data_2JOR
# 
_entry.id   2JOR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2JOR         pdb_00002jor 10.2210/pdb2jor/pdb 
RCSB  RCSB100099   ?            ?                   
WWPDB D_1000100099 ?            ?                   
# 
_pdbx_database_related.db_id          2BAF 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JOR 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-20 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Burton, R.A.' 1 
'Tsurupa, G.'  2 
'Roy, H.'      3 
'Nico, T.'     4 
'Leonid, M.'   5 
# 
_citation.id                        primary 
_citation.title                     
'NMR Solution Structure, Stability, and Interaction of the Recombinant Bovine Fibrinogen alphaC-Domain Fragment' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            46 
_citation.page_first                8550 
_citation.page_last                 8560 
_citation.year                      2007 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17590019 
_citation.pdbx_database_id_DOI      10.1021/bi700606v 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Burton, R.A.'  1 ? 
primary 'Tsurupa, G.'   2 ? 
primary 'Hantgan, R.R.' 3 ? 
primary 'Tjandra, N.'   4 ? 
primary 'Medved, L.'    5 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Fibrinogen alpha chain' 
_entity.formula_weight             8974.674 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'ALPHA-C DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MIDNEKVTSGHTTTTRRSCSKVITKTVTNADGRTETTKEVVKSEDGSDCGDADFDWHHTFPSRGNLDDFFHRDKDDFFT 
_entity_poly.pdbx_seq_one_letter_code_can   MIDNEKVTSGHTTTTRRSCSKVITKTVTNADGRTETTKEVVKSEDGSDCGDADFDWHHTFPSRGNLDDFFHRDKDDFFT 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ILE n 
1 3  ASP n 
1 4  ASN n 
1 5  GLU n 
1 6  LYS n 
1 7  VAL n 
1 8  THR n 
1 9  SER n 
1 10 GLY n 
1 11 HIS n 
1 12 THR n 
1 13 THR n 
1 14 THR n 
1 15 THR n 
1 16 ARG n 
1 17 ARG n 
1 18 SER n 
1 19 CYS n 
1 20 SER n 
1 21 LYS n 
1 22 VAL n 
1 23 ILE n 
1 24 THR n 
1 25 LYS n 
1 26 THR n 
1 27 VAL n 
1 28 THR n 
1 29 ASN n 
1 30 ALA n 
1 31 ASP n 
1 32 GLY n 
1 33 ARG n 
1 34 THR n 
1 35 GLU n 
1 36 THR n 
1 37 THR n 
1 38 LYS n 
1 39 GLU n 
1 40 VAL n 
1 41 VAL n 
1 42 LYS n 
1 43 SER n 
1 44 GLU n 
1 45 ASP n 
1 46 GLY n 
1 47 SER n 
1 48 ASP n 
1 49 CYS n 
1 50 GLY n 
1 51 ASP n 
1 52 ALA n 
1 53 ASP n 
1 54 PHE n 
1 55 ASP n 
1 56 TRP n 
1 57 HIS n 
1 58 HIS n 
1 59 THR n 
1 60 PHE n 
1 61 PRO n 
1 62 SER n 
1 63 ARG n 
1 64 GLY n 
1 65 ASN n 
1 66 LEU n 
1 67 ASP n 
1 68 ASP n 
1 69 PHE n 
1 70 PHE n 
1 71 HIS n 
1 72 ARG n 
1 73 ASP n 
1 74 LYS n 
1 75 ASP n 
1 76 ASP n 
1 77 PHE n 
1 78 PHE n 
1 79 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               cattle 
_entity_src_gen.gene_src_genus                     Bos 
_entity_src_gen.pdbx_gene_src_gene                 FGA 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bos taurus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9913 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'B834(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pLysS 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FIBA_BOVIN 
_struct_ref.pdbx_db_accession          P02672 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   IDNEKVTSGHTTTTRRSCSKVITKTVTNADGRTETTKEVVKSEDGSDCGDADFDWHHTFPSRGNLDDFFHRDKDDFFT 
_struct_ref.pdbx_align_begin           438 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JOR 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 79 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02672 
_struct_ref_seq.db_align_beg                  438 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  515 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       79 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2JOR 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P02672 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'initiating methionine' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'  
1 2 1 '3D HNCACB'       
1 3 1 '3D CBCA(CO)NH'   
1 4 1 '3D 1H-15N NOESY' 
1 5 1 '3D C(CO)NH'      
1 6 1 '2D 1H-15N HSQC'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         282 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '150 uM [U-99% 13C; U-99% 15N] protein, 10 mM KPO4 pH 6.5, 150 mM NaCl, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.entry_id           2JOR 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JOR 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JOR 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_software.authors          'Schwieters, Kuszewski, Tjandra and Clore' 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             'X-PLOR NIH' 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JOR 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JOR 
_struct.title                     
'NMR Solution Structure, Stability, and Interaction of the Recombinant Bovine Fibrinogen alphaC-Domain Fragment' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JOR 
_struct_keywords.pdbx_keywords   'BLOOD CLOTTING' 
_struct_keywords.text            'Protein, BLOOD CLOTTING' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       CYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        49 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASP 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        53 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        CYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         49 
_struct_conf.end_auth_comp_id        ASP 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         53 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            19 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            49 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             19 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             49 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.022 
_struct_conn.pdbx_value_order              ? 
_struct_conn.pdbx_role                     ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 21 ? ASN A 29 ? LYS A 21 ASN A 29 
A 2 ARG A 33 ? VAL A 41 ? ARG A 33 VAL A 41 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    25 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     25 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    37 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     37 
# 
_atom_sites.entry_id                    2JOR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? 24.528  6.454   5.671   1.00 0.00 ? 1  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? 24.866  6.731   7.096   1.00 0.00 ? 1  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? 23.805  6.096   8.001   1.00 0.00 ? 1  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? 22.697  5.832   7.582   1.00 0.00 ? 1  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? 24.904  8.249   7.323   1.00 0.00 ? 1  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? 25.693  8.565   8.597   1.00 0.00 ? 1  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? 25.393  10.284  9.082   1.00 0.00 ? 1  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? 26.676  10.386  10.354  1.00 0.00 ? 1  MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? 24.738  7.294   5.095   1.00 0.00 ? 1  MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? 23.516  6.223   5.594   1.00 0.00 ? 1  MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? 25.095  5.653   5.329   1.00 0.00 ? 1  MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? 25.833  6.307   7.324   1.00 0.00 ? 1  MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? 25.381  8.724   6.478   1.00 0.00 ? 1  MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? 23.896  8.625   7.422   1.00 0.00 ? 1  MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? 25.374  7.907   9.391   1.00 0.00 ? 1  MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? 26.747  8.423   8.412   1.00 0.00 ? 1  MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? 26.533  9.590   11.073  1.00 0.00 ? 1  MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? 26.612  11.343  10.852  1.00 0.00 ? 1  MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? 27.647  10.284  9.899   1.00 0.00 ? 1  MET A HE3  1  
ATOM 20    N N    . ILE A 1 2  ? 24.137  5.848   9.240   1.00 0.00 ? 2  ILE A N    1  
ATOM 21    C CA   . ILE A 1 2  ? 23.148  5.229   10.167  1.00 0.00 ? 2  ILE A CA   1  
ATOM 22    C C    . ILE A 1 2  ? 22.629  3.924   9.561   1.00 0.00 ? 2  ILE A C    1  
ATOM 23    O O    . ILE A 1 2  ? 21.494  3.834   9.134   1.00 0.00 ? 2  ILE A O    1  
ATOM 24    C CB   . ILE A 1 2  ? 21.978  6.191   10.384  1.00 0.00 ? 2  ILE A CB   1  
ATOM 25    C CG1  . ILE A 1 2  ? 22.518  7.587   10.703  1.00 0.00 ? 2  ILE A CG1  1  
ATOM 26    C CG2  . ILE A 1 2  ? 21.123  5.698   11.553  1.00 0.00 ? 2  ILE A CG2  1  
ATOM 27    C CD1  . ILE A 1 2  ? 21.352  8.531   11.000  1.00 0.00 ? 2  ILE A CD1  1  
ATOM 28    H H    . ILE A 1 2  ? 25.037  6.067   9.559   1.00 0.00 ? 2  ILE A H    1  
ATOM 29    H HA   . ILE A 1 2  ? 23.624  5.022   11.114  1.00 0.00 ? 2  ILE A HA   1  
ATOM 30    H HB   . ILE A 1 2  ? 21.375  6.232   9.490   1.00 0.00 ? 2  ILE A HB   1  
ATOM 31    H HG12 . ILE A 1 2  ? 23.168  7.533   11.565  1.00 0.00 ? 2  ILE A HG12 1  
ATOM 32    H HG13 . ILE A 1 2  ? 23.074  7.960   9.856   1.00 0.00 ? 2  ILE A HG13 1  
ATOM 33    H HG21 . ILE A 1 2  ? 20.199  6.259   11.586  1.00 0.00 ? 2  ILE A HG21 1  
ATOM 34    H HG22 . ILE A 1 2  ? 21.662  5.837   12.478  1.00 0.00 ? 2  ILE A HG22 1  
ATOM 35    H HG23 . ILE A 1 2  ? 20.902  4.649   11.420  1.00 0.00 ? 2  ILE A HG23 1  
ATOM 36    H HD11 . ILE A 1 2  ? 21.713  9.549   11.037  1.00 0.00 ? 2  ILE A HD11 1  
ATOM 37    H HD12 . ILE A 1 2  ? 20.911  8.272   11.951  1.00 0.00 ? 2  ILE A HD12 1  
ATOM 38    H HD13 . ILE A 1 2  ? 20.609  8.441   10.222  1.00 0.00 ? 2  ILE A HD13 1  
ATOM 39    N N    . ASP A 1 3  ? 23.449  2.909   9.522   1.00 0.00 ? 3  ASP A N    1  
ATOM 40    C CA   . ASP A 1 3  ? 23.002  1.610   8.945   1.00 0.00 ? 3  ASP A CA   1  
ATOM 41    C C    . ASP A 1 3  ? 21.955  0.978   9.863   1.00 0.00 ? 3  ASP A C    1  
ATOM 42    O O    . ASP A 1 3  ? 22.206  -0.016  10.515  1.00 0.00 ? 3  ASP A O    1  
ATOM 43    C CB   . ASP A 1 3  ? 24.203  0.670   8.816   1.00 0.00 ? 3  ASP A CB   1  
ATOM 44    C CG   . ASP A 1 3  ? 25.250  1.301   7.896   1.00 0.00 ? 3  ASP A CG   1  
ATOM 45    O OD1  . ASP A 1 3  ? 26.034  2.098   8.384   1.00 0.00 ? 3  ASP A OD1  1  
ATOM 46    O OD2  . ASP A 1 3  ? 25.252  0.975   6.720   1.00 0.00 ? 3  ASP A OD2  1  
ATOM 47    H H    . ASP A 1 3  ? 24.360  3.002   9.873   1.00 0.00 ? 3  ASP A H    1  
ATOM 48    H HA   . ASP A 1 3  ? 22.570  1.780   7.969   1.00 0.00 ? 3  ASP A HA   1  
ATOM 49    H HB2  . ASP A 1 3  ? 24.633  0.500   9.792   1.00 0.00 ? 3  ASP A HB2  1  
ATOM 50    H HB3  . ASP A 1 3  ? 23.879  -0.272  8.396   1.00 0.00 ? 3  ASP A HB3  1  
ATOM 51    N N    . ASN A 1 4  ? 20.781  1.547   9.921   1.00 0.00 ? 4  ASN A N    1  
ATOM 52    C CA   . ASN A 1 4  ? 19.717  0.980   10.798  1.00 0.00 ? 4  ASN A CA   1  
ATOM 53    C C    . ASN A 1 4  ? 18.346  1.435   10.294  1.00 0.00 ? 4  ASN A C    1  
ATOM 54    O O    . ASN A 1 4  ? 18.112  2.608   10.079  1.00 0.00 ? 4  ASN A O    1  
ATOM 55    C CB   . ASN A 1 4  ? 19.922  1.472   12.232  1.00 0.00 ? 4  ASN A CB   1  
ATOM 56    C CG   . ASN A 1 4  ? 21.263  0.962   12.761  1.00 0.00 ? 4  ASN A CG   1  
ATOM 57    O OD1  . ASN A 1 4  ? 22.159  1.739   13.028  1.00 0.00 ? 4  ASN A OD1  1  
ATOM 58    N ND2  . ASN A 1 4  ? 21.441  -0.321  12.925  1.00 0.00 ? 4  ASN A ND2  1  
ATOM 59    H H    . ASN A 1 4  ? 20.600  2.348   9.388   1.00 0.00 ? 4  ASN A H    1  
ATOM 60    H HA   . ASN A 1 4  ? 19.767  -0.100  10.777  1.00 0.00 ? 4  ASN A HA   1  
ATOM 61    H HB2  . ASN A 1 4  ? 19.916  2.553   12.245  1.00 0.00 ? 4  ASN A HB2  1  
ATOM 62    H HB3  . ASN A 1 4  ? 19.125  1.100   12.858  1.00 0.00 ? 4  ASN A HB3  1  
ATOM 63    H HD21 . ASN A 1 4  ? 20.719  -0.947  12.708  1.00 0.00 ? 4  ASN A HD21 1  
ATOM 64    H HD22 . ASN A 1 4  ? 22.298  -0.657  13.262  1.00 0.00 ? 4  ASN A HD22 1  
ATOM 65    N N    . GLU A 1 5  ? 17.437  0.518   10.106  1.00 0.00 ? 5  GLU A N    1  
ATOM 66    C CA   . GLU A 1 5  ? 16.083  0.901   9.616   1.00 0.00 ? 5  GLU A CA   1  
ATOM 67    C C    . GLU A 1 5  ? 15.369  1.728   10.688  1.00 0.00 ? 5  GLU A C    1  
ATOM 68    O O    . GLU A 1 5  ? 15.311  1.352   11.841  1.00 0.00 ? 5  GLU A O    1  
ATOM 69    C CB   . GLU A 1 5  ? 15.271  -0.363  9.324   1.00 0.00 ? 5  GLU A CB   1  
ATOM 70    C CG   . GLU A 1 5  ? 16.008  -1.216  8.289   1.00 0.00 ? 5  GLU A CG   1  
ATOM 71    C CD   . GLU A 1 5  ? 16.015  -0.491  6.942   1.00 0.00 ? 5  GLU A CD   1  
ATOM 72    O OE1  . GLU A 1 5  ? 14.942  -0.169  6.459   1.00 0.00 ? 5  GLU A OE1  1  
ATOM 73    O OE2  . GLU A 1 5  ? 17.093  -0.270  6.416   1.00 0.00 ? 5  GLU A OE2  1  
ATOM 74    H H    . GLU A 1 5  ? 17.646  -0.423  10.286  1.00 0.00 ? 5  GLU A H    1  
ATOM 75    H HA   . GLU A 1 5  ? 16.178  1.484   8.714   1.00 0.00 ? 5  GLU A HA   1  
ATOM 76    H HB2  . GLU A 1 5  ? 15.145  -0.930  10.235  1.00 0.00 ? 5  GLU A HB2  1  
ATOM 77    H HB3  . GLU A 1 5  ? 14.302  -0.087  8.934   1.00 0.00 ? 5  GLU A HB3  1  
ATOM 78    H HG2  . GLU A 1 5  ? 17.025  -1.378  8.617   1.00 0.00 ? 5  GLU A HG2  1  
ATOM 79    H HG3  . GLU A 1 5  ? 15.508  -2.166  8.183   1.00 0.00 ? 5  GLU A HG3  1  
ATOM 80    N N    . LYS A 1 6  ? 14.825  2.855   10.315  1.00 0.00 ? 6  LYS A N    1  
ATOM 81    C CA   . LYS A 1 6  ? 14.115  3.706   11.311  1.00 0.00 ? 6  LYS A CA   1  
ATOM 82    C C    . LYS A 1 6  ? 13.010  2.889   11.984  1.00 0.00 ? 6  LYS A C    1  
ATOM 83    O O    . LYS A 1 6  ? 12.733  1.770   11.603  1.00 0.00 ? 6  LYS A O    1  
ATOM 84    C CB   . LYS A 1 6  ? 13.499  4.913   10.601  1.00 0.00 ? 6  LYS A CB   1  
ATOM 85    C CG   . LYS A 1 6  ? 14.603  5.720   9.915   1.00 0.00 ? 6  LYS A CG   1  
ATOM 86    C CD   . LYS A 1 6  ? 13.984  6.895   9.156   1.00 0.00 ? 6  LYS A CD   1  
ATOM 87    C CE   . LYS A 1 6  ? 15.093  7.745   8.536   1.00 0.00 ? 6  LYS A CE   1  
ATOM 88    N NZ   . LYS A 1 6  ? 15.963  8.291   9.616   1.00 0.00 ? 6  LYS A NZ   1  
ATOM 89    H H    . LYS A 1 6  ? 14.883  3.140   9.379   1.00 0.00 ? 6  LYS A H    1  
ATOM 90    H HA   . LYS A 1 6  ? 14.817  4.047   12.057  1.00 0.00 ? 6  LYS A HA   1  
ATOM 91    H HB2  . LYS A 1 6  ? 12.790  4.571   9.860   1.00 0.00 ? 6  LYS A HB2  1  
ATOM 92    H HB3  . LYS A 1 6  ? 12.994  5.537   11.322  1.00 0.00 ? 6  LYS A HB3  1  
ATOM 93    H HG2  . LYS A 1 6  ? 15.291  6.094   10.661  1.00 0.00 ? 6  LYS A HG2  1  
ATOM 94    H HG3  . LYS A 1 6  ? 15.135  5.086   9.220   1.00 0.00 ? 6  LYS A HG3  1  
ATOM 95    H HD2  . LYS A 1 6  ? 13.338  6.519   8.376   1.00 0.00 ? 6  LYS A HD2  1  
ATOM 96    H HD3  . LYS A 1 6  ? 13.408  7.502   9.839   1.00 0.00 ? 6  LYS A HD3  1  
ATOM 97    H HE2  . LYS A 1 6  ? 15.686  7.133   7.872   1.00 0.00 ? 6  LYS A HE2  1  
ATOM 98    H HE3  . LYS A 1 6  ? 14.655  8.560   7.980   1.00 0.00 ? 6  LYS A HE3  1  
ATOM 99    H HZ1  . LYS A 1 6  ? 16.331  9.220   9.329   1.00 0.00 ? 6  LYS A HZ1  1  
ATOM 100   H HZ2  . LYS A 1 6  ? 16.758  7.643   9.782   1.00 0.00 ? 6  LYS A HZ2  1  
ATOM 101   H HZ3  . LYS A 1 6  ? 15.408  8.391   10.490  1.00 0.00 ? 6  LYS A HZ3  1  
ATOM 102   N N    . VAL A 1 7  ? 12.375  3.441   12.983  1.00 0.00 ? 7  VAL A N    1  
ATOM 103   C CA   . VAL A 1 7  ? 11.289  2.695   13.677  1.00 0.00 ? 7  VAL A CA   1  
ATOM 104   C C    . VAL A 1 7  ? 10.148  2.427   12.695  1.00 0.00 ? 7  VAL A C    1  
ATOM 105   O O    . VAL A 1 7  ? 9.311   1.575   12.918  1.00 0.00 ? 7  VAL A O    1  
ATOM 106   C CB   . VAL A 1 7  ? 10.766  3.526   14.850  1.00 0.00 ? 7  VAL A CB   1  
ATOM 107   C CG1  . VAL A 1 7  ? 11.881  3.719   15.880  1.00 0.00 ? 7  VAL A CG1  1  
ATOM 108   C CG2  . VAL A 1 7  ? 10.304  4.893   14.340  1.00 0.00 ? 7  VAL A CG2  1  
ATOM 109   H H    . VAL A 1 7  ? 12.614  4.346   13.274  1.00 0.00 ? 7  VAL A H    1  
ATOM 110   H HA   . VAL A 1 7  ? 11.675  1.756   14.046  1.00 0.00 ? 7  VAL A HA   1  
ATOM 111   H HB   . VAL A 1 7  ? 9.934   3.013   15.312  1.00 0.00 ? 7  VAL A HB   1  
ATOM 112   H HG11 . VAL A 1 7  ? 11.519  4.330   16.693  1.00 0.00 ? 7  VAL A HG11 1  
ATOM 113   H HG12 . VAL A 1 7  ? 12.724  4.204   15.411  1.00 0.00 ? 7  VAL A HG12 1  
ATOM 114   H HG13 . VAL A 1 7  ? 12.187  2.756   16.263  1.00 0.00 ? 7  VAL A HG13 1  
ATOM 115   H HG21 . VAL A 1 7  ? 10.030  5.518   15.176  1.00 0.00 ? 7  VAL A HG21 1  
ATOM 116   H HG22 . VAL A 1 7  ? 9.449   4.765   13.691  1.00 0.00 ? 7  VAL A HG22 1  
ATOM 117   H HG23 . VAL A 1 7  ? 11.106  5.362   13.788  1.00 0.00 ? 7  VAL A HG23 1  
ATOM 118   N N    . THR A 1 8  ? 10.108  3.148   11.608  1.00 0.00 ? 8  THR A N    1  
ATOM 119   C CA   . THR A 1 8  ? 9.019   2.935   10.613  1.00 0.00 ? 8  THR A CA   1  
ATOM 120   C C    . THR A 1 8  ? 7.663   3.018   11.316  1.00 0.00 ? 8  THR A C    1  
ATOM 121   O O    . THR A 1 8  ? 6.896   2.075   11.321  1.00 0.00 ? 8  THR A O    1  
ATOM 122   C CB   . THR A 1 8  ? 9.178   1.555   9.970   1.00 0.00 ? 8  THR A CB   1  
ATOM 123   O OG1  . THR A 1 8  ? 10.533  1.369   9.582   1.00 0.00 ? 8  THR A OG1  1  
ATOM 124   C CG2  . THR A 1 8  ? 8.275   1.457   8.740   1.00 0.00 ? 8  THR A CG2  1  
ATOM 125   H H    . THR A 1 8  ? 10.792  3.831   11.447  1.00 0.00 ? 8  THR A H    1  
ATOM 126   H HA   . THR A 1 8  ? 9.077   3.697   9.849   1.00 0.00 ? 8  THR A HA   1  
ATOM 127   H HB   . THR A 1 8  ? 8.898   0.792   10.679  1.00 0.00 ? 8  THR A HB   1  
ATOM 128   H HG1  . THR A 1 8  ? 10.966  2.225   9.599   1.00 0.00 ? 8  THR A HG1  1  
ATOM 129   H HG21 . THR A 1 8  ? 8.288   0.444   8.363   1.00 0.00 ? 8  THR A HG21 1  
ATOM 130   H HG22 . THR A 1 8  ? 8.633   2.130   7.975   1.00 0.00 ? 8  THR A HG22 1  
ATOM 131   H HG23 . THR A 1 8  ? 7.265   1.727   9.012   1.00 0.00 ? 8  THR A HG23 1  
ATOM 132   N N    . SER A 1 9  ? 7.360   4.140   11.908  1.00 0.00 ? 9  SER A N    1  
ATOM 133   C CA   . SER A 1 9  ? 6.054   4.284   12.611  1.00 0.00 ? 9  SER A CA   1  
ATOM 134   C C    . SER A 1 9  ? 4.934   4.419   11.577  1.00 0.00 ? 9  SER A C    1  
ATOM 135   O O    . SER A 1 9  ? 5.047   5.155   10.617  1.00 0.00 ? 9  SER A O    1  
ATOM 136   C CB   . SER A 1 9  ? 6.084   5.530   13.496  1.00 0.00 ? 9  SER A CB   1  
ATOM 137   O OG   . SER A 1 9  ? 6.251   6.682   12.679  1.00 0.00 ? 9  SER A OG   1  
ATOM 138   H H    . SER A 1 9  ? 7.993   4.889   11.893  1.00 0.00 ? 9  SER A H    1  
ATOM 139   H HA   . SER A 1 9  ? 5.876   3.412   13.223  1.00 0.00 ? 9  SER A HA   1  
ATOM 140   H HB2  . SER A 1 9  ? 5.157   5.612   14.038  1.00 0.00 ? 9  SER A HB2  1  
ATOM 141   H HB3  . SER A 1 9  ? 6.904   5.453   14.197  1.00 0.00 ? 9  SER A HB3  1  
ATOM 142   H HG   . SER A 1 9  ? 7.174   6.730   12.417  1.00 0.00 ? 9  SER A HG   1  
ATOM 143   N N    . GLY A 1 10 ? 3.852   3.715   11.766  1.00 0.00 ? 10 GLY A N    1  
ATOM 144   C CA   . GLY A 1 10 ? 2.726   3.804   10.794  1.00 0.00 ? 10 GLY A CA   1  
ATOM 145   C C    . GLY A 1 10 ? 1.576   2.911   11.258  1.00 0.00 ? 10 GLY A C    1  
ATOM 146   O O    . GLY A 1 10 ? 1.763   1.998   12.039  1.00 0.00 ? 10 GLY A O    1  
ATOM 147   H H    . GLY A 1 10 ? 3.779   3.128   12.547  1.00 0.00 ? 10 GLY A H    1  
ATOM 148   H HA2  . GLY A 1 10 ? 2.387   4.829   10.731  1.00 0.00 ? 10 GLY A HA2  1  
ATOM 149   H HA3  . GLY A 1 10 ? 3.062   3.476   9.822   1.00 0.00 ? 10 GLY A HA3  1  
ATOM 150   N N    . HIS A 1 11 ? 0.386   3.165   10.786  1.00 0.00 ? 11 HIS A N    1  
ATOM 151   C CA   . HIS A 1 11 ? -0.776  2.328   11.202  1.00 0.00 ? 11 HIS A CA   1  
ATOM 152   C C    . HIS A 1 11 ? -0.492  0.863   10.864  1.00 0.00 ? 11 HIS A C    1  
ATOM 153   O O    . HIS A 1 11 ? -1.193  -0.030  11.298  1.00 0.00 ? 11 HIS A O    1  
ATOM 154   C CB   . HIS A 1 11 ? -2.032  2.791   10.457  1.00 0.00 ? 11 HIS A CB   1  
ATOM 155   C CG   . HIS A 1 11 ? -3.255  2.225   11.128  1.00 0.00 ? 11 HIS A CG   1  
ATOM 156   N ND1  . HIS A 1 11 ? -3.676  0.920   10.922  1.00 0.00 ? 11 HIS A ND1  1  
ATOM 157   C CD2  . HIS A 1 11 ? -4.157  2.776   12.005  1.00 0.00 ? 11 HIS A CD2  1  
ATOM 158   C CE1  . HIS A 1 11 ? -4.786  0.732   11.658  1.00 0.00 ? 11 HIS A CE1  1  
ATOM 159   N NE2  . HIS A 1 11 ? -5.123  1.831   12.338  1.00 0.00 ? 11 HIS A NE2  1  
ATOM 160   H H    . HIS A 1 11 ? 0.256   3.905   10.158  1.00 0.00 ? 11 HIS A H    1  
ATOM 161   H HA   . HIS A 1 11 ? -0.928  2.429   12.267  1.00 0.00 ? 11 HIS A HA   1  
ATOM 162   H HB2  . HIS A 1 11 ? -2.081  3.869   10.471  1.00 0.00 ? 11 HIS A HB2  1  
ATOM 163   H HB3  . HIS A 1 11 ? -1.992  2.446   9.434   1.00 0.00 ? 11 HIS A HB3  1  
ATOM 164   H HD1  . HIS A 1 11 ? -3.243  0.256   10.346  1.00 0.00 ? 11 HIS A HD1  1  
ATOM 165   H HD2  . HIS A 1 11 ? -4.122  3.788   12.378  1.00 0.00 ? 11 HIS A HD2  1  
ATOM 166   H HE1  . HIS A 1 11 ? -5.338  -0.196  11.694  1.00 0.00 ? 11 HIS A HE1  1  
ATOM 167   N N    . THR A 1 12 ? 0.530   0.612   10.090  1.00 0.00 ? 12 THR A N    1  
ATOM 168   C CA   . THR A 1 12 ? 0.864   -0.792  9.717   1.00 0.00 ? 12 THR A CA   1  
ATOM 169   C C    . THR A 1 12 ? -0.316  -1.414  8.967   1.00 0.00 ? 12 THR A C    1  
ATOM 170   O O    . THR A 1 12 ? -0.280  -2.564  8.577   1.00 0.00 ? 12 THR A O    1  
ATOM 171   C CB   . THR A 1 12 ? 1.162   -1.604  10.986  1.00 0.00 ? 12 THR A CB   1  
ATOM 172   O OG1  . THR A 1 12 ? 1.943   -0.817  11.873  1.00 0.00 ? 12 THR A OG1  1  
ATOM 173   C CG2  . THR A 1 12 ? 1.932   -2.877  10.621  1.00 0.00 ? 12 THR A CG2  1  
ATOM 174   H H    . THR A 1 12 ? 1.078   1.351   9.751   1.00 0.00 ? 12 THR A H    1  
ATOM 175   H HA   . THR A 1 12 ? 1.734   -0.792  9.077   1.00 0.00 ? 12 THR A HA   1  
ATOM 176   H HB   . THR A 1 12 ? 0.235   -1.876  11.468  1.00 0.00 ? 12 THR A HB   1  
ATOM 177   H HG1  . THR A 1 12 ? 2.425   -0.171  11.351  1.00 0.00 ? 12 THR A HG1  1  
ATOM 178   H HG21 . THR A 1 12 ? 1.306   -3.517  10.018  1.00 0.00 ? 12 THR A HG21 1  
ATOM 179   H HG22 . THR A 1 12 ? 2.214   -3.397  11.524  1.00 0.00 ? 12 THR A HG22 1  
ATOM 180   H HG23 . THR A 1 12 ? 2.819   -2.615  10.065  1.00 0.00 ? 12 THR A HG23 1  
ATOM 181   N N    . THR A 1 13 ? -1.357  -0.655  8.755   1.00 0.00 ? 13 THR A N    1  
ATOM 182   C CA   . THR A 1 13 ? -2.542  -1.189  8.023   1.00 0.00 ? 13 THR A CA   1  
ATOM 183   C C    . THR A 1 13 ? -3.074  -2.443  8.726   1.00 0.00 ? 13 THR A C    1  
ATOM 184   O O    . THR A 1 13 ? -2.378  -3.097  9.476   1.00 0.00 ? 13 THR A O    1  
ATOM 185   C CB   . THR A 1 13 ? -2.143  -1.534  6.585   1.00 0.00 ? 13 THR A CB   1  
ATOM 186   O OG1  . THR A 1 13 ? -1.491  -2.796  6.564   1.00 0.00 ? 13 THR A OG1  1  
ATOM 187   C CG2  . THR A 1 13 ? -1.198  -0.459  6.043   1.00 0.00 ? 13 THR A CG2  1  
ATOM 188   H H    . THR A 1 13 ? -1.357  0.272   9.070   1.00 0.00 ? 13 THR A H    1  
ATOM 189   H HA   . THR A 1 13 ? -3.316  -0.436  8.005   1.00 0.00 ? 13 THR A HA   1  
ATOM 190   H HB   . THR A 1 13 ? -3.026  -1.575  5.966   1.00 0.00 ? 13 THR A HB   1  
ATOM 191   H HG1  . THR A 1 13 ? -2.068  -3.420  6.115   1.00 0.00 ? 13 THR A HG1  1  
ATOM 192   H HG21 . THR A 1 13 ? -0.223  -0.578  6.491   1.00 0.00 ? 13 THR A HG21 1  
ATOM 193   H HG22 . THR A 1 13 ? -1.589  0.518   6.287   1.00 0.00 ? 13 THR A HG22 1  
ATOM 194   H HG23 . THR A 1 13 ? -1.118  -0.558  4.971   1.00 0.00 ? 13 THR A HG23 1  
ATOM 195   N N    . THR A 1 14 ? -4.315  -2.774  8.486   1.00 0.00 ? 14 THR A N    1  
ATOM 196   C CA   . THR A 1 14 ? -4.914  -3.979  9.136   1.00 0.00 ? 14 THR A CA   1  
ATOM 197   C C    . THR A 1 14 ? -5.959  -4.596  8.206   1.00 0.00 ? 14 THR A C    1  
ATOM 198   O O    . THR A 1 14 ? -5.953  -5.784  7.952   1.00 0.00 ? 14 THR A O    1  
ATOM 199   C CB   . THR A 1 14 ? -5.581  -3.569  10.451  1.00 0.00 ? 14 THR A CB   1  
ATOM 200   O OG1  . THR A 1 14 ? -6.519  -2.531  10.201  1.00 0.00 ? 14 THR A OG1  1  
ATOM 201   C CG2  . THR A 1 14 ? -4.517  -3.073  11.431  1.00 0.00 ? 14 THR A CG2  1  
ATOM 202   H H    . THR A 1 14 ? -4.849  -2.218  7.881   1.00 0.00 ? 14 THR A H    1  
ATOM 203   H HA   . THR A 1 14 ? -4.141  -4.708  9.338   1.00 0.00 ? 14 THR A HA   1  
ATOM 204   H HB   . THR A 1 14 ? -6.090  -4.419  10.878  1.00 0.00 ? 14 THR A HB   1  
ATOM 205   H HG1  . THR A 1 14 ? -6.528  -1.949  10.965  1.00 0.00 ? 14 THR A HG1  1  
ATOM 206   H HG21 . THR A 1 14 ? -3.710  -3.790  11.480  1.00 0.00 ? 14 THR A HG21 1  
ATOM 207   H HG22 . THR A 1 14 ? -4.956  -2.958  12.411  1.00 0.00 ? 14 THR A HG22 1  
ATOM 208   H HG23 . THR A 1 14 ? -4.133  -2.121  11.094  1.00 0.00 ? 14 THR A HG23 1  
ATOM 209   N N    . THR A 1 15 ? -6.870  -3.804  7.711   1.00 0.00 ? 15 THR A N    1  
ATOM 210   C CA   . THR A 1 15 ? -7.927  -4.350  6.810   1.00 0.00 ? 15 THR A CA   1  
ATOM 211   C C    . THR A 1 15 ? -7.447  -4.320  5.356   1.00 0.00 ? 15 THR A C    1  
ATOM 212   O O    . THR A 1 15 ? -6.869  -3.354  4.900   1.00 0.00 ? 15 THR A O    1  
ATOM 213   C CB   . THR A 1 15 ? -9.189  -3.495  6.946   1.00 0.00 ? 15 THR A CB   1  
ATOM 214   O OG1  . THR A 1 15 ? -9.527  -3.372  8.321   1.00 0.00 ? 15 THR A OG1  1  
ATOM 215   C CG2  . THR A 1 15 ? -10.344 -4.157  6.193   1.00 0.00 ? 15 THR A CG2  1  
ATOM 216   H H    . THR A 1 15 ? -6.869  -2.853  7.946   1.00 0.00 ? 15 THR A H    1  
ATOM 217   H HA   . THR A 1 15 ? -8.155  -5.368  7.092   1.00 0.00 ? 15 THR A HA   1  
ATOM 218   H HB   . THR A 1 15 ? -9.008  -2.516  6.531   1.00 0.00 ? 15 THR A HB   1  
ATOM 219   H HG1  . THR A 1 15 ? -9.818  -4.233  8.633   1.00 0.00 ? 15 THR A HG1  1  
ATOM 220   H HG21 . THR A 1 15 ? -10.445 -5.182  6.517   1.00 0.00 ? 15 THR A HG21 1  
ATOM 221   H HG22 . THR A 1 15 ? -10.143 -4.131  5.133   1.00 0.00 ? 15 THR A HG22 1  
ATOM 222   H HG23 . THR A 1 15 ? -11.260 -3.623  6.399   1.00 0.00 ? 15 THR A HG23 1  
ATOM 223   N N    . ARG A 1 16 ? -7.716  -5.368  4.620   1.00 0.00 ? 16 ARG A N    1  
ATOM 224   C CA   . ARG A 1 16 ? -7.317  -5.423  3.179   1.00 0.00 ? 16 ARG A CA   1  
ATOM 225   C C    . ARG A 1 16 ? -8.443  -6.114  2.406   1.00 0.00 ? 16 ARG A C    1  
ATOM 226   O O    . ARG A 1 16 ? -9.135  -6.938  2.962   1.00 0.00 ? 16 ARG A O    1  
ATOM 227   C CB   . ARG A 1 16 ? -6.025  -6.240  3.006   1.00 0.00 ? 16 ARG A CB   1  
ATOM 228   C CG   . ARG A 1 16 ? -4.934  -5.775  3.999   1.00 0.00 ? 16 ARG A CG   1  
ATOM 229   C CD   . ARG A 1 16 ? -4.973  -6.642  5.266   1.00 0.00 ? 16 ARG A CD   1  
ATOM 230   N NE   . ARG A 1 16 ? -4.160  -6.002  6.353   1.00 0.00 ? 16 ARG A NE   1  
ATOM 231   C CZ   . ARG A 1 16 ? -2.901  -5.698  6.181   1.00 0.00 ? 16 ARG A CZ   1  
ATOM 232   N NH1  . ARG A 1 16 ? -2.252  -6.113  5.129   1.00 0.00 ? 16 ARG A NH1  1  
ATOM 233   N NH2  . ARG A 1 16 ? -2.271  -5.022  7.102   1.00 0.00 ? 16 ARG A NH2  1  
ATOM 234   H H    . ARG A 1 16 ? -8.211  -6.117  5.013   1.00 0.00 ? 16 ARG A H    1  
ATOM 235   H HA   . ARG A 1 16 ? -7.171  -4.421  2.799   1.00 0.00 ? 16 ARG A HA   1  
ATOM 236   H HB2  . ARG A 1 16 ? -6.244  -7.288  3.165   1.00 0.00 ? 16 ARG A HB2  1  
ATOM 237   H HB3  . ARG A 1 16 ? -5.665  -6.108  1.994   1.00 0.00 ? 16 ARG A HB3  1  
ATOM 238   H HG2  . ARG A 1 16 ? -3.969  -5.868  3.529   1.00 0.00 ? 16 ARG A HG2  1  
ATOM 239   H HG3  . ARG A 1 16 ? -5.098  -4.742  4.268   1.00 0.00 ? 16 ARG A HG3  1  
ATOM 240   H HD2  . ARG A 1 16 ? -5.985  -6.710  5.618   1.00 0.00 ? 16 ARG A HD2  1  
ATOM 241   H HD3  . ARG A 1 16 ? -4.614  -7.641  5.028   1.00 0.00 ? 16 ARG A HD3  1  
ATOM 242   H HE   . ARG A 1 16 ? -4.597  -5.763  7.194   1.00 0.00 ? 16 ARG A HE   1  
ATOM 243   H HH11 . ARG A 1 16 ? -2.716  -6.674  4.445   1.00 0.00 ? 16 ARG A HH11 1  
ATOM 244   H HH12 . ARG A 1 16 ? -1.291  -5.870  5.007   1.00 0.00 ? 16 ARG A HH12 1  
ATOM 245   H HH21 . ARG A 1 16 ? -2.751  -4.741  7.933   1.00 0.00 ? 16 ARG A HH21 1  
ATOM 246   H HH22 . ARG A 1 16 ? -1.307  -4.784  6.978   1.00 0.00 ? 16 ARG A HH22 1  
ATOM 247   N N    . ARG A 1 17 ? -8.640  -5.759  1.146   1.00 0.00 ? 17 ARG A N    1  
ATOM 248   C CA   . ARG A 1 17 ? -9.736  -6.362  0.298   1.00 0.00 ? 17 ARG A CA   1  
ATOM 249   C C    . ARG A 1 17 ? -10.946 -5.421  0.287   1.00 0.00 ? 17 ARG A C    1  
ATOM 250   O O    . ARG A 1 17 ? -11.258 -4.827  -0.723  1.00 0.00 ? 17 ARG A O    1  
ATOM 251   C CB   . ARG A 1 17 ? -10.160 -7.758  0.801   1.00 0.00 ? 17 ARG A CB   1  
ATOM 252   C CG   . ARG A 1 17 ? -10.869 -8.535  -0.315  1.00 0.00 ? 17 ARG A CG   1  
ATOM 253   C CD   . ARG A 1 17 ? -11.021 -10.000 0.104   1.00 0.00 ? 17 ARG A CD   1  
ATOM 254   N NE   . ARG A 1 17 ? -9.678  -10.576 0.402   1.00 0.00 ? 17 ARG A NE   1  
ATOM 255   C CZ   . ARG A 1 17 ? -9.579  -11.698 1.059   1.00 0.00 ? 17 ARG A CZ   1  
ATOM 256   N NH1  . ARG A 1 17 ? -10.657 -12.322 1.452   1.00 0.00 ? 17 ARG A NH1  1  
ATOM 257   N NH2  . ARG A 1 17 ? -8.404  -12.198 1.323   1.00 0.00 ? 17 ARG A NH2  1  
ATOM 258   H H    . ARG A 1 17 ? -8.074  -5.056  0.752   1.00 0.00 ? 17 ARG A H    1  
ATOM 259   H HA   . ARG A 1 17 ? -9.369  -6.446  -0.710  1.00 0.00 ? 17 ARG A HA   1  
ATOM 260   H HB2  . ARG A 1 17 ? -9.287  -8.309  1.113   1.00 0.00 ? 17 ARG A HB2  1  
ATOM 261   H HB3  . ARG A 1 17 ? -10.839 -7.650  1.635   1.00 0.00 ? 17 ARG A HB3  1  
ATOM 262   H HG2  . ARG A 1 17 ? -11.847 -8.109  -0.483  1.00 0.00 ? 17 ARG A HG2  1  
ATOM 263   H HG3  . ARG A 1 17 ? -10.290 -8.485  -1.225  1.00 0.00 ? 17 ARG A HG3  1  
ATOM 264   H HD2  . ARG A 1 17 ? -11.641 -10.059 0.986   1.00 0.00 ? 17 ARG A HD2  1  
ATOM 265   H HD3  . ARG A 1 17 ? -11.481 -10.557 -0.698  1.00 0.00 ? 17 ARG A HD3  1  
ATOM 266   H HE   . ARG A 1 17 ? -8.869  -10.108 0.104   1.00 0.00 ? 17 ARG A HE   1  
ATOM 267   H HH11 . ARG A 1 17 ? -11.558 -11.939 1.250   1.00 0.00 ? 17 ARG A HH11 1  
ATOM 268   H HH12 . ARG A 1 17 ? -10.581 -13.182 1.956   1.00 0.00 ? 17 ARG A HH12 1  
ATOM 269   H HH21 . ARG A 1 17 ? -7.579  -11.722 1.022   1.00 0.00 ? 17 ARG A HH21 1  
ATOM 270   H HH22 . ARG A 1 17 ? -8.328  -13.060 1.827   1.00 0.00 ? 17 ARG A HH22 1  
ATOM 271   N N    . SER A 1 18 ? -11.624 -5.274  1.397   1.00 0.00 ? 18 SER A N    1  
ATOM 272   C CA   . SER A 1 18 ? -12.816 -4.352  1.437   1.00 0.00 ? 18 SER A CA   1  
ATOM 273   C C    . SER A 1 18 ? -12.463 -3.042  0.723   1.00 0.00 ? 18 SER A C    1  
ATOM 274   O O    . SER A 1 18 ? -13.315 -2.308  0.266   1.00 0.00 ? 18 SER A O    1  
ATOM 275   C CB   . SER A 1 18 ? -13.183 -4.056  2.893   1.00 0.00 ? 18 SER A CB   1  
ATOM 276   O OG   . SER A 1 18 ? -13.232 -5.275  3.622   1.00 0.00 ? 18 SER A OG   1  
ATOM 277   H H    . SER A 1 18 ? -11.349 -5.765  2.201   1.00 0.00 ? 18 SER A H    1  
ATOM 278   H HA   . SER A 1 18 ? -13.658 -4.818  0.937   1.00 0.00 ? 18 SER A HA   1  
ATOM 279   H HB2  . SER A 1 18 ? -12.438 -3.413  3.329   1.00 0.00 ? 18 SER A HB2  1  
ATOM 280   H HB3  . SER A 1 18 ? -14.145 -3.564  2.928   1.00 0.00 ? 18 SER A HB3  1  
ATOM 281   H HG   . SER A 1 18 ? -12.330 -5.564  3.781   1.00 0.00 ? 18 SER A HG   1  
ATOM 282   N N    . CYS A 1 19 ? -11.194 -2.780  0.615   1.00 0.00 ? 19 CYS A N    1  
ATOM 283   C CA   . CYS A 1 19 ? -10.710 -1.552  -0.082  1.00 0.00 ? 19 CYS A CA   1  
ATOM 284   C C    . CYS A 1 19 ? -9.496  -1.935  -0.922  1.00 0.00 ? 19 CYS A C    1  
ATOM 285   O O    . CYS A 1 19 ? -8.827  -2.910  -0.640  1.00 0.00 ? 19 CYS A O    1  
ATOM 286   C CB   . CYS A 1 19 ? -10.319 -0.489  0.949   1.00 0.00 ? 19 CYS A CB   1  
ATOM 287   S SG   . CYS A 1 19 ? -11.730 -0.146  2.032   1.00 0.00 ? 19 CYS A SG   1  
ATOM 288   H H    . CYS A 1 19 ? -10.562 -3.425  0.990   1.00 0.00 ? 19 CYS A H    1  
ATOM 289   H HA   . CYS A 1 19 ? -11.486 -1.163  -0.728  1.00 0.00 ? 19 CYS A HA   1  
ATOM 290   H HB2  . CYS A 1 19 ? -9.489  -0.848  1.540   1.00 0.00 ? 19 CYS A HB2  1  
ATOM 291   H HB3  . CYS A 1 19 ? -10.030 0.415   0.437   1.00 0.00 ? 19 CYS A HB3  1  
ATOM 292   N N    . SER A 1 20 ? -9.198  -1.196  -1.953  1.00 0.00 ? 20 SER A N    1  
ATOM 293   C CA   . SER A 1 20 ? -8.012  -1.573  -2.787  1.00 0.00 ? 20 SER A CA   1  
ATOM 294   C C    . SER A 1 20 ? -6.739  -1.328  -1.982  1.00 0.00 ? 20 SER A C    1  
ATOM 295   O O    . SER A 1 20 ? -6.436  -0.213  -1.611  1.00 0.00 ? 20 SER A O    1  
ATOM 296   C CB   . SER A 1 20 ? -7.951  -0.745  -4.083  1.00 0.00 ? 20 SER A CB   1  
ATOM 297   O OG   . SER A 1 20 ? -6.843  -1.183  -4.857  1.00 0.00 ? 20 SER A OG   1  
ATOM 298   H H    . SER A 1 20 ? -9.744  -0.412  -2.173  1.00 0.00 ? 20 SER A H    1  
ATOM 299   H HA   . SER A 1 20 ? -8.075  -2.623  -3.036  1.00 0.00 ? 20 SER A HA   1  
ATOM 300   H HB2  . SER A 1 20 ? -8.853  -0.888  -4.659  1.00 0.00 ? 20 SER A HB2  1  
ATOM 301   H HB3  . SER A 1 20 ? -7.836  0.305   -3.845  1.00 0.00 ? 20 SER A HB3  1  
ATOM 302   H HG   . SER A 1 20 ? -6.748  -0.587  -5.604  1.00 0.00 ? 20 SER A HG   1  
ATOM 303   N N    . LYS A 1 21 ? -5.991  -2.367  -1.709  1.00 0.00 ? 21 LYS A N    1  
ATOM 304   C CA   . LYS A 1 21 ? -4.720  -2.214  -0.921  1.00 0.00 ? 21 LYS A CA   1  
ATOM 305   C C    . LYS A 1 21 ? -3.614  -3.006  -1.617  1.00 0.00 ? 21 LYS A C    1  
ATOM 306   O O    . LYS A 1 21 ? -3.660  -4.218  -1.690  1.00 0.00 ? 21 LYS A O    1  
ATOM 307   C CB   . LYS A 1 21 ? -4.907  -2.750  0.518   1.00 0.00 ? 21 LYS A CB   1  
ATOM 308   C CG   . LYS A 1 21 ? -5.644  -1.708  1.392   1.00 0.00 ? 21 LYS A CG   1  
ATOM 309   C CD   . LYS A 1 21 ? -4.632  -0.828  2.139   1.00 0.00 ? 21 LYS A CD   1  
ATOM 310   C CE   . LYS A 1 21 ? -5.378  0.235   2.947   1.00 0.00 ? 21 LYS A CE   1  
ATOM 311   N NZ   . LYS A 1 21 ? -6.013  -0.402  4.136   1.00 0.00 ? 21 LYS A NZ   1  
ATOM 312   H H    . LYS A 1 21 ? -6.267  -3.259  -2.016  1.00 0.00 ? 21 LYS A H    1  
ATOM 313   H HA   . LYS A 1 21 ? -4.433  -1.171  -0.880  1.00 0.00 ? 21 LYS A HA   1  
ATOM 314   H HB2  . LYS A 1 21 ? -5.480  -3.666  0.493   1.00 0.00 ? 21 LYS A HB2  1  
ATOM 315   H HB3  . LYS A 1 21 ? -3.936  -2.958  0.950   1.00 0.00 ? 21 LYS A HB3  1  
ATOM 316   H HG2  . LYS A 1 21 ? -6.270  -1.082  0.770   1.00 0.00 ? 21 LYS A HG2  1  
ATOM 317   H HG3  . LYS A 1 21 ? -6.264  -2.221  2.115   1.00 0.00 ? 21 LYS A HG3  1  
ATOM 318   H HD2  . LYS A 1 21 ? -4.047  -1.443  2.808   1.00 0.00 ? 21 LYS A HD2  1  
ATOM 319   H HD3  . LYS A 1 21 ? -3.977  -0.347  1.430   1.00 0.00 ? 21 LYS A HD3  1  
ATOM 320   H HE2  . LYS A 1 21 ? -4.682  0.994   3.275   1.00 0.00 ? 21 LYS A HE2  1  
ATOM 321   H HE3  . LYS A 1 21 ? -6.141  0.688   2.331   1.00 0.00 ? 21 LYS A HE3  1  
ATOM 322   H HZ1  . LYS A 1 21 ? -6.106  0.299   4.897   1.00 0.00 ? 21 LYS A HZ1  1  
ATOM 323   H HZ2  . LYS A 1 21 ? -5.421  -1.191  4.465   1.00 0.00 ? 21 LYS A HZ2  1  
ATOM 324   H HZ3  . LYS A 1 21 ? -6.955  -0.759  3.875   1.00 0.00 ? 21 LYS A HZ3  1  
ATOM 325   N N    . VAL A 1 22 ? -2.603  -2.324  -2.096  1.00 0.00 ? 22 VAL A N    1  
ATOM 326   C CA   . VAL A 1 22 ? -1.457  -3.030  -2.759  1.00 0.00 ? 22 VAL A CA   1  
ATOM 327   C C    . VAL A 1 22 ? -0.160  -2.601  -2.078  1.00 0.00 ? 22 VAL A C    1  
ATOM 328   O O    . VAL A 1 22 ? 0.186   -1.438  -2.088  1.00 0.00 ? 22 VAL A O    1  
ATOM 329   C CB   . VAL A 1 22 ? -1.419  -2.658  -4.241  1.00 0.00 ? 22 VAL A CB   1  
ATOM 330   C CG1  . VAL A 1 22 ? -0.400  -3.537  -4.967  1.00 0.00 ? 22 VAL A CG1  1  
ATOM 331   C CG2  . VAL A 1 22 ? -2.808  -2.876  -4.849  1.00 0.00 ? 22 VAL A CG2  1  
ATOM 332   H H    . VAL A 1 22 ? -2.589  -1.344  -1.966  1.00 0.00 ? 22 VAL A H    1  
ATOM 333   H HA   . VAL A 1 22 ? -1.570  -4.101  -2.661  1.00 0.00 ? 22 VAL A HA   1  
ATOM 334   H HB   . VAL A 1 22 ? -1.138  -1.626  -4.344  1.00 0.00 ? 22 VAL A HB   1  
ATOM 335   H HG11 . VAL A 1 22 ? 0.596   -3.255  -4.664  1.00 0.00 ? 22 VAL A HG11 1  
ATOM 336   H HG12 . VAL A 1 22 ? -0.505  -3.402  -6.033  1.00 0.00 ? 22 VAL A HG12 1  
ATOM 337   H HG13 . VAL A 1 22 ? -0.574  -4.572  -4.718  1.00 0.00 ? 22 VAL A HG13 1  
ATOM 338   H HG21 . VAL A 1 22 ? -3.088  -3.913  -4.743  1.00 0.00 ? 22 VAL A HG21 1  
ATOM 339   H HG22 . VAL A 1 22 ? -2.787  -2.613  -5.896  1.00 0.00 ? 22 VAL A HG22 1  
ATOM 340   H HG23 . VAL A 1 22 ? -3.527  -2.254  -4.336  1.00 0.00 ? 22 VAL A HG23 1  
ATOM 341   N N    . ILE A 1 23 ? 0.561   -3.518  -1.471  1.00 0.00 ? 23 ILE A N    1  
