEU A CB   9  
ATOM 10919 C CG   . LEU A 1 76 ? 12.846 -6.785  -2.357  1.00 0.00 ? 76 LEU A CG   9  
ATOM 10920 C CD1  . LEU A 1 76 ? 12.703 -7.257  -3.788  1.00 0.00 ? 76 LEU A CD1  9  
ATOM 10921 C CD2  . LEU A 1 76 ? 14.316 -6.722  -1.979  1.00 0.00 ? 76 LEU A CD2  9  
ATOM 10922 H H    . LEU A 1 76 ? 10.547 -3.332  -1.790  1.00 0.00 ? 76 LEU A H    9  
ATOM 10923 H HA   . LEU A 1 76 ? 10.532 -5.715  -3.464  1.00 0.00 ? 76 LEU A HA   9  
ATOM 10924 H HB2  . LEU A 1 76 ? 12.737 -4.697  -2.789  1.00 0.00 ? 76 LEU A HB2  9  
ATOM 10925 H HB3  . LEU A 1 76 ? 12.347 -5.112  -1.141  1.00 0.00 ? 76 LEU A HB3  9  
ATOM 10926 H HG   . LEU A 1 76 ? 12.359 -7.500  -1.700  1.00 0.00 ? 76 LEU A HG   9  
ATOM 10927 H HD11 . LEU A 1 76 ? 13.142 -8.244  -3.899  1.00 0.00 ? 76 LEU A HD11 9  
ATOM 10928 H HD12 . LEU A 1 76 ? 13.203 -6.564  -4.446  1.00 0.00 ? 76 LEU A HD12 9  
ATOM 10929 H HD13 . LEU A 1 76 ? 11.650 -7.313  -4.046  1.00 0.00 ? 76 LEU A HD13 9  
ATOM 10930 H HD21 . LEU A 1 76 ? 14.762 -7.692  -2.117  1.00 0.00 ? 76 LEU A HD21 9  
ATOM 10931 H HD22 . LEU A 1 76 ? 14.420 -6.444  -0.940  1.00 0.00 ? 76 LEU A HD22 9  
ATOM 10932 H HD23 . LEU A 1 76 ? 14.830 -5.997  -2.602  1.00 0.00 ? 76 LEU A HD23 9  
ATOM 10933 N N    . GLY A 1 77 ? 9.879  -5.513  -0.246  1.00 0.00 ? 77 GLY A N    9  
ATOM 10934 C CA   . GLY A 1 77 ? 9.102  -6.121  0.819   1.00 0.00 ? 77 GLY A CA   9  
ATOM 10935 C C    . GLY A 1 77 ? 9.971  -6.913  1.755   1.00 0.00 ? 77 GLY A C    9  
ATOM 10936 O O    . GLY A 1 77 ? 11.035 -6.435  2.166   1.00 0.00 ? 77 GLY A O    9  
ATOM 10937 H H    . GLY A 1 77 ? 10.419 -4.710  -0.064  1.00 0.00 ? 77 GLY A H    9  
ATOM 10938 H HA2  . GLY A 1 77 ? 8.599  -5.349  1.368   1.00 0.00 ? 77 GLY A HA2  9  
ATOM 10939 H HA3  . GLY A 1 77 ? 8.371  -6.789  0.375   1.00 0.00 ? 77 GLY A HA3  9  
ATOM 10940 N N    . PHE A 1 78 ? 9.533  -8.101  2.113   1.00 0.00 ? 78 PHE A N    9  
ATOM 10941 C CA   . PHE A 1 78 ? 10.316 -8.971  2.974   1.00 0.00 ? 78 PHE A CA   9  
ATOM 10942 C C    . PHE A 1 78 ? 9.731  -10.381 2.951   1.00 0.00 ? 78 PHE A C    9  
ATOM 10943 O O    . PHE A 1 78 ? 10.469 -11.366 2.986   1.00 0.00 ? 78 PHE A O    9  
ATOM 10944 C CB   . PHE A 1 78 ? 10.356 -8.429  4.409   1.00 0.00 ? 78 PHE A CB   9  
ATOM 10945 C CG   . PHE A 1 78 ? 11.415 -9.076  5.263   1.00 0.00 ? 78 PHE A CG   9  
ATOM 10946 C CD1  . PHE A 1 78 ? 12.752 -8.737  5.102   1.00 0.00 ? 78 PHE A CD1  9  
ATOM 10947 C CD2  . PHE A 1 78 ? 11.068 -10.022 6.216   1.00 0.00 ? 78 PHE A CD2  9  
ATOM 10948 C CE1  . PHE A 1 78 ? 13.730 -9.328  5.881   1.00 0.00 ? 78 PHE A CE1  9  
ATOM 10949 C CE2  . PHE A 1 78 ? 12.044 -10.615 6.997   1.00 0.00 ? 78 PHE A CE2  9  
ATOM 10950 C CZ   . PHE A 1 78 ? 13.371 -10.270 6.825   1.00 0.00 ? 78 PHE A CZ   9  
ATOM 10951 H H    . PHE A 1 78 ? 8.671  -8.425  1.784   1.00 0.00 ? 78 PHE A H    9  
ATOM 10952 H HA   . PHE A 1 78 ? 11.314 -9.011  2.568   1.00 0.00 ? 78 PHE A HA   9  
ATOM 10953 H HB2  . PHE A 1 78 ? 10.557 -7.362  4.386   1.00 0.00 ? 78 PHE A HB2  9  
ATOM 10954 H HB3  . PHE A 1 78 ? 9.397  -8.596  4.871   1.00 0.00 ? 78 PHE A HB3  9  
ATOM 10955 H HD1  . PHE A 1 78 ? 13.032 -8.010  4.361   1.00 0.00 ? 78 PHE A HD1  9  
ATOM 10956 H HD2  . PHE A 1 78 ? 10.032 -10.294 6.352   1.00 0.00 ? 78 PHE A HD2  9  
ATOM 10957 H HE1  . PHE A 1 78 ? 14.760 -9.065  5.746   1.00 0.00 ? 78 PHE A HE1  9  
ATOM 10958 H HE2  . PHE A 1 78 ? 11.772 -11.369 7.730   1.00 0.00 ? 78 PHE A HE2  9  
ATOM 10959 H HZ   . PHE A 1 78 ? 14.131 -10.739 7.423   1.00 0.00 ? 78 PHE A HZ   9  
ATOM 10960 N N    . GLU A 1 79 ? 8.418  -10.460 2.886   1.00 0.00 ? 79 GLU A N    9  
ATOM 10961 C CA   . GLU A 1 79 ? 7.741  -11.753 2.834   1.00 0.00 ? 79 GLU A CA   9  
ATOM 10962 C C    . GLU A 1 79 ? 8.094  -12.455 1.535   1.00 0.00 ? 79 GLU A C    9  
ATOM 10963 O O    . GLU A 1 79 ? 8.307  -13.674 1.495   1.00 0.00 ? 79 GLU A O    9  
ATOM 10964 C CB   . GLU A 1 79 ? 6.220  -11.572 2.920   1.00 0.00 ? 79 GLU A CB   9  
ATOM 10965 C CG   . GLU A 1 79 ? 5.760  -10.542 3.944   1.00 0.00 ? 79 GLU A CG   9  
ATOM 10966 C CD   . GLU A 1 79 ? 5.808  -9.130  3.382   1.00 0.00 ? 79 GLU A CD   9  
ATOM 10967 O OE1  . GLU A 1 79 ? 4.866  -8.738  2.667   1.00 0.00 ? 79 GLU A OE1  9  
ATOM 10968 O OE2  . GLU A 1 79 ? 6.803  -8.419  3.646   1.00 0.00 ? 79 GLU A OE2  9  
ATOM 10969 H H    . GLU A 1 79 ? 7.882  -9.636  2.898   1.00 0.00 ? 79 GLU A H    9  
ATOM 10970 H HA   . GLU A 1 79 ? 8.082  -12.334 3.665   1.00 0.00 ? 79 GLU A HA   9  
ATOM 10971 H HB2  . GLU A 1 79 ? 5.858  -11.271 1.945   1.00 0.00 ? 79 GLU A HB2  9  
ATOM 10972 H HB3  . GLU A 1 79 ? 5.780  -12.536 3.182   1.00 0.00 ? 79 GLU A HB3  9  
ATOM 10973 H HG2  . GLU A 1 79 ? 4.743  -10.756 4.232   1.00 0.00 ? 79 GLU A HG2  9  
ATOM 10974 H HG3  . GLU A 1 79 ? 6.399  -10.587 4.809   1.00 0.00 ? 79 GLU A HG3  9  
ATOM 10975 N N    . GLU A 1 80 ? 8.209  -11.690 0.469   1.00 0.00 ? 80 GLU A N    9  
ATOM 10976 C CA   . GLU A 1 80 ? 8.476  -12.232 -0.855  1.00 0.00 ? 80 GLU A CA   9  
ATOM 10977 C C    . GLU A 1 80 ? 9.981  -12.377 -1.110  1.00 0.00 ? 80 GLU A C    9  
ATOM 10978 O O    . GLU A 1 80 ? 10.406 -12.642 -2.235  1.00 0.00 ? 80 GLU A O    9  
ATOM 10979 C CB   . GLU A 1 80 ? 7.856  -11.344 -1.931  1.00 0.00 ? 80 GLU A CB   9  
ATOM 10980 C CG   . GLU A 1 80 ? 6.338  -11.339 -1.896  1.00 0.00 ? 80 GLU A CG   9  
ATOM 10981 C CD   . GLU A 1 80 ? 5.740  -10.650 -3.105  1.00 0.00 ? 80 GLU A CD   9  
ATOM 10982 O OE1  . GLU A 1 80 ? 5.739  -11.257 -4.197  1.00 0.00 ? 80 GLU A OE1  9  
ATOM 10983 O OE2  . GLU A 1 80 ? 5.265  -9.501  -2.962  1.00 0.00 ? 80 GLU A OE2  9  
ATOM 10984 H H    . GLU A 1 80 ? 8.098  -10.715 0.580   1.00 0.00 ? 80 GLU A H    9  
ATOM 10985 H HA   . GLU A 1 80 ? 8.025  -13.214 -0.925  1.00 0.00 ? 80 GLU A HA   9  
ATOM 10986 H HB2  . GLU A 1 80 ? 8.206  -10.329 -1.802  1.00 0.00 ? 80 GLU A HB2  9  
ATOM 10987 H HB3  . GLU A 1 80 ? 8.162  -11.699 -2.903  1.00 0.00 ? 80 GLU A HB3  9  
ATOM 10988 H HG2  . GLU A 1 80 ? 5.986  -12.351 -1.863  1.00 0.00 ? 80 GLU A HG2  9  
ATOM 10989 H HG3  . GLU A 1 80 ? 6.024  -10.800 -1.009  1.00 0.00 ? 80 GLU A HG3  9  
ATOM 10990 N N    . MET A 1 4  ? 11.592 7.304   -18.829 1.00 0.00 ? 4  MET A N    10 
ATOM 10991 C CA   . MET A 1 4  ? 12.040 7.588   -17.486 1.00 0.00 ? 4  MET A CA   10 
ATOM 10992 C C    . MET A 1 4  ? 11.042 7.006   -16.485 1.00 0.00 ? 4  MET A C    10 
ATOM 10993 O O    . MET A 1 4  ? 9.897  6.765   -16.837 1.00 0.00 ? 4  MET A O    10 
ATOM 10994 C CB   . MET A 1 4  ? 12.169 9.113   -17.310 1.00 0.00 ? 4  MET A CB   10 
ATOM 10995 C CG   . MET A 1 4  ? 13.124 9.548   -16.207 1.00 0.00 ? 4  MET A CG   10 
ATOM 10996 S SD   . MET A 1 4  ? 12.400 9.535   -14.564 1.00 0.00 ? 4  MET A SD   10 
ATOM 10997 C CE   . MET A 1 4  ? 13.754 10.210  -13.588 1.00 0.00 ? 4  MET A CE   10 
ATOM 10998 H H    . MET A 1 4  ? 11.211 8.032   -19.361 1.00 0.00 ? 4  MET A H    10 
ATOM 10999 H HA   . MET A 1 4  ? 13.011 7.132   -17.345 1.00 0.00 ? 4  MET A HA   10 
ATOM 11000 H HB2  . MET A 1 4  ? 12.494 9.541   -18.243 1.00 0.00 ? 4  MET A HB2  10 
ATOM 11001 H HB3  . MET A 1 4  ? 11.193 9.518   -17.063 1.00 0.00 ? 4  MET A HB3  10 
ATOM 11002 H HG2  . MET A 1 4  ? 13.973 8.878   -16.218 1.00 0.00 ? 4  MET A HG2  10 
ATOM 11003 H HG3  . MET A 1 4  ? 13.470 10.555  -16.435 1.00 0.00 ? 4  MET A HG3  10 
ATOM 11004 H HE1  . MET A 1 4  ? 13.468 10.241  -12.536 1.00 0.00 ? 4  MET A HE1  10 
ATOM 11005 H HE2  . MET A 1 4  ? 13.979 11.214  -13.933 1.00 0.00 ? 4  MET A HE2  10 
ATOM 11006 H HE3  . MET A 1 4  ? 14.625 9.595   -13.705 1.00 0.00 ? 4  MET A HE3  10 
ATOM 11007 N N    . ARG A 1 5  ? 11.496 6.787   -15.265 1.00 0.00 ? 5  ARG A N    10 
ATOM 11008 C CA   . ARG A 1 5  ? 10.644 6.238   -14.208 1.00 0.00 ? 5  ARG A CA   10 
ATOM 11009 C C    . ARG A 1 5  ? 9.394  7.093   -13.984 1.00 0.00 ? 5  ARG A C    10 
ATOM 11010 O O    . ARG A 1 5  ? 8.348  6.593   -13.575 1.00 0.00 ? 5  ARG A O    10 
ATOM 11011 C CB   . ARG A 1 5  ? 11.430 6.147   -12.904 1.00 0.00 ? 5  ARG A CB   10 
ATOM 11012 C CG   . ARG A 1 5  ? 10.860 5.159   -11.903 1.00 0.00 ? 5  ARG A CG   10 
ATOM 11013 C CD   . ARG A 1 5  ? 10.933 3.738   -12.424 1.00 0.00 ? 5  ARG A CD   10 
ATOM 11014 N NE   . ARG A 1 5  ? 10.608 2.771   -11.380 1.00 0.00 ? 5  ARG A NE   10 
ATOM 11015 C CZ   . ARG A 1 5  ? 10.540 1.459   -11.566 1.00 0.00 ? 5  ARG A CZ   10 
ATOM 11016 N NH1  . ARG A 1 5  ? 10.750 0.924   -12.766 1.00 0.00 ? 5  ARG A NH1  10 
ATOM 11017 N NH2  . ARG A 1 5  ? 10.289 0.676   -10.525 1.00 0.00 ? 5  ARG A NH2  10 
ATOM 11018 H H    . ARG A 1 5  ? 12.416 7.020   -15.050 1.00 0.00 ? 5  ARG A H    10 
ATOM 11019 H HA   . ARG A 1 5  ? 10.335 5.254   -14.513 1.00 0.00 ? 5  ARG A HA   10 
ATOM 11020 H HB2  . ARG A 1 5  ? 12.452 5.863   -13.128 1.00 0.00 ? 5  ARG A HB2  10 
ATOM 11021 H HB3  . ARG A 1 5  ? 11.440 7.128   -12.445 1.00 0.00 ? 5  ARG A HB3  10 
ATOM 11022 H HG2  . ARG A 1 5  ? 11.434 5.236   -10.999 1.00 0.00 ? 5  ARG A HG2  10 
ATOM 11023 H HG3  . ARG A 1 5  ? 9.825  5.423   -11.704 1.00 0.00 ? 5  ARG A HG3  10 
ATOM 11024 H HD2  . ARG A 1 5  ? 10.236 3.619   -13.246 1.00 0.00 ? 5  ARG A HD2  10 
ATOM 11025 H HD3  . ARG A 1 5  ? 11.936 3.534   -12.762 1.00 0.00 ? 5  ARG A HD3  10 
ATOM 11026 H HE   . ARG A 1 5  ? 10.432 3.140   -10.481 1.00 0.00 ? 5  ARG A HE   10 
ATOM 11027 H HH11 . ARG A 1 5  ? 10.935 1.523   -13.551 1.00 0.00 ? 5  ARG A HH11 10 
ATOM 11028 H HH12 . ARG A 1 5  ? 10.722 -0.071  -12.889 1.00 0.00 ? 5  ARG A HH12 10 
ATOM 11029 H HH21 . ARG A 1 5  ? 10.126 1.069   -9.630  1.00 0.00 ? 5  ARG A HH21 10 
ATOM 11030 H HH22 . ARG A 1 5  ? 10.278 -0.330  -10.636 1.00 0.00 ? 5  ARG A HH22 10 
ATOM 11031 N N    . SER A 1 6  ? 9.504  8.386   -14.282 1.00 0.00 ? 6  SER A N    10 
ATOM 11032 C CA   . SER A 1 6  ? 8.421  9.334   -14.071 1.00 0.00 ? 6  SER A CA   10 
ATOM 11033 C C    . SER A 1 6  ? 7.365  9.268   -15.194 1.00 0.00 ? 6  SER A C    10 
ATOM 11034 O O    . SER A 1 6  ? 6.500  10.136  -15.294 1.00 0.00 ? 6  SER A O    10 
ATOM 11035 C CB   . SER A 1 6  ? 8.988  10.759  -13.975 1.00 0.00 ? 6  SER A CB   10 
ATOM 11036 O OG   . SER A 1 6  ? 10.082 10.803  -13.069 1.00 0.00 ? 6  SER A OG   10 
ATOM 11037 H H    . SER A 1 6  ? 10.345 8.713   -14.671 1.00 0.00 ? 6  SER A H    10 
ATOM 11038 H HA   . SER A 1 6  ? 7.936  9.099   -13.127 1.00 0.00 ? 6  SER A HA   10 
ATOM 11039 H HB2  . SER A 1 6  ? 9.335  11.075  -14.951 1.00 0.00 ? 6  SER A HB2  10 
ATOM 11040 H HB3  . SER A 1 6  ? 8.221  11.434  -13.634 1.00 0.00 ? 6  SER A HB3  10 
ATOM 11041 H HG   . SER A 1 6  ? 10.900 10.629  -13.543 1.00 0.00 ? 6  SER A HG   10 
ATOM 11042 N N    . GLU A 1 7  ? 7.432  8.221   -16.022 1.00 0.00 ? 7  GLU A N    10 
ATOM 11043 C CA   . GLU A 1 7  ? 6.503  8.051   -17.155 1.00 0.00 ? 7  GLU A CA   10 
ATOM 11044 C C    . GLU A 1 7  ? 5.111  7.611   -16.710 1.00 0.00 ? 7  GLU A C    10 
ATOM 11045 O O    . GLU A 1 7  ? 4.264  7.278   -17.540 1.00 0.00 ? 7  GLU A O    10 
ATOM 11046 C CB   . GLU A 1 7  ? 7.070  7.032   -18.144 1.00 0.00 ? 7  GLU A CB   10 