ATOM 342   C CA   . ILE A 1 23 ? 1.837   -3.142  -0.776  1.00 0.00 ? 23 ILE A CA   1  
ATOM 343   C C    . ILE A 1 23 ? 3.015   -3.859  -1.444  1.00 0.00 ? 23 ILE A C    1  
ATOM 344   O O    . ILE A 1 23 ? 3.180   -5.058  -1.327  1.00 0.00 ? 23 ILE A O    1  
ATOM 345   C CB   . ILE A 1 23 ? 1.755   -3.560  0.700   1.00 0.00 ? 23 ILE A CB   1  
ATOM 346   C CG1  . ILE A 1 23 ? 0.673   -2.735  1.427   1.00 0.00 ? 23 ILE A CG1  1  
ATOM 347   C CG2  . ILE A 1 23 ? 3.107   -3.311  1.373   1.00 0.00 ? 23 ILE A CG2  1  
ATOM 348   C CD1  . ILE A 1 23 ? -0.746  -3.153  0.984   1.00 0.00 ? 23 ILE A CD1  1  
ATOM 349   H H    . ILE A 1 23 ? 0.261   -4.454  -1.454  1.00 0.00 ? 23 ILE A H    1  
ATOM 350   H HA   . ILE A 1 23 ? 1.998   -2.074  -0.833  1.00 0.00 ? 23 ILE A HA   1  
ATOM 351   H HB   . ILE A 1 23 ? 1.517   -4.609  0.764   1.00 0.00 ? 23 ILE A HB   1  
ATOM 352   H HG12 . ILE A 1 23 ? 0.769   -2.889  2.494   1.00 0.00 ? 23 ILE A HG12 1  
ATOM 353   H HG13 . ILE A 1 23 ? 0.818   -1.684  1.210   1.00 0.00 ? 23 ILE A HG13 1  
ATOM 354   H HG21 . ILE A 1 23 ? 3.465   -2.326  1.111   1.00 0.00 ? 23 ILE A HG21 1  
ATOM 355   H HG22 . ILE A 1 23 ? 3.817   -4.053  1.039   1.00 0.00 ? 23 ILE A HG22 1  
ATOM 356   H HG23 . ILE A 1 23 ? 2.993   -3.380  2.444   1.00 0.00 ? 23 ILE A HG23 1  
ATOM 357   H HD11 . ILE A 1 23 ? -1.150  -2.405  0.320   1.00 0.00 ? 23 ILE A HD11 1  
ATOM 358   H HD12 . ILE A 1 23 ? -1.382  -3.233  1.854   1.00 0.00 ? 23 ILE A HD12 1  
ATOM 359   H HD13 . ILE A 1 23 ? -0.721  -4.107  0.476   1.00 0.00 ? 23 ILE A HD13 1  
ATOM 360   N N    . THR A 1 24 ? 3.843   -3.114  -2.134  1.00 0.00 ? 24 THR A N    1  
ATOM 361   C CA   . THR A 1 24 ? 5.037   -3.695  -2.816  1.00 0.00 ? 24 THR A CA   1  
ATOM 362   C C    . THR A 1 24 ? 6.281   -2.915  -2.378  1.00 0.00 ? 24 THR A C    1  
ATOM 363   O O    . THR A 1 24 ? 6.448   -1.768  -2.743  1.00 0.00 ? 24 THR A O    1  
ATOM 364   C CB   . THR A 1 24 ? 4.869   -3.562  -4.330  1.00 0.00 ? 24 THR A CB   1  
ATOM 365   O OG1  . THR A 1 24 ? 4.814   -2.185  -4.680  1.00 0.00 ? 24 THR A OG1  1  
ATOM 366   C CG2  . THR A 1 24 ? 3.576   -4.253  -4.765  1.00 0.00 ? 24 THR A CG2  1  
ATOM 367   H H    . THR A 1 24 ? 3.680   -2.160  -2.188  1.00 0.00 ? 24 THR A H    1  
ATOM 368   H HA   . THR A 1 24 ? 5.147   -4.732  -2.556  1.00 0.00 ? 24 THR A HA   1  
ATOM 369   H HB   . THR A 1 24 ? 5.705   -4.028  -4.829  1.00 0.00 ? 24 THR A HB   1  
ATOM 370   H HG1  . THR A 1 24 ? 4.756   -1.675  -3.869  1.00 0.00 ? 24 THR A HG1  1  
ATOM 371   H HG21 . THR A 1 24 ? 2.765   -3.927  -4.132  1.00 0.00 ? 24 THR A HG21 1  
ATOM 372   H HG22 . THR A 1 24 ? 3.692   -5.323  -4.678  1.00 0.00 ? 24 THR A HG22 1  
ATOM 373   H HG23 . THR A 1 24 ? 3.357   -3.996  -5.791  1.00 0.00 ? 24 THR A HG23 1  
ATOM 374   N N    . LYS A 1 25 ? 7.172   -3.526  -1.629  1.00 0.00 ? 25 LYS A N    1  
ATOM 375   C CA   . LYS A 1 25 ? 8.419   -2.821  -1.205  1.00 0.00 ? 25 LYS A CA   1  
ATOM 376   C C    . LYS A 1 25 ? 9.578   -3.660  -1.699  1.00 0.00 ? 25 LYS A C    1  
ATOM 377   O O    . LYS A 1 25 ? 9.838   -4.725  -1.175  1.00 0.00 ? 25 LYS A O    1  
ATOM 378   C CB   . LYS A 1 25 ? 8.466   -2.709  0.326   1.00 0.00 ? 25 LYS A CB   1  
ATOM 379   C CG   . LYS A 1 25 ? 9.526   -1.683  0.742   1.00 0.00 ? 25 LYS A CG   1  
ATOM 380   C CD   . LYS A 1 25 ? 9.420   -1.413  2.247   1.00 0.00 ? 25 LYS A CD   1  
ATOM 381   C CE   . LYS A 1 25 ? 9.571   -2.723  3.028   1.00 0.00 ? 25 LYS A CE   1  
ATOM 382   N NZ   . LYS A 1 25 ? 10.607  -3.577  2.382   1.00 0.00 ? 25 LYS A NZ   1  
ATOM 383   H H    . LYS A 1 25 ? 7.046   -4.468  -1.378  1.00 0.00 ? 25 LYS A H    1  
ATOM 384   H HA   . LYS A 1 25 ? 8.476   -1.833  -1.649  1.00 0.00 ? 25 LYS A HA   1  
ATOM 385   H HB2  . LYS A 1 25 ? 7.499   -2.395  0.693   1.00 0.00 ? 25 LYS A HB2  1  
ATOM 386   H HB3  . LYS A 1 25 ? 8.717   -3.668  0.749   1.00 0.00 ? 25 LYS A HB3  1  
ATOM 387   H HG2  . LYS A 1 25 ? 10.509  -2.067  0.512   1.00 0.00 ? 25 LYS A HG2  1  
ATOM 388   H HG3  . LYS A 1 25 ? 9.366   -0.761  0.204   1.00 0.00 ? 25 LYS A HG3  1  
ATOM 389   H HD2  . LYS A 1 25 ? 10.200  -0.727  2.543   1.00 0.00 ? 25 LYS A HD2  1  
ATOM 390   H HD3  . LYS A 1 25 ? 8.457   -0.977  2.465   1.00 0.00 ? 25 LYS A HD3  1  
ATOM 391   H HE2  . LYS A 1 25 ? 9.870   -2.502  4.042   1.00 0.00 ? 25 LYS A HE2  1  
ATOM 392   H HE3  . LYS A 1 25 ? 8.627   -3.246  3.041   1.00 0.00 ? 25 LYS A HE3  1  
ATOM 393   H HZ1  . LYS A 1 25 ? 11.544  -3.149  2.517   1.00 0.00 ? 25 LYS A HZ1  1  
ATOM 394   H HZ2  . LYS A 1 25 ? 10.408  -3.655  1.365   1.00 0.00 ? 25 LYS A HZ2  1  
ATOM 395   H HZ3  . LYS A 1 25 ? 10.591  -4.525  2.813   1.00 0.00 ? 25 LYS A HZ3  1  
ATOM 396   N N    . THR A 1 26 ? 10.272  -3.207  -2.703  1.00 0.00 ? 26 THR A N    1  
ATOM 397   C CA   . THR A 1 26 ? 11.413  -4.001  -3.234  1.00 0.00 ? 26 THR A CA   1  
ATOM 398   C C    . THR A 1 26 ? 12.721  -3.310  -2.843  1.00 0.00 ? 26 THR A C    1  
ATOM 399   O O    . THR A 1 26 ? 12.965  -2.184  -3.229  1.00 0.00 ? 26 THR A O    1  
ATOM 400   C CB   . THR A 1 26 ? 11.311  -4.067  -4.761  1.00 0.00 ? 26 THR A CB   1  
ATOM 401   O OG1  . THR A 1 26 ? 10.053  -4.617  -5.126  1.00 0.00 ? 26 THR A OG1  1  
ATOM 402   C CG2  . THR A 1 26 ? 12.434  -4.945  -5.316  1.00 0.00 ? 26 THR A CG2  1  
ATOM 403   H H    . THR A 1 26 ? 10.036  -2.349  -3.114  1.00 0.00 ? 26 THR A H    1  
ATOM 404   H HA   . THR A 1 26 ? 11.378  -5.004  -2.828  1.00 0.00 ? 26 THR A HA   1  
ATOM 405   H HB   . THR A 1 26 ? 11.402  -3.073  -5.172  1.00 0.00 ? 26 THR A HB   1  
ATOM 406   H HG1  . THR A 1 26 ? 10.107  -4.898  -6.042  1.00 0.00 ? 26 THR A HG1  1  
ATOM 407   H HG21 . THR A 1 26 ? 12.265  -5.124  -6.367  1.00 0.00 ? 26 THR A HG21 1  
ATOM 408   H HG22 . THR A 1 26 ? 12.448  -5.888  -4.789  1.00 0.00 ? 26 THR A HG22 1  
ATOM 409   H HG23 . THR A 1 26 ? 13.381  -4.444  -5.183  1.00 0.00 ? 26 THR A HG23 1  
ATOM 410   N N    . VAL A 1 27 ? 13.564  -3.964  -2.076  1.00 0.00 ? 27 VAL A N    1  
ATOM 411   C CA   . VAL A 1 27 ? 14.857  -3.328  -1.658  1.00 0.00 ? 27 VAL A CA   1  
ATOM 412   C C    . VAL A 1 27 ? 16.022  -3.954  -2.430  1.00 0.00 ? 27 VAL A C    1  
ATOM 413   O O    . VAL A 1 27 ? 16.341  -5.118  -2.276  1.00 0.00 ? 27 VAL A O    1  
ATOM 414   C CB   . VAL A 1 27 ? 15.060  -3.528  -0.148  1.00 0.00 ? 27 VAL A CB   1  
ATOM 415   C CG1  . VAL A 1 27 ? 15.403  -4.996  0.162   1.00 0.00 ? 27 VAL A CG1  1  
ATOM 416   C CG2  . VAL A 1 27 ? 16.197  -2.620  0.333   1.00 0.00 ? 27 VAL A CG2  1  
ATOM 417   H H    . VAL A 1 27 ? 13.349  -4.869  -1.769  1.00 0.00 ? 27 VAL A H    1  
ATOM 418   H HA   . VAL A 1 27 ? 14.831  -2.266  -1.867  1.00 0.00 ? 27 VAL A HA   1  
ATOM 419   H HB   . VAL A 1 27 ? 14.149  -3.260  0.368   1.00 0.00 ? 27 VAL A HB   1  
ATOM 420   H HG11 . VAL A 1 27 ? 16.466  -5.157  0.049   1.00 0.00 ? 27 VAL A HG11 1  
ATOM 421   H HG12 . VAL A 1 27 ? 14.868  -5.643  -0.517  1.00 0.00 ? 27 VAL A HG12 1  
ATOM 422   H HG13 . VAL A 1 27 ? 15.114  -5.225  1.178   1.00 0.00 ? 27 VAL A HG13 1  
ATOM 423   H HG21 . VAL A 1 27 ? 17.110  -2.882  -0.181  1.00 0.00 ? 27 VAL A HG21 1  
ATOM 424   H HG22 . VAL A 1 27 ? 16.334  -2.745  1.397   1.00 0.00 ? 27 VAL A HG22 1  
ATOM 425   H HG23 . VAL A 1 27 ? 15.949  -1.589  0.120   1.00 0.00 ? 27 VAL A HG23 1  
ATOM 426   N N    . THR A 1 28 ? 16.655  -3.172  -3.265  1.00 0.00 ? 28 THR A N    1  
ATOM 427   C CA   . THR A 1 28 ? 17.813  -3.682  -4.065  1.00 0.00 ? 28 THR A CA   1  
ATOM 428   C C    . THR A 1 28 ? 19.110  -3.087  -3.512  1.00 0.00 ? 28 THR A C    1  
ATOM 429   O O    . THR A 1 28 ? 19.410  -1.930  -3.732  1.00 0.00 ? 28 THR A O    1  
ATOM 430   C CB   . THR A 1 28 ? 17.642  -3.257  -5.526  1.00 0.00 ? 28 THR A CB   1  
ATOM 431   O OG1  . THR A 1 28 ? 16.378  -3.698  -5.998  1.00 0.00 ? 28 THR A OG1  1  
ATOM 432   C CG2  . THR A 1 28 ? 18.751  -3.883  -6.375  1.00 0.00 ? 28 THR A CG2  1  
ATOM 433   H H    . THR A 1 28 ? 16.352  -2.243  -3.350  1.00 0.00 ? 28 THR A H    1  
ATOM 434   H HA   . THR A 1 28 ? 17.862  -4.761  -4.009  1.00 0.00 ? 28 THR A HA   1  
ATOM 435   H HB   . THR A 1 28 ? 17.702  -2.182  -5.599  1.00 0.00 ? 28 THR A HB   1  
ATOM 436   H HG1  . THR A 1 28 ? 15.842  -2.922  -6.179  1.00 0.00 ? 28 THR A HG1  1  
ATOM 437   H HG21 . THR A 1 28 ? 18.577  -3.656  -7.417  1.00 0.00 ? 28 THR A HG21 1  
ATOM 438   H HG22 . THR A 1 28 ? 18.751  -4.954  -6.236  1.00 0.00 ? 28 THR A HG22 1  
ATOM 439   H HG23 . THR A 1 28 ? 19.707  -3.480  -6.074  1.00 0.00 ? 28 THR A HG23 1  
ATOM 440   N N    . ASN A 1 29 ? 19.884  -3.862  -2.792  1.00 0.00 ? 29 ASN A N    1  
ATOM 441   C CA   . ASN A 1 29 ? 21.163  -3.336  -2.221  1.00 0.00 ? 29 ASN A CA   1  
ATOM 442   C C    . ASN A 1 29 ? 22.333  -3.764  -3.109  1.00 0.00 ? 29 ASN A C    1  
ATOM 443   O O    . ASN A 1 29 ? 22.602  -4.940  -3.280  1.00 0.00 ? 29 ASN A O    1  
ATOM 444   C CB   . ASN A 1 29 ? 21.359  -3.906  -0.815  1.00 0.00 ? 29 ASN A CB   1  
ATOM 445   C CG   . ASN A 1 29 ? 22.703  -3.438  -0.253  1.00 0.00 ? 29 ASN A CG   1  
ATOM 446   O OD1  . ASN A 1 29 ? 23.122  -3.879  0.798   1.00 0.00 ? 29 ASN A OD1  1  
ATOM 447   N ND2  . ASN A 1 29 ? 23.402  -2.556  -0.914  1.00 0.00 ? 29 ASN A ND2  1  
ATOM 448   H H    . ASN A 1 29 ? 19.627  -4.789  -2.606  1.00 0.00 ? 29 ASN A H    1  
ATOM 449   H HA   . ASN A 1 29 ? 21.129  -2.257  -2.167  1.00 0.00 ? 29 ASN A HA   1  
ATOM 450   H HB2  . ASN A 1 29 ? 20.561  -3.561  -0.173  1.00 0.00 ? 29 ASN A HB2  1  
ATOM 451   H HB3  . ASN A 1 29 ? 21.345  -4.983  -0.859  1.00 0.00 ? 29 ASN A HB3  1  
ATOM 452   H HD21 . ASN A 1 29 ? 23.063  -2.199  -1.762  1.00 0.00 ? 29 ASN A HD21 1  
ATOM 453   H HD22 . ASN A 1 29 ? 24.263  -2.250  -0.563  1.00 0.00 ? 29 ASN A HD22 1  
ATOM 454   N N    . ALA A 1 30 ? 23.022  -2.813  -3.676  1.00 0.00 ? 30 ALA A N    1  
ATOM 455   C CA   . ALA A 1 30 ? 24.174  -3.127  -4.568  1.00 0.00 ? 30 ALA A CA   1  
ATOM 456   C C    . ALA A 1 30 ? 25.105  -4.151  -3.915  1.00 0.00 ? 30 ALA A C    1  
ATOM 457   O O    . ALA A 1 30 ? 25.974  -4.701  -4.562  1.00 0.00 ? 30 ALA A O    1  
ATOM 458   C CB   . ALA A 1 30 ? 24.957  -1.843  -4.851  1.00 0.00 ? 30 ALA A CB   1  
ATOM 459   H H    . ALA A 1 30 ? 22.778  -1.876  -3.525  1.00 0.00 ? 30 ALA A H    1  
ATOM 460   H HA   . ALA A 1 30 ? 23.803  -3.528  -5.500  1.00 0.00 ? 30 ALA A HA   1  
ATOM 461   H HB1  . ALA A 1 30 ? 24.303  -1.117  -5.311  1.00 0.00 ? 30 ALA A HB1  1  
ATOM 462   H HB2  . ALA A 1 30 ? 25.777  -2.062  -5.518  1.00 0.00 ? 30 ALA A HB2  1  
ATOM 463   H HB3  . ALA A 1 30 ? 25.343  -1.444  -3.924  1.00 0.00 ? 30 ALA A HB3  1  
ATOM 464   N N    . ASP A 1 31 ? 24.953  -4.415  -2.644  1.00 0.00 ? 31 ASP A N    1  
ATOM 465   C CA   . ASP A 1 31 ? 25.861  -5.400  -1.992  1.00 0.00 ? 31 ASP A CA   1  
ATOM 466   C C    . ASP A 1 31 ? 25.511  -6.813  -2.474  1.00 0.00 ? 31 ASP A C    1  
ATOM 467   O O    . ASP A 1 31 ? 26.192  -7.768  -2.157  1.00 0.00 ? 31 ASP A O    1  
ATOM 468   C CB   . ASP A 1 31 ? 25.715  -5.305  -0.468  1.00 0.00 ? 31 ASP A CB   1  
ATOM 469   C CG   . ASP A 1 31 ? 26.465  -6.462  0.198   1.00 0.00 ? 31 ASP A CG   1  
ATOM 470   O OD1  . ASP A 1 31 ? 27.656  -6.320  0.418   1.00 0.00 ? 31 ASP A OD1  1  
ATOM 471   O OD2  . ASP A 1 31 ? 25.835  -7.467  0.478   1.00 0.00 ? 31 ASP A OD2  1  
ATOM 472   H H    . ASP A 1 31 ? 24.256  -3.970  -2.119  1.00 0.00 ? 31 ASP A H    1  
ATOM 473   H HA   . ASP A 1 31 ? 26.881  -5.176  -2.267  1.00 0.00 ? 31 ASP A HA   1  
ATOM 474   H HB2  . ASP A 1 31 ? 26.130  -4.367  -0.128  1.00 0.00 ? 31 ASP A HB2  1  
ATOM 475   H HB3  . ASP A 1 31 ? 24.672  -5.352  -0.199  1.00 0.00 ? 31 ASP A HB3  1  
ATOM 476   N N    . GLY A 1 32 ? 24.467  -6.952  -3.257  1.00 0.00 ? 32 GLY A N    1  
ATOM 477   C CA   . GLY A 1 32 ? 24.081  -8.301  -3.787  1.00 0.00 ? 32 GLY A CA   1  
ATOM 478   C C    . GLY A 1 32 ? 22.862  -8.849  -3.040  1.00 0.00 ? 32 GLY A C    1  
ATOM 479   O O    . GLY A 1 32 ? 22.447  -9.970  -3.266  1.00 0.00 ? 32 GLY A O    1  
ATOM 480   H H    . GLY A 1 32 ? 23.938  -6.165  -3.507  1.00 0.00 ? 32 GLY A H    1  
ATOM 481   H HA2  . GLY A 1 32 ? 23.839  -8.210  -4.836  1.00 0.00 ? 32 GLY A HA2  1  
ATOM 482   H HA3  . GLY A 1 32 ? 24.905  -8.992  -3.674  1.00 0.00 ? 32 GLY A HA3  1  
ATOM 483   N N    . ARG A 1 33 ? 22.279  -8.080  -2.157  1.00 0.00 ? 33 ARG A N    1  
ATOM 484   C CA   . ARG A 1 33 ? 21.081  -8.572  -1.403  1.00 0.00 ? 33 ARG A CA   1  
ATOM 485   C C    . ARG A 1 33 ? 19.813  -8.064  -2.086  1.00 0.00 ? 33 ARG A C    1  
ATOM 486   O O    . ARG A 1 33 ? 19.802  -7.023  -2.713  1.00 0.00 ? 33 ARG A O    1  
ATOM 487   C CB   . ARG A 1 33 ? 21.143  -8.061  0.051   1.00 0.00 ? 33 ARG A CB   1  
ATOM 488   C CG   . ARG A 1 33 ? 21.919  -9.065  0.916   1.00 0.00 ? 33 ARG A CG   1  
ATOM 489   C CD   . ARG A 1 33 ? 22.488  -8.366  2.155   1.00 0.00 ? 33 ARG A CD   1  
ATOM 490   N NE   . ARG A 1 33 ? 23.060  -9.386  3.080   1.00 0.00 ? 33 ARG A NE   1  
ATOM 491   C CZ   . ARG A 1 33 ? 23.855  -9.019  4.048   1.00 0.00 ? 33 ARG A CZ   1  
ATOM 492   N NH1  . ARG A 1 33 ? 24.151  -7.758  4.208   1.00 0.00 ? 33 ARG A NH1  1  
ATOM 493   N NH2  . ARG A 1 33 ? 24.355  -9.913  4.856   1.00 0.00 ? 33 ARG A NH2  1  
ATOM 494   H H    . ARG A 1 33 ? 22.624  -7.180  -1.986  1.00 0.00 ? 33 ARG A H    1  
ATOM 495   H HA   . ARG A 1 33 ? 21.066  -9.656  -1.404  1.00 0.00 ? 33 ARG A HA   1  
ATOM 496   H HB2  . ARG A 1 33 ? 21.644  -7.104  0.069   1.00 0.00 ? 33 ARG A HB2  1  
ATOM 497   H HB3  . ARG A 1 33 ? 20.143  -7.950  0.446   1.00 0.00 ? 33 ARG A HB3  1  
ATOM 498   H HG2  . ARG A 1 33 ? 21.255  -9.858  1.227   1.00 0.00 ? 33 ARG A HG2  1  
ATOM 499   H HG3  . ARG A 1 33 ? 22.727  -9.483  0.337   1.00 0.00 ? 33 ARG A HG3  1  
ATOM 500   H HD2  . ARG A 1 33 ? 23.264  -7.677  1.855   1.00 0.00 ? 33 ARG A HD2  1  
ATOM 501   H HD3  . ARG A 1 33 ? 21.700  -7.826  2.657   1.00 0.00 ? 33 ARG A HD3  1  
ATOM 502   H HE   . ARG A 1 33 ? 22.839  -10.333 2.961   1.00 0.00 ? 33 ARG A HE   1  
ATOM 503   H HH11 . ARG A 1 33 ? 23.768  -7.072  3.589   1.00 0.00 ? 33 ARG A HH11 1  
ATOM 504   H HH12 . ARG A 1 33 ? 24.759  -7.478  4.949   1.00 0.00 ? 33 ARG A HH12 1  
ATOM 505   H HH21 . ARG A 1 33 ? 24.128  -10.879 4.734   1.00 0.00 ? 33 ARG A HH21 1  
ATOM 506   H HH22 . ARG A 1 33 ? 24.963  -9.632  5.598   1.00 0.00 ? 33 ARG A HH22 1  
ATOM 507   N N    . THR A 1 34 ? 18.746  -8.802  -1.972  1.00 0.00 ? 34 THR A N    1  
ATOM 508   C CA   . THR A 1 34 ? 17.474  -8.369  -2.619  1.00 0.00 ? 34 THR A CA   1  
ATOM 509   C C    . THR A 1 34 ? 16.272  -9.060  -1.966  1.00 0.00 ? 34 THR A C    1  
ATOM 510   O O    . THR A 1 34 ? 16.129  -10.265 -2.022  1.00 0.00 ? 34 THR A O    1  
ATOM 511   C CB   . THR A 1 34 ? 17.518  -8.728  -4.107  1.00 0.00 ? 34 THR A CB   1  
ATOM 512   O OG1  . THR A 1 34 ? 16.192  -8.800  -4.613  1.00 0.00 ? 34 THR A OG1  1  
ATOM 513   C CG2  . THR A 1 34 ? 18.211  -10.079 -4.289  1.00 0.00 ? 34 THR A CG2  1  
ATOM 514   H H    . THR A 1 34 ? 18.788  -9.638  -1.458  1.00 0.00 ? 34 THR A H    1  
ATOM 515   H HA   . THR A 1 34 ? 17.366  -7.299  -2.515  1.00 0.00 ? 34 THR A HA   1  
ATOM 516   H HB   . THR A 1 34 ? 18.068  -7.971  -4.644  1.00 0.00 ? 34 THR A HB   1  
ATOM 517   H HG1  . THR A 1 34 ? 15.679  -8.104  -4.198  1.00 0.00 ? 34 THR A HG1  1  
ATOM 518   H HG21 . THR A 1 34 ? 18.131  -10.389 -5.320  1.00 0.00 ? 34 THR A HG21 1  
ATOM 519   H HG22 . THR A 1 34 ? 17.740  -10.815 -3.654  1.00 0.00 ? 34 THR A HG22 1  
ATOM 520   H HG23 . THR A 1 34 ? 19.254  -9.987  -4.021  1.00 0.00 ? 34 THR A HG23 1  
ATOM 521   N N    . GLU A 1 35 ? 15.396  -8.290  -1.370  1.00 0.00 ? 35 GLU A N    1  
ATOM 522   C CA   . GLU A 1 35 ? 14.166  -8.861  -0.727  1.00 0.00 ? 35 GLU A CA   1  
ATOM 523   C C    . GLU A 1 35 ? 12.954  -8.256  -1.445  1.00 0.00 ? 35 GLU A C    1  
ATOM 524   O O    . GLU A 1 35 ? 12.999  -7.114  -1.857  1.00 0.00 ? 35 GLU A O    1  
ATOM 525   C CB   . GLU A 1 35 ? 14.149  -8.478  0.762   1.00 0.00 ? 35 GLU A CB   1  
ATOM 526   C CG   . GLU A 1 35 ? 15.100  -9.394  1.535   1.00 0.00 ? 35 GLU A CG   1  
ATOM 527   C CD   . GLU A 1 35 ? 16.520  -9.230  0.990   1.00 0.00 ? 35 GLU A CD   1  
ATOM 528   O OE1  . GLU A 1 35 ? 17.087  -8.168  1.183   1.00 0.00 ? 35 GLU A OE1  1  
ATOM 529   O OE2  . GLU A 1 35 ? 17.015  -10.170 0.391   1.00 0.00 ? 35 GLU A OE2  1  
ATOM 530   H H    . GLU A 1 35 ? 15.535  -7.319  -1.364  1.00 0.00 ? 35 GLU A H    1  
ATOM 531   H HA   . GLU A 1 35 ? 14.148  -9.939  -0.831  1.00 0.00 ? 35 GLU A HA   1  
ATOM 532   H HB2  . GLU A 1 35 ? 14.471  -7.455  0.873   1.00 0.00 ? 35 GLU A HB2  1  
ATOM 533   H HB3  . GLU A 1 35 ? 13.152  -8.582  1.159   1.00 0.00 ? 35 GLU A HB3  1  
ATOM 534   H HG2  . GLU A 1 35 ? 15.081  -9.130  2.583   1.00 0.00 ? 35 GLU A HG2  1  
ATOM 535   H HG3  . GLU A 1 35 ? 14.786  -10.421 1.416   1.00 0.00 ? 35 GLU A HG3  1  
ATOM 536   N N    . THR A 1 36 ? 11.876  -8.994  -1.620  1.00 0.00 ? 36 THR A N    1  
ATOM 537   C CA   . THR A 1 36 ? 10.693  -8.437  -2.325  1.00 0.00 ? 36 THR A CA   1  
ATOM 538   C C    . THR A 1 36 ? 9.459   -8.711  -1.485  1.00 0.00 ? 36 THR A C    1  
ATOM 539   O O    . THR A 1 36 ? 9.036   -9.840  -1.333  1.00 0.00 ? 36 THR A O    1  
ATOM 540   C CB   . THR A 1 36 ? 10.553  -9.121  -3.688  1.00 0.00 ? 36 THR A CB   1  
ATOM 541   O OG1  . THR A 1 36 ? 11.638  -8.736  -4.522  1.00 0.00 ? 36 THR A OG1  1  
ATOM 542   C CG2  . THR A 1 36 ? 9.234   -8.706  -4.344  1.00 0.00 ? 36 THR A CG2  1  
ATOM 543   H H    . THR A 1 36 ? 11.831  -9.917  -1.291  1.00 0.00 ? 36 THR A H    1  
ATOM 544   H HA   . THR A 1 36 ? 10.797  -7.369  -2.466  1.00 0.00 ? 36 THR A HA   1  
ATOM 545   H HB   . THR A 1 36 ? 10.562  -10.192 -3.557  1.00 0.00 ? 36 THR A HB   1  
ATOM 546   H HG1  . THR A 1 36 ? 11.450  -7.863  -4.871  1.00 0.00 ? 36 THR A HG1  1  
ATOM 547   H HG21 . THR A 1 36 ? 8.420   -9.241  -3.878  1.00 0.00 ? 36 THR A HG21 1  
ATOM 548   H HG22 . THR A 1 36 ? 9.265   -8.944  -5.397  1.00 0.00 ? 36 THR A HG22 1  
ATOM 549   H HG23 . THR A 1 36 ? 9.087   -7.644  -4.219  1.00 0.00 ? 36 THR A HG23 1  
ATOM 550   N N    . THR A 1 37 ? 8.852   -7.680  -0.975  1.00 0.00 ? 37 THR A N    1  
ATOM 551   C CA   . THR A 1 37 ? 7.606   -7.857  -0.178  1.00 0.00 ? 37 THR A CA   1  
ATOM 552   C C    . THR A 1 37 ? 6.468   -7.444  -1.087  1.00 0.00 ? 37 THR A C    1  
ATOM 553   O O    . THR A 1 37 ? 6.337   -6.293  -1.431  1.00 0.00 ? 37 THR A O    1  
ATOM 554   C CB   . THR A 1 37 ? 7.627   -6.960  1.064   1.00 0.00 ? 37 THR A CB   1  
ATOM 555   O OG1  . THR A 1 37 ? 7.455   -5.609  0.668   1.00 0.00 ? 37 THR A OG1  1  
ATOM 556   C CG2  . THR A 1 37 ? 8.959   -7.117  1.806   1.00 0.00 ? 37 THR A CG2  1  
ATOM 557   H H    . THR A 1 37 ? 9.191   -6.774  -1.159  1.00 0.00 ? 37 THR A H    1  
ATOM 558   H HA   . THR A 1 37 ? 7.480   -8.895  0.118   1.00 0.00 ? 37 THR A HA   1  
ATOM 559   H HB   . THR A 1 37 ? 6.821   -7.244  1.722   1.00 0.00 ? 37 THR A HB   1  
ATOM 560   H HG1  . THR A 1 37 ? 7.934   -5.478  -0.154  1.00 0.00 ? 37 THR A HG1  1  
ATOM 561   H HG21 . THR A 1 37 ? 9.715   -6.512  1.328   1.00 0.00 ? 37 THR A HG21 1  
ATOM 562   H HG22 . THR A 1 37 ? 9.265   -8.153  1.791   1.00 0.00 ? 37 THR A HG22 1  
ATOM 563   H HG23 . THR A 1 37 ? 8.839   -6.794  2.830   1.00 0.00 ? 37 THR A HG23 1  
ATOM 564   N N    . LYS A 1 38 ? 5.652   -8.373  -1.483  1.00 0.00 ? 38 LYS A N    1  
ATOM 565   C CA   . LYS A 1 38 ? 4.500   -8.058  -2.392  1.00 0.00 ? 38 LYS A CA   1  
ATOM 566   C C    . LYS A 1 38 ? 3.201   -8.590  -1.779  1.00 0.00 ? 38 LYS A C    1  
ATOM 567   O O    . LYS A 1 38 ? 3.131   -9.716  -1.327  1.00 0.00 ? 38 LYS A O    1  
ATOM 568   C CB   . LYS A 1 38 ? 4.731   -8.731  -3.750  1.00 0.00 ? 38 LYS A CB   1  
ATOM 569   C CG   . LYS A 1 38 ? 5.757   -7.931  -4.556  1.00 0.00 ? 38 LYS A CG   1  
ATOM 570   C CD   . LYS A 1 38 ? 6.162   -8.724  -5.800  1.00 0.00 ? 38 LYS A CD   1  
ATOM 571   C CE   . LYS A 1 38 ? 6.951   -7.821  -6.750  1.00 0.00 ? 38 LYS A CE   1  
ATOM 572   N NZ   . LYS A 1 38 ? 6.018   -6.870  -7.417  1.00 0.00 ? 38 LYS A NZ   1  
ATOM 573   H H    . LYS A 1 38 ? 5.781   -9.289  -1.174  1.00 0.00 ? 38 LYS A H    1  
ATOM 574   H HA   . LYS A 1 38 ? 4.414   -6.988  -2.531  1.00 0.00 ? 38 LYS A HA   1  
ATOM 575   H HB2  . LYS A 1 38 ? 5.100   -9.735  -3.595  1.00 0.00 ? 38 LYS A HB2  1  
ATOM 576   H HB3  . LYS A 1 38 ? 3.800   -8.771  -4.298  1.00 0.00 ? 38 LYS A HB3  1  
ATOM 577   H HG2  . LYS A 1 38 ? 5.322   -6.989  -4.856  1.00 0.00 ? 38 LYS A HG2  1  
ATOM 578   H HG3  . LYS A 1 38 ? 6.629   -7.746  -3.949  1.00 0.00 ? 38 LYS A HG3  1  
ATOM 579   H HD2  . LYS A 1 38 ? 6.776   -9.565  -5.508  1.00 0.00 ? 38 LYS A HD2  1  
ATOM 580   H HD3  . LYS A 1 38 ? 5.277   -9.085  -6.302  1.00 0.00 ? 38 LYS A HD3  1  
ATOM 581   H HE2  . LYS A 1 38 ? 7.690   -7.267  -6.189  1.00 0.00 ? 38 LYS A HE2  1  
ATOM 582   H HE3  . LYS A 1 38 ? 7.444   -8.425  -7.497  1.00 0.00 ? 38 LYS A HE3  1  
ATOM 583   H HZ1  . LYS A 1 38 ? 6.406   -6.595  -8.342  1.00 0.00 ? 38 LYS A HZ1  1  
ATOM 584   H HZ2  . LYS A 1 38 ? 5.903   -6.023  -6.826  1.00 0.00 ? 38 LYS A HZ2  1  
ATOM 585   H HZ3  . LYS A 1 38 ? 5.093   -7.329  -7.550  1.00 0.00 ? 38 LYS A HZ3  1  
ATOM 586   N N    . GLU A 1 39 ? 2.168   -7.787  -1.769  1.00 0.00 ? 39 GLU A N    1  
ATOM 587   C CA   . GLU A 1 39 ? 0.861   -8.232  -1.198  1.00 0.00 ? 39 GLU A CA   1  
ATOM 588   C C    . GLU A 1 39 ? -0.275  -7.521  -1.951  1.00 0.00 ? 39 GLU A C    1  
ATOM 589   O O    . GLU A 1 39 ? -0.695  -6.446  -1.570  1.00 0.00 ? 39 GLU A O    1  
ATOM 590   C CB   . GLU A 1 39 ? 0.794   -7.851  0.284   1.00 0.00 ? 39 GLU A CB   1  
ATOM 591   C CG   . GLU A 1 39 ? 2.009   -8.422  1.020   1.00 0.00 ? 39 GLU A CG   1  
ATOM 592   C CD   . GLU A 1 39 ? 1.816   -8.257  2.529   1.00 0.00 ? 39 GLU A CD   1  
ATOM 593   O OE1  . GLU A 1 39 ? 1.783   -7.124  2.981   1.00 0.00 ? 39 GLU A OE1  1  
ATOM 594   O OE2  . GLU A 1 39 ? 1.705   -9.266  3.206   1.00 0.00 ? 39 GLU A OE2  1  
ATOM 595   H H    . GLU A 1 39 ? 2.252   -6.887  -2.146  1.00 0.00 ? 39 GLU A H    1  
ATOM 596   H HA   . GLU A 1 39 ? 0.761   -9.305  -1.296  1.00 0.00 ? 39 GLU A HA   1  
ATOM 597   H HB2  . GLU A 1 39 ? 0.789   -6.777  0.378   1.00 0.00 ? 39 GLU A HB2  1  
ATOM 598   H HB3  . GLU A 1 39 ? -0.108  -8.253  0.718   1.00 0.00 ? 39 GLU A HB3  1  
ATOM 599   H HG2  . GLU A 1 39 ? 2.113   -9.471  0.782   1.00 0.00 ? 39 GLU A HG2  1  
ATOM 600   H HG3  . GLU A 1 39 ? 2.898   -7.893  0.714   1.00 0.00 ? 39 GLU A HG3  1  
ATOM 601   N N    . VAL A 1 40 ? -0.777  -8.098  -3.019  1.00 0.00 ? 40 VAL A N    1  
ATOM 602   C CA   . VAL A 1 40 ? -1.878  -7.433  -3.784  1.00 0.00 ? 40 VAL A CA   1  
ATOM 603   C C    . VAL A 1 40 ? -3.237  -7.962  -3.310  1.00 0.00 ? 40 VAL A C    1  
ATOM 604   O O    . VAL A 1 40 ? -3.530  -9.135  -3.441  1.00 0.00 ? 40 VAL A O    1  
ATOM 605   C CB   . VAL A 1 40 ? -1.709  -7.745  -5.276  1.00 0.00 ? 40 VAL A CB   1  
ATOM 606   C CG1  . VAL A 1 40 ? -2.538  -6.762  -6.107  1.00 0.00 ? 40 VAL A CG1  1  
ATOM 607   C CG2  . VAL A 1 40 ? -0.231  -7.619  -5.659  1.00 0.00 ? 40 VAL A CG2  1  
ATOM 608   H H    . VAL A 1 40 ? -0.432  -8.965  -3.322  1.00 0.00 ? 40 VAL A H    1  
ATOM 609   H HA   . VAL A 1 40 ? -1.834  -6.361  -3.636  1.00 0.00 ? 40 VAL A HA   1  
ATOM 610   H HB   . VAL A 1 40 ? -2.046  -8.753  -5.475  1.00 0.00 ? 40 VAL A HB   1  
ATOM 611   H HG11 . VAL A 1 40 ? -2.160  -5.760  -5.965  1.00 0.00 ? 40 VAL A HG11 1  
ATOM 612   H HG12 . VAL A 1 40 ? -3.570  -6.805  -5.791  1.00 0.00 ? 40 VAL A HG12 1  
ATOM 613   H HG13 . VAL A 1 40 ? -2.470  -7.028  -7.152  1.00 0.00 ? 40 VAL A HG13 1  
ATOM 614   H HG21 . VAL A 1 40 ? 0.181   -6.722  -5.223  1.00 0.00 ? 40 VAL A HG21 1  
ATOM 615   H HG22 . VAL A 1 40 ? -0.139  -7.572  -6.734  1.00 0.00 ? 40 VAL A HG22 1  
ATOM 616   H HG23 . VAL A 1 40 ? 0.310   -8.478  -5.290  1.00 0.00 ? 40 VAL A HG23 1  
ATOM 617   N N    . VAL A 1 41 ? -4.080  -7.102  -2.787  1.00 0.00 ? 41 VAL A N    1  
ATOM 618   C CA   . VAL A 1 41 ? -5.439  -7.545  -2.334  1.00 0.00 ? 41 VAL A CA   1  
ATOM 619   C C    . VAL A 1 41 ? -6.487  -6.562  -2.863  1.00 0.00 ? 41 VAL A C    1  
ATOM 620   O O    . VAL A 1 41 ? -6.583  -5.444  -2.396  1.00 0.00 ? 41 VAL A O    1  
ATOM 621   C CB   . VAL A 1 41 ? -5.480  -7.553  -0.804  1.00 0.00 ? 41 VAL A CB   1  
ATOM 622   C CG1  . VAL A 1 41 ? -6.739  -8.281  -0.326  1.00 0.00 ? 41 VAL A CG1  1  
ATOM 623   C CG2  . VAL A 1 41 ? -4.240  -8.274  -0.266  1.00 0.00 ? 41 VAL A CG2  1  
ATOM 624   H H    . VAL A 1 41 ? -3.831  -6.156  -2.726  1.00 0.00 ? 41 VAL A H    1  
ATOM 625   H HA   . VAL A 1 41 ? -5.657  -8.537  -2.707  1.00 0.00 ? 41 VAL A HA   1  
ATOM 626   H HB   . VAL A 1 41 ? -5.492  -6.537  -0.439  1.00 0.00 ? 41 VAL A HB   1  
ATOM 627   H HG11 . VAL A 1 41 ? -6.908  -8.060  0.719   1.00 0.00 ? 41 VAL A HG11 1  
ATOM 628   H HG12 . VAL A 1 41 ? -6.611  -9.345  -0.453  1.00 0.00 ? 41 VAL A HG12 1  
ATOM 629   H HG13 . VAL A 1 41 ? -7.588  -7.949  -0.905  1.00 0.00 ? 41 VAL A HG13 1  
ATOM 630   H HG21 . VAL A 1 41 ? -4.308  -8.353  0.809   1.00 0.00 ? 41 VAL A HG21 1  
ATOM 631   H HG22 . VAL A 1 41 ? -3.356  -7.715  -0.531  1.00 0.00 ? 41 VAL A HG22 1  
ATOM 632   H HG23 . VAL A 1 41 ? -4.185  -9.263  -0.696  1.00 0.00 ? 41 VAL A HG23 1  
ATOM 633   N N    . LYS A 1 42 ? -7.259  -6.960  -3.846  1.00 0.00 ? 42 LYS A N    1  
ATOM 634   C CA   . LYS A 1 42 ? -8.293  -6.043  -4.433  1.00 0.00 ? 42 LYS A CA   1  
ATOM 635   C C    . LYS A 1 42 ? -9.697  -6.599  -4.187  1.00 0.00 ? 42 LYS A C    1  
ATOM 636   O O    . LYS A 1 42 ? -9.987  -7.737  -4.499  1.00 0.00 ? 42 LYS A O    1  
ATOM 637   C CB   . LYS A 1 42 ? -8.055  -5.938  -5.943  1.00 0.00 ? 42 LYS A CB   1  
ATOM 638   C CG   . LYS A 1 42 ? -6.758  -5.147  -6.219  1.00 0.00 ? 42 LYS A CG   1  
ATOM 639   C CD   . LYS A 1 42 ? -7.053  -3.637  -6.298  1.00 0.00 ? 42 LYS A CD   1  
ATOM 640   C CE   . LYS A 1 42 ? -7.498  -3.257  -7.716  1.00 0.00 ? 42 LYS A CE   1  
ATOM 641   N NZ   . LYS A 1 42 ? -7.792  -1.797  -7.770  1.00 0.00 ? 42 LYS A NZ   1  
ATOM 642   H H    . LYS A 1 42 ? -7.135  -7.853  -4.234  1.00 0.00 ? 42 LYS A H    1  
ATOM 643   H HA   . LYS A 1 42 ? -8.217  -5.059  -3.993  1.00 0.00 ? 42 LYS A HA   1  
ATOM 644   H HB2  . LYS A 1 42 ? -7.964  -6.933  -6.357  1.00 0.00 ? 42 LYS A HB2  1  
ATOM 645   H HB3  . LYS A 1 42 ? -8.892  -5.437  -6.402  1.00 0.00 ? 42 LYS A HB3  1  
ATOM 646   H HG2  . LYS A 1 42 ? -6.047  -5.330  -5.423  1.00 0.00 ? 42 LYS A HG2  1  
ATOM 647   H HG3  . LYS A 1 42 ? -6.330  -5.478  -7.155  1.00 0.00 ? 42 LYS A HG3  1  
ATOM 648   H HD2  . LYS A 1 42 ? -7.834  -3.382  -5.596  1.00 0.00 ? 42 LYS A HD2  1  
ATOM 649   H HD3  . LYS A 1 42 ? -6.158  -3.086  -6.049  1.00 0.00 ? 42 LYS A HD3  1  
ATOM 650   H HE2  . LYS A 1 42 ? -6.709  -3.490  -8.415  1.00 0.00 ? 42 LYS A HE2  1  
ATOM 651   H HE3  . LYS A 1 42 ? -8.386  -3.811  -7.978  1.00 0.00 ? 42 LYS A HE3  1  
ATOM 652   H HZ1  . LYS A 1 42 ? -8.380  -1.530  -6.955  1.00 0.00 ? 42 LYS A HZ1  1  
ATOM 653   H HZ2  . LYS A 1 42 ? -8.303  -1.578  -8.649  1.00 0.00 ? 42 LYS A HZ2  1  
ATOM 654   H HZ3  . LYS A 1 42 ? -6.899  -1.262  -7.744  1.00 0.00 ? 42 LYS A HZ3  1  
ATOM 655   N N    . SER A 1 43 ? -10.561 -5.798  -3.615  1.00 0.00 ? 43 SER A N    1  
ATOM 656   C CA   . SER A 1 43 ? -11.961 -6.243  -3.321  1.00 0.00 ? 43 SER A CA   1  
ATOM 657   C C    . SER A 1 43 ? -12.494 -7.154  -4.436  1.00 0.00 ? 43 SER A C    1  
ATOM 658   O O    . SER A 1 43 ? -12.626 -6.749  -5.573  1.00 0.00 ? 43 SER A O    1  
ATOM 659   C CB   . SER A 1 43 ? -12.864 -5.011  -3.204  1.00 0.00 ? 43 SER A CB   1  
ATOM 660   O OG   . SER A 1 43 ? -14.023 -5.347  -2.451  1.00 0.00 ? 43 SER A OG   1  
ATOM 661   H H    . SER A 1 43 ? -10.285 -4.894  -3.358  1.00 0.00 ? 43 SER A H    1  
ATOM 662   H HA   . SER A 1 43 ? -11.973 -6.781  -2.388  1.00 0.00 ? 43 SER A HA   1  
ATOM 663   H HB2  . SER A 1 43 ? -12.334 -4.220  -2.703  1.00 0.00 ? 43 SER A HB2  1  
ATOM 664   H HB3  . SER A 1 43 ? -13.149 -4.675  -4.193  1.00 0.00 ? 43 SER A HB3  1  
ATOM 665   H HG   . SER A 1 43 ? -13.956 -6.271  -2.200  1.00 0.00 ? 43 SER A HG   1  
ATOM 666   N N    . GLU A 1 44 ? -12.811 -8.379  -4.109  1.00 0.00 ? 44 GLU A N    1  
ATOM 667   C CA   . GLU A 1 44 ? -13.348 -9.317  -5.139  1.00 0.00 ? 44 GLU A CA   1  
ATOM 668   C C    . GLU A 1 44 ? -14.874 -9.198  -5.180  1.00 0.00 ? 44 GLU A C    1  
ATOM 669   O O    . GLU A 1 44 ? -15.548 -9.944  -5.862  1.00 0.00 ? 44 GLU A O    1  
ATOM 670   C CB   . GLU A 1 44 ? -12.963 -10.753 -4.774  1.00 0.00 ? 44 GLU A CB   1  
ATOM 671   C CG   . GLU A 1 44 ? -11.457 -10.943 -4.964  1.00 0.00 ? 44 GLU A CG   1  
ATOM 672   C CD   . GLU A 1 44 ? -11.067 -12.367 -4.565  1.00 0.00 ? 44 GLU A CD   1  
ATOM 673   O OE1  . GLU A 1 44 ? -11.736 -12.927 -3.712  1.00 0.00 ? 44 GLU A OE1  1  
ATOM 674   O OE2  . GLU A 1 44 ? -10.107 -12.875 -5.120  1.00 0.00 ? 44 GLU A OE2  1  
ATOM 675   H H    . GLU A 1 44 ? -12.703 -8.681  -3.183  1.00 0.00 ? 44 GLU A H    1  
ATOM 676   H HA   . GLU A 1 44 ? -12.941 -9.071  -6.110  1.00 0.00 ? 44 GLU A HA   1  
ATOM 677   H HB2  . GLU A 1 44 ? -13.224 -10.945 -3.744  1.00 0.00 ? 44 GLU A HB2  1  
ATOM 678   H HB3  . GLU A 1 44 ? -13.493 -11.442 -5.414  1.00 0.00 ? 44 GLU A HB3  1  
ATOM 679   H HG2  . GLU A 1 44 ? -11.201 -10.775 -6.001  1.00 0.00 ? 44 GLU A HG2  1  
ATOM 680   H HG3  . GLU A 1 44 ? -10.923 -10.239 -4.344  1.00 0.00 ? 44 GLU A HG3  1  
ATOM 681   N N    . ASP A 1 45 ? -15.425 -8.264  -4.446  1.00 0.00 ? 45 ASP A N    1  
ATOM 682   C CA   . ASP A 1 45 ? -16.909 -8.089  -4.427  1.00 0.00 ? 45 ASP A CA   1  
ATOM 683   C C    . ASP A 1 45 ? -17.240 -6.596  -4.347  1.00 0.00 ? 45 ASP A C    1  
ATOM 684   O O    . ASP A 1 45 ? -16.625 -5.854  -3.606  1.00 0.00 ? 45 ASP A O    1  
ATOM 685   C CB   . ASP A 1 45 ? -17.484 -8.808  -3.204  1.00 0.00 ? 45 ASP A CB   1  
ATOM 686   C CG   . ASP A 1 45 ? -17.043 -10.272 -3.221  1.00 0.00 ? 45 ASP A CG   1  
ATOM 687   O OD1  . ASP A 1 45 ? -17.480 -10.993 -4.103  1.00 0.00 ? 45 ASP A OD1  1  
ATOM 688   O OD2  . ASP A 1 45 ? -16.273 -10.648 -2.352  1.00 0.00 ? 45 ASP A OD2  1  
ATOM 689   H H    . ASP A 1 45 ? -14.860 -7.678  -3.900  1.00 0.00 ? 45 ASP A H    1  
ATOM 690   H HA   . ASP A 1 45 ? -17.342 -8.504  -5.328  1.00 0.00 ? 45 ASP A HA   1  
ATOM 691   H HB2  . ASP A 1 45 ? -17.121 -8.332  -2.305  1.00 0.00 ? 45 ASP A HB2  1  
ATOM 692   H HB3  . ASP A 1 45 ? -18.562 -8.759  -3.228  1.00 0.00 ? 45 ASP A HB3  1  
ATOM 693   N N    . GLY A 1 46 ? -18.204 -6.149  -5.104  1.00 0.00 ? 46 GLY A N    1  
ATOM 694   C CA   . GLY A 1 46 ? -18.570 -4.705  -5.069  1.00 0.00 ? 46 GLY A CA   1  
ATOM 695   C C    . GLY A 1 46 ? -17.438 -3.880  -5.681  1.00 0.00 ? 46 GLY A C    1  
ATOM 696   O O    . GLY A 1 46 ? -17.446 -3.589  -6.860  1.00 0.00 ? 46 GLY A O    1  
ATOM 697   H H    . GLY A 1 46 ? -18.688 -6.764  -5.695  1.00 0.00 ? 46 GLY A H    1  
ATOM 698   H HA2  . GLY A 1 46 ? -19.478 -4.551  -5.635  1.00 0.00 ? 46 GLY A HA2  1  
ATOM 699   H HA3  . GLY A 1 46 ? -18.724 -4.397  -4.047  1.00 0.00 ? 46 GLY A HA3  1  
ATOM 700   N N    . SER A 1 47 ? -16.479 -3.489  -4.875  1.00 0.00 ? 47 SER A N    1  
ATOM 701   C CA   . SER A 1 47 ? -15.326 -2.663  -5.364  1.00 0.00 ? 47 SER A CA   1  
ATOM 702   C C    . SER A 1 47 ? -15.705 -1.180  -5.296  1.00 0.00 ? 47 SER A C    1  
ATOM 703   O O    . SER A 1 47 ? -15.804 -0.502  -6.299  1.00 0.00 ? 47 SER A O    1  
ATOM 704   C CB   . SER A 1 47 ? -14.938 -3.055  -6.802  1.00 0.00 ? 47 SER A CB   1  
ATOM 705   O OG   . SER A 1 47 ? -15.210 -4.436  -6.998  1.00 0.00 ? 47 SER A OG   1  
ATOM 706   H H    . SER A 1 47 ? -16.523 -3.725  -3.924  1.00 0.00 ? 47 SER A H    1  
ATOM 707   H HA   . SER A 1 47 ? -14.482 -2.832  -4.712  1.00 0.00 ? 47 SER A HA   1  
ATOM 708   H HB2  . SER A 1 47 ? -15.510 -2.480  -7.513  1.00 0.00 ? 47 SER A HB2  1  
ATOM 709   H HB3  . SER A 1 47 ? -13.884 -2.862  -6.956  1.00 0.00 ? 47 SER A HB3  1  
ATOM 710   H HG   . SER A 1 47 ? -14.379 -4.879  -7.185  1.00 0.00 ? 47 SER A HG   1  
ATOM 711   N N    . ASP A 1 48 ? -15.908 -0.676  -4.108  1.00 0.00 ? 48 ASP A N    1  
ATOM 712   C CA   . ASP A 1 48 ? -16.271 0.760   -3.946  1.00 0.00 ? 48 ASP A CA   1  
ATOM 713   C C    . ASP A 1 48 ? -15.950 1.186   -2.511  1.00 0.00 ? 48 ASP A C    1  
ATOM 714   O O    . ASP A 1 48 ? -16.816 1.224   -1.659  1.00 0.00 ? 48 ASP A O    1  
ATOM 715   C CB   . ASP A 1 48 ? -17.767 0.948   -4.211  1.00 0.00 ? 48 ASP A CB   1  
ATOM 716   C CG   . ASP A 1 48 ? -18.071 0.645   -5.680  1.00 0.00 ? 48 ASP A CG   1  
ATOM 717   O OD1  . ASP A 1 48 ? -18.280 -0.515  -5.993  1.00 0.00 ? 48 ASP A OD1  1  
ATOM 718   O OD2  . ASP A 1 48 ? -18.088 1.578   -6.466  1.00 0.00 ? 48 ASP A OD2  1  
ATOM 719   H H    . ASP A 1 48 ? -15.811 -1.239  -3.313  1.00 0.00 ? 48 ASP A H    1  
ATOM 720   H HA   . ASP A 1 48 ? -15.700 1.360   -4.639  1.00 0.00 ? 48 ASP A HA   1  
ATOM 721   H HB2  . ASP A 1 48 ? -18.331 0.276   -3.580  1.00 0.00 ? 48 ASP A HB2  1  
ATOM 722   H HB3  . ASP A 1 48 ? -18.046 1.968   -3.992  1.00 0.00 ? 48 ASP A HB3  1  
ATOM 723   N N    . CYS A 1 49 ? -14.705 1.491   -2.239  1.00 0.00 ? 49 CYS A N    1  
ATOM 724   C CA   . CYS A 1 49 ? -14.293 1.905   -0.858  1.00 0.00 ? 49 CYS A CA   1  
ATOM 725   C C    . CYS A 1 49 ? -13.782 3.346   -0.889  1.00 0.00 ? 49 CYS A C    1  
ATOM 726   O O    . CYS A 1 49 ? -13.311 3.823   -1.900  1.00 0.00 ? 49 CYS A O    1  
ATOM 727   C CB   . CYS A 1 49 ? -13.171 0.976   -0.380  1.00 0.00 ? 49 CYS A CB   1  
ATOM 728   S SG   . CYS A 1 49 ? -12.579 1.511   1.244   1.00 0.00 ? 49 CYS A SG   1  
ATOM 729   H H    . CYS A 1 49 ? -14.030 1.440   -2.947  1.00 0.00 ? 49 CYS A H    1  
ATOM 730   H HA   . CYS A 1 49 ? -15.130 1.835   -0.177  1.00 0.00 ? 49 CYS A HA   1  
ATOM 731   H HB2  . CYS A 1 49 ? -13.547 -0.034  -0.309  1.00 0.00 ? 49 CYS A HB2  1  
ATOM 732   H HB3  . CYS A 1 49 ? -12.356 1.006   -1.088  1.00 0.00 ? 49 CYS A HB3  1  
ATOM 733   N N    . GLY A 1 50 ? -13.874 4.045   0.209   1.00 0.00 ? 50 GLY A N    1  
ATOM 734   C CA   . GLY A 1 50 ? -13.391 5.461   0.229   1.00 0.00 ? 50 GLY A CA   1  
ATOM 735   C C    . GLY A 1 50 ? -14.003 6.228   -0.945  1.00 0.00 ? 50 GLY A C    1  
ATOM 736   O O    . GLY A 1 50 ? -13.312 6.893   -1.692  1.00 0.00 ? 50 GLY A O    1  
ATOM 737   H H    . GLY A 1 50 ? -14.262 3.639   1.016   1.00 0.00 ? 50 GLY A H    1  
ATOM 738   H HA2  . GLY A 1 50 ? -13.681 5.936   1.159   1.00 0.00 ? 50 GLY A HA2  1  
ATOM 739   H HA3  . GLY A 1 50 ? -12.314 5.477   0.140   1.00 0.00 ? 50 GLY A HA3  1  
ATOM 740   N N    . ASP A 1 51 ? -15.294 6.139   -1.116  1.00 0.00 ? 51 ASP A N    1  
ATOM 741   C CA   . ASP A 1 51 ? -15.955 6.863   -2.240  1.00 0.00 ? 51 ASP A CA   1  
ATOM 742   C C    . ASP A 1 51 ? -15.339 6.424   -3.571  1.00 0.00 ? 51 ASP A C    1  
ATOM 743   O O    . ASP A 1 51 ? -15.693 6.920   -4.622  1.00 0.00 ? 51 ASP A O    1  
ATOM 744   C CB   . ASP A 1 51 ? -15.762 8.373   -2.061  1.00 0.00 ? 51 ASP A CB   1  
ATOM 745   C CG   . ASP A 1 51 ? -16.740 9.124   -2.964  1.00 0.00 ? 51 ASP A CG   1  
ATOM 746   O OD1  . ASP A 1 51 ? -17.347 8.486   -3.809  1.00 0.00 ? 51 ASP A OD1  1  
ATOM 747   O OD2  . ASP A 1 51 ? -16.868 10.326  -2.795  1.00 0.00 ? 51 ASP A OD2  1  
ATOM 748   H H    . ASP A 1 51 ? -15.832 5.598   -0.501  1.00 0.00 ? 51 ASP A H    1  
ATOM 749   H HA   . ASP A 1 51 ? -17.011 6.635   -2.241  1.00 0.00 ? 51 ASP A HA   1  
ATOM 750   H HB2  . ASP A 1 51 ? -15.946 8.637   -1.030  1.00 0.00 ? 51 ASP A HB2  1  
ATOM 751   H HB3  . ASP A 1 51 ? -14.751 8.642   -2.326  1.00 0.00 ? 51 ASP A HB3  1  
ATOM 752   N N    . ALA A 1 52 ? -14.423 5.495   -3.535  1.00 0.00 ? 52 ALA A N    1  
ATOM 753   C CA   . ALA A 1 52 ? -13.785 5.021   -4.798  1.00 0.00 ? 52 ALA A CA   1  
ATOM 754   C C    . ALA A 1 52 ? -12.782 3.914   -4.466  1.00 0.00 ? 52 ALA A C    1  
ATOM 755   O O    . ALA A 1 52 ? -12.920 2.785   -4.895  1.00 0.00 ? 52 ALA A O    1  
ATOM 756   C CB   . ALA A 1 52 ? -13.057 6.188   -5.474  1.00 0.00 ? 52 ALA A CB   1  
ATOM 757   H H    . ALA A 1 52 ? -14.154 5.106   -2.678  1.00 0.00 ? 52 ALA A H    1  
ATOM 758   H HA   . ALA A 1 52 ? -14.543 4.634   -5.463  1.00 0.00 ? 52 ALA A HA   1  
ATOM 759   H HB1  . ALA A 1 52 ? -12.532 6.764   -4.728  1.00 0.00 ? 52 ALA A HB1  1  
ATOM 760   H HB2  . ALA A 1 52 ? -13.775 6.818   -5.976  1.00 0.00 ? 52 ALA A HB2  1  
ATOM 761   H HB3  . ALA A 1 52 ? -12.351 5.804   -6.196  1.00 0.00 ? 52 ALA A HB3  1  
ATOM 762   N N    . ASP A 1 53 ? -11.776 4.231   -3.698  1.00 0.00 ? 53 ASP A N    1  
ATOM 763   C CA   . ASP A 1 53 ? -10.763 3.205   -3.327  1.00 0.00 ? 53 ASP A CA   1  
ATOM 764   C C    . ASP A 1 53 ? -9.834  3.787   -2.256  1.00 0.00 ? 53 ASP A C    1  
ATOM 765   O O    . ASP A 1 53 ? -9.125  4.743   -2.499  1.00 0.00 ? 53 ASP A O    1  
ATOM 766   C CB   . ASP A 1 53 ? -9.941  2.831   -4.562  1.00 0.00 ? 53 ASP A CB   1  
ATOM 767   C CG   . ASP A 1 53 ? -9.463  4.103   -5.262  1.00 0.00 ? 53 ASP A CG   1  
ATOM 768   O OD1  . ASP A 1 53 ? -8.413  4.600   -4.891  1.00 0.00 ? 53 ASP A OD1  1  
ATOM 769   O OD2  . ASP A 1 53 ? -10.155 4.560   -6.157  1.00 0.00 ? 53 ASP A OD2  1  
ATOM 770   H H    . ASP A 1 53 ? -11.689 5.147   -3.361  1.00 0.00 ? 53 ASP A H    1  
ATOM 771   H HA   . ASP A 1 53 ? -11.260 2.327   -2.944  1.00 0.00 ? 53 ASP A HA   1  
ATOM 772   H HB2  . ASP A 1 53 ? -9.087  2.242   -4.261  1.00 0.00 ? 53 ASP A HB2  1  
ATOM 773   H HB3  . ASP A 1 53 ? -10.554 2.257   -5.241  1.00 0.00 ? 53 ASP A HB3  1  
ATOM 774   N N    . PHE A 1 54 ? -9.825  3.229   -1.072  1.00 0.00 ? 54 PHE A N    1  
ATOM 775   C CA   . PHE A 1 54 ? -8.932  3.778   -0.013  1.00 0.00 ? 54 PHE A CA   1  
ATOM 776   C C    . PHE A 1 54 ? -7.479  3.496   -0.394  1.00 0.00 ? 54 PHE A C    1  
ATOM 777   O O    . PHE A 1 54 ? -7.094  2.364   -0.607  1.00 0.00 ? 54 PHE A O    1  
ATOM 778   C CB   . PHE A 1 54 ? -9.257  3.113   1.333   1.00 0.00 ? 54 PHE A CB   1  
ATOM 779   C CG   . PHE A 1 54 ? -8.742  3.969   2.467   1.00 0.00 ? 54 PHE A CG   1  
ATOM 780   C CD1  . PHE A 1 54 ? -9.522  5.023   2.957   1.00 0.00 ? 54 PHE A CD1  1  
ATOM 781   C CD2  . PHE A 1 54 ? -7.487  3.707   3.028   1.00 0.00 ? 54 PHE A CD2  1  
ATOM 782   C CE1  . PHE A 1 54 ? -9.046  5.816   4.009   1.00 0.00 ? 54 PHE A CE1  1  
ATOM 783   C CE2  . PHE A 1 54 ? -7.011  4.500   4.080   1.00 0.00 ? 54 PHE A CE2  1  
ATOM 784   C CZ   . PHE A 1 54 ? -7.791  5.554   4.570   1.00 0.00 ? 54 PHE A CZ   1  
ATOM 785   H H    . PHE A 1 54 ? -10.400 2.455   -0.880  1.00 0.00 ? 54 PHE A H    1  
ATOM 786   H HA   . PHE A 1 54 ? -9.083  4.846   0.063   1.00 0.00 ? 54 PHE A HA   1  
ATOM 787   H HB2  . PHE A 1 54 ? -10.327 2.999   1.427   1.00 0.00 ? 54 PHE A HB2  1  
ATOM 788   H HB3  . PHE A 1 54 ? -8.788  2.140   1.379   1.00 0.00 ? 54 PHE A HB3  1  
ATOM 789   H HD1  . PHE A 1 54 ? -10.491 5.226   2.524   1.00 0.00 ? 54 PHE A HD1  1  
ATOM 790   H HD2  . PHE A 1 54 ? -6.886  2.894   2.650   1.00 0.00 ? 54 PHE A HD2  1  
ATOM 791   H HE1  . PHE A 1 54 ? -9.648  6.629   4.387   1.00 0.00 ? 54 PHE A HE1  1  
ATOM 792   H HE2  . PHE A 1 54 ? -6.042  4.297   4.513   1.00 0.00 ? 54 PHE A HE2  1  
ATOM 793   H HZ   . PHE A 1 54 ? -7.424  6.165   5.381   1.00 0.00 ? 54 PHE A HZ   1  
ATOM 794   N N    . ASP A 1 55 ? -6.669  4.515   -0.493  1.00 0.00 ? 55 ASP A N    1  
ATOM 795   C CA   . ASP A 1 55 ? -5.246  4.291   -0.870  1.00 0.00 ? 55 ASP A CA   1  
ATOM 796   C C    . ASP A 1 55 ? -5.203  3.769   -2.317  1.00 0.00 ? 55 ASP A C    1  
ATOM 797   O O    . ASP A 1 55 ? -6.059  3.011   -2.728  1.00 0.00 ? 55 ASP A O    1  
ATOM 798   C CB   . ASP A 1 55 ? -4.618  3.284   0.135   1.00 0.00 ? 55 ASP A CB   1  
ATOM 799   C CG   . ASP A 1 55 ? -4.534  1.870   -0.457  1.00 0.00 ? 55 ASP A CG   1  
ATOM 800   O OD1  . ASP A 1 55 ? -3.751  1.677   -1.372  1.00 0.00 ? 55 ASP A OD1  1  
ATOM 801   O OD2  . ASP A 1 55 ? -5.256  1.010   0.016   1.00 0.00 ? 55 ASP A OD2  1  
ATOM 802   H H    . ASP A 1 55 ? -6.996  5.423   -0.327  1.00 0.00 ? 55 ASP A H    1  
ATOM 803   H HA   . ASP A 1 55 ? -4.715  5.231   -0.821  1.00 0.00 ? 55 ASP A HA   1  
ATOM 804   H HB2  . ASP A 1 55 ? -3.623  3.611   0.410   1.00 0.00 ? 55 ASP A HB2  1  
ATOM 805   H HB3  . ASP A 1 55 ? -5.231  3.253   1.025   1.00 0.00 ? 55 ASP A HB3  1  
ATOM 806   N N    . TRP A 1 56 ? -4.211  4.161   -3.086  1.00 0.00 ? 56 TRP A N    1  
ATOM 807   C CA   . TRP A 1 56 ? -4.104  3.684   -4.502  1.00 0.00 ? 56 TRP A CA   1  
ATOM 808   C C    . TRP A 1 56 ? -2.809  2.886   -4.656  1.00 0.00 ? 56 TRP A C    1  
ATOM 809   O O    . TRP A 1 56 ? -2.806  1.799   -5.197  1.00 0.00 ? 56 TRP A O    1  
ATOM 810   C CB   . TRP A 1 56 ? -4.093  4.895   -5.447  1.00 0.00 ? 56 TRP A CB   1  
ATOM 811   C CG   . TRP A 1 56 ? -4.509  4.477   -6.827  1.00 0.00 ? 56 TRP A CG   1  
ATOM 812   C CD1  . TRP A 1 56 ? -3.760  3.736   -7.677  1.00 0.00 ? 56 TRP A CD1  1  
ATOM 813   C CD2  . TRP A 1 56 ? -5.756  4.762   -7.526  1.00 0.00 ? 56 TRP A CD2  1  
ATOM 814   N NE1  . TRP A 1 56 ? -4.466  3.551   -8.850  1.00 0.00 ? 56 TRP A NE1  1  
ATOM 815   C CE2  . TRP A 1 56 ? -5.702  4.163   -8.808  1.00 0.00 ? 56 TRP A CE2  1  
ATOM 816   C CE3  . TRP A 1 56 ? -6.917  5.474   -7.177  1.00 0.00 ? 56 TRP A CE3  1  
ATOM 817   C CZ2  . TRP A 1 56 ? -6.762  4.268   -9.710  1.00 0.00 ? 56 TRP A CZ2  1  
ATOM 818   C CZ3  . TRP A 1 56 ? -7.986  5.582   -8.082  1.00 0.00 ? 56 TRP A CZ3  1  
ATOM 819   C CH2  . TRP A 1 56 ? -7.908  4.979   -9.346  1.00 0.00 ? 56 TRP A CH2  1  
ATOM 820   H H    . TRP A 1 56 ? -3.526  4.760   -2.725  1.00 0.00 ? 56 TRP A H    1  
ATOM 821   H HA   . TRP A 1 56 ? -4.939  3.044   -4.742  1.00 0.00 ? 56 TRP A HA   1  
ATOM 822   H HB2  . TRP A 1 56 ? -4.781  5.641   -5.078  1.00 0.00 ? 56 TRP A HB2  1  
ATOM 823   H HB3  . TRP A 1 56 ? -3.100  5.315   -5.483  1.00 0.00 ? 56 TRP A HB3  1  
ATOM 824   H HD1  . TRP A 1 56 ? -2.774  3.354   -7.471  1.00 0.00 ? 56 TRP A HD1  1  
ATOM 825   H HE1  . TRP A 1 56 ? -4.145  3.049   -9.629  1.00 0.00 ? 56 TRP A HE1  1  
ATOM 826   H HE3  . TRP A 1 56 ? -6.989  5.941   -6.207  1.00 0.00 ? 56 TRP A HE3  1  
ATOM 827   H HZ2  . TRP A 1 56 ? -6.697  3.802   -10.682 1.00 0.00 ? 56 TRP A HZ2  1  
ATOM 828   H HZ3  . TRP A 1 56 ? -8.873  6.131   -7.804  1.00 0.00 ? 56 TRP A HZ3  1  
ATOM 829   H HH2  . TRP A 1 56 ? -8.733  5.067   -10.038 1.00 0.00 ? 56 TRP A HH2  1  
ATOM 830   N N    . HIS A 1 57 ? -1.709  3.425   -4.194  1.00 0.00 ? 57 HIS A N    1  
ATOM 831   C CA   . HIS A 1 57 ? -0.406  2.710   -4.316  1.00 0.00 ? 57 HIS A CA   1  
ATOM 832   C C    . HIS A 1 57 ? 0.022   2.670   -5.785  1.00 0.00 ? 57 HIS A C    1  
ATOM 833   O O    . HIS A 1 57 ? -0.595  3.269   -6.639  1.00 0.00 ? 57 HIS A O    1  
ATOM 834   C CB   . HIS A 1 57 ? -0.545  1.276   -3.778  1.00 0.00 ? 57 HIS A CB   1  
ATOM 835   C CG   . HIS A 1 57 ? 0.802   0.761   -3.342  1.00 0.00 ? 57 HIS A CG   1  
ATOM 836   N ND1  . HIS A 1 57 ? 1.353   1.086   -2.114  1.00 0.00 ? 57 HIS A ND1  1  
ATOM 837   C CD2  . HIS A 1 57 ? 1.716   -0.056  -3.960  1.00 0.00 ? 57 HIS A CD2  1  
ATOM 838   C CE1  . HIS A 1 57 ? 2.548   0.474   -2.031  1.00 0.00 ? 57 HIS A CE1  1  
ATOM 839   N NE2  . HIS A 1 57 ? 2.818   -0.236  -3.131  1.00 0.00 ? 57 HIS A NE2  1  
ATOM 840   H H    . HIS A 1 57 ? -1.736  4.311   -3.780  1.00 0.00 ? 57 HIS A H    1  
ATOM 841   H HA   . HIS A 1 57 ? 0.339   3.236   -3.741  1.00 0.00 ? 57 HIS A HA   1  
ATOM 842   H HB2  . HIS A 1 57 ? -1.220  1.273   -2.935  1.00 0.00 ? 57 HIS A HB2  1  
ATOM 843   H HB3  . HIS A 1 57 ? -0.936  0.636   -4.552  1.00 0.00 ? 57 HIS A HB3  1  
ATOM 844   H HD1  . HIS A 1 57 ? 0.947   1.658   -1.429  1.00 0.00 ? 57 HIS A HD1  1  
ATOM 845   H HD2  . HIS A 1 57 ? 1.597   -0.493  -4.940  1.00 0.00 ? 57 HIS A HD2  1  
ATOM 846   H HE1  . HIS A 1 57 ? 3.207   0.545   -1.180  1.00 0.00 ? 57 HIS A HE1  1  
ATOM 847   N N    . HIS A 1 58 ? 1.068   1.950   -6.078  1.00 0.00 ? 58 HIS A N    1  
ATOM 848   C CA   . HIS A 1 58 ? 1.541   1.842   -7.489  1.00 0.00 ? 58 HIS A CA   1  
ATOM 849   C C    . HIS A 1 58 ? 2.694   0.836   -7.555  1.00 0.00 ? 58 HIS A C    1  
ATOM 850   O O    . HIS A 1 58 ? 2.516   -0.341  -7.316  1.00 0.00 ? 58 HIS A O    1  
ATOM 851   C CB   . HIS A 1 58 ? 2.020   3.207   -7.989  1.00 0.00 ? 58 HIS A CB   1  
ATOM 852   C CG   . HIS A 1 58 ? 2.565   3.064   -9.384  1.00 0.00 ? 58 HIS A CG   1  
ATOM 853   N ND1  . HIS A 1 58 ? 1.771   2.670   -10.449 1.00 0.00 ? 58 HIS A ND1  1  
ATOM 854   C CD2  . HIS A 1 58 ? 3.821   3.255   -9.903  1.00 0.00 ? 58 HIS A CD2  1  
ATOM 855   C CE1  . HIS A 1 58 ? 2.550   2.637   -11.546 1.00 0.00 ? 58 HIS A CE1  1  
ATOM 856   N NE2  . HIS A 1 58 ? 3.810   2.985   -11.269 1.00 0.00 ? 58 HIS A NE2  1  
ATOM 857   H H    . HIS A 1 58 ? 1.535   1.465   -5.368  1.00 0.00 ? 58 HIS A H    1  
ATOM 858   H HA   . HIS A 1 58 ? 0.729   1.495   -8.112  1.00 0.00 ? 58 HIS A HA   1  
ATOM 859   H HB2  . HIS A 1 58 ? 1.193   3.897   -7.999  1.00 0.00 ? 58 HIS A HB2  1  
ATOM 860   H HB3  . HIS A 1 58 ? 2.796   3.579   -7.337  1.00 0.00 ? 58 HIS A HB3  1  
ATOM 861   H HD1  . HIS A 1 58 ? 0.815   2.456   -10.412 1.00 0.00 ? 58 HIS A HD1  1  
ATOM 862   H HD2  . HIS A 1 58 ? 4.687   3.568   -9.337  1.00 0.00 ? 58 HIS A HD2  1  
ATOM 863   H HE1  . HIS A 1 58 ? 2.200   2.363   -12.529 1.00 0.00 ? 58 HIS A HE1  1  
ATOM 864   N N    . THR A 1 59 ? 3.875   1.290   -7.875  1.00 0.00 ? 59 THR A N    1  
ATOM 865   C CA   . THR A 1 59 ? 5.037   0.361   -7.954  1.00 0.00 ? 59 THR A CA   1  
ATOM 866   C C    . THR A 1 59 ? 6.332   1.174   -8.011  1.00 0.00 ? 59 THR A C    1  
ATOM 867   O O    . THR A 1 59 ? 6.783   1.564   -9.069  1.00 0.00 ? 59 THR A O    1  
ATOM 868   C CB   . THR A 1 59 ? 4.918   -0.500  -9.215  1.00 0.00 ? 59 THR A CB   1  
ATOM 869   O OG1  . THR A 1 59 ? 3.608   -1.048  -9.290  1.00 0.00 ? 59 THR A OG1  1  
ATOM 870   C CG2  . THR A 1 59 ? 5.944   -1.633  -9.159  1.00 0.00 ? 59 THR A CG2  1  
ATOM 871   H H    . THR A 1 59 ? 3.998   2.245   -8.062  1.00 0.00 ? 59 THR A H    1  
ATOM 872   H HA   . THR A 1 59 ? 5.048   -0.275  -7.082  1.00 0.00 ? 59 THR A HA   1  
ATOM 873   H HB   . THR A 1 59 ? 5.106   0.106   -10.085 1.00 0.00 ? 59 THR A HB   1  
ATOM 874   H HG1  . THR A 1 59 ? 3.345   -1.311  -8.406  1.00 0.00 ? 59 THR A HG1  1  
ATOM 875   H HG21 . THR A 1 59 ? 6.939   -1.221  -9.228  1.00 0.00 ? 59 THR A HG21 1  
ATOM 876   H HG22 . THR A 1 59 ? 5.776   -2.312  -9.981  1.00 0.00 ? 59 THR A HG22 1  
ATOM 877   H HG23 . THR A 1 59 ? 5.840   -2.168  -8.225  1.00 0.00 ? 59 THR A HG23 1  
ATOM 878   N N    . PHE A 1 60 ? 6.937   1.423   -6.876  1.00 0.00 ? 60 PHE A N    1  
ATOM 879   C CA   . PHE A 1 60 ? 8.216   2.203   -6.845  1.00 0.00 ? 60 PHE A CA   1  
ATOM 880   C C    . PHE A 1 60 ? 9.390   1.219   -6.653  1.00 0.00 ? 60 PHE A C    1  
ATOM 881   O O    . PHE A 1 60 ? 9.197   0.164   -6.082  1.00 0.00 ? 60 PHE A O    1  
ATOM 882   C CB   . PHE A 1 60 ? 8.168   3.196   -5.672  1.00 0.00 ? 60 PHE A CB   1  
ATOM 883   C CG   . PHE A 1 60 ? 7.410   2.584   -4.517  1.00 0.00 ? 60 PHE A CG   1  
ATOM 884   C CD1  . PHE A 1 60 ? 8.047   1.669   -3.671  1.00 0.00 ? 60 PHE A CD1  1  
ATOM 885   C CD2  . PHE A 1 60 ? 6.073   2.933   -4.291  1.00 0.00 ? 60 PHE A CD2  1  
ATOM 886   C CE1  . PHE A 1 60 ? 7.347   1.104   -2.599  1.00 0.00 ? 60 PHE A CE1  1  
ATOM 887   C CE2  . PHE A 1 60 ? 5.374   2.368   -3.217  1.00 0.00 ? 60 PHE A CE2  1  
ATOM 888   C CZ   . PHE A 1 60 ? 6.012   1.453   -2.372  1.00 0.00 ? 60 PHE A CZ   1  
ATOM 889   H H    . PHE A 1 60 ? 6.556   1.080   -6.041  1.00 0.00 ? 60 PHE A H    1  
ATOM 890   H HA   . PHE A 1 60 ? 8.326   2.745   -7.771  1.00 0.00 ? 60 PHE A HA   1  
ATOM 891   H HB2  . PHE A 1 60 ? 9.172   3.435   -5.353  1.00 0.00 ? 60 PHE A HB2  1  
ATOM 892   H HB3  . PHE A 1 60 ? 7.668   4.101   -5.987  1.00 0.00 ? 60 PHE A HB3  1  
ATOM 893   H HD1  . PHE A 1 60 ? 9.077   1.398   -3.847  1.00 0.00 ? 60 PHE A HD1  1  
ATOM 894   H HD2  . PHE A 1 60 ? 5.582   3.639   -4.944  1.00 0.00 ? 60 PHE A HD2  1  
ATOM 895   H HE1  . PHE A 1 60 ? 7.840   0.399   -1.945  1.00 0.00 ? 60 PHE A HE1  1  
ATOM 896   H HE2  . PHE A 1 60 ? 4.343   2.638   -3.043  1.00 0.00 ? 60 PHE A HE2  1  
ATOM 897   H HZ   . PHE A 1 60 ? 5.473   1.018   -1.543  1.00 0.00 ? 60 PHE A HZ   1  
ATOM 898   N N    . PRO A 1 61 ? 10.576  1.577   -7.112  1.00 0.00 ? 61 PRO A N    1  
ATOM 899   C CA   . PRO A 1 61 ? 11.751  0.697   -6.953  1.00 0.00 ? 61 PRO A CA   1  
ATOM 900   C C    . PRO A 1 61 ? 11.968  0.389   -5.463  1.00 0.00 ? 61 PRO A C    1  
ATOM 901   O O    . PRO A 1 61 ? 12.149  -0.748  -5.074  1.00 0.00 ? 61 PRO A O    1  
ATOM 902   C CB   . PRO A 1 61 ? 12.936  1.497   -7.546  1.00 0.00 ? 61 PRO A CB   1  
ATOM 903   C CG   . PRO A 1 61 ? 12.384  2.880   -7.997  1.00 0.00 ? 61 PRO A CG   1  
ATOM 904   C CD   . PRO A 1 61 ? 10.852  2.852   -7.811  1.00 0.00 ? 61 PRO A CD   1  
ATOM 905   H HA   . PRO A 1 61 ? 11.606  -0.221  -7.504  1.00 0.00 ? 61 PRO A HA   1  
ATOM 906   H HB2  . PRO A 1 61 ? 13.714  1.631   -6.800  1.00 0.00 ? 61 PRO A HB2  1  
ATOM 907   H HB3  . PRO A 1 61 ? 13.344  0.974   -8.402  1.00 0.00 ? 61 PRO A HB3  1  
ATOM 908   H HG2  . PRO A 1 61 ? 12.818  3.665   -7.387  1.00 0.00 ? 61 PRO A HG2  1  
ATOM 909   H HG3  . PRO A 1 61 ? 12.624  3.056   -9.037  1.00 0.00 ? 61 PRO A HG3  1  
ATOM 910   H HD2  . PRO A 1 61 ? 10.524  3.693   -7.216  1.00 0.00 ? 61 PRO A HD2  1  
ATOM 911   H HD3  . PRO A 1 61 ? 10.360  2.858   -8.774  1.00 0.00 ? 61 PRO A HD3  1  
ATOM 912   N N    . SER A 1 62 ? 11.955  1.401   -4.631  1.00 0.00 ? 62 SER A N    1  
ATOM 913   C CA   . SER A 1 62 ? 12.160  1.192   -3.163  1.00 0.00 ? 62 SER A CA   1  
ATOM 914   C C    . SER A 1 62 ? 11.140  2.026   -2.384  1.00 0.00 ? 62 SER A C    1  
ATOM 915   O O    . SER A 1 62 ? 10.374  1.507   -1.596  1.00 0.00 ? 62 SER A O    1  
ATOM 916   C CB   . SER A 1 62 ? 13.572  1.636   -2.782  1.00 0.00 ? 62 SER A CB   1  
ATOM 917   O OG   . SER A 1 62 ? 13.725  3.019   -3.073  1.00 0.00 ? 62 SER A OG   1  
ATOM 918   H H    . SER A 1 62 ? 11.809  2.307   -4.975  1.00 0.00 ? 62 SER A H    1  
ATOM 919   H HA   . SER A 1 62 ? 12.031  0.147   -2.915  1.00 0.00 ? 62 SER A HA   1  
ATOM 920   H HB2  . SER A 1 62 ? 13.730  1.475   -1.729  1.00 0.00 ? 62 SER A HB2  1  
ATOM 921   H HB3  . SER A 1 62 ? 14.294  1.056   -3.343  1.00 0.00 ? 62 SER A HB3  1  
ATOM 922   H HG   . SER A 1 62 ? 14.556  3.135   -3.540  1.00 0.00 ? 62 SER A HG   1  
ATOM 923   N N    . ARG A 1 63 ? 11.120  3.315   -2.598  1.00 0.00 ? 63 ARG A N    1  
ATOM 924   C CA   . ARG A 1 63 ? 10.148  4.183   -1.870  1.00 0.00 ? 63 ARG A CA   1  
ATOM 925   C C    . ARG A 1 63 ? 10.303  5.627   -2.354  1.00 0.00 ? 63 ARG A C    1  
ATOM 926   O O    . ARG A 1 63 ? 11.374  6.045   -2.747  1.00 0.00 ? 63 ARG A O    1  
ATOM 927   C CB   . ARG A 1 63 ? 10.428  4.117   -0.365  1.00 0.00 ? 63 ARG A CB   1  
ATOM 928   C CG   . ARG A 1 63 ? 11.940  4.227   -0.117  1.00 0.00 ? 63 ARG A CG   1  
ATOM 929   C CD   . ARG A 1 63 ? 12.239  4.278   1.399   1.00 0.00 ? 63 ARG A CD   1  
ATOM 930   N NE   . ARG A 1 63 ? 13.268  5.331   1.679   1.00 0.00 ? 63 ARG A NE   1  
ATOM 931   C CZ   . ARG A 1 63 ? 14.363  5.421   0.968   1.00 0.00 ? 63 ARG A CZ   1  
ATOM 932   N NH1  . ARG A 1 63 ? 14.642  4.520   0.067   1.00 0.00 ? 63 ARG A NH1  1  
ATOM 933   N NH2  . ARG A 1 63 ? 15.200  6.397   1.188   1.00 0.00 ? 63 ARG A NH2  1  
ATOM 934   H H    . ARG A 1 63 ? 11.743  3.717   -3.240  1.00 0.00 ? 63 ARG A H    1  
ATOM 935   H HA   . ARG A 1 63 ? 9.142   3.841   -2.066  1.00 0.00 ? 63 ARG A HA   1  
ATOM 936   H HB2  . ARG A 1 63 ? 9.921   4.933   0.130   1.00 0.00 ? 63 ARG A HB2  1  
ATOM 937   H HB3  . ARG A 1 63 ? 10.067  3.180   0.029   1.00 0.00 ? 63 ARG A HB3  1  
ATOM 938   H HG2  . ARG A 1 63 ? 12.428  3.368   -0.557  1.00 0.00 ? 63 ARG A HG2  1  
ATOM 939   H HG3  . ARG A 1 63 ? 12.311  5.125   -0.587  1.00 0.00 ? 63 ARG A HG3  1  
ATOM 940   H HD2  . ARG A 1 63 ? 11.347  4.536   1.944   1.00 0.00 ? 63 ARG A HD2  1  
ATOM 941   H HD3  . ARG A 1 63 ? 12.588  3.305   1.734   1.00 0.00 ? 63 ARG A HD3  1  
ATOM 942   H HE   . ARG A 1 63 ? 13.103  5.986   2.390   1.00 0.00 ? 63 ARG A HE   1  
ATOM 943   H HH11 . ARG A 1 63 ? 14.022  3.755   -0.084  1.00 0.00 ? 63 ARG A HH11 1  
ATOM 944   H HH12 . ARG A 1 63 ? 15.478  4.598   -0.475  1.00 0.00 ? 63 ARG A HH12 1  
ATOM 945   H HH21 . ARG A 1 63 ? 15.004  7.074   1.896   1.00 0.00 ? 63 ARG A HH21 1  
ATOM 946   H HH22 . ARG A 1 63 ? 16.039  6.468   0.647   1.00 0.00 ? 63 ARG A HH22 1  
ATOM 947   N N    . GLY A 1 64 ? 9.247   6.398   -2.327  1.00 0.00 ? 64 GLY A N    1  
ATOM 948   C CA   . GLY A 1 64 ? 9.356   7.812   -2.787  1.00 0.00 ? 64 GLY A CA   1  
ATOM 949   C C    . GLY A 1 64 ? 7.961   8.411   -2.989  1.00 0.00 ? 64 GLY A C    1  
ATOM 950   O O    . GLY A 1 64 ? 7.699   9.535   -2.609  1.00 0.00 ? 64 GLY A O    1  
ATOM 951   H H    . GLY A 1 64 ? 8.389   6.050   -2.006  1.00 0.00 ? 64 GLY A H    1  
ATOM 952   H HA2  . GLY A 1 64 ? 9.891   8.389   -2.046  1.00 0.00 ? 64 GLY A HA2  1  
ATOM 953   H HA3  . GLY A 1 64 ? 9.894   7.844   -3.723  1.00 0.00 ? 64 GLY A HA3  1  
ATOM 954   N N    . ASN A 1 65 ? 7.065   7.677   -3.592  1.00 0.00 ? 65 ASN A N    1  
ATOM 955   C CA   . ASN A 1 65 ? 5.694   8.216   -3.824  1.00 0.00 ? 65 ASN A CA   1  
ATOM 956   C C    . ASN A 1 65 ? 4.796   7.104   -4.378  1.00 0.00 ? 65 ASN A C    1  
ATOM 957   O O    . ASN A 1 65 ? 5.271   6.061   -4.780  1.00 0.00 ? 65 ASN A O    1  
ATOM 958   C CB   . ASN A 1 65 ? 5.777   9.368   -4.833  1.00 0.00 ? 65 ASN A CB   1  
ATOM 959   C CG   . ASN A 1 65 ? 6.540   8.902   -6.075  1.00 0.00 ? 65 ASN A CG   1  
ATOM 960   O OD1  . ASN A 1 65 ? 6.911   9.704   -6.909  1.00 0.00 ? 65 ASN A OD1  1  
ATOM 961   N ND2  . ASN A 1 65 ? 6.793   7.631   -6.234  1.00 0.00 ? 65 ASN A ND2  1  
ATOM 962   H H    . ASN A 1 65 ? 7.296   6.774   -3.899  1.00 0.00 ? 65 ASN A H    1  
ATOM 963   H HA   . ASN A 1 65 ? 5.285   8.581   -2.892  1.00 0.00 ? 65 ASN A HA   1  
ATOM 964   H HB2  . ASN A 1 65 ? 4.783   9.677   -5.116  1.00 0.00 ? 65 ASN A HB2  1  
ATOM 965   H HB3  . ASN A 1 65 ? 6.299   10.199  -4.386  1.00 0.00 ? 65 ASN A HB3  1  
ATOM 966   H HD21 . ASN A 1 65 ? 6.494   6.984   -5.561  1.00 0.00 ? 65 ASN A HD21 1  
ATOM 967   H HD22 . ASN A 1 65 ? 7.279   7.324   -7.028  1.00 0.00 ? 65 ASN A HD22 1  
ATOM 968   N N    . LEU A 1 66 ? 3.500   7.318   -4.416  1.00 0.00 ? 66 LEU A N    1  
ATOM 969   C CA   . LEU A 1 66 ? 2.581   6.270   -4.961  1.00 0.00 ? 66 LEU A CA   1  
ATOM 970   C C    . LEU A 1 66 ? 2.223   6.607   -6.406  1.00 0.00 ? 66 LEU A C    1  
ATOM 971   O O    . LEU A 1 66 ? 1.352   5.993   -6.987  1.00 0.00 ? 66 LEU A O    1  
ATOM 972   C CB   . LEU A 1 66 ? 1.279   6.224   -4.150  1.00 0.00 ? 66 LEU A CB   1  
ATOM 973   C CG   . LEU A 1 66 ? 1.574   6.136   -2.651  1.00 0.00 ? 66 LEU A CG   1  
ATOM 974   C CD1  . LEU A 1 66 ? 0.277   5.846   -1.890  1.00 0.00 ? 66 LEU A CD1  1  
ATOM 975   C CD2  . LEU A 1 66 ? 2.592   5.022   -2.379  1.00 0.00 ? 66 LEU A CD2  1  
ATOM 976   H H    . LEU A 1 66 ? 3.137   8.172   -4.103  1.00 0.00 ? 66 LEU A H    1  
ATOM 977   H HA   . LEU A 1 66 ? 3.059   5.300   -4.926  1.00 0.00 ? 66 LEU A HA   1  
ATOM 978   H HB2  . LEU A 1 66 ? 0.706   7.119   -4.348  1.00 0.00 ? 66 LEU A HB2  1  
ATOM 979   H HB3  . LEU A 1 66 ? 0.707   5.362   -4.455  1.00 0.00 ? 66 LEU A HB3  1  
ATOM 980   H HG   . LEU A 1 66 ? 1.971   7.078   -2.316  1.00 0.00 ? 66 LEU A HG   1  
ATOM 981   H HD11 . LEU A 1 66 ? -0.369  6.710   -1.941  1.00 0.00 ? 66 LEU A HD11 1  
ATOM 982   H HD12 . LEU A 1 66 ? 0.507   5.630   -0.857  1.00 0.00 ? 66 LEU A HD12 1  
ATOM 983   H HD13 . LEU A 1 66 ? -0.221  4.998   -2.333  1.00 0.00 ? 66 LEU A HD13 1  
ATOM 984   H HD21 . LEU A 1 66 ? 3.581   5.367   -2.643  1.00 0.00 ? 66 LEU A HD21 1  
ATOM 985   H HD22 . LEU A 1 66 ? 2.344   4.154   -2.972  1.00 0.00 ? 66 LEU A HD22 1  
ATOM 986   H HD23 . LEU A 1 66 ? 2.572   4.760   -1.331  1.00 0.00 ? 66 LEU A HD23 1  
ATOM 987   N N    . ASP A 1 67 ? 2.853   7.588   -6.994  1.00 0.00 ? 67 ASP A N    1  
ATOM 988   C CA   . ASP A 1 67 ? 2.493   7.944   -8.393  1.00 0.00 ? 67 ASP A CA   1  
ATOM 989   C C    . ASP A 1 67 ? 0.989   8.207   -8.448  1.00 0.00 ? 67 ASP A C    1  
ATOM 990   O O    . ASP A 1 67 ? 0.393   8.286   -9.503  1.00 0.00 ? 67 ASP A O    1  
ATOM 991   C CB   . ASP A 1 67 ? 2.850   6.788   -9.330  1.00 0.00 ? 67 ASP A CB   1  
ATOM 992   C CG   . ASP A 1 67 ? 2.822   7.277   -10.779 1.00 0.00 ? 67 ASP A CG   1  
ATOM 993   O OD1  . ASP A 1 67 ? 3.770   7.928   -11.183 1.00 0.00 ? 67 ASP A OD1  1  
ATOM 994   O OD2  . ASP A 1 67 ? 1.851   6.991   -11.461 1.00 0.00 ? 67 ASP A OD2  1  
ATOM 995   H H    . ASP A 1 67 ? 3.539   8.104   -6.522  1.00 0.00 ? 67 ASP A H    1  
ATOM 996   H HA   . ASP A 1 67 ? 3.028   8.834   -8.691  1.00 0.00 ? 67 ASP A HA   1  
ATOM 997   H HB2  . ASP A 1 67 ? 3.840   6.425   -9.092  1.00 0.00 ? 67 ASP A HB2  1  
ATOM 998   H HB3  . ASP A 1 67 ? 2.134   5.989   -9.208  1.00 0.00 ? 67 ASP A HB3  1  
ATOM 999   N N    . ASP A 1 68 ? 0.371   8.338   -7.300  1.00 0.00 ? 68 ASP A N    1  
ATOM 1000  C CA   . ASP A 1 68 ? -1.099  8.592   -7.247  1.00 0.00 ? 68 ASP A CA   1  
ATOM 1001  C C    . ASP A 1 68 ? -1.405  9.549   -6.094  1.00 0.00 ? 68 ASP A C    1  
ATOM 1002  O O    . ASP A 1 68 ? -1.273  10.747  -6.231  1.00 0.00 ? 68 ASP A O    1  
ATOM 1003  C CB   . ASP A 1 68 ? -1.830  7.270   -7.017  1.00 0.00 ? 68 ASP A CB   1  
ATOM 1004  C CG   . ASP A 1 68 ? -3.326  7.537   -6.828  1.00 0.00 ? 68 ASP A CG   1  
ATOM 1005  O OD1  . ASP A 1 68 ? -3.729  7.757   -5.697  1.00 0.00 ? 68 ASP A OD1  1  
ATOM 1006  O OD2  . ASP A 1 68 ? -4.041  7.515   -7.816  1.00 0.00 ? 68 ASP A OD2  1  
ATOM 1007  H H    . ASP A 1 68 ? 0.880   8.266   -6.466  1.00 0.00 ? 68 ASP A H    1  
ATOM 1008  H HA   . ASP A 1 68 ? -1.432  9.031   -8.176  1.00 0.00 ? 68 ASP A HA   1  
ATOM 1009  H HB2  . ASP A 1 68 ? -1.683  6.625   -7.872  1.00 0.00 ? 68 ASP A HB2  1  
ATOM 1010  H HB3  . ASP A 1 68 ? -1.435  6.793   -6.134  1.00 0.00 ? 68 ASP A HB3  1  
ATOM 1011  N N    . PHE A 1 69 ? -1.802  9.027   -4.957  1.00 0.00 ? 69 PHE A N    1  
ATOM 1012  C CA   . PHE A 1 69 ? -2.112  9.896   -3.789  1.00 0.00 ? 69 PHE A CA   1  
ATOM 1013  C C    . PHE A 1 69 ? -2.732  9.015   -2.705  1.00 0.00 ? 69 PHE A C    1  
ATOM 1014  O O    . PHE A 1 69 ? -3.823  8.506   -2.856  1.00 0.00 ? 69 PHE A O    1  
ATOM 1015  C CB   . PHE A 1 69 ? -3.094  11.017  -4.198  1.00 0.00 ? 69 PHE A CB   1  
ATOM 1016  C CG   . PHE A 1 69 ? -3.815  11.574  -2.984  1.00 0.00 ? 69 PHE A CG   1  
ATOM 1017  C CD1  . PHE A 1 69 ? -3.088  11.933  -1.841  1.00 0.00 ? 69 PHE A CD1  1  
ATOM 1018  C CD2  . PHE A 1 69 ? -5.207  11.732  -3.005  1.00 0.00 ? 69 PHE A CD2  1  
ATOM 1019  C CE1  . PHE A 1 69 ? -3.754  12.447  -0.720  1.00 0.00 ? 69 PHE A CE1  1  
ATOM 1020  C CE2  . PHE A 1 69 ? -5.871  12.246  -1.884  1.00 0.00 ? 69 PHE A CE2  1  
ATOM 1021  C CZ   . PHE A 1 69 ? -5.144  12.604  -0.742  1.00 0.00 ? 69 PHE A CZ   1  
ATOM 1022  H H    . PHE A 1 69 ? -1.889  8.053   -4.862  1.00 0.00 ? 69 PHE A H    1  
ATOM 1023  H HA   . PHE A 1 69 ? -1.197  10.326  -3.422  1.00 0.00 ? 69 PHE A HA   1  
ATOM 1024  H HB2  . PHE A 1 69 ? -2.547  11.818  -4.672  1.00 0.00 ? 69 PHE A HB2  1  
ATOM 1025  H HB3  . PHE A 1 69 ? -3.819  10.620  -4.895  1.00 0.00 ? 69 PHE A HB3  1  
ATOM 1026  H HD1  . PHE A 1 69 ? -2.016  11.814  -1.822  1.00 0.00 ? 69 PHE A HD1  1  
ATOM 1027  H HD2  . PHE A 1 69 ? -5.769  11.457  -3.885  1.00 0.00 ? 69 PHE A HD2  1  
ATOM 1028  H HE1  . PHE A 1 69 ? -3.193  12.723  0.160   1.00 0.00 ? 69 PHE A HE1  1  
ATOM 1029  H HE2  . PHE A 1 69 ? -6.944  12.367  -1.900  1.00 0.00 ? 69 PHE A HE2  1  
ATOM 1030  H HZ   . PHE A 1 69 ? -5.657  13.000  0.122   1.00 0.00 ? 69 PHE A HZ   1  
ATOM 1031  N N    . PHE A 1 70 ? -2.044  8.813   -1.624  1.00 0.00 ? 70 PHE A N    1  
ATOM 1032  C CA   . PHE A 1 70 ? -2.606  7.948   -0.558  1.00 0.00 ? 70 PHE A CA   1  
ATOM 1033  C C    . PHE A 1 70 ? -3.940  8.529   -0.071  1.00 0.00 ? 70 PHE A C    1  
ATOM 1034  O O    . PHE A 1 70 ? -4.247  9.682   -0.299  1.00 0.00 ? 70 PHE A O    1  
ATOM 1035  C CB   . PHE A 1 70 ? -1.617  7.868   0.608   1.00 0.00 ? 70 PHE A CB   1  
ATOM 1036  C CG   . PHE A 1 70 ? -2.190  7.002   1.706   1.00 0.00 ? 70 PHE A CG   1  
ATOM 1037  C CD1  . PHE A 1 70 ? -2.142  5.607   1.593   1.00 0.00 ? 70 PHE A CD1  1  
ATOM 1038  C CD2  . PHE A 1 70 ? -2.766  7.593   2.836   1.00 0.00 ? 70 PHE A CD2  1  
ATOM 1039  C CE1  . PHE A 1 70 ? -2.670  4.804   2.612   1.00 0.00 ? 70 PHE A CE1  1  
ATOM 1040  C CE2  . PHE A 1 70 ? -3.295  6.790   3.854   1.00 0.00 ? 70 PHE A CE2  1  
ATOM 1041  C CZ   . PHE A 1 70 ? -3.247  5.396   3.742   1.00 0.00 ? 70 PHE A CZ   1  
ATOM 1042  H H    . PHE A 1 70 ? -1.156  9.214   -1.517  1.00 0.00 ? 70 PHE A H    1  
ATOM 1043  H HA   . PHE A 1 70 ? -2.768  6.960   -0.965  1.00 0.00 ? 70 PHE A HA   1  
ATOM 1044  H HB2  . PHE A 1 70 ? -0.687  7.441   0.262   1.00 0.00 ? 70 PHE A HB2  1  
ATOM 1045  H HB3  . PHE A 1 70 ? -1.435  8.862   0.992   1.00 0.00 ? 70 PHE A HB3  1  
ATOM 1046  H HD1  . PHE A 1 70 ? -1.698  5.150   0.721   1.00 0.00 ? 70 PHE A HD1  1  
ATOM 1047  H HD2  . PHE A 1 70 ? -2.801  8.669   2.924   1.00 0.00 ? 70 PHE A HD2  1  
ATOM 1048  H HE1  . PHE A 1 70 ? -2.632  3.729   2.526   1.00 0.00 ? 70 PHE A HE1  1  
ATOM 1049  H HE2  . PHE A 1 70 ? -3.740  7.246   4.726   1.00 0.00 ? 70 PHE A HE2  1  
ATOM 1050  H HZ   . PHE A 1 70 ? -3.654  4.777   4.527   1.00 0.00 ? 70 PHE A HZ   1  
ATOM 1051  N N    . HIS A 1 71 ? -4.728  7.736   0.603   1.00 0.00 ? 71 HIS A N    1  
ATOM 1052  C CA   . HIS A 1 71 ? -6.041  8.230   1.115   1.00 0.00 ? 71 HIS A CA   1  
ATOM 1053  C C    . HIS A 1 71 ? -6.875  8.824   -0.026  1.00 0.00 ? 71 HIS A C    1  
ATOM 1054  O O    . HIS A 1 71 ? -7.596  9.783   0.162   1.00 0.00 ? 71 HIS A O    1  
ATOM 1055  C CB   . HIS A 1 71 ? -5.805  9.303   2.180   1.00 0.00 ? 71 HIS A CB   1  
ATOM 1056  C CG   . HIS A 1 71 ? -7.115  9.662   2.824   1.00 0.00 ? 71 HIS A CG   1  
ATOM 1057  N ND1  . HIS A 1 71 ? -8.297  9.009   2.511   1.00 0.00 ? 71 HIS A ND1  1  
ATOM 1058  C CD2  . HIS A 1 71 ? -7.446  10.604  3.768   1.00 0.00 ? 71 HIS A CD2  1  
ATOM 1059  C CE1  . HIS A 1 71 ? -9.274  9.561   3.254   1.00 0.00 ? 71 HIS A CE1  1  
ATOM 1060  N NE2  . HIS A 1 71 ? -8.810  10.537  4.038   1.00 0.00 ? 71 HIS A NE2  1  
ATOM 1061  H H    . HIS A 1 71 ? -4.455  6.812   0.778   1.00 0.00 ? 71 HIS A H    1  
ATOM 1062  H HA   . HIS A 1 71 ? -6.582  7.405   1.557   1.00 0.00 ? 71 HIS A HA   1  
ATOM 1063  H HB2  . HIS A 1 71 ? -5.127  8.924   2.929   1.00 0.00 ? 71 HIS A HB2  1  
ATOM 1064  H HB3  . HIS A 1 71 ? -5.379  10.181  1.718   1.00 0.00 ? 71 HIS A HB3  1  
ATOM 1065  H HD1  . HIS A 1 71 ? -8.401  8.280   1.866   1.00 0.00 ? 71 HIS A HD1  1  
ATOM 1066  H HD2  . HIS A 1 71 ? -6.752  11.290  4.231   1.00 0.00 ? 71 HIS A HD2  1  
ATOM 1067  H HE1  . HIS A 1 71 ? -10.307 9.250   3.220   1.00 0.00 ? 71 HIS A HE1  1  
ATOM 1068  N N    . ARG A 1 72 ? -6.797  8.264   -1.202  1.00 0.00 ? 72 ARG A N    1  
ATOM 1069  C CA   . ARG A 1 72 ? -7.602  8.809   -2.335  1.00 0.00 ? 72 ARG A CA   1  
ATOM 1070  C C    . ARG A 1 72 ? -9.081  8.828   -1.925  1.00 0.00 ? 72 ARG A C    1  
ATOM 1071  O O    . ARG A 1 72 ? -9.558  7.940   -1.244  1.00 0.00 ? 72 ARG A O    1  
ATOM 1072  C CB   . ARG A 1 72 ? -7.400  7.914   -3.585  1.00 0.00 ? 72 ARG A CB   1  
ATOM 1073  C CG   . ARG A 1 72 ? -6.488  8.608   -4.610  1.00 0.00 ? 72 ARG A CG   1  
ATOM 1074  C CD   . ARG A 1 72 ? -7.298  9.616   -5.430  1.00 0.00 ? 72 ARG A CD   1  
ATOM 1075  N NE   . ARG A 1 72 ? -8.146  8.887   -6.415  1.00 0.00 ? 72 ARG A NE   1  
ATOM 1076  C CZ   . ARG A 1 72 ? -9.124  9.506   -7.018  1.00 0.00 ? 72 ARG A CZ   1  
ATOM 1077  N NH1  . ARG A 1 72 ? -9.358  10.764  -6.760  1.00 0.00 ? 72 ARG A NH1  1  
ATOM 1078  N NH2  . ARG A 1 72 ? -9.868  8.867   -7.879  1.00 0.00 ? 72 ARG A NH2  1  
ATOM 1079  H H    . ARG A 1 72 ? -6.216  7.487   -1.341  1.00 0.00 ? 72 ARG A H    1  
ATOM 1080  H HA   . ARG A 1 72 ? -7.283  9.820   -2.544  1.00 0.00 ? 72 ARG A HA   1  
ATOM 1081  H HB2  . ARG A 1 72 ? -6.941  6.985   -3.280  1.00 0.00 ? 72 ARG A HB2  1  
ATOM 1082  H HB3  . ARG A 1 72 ? -8.355  7.699   -4.048  1.00 0.00 ? 72 ARG A HB3  1  
ATOM 1083  H HG2  . ARG A 1 72 ? -5.694  9.124   -4.094  1.00 0.00 ? 72 ARG A HG2  1  
ATOM 1084  H HG3  . ARG A 1 72 ? -6.064  7.870   -5.272  1.00 0.00 ? 72 ARG A HG3  1  
ATOM 1085  H HD2  . ARG A 1 72 ? -7.929  10.193  -4.770  1.00 0.00 ? 72 ARG A HD2  1  
ATOM 1086  H HD3  . ARG A 1 72 ? -6.624  10.279  -5.954  1.00 0.00 ? 72 ARG A HD3  1  
ATOM 1087  H HE   . ARG A 1 72 ? -7.969  7.943   -6.610  1.00 0.00 ? 72 ARG A HE   1  
ATOM 1088  H HH11 . ARG A 1 72 ? -8.788  11.253  -6.100  1.00 0.00 ? 72 ARG A HH11 1  
ATOM 1089  H HH12 . ARG A 1 72 ? -10.107 11.238  -7.223  1.00 0.00 ? 72 ARG A HH12 1  
ATOM 1090  H HH21 . ARG A 1 72 ? -9.688  7.904   -8.077  1.00 0.00 ? 72 ARG A HH21 1  
ATOM 1091  H HH22 . ARG A 1 72 ? -10.616 9.342   -8.342  1.00 0.00 ? 72 ARG A HH22 1  
ATOM 1092  N N    . ASP A 1 73 ? -9.808  9.833   -2.335  1.00 0.00 ? 73 ASP A N    1  
ATOM 1093  C CA   . ASP A 1 73 ? -11.252 9.910   -1.972  1.00 0.00 ? 73 ASP A CA   1  
ATOM 1094  C C    . ASP A 1 73 ? -11.906 11.073  -2.722  1.00 0.00 ? 73 ASP A C    1  
ATOM 1095  O O    . ASP A 1 73 ? -11.560 12.222  -2.528  1.00 0.00 ? 73 ASP A O    1  
ATOM 1096  C CB   . ASP A 1 73 ? -11.388 10.138  -0.464  1.00 0.00 ? 73 ASP A CB   1  
ATOM 1097  C CG   . ASP A 1 73 ? -12.868 10.267  -0.099  1.00 0.00 ? 73 ASP A CG   1  
ATOM 1098  O OD1  . ASP A 1 73 ? -13.519 11.144  -0.643  1.00 0.00 ? 73 ASP A OD1  1  
ATOM 1099  O OD2  . ASP A 1 73 ? -13.325 9.486   0.720   1.00 0.00 ? 73 ASP A OD2  1  
ATOM 1100  H H    . ASP A 1 73 ? -9.404  10.537  -2.884  1.00 0.00 ? 73 ASP A H    1  
ATOM 1101  H HA   . ASP A 1 73 ? -11.741 8.986   -2.242  1.00 0.00 ? 73 ASP A HA   1  
ATOM 1102  H HB2  . ASP A 1 73 ? -10.957 9.302   0.066   1.00 0.00 ? 73 ASP A HB2  1  
ATOM 1103  H HB3  . ASP A 1 73 ? -10.871 11.045  -0.190  1.00 0.00 ? 73 ASP A HB3  1  
ATOM 1104  N N    . LYS A 1 74 ? -12.849 10.786  -3.577  1.00 0.00 ? 74 LYS A N    1  
ATOM 1105  C CA   . LYS A 1 74 ? -13.525 11.878  -4.336  1.00 0.00 ? 74 LYS A CA   1  
ATOM 1106  C C    . LYS A 1 74 ? -14.749 11.313  -5.058  1.00 0.00 ? 74 LYS A C    1  
ATOM 1107  O O    . LYS A 1 74 ? -14.826 10.135  -5.342  1.00 0.00 ? 74 LYS A O    1  
ATOM 1108  C CB   . LYS A 1 74 ? -12.553 12.467  -5.361  1.00 0.00 ? 74 LYS A CB   1  
ATOM 1109  C CG   . LYS A 1 74 ? -13.242 13.601  -6.125  1.00 0.00 ? 74 LYS A CG   1  
ATOM 1110  C CD   . LYS A 1 74 ? -12.192 14.434  -6.865  1.00 0.00 ? 74 LYS A CD   1  
ATOM 1111  C CE   . LYS A 1 74 ? -11.378 13.528  -7.794  1.00 0.00 ? 74 LYS A CE   1  
ATOM 1112  N NZ   . LYS A 1 74 ? -12.294 12.583  -8.492  1.00 0.00 ? 74 LYS A NZ   1  
ATOM 1113  H H    . LYS A 1 74 ? -13.115 9.853   -3.718  1.00 0.00 ? 74 LYS A H    1  
ATOM 1114  H HA   . LYS A 1 74 ? -13.836 12.652  -3.650  1.00 0.00 ? 74 LYS A HA   1  
ATOM 1115  H HB2  . LYS A 1 74 ? -11.681 12.851  -4.852  1.00 0.00 ? 74 LYS A HB2  1  
ATOM 1116  H HB3  . LYS A 1 74 ? -12.255 11.697  -6.058  1.00 0.00 ? 74 LYS A HB3  1  
ATOM 1117  H HG2  . LYS A 1 74 ? -13.939 13.185  -6.836  1.00 0.00 ? 74 LYS A HG2  1  
ATOM 1118  H HG3  . LYS A 1 74 ? -13.773 14.234  -5.429  1.00 0.00 ? 74 LYS A HG3  1  
ATOM 1119  H HD2  . LYS A 1 74 ? -12.685 15.198  -7.449  1.00 0.00 ? 74 LYS A HD2  1  
ATOM 1120  H HD3  . LYS A 1 74 ? -11.530 14.898  -6.150  1.00 0.00 ? 74 LYS A HD3  1  
ATOM 1121  H HE2  . LYS A 1 74 ? -10.860 14.133  -8.523  1.00 0.00 ? 74 LYS A HE2  1  
ATOM 1122  H HE3  . LYS A 1 74 ? -10.659 12.970  -7.212  1.00 0.00 ? 74 LYS A HE3  1  
ATOM 1123  H HZ1  . LYS A 1 74 ? -12.592 11.836  -7.833  1.00 0.00 ? 74 LYS A HZ1  1  
ATOM 1124  H HZ2  . LYS A 1 74 ? -11.798 12.153  -9.299  1.00 0.00 ? 74 LYS A HZ2  1  
ATOM 1125  H HZ3  . LYS A 1 74 ? -13.130 13.099  -8.834  1.00 0.00 ? 74 LYS A HZ3  1  
ATOM 1126  N N    . ASP A 1 75 ? -15.710 12.146  -5.357  1.00 0.00 ? 75 ASP A N    1  
ATOM 1127  C CA   . ASP A 1 75 ? -16.928 11.654  -6.060  1.00 0.00 ? 75 ASP A CA   1  
ATOM 1128  C C    . ASP A 1 75 ? -16.601 11.405  -7.533  1.00 0.00 ? 75 ASP A C    1  
ATOM 1129  O O    . ASP A 1 75 ? -15.943 12.199  -8.176  1.00 0.00 ? 75 ASP A O    1  
ATOM 1130  C CB   . ASP A 1 75 ? -18.038 12.702  -5.954  1.00 0.00 ? 75 ASP A CB   1  
ATOM 1131  C CG   . ASP A 1 75 ? -18.369 12.949  -4.481  1.00 0.00 ? 75 ASP A CG   1  
ATOM 1132  O OD1  . ASP A 1 75 ? -17.722 13.792  -3.882  1.00 0.00 ? 75 ASP A OD1  1  
ATOM 1133  O OD2  . ASP A 1 75 ? -19.263 12.290  -3.977  1.00 0.00 ? 75 ASP A OD2  1  
ATOM 1134  H H    . ASP A 1 75 ? -15.630 13.093  -5.119  1.00 0.00 ? 75 ASP A H    1  
ATOM 1135  H HA   . ASP A 1 75 ? -17.260 10.732  -5.604  1.00 0.00 ? 75 ASP A HA   1  
ATOM 1136  H HB2  . ASP A 1 75 ? -17.705 13.624  -6.410  1.00 0.00 ? 75 ASP A HB2  1  
ATOM 1137  H HB3  . ASP A 1 75 ? -18.920 12.346  -6.465  1.00 0.00 ? 75 ASP A HB3  1  
ATOM 1138  N N    . ASP A 1 76 ? -17.055 10.307  -8.075  1.00 0.00 ? 76 ASP A N    1  
ATOM 1139  C CA   . ASP A 1 76 ? -16.769 10.009  -9.506  1.00 0.00 ? 76 ASP A CA   1  
ATOM 1140  C C    . ASP A 1 76 ? -17.742 10.788  -10.393 1.00 0.00 ? 76 ASP A C    1  
ATOM 1141  O O    . ASP A 1 76 ? -18.296 10.261  -11.337 1.00 0.00 ? 76 ASP A O    1  
ATOM 1142  C CB   . ASP A 1 76 ? -16.937 8.508   -9.757  1.00 0.00 ? 76 ASP A CB   1  
ATOM 1143  C CG   . ASP A 1 76 ? -15.988 7.731   -8.842  1.00 0.00 ? 76 ASP A CG   1  
ATOM 1144  O OD1  . ASP A 1 76 ? -16.357 7.496   -7.703  1.00 0.00 ? 76 ASP A OD1  1  
ATOM 1145  O OD2  . ASP A 1 76 ? -14.911 7.385   -9.296  1.00 0.00 ? 76 ASP A OD2  1  
ATOM 1146  H H    . ASP A 1 76 ? -17.584 9.679   -7.539  1.00 0.00 ? 76 ASP A H    1  
ATOM 1147  H HA   . ASP A 1 76 ? -15.756 10.301  -9.739  1.00 0.00 ? 76 ASP A HA   1  
ATOM 1148  H HB2  . ASP A 1 76 ? -17.957 8.219   -9.549  1.00 0.00 ? 76 ASP A HB2  1  
ATOM 1149  H HB3  . ASP A 1 76 ? -16.702 8.287   -10.786 1.00 0.00 ? 76 ASP A HB3  1  
ATOM 1150  N N    . PHE A 1 77 ? -17.953 12.042  -10.098 1.00 0.00 ? 77 PHE A N    1  
ATOM 1151  C CA   . PHE A 1 77 ? -18.886 12.856  -10.926 1.00 0.00 ? 77 PHE A CA   1  
ATOM 1152  C C    . PHE A 1 77 ? -20.218 12.118  -11.071 1.00 0.00 ? 77 PHE A C    1  
ATOM 1153  O O    . PHE A 1 77 ? -20.774 11.624  -10.109 1.00 0.00 ? 77 PHE A O    1  
ATOM 1154  C CB   . PHE A 1 77 ? -18.272 13.081  -12.309 1.00 0.00 ? 77 PHE A CB   1  
ATOM 1155  C CG   . PHE A 1 77 ? -16.946 13.786  -12.157 1.00 0.00 ? 77 PHE A CG   1  
ATOM 1156  C CD1  . PHE A 1 77 ? -15.771 13.042  -12.005 1.00 0.00 ? 77 PHE A CD1  1  
ATOM 1157  C CD2  . PHE A 1 77 ? -16.894 15.185  -12.162 1.00 0.00 ? 77 PHE A CD2  1  
ATOM 1158  C CE1  . PHE A 1 77 ? -14.542 13.696  -11.860 1.00 0.00 ? 77 PHE A CE1  1  
ATOM 1159  C CE2  . PHE A 1 77 ? -15.665 15.840  -12.017 1.00 0.00 ? 77 PHE A CE2  1  
ATOM 1160  C CZ   . PHE A 1 77 ? -14.489 15.096  -11.866 1.00 0.00 ? 77 PHE A CZ   1  
ATOM 1161  H H    . PHE A 1 77 ? -17.495 12.448  -9.333  1.00 0.00 ? 77 PHE A H    1  
ATOM 1162  H HA   . PHE A 1 77 ? -19.054 13.809  -10.447 1.00 0.00 ? 77 PHE A HA   1  
ATOM 1163  H HB2  . PHE A 1 77 ? -18.122 12.129  -12.795 1.00 0.00 ? 77 PHE A HB2  1  
ATOM 1164  H HB3  . PHE A 1 77 ? -18.937 13.689  -12.904 1.00 0.00 ? 77 PHE A HB3  1  
ATOM 1165  H HD1  . PHE A 1 77 ? -15.812 11.962  -12.000 1.00 0.00 ? 77 PHE A HD1  1  
ATOM 1166  H HD2  . PHE A 1 77 ? -17.801 15.759  -12.279 1.00 0.00 ? 77 PHE A HD2  1  
ATOM 1167  H HE1  . PHE A 1 77 ? -13.634 13.122  -11.744 1.00 0.00 ? 77 PHE A HE1  1  
ATOM 1168  H HE2  . PHE A 1 77 ? -15.625 16.918  -12.022 1.00 0.00 ? 77 PHE A HE2  1  
ATOM 1169  H HZ   . PHE A 1 77 ? -13.541 15.601  -11.754 1.00 0.00 ? 77 PHE A HZ   1  
ATOM 1170  N N    . PHE A 1 78 ? -20.736 12.039  -12.266 1.00 0.00 ? 78 PHE A N    1  
ATOM 1171  C CA   . PHE A 1 78 ? -22.031 11.334  -12.473 1.00 0.00 ? 78 PHE A CA   1  
ATOM 1172  C C    . PHE A 1 78 ? -22.215 11.039  -13.962 1.00 0.00 ? 78 PHE A C    1  
ATOM 1173  O O    . PHE A 1 78 ? -22.557 11.910  -14.739 1.00 0.00 ? 78 PHE A O    1  
ATOM 1174  C CB   . PHE A 1 78 ? -23.179 12.215  -11.980 1.00 0.00 ? 78 PHE A CB   1  
ATOM 1175  C CG   . PHE A 1 78 ? -24.491 11.506  -12.215 1.00 0.00 ? 78 PHE A CG   1  