ATOM 11047 C CG   . GLU A 1 7  ? 7.747  7.661   -19.354 1.00 0.00 ? 7  GLU A CG   10 
ATOM 11048 C CD   . GLU A 1 7  ? 6.754  8.335   -20.276 1.00 0.00 ? 7  GLU A CD   10 
ATOM 11049 O OE1  . GLU A 1 7  ? 6.380  9.495   -20.014 1.00 0.00 ? 7  GLU A OE1  10 
ATOM 11050 O OE2  . GLU A 1 7  ? 6.351  7.694   -21.275 1.00 0.00 ? 7  GLU A OE2  10 
ATOM 11051 H H    . GLU A 1 7  ? 8.124  7.555   -15.873 1.00 0.00 ? 7  GLU A H    10 
ATOM 11052 H HA   . GLU A 1 7  ? 6.409  8.995   -17.648 1.00 0.00 ? 7  GLU A HA   10 
ATOM 11053 H HB2  . GLU A 1 7  ? 7.798  6.415   -17.639 1.00 0.00 ? 7  GLU A HB2  10 
ATOM 11054 H HB3  . GLU A 1 7  ? 6.272  6.393   -18.505 1.00 0.00 ? 7  GLU A HB3  10 
ATOM 11055 H HG2  . GLU A 1 7  ? 8.453  8.411   -19.011 1.00 0.00 ? 7  GLU A HG2  10 
ATOM 11056 H HG3  . GLU A 1 7  ? 8.285  6.905   -19.909 1.00 0.00 ? 7  GLU A HG3  10 
ATOM 11057 N N    . PHE A 1 8  ? 4.874  7.586   -15.403 1.00 0.00 ? 8  PHE A N    10 
ATOM 11058 C CA   . PHE A 1 8  ? 3.569  7.203   -14.884 1.00 0.00 ? 8  PHE A CA   10 
ATOM 11059 C C    . PHE A 1 8  ? 2.524  8.296   -15.153 1.00 0.00 ? 8  PHE A C    10 
ATOM 11060 O O    . PHE A 1 8  ? 2.876  9.357   -15.672 1.00 0.00 ? 8  PHE A O    10 
ATOM 11061 C CB   . PHE A 1 8  ? 3.670  6.895   -13.398 1.00 0.00 ? 8  PHE A CB   10 
ATOM 11062 C CG   . PHE A 1 8  ? 4.303  5.565   -13.120 1.00 0.00 ? 8  PHE A CG   10 
ATOM 11063 C CD1  . PHE A 1 8  ? 5.665  5.381   -13.311 1.00 0.00 ? 8  PHE A CD1  10 
ATOM 11064 C CD2  . PHE A 1 8  ? 3.547  4.496   -12.695 1.00 0.00 ? 8  PHE A CD2  10 
ATOM 11065 C CE1  . PHE A 1 8  ? 6.256  4.165   -13.074 1.00 0.00 ? 8  PHE A CE1  10 
ATOM 11066 C CE2  . PHE A 1 8  ? 4.132  3.269   -12.447 1.00 0.00 ? 8  PHE A CE2  10 
ATOM 11067 C CZ   . PHE A 1 8  ? 5.491  3.104   -12.633 1.00 0.00 ? 8  PHE A CZ   10 
ATOM 11068 H H    . PHE A 1 8  ? 5.598  7.825   -14.786 1.00 0.00 ? 8  PHE A H    10 
ATOM 11069 H HA   . PHE A 1 8  ? 3.253  6.317   -15.403 1.00 0.00 ? 8  PHE A HA   10 
ATOM 11070 H HB2  . PHE A 1 8  ? 4.256  7.660   -12.902 1.00 0.00 ? 8  PHE A HB2  10 
ATOM 11071 H HB3  . PHE A 1 8  ? 2.677  6.889   -12.967 1.00 0.00 ? 8  PHE A HB3  10 
ATOM 11072 H HD1  . PHE A 1 8  ? 6.266  6.212   -13.660 1.00 0.00 ? 8  PHE A HD1  10 
ATOM 11073 H HD2  . PHE A 1 8  ? 2.485  4.622   -12.548 1.00 0.00 ? 8  PHE A HD2  10 
ATOM 11074 H HE1  . PHE A 1 8  ? 7.313  4.037   -13.234 1.00 0.00 ? 8  PHE A HE1  10 
ATOM 11075 H HE2  . PHE A 1 8  ? 3.527  2.450   -12.116 1.00 0.00 ? 8  PHE A HE2  10 
ATOM 11076 H HZ   . PHE A 1 8  ? 5.956  2.142   -12.436 1.00 0.00 ? 8  PHE A HZ   10 
ATOM 11077 N N    . ALA A 1 9  ? 1.278  8.030   -14.769 1.00 0.00 ? 9  ALA A N    10 
ATOM 11078 C CA   . ALA A 1 9  ? 0.139  8.881   -15.155 1.00 0.00 ? 9  ALA A CA   10 
ATOM 11079 C C    . ALA A 1 9  ? 0.411  10.367  -14.953 1.00 0.00 ? 9  ALA A C    10 
ATOM 11080 O O    . ALA A 1 9  ? 0.178  11.179  -15.844 1.00 0.00 ? 9  ALA A O    10 
ATOM 11081 C CB   . ALA A 1 9  ? -1.100 8.463   -14.390 1.00 0.00 ? 9  ALA A CB   10 
ATOM 11082 H H    . ALA A 1 9  ? 1.107  7.243   -14.209 1.00 0.00 ? 9  ALA A H    10 
ATOM 11083 H HA   . ALA A 1 9  ? -0.051 8.708   -16.198 1.00 0.00 ? 9  ALA A HA   10 
ATOM 11084 H HB1  . ALA A 1 9  ? -1.227 7.396   -14.473 1.00 0.00 ? 9  ALA A HB1  10 
ATOM 11085 H HB2  . ALA A 1 9  ? -1.964 8.972   -14.801 1.00 0.00 ? 9  ALA A HB2  10 
ATOM 11086 H HB3  . ALA A 1 9  ? -0.989 8.733   -13.358 1.00 0.00 ? 9  ALA A HB3  10 
ATOM 11087 N N    . SER A 1 10 ? 0.915  10.723  -13.782 1.00 0.00 ? 10 SER A N    10 
ATOM 11088 C CA   . SER A 1 10 ? 1.243  12.116  -13.505 1.00 0.00 ? 10 SER A CA   10 
ATOM 11089 C C    . SER A 1 10 ? 2.671  12.222  -12.983 1.00 0.00 ? 10 SER A C    10 
ATOM 11090 O O    . SER A 1 10 ? 3.049  13.207  -12.379 1.00 0.00 ? 10 SER A O    10 
ATOM 11091 C CB   . SER A 1 10 ? 0.252  12.680  -12.489 1.00 0.00 ? 10 SER A CB   10 
ATOM 11092 O OG   . SER A 1 10 ? 0.296  14.102  -12.457 1.00 0.00 ? 10 SER A OG   10 
ATOM 11093 H H    . SER A 1 10 ? 1.056  10.036  -13.089 1.00 0.00 ? 10 SER A H    10 
ATOM 11094 H HA   . SER A 1 10 ? 1.151  12.672  -14.430 1.00 0.00 ? 10 SER A HA   10 
ATOM 11095 H HB2  . SER A 1 10 ? -0.752 12.369  -12.735 1.00 0.00 ? 10 SER A HB2  10 
ATOM 11096 H HB3  . SER A 1 10 ? 0.503  12.308  -11.502 1.00 0.00 ? 10 SER A HB3  10 
ATOM 11097 H HG   . SER A 1 10 ? 0.374  14.437  -13.368 1.00 0.00 ? 10 SER A HG   10 
ATOM 11098 N N    . GLY A 1 11 ? 3.460  11.172  -13.225 1.00 0.00 ? 11 GLY A N    10 
ATOM 11099 C CA   . GLY A 1 11 ? 4.837  11.129  -12.751 1.00 0.00 ? 11 GLY A CA   10 
ATOM 11100 C C    . GLY A 1 11 ? 4.924  10.874  -11.253 1.00 0.00 ? 11 GLY A C    10 
ATOM 11101 O O    . GLY A 1 11 ? 5.472  9.855   -10.827 1.00 0.00 ? 11 GLY A O    10 
ATOM 11102 H H    . GLY A 1 11 ? 3.108  10.427  -13.759 1.00 0.00 ? 11 GLY A H    10 
ATOM 11103 H HA2  . GLY A 1 11 ? 5.370  10.346  -13.272 1.00 0.00 ? 11 GLY A HA2  10 
ATOM 11104 H HA3  . GLY A 1 11 ? 5.306  12.077  -12.966 1.00 0.00 ? 11 GLY A HA3  10 
ATOM 11105 N N    . ASN A 1 12 ? 4.335  11.768  -10.473 1.00 0.00 ? 12 ASN A N    10 
ATOM 11106 C CA   . ASN A 1 12 ? 4.295  11.635  -9.021  1.00 0.00 ? 12 ASN A CA   10 
ATOM 11107 C C    . ASN A 1 12 ? 3.533  10.383  -8.607  1.00 0.00 ? 12 ASN A C    10 
ATOM 11108 O O    . ASN A 1 12 ? 3.737  9.855   -7.509  1.00 0.00 ? 12 ASN A O    10 
ATOM 11109 C CB   . ASN A 1 12 ? 3.651  12.869  -8.378  1.00 0.00 ? 12 ASN A CB   10 
ATOM 11110 C CG   . ASN A 1 12 ? 4.500  14.111  -8.479  1.00 0.00 ? 12 ASN A CG   10 
ATOM 11111 O OD1  . ASN A 1 12 ? 5.393  14.315  -7.674  1.00 0.00 ? 12 ASN A OD1  10 
ATOM 11112 N ND2  . ASN A 1 12 ? 4.231  14.952  -9.464  1.00 0.00 ? 12 ASN A ND2  10 
ATOM 11113 H H    . ASN A 1 12 ? 3.930  12.565  -10.894 1.00 0.00 ? 12 ASN A H    10 
ATOM 11114 H HA   . ASN A 1 12 ? 5.302  11.549  -8.669  1.00 0.00 ? 12 ASN A HA   10 
ATOM 11115 H HB2  . ASN A 1 12 ? 2.709  13.069  -8.868  1.00 0.00 ? 12 ASN A HB2  10 
ATOM 11116 H HB3  . ASN A 1 12 ? 3.468  12.653  -7.333  1.00 0.00 ? 12 ASN A HB3  10 
ATOM 11117 H HD21 . ASN A 1 12 ? 3.490  14.735  -10.089 1.00 0.00 ? 12 ASN A HD21 10 
ATOM 11118 H HD22 . ASN A 1 12 ? 4.763  15.779  -9.529  1.00 0.00 ? 12 ASN A HD22 10 
ATOM 11119 N N    . THR A 1 13 ? 2.620  9.923   -9.464  1.00 0.00 ? 13 THR A N    10 
ATOM 11120 C CA   . THR A 1 13 ? 1.796  8.759   -9.178  1.00 0.00 ? 13 THR A CA   10 
ATOM 11121 C C    . THR A 1 13 ? 2.632  7.557   -8.739  1.00 0.00 ? 13 THR A C    10 
ATOM 11122 O O    . THR A 1 13 ? 2.201  6.748   -7.919  1.00 0.00 ? 13 THR A O    10 
ATOM 11123 C CB   . THR A 1 13 ? 0.980  8.375   -10.429 1.00 0.00 ? 13 THR A CB   10 
ATOM 11124 O OG1  . THR A 1 13 ? 0.617  9.567   -11.147 1.00 0.00 ? 13 THR A OG1  10 
ATOM 11125 C CG2  . THR A 1 13 ? -0.282 7.611   -10.047 1.00 0.00 ? 13 THR A CG2  10 
ATOM 11126 H H    . THR A 1 13 ? 2.484  10.386  -10.315 1.00 0.00 ? 13 THR A H    10 
ATOM 11127 H HA   . THR A 1 13 ? 1.102  9.025   -8.393  1.00 0.00 ? 13 THR A HA   10 
ATOM 11128 H HB   . THR A 1 13 ? 1.590  7.748   -11.056 1.00 0.00 ? 13 THR A HB   10 
ATOM 11129 H HG1  . THR A 1 13 ? 0.266  10.225  -10.512 1.00 0.00 ? 13 THR A HG1  10 
ATOM 11130 H HG21 . THR A 1 13 ? -0.838 7.362   -10.944 1.00 0.00 ? 13 THR A HG21 10 
ATOM 11131 H HG22 . THR A 1 13 ? -0.897 8.224   -9.405  1.00 0.00 ? 13 THR A HG22 10 
ATOM 11132 H HG23 . THR A 1 13 ? -0.015 6.710   -9.522  1.00 0.00 ? 13 THR A HG23 10 
ATOM 11133 N N    . TYR A 1 14 ? 3.853  7.459   -9.267  1.00 0.00 ? 14 TYR A N    10 
ATOM 11134 C CA   . TYR A 1 14 ? 4.739  6.375   -8.912  1.00 0.00 ? 14 TYR A CA   10 
ATOM 11135 C C    . TYR A 1 14 ? 5.141  6.485   -7.442  1.00 0.00 ? 14 TYR A C    10 
ATOM 11136 O O    . TYR A 1 14 ? 5.022  5.520   -6.683  1.00 0.00 ? 14 TYR A O    10 
ATOM 11137 C CB   . TYR A 1 14 ? 5.973  6.375   -9.813  1.00 0.00 ? 14 TYR A CB   10 
ATOM 11138 C CG   . TYR A 1 14 ? 6.971  5.298   -9.437  1.00 0.00 ? 14 TYR A CG   10 
ATOM 11139 C CD1  . TYR A 1 14 ? 6.639  3.962   -9.553  1.00 0.00 ? 14 TYR A CD1  10 
ATOM 11140 C CD2  . TYR A 1 14 ? 8.230  5.634   -8.969  1.00 0.00 ? 14 TYR A CD2  10 
ATOM 11141 C CE1  . TYR A 1 14 ? 7.529  2.981   -9.201  1.00 0.00 ? 14 TYR A CE1  10 
ATOM 11142 C CE2  . TYR A 1 14 ? 9.131  4.655   -8.607  1.00 0.00 ? 14 TYR A CE2  10 
ATOM 11143 C CZ   . TYR A 1 14 ? 8.774  3.325   -8.725  1.00 0.00 ? 14 TYR A CZ   10 
ATOM 11144 O OH   . TYR A 1 14 ? 9.657  2.330   -8.384  1.00 0.00 ? 14 TYR A OH   10 
ATOM 11145 H H    . TYR A 1 14 ? 4.163  8.141   -9.893  1.00 0.00 ? 14 TYR A H    10 
ATOM 11146 H HA   . TYR A 1 14 ? 4.202  5.452   -9.050  1.00 0.00 ? 14 TYR A HA   10 
ATOM 11147 H HB2  . TYR A 1 14 ? 5.671  6.213   -10.835 1.00 0.00 ? 14 TYR A HB2  10 
ATOM 11148 H HB3  . TYR A 1 14 ? 6.471  7.329   -9.741  1.00 0.00 ? 14 TYR A HB3  10 
ATOM 11149 H HD1  . TYR A 1 14 ? 5.669  3.696   -9.932  1.00 0.00 ? 14 TYR A HD1  10 
ATOM 11150 H HD2  . TYR A 1 14 ? 8.494  6.668   -8.885  1.00 0.00 ? 14 TYR A HD2  10 
ATOM 11151 H HE1  . TYR A 1 14 ? 7.246  1.934   -9.289  1.00 0.00 ? 14 TYR A HE1  10 
ATOM 11152 H HE2  . TYR A 1 14 ? 10.117 4.911   -8.240  1.00 0.00 ? 14 TYR A HE2  10 
ATOM 11153 H HH   . TYR A 1 14 ? 10.113 2.581   -7.565  1.00 0.00 ? 14 TYR A HH   10 
ATOM 11154 N N    . ALA A 1 15 ? 5.586  7.670   -7.060  1.00 0.00 ? 15 ALA A N    10 
ATOM 11155 C CA   . ALA A 1 15 ? 5.975  7.952   -5.682  1.00 0.00 ? 15 ALA A CA   10 
ATOM 11156 C C    . ALA A 1 15 ? 4.820  7.711   -4.732  1.00 0.00 ? 15 ALA A C    10 
ATOM 11157 O O    . ALA A 1 15 ? 5.021  7.308   -3.592  1.00 0.00 ? 15 ALA A O    10 
ATOM 11158 C CB   . ALA A 1 15 ? 6.459  9.380   -5.557  1.00 0.00 ? 15 ALA A CB   10 
ATOM 11159 H H    . ALA A 1 15 ? 5.687  8.375   -7.730  1.00 0.00 ? 15 ALA A H    10 
ATOM 11160 H HA   . ALA A 1 15 ? 6.793  7.298   -5.435  1.00 0.00 ? 15 ALA A HA   10 
ATOM 11161 H HB1  . ALA A 1 15 ? 5.656  10.048  -5.812  1.00 0.00 ? 15 ALA A HB1  10 
ATOM 11162 H HB2  . ALA A 1 15 ? 7.291  9.544   -6.235  1.00 0.00 ? 15 ALA A HB2  10 
ATOM 11163 H HB3  . ALA A 1 15 ? 6.777  9.553   -4.539  1.00 0.00 ? 15 ALA A HB3  10 
ATOM 11164 N N    . LEU A 1 16 ? 3.611  7.962   -5.211  1.00 0.00 ? 16 LEU A N    10 
ATOM 11165 C CA   . LEU A 1 16 ? 2.410  7.761   -4.417  1.00 0.00 ? 16 LEU A CA   10 
ATOM 11166 C C    . LEU A 1 16 ? 2.127  6.269   -4.285  1.00 0.00 ? 16 LEU A C    10 
ATOM 11167 O O    . LEU A 1 16 ? 1.838  5.775   -3.192  1.00 0.00 ? 16 LEU A O    10 
ATOM 11168 C CB   . LEU A 1 16 ? 1.201  8.458   -5.067  1.00 0.00 ? 16 LEU A CB   10 
ATOM 11169 C CG   . LEU A 1 16 ? -0.119 8.287   -4.330  1.00 0.00 ? 16 LEU A CG   10 
ATOM 11170 C CD1  . LEU A 1 16 ? -0.061 8.943   -2.950  1.00 0.00 ? 16 LEU A CD1  10 
ATOM 11171 C CD2  . LEU A 1 16 ? -1.248 8.891   -5.135  1.00 0.00 ? 16 LEU A CD2  10 
ATOM 11172 H H    . LEU A 1 16 ? 3.508  8.260   -6.131  1.00 0.00 ? 16 LEU A H    10 
ATOM 11173 H HA   . LEU A 1 16 ? 2.591  8.173   -3.444  1.00 0.00 ? 16 LEU A HA   10 
ATOM 11174 H HB2  . LEU A 1 16 ? 1.412  9.513   -5.134  1.00 0.00 ? 16 LEU A HB2  10 