ATOM 1176  C CD1  . PHE A 1 78 ? -24.969 10.587  -11.274 1.00 0.00 ? 78 PHE A CD1  1  
ATOM 1177  C CD2  . PHE A 1 78 ? -25.229 11.765  -13.377 1.00 0.00 ? 78 PHE A CD2  1  
ATOM 1178  C CE1  . PHE A 1 78 ? -26.184 9.927   -11.493 1.00 0.00 ? 78 PHE A CE1  1  
ATOM 1179  C CE2  . PHE A 1 78 ? -26.444 11.106  -13.596 1.00 0.00 ? 78 PHE A CE2  1  
ATOM 1180  C CZ   . PHE A 1 78 ? -26.921 10.188  -12.654 1.00 0.00 ? 78 PHE A CZ   1  
ATOM 1181  H H    . PHE A 1 78 ? -20.271 12.444  -13.028 1.00 0.00 ? 78 PHE A H    1  
ATOM 1182  H HA   . PHE A 1 78 ? -22.027 10.405  -11.921 1.00 0.00 ? 78 PHE A HA   1  
ATOM 1183  H HB2  . PHE A 1 78 ? -23.058 12.409  -10.924 1.00 0.00 ? 78 PHE A HB2  1  
ATOM 1184  H HB3  . PHE A 1 78 ? -23.174 13.150  -12.521 1.00 0.00 ? 78 PHE A HB3  1  
ATOM 1185  H HD1  . PHE A 1 78 ? -24.399 10.386  -10.378 1.00 0.00 ? 78 PHE A HD1  1  
ATOM 1186  H HD2  . PHE A 1 78 ? -24.860 12.475  -14.103 1.00 0.00 ? 78 PHE A HD2  1  
ATOM 1187  H HE1  . PHE A 1 78 ? -26.552 9.218   -10.766 1.00 0.00 ? 78 PHE A HE1  1  
ATOM 1188  H HE2  . PHE A 1 78 ? -27.013 11.306  -14.492 1.00 0.00 ? 78 PHE A HE2  1  
ATOM 1189  H HZ   . PHE A 1 78 ? -27.859 9.679   -12.823 1.00 0.00 ? 78 PHE A HZ   1  
ATOM 1190  N N    . THR A 1 79 ? -21.990 9.820   -14.366 1.00 0.00 ? 79 THR A N    1  
ATOM 1191  C CA   . THR A 1 79 ? -22.151 9.470   -15.805 1.00 0.00 ? 79 THR A CA   1  
ATOM 1192  C C    . THR A 1 79 ? -23.625 9.581   -16.197 1.00 0.00 ? 79 THR A C    1  
ATOM 1193  O O    . THR A 1 79 ? -24.387 8.707   -15.818 1.00 0.00 ? 79 THR A O    1  
ATOM 1194  C CB   . THR A 1 79 ? -21.667 8.036   -16.033 1.00 0.00 ? 79 THR A CB   1  
ATOM 1195  O OG1  . THR A 1 79 ? -22.461 7.144   -15.264 1.00 0.00 ? 79 THR A OG1  1  
ATOM 1196  C CG2  . THR A 1 79 ? -20.203 7.918   -15.605 1.00 0.00 ? 79 THR A CG2  1  
ATOM 1197  O OXT  . THR A 1 79 ? -23.968 10.539  -16.872 1.00 0.00 ? 79 THR A OXT  1  
ATOM 1198  H H    . THR A 1 79 ? -21.715 9.134   -13.723 1.00 0.00 ? 79 THR A H    1  
ATOM 1199  H HA   . THR A 1 79 ? -21.564 10.147  -16.408 1.00 0.00 ? 79 THR A HA   1  
ATOM 1200  H HB   . THR A 1 79 ? -21.754 7.788   -17.080 1.00 0.00 ? 79 THR A HB   1  
ATOM 1201  H HG1  . THR A 1 79 ? -22.647 7.564   -14.422 1.00 0.00 ? 79 THR A HG1  1  
ATOM 1202  H HG21 . THR A 1 79 ? -19.866 6.903   -15.756 1.00 0.00 ? 79 THR A HG21 1  
ATOM 1203  H HG22 . THR A 1 79 ? -20.111 8.177   -14.562 1.00 0.00 ? 79 THR A HG22 1  
ATOM 1204  H HG23 . THR A 1 79 ? -19.600 8.590   -16.197 1.00 0.00 ? 79 THR A HG23 1  
ATOM 1205  N N    . MET A 1 1  ? 12.544  3.102   7.695   1.00 0.00 ? 1  MET A N    2  
ATOM 1206  C CA   . MET A 1 1  ? 11.451  3.673   6.858   1.00 0.00 ? 1  MET A CA   2  
ATOM 1207  C C    . MET A 1 1  ? 10.198  3.859   7.715   1.00 0.00 ? 1  MET A C    2  
ATOM 1208  O O    . MET A 1 1  ? 9.376   4.715   7.451   1.00 0.00 ? 1  MET A O    2  
ATOM 1209  C CB   . MET A 1 1  ? 11.142  2.718   5.702   1.00 0.00 ? 1  MET A CB   2  
ATOM 1210  C CG   . MET A 1 1  ? 12.394  2.536   4.843   1.00 0.00 ? 1  MET A CG   2  
ATOM 1211  S SD   . MET A 1 1  ? 12.756  4.079   3.968   1.00 0.00 ? 1  MET A SD   2  
ATOM 1212  C CE   . MET A 1 1  ? 11.741  3.753   2.505   1.00 0.00 ? 1  MET A CE   2  
ATOM 1213  H H1   . MET A 1 1  ? 13.381  3.717   7.641   1.00 0.00 ? 1  MET A H1   2  
ATOM 1214  H H2   . MET A 1 1  ? 12.789  2.153   7.346   1.00 0.00 ? 1  MET A H2   2  
ATOM 1215  H H3   . MET A 1 1  ? 12.228  3.038   8.683   1.00 0.00 ? 1  MET A H3   2  
ATOM 1216  H HA   . MET A 1 1  ? 11.763  4.628   6.462   1.00 0.00 ? 1  MET A HA   2  
ATOM 1217  H HB2  . MET A 1 1  ? 10.834  1.762   6.099   1.00 0.00 ? 1  MET A HB2  2  
ATOM 1218  H HB3  . MET A 1 1  ? 10.349  3.131   5.097   1.00 0.00 ? 1  MET A HB3  2  
ATOM 1219  H HG2  . MET A 1 1  ? 13.230  2.275   5.474   1.00 0.00 ? 1  MET A HG2  2  
ATOM 1220  H HG3  . MET A 1 1  ? 12.225  1.746   4.125   1.00 0.00 ? 1  MET A HG3  2  
ATOM 1221  H HE1  . MET A 1 1  ? 12.141  2.902   1.973   1.00 0.00 ? 1  MET A HE1  2  
ATOM 1222  H HE2  . MET A 1 1  ? 11.749  4.623   1.863   1.00 0.00 ? 1  MET A HE2  2  
ATOM 1223  H HE3  . MET A 1 1  ? 10.728  3.542   2.808   1.00 0.00 ? 1  MET A HE3  2  
ATOM 1224  N N    . ILE A 1 2  ? 10.044  3.067   8.739   1.00 0.00 ? 2  ILE A N    2  
ATOM 1225  C CA   . ILE A 1 2  ? 8.843   3.200   9.612   1.00 0.00 ? 2  ILE A CA   2  
ATOM 1226  C C    . ILE A 1 2  ? 8.882   4.550   10.330  1.00 0.00 ? 2  ILE A C    2  
ATOM 1227  O O    . ILE A 1 2  ? 9.827   4.868   11.025  1.00 0.00 ? 2  ILE A O    2  
ATOM 1228  C CB   . ILE A 1 2  ? 8.836   2.072   10.645  1.00 0.00 ? 2  ILE A CB   2  
ATOM 1229  C CG1  . ILE A 1 2  ? 8.846   0.721   9.924   1.00 0.00 ? 2  ILE A CG1  2  
ATOM 1230  C CG2  . ILE A 1 2  ? 7.578   2.178   11.509  1.00 0.00 ? 2  ILE A CG2  2  
ATOM 1231  C CD1  . ILE A 1 2  ? 9.102   -0.396  10.938  1.00 0.00 ? 2  ILE A CD1  2  
ATOM 1232  H H    . ILE A 1 2  ? 10.719  2.383   8.936   1.00 0.00 ? 2  ILE A H    2  
ATOM 1233  H HA   . ILE A 1 2  ? 7.951   3.139   9.007   1.00 0.00 ? 2  ILE A HA   2  
ATOM 1234  H HB   . ILE A 1 2  ? 9.712   2.154   11.273  1.00 0.00 ? 2  ILE A HB   2  
ATOM 1235  H HG12 . ILE A 1 2  ? 7.890   0.563   9.445   1.00 0.00 ? 2  ILE A HG12 2  
ATOM 1236  H HG13 . ILE A 1 2  ? 9.627   0.715   9.180   1.00 0.00 ? 2  ILE A HG13 2  
ATOM 1237  H HG21 . ILE A 1 2  ? 7.632   3.071   12.114  1.00 0.00 ? 2  ILE A HG21 2  
ATOM 1238  H HG22 . ILE A 1 2  ? 7.508   1.312   12.151  1.00 0.00 ? 2  ILE A HG22 2  
ATOM 1239  H HG23 . ILE A 1 2  ? 6.707   2.226   10.872  1.00 0.00 ? 2  ILE A HG23 2  
ATOM 1240  H HD11 . ILE A 1 2  ? 9.201   -1.337  10.418  1.00 0.00 ? 2  ILE A HD11 2  
ATOM 1241  H HD12 . ILE A 1 2  ? 8.273   -0.453  11.628  1.00 0.00 ? 2  ILE A HD12 2  
ATOM 1242  H HD13 . ILE A 1 2  ? 10.010  -0.188  11.482  1.00 0.00 ? 2  ILE A HD13 2  
ATOM 1243  N N    . ASP A 1 3  ? 7.862   5.347   10.170  1.00 0.00 ? 3  ASP A N    2  
ATOM 1244  C CA   . ASP A 1 3  ? 7.841   6.676   10.845  1.00 0.00 ? 3  ASP A CA   2  
ATOM 1245  C C    . ASP A 1 3  ? 7.797   6.477   12.361  1.00 0.00 ? 3  ASP A C    2  
ATOM 1246  O O    . ASP A 1 3  ? 6.995   5.723   12.875  1.00 0.00 ? 3  ASP A O    2  
ATOM 1247  C CB   . ASP A 1 3  ? 6.603   7.456   10.396  1.00 0.00 ? 3  ASP A CB   2  
ATOM 1248  C CG   . ASP A 1 3  ? 6.641   7.646   8.880   1.00 0.00 ? 3  ASP A CG   2  
ATOM 1249  O OD1  . ASP A 1 3  ? 6.957   6.690   8.190   1.00 0.00 ? 3  ASP A OD1  2  
ATOM 1250  O OD2  . ASP A 1 3  ? 6.355   8.745   8.433   1.00 0.00 ? 3  ASP A OD2  2  
ATOM 1251  H H    . ASP A 1 3  ? 7.108   5.072   9.606   1.00 0.00 ? 3  ASP A H    2  
ATOM 1252  H HA   . ASP A 1 3  ? 8.731   7.228   10.579  1.00 0.00 ? 3  ASP A HA   2  
ATOM 1253  H HB2  . ASP A 1 3  ? 5.713   6.908   10.670  1.00 0.00 ? 3  ASP A HB2  2  
ATOM 1254  H HB3  . ASP A 1 3  ? 6.593   8.422   10.878  1.00 0.00 ? 3  ASP A HB3  2  
ATOM 1255  N N    . ASN A 1 4  ? 8.653   7.147   13.082  1.00 0.00 ? 4  ASN A N    2  
ATOM 1256  C CA   . ASN A 1 4  ? 8.660   6.995   14.564  1.00 0.00 ? 4  ASN A CA   2  
ATOM 1257  C C    . ASN A 1 4  ? 7.361   7.562   15.140  1.00 0.00 ? 4  ASN A C    2  
ATOM 1258  O O    . ASN A 1 4  ? 6.777   8.477   14.595  1.00 0.00 ? 4  ASN A O    2  
ATOM 1259  C CB   . ASN A 1 4  ? 9.852   7.755   15.150  1.00 0.00 ? 4  ASN A CB   2  
ATOM 1260  C CG   . ASN A 1 4  ? 9.802   9.214   14.692  1.00 0.00 ? 4  ASN A CG   2  
ATOM 1261  O OD1  . ASN A 1 4  ? 8.834   9.906   14.933  1.00 0.00 ? 4  ASN A OD1  2  
ATOM 1262  N ND2  . ASN A 1 4  ? 10.814  9.713   14.036  1.00 0.00 ? 4  ASN A ND2  2  
ATOM 1263  H H    . ASN A 1 4  ? 9.293   7.750   12.648  1.00 0.00 ? 4  ASN A H    2  
ATOM 1264  H HA   . ASN A 1 4  ? 8.740   5.949   14.818  1.00 0.00 ? 4  ASN A HA   2  
ATOM 1265  H HB2  . ASN A 1 4  ? 9.809   7.713   16.229  1.00 0.00 ? 4  ASN A HB2  2  
ATOM 1266  H HB3  . ASN A 1 4  ? 10.770  7.303   14.809  1.00 0.00 ? 4  ASN A HB3  2  
ATOM 1267  H HD21 . ASN A 1 4  ? 11.595  9.155   13.842  1.00 0.00 ? 4  ASN A HD21 2  
ATOM 1268  H HD22 . ASN A 1 4  ? 10.793  10.647  13.738  1.00 0.00 ? 4  ASN A HD22 2  
ATOM 1269  N N    . GLU A 1 5  ? 6.904   7.025   16.238  1.00 0.00 ? 5  GLU A N    2  
ATOM 1270  C CA   . GLU A 1 5  ? 5.644   7.532   16.848  1.00 0.00 ? 5  GLU A CA   2  
ATOM 1271  C C    . GLU A 1 5  ? 5.458   6.904   18.232  1.00 0.00 ? 5  GLU A C    2  
ATOM 1272  O O    . GLU A 1 5  ? 5.792   5.758   18.453  1.00 0.00 ? 5  GLU A O    2  
ATOM 1273  C CB   . GLU A 1 5  ? 4.458   7.160   15.955  1.00 0.00 ? 5  GLU A CB   2  
ATOM 1274  C CG   . GLU A 1 5  ? 4.497   5.661   15.652  1.00 0.00 ? 5  GLU A CG   2  
ATOM 1275  C CD   . GLU A 1 5  ? 3.314   5.290   14.756  1.00 0.00 ? 5  GLU A CD   2  
ATOM 1276  O OE1  . GLU A 1 5  ? 2.193   5.583   15.137  1.00 0.00 ? 5  GLU A OE1  2  
ATOM 1277  O OE2  . GLU A 1 5  ? 3.549   4.718   13.704  1.00 0.00 ? 5  GLU A OE2  2  
ATOM 1278  H H    . GLU A 1 5  ? 7.390   6.287   16.662  1.00 0.00 ? 5  GLU A H    2  
ATOM 1279  H HA   . GLU A 1 5  ? 5.698   8.607   16.945  1.00 0.00 ? 5  GLU A HA   2  
ATOM 1280  H HB2  . GLU A 1 5  ? 3.535   7.402   16.464  1.00 0.00 ? 5  GLU A HB2  2  
ATOM 1281  H HB3  . GLU A 1 5  ? 4.516   7.715   15.031  1.00 0.00 ? 5  GLU A HB3  2  
ATOM 1282  H HG2  . GLU A 1 5  ? 5.422   5.420   15.148  1.00 0.00 ? 5  GLU A HG2  2  
ATOM 1283  H HG3  . GLU A 1 5  ? 4.435   5.105   16.576  1.00 0.00 ? 5  GLU A HG3  2  
ATOM 1284  N N    . LYS A 1 6  ? 4.927   7.647   19.164  1.00 0.00 ? 6  LYS A N    2  
ATOM 1285  C CA   . LYS A 1 6  ? 4.721   7.091   20.531  1.00 0.00 ? 6  LYS A CA   2  
ATOM 1286  C C    . LYS A 1 6  ? 3.618   6.032   20.491  1.00 0.00 ? 6  LYS A C    2  
ATOM 1287  O O    . LYS A 1 6  ? 3.883   4.848   20.416  1.00 0.00 ? 6  LYS A O    2  
ATOM 1288  C CB   . LYS A 1 6  ? 4.313   8.217   21.484  1.00 0.00 ? 6  LYS A CB   2  
ATOM 1289  C CG   . LYS A 1 6  ? 5.424   9.267   21.539  1.00 0.00 ? 6  LYS A CG   2  
ATOM 1290  C CD   . LYS A 1 6  ? 4.892   10.541  22.199  1.00 0.00 ? 6  LYS A CD   2  
ATOM 1291  C CE   . LYS A 1 6  ? 4.314   10.203  23.574  1.00 0.00 ? 6  LYS A CE   2  
ATOM 1292  N NZ   . LYS A 1 6  ? 5.200   9.220   24.258  1.00 0.00 ? 6  LYS A NZ   2  
ATOM 1293  H H    . LYS A 1 6  ? 4.663   8.570   18.966  1.00 0.00 ? 6  LYS A H    2  
ATOM 1294  H HA   . LYS A 1 6  ? 5.639   6.641   20.879  1.00 0.00 ? 6  LYS A HA   2  
ATOM 1295  H HB2  . LYS A 1 6  ? 3.400   8.675   21.129  1.00 0.00 ? 6  LYS A HB2  2  
ATOM 1296  H HB3  . LYS A 1 6  ? 4.152   7.813   22.472  1.00 0.00 ? 6  LYS A HB3  2  
ATOM 1297  H HG2  . LYS A 1 6  ? 6.254   8.882   22.113  1.00 0.00 ? 6  LYS A HG2  2  
ATOM 1298  H HG3  . LYS A 1 6  ? 5.754   9.495   20.537  1.00 0.00 ? 6  LYS A HG3  2  
ATOM 1299  H HD2  . LYS A 1 6  ? 5.698   11.252  22.311  1.00 0.00 ? 6  LYS A HD2  2  
ATOM 1300  H HD3  . LYS A 1 6  ? 4.117   10.970  21.581  1.00 0.00 ? 6  LYS A HD3  2  
ATOM 1301  H HE2  . LYS A 1 6  ? 4.250   11.103  24.168  1.00 0.00 ? 6  LYS A HE2  2  
ATOM 1302  H HE3  . LYS A 1 6  ? 3.328   9.779   23.456  1.00 0.00 ? 6  LYS A HE3  2  
ATOM 1303  H HZ1  . LYS A 1 6  ? 6.166   9.304   23.885  1.00 0.00 ? 6  LYS A HZ1  2  
ATOM 1304  H HZ2  . LYS A 1 6  ? 4.848   8.257   24.086  1.00 0.00 ? 6  LYS A HZ2  2  
ATOM 1305  H HZ3  . LYS A 1 6  ? 5.205   9.411   25.281  1.00 0.00 ? 6  LYS A HZ3  2  
ATOM 1306  N N    . VAL A 1 7  ? 2.382   6.447   20.540  1.00 0.00 ? 7  VAL A N    2  
ATOM 1307  C CA   . VAL A 1 7  ? 1.263   5.464   20.504  1.00 0.00 ? 7  VAL A CA   2  
ATOM 1308  C C    . VAL A 1 7  ? 1.162   4.857   19.102  1.00 0.00 ? 7  VAL A C    2  
ATOM 1309  O O    . VAL A 1 7  ? 1.379   5.523   18.109  1.00 0.00 ? 7  VAL A O    2  
ATOM 1310  C CB   . VAL A 1 7  ? -0.048  6.172   20.849  1.00 0.00 ? 7  VAL A CB   2  
ATOM 1311  C CG1  . VAL A 1 7  ? -0.317  7.276   19.825  1.00 0.00 ? 7  VAL A CG1  2  
ATOM 1312  C CG2  . VAL A 1 7  ? -1.195  5.160   20.820  1.00 0.00 ? 7  VAL A CG2  2  
ATOM 1313  H H    . VAL A 1 7  ? 2.190   7.406   20.599  1.00 0.00 ? 7  VAL A H    2  
ATOM 1314  H HA   . VAL A 1 7  ? 1.450   4.680   21.223  1.00 0.00 ? 7  VAL A HA   2  
ATOM 1315  H HB   . VAL A 1 7  ? 0.027   6.606   21.836  1.00 0.00 ? 7  VAL A HB   2  
ATOM 1316  H HG11 . VAL A 1 7  ? -0.571  6.832   18.875  1.00 0.00 ? 7  VAL A HG11 2  
ATOM 1317  H HG12 . VAL A 1 7  ? 0.567   7.887   19.714  1.00 0.00 ? 7  VAL A HG12 2  
ATOM 1318  H HG13 . VAL A 1 7  ? -1.138  7.891   20.167  1.00 0.00 ? 7  VAL A HG13 2  
ATOM 1319  H HG21 . VAL A 1 7  ? -0.925  4.293   21.403  1.00 0.00 ? 7  VAL A HG21 2  
ATOM 1320  H HG22 . VAL A 1 7  ? -1.387  4.862   19.799  1.00 0.00 ? 7  VAL A HG22 2  
ATOM 1321  H HG23 . VAL A 1 7  ? -2.084  5.611   21.236  1.00 0.00 ? 7  VAL A HG23 2  
ATOM 1322  N N    . THR A 1 8  ? 0.832   3.597   19.013  1.00 0.00 ? 8  THR A N    2  
ATOM 1323  C CA   . THR A 1 8  ? 0.717   2.950   17.676  1.00 0.00 ? 8  THR A CA   2  
ATOM 1324  C C    . THR A 1 8  ? -0.499  3.516   16.939  1.00 0.00 ? 8  THR A C    2  
ATOM 1325  O O    . THR A 1 8  ? -0.698  4.713   16.880  1.00 0.00 ? 8  THR A O    2  
ATOM 1326  C CB   . THR A 1 8  ? 0.551   1.438   17.853  1.00 0.00 ? 8  THR A CB   2  
ATOM 1327  O OG1  . THR A 1 8  ? -0.663  1.175   18.544  1.00 0.00 ? 8  THR A OG1  2  
ATOM 1328  C CG2  . THR A 1 8  ? 1.728   0.882   18.655  1.00 0.00 ? 8  THR A CG2  2  
ATOM 1329  H H    . THR A 1 8  ? 0.661   3.076   19.826  1.00 0.00 ? 8  THR A H    2  
ATOM 1330  H HA   . THR A 1 8  ? 1.611   3.148   17.102  1.00 0.00 ? 8  THR A HA   2  
ATOM 1331  H HB   . THR A 1 8  ? 0.524   0.962   16.884  1.00 0.00 ? 8  THR A HB   2  
ATOM 1332  H HG1  . THR A 1 8  ? -0.922  1.976   19.005  1.00 0.00 ? 8  THR A HG1  2  
ATOM 1333  H HG21 . THR A 1 8  ? 1.618   -0.186  18.763  1.00 0.00 ? 8  THR A HG21 2  
ATOM 1334  H HG22 . THR A 1 8  ? 1.747   1.343   19.631  1.00 0.00 ? 8  THR A HG22 2  
ATOM 1335  H HG23 . THR A 1 8  ? 2.651   1.098   18.136  1.00 0.00 ? 8  THR A HG23 2  
ATOM 1336  N N    . SER A 1 9  ? -1.314  2.666   16.377  1.00 0.00 ? 9  SER A N    2  
ATOM 1337  C CA   . SER A 1 9  ? -2.515  3.157   15.646  1.00 0.00 ? 9  SER A CA   2  
ATOM 1338  C C    . SER A 1 9  ? -3.499  2.002   15.446  1.00 0.00 ? 9  SER A C    2  
ATOM 1339  O O    . SER A 1 9  ? -4.337  1.736   16.284  1.00 0.00 ? 9  SER A O    2  
ATOM 1340  C CB   . SER A 1 9  ? -2.092  3.707   14.283  1.00 0.00 ? 9  SER A CB   2  
ATOM 1341  O OG   . SER A 1 9  ? -1.286  4.863   14.474  1.00 0.00 ? 9  SER A OG   2  
ATOM 1342  H H    . SER A 1 9  ? -1.136  1.704   16.437  1.00 0.00 ? 9  SER A H    2  
ATOM 1343  H HA   . SER A 1 9  ? -2.991  3.940   16.218  1.00 0.00 ? 9  SER A HA   2  
ATOM 1344  H HB2  . SER A 1 9  ? -1.524  2.963   13.753  1.00 0.00 ? 9  SER A HB2  2  
ATOM 1345  H HB3  . SER A 1 9  ? -2.974  3.962   13.709  1.00 0.00 ? 9  SER A HB3  2  
ATOM 1346  H HG   . SER A 1 9  ? -1.605  5.322   15.255  1.00 0.00 ? 9  SER A HG   2  
ATOM 1347  N N    . GLY A 1 10 ? -3.403  1.314   14.342  1.00 0.00 ? 10 GLY A N    2  
ATOM 1348  C CA   . GLY A 1 10 ? -4.331  0.176   14.088  1.00 0.00 ? 10 GLY A CA   2  
ATOM 1349  C C    . GLY A 1 10 ? -3.802  -0.669  12.929  1.00 0.00 ? 10 GLY A C    2  
ATOM 1350  O O    . GLY A 1 10 ? -3.772  -0.235  11.794  1.00 0.00 ? 10 GLY A O    2  
ATOM 1351  H H    . GLY A 1 10 ? -2.719  1.545   13.677  1.00 0.00 ? 10 GLY A H    2  
ATOM 1352  H HA2  . GLY A 1 10 ? -4.402  -0.434  14.978  1.00 0.00 ? 10 GLY A HA2  2  
ATOM 1353  H HA3  . GLY A 1 10 ? -5.308  0.559   13.834  1.00 0.00 ? 10 GLY A HA3  2  
ATOM 1354  N N    . HIS A 1 11 ? -3.384  -1.874  13.204  1.00 0.00 ? 11 HIS A N    2  
ATOM 1355  C CA   . HIS A 1 11 ? -2.857  -2.748  12.117  1.00 0.00 ? 11 HIS A CA   2  
ATOM 1356  C C    . HIS A 1 11 ? -1.732  -2.021  11.379  1.00 0.00 ? 11 HIS A C    2  
ATOM 1357  O O    . HIS A 1 11 ? -1.484  -0.852  11.600  1.00 0.00 ? 11 HIS A O    2  
ATOM 1358  C CB   . HIS A 1 11 ? -3.983  -3.076  11.134  1.00 0.00 ? 11 HIS A CB   2  
ATOM 1359  C CG   . HIS A 1 11 ? -3.541  -4.184  10.218  1.00 0.00 ? 11 HIS A CG   2  
ATOM 1360  N ND1  . HIS A 1 11 ? -2.741  -3.951  9.111   1.00 0.00 ? 11 HIS A ND1  2  
ATOM 1361  C CD2  . HIS A 1 11 ? -3.777  -5.536  10.232  1.00 0.00 ? 11 HIS A CD2  2  
ATOM 1362  C CE1  . HIS A 1 11 ? -2.525  -5.136  8.510   1.00 0.00 ? 11 HIS A CE1  2  
ATOM 1363  N NE2  . HIS A 1 11 ? -3.135  -6.136  9.153   1.00 0.00 ? 11 HIS A NE2  2  
ATOM 1364  H H    . HIS A 1 11 ? -3.417  -2.205  14.126  1.00 0.00 ? 11 HIS A H    2  
ATOM 1365  H HA   . HIS A 1 11 ? -2.474  -3.662  12.545  1.00 0.00 ? 11 HIS A HA   2  
ATOM 1366  H HB2  . HIS A 1 11 ? -4.858  -3.390  11.683  1.00 0.00 ? 11 HIS A HB2  2  
ATOM 1367  H HB3  . HIS A 1 11 ? -4.219  -2.199  10.550  1.00 0.00 ? 11 HIS A HB3  2  
ATOM 1368  H HD1  . HIS A 1 11 ? -2.394  -3.083  8.818   1.00 0.00 ? 11 HIS A HD1  2  
ATOM 1369  H HD2  . HIS A 1 11 ? -4.371  -6.055  10.969  1.00 0.00 ? 11 HIS A HD2  2  
ATOM 1370  H HE1  . HIS A 1 11 ? -1.932  -5.264  7.616   1.00 0.00 ? 11 HIS A HE1  2  
ATOM 1371  N N    . THR A 1 12 ? -1.046  -2.705  10.503  1.00 0.00 ? 12 THR A N    2  
ATOM 1372  C CA   . THR A 1 12 ? 0.065   -2.056  9.753   1.00 0.00 ? 12 THR A CA   2  
ATOM 1373  C C    . THR A 1 12 ? -0.512  -1.155  8.657   1.00 0.00 ? 12 THR A C    2  
ATOM 1374  O O    . THR A 1 12 ? -0.497  0.054   8.763   1.00 0.00 ? 12 THR A O    2  
ATOM 1375  C CB   . THR A 1 12 ? 0.946   -3.132  9.115   1.00 0.00 ? 12 THR A CB   2  
ATOM 1376  O OG1  . THR A 1 12 ? 0.178   -3.879  8.181   1.00 0.00 ? 12 THR A OG1  2  
ATOM 1377  C CG2  . THR A 1 12 ? 1.481   -4.067  10.201  1.00 0.00 ? 12 THR A CG2  2  
ATOM 1378  H H    . THR A 1 12 ? -1.262  -3.648  10.343  1.00 0.00 ? 12 THR A H    2  
ATOM 1379  H HA   . THR A 1 12 ? 0.658   -1.462  10.431  1.00 0.00 ? 12 THR A HA   2  
ATOM 1380  H HB   . THR A 1 12 ? 1.777   -2.665  8.608   1.00 0.00 ? 12 THR A HB   2  
ATOM 1381  H HG1  . THR A 1 12 ? 0.026   -4.751  8.552   1.00 0.00 ? 12 THR A HG1  2  
ATOM 1382  H HG21 . THR A 1 12 ? 0.652   -4.504  10.740  1.00 0.00 ? 12 THR A HG21 2  
ATOM 1383  H HG22 . THR A 1 12 ? 2.100   -3.507  10.886  1.00 0.00 ? 12 THR A HG22 2  
ATOM 1384  H HG23 . THR A 1 12 ? 2.067   -4.851  9.745   1.00 0.00 ? 12 THR A HG23 2  
ATOM 1385  N N    . THR A 1 13 ? -1.023  -1.738  7.604   1.00 0.00 ? 13 THR A N    2  
ATOM 1386  C CA   . THR A 1 13 ? -1.604  -0.919  6.498   1.00 0.00 ? 13 THR A CA   2  
ATOM 1387  C C    . THR A 1 13 ? -3.090  -0.679  6.767   1.00 0.00 ? 13 THR A C    2  
ATOM 1388  O O    . THR A 1 13 ? -3.686  -1.310  7.617   1.00 0.00 ? 13 THR A O    2  
ATOM 1389  C CB   . THR A 1 13 ? -1.442  -1.671  5.174   1.00 0.00 ? 13 THR A CB   2  
ATOM 1390  O OG1  . THR A 1 13 ? -2.054  -2.948  5.280   1.00 0.00 ? 13 THR A OG1  2  
ATOM 1391  C CG2  . THR A 1 13 ? 0.045   -1.839  4.858   1.00 0.00 ? 13 THR A CG2  2  
ATOM 1392  H H    . THR A 1 13 ? -1.026  -2.716  7.543   1.00 0.00 ? 13 THR A H    2  
ATOM 1393  H HA   . THR A 1 13 ? -1.090  0.030   6.435   1.00 0.00 ? 13 THR A HA   2  
ATOM 1394  H HB   . THR A 1 13 ? -1.913  -1.110  4.381   1.00 0.00 ? 13 THR A HB   2  
ATOM 1395  H HG1  . THR A 1 13 ? -1.702  -3.383  6.060   1.00 0.00 ? 13 THR A HG1  2  
ATOM 1396  H HG21 . THR A 1 13 ? 0.158   -2.330  3.903   1.00 0.00 ? 13 THR A HG21 2  
ATOM 1397  H HG22 . THR A 1 13 ? 0.511   -2.437  5.628   1.00 0.00 ? 13 THR A HG22 2  
ATOM 1398  H HG23 . THR A 1 13 ? 0.517   -0.869  4.822   1.00 0.00 ? 13 THR A HG23 2  
ATOM 1399  N N    . THR A 1 14 ? -3.696  0.228   6.048   1.00 0.00 ? 14 THR A N    2  
ATOM 1400  C CA   . THR A 1 14 ? -5.145  0.503   6.265   1.00 0.00 ? 14 THR A CA   2  
ATOM 1401  C C    . THR A 1 14 ? -5.948  -0.760  5.938   1.00 0.00 ? 14 THR A C    2  
ATOM 1402  O O    . THR A 1 14 ? -5.530  -1.863  6.233   1.00 0.00 ? 14 THR A O    2  
ATOM 1403  C CB   . THR A 1 14 ? -5.588  1.663   5.357   1.00 0.00 ? 14 THR A CB   2  
ATOM 1404  O OG1  . THR A 1 14 ? -4.533  2.610   5.265   1.00 0.00 ? 14 THR A OG1  2  
ATOM 1405  C CG2  . THR A 1 14 ? -6.831  2.345   5.941   1.00 0.00 ? 14 THR A CG2  2  
ATOM 1406  H H    . THR A 1 14 ? -3.199  0.725   5.365   1.00 0.00 ? 14 THR A H    2  
ATOM 1407  H HA   . THR A 1 14 ? -5.304  0.770   7.301   1.00 0.00 ? 14 THR A HA   2  
ATOM 1408  H HB   . THR A 1 14 ? -5.818  1.287   4.371   1.00 0.00 ? 14 THR A HB   2  
ATOM 1409  H HG1  . THR A 1 14 ? -4.753  3.231   4.567   1.00 0.00 ? 14 THR A HG1  2  
ATOM 1410  H HG21 . THR A 1 14 ? -6.534  3.024   6.725   1.00 0.00 ? 14 THR A HG21 2  
ATOM 1411  H HG22 . THR A 1 14 ? -7.500  1.599   6.346   1.00 0.00 ? 14 THR A HG22 2  
ATOM 1412  H HG23 . THR A 1 14 ? -7.339  2.895   5.162   1.00 0.00 ? 14 THR A HG23 2  
ATOM 1413  N N    . THR A 1 15 ? -7.100  -0.614  5.334   1.00 0.00 ? 15 THR A N    2  
ATOM 1414  C CA   . THR A 1 15 ? -7.925  -1.813  4.994   1.00 0.00 ? 15 THR A CA   2  
ATOM 1415  C C    . THR A 1 15 ? -7.651  -2.232  3.548   1.00 0.00 ? 15 THR A C    2  
ATOM 1416  O O    . THR A 1 15 ? -7.751  -1.440  2.632   1.00 0.00 ? 15 THR A O    2  
ATOM 1417  C CB   . THR A 1 15 ? -9.407  -1.463  5.147   1.00 0.00 ? 15 THR A CB   2  
ATOM 1418  O OG1  . THR A 1 15 ? -9.733  -0.393  4.270   1.00 0.00 ? 15 THR A OG1  2  
ATOM 1419  C CG2  . THR A 1 15 ? -9.688  -1.045  6.590   1.00 0.00 ? 15 THR A CG2  2  
ATOM 1420  H H    . THR A 1 15 ? -7.423  0.282   5.106   1.00 0.00 ? 15 THR A H    2  
ATOM 1421  H HA   . THR A 1 15 ? -7.681  -2.631  5.659   1.00 0.00 ? 15 THR A HA   2  
ATOM 1422  H HB   . THR A 1 15 ? -10.009 -2.325  4.902   1.00 0.00 ? 15 THR A HB   2  
ATOM 1423  H HG1  . THR A 1 15 ? -10.039 0.344   4.803   1.00 0.00 ? 15 THR A HG1  2  
ATOM 1424  H HG21 . THR A 1 15 ? -9.431  -1.857  7.256   1.00 0.00 ? 15 THR A HG21 2  
ATOM 1425  H HG22 . THR A 1 15 ? -10.737 -0.808  6.700   1.00 0.00 ? 15 THR A HG22 2  
ATOM 1426  H HG23 . THR A 1 15 ? -9.095  -0.177  6.836   1.00 0.00 ? 15 THR A HG23 2  
ATOM 1427  N N    . ARG A 1 16 ? -7.301  -3.479  3.347   1.00 0.00 ? 16 ARG A N    2  
ATOM 1428  C CA   . ARG A 1 16 ? -7.008  -3.989  1.972   1.00 0.00 ? 16 ARG A CA   2  
ATOM 1429  C C    . ARG A 1 16 ? -7.943  -5.163  1.665   1.00 0.00 ? 16 ARG A C    2  
ATOM 1430  O O    . ARG A 1 16 ? -8.473  -5.781  2.565   1.00 0.00 ? 16 ARG A O    2  
ATOM 1431  C CB   . ARG A 1 16 ? -5.537  -4.446  1.903   1.00 0.00 ? 16 ARG A CB   2  
ATOM 1432  C CG   . ARG A 1 16 ? -5.249  -5.554  2.939   1.00 0.00 ? 16 ARG A CG   2  
ATOM 1433  C CD   . ARG A 1 16 ? -5.250  -4.991  4.382   1.00 0.00 ? 16 ARG A CD   2  
ATOM 1434  N NE   . ARG A 1 16 ? -4.059  -5.506  5.133   1.00 0.00 ? 16 ARG A NE   2  
ATOM 1435  C CZ   . ARG A 1 16 ? -3.740  -6.775  5.116   1.00 0.00 ? 16 ARG A CZ   2  
ATOM 1436  N NH1  . ARG A 1 16 ? -4.513  -7.644  4.525   1.00 0.00 ? 16 ARG A NH1  2  
ATOM 1437  N NH2  . ARG A 1 16 ? -2.656  -7.179  5.721   1.00 0.00 ? 16 ARG A NH2  2  
ATOM 1438  H H    . ARG A 1 16 ? -7.220  -4.080  4.113   1.00 0.00 ? 16 ARG A H    2  
ATOM 1439  H HA   . ARG A 1 16 ? -7.172  -3.207  1.243   1.00 0.00 ? 16 ARG A HA   2  
ATOM 1440  H HB2  . ARG A 1 16 ? -5.327  -4.823  0.914   1.00 0.00 ? 16 ARG A HB2  2  
ATOM 1441  H HB3  . ARG A 1 16 ? -4.893  -3.601  2.098   1.00 0.00 ? 16 ARG A HB3  2  
ATOM 1442  H HG2  . ARG A 1 16 ? -5.999  -6.326  2.850   1.00 0.00 ? 16 ARG A HG2  2  
ATOM 1443  H HG3  . ARG A 1 16 ? -4.282  -5.981  2.726   1.00 0.00 ? 16 ARG A HG3  2  
ATOM 1444  H HD2  . ARG A 1 16 ? -5.183  -3.917  4.363   1.00 0.00 ? 16 ARG A HD2  2  
ATOM 1445  H HD3  . ARG A 1 16 ? -6.169  -5.278  4.884   1.00 0.00 ? 16 ARG A HD3  2  
ATOM 1446  H HE   . ARG A 1 16 ? -3.493  -4.876  5.626   1.00 0.00 ? 16 ARG A HE   2  
ATOM 1447  H HH11 . ARG A 1 16 ? -5.356  -7.345  4.085   1.00 0.00 ? 16 ARG A HH11 2  
ATOM 1448  H HH12 . ARG A 1 16 ? -4.259  -8.611  4.513   1.00 0.00 ? 16 ARG A HH12 2  
ATOM 1449  H HH21 . ARG A 1 16 ? -2.073  -6.520  6.196   1.00 0.00 ? 16 ARG A HH21 2  
ATOM 1450  H HH22 . ARG A 1 16 ? -2.409  -8.148  5.710   1.00 0.00 ? 16 ARG A HH22 2  
ATOM 1451  N N    . ARG A 1 17 ? -8.152  -5.464  0.403   1.00 0.00 ? 17 ARG A N    2  
ATOM 1452  C CA   . ARG A 1 17 ? -9.058  -6.599  0.013   1.00 0.00 ? 17 ARG A CA   2  
ATOM 1453  C C    . ARG A 1 17 ? -10.523 -6.121  -0.011  1.00 0.00 ? 17 ARG A C    2  
ATOM 1454  O O    . ARG A 1 17 ? -11.447 -6.908  0.048   1.00 0.00 ? 17 ARG A O    2  
ATOM 1455  C CB   . ARG A 1 17 ? -8.903  -7.780  0.996   1.00 0.00 ? 17 ARG A CB   2  
ATOM 1456  C CG   . ARG A 1 17 ? -9.197  -9.103  0.279   1.00 0.00 ? 17 ARG A CG   2  
ATOM 1457  C CD   . ARG A 1 17 ? -9.355  -10.221 1.312   1.00 0.00 ? 17 ARG A CD   2  
ATOM 1458  N NE   . ARG A 1 17 ? -9.773  -11.475 0.625   1.00 0.00 ? 17 ARG A NE   2  
ATOM 1459  C CZ   . ARG A 1 17 ? -9.682  -12.620 1.244   1.00 0.00 ? 17 ARG A CZ   2  
ATOM 1460  N NH1  . ARG A 1 17 ? -9.225  -12.667 2.466   1.00 0.00 ? 17 ARG A NH1  2  
ATOM 1461  N NH2  . ARG A 1 17 ? -10.048 -13.718 0.642   1.00 0.00 ? 17 ARG A NH2  2  
ATOM 1462  H H    . ARG A 1 17 ? -7.711  -4.932  -0.301  1.00 0.00 ? 17 ARG A H    2  
ATOM 1463  H HA   . ARG A 1 17 ? -8.781  -6.925  -0.982  1.00 0.00 ? 17 ARG A HA   2  
ATOM 1464  H HB2  . ARG A 1 17 ? -7.893  -7.798  1.377   1.00 0.00 ? 17 ARG A HB2  2  
ATOM 1465  H HB3  . ARG A 1 17 ? -9.592  -7.664  1.822   1.00 0.00 ? 17 ARG A HB3  2  
ATOM 1466  H HG2  . ARG A 1 17 ? -10.111 -9.008  -0.290  1.00 0.00 ? 17 ARG A HG2  2  
ATOM 1467  H HG3  . ARG A 1 17 ? -8.381  -9.342  -0.385  1.00 0.00 ? 17 ARG A HG3  2  
ATOM 1468  H HD2  . ARG A 1 17 ? -8.412  -10.384 1.814   1.00 0.00 ? 17 ARG A HD2  2  
ATOM 1469  H HD3  . ARG A 1 17 ? -10.105 -9.941  2.037   1.00 0.00 ? 17 ARG A HD3  2  
ATOM 1470  H HE   . ARG A 1 17 ? -10.117 -11.440 -0.292  1.00 0.00 ? 17 ARG A HE   2  
ATOM 1471  H HH11 . ARG A 1 17 ? -8.945  -11.826 2.927   1.00 0.00 ? 17 ARG A HH11 2  
ATOM 1472  H HH12 . ARG A 1 17 ? -9.155  -13.544 2.941   1.00 0.00 ? 17 ARG A HH12 2  
ATOM 1473  H HH21 . ARG A 1 17 ? -10.398 -13.683 -0.294  1.00 0.00 ? 17 ARG A HH21 2  
ATOM 1474  H HH22 . ARG A 1 17 ? -9.978  -14.597 1.116   1.00 0.00 ? 17 ARG A HH22 2  
ATOM 1475  N N    . SER A 1 18 ? -10.728 -4.839  -0.136  1.00 0.00 ? 18 SER A N    2  
ATOM 1476  C CA   . SER A 1 18 ? -12.110 -4.267  -0.211  1.00 0.00 ? 18 SER A CA   2  
ATOM 1477  C C    . SER A 1 18 ? -12.009 -3.078  -1.161  1.00 0.00 ? 18 SER A C    2  
ATOM 1478  O O    . SER A 1 18 ? -12.875 -2.795  -1.965  1.00 0.00 ? 18 SER A O    2  
ATOM 1479  C CB   . SER A 1 18 ? -12.556 -3.792  1.174   1.00 0.00 ? 18 SER A CB   2  
ATOM 1480  O OG   . SER A 1 18 ? -11.648 -2.808  1.650   1.00 0.00 ? 18 SER A OG   2  
ATOM 1481  H H    . SER A 1 18 ? -9.961  -4.233  -0.214  1.00 0.00 ? 18 SER A H    2  
ATOM 1482  H HA   . SER A 1 18 ? -12.800 -5.000  -0.600  1.00 0.00 ? 18 SER A HA   2  
ATOM 1483  H HB2  . SER A 1 18 ? -13.541 -3.364  1.110   1.00 0.00 ? 18 SER A HB2  2  
ATOM 1484  H HB3  . SER A 1 18 ? -12.577 -4.636  1.852   1.00 0.00 ? 18 SER A HB3  2  
ATOM 1485  H HG   . SER A 1 18 ? -11.802 -2.691  2.591   1.00 0.00 ? 18 SER A HG   2  
ATOM 1486  N N    . CYS A 1 19 ? -10.887 -2.433  -1.073  1.00 0.00 ? 19 CYS A N    2  
ATOM 1487  C CA   . CYS A 1 19 ? -10.556 -1.275  -1.956  1.00 0.00 ? 19 CYS A CA   2  
ATOM 1488  C C    . CYS A 1 19 ? -9.226  -1.618  -2.605  1.00 0.00 ? 19 CYS A C    2  
ATOM 1489  O O    . CYS A 1 19 ? -8.499  -2.451  -2.100  1.00 0.00 ? 19 CYS A O    2  
ATOM 1490  C CB   . CYS A 1 19 ? -10.445 0.029   -1.146  1.00 0.00 ? 19 CYS A CB   2  
ATOM 1491  S SG   . CYS A 1 19 ? -12.105 0.705   -0.876  1.00 0.00 ? 19 CYS A SG   2  
ATOM 1492  H H    . CYS A 1 19 ? -10.246 -2.780  -0.418  1.00 0.00 ? 19 CYS A H    2  
ATOM 1493  H HA   . CYS A 1 19 ? -11.313 -1.167  -2.724  1.00 0.00 ? 19 CYS A HA   2  
ATOM 1494  H HB2  . CYS A 1 19 ? -9.973  -0.159  -0.193  1.00 0.00 ? 19 CYS A HB2  2  
ATOM 1495  H HB3  . CYS A 1 19 ? -9.856  0.746   -1.699  1.00 0.00 ? 19 CYS A HB3  2  
ATOM 1496  N N    . SER A 1 20 ? -8.880  -1.036  -3.716  1.00 0.00 ? 20 SER A N    2  
ATOM 1497  C CA   . SER A 1 20 ? -7.586  -1.425  -4.328  1.00 0.00 ? 20 SER A CA   2  
ATOM 1498  C C    . SER A 1 20 ? -6.440  -0.922  -3.456  1.00 0.00 ? 20 SER A C    2  
ATOM 1499  O O    . SER A 1 20 ? -6.210  0.263   -3.334  1.00 0.00 ? 20 SER A O    2  
ATOM 1500  C CB   . SER A 1 20 ? -7.479  -0.812  -5.727  1.00 0.00 ? 20 SER A CB   2  
ATOM 1501  O OG   . SER A 1 20 ? -8.736  -0.918  -6.381  1.00 0.00 ? 20 SER A OG   2  
ATOM 1502  H H    . SER A 1 20 ? -9.448  -0.368  -4.153  1.00 0.00 ? 20 SER A H    2  
ATOM 1503  H HA   . SER A 1 20 ? -7.534  -2.500  -4.402  1.00 0.00 ? 20 SER A HA   2  
ATOM 1504  H HB2  . SER A 1 20 ? -7.204  0.228   -5.653  1.00 0.00 ? 20 SER A HB2  2  
ATOM 1505  H HB3  . SER A 1 20 ? -6.723  -1.342  -6.293  1.00 0.00 ? 20 SER A HB3  2  
ATOM 1506  H HG   . SER A 1 20 ? -9.346  -0.312  -5.951  1.00 0.00 ? 20 SER A HG   2  
ATOM 1507  N N    . LYS A 1 21 ? -5.714  -1.824  -2.849  1.00 0.00 ? 21 LYS A N    2  
ATOM 1508  C CA   . LYS A 1 21 ? -4.561  -1.422  -1.980  1.00 0.00 ? 21 LYS A CA   2  
ATOM 1509  C C    . LYS A 1 21 ? -3.382  -2.317  -2.336  1.00 0.00 ? 21 LYS A C    2  
ATOM 1510  O O    . LYS A 1 21 ? -3.419  -3.516  -2.145  1.00 0.00 ? 21 LYS A O    2  
ATOM 1511  C CB   . LYS A 1 21 ? -4.908  -1.588  -0.485  1.00 0.00 ? 21 LYS A CB   2  
ATOM 1512  C CG   . LYS A 1 21 ? -5.792  -0.418  -0.007  1.00 0.00 ? 21 LYS A CG   2  
ATOM 1513  C CD   . LYS A 1 21 ? -4.927  0.785   0.390   1.00 0.00 ? 21 LYS A CD   2  
ATOM 1514  C CE   . LYS A 1 21 ? -5.813  1.855   1.026   1.00 0.00 ? 21 LYS A CE   2  
ATOM 1515  N NZ   . LYS A 1 21 ? -5.062  3.140   1.110   1.00 0.00 ? 21 LYS A NZ   2  
ATOM 1516  H H    . LYS A 1 21 ? -5.933  -2.778  -2.952  1.00 0.00 ? 21 LYS A H    2  
ATOM 1517  H HA   . LYS A 1 21 ? -4.291  -0.393  -2.177  1.00 0.00 ? 21 LYS A HA   2  
ATOM 1518  H HB2  . LYS A 1 21 ? -5.436  -2.520  -0.334  1.00 0.00 ? 21 LYS A HB2  2  
ATOM 1519  H HB3  . LYS A 1 21 ? -3.996  -1.606  0.092   1.00 0.00 ? 21 LYS A HB3  2  
ATOM 1520  H HG2  . LYS A 1 21 ? -6.467  -0.125  -0.797  1.00 0.00 ? 21 LYS A HG2  2  
ATOM 1521  H HG3  . LYS A 1 21 ? -6.368  -0.735  0.851   1.00 0.00 ? 21 LYS A HG3  2  
ATOM 1522  H HD2  . LYS A 1 21 ? -4.174  0.473   1.101   1.00 0.00 ? 21 LYS A HD2  2  
ATOM 1523  H HD3  . LYS A 1 21 ? -4.448  1.193   -0.486  1.00 0.00 ? 21 LYS A HD3  2  
ATOM 1524  H HE2  . LYS A 1 21 ? -6.698  1.995   0.423   1.00 0.00 ? 21 LYS A HE2  2  
ATOM 1525  H HE3  . LYS A 1 21 ? -6.100  1.541   2.019   1.00 0.00 ? 21 LYS A HE3  2  
ATOM 1526  H HZ1  . LYS A 1 21 ? -4.700  3.268   2.076   1.00 0.00 ? 21 LYS A HZ1  2  
ATOM 1527  H HZ2  . LYS A 1 21 ? -5.696  3.928   0.872   1.00 0.00 ? 21 LYS A HZ2  2  
ATOM 1528  H HZ3  . LYS A 1 21 ? -4.266  3.119   0.439   1.00 0.00 ? 21 LYS A HZ3  2  
ATOM 1529  N N    . VAL A 1 22 ? -2.338  -1.734  -2.858  1.00 0.00 ? 22 VAL A N    2  
ATOM 1530  C CA   . VAL A 1 22 ? -1.136  -2.524  -3.244  1.00 0.00 ? 22 VAL A CA   2  
ATOM 1531  C C    . VAL A 1 22 ? 0.097   -1.965  -2.526  1.00 0.00 ? 22 VAL A C    2  
ATOM 1532  O O    . VAL A 1 22 ? 0.494   -0.842  -2.760  1.00 0.00 ? 22 VAL A O    2  
ATOM 1533  C CB   . VAL A 1 22 ? -0.955  -2.408  -4.764  1.00 0.00 ? 22 VAL A CB   2  
ATOM 1534  C CG1  . VAL A 1 22 ? -1.862  -3.415  -5.479  1.00 0.00 ? 22 VAL A CG1  2  
ATOM 1535  C CG2  . VAL A 1 22 ? -1.332  -0.994  -5.222  1.00 0.00 ? 22 VAL A CG2  2  
ATOM 1536  H H    . VAL A 1 22 ? -2.353  -0.763  -2.977  1.00 0.00 ? 22 VAL A H    2  
ATOM 1537  H HA   . VAL A 1 22 ? -1.263  -3.562  -2.973  1.00 0.00 ? 22 VAL A HA   2  
ATOM 1538  H HB   . VAL A 1 22 ? 0.070   -2.603  -5.020  1.00 0.00 ? 22 VAL A HB   2  
ATOM 1539  H HG11 . VAL A 1 22 ? -1.652  -4.410  -5.121  1.00 0.00 ? 22 VAL A HG11 2  
ATOM 1540  H HG12 . VAL A 1 22 ? -1.681  -3.370  -6.543  1.00 0.00 ? 22 VAL A HG12 2  
ATOM 1541  H HG13 . VAL A 1 22 ? -2.896  -3.171  -5.281  1.00 0.00 ? 22 VAL A HG13 2  
ATOM 1542  H HG21 . VAL A 1 22 ? -1.105  -0.885  -6.271  1.00 0.00 ? 22 VAL A HG21 2  
ATOM 1543  H HG22 . VAL A 1 22 ? -0.770  -0.268  -4.655  1.00 0.00 ? 22 VAL A HG22 2  
ATOM 1544  H HG23 . VAL A 1 22 ? -2.389  -0.833  -5.067  1.00 0.00 ? 22 VAL A HG23 2  
ATOM 1545  N N    . ILE A 1 23 ? 0.712   -2.737  -1.654  1.00 0.00 ? 23 ILE A N    2  
ATOM 1546  C CA   . ILE A 1 23 ? 1.929   -2.247  -0.925  1.00 0.00 ? 23 ILE A CA   2  
ATOM 1547  C C    . ILE A 1 23 ? 3.075   -3.242  -1.170  1.00 0.00 ? 23 ILE A C    2  
ATOM 1548  O O    . ILE A 1 23 ? 3.059   -4.365  -0.708  1.00 0.00 ? 23 ILE A O    2  
ATOM 1549  C CB   . ILE A 1 23 ? 1.638   -2.130  0.586   1.00 0.00 ? 23 ILE A CB   2  
ATOM 1550  C CG1  . ILE A 1 23 ? 0.419   -1.213  0.833   1.00 0.00 ? 23 ILE A CG1  2  
ATOM 1551  C CG2  . ILE A 1 23 ? 2.851   -1.518  1.296   1.00 0.00 ? 23 ILE A CG2  2  
ATOM 1552  C CD1  . ILE A 1 23 ? -0.903  -1.911  0.452   1.00 0.00 ? 23 ILE A CD1  2  
ATOM 1553  H H    . ILE A 1 23 ? 0.376   -3.644  -1.464  1.00 0.00 ? 23 ILE A H    2  
ATOM 1554  H HA   . ILE A 1 23 ? 2.226   -1.278  -1.305  1.00 0.00 ? 23 ILE A HA   2  
ATOM 1555  H HB   . ILE A 1 23 ? 1.444   -3.112  0.992   1.00 0.00 ? 23 ILE A HB   2  
ATOM 1556  H HG12 . ILE A 1 23 ? 0.384   -0.950  1.882   1.00 0.00 ? 23 ILE A HG12 2  
ATOM 1557  H HG13 . ILE A 1 23 ? 0.527   -0.308  0.249   1.00 0.00 ? 23 ILE A HG13 2  
ATOM 1558  H HG21 . ILE A 1 23 ? 3.753   -2.021  0.989   1.00 0.00 ? 23 ILE A HG21 2  
ATOM 1559  H HG22 . ILE A 1 23 ? 2.731   -1.621  2.365   1.00 0.00 ? 23 ILE A HG22 2  
ATOM 1560  H HG23 . ILE A 1 23 ? 2.922   -0.470  1.044   1.00 0.00 ? 23 ILE A HG23 2  
ATOM 1561  H HD11 . ILE A 1 23 ? -1.323  -1.431  -0.419  1.00 0.00 ? 23 ILE A HD11 2  
ATOM 1562  H HD12 . ILE A 1 23 ? -1.598  -1.826  1.273   1.00 0.00 ? 23 ILE A HD12 2  
ATOM 1563  H HD13 . ILE A 1 23 ? -0.735  -2.958  0.238   1.00 0.00 ? 23 ILE A HD13 2  
ATOM 1564  N N    . THR A 1 24 ? 4.068   -2.814  -1.898  1.00 0.00 ? 24 THR A N    2  
ATOM 1565  C CA   . THR A 1 24 ? 5.250   -3.676  -2.203  1.00 0.00 ? 24 THR A CA   2  
ATOM 1566  C C    . THR A 1 24 ? 6.527   -2.871  -1.967  1.00 0.00 ? 24 THR A C    2  
ATOM 1567  O O    . THR A 1 24 ? 6.758   -1.876  -2.623  1.00 0.00 ? 24 THR A O    2  
ATOM 1568  C CB   . THR A 1 24 ? 5.193   -4.122  -3.667  1.00 0.00 ? 24 THR A CB   2  
ATOM 1569  O OG1  . THR A 1 24 ? 6.506   -4.428  -4.117  1.00 0.00 ? 24 THR A OG1  2  
ATOM 1570  C CG2  . THR A 1 24 ? 4.607   -2.999  -4.523  1.00 0.00 ? 24 THR A CG2  2  
ATOM 1571  H H    . THR A 1 24 ? 4.038   -1.900  -2.223  1.00 0.00 ? 24 THR A H    2  
ATOM 1572  H HA   . THR A 1 24 ? 5.249   -4.545  -1.559  1.00 0.00 ? 24 THR A HA   2  
ATOM 1573  H HB   . THR A 1 24 ? 4.568   -4.998  -3.754  1.00 0.00 ? 24 THR A HB   2  
ATOM 1574  H HG1  . THR A 1 24 ? 7.057   -4.576  -3.345  1.00 0.00 ? 24 THR A HG1  2  
ATOM 1575  H HG21 . THR A 1 24 ? 4.684   -3.264  -5.567  1.00 0.00 ? 24 THR A HG21 2  
ATOM 1576  H HG22 . THR A 1 24 ? 5.154   -2.085  -4.342  1.00 0.00 ? 24 THR A HG22 2  
ATOM 1577  H HG23 . THR A 1 24 ? 3.569   -2.854  -4.263  1.00 0.00 ? 24 THR A HG23 2  
ATOM 1578  N N    . LYS A 1 25 ? 7.378   -3.303  -1.072  1.00 0.00 ? 25 LYS A N    2  
ATOM 1579  C CA   . LYS A 1 25 ? 8.661   -2.582  -0.834  1.00 0.00 ? 25 LYS A CA   2  
ATOM 1580  C C    . LYS A 1 25 ? 9.756   -3.580  -1.134  1.00 0.00 ? 25 LYS A C    2  
ATOM 1581  O O    . LYS A 1 25 ? 9.951   -4.524  -0.394  1.00 0.00 ? 25 LYS A O    2  
ATOM 1582  C CB   . LYS A 1 25 ? 8.745   -2.132  0.626   1.00 0.00 ? 25 LYS A CB   2  
ATOM 1583  C CG   . LYS A 1 25 ? 7.622   -1.134  0.918   1.00 0.00 ? 25 LYS A CG   2  
ATOM 1584  C CD   . LYS A 1 25 ? 7.545   -0.879  2.425   1.00 0.00 ? 25 LYS A CD   2  
ATOM 1585  C CE   . LYS A 1 25 ? 6.307   -0.038  2.739   1.00 0.00 ? 25 LYS A CE   2  
ATOM 1586  N NZ   . LYS A 1 25 ? 6.290   0.300   4.190   1.00 0.00 ? 25 LYS A NZ   2  
ATOM 1587  H H    . LYS A 1 25 ? 7.202   -4.138  -0.586  1.00 0.00 ? 25 LYS A H    2  
ATOM 1588  H HA   . LYS A 1 25 ? 8.759   -1.724  -1.494  1.00 0.00 ? 25 LYS A HA   2  
ATOM 1589  H HB2  . LYS A 1 25 ? 8.642   -2.988  1.272   1.00 0.00 ? 25 LYS A HB2  2  
ATOM 1590  H HB3  . LYS A 1 25 ? 9.699   -1.659  0.803   1.00 0.00 ? 25 LYS A HB3  2  
ATOM 1591  H HG2  . LYS A 1 25 ? 7.823   -0.205  0.404   1.00 0.00 ? 25 LYS A HG2  2  
ATOM 1592  H HG3  . LYS A 1 25 ? 6.682   -1.539  0.575   1.00 0.00 ? 25 LYS A HG3  2  
ATOM 1593  H HD2  . LYS A 1 25 ? 7.484   -1.823  2.947   1.00 0.00 ? 25 LYS A HD2  2  
ATOM 1594  H HD3  . LYS A 1 25 ? 8.429   -0.348  2.746   1.00 0.00 ? 25 LYS A HD3  2  
ATOM 1595  H HE2  . LYS A 1 25 ? 6.332   0.871   2.157   1.00 0.00 ? 25 LYS A HE2  2  
ATOM 1596  H HE3  . LYS A 1 25 ? 5.418   -0.600  2.490   1.00 0.00 ? 25 LYS A HE3  2  
ATOM 1597  H HZ1  . LYS A 1 25 ? 7.066   0.959   4.401   1.00 0.00 ? 25 LYS A HZ1  2  
ATOM 1598  H HZ2  . LYS A 1 25 ? 6.412   -0.567  4.750   1.00 0.00 ? 25 LYS A HZ2  2  
ATOM 1599  H HZ3  . LYS A 1 25 ? 5.381   0.745   4.432   1.00 0.00 ? 25 LYS A HZ3  2  
ATOM 1600  N N    . THR A 1 26 ? 10.452  -3.412  -2.224  1.00 0.00 ? 26 THR A N    2  
ATOM 1601  C CA   . THR A 1 26 ? 11.515  -4.390  -2.586  1.00 0.00 ? 26 THR A CA   2  
ATOM 1602  C C    . THR A 1 26 ? 12.890  -3.732  -2.489  1.00 0.00 ? 26 THR A C    2  
ATOM 1603  O O    . THR A 1 26 ? 13.165  -2.757  -3.160  1.00 0.00 ? 26 THR A O    2  
ATOM 1604  C CB   . THR A 1 26 ? 11.289  -4.867  -4.023  1.00 0.00 ? 26 THR A CB   2  
ATOM 1605  O OG1  . THR A 1 26 ? 9.982   -5.410  -4.141  1.00 0.00 ? 26 THR A OG1  2  
ATOM 1606  C CG2  . THR A 1 26 ? 12.322  -5.939  -4.375  1.00 0.00 ? 26 THR A CG2  2  
ATOM 1607  H H    . THR A 1 26 ? 10.257  -2.657  -2.818  1.00 0.00 ? 26 THR A H    2  
ATOM 1608  H HA   . THR A 1 26 ? 11.464  -5.241  -1.921  1.00 0.00 ? 26 THR A HA   2  
ATOM 1609  H HB   . THR A 1 26 ? 11.397  -4.034  -4.700  1.00 0.00 ? 26 THR A HB   2  
ATOM 1610  H HG1  . THR A 1 26 ? 9.853   -5.677  -5.055  1.00 0.00 ? 26 THR A HG1  2  
ATOM 1611  H HG21 . THR A 1 26 ? 13.299  -5.484  -4.458  1.00 0.00 ? 26 THR A HG21 2  
ATOM 1612  H HG22 . THR A 1 26 ? 12.059  -6.398  -5.316  1.00 0.00 ? 26 THR A HG22 2  
ATOM 1613  H HG23 . THR A 1 26 ? 12.340  -6.691  -3.599  1.00 0.00 ? 26 THR A HG23 2  
ATOM 1614  N N    . VAL A 1 27 ? 13.767  -4.264  -1.670  1.00 0.00 ? 27 VAL A N    2  
ATOM 1615  C CA   . VAL A 1 27 ? 15.138  -3.677  -1.542  1.00 0.00 ? 27 VAL A CA   2  
ATOM 1616  C C    . VAL A 1 27 ? 16.131  -4.585  -2.267  1.00 0.00 ? 27 VAL A C    2  
ATOM 1617  O O    . VAL A 1 27 ? 16.391  -5.695  -1.850  1.00 0.00 ? 27 VAL A O    2  
ATOM 1618  C CB   . VAL A 1 27 ? 15.520  -3.587  -0.063  1.00 0.00 ? 27 VAL A CB   2  
ATOM 1619  C CG1  . VAL A 1 27 ? 16.774  -2.724  0.089   1.00 0.00 ? 27 VAL A CG1  2  
ATOM 1620  C CG2  . VAL A 1 27 ? 14.369  -2.953  0.724   1.00 0.00 ? 27 VAL A CG2  2  
ATOM 1621  H H    . VAL A 1 27 ? 13.528  -5.057  -1.146  1.00 0.00 ? 27 VAL A H    2  
ATOM 1622  H HA   . VAL A 1 27 ? 15.167  -2.688  -1.981  1.00 0.00 ? 27 VAL A HA   2  
ATOM 1623  H HB   . VAL A 1 27 ? 15.718  -4.578  0.321   1.00 0.00 ? 27 VAL A HB   2  
ATOM 1624  H HG11 . VAL A 1 27 ? 17.599  -3.194  -0.425  1.00 0.00 ? 27 VAL A HG11 2  
ATOM 1625  H HG12 . VAL A 1 27 ? 17.014  -2.620  1.137   1.00 0.00 ? 27 VAL A HG12 2  
ATOM 1626  H HG13 . VAL A 1 27 ? 16.593  -1.748  -0.337  1.00 0.00 ? 27 VAL A HG13 2  
ATOM 1627  H HG21 . VAL A 1 27 ? 14.105  -2.007  0.274   1.00 0.00 ? 27 VAL A HG21 2  
ATOM 1628  H HG22 . VAL A 1 27 ? 14.678  -2.791  1.746   1.00 0.00 ? 27 VAL A HG22 2  
ATOM 1629  H HG23 . VAL A 1 27 ? 13.514  -3.611  0.705   1.00 0.00 ? 27 VAL A HG23 2  
ATOM 1630  N N    . THR A 1 28 ? 16.674  -4.117  -3.361  1.00 0.00 ? 28 THR A N    2  
ATOM 1631  C CA   . THR A 1 28 ? 17.648  -4.944  -4.143  1.00 0.00 ? 28 THR A CA   2  
ATOM 1632  C C    . THR A 1 28 ? 19.070  -4.430  -3.922  1.00 0.00 ? 28 THR A C    2  
ATOM 1633  O O    . THR A 1 28 ? 19.453  -3.403  -4.445  1.00 0.00 ? 28 THR A O    2  
ATOM 1634  C CB   . THR A 1 28 ? 17.307  -4.846  -5.632  1.00 0.00 ? 28 THR A CB   2  
ATOM 1635  O OG1  . THR A 1 28 ? 15.964  -5.264  -5.837  1.00 0.00 ? 28 THR A OG1  2  
ATOM 1636  C CG2  . THR A 1 28 ? 18.250  -5.743  -6.435  1.00 0.00 ? 28 THR A CG2  2  
ATOM 1637  H H    . THR A 1 28 ? 16.419  -3.219  -3.662  1.00 0.00 ? 28 THR A H    2  
ATOM 1638  H HA   . THR A 1 28 ? 17.589  -5.979  -3.834  1.00 0.00 ? 28 THR A HA   2  
ATOM 1639  H HB   . THR A 1 28 ? 17.420  -3.825  -5.962  1.00 0.00 ? 28 THR A HB   2  
ATOM 1640  H HG1  . THR A 1 28 ? 15.746  -5.119  -6.761  1.00 0.00 ? 28 THR A HG1  2  
ATOM 1641  H HG21 . THR A 1 28 ? 19.259  -5.364  -6.360  1.00 0.00 ? 28 THR A HG21 2  
ATOM 1642  H HG22 . THR A 1 28 ? 17.945  -5.750  -7.471  1.00 0.00 ? 28 THR A HG22 2  
ATOM 1643  H HG23 . THR A 1 28 ? 18.213  -6.747  -6.041  1.00 0.00 ? 28 THR A HG23 2  
ATOM 1644  N N    . ASN A 1 29 ? 19.860  -5.139  -3.155  1.00 0.00 ? 29 ASN A N    2  
ATOM 1645  C CA   . ASN A 1 29 ? 21.265  -4.699  -2.902  1.00 0.00 ? 29 ASN A CA   2  
ATOM 1646  C C    . ASN A 1 29 ? 22.209  -5.469  -3.826  1.00 0.00 ? 29 ASN A C    2  
ATOM 1647  O O    . ASN A 1 29 ? 22.258  -6.689  -3.812  1.00 0.00 ? 29 ASN A O    2  
ATOM 1648  C CB   . ASN A 1 29 ? 21.633  -4.987  -1.445  1.00 0.00 ? 29 ASN A CB   2  
ATOM 1649  C CG   . ASN A 1 29 ? 23.044  -4.469  -1.160  1.00 0.00 ? 29 ASN A CG   2  
ATOM 1650  O OD1  . ASN A 1 29 ? 23.840  -4.312  -2.064  1.00 0.00 ? 29 ASN A OD1  2  
ATOM 1651  N ND2  . ASN A 1 29 ? 23.391  -4.195  0.069   1.00 0.00 ? 29 ASN A ND2  2  
ATOM 1652  H H    . ASN A 1 29 ? 19.536  -5.963  -2.733  1.00 0.00 ? 29 ASN A H    2  
ATOM 1653  H HA   . ASN A 1 29 ? 21.361  -3.638  -3.092  1.00 0.00 ? 29 ASN A HA   2  
ATOM 1654  H HB2  . ASN A 1 29 ? 20.928  -4.493  -0.791  1.00 0.00 ? 29 ASN A HB2  2  
ATOM 1655  H HB3  . ASN A 1 29 ? 21.601  -6.051  -1.269  1.00 0.00 ? 29 ASN A HB3  2  
ATOM 1656  H HD21 . ASN A 1 29 ? 22.749  -4.321  0.798   1.00 0.00 ? 29 ASN A HD21 2  
ATOM 1657  H HD22 . ASN A 1 29 ? 24.292  -3.863  0.262   1.00 0.00 ? 29 ASN A HD22 2  
ATOM 1658  N N    . ALA A 1 30 ? 22.952  -4.760  -4.634  1.00 0.00 ? 30 ALA A N    2  
ATOM 1659  C CA   . ALA A 1 30 ? 23.898  -5.412  -5.583  1.00 0.00 ? 30 ALA A CA   2  
ATOM 1660  C C    . ALA A 1 30 ? 24.723  -6.484  -4.873  1.00 0.00 ? 30 ALA A C    2  
ATOM 1661  O O    . ALA A 1 30 ? 25.430  -7.247  -5.502  1.00 0.00 ? 30 ALA A O    2  
ATOM 1662  C CB   . ALA A 1 30 ? 24.840  -4.355  -6.164  1.00 0.00 ? 30 ALA A CB   2  
ATOM 1663  H H    . ALA A 1 30 ? 22.884  -3.783  -4.631  1.00 0.00 ? 30 ALA A H    2  
ATOM 1664  H HA   . ALA A 1 30 ? 23.339  -5.867  -6.387  1.00 0.00 ? 30 ALA A HA   2  
ATOM 1665  H HB1  . ALA A 1 30 ? 24.258  -3.573  -6.631  1.00 0.00 ? 30 ALA A HB1  2  
ATOM 1666  H HB2  . ALA A 1 30 ? 25.484  -4.812  -6.900  1.00 0.00 ? 30 ALA A HB2  2  
ATOM 1667  H HB3  . ALA A 1 30 ? 25.439  -3.932  -5.372  1.00 0.00 ? 30 ALA A HB3  2  
ATOM 1668  N N    . ASP A 1 31 ? 24.662  -6.552  -3.573  1.00 0.00 ? 31 ASP A N    2  
ATOM 1669  C CA   . ASP A 1 31 ? 25.469  -7.575  -2.858  1.00 0.00 ? 31 ASP A CA   2  
ATOM 1670  C C    . ASP A 1 31 ? 24.912  -8.970  -3.161  1.00 0.00 ? 31 ASP A C    2  
ATOM 1671  O O    . ASP A 1 31 ? 25.484  -9.968  -2.771  1.00 0.00 ? 31 ASP A O    2  
ATOM 1672  C CB   . ASP A 1 31 ? 25.415  -7.313  -1.350  1.00 0.00 ? 31 ASP A CB   2  
ATOM 1673  C CG   . ASP A 1 31 ? 26.317  -6.127  -1.002  1.00 0.00 ? 31 ASP A CG   2  
ATOM 1674  O OD1  . ASP A 1 31 ? 26.290  -5.153  -1.736  1.00 0.00 ? 31 ASP A OD1  2  
ATOM 1675  O OD2  . ASP A 1 31 ? 27.018  -6.213  -0.008  1.00 0.00 ? 31 ASP A OD2  2  
ATOM 1676  H H    . ASP A 1 31 ? 24.098  -5.930  -3.067  1.00 0.00 ? 31 ASP A H    2  
ATOM 1677  H HA   . ASP A 1 31 ? 26.494  -7.521  -3.195  1.00 0.00 ? 31 ASP A HA   2  
ATOM 1678  H HB2  . ASP A 1 31 ? 24.399  -7.089  -1.059  1.00 0.00 ? 31 ASP A HB2  2  
ATOM 1679  H HB3  . ASP A 1 31 ? 25.756  -8.189  -0.819  1.00 0.00 ? 31 ASP A HB3  2  
ATOM 1680  N N    . GLY A 1 32 ? 23.814  -9.052  -3.878  1.00 0.00 ? 32 GLY A N    2  
ATOM 1681  C CA   . GLY A 1 32 ? 23.245  -10.393 -4.231  1.00 0.00 ? 32 GLY A CA   2  
ATOM 1682  C C    . GLY A 1 32 ? 22.079  -10.756 -3.306  1.00 0.00 ? 32 GLY A C    2  
ATOM 1683  O O    . GLY A 1 32 ? 21.632  -11.885 -3.298  1.00 0.00 ? 32 GLY A O    2  
ATOM 1684  H H    . GLY A 1 32 ? 23.376  -8.236  -4.198  1.00 0.00 ? 32 GLY A H    2  
ATOM 1685  H HA2  . GLY A 1 32 ? 22.886  -10.363 -5.250  1.00 0.00 ? 32 GLY A HA2  2  
ATOM 1686  H HA3  . GLY A 1 32 ? 24.009  -11.151 -4.150  1.00 0.00 ? 32 GLY A HA3  2  
ATOM 1687  N N    . ARG A 1 33 ? 21.584  -9.821  -2.524  1.00 0.00 ? 33 ARG A N    2  
ATOM 1688  C CA   . ARG A 1 33 ? 20.440  -10.138 -1.593  1.00 0.00 ? 33 ARG A CA   2  
ATOM 1689  C C    . ARG A 1 33 ? 19.226  -9.273  -1.940  1.00 0.00 ? 33 ARG A C    2  
ATOM 1690  O O    . ARG A 1 33 ? 19.356  -8.149  -2.382  1.00 0.00 ? 33 ARG A O    2  
ATOM 1691  C CB   . ARG A 1 33 ? 20.861  -9.905  -0.126  1.00 0.00 ? 33 ARG A CB   2  
ATOM 1692  C CG   . ARG A 1 33 ? 21.191  -8.428  0.147   1.00 0.00 ? 33 ARG A CG   2  
ATOM 1693  C CD   . ARG A 1 33 ? 21.260  -8.202  1.660   1.00 0.00 ? 33 ARG A CD   2  
ATOM 1694  N NE   . ARG A 1 33 ? 21.584  -6.773  1.935   1.00 0.00 ? 33 ARG A NE   2  
ATOM 1695  C CZ   . ARG A 1 33 ? 21.404  -6.284  3.132   1.00 0.00 ? 33 ARG A CZ   2  
ATOM 1696  N NH1  . ARG A 1 33 ? 20.943  -7.046  4.086   1.00 0.00 ? 33 ARG A NH1  2  
ATOM 1697  N NH2  . ARG A 1 33 ? 21.687  -5.033  3.374   1.00 0.00 ? 33 ARG A NH2  2  
ATOM 1698  H H    . ARG A 1 33 ? 21.960  -8.915  -2.553  1.00 0.00 ? 33 ARG A H    2  
ATOM 1699  H HA   . ARG A 1 33 ? 20.154  -11.175 -1.705  1.00 0.00 ? 33 ARG A HA   2  
ATOM 1700  H HB2  . ARG A 1 33 ? 20.056  -10.212 0.524   1.00 0.00 ? 33 ARG A HB2  2  
ATOM 1701  H HB3  . ARG A 1 33 ? 21.734  -10.507 0.087   1.00 0.00 ? 33 ARG A HB3  2  
ATOM 1702  H HG2  . ARG A 1 33 ? 22.146  -8.179  -0.290  1.00 0.00 ? 33 ARG A HG2  2  
ATOM 1703  H HG3  . ARG A 1 33 ? 20.426  -7.793  -0.268  1.00 0.00 ? 33 ARG A HG3  2  
ATOM 1704  H HD2  . ARG A 1 33 ? 20.307  -8.447  2.105   1.00 0.00 ? 33 ARG A HD2  2  
ATOM 1705  H HD3  . ARG A 1 33 ? 22.028  -8.833  2.084   1.00 0.00 ? 33 ARG A HD3  2  
ATOM 1706  H HE   . ARG A 1 33 ? 21.931  -6.202  1.218   1.00 0.00 ? 33 ARG A HE   2  
ATOM 1707  H HH11 . ARG A 1 33 ? 20.727  -8.004  3.900   1.00 0.00 ? 33 ARG A HH11 2  
ATOM 1708  H HH12 . ARG A 1 33 ? 20.806  -6.670  5.003   1.00 0.00 ? 33 ARG A HH12 2  
ATOM 1709  H HH21 . ARG A 1 33 ? 22.041  -4.450  2.642   1.00 0.00 ? 33 ARG A HH21 2  
ATOM 1710  H HH22 . ARG A 1 33 ? 21.549  -4.657  4.290   1.00 0.00 ? 33 ARG A HH22 2  
ATOM 1711  N N    . THR A 1 34 ? 18.039  -9.796  -1.747  1.00 0.00 ? 34 THR A N    2  
ATOM 1712  C CA   . THR A 1 34 ? 16.811  -9.012  -2.070  1.00 0.00 ? 34 THR A CA   2  
ATOM 1713  C C    . THR A 1 34 ? 15.655  -9.450  -1.164  1.00 0.00 ? 34 THR A C    2  
ATOM 1714  O O    . THR A 1 34 ? 15.339  -10.619 -1.058  1.00 0.00 ? 34 THR A O    2  
ATOM 1715  C CB   . THR A 1 34 ? 16.428  -9.249  -3.533  1.00 0.00 ? 34 THR A CB   2  
ATOM 1716  O OG1  . THR A 1 34 ? 17.552  -8.991  -4.362  1.00 0.00 ? 34 THR A OG1  2  
ATOM 1717  C CG2  . THR A 1 34 ? 15.280  -8.315  -3.920  1.00 0.00 ? 34 THR A CG2  2  
ATOM 1718  H H    . THR A 1 34 ? 17.959  -10.707 -1.394  1.00 0.00 ? 34 THR A H    2  
ATOM 1719  H HA   . THR A 1 34 ? 17.003  -7.959  -1.918  1.00 0.00 ? 34 THR A HA   2  
ATOM 1720  H HB   . THR A 1 34 ? 16.112  -10.273 -3.662  1.00 0.00 ? 34 THR A HB   2  
ATOM 1721  H HG1  . THR A 1 34 ? 17.562  -9.649  -5.062  1.00 0.00 ? 34 THR A HG1  2  
ATOM 1722  H HG21 . THR A 1 34 ? 15.084  -8.405  -4.978  1.00 0.00 ? 34 THR A HG21 2  
ATOM 1723  H HG22 . THR A 1 34 ? 15.552  -7.296  -3.690  1.00 0.00 ? 34 THR A HG22 2  
ATOM 1724  H HG23 . THR A 1 34 ? 14.393  -8.585  -3.365  1.00 0.00 ? 34 THR A HG23 2  
ATOM 1725  N N    . GLU A 1 35 ? 15.017  -8.505  -0.517  1.00 0.00 ? 35 GLU A N    2  
ATOM 1726  C CA   . GLU A 1 35 ? 13.864  -8.816  0.389   1.00 0.00 ? 35 GLU A CA   2  
ATOM 1727  C C    . GLU A 1 35 ? 12.618  -8.111  -0.153  1.00 0.00 ? 35 GLU A C    2  
ATOM 1728  O O    . GLU A 1 35 ? 12.727  -7.119  -0.847  1.00 0.00 ? 35 GLU A O    2  
ATOM 1729  C CB   . GLU A 1 35 ? 14.169  -8.298  1.798   1.00 0.00 ? 35 GLU A CB   2  
ATOM 1730  C CG   . GLU A 1 35 ? 13.071  -8.757  2.759   1.00 0.00 ? 35 GLU A CG   2  
ATOM 1731  C CD   . GLU A 1 35 ? 13.446  -8.361  4.189   1.00 0.00 ? 35 GLU A CD   2  
ATOM 1732  O OE1  . GLU A 1 35 ? 14.251  -9.058  4.784   1.00 0.00 ? 35 GLU A OE1  2  
ATOM 1733  O OE2  . GLU A 1 35 ? 12.922  -7.367  4.664   1.00 0.00 ? 35 GLU A OE2  2  
ATOM 1734  H H    . GLU A 1 35 ? 15.297  -7.573  -0.634  1.00 0.00 ? 35 GLU A H    2  
ATOM 1735  H HA   . GLU A 1 35 ? 13.689  -9.883  0.425   1.00 0.00 ? 35 GLU A HA   2  
ATOM 1736  H HB2  . GLU A 1 35 ? 15.122  -8.688  2.125   1.00 0.00 ? 35 GLU A HB2  2  
ATOM 1737  H HB3  . GLU A 1 35 ? 14.206  -7.220  1.785   1.00 0.00 ? 35 GLU A HB3  2  
ATOM 1738  H HG2  . GLU A 1 35 ? 12.136  -8.287  2.488   1.00 0.00 ? 35 GLU A HG2  2  
ATOM 1739  H HG3  . GLU A 1 35 ? 12.966  -9.830  2.700   1.00 0.00 ? 35 GLU A HG3  2  
ATOM 1740  N N    . THR A 1 36 ? 11.435  -8.599  0.154   1.00 0.00 ? 36 THR A N    2  
ATOM 1741  C CA   . THR A 1 36 ? 10.197  -7.945  -0.346  1.00 0.00 ? 36 THR A CA   2  
ATOM 1742  C C    . THR A 1 36 ? 9.292   -7.693  0.846   1.00 0.00 ? 36 THR A C    2  
ATOM 1743  O O    . THR A 1 36 ? 8.757   -8.611  1.435   1.00 0.00 ? 36 THR A O    2  
ATOM 1744  C CB   . THR A 1 36 ? 9.492   -8.873  -1.338  1.00 0.00 ? 36 THR A CB   2  
ATOM 1745  O OG1  . THR A 1 36 ? 9.090   -10.060 -0.671  1.00 0.00 ? 36 THR A OG1  2  
ATOM 1746  C CG2  . THR A 1 36 ? 10.449  -9.224  -2.479  1.00 0.00 ? 36 THR A CG2  2  
ATOM 1747  H H    . THR A 1 36 ? 11.351  -9.389  0.727   1.00 0.00 ? 36 THR A H    2  
ATOM 1748  H HA   . THR A 1 36 ? 10.424  -7.005  -0.826  1.00 0.00 ? 36 THR A HA   2  
ATOM 1749  H HB   . THR A 1 36 ? 8.624   -8.376  -1.743  1.00 0.00 ? 36 THR A HB   2  
ATOM 1750  H HG1  . THR A 1 36 ? 8.233   -10.320 -1.018  1.00 0.00 ? 36 THR A HG1  2  
ATOM 1751  H HG21 . THR A 1 36 ? 10.686  -8.329  -3.037  1.00 0.00 ? 36 THR A HG21 2  
ATOM 1752  H HG22 . THR A 1 36 ? 9.982   -9.944  -3.133  1.00 0.00 ? 36 THR A HG22 2  
ATOM 1753  H HG23 . THR A 1 36 ? 11.357  -9.643  -2.070  1.00 0.00 ? 36 THR A HG23 2  
ATOM 1754  N N    . THR A 1 37 ? 9.101   -6.455  1.195   1.00 0.00 ? 37 THR A N    2  
ATOM 1755  C CA   . THR A 1 37 ? 8.212   -6.129  2.344   1.00 0.00 ? 37 THR A CA   2  
ATOM 1756  C C    . THR A 1 37 ? 6.851   -5.756  1.766   1.00 0.00 ? 37 THR A C    2  
ATOM 1757  O O    . THR A 1 37 ? 6.720   -4.782  1.058   1.00 0.00 ? 37 THR A O    2  
ATOM 1758  C CB   . THR A 1 37 ? 8.821   -4.947  3.145   1.00 0.00 ? 37 THR A CB   2  
ATOM 1759  O OG1  . THR A 1 37 ? 9.979   -4.480  2.470   1.00 0.00 ? 37 THR A OG1  2  
ATOM 1760  C CG2  . THR A 1 37 ? 9.218   -5.400  4.557   1.00 0.00 ? 37 THR A CG2  2  
ATOM 1761  H H    . THR A 1 37 ? 9.527   -5.727  0.686   1.00 0.00 ? 37 THR A H    2  
ATOM 1762  H HA   . THR A 1 37 ? 8.094   -6.999  2.989   1.00 0.00 ? 37 THR A HA   2  
ATOM 1763  H HB   . THR A 1 37 ? 8.105   -4.139  3.225   1.00 0.00 ? 37 THR A HB   2  
ATOM 1764  H HG1  . THR A 1 37 ? 9.868   -4.656  1.533   1.00 0.00 ? 37 THR A HG1  2  
ATOM 1765  H HG21 . THR A 1 37 ? 8.336   -5.708  5.098   1.00 0.00 ? 37 THR A HG21 2  
ATOM 1766  H HG22 . THR A 1 37 ? 9.692   -4.581  5.078   1.00 0.00 ? 37 THR A HG22 2  
ATOM 1767  H HG23 . THR A 1 37 ? 9.907   -6.229  4.489   1.00 0.00 ? 37 THR A HG23 2  
ATOM 1768  N N    . LYS A 1 38 ? 5.851   -6.541  2.061   1.00 0.00 ? 38 LYS A N    2  
ATOM 1769  C CA   . LYS A 1 38 ? 4.466   -6.289  1.557   1.00 0.00 ? 38 LYS A CA   2  
ATOM 1770  C C    . LYS A 1 38 ? 4.380   -6.672  0.079   1.00 0.00 ? 38 LYS A C    2  
ATOM 1771  O O    . LYS A 1 38 ? 5.381   -6.858  -0.584  1.00 0.00 ? 38 LYS A O    2  
ATOM 1772  C CB   . LYS A 1 38 ? 4.041   -4.825  1.762   1.00 0.00 ? 38 LYS A CB   2  
ATOM 1773  C CG   . LYS A 1 38 ? 4.324   -4.373  3.206   1.00 0.00 ? 38 LYS A CG   2  
ATOM 1774  C CD   . LYS A 1 38 ? 3.220   -4.882  4.141   1.00 0.00 ? 38 LYS A CD   2  
ATOM 1775  C CE   . LYS A 1 38 ? 3.456   -4.343  5.554   1.00 0.00 ? 38 LYS A CE   2  
ATOM 1776  N NZ   . LYS A 1 38 ? 2.214   -4.508  6.361   1.00 0.00 ? 38 LYS A NZ   2  
ATOM 1777  H H    . LYS A 1 38 ? 5.993   -7.320  2.626   1.00 0.00 ? 38 LYS A H    2  
ATOM 1778  H HA   . LYS A 1 38 ? 3.786   -6.926  2.108   1.00 0.00 ? 38 LYS A HA   2  
ATOM 1779  H HB2  . LYS A 1 38 ? 4.569   -4.191  1.073   1.00 0.00 ? 38 LYS A HB2  2  
ATOM 1780  H HB3  . LYS A 1 38 ? 2.983   -4.744  1.572   1.00 0.00 ? 38 LYS A HB3  2  
ATOM 1781  H HG2  . LYS A 1 38 ? 5.274   -4.760  3.536   1.00 0.00 ? 38 LYS A HG2  2  
ATOM 1782  H HG3  . LYS A 1 38 ? 4.347   -3.295  3.243   1.00 0.00 ? 38 LYS A HG3  2  
ATOM 1783  H HD2  . LYS A 1 38 ? 2.258   -4.542  3.782   1.00 0.00 ? 38 LYS A HD2  2  
ATOM 1784  H HD3  . LYS A 1 38 ? 3.234   -5.961  4.164   1.00 0.00 ? 38 LYS A HD3  2  
ATOM 1785  H HE2  . LYS A 1 38 ? 4.262   -4.890  6.018   1.00 0.00 ? 38 LYS A HE2  2  
ATOM 1786  H HE3  . LYS A 1 38 ? 3.713   -3.295  5.502   1.00 0.00 ? 38 LYS A HE3  2  
ATOM 1787  H HZ1  . LYS A 1 38 ? 2.265   -3.902  7.203   1.00 0.00 ? 38 LYS A HZ1  2  
ATOM 1788  H HZ2  . LYS A 1 38 ? 2.121   -5.500  6.655   1.00 0.00 ? 38 LYS A HZ2  2  
ATOM 1789  H HZ3  . LYS A 1 38 ? 1.389   -4.236  5.786   1.00 0.00 ? 38 LYS A HZ3  2  
ATOM 1790  N N    . GLU A 1 39 ? 3.185   -6.819  -0.438  1.00 0.00 ? 39 GLU A N    2  
ATOM 1791  C CA   . GLU A 1 39 ? 3.025   -7.222  -1.871  1.00 0.00 ? 39 GLU A CA   2  
ATOM 1792  C C    . GLU A 1 39 ? 1.815   -6.505  -2.482  1.00 0.00 ? 39 GLU A C    2  
ATOM 1793  O O    . GLU A 1 39 ? 1.644   -5.316  -2.310  1.00 0.00 ? 39 GLU A O    2  
ATOM 1794  C CB   . GLU A 1 39 ? 2.825   -8.740  -1.938  1.00 0.00 ? 39 GLU A CB   2  
ATOM 1795  C CG   . GLU A 1 39 ? 1.668   -9.152  -1.021  1.00 0.00 ? 39 GLU A CG   2  
ATOM 1796  C CD   . GLU A 1 39 ? 1.564   -10.677 -0.981  1.00 0.00 ? 39 GLU A CD   2  
ATOM 1797  O OE1  . GLU A 1 39 ? 2.594   -11.324 -1.077  1.00 0.00 ? 39 GLU A OE1  2  
ATOM 1798  O OE2  . GLU A 1 39 ? 0.457   -11.173 -0.856  1.00 0.00 ? 39 GLU A OE2  2  
ATOM 1799  H H    . GLU A 1 39 ? 2.393   -6.680  0.119   1.00 0.00 ? 39 GLU A H    2  
ATOM 1800  H HA   . GLU A 1 39 ? 3.914   -6.954  -2.427  1.00 0.00 ? 39 GLU A HA   2  
ATOM 1801  H HB2  . GLU A 1 39 ? 2.607   -9.033  -2.954  1.00 0.00 ? 39 GLU A HB2  2  
ATOM 1802  H HB3  . GLU A 1 39 ? 3.729   -9.234  -1.611  1.00 0.00 ? 39 GLU A HB3  2  
ATOM 1803  H HG2  . GLU A 1 39 ? 1.848   -8.777  -0.025  1.00 0.00 ? 39 GLU A HG2  2  
ATOM 1804  H HG3  . GLU A 1 39 ? 0.743   -8.741  -1.397  1.00 0.00 ? 39 GLU A HG3  2  
ATOM 1805  N N    . VAL A 1 40 ? 0.983   -7.214  -3.214  1.00 0.00 ? 40 VAL A N    2  
ATOM 1806  C CA   . VAL A 1 40 ? -0.209  -6.572  -3.859  1.00 0.00 ? 40 VAL A CA   2  
ATOM 1807  C C    . VAL A 1 40 ? -1.509  -7.183  -3.319  1.00 0.00 ? 40 VAL A C    2  
ATOM 1808  O O    . VAL A 1 40 ? -1.633  -8.383  -3.178  1.00 0.00 ? 40 VAL A O    2  
ATOM 1809  C CB   . VAL A 1 40 ? -0.135  -6.802  -5.372  1.00 0.00 ? 40 VAL A CB   2  
ATOM 1810  C CG1  . VAL A 1 40 ? 0.935   -5.892  -5.976  1.00 0.00 ? 40 VAL A CG1  2  
ATOM 1811  C CG2  . VAL A 1 40 ? 0.225   -8.263  -5.650  1.00 0.00 ? 40 VAL A CG2  2  
ATOM 1812  H H    . VAL A 1 40 ? 1.150   -8.168  -3.353  1.00 0.00 ? 40 VAL A H    2  
ATOM 1813  H HA   . VAL A 1 40 ? -0.207  -5.511  -3.665  1.00 0.00 ? 40 VAL A HA   2  
ATOM 1814  H HB   . VAL A 1 40 ? -1.093  -6.575  -5.818  1.00 0.00 ? 40 VAL A HB   2  
ATOM 1815  H HG11 . VAL A 1 40 ? 0.977   -6.046  -7.044  1.00 0.00 ? 40 VAL A HG11 2  
ATOM 1816  H HG12 . VAL A 1 40 ? 1.894   -6.126  -5.540  1.00 0.00 ? 40 VAL A HG12 2  
ATOM 1817  H HG13 . VAL A 1 40 ? 0.688   -4.860  -5.771  1.00 0.00 ? 40 VAL A HG13 2  
ATOM 1818  H HG21 . VAL A 1 40 ? 0.218   -8.440  -6.715  1.00 0.00 ? 40 VAL A HG21 2  
ATOM 1819  H HG22 . VAL A 1 40 ? -0.497  -8.909  -5.173  1.00 0.00 ? 40 VAL A HG22 2  
ATOM 1820  H HG23 . VAL A 1 40 ? 1.209   -8.472  -5.257  1.00 0.00 ? 40 VAL A HG23 2  
ATOM 1821  N N    . VAL A 1 41 ? -2.495  -6.356  -3.061  1.00 0.00 ? 41 VAL A N    2  
ATOM 1822  C CA   . VAL A 1 41 ? -3.819  -6.859  -2.579  1.00 0.00 ? 41 VAL A CA   2  
ATOM 1823  C C    . VAL A 1 41 ? -4.913  -6.150  -3.381  1.00 0.00 ? 41 VAL A C    2  
ATOM 1824  O O    . VAL A 1 41 ? -5.120  -4.962  -3.233  1.00 0.00 ? 41 VAL A O    2  
ATOM 1825  C CB   . VAL A 1 41 ? -3.981  -6.543  -1.089  1.00 0.00 ? 41 VAL A CB   2  
ATOM 1826  C CG1  . VAL A 1 41 ? -5.334  -7.068  -0.594  1.00 0.00 ? 41 VAL A CG1  2  
ATOM 1827  C CG2  . VAL A 1 41 ? -2.853  -7.217  -0.303  1.00 0.00 ? 41 VAL A CG2  2  
ATOM 1828  H H    . VAL A 1 41 ? -2.374  -5.400  -3.235  1.00 0.00 ? 41 VAL A H    2  
ATOM 1829  H HA   . VAL A 1 41 ? -3.893  -7.928  -2.737  1.00 0.00 ? 41 VAL A HA   2  
ATOM 1830  H HB   . VAL A 1 41 ? -3.937  -5.475  -0.942  1.00 0.00 ? 41 VAL A HB   2  
ATOM 1831  H HG11 . VAL A 1 41 ? -6.119  -6.402  -0.918  1.00 0.00 ? 41 VAL A HG11 2  
ATOM 1832  H HG12 . VAL A 1 41 ? -5.329  -7.120  0.486   1.00 0.00 ? 41 VAL A HG12 2  
ATOM 1833  H HG13 . VAL A 1 41 ? -5.509  -8.054  -1.000  1.00 0.00 ? 41 VAL A HG13 2  
ATOM 1834  H HG21 . VAL A 1 41 ? -1.904  -6.801  -0.609  1.00 0.00 ? 41 VAL A HG21 2  
ATOM 1835  H HG22 . VAL A 1 41 ? -2.861  -8.278  -0.500  1.00 0.00 ? 41 VAL A HG22 2  
ATOM 1836  H HG23 . VAL A 1 41 ? -2.998  -7.045  0.753   1.00 0.00 ? 41 VAL A HG23 2  
ATOM 1837  N N    . LYS A 1 42 ? -5.602  -6.859  -4.244  1.00 0.00 ? 42 LYS A N    2  
ATOM 1838  C CA   . LYS A 1 42 ? -6.673  -6.219  -5.078  1.00 0.00 ? 42 LYS A CA   2  
ATOM 1839  C C    . LYS A 1 42 ? -8.038  -6.799  -4.718  1.00 0.00 ? 42 LYS A C    2  
ATOM 1840  O O    . LYS A 1 42 ? -8.257  -7.993  -4.779  1.00 0.00 ? 42 LYS A O    2  
ATOM 1841  C CB   . LYS A 1 42 ? -6.384  -6.492  -6.556  1.00 0.00 ? 42 LYS A CB   2  
ATOM 1842  C CG   . LYS A 1 42 ? -5.178  -5.660  -6.999  1.00 0.00 ? 42 LYS A CG   2  
ATOM 1843  C CD   . LYS A 1 42 ? -4.659  -6.183  -8.341  1.00 0.00 ? 42 LYS A CD   2  
ATOM 1844  C CE   . LYS A 1 42 ? -5.718  -5.965  -9.424  1.00 0.00 ? 42 LYS A CE   2  
ATOM 1845  N NZ   . LYS A 1 42 ? -5.088  -6.102  -10.768 1.00 0.00 ? 42 LYS A NZ   2  
ATOM 1846  H H    . LYS A 1 42 ? -5.398  -7.810  -4.366  1.00 0.00 ? 42 LYS A H    2  
ATOM 1847  H HA   . LYS A 1 42 ? -6.689  -5.150  -4.915  1.00 0.00 ? 42 LYS A HA   2  
ATOM 1848  H HB2  . LYS A 1 42 ? -6.170  -7.542  -6.693  1.00 0.00 ? 42 LYS A HB2  2  
ATOM 1849  H HB3  . LYS A 1 42 ? -7.244  -6.218  -7.148  1.00 0.00 ? 42 LYS A HB3  2  
ATOM 1850  H HG2  . LYS A 1 42 ? -5.474  -4.627  -7.101  1.00 0.00 ? 42 LYS A HG2  2  
ATOM 1851  H HG3  . LYS A 1 42 ? -4.397  -5.738  -6.257  1.00 0.00 ? 42 LYS A HG3  2  
ATOM 1852  H HD2  . LYS A 1 42 ? -3.756  -5.652  -8.607  1.00 0.00 ? 42 LYS A HD2  2  
ATOM 1853  H HD3  . LYS A 1 42 ? -4.444  -7.238  -8.256  1.00 0.00 ? 42 LYS A HD3  2  
ATOM 1854  H HE2  . LYS A 1 42 ? -6.500  -6.703  -9.317  1.00 0.00 ? 42 LYS A HE2  2  
ATOM 1855  H HE3  . LYS A 1 42 ? -6.140  -4.976  -9.324  1.00 0.00 ? 42 LYS A HE3  2  
ATOM 1856  H HZ1  . LYS A 1 42 ? -5.806  -5.955  -11.505 1.00 0.00 ? 42 LYS A HZ1  2  
ATOM 1857  H HZ2  . LYS A 1 42 ? -4.684  -7.055  -10.867 1.00 0.00 ? 42 LYS A HZ2  2  
ATOM 1858  H HZ3  . LYS A 1 42 ? -4.333  -5.393  -10.871 1.00 0.00 ? 42 LYS A HZ3  2  
ATOM 1859  N N    . SER A 1 43 ? -8.959  -5.957  -4.343  1.00 0.00 ? 43 SER A N    2  
ATOM 1860  C CA   . SER A 1 43 ? -10.315 -6.444  -3.976  1.00 0.00 ? 43 SER A CA   2  
ATOM 1861  C C    . SER A 1 43 ? -11.080 -6.847  -5.236  1.00 0.00 ? 43 SER A C    2  
ATOM 1862  O O    . SER A 1 43 ? -10.592 -6.717  -6.342  1.00 0.00 ? 43 SER A O    2  
ATOM 1863  C CB   . SER A 1 43 ? -11.080 -5.328  -3.272  1.00 0.00 ? 43 SER A CB   2  
ATOM 1864  O OG   . SER A 1 43 ? -12.257 -5.867  -2.689  1.00 0.00 ? 43 SER A OG   2  
ATOM 1865  H H    . SER A 1 43 ? -8.758  -4.998  -4.299  1.00 0.00 ? 43 SER A H    2  
ATOM 1866  H HA   . SER A 1 43 ? -10.229 -7.294  -3.316  1.00 0.00 ? 43 SER A HA   2  
ATOM 1867  H HB2  . SER A 1 43 ? -10.464 -4.897  -2.504  1.00 0.00 ? 43 SER A HB2  2  
ATOM 1868  H HB3  . SER A 1 43 ? -11.340 -4.562  -3.992  1.00 0.00 ? 43 SER A HB3  2  
ATOM 1869  H HG   . SER A 1 43 ? -12.975 -5.760  -3.318  1.00 0.00 ? 43 SER A HG   2  
ATOM 1870  N N    . GLU A 1 44 ? -12.285 -7.328  -5.071  1.00 0.00 ? 44 GLU A N    2  
ATOM 1871  C CA   . GLU A 1 44 ? -13.112 -7.740  -6.245  1.00 0.00 ? 44 GLU A CA   2  
ATOM 1872  C C    . GLU A 1 44 ? -14.172 -6.668  -6.509  1.00 0.00 ? 44 GLU A C    2  
ATOM 1873  O O    . GLU A 1 44 ? -15.356 -6.911  -6.381  1.00 0.00 ? 44 GLU A O    2  
ATOM 1874  C CB   . GLU A 1 44 ? -13.805 -9.068  -5.932  1.00 0.00 ? 44 GLU A CB   2  
ATOM 1875  C CG   . GLU A 1 44 ? -12.751 -10.158 -5.726  1.00 0.00 ? 44 GLU A CG   2  
ATOM 1876  C CD   . GLU A 1 44 ? -13.445 -11.498 -5.479  1.00 0.00 ? 44 GLU A CD   2  
ATOM 1877  O OE1  . GLU A 1 44 ? -14.541 -11.678 -5.984  1.00 0.00 ? 44 GLU A OE1  2  
ATOM 1878  O OE2  . GLU A 1 44 ? -12.870 -12.323 -4.787  1.00 0.00 ? 44 GLU A OE2  2  
ATOM 1879  H H    . GLU A 1 44 ? -12.652 -7.414  -4.166  1.00 0.00 ? 44 GLU A H    2  
ATOM 1880  H HA   . GLU A 1 44 ? -12.489 -7.855  -7.122  1.00 0.00 ? 44 GLU A HA   2  
ATOM 1881  H HB2  . GLU A 1 44 ? -14.395 -8.963  -5.034  1.00 0.00 ? 44 GLU A HB2  2  
ATOM 1882  H HB3  . GLU A 1 44 ? -14.447 -9.342  -6.755  1.00 0.00 ? 44 GLU A HB3  2  
ATOM 1883  H HG2  . GLU A 1 44 ? -12.131 -10.230 -6.608  1.00 0.00 ? 44 GLU A HG2  2  
ATOM 1884  H HG3  . GLU A 1 44 ? -12.137 -9.910  -4.874  1.00 0.00 ? 44 GLU A HG3  2  
ATOM 1885  N N    . ASP A 1 45 ? -13.757 -5.484  -6.874  1.00 0.00 ? 45 ASP A N    2  
ATOM 1886  C CA   . ASP A 1 45 ? -14.737 -4.394  -7.149  1.00 0.00 ? 45 ASP A CA   2  
ATOM 1887  C C    . ASP A 1 45 ? -15.562 -4.101  -5.891  1.00 0.00 ? 45 ASP A C    2  
ATOM 1888  O O    . ASP A 1 45 ? -16.736 -4.407  -5.824  1.00 0.00 ? 45 ASP A O    2  
ATOM 1889  C CB   . ASP A 1 45 ? -15.670 -4.814  -8.290  1.00 0.00 ? 45 ASP A CB   2  
ATOM 1890  C CG   . ASP A 1 45 ? -16.367 -3.578  -8.865  1.00 0.00 ? 45 ASP A CG   2  
ATOM 1891  O OD1  . ASP A 1 45 ? -15.778 -2.931  -9.715  1.00 0.00 ? 45 ASP A OD1  2  
ATOM 1892  O OD2  . ASP A 1 45 ? -17.478 -3.300  -8.444  1.00 0.00 ? 45 ASP A OD2  2  
ATOM 1893  H H    . ASP A 1 45 ? -12.799 -5.304  -6.972  1.00 0.00 ? 45 ASP A H    2  
ATOM 1894  H HA   . ASP A 1 45 ? -14.200 -3.501  -7.436  1.00 0.00 ? 45 ASP A HA   2  
ATOM 1895  H HB2  . ASP A 1 45 ? -15.092 -5.294  -9.067  1.00 0.00 ? 45 ASP A HB2  2  
ATOM 1896  H HB3  . ASP A 1 45 ? -16.413 -5.501  -7.918  1.00 0.00 ? 45 ASP A HB3  2  
ATOM 1897  N N    . GLY A 1 46 ? -14.961 -3.500  -4.899  1.00 0.00 ? 46 GLY A N    2  
ATOM 1898  C CA   . GLY A 1 46 ? -15.717 -3.177  -3.655  1.00 0.00 ? 46 GLY A CA   2  
ATOM 1899  C C    . GLY A 1 46 ? -16.697 -2.042  -3.952  1.00 0.00 ? 46 GLY A C    2  
ATOM 1900  O O    . GLY A 1 46 ? -16.493 -0.913  -3.556  1.00 0.00 ? 46 GLY A O    2  
ATOM 1901  H H    . GLY A 1 46 ? -14.015 -3.253  -4.975  1.00 0.00 ? 46 GLY A H    2  
ATOM 1902  H HA2  . GLY A 1 46 ? -16.262 -4.052  -3.327  1.00 0.00 ? 46 GLY A HA2  2  
ATOM 1903  H HA3  . GLY A 1 46 ? -15.032 -2.866  -2.883  1.00 0.00 ? 46 GLY A HA3  2  
ATOM 1904  N N    . SER A 1 47 ? -17.747 -2.339  -4.669  1.00 0.00 ? 47 SER A N    2  
ATOM 1905  C CA   . SER A 1 47 ? -18.749 -1.294  -5.031  1.00 0.00 ? 47 SER A CA   2  
ATOM 1906  C C    . SER A 1 47 ? -19.012 -0.346  -3.857  1.00 0.00 ? 47 SER A C    2  
ATOM 1907  O O    . SER A 1 47 ? -19.265 0.826   -4.056  1.00 0.00 ? 47 SER A O    2  
ATOM 1908  C CB   . SER A 1 47 ? -20.058 -1.974  -5.428  1.00 0.00 ? 47 SER A CB   2  
ATOM 1909  O OG   . SER A 1 47 ? -20.485 -2.823  -4.371  1.00 0.00 ? 47 SER A OG   2  
ATOM 1910  H H    . SER A 1 47 ? -17.868 -3.256  -4.990  1.00 0.00 ? 47 SER A H    2  
ATOM 1911  H HA   . SER A 1 47 ? -18.379 -0.725  -5.871  1.00 0.00 ? 47 SER A HA   2  
ATOM 1912  H HB2  . SER A 1 47 ? -20.813 -1.228  -5.610  1.00 0.00 ? 47 SER A HB2  2  
ATOM 1913  H HB3  . SER A 1 47 ? -19.904 -2.553  -6.329  1.00 0.00 ? 47 SER A HB3  2  
ATOM 1914  H HG   . SER A 1 47 ? -20.498 -2.306  -3.562  1.00 0.00 ? 47 SER A HG   2  
ATOM 1915  N N    . ASP A 1 48 ? -18.979 -0.837  -2.638  1.00 0.00 ? 48 ASP A N    2  
ATOM 1916  C CA   . ASP A 1 48 ? -19.253 0.041   -1.454  1.00 0.00 ? 48 ASP A CA   2  
ATOM 1917  C C    . ASP A 1 48 ? -18.032 0.079   -0.534  1.00 0.00 ? 48 ASP A C    2  
ATOM 1918  O O    . ASP A 1 48 ? -18.163 0.058   0.675   1.00 0.00 ? 48 ASP A O    2  
ATOM 1919  C CB   . ASP A 1 48 ? -20.446 -0.525  -0.681  1.00 0.00 ? 48 ASP A CB   2  
ATOM 1920  C CG   . ASP A 1 48 ? -21.639 -0.676  -1.626  1.00 0.00 ? 48 ASP A CG   2  
ATOM 1921  O OD1  . ASP A 1 48 ? -21.867 0.231   -2.411  1.00 0.00 ? 48 ASP A OD1  2  
ATOM 1922  O OD2  . ASP A 1 48 ? -22.305 -1.695  -1.551  1.00 0.00 ? 48 ASP A OD2  2  
ATOM 1923  H H    . ASP A 1 48 ? -18.790 -1.787  -2.494  1.00 0.00 ? 48 ASP A H    2  
ATOM 1924  H HA   . ASP A 1 48 ? -19.485 1.048   -1.774  1.00 0.00 ? 48 ASP A HA   2  
ATOM 1925  H HB2  . ASP A 1 48 ? -20.184 -1.491  -0.273  1.00 0.00 ? 48 ASP A HB2  2  
ATOM 1926  H HB3  . ASP A 1 48 ? -20.708 0.147   0.122   1.00 0.00 ? 48 ASP A HB3  2  
ATOM 1927  N N    . CYS A 1 49 ? -16.847 0.143   -1.093  1.00 0.00 ? 49 CYS A N    2  
ATOM 1928  C CA   . CYS A 1 49 ? -15.607 0.190   -0.252  1.00 0.00 ? 49 CYS A CA   2  
ATOM 1929  C C    . CYS A 1 49 ? -14.898 1.526   -0.466  1.00 0.00 ? 49 CYS A C    2  
ATOM 1930  O O    . CYS A 1 49 ? -14.876 2.058   -1.558  1.00 0.00 ? 49 CYS A O    2  
ATOM 1931  C CB   . CYS A 1 49 ? -14.654 -0.933  -0.660  1.00 0.00 ? 49 CYS A CB   2  
ATOM 1932  S SG   . CYS A 1 49 ? -13.072 -0.710  0.198   1.00 0.00 ? 49 CYS A SG   2  
ATOM 1933  H H    . CYS A 1 49 ? -16.771 0.159   -2.070  1.00 0.00 ? 49 CYS A H    2  
ATOM 1934  H HA   . CYS A 1 49 ? -15.858 0.081   0.793   1.00 0.00 ? 49 CYS A HA   2  
ATOM 1935  H HB2  . CYS A 1 49 ? -15.082 -1.886  -0.390  1.00 0.00 ? 49 CYS A HB2  2  
ATOM 1936  H HB3  . CYS A 1 49 ? -14.493 -0.898  -1.727  1.00 0.00 ? 49 CYS A HB3  2  
ATOM 1937  N N    . GLY A 1 50 ? -14.308 2.065   0.570   1.00 0.00 ? 50 GLY A N    2  
ATOM 1938  C CA   . GLY A 1 50 ? -13.584 3.370   0.430   1.00 0.00 ? 50 GLY A CA   2  
ATOM 1939  C C    . GLY A 1 50 ? -14.425 4.343   -0.394  1.00 0.00 ? 50 GLY A C    2  
ATOM 1940  O O    . GLY A 1 50 ? -14.125 4.610   -1.537  1.00 0.00 ? 50 GLY A O    2  
ATOM 1941  H H    . GLY A 1 50 ? -14.337 1.605   1.439   1.00 0.00 ? 50 GLY A H    2  
ATOM 1942  H HA2  . GLY A 1 50 ? -13.401 3.795   1.407   1.00 0.00 ? 50 GLY A HA2  2  
ATOM 1943  H HA3  . GLY A 1 50 ? -12.641 3.208   -0.070  1.00 0.00 ? 50 GLY A HA3  2  
ATOM 1944  N N    . ASP A 1 51 ? -15.477 4.863   0.177   1.00 0.00 ? 51 ASP A N    2  
ATOM 1945  C CA   . ASP A 1 51 ? -16.350 5.818   -0.570  1.00 0.00 ? 51 ASP A CA   2  
ATOM 1946  C C    . ASP A 1 51 ? -16.754 5.208   -1.915  1.00 0.00 ? 51 ASP A C    2  
ATOM 1947  O O    . ASP A 1 51 ? -17.833 4.669   -2.054  1.00 0.00 ? 51 ASP A O    2  
ATOM 1948  C CB   . ASP A 1 51 ? -15.600 7.131   -0.805  1.00 0.00 ? 51 ASP A CB   2  
ATOM 1949  C CG   . ASP A 1 51 ? -16.560 8.169   -1.389  1.00 0.00 ? 51 ASP A CG   2  
ATOM 1950  O OD1  . ASP A 1 51 ? -17.497 7.769   -2.062  1.00 0.00 ? 51 ASP A OD1  2  
ATOM 1951  O OD2  . ASP A 1 51 ? -16.341 9.347   -1.156  1.00 0.00 ? 51 ASP A OD2  2  
ATOM 1952  H H    . ASP A 1 51 ? -15.699 4.619   1.099   1.00 0.00 ? 51 ASP A H    2  
ATOM 1953  H HA   . ASP A 1 51 ? -17.239 6.013   0.012   1.00 0.00 ? 51 ASP A HA   2  
ATOM 1954  H HB2  . ASP A 1 51 ? -15.207 7.493   0.133   1.00 0.00 ? 51 ASP A HB2  2  
ATOM 1955  H HB3  . ASP A 1 51 ? -14.790 6.965   -1.496  1.00 0.00 ? 51 ASP A HB3  2  
ATOM 1956  N N    . ALA A 1 52 ? -15.898 5.291   -2.909  1.00 0.00 ? 52 ALA A N    2  
ATOM 1957  C CA   . ALA A 1 52 ? -16.226 4.721   -4.251  1.00 0.00 ? 52 ALA A CA   2  
ATOM 1958  C C    . ALA A 1 52 ? -15.111 3.774   -4.693  1.00 0.00 ? 52 ALA A C    2  
ATOM 1959  O O    . ALA A 1 52 ? -14.818 3.661   -5.866  1.00 0.00 ? 52 ALA A O    2  
ATOM 1960  C CB   . ALA A 1 52 ? -16.356 5.857   -5.267  1.00 0.00 ? 52 ALA A CB   2  
ATOM 1961  H H    . ALA A 1 52 ? -15.031 5.734   -2.775  1.00 0.00 ? 52 ALA A H    2  
ATOM 1962  H HA   . ALA A 1 52 ? -17.158 4.173   -4.209  1.00 0.00 ? 52 ALA A HA   2  
ATOM 1963  H HB1  . ALA A 1 52 ? -15.505 6.514   -5.183  1.00 0.00 ? 52 ALA A HB1  2  
ATOM 1964  H HB2  . ALA A 1 52 ? -17.261 6.412   -5.073  1.00 0.00 ? 52 ALA A HB2  2  
ATOM 1965  H HB3  . ALA A 1 52 ? -16.394 5.444   -6.265  1.00 0.00 ? 52 ALA A HB3  2  
ATOM 1966  N N    . ASP A 1 53 ? -14.507 3.067   -3.775  1.00 0.00 ? 53 ASP A N    2  
ATOM 1967  C CA   . ASP A 1 53 ? -13.436 2.096   -4.163  1.00 0.00 ? 53 ASP A CA   2  
ATOM 1968  C C    . ASP A 1 53 ? -12.311 2.802   -4.925  1.00 0.00 ? 53 ASP A C    2  
ATOM 1969  O O    . ASP A 1 53 ? -12.482 3.220   -6.053  1.00 0.00 ? 53 ASP A O    2  
ATOM 1970  C CB   . ASP A 1 53 ? -14.025 0.999   -5.063  1.00 0.00 ? 53 ASP A CB   2  
ATOM 1971  C CG   . ASP A 1 53 ? -13.027 -0.156  -5.169  1.00 0.00 ? 53 ASP A CG   2  
ATOM 1972  O OD1  . ASP A 1 53 ? -12.022 0.013   -5.840  1.00 0.00 ? 53 ASP A OD1  2  
ATOM 1973  O OD2  . ASP A 1 53 ? -13.286 -1.192  -4.578  1.00 0.00 ? 53 ASP A OD2  2  
ATOM 1974  H H    . ASP A 1 53 ? -14.768 3.134   -2.825  1.00 0.00 ? 53 ASP A H    2  
ATOM 1975  H HA   . ASP A 1 53 ? -13.036 1.640   -3.271  1.00 0.00 ? 53 ASP A HA   2  
ATOM 1976  H HB2  . ASP A 1 53 ? -14.951 0.634   -4.644  1.00 0.00 ? 53 ASP A HB2  2  
ATOM 1977  H HB3  . ASP A 1 53 ? -14.209 1.399   -6.049  1.00 0.00 ? 53 ASP A HB3  2  
ATOM 1978  N N    . PHE A 1 54 ? -11.154 2.915   -4.331  1.00 0.00 ? 54 PHE A N    2  
ATOM 1979  C CA   . PHE A 1 54 ? -10.017 3.569   -5.040  1.00 0.00 ? 54 PHE A CA   2  
ATOM 1980  C C    . PHE A 1 54 ? -8.721  3.325   -4.266  1.00 0.00 ? 54 PHE A C    2  
ATOM 1981  O O    . PHE A 1 54 ? -8.373  2.200   -3.969  1.00 0.00 ? 54 PHE A O    2  
ATOM 1982  C CB   . PHE A 1 54 ? -10.277 5.073   -5.163  1.00 0.00 ? 54 PHE A CB   2  
ATOM 1983  C CG   . PHE A 1 54 ? -9.360  5.667   -6.216  1.00 0.00 ? 54 PHE A CG   2  
ATOM 1984  C CD1  . PHE A 1 54 ? -9.487  5.275   -7.555  1.00 0.00 ? 54 PHE A CD1  2  
ATOM 1985  C CD2  . PHE A 1 54 ? -8.388  6.611   -5.853  1.00 0.00 ? 54 PHE A CD2  2  
ATOM 1986  C CE1  . PHE A 1 54 ? -8.642  5.823   -8.528  1.00 0.00 ? 54 PHE A CE1  2  
ATOM 1987  C CE2  . PHE A 1 54 ? -7.545  7.157   -6.828  1.00 0.00 ? 54 PHE A CE2  2  
ATOM 1988  C CZ   . PHE A 1 54 ? -7.672  6.763   -8.165  1.00 0.00 ? 54 PHE A CZ   2  
ATOM 1989  H H    . PHE A 1 54 ? -11.028 2.559   -3.424  1.00 0.00 ? 54 PHE A H    2  
ATOM 1990  H HA   . PHE A 1 54 ? -9.925  3.138   -6.027  1.00 0.00 ? 54 PHE A HA   2  
ATOM 1991  H HB2  . PHE A 1 54 ? -11.306 5.235   -5.451  1.00 0.00 ? 54 PHE A HB2  2  
ATOM 1992  H HB3  . PHE A 1 54 ? -10.092 5.549   -4.212  1.00 0.00 ? 54 PHE A HB3  2  
ATOM 1993  H HD1  . PHE A 1 54 ? -10.237 4.553   -7.839  1.00 0.00 ? 54 PHE A HD1  2  
ATOM 1994  H HD2  . PHE A 1 54 ? -8.289  6.918   -4.824  1.00 0.00 ? 54 PHE A HD2  2  
ATOM 1995  H HE1  . PHE A 1 54 ? -8.741  5.519   -9.560  1.00 0.00 ? 54 PHE A HE1  2  
ATOM 1996  H HE2  . PHE A 1 54 ? -6.795  7.883   -6.549  1.00 0.00 ? 54 PHE A HE2  2  
ATOM 1997  H HZ   . PHE A 1 54 ? -7.020  7.185   -8.916  1.00 0.00 ? 54 PHE A HZ   2  
ATOM 1998  N N    . ASP A 1 55 ? -8.005  4.367   -3.939  1.00 0.00 ? 55 ASP A N    2  
ATOM 1999  C CA   . ASP A 1 55 ? -6.727  4.192   -3.183  1.00 0.00 ? 55 ASP A CA   2  
ATOM 2000  C C    . ASP A 1 55 ? -5.745  3.356   -4.020  1.00 0.00 ? 55 ASP A C    2  
ATOM 2001  O O    . ASP A 1 55 ? -6.082  2.291   -4.494  1.00 0.00 ? 55 ASP A O    2  
ATOM 2002  C CB   . ASP A 1 55 ? -7.020  3.479   -1.852  1.00 0.00 ? 55 ASP A CB   2  
ATOM 2003  C CG   . ASP A 1 55 ? -8.330  4.010   -1.268  1.00 0.00 ? 55 ASP A CG   2  
ATOM 2004  O OD1  . ASP A 1 55 ? -9.376  3.598   -1.740  1.00 0.00 ? 55 ASP A OD1  2  
ATOM 2005  O OD2  . ASP A 1 55 ? -8.264  4.819   -0.358  1.00 0.00 ? 55 ASP A OD2  2  
ATOM 2006  H H    . ASP A 1 55 ? -8.308  5.264   -4.191  1.00 0.00 ? 55 ASP A H    2  
ATOM 2007  H HA   . ASP A 1 55 ? -6.292  5.161   -2.984  1.00 0.00 ? 55 ASP A HA   2  
ATOM 2008  H HB2  . ASP A 1 55 ? -7.106  2.415   -2.018  1.00 0.00 ? 55 ASP A HB2  2  
ATOM 2009  H HB3  . ASP A 1 55 ? -6.219  3.669   -1.152  1.00 0.00 ? 55 ASP A HB3  2  
ATOM 2010  N N    . TRP A 1 56 ? -4.534  3.833   -4.213  1.00 0.00 ? 56 TRP A N    2  