ATOM 11175 H HB3  . LEU A 1 16 ? 1.093  8.054   -6.069  1.00 0.00 ? 16 LEU A HB3  10 
ATOM 11176 H HG   . LEU A 1 16 ? -0.327 7.236   -4.187  1.00 0.00 ? 16 LEU A HG   10 
ATOM 11177 H HD11 . LEU A 1 16 ? -0.998 8.813   -2.448  1.00 0.00 ? 16 LEU A HD11 10 
ATOM 11178 H HD12 . LEU A 1 16 ? 0.147  9.994   -3.065  1.00 0.00 ? 16 LEU A HD12 10 
ATOM 11179 H HD13 . LEU A 1 16 ? 0.717  8.490   -2.364  1.00 0.00 ? 16 LEU A HD13 10 
ATOM 11180 H HD21 . LEU A 1 16 ? -1.057 9.947   -5.285  1.00 0.00 ? 16 LEU A HD21 10 
ATOM 11181 H HD22 . LEU A 1 16 ? -2.176 8.778   -4.608  1.00 0.00 ? 16 LEU A HD22 10 
ATOM 11182 H HD23 . LEU A 1 16 ? -1.322 8.388   -6.086  1.00 0.00 ? 16 LEU A HD23 10 
ATOM 11183 N N    . TYR A 1 17 ? 2.211  5.566   -5.405  1.00 0.00 ? 17 TYR A N    10 
ATOM 11184 C CA   . TYR A 1 17 ? 1.921  4.140   -5.456  1.00 0.00 ? 17 TYR A CA   10 
ATOM 11185 C C    . TYR A 1 17 ? 2.843  3.366   -4.517  1.00 0.00 ? 17 TYR A C    10 
ATOM 11186 O O    . TYR A 1 17 ? 2.380  2.610   -3.659  1.00 0.00 ? 17 TYR A O    10 
ATOM 11187 C CB   . TYR A 1 17 ? 2.078  3.624   -6.892  1.00 0.00 ? 17 TYR A CB   10 
ATOM 11188 C CG   . TYR A 1 17 ? 1.539  2.222   -7.096  1.00 0.00 ? 17 TYR A CG   10 
ATOM 11189 C CD1  . TYR A 1 17 ? 0.192  2.032   -7.360  1.00 0.00 ? 17 TYR A CD1  10 
ATOM 11190 C CD2  . TYR A 1 17 ? 2.374  1.110   -7.041  1.00 0.00 ? 17 TYR A CD2  10 
ATOM 11191 C CE1  . TYR A 1 17 ? -0.322 0.760   -7.557  1.00 0.00 ? 17 TYR A CE1  10 
ATOM 11192 C CE2  . TYR A 1 17 ? 1.869  -0.153  -7.240  1.00 0.00 ? 17 TYR A CE2  10 
ATOM 11193 C CZ   . TYR A 1 17 ? 0.522  -0.328  -7.499  1.00 0.00 ? 17 TYR A CZ   10 
ATOM 11194 O OH   . TYR A 1 17 ? 0.028  -1.596  -7.710  1.00 0.00 ? 17 TYR A OH   10 
ATOM 11195 H H    . TYR A 1 17 ? 2.428  6.022   -6.248  1.00 0.00 ? 17 TYR A H    10 
ATOM 11196 H HA   . TYR A 1 17 ? 0.900  4.000   -5.145  1.00 0.00 ? 17 TYR A HA   10 
ATOM 11197 H HB2  . TYR A 1 17 ? 1.555  4.289   -7.559  1.00 0.00 ? 17 TYR A HB2  10 
ATOM 11198 H HB3  . TYR A 1 17 ? 3.137  3.618   -7.137  1.00 0.00 ? 17 TYR A HB3  10 
ATOM 11199 H HD1  . TYR A 1 17 ? -0.468 2.890   -7.410  1.00 0.00 ? 17 TYR A HD1  10 
ATOM 11200 H HD2  . TYR A 1 17 ? 3.427  1.250   -6.840  1.00 0.00 ? 17 TYR A HD2  10 
ATOM 11201 H HE1  . TYR A 1 17 ? -1.375 0.615   -7.766  1.00 0.00 ? 17 TYR A HE1  10 
ATOM 11202 H HE2  . TYR A 1 17 ? 2.537  -1.007  -7.199  1.00 0.00 ? 17 TYR A HE2  10 
ATOM 11203 H HH   . TYR A 1 17 ? 0.378  -2.197  -7.034  1.00 0.00 ? 17 TYR A HH   10 
ATOM 11204 N N    . VAL A 1 18 ? 4.140  3.579   -4.669  1.00 0.00 ? 18 VAL A N    10 
ATOM 11205 C CA   . VAL A 1 18 ? 5.112  2.936   -3.798  1.00 0.00 ? 18 VAL A CA   10 
ATOM 11206 C C    . VAL A 1 18 ? 4.897  3.367   -2.338  1.00 0.00 ? 18 VAL A C    10 
ATOM 11207 O O    . VAL A 1 18 ? 4.948  2.545   -1.439  1.00 0.00 ? 18 VAL A O    10 
ATOM 11208 C CB   . VAL A 1 18 ? 6.570  3.197   -4.246  1.00 0.00 ? 18 VAL A CB   10 
ATOM 11209 C CG1  . VAL A 1 18 ? 6.797  2.610   -5.641  1.00 0.00 ? 18 VAL A CG1  10 
ATOM 11210 C CG2  . VAL A 1 18 ? 6.904  4.692   -4.222  1.00 0.00 ? 18 VAL A CG2  10 
ATOM 11211 H H    . VAL A 1 18 ? 4.436  4.156   -5.410  1.00 0.00 ? 18 VAL A H    10 
ATOM 11212 H HA   . VAL A 1 18 ? 4.940  1.871   -3.858  1.00 0.00 ? 18 VAL A HA   10 
ATOM 11213 H HB   . VAL A 1 18 ? 7.227  2.690   -3.563  1.00 0.00 ? 18 VAL A HB   10 
ATOM 11214 H HG11 . VAL A 1 18 ? 7.810  2.808   -5.943  1.00 0.00 ? 18 VAL A HG11 10 
ATOM 11215 H HG12 . VAL A 1 18 ? 6.117  3.069   -6.342  1.00 0.00 ? 18 VAL A HG12 10 
ATOM 11216 H HG13 . VAL A 1 18 ? 6.619  1.540   -5.615  1.00 0.00 ? 18 VAL A HG13 10 
ATOM 11217 H HG21 . VAL A 1 18 ? 7.927  4.832   -4.537  1.00 0.00 ? 18 VAL A HG21 10 
ATOM 11218 H HG22 . VAL A 1 18 ? 6.778  5.079   -3.220  1.00 0.00 ? 18 VAL A HG22 10 
ATOM 11219 H HG23 . VAL A 1 18 ? 6.243  5.228   -4.893  1.00 0.00 ? 18 VAL A HG23 10 
ATOM 11220 N N    . ARG A 1 19 ? 4.604  4.639   -2.127  1.00 0.00 ? 19 ARG A N    10 
ATOM 11221 C CA   . ARG A 1 19 ? 4.351  5.167   -0.784  1.00 0.00 ? 19 ARG A CA   10 
ATOM 11222 C C    . ARG A 1 19 ? 3.193  4.431   -0.085  1.00 0.00 ? 19 ARG A C    10 
ATOM 11223 O O    . ARG A 1 19 ? 3.301  4.016   1.063   1.00 0.00 ? 19 ARG A O    10 
ATOM 11224 C CB   . ARG A 1 19 ? 4.032  6.662   -0.855  1.00 0.00 ? 19 ARG A CB   10 
ATOM 11225 C CG   . ARG A 1 19 ? 3.544  7.262   0.453   1.00 0.00 ? 19 ARG A CG   10 
ATOM 11226 C CD   . ARG A 1 19 ? 3.073  8.694   0.253   1.00 0.00 ? 19 ARG A CD   10 
ATOM 11227 N NE   . ARG A 1 19 ? 2.301  9.156   1.399   1.00 0.00 ? 19 ARG A NE   10 
ATOM 11228 C CZ   . ARG A 1 19 ? 1.314  10.060  1.325   1.00 0.00 ? 19 ARG A CZ   10 
ATOM 11229 N NH1  . ARG A 1 19 ? 1.073  10.704  0.204   1.00 0.00 ? 19 ARG A NH1  10 
ATOM 11230 N NH2  . ARG A 1 19 ? 0.598  10.337  2.407   1.00 0.00 ? 19 ARG A NH2  10 
ATOM 11231 H H    . ARG A 1 19 ? 4.557  5.248   -2.886  1.00 0.00 ? 19 ARG A H    10 
ATOM 11232 H HA   . ARG A 1 19 ? 5.243  5.032   -0.196  1.00 0.00 ? 19 ARG A HA   10 
ATOM 11233 H HB2  . ARG A 1 19 ? 4.930  7.189   -1.148  1.00 0.00 ? 19 ARG A HB2  10 
ATOM 11234 H HB3  . ARG A 1 19 ? 3.281  6.813   -1.602  1.00 0.00 ? 19 ARG A HB3  10 
ATOM 11235 H HG2  . ARG A 1 19 ? 2.703  6.666   0.817   1.00 0.00 ? 19 ARG A HG2  10 
ATOM 11236 H HG3  . ARG A 1 19 ? 4.335  7.245   1.180   1.00 0.00 ? 19 ARG A HG3  10 
ATOM 11237 H HD2  . ARG A 1 19 ? 3.943  9.334   0.128   1.00 0.00 ? 19 ARG A HD2  10 
ATOM 11238 H HD3  . ARG A 1 19 ? 2.455  8.745   -0.635  1.00 0.00 ? 19 ARG A HD3  10 
ATOM 11239 H HE   . ARG A 1 19 ? 2.512  8.760   2.277   1.00 0.00 ? 19 ARG A HE   10 
ATOM 11240 H HH11 . ARG A 1 19 ? 1.626  10.534  -0.615  1.00 0.00 ? 19 ARG A HH11 10 
ATOM 11241 H HH12 . ARG A 1 19 ? 0.318  11.377  0.164   1.00 0.00 ? 19 ARG A HH12 10 
ATOM 11242 H HH21 . ARG A 1 19 ? 0.795  9.876   3.265   1.00 0.00 ? 19 ARG A HH21 10 
ATOM 11243 H HH22 . ARG A 1 19 ? -0.148 11.016  2.366   1.00 0.00 ? 19 ARG A HH22 10 
ATOM 11244 N N    . ASP A 1 20 ? 2.108  4.267   -0.816  1.00 0.00 ? 20 ASP A N    10 
ATOM 11245 C CA   . ASP A 1 20 ? 0.881  3.677   -0.259  1.00 0.00 ? 20 ASP A CA   10 
ATOM 11246 C C    . ASP A 1 20 ? 1.001  2.161   -0.073  1.00 0.00 ? 20 ASP A C    10 
ATOM 11247 O O    . ASP A 1 20 ? 0.262  1.559   0.709   1.00 0.00 ? 20 ASP A O    10 
ATOM 11248 C CB   . ASP A 1 20 ? -0.297 3.989   -1.183  1.00 0.00 ? 20 ASP A CB   10 
ATOM 11249 C CG   . ASP A 1 20 ? -1.612 3.482   -0.632  1.00 0.00 ? 20 ASP A CG   10 
ATOM 11250 O OD1  . ASP A 1 20 ? -2.201 4.166   0.227   1.00 0.00 ? 20 ASP A OD1  10 
ATOM 11251 O OD2  . ASP A 1 20 ? -2.073 2.411   -1.081  1.00 0.00 ? 20 ASP A OD2  10 
ATOM 11252 H H    . ASP A 1 20 ? 2.107  4.560   -1.757  1.00 0.00 ? 20 ASP A H    10 
ATOM 11253 H HA   . ASP A 1 20 ? 0.706  4.135   0.703   1.00 0.00 ? 20 ASP A HA   10 
ATOM 11254 H HB2  . ASP A 1 20 ? -0.364 5.047   -1.328  1.00 0.00 ? 20 ASP A HB2  10 
ATOM 11255 H HB3  . ASP A 1 20 ? -0.120 3.509   -2.139  1.00 0.00 ? 20 ASP A HB3  10 
ATOM 11256 N N    . THR A 1 21 ? 1.935  1.545   -0.781  1.00 0.00 ? 21 THR A N    10 
ATOM 11257 C CA   . THR A 1 21 ? 2.087  0.106   -0.752  1.00 0.00 ? 21 THR A CA   10 
ATOM 11258 C C    . THR A 1 21 ? 3.225  -0.319  0.182   1.00 0.00 ? 21 THR A C    10 
ATOM 11259 O O    . THR A 1 21 ? 3.208  -1.403  0.771   1.00 0.00 ? 21 THR A O    10 
ATOM 11260 C CB   . THR A 1 21 ? 2.334  -0.439  -2.175  1.00 0.00 ? 21 THR A CB   10 
ATOM 11261 O OG1  . THR A 1 21 ? 1.393  0.150   -3.083  1.00 0.00 ? 21 THR A OG1  10 
ATOM 11262 C CG2  . THR A 1 21 ? 2.207  -1.949  -2.226  1.00 0.00 ? 21 THR A CG2  10 
ATOM 11263 H H    . THR A 1 21 ? 2.546  2.087   -1.327  1.00 0.00 ? 21 THR A H    10 
ATOM 11264 H HA   . THR A 1 21 ? 1.156  -0.324  -0.381  1.00 0.00 ? 21 THR A HA   10 
ATOM 11265 H HB   . THR A 1 21 ? 3.340  -0.163  -2.475  1.00 0.00 ? 21 THR A HB   10 
ATOM 11266 H HG1  . THR A 1 21 ? 1.756  0.997   -3.403  1.00 0.00 ? 21 THR A HG1  10 
ATOM 11267 H HG21 . THR A 1 21 ? 2.383  -2.288  -3.240  1.00 0.00 ? 21 THR A HG21 10 
ATOM 11268 H HG22 . THR A 1 21 ? 1.215  -2.244  -1.910  1.00 0.00 ? 21 THR A HG22 10 
ATOM 11269 H HG23 . THR A 1 21 ? 2.945  -2.392  -1.569  1.00 0.00 ? 21 THR A HG23 10 
ATOM 11270 N N    . LEU A 1 22 ? 4.221  0.543   0.314   1.00 0.00 ? 22 LEU A N    10 
ATOM 11271 C CA   . LEU A 1 22 ? 5.415  0.252   1.104   1.00 0.00 ? 22 LEU A CA   10 
ATOM 11272 C C    . LEU A 1 22 ? 5.133  0.442   2.589   1.00 0.00 ? 22 LEU A C    10 
ATOM 11273 O O    . LEU A 1 22 ? 4.971  1.561   3.061   1.00 0.00 ? 22 LEU A O    10 
ATOM 11274 C CB   . LEU A 1 22 ? 6.549  1.174   0.690   1.00 0.00 ? 22 LEU A CB   10 
ATOM 11275 C CG   . LEU A 1 22 ? 7.915  0.855   1.266   1.00 0.00 ? 22 LEU A CG   10 
ATOM 11276 C CD1  . LEU A 1 22 ? 8.392  -0.517  0.807   1.00 0.00 ? 22 LEU A CD1  10 
ATOM 11277 C CD2  . LEU A 1 22 ? 8.926  1.922   0.882   1.00 0.00 ? 22 LEU A CD2  10 
ATOM 11278 H H    . LEU A 1 22 ? 4.162  1.408   -0.157  1.00 0.00 ? 22 LEU A H    10 
ATOM 11279 H HA   . LEU A 1 22 ? 5.708  -0.771  0.925   1.00 0.00 ? 22 LEU A HA   10 
ATOM 11280 H HB2  . LEU A 1 22 ? 6.626  1.131   -0.383  1.00 0.00 ? 22 LEU A HB2  10 
ATOM 11281 H HB3  . LEU A 1 22 ? 6.283  2.183   0.971   1.00 0.00 ? 22 LEU A HB3  10 
ATOM 11282 H HG   . LEU A 1 22 ? 7.846  0.835   2.351   1.00 0.00 ? 22 LEU A HG   10 
ATOM 11283 H HD11 . LEU A 1 22 ? 7.696  -1.282  1.161   1.00 0.00 ? 22 LEU A HD11 10 
ATOM 11284 H HD12 . LEU A 1 22 ? 9.370  -0.720  1.205   1.00 0.00 ? 22 LEU A HD12 10 
ATOM 11285 H HD13 . LEU A 1 22 ? 8.438  -0.553  -0.274  1.00 0.00 ? 22 LEU A HD13 10 
ATOM 11286 H HD21 . LEU A 1 22 ? 8.570  2.894   1.205   1.00 0.00 ? 22 LEU A HD21 10 
ATOM 11287 H HD22 . LEU A 1 22 ? 9.045  1.925   -0.196  1.00 0.00 ? 22 LEU A HD22 10 
ATOM 11288 H HD23 . LEU A 1 22 ? 9.865  1.712   1.345   1.00 0.00 ? 22 LEU A HD23 10 
ATOM 11289 N N    . GLN A 1 23 ? 5.013  -0.665  3.299   1.00 0.00 ? 23 GLN A N    10 
ATOM 11290 C CA   . GLN A 1 23 ? 4.803  -0.639  4.742   1.00 0.00 ? 23 GLN A CA   10 
ATOM 11291 C C    . GLN A 1 23 ? 6.133  -0.554  5.493   1.00 0.00 ? 23 GLN A C    10 
ATOM 11292 O O    . GLN A 1 23 ? 7.164  -1.014  4.995   1.00 0.00 ? 23 GLN A O    10 
ATOM 11293 C CB   . GLN A 1 23 ? 4.048  -1.883  5.172   1.00 0.00 ? 23 GLN A CB   10 
ATOM 11294 C CG   . GLN A 1 23 ? 2.590  -1.881  4.770   1.00 0.00 ? 23 GLN A CG   10 
ATOM 11295 C CD   . GLN A 1 23 ? 1.835  -3.084  5.273   1.00 0.00 ? 23 GLN A CD   10 
ATOM 11296 O OE1  . GLN A 1 23 ? 0.884  -3.540  4.648   1.00 0.00 ? 23 GLN A OE1  10 
ATOM 11297 N NE2  . GLN A 1 23 ? 2.260  -3.632  6.422   1.00 0.00 ? 23 GLN A NE2  10 
ATOM 11298 H H    . GLN A 1 23 ? 5.074  -1.529  2.837   1.00 0.00 ? 23 GLN A H    10 
ATOM 11299 H HA   . GLN A 1 23 ? 4.216  0.237   4.971   1.00 0.00 ? 23 GLN A HA   10 
ATOM 11300 H HB2  . GLN A 1 23 ? 4.519  -2.757  4.737   1.00 0.00 ? 23 GLN A HB2  10 
ATOM 11301 H HB3  . GLN A 1 23 ? 4.101  -1.951  6.248   1.00 0.00 ? 23 GLN A HB3  10 
ATOM 11302 H HG2  . GLN A 1 23 ? 2.101  -0.992  5.152   1.00 0.00 ? 23 GLN A HG2  10 