ATOM 2011  C CA   . TRP A 1 56 ? -3.529  3.066   -5.021  1.00 0.00 ? 56 TRP A CA   2  
ATOM 2012  C C    . TRP A 1 56 ? -2.209  2.984   -4.247  1.00 0.00 ? 56 TRP A C    2  
ATOM 2013  O O    . TRP A 1 56 ? -1.922  2.005   -3.589  1.00 0.00 ? 56 TRP A O    2  
ATOM 2014  C CB   . TRP A 1 56 ? -3.291  3.791   -6.349  1.00 0.00 ? 56 TRP A CB   2  
ATOM 2015  C CG   . TRP A 1 56 ? -4.476  3.606   -7.242  1.00 0.00 ? 56 TRP A CG   2  
ATOM 2016  C CD1  . TRP A 1 56 ? -5.325  4.590   -7.617  1.00 0.00 ? 56 TRP A CD1  2  
ATOM 2017  C CD2  . TRP A 1 56 ? -4.956  2.386   -7.878  1.00 0.00 ? 56 TRP A CD2  2  
ATOM 2018  N NE1  . TRP A 1 56 ? -6.296  4.051   -8.443  1.00 0.00 ? 56 TRP A NE1  2  
ATOM 2019  C CE2  . TRP A 1 56 ? -6.111  2.697   -8.634  1.00 0.00 ? 56 TRP A CE2  2  
ATOM 2020  C CE3  . TRP A 1 56 ? -4.505  1.053   -7.873  1.00 0.00 ? 56 TRP A CE3  2  
ATOM 2021  C CZ2  . TRP A 1 56 ? -6.794  1.720   -9.359  1.00 0.00 ? 56 TRP A CZ2  2  
ATOM 2022  C CZ3  . TRP A 1 56 ? -5.192  0.068   -8.602  1.00 0.00 ? 56 TRP A CZ3  2  
ATOM 2023  C CH2  . TRP A 1 56 ? -6.334  0.401   -9.343  1.00 0.00 ? 56 TRP A CH2  2  
ATOM 2024  H H    . TRP A 1 56 ? -4.283  4.701   -3.829  1.00 0.00 ? 56 TRP A H    2  
ATOM 2025  H HA   . TRP A 1 56 ? -3.887  2.066   -5.217  1.00 0.00 ? 56 TRP A HA   2  
ATOM 2026  H HB2  . TRP A 1 56 ? -3.143  4.844   -6.161  1.00 0.00 ? 56 TRP A HB2  2  
ATOM 2027  H HB3  . TRP A 1 56 ? -2.413  3.384   -6.828  1.00 0.00 ? 56 TRP A HB3  2  
ATOM 2028  H HD1  . TRP A 1 56 ? -5.257  5.626   -7.320  1.00 0.00 ? 56 TRP A HD1  2  
ATOM 2029  H HE1  . TRP A 1 56 ? -7.032  4.552   -8.852  1.00 0.00 ? 56 TRP A HE1  2  
ATOM 2030  H HE3  . TRP A 1 56 ? -3.627  0.786   -7.305  1.00 0.00 ? 56 TRP A HE3  2  
ATOM 2031  H HZ2  . TRP A 1 56 ? -7.675  1.983   -9.928  1.00 0.00 ? 56 TRP A HZ2  2  
ATOM 2032  H HZ3  . TRP A 1 56 ? -4.837  -0.952  -8.591  1.00 0.00 ? 56 TRP A HZ3  2  
ATOM 2033  H HH2  . TRP A 1 56 ? -6.858  -0.360  -9.902  1.00 0.00 ? 56 TRP A HH2  2  
ATOM 2034  N N    . HIS A 1 57 ? -1.411  4.013   -4.327  1.00 0.00 ? 57 HIS A N    2  
ATOM 2035  C CA   . HIS A 1 57 ? -0.104  4.028   -3.606  1.00 0.00 ? 57 HIS A CA   2  
ATOM 2036  C C    . HIS A 1 57 ? 0.815   2.934   -4.159  1.00 0.00 ? 57 HIS A C    2  
ATOM 2037  O O    . HIS A 1 57 ? 0.414   1.800   -4.333  1.00 0.00 ? 57 HIS A O    2  
ATOM 2038  C CB   . HIS A 1 57 ? -0.336  3.803   -2.108  1.00 0.00 ? 57 HIS A CB   2  
ATOM 2039  C CG   . HIS A 1 57 ? -1.556  4.567   -1.671  1.00 0.00 ? 57 HIS A CG   2  
ATOM 2040  N ND1  . HIS A 1 57 ? -2.213  4.295   -0.481  1.00 0.00 ? 57 HIS A ND1  2  
ATOM 2041  C CD2  . HIS A 1 57 ? -2.248  5.600   -2.253  1.00 0.00 ? 57 HIS A CD2  2  
ATOM 2042  C CE1  . HIS A 1 57 ? -3.250  5.147   -0.387  1.00 0.00 ? 57 HIS A CE1  2  
ATOM 2043  N NE2  . HIS A 1 57 ? -3.318  5.965   -1.441  1.00 0.00 ? 57 HIS A NE2  2  
ATOM 2044  H H    . HIS A 1 57 ? -1.674  4.783   -4.866  1.00 0.00 ? 57 HIS A H    2  
ATOM 2045  H HA   . HIS A 1 57 ? 0.367   4.989   -3.750  1.00 0.00 ? 57 HIS A HA   2  
ATOM 2046  H HB2  . HIS A 1 57 ? -0.479  2.750   -1.913  1.00 0.00 ? 57 HIS A HB2  2  
ATOM 2047  H HB3  . HIS A 1 57 ? 0.522   4.156   -1.554  1.00 0.00 ? 57 HIS A HB3  2  
ATOM 2048  H HD1  . HIS A 1 57 ? -1.968  3.606   0.172   1.00 0.00 ? 57 HIS A HD1  2  
ATOM 2049  H HD2  . HIS A 1 57 ? -1.999  6.060   -3.198  1.00 0.00 ? 57 HIS A HD2  2  
ATOM 2050  H HE1  . HIS A 1 57 ? -3.943  5.169   0.441   1.00 0.00 ? 57 HIS A HE1  2  
ATOM 2051  N N    . HIS A 1 58 ? 2.050   3.270   -4.433  1.00 0.00 ? 58 HIS A N    2  
ATOM 2052  C CA   . HIS A 1 58 ? 3.011   2.258   -4.975  1.00 0.00 ? 58 HIS A CA   2  
ATOM 2053  C C    . HIS A 1 58 ? 4.426   2.589   -4.493  1.00 0.00 ? 58 HIS A C    2  
ATOM 2054  O O    . HIS A 1 58 ? 5.127   3.379   -5.095  1.00 0.00 ? 58 HIS A O    2  
ATOM 2055  C CB   . HIS A 1 58 ? 2.985   2.278   -6.507  1.00 0.00 ? 58 HIS A CB   2  
ATOM 2056  C CG   . HIS A 1 58 ? 1.597   1.970   -6.994  1.00 0.00 ? 58 HIS A CG   2  
ATOM 2057  N ND1  . HIS A 1 58 ? 0.875   2.854   -7.781  1.00 0.00 ? 58 HIS A ND1  2  
ATOM 2058  C CD2  . HIS A 1 58 ? 0.790   0.875   -6.822  1.00 0.00 ? 58 HIS A CD2  2  
ATOM 2059  C CE1  . HIS A 1 58 ? -0.311  2.280   -8.050  1.00 0.00 ? 58 HIS A CE1  2  
ATOM 2060  N NE2  . HIS A 1 58 ? -0.415  1.072   -7.489  1.00 0.00 ? 58 HIS A NE2  2  
ATOM 2061  H H    . HIS A 1 58 ? 2.348   4.193   -4.281  1.00 0.00 ? 58 HIS A H    2  
ATOM 2062  H HA   . HIS A 1 58 ? 2.737   1.272   -4.624  1.00 0.00 ? 58 HIS A HA   2  
ATOM 2063  H HB2  . HIS A 1 58 ? 3.285   3.253   -6.864  1.00 0.00 ? 58 HIS A HB2  2  
ATOM 2064  H HB3  . HIS A 1 58 ? 3.671   1.533   -6.887  1.00 0.00 ? 58 HIS A HB3  2  
ATOM 2065  H HD1  . HIS A 1 58 ? 1.174   3.736   -8.085  1.00 0.00 ? 58 HIS A HD1  2  
ATOM 2066  H HD2  . HIS A 1 58 ? 1.053   -0.007  -6.257  1.00 0.00 ? 58 HIS A HD2  2  
ATOM 2067  H HE1  . HIS A 1 58 ? -1.085  2.738   -8.648  1.00 0.00 ? 58 HIS A HE1  2  
ATOM 2068  N N    . THR A 1 59 ? 4.853   1.991   -3.414  1.00 0.00 ? 59 THR A N    2  
ATOM 2069  C CA   . THR A 1 59 ? 6.223   2.268   -2.896  1.00 0.00 ? 59 THR A CA   2  
ATOM 2070  C C    . THR A 1 59 ? 7.236   1.407   -3.653  1.00 0.00 ? 59 THR A C    2  
ATOM 2071  O O    . THR A 1 59 ? 7.471   0.266   -3.311  1.00 0.00 ? 59 THR A O    2  
ATOM 2072  C CB   . THR A 1 59 ? 6.282   1.930   -1.405  1.00 0.00 ? 59 THR A CB   2  
ATOM 2073  O OG1  . THR A 1 59 ? 5.254   2.635   -0.721  1.00 0.00 ? 59 THR A OG1  2  
ATOM 2074  C CG2  . THR A 1 59 ? 7.645   2.337   -0.842  1.00 0.00 ? 59 THR A CG2  2  
ATOM 2075  H H    . THR A 1 59 ? 4.272   1.355   -2.945  1.00 0.00 ? 59 THR A H    2  
ATOM 2076  H HA   . THR A 1 59 ? 6.461   3.313   -3.039  1.00 0.00 ? 59 THR A HA   2  
ATOM 2077  H HB   . THR A 1 59 ? 6.143   0.870   -1.270  1.00 0.00 ? 59 THR A HB   2  
ATOM 2078  H HG1  . THR A 1 59 ? 4.746   1.998   -0.214  1.00 0.00 ? 59 THR A HG1  2  
ATOM 2079  H HG21 . THR A 1 59 ? 8.416   1.732   -1.296  1.00 0.00 ? 59 THR A HG21 2  
ATOM 2080  H HG22 . THR A 1 59 ? 7.652   2.186   0.227   1.00 0.00 ? 59 THR A HG22 2  
ATOM 2081  H HG23 . THR A 1 59 ? 7.828   3.378   -1.060  1.00 0.00 ? 59 THR A HG23 2  
ATOM 2082  N N    . PHE A 1 60 ? 7.840   1.946   -4.682  1.00 0.00 ? 60 PHE A N    2  
ATOM 2083  C CA   . PHE A 1 60 ? 8.846   1.166   -5.474  1.00 0.00 ? 60 PHE A CA   2  
ATOM 2084  C C    . PHE A 1 60 ? 10.258  1.584   -5.017  1.00 0.00 ? 60 PHE A C    2  
ATOM 2085  O O    . PHE A 1 60 ? 10.426  2.673   -4.504  1.00 0.00 ? 60 PHE A O    2  
ATOM 2086  C CB   . PHE A 1 60 ? 8.656   1.485   -6.976  1.00 0.00 ? 60 PHE A CB   2  
ATOM 2087  C CG   . PHE A 1 60 ? 7.733   0.462   -7.613  1.00 0.00 ? 60 PHE A CG   2  
ATOM 2088  C CD1  . PHE A 1 60 ? 6.409   0.348   -7.171  1.00 0.00 ? 60 PHE A CD1  2  
ATOM 2089  C CD2  . PHE A 1 60 ? 8.201   -0.369  -8.641  1.00 0.00 ? 60 PHE A CD2  2  
ATOM 2090  C CE1  . PHE A 1 60 ? 5.554   -0.595  -7.754  1.00 0.00 ? 60 PHE A CE1  2  
ATOM 2091  C CE2  . PHE A 1 60 ? 7.345   -1.312  -9.224  1.00 0.00 ? 60 PHE A CE2  2  
ATOM 2092  C CZ   . PHE A 1 60 ? 6.022   -1.424  -8.780  1.00 0.00 ? 60 PHE A CZ   2  
ATOM 2093  H H    . PHE A 1 60 ? 7.636   2.872   -4.934  1.00 0.00 ? 60 PHE A H    2  
ATOM 2094  H HA   . PHE A 1 60 ? 8.701   0.110   -5.297  1.00 0.00 ? 60 PHE A HA   2  
ATOM 2095  H HB2  . PHE A 1 60 ? 8.218   2.466   -7.078  1.00 0.00 ? 60 PHE A HB2  2  
ATOM 2096  H HB3  . PHE A 1 60 ? 9.611   1.471   -7.483  1.00 0.00 ? 60 PHE A HB3  2  
ATOM 2097  H HD1  . PHE A 1 60 ? 6.048   0.988   -6.380  1.00 0.00 ? 60 PHE A HD1  2  
ATOM 2098  H HD2  . PHE A 1 60 ? 9.221   -0.283  -8.983  1.00 0.00 ? 60 PHE A HD2  2  
ATOM 2099  H HE1  . PHE A 1 60 ? 4.534   -0.682  -7.412  1.00 0.00 ? 60 PHE A HE1  2  
ATOM 2100  H HE2  . PHE A 1 60 ? 7.706   -1.952  -10.015 1.00 0.00 ? 60 PHE A HE2  2  
ATOM 2101  H HZ   . PHE A 1 60 ? 5.363   -2.152  -9.229  1.00 0.00 ? 60 PHE A HZ   2  
ATOM 2102  N N    . PRO A 1 61 ? 11.241  0.725   -5.216  1.00 0.00 ? 61 PRO A N    2  
ATOM 2103  C CA   . PRO A 1 61 ? 12.621  1.047   -4.818  1.00 0.00 ? 61 PRO A CA   2  
ATOM 2104  C C    . PRO A 1 61 ? 12.983  2.448   -5.324  1.00 0.00 ? 61 PRO A C    2  
ATOM 2105  O O    . PRO A 1 61 ? 12.644  2.828   -6.427  1.00 0.00 ? 61 PRO A O    2  
ATOM 2106  C CB   . PRO A 1 61 ? 13.489  -0.054  -5.472  1.00 0.00 ? 61 PRO A CB   2  
ATOM 2107  C CG   . PRO A 1 61 ? 12.516  -1.107  -6.085  1.00 0.00 ? 61 PRO A CG   2  
ATOM 2108  C CD   . PRO A 1 61 ? 11.075  -0.603  -5.847  1.00 0.00 ? 61 PRO A CD   2  
ATOM 2109  H HA   . PRO A 1 61 ? 12.715  1.005   -3.744  1.00 0.00 ? 61 PRO A HA   2  
ATOM 2110  H HB2  . PRO A 1 61 ? 14.113  0.373   -6.250  1.00 0.00 ? 61 PRO A HB2  2  
ATOM 2111  H HB3  . PRO A 1 61 ? 14.113  -0.527  -4.726  1.00 0.00 ? 61 PRO A HB3  2  
ATOM 2112  H HG2  . PRO A 1 61 ? 12.706  -1.207  -7.148  1.00 0.00 ? 61 PRO A HG2  2  
ATOM 2113  H HG3  . PRO A 1 61 ? 12.653  -2.065  -5.601  1.00 0.00 ? 61 PRO A HG3  2  
ATOM 2114  H HD2  . PRO A 1 61 ? 10.543  -0.517  -6.785  1.00 0.00 ? 61 PRO A HD2  2  
ATOM 2115  H HD3  . PRO A 1 61 ? 10.548  -1.267  -5.176  1.00 0.00 ? 61 PRO A HD3  2  
ATOM 2116  N N    . SER A 1 62 ? 13.652  3.225   -4.518  1.00 0.00 ? 62 SER A N    2  
ATOM 2117  C CA   . SER A 1 62 ? 14.012  4.604   -4.951  1.00 0.00 ? 62 SER A CA   2  
ATOM 2118  C C    . SER A 1 62 ? 12.719  5.420   -5.086  1.00 0.00 ? 62 SER A C    2  
ATOM 2119  O O    . SER A 1 62 ? 11.694  5.061   -4.542  1.00 0.00 ? 62 SER A O    2  
ATOM 2120  C CB   . SER A 1 62 ? 14.750  4.539   -6.300  1.00 0.00 ? 62 SER A CB   2  
ATOM 2121  O OG   . SER A 1 62 ? 13.888  4.980   -7.343  1.00 0.00 ? 62 SER A OG   2  
ATOM 2122  H H    . SER A 1 62 ? 13.905  2.904   -3.627  1.00 0.00 ? 62 SER A H    2  
ATOM 2123  H HA   . SER A 1 62 ? 14.648  5.059   -4.203  1.00 0.00 ? 62 SER A HA   2  
ATOM 2124  H HB2  . SER A 1 62 ? 15.625  5.170   -6.274  1.00 0.00 ? 62 SER A HB2  2  
ATOM 2125  H HB3  . SER A 1 62 ? 15.059  3.518   -6.487  1.00 0.00 ? 62 SER A HB3  2  
ATOM 2126  H HG   . SER A 1 62 ? 13.434  4.212   -7.699  1.00 0.00 ? 62 SER A HG   2  
ATOM 2127  N N    . ARG A 1 63 ? 12.751  6.512   -5.803  1.00 0.00 ? 63 ARG A N    2  
ATOM 2128  C CA   . ARG A 1 63 ? 11.518  7.334   -5.963  1.00 0.00 ? 63 ARG A CA   2  
ATOM 2129  C C    . ARG A 1 63 ? 10.342  6.430   -6.344  1.00 0.00 ? 63 ARG A C    2  
ATOM 2130  O O    . ARG A 1 63 ? 10.352  5.786   -7.374  1.00 0.00 ? 63 ARG A O    2  
ATOM 2131  C CB   . ARG A 1 63 ? 11.744  8.369   -7.068  1.00 0.00 ? 63 ARG A CB   2  
ATOM 2132  C CG   . ARG A 1 63 ? 10.569  9.348   -7.107  1.00 0.00 ? 63 ARG A CG   2  
ATOM 2133  C CD   . ARG A 1 63 ? 10.857  10.447  -8.132  1.00 0.00 ? 63 ARG A CD   2  
ATOM 2134  N NE   . ARG A 1 63 ? 12.122  11.144  -7.767  1.00 0.00 ? 63 ARG A NE   2  
ATOM 2135  C CZ   . ARG A 1 63 ? 12.722  11.907  -8.640  1.00 0.00 ? 63 ARG A CZ   2  
ATOM 2136  N NH1  . ARG A 1 63 ? 12.215  12.061  -9.832  1.00 0.00 ? 63 ARG A NH1  2  
ATOM 2137  N NH2  . ARG A 1 63 ? 13.833  12.516  -8.320  1.00 0.00 ? 63 ARG A NH2  2  
ATOM 2138  H H    . ARG A 1 63 ? 13.578  6.796   -6.237  1.00 0.00 ? 63 ARG A H    2  
ATOM 2139  H HA   . ARG A 1 63 ? 11.298  7.840   -5.035  1.00 0.00 ? 63 ARG A HA   2  
ATOM 2140  H HB2  . ARG A 1 63 ? 12.657  8.912   -6.870  1.00 0.00 ? 63 ARG A HB2  2  
ATOM 2141  H HB3  . ARG A 1 63 ? 11.823  7.867   -8.021  1.00 0.00 ? 63 ARG A HB3  2  
ATOM 2142  H HG2  . ARG A 1 63 ? 9.669   8.819   -7.387  1.00 0.00 ? 63 ARG A HG2  2  
ATOM 2143  H HG3  . ARG A 1 63 ? 10.437  9.793   -6.132  1.00 0.00 ? 63 ARG A HG3  2  
ATOM 2144  H HD2  . ARG A 1 63 ? 10.959  10.006  -9.112  1.00 0.00 ? 63 ARG A HD2  2  
ATOM 2145  H HD3  . ARG A 1 63 ? 10.043  11.156  -8.138  1.00 0.00 ? 63 ARG A HD3  2  
ATOM 2146  H HE   . ARG A 1 63 ? 12.504  11.031  -6.872  1.00 0.00 ? 63 ARG A HE   2  
ATOM 2147  H HH11 . ARG A 1 63 ? 11.364  11.595  -10.077 1.00 0.00 ? 63 ARG A HH11 2  
ATOM 2148  H HH12 . ARG A 1 63 ? 12.675  12.646  -10.501 1.00 0.00 ? 63 ARG A HH12 2  
ATOM 2149  H HH21 . ARG A 1 63 ? 14.222  12.398  -7.407  1.00 0.00 ? 63 ARG A HH21 2  
ATOM 2150  H HH22 . ARG A 1 63 ? 14.292  13.100  -8.989  1.00 0.00 ? 63 ARG A HH22 2  
ATOM 2151  N N    . GLY A 1 64 ? 9.329   6.378   -5.523  1.00 0.00 ? 64 GLY A N    2  
ATOM 2152  C CA   . GLY A 1 64 ? 8.156   5.516   -5.841  1.00 0.00 ? 64 GLY A CA   2  
ATOM 2153  C C    . GLY A 1 64 ? 7.554   5.948   -7.179  1.00 0.00 ? 64 GLY A C    2  
ATOM 2154  O O    . GLY A 1 64 ? 7.331   7.117   -7.421  1.00 0.00 ? 64 GLY A O    2  
ATOM 2155  H H    . GLY A 1 64 ? 9.340   6.906   -4.696  1.00 0.00 ? 64 GLY A H    2  
ATOM 2156  H HA2  . GLY A 1 64 ? 8.475   4.485   -5.903  1.00 0.00 ? 64 GLY A HA2  2  
ATOM 2157  H HA3  . GLY A 1 64 ? 7.413   5.618   -5.066  1.00 0.00 ? 64 GLY A HA3  2  
ATOM 2158  N N    . ASN A 1 65 ? 7.288   5.014   -8.051  1.00 0.00 ? 65 ASN A N    2  
ATOM 2159  C CA   . ASN A 1 65 ? 6.700   5.376   -9.372  1.00 0.00 ? 65 ASN A CA   2  
ATOM 2160  C C    . ASN A 1 65 ? 5.423   6.188   -9.153  1.00 0.00 ? 65 ASN A C    2  
ATOM 2161  O O    . ASN A 1 65 ? 4.939   6.853   -10.046 1.00 0.00 ? 65 ASN A O    2  
ATOM 2162  C CB   . ASN A 1 65 ? 6.364   4.103   -10.151 1.00 0.00 ? 65 ASN A CB   2  
ATOM 2163  C CG   . ASN A 1 65 ? 5.851   4.479   -11.543 1.00 0.00 ? 65 ASN A CG   2  
ATOM 2164  O OD1  . ASN A 1 65 ? 6.342   5.406   -12.155 1.00 0.00 ? 65 ASN A OD1  2  
ATOM 2165  N ND2  . ASN A 1 65 ? 4.875   3.794   -12.072 1.00 0.00 ? 65 ASN A ND2  2  
ATOM 2166  H H    . ASN A 1 65 ? 7.475   4.075   -7.838  1.00 0.00 ? 65 ASN A H    2  
ATOM 2167  H HA   . ASN A 1 65 ? 7.410   5.966   -9.932  1.00 0.00 ? 65 ASN A HA   2  
ATOM 2168  H HB2  . ASN A 1 65 ? 7.252   3.494   -10.245 1.00 0.00 ? 65 ASN A HB2  2  
ATOM 2169  H HB3  . ASN A 1 65 ? 5.601   3.550   -9.625  1.00 0.00 ? 65 ASN A HB3  2  
ATOM 2170  H HD21 . ASN A 1 65 ? 4.477   3.045   -11.580 1.00 0.00 ? 65 ASN A HD21 2  
ATOM 2171  H HD22 . ASN A 1 65 ? 4.539   4.026   -12.963 1.00 0.00 ? 65 ASN A HD22 2  
ATOM 2172  N N    . LEU A 1 66 ? 4.872   6.135   -7.972  1.00 0.00 ? 66 LEU A N    2  
ATOM 2173  C CA   . LEU A 1 66 ? 3.625   6.902   -7.699  1.00 0.00 ? 66 LEU A CA   2  
ATOM 2174  C C    . LEU A 1 66 ? 3.434   7.045   -6.188  1.00 0.00 ? 66 LEU A C    2  
ATOM 2175  O O    . LEU A 1 66 ? 2.833   6.207   -5.548  1.00 0.00 ? 66 LEU A O    2  
ATOM 2176  C CB   . LEU A 1 66 ? 2.429   6.150   -8.295  1.00 0.00 ? 66 LEU A CB   2  
ATOM 2177  C CG   . LEU A 1 66 ? 1.167   7.036   -8.255  1.00 0.00 ? 66 LEU A CG   2  
ATOM 2178  C CD1  . LEU A 1 66 ? 1.149   8.000   -9.449  1.00 0.00 ? 66 LEU A CD1  2  
ATOM 2179  C CD2  . LEU A 1 66 ? -0.082  6.150   -8.314  1.00 0.00 ? 66 LEU A CD2  2  
ATOM 2180  H H    . LEU A 1 66 ? 5.278   5.591   -7.265  1.00 0.00 ? 66 LEU A H    2  
ATOM 2181  H HA   . LEU A 1 66 ? 3.701   7.879   -8.147  1.00 0.00 ? 66 LEU A HA   2  
ATOM 2182  H HB2  . LEU A 1 66 ? 2.651   5.877   -9.317  1.00 0.00 ? 66 LEU A HB2  2  
ATOM 2183  H HB3  . LEU A 1 66 ? 2.255   5.253   -7.717  1.00 0.00 ? 66 LEU A HB3  2  
ATOM 2184  H HG   . LEU A 1 66 ? 1.157   7.607   -7.336  1.00 0.00 ? 66 LEU A HG   2  
ATOM 2185  H HD11 . LEU A 1 66 ? 1.313   7.449   -10.364 1.00 0.00 ? 66 LEU A HD11 2  
ATOM 2186  H HD12 . LEU A 1 66 ? 1.923   8.742   -9.332  1.00 0.00 ? 66 LEU A HD12 2  
ATOM 2187  H HD13 . LEU A 1 66 ? 0.189   8.490   -9.496  1.00 0.00 ? 66 LEU A HD13 2  
ATOM 2188  H HD21 . LEU A 1 66 ? -0.132  5.539   -7.425  1.00 0.00 ? 66 LEU A HD21 2  
ATOM 2189  H HD22 . LEU A 1 66 ? -0.031  5.515   -9.186  1.00 0.00 ? 66 LEU A HD22 2  
ATOM 2190  H HD23 . LEU A 1 66 ? -0.962  6.772   -8.373  1.00 0.00 ? 66 LEU A HD23 2  
ATOM 2191  N N    . ASP A 1 67 ? 3.939   8.102   -5.612  1.00 0.00 ? 67 ASP A N    2  
ATOM 2192  C CA   . ASP A 1 67 ? 3.781   8.295   -4.143  1.00 0.00 ? 67 ASP A CA   2  
ATOM 2193  C C    . ASP A 1 67 ? 2.312   8.104   -3.764  1.00 0.00 ? 67 ASP A C    2  
ATOM 2194  O O    . ASP A 1 67 ? 1.460   7.927   -4.613  1.00 0.00 ? 67 ASP A O    2  
ATOM 2195  C CB   . ASP A 1 67 ? 4.227   9.708   -3.760  1.00 0.00 ? 67 ASP A CB   2  
ATOM 2196  C CG   . ASP A 1 67 ? 4.197   9.857   -2.238  1.00 0.00 ? 67 ASP A CG   2  
ATOM 2197  O OD1  . ASP A 1 67 ? 4.573   8.914   -1.561  1.00 0.00 ? 67 ASP A OD1  2  
ATOM 2198  O OD2  . ASP A 1 67 ? 3.799   10.914  -1.774  1.00 0.00 ? 67 ASP A OD2  2  
ATOM 2199  H H    . ASP A 1 67 ? 4.419   8.770   -6.146  1.00 0.00 ? 67 ASP A H    2  
ATOM 2200  H HA   . ASP A 1 67 ? 4.386   7.571   -3.617  1.00 0.00 ? 67 ASP A HA   2  
ATOM 2201  H HB2  . ASP A 1 67 ? 5.232   9.878   -4.120  1.00 0.00 ? 67 ASP A HB2  2  
ATOM 2202  H HB3  . ASP A 1 67 ? 3.557   10.429  -4.203  1.00 0.00 ? 67 ASP A HB3  2  
ATOM 2203  N N    . ASP A 1 68 ? 2.006   8.139   -2.497  1.00 0.00 ? 68 ASP A N    2  
ATOM 2204  C CA   . ASP A 1 68 ? 0.591   7.959   -2.070  1.00 0.00 ? 68 ASP A CA   2  
ATOM 2205  C C    . ASP A 1 68 ? -0.303  8.917   -2.859  1.00 0.00 ? 68 ASP A C    2  
ATOM 2206  O O    . ASP A 1 68 ? 0.148   9.921   -3.374  1.00 0.00 ? 68 ASP A O    2  
ATOM 2207  C CB   . ASP A 1 68 ? 0.467   8.265   -0.576  1.00 0.00 ? 68 ASP A CB   2  
ATOM 2208  C CG   . ASP A 1 68 ? 1.028   9.659   -0.294  1.00 0.00 ? 68 ASP A CG   2  
ATOM 2209  O OD1  . ASP A 1 68 ? 2.223   9.760   -0.065  1.00 0.00 ? 68 ASP A OD1  2  
ATOM 2210  O OD2  . ASP A 1 68 ? 0.254   10.603  -0.313  1.00 0.00 ? 68 ASP A OD2  2  
ATOM 2211  H H    . ASP A 1 68 ? 2.706   8.283   -1.827  1.00 0.00 ? 68 ASP A H    2  
ATOM 2212  H HA   . ASP A 1 68 ? 0.284   6.941   -2.256  1.00 0.00 ? 68 ASP A HA   2  
ATOM 2213  H HB2  . ASP A 1 68 ? -0.574  8.229   -0.287  1.00 0.00 ? 68 ASP A HB2  2  
ATOM 2214  H HB3  . ASP A 1 68 ? 1.023   7.534   -0.011  1.00 0.00 ? 68 ASP A HB3  2  
ATOM 2215  N N    . PHE A 1 69 ? -1.568  8.615   -2.959  1.00 0.00 ? 69 PHE A N    2  
ATOM 2216  C CA   . PHE A 1 69 ? -2.489  9.510   -3.714  1.00 0.00 ? 69 PHE A CA   2  
ATOM 2217  C C    . PHE A 1 69 ? -3.934  9.217   -3.304  1.00 0.00 ? 69 PHE A C    2  
ATOM 2218  O O    . PHE A 1 69 ? -4.844  9.300   -4.103  1.00 0.00 ? 69 PHE A O    2  
ATOM 2219  C CB   . PHE A 1 69 ? -2.323  9.266   -5.214  1.00 0.00 ? 69 PHE A CB   2  
ATOM 2220  C CG   . PHE A 1 69 ? -3.112  10.300  -5.984  1.00 0.00 ? 69 PHE A CG   2  
ATOM 2221  C CD1  . PHE A 1 69 ? -2.631  11.611  -6.088  1.00 0.00 ? 69 PHE A CD1  2  
ATOM 2222  C CD2  . PHE A 1 69 ? -4.322  9.949   -6.597  1.00 0.00 ? 69 PHE A CD2  2  
ATOM 2223  C CE1  . PHE A 1 69 ? -3.359  12.571  -6.800  1.00 0.00 ? 69 PHE A CE1  2  
ATOM 2224  C CE2  . PHE A 1 69 ? -5.050  10.909  -7.310  1.00 0.00 ? 69 PHE A CE2  2  
ATOM 2225  C CZ   . PHE A 1 69 ? -4.569  12.220  -7.411  1.00 0.00 ? 69 PHE A CZ   2  
ATOM 2226  H H    . PHE A 1 69 ? -1.913  7.800   -2.536  1.00 0.00 ? 69 PHE A H    2  
ATOM 2227  H HA   . PHE A 1 69 ? -2.254  10.540  -3.489  1.00 0.00 ? 69 PHE A HA   2  
ATOM 2228  H HB2  . PHE A 1 69 ? -1.277  9.343   -5.477  1.00 0.00 ? 69 PHE A HB2  2  
ATOM 2229  H HB3  . PHE A 1 69 ? -2.685  8.279   -5.462  1.00 0.00 ? 69 PHE A HB3  2  
ATOM 2230  H HD1  . PHE A 1 69 ? -1.698  11.882  -5.616  1.00 0.00 ? 69 PHE A HD1  2  
ATOM 2231  H HD2  . PHE A 1 69 ? -4.694  8.938   -6.518  1.00 0.00 ? 69 PHE A HD2  2  
ATOM 2232  H HE1  . PHE A 1 69 ? -2.988  13.582  -6.879  1.00 0.00 ? 69 PHE A HE1  2  
ATOM 2233  H HE2  . PHE A 1 69 ? -5.984  10.639  -7.781  1.00 0.00 ? 69 PHE A HE2  2  
ATOM 2234  H HZ   . PHE A 1 69 ? -5.130  12.960  -7.962  1.00 0.00 ? 69 PHE A HZ   2  
ATOM 2235  N N    . PHE A 1 70 ? -4.150  8.875   -2.063  1.00 0.00 ? 70 PHE A N    2  
ATOM 2236  C CA   . PHE A 1 70 ? -5.535  8.577   -1.604  1.00 0.00 ? 70 PHE A CA   2  
ATOM 2237  C C    . PHE A 1 70 ? -6.439  9.773   -1.905  1.00 0.00 ? 70 PHE A C    2  
ATOM 2238  O O    . PHE A 1 70 ? -6.102  10.905  -1.618  1.00 0.00 ? 70 PHE A O    2  
ATOM 2239  C CB   . PHE A 1 70 ? -5.527  8.311   -0.097  1.00 0.00 ? 70 PHE A CB   2  
ATOM 2240  C CG   . PHE A 1 70 ? -5.037  9.540   0.631   1.00 0.00 ? 70 PHE A CG   2  
ATOM 2241  C CD1  . PHE A 1 70 ? -3.666  9.724   0.848   1.00 0.00 ? 70 PHE A CD1  2  
ATOM 2242  C CD2  . PHE A 1 70 ? -5.953  10.495  1.088   1.00 0.00 ? 70 PHE A CD2  2  
ATOM 2243  C CE1  . PHE A 1 70 ? -3.212  10.864  1.523   1.00 0.00 ? 70 PHE A CE1  2  
ATOM 2244  C CE2  . PHE A 1 70 ? -5.498  11.634  1.763   1.00 0.00 ? 70 PHE A CE2  2  
ATOM 2245  C CZ   . PHE A 1 70 ? -4.128  11.819  1.981   1.00 0.00 ? 70 PHE A CZ   2  
ATOM 2246  H H    . PHE A 1 70 ? -3.401  8.814   -1.435  1.00 0.00 ? 70 PHE A H    2  
ATOM 2247  H HA   . PHE A 1 70 ? -5.907  7.705   -2.121  1.00 0.00 ? 70 PHE A HA   2  
ATOM 2248  H HB2  . PHE A 1 70 ? -6.528  8.074   0.232   1.00 0.00 ? 70 PHE A HB2  2  
ATOM 2249  H HB3  . PHE A 1 70 ? -4.871  7.481   0.119   1.00 0.00 ? 70 PHE A HB3  2  
ATOM 2250  H HD1  . PHE A 1 70 ? -2.959  8.989   0.495   1.00 0.00 ? 70 PHE A HD1  2  
ATOM 2251  H HD2  . PHE A 1 70 ? -7.010  10.352  0.921   1.00 0.00 ? 70 PHE A HD2  2  
ATOM 2252  H HE1  . PHE A 1 70 ? -2.155  11.007  1.690   1.00 0.00 ? 70 PHE A HE1  2  
ATOM 2253  H HE2  . PHE A 1 70 ? -6.204  12.370  2.117   1.00 0.00 ? 70 PHE A HE2  2  
ATOM 2254  H HZ   . PHE A 1 70 ? -3.777  12.697  2.502   1.00 0.00 ? 70 PHE A HZ   2  
ATOM 2255  N N    . HIS A 1 71 ? -7.585  9.534   -2.482  1.00 0.00 ? 71 HIS A N    2  
ATOM 2256  C CA   . HIS A 1 71 ? -8.510  10.660  -2.802  1.00 0.00 ? 71 HIS A CA   2  
ATOM 2257  C C    . HIS A 1 71 ? -9.943  10.132  -2.903  1.00 0.00 ? 71 HIS A C    2  
ATOM 2258  O O    . HIS A 1 71 ? -10.773 10.398  -2.058  1.00 0.00 ? 71 HIS A O    2  
ATOM 2259  C CB   . HIS A 1 71 ? -8.104  11.290  -4.135  1.00 0.00 ? 71 HIS A CB   2  
ATOM 2260  C CG   . HIS A 1 71 ? -8.994  12.467  -4.424  1.00 0.00 ? 71 HIS A CG   2  
ATOM 2261  N ND1  . HIS A 1 71 ? -10.262 12.321  -4.963  1.00 0.00 ? 71 HIS A ND1  2  
ATOM 2262  C CD2  . HIS A 1 71 ? -8.813  13.817  -4.254  1.00 0.00 ? 71 HIS A CD2  2  
ATOM 2263  C CE1  . HIS A 1 71 ? -10.791 13.551  -5.096  1.00 0.00 ? 71 HIS A CE1  2  
ATOM 2264  N NE2  . HIS A 1 71 ? -9.948  14.499  -4.679  1.00 0.00 ? 71 HIS A NE2  2  
ATOM 2265  H H    . HIS A 1 71 ? -7.838  8.614   -2.705  1.00 0.00 ? 71 HIS A H    2  
ATOM 2266  H HA   . HIS A 1 71 ? -8.458  11.405  -2.021  1.00 0.00 ? 71 HIS A HA   2  
ATOM 2267  H HB2  . HIS A 1 71 ? -7.077  11.620  -4.079  1.00 0.00 ? 71 HIS A HB2  2  
ATOM 2268  H HB3  . HIS A 1 71 ? -8.206  10.559  -4.924  1.00 0.00 ? 71 HIS A HB3  2  
ATOM 2269  H HD1  . HIS A 1 71 ? -10.695 11.475  -5.205  1.00 0.00 ? 71 HIS A HD1  2  
ATOM 2270  H HD2  . HIS A 1 71 ? -7.924  14.279  -3.851  1.00 0.00 ? 71 HIS A HD2  2  
ATOM 2271  H HE1  . HIS A 1 71 ? -11.776 13.747  -5.493  1.00 0.00 ? 71 HIS A HE1  2  
ATOM 2272  N N    . ARG A 1 72 ? -10.240 9.387   -3.933  1.00 0.00 ? 72 ARG A N    2  
ATOM 2273  C CA   . ARG A 1 72 ? -11.619 8.846   -4.084  1.00 0.00 ? 72 ARG A CA   2  
ATOM 2274  C C    . ARG A 1 72 ? -11.845 7.738   -3.049  1.00 0.00 ? 72 ARG A C    2  
ATOM 2275  O O    . ARG A 1 72 ? -12.075 6.591   -3.375  1.00 0.00 ? 72 ARG A O    2  
ATOM 2276  C CB   . ARG A 1 72 ? -11.797 8.302   -5.507  1.00 0.00 ? 72 ARG A CB   2  
ATOM 2277  C CG   . ARG A 1 72 ? -13.202 7.690   -5.675  1.00 0.00 ? 72 ARG A CG   2  
ATOM 2278  C CD   . ARG A 1 72 ? -13.662 7.822   -7.132  1.00 0.00 ? 72 ARG A CD   2  
ATOM 2279  N NE   . ARG A 1 72 ? -14.034 9.239   -7.405  1.00 0.00 ? 72 ARG A NE   2  
ATOM 2280  C CZ   . ARG A 1 72 ? -14.175 9.652   -8.635  1.00 0.00 ? 72 ARG A CZ   2  
ATOM 2281  N NH1  . ARG A 1 72 ? -13.995 8.823   -9.627  1.00 0.00 ? 72 ARG A NH1  2  
ATOM 2282  N NH2  . ARG A 1 72 ? -14.499 10.894  -8.873  1.00 0.00 ? 72 ARG A NH2  2  
ATOM 2283  H H    . ARG A 1 72 ? -9.556  9.183   -4.605  1.00 0.00 ? 72 ARG A H    2  
ATOM 2284  H HA   . ARG A 1 72 ? -12.331 9.640   -3.914  1.00 0.00 ? 72 ARG A HA   2  
ATOM 2285  H HB2  . ARG A 1 72 ? -11.664 9.113   -6.210  1.00 0.00 ? 72 ARG A HB2  2  
ATOM 2286  H HB3  . ARG A 1 72 ? -11.052 7.548   -5.694  1.00 0.00 ? 72 ARG A HB3  2  
ATOM 2287  H HG2  . ARG A 1 72 ? -13.174 6.643   -5.408  1.00 0.00 ? 72 ARG A HG2  2  
ATOM 2288  H HG3  . ARG A 1 72 ? -13.904 8.204   -5.035  1.00 0.00 ? 72 ARG A HG3  2  
ATOM 2289  H HD2  . ARG A 1 72 ? -12.861 7.526   -7.792  1.00 0.00 ? 72 ARG A HD2  2  
ATOM 2290  H HD3  . ARG A 1 72 ? -14.519 7.185   -7.298  1.00 0.00 ? 72 ARG A HD3  2  
ATOM 2291  H HE   . ARG A 1 72 ? -14.171 9.861   -6.662  1.00 0.00 ? 72 ARG A HE   2  
ATOM 2292  H HH11 . ARG A 1 72 ? -13.749 7.871   -9.445  1.00 0.00 ? 72 ARG A HH11 2  
ATOM 2293  H HH12 . ARG A 1 72 ? -14.104 9.140   -10.569 1.00 0.00 ? 72 ARG A HH12 2  
ATOM 2294  H HH21 . ARG A 1 72 ? -14.638 11.528  -8.113  1.00 0.00 ? 72 ARG A HH21 2  
ATOM 2295  H HH22 . ARG A 1 72 ? -14.608 11.211  -9.815  1.00 0.00 ? 72 ARG A HH22 2  
ATOM 2296  N N    . ASP A 1 73 ? -11.771 8.086   -1.794  1.00 0.00 ? 73 ASP A N    2  
ATOM 2297  C CA   . ASP A 1 73 ? -11.974 7.082   -0.707  1.00 0.00 ? 73 ASP A CA   2  
ATOM 2298  C C    . ASP A 1 73 ? -12.639 7.770   0.489   1.00 0.00 ? 73 ASP A C    2  
ATOM 2299  O O    . ASP A 1 73 ? -12.648 8.981   0.589   1.00 0.00 ? 73 ASP A O    2  
ATOM 2300  C CB   . ASP A 1 73 ? -10.620 6.514   -0.278  1.00 0.00 ? 73 ASP A CB   2  
ATOM 2301  C CG   . ASP A 1 73 ? -9.687  7.662   0.113   1.00 0.00 ? 73 ASP A CG   2  
ATOM 2302  O OD1  . ASP A 1 73 ? -9.091  8.245   -0.777  1.00 0.00 ? 73 ASP A OD1  2  
ATOM 2303  O OD2  . ASP A 1 73 ? -9.583  7.937   1.297   1.00 0.00 ? 73 ASP A OD2  2  
ATOM 2304  H H    . ASP A 1 73 ? -11.573 9.022   -1.577  1.00 0.00 ? 73 ASP A H    2  
ATOM 2305  H HA   . ASP A 1 73 ? -12.608 6.275   -1.063  1.00 0.00 ? 73 ASP A HA   2  
ATOM 2306  H HB2  . ASP A 1 73 ? -10.756 5.855   0.567   1.00 0.00 ? 73 ASP A HB2  2  
ATOM 2307  H HB3  . ASP A 1 73 ? -10.185 5.964   -1.098  1.00 0.00 ? 73 ASP A HB3  2  
ATOM 2308  N N    . LYS A 1 74 ? -13.201 7.016   1.396   1.00 0.00 ? 74 LYS A N    2  
ATOM 2309  C CA   . LYS A 1 74 ? -13.864 7.650   2.573   1.00 0.00 ? 74 LYS A CA   2  
ATOM 2310  C C    . LYS A 1 74 ? -12.814 8.353   3.440   1.00 0.00 ? 74 LYS A C    2  
ATOM 2311  O O    . LYS A 1 74 ? -12.088 7.732   4.187   1.00 0.00 ? 74 LYS A O    2  
ATOM 2312  C CB   . LYS A 1 74 ? -14.609 6.584   3.395   1.00 0.00 ? 74 LYS A CB   2  
ATOM 2313  C CG   . LYS A 1 74 ? -13.640 5.488   3.877   1.00 0.00 ? 74 LYS A CG   2  
ATOM 2314  C CD   . LYS A 1 74 ? -14.414 4.190   4.143   1.00 0.00 ? 74 LYS A CD   2  
ATOM 2315  C CE   . LYS A 1 74 ? -13.457 3.123   4.677   1.00 0.00 ? 74 LYS A CE   2  
ATOM 2316  N NZ   . LYS A 1 74 ? -12.215 3.109   3.853   1.00 0.00 ? 74 LYS A NZ   2  
ATOM 2317  H H    . LYS A 1 74 ? -13.191 6.042   1.301   1.00 0.00 ? 74 LYS A H    2  
ATOM 2318  H HA   . LYS A 1 74 ? -14.575 8.384   2.220   1.00 0.00 ? 74 LYS A HA   2  
ATOM 2319  H HB2  . LYS A 1 74 ? -15.068 7.056   4.253   1.00 0.00 ? 74 LYS A HB2  2  
ATOM 2320  H HB3  . LYS A 1 74 ? -15.379 6.140   2.780   1.00 0.00 ? 74 LYS A HB3  2  
ATOM 2321  H HG2  . LYS A 1 74 ? -12.886 5.310   3.124   1.00 0.00 ? 74 LYS A HG2  2  
ATOM 2322  H HG3  . LYS A 1 74 ? -13.165 5.803   4.794   1.00 0.00 ? 74 LYS A HG3  2  
ATOM 2323  H HD2  . LYS A 1 74 ? -15.188 4.377   4.872   1.00 0.00 ? 74 LYS A HD2  2  
ATOM 2324  H HD3  . LYS A 1 74 ? -14.861 3.842   3.225   1.00 0.00 ? 74 LYS A HD3  2  
ATOM 2325  H HE2  . LYS A 1 74 ? -13.204 3.348   5.703   1.00 0.00 ? 74 LYS A HE2  2  
ATOM 2326  H HE3  . LYS A 1 74 ? -13.933 2.156   4.628   1.00 0.00 ? 74 LYS A HE3  2  
ATOM 2327  H HZ1  . LYS A 1 74 ? -11.564 3.844   4.192   1.00 0.00 ? 74 LYS A HZ1  2  
ATOM 2328  H HZ2  . LYS A 1 74 ? -12.456 3.293   2.860   1.00 0.00 ? 74 LYS A HZ2  2  
ATOM 2329  H HZ3  . LYS A 1 74 ? -11.759 2.177   3.932   1.00 0.00 ? 74 LYS A HZ3  2  
ATOM 2330  N N    . ASP A 1 75 ? -12.720 9.653   3.338   1.00 0.00 ? 75 ASP A N    2  
ATOM 2331  C CA   . ASP A 1 75 ? -11.714 10.397  4.151   1.00 0.00 ? 75 ASP A CA   2  
ATOM 2332  C C    . ASP A 1 75 ? -12.200 11.832  4.368   1.00 0.00 ? 75 ASP A C    2  
ATOM 2333  O O    . ASP A 1 75 ? -11.600 12.778  3.898   1.00 0.00 ? 75 ASP A O    2  
ATOM 2334  C CB   . ASP A 1 75 ? -10.376 10.420  3.410   1.00 0.00 ? 75 ASP A CB   2  
ATOM 2335  C CG   . ASP A 1 75 ? -10.565 11.060  2.034   1.00 0.00 ? 75 ASP A CG   2  
ATOM 2336  O OD1  . ASP A 1 75 ? -11.680 11.033  1.538   1.00 0.00 ? 75 ASP A OD1  2  
ATOM 2337  O OD2  . ASP A 1 75 ? -9.593  11.565  1.498   1.00 0.00 ? 75 ASP A OD2  2  
ATOM 2338  H H    . ASP A 1 75 ? -13.303 10.142  2.721   1.00 0.00 ? 75 ASP A H    2  
ATOM 2339  H HA   . ASP A 1 75 ? -11.588 9.912   5.109   1.00 0.00 ? 75 ASP A HA   2  
ATOM 2340  H HB2  . ASP A 1 75 ? -9.659  10.994  3.980   1.00 0.00 ? 75 ASP A HB2  2  
ATOM 2341  H HB3  . ASP A 1 75 ? -10.013 9.410   3.288   1.00 0.00 ? 75 ASP A HB3  2  
ATOM 2342  N N    . ASP A 1 76 ? -13.284 12.000  5.075   1.00 0.00 ? 76 ASP A N    2  
ATOM 2343  C CA   . ASP A 1 76 ? -13.810 13.373  5.320   1.00 0.00 ? 76 ASP A CA   2  
ATOM 2344  C C    . ASP A 1 76 ? -12.855 14.128  6.249   1.00 0.00 ? 76 ASP A C    2  
ATOM 2345  O O    . ASP A 1 76 ? -11.709 14.362  5.918   1.00 0.00 ? 76 ASP A O    2  
ATOM 2346  C CB   . ASP A 1 76 ? -15.192 13.280  5.971   1.00 0.00 ? 76 ASP A CB   2  
ATOM 2347  C CG   . ASP A 1 76 ? -16.131 12.478  5.066   1.00 0.00 ? 76 ASP A CG   2  
ATOM 2348  O OD1  . ASP A 1 76 ? -16.047 11.261  5.090   1.00 0.00 ? 76 ASP A OD1  2  
ATOM 2349  O OD2  . ASP A 1 76 ? -16.916 13.095  4.366   1.00 0.00 ? 76 ASP A OD2  2  
ATOM 2350  H H    . ASP A 1 76 ? -13.754 11.223  5.444   1.00 0.00 ? 76 ASP A H    2  
ATOM 2351  H HA   . ASP A 1 76 ? -13.889 13.900  4.381   1.00 0.00 ? 76 ASP A HA   2  
ATOM 2352  H HB2  . ASP A 1 76 ? -15.107 12.787  6.929   1.00 0.00 ? 76 ASP A HB2  2  
ATOM 2353  H HB3  . ASP A 1 76 ? -15.592 14.273  6.110   1.00 0.00 ? 76 ASP A HB3  2  
ATOM 2354  N N    . PHE A 1 77 ? -13.316 14.513  7.408   1.00 0.00 ? 77 PHE A N    2  
ATOM 2355  C CA   . PHE A 1 77 ? -12.433 15.253  8.354   1.00 0.00 ? 77 PHE A CA   2  
ATOM 2356  C C    . PHE A 1 77 ? -11.789 16.437  7.630   1.00 0.00 ? 77 PHE A C    2  
ATOM 2357  O O    . PHE A 1 77 ? -12.327 17.525  7.601   1.00 0.00 ? 77 PHE A O    2  
ATOM 2358  C CB   . PHE A 1 77 ? -11.344 14.314  8.875   1.00 0.00 ? 77 PHE A CB   2  
ATOM 2359  C CG   . PHE A 1 77 ? -11.982 13.181  9.643   1.00 0.00 ? 77 PHE A CG   2  
ATOM 2360  C CD1  . PHE A 1 77 ? -12.360 13.367  10.978  1.00 0.00 ? 77 PHE A CD1  2  
ATOM 2361  C CD2  . PHE A 1 77 ? -12.199 11.946  9.018   1.00 0.00 ? 77 PHE A CD2  2  
ATOM 2362  C CE1  . PHE A 1 77 ? -12.954 12.316  11.689  1.00 0.00 ? 77 PHE A CE1  2  
ATOM 2363  C CE2  . PHE A 1 77 ? -12.792 10.898  9.729   1.00 0.00 ? 77 PHE A CE2  2  
ATOM 2364  C CZ   . PHE A 1 77 ? -13.170 11.082  11.065  1.00 0.00 ? 77 PHE A CZ   2  
ATOM 2365  H H    . PHE A 1 77 ? -14.244 14.315  7.657   1.00 0.00 ? 77 PHE A H    2  
ATOM 2366  H HA   . PHE A 1 77 ? -13.022 15.616  9.184   1.00 0.00 ? 77 PHE A HA   2  
ATOM 2367  H HB2  . PHE A 1 77 ? -10.784 13.915  8.042   1.00 0.00 ? 77 PHE A HB2  2  
ATOM 2368  H HB3  . PHE A 1 77 ? -10.679 14.860  9.527   1.00 0.00 ? 77 PHE A HB3  2  
ATOM 2369  H HD1  . PHE A 1 77 ? -12.194 14.319  11.460  1.00 0.00 ? 77 PHE A HD1  2  
ATOM 2370  H HD2  . PHE A 1 77 ? -11.907 11.804  7.988   1.00 0.00 ? 77 PHE A HD2  2  
ATOM 2371  H HE1  . PHE A 1 77 ? -13.245 12.459  12.719  1.00 0.00 ? 77 PHE A HE1  2  
ATOM 2372  H HE2  . PHE A 1 77 ? -12.958 9.945   9.248   1.00 0.00 ? 77 PHE A HE2  2  
ATOM 2373  H HZ   . PHE A 1 77 ? -13.628 10.272  11.613  1.00 0.00 ? 77 PHE A HZ   2  
ATOM 2374  N N    . PHE A 1 78 ? -10.642 16.232  7.043   1.00 0.00 ? 78 PHE A N    2  
ATOM 2375  C CA   . PHE A 1 78 ? -9.967  17.348  6.321   1.00 0.00 ? 78 PHE A CA   2  
ATOM 2376  C C    . PHE A 1 78 ? -8.830  16.784  5.466   1.00 0.00 ? 78 PHE A C    2  
ATOM 2377  O O    . PHE A 1 78 ? -8.377  15.676  5.669   1.00 0.00 ? 78 PHE A O    2  
ATOM 2378  C CB   . PHE A 1 78 ? -9.399  18.342  7.335   1.00 0.00 ? 78 PHE A CB   2  
ATOM 2379  C CG   . PHE A 1 78 ? -8.500  17.614  8.305   1.00 0.00 ? 78 PHE A CG   2  
ATOM 2380  C CD1  . PHE A 1 78 ? -7.143  17.441  8.007   1.00 0.00 ? 78 PHE A CD1  2  
ATOM 2381  C CD2  . PHE A 1 78 ? -9.024  17.110  9.502   1.00 0.00 ? 78 PHE A CD2  2  
ATOM 2382  C CE1  . PHE A 1 78 ? -6.310  16.765  8.906   1.00 0.00 ? 78 PHE A CE1  2  
ATOM 2383  C CE2  . PHE A 1 78 ? -8.190  16.435  10.401  1.00 0.00 ? 78 PHE A CE2  2  
ATOM 2384  C CZ   . PHE A 1 78 ? -6.833  16.262  10.103  1.00 0.00 ? 78 PHE A CZ   2  
ATOM 2385  H H    . PHE A 1 78 ? -10.225 15.346  7.077   1.00 0.00 ? 78 PHE A H    2  
ATOM 2386  H HA   . PHE A 1 78 ? -10.681 17.849  5.685   1.00 0.00 ? 78 PHE A HA   2  
ATOM 2387  H HB2  . PHE A 1 78 ? -8.830  19.100  6.816   1.00 0.00 ? 78 PHE A HB2  2  
ATOM 2388  H HB3  . PHE A 1 78 ? -10.209 18.808  7.876   1.00 0.00 ? 78 PHE A HB3  2  
ATOM 2389  H HD1  . PHE A 1 78 ? -6.739  17.829  7.084   1.00 0.00 ? 78 PHE A HD1  2  
ATOM 2390  H HD2  . PHE A 1 78 ? -10.071 17.244  9.731   1.00 0.00 ? 78 PHE A HD2  2  
ATOM 2391  H HE1  . PHE A 1 78 ? -5.263  16.631  8.677   1.00 0.00 ? 78 PHE A HE1  2  
ATOM 2392  H HE2  . PHE A 1 78 ? -8.595  16.046  11.324  1.00 0.00 ? 78 PHE A HE2  2  
ATOM 2393  H HZ   . PHE A 1 78 ? -6.191  15.740  10.797  1.00 0.00 ? 78 PHE A HZ   2  
ATOM 2394  N N    . THR A 1 79 ? -8.364  17.540  4.509   1.00 0.00 ? 79 THR A N    2  
ATOM 2395  C CA   . THR A 1 79 ? -7.257  17.045  3.643   1.00 0.00 ? 79 THR A CA   2  
ATOM 2396  C C    . THR A 1 79 ? -6.029  16.749  4.507   1.00 0.00 ? 79 THR A C    2  
ATOM 2397  O O    . THR A 1 79 ? -5.296  17.679  4.800   1.00 0.00 ? 79 THR A O    2  
ATOM 2398  C CB   . THR A 1 79 ? -6.905  18.112  2.604   1.00 0.00 ? 79 THR A CB   2  
ATOM 2399  O OG1  . THR A 1 79 ? -6.427  19.275  3.266   1.00 0.00 ? 79 THR A OG1  2  
ATOM 2400  C CG2  . THR A 1 79 ? -8.150  18.463  1.789   1.00 0.00 ? 79 THR A CG2  2  
ATOM 2401  O OXT  . THR A 1 79 ? -5.843  15.596  4.861   1.00 0.00 ? 79 THR A OXT  2  
ATOM 2402  H H    . THR A 1 79 ? -8.742  18.431  4.360   1.00 0.00 ? 79 THR A H    2  
ATOM 2403  H HA   . THR A 1 79 ? -7.569  16.142  3.141   1.00 0.00 ? 79 THR A HA   2  
ATOM 2404  H HB   . THR A 1 79 ? -6.141  17.733  1.943   1.00 0.00 ? 79 THR A HB   2  
ATOM 2405  H HG1  . THR A 1 79 ? -5.565  19.071  3.639   1.00 0.00 ? 79 THR A HG1  2  
ATOM 2406  H HG21 . THR A 1 79 ? -8.917  18.843  2.447   1.00 0.00 ? 79 THR A HG21 2  
ATOM 2407  H HG22 . THR A 1 79 ? -8.513  17.577  1.287   1.00 0.00 ? 79 THR A HG22 2  
ATOM 2408  H HG23 . THR A 1 79 ? -7.899  19.215  1.055   1.00 0.00 ? 79 THR A HG23 2  
ATOM 2409  N N    . MET A 1 1  ? 21.095  -3.751  20.297  1.00 0.00 ? 1  MET A N    3  
ATOM 2410  C CA   . MET A 1 1  ? 20.960  -2.417  20.946  1.00 0.00 ? 1  MET A CA   3  
ATOM 2411  C C    . MET A 1 1  ? 19.560  -1.860  20.681  1.00 0.00 ? 1  MET A C    3  
ATOM 2412  O O    . MET A 1 1  ? 19.331  -1.169  19.708  1.00 0.00 ? 1  MET A O    3  
ATOM 2413  C CB   . MET A 1 1  ? 22.006  -1.462  20.369  1.00 0.00 ? 1  MET A CB   3  
ATOM 2414  C CG   . MET A 1 1  ? 23.406  -2.023  20.622  1.00 0.00 ? 1  MET A CG   3  
ATOM 2415  S SD   . MET A 1 1  ? 23.767  -1.968  22.395  1.00 0.00 ? 1  MET A SD   3  
ATOM 2416  C CE   . MET A 1 1  ? 25.402  -2.740  22.317  1.00 0.00 ? 1  MET A CE   3  
ATOM 2417  H H1   . MET A 1 1  ? 20.258  -4.329  20.512  1.00 0.00 ? 1  MET A H1   3  
ATOM 2418  H H2   . MET A 1 1  ? 21.947  -4.227  20.658  1.00 0.00 ? 1  MET A H2   3  
ATOM 2419  H H3   . MET A 1 1  ? 21.175  -3.631  19.268  1.00 0.00 ? 1  MET A H3   3  
ATOM 2420  H HA   . MET A 1 1  ? 21.112  -2.517  22.010  1.00 0.00 ? 1  MET A HA   3  
ATOM 2421  H HB2  . MET A 1 1  ? 21.848  -1.354  19.305  1.00 0.00 ? 1  MET A HB2  3  
ATOM 2422  H HB3  . MET A 1 1  ? 21.916  -0.498  20.847  1.00 0.00 ? 1  MET A HB3  3  
ATOM 2423  H HG2  . MET A 1 1  ? 23.452  -3.046  20.278  1.00 0.00 ? 1  MET A HG2  3  
ATOM 2424  H HG3  . MET A 1 1  ? 24.134  -1.431  20.088  1.00 0.00 ? 1  MET A HG3  3  
ATOM 2425  H HE1  . MET A 1 1  ? 25.861  -2.706  23.296  1.00 0.00 ? 1  MET A HE1  3  
ATOM 2426  H HE2  . MET A 1 1  ? 26.018  -2.206  21.606  1.00 0.00 ? 1  MET A HE2  3  
ATOM 2427  H HE3  . MET A 1 1  ? 25.303  -3.766  22.004  1.00 0.00 ? 1  MET A HE3  3  