ATOM 11303 H HG3  . GLN A 1 23 ? 2.529  -1.881  3.683   1.00 0.00 ? 23 GLN A HG3  10 
ATOM 11304 H HE21 . GLN A 1 23 ? 3.043  -3.209  6.868   1.00 0.00 ? 23 GLN A HE21 10 
ATOM 11305 H HE22 . GLN A 1 23 ? 1.796  -4.429  6.767   1.00 0.00 ? 23 GLN A HE22 10 
ATOM 11306 N N    . PRO A 1 24 ? 6.117  0.057   6.692   1.00 0.00 ? 24 PRO A N    10 
ATOM 11307 C CA   . PRO A 1 24 ? 7.293  0.139   7.552   1.00 0.00 ? 24 PRO A CA   10 
ATOM 11308 C C    . PRO A 1 24 ? 7.872  -1.255  7.851   1.00 0.00 ? 24 PRO A C    10 
ATOM 11309 O O    . PRO A 1 24 ? 7.156  -2.138  8.320   1.00 0.00 ? 24 PRO A O    10 
ATOM 11310 C CB   . PRO A 1 24 ? 6.761  0.775   8.829   1.00 0.00 ? 24 PRO A CB   10 
ATOM 11311 C CG   . PRO A 1 24 ? 5.507  1.492   8.439   1.00 0.00 ? 24 PRO A CG   10 
ATOM 11312 C CD   . PRO A 1 24 ? 4.941  0.722   7.290   1.00 0.00 ? 24 PRO A CD   10 
ATOM 11313 H HA   . PRO A 1 24 ? 8.049  0.759   7.111   1.00 0.00 ? 24 PRO A HA   10 
ATOM 11314 H HB2  . PRO A 1 24 ? 6.561  0.012   9.570   1.00 0.00 ? 24 PRO A HB2  10 
ATOM 11315 H HB3  . PRO A 1 24 ? 7.496  1.469   9.216   1.00 0.00 ? 24 PRO A HB3  10 
ATOM 11316 H HG2  . PRO A 1 24 ? 4.811  1.503   9.254   1.00 0.00 ? 24 PRO A HG2  10 
ATOM 11317 H HG3  . PRO A 1 24 ? 5.754  2.504   8.113   1.00 0.00 ? 24 PRO A HG3  10 
ATOM 11318 H HD2  . PRO A 1 24 ? 4.226  -0.011  7.639   1.00 0.00 ? 24 PRO A HD2  10 
ATOM 11319 H HD3  . PRO A 1 24 ? 4.467  1.382   6.590   1.00 0.00 ? 24 PRO A HD3  10 
ATOM 11320 N N    . GLY A 1 25 ? 9.148  -1.409  7.580   1.00 0.00 ? 25 GLY A N    10 
ATOM 11321 C CA   . GLY A 1 25 ? 9.793  -2.694  7.776   1.00 0.00 ? 25 GLY A CA   10 
ATOM 11322 C C    . GLY A 1 25 ? 10.093 -3.401  6.469   1.00 0.00 ? 25 GLY A C    10 
ATOM 11323 O O    . GLY A 1 25 ? 10.914 -4.327  6.426   1.00 0.00 ? 25 GLY A O    10 
ATOM 11324 H H    . GLY A 1 25 ? 9.670  -0.662  7.223   1.00 0.00 ? 25 GLY A H    10 
ATOM 11325 H HA2  . GLY A 1 25 ? 10.721 -2.553  8.309   1.00 0.00 ? 25 GLY A HA2  10 
ATOM 11326 H HA3  . GLY A 1 25 ? 9.143  -3.327  8.374   1.00 0.00 ? 25 GLY A HA3  10 
ATOM 11327 N N    . MET A 1 26 ? 9.423  -2.956  5.403   1.00 0.00 ? 26 MET A N    10 
ATOM 11328 C CA   . MET A 1 26 ? 9.614  -3.558  4.080   1.00 0.00 ? 26 MET A CA   10 
ATOM 11329 C C    . MET A 1 26 ? 10.976 -3.204  3.510   1.00 0.00 ? 26 MET A C    10 
ATOM 11330 O O    . MET A 1 26 ? 11.491 -2.116  3.733   1.00 0.00 ? 26 MET A O    10 
ATOM 11331 C CB   . MET A 1 26 ? 8.527  -3.102  3.108   1.00 0.00 ? 26 MET A CB   10 
ATOM 11332 C CG   . MET A 1 26 ? 7.225  -3.867  3.222   1.00 0.00 ? 26 MET A CG   10 
ATOM 11333 S SD   . MET A 1 26 ? 6.003  -3.327  2.016   1.00 0.00 ? 26 MET A SD   10 
ATOM 11334 C CE   . MET A 1 26 ? 4.727  -4.554  2.237   1.00 0.00 ? 26 MET A CE   10 
ATOM 11335 H H    . MET A 1 26 ? 8.789  -2.217  5.507   1.00 0.00 ? 26 MET A H    10 
ATOM 11336 H HA   . MET A 1 26 ? 9.557  -4.623  4.195   1.00 0.00 ? 26 MET A HA   10 
ATOM 11337 H HB2  . MET A 1 26 ? 8.313  -2.052  3.287   1.00 0.00 ? 26 MET A HB2  10 
ATOM 11338 H HB3  . MET A 1 26 ? 8.898  -3.219  2.108   1.00 0.00 ? 26 MET A HB3  10 
ATOM 11339 H HG2  . MET A 1 26 ? 7.422  -4.918  3.061   1.00 0.00 ? 26 MET A HG2  10 
ATOM 11340 H HG3  . MET A 1 26 ? 6.818  -3.727  4.213   1.00 0.00 ? 26 MET A HG3  10 
ATOM 11341 H HE1  . MET A 1 26 ? 4.360  -4.500  3.240   1.00 0.00 ? 26 MET A HE1  10 
ATOM 11342 H HE2  . MET A 1 26 ? 5.123  -5.537  2.055   1.00 0.00 ? 26 MET A HE2  10 
ATOM 11343 H HE3  . MET A 1 26 ? 3.912  -4.366  1.547   1.00 0.00 ? 26 MET A HE3  10 
ATOM 11344 N N    . ARG A 1 27 ? 11.532 -4.152  2.795   1.00 0.00 ? 27 ARG A N    10 
ATOM 11345 C CA   . ARG A 1 27 ? 12.804 -3.947  2.119   1.00 0.00 ? 27 ARG A CA   10 
ATOM 11346 C C    . ARG A 1 27 ? 12.605 -3.263  0.773   1.00 0.00 ? 27 ARG A C    10 
ATOM 11347 O O    . ARG A 1 27 ? 11.628 -3.520  0.062   1.00 0.00 ? 27 ARG A O    10 
ATOM 11348 C CB   . ARG A 1 27 ? 13.555 -5.256  1.930   1.00 0.00 ? 27 ARG A CB   10 
ATOM 11349 C CG   . ARG A 1 27 ? 14.596 -5.531  3.000   1.00 0.00 ? 27 ARG A CG   10 
ATOM 11350 C CD   . ARG A 1 27 ? 13.980 -5.654  4.385   1.00 0.00 ? 27 ARG A CD   10 
ATOM 11351 N NE   . ARG A 1 27 ? 15.008 -5.807  5.414   1.00 0.00 ? 27 ARG A NE   10 
ATOM 11352 C CZ   . ARG A 1 27 ? 14.834 -5.485  6.694   1.00 0.00 ? 27 ARG A CZ   10 
ATOM 11353 N NH1  . ARG A 1 27 ? 13.637 -5.095  7.131   1.00 0.00 ? 27 ARG A NH1  10 
ATOM 11354 N NH2  . ARG A 1 27 ? 15.847 -5.577  7.548   1.00 0.00 ? 27 ARG A NH2  10 
ATOM 11355 H H    . ARG A 1 27 ? 11.084 -5.017  2.736   1.00 0.00 ? 27 ARG A H    10 
ATOM 11356 H HA   . ARG A 1 27 ? 13.409 -3.292  2.735   1.00 0.00 ? 27 ARG A HA   10 
ATOM 11357 H HB2  . ARG A 1 27 ? 12.837 -6.068  1.959   1.00 0.00 ? 27 ARG A HB2  10 
ATOM 11358 H HB3  . ARG A 1 27 ? 14.048 -5.267  0.970   1.00 0.00 ? 27 ARG A HB3  10 
ATOM 11359 H HG2  . ARG A 1 27 ? 15.096 -6.460  2.778   1.00 0.00 ? 27 ARG A HG2  10 
ATOM 11360 H HG3  . ARG A 1 27 ? 15.308 -4.720  3.013   1.00 0.00 ? 27 ARG A HG3  10 
ATOM 11361 H HD2  . ARG A 1 27 ? 13.406 -4.746  4.589   1.00 0.00 ? 27 ARG A HD2  10 
ATOM 11362 H HD3  . ARG A 1 27 ? 13.319 -6.506  4.405   1.00 0.00 ? 27 ARG A HD3  10 
ATOM 11363 H HE   . ARG A 1 27 ? 15.887 -6.147  5.117   1.00 0.00 ? 27 ARG A HE   10 
ATOM 11364 H HH11 . ARG A 1 27 ? 12.860 -5.045  6.499   1.00 0.00 ? 27 ARG A HH11 10 
ATOM 11365 H HH12 . ARG A 1 27 ? 13.519 -4.823  8.081   1.00 0.00 ? 27 ARG A HH12 10 
ATOM 11366 H HH21 . ARG A 1 27 ? 16.750 -5.897  7.225   1.00 0.00 ? 27 ARG A HH21 10 
ATOM 11367 H HH22 . ARG A 1 27 ? 15.728 -5.337  8.517   1.00 0.00 ? 27 ARG A HH22 10 
ATOM 11368 N N    . VAL A 1 28 ? 13.527 -2.400  0.446   1.00 0.00 ? 28 VAL A N    10 
ATOM 11369 C CA   . VAL A 1 28 ? 13.533 -1.660  -0.788  1.00 0.00 ? 28 VAL A CA   10 
ATOM 11370 C C    . VAL A 1 28 ? 14.869 -1.841  -1.488  1.00 0.00 ? 28 VAL A C    10 
ATOM 11371 O O    . VAL A 1 28 ? 15.858 -2.183  -0.853  1.00 0.00 ? 28 VAL A O    10 
ATOM 11372 C CB   . VAL A 1 28 ? 13.284 -0.160  -0.570  1.00 0.00 ? 28 VAL A CB   10 
ATOM 11373 C CG1  . VAL A 1 28 ? 11.933 0.095   0.087   1.00 0.00 ? 28 VAL A CG1  10 
ATOM 11374 C CG2  . VAL A 1 28 ? 14.403 0.457   0.273   1.00 0.00 ? 28 VAL A CG2  10 
ATOM 11375 H H    . VAL A 1 28 ? 14.272 -2.239  1.087   1.00 0.00 ? 28 VAL A H    10 
ATOM 11376 H HA   . VAL A 1 28 ? 12.746 -2.065  -1.408  1.00 0.00 ? 28 VAL A HA   10 
ATOM 11377 H HB   . VAL A 1 28 ? 13.278 0.331   -1.528  1.00 0.00 ? 28 VAL A HB   10 
ATOM 11378 H HG11 . VAL A 1 28 ? 11.787 1.148   0.211   1.00 0.00 ? 28 VAL A HG11 10 
ATOM 11379 H HG12 . VAL A 1 28 ? 11.903 -0.397  1.048   1.00 0.00 ? 28 VAL A HG12 10 
ATOM 11380 H HG13 . VAL A 1 28 ? 11.164 -0.326  -0.550  1.00 0.00 ? 28 VAL A HG13 10 
ATOM 11381 H HG21 . VAL A 1 28 ? 15.347 0.348   -0.249  1.00 0.00 ? 28 VAL A HG21 10 
ATOM 11382 H HG22 . VAL A 1 28 ? 14.466 -0.060  1.218   1.00 0.00 ? 28 VAL A HG22 10 
ATOM 11383 H HG23 . VAL A 1 28 ? 14.209 1.501   0.441   1.00 0.00 ? 28 VAL A HG23 10 
ATOM 11384 N N    . ARG A 1 29 ? 14.889 -1.603  -2.776  1.00 0.00 ? 29 ARG A N    10 
ATOM 11385 C CA   . ARG A 1 29 ? 16.143 -1.608  -3.509  1.00 0.00 ? 29 ARG A CA   10 
ATOM 11386 C C    . ARG A 1 29 ? 16.317 -0.348  -4.361  1.00 0.00 ? 29 ARG A C    10 
ATOM 11387 O O    . ARG A 1 29 ? 15.379 0.119   -5.000  1.00 0.00 ? 29 ARG A O    10 
ATOM 11388 C CB   . ARG A 1 29 ? 16.258 -2.869  -4.377  1.00 0.00 ? 29 ARG A CB   10 
ATOM 11389 C CG   . ARG A 1 29 ? 17.625 -3.072  -5.000  1.00 0.00 ? 29 ARG A CG   10 
ATOM 11390 C CD   . ARG A 1 29 ? 17.859 -4.525  -5.387  1.00 0.00 ? 29 ARG A CD   10 
ATOM 11391 N NE   . ARG A 1 29 ? 16.875 -5.013  -6.351  1.00 0.00 ? 29 ARG A NE   10 
ATOM 11392 C CZ   . ARG A 1 29 ? 16.203 -6.152  -6.215  1.00 0.00 ? 29 ARG A CZ   10 
ATOM 11393 N NH1  . ARG A 1 29 ? 16.351 -6.881  -5.107  1.00 0.00 ? 29 ARG A NH1  10 
ATOM 11394 N NH2  . ARG A 1 29 ? 15.387 -6.551  -7.171  1.00 0.00 ? 29 ARG A NH2  10 
ATOM 11395 H H    . ARG A 1 29 ? 14.031 -1.477  -3.254  1.00 0.00 ? 29 ARG A H    10 
ATOM 11396 H HA   . ARG A 1 29 ? 16.934 -1.630  -2.773  1.00 0.00 ? 29 ARG A HA   10 
ATOM 11397 H HB2  . ARG A 1 29 ? 16.040 -3.726  -3.758  1.00 0.00 ? 29 ARG A HB2  10 
ATOM 11398 H HB3  . ARG A 1 29 ? 15.525 -2.808  -5.171  1.00 0.00 ? 29 ARG A HB3  10 
ATOM 11399 H HG2  . ARG A 1 29 ? 17.705 -2.452  -5.879  1.00 0.00 ? 29 ARG A HG2  10 
ATOM 11400 H HG3  . ARG A 1 29 ? 18.389 -2.773  -4.290  1.00 0.00 ? 29 ARG A HG3  10 
ATOM 11401 H HD2  . ARG A 1 29 ? 18.847 -4.607  -5.820  1.00 0.00 ? 29 ARG A HD2  10 
ATOM 11402 H HD3  . ARG A 1 29 ? 17.806 -5.127  -4.485  1.00 0.00 ? 29 ARG A HD3  10 
ATOM 11403 H HE   . ARG A 1 29 ? 16.725 -4.462  -7.148  1.00 0.00 ? 29 ARG A HE   10 
ATOM 11404 H HH11 . ARG A 1 29 ? 16.962 -6.568  -4.376  1.00 0.00 ? 29 ARG A HH11 10 
ATOM 11405 H HH12 . ARG A 1 29 ? 15.841 -7.743  -5.003  1.00 0.00 ? 29 ARG A HH12 10 
ATOM 11406 H HH21 . ARG A 1 29 ? 15.257 -5.991  -8.004  1.00 0.00 ? 29 ARG A HH21 10 
ATOM 11407 H HH22 . ARG A 1 29 ? 14.871 -7.410  -7.066  1.00 0.00 ? 29 ARG A HH22 10 
ATOM 11408 N N    . MET A 1 30 ? 17.529 0.193   -4.322  1.00 0.00 ? 30 MET A N    10 
ATOM 11409 C CA   . MET A 1 30 ? 17.868 1.388   -5.077  1.00 0.00 ? 30 MET A CA   10 
ATOM 11410 C C    . MET A 1 30 ? 17.943 1.040   -6.534  1.00 0.00 ? 30 MET A C    10 
ATOM 11411 O O    . MET A 1 30 ? 18.599 0.071   -6.913  1.00 0.00 ? 30 MET A O    10 
ATOM 11412 C CB   . MET A 1 30 ? 19.202 1.967   -4.580  1.00 0.00 ? 30 MET A CB   10 
ATOM 11413 C CG   . MET A 1 30 ? 19.543 3.343   -5.131  1.00 0.00 ? 30 MET A CG   10 
ATOM 11414 S SD   . MET A 1 30 ? 18.368 4.604   -4.616  1.00 0.00 ? 30 MET A SD   10 
ATOM 11415 C CE   . MET A 1 30 ? 19.254 6.093   -5.085  1.00 0.00 ? 30 MET A CE   10 
ATOM 11416 H H    . MET A 1 30 ? 18.237 -0.243  -3.774  1.00 0.00 ? 30 MET A H    10 
ATOM 11417 H HA   . MET A 1 30 ? 17.077 2.114   -4.938  1.00 0.00 ? 30 MET A HA   10 
ATOM 11418 H HB2  . MET A 1 30 ? 19.170 2.039   -3.509  1.00 0.00 ? 30 MET A HB2  10 
ATOM 11419 H HB3  . MET A 1 30 ? 19.992 1.283   -4.852  1.00 0.00 ? 30 MET A HB3  10 
ATOM 11420 H HG2  . MET A 1 30 ? 20.527 3.625   -4.779  1.00 0.00 ? 30 MET A HG2  10 
ATOM 11421 H HG3  . MET A 1 30 ? 19.562 3.298   -6.217  1.00 0.00 ? 30 MET A HG3  10 
ATOM 11422 H HE1  . MET A 1 30 ? 20.165 6.169   -4.511  1.00 0.00 ? 30 MET A HE1  10 
ATOM 11423 H HE2  . MET A 1 30 ? 18.628 6.947   -4.889  1.00 0.00 ? 30 MET A HE2  10 
ATOM 11424 H HE3  . MET A 1 30 ? 19.490 6.047   -6.139  1.00 0.00 ? 30 MET A HE3  10 
ATOM 11425 N N    . LEU A 1 31 ? 17.279 1.839   -7.330  1.00 0.00 ? 31 LEU A N    10 
ATOM 11426 C CA   . LEU A 1 31 ? 17.118 1.524   -8.721  1.00 0.00 ? 31 LEU A CA   10 
ATOM 11427 C C    . LEU A 1 31 ? 17.874 2.539   -9.577  1.00 0.00 ? 31 LEU A C    10 
ATOM 11428 O O    . LEU A 1 31 ? 18.200 2.275   -10.732 1.00 0.00 ? 31 LEU A O    10 
ATOM 11429 C CB   . LEU A 1 31 ? 15.641 1.505   -9.056  1.00 0.00 ? 31 LEU A CB   10 
ATOM 11430 C CG   . LEU A 1 31 ? 15.316 1.117   -10.491 1.00 0.00 ? 31 LEU A CG   10 