ATOM 2428  N N    . ILE A 1 2  ? 18.622  -2.154  21.538  1.00 0.00 ? 2  ILE A N    3  
ATOM 2429  C CA   . ILE A 1 2  ? 17.239  -1.641  21.335  1.00 0.00 ? 2  ILE A CA   3  
ATOM 2430  C C    . ILE A 1 2  ? 17.256  -0.111  21.350  1.00 0.00 ? 2  ILE A C    3  
ATOM 2431  O O    . ILE A 1 2  ? 18.231  0.505   21.734  1.00 0.00 ? 2  ILE A O    3  
ATOM 2432  C CB   . ILE A 1 2  ? 16.336  -2.152  22.459  1.00 0.00 ? 2  ILE A CB   3  
ATOM 2433  C CG1  . ILE A 1 2  ? 17.004  -1.882  23.809  1.00 0.00 ? 2  ILE A CG1  3  
ATOM 2434  C CG2  . ILE A 1 2  ? 16.114  -3.656  22.292  1.00 0.00 ? 2  ILE A CG2  3  
ATOM 2435  C CD1  . ILE A 1 2  ? 16.048  -2.272  24.939  1.00 0.00 ? 2  ILE A CD1  3  
ATOM 2436  H H    . ILE A 1 2  ? 18.828  -2.713  22.317  1.00 0.00 ? 2  ILE A H    3  
ATOM 2437  H HA   . ILE A 1 2  ? 16.861  -1.988  20.384  1.00 0.00 ? 2  ILE A HA   3  
ATOM 2438  H HB   . ILE A 1 2  ? 15.385  -1.641  22.417  1.00 0.00 ? 2  ILE A HB   3  
ATOM 2439  H HG12 . ILE A 1 2  ? 17.910  -2.466  23.886  1.00 0.00 ? 2  ILE A HG12 3  
ATOM 2440  H HG13 . ILE A 1 2  ? 17.243  -0.833  23.890  1.00 0.00 ? 2  ILE A HG13 3  
ATOM 2441  H HG21 . ILE A 1 2  ? 17.054  -4.173  22.412  1.00 0.00 ? 2  ILE A HG21 3  
ATOM 2442  H HG22 . ILE A 1 2  ? 15.716  -3.854  21.307  1.00 0.00 ? 2  ILE A HG22 3  
ATOM 2443  H HG23 . ILE A 1 2  ? 15.415  -4.002  23.039  1.00 0.00 ? 2  ILE A HG23 3  
ATOM 2444  H HD11 . ILE A 1 2  ? 15.102  -1.771  24.799  1.00 0.00 ? 2  ILE A HD11 3  
ATOM 2445  H HD12 . ILE A 1 2  ? 16.474  -1.981  25.888  1.00 0.00 ? 2  ILE A HD12 3  
ATOM 2446  H HD13 . ILE A 1 2  ? 15.894  -3.341  24.927  1.00 0.00 ? 2  ILE A HD13 3  
ATOM 2447  N N    . ASP A 1 3  ? 16.185  0.509   20.932  1.00 0.00 ? 3  ASP A N    3  
ATOM 2448  C CA   . ASP A 1 3  ? 16.140  1.999   20.920  1.00 0.00 ? 3  ASP A CA   3  
ATOM 2449  C C    . ASP A 1 3  ? 14.682  2.463   20.940  1.00 0.00 ? 3  ASP A C    3  
ATOM 2450  O O    . ASP A 1 3  ? 13.768  1.665   20.998  1.00 0.00 ? 3  ASP A O    3  
ATOM 2451  C CB   . ASP A 1 3  ? 16.825  2.520   19.655  1.00 0.00 ? 3  ASP A CB   3  
ATOM 2452  C CG   . ASP A 1 3  ? 18.307  2.144   19.685  1.00 0.00 ? 3  ASP A CG   3  
ATOM 2453  O OD1  . ASP A 1 3  ? 19.054  2.813   20.380  1.00 0.00 ? 3  ASP A OD1  3  
ATOM 2454  O OD2  . ASP A 1 3  ? 18.670  1.194   19.010  1.00 0.00 ? 3  ASP A OD2  3  
ATOM 2455  H H    . ASP A 1 3  ? 15.410  -0.006  20.625  1.00 0.00 ? 3  ASP A H    3  
ATOM 2456  H HA   . ASP A 1 3  ? 16.651  2.384   21.792  1.00 0.00 ? 3  ASP A HA   3  
ATOM 2457  H HB2  . ASP A 1 3  ? 16.357  2.078   18.787  1.00 0.00 ? 3  ASP A HB2  3  
ATOM 2458  H HB3  . ASP A 1 3  ? 16.728  3.594   19.610  1.00 0.00 ? 3  ASP A HB3  3  
ATOM 2459  N N    . ASN A 1 4  ? 14.456  3.747   20.890  1.00 0.00 ? 4  ASN A N    3  
ATOM 2460  C CA   . ASN A 1 4  ? 13.055  4.258   20.904  1.00 0.00 ? 4  ASN A CA   3  
ATOM 2461  C C    . ASN A 1 4  ? 12.338  3.809   19.629  1.00 0.00 ? 4  ASN A C    3  
ATOM 2462  O O    . ASN A 1 4  ? 12.389  4.471   18.611  1.00 0.00 ? 4  ASN A O    3  
ATOM 2463  C CB   . ASN A 1 4  ? 13.067  5.787   20.970  1.00 0.00 ? 4  ASN A CB   3  
ATOM 2464  C CG   . ASN A 1 4  ? 13.817  6.239   22.224  1.00 0.00 ? 4  ASN A CG   3  
ATOM 2465  O OD1  . ASN A 1 4  ? 14.897  5.758   22.507  1.00 0.00 ? 4  ASN A OD1  3  
ATOM 2466  N ND2  . ASN A 1 4  ? 13.288  7.153   22.991  1.00 0.00 ? 4  ASN A ND2  3  
ATOM 2467  H H    . ASN A 1 4  ? 15.206  4.377   20.842  1.00 0.00 ? 4  ASN A H    3  
ATOM 2468  H HA   . ASN A 1 4  ? 12.538  3.864   21.766  1.00 0.00 ? 4  ASN A HA   3  
ATOM 2469  H HB2  . ASN A 1 4  ? 13.559  6.181   20.093  1.00 0.00 ? 4  ASN A HB2  3  
ATOM 2470  H HB3  . ASN A 1 4  ? 12.052  6.153   21.009  1.00 0.00 ? 4  ASN A HB3  3  
ATOM 2471  H HD21 . ASN A 1 4  ? 12.419  7.541   22.763  1.00 0.00 ? 4  ASN A HD21 3  
ATOM 2472  H HD22 . ASN A 1 4  ? 13.761  7.450   23.796  1.00 0.00 ? 4  ASN A HD22 3  
ATOM 2473  N N    . GLU A 1 5  ? 11.669  2.690   19.675  1.00 0.00 ? 5  GLU A N    3  
ATOM 2474  C CA   . GLU A 1 5  ? 10.949  2.203   18.465  1.00 0.00 ? 5  GLU A CA   3  
ATOM 2475  C C    . GLU A 1 5  ? 9.762   3.121   18.174  1.00 0.00 ? 5  GLU A C    3  
ATOM 2476  O O    . GLU A 1 5  ? 9.920   4.217   17.674  1.00 0.00 ? 5  GLU A O    3  
ATOM 2477  C CB   . GLU A 1 5  ? 10.443  0.779   18.710  1.00 0.00 ? 5  GLU A CB   3  
ATOM 2478  C CG   . GLU A 1 5  ? 11.631  -0.152  18.959  1.00 0.00 ? 5  GLU A CG   3  
ATOM 2479  C CD   . GLU A 1 5  ? 11.119  -1.560  19.266  1.00 0.00 ? 5  GLU A CD   3  
ATOM 2480  O OE1  . GLU A 1 5  ? 10.141  -1.959  18.654  1.00 0.00 ? 5  GLU A OE1  3  
ATOM 2481  O OE2  . GLU A 1 5  ? 11.711  -2.215  20.107  1.00 0.00 ? 5  GLU A OE2  3  
ATOM 2482  H H    . GLU A 1 5  ? 11.641  2.170   20.505  1.00 0.00 ? 5  GLU A H    3  
ATOM 2483  H HA   . GLU A 1 5  ? 11.622  2.205   17.621  1.00 0.00 ? 5  GLU A HA   3  
ATOM 2484  H HB2  . GLU A 1 5  ? 9.792   0.773   19.572  1.00 0.00 ? 5  GLU A HB2  3  
ATOM 2485  H HB3  . GLU A 1 5  ? 9.896   0.438   17.843  1.00 0.00 ? 5  GLU A HB3  3  
ATOM 2486  H HG2  . GLU A 1 5  ? 12.258  -0.179  18.079  1.00 0.00 ? 5  GLU A HG2  3  
ATOM 2487  H HG3  . GLU A 1 5  ? 12.203  0.211   19.799  1.00 0.00 ? 5  GLU A HG3  3  
ATOM 2488  N N    . LYS A 1 6  ? 8.572   2.683   18.481  1.00 0.00 ? 6  LYS A N    3  
ATOM 2489  C CA   . LYS A 1 6  ? 7.375   3.530   18.221  1.00 0.00 ? 6  LYS A CA   3  
ATOM 2490  C C    . LYS A 1 6  ? 7.375   3.954   16.747  1.00 0.00 ? 6  LYS A C    3  
ATOM 2491  O O    . LYS A 1 6  ? 7.195   5.111   16.422  1.00 0.00 ? 6  LYS A O    3  
ATOM 2492  C CB   . LYS A 1 6  ? 7.421   4.770   19.141  1.00 0.00 ? 6  LYS A CB   3  
ATOM 2493  C CG   . LYS A 1 6  ? 6.001   5.199   19.538  1.00 0.00 ? 6  LYS A CG   3  
ATOM 2494  C CD   . LYS A 1 6  ? 5.223   5.639   18.295  1.00 0.00 ? 6  LYS A CD   3  
ATOM 2495  C CE   . LYS A 1 6  ? 3.859   6.189   18.718  1.00 0.00 ? 6  LYS A CE   3  
ATOM 2496  N NZ   . LYS A 1 6  ? 3.124   5.150   19.493  1.00 0.00 ? 6  LYS A NZ   3  
ATOM 2497  H H    . LYS A 1 6  ? 8.466   1.795   18.883  1.00 0.00 ? 6  LYS A H    3  
ATOM 2498  H HA   . LYS A 1 6  ? 6.483   2.953   18.427  1.00 0.00 ? 6  LYS A HA   3  
ATOM 2499  H HB2  . LYS A 1 6  ? 7.978   4.526   20.033  1.00 0.00 ? 6  LYS A HB2  3  
ATOM 2500  H HB3  . LYS A 1 6  ? 7.910   5.589   18.631  1.00 0.00 ? 6  LYS A HB3  3  
ATOM 2501  H HG2  . LYS A 1 6  ? 5.492   4.368   20.005  1.00 0.00 ? 6  LYS A HG2  3  
ATOM 2502  H HG3  . LYS A 1 6  ? 6.057   6.022   20.235  1.00 0.00 ? 6  LYS A HG3  3  
ATOM 2503  H HD2  . LYS A 1 6  ? 5.777   6.409   17.778  1.00 0.00 ? 6  LYS A HD2  3  
ATOM 2504  H HD3  . LYS A 1 6  ? 5.079   4.794   17.640  1.00 0.00 ? 6  LYS A HD3  3  
ATOM 2505  H HE2  . LYS A 1 6  ? 3.999   7.066   19.333  1.00 0.00 ? 6  LYS A HE2  3  
ATOM 2506  H HE3  . LYS A 1 6  ? 3.289   6.452   17.839  1.00 0.00 ? 6  LYS A HE3  3  
ATOM 2507  H HZ1  . LYS A 1 6  ? 2.101   5.275   19.358  1.00 0.00 ? 6  LYS A HZ1  3  
ATOM 2508  H HZ2  . LYS A 1 6  ? 3.351   5.244   20.503  1.00 0.00 ? 6  LYS A HZ2  3  
ATOM 2509  H HZ3  . LYS A 1 6  ? 3.405   4.206   19.160  1.00 0.00 ? 6  LYS A HZ3  3  
ATOM 2510  N N    . VAL A 1 7  ? 7.580   3.024   15.856  1.00 0.00 ? 7  VAL A N    3  
ATOM 2511  C CA   . VAL A 1 7  ? 7.595   3.369   14.406  1.00 0.00 ? 7  VAL A CA   3  
ATOM 2512  C C    . VAL A 1 7  ? 6.201   3.836   13.979  1.00 0.00 ? 7  VAL A C    3  
ATOM 2513  O O    . VAL A 1 7  ? 5.967   5.009   13.767  1.00 0.00 ? 7  VAL A O    3  
ATOM 2514  C CB   . VAL A 1 7  ? 7.992   2.136   13.593  1.00 0.00 ? 7  VAL A CB   3  
ATOM 2515  C CG1  . VAL A 1 7  ? 8.140   2.519   12.121  1.00 0.00 ? 7  VAL A CG1  3  
ATOM 2516  C CG2  . VAL A 1 7  ? 9.324   1.592   14.114  1.00 0.00 ? 7  VAL A CG2  3  
ATOM 2517  H H    . VAL A 1 7  ? 7.724   2.097   16.139  1.00 0.00 ? 7  VAL A H    3  
ATOM 2518  H HA   . VAL A 1 7  ? 8.309   4.161   14.232  1.00 0.00 ? 7  VAL A HA   3  
ATOM 2519  H HB   . VAL A 1 7  ? 7.228   1.378   13.694  1.00 0.00 ? 7  VAL A HB   3  
ATOM 2520  H HG11 . VAL A 1 7  ? 8.507   1.669   11.562  1.00 0.00 ? 7  VAL A HG11 3  
ATOM 2521  H HG12 . VAL A 1 7  ? 8.838   3.338   12.030  1.00 0.00 ? 7  VAL A HG12 3  
ATOM 2522  H HG13 . VAL A 1 7  ? 7.179   2.819   11.728  1.00 0.00 ? 7  VAL A HG13 3  
ATOM 2523  H HG21 . VAL A 1 7  ? 9.621   0.739   13.522  1.00 0.00 ? 7  VAL A HG21 3  
ATOM 2524  H HG22 . VAL A 1 7  ? 9.213   1.293   15.146  1.00 0.00 ? 7  VAL A HG22 3  
ATOM 2525  H HG23 . VAL A 1 7  ? 10.080  2.360   14.042  1.00 0.00 ? 7  VAL A HG23 3  
ATOM 2526  N N    . THR A 1 8  ? 5.274   2.926   13.853  1.00 0.00 ? 8  THR A N    3  
ATOM 2527  C CA   . THR A 1 8  ? 3.897   3.319   13.442  1.00 0.00 ? 8  THR A CA   3  
ATOM 2528  C C    . THR A 1 8  ? 2.933   2.163   13.717  1.00 0.00 ? 8  THR A C    3  
ATOM 2529  O O    . THR A 1 8  ? 3.232   1.016   13.453  1.00 0.00 ? 8  THR A O    3  
ATOM 2530  C CB   . THR A 1 8  ? 3.885   3.648   11.948  1.00 0.00 ? 8  THR A CB   3  
ATOM 2531  O OG1  . THR A 1 8  ? 4.885   4.620   11.671  1.00 0.00 ? 8  THR A OG1  3  
ATOM 2532  C CG2  . THR A 1 8  ? 2.513   4.197   11.555  1.00 0.00 ? 8  THR A CG2  3  
ATOM 2533  H H    . THR A 1 8  ? 5.483   1.984   14.030  1.00 0.00 ? 8  THR A H    3  
ATOM 2534  H HA   . THR A 1 8  ? 3.588   4.188   14.005  1.00 0.00 ? 8  THR A HA   3  
ATOM 2535  H HB   . THR A 1 8  ? 4.086   2.753   11.380  1.00 0.00 ? 8  THR A HB   3  
ATOM 2536  H HG1  . THR A 1 8  ? 4.848   5.288   12.360  1.00 0.00 ? 8  THR A HG1  3  
ATOM 2537  H HG21 . THR A 1 8  ? 2.536   4.521   10.526  1.00 0.00 ? 8  THR A HG21 3  
ATOM 2538  H HG22 . THR A 1 8  ? 2.264   5.034   12.191  1.00 0.00 ? 8  THR A HG22 3  
ATOM 2539  H HG23 . THR A 1 8  ? 1.769   3.424   11.672  1.00 0.00 ? 8  THR A HG23 3  
ATOM 2540  N N    . SER A 1 9  ? 1.776   2.457   14.245  1.00 0.00 ? 9  SER A N    3  
ATOM 2541  C CA   . SER A 1 9  ? 0.793   1.374   14.534  1.00 0.00 ? 9  SER A CA   3  
ATOM 2542  C C    . SER A 1 9  ? 0.569   0.541   13.271  1.00 0.00 ? 9  SER A C    3  
ATOM 2543  O O    . SER A 1 9  ? 0.688   1.029   12.165  1.00 0.00 ? 9  SER A O    3  
ATOM 2544  C CB   . SER A 1 9  ? -0.532  1.994   14.977  1.00 0.00 ? 9  SER A CB   3  
ATOM 2545  O OG   . SER A 1 9  ? -0.316  2.781   16.141  1.00 0.00 ? 9  SER A OG   3  
ATOM 2546  H H    . SER A 1 9  ? 1.552   3.389   14.450  1.00 0.00 ? 9  SER A H    3  
ATOM 2547  H HA   . SER A 1 9  ? 1.176   0.741   15.321  1.00 0.00 ? 9  SER A HA   3  
ATOM 2548  H HB2  . SER A 1 9  ? -0.919  2.621   14.192  1.00 0.00 ? 9  SER A HB2  3  
ATOM 2549  H HB3  . SER A 1 9  ? -1.244  1.207   15.189  1.00 0.00 ? 9  SER A HB3  3  
ATOM 2550  H HG   . SER A 1 9  ? -0.598  3.679   15.948  1.00 0.00 ? 9  SER A HG   3  
ATOM 2551  N N    . GLY A 1 10 ? 0.247   -0.715  13.425  1.00 0.00 ? 10 GLY A N    3  
ATOM 2552  C CA   . GLY A 1 10 ? 0.017   -1.575  12.230  1.00 0.00 ? 10 GLY A CA   3  
ATOM 2553  C C    . GLY A 1 10 ? -0.627  -2.895  12.658  1.00 0.00 ? 10 GLY A C    3  
ATOM 2554  O O    . GLY A 1 10 ? -0.008  -3.939  12.620  1.00 0.00 ? 10 GLY A O    3  
ATOM 2555  H H    . GLY A 1 10 ? 0.156   -1.093  14.325  1.00 0.00 ? 10 GLY A H    3  
ATOM 2556  H HA2  . GLY A 1 10 ? -0.636  -1.062  11.539  1.00 0.00 ? 10 GLY A HA2  3  
ATOM 2557  H HA3  . GLY A 1 10 ? 0.961   -1.780  11.747  1.00 0.00 ? 10 GLY A HA3  3  
ATOM 2558  N N    . HIS A 1 11 ? -1.867  -2.858  13.062  1.00 0.00 ? 11 HIS A N    3  
ATOM 2559  C CA   . HIS A 1 11 ? -2.550  -4.113  13.486  1.00 0.00 ? 11 HIS A CA   3  
ATOM 2560  C C    . HIS A 1 11 ? -2.859  -4.958  12.249  1.00 0.00 ? 11 HIS A C    3  
ATOM 2561  O O    . HIS A 1 11 ? -3.338  -4.455  11.251  1.00 0.00 ? 11 HIS A O    3  
ATOM 2562  C CB   . HIS A 1 11 ? -3.855  -3.767  14.208  1.00 0.00 ? 11 HIS A CB   3  
ATOM 2563  C CG   . HIS A 1 11 ? -4.743  -2.977  13.286  1.00 0.00 ? 11 HIS A CG   3  
ATOM 2564  N ND1  . HIS A 1 11 ? -4.263  -2.375  12.134  1.00 0.00 ? 11 HIS A ND1  3  
ATOM 2565  C CD2  . HIS A 1 11 ? -6.083  -2.682  13.334  1.00 0.00 ? 11 HIS A CD2  3  
ATOM 2566  C CE1  . HIS A 1 11 ? -5.299  -1.753  11.540  1.00 0.00 ? 11 HIS A CE1  3  
ATOM 2567  N NE2  . HIS A 1 11 ? -6.432  -1.909  12.231  1.00 0.00 ? 11 HIS A NE2  3  
ATOM 2568  H H    . HIS A 1 11 ? -2.350  -2.005  13.081  1.00 0.00 ? 11 HIS A H    3  
ATOM 2569  H HA   . HIS A 1 11 ? -1.905  -4.669  14.150  1.00 0.00 ? 11 HIS A HA   3  
ATOM 2570  H HB2  . HIS A 1 11 ? -4.357  -4.678  14.500  1.00 0.00 ? 11 HIS A HB2  3  
ATOM 2571  H HB3  . HIS A 1 11 ? -3.634  -3.179  15.086  1.00 0.00 ? 11 HIS A HB3  3  
ATOM 2572  H HD1  . HIS A 1 11 ? -3.338  -2.396  11.811  1.00 0.00 ? 11 HIS A HD1  3  
ATOM 2573  H HD2  . HIS A 1 11 ? -6.763  -3.001  14.110  1.00 0.00 ? 11 HIS A HD2  3  
ATOM 2574  H HE1  . HIS A 1 11 ? -5.223  -1.197  10.618  1.00 0.00 ? 11 HIS A HE1  3  
ATOM 2575  N N    . THR A 1 12 ? -2.601  -6.238  12.304  1.00 0.00 ? 12 THR A N    3  
ATOM 2576  C CA   . THR A 1 12 ? -2.888  -7.109  11.129  1.00 0.00 ? 12 THR A CA   3  
ATOM 2577  C C    . THR A 1 12 ? -2.279  -6.477  9.869   1.00 0.00 ? 12 THR A C    3  
ATOM 2578  O O    . THR A 1 12 ? -1.668  -5.429  9.922   1.00 0.00 ? 12 THR A O    3  
ATOM 2579  C CB   . THR A 1 12 ? -4.418  -7.251  10.975  1.00 0.00 ? 12 THR A CB   3  
ATOM 2580  O OG1  . THR A 1 12 ? -5.023  -7.130  12.254  1.00 0.00 ? 12 THR A OG1  3  
ATOM 2581  C CG2  . THR A 1 12 ? -4.777  -8.620  10.378  1.00 0.00 ? 12 THR A CG2  3  
ATOM 2582  H H    . THR A 1 12 ? -2.228  -6.632  13.120  1.00 0.00 ? 12 THR A H    3  
ATOM 2583  H HA   . THR A 1 12 ? -2.443  -8.080  11.292  1.00 0.00 ? 12 THR A HA   3  
ATOM 2584  H HB   . THR A 1 12 ? -4.796  -6.473  10.328  1.00 0.00 ? 12 THR A HB   3  
ATOM 2585  H HG1  . THR A 1 12 ? -5.439  -7.968  12.467  1.00 0.00 ? 12 THR A HG1  3  
ATOM 2586  H HG21 . THR A 1 12 ? -4.335  -9.403  10.975  1.00 0.00 ? 12 THR A HG21 3  
ATOM 2587  H HG22 . THR A 1 12 ? -4.404  -8.684  9.368   1.00 0.00 ? 12 THR A HG22 3  
ATOM 2588  H HG23 . THR A 1 12 ? -5.850  -8.737  10.372  1.00 0.00 ? 12 THR A HG23 3  
ATOM 2589  N N    . THR A 1 13 ? -2.440  -7.105  8.735   1.00 0.00 ? 13 THR A N    3  
ATOM 2590  C CA   . THR A 1 13 ? -1.873  -6.532  7.483   1.00 0.00 ? 13 THR A CA   3  
ATOM 2591  C C    . THR A 1 13 ? -2.730  -5.342  7.046   1.00 0.00 ? 13 THR A C    3  
ATOM 2592  O O    . THR A 1 13 ? -2.665  -4.901  5.916   1.00 0.00 ? 13 THR A O    3  
ATOM 2593  C CB   . THR A 1 13 ? -1.881  -7.598  6.383   1.00 0.00 ? 13 THR A CB   3  
ATOM 2594  O OG1  . THR A 1 13 ? -3.214  -8.030  6.157   1.00 0.00 ? 13 THR A OG1  3  
ATOM 2595  C CG2  . THR A 1 13 ? -1.023  -8.787  6.815   1.00 0.00 ? 13 THR A CG2  3  
ATOM 2596  H H    . THR A 1 13 ? -2.934  -7.949  8.708   1.00 0.00 ? 13 THR A H    3  
ATOM 2597  H HA   . THR A 1 13 ? -0.859  -6.203  7.661   1.00 0.00 ? 13 THR A HA   3  
ATOM 2598  H HB   . THR A 1 13 ? -1.477  -7.179  5.474   1.00 0.00 ? 13 THR A HB   3  
ATOM 2599  H HG1  . THR A 1 13 ? -3.251  -8.439  5.289   1.00 0.00 ? 13 THR A HG1  3  
ATOM 2600  H HG21 . THR A 1 13 ? -1.046  -9.545  6.047   1.00 0.00 ? 13 THR A HG21 3  
ATOM 2601  H HG22 . THR A 1 13 ? -1.411  -9.196  7.736   1.00 0.00 ? 13 THR A HG22 3  
ATOM 2602  H HG23 . THR A 1 13 ? -0.005  -8.460  6.968   1.00 0.00 ? 13 THR A HG23 3  
ATOM 2603  N N    . THR A 1 14 ? -3.538  -4.832  7.938   1.00 0.00 ? 14 THR A N    3  
ATOM 2604  C CA   . THR A 1 14 ? -4.423  -3.676  7.600   1.00 0.00 ? 14 THR A CA   3  
ATOM 2605  C C    . THR A 1 14 ? -5.635  -4.192  6.815   1.00 0.00 ? 14 THR A C    3  
ATOM 2606  O O    . THR A 1 14 ? -5.736  -5.365  6.516   1.00 0.00 ? 14 THR A O    3  
ATOM 2607  C CB   . THR A 1 14 ? -3.639  -2.638  6.765   1.00 0.00 ? 14 THR A CB   3  
ATOM 2608  O OG1  . THR A 1 14 ? -2.262  -2.713  7.102   1.00 0.00 ? 14 THR A OG1  3  
ATOM 2609  C CG2  . THR A 1 14 ? -4.152  -1.221  7.051   1.00 0.00 ? 14 THR A CG2  3  
ATOM 2610  H H    . THR A 1 14 ? -3.573  -5.224  8.836   1.00 0.00 ? 14 THR A H    3  
ATOM 2611  H HA   . THR A 1 14 ? -4.767  -3.220  8.519   1.00 0.00 ? 14 THR A HA   3  
ATOM 2612  H HB   . THR A 1 14 ? -3.758  -2.848  5.711   1.00 0.00 ? 14 THR A HB   3  
ATOM 2613  H HG1  . THR A 1 14 ? -1.754  -2.659  6.289   1.00 0.00 ? 14 THR A HG1  3  
ATOM 2614  H HG21 . THR A 1 14 ? -4.084  -1.019  8.110   1.00 0.00 ? 14 THR A HG21 3  
ATOM 2615  H HG22 . THR A 1 14 ? -5.180  -1.137  6.734   1.00 0.00 ? 14 THR A HG22 3  
ATOM 2616  H HG23 . THR A 1 14 ? -3.550  -0.504  6.511   1.00 0.00 ? 14 THR A HG23 3  
ATOM 2617  N N    . THR A 1 15 ? -6.561  -3.331  6.493   1.00 0.00 ? 15 THR A N    3  
ATOM 2618  C CA   . THR A 1 15 ? -7.772  -3.781  5.745   1.00 0.00 ? 15 THR A CA   3  
ATOM 2619  C C    . THR A 1 15 ? -7.486  -3.777  4.242   1.00 0.00 ? 15 THR A C    3  
ATOM 2620  O O    . THR A 1 15 ? -6.835  -2.894  3.722   1.00 0.00 ? 15 THR A O    3  
ATOM 2621  C CB   . THR A 1 15 ? -8.932  -2.829  6.039   1.00 0.00 ? 15 THR A CB   3  
ATOM 2622  O OG1  . THR A 1 15 ? -10.088 -3.263  5.337   1.00 0.00 ? 15 THR A OG1  3  
ATOM 2623  C CG2  . THR A 1 15 ? -8.558  -1.416  5.589   1.00 0.00 ? 15 THR A CG2  3  
ATOM 2624  H H    . THR A 1 15 ? -6.474  -2.393  6.761   1.00 0.00 ? 15 THR A H    3  
ATOM 2625  H HA   . THR A 1 15 ? -8.041  -4.780  6.057   1.00 0.00 ? 15 THR A HA   3  
ATOM 2626  H HB   . THR A 1 15 ? -9.134  -2.822  7.099   1.00 0.00 ? 15 THR A HB   3  
ATOM 2627  H HG1  . THR A 1 15 ? -9.817  -3.530  4.456   1.00 0.00 ? 15 THR A HG1  3  
ATOM 2628  H HG21 . THR A 1 15 ? -7.586  -1.159  5.982   1.00 0.00 ? 15 THR A HG21 3  
ATOM 2629  H HG22 . THR A 1 15 ? -9.292  -0.714  5.956   1.00 0.00 ? 15 THR A HG22 3  
ATOM 2630  H HG23 . THR A 1 15 ? -8.532  -1.377  4.510   1.00 0.00 ? 15 THR A HG23 3  
ATOM 2631  N N    . ARG A 1 16 ? -7.978  -4.765  3.546   1.00 0.00 ? 16 ARG A N    3  
ATOM 2632  C CA   . ARG A 1 16 ? -7.757  -4.845  2.075   1.00 0.00 ? 16 ARG A CA   3  
ATOM 2633  C C    . ARG A 1 16 ? -8.912  -5.635  1.455   1.00 0.00 ? 16 ARG A C    3  
ATOM 2634  O O    . ARG A 1 16 ? -9.555  -6.395  2.145   1.00 0.00 ? 16 ARG A O    3  
ATOM 2635  C CB   . ARG A 1 16 ? -6.423  -5.550  1.791   1.00 0.00 ? 16 ARG A CB   3  
ATOM 2636  C CG   . ARG A 1 16 ? -6.372  -6.896  2.521   1.00 0.00 ? 16 ARG A CG   3  
ATOM 2637  C CD   . ARG A 1 16 ? -4.945  -7.447  2.481   1.00 0.00 ? 16 ARG A CD   3  
ATOM 2638  N NE   . ARG A 1 16 ? -4.959  -8.881  2.887   1.00 0.00 ? 16 ARG A NE   3  
ATOM 2639  C CZ   . ARG A 1 16 ? -3.921  -9.637  2.654   1.00 0.00 ? 16 ARG A CZ   3  
ATOM 2640  N NH1  . ARG A 1 16 ? -2.869  -9.138  2.065   1.00 0.00 ? 16 ARG A NH1  3  
ATOM 2641  N NH2  . ARG A 1 16 ? -3.935  -10.892 3.011   1.00 0.00 ? 16 ARG A NH2  3  
ATOM 2642  H H    . ARG A 1 16 ? -8.505  -5.460  3.993   1.00 0.00 ? 16 ARG A H    3  
ATOM 2643  H HA   . ARG A 1 16 ? -7.738  -3.850  1.659   1.00 0.00 ? 16 ARG A HA   3  
ATOM 2644  H HB2  . ARG A 1 16 ? -6.324  -5.716  0.728   1.00 0.00 ? 16 ARG A HB2  3  
ATOM 2645  H HB3  . ARG A 1 16 ? -5.610  -4.927  2.133   1.00 0.00 ? 16 ARG A HB3  3  
ATOM 2646  H HG2  . ARG A 1 16 ? -6.672  -6.763  3.551   1.00 0.00 ? 16 ARG A HG2  3  
ATOM 2647  H HG3  . ARG A 1 16 ? -7.039  -7.595  2.039   1.00 0.00 ? 16 ARG A HG3  3  
ATOM 2648  H HD2  . ARG A 1 16 ? -4.553  -7.359  1.479   1.00 0.00 ? 16 ARG A HD2  3  
ATOM 2649  H HD3  . ARG A 1 16 ? -4.323  -6.885  3.162   1.00 0.00 ? 16 ARG A HD3  3  
ATOM 2650  H HE   . ARG A 1 16 ? -5.748  -9.256  3.330   1.00 0.00 ? 16 ARG A HE   3  
ATOM 2651  H HH11 . ARG A 1 16 ? -2.858  -8.176  1.792   1.00 0.00 ? 16 ARG A HH11 3  
ATOM 2652  H HH12 . ARG A 1 16 ? -2.075  -9.718  1.886   1.00 0.00 ? 16 ARG A HH12 3  
ATOM 2653  H HH21 . ARG A 1 16 ? -4.742  -11.274 3.463   1.00 0.00 ? 16 ARG A HH21 3  
ATOM 2654  H HH22 . ARG A 1 16 ? -3.141  -11.471 2.832   1.00 0.00 ? 16 ARG A HH22 3  
ATOM 2655  N N    . ARG A 1 17 ? -9.188  -5.417  0.179   1.00 0.00 ? 17 ARG A N    3  
ATOM 2656  C CA   . ARG A 1 17 ? -10.328 -6.108  -0.544  1.00 0.00 ? 17 ARG A CA   3  
ATOM 2657  C C    . ARG A 1 17 ? -11.491 -5.123  -0.700  1.00 0.00 ? 17 ARG A C    3  
ATOM 2658  O O    . ARG A 1 17 ? -11.725 -4.608  -1.775  1.00 0.00 ? 17 ARG A O    3  
ATOM 2659  C CB   . ARG A 1 17 ? -10.809 -7.379  0.187   1.00 0.00 ? 17 ARG A CB   3  
ATOM 2660  C CG   . ARG A 1 17 ? -11.641 -8.263  -0.763  1.00 0.00 ? 17 ARG A CG   3  
ATOM 2661  C CD   . ARG A 1 17 ? -10.724 -9.184  -1.579  1.00 0.00 ? 17 ARG A CD   3  
ATOM 2662  N NE   . ARG A 1 17 ? -9.907  -10.021 -0.655  1.00 0.00 ? 17 ARG A NE   3  
ATOM 2663  C CZ   . ARG A 1 17 ? -9.287  -11.077 -1.105  1.00 0.00 ? 17 ARG A CZ   3  
ATOM 2664  N NH1  . ARG A 1 17 ? -9.376  -11.400 -2.367  1.00 0.00 ? 17 ARG A NH1  3  
ATOM 2665  N NH2  . ARG A 1 17 ? -8.575  -11.812 -0.294  1.00 0.00 ? 17 ARG A NH2  3  
ATOM 2666  H H    . ARG A 1 17 ? -8.655  -4.748  -0.314  1.00 0.00 ? 17 ARG A H    3  
ATOM 2667  H HA   . ARG A 1 17 ? -9.992  -6.378  -1.530  1.00 0.00 ? 17 ARG A HA   3  
ATOM 2668  H HB2  . ARG A 1 17 ? -9.955  -7.939  0.538   1.00 0.00 ? 17 ARG A HB2  3  
ATOM 2669  H HB3  . ARG A 1 17 ? -11.425 -7.094  1.030   1.00 0.00 ? 17 ARG A HB3  3  
ATOM 2670  H HG2  . ARG A 1 17 ? -12.322 -8.869  -0.182  1.00 0.00 ? 17 ARG A HG2  3  
ATOM 2671  H HG3  . ARG A 1 17 ? -12.207 -7.640  -1.434  1.00 0.00 ? 17 ARG A HG3  3  
ATOM 2672  H HD2  . ARG A 1 17 ? -11.327 -9.826  -2.205  1.00 0.00 ? 17 ARG A HD2  3  
ATOM 2673  H HD3  . ARG A 1 17 ? -10.071 -8.592  -2.200  1.00 0.00 ? 17 ARG A HD3  3  
ATOM 2674  H HE   . ARG A 1 17 ? -9.838  -9.779  0.292   1.00 0.00 ? 17 ARG A HE   3  
ATOM 2675  H HH11 . ARG A 1 17 ? -9.921  -10.837 -2.989  1.00 0.00 ? 17 ARG A HH11 3  
ATOM 2676  H HH12 . ARG A 1 17 ? -8.901  -12.209 -2.712  1.00 0.00 ? 17 ARG A HH12 3  
ATOM 2677  H HH21 . ARG A 1 17 ? -8.507  -11.564 0.672   1.00 0.00 ? 17 ARG A HH21 3  
ATOM 2678  H HH22 . ARG A 1 17 ? -8.101  -12.621 -0.638  1.00 0.00 ? 17 ARG A HH22 3  
ATOM 2679  N N    . SER A 1 18 ? -12.215 -4.843  0.356   1.00 0.00 ? 18 SER A N    3  
ATOM 2680  C CA   . SER A 1 18 ? -13.362 -3.869  0.253   1.00 0.00 ? 18 SER A CA   3  
ATOM 2681  C C    . SER A 1 18 ? -12.910 -2.639  -0.547  1.00 0.00 ? 18 SER A C    3  
ATOM 2682  O O    . SER A 1 18 ? -13.702 -1.871  -1.054  1.00 0.00 ? 18 SER A O    3  
ATOM 2683  C CB   . SER A 1 18 ? -13.789 -3.434  1.656   1.00 0.00 ? 18 SER A CB   3  
ATOM 2684  O OG   . SER A 1 18 ? -14.088 -4.584  2.436   1.00 0.00 ? 18 SER A OG   3  
ATOM 2685  H H    . SER A 1 18 ? -12.004 -5.273  1.213   1.00 0.00 ? 18 SER A H    3  
ATOM 2686  H HA   . SER A 1 18 ? -14.198 -4.338  -0.252  1.00 0.00 ? 18 SER A HA   3  
ATOM 2687  H HB2  . SER A 1 18 ? -12.988 -2.886  2.125   1.00 0.00 ? 18 SER A HB2  3  
ATOM 2688  H HB3  . SER A 1 18 ? -14.661 -2.798  1.584   1.00 0.00 ? 18 SER A HB3  3  
ATOM 2689  H HG   . SER A 1 18 ? -13.606 -5.328  2.064   1.00 0.00 ? 18 SER A HG   3  
ATOM 2690  N N    . CYS A 1 19 ? -11.629 -2.486  -0.681  1.00 0.00 ? 19 CYS A N    3  
ATOM 2691  C CA   . CYS A 1 19 ? -11.066 -1.352  -1.470  1.00 0.00 ? 19 CYS A CA   3  
ATOM 2692  C C    . CYS A 1 19 ? -9.800  -1.857  -2.164  1.00 0.00 ? 19 CYS A C    3  
ATOM 2693  O O    . CYS A 1 19 ? -9.155  -2.775  -1.698  1.00 0.00 ? 19 CYS A O    3  
ATOM 2694  C CB   . CYS A 1 19 ? -10.765 -0.155  -0.535  1.00 0.00 ? 19 CYS A CB   3  
ATOM 2695  S SG   . CYS A 1 19 ? -11.948 1.188   -0.861  1.00 0.00 ? 19 CYS A SG   3  
ATOM 2696  H H    . CYS A 1 19 ? -11.050 -3.162  -0.269  1.00 0.00 ? 19 CYS A H    3  
ATOM 2697  H HA   . CYS A 1 19 ? -11.779 -1.056  -2.228  1.00 0.00 ? 19 CYS A HA   3  
ATOM 2698  H HB2  . CYS A 1 19 ? -10.860 -0.466  0.494   1.00 0.00 ? 19 CYS A HB2  3  
ATOM 2699  H HB3  . CYS A 1 19 ? -9.761  0.210   -0.706  1.00 0.00 ? 19 CYS A HB3  3  
ATOM 2700  N N    . SER A 1 20 ? -9.441  -1.285  -3.279  1.00 0.00 ? 20 SER A N    3  
ATOM 2701  C CA   . SER A 1 20 ? -8.223  -1.763  -3.984  1.00 0.00 ? 20 SER A CA   3  
ATOM 2702  C C    . SER A 1 20 ? -6.994  -1.443  -3.138  1.00 0.00 ? 20 SER A C    3  
ATOM 2703  O O    . SER A 1 20 ? -6.737  -0.303  -2.812  1.00 0.00 ? 20 SER A O    3  
ATOM 2704  C CB   . SER A 1 20 ? -8.111  -1.070  -5.344  1.00 0.00 ? 20 SER A CB   3  
ATOM 2705  O OG   . SER A 1 20 ? -9.399  -0.995  -5.940  1.00 0.00 ? 20 SER A OG   3  
ATOM 2706  H H    . SER A 1 20 ? -9.962  -0.544  -3.653  1.00 0.00 ? 20 SER A H    3  
ATOM 2707  H HA   . SER A 1 20 ? -8.290  -2.831  -4.130  1.00 0.00 ? 20 SER A HA   3  
ATOM 2708  H HB2  . SER A 1 20 ? -7.722  -0.074  -5.215  1.00 0.00 ? 20 SER A HB2  3  
ATOM 2709  H HB3  . SER A 1 20 ? -7.441  -1.635  -5.979  1.00 0.00 ? 20 SER A HB3  3  
ATOM 2710  H HG   . SER A 1 20 ? -9.845  -0.222  -5.586  1.00 0.00 ? 20 SER A HG   3  
ATOM 2711  N N    . LYS A 1 21 ? -6.228  -2.443  -2.787  1.00 0.00 ? 21 LYS A N    3  
ATOM 2712  C CA   . LYS A 1 21 ? -4.998  -2.204  -1.963  1.00 0.00 ? 21 LYS A CA   3  
ATOM 2713  C C    . LYS A 1 21 ? -3.850  -3.021  -2.546  1.00 0.00 ? 21 LYS A C    3  
ATOM 2714  O O    . LYS A 1 21 ? -3.879  -4.236  -2.576  1.00 0.00 ? 21 LYS A O    3  
ATOM 2715  C CB   . LYS A 1 21 ? -5.240  -2.599  -0.493  1.00 0.00 ? 21 LYS A CB   3  
ATOM 2716  C CG   . LYS A 1 21 ? -6.042  -1.494  0.225   1.00 0.00 ? 21 LYS A CG   3  
ATOM 2717  C CD   . LYS A 1 21 ? -5.099  -0.408  0.759   1.00 0.00 ? 21 LYS A CD   3  
ATOM 2718  C CE   . LYS A 1 21 ? -5.910  0.625   1.544   1.00 0.00 ? 21 LYS A CE   3  
ATOM 2719  N NZ   . LYS A 1 21 ? -7.017  1.139   0.688   1.00 0.00 ? 21 LYS A NZ   3  
ATOM 2720  H H    . LYS A 1 21 ? -6.458  -3.355  -3.074  1.00 0.00 ? 21 LYS A H    3  
ATOM 2721  H HA   . LYS A 1 21 ? -4.728  -1.157  -2.010  1.00 0.00 ? 21 LYS A HA   3  
ATOM 2722  H HB2  . LYS A 1 21 ? -5.791  -3.528  -0.452  1.00 0.00 ? 21 LYS A HB2  3  
ATOM 2723  H HB3  . LYS A 1 21 ? -4.288  -2.731  0.004   1.00 0.00 ? 21 LYS A HB3  3  
ATOM 2724  H HG2  . LYS A 1 21 ? -6.746  -1.048  -0.464  1.00 0.00 ? 21 LYS A HG2  3  
ATOM 2725  H HG3  . LYS A 1 21 ? -6.583  -1.927  1.052   1.00 0.00 ? 21 LYS A HG3  3  
ATOM 2726  H HD2  . LYS A 1 21 ? -4.363  -0.859  1.410   1.00 0.00 ? 21 LYS A HD2  3  
ATOM 2727  H HD3  . LYS A 1 21 ? -4.602  0.080   -0.063  1.00 0.00 ? 21 LYS A HD3  3  
ATOM 2728  H HE2  . LYS A 1 21 ? -6.323  0.162   2.428   1.00 0.00 ? 21 LYS A HE2  3  
ATOM 2729  H HE3  . LYS A 1 21 ? -5.268  1.444   1.833   1.00 0.00 ? 21 LYS A HE3  3  
ATOM 2730  H HZ1  . LYS A 1 21 ? -7.094  2.170   0.801   1.00 0.00 ? 21 LYS A HZ1  3  
ATOM 2731  H HZ2  . LYS A 1 21 ? -7.912  0.694   0.974   1.00 0.00 ? 21 LYS A HZ2  3  
ATOM 2732  H HZ3  . LYS A 1 21 ? -6.818  0.912   -0.308  1.00 0.00 ? 21 LYS A HZ3  3  
ATOM 2733  N N    . VAL A 1 22 ? -2.833  -2.340  -2.997  1.00 0.00 ? 22 VAL A N    3  
ATOM 2734  C CA   . VAL A 1 22 ? -1.643  -3.021  -3.575  1.00 0.00 ? 22 VAL A CA   3  
ATOM 2735  C C    . VAL A 1 22 ? -0.405  -2.558  -2.806  1.00 0.00 ? 22 VAL A C    3  
ATOM 2736  O O    . VAL A 1 22 ? -0.074  -1.389  -2.811  1.00 0.00 ? 22 VAL A O    3  
ATOM 2737  C CB   . VAL A 1 22 ? -1.534  -2.627  -5.052  1.00 0.00 ? 22 VAL A CB   3  
ATOM 2738  C CG1  . VAL A 1 22 ? -2.439  -3.532  -5.895  1.00 0.00 ? 22 VAL A CG1  3  
ATOM 2739  C CG2  . VAL A 1 22 ? -1.979  -1.171  -5.226  1.00 0.00 ? 22 VAL A CG2  3  
ATOM 2740  H H    . VAL A 1 22 ? -2.855  -1.366  -2.916  1.00 0.00 ? 22 VAL A H    3  
ATOM 2741  H HA   . VAL A 1 22 ? -1.740  -4.095  -3.486  1.00 0.00 ? 22 VAL A HA   3  
ATOM 2742  H HB   . VAL A 1 22 ? -0.514  -2.730  -5.377  1.00 0.00 ? 22 VAL A HB   3  
ATOM 2743  H HG11 . VAL A 1 22 ? -2.562  -3.104  -6.880  1.00 0.00 ? 22 VAL A HG11 3  
ATOM 2744  H HG12 . VAL A 1 22 ? -3.406  -3.620  -5.417  1.00 0.00 ? 22 VAL A HG12 3  
ATOM 2745  H HG13 . VAL A 1 22 ? -1.991  -4.510  -5.980  1.00 0.00 ? 22 VAL A HG13 3  
ATOM 2746  H HG21 . VAL A 1 22 ? -3.043  -1.097  -5.048  1.00 0.00 ? 22 VAL A HG21 3  
ATOM 2747  H HG22 . VAL A 1 22 ? -1.760  -0.845  -6.231  1.00 0.00 ? 22 VAL A HG22 3  
ATOM 2748  H HG23 . VAL A 1 22 ? -1.452  -0.546  -4.521  1.00 0.00 ? 22 VAL A HG23 3  
ATOM 2749  N N    . ILE A 1 23 ? 0.275   -3.457  -2.131  1.00 0.00 ? 23 ILE A N    3  
ATOM 2750  C CA   . ILE A 1 23 ? 1.487   -3.058  -1.345  1.00 0.00 ? 23 ILE A CA   3  
ATOM 2751  C C    . ILE A 1 23 ? 2.717   -3.775  -1.910  1.00 0.00 ? 23 ILE A C    3  
ATOM 2752  O O    . ILE A 1 23 ? 2.871   -4.972  -1.772  1.00 0.00 ? 23 ILE A O    3  
ATOM 2753  C CB   . ILE A 1 23 ? 1.295   -3.461  0.124   1.00 0.00 ? 23 ILE A CB   3  
ATOM 2754  C CG1  . ILE A 1 23 ? 0.143   -2.648  0.755   1.00 0.00 ? 23 ILE A CG1  3  
ATOM 2755  C CG2  . ILE A 1 23 ? 2.585   -3.183  0.900   1.00 0.00 ? 23 ILE A CG2  3  
ATOM 2756  C CD1  . ILE A 1 23 ? -1.229  -3.095  0.205   1.00 0.00 ? 23 ILE A CD1  3  
ATOM 2757  H H    . ILE A 1 23 ? -0.018  -4.394  -2.120  1.00 0.00 ? 23 ILE A H    3  
ATOM 2758  H HA   . ILE A 1 23 ? 1.643   -1.990  -1.402  1.00 0.00 ? 23 ILE A HA   3  
ATOM 2759  H HB   . ILE A 1 23 ? 1.069   -4.515  0.180   1.00 0.00 ? 23 ILE A HB   3  
ATOM 2760  H HG12 . ILE A 1 23 ? 0.158   -2.792  1.827   1.00 0.00 ? 23 ILE A HG12 3  
ATOM 2761  H HG13 . ILE A 1 23 ? 0.289   -1.598  0.540   1.00 0.00 ? 23 ILE A HG13 3  
ATOM 2762  H HG21 . ILE A 1 23 ? 2.387   -3.245  1.960   1.00 0.00 ? 23 ILE A HG21 3  
ATOM 2763  H HG22 . ILE A 1 23 ? 2.944   -2.195  0.658   1.00 0.00 ? 23 ILE A HG22 3  
ATOM 2764  H HG23 . ILE A 1 23 ? 3.332   -3.914  0.630   1.00 0.00 ? 23 ILE A HG23 3  
ATOM 2765  H HD11 . ILE A 1 23 ? -1.590  -2.361  -0.500  1.00 0.00 ? 23 ILE A HD11 3  
ATOM 2766  H HD12 . ILE A 1 23 ? -1.933  -3.175  1.021   1.00 0.00 ? 23 ILE A HD12 3  
ATOM 2767  H HD13 . ILE A 1 23 ? -1.148  -4.054  -0.287  1.00 0.00 ? 23 ILE A HD13 3  
ATOM 2768  N N    . THR A 1 24 ? 3.598   -3.034  -2.536  1.00 0.00 ? 24 THR A N    3  
ATOM 2769  C CA   . THR A 1 24 ? 4.843   -3.624  -3.116  1.00 0.00 ? 24 THR A CA   3  
ATOM 2770  C C    . THR A 1 24 ? 6.051   -2.859  -2.569  1.00 0.00 ? 24 THR A C    3  
ATOM 2771  O O    . THR A 1 24 ? 6.267   -1.714  -2.918  1.00 0.00 ? 24 THR A O    3  
ATOM 2772  C CB   . THR A 1 24 ? 4.806   -3.489  -4.642  1.00 0.00 ? 24 THR A CB   3  
ATOM 2773  O OG1  . THR A 1 24 ? 3.664   -4.165  -5.149  1.00 0.00 ? 24 THR A OG1  3  
ATOM 2774  C CG2  . THR A 1 24 ? 6.074   -4.102  -5.240  1.00 0.00 ? 24 THR A CG2  3  
ATOM 2775  H H    . THR A 1 24 ? 3.444   -2.080  -2.613  1.00 0.00 ? 24 THR A H    3  
ATOM 2776  H HA   . THR A 1 24 ? 4.920   -4.663  -2.852  1.00 0.00 ? 24 THR A HA   3  
ATOM 2777  H HB   . THR A 1 24 ? 4.757   -2.446  -4.911  1.00 0.00 ? 24 THR A HB   3  
ATOM 2778  H HG1  . THR A 1 24 ? 3.969   -4.866  -5.730  1.00 0.00 ? 24 THR A HG1  3  
ATOM 2779  H HG21 . THR A 1 24 ? 6.247   -5.073  -4.798  1.00 0.00 ? 24 THR A HG21 3  
ATOM 2780  H HG22 . THR A 1 24 ? 6.916   -3.458  -5.037  1.00 0.00 ? 24 THR A HG22 3  
ATOM 2781  H HG23 . THR A 1 24 ? 5.951   -4.209  -6.307  1.00 0.00 ? 24 THR A HG23 3  
ATOM 2782  N N    . LYS A 1 25 ? 6.858   -3.479  -1.738  1.00 0.00 ? 25 LYS A N    3  
ATOM 2783  C CA   . LYS A 1 25 ? 8.070   -2.793  -1.197  1.00 0.00 ? 25 LYS A CA   3  
ATOM 2784  C C    . LYS A 1 25 ? 9.260   -3.652  -1.567  1.00 0.00 ? 25 LYS A C    3  
ATOM 2785  O O    . LYS A 1 25 ? 9.450   -4.717  -1.012  1.00 0.00 ? 25 LYS A O    3  
ATOM 2786  C CB   . LYS A 1 25 ? 7.962   -2.676  0.331   1.00 0.00 ? 25 LYS A CB   3  
ATOM 2787  C CG   . LYS A 1 25 ? 8.968   -1.641  0.844   1.00 0.00 ? 25 LYS A CG   3  
ATOM 2788  C CD   . LYS A 1 25 ? 8.909   -1.591  2.373   1.00 0.00 ? 25 LYS A CD   3  
ATOM 2789  C CE   . LYS A 1 25 ? 10.087  -0.773  2.906   1.00 0.00 ? 25 LYS A CE   3  
ATOM 2790  N NZ   . LYS A 1 25 ? 9.906   0.658   2.531   1.00 0.00 ? 25 LYS A NZ   3  
ATOM 2791  H H    . LYS A 1 25 ? 6.693   -4.418  -1.496  1.00 0.00 ? 25 LYS A H    3  
ATOM 2792  H HA   . LYS A 1 25 ? 8.185   -1.806  -1.635  1.00 0.00 ? 25 LYS A HA   3  
ATOM 2793  H HB2  . LYS A 1 25 ? 6.963   -2.366  0.599   1.00 0.00 ? 25 LYS A HB2  3  
ATOM 2794  H HB3  . LYS A 1 25 ? 8.175   -3.632  0.786   1.00 0.00 ? 25 LYS A HB3  3  
ATOM 2795  H HG2  . LYS A 1 25 ? 9.964   -1.919  0.529   1.00 0.00 ? 25 LYS A HG2  3  
ATOM 2796  H HG3  . LYS A 1 25 ? 8.721   -0.669  0.444   1.00 0.00 ? 25 LYS A HG3  3  
ATOM 2797  H HD2  . LYS A 1 25 ? 7.982   -1.131  2.681   1.00 0.00 ? 25 LYS A HD2  3  
ATOM 2798  H HD3  . LYS A 1 25 ? 8.964   -2.595  2.768   1.00 0.00 ? 25 LYS A HD3  3  
ATOM 2799  H HE2  . LYS A 1 25 ? 10.129  -0.860  3.981   1.00 0.00 ? 25 LYS A HE2  3  
ATOM 2800  H HE3  . LYS A 1 25 ? 11.008  -1.143  2.479   1.00 0.00 ? 25 LYS A HE3  3  
ATOM 2801  H HZ1  . LYS A 1 25 ? 10.511  0.883   1.716   1.00 0.00 ? 25 LYS A HZ1  3  
ATOM 2802  H HZ2  . LYS A 1 25 ? 10.170  1.263   3.334   1.00 0.00 ? 25 LYS A HZ2  3  
ATOM 2803  H HZ3  . LYS A 1 25 ? 8.909   0.827   2.281   1.00 0.00 ? 25 LYS A HZ3  3  
ATOM 2804  N N    . THR A 1 26 ? 10.058  -3.222  -2.502  1.00 0.00 ? 26 THR A N    3  
ATOM 2805  C CA   . THR A 1 26 ? 11.233  -4.043  -2.909  1.00 0.00 ? 26 THR A CA   3  
ATOM 2806  C C    . THR A 1 26 ? 12.506  -3.405  -2.347  1.00 0.00 ? 26 THR A C    3  
ATOM 2807  O O    . THR A 1 26 ? 12.826  -2.279  -2.671  1.00 0.00 ? 26 THR A O    3  
ATOM 2808  C CB   . THR A 1 26 ? 11.319  -4.080  -4.436  1.00 0.00 ? 26 THR A CB   3  
ATOM 2809  O OG1  . THR A 1 26 ? 11.258  -2.754  -4.943  1.00 0.00 ? 26 THR A OG1  3  
ATOM 2810  C CG2  . THR A 1 26 ? 10.152  -4.896  -4.995  1.00 0.00 ? 26 THR A CG2  3  
ATOM 2811  H H    . THR A 1 26 ? 9.880   -2.366  -2.944  1.00 0.00 ? 26 THR A H    3  
ATOM 2812  H HA   . THR A 1 26 ? 11.117  -5.052  -2.530  1.00 0.00 ? 26 THR A HA   3  
ATOM 2813  H HB   . THR A 1 26 ? 12.248  -4.538  -4.735  1.00 0.00 ? 26 THR A HB   3  
ATOM 2814  H HG1  . THR A 1 26 ? 10.753  -2.223  -4.324  1.00 0.00 ? 26 THR A HG1  3  
ATOM 2815  H HG21 . THR A 1 26 ? 10.285  -5.937  -4.739  1.00 0.00 ? 26 THR A HG21 3  
ATOM 2816  H HG22 . THR A 1 26 ? 10.122  -4.792  -6.069  1.00 0.00 ? 26 THR A HG22 3  
ATOM 2817  H HG23 . THR A 1 26 ? 9.226   -4.537  -4.573  1.00 0.00 ? 26 THR A HG23 3  
ATOM 2818  N N    . VAL A 1 27 ? 13.234  -4.101  -1.503  1.00 0.00 ? 27 VAL A N    3  
ATOM 2819  C CA   . VAL A 1 27 ? 14.484  -3.513  -0.920  1.00 0.00 ? 27 VAL A CA   3  
ATOM 2820  C C    . VAL A 1 27 ? 15.714  -4.154  -1.567  1.00 0.00 ? 27 VAL A C    3  
ATOM 2821  O O    . VAL A 1 27 ? 16.006  -5.316  -1.363  1.00 0.00 ? 27 VAL A O    3  
ATOM 2822  C CB   . VAL A 1 27 ? 14.516  -3.781  0.588   1.00 0.00 ? 27 VAL A CB   3  
ATOM 2823  C CG1  . VAL A 1 27 ? 15.621  -2.943  1.232   1.00 0.00 ? 27 VAL A CG1  3  
ATOM 2824  C CG2  . VAL A 1 27 ? 13.167  -3.402  1.202   1.00 0.00 ? 27 VAL A CG2  3  
ATOM 2825  H H    . VAL A 1 27 ? 12.960  -5.006  -1.243  1.00 0.00 ? 27 VAL A H    3  
ATOM 2826  H HA   . VAL A 1 27 ? 14.510  -2.445  -1.088  1.00 0.00 ? 27 VAL A HA   3  
ATOM 2827  H HB   . VAL A 1 27 ? 14.714  -4.829  0.765   1.00 0.00 ? 27 VAL A HB   3  
ATOM 2828  H HG11 . VAL A 1 27 ? 16.578  -3.238  0.829   1.00 0.00 ? 27 VAL A HG11 3  
ATOM 2829  H HG12 . VAL A 1 27 ? 15.616  -3.100  2.301   1.00 0.00 ? 27 VAL A HG12 3  
ATOM 2830  H HG13 . VAL A 1 27 ? 15.448  -1.897  1.022   1.00 0.00 ? 27 VAL A HG13 3  
ATOM 2831  H HG21 . VAL A 1 27 ? 12.919  -2.386  0.928   1.00 0.00 ? 27 VAL A HG21 3  
ATOM 2832  H HG22 . VAL A 1 27 ? 13.226  -3.479  2.278   1.00 0.00 ? 27 VAL A HG22 3  
ATOM 2833  H HG23 . VAL A 1 27 ? 12.403  -4.070  0.836   1.00 0.00 ? 27 VAL A HG23 3  
ATOM 2834  N N    . THR A 1 28 ? 16.441  -3.384  -2.336  1.00 0.00 ? 28 THR A N    3  
ATOM 2835  C CA   . THR A 1 28 ? 17.674  -3.910  -3.005  1.00 0.00 ? 28 THR A CA   3  
ATOM 2836  C C    . THR A 1 28 ? 18.911  -3.307  -2.335  1.00 0.00 ? 28 THR A C    3  
ATOM 2837  O O    . THR A 1 28 ? 19.233  -2.155  -2.544  1.00 0.00 ? 28 THR A O    3  
ATOM 2838  C CB   . THR A 1 28 ? 17.656  -3.510  -4.483  1.00 0.00 ? 28 THR A CB   3  
ATOM 2839  O OG1  . THR A 1 28 ? 16.467  -3.999  -5.089  1.00 0.00 ? 28 THR A OG1  3  
ATOM 2840  C CG2  . THR A 1 28 ? 18.874  -4.107  -5.191  1.00 0.00 ? 28 THR A CG2  3  
ATOM 2841  H H    . THR A 1 28 ? 16.163  -2.453  -2.458  1.00 0.00 ? 28 THR A H    3  
ATOM 2842  H HA   . THR A 1 28 ? 17.712  -4.989  -2.925  1.00 0.00 ? 28 THR A HA   3  
ATOM 2843  H HB   . THR A 1 28 ? 17.688  -2.435  -4.566  1.00 0.00 ? 28 THR A HB   3  
ATOM 2844  H HG1  . THR A 1 28 ? 16.390  -4.933  -4.882  1.00 0.00 ? 28 THR A HG1  3  