ATOM 11431 C CD1  . LEU A 1 31 ? 15.659 -0.353  -10.723 1.00 0.00 ? 31 LEU A CD1  10 
ATOM 11432 C CD2  . LEU A 1 31 ? 13.874 1.394   -10.814 1.00 0.00 ? 31 LEU A CD2  10 
ATOM 11433 H H    . LEU A 1 31 ? 16.885 2.667   -6.983  1.00 0.00 ? 31 LEU A H    10 
ATOM 11434 H HA   . LEU A 1 31 ? 17.534 0.538   -8.892  1.00 0.00 ? 31 LEU A HA   10 
ATOM 11435 H HB2  . LEU A 1 31 ? 15.133 0.819   -8.394  1.00 0.00 ? 31 LEU A HB2  10 
ATOM 11436 H HB3  . LEU A 1 31 ? 15.231 2.507   -8.888  1.00 0.00 ? 31 LEU A HB3  10 
ATOM 11437 H HG   . LEU A 1 31 ? 15.944 1.707   -11.128 1.00 0.00 ? 31 LEU A HG   10 
ATOM 11438 H HD11 . LEU A 1 31 ? 15.419 -0.620  -11.750 1.00 0.00 ? 31 LEU A HD11 10 
ATOM 11439 H HD12 . LEU A 1 31 ? 15.075 -0.963  -10.060 1.00 0.00 ? 31 LEU A HD12 10 
ATOM 11440 H HD13 . LEU A 1 31 ? 16.701 -0.521  -10.543 1.00 0.00 ? 31 LEU A HD13 10 
ATOM 11441 H HD21 . LEU A 1 31 ? 13.678 2.460   -10.713 1.00 0.00 ? 31 LEU A HD21 10 
ATOM 11442 H HD22 . LEU A 1 31 ? 13.239 0.856   -10.115 1.00 0.00 ? 31 LEU A HD22 10 
ATOM 11443 H HD23 . LEU A 1 31 ? 13.665 1.075   -11.817 1.00 0.00 ? 31 LEU A HD23 10 
ATOM 11444 N N    . ASP A 1 32 ? 18.141 3.692   -8.992  1.00 0.00 ? 32 ASP A N    10 
ATOM 11445 C CA   . ASP A 1 32 ? 18.891 4.753   -9.679  1.00 0.00 ? 32 ASP A CA   10 
ATOM 11446 C C    . ASP A 1 32 ? 20.221 4.958   -8.972  1.00 0.00 ? 32 ASP A C    10 
ATOM 11447 O O    . ASP A 1 32 ? 20.325 4.735   -7.767  1.00 0.00 ? 32 ASP A O    10 
ATOM 11448 C CB   . ASP A 1 32 ? 18.075 6.054   -9.687  1.00 0.00 ? 32 ASP A CB   10 
ATOM 11449 C CG   . ASP A 1 32 ? 18.709 7.160   -10.524 1.00 0.00 ? 32 ASP A CG   10 
ATOM 11450 O OD1  . ASP A 1 32 ? 19.147 6.874   -11.666 1.00 0.00 ? 32 ASP A OD1  10 
ATOM 11451 O OD2  . ASP A 1 32 ? 18.719 8.320   -10.072 1.00 0.00 ? 32 ASP A OD2  10 
ATOM 11452 H H    . ASP A 1 32 ? 17.832 3.842   -8.073  1.00 0.00 ? 32 ASP A H    10 
ATOM 11453 H HA   . ASP A 1 32 ? 19.075 4.439   -10.698 1.00 0.00 ? 32 ASP A HA   10 
ATOM 11454 H HB2  . ASP A 1 32 ? 17.095 5.854   -10.093 1.00 0.00 ? 32 ASP A HB2  10 
ATOM 11455 H HB3  . ASP A 1 32 ? 17.979 6.413   -8.673  1.00 0.00 ? 32 ASP A HB3  10 
ATOM 11456 N N    . ASP A 1 33 ? 21.248 5.373   -9.719  1.00 0.00 ? 33 ASP A N    10 
ATOM 11457 C CA   . ASP A 1 33 ? 22.584 5.538   -9.145  1.00 0.00 ? 33 ASP A CA   10 
ATOM 11458 C C    . ASP A 1 33 ? 22.806 6.984   -8.725  1.00 0.00 ? 33 ASP A C    10 
ATOM 11459 O O    . ASP A 1 33 ? 22.347 7.920   -9.388  1.00 0.00 ? 33 ASP A O    10 
ATOM 11460 C CB   . ASP A 1 33 ? 23.676 5.125   -10.149 1.00 0.00 ? 33 ASP A CB   10 
ATOM 11461 C CG   . ASP A 1 33 ? 23.959 3.633   -10.123 1.00 0.00 ? 33 ASP A CG   10 
ATOM 11462 O OD1  . ASP A 1 33 ? 24.487 3.148   -9.102  1.00 0.00 ? 33 ASP A OD1  10 
ATOM 11463 O OD2  . ASP A 1 33 ? 23.660 2.945   -11.119 1.00 0.00 ? 33 ASP A OD2  10 
ATOM 11464 H H    . ASP A 1 33 ? 21.104 5.584   -10.654 1.00 0.00 ? 33 ASP A H    10 
ATOM 11465 H HA   . ASP A 1 33 ? 22.660 4.904   -8.271  1.00 0.00 ? 33 ASP A HA   10 
ATOM 11466 H HB2  . ASP A 1 33 ? 23.358 5.382   -11.144 1.00 0.00 ? 33 ASP A HB2  10 
ATOM 11467 H HB3  . ASP A 1 33 ? 24.585 5.658   -9.909  1.00 0.00 ? 33 ASP A HB3  10 
ATOM 11468 N N    . TYR A 1 34 ? 23.522 7.171   -7.630  1.00 0.00 ? 34 TYR A N    10 
ATOM 11469 C CA   . TYR A 1 34 ? 23.728 8.481   -7.044  1.00 0.00 ? 34 TYR A CA   10 
ATOM 11470 C C    . TYR A 1 34 ? 24.968 8.474   -6.153  1.00 0.00 ? 34 TYR A C    10 
ATOM 11471 O O    . TYR A 1 34 ? 25.383 7.415   -5.698  1.00 0.00 ? 34 TYR A O    10 
ATOM 11472 C CB   . TYR A 1 34 ? 22.478 8.861   -6.231  1.00 0.00 ? 34 TYR A CB   10 
ATOM 11473 C CG   . TYR A 1 34 ? 22.450 10.275  -5.703  1.00 0.00 ? 34 TYR A CG   10 
ATOM 11474 C CD1  . TYR A 1 34 ? 22.529 11.363  -6.549  1.00 0.00 ? 34 TYR A CD1  10 
ATOM 11475 C CD2  . TYR A 1 34 ? 22.322 10.510  -4.338  1.00 0.00 ? 34 TYR A CD2  10 
ATOM 11476 C CE1  . TYR A 1 34 ? 22.483 12.662  -6.068  1.00 0.00 ? 34 TYR A CE1  10 
ATOM 11477 C CE2  . TYR A 1 34 ? 22.276 11.794  -3.841  1.00 0.00 ? 34 TYR A CE2  10 
ATOM 11478 C CZ   . TYR A 1 34 ? 22.356 12.869  -4.703  1.00 0.00 ? 34 TYR A CZ   10 
ATOM 11479 O OH   . TYR A 1 34 ? 22.304 14.149  -4.190  1.00 0.00 ? 34 TYR A OH   10 
ATOM 11480 H H    . TYR A 1 34 ? 23.929 6.395   -7.177  1.00 0.00 ? 34 TYR A H    10 
ATOM 11481 H HA   . TYR A 1 34 ? 23.872 9.188   -7.854  1.00 0.00 ? 34 TYR A HA   10 
ATOM 11482 H HB2  . TYR A 1 34 ? 21.604 8.735   -6.850  1.00 0.00 ? 34 TYR A HB2  10 
ATOM 11483 H HB3  . TYR A 1 34 ? 22.402 8.194   -5.381  1.00 0.00 ? 34 TYR A HB3  10 
ATOM 11484 H HD1  . TYR A 1 34 ? 22.623 11.195  -7.615  1.00 0.00 ? 34 TYR A HD1  10 
ATOM 11485 H HD2  . TYR A 1 34 ? 22.261 9.674   -3.661  1.00 0.00 ? 34 TYR A HD2  10 
ATOM 11486 H HE1  . TYR A 1 34 ? 22.555 13.488  -6.757  1.00 0.00 ? 34 TYR A HE1  10 
ATOM 11487 H HE2  . TYR A 1 34 ? 22.165 11.953  -2.786  1.00 0.00 ? 34 TYR A HE2  10 
ATOM 11488 H HH   . TYR A 1 34 ? 22.806 14.184  -3.353  1.00 0.00 ? 34 TYR A HH   10 
ATOM 11489 N N    . GLU A 1 35 ? 25.581 9.625   -5.946  1.00 0.00 ? 35 GLU A N    10 
ATOM 11490 C CA   . GLU A 1 35 ? 26.771 9.744   -5.108  1.00 0.00 ? 35 GLU A CA   10 
ATOM 11491 C C    . GLU A 1 35 ? 26.623 9.041   -3.754  1.00 0.00 ? 35 GLU A C    10 
ATOM 11492 O O    . GLU A 1 35 ? 27.552 8.373   -3.290  1.00 0.00 ? 35 GLU A O    10 
ATOM 11493 C CB   . GLU A 1 35 ? 27.094 11.234  -4.863  1.00 0.00 ? 35 GLU A CB   10 
ATOM 11494 C CG   . GLU A 1 35 ? 27.564 11.991  -6.101  1.00 0.00 ? 35 GLU A CG   10 
ATOM 11495 C CD   . GLU A 1 35 ? 26.464 12.145  -7.152  1.00 0.00 ? 35 GLU A CD   10 
ATOM 11496 O OE1  . GLU A 1 35 ? 25.633 13.051  -7.006  1.00 0.00 ? 35 GLU A OE1  10 
ATOM 11497 O OE2  . GLU A 1 35 ? 26.431 11.347  -8.107  1.00 0.00 ? 35 GLU A OE2  10 
ATOM 11498 H H    . GLU A 1 35 ? 25.284 10.440  -6.422  1.00 0.00 ? 35 GLU A H    10 
ATOM 11499 H HA   . GLU A 1 35 ? 27.600 9.300   -5.636  1.00 0.00 ? 35 GLU A HA   10 
ATOM 11500 H HB2  . GLU A 1 35 ? 26.212 11.715  -4.491  1.00 0.00 ? 35 GLU A HB2  10 
ATOM 11501 H HB3  . GLU A 1 35 ? 27.874 11.292  -4.124  1.00 0.00 ? 35 GLU A HB3  10 
ATOM 11502 H HG2  . GLU A 1 35 ? 27.888 12.988  -5.818  1.00 0.00 ? 35 GLU A HG2  10 
ATOM 11503 H HG3  . GLU A 1 35 ? 28.385 11.451  -6.554  1.00 0.00 ? 35 GLU A HG3  10 
ATOM 11504 N N    . GLU A 1 36 ? 25.478 9.183   -3.120  1.00 0.00 ? 36 GLU A N    10 
ATOM 11505 C CA   . GLU A 1 36 ? 25.255 8.575   -1.825  1.00 0.00 ? 36 GLU A CA   10 
ATOM 11506 C C    . GLU A 1 36 ? 24.979 7.081   -1.948  1.00 0.00 ? 36 GLU A C    10 
ATOM 11507 O O    . GLU A 1 36 ? 25.744 6.255   -1.452  1.00 0.00 ? 36 GLU A O    10 
ATOM 11508 C CB   . GLU A 1 36 ? 24.108 9.245   -1.100  1.00 0.00 ? 36 GLU A CB   10 
ATOM 11509 C CG   . GLU A 1 36 ? 24.369 10.705  -0.785  1.00 0.00 ? 36 GLU A CG   10 
ATOM 11510 C CD   . GLU A 1 36 ? 25.653 10.903  -0.005  1.00 0.00 ? 36 GLU A CD   10 
ATOM 11511 O OE1  . GLU A 1 36 ? 25.681 10.568  1.195   1.00 0.00 ? 36 GLU A OE1  10 
ATOM 11512 O OE2  . GLU A 1 36 ? 26.641 11.390  -0.595  1.00 0.00 ? 36 GLU A OE2  10 
ATOM 11513 H H    . GLU A 1 36 ? 24.771 9.710   -3.533  1.00 0.00 ? 36 GLU A H    10 
ATOM 11514 H HA   . GLU A 1 36 ? 26.153 8.715   -1.251  1.00 0.00 ? 36 GLU A HA   10 
ATOM 11515 H HB2  . GLU A 1 36 ? 23.221 9.180   -1.715  1.00 0.00 ? 36 GLU A HB2  10 
ATOM 11516 H HB3  . GLU A 1 36 ? 23.913 8.719   -0.172  1.00 0.00 ? 36 GLU A HB3  10 
ATOM 11517 H HG2  . GLU A 1 36 ? 24.435 11.261  -1.720  1.00 0.00 ? 36 GLU A HG2  10 
ATOM 11518 H HG3  . GLU A 1 36 ? 23.537 11.090  -0.181  1.00 0.00 ? 36 GLU A HG3  10 
ATOM 11519 N N    . ILE A 1 37 ? 23.901 6.752   -2.629  1.00 0.00 ? 37 ILE A N    10 
ATOM 11520 C CA   . ILE A 1 37 ? 23.459 5.376   -2.745  1.00 0.00 ? 37 ILE A CA   10 
ATOM 11521 C C    . ILE A 1 37 ? 23.514 4.948   -4.202  1.00 0.00 ? 37 ILE A C    10 
ATOM 11522 O O    . ILE A 1 37 ? 23.313 5.757   -5.112  1.00 0.00 ? 37 ILE A O    10 
ATOM 11523 C CB   . ILE A 1 37 ? 22.010 5.204   -2.200  1.00 0.00 ? 37 ILE A CB   10 
ATOM 11524 C CG1  . ILE A 1 37 ? 21.874 5.840   -0.809  1.00 0.00 ? 37 ILE A CG1  10 
ATOM 11525 C CG2  . ILE A 1 37 ? 21.638 3.734   -2.155  1.00 0.00 ? 37 ILE A CG2  10 
ATOM 11526 C CD1  . ILE A 1 37 ? 22.824 5.265   0.216   1.00 0.00 ? 37 ILE A CD1  10 
ATOM 11527 H H    . ILE A 1 37 ? 23.402 7.450   -3.093  1.00 0.00 ? 37 ILE A H    10 
ATOM 11528 H HA   . ILE A 1 37 ? 24.122 4.757   -2.160  1.00 0.00 ? 37 ILE A HA   10 
ATOM 11529 H HB   . ILE A 1 37 ? 21.348 5.692   -2.877  1.00 0.00 ? 37 ILE A HB   10 
ATOM 11530 H HG12 . ILE A 1 37 ? 22.059 6.895   -0.888  1.00 0.00 ? 37 ILE A HG12 10 
ATOM 11531 H HG13 . ILE A 1 37 ? 20.865 5.669   -0.444  1.00 0.00 ? 37 ILE A HG13 10 
ATOM 11532 H HG21 . ILE A 1 37 ? 20.629 3.640   -1.783  1.00 0.00 ? 37 ILE A HG21 10 
ATOM 11533 H HG22 . ILE A 1 37 ? 22.315 3.205   -1.497  1.00 0.00 ? 37 ILE A HG22 10 
ATOM 11534 H HG23 . ILE A 1 37 ? 21.709 3.327   -3.152  1.00 0.00 ? 37 ILE A HG23 10 
ATOM 11535 H HD11 . ILE A 1 37 ? 22.613 4.223   0.365   1.00 0.00 ? 37 ILE A HD11 10 
ATOM 11536 H HD12 . ILE A 1 37 ? 22.710 5.799   1.143   1.00 0.00 ? 37 ILE A HD12 10 
ATOM 11537 H HD13 . ILE A 1 37 ? 23.847 5.376   -0.142  1.00 0.00 ? 37 ILE A HD13 10 
ATOM 11538 N N    . SER A 1 38 ? 23.747 3.675   -4.442  1.00 0.00 ? 38 SER A N    10 
ATOM 11539 C CA   . SER A 1 38 ? 23.979 3.183   -5.788  1.00 0.00 ? 38 SER A CA   10 
ATOM 11540 C C    . SER A 1 38 ? 22.967 2.105   -6.115  1.00 0.00 ? 38 SER A C    10 
ATOM 11541 O O    . SER A 1 38 ? 22.466 1.418   -5.220  1.00 0.00 ? 38 SER A O    10 
ATOM 11542 C CB   . SER A 1 38 ? 25.395 2.641   -5.906  1.00 0.00 ? 38 SER A CB   10 
ATOM 11543 O OG   . SER A 1 38 ? 26.349 3.647   -5.627  1.00 0.00 ? 38 SER A OG   10 
ATOM 11544 H H    . SER A 1 38 ? 23.651 3.023   -3.722  1.00 0.00 ? 38 SER A H    10 
ATOM 11545 H HA   . SER A 1 38 ? 23.852 4.005   -6.477  1.00 0.00 ? 38 SER A HA   10 
ATOM 11546 H HB2  . SER A 1 38 ? 25.536 1.828   -5.201  1.00 0.00 ? 38 SER A HB2  10 
ATOM 11547 H HB3  . SER A 1 38 ? 25.564 2.275   -6.916  1.00 0.00 ? 38 SER A HB3  10 
ATOM 11548 H HG   . SER A 1 38 ? 26.162 4.012   -4.756  1.00 0.00 ? 38 SER A HG   10 
ATOM 11549 N N    . ALA A 1 39 ? 22.643 1.964   -7.394  1.00 0.00 ? 39 ALA A N    10 
ATOM 11550 C CA   . ALA A 1 39 ? 21.633 1.009   -7.822  1.00 0.00 ? 39 ALA A CA   10 
ATOM 11551 C C    . ALA A 1 39 ? 22.019 -0.403  -7.412  1.00 0.00 ? 39 ALA A C    10 
ATOM 11552 O O    . ALA A 1 39 ? 23.174 -0.810  -7.543  1.00 0.00 ? 39 ALA A O    10 
ATOM 11553 C CB   . ALA A 1 39 ? 21.438 1.110   -9.335  1.00 0.00 ? 39 ALA A CB   10 
ATOM 11554 H H    . ALA A 1 39 ? 23.091 2.523   -8.059  1.00 0.00 ? 39 ALA A H    10 
ATOM 11555 H HA   . ALA A 1 39 ? 20.707 1.274   -7.341  1.00 0.00 ? 39 ALA A HA   10 
ATOM 11556 H HB1  . ALA A 1 39 ? 21.187 2.116   -9.592  1.00 0.00 ? 39 ALA A HB1  10 
ATOM 11557 H HB2  . ALA A 1 39 ? 20.641 0.440   -9.626  1.00 0.00 ? 39 ALA A HB2  10 
ATOM 11558 H HB3  . ALA A 1 39 ? 22.354 0.818   -9.822  1.00 0.00 ? 39 ALA A HB3  10 
ATOM 11559 N N    . GLY A 1 40 ? 21.051 -1.128  -6.888  1.00 0.00 ? 40 GLY A N    10 
ATOM 11560 C CA   . GLY A 1 40 ? 21.302 -2.483  -6.446  1.00 0.00 ? 40 GLY A CA   10 
ATOM 11561 C C    . GLY A 1 40 ? 21.397 -2.590  -4.934  1.00 0.00 ? 40 GLY A C    10 
ATOM 11562 O O    . GLY A 1 40 ? 21.282 -3.681  -4.371  1.00 0.00 ? 40 GLY A O    10 
ATOM 11563 H H    . GLY A 1 40 ? 20.156 -0.734  -6.798  1.00 0.00 ? 40 GLY A H    10 
ATOM 11564 H HA2  . GLY A 1 40 ? 20.496 -3.132  -6.784  1.00 0.00 ? 40 GLY A HA2  10 
ATOM 11565 H HA3  . GLY A 1 40 ? 22.231 -2.830  -6.877  1.00 0.00 ? 40 GLY A HA3  10 
ATOM 11566 N N    . ASP A 1 41 ? 21.623 -1.466  -4.265  1.00 0.00 ? 41 ASP A N    10 
ATOM 11567 C CA   . ASP A 1 41 ? 21.670 -1.446  -2.807  1.00 0.00 ? 41 ASP A CA   10 
ATOM 11568 C C    . ASP A 1 41 ? 20.275 -1.712  -2.255  1.00 0.00 ? 41 ASP A C    10 
ATOM 11569 O O    . ASP A 1 41 ? 19.282 -1.220  -2.780  1.00 0.00 ? 41 ASP A O    10 
ATOM 11570 C CB   . ASP A 1 41 ? 22.195 -0.104  -2.305  1.00 0.00 ? 41 ASP A CB   10 
ATOM 11571 C CG   . ASP A 1 41 ? 22.726 -0.163  -0.872  1.00 0.00 ? 41 ASP A CG   10 
ATOM 11572 O OD1  . ASP A 1 41 ? 22.538 -1.207  -0.206  1.00 0.00 ? 41 ASP A OD1  10 
ATOM 11573 O OD2  . ASP A 1 41 ? 23.365 0.813   -0.423  1.00 0.00 ? 41 ASP A OD2  10 
ATOM 11574 H H    . ASP A 1 41 ? 21.750 -0.629  -4.760  1.00 0.00 ? 41 ASP A H    10 
ATOM 11575 H HA   . ASP A 1 41 ? 22.340 -2.235  -2.492  1.00 0.00 ? 41 ASP A HA   10 
ATOM 11576 H HB2  . ASP A 1 41 ? 22.995 0.226   -2.946  1.00 0.00 ? 41 ASP A HB2  10 
ATOM 11577 H HB3  . ASP A 1 41 ? 21.391 0.626   -2.338  1.00 0.00 ? 41 ASP A HB3  10 
ATOM 11578 N N    . GLU A 1 42 ? 20.225 -2.507  -1.202  1.00 0.00 ? 42 GLU A N    10 
ATOM 11579 C CA   . GLU A 1 42 ? 18.943 -2.863  -0.592  1.00 0.00 ? 42 GLU A CA   10 
ATOM 11580 C C    . GLU A 1 42 ? 18.855 -2.231  0.796   1.00 0.00 ? 42 GLU A C    10 
ATOM 11581 O O    . GLU A 1 42 ? 19.855 -2.050  1.459   1.00 0.00 ? 42 GLU A O    10 
ATOM 11582 C CB   . GLU A 1 42 ? 18.786 -4.377  -0.514  1.00 0.00 ? 42 GLU A CB   10 
ATOM 11583 C CG   . GLU A 1 42 ? 18.836 -5.047  -1.876  1.00 0.00 ? 42 GLU A CG   10 
ATOM 11584 C CD   . GLU A 1 42 ? 18.572 -6.543  -1.837  1.00 0.00 ? 42 GLU A CD   10 
ATOM 11585 O OE1  . GLU A 1 42 ? 19.473 -7.287  -1.391  1.00 0.00 ? 42 GLU A OE1  10 
ATOM 11586 O OE2  . GLU A 1 42 ? 17.484 -6.963  -2.252  1.00 0.00 ? 42 GLU A OE2  10 
ATOM 11587 H H    . GLU A 1 42 ? 21.051 -2.829  -0.808  1.00 0.00 ? 42 GLU A H    10 
ATOM 11588 H HA   . GLU A 1 42 ? 18.161 -2.467  -1.209  1.00 0.00 ? 42 GLU A HA   10 
ATOM 11589 H HB2  . GLU A 1 42 ? 19.577 -4.779  0.095   1.00 0.00 ? 42 GLU A HB2  10 
ATOM 11590 H HB3  . GLU A 1 42 ? 17.822 -4.613  -0.056  1.00 0.00 ? 42 GLU A HB3  10 
ATOM 11591 H HG2  . GLU A 1 42 ? 18.107 -4.600  -2.520  1.00 0.00 ? 42 GLU A HG2  10 
ATOM 11592 H HG3  . GLU A 1 42 ? 19.819 -4.884  -2.291  1.00 0.00 ? 42 GLU A HG3  10 
ATOM 11593 N N    . GLY A 1 43 ? 17.646 -1.885  1.204   1.00 0.00 ? 43 GLY A N    10 
ATOM 11594 C CA   . GLY A 1 43 ? 17.482 -1.231  2.480   1.00 0.00 ? 43 GLY A CA   10 
ATOM 11595 C C    . GLY A 1 43 ? 16.142 -1.490  3.090   1.00 0.00 ? 43 GLY A C    10 
ATOM 11596 O O    . GLY A 1 43 ? 15.301 -2.161  2.505   1.00 0.00 ? 43 GLY A O    10 
ATOM 11597 H H    . GLY A 1 43 ? 16.861 -2.074  0.637   1.00 0.00 ? 43 GLY A H    10 
ATOM 11598 H HA2  . GLY A 1 43 ? 18.258 -1.566  3.151   1.00 0.00 ? 43 GLY A HA2  10 
ATOM 11599 H HA3  . GLY A 1 43 ? 17.587 -0.162  2.323   1.00 0.00 ? 43 GLY A HA3  10 
ATOM 11600 N N    . GLU A 1 44 ? 15.951 -0.965  4.304   1.00 0.00 ? 44 GLU A N    10 
ATOM 11601 C CA   . GLU A 1 44 ? 14.681 -1.111  4.994   1.00 0.00 ? 44 GLU A CA   10 
ATOM 11602 C C    . GLU A 1 44 ? 13.958 0.248   5.008   1.00 0.00 ? 44 GLU A C    10 
ATOM 11603 O O    . GLU A 1 44 ? 14.596 1.290   5.136   1.00 0.00 ? 44 GLU A O    10 
ATOM 11604 C CB   . GLU A 1 44 ? 14.912 -1.590  6.437   1.00 0.00 ? 44 GLU A CB   10 
ATOM 11605 C CG   . GLU A 1 44 ? 13.648 -1.715  7.261   1.00 0.00 ? 44 GLU A CG   10 
ATOM 11606 C CD   . GLU A 1 44 ? 13.925 -2.038  8.716   1.00 0.00 ? 44 GLU A CD   10 
ATOM 11607 O OE1  . GLU A 1 44 ? 14.311 -1.127  9.472   1.00 0.00 ? 44 GLU A OE1  10 
ATOM 11608 O OE2  . GLU A 1 44 ? 13.753 -3.208  9.105   1.00 0.00 ? 44 GLU A OE2  10 
ATOM 11609 H H    . GLU A 1 44 ? 16.677 -0.470  4.723   1.00 0.00 ? 44 GLU A H    10 
ATOM 11610 H HA   . GLU A 1 44 ? 14.065 -1.834  4.468   1.00 0.00 ? 44 GLU A HA   10 
ATOM 11611 H HB2  . GLU A 1 44 ? 15.371 -2.561  6.400   1.00 0.00 ? 44 GLU A HB2  10 
ATOM 11612 H HB3  . GLU A 1 44 ? 15.582 -0.908  6.946   1.00 0.00 ? 44 GLU A HB3  10 
ATOM 11613 H HG2  . GLU A 1 44 ? 13.111 -0.783  7.205   1.00 0.00 ? 44 GLU A HG2  10 
ATOM 11614 H HG3  . GLU A 1 44 ? 13.052 -2.500  6.844   1.00 0.00 ? 44 GLU A HG3  10 
ATOM 11615 N N    . PHE A 1 45 ? 12.654 0.202   4.875   1.00 0.00 ? 45 PHE A N    10 
ATOM 11616 C CA   . PHE A 1 45 ? 11.850 1.397   4.970   1.00 0.00 ? 45 PHE A CA   10 
ATOM 11617 C C    . PHE A 1 45 ? 11.441 1.607   6.426   1.00 0.00 ? 45 PHE A C    10 
ATOM 11618 O O    . PHE A 1 45 ? 10.722 0.786   6.997   1.00 0.00 ? 45 PHE A O    10 
ATOM 11619 C CB   . PHE A 1 45 ? 10.606 1.298   4.072   1.00 0.00 ? 45 PHE A CB   10 
ATOM 11620 C CG   . PHE A 1 45 ? 9.603  2.390   4.307   1.00 0.00 ? 45 PHE A CG   10 
ATOM 11621 C CD1  . PHE A 1 45 ? 9.888  3.700   3.931   1.00 0.00 ? 45 PHE A CD1  10 
ATOM 11622 C CD2  . PHE A 1 45 ? 8.382  2.127   4.910   1.00 0.00 ? 45 PHE A CD2  10 
ATOM 11623 C CE1  . PHE A 1 45 ? 8.973  4.709   4.152   1.00 0.00 ? 45 PHE A CE1  10 
ATOM 11624 C CE2  . PHE A 1 45 ? 7.451  3.141   5.131   1.00 0.00 ? 45 PHE A CE2  10 
ATOM 11625 C CZ   . PHE A 1 45 ? 7.766  4.436   4.740   1.00 0.00 ? 45 PHE A CZ   10 
ATOM 11626 H H    . PHE A 1 45 ? 12.219 -0.666  4.745   1.00 0.00 ? 45 PHE A H    10 
ATOM 11627 H HA   . PHE A 1 45 ? 12.460 2.228   4.653   1.00 0.00 ? 45 PHE A HA   10 
ATOM 11628 H HB2  . PHE A 1 45 ? 10.907 1.341   3.046   1.00 0.00 ? 45 PHE A HB2  10 
ATOM 11629 H HB3  . PHE A 1 45 ? 10.116 0.344   4.256   1.00 0.00 ? 45 PHE A HB3  10 
ATOM 11630 H HD1  . PHE A 1 45 ? 10.836 3.921   3.460   1.00 0.00 ? 45 PHE A HD1  10 
ATOM 11631 H HD2  . PHE A 1 45 ? 8.147  1.117   5.221   1.00 0.00 ? 45 PHE A HD2  10 
ATOM 11632 H HE1  . PHE A 1 45 ? 9.208  5.710   3.835   1.00 0.00 ? 45 PHE A HE1  10 
ATOM 11633 H HE2  . PHE A 1 45 ? 6.507  2.945   5.590   1.00 0.00 ? 45 PHE A HE2  10 
ATOM 11634 H HZ   . PHE A 1 45 ? 7.043  5.234   4.910   1.00 0.00 ? 45 PHE A HZ   10 
ATOM 11635 N N    . ARG A 1 46 ? 11.922 2.690   7.008   1.00 0.00 ? 46 ARG A N    10 
ATOM 11636 C CA   . ARG A 1 46 ? 11.666 2.945   8.418   1.00 0.00 ? 46 ARG A CA   10 
ATOM 11637 C C    . ARG A 1 46 ? 10.536 3.952   8.586   1.00 0.00 ? 46 ARG A C    10 
ATOM 11638 O O    . ARG A 1 46 ? 9.555  3.662   9.272   1.00 0.00 ? 46 ARG A O    10 
ATOM 11639 C CB   . ARG A 1 46 ? 12.946 3.485   9.072   1.00 0.00 ? 46 ARG A CB   10 
ATOM 11640 C CG   . ARG A 1 46 ? 14.108 2.512   8.967   1.00 0.00 ? 46 ARG A CG   10 
ATOM 11641 C CD   . ARG A 1 46 ? 15.399 3.120   9.468   1.00 0.00 ? 46 ARG A CD   10 
ATOM 11642 N NE   . ARG A 1 46 ? 15.321 3.535   10.863  1.00 0.00 ? 46 ARG A NE   10 
ATOM 11643 C CZ   . ARG A 1 46 ? 16.341 3.450   11.713  1.00 0.00 ? 46 ARG A CZ   10 
ATOM 11644 N NH1  . ARG A 1 46 ? 17.483 2.889   11.296  1.00 0.00 ? 46 ARG A NH1  10 
ATOM 11645 N NH2  . ARG A 1 46 ? 16.222 3.888   12.946  1.00 0.00 ? 46 ARG A NH2  10 
ATOM 11646 H H    . ARG A 1 46 ? 12.466 3.308   6.492   1.00 0.00 ? 46 ARG A H    10 
ATOM 11647 H HA   . ARG A 1 46 ? 11.387 2.019   8.888   1.00 0.00 ? 46 ARG A HA   10 
ATOM 11648 H HB2  . ARG A 1 46 ? 13.226 4.408   8.585   1.00 0.00 ? 46 ARG A HB2  10 
ATOM 11649 H HB3  . ARG A 1 46 ? 12.753 3.678   10.115  1.00 0.00 ? 46 ARG A HB3  10 
ATOM 11650 H HG2  . ARG A 1 46 ? 13.882 1.639   9.555   1.00 0.00 ? 46 ARG A HG2  10 
ATOM 11651 H HG3  . ARG A 1 46 ? 14.228 2.236   7.931   1.00 0.00 ? 46 ARG A HG3  10 
ATOM 11652 H HD2  . ARG A 1 46 ? 16.190 2.389   9.363   1.00 0.00 ? 46 ARG A HD2  10 
ATOM 11653 H HD3  . ARG A 1 46 ? 15.630 3.989   8.863   1.00 0.00 ? 46 ARG A HD3  10 
ATOM 11654 H HE   . ARG A 1 46 ? 14.463 3.906   11.180  1.00 0.00 ? 46 ARG A HE   10 
ATOM 11655 H HH11 . ARG A 1 46 ? 17.560 2.524   10.374  1.00 0.00 ? 46 ARG A HH11 10 
ATOM 11656 H HH12 . ARG A 1 46 ? 18.272 2.837   11.936  1.00 0.00 ? 46 ARG A HH12 10 
ATOM 11657 H HH21 . ARG A 1 46 ? 15.347 4.285   13.268  1.00 0.00 ? 46 ARG A HH21 10 
ATOM 11658 H HH22 . ARG A 1 46 ? 16.992 3.836   13.585  1.00 0.00 ? 46 ARG A HH22 10 
ATOM 11659 N N    . GLN A 1 47 ? 10.681 5.089   7.940   1.00 0.00 ? 47 GLN A N    10 
ATOM 11660 C CA   . GLN A 1 47 ? 9.703  6.163   8.033   1.00 0.00 ? 47 GLN A CA   10 
ATOM 11661 C C    . GLN A 1 47 ? 10.036 7.240   7.010   1.00 0.00 ? 47 GLN A C    10 
ATOM 11662 O O    . GLN A 1 47 ? 11.125 7.265   6.427   1.00 0.00 ? 47 GLN A O    10 
ATOM 11663 C CB   . GLN A 1 47 ? 9.646  6.749   9.453   1.00 0.00 ? 47 GLN A CB   10 
ATOM 11664 C CG   . GLN A 1 47 ? 10.963 7.300   9.970   1.00 0.00 ? 47 GLN A CG   10 
ATOM 11665 C CD   . GLN A 1 47 ? 11.241 8.714   9.500   1.00 0.00 ? 47 GLN A CD   10 
ATOM 11666 O OE1  . GLN A 1 47 ? 10.318 9.502   9.255   1.00 0.00 ? 47 GLN A OE1  10 
ATOM 11667 N NE2  . GLN A 1 47 ? 12.507 9.072   9.385   1.00 0.00 ? 47 GLN A NE2  10 
ATOM 11668 H H    . GLN A 1 47 ? 11.457 5.196   7.367   1.00 0.00 ? 47 GLN A H    10 
ATOM 11669 H HA   . GLN A 1 47 ? 8.742  5.746   7.782   1.00 0.00 ? 47 GLN A HA   10 
ATOM 11670 H HB2  . GLN A 1 47 ? 8.914  7.546   9.468   1.00 0.00 ? 47 GLN A HB2  10 
ATOM 11671 H HB3  . GLN A 1 47 ? 9.321  5.953   10.138  1.00 0.00 ? 47 GLN A HB3  10 
ATOM 11672 H HG2  . GLN A 1 47 ? 10.949 7.300   11.037  1.00 0.00 ? 47 GLN A HG2  10 
ATOM 11673 H HG3  . GLN A 1 47 ? 11.777 6.653   9.615   1.00 0.00 ? 47 GLN A HG3  10 
ATOM 11674 H HE21 . GLN A 1 47 ? 13.204 8.402   9.587   1.00 0.00 ? 47 GLN A HE21 10 
ATOM 11675 H HE22 . GLN A 1 47 ? 12.700 9.983   9.076   1.00 0.00 ? 47 GLN A HE22 10 
ATOM 11676 N N    . SER A 1 48 ? 9.095  8.132   6.749   1.00 0.00 ? 48 SER A N    10 
ATOM 11677 C CA   . SER A 1 48 ? 9.314  9.227   5.812   1.00 0.00 ? 48 SER A CA   10 
ATOM 11678 C C    . SER A 1 48 ? 8.432  10.410  6.124   1.00 0.00 ? 48 SER A C    10 
ATOM 11679 O O    . SER A 1 48 ? 7.702  10.410  7.105   1.00 0.00 ? 48 SER A O    10 
ATOM 11680 C CB   . SER A 1 48 ? 9.062  8.757   4.384   1.00 0.00 ? 48 SER A CB   10 
ATOM 11681 O OG   . SER A 1 48 ? 9.929  7.697   4.034   1.00 0.00 ? 48 SER A OG   10 
ATOM 11682 H H    . SER A 1 48 ? 8.212  8.037   7.177   1.00 0.00 ? 48 SER A H    10 
ATOM 11683 H HA   . SER A 1 48 ? 10.346 9.538   5.896   1.00 0.00 ? 48 SER A HA   10 
ATOM 11684 H HB2  . SER A 1 48 ? 8.034  8.411   4.307   1.00 0.00 ? 48 SER A HB2  10 
ATOM 11685 H HB3  . SER A 1 48 ? 9.212  9.581   3.694   1.00 0.00 ? 48 SER A HB3  10 
ATOM 11686 H HG   . SER A 1 48 ? 10.235 7.257   4.830   1.00 0.00 ? 48 SER A HG   10 
ATOM 11687 N N    . ASN A 1 49 ? 8.520  11.423  5.284   1.00 0.00 ? 49 ASN A N    10 
ATOM 11688 C CA   . ASN A 1 49 ? 7.620  12.562  5.371   1.00 0.00 ? 49 ASN A CA   10 
ATOM 11689 C C    . ASN A 1 49 ? 6.410  12.205  4.530   1.00 0.00 ? 49 ASN A C    10 
ATOM 11690 O O    . ASN A 1 49 ? 6.486  12.168  3.307   1.00 0.00 ? 49 ASN A O    10 
ATOM 11691 C CB   . ASN A 1 49 ? 8.271  13.867  4.913   1.00 0.00 ? 49 ASN A CB   10 
ATOM 11692 C CG   . ASN A 1 49 ? 9.358  14.370  5.866   1.00 0.00 ? 49 ASN A CG   10 
ATOM 11693 O OD1  . ASN A 1 49 ? 9.532  15.573  6.043   1.00 0.00 ? 49 ASN A OD1  10 
ATOM 11694 N ND2  . ASN A 1 49 ? 10.093 13.454  6.482   1.00 0.00 ? 49 ASN A ND2  10 
ATOM 11695 H H    . ASN A 1 49 ? 9.160  11.367  4.519   1.00 0.00 ? 49 ASN A H    10 
ATOM 11696 H HA   . ASN A 1 49 ? 7.310  12.664  6.409   1.00 0.00 ? 49 ASN A HA   10 
ATOM 11697 H HB2  . ASN A 1 49 ? 8.724  13.714  3.946   1.00 0.00 ? 49 ASN A HB2  10 
ATOM 11698 H HB3  . ASN A 1 49 ? 7.510  14.637  4.832   1.00 0.00 ? 49 ASN A HB3  10 
ATOM 11699 H HD21 . ASN A 1 49 ? 9.894  12.508  6.305   1.00 0.00 ? 49 ASN A HD21 10 
ATOM 11700 H HD22 . ASN A 1 49 ? 10.815 13.759  7.076   1.00 0.00 ? 49 ASN A HD22 10 
ATOM 11701 N N    . ASN A 1 50 ? 5.305  11.928  5.199   1.00 0.00 ? 50 ASN A N    10 
ATOM 11702 C CA   . ASN A 1 50 ? 4.182  11.242  4.571   1.00 0.00 ? 50 ASN A CA   10 
ATOM 11703 C C    . ASN A 1 50 ? 3.379  12.177  3.660   1.00 0.00 ? 50 ASN A C    10 
ATOM 11704 O O    . ASN A 1 50 ? 2.247  12.564  3.988   1.00 0.00 ? 50 ASN A O    10 
ATOM 11705 C CB   . ASN A 1 50 ? 3.267  10.638  5.643   1.00 0.00 ? 50 ASN A CB   10 
ATOM 11706 C CG   . ASN A 1 50 ? 2.304  9.619   5.058   1.00 0.00 ? 50 ASN A CG   10 
ATOM 11707 O OD1  . ASN A 1 50 ? 2.592  8.958   4.072   1.00 0.00 ? 50 ASN A OD1  10 
ATOM 11708 N ND2  . ASN A 1 50 ? 1.139  9.483   5.680   1.00 0.00 ? 50 ASN A ND2  10 
ATOM 11709 H H    . ASN A 1 50 ? 5.236  12.219  6.146   1.00 0.00 ? 50 ASN A H    10 
ATOM 11710 H HA   . ASN A 1 50 ? 4.576  10.445  3.960   1.00 0.00 ? 50 ASN A HA   10 
ATOM 11711 H HB2  . ASN A 1 50 ? 3.881  10.147  6.385   1.00 0.00 ? 50 ASN A HB2  10 
ATOM 11712 H HB3  . ASN A 1 50 ? 2.700  11.442  6.091   1.00 0.00 ? 50 ASN A HB3  10 
ATOM 11713 H HD21 . ASN A 1 50 ? 0.976  10.041  6.477   1.00 0.00 ? 50 ASN A HD21 10 
ATOM 11714 H HD22 . ASN A 1 50 ? 0.477  8.836   5.327   1.00 0.00 ? 50 ASN A HD22 10 
ATOM 11715 N N    . GLY A 1 51 ? 3.993  12.562  2.552   1.00 0.00 ? 51 GLY A N    10 
ATOM 11716 C CA   . GLY A 1 51 ? 3.307  13.352  1.549   1.00 0.00 ? 51 GLY A CA   10 
ATOM 11717 C C    . GLY A 1 51 ? 4.248  14.037  0.559   1.00 0.00 ? 51 GLY A C    10 
ATOM 11718 O O    . GLY A 1 51 ? 3.798  14.707  -0.375  1.00 0.00 ? 51 GLY A O    10 
ATOM 11719 H H    . GLY A 1 51 ? 4.943  12.378  2.444   1.00 0.00 ? 51 GLY A H    10 
ATOM 11720 H HA2  . GLY A 1 51 ? 2.637  12.699  0.990   1.00 0.00 ? 51 GLY A HA2  10 
ATOM 11721 H HA3  . GLY A 1 51 ? 2.725  14.120  2.053   1.00 0.00 ? 51 GLY A HA3  10 
ATOM 11722 N N    . VAL A 1 52 ? 5.560  13.875  0.756   1.00 0.00 ? 52 VAL A N    10 
ATOM 11723 C CA   . VAL A 1 52 ? 6.558  14.495  -0.110  1.00 0.00 ? 52 VAL A CA   10 
ATOM 11724 C C    . VAL A 1 52 ? 7.669  13.506  -0.477  1.00 0.00 ? 52 VAL A C    10 
ATOM 11725 O O    . VAL A 1 52 ? 7.763  12.424  0.118   1.00 0.00 ? 52 VAL A O    10 
ATOM 11726 C CB   . VAL A 1 52 ? 7.161  15.755  0.552   1.00 0.00 ? 52 VAL A CB   10 
ATOM 11727 C CG1  . VAL A 1 52 ? 6.167  16.914  0.570   1.00 0.00 ? 52 VAL A CG1  10 
ATOM 11728 C CG2  . VAL A 1 52 ? 7.615  15.450  1.963   1.00 0.00 ? 52 VAL A CG2  10 
ATOM 11729 H H    . VAL A 1 52 ? 5.858  13.307  1.494   1.00 0.00 ? 52 VAL A H    10 
ATOM 11730 H HA   . VAL A 1 52 ? 6.052  14.793  -1.014  1.00 0.00 ? 52 VAL A HA   10 
ATOM 11731 H HB   . VAL A 1 52 ? 8.034  16.070  -0.017  1.00 0.00 ? 52 VAL A HB   10 
ATOM 11732 H HG11 . VAL A 1 52 ? 5.284  16.605  1.088   1.00 0.00 ? 52 VAL A HG11 10 
ATOM 11733 H HG12 . VAL A 1 52 ? 5.916  17.172  -0.455  1.00 0.00 ? 52 VAL A HG12 10 
ATOM 11734 H HG13 . VAL A 1 52 ? 6.608  17.755  1.064   1.00 0.00 ? 52 VAL A HG13 10 
ATOM 11735 H HG21 . VAL A 1 52 ? 6.771  15.111  2.549   1.00 0.00 ? 52 VAL A HG21 10 
ATOM 11736 H HG22 . VAL A 1 52 ? 8.011  16.351  2.421   1.00 0.00 ? 52 VAL A HG22 10 
ATOM 11737 H HG23 . VAL A 1 52 ? 8.379  14.695  1.955   1.00 0.00 ? 52 VAL A HG23 10 
ATOM 11738 N N    . PRO A 1 53 ? 8.500  13.864  -1.489  1.00 0.00 ? 53 PRO A N    10 
ATOM 11739 C CA   . PRO A 1 53 ? 9.600  13.018  -2.001  1.00 0.00 ? 53 PRO A CA   10 
ATOM 11740 C C    . PRO A 1 53 ? 10.543 12.397  -0.966  1.00 0.00 ? 53 PRO A C    10 
ATOM 11741 O O    . PRO A 1 53 ? 10.900 11.236  -1.116  1.00 0.00 ? 53 PRO A O    10 
ATOM 11742 C CB   . PRO A 1 53 ? 10.371 13.933  -2.963  1.00 0.00 ? 53 PRO A CB   10 
ATOM 11743 C CG   . PRO A 1 53 ? 9.806  15.299  -2.779  1.00 0.00 ? 53 PRO A CG   10 
ATOM 11744 C CD   . PRO A 1 53 ? 8.421  15.127  -2.248  1.00 0.00 ? 53 PRO A CD   10 
ATOM 11745 H HA   . PRO A 1 53 ? 9.181  12.204  -2.602  1.00 0.00 ? 53 PRO A HA   10 
ATOM 11746 H HB2  . PRO A 1 53 ? 11.418 13.903  -2.717  1.00 0.00 ? 53 PRO A HB2  10 
ATOM 11747 H HB3  . PRO A 1 53 ? 10.234 13.586  -3.988  1.00 0.00 ? 53 PRO A HB3  10 
ATOM 11748 H HG2  . PRO A 1 53 ? 10.412 15.860  -2.074  1.00 0.00 ? 53 PRO A HG2  10 
ATOM 11749 H HG3  . PRO A 1 53 ? 9.771  15.820  -3.728  1.00 0.00 ? 53 PRO A HG3  10 
ATOM 11750 H HD2  . PRO A 1 53 ? 8.157  15.953  -1.605  1.00 0.00 ? 53 PRO A HD2  10 
ATOM 11751 H HD3  . PRO A 1 53 ? 7.712  15.045  -3.062  1.00 0.00 ? 53 PRO A HD3  10 
ATOM 11752 N N    . PRO A 1 54 ? 11.014 13.136  0.083   1.00 0.00 ? 54 PRO A N    10 
ATOM 11753 C CA   . PRO A 1 54 ? 11.978 12.582  1.053   1.00 0.00 ? 54 PRO A CA   10 
ATOM 11754 C C    . PRO A 1 54 ? 11.505 11.288  1.717   1.00 0.00 ? 54 PRO A C    10 
ATOM 11755 O O    . PRO A 1 54 ? 10.516 11.262  2.469   1.00 0.00 ? 54 PRO A O    10 
ATOM 11756 C CB   . PRO A 1 54 ? 12.132 13.687  2.106   1.00 0.00 ? 54 PRO A CB   10 
ATOM 11757 C CG   . PRO A 1 54 ? 10.983 14.610  1.878   1.00 0.00 ? 54 PRO A CG   10 
ATOM 11758 C CD   . PRO A 1 54 ? 10.681 14.527  0.419   1.00 0.00 ? 54 PRO A CD   10 
ATOM 11759 H HA   . PRO A 1 54 ? 12.935 12.406  0.572   1.00 0.00 ? 54 PRO A HA   10 
ATOM 11760 H HB2  . PRO A 1 54 ? 12.105 13.273  3.102   1.00 0.00 ? 54 PRO A HB2  10 
ATOM 11761 H HB3  . PRO A 1 54 ? 13.082 14.209  1.954   1.00 0.00 ? 54 PRO A HB3  10 
ATOM 11762 H HG2  . PRO A 1 54 ? 10.138 14.280  2.456   1.00 0.00 ? 54 PRO A HG2  10 
ATOM 11763 H HG3  . PRO A 1 54 ? 11.262 15.621  2.155   1.00 0.00 ? 54 PRO A HG3  10 
ATOM 11764 H HD2  . PRO A 1 54 ? 9.628  14.728  0.246   1.00 0.00 ? 54 PRO A HD2  10 
ATOM 11765 H HD3  . PRO A 1 54 ? 11.295 15.216  -0.136  1.00 0.00 ? 54 PRO A HD3  10 
ATOM 11766 N N    . VAL A 1 55 ? 12.242 10.224  1.459   1.00 0.00 ? 55 VAL A N    10 
ATOM 11767 C CA   . VAL A 1 55 ? 12.022 8.933   2.087   1.00 0.00 ? 55 VAL A CA   10 
ATOM 11768 C C    . VAL A 1 55 ? 13.260 8.524   2.862   1.00 0.00 ? 55 VAL A C    10 
ATOM 11769 O O    . VAL A 1 55 ? 14.379 8.567   2.339   1.00 0.00 ? 55 VAL A O    10 
ATOM 11770 C CB   . VAL A 1 55 ? 11.630 7.835   1.049   1.00 0.00 ? 55 VAL A CB   10 
ATOM 11771 C CG1  . VAL A 1 55 ? 12.681 7.695   -0.054  1.00 0.00 ? 55 VAL A CG1  10 
ATOM 11772 C CG2  . VAL A 1 55 ? 11.402 6.506   1.738   1.00 0.00 ? 55 VAL A CG2  10 
ATOM 11773 H H    . VAL A 1 55 ? 12.975 10.316  0.817   1.00 0.00 ? 55 VAL A H    10 
ATOM 11774 H HA   . VAL A 1 55 ? 11.202 9.043   2.772   1.00 0.00 ? 55 VAL A HA   10 
ATOM 11775 H HB   . VAL A 1 55 ? 10.694 8.139   0.586   1.00 0.00 ? 55 VAL A HB   10 
ATOM 11776 H HG11 . VAL A 1 55 ? 12.397 6.901   -0.732  1.00 0.00 ? 55 VAL A HG11 10 
ATOM 11777 H HG12 . VAL A 1 55 ? 13.646 7.470   0.400   1.00 0.00 ? 55 VAL A HG12 10 
ATOM 11778 H HG13 . VAL A 1 55 ? 12.743 8.622   -0.596  1.00 0.00 ? 55 VAL A HG13 10 
ATOM 11779 H HG21 . VAL A 1 55 ? 12.319 6.193   2.217   1.00 0.00 ? 55 VAL A HG21 10 
ATOM 11780 H HG22 . VAL A 1 55 ? 11.106 5.782   1.004   1.00 0.00 ? 55 VAL A HG22 10 
ATOM 11781 H HG23 . VAL A 1 55 ? 10.625 6.615   2.473   1.00 0.00 ? 55 VAL A HG23 10 
ATOM 11782 N N    . GLN A 1 56 ? 13.081 8.167   4.124   1.00 0.00 ? 56 GLN A N    10 
ATOM 11783 C CA   . GLN A 1 56 ? 14.215 7.822   4.987   1.00 0.00 ? 56 GLN A CA   10 
ATOM 11784 C C    . GLN A 1 56 ? 14.415 6.319   4.976   1.00 0.00 ? 56 GLN A C    10 
ATOM 11785 O O    . GLN A 1 56 ? 13.602 5.561   5.525   1.00 0.00 ? 56 GLN A O    10 
ATOM 11786 C CB   . GLN A 1 56 ? 13.984 8.338   6.410   1.00 0.00 ? 56 GLN A CB   10 
ATOM 11787 C CG   . GLN A 1 56 ? 15.095 7.957   7.388   1.00 0.00 ? 56 GLN A CG   10 
ATOM 11788 C CD   . GLN A 1 56 ? 16.434 8.601   7.065   1.00 0.00 ? 56 GLN A CD   10 
ATOM 11789 O OE1  . GLN A 1 56 ? 16.759 8.839   5.910   1.00 0.00 ? 56 GLN A OE1  10 
ATOM 11790 N NE2  . GLN A 1 56 ? 17.231 8.858   8.089   1.00 0.00 ? 56 GLN A NE2  10 
ATOM 11791 H H    . GLN A 1 56 ? 12.163 8.050   4.477   1.00 0.00 ? 56 GLN A H    10 
ATOM 11792 H HA   . GLN A 1 56 ? 15.091 8.296   4.566   1.00 0.00 ? 56 GLN A HA   10 
ATOM 11793 H HB2  . GLN A 1 56 ? 13.891 9.416   6.382   1.00 0.00 ? 56 GLN A HB2  10 
ATOM 11794 H HB3  . GLN A 1 56 ? 13.058 7.913   6.786   1.00 0.00 ? 56 GLN A HB3  10 
ATOM 11795 H HG2  . GLN A 1 56 ? 14.786 8.304   8.372   1.00 0.00 ? 56 GLN A HG2  10 
ATOM 11796 H HG3  . GLN A 1 56 ? 15.205 6.885   7.396   1.00 0.00 ? 56 GLN A HG3  10 
ATOM 11797 H HE21 . GLN A 1 56 ? 16.888 8.656   8.999   1.00 0.00 ? 56 GLN A HE21 10 
ATOM 11798 H HE22 . GLN A 1 56 ? 18.110 9.255   7.913   1.00 0.00 ? 56 GLN A HE22 10 
ATOM 11799 N N    . VAL A 1 57 ? 15.499 5.890   4.370   1.00 0.00 ? 57 VAL A N    10 
ATOM 11800 C CA   . VAL A 1 57 ? 15.759 4.478   4.154   1.00 0.00 ? 57 VAL A CA   10 
ATOM 11801 C C    . VAL A 1 57 ? 17.112 4.090   4.769   1.00 0.00 ? 57 VAL A C    10 
ATOM 11802 O O    . VAL A 1 57 ? 18.070 4.862   4.730   1.00 0.00 ? 57 VAL A O    10 
ATOM 11803 C CB   . VAL A 1 57 ? 15.771 4.156   2.649   1.00 0.00 ? 57 VAL A CB   10 
ATOM 11804 C CG1  . VAL A 1 57 ? 16.085 2.692   2.381   1.00 0.00 ? 57 VAL A CG1  10 
ATOM 11805 C CG2  . VAL A 1 57 ? 14.436 4.523   2.020   1.00 0.00 ? 57 VAL A CG2  10 
ATOM 11806 H H    . VAL A 1 57 ? 16.170 6.547   4.053   1.00 0.00 ? 57 VAL A H    10 
ATOM 11807 H HA   . VAL A 1 57 ? 14.978 3.906   4.633   1.00 0.00 ? 57 VAL A HA   10 
ATOM 11808 H HB   . VAL A 1 57 ? 16.532 4.756   2.165   1.00 0.00 ? 57 VAL A HB   10 
ATOM 11809 H HG11 . VAL A 1 57 ? 16.064 2.512   1.312   1.00 0.00 ? 57 VAL A HG11 10 
ATOM 11810 H HG12 . VAL A 1 57 ? 15.346 2.073   2.866   1.00 0.00 ? 57 VAL A HG12 10 
ATOM 11811 H HG13 . VAL A 1 57 ? 17.068 2.450   2.775   1.00 0.00 ? 57 VAL A HG13 10 
ATOM 11812 H HG21 . VAL A 1 57 ? 13.654 3.956   2.490   1.00 0.00 ? 57 VAL A HG21 10 
ATOM 11813 H HG22 . VAL A 1 57 ? 14.461 4.304   0.967   1.00 0.00 ? 57 VAL A HG22 10 
ATOM 11814 H HG23 . VAL A 1 57 ? 14.237 5.574   2.169   1.00 0.00 ? 57 VAL A HG23 10 
ATOM 11815 N N    . PHE A 1 58 ? 17.168 2.910   5.370   1.00 0.00 ? 58 PHE A N    10 
ATOM 11816 C CA   . PHE A 1 58 ? 18.429 2.392   5.871   1.00 0.00 ? 58 PHE A CA   10 
ATOM 11817 C C    . PHE A 1 58 ? 19.058 1.478   4.825   1.00 0.00 ? 58 PHE A C    10 
ATOM 11818 O O    . PHE A 1 58 ? 18.562 0.390   4.571   1.00 0.00 ? 58 PHE A O    10 
ATOM 11819 C CB   . PHE A 1 58 ? 18.233 1.637   7.203   1.00 0.00 ? 58 PHE A CB   10 
ATOM 11820 C CG   . PHE A 1 58 ? 19.500 1.063   7.761   1.00 0.00 ? 58 PHE A CG   10 
ATOM 11821 C CD1  . PHE A 1 58 ? 20.435 1.890   8.373   1.00 0.00 ? 58 PHE A CD1  10 
ATOM 11822 C CD2  . PHE A 1 58 ? 19.753 -0.297  7.686   1.00 0.00 ? 58 PHE A CD2  10 
ATOM 11823 C CE1  . PHE A 1 58 ? 21.605 1.375   8.902   1.00 0.00 ? 58 PHE A CE1  10 
ATOM 11824 C CE2  . PHE A 1 58 ? 20.919 -0.822  8.218   1.00 0.00 ? 58 PHE A CE2  10 
ATOM 11825 C CZ   . PHE A 1 58 ? 21.844 0.011   8.818   1.00 0.00 ? 58 PHE A CZ   10 
ATOM 11826 H H    . PHE A 1 58 ? 16.349 2.376   5.472   1.00 0.00 ? 58 PHE A H    10 
ATOM 11827 H HA   . PHE A 1 58 ? 19.097 3.229   6.038   1.00 0.00 ? 58 PHE A HA   10 
ATOM 11828 H HB2  . PHE A 1 58 ? 17.810 2.311   7.933   1.00 0.00 ? 58 PHE A HB2  10 
ATOM 11829 H HB3  . PHE A 1 58 ? 17.533 0.812   7.024   1.00 0.00 ? 58 PHE A HB3  10 
ATOM 11830 H HD1  . PHE A 1 58 ? 20.235 2.959   8.438   1.00 0.00 ? 58 PHE A HD1  10 
ATOM 11831 H HD2  . PHE A 1 58 ? 19.032 -0.963  7.215   1.00 0.00 ? 58 PHE A HD2  10 
ATOM 11832 H HE1  . PHE A 1 58 ? 22.328 2.026   9.378   1.00 0.00 ? 58 PHE A HE1  10 
ATOM 11833 H HE2  . PHE A 1 58 ? 21.115 -1.882  8.146   1.00 0.00 ? 58 PHE A HE2  10 
ATOM 11834 H HZ   . PHE A 1 58 ? 22.756 -0.405  9.242   1.00 0.00 ? 58 PHE A HZ   10 
ATOM 11835 N N    . TRP A 1 59 ? 20.139 1.930   4.246   1.00 0.00 ? 59 TRP A N    10 
ATOM 11836 C CA   . TRP A 1 59 ? 20.794 1.196   3.153   1.00 0.00 ? 59 TRP A CA   10 
ATOM 11837 C C    . TRP A 1 59 ? 21.906 0.324   3.713   1.00 0.00 ? 59 TRP A C    10 
ATOM 11838 O O    . TRP A 1 59 ? 22.785 0.818   4.429   1.00 0.00 ? 59 TRP A O    10 
ATOM 11839 C CB   . TRP A 1 59 ? 21.336 2.172   2.126   1.00 0.00 ? 59 TRP A CB   10 
ATOM 11840 C CG   . TRP A 1 59 ? 20.260 3.021   1.512   1.00 0.00 ? 59 TRP A CG   10 
ATOM 11841 C CD1  . TRP A 1 59 ? 19.896 4.278   1.879   1.00 0.00 ? 59 TRP A CD1  10 
ATOM 11842 C CD2  . TRP A 1 59 ? 19.380 2.640   0.454   1.00 0.00 ? 59 TRP A CD2  10 
ATOM 11843 N NE1  . TRP A 1 59 ? 18.859 4.714   1.093   1.00 0.00 ? 59 TRP A NE1  10 
ATOM 11844 C CE2  . TRP A 1 59 ? 18.528 3.718   0.210   1.00 0.00 ? 59 TRP A CE2  10 
ATOM 11845 C CE3  . TRP A 1 59 ? 19.240 1.493   -0.316  1.00 0.00 ? 59 TRP A CE3  10 
ATOM 11846 C CZ2  . TRP A 1 59 ? 17.541 3.686   -0.765  1.00 0.00 ? 59 TRP A CZ2  10 
ATOM 11847 C CZ3  . TRP A 1 59 ? 18.264 1.447   -1.286  1.00 0.00 ? 59 TRP A CZ3  10 
ATOM 11848 C CH2  . TRP A 1 59 ? 17.420 2.541   -1.499  1.00 0.00 ? 59 TRP A CH2  10 
ATOM 11849 H H    . TRP A 1 59 ? 20.538 2.769   4.576   1.00 0.00 ? 59 TRP A H    10 
ATOM 11850 H HA   . TRP A 1 59 ? 20.046 0.574   2.700   1.00 0.00 ? 59 TRP A HA   10 
ATOM 11851 H HB2  . TRP A 1 59 ? 22.055 2.826   2.579   1.00 0.00 ? 59 TRP A HB2  10 
ATOM 11852 H HB3  . TRP A 1 59 ? 21.818 1.634   1.326   1.00 0.00 ? 59 TRP A HB3  10 
ATOM 11853 H HD1  . TRP A 1 59 ? 20.373 4.851   2.672   1.00 0.00 ? 59 TRP A HD1  10 
ATOM 11854 H HE1  . TRP A 1 59 ? 18.433 5.596   1.151   1.00 0.00 ? 59 TRP A HE1  10 
ATOM 11855 H HE3  . TRP A 1 59 ? 19.883 0.631   -0.161  1.00 0.00 ? 59 TRP A HE3  10 
ATOM 11856 H HZ2  . TRP A 1 59 ? 16.899 4.526   -0.936  1.00 0.00 ? 59 TRP A HZ2  10 
ATOM 11857 H HZ3  . TRP A 1 59 ? 18.136 0.569   -1.905  1.00 0.00 ? 59 TRP A HZ3  10 
ATOM 11858 H HH2  . TRP A 1 59 ? 16.663 2.472   -2.280  1.00 0.00 ? 59 TRP A HH2  10 
ATOM 11859 N N    . GLU A 1 60 ? 21.860 -0.965  3.406   1.00 0.00 ? 60 GLU A N    10 
ATOM 11860 C CA   . GLU A 1 60 ? 22.760 -1.931  4.016   1.00 0.00 ? 60 GLU A CA   10 
ATOM 11861 C C    . GLU A 1 60 ? 24.202 -1.786  3.524   1.00 0.00 ? 60 GLU A C    10 
ATOM 11862 O O    . GLU A 1 60 ? 25.121 -1.793  4.333   1.00 0.00 ? 60 GLU A O    10 
ATOM 11863 C CB   . GLU A 1 60 ? 22.264 -3.374  3.790   1.00 0.00 ? 60 GLU A CB   10 
ATOM 11864 C CG   . GLU A 1 60 ? 22.115 -3.769  2.334   1.00 0.00 ? 60 GLU A CG   10 
ATOM 11865 C CD   . GLU A 1 60 ? 21.688 -5.215  2.163   1.00 0.00 ? 60 GLU A CD   10 
ATOM 11866 O OE1  . GLU A 1 60 ? 20.639 -5.596  2.714   1.00 0.00 ? 60 GLU A OE1  10 
ATOM 11867 O OE2  . GLU A 1 60 ? 22.420 -5.971  1.510   1.00 0.00 ? 60 GLU A OE2  10 
ATOM 11868 H H    . GLU A 1 60 ? 21.199 -1.280  2.755   1.00 0.00 ? 60 GLU A H    10 
ATOM 11869 H HA   . GLU A 1 60 ? 22.735 -1.733  5.076   1.00 0.00 ? 60 GLU A HA   10 
ATOM 11870 H HB2  . GLU A 1 60 ? 22.968 -4.059  4.253   1.00 0.00 ? 60 GLU A HB2  10 
ATOM 11871 H HB3  . GLU A 1 60 ? 21.305 -3.484  4.274   1.00 0.00 ? 60 GLU A HB3  10 
ATOM 11872 H HG2  . GLU A 1 60 ? 21.361 -3.138  1.880   1.00 0.00 ? 60 GLU A HG2  10 
ATOM 11873 H HG3  . GLU A 1 60 ? 23.054 -3.624  1.833   1.00 0.00 ? 60 GLU A HG3  10 
ATOM 11874 N N    . SER A 1 61 ? 24.408 -1.612  2.213   1.00 0.00 ? 61 SER A N    10 
ATOM 11875 C CA   . SER A 1 61 ? 25.747 -1.568  1.652   1.00 0.00 ? 61 SER A CA   10 
ATOM 11876 C C    . SER A 1 61 ? 26.534 -0.371  2.184   1.00 0.00 ? 61 SER A C    10 
ATOM 11877 O O    . SER A 1 61 ? 27.706 -0.474  2.548   1.00 0.00 ? 61 SER A O    10 
ATOM 11878 C CB   . SER A 1 61 ? 25.666 -1.544  0.133   1.00 0.00 ? 61 SER A CB   10 
ATOM 11879 O OG   . SER A 1 61 ? 24.773 -2.549  -0.330  1.00 0.00 ? 61 SER A OG   10 
ATOM 11880 H H    . SER A 1 61 ? 23.629 -1.531  1.615   1.00 0.00 ? 61 SER A H    10 
ATOM 11881 H HA   . SER A 1 61 ? 26.253 -2.472  1.974   1.00 0.00 ? 61 SER A HA   10 
ATOM 11882 H HB2  . SER A 1 61 ? 25.317 -0.585  -0.192  1.00 0.00 ? 61 SER A HB2  10 
ATOM 11883 H HB3  . SER A 1 61 ? 26.645 -1.729  -0.290  1.00 0.00 ? 61 SER A HB3  10 
ATOM 11884 H HG   . SER A 1 61 ? 23.867 -2.171  -0.331  1.00 0.00 ? 61 SER A HG   10 
ATOM 11885 N N    . THR A 1 62 ? 25.865 0.770   2.279   1.00 0.00 ? 62 THR A N    10 
ATOM 11886 C CA   . THR A 1 62 ? 26.470 1.978   2.833   1.00 0.00 ? 62 THR A CA   10 
ATOM 11887 C C    . THR A 1 62 ? 26.411 1.935   4.356   1.00 0.00 ? 62 THR A C    10 
ATOM 11888 O O    . THR A 1 62 ? 27.204 2.568   5.066   1.00 0.00 ? 62 THR A O    10 
ATOM 11889 C CB   . THR A 1 62 ? 25.740 3.221   2.325   1.00 0.00 ? 62 THR A CB   10 
ATOM 11890 O OG1  . THR A 1 62 ? 25.626 3.171   0.893   1.00 0.00 ? 62 THR A OG1  10 
ATOM 11891 C CG2  . THR A 1 62 ? 26.465 4.493   2.735   1.00 0.00 ? 62 THR A CG2  10 
ATOM 11892 H H    . THR A 1 62 ? 24.948 0.807   1.953   1.00 0.00 ? 62 THR A H    10 
ATOM 11893 H HA   . THR A 1 62 ? 27.518 2.029   2.516   1.00 0.00 ? 62 THR A HA   10 
ATOM 11894 H HB   . THR A 1 62 ? 24.745 3.236   2.750   1.00 0.00 ? 62 THR A HB   10 
ATOM 11895 H HG1  . THR A 1 62 ? 24.862 2.646   0.635   1.00 0.00 ? 62 THR A HG1  10 
ATOM 11896 H HG21 . THR A 1 62 ? 25.937 5.354   2.354   1.00 0.00 ? 62 THR A HG21 10 
ATOM 11897 H HG22 . THR A 1 62 ? 27.467 4.478   2.324   1.00 0.00 ? 62 THR A HG22 10 
ATOM 11898 H HG23 . THR A 1 62 ? 26.525 4.527   3.811   1.00 0.00 ? 62 THR A HG23 10 
ATOM 11899 N N    . GLY A 1 63 ? 25.464 1.146   4.858   1.00 0.00 ? 63 GLY A N    10 
ATOM 11900 C CA   . GLY A 1 63 ? 25.261 1.012   6.293   1.00 0.00 ? 63 GLY A CA   10 
ATOM 11901 C C    . GLY A 1 63 ? 24.894 2.330   6.931   1.00 0.00 ? 63 GLY A C    10 
ATOM 11902 O O    . GLY A 1 63 ? 25.256 2.609   8.077   1.00 0.00 ? 63 GLY A O    10 
ATOM 11903 H H    . GLY A 1 63 ? 24.909 0.638   4.218   1.00 0.00 ? 63 GLY A H    10 
ATOM 11904 H HA2  . GLY A 1 63 ? 24.465 0.301   6.453   1.00 0.00 ? 63 GLY A HA2  10 
ATOM 11905 H HA3  . GLY A 1 63 ? 26.168 0.638   6.739   1.00 0.00 ? 63 GLY A HA3  10 
ATOM 11906 N N    . ARG A 1 64 ? 24.158 3.153   6.187   1.00 0.00 ? 64 ARG A N    10 
ATOM 11907 C CA   . ARG A 1 64 ? 23.758 4.486   6.617   1.00 0.00 ? 64 ARG A CA   10 
ATOM 11908 C C    . ARG A 1 64 ? 22.310 4.782   6.225   1.00 0.00 ? 64 ARG A C    10 
ATOM 11909 O O    . ARG A 1 64 ? 21.811 4.244   5.239   1.00 0.00 ? 64 ARG A O    10 
ATOM 11910 C CB   . ARG A 1 64 ? 24.679 5.557   6.013   1.00 0.00 ? 64 ARG A CB   10 
ATOM 11911 C CG   . ARG A 1 64 ? 26.054 5.630   6.663   1.00 0.00 ? 64 ARG A CG   10 
ATOM 11912 C CD   . ARG A 1 64 ? 26.995 6.534   5.883   1.00 0.00 ? 64 ARG A CD   10 
ATOM 11913 N NE   . ARG A 1 64 ? 26.383 7.798   5.496   1.00 0.00 ? 64 ARG A NE   10 
ATOM 11914 C CZ   . ARG A 1 64 ? 26.828 8.997   5.883   1.00 0.00 ? 64 ARG A CZ   10 
ATOM 11915 N NH1  . ARG A 1 64 ? 27.820 9.089   6.769   1.00 0.00 ? 64 ARG A NH1  10 
ATOM 11916 N NH2  . ARG A 1 64 ? 26.275 10.091  5.404   1.00 0.00 ? 64 ARG A NH2  10 
ATOM 11917 H H    . ARG A 1 64 ? 23.892 2.857   5.293   1.00 0.00 ? 64 ARG A H    10 
ATOM 11918 H HA   . ARG A 1 64 ? 23.852 4.529   7.697   1.00 0.00 ? 64 ARG A HA   10 
ATOM 11919 H HB2  . ARG A 1 64 ? 24.808 5.332   4.958   1.00 0.00 ? 64 ARG A HB2  10 
ATOM 11920 H HB3  . ARG A 1 64 ? 24.203 6.508   6.119   1.00 0.00 ? 64 ARG A HB3  10 
ATOM 11921 H HG2  . ARG A 1 64 ? 25.941 6.015   7.658   1.00 0.00 ? 64 ARG A HG2  10 
ATOM 11922 H HG3  . ARG A 1 64 ? 26.464 4.635   6.708   1.00 0.00 ? 64 ARG A HG3  10 
ATOM 11923 H HD2  . ARG A 1 64 ? 27.865 6.731   6.493   1.00 0.00 ? 64 ARG A HD2  10 
ATOM 11924 H HD3  . ARG A 1 64 ? 27.300 6.012   4.985   1.00 0.00 ? 64 ARG A HD3  10 
ATOM 11925 H HE   . ARG A 1 64 ? 25.614 7.755   4.882   1.00 0.00 ? 64 ARG A HE   10 
ATOM 11926 H HH11 . ARG A 1 64 ? 28.237 8.264   7.147   1.00 0.00 ? 64 ARG A HH11 10 
ATOM 11927 H HH12 . ARG A 1 64 ? 28.155 9.994   7.054   1.00 0.00 ? 64 ARG A HH12 10 
ATOM 11928 H HH21 . ARG A 1 64 ? 25.518 10.039  4.745   1.00 0.00 ? 64 ARG A HH21 10 
ATOM 11929 H HH22 . ARG A 1 64 ? 26.616 11.003  5.703   1.00 0.00 ? 64 ARG A HH22 10 
ATOM 11930 N N    . THR A 1 65 ? 21.654 5.623   6.998   1.00 0.00 ? 65 THR A N    10 
ATOM 11931 C CA   . THR A 1 65 ? 20.346 6.130   6.635   1.00 0.00 ? 65 THR A CA   10 
ATOM 11932 C C    . THR A 1 65 ? 20.487 7.326   5.715   1.00 0.00 ? 65 THR A C    10 
ATOM 11933 O O    . THR A 1 65 ? 21.415 8.127   5.835   1.00 0.00 ? 65 THR A O    10 
ATOM 11934 C CB   . THR A 1 65 ? 19.548 6.519   7.881   1.00 0.00 ? 65 THR A CB   10 
ATOM 11935 O OG1  . THR A 1 65 ? 20.387 7.251   8.786   1.00 0.00 ? 65 THR A OG1  10 
ATOM 11936 C CG2  . THR A 1 65 ? 18.981 5.298   8.583   1.00 0.00 ? 65 THR A CG2  10 
ATOM 11937 H H    . THR A 1 65 ? 22.042 5.910   7.850   1.00 0.00 ? 65 THR A H    10 
ATOM 11938 H HA   . THR A 1 65 ? 19.822 5.342   6.123   1.00 0.00 ? 65 THR A HA   10 
ATOM 11939 H HB   . THR A 1 65 ? 18.724 7.155   7.587   1.00 0.00 ? 65 THR A HB   10 
ATOM 11940 H HG1  . THR A 1 65 ? 20.291 8.200   8.615   1.00 0.00 ? 65 THR A HG1  10 
ATOM 11941 H HG21 . THR A 1 65 ? 19.790 4.669   8.906   1.00 0.00 ? 65 THR A HG21 10 
ATOM 11942 H HG22 . THR A 1 65 ? 18.347 4.750   7.897   1.00 0.00 ? 65 THR A HG22 10 
ATOM 11943 H HG23 . THR A 1 65 ? 18.39