ATOM 2845  H HG21 . THR A 1 28 ? 19.776  -3.688  -4.771  1.00 0.00 ? 28 THR A HG21 3  
ATOM 2846  H HG22 . THR A 1 28 ? 18.827  -3.876  -6.246  1.00 0.00 ? 28 THR A HG22 3  
ATOM 2847  H HG23 . THR A 1 28 ? 18.880  -5.179  -5.058  1.00 0.00 ? 28 THR A HG23 3  
ATOM 2848  N N    . ASN A 1 29 ? 19.609  -4.070  -1.527  1.00 0.00 ? 29 ASN A N    3  
ATOM 2849  C CA   . ASN A 1 29 ? 20.826  -3.532  -0.842  1.00 0.00 ? 29 ASN A CA   3  
ATOM 2850  C C    . ASN A 1 29 ? 22.081  -3.992  -1.586  1.00 0.00 ? 29 ASN A C    3  
ATOM 2851  O O    . ASN A 1 29 ? 22.335  -5.173  -1.734  1.00 0.00 ? 29 ASN A O    3  
ATOM 2852  C CB   . ASN A 1 29 ? 20.869  -4.059  0.594   1.00 0.00 ? 29 ASN A CB   3  
ATOM 2853  C CG   . ASN A 1 29 ? 22.058  -3.441  1.331   1.00 0.00 ? 29 ASN A CG   3  
ATOM 2854  O OD1  . ASN A 1 29 ? 22.931  -2.859  0.720   1.00 0.00 ? 29 ASN A OD1  3  
ATOM 2855  N ND2  . ASN A 1 29 ? 22.129  -3.546  2.630   1.00 0.00 ? 29 ASN A ND2  3  
ATOM 2856  H H    . ASN A 1 29 ? 19.335  -4.994  -1.351  1.00 0.00 ? 29 ASN A H    3  
ATOM 2857  H HA   . ASN A 1 29 ? 20.795  -2.450  -0.824  1.00 0.00 ? 29 ASN A HA   3  
ATOM 2858  H HB2  . ASN A 1 29 ? 19.952  -3.794  1.101   1.00 0.00 ? 29 ASN A HB2  3  
ATOM 2859  H HB3  . ASN A 1 29 ? 20.976  -5.131  0.579   1.00 0.00 ? 29 ASN A HB3  3  
ATOM 2860  H HD21 . ASN A 1 29 ? 21.425  -4.015  3.123   1.00 0.00 ? 29 ASN A HD21 3  
ATOM 2861  H HD22 . ASN A 1 29 ? 22.888  -3.154  3.113   1.00 0.00 ? 29 ASN A HD22 3  
ATOM 2862  N N    . ALA A 1 30 ? 22.863  -3.059  -2.059  1.00 0.00 ? 30 ALA A N    3  
ATOM 2863  C CA   . ALA A 1 30 ? 24.106  -3.405  -2.805  1.00 0.00 ? 30 ALA A CA   3  
ATOM 2864  C C    . ALA A 1 30 ? 24.920  -4.456  -2.047  1.00 0.00 ? 30 ALA A C    3  
ATOM 2865  O O    . ALA A 1 30 ? 25.859  -5.018  -2.577  1.00 0.00 ? 30 ALA A O    3  
ATOM 2866  C CB   . ALA A 1 30 ? 24.954  -2.145  -2.985  1.00 0.00 ? 30 ALA A CB   3  
ATOM 2867  H H    . ALA A 1 30 ? 22.631  -2.116  -1.931  1.00 0.00 ? 30 ALA A H    3  
ATOM 2868  H HA   . ALA A 1 30 ? 23.841  -3.794  -3.777  1.00 0.00 ? 30 ALA A HA   3  
ATOM 2869  H HB1  . ALA A 1 30 ? 24.376  -1.393  -3.503  1.00 0.00 ? 30 ALA A HB1  3  
ATOM 2870  H HB2  . ALA A 1 30 ? 25.836  -2.383  -3.562  1.00 0.00 ? 30 ALA A HB2  3  
ATOM 2871  H HB3  . ALA A 1 30 ? 25.248  -1.767  -2.017  1.00 0.00 ? 30 ALA A HB3  3  
ATOM 2872  N N    . ASP A 1 31 ? 24.591  -4.729  -0.813  1.00 0.00 ? 31 ASP A N    3  
ATOM 2873  C CA   . ASP A 1 31 ? 25.381  -5.739  -0.054  1.00 0.00 ? 31 ASP A CA   3  
ATOM 2874  C C    . ASP A 1 31 ? 25.074  -7.141  -0.595  1.00 0.00 ? 31 ASP A C    3  
ATOM 2875  O O    . ASP A 1 31 ? 25.690  -8.112  -0.202  1.00 0.00 ? 31 ASP A O    3  
ATOM 2876  C CB   . ASP A 1 31 ? 25.024  -5.661  1.438   1.00 0.00 ? 31 ASP A CB   3  
ATOM 2877  C CG   . ASP A 1 31 ? 25.737  -4.466  2.075   1.00 0.00 ? 31 ASP A CG   3  
ATOM 2878  O OD1  . ASP A 1 31 ? 26.883  -4.230  1.729   1.00 0.00 ? 31 ASP A OD1  3  
ATOM 2879  O OD2  . ASP A 1 31 ? 25.124  -3.807  2.898   1.00 0.00 ? 31 ASP A OD2  3  
ATOM 2880  H H    . ASP A 1 31 ? 23.836  -4.273  -0.385  1.00 0.00 ? 31 ASP A H    3  
ATOM 2881  H HA   . ASP A 1 31 ? 26.434  -5.535  -0.183  1.00 0.00 ? 31 ASP A HA   3  
ATOM 2882  H HB2  . ASP A 1 31 ? 23.958  -5.541  1.548   1.00 0.00 ? 31 ASP A HB2  3  
ATOM 2883  H HB3  . ASP A 1 31 ? 25.339  -6.569  1.932   1.00 0.00 ? 31 ASP A HB3  3  
ATOM 2884  N N    . GLY A 1 32 ? 24.139  -7.252  -1.510  1.00 0.00 ? 32 GLY A N    3  
ATOM 2885  C CA   . GLY A 1 32 ? 23.802  -8.589  -2.102  1.00 0.00 ? 32 GLY A CA   3  
ATOM 2886  C C    . GLY A 1 32 ? 22.492  -9.122  -1.518  1.00 0.00 ? 32 GLY A C    3  
ATOM 2887  O O    . GLY A 1 32 ? 22.104  -10.244 -1.779  1.00 0.00 ? 32 GLY A O    3  
ATOM 2888  H H    . GLY A 1 32 ? 23.661  -6.453  -1.818  1.00 0.00 ? 32 GLY A H    3  
ATOM 2889  H HA2  . GLY A 1 32 ? 23.694  -8.484  -3.171  1.00 0.00 ? 32 GLY A HA2  3  
ATOM 2890  H HA3  . GLY A 1 32 ? 24.595  -9.295  -1.895  1.00 0.00 ? 32 GLY A HA3  3  
ATOM 2891  N N    . ARG A 1 33 ? 21.801  -8.334  -0.733  1.00 0.00 ? 33 ARG A N    3  
ATOM 2892  C CA   . ARG A 1 33 ? 20.511  -8.804  -0.138  1.00 0.00 ? 33 ARG A CA   3  
ATOM 2893  C C    . ARG A 1 33 ? 19.349  -8.284  -0.978  1.00 0.00 ? 33 ARG A C    3  
ATOM 2894  O O    . ARG A 1 33 ? 19.404  -7.212  -1.547  1.00 0.00 ? 33 ARG A O    3  
ATOM 2895  C CB   . ARG A 1 33 ? 20.397  -8.283  1.308   1.00 0.00 ? 33 ARG A CB   3  
ATOM 2896  C CG   . ARG A 1 33 ? 21.059  -9.284  2.270   1.00 0.00 ? 33 ARG A CG   3  
ATOM 2897  C CD   . ARG A 1 33 ? 21.517  -8.570  3.546   1.00 0.00 ? 33 ARG A CD   3  
ATOM 2898  N NE   . ARG A 1 33 ? 20.448  -7.641  4.008   1.00 0.00 ? 33 ARG A NE   3  
ATOM 2899  C CZ   . ARG A 1 33 ? 20.480  -7.164  5.222   1.00 0.00 ? 33 ARG A CZ   3  
ATOM 2900  N NH1  . ARG A 1 33 ? 21.444  -7.508  6.032   1.00 0.00 ? 33 ARG A NH1  3  
ATOM 2901  N NH2  . ARG A 1 33 ? 19.548  -6.346  5.627   1.00 0.00 ? 33 ARG A NH2  3  
ATOM 2902  H H    . ARG A 1 33 ? 22.127  -7.434  -0.537  1.00 0.00 ? 33 ARG A H    3  
ATOM 2903  H HA   . ARG A 1 33 ? 20.479  -9.887  -0.135  1.00 0.00 ? 33 ARG A HA   3  
ATOM 2904  H HB2  . ARG A 1 33 ? 20.893  -7.326  1.381   1.00 0.00 ? 33 ARG A HB2  3  
ATOM 2905  H HB3  . ARG A 1 33 ? 19.355  -8.168  1.578   1.00 0.00 ? 33 ARG A HB3  3  
ATOM 2906  H HG2  . ARG A 1 33 ? 20.350  -10.058 2.527   1.00 0.00 ? 33 ARG A HG2  3  
ATOM 2907  H HG3  . ARG A 1 33 ? 21.912  -9.731  1.784   1.00 0.00 ? 33 ARG A HG3  3  
ATOM 2908  H HD2  . ARG A 1 33 ? 21.715  -9.302  4.315   1.00 0.00 ? 33 ARG A HD2  3  
ATOM 2909  H HD3  . ARG A 1 33 ? 22.416  -8.009  3.341   1.00 0.00 ? 33 ARG A HD3  3  
ATOM 2910  H HE   . ARG A 1 33 ? 19.722  -7.386  3.400   1.00 0.00 ? 33 ARG A HE   3  
ATOM 2911  H HH11 . ARG A 1 33 ? 22.157  -8.135  5.722   1.00 0.00 ? 33 ARG A HH11 3  
ATOM 2912  H HH12 . ARG A 1 33 ? 21.469  -7.142  6.963   1.00 0.00 ? 33 ARG A HH12 3  
ATOM 2913  H HH21 . ARG A 1 33 ? 18.808  -6.084  5.006   1.00 0.00 ? 33 ARG A HH21 3  
ATOM 2914  H HH22 . ARG A 1 33 ? 19.573  -5.980  6.557   1.00 0.00 ? 33 ARG A HH22 3  
ATOM 2915  N N    . THR A 1 34 ? 18.297  -9.045  -1.058  1.00 0.00 ? 34 THR A N    3  
ATOM 2916  C CA   . THR A 1 34 ? 17.120  -8.610  -1.867  1.00 0.00 ? 34 THR A CA   3  
ATOM 2917  C C    . THR A 1 34 ? 15.845  -9.283  -1.354  1.00 0.00 ? 34 THR A C    3  
ATOM 2918  O O    . THR A 1 34 ? 15.666  -10.479 -1.479  1.00 0.00 ? 34 THR A O    3  
ATOM 2919  C CB   . THR A 1 34 ? 17.335  -8.997  -3.335  1.00 0.00 ? 34 THR A CB   3  
ATOM 2920  O OG1  . THR A 1 34 ? 17.663  -10.377 -3.413  1.00 0.00 ? 34 THR A OG1  3  
ATOM 2921  C CG2  . THR A 1 34 ? 18.473  -8.166  -3.935  1.00 0.00 ? 34 THR A CG2  3  
ATOM 2922  H H    . THR A 1 34 ? 18.288  -9.906  -0.587  1.00 0.00 ? 34 THR A H    3  
ATOM 2923  H HA   . THR A 1 34 ? 17.007  -7.537  -1.793  1.00 0.00 ? 34 THR A HA   3  
ATOM 2924  H HB   . THR A 1 34 ? 16.429  -8.811  -3.891  1.00 0.00 ? 34 THR A HB   3  
ATOM 2925  H HG1  . THR A 1 34 ? 18.057  -10.636 -2.578  1.00 0.00 ? 34 THR A HG1  3  
ATOM 2926  H HG21 . THR A 1 34 ? 19.420  -8.534  -3.569  1.00 0.00 ? 34 THR A HG21 3  
ATOM 2927  H HG22 . THR A 1 34 ? 18.354  -7.131  -3.652  1.00 0.00 ? 34 THR A HG22 3  
ATOM 2928  H HG23 . THR A 1 34 ? 18.447  -8.249  -5.012  1.00 0.00 ? 34 THR A HG23 3  
ATOM 2929  N N    . GLU A 1 35 ? 14.947  -8.508  -0.799  1.00 0.00 ? 35 GLU A N    3  
ATOM 2930  C CA   . GLU A 1 35 ? 13.652  -9.059  -0.290  1.00 0.00 ? 35 GLU A CA   3  
ATOM 2931  C C    . GLU A 1 35 ? 12.529  -8.460  -1.135  1.00 0.00 ? 35 GLU A C    3  
ATOM 2932  O O    . GLU A 1 35 ? 12.666  -7.370  -1.653  1.00 0.00 ? 35 GLU A O    3  
ATOM 2933  C CB   . GLU A 1 35 ? 13.463  -8.655  1.174   1.00 0.00 ? 35 GLU A CB   3  
ATOM 2934  C CG   . GLU A 1 35 ? 12.157  -9.251  1.703   1.00 0.00 ? 35 GLU A CG   3  
ATOM 2935  C CD   . GLU A 1 35 ? 12.006  -8.920  3.188   1.00 0.00 ? 35 GLU A CD   3  
ATOM 2936  O OE1  . GLU A 1 35 ? 12.348  -7.810  3.565   1.00 0.00 ? 35 GLU A OE1  3  
ATOM 2937  O OE2  . GLU A 1 35 ? 11.551  -9.779  3.924   1.00 0.00 ? 35 GLU A OE2  3  
ATOM 2938  H H    . GLU A 1 35 ? 15.120  -7.545  -0.733  1.00 0.00 ? 35 GLU A H    3  
ATOM 2939  H HA   . GLU A 1 35 ? 13.638  -10.137 -0.376  1.00 0.00 ? 35 GLU A HA   3  
ATOM 2940  H HB2  . GLU A 1 35 ? 14.292  -9.025  1.760   1.00 0.00 ? 35 GLU A HB2  3  
ATOM 2941  H HB3  . GLU A 1 35 ? 13.420  -7.578  1.249   1.00 0.00 ? 35 GLU A HB3  3  
ATOM 2942  H HG2  . GLU A 1 35 ? 11.324  -8.836  1.154   1.00 0.00 ? 35 GLU A HG2  3  
ATOM 2943  H HG3  . GLU A 1 35 ? 12.173  -10.323 1.576   1.00 0.00 ? 35 GLU A HG3  3  
ATOM 2944  N N    . THR A 1 36 ? 11.421  -9.150  -1.291  1.00 0.00 ? 36 THR A N    3  
ATOM 2945  C CA   . THR A 1 36 ? 10.308  -8.603  -2.110  1.00 0.00 ? 36 THR A CA   3  
ATOM 2946  C C    . THR A 1 36 ? 9.019   -8.738  -1.322  1.00 0.00 ? 36 THR A C    3  
ATOM 2947  O O    . THR A 1 36 ? 8.516   -9.825  -1.117  1.00 0.00 ? 36 THR A O    3  
ATOM 2948  C CB   . THR A 1 36 ? 10.194  -9.400  -3.412  1.00 0.00 ? 36 THR A CB   3  
ATOM 2949  O OG1  . THR A 1 36 ? 10.031  -10.778 -3.109  1.00 0.00 ? 36 THR A OG1  3  
ATOM 2950  C CG2  . THR A 1 36 ? 11.463  -9.205  -4.243  1.00 0.00 ? 36 THR A CG2  3  
ATOM 2951  H H    . THR A 1 36 ? 11.312  -10.025 -0.868  1.00 0.00 ? 36 THR A H    3  
ATOM 2952  H HA   . THR A 1 36 ? 10.477  -7.559  -2.339  1.00 0.00 ? 36 THR A HA   3  
ATOM 2953  H HB   . THR A 1 36 ? 9.343   -9.050  -3.975  1.00 0.00 ? 36 THR A HB   3  
ATOM 2954  H HG1  . THR A 1 36 ? 10.144  -11.276 -3.921  1.00 0.00 ? 36 THR A HG1  3  
ATOM 2955  H HG21 . THR A 1 36 ? 12.320  -9.541  -3.678  1.00 0.00 ? 36 THR A HG21 3  
ATOM 2956  H HG22 . THR A 1 36 ? 11.579  -8.159  -4.485  1.00 0.00 ? 36 THR A HG22 3  
ATOM 2957  H HG23 . THR A 1 36 ? 11.387  -9.779  -5.155  1.00 0.00 ? 36 THR A HG23 3  
ATOM 2958  N N    . THR A 1 37 ? 8.453   -7.640  -0.918  1.00 0.00 ? 37 THR A N    3  
ATOM 2959  C CA   . THR A 1 37 ? 7.159   -7.687  -0.185  1.00 0.00 ? 37 THR A CA   3  
ATOM 2960  C C    . THR A 1 37 ? 6.093   -7.337  -1.202  1.00 0.00 ? 37 THR A C    3  
ATOM 2961  O O    . THR A 1 37 ? 6.020   -6.221  -1.656  1.00 0.00 ? 37 THR A O    3  
ATOM 2962  C CB   . THR A 1 37 ? 7.158   -6.655  0.946   1.00 0.00 ? 37 THR A CB   3  
ATOM 2963  O OG1  . THR A 1 37 ? 8.360   -6.771  1.694   1.00 0.00 ? 37 THR A OG1  3  
ATOM 2964  C CG2  . THR A 1 37 ? 5.958   -6.901  1.862   1.00 0.00 ? 37 THR A CG2  3  
ATOM 2965  H H    . THR A 1 37 ? 8.852   -6.768  -1.141  1.00 0.00 ? 37 THR A H    3  
ATOM 2966  H HA   . THR A 1 37 ? 6.975   -8.681  0.216   1.00 0.00 ? 37 THR A HA   3  
ATOM 2967  H HB   . THR A 1 37 ? 7.087   -5.665  0.527   1.00 0.00 ? 37 THR A HB   3  
ATOM 2968  H HG1  . THR A 1 37 ? 8.978   -7.300  1.184   1.00 0.00 ? 37 THR A HG1  3  
ATOM 2969  H HG21 . THR A 1 37 ? 5.044   -6.698  1.321   1.00 0.00 ? 37 THR A HG21 3  
ATOM 2970  H HG22 . THR A 1 37 ? 6.021   -6.247  2.720   1.00 0.00 ? 37 THR A HG22 3  
ATOM 2971  H HG23 . THR A 1 37 ? 5.960   -7.929  2.191   1.00 0.00 ? 37 THR A HG23 3  
ATOM 2972  N N    . LYS A 1 38 ? 5.282   -8.281  -1.576  1.00 0.00 ? 38 LYS A N    3  
ATOM 2973  C CA   . LYS A 1 38 ? 4.212   -8.013  -2.592  1.00 0.00 ? 38 LYS A CA   3  
ATOM 2974  C C    . LYS A 1 38 ? 2.881   -8.591  -2.106  1.00 0.00 ? 38 LYS A C    3  
ATOM 2975  O O    . LYS A 1 38 ? 2.723   -9.789  -1.976  1.00 0.00 ? 38 LYS A O    3  
ATOM 2976  C CB   . LYS A 1 38 ? 4.594   -8.685  -3.913  1.00 0.00 ? 38 LYS A CB   3  
ATOM 2977  C CG   . LYS A 1 38 ? 6.051   -8.362  -4.252  1.00 0.00 ? 38 LYS A CG   3  
ATOM 2978  C CD   . LYS A 1 38 ? 6.326   -8.710  -5.717  1.00 0.00 ? 38 LYS A CD   3  
ATOM 2979  C CE   . LYS A 1 38 ? 6.034   -10.194 -5.960  1.00 0.00 ? 38 LYS A CE   3  
ATOM 2980  N NZ   . LYS A 1 38 ? 6.677   -10.624 -7.233  1.00 0.00 ? 38 LYS A NZ   3  
ATOM 2981  H H    . LYS A 1 38 ? 5.361   -9.172  -1.192  1.00 0.00 ? 38 LYS A H    3  
ATOM 2982  H HA   . LYS A 1 38 ? 4.101   -6.949  -2.751  1.00 0.00 ? 38 LYS A HA   3  
ATOM 2983  H HB2  . LYS A 1 38 ? 4.475   -9.755  -3.817  1.00 0.00 ? 38 LYS A HB2  3  
ATOM 2984  H HB3  . LYS A 1 38 ? 3.953   -8.321  -4.701  1.00 0.00 ? 38 LYS A HB3  3  
ATOM 2985  H HG2  . LYS A 1 38 ? 6.232   -7.310  -4.090  1.00 0.00 ? 38 LYS A HG2  3  
ATOM 2986  H HG3  . LYS A 1 38 ? 6.704   -8.942  -3.617  1.00 0.00 ? 38 LYS A HG3  3  
ATOM 2987  H HD2  . LYS A 1 38 ? 5.693   -8.110  -6.354  1.00 0.00 ? 38 LYS A HD2  3  
ATOM 2988  H HD3  . LYS A 1 38 ? 7.361   -8.508  -5.946  1.00 0.00 ? 38 LYS A HD3  3  
ATOM 2989  H HE2  . LYS A 1 38 ? 6.429   -10.780 -5.142  1.00 0.00 ? 38 LYS A HE2  3  
ATOM 2990  H HE3  . LYS A 1 38 ? 4.967   -10.345 -6.028  1.00 0.00 ? 38 LYS A HE3  3  
ATOM 2991  H HZ1  . LYS A 1 38 ? 6.167   -10.207 -8.038  1.00 0.00 ? 38 LYS A HZ1  3  
ATOM 2992  H HZ2  . LYS A 1 38 ? 6.644   -11.661 -7.306  1.00 0.00 ? 38 LYS A HZ2  3  
ATOM 2993  H HZ3  . LYS A 1 38 ? 7.667   -10.306 -7.246  1.00 0.00 ? 38 LYS A HZ3  3  
ATOM 2994  N N    . GLU A 1 39 ? 1.921   -7.741  -1.847  1.00 0.00 ? 39 GLU A N    3  
ATOM 2995  C CA   . GLU A 1 39 ? 0.579   -8.207  -1.379  1.00 0.00 ? 39 GLU A CA   3  
ATOM 2996  C C    . GLU A 1 39 ? -0.494  -7.512  -2.230  1.00 0.00 ? 39 GLU A C    3  
ATOM 2997  O O    . GLU A 1 39 ? -0.951  -6.437  -1.895  1.00 0.00 ? 39 GLU A O    3  
ATOM 2998  C CB   . GLU A 1 39 ? 0.391   -7.819  0.094   1.00 0.00 ? 39 GLU A CB   3  
ATOM 2999  C CG   . GLU A 1 39 ? 1.147   -8.802  0.994   1.00 0.00 ? 39 GLU A CG   3  
ATOM 3000  C CD   . GLU A 1 39 ? 2.651   -8.667  0.754   1.00 0.00 ? 39 GLU A CD   3  
ATOM 3001  O OE1  . GLU A 1 39 ? 3.070   -7.600  0.336   1.00 0.00 ? 39 GLU A OE1  3  
ATOM 3002  O OE2  . GLU A 1 39 ? 3.358   -9.633  0.988   1.00 0.00 ? 39 GLU A OE2  3  
ATOM 3003  H H    . GLU A 1 39 ? 2.081   -6.782  -1.971  1.00 0.00 ? 39 GLU A H    3  
ATOM 3004  H HA   . GLU A 1 39 ? 0.496   -9.282  -1.482  1.00 0.00 ? 39 GLU A HA   3  
ATOM 3005  H HB2  . GLU A 1 39 ? 0.773   -6.822  0.252   1.00 0.00 ? 39 GLU A HB2  3  
ATOM 3006  H HB3  . GLU A 1 39 ? -0.660  -7.844  0.342   1.00 0.00 ? 39 GLU A HB3  3  
ATOM 3007  H HG2  . GLU A 1 39 ? 0.927   -8.582  2.028   1.00 0.00 ? 39 GLU A HG2  3  
ATOM 3008  H HG3  . GLU A 1 39 ? 0.836   -9.811  0.767   1.00 0.00 ? 39 GLU A HG3  3  
ATOM 3009  N N    . VAL A 1 40 ? -0.902  -8.105  -3.332  1.00 0.00 ? 40 VAL A N    3  
ATOM 3010  C CA   . VAL A 1 40 ? -1.941  -7.458  -4.195  1.00 0.00 ? 40 VAL A CA   3  
ATOM 3011  C C    . VAL A 1 40 ? -3.316  -8.051  -3.872  1.00 0.00 ? 40 VAL A C    3  
ATOM 3012  O O    . VAL A 1 40 ? -3.539  -9.236  -4.015  1.00 0.00 ? 40 VAL A O    3  
ATOM 3013  C CB   . VAL A 1 40 ? -1.602  -7.704  -5.670  1.00 0.00 ? 40 VAL A CB   3  
ATOM 3014  C CG1  . VAL A 1 40 ? -0.239  -7.079  -5.982  1.00 0.00 ? 40 VAL A CG1  3  
ATOM 3015  C CG2  . VAL A 1 40 ? -1.556  -9.214  -5.957  1.00 0.00 ? 40 VAL A CG2  3  
ATOM 3016  H H    . VAL A 1 40 ? -0.530  -8.974  -3.592  1.00 0.00 ? 40 VAL A H    3  
ATOM 3017  H HA   . VAL A 1 40 ? -1.958  -6.391  -4.011  1.00 0.00 ? 40 VAL A HA   3  
ATOM 3018  H HB   . VAL A 1 40 ? -2.357  -7.243  -6.290  1.00 0.00 ? 40 VAL A HB   3  
ATOM 3019  H HG11 . VAL A 1 40 ? 0.540   -7.659  -5.508  1.00 0.00 ? 40 VAL A HG11 3  
ATOM 3020  H HG12 . VAL A 1 40 ? -0.213  -6.067  -5.608  1.00 0.00 ? 40 VAL A HG12 3  
ATOM 3021  H HG13 . VAL A 1 40 ? -0.083  -7.072  -7.050  1.00 0.00 ? 40 VAL A HG13 3  
ATOM 3022  H HG21 . VAL A 1 40 ? -2.559  -9.583  -6.106  1.00 0.00 ? 40 VAL A HG21 3  
ATOM 3023  H HG22 . VAL A 1 40 ? -1.102  -9.730  -5.124  1.00 0.00 ? 40 VAL A HG22 3  
ATOM 3024  H HG23 . VAL A 1 40 ? -0.975  -9.397  -6.851  1.00 0.00 ? 40 VAL A HG23 3  
ATOM 3025  N N    . VAL A 1 41 ? -4.247  -7.227  -3.453  1.00 0.00 ? 41 VAL A N    3  
ATOM 3026  C CA   . VAL A 1 41 ? -5.623  -7.727  -3.141  1.00 0.00 ? 41 VAL A CA   3  
ATOM 3027  C C    . VAL A 1 41 ? -6.649  -6.781  -3.781  1.00 0.00 ? 41 VAL A C    3  
ATOM 3028  O O    . VAL A 1 41 ? -6.837  -5.668  -3.333  1.00 0.00 ? 41 VAL A O    3  
ATOM 3029  C CB   . VAL A 1 41 ? -5.798  -7.755  -1.612  1.00 0.00 ? 41 VAL A CB   3  
ATOM 3030  C CG1  . VAL A 1 41 ? -7.279  -7.869  -1.245  1.00 0.00 ? 41 VAL A CG1  3  
ATOM 3031  C CG2  . VAL A 1 41 ? -5.041  -8.957  -1.036  1.00 0.00 ? 41 VAL A CG2  3  
ATOM 3032  H H    . VAL A 1 41 ? -4.046  -6.271  -3.374  1.00 0.00 ? 41 VAL A H    3  
ATOM 3033  H HA   . VAL A 1 41 ? -5.760  -8.724  -3.540  1.00 0.00 ? 41 VAL A HA   3  
ATOM 3034  H HB   . VAL A 1 41 ? -5.396  -6.845  -1.191  1.00 0.00 ? 41 VAL A HB   3  
ATOM 3035  H HG11 . VAL A 1 41 ? -7.755  -6.913  -1.394  1.00 0.00 ? 41 VAL A HG11 3  
ATOM 3036  H HG12 . VAL A 1 41 ? -7.376  -8.161  -0.209  1.00 0.00 ? 41 VAL A HG12 3  
ATOM 3037  H HG13 . VAL A 1 41 ? -7.751  -8.608  -1.874  1.00 0.00 ? 41 VAL A HG13 3  
ATOM 3038  H HG21 . VAL A 1 41 ? -5.256  -9.043  0.019   1.00 0.00 ? 41 VAL A HG21 3  
ATOM 3039  H HG22 . VAL A 1 41 ? -3.981  -8.817  -1.178  1.00 0.00 ? 41 VAL A HG22 3  
ATOM 3040  H HG23 . VAL A 1 41 ? -5.357  -9.859  -1.540  1.00 0.00 ? 41 VAL A HG23 3  
ATOM 3041  N N    . LYS A 1 42 ? -7.303  -7.214  -4.835  1.00 0.00 ? 42 LYS A N    3  
ATOM 3042  C CA   . LYS A 1 42 ? -8.312  -6.343  -5.527  1.00 0.00 ? 42 LYS A CA   3  
ATOM 3043  C C    . LYS A 1 42 ? -9.702  -6.979  -5.437  1.00 0.00 ? 42 LYS A C    3  
ATOM 3044  O O    . LYS A 1 42 ? -9.896  -8.124  -5.796  1.00 0.00 ? 42 LYS A O    3  
ATOM 3045  C CB   . LYS A 1 42 ? -7.921  -6.199  -7.000  1.00 0.00 ? 42 LYS A CB   3  
ATOM 3046  C CG   . LYS A 1 42 ? -6.657  -5.344  -7.113  1.00 0.00 ? 42 LYS A CG   3  
ATOM 3047  C CD   . LYS A 1 42 ? -6.363  -5.049  -8.588  1.00 0.00 ? 42 LYS A CD   3  
ATOM 3048  C CE   . LYS A 1 42 ? -6.057  -6.353  -9.336  1.00 0.00 ? 42 LYS A CE   3  
ATOM 3049  N NZ   . LYS A 1 42 ? -5.286  -6.045  -10.573 1.00 0.00 ? 42 LYS A NZ   3  
ATOM 3050  H H    . LYS A 1 42 ? -7.112  -8.104  -5.195  1.00 0.00 ? 42 LYS A H    3  
ATOM 3051  H HA   . LYS A 1 42 ? -8.340  -5.363  -5.070  1.00 0.00 ? 42 LYS A HA   3  
ATOM 3052  H HB2  . LYS A 1 42 ? -7.735  -7.178  -7.418  1.00 0.00 ? 42 LYS A HB2  3  
ATOM 3053  H HB3  . LYS A 1 42 ? -8.725  -5.723  -7.542  1.00 0.00 ? 42 LYS A HB3  3  
ATOM 3054  H HG2  . LYS A 1 42 ? -6.804  -4.415  -6.582  1.00 0.00 ? 42 LYS A HG2  3  
ATOM 3055  H HG3  . LYS A 1 42 ? -5.823  -5.876  -6.682  1.00 0.00 ? 42 LYS A HG3  3  
ATOM 3056  H HD2  . LYS A 1 42 ? -7.223  -4.572  -9.037  1.00 0.00 ? 42 LYS A HD2  3  
ATOM 3057  H HD3  . LYS A 1 42 ? -5.511  -4.389  -8.658  1.00 0.00 ? 42 LYS A HD3  3  
ATOM 3058  H HE2  . LYS A 1 42 ? -5.475  -7.009  -8.704  1.00 0.00 ? 42 LYS A HE2  3  
ATOM 3059  H HE3  . LYS A 1 42 ? -6.983  -6.840  -9.603  1.00 0.00 ? 42 LYS A HE3  3  
ATOM 3060  H HZ1  . LYS A 1 42 ? -4.906  -6.927  -10.974 1.00 0.00 ? 42 LYS A HZ1  3  
ATOM 3061  H HZ2  . LYS A 1 42 ? -4.500  -5.406  -10.342 1.00 0.00 ? 42 LYS A HZ2  3  
ATOM 3062  H HZ3  . LYS A 1 42 ? -5.912  -5.590  -11.267 1.00 0.00 ? 42 LYS A HZ3  3  
ATOM 3063  N N    . SER A 1 43 ? -10.671 -6.245  -4.960  1.00 0.00 ? 43 SER A N    3  
ATOM 3064  C CA   . SER A 1 43 ? -12.050 -6.803  -4.847  1.00 0.00 ? 43 SER A CA   3  
ATOM 3065  C C    . SER A 1 43 ? -12.645 -6.996  -6.247  1.00 0.00 ? 43 SER A C    3  
ATOM 3066  O O    . SER A 1 43 ? -13.384 -6.162  -6.728  1.00 0.00 ? 43 SER A O    3  
ATOM 3067  C CB   . SER A 1 43 ? -12.930 -5.828  -4.040  1.00 0.00 ? 43 SER A CB   3  
ATOM 3068  O OG   . SER A 1 43 ? -12.382 -4.520  -4.134  1.00 0.00 ? 43 SER A OG   3  
ATOM 3069  H H    . SER A 1 43 ? -10.494 -5.326  -4.672  1.00 0.00 ? 43 SER A H    3  
ATOM 3070  H HA   . SER A 1 43 ? -12.009 -7.759  -4.341  1.00 0.00 ? 43 SER A HA   3  
ATOM 3071  H HB2  . SER A 1 43 ? -13.935 -5.816  -4.430  1.00 0.00 ? 43 SER A HB2  3  
ATOM 3072  H HB3  . SER A 1 43 ? -12.962 -6.139  -3.007  1.00 0.00 ? 43 SER A HB3  3  
ATOM 3073  H HG   . SER A 1 43 ? -12.089 -4.384  -5.038  1.00 0.00 ? 43 SER A HG   3  
ATOM 3074  N N    . GLU A 1 44 ? -12.328 -8.084  -6.901  1.00 0.00 ? 44 GLU A N    3  
ATOM 3075  C CA   . GLU A 1 44 ? -12.882 -8.326  -8.270  1.00 0.00 ? 44 GLU A CA   3  
ATOM 3076  C C    . GLU A 1 44 ? -14.376 -7.981  -8.288  1.00 0.00 ? 44 GLU A C    3  
ATOM 3077  O O    . GLU A 1 44 ? -14.961 -7.761  -9.329  1.00 0.00 ? 44 GLU A O    3  
ATOM 3078  C CB   . GLU A 1 44 ? -12.696 -9.800  -8.642  1.00 0.00 ? 44 GLU A CB   3  
ATOM 3079  C CG   . GLU A 1 44 ? -11.214 -10.084 -8.895  1.00 0.00 ? 44 GLU A CG   3  
ATOM 3080  C CD   . GLU A 1 44 ? -10.441 -9.972  -7.579  1.00 0.00 ? 44 GLU A CD   3  
ATOM 3081  O OE1  . GLU A 1 44 ? -11.009 -10.300 -6.551  1.00 0.00 ? 44 GLU A OE1  3  
ATOM 3082  O OE2  . GLU A 1 44 ? -9.293  -9.562  -7.623  1.00 0.00 ? 44 GLU A OE2  3  
ATOM 3083  H H    . GLU A 1 44 ? -11.717 -8.737  -6.499  1.00 0.00 ? 44 GLU A H    3  
ATOM 3084  H HA   . GLU A 1 44 ? -12.360 -7.706  -8.984  1.00 0.00 ? 44 GLU A HA   3  
ATOM 3085  H HB2  . GLU A 1 44 ? -13.051 -10.422 -7.833  1.00 0.00 ? 44 GLU A HB2  3  
ATOM 3086  H HB3  . GLU A 1 44 ? -13.260 -10.018 -9.537  1.00 0.00 ? 44 GLU A HB3  3  
ATOM 3087  H HG2  . GLU A 1 44 ? -11.103 -11.082 -9.294  1.00 0.00 ? 44 GLU A HG2  3  
ATOM 3088  H HG3  . GLU A 1 44 ? -10.825 -9.367  -9.602  1.00 0.00 ? 44 GLU A HG3  3  
ATOM 3089  N N    . ASP A 1 45 ? -14.989 -7.920  -7.131  1.00 0.00 ? 45 ASP A N    3  
ATOM 3090  C CA   . ASP A 1 45 ? -16.443 -7.575  -7.046  1.00 0.00 ? 45 ASP A CA   3  
ATOM 3091  C C    . ASP A 1 45 ? -16.584 -6.159  -6.482  1.00 0.00 ? 45 ASP A C    3  
ATOM 3092  O O    . ASP A 1 45 ? -15.621 -5.560  -6.047  1.00 0.00 ? 45 ASP A O    3  
ATOM 3093  C CB   . ASP A 1 45 ? -17.142 -8.565  -6.110  1.00 0.00 ? 45 ASP A CB   3  
ATOM 3094  C CG   . ASP A 1 45 ? -18.641 -8.264  -6.075  1.00 0.00 ? 45 ASP A CG   3  
ATOM 3095  O OD1  . ASP A 1 45 ? -19.338 -8.720  -6.966  1.00 0.00 ? 45 ASP A OD1  3  
ATOM 3096  O OD2  . ASP A 1 45 ? -19.067 -7.583  -5.156  1.00 0.00 ? 45 ASP A OD2  3  
ATOM 3097  H H    . ASP A 1 45 ? -14.485 -8.092  -6.308  1.00 0.00 ? 45 ASP A H    3  
ATOM 3098  H HA   . ASP A 1 45 ? -16.898 -7.620  -8.025  1.00 0.00 ? 45 ASP A HA   3  
ATOM 3099  H HB2  . ASP A 1 45 ? -16.984 -9.571  -6.470  1.00 0.00 ? 45 ASP A HB2  3  
ATOM 3100  H HB3  . ASP A 1 45 ? -16.734 -8.469  -5.116  1.00 0.00 ? 45 ASP A HB3  3  
ATOM 3101  N N    . GLY A 1 46 ? -17.769 -5.612  -6.496  1.00 0.00 ? 46 GLY A N    3  
ATOM 3102  C CA   . GLY A 1 46 ? -17.958 -4.231  -5.968  1.00 0.00 ? 46 GLY A CA   3  
ATOM 3103  C C    . GLY A 1 46 ? -17.545 -4.170  -4.495  1.00 0.00 ? 46 GLY A C    3  
ATOM 3104  O O    . GLY A 1 46 ? -16.696 -4.914  -4.048  1.00 0.00 ? 46 GLY A O    3  
ATOM 3105  H H    . GLY A 1 46 ? -18.534 -6.101  -6.864  1.00 0.00 ? 46 GLY A H    3  
ATOM 3106  H HA2  . GLY A 1 46 ? -17.354 -3.542  -6.541  1.00 0.00 ? 46 GLY A HA2  3  
ATOM 3107  H HA3  . GLY A 1 46 ? -18.999 -3.953  -6.056  1.00 0.00 ? 46 GLY A HA3  3  
ATOM 3108  N N    . SER A 1 47 ? -18.152 -3.289  -3.741  1.00 0.00 ? 47 SER A N    3  
ATOM 3109  C CA   . SER A 1 47 ? -17.820 -3.160  -2.290  1.00 0.00 ? 47 SER A CA   3  
ATOM 3110  C C    . SER A 1 47 ? -18.332 -1.805  -1.795  1.00 0.00 ? 47 SER A C    3  
ATOM 3111  O O    . SER A 1 47 ? -18.859 -1.022  -2.558  1.00 0.00 ? 47 SER A O    3  
ATOM 3112  C CB   . SER A 1 47 ? -16.305 -3.234  -2.079  1.00 0.00 ? 47 SER A CB   3  
ATOM 3113  O OG   . SER A 1 47 ? -15.958 -2.469  -0.934  1.00 0.00 ? 47 SER A OG   3  
ATOM 3114  H H    . SER A 1 47 ? -18.843 -2.714  -4.128  1.00 0.00 ? 47 SER A H    3  
ATOM 3115  H HA   . SER A 1 47 ? -18.307 -3.952  -1.738  1.00 0.00 ? 47 SER A HA   3  
ATOM 3116  H HB2  . SER A 1 47 ? -16.007 -4.258  -1.922  1.00 0.00 ? 47 SER A HB2  3  
ATOM 3117  H HB3  . SER A 1 47 ? -15.801 -2.844  -2.954  1.00 0.00 ? 47 SER A HB3  3  
ATOM 3118  H HG   . SER A 1 47 ? -15.055 -2.162  -1.046  1.00 0.00 ? 47 SER A HG   3  
ATOM 3119  N N    . ASP A 1 48 ? -18.194 -1.528  -0.519  1.00 0.00 ? 48 ASP A N    3  
ATOM 3120  C CA   . ASP A 1 48 ? -18.687 -0.226  0.034   1.00 0.00 ? 48 ASP A CA   3  
ATOM 3121  C C    . ASP A 1 48 ? -17.588 0.445   0.860   1.00 0.00 ? 48 ASP A C    3  
ATOM 3122  O O    . ASP A 1 48 ? -17.332 0.077   1.990   1.00 0.00 ? 48 ASP A O    3  
ATOM 3123  C CB   . ASP A 1 48 ? -19.900 -0.489  0.929   1.00 0.00 ? 48 ASP A CB   3  
ATOM 3124  C CG   . ASP A 1 48 ? -20.400 0.833   1.512   1.00 0.00 ? 48 ASP A CG   3  
ATOM 3125  O OD1  . ASP A 1 48 ? -20.992 1.598   0.768   1.00 0.00 ? 48 ASP A OD1  3  
ATOM 3126  O OD2  . ASP A 1 48 ? -20.186 1.057   2.691   1.00 0.00 ? 48 ASP A OD2  3  
ATOM 3127  H H    . ASP A 1 48 ? -17.781 -2.184  0.079   1.00 0.00 ? 48 ASP A H    3  
ATOM 3128  H HA   . ASP A 1 48 ? -18.977 0.438   -0.769  1.00 0.00 ? 48 ASP A HA   3  
ATOM 3129  H HB2  . ASP A 1 48 ? -20.684 -0.947  0.344   1.00 0.00 ? 48 ASP A HB2  3  
ATOM 3130  H HB3  . ASP A 1 48 ? -19.617 -1.152  1.733   1.00 0.00 ? 48 ASP A HB3  3  
ATOM 3131  N N    . CYS A 1 49 ? -16.934 1.432   0.295   1.00 0.00 ? 49 CYS A N    3  
ATOM 3132  C CA   . CYS A 1 49 ? -15.846 2.146   1.018   1.00 0.00 ? 49 CYS A CA   3  
ATOM 3133  C C    . CYS A 1 49 ? -16.348 3.562   1.357   1.00 0.00 ? 49 CYS A C    3  
ATOM 3134  O O    . CYS A 1 49 ? -17.016 4.197   0.566   1.00 0.00 ? 49 CYS A O    3  
ATOM 3135  C CB   . CYS A 1 49 ? -14.628 2.219   0.078   1.00 0.00 ? 49 CYS A CB   3  
ATOM 3136  S SG   . CYS A 1 49 ? -13.418 0.936   0.505   1.00 0.00 ? 49 CYS A SG   3  
ATOM 3137  H H    . CYS A 1 49 ? -17.156 1.685   -0.624  1.00 0.00 ? 49 CYS A H    3  
ATOM 3138  H HA   . CYS A 1 49 ? -15.582 1.619   1.924   1.00 0.00 ? 49 CYS A HA   3  
ATOM 3139  H HB2  . CYS A 1 49 ? -14.961 2.060   -0.936  1.00 0.00 ? 49 CYS A HB2  3  
ATOM 3140  H HB3  . CYS A 1 49 ? -14.162 3.188   0.149   1.00 0.00 ? 49 CYS A HB3  3  
ATOM 3141  N N    . GLY A 1 50 ? -16.046 4.048   2.534   1.00 0.00 ? 50 GLY A N    3  
ATOM 3142  C CA   . GLY A 1 50 ? -16.527 5.414   2.930   1.00 0.00 ? 50 GLY A CA   3  
ATOM 3143  C C    . GLY A 1 50 ? -16.282 6.421   1.801   1.00 0.00 ? 50 GLY A C    3  
ATOM 3144  O O    . GLY A 1 50 ? -16.820 7.508   1.813   1.00 0.00 ? 50 GLY A O    3  
ATOM 3145  H H    . GLY A 1 50 ? -15.519 3.507   3.166   1.00 0.00 ? 50 GLY A H    3  
ATOM 3146  H HA2  . GLY A 1 50 ? -17.587 5.370   3.142   1.00 0.00 ? 50 GLY A HA2  3  
ATOM 3147  H HA3  . GLY A 1 50 ? -16.000 5.743   3.815   1.00 0.00 ? 50 GLY A HA3  3  
ATOM 3148  N N    . ASP A 1 51 ? -15.491 6.063   0.826   1.00 0.00 ? 51 ASP A N    3  
ATOM 3149  C CA   . ASP A 1 51 ? -15.224 7.007   -0.305  1.00 0.00 ? 51 ASP A CA   3  
ATOM 3150  C C    . ASP A 1 51 ? -14.352 6.334   -1.363  1.00 0.00 ? 51 ASP A C    3  
ATOM 3151  O O    . ASP A 1 51 ? -13.650 6.997   -2.098  1.00 0.00 ? 51 ASP A O    3  
ATOM 3152  C CB   . ASP A 1 51 ? -14.485 8.249   0.215   1.00 0.00 ? 51 ASP A CB   3  
ATOM 3153  C CG   . ASP A 1 51 ? -14.301 9.250   -0.927  1.00 0.00 ? 51 ASP A CG   3  
ATOM 3154  O OD1  . ASP A 1 51 ? -15.101 9.223   -1.848  1.00 0.00 ? 51 ASP A OD1  3  
ATOM 3155  O OD2  . ASP A 1 51 ? -13.362 10.027  -0.861  1.00 0.00 ? 51 ASP A OD2  3  
ATOM 3156  H H    . ASP A 1 51 ? -15.094 5.167   0.840   1.00 0.00 ? 51 ASP A H    3  
ATOM 3157  H HA   . ASP A 1 51 ? -16.161 7.309   -0.751  1.00 0.00 ? 51 ASP A HA   3  
ATOM 3158  H HB2  . ASP A 1 51 ? -15.053 8.711   1.005   1.00 0.00 ? 51 ASP A HB2  3  
ATOM 3159  H HB3  . ASP A 1 51 ? -13.517 7.958   0.592   1.00 0.00 ? 51 ASP A HB3  3  
ATOM 3160  N N    . ALA A 1 52 ? -14.360 5.030   -1.433  1.00 0.00 ? 52 ALA A N    3  
ATOM 3161  C CA   . ALA A 1 52 ? -13.502 4.341   -2.431  1.00 0.00 ? 52 ALA A CA   3  
ATOM 3162  C C    . ALA A 1 52 ? -12.065 4.473   -1.947  1.00 0.00 ? 52 ALA A C    3  
ATOM 3163  O O    . ALA A 1 52 ? -11.198 4.939   -2.657  1.00 0.00 ? 52 ALA A O    3  
ATOM 3164  C CB   . ALA A 1 52 ? -13.679 4.988   -3.817  1.00 0.00 ? 52 ALA A CB   3  
ATOM 3165  H H    . ALA A 1 52 ? -14.905 4.508   -0.816  1.00 0.00 ? 52 ALA A H    3  
ATOM 3166  H HA   . ALA A 1 52 ? -13.769 3.295   -2.478  1.00 0.00 ? 52 ALA A HA   3  
ATOM 3167  H HB1  . ALA A 1 52 ? -13.511 4.246   -4.585  1.00 0.00 ? 52 ALA A HB1  3  
ATOM 3168  H HB2  . ALA A 1 52 ? -12.976 5.799   -3.943  1.00 0.00 ? 52 ALA A HB2  3  
ATOM 3169  H HB3  . ALA A 1 52 ? -14.685 5.372   -3.906  1.00 0.00 ? 52 ALA A HB3  3  
ATOM 3170  N N    . ASP A 1 53 ? -11.839 4.095   -0.708  1.00 0.00 ? 53 ASP A N    3  
ATOM 3171  C CA   . ASP A 1 53 ? -10.475 4.211   -0.088  1.00 0.00 ? 53 ASP A CA   3  
ATOM 3172  C C    . ASP A 1 53 ? -9.376  4.053   -1.140  1.00 0.00 ? 53 ASP A C    3  
ATOM 3173  O O    . ASP A 1 53 ? -8.373  4.735   -1.099  1.00 0.00 ? 53 ASP A O    3  
ATOM 3174  C CB   . ASP A 1 53 ? -10.283 3.150   1.012   1.00 0.00 ? 53 ASP A CB   3  
ATOM 3175  C CG   . ASP A 1 53 ? -11.605 2.924   1.748   1.00 0.00 ? 53 ASP A CG   3  
ATOM 3176  O OD1  . ASP A 1 53 ? -12.462 3.789   1.662   1.00 0.00 ? 53 ASP A OD1  3  
ATOM 3177  O OD2  . ASP A 1 53 ? -11.735 1.895   2.389   1.00 0.00 ? 53 ASP A OD2  3  
ATOM 3178  H H    . ASP A 1 53 ? -12.593 3.759   -0.170  1.00 0.00 ? 53 ASP A H    3  
ATOM 3179  H HA   . ASP A 1 53 ? -10.392 5.186   0.354   1.00 0.00 ? 53 ASP A HA   3  
ATOM 3180  H HB2  . ASP A 1 53 ? -9.947  2.216   0.575   1.00 0.00 ? 53 ASP A HB2  3  
ATOM 3181  H HB3  . ASP A 1 53 ? -9.539  3.495   1.718   1.00 0.00 ? 53 ASP A HB3  3  
ATOM 3182  N N    . PHE A 1 54 ? -9.563  3.166   -2.083  1.00 0.00 ? 54 PHE A N    3  
ATOM 3183  C CA   . PHE A 1 54 ? -8.529  2.964   -3.149  1.00 0.00 ? 54 PHE A CA   3  
ATOM 3184  C C    . PHE A 1 54 ? -7.132  2.952   -2.506  1.00 0.00 ? 54 PHE A C    3  
ATOM 3185  O O    . PHE A 1 54 ? -6.644  1.928   -2.072  1.00 0.00 ? 54 PHE A O    3  
ATOM 3186  C CB   . PHE A 1 54 ? -8.626  4.116   -4.176  1.00 0.00 ? 54 PHE A CB   3  
ATOM 3187  C CG   . PHE A 1 54 ? -9.536  3.726   -5.328  1.00 0.00 ? 54 PHE A CG   3  
ATOM 3188  C CD1  . PHE A 1 54 ? -9.209  2.630   -6.136  1.00 0.00 ? 54 PHE A CD1  3  
ATOM 3189  C CD2  . PHE A 1 54 ? -10.700 4.462   -5.587  1.00 0.00 ? 54 PHE A CD2  3  
ATOM 3190  C CE1  . PHE A 1 54 ? -10.046 2.269   -7.199  1.00 0.00 ? 54 PHE A CE1  3  
ATOM 3191  C CE2  . PHE A 1 54 ? -11.536 4.100   -6.651  1.00 0.00 ? 54 PHE A CE2  3  
ATOM 3192  C CZ   . PHE A 1 54 ? -11.210 3.004   -7.456  1.00 0.00 ? 54 PHE A CZ   3  
ATOM 3193  H H    . PHE A 1 54 ? -10.390 2.634   -2.095  1.00 0.00 ? 54 PHE A H    3  
ATOM 3194  H HA   . PHE A 1 54 ? -8.701  2.016   -3.638  1.00 0.00 ? 54 PHE A HA   3  
ATOM 3195  H HB2  . PHE A 1 54 ? -9.020  4.993   -3.688  1.00 0.00 ? 54 PHE A HB2  3  
ATOM 3196  H HB3  . PHE A 1 54 ? -7.644  4.342   -4.567  1.00 0.00 ? 54 PHE A HB3  3  
ATOM 3197  H HD1  . PHE A 1 54 ? -8.313  2.063   -5.940  1.00 0.00 ? 54 PHE A HD1  3  
ATOM 3198  H HD2  . PHE A 1 54 ? -10.951 5.309   -4.969  1.00 0.00 ? 54 PHE A HD2  3  
ATOM 3199  H HE1  . PHE A 1 54 ? -9.793  1.424   -7.822  1.00 0.00 ? 54 PHE A HE1  3  
ATOM 3200  H HE2  . PHE A 1 54 ? -12.433 4.669   -6.850  1.00 0.00 ? 54 PHE A HE2  3  
ATOM 3201  H HZ   . PHE A 1 54 ? -11.854 2.726   -8.277  1.00 0.00 ? 54 PHE A HZ   3  
ATOM 3202  N N    . ASP A 1 55 ? -6.496  4.090   -2.440  1.00 0.00 ? 55 ASP A N    3  
ATOM 3203  C CA   . ASP A 1 55 ? -5.139  4.160   -1.823  1.00 0.00 ? 55 ASP A CA   3  
ATOM 3204  C C    . ASP A 1 55 ? -4.177  3.232   -2.569  1.00 0.00 ? 55 ASP A C    3  
ATOM 3205  O O    . ASP A 1 55 ? -3.390  2.535   -1.962  1.00 0.00 ? 55 ASP A O    3  
ATOM 3206  C CB   . ASP A 1 55 ? -5.217  3.734   -0.350  1.00 0.00 ? 55 ASP A CB   3  
ATOM 3207  C CG   . ASP A 1 55 ? -3.945  4.175   0.376   1.00 0.00 ? 55 ASP A CG   3  
ATOM 3208  O OD1  . ASP A 1 55 ? -2.882  4.068   -0.213  1.00 0.00 ? 55 ASP A OD1  3  
ATOM 3209  O OD2  . ASP A 1 55 ? -4.055  4.613   1.510   1.00 0.00 ? 55 ASP A OD2  3  
ATOM 3210  H H    . ASP A 1 55 ? -6.917  4.905   -2.793  1.00 0.00 ? 55 ASP A H    3  
ATOM 3211  H HA   . ASP A 1 55 ? -4.774  5.174   -1.882  1.00 0.00 ? 55 ASP A HA   3  
ATOM 3212  H HB2  . ASP A 1 55 ? -6.076  4.198   0.115   1.00 0.00 ? 55 ASP A HB2  3  
ATOM 3213  H HB3  . ASP A 1 55 ? -5.309  2.661   -0.288  1.00 0.00 ? 55 ASP A HB3  3  
ATOM 3214  N N    . TRP A 1 56 ? -4.247  3.212   -3.878  1.00 0.00 ? 56 TRP A N    3  
ATOM 3215  C CA   . TRP A 1 56 ? -3.347  2.324   -4.685  1.00 0.00 ? 56 TRP A CA   3  
ATOM 3216  C C    . TRP A 1 56 ? -1.931  2.314   -4.085  1.00 0.00 ? 56 TRP A C    3  
ATOM 3217  O O    . TRP A 1 56 ? -1.643  1.561   -3.176  1.00 0.00 ? 56 TRP A O    3  
ATOM 3218  C CB   . TRP A 1 56 ? -3.290  2.842   -6.134  1.00 0.00 ? 56 TRP A CB   3  
ATOM 3219  C CG   . TRP A 1 56 ? -4.452  2.316   -6.920  1.00 0.00 ? 56 TRP A CG   3  
ATOM 3220  C CD1  . TRP A 1 56 ? -5.741  2.673   -6.731  1.00 0.00 ? 56 TRP A CD1  3  
ATOM 3221  C CD2  . TRP A 1 56 ? -4.449  1.349   -8.008  1.00 0.00 ? 56 TRP A CD2  3  
ATOM 3222  N NE1  . TRP A 1 56 ? -6.531  1.990   -7.637  1.00 0.00 ? 56 TRP A NE1  3  
ATOM 3223  C CE2  . TRP A 1 56 ? -5.781  1.161   -8.447  1.00 0.00 ? 56 TRP A CE2  3  
ATOM 3224  C CE3  . TRP A 1 56 ? -3.431  0.626   -8.653  1.00 0.00 ? 56 TRP A CE3  3  
ATOM 3225  C CZ2  . TRP A 1 56 ? -6.092  0.285   -9.488  1.00 0.00 ? 56 TRP A CZ2  3  
ATOM 3226  C CZ3  . TRP A 1 56 ? -3.739  -0.257  -9.700  1.00 0.00 ? 56 TRP A CZ3  3  
ATOM 3227  C CH2  . TRP A 1 56 ? -5.066  -0.426  -10.117 1.00 0.00 ? 56 TRP A CH2  3  
ATOM 3228  H H    . TRP A 1 56 ? -4.910  3.774   -4.333  1.00 0.00 ? 56 TRP A H    3  
ATOM 3229  H HA   . TRP A 1 56 ? -3.740  1.318   -4.675  1.00 0.00 ? 56 TRP A HA   3  
ATOM 3230  H HB2  . TRP A 1 56 ? -3.323  3.921   -6.130  1.00 0.00 ? 56 TRP A HB2  3  
ATOM 3231  H HB3  . TRP A 1 56 ? -2.372  2.516   -6.599  1.00 0.00 ? 56 TRP A HB3  3  
ATOM 3232  H HD1  . TRP A 1 56 ? -6.094  3.375   -5.996  1.00 0.00 ? 56 TRP A HD1  3  
ATOM 3233  H HE1  . TRP A 1 56 ? -7.505  2.071   -7.712  1.00 0.00 ? 56 TRP A HE1  3  
ATOM 3234  H HE3  . TRP A 1 56 ? -2.404  0.748   -8.339  1.00 0.00 ? 56 TRP A HE3  3  
ATOM 3235  H HZ2  . TRP A 1 56 ? -7.115  0.159   -9.805  1.00 0.00 ? 56 TRP A HZ2  3  
ATOM 3236  H HZ3  . TRP A 1 56 ? -2.948  -0.808  -10.188 1.00 0.00 ? 56 TRP A HZ3  3  
ATOM 3237  H HH2  . TRP A 1 56 ? -5.297  -1.108  -10.923 1.00 0.00 ? 56 TRP A HH2  3  
ATOM 3238  N N    . HIS A 1 57 ? -1.042  3.130   -4.589  1.00 0.00 ? 57 HIS A N    3  
ATOM 3239  C CA   . HIS A 1 57 ? 0.345   3.138   -4.029  1.00 0.00 ? 57 HIS A CA   3  
ATOM 3240  C C    . HIS A 1 57 ? 1.148   4.304   -4.622  1.00 0.00 ? 57 HIS A C    3  
ATOM 3241  O O    . HIS A 1 57 ? 0.742   4.923   -5.582  1.00 0.00 ? 57 HIS A O    3  
ATOM 3242  C CB   . HIS A 1 57 ? 1.037   1.800   -4.360  1.00 0.00 ? 57 HIS A CB   3  
ATOM 3243  C CG   . HIS A 1 57 ? 2.067   1.474   -3.308  1.00 0.00 ? 57 HIS A CG   3  
ATOM 3244  N ND1  . HIS A 1 57 ? 2.522   2.416   -2.400  1.00 0.00 ? 57 HIS A ND1  3  
ATOM 3245  C CD2  . HIS A 1 57 ? 2.734   0.312   -3.007  1.00 0.00 ? 57 HIS A CD2  3  
ATOM 3246  C CE1  . HIS A 1 57 ? 3.423   1.811   -1.604  1.00 0.00 ? 57 HIS A CE1  3  
ATOM 3247  N NE2  . HIS A 1 57 ? 3.591   0.528   -1.932  1.00 0.00 ? 57 HIS A NE2  3  
ATOM 3248  H H    . HIS A 1 57 ? -1.284  3.731   -5.328  1.00 0.00 ? 57 HIS A H    3  
ATOM 3249  H HA   . HIS A 1 57 ? 0.286   3.260   -2.956  1.00 0.00 ? 57 HIS A HA   3  
ATOM 3250  H HB2  . HIS A 1 57 ? 0.299   1.013   -4.387  1.00 0.00 ? 57 HIS A HB2  3  
ATOM 3251  H HB3  . HIS A 1 57 ? 1.520   1.866   -5.325  1.00 0.00 ? 57 HIS A HB3  3  
ATOM 3252  H HD1  . HIS A 1 57 ? 2.236   3.352   -2.343  1.00 0.00 ? 57 HIS A HD1  3  
ATOM 3253  H HD2  . HIS A 1 57 ? 2.609   -0.629  -3.524  1.00 0.00 ? 57 HIS A HD2  3  
ATOM 3254  H HE1  . HIS A 1 57 ? 3.947   2.305   -0.799  1.00 0.00 ? 57 HIS A HE1  3  
ATOM 3255  N N    . HIS A 1 58 ? 2.292   4.597   -4.052  1.00 0.00 ? 58 HIS A N    3  
ATOM 3256  C CA   . HIS A 1 58 ? 3.139   5.717   -4.564  1.00 0.00 ? 58 HIS A CA   3  
ATOM 3257  C C    . HIS A 1 58 ? 4.399   5.837   -3.700  1.00 0.00 ? 58 HIS A C    3  
ATOM 3258  O O    . HIS A 1 58 ? 4.632   5.048   -2.805  1.00 0.00 ? 58 HIS A O    3  
ATOM 3259  C CB   . HIS A 1 58 ? 2.367   7.039   -4.483  1.00 0.00 ? 58 HIS A CB   3  
ATOM 3260  C CG   . HIS A 1 58 ? 1.793   7.202   -3.103  1.00 0.00 ? 58 HIS A CG   3  
ATOM 3261  N ND1  . HIS A 1 58 ? 1.124   6.176   -2.454  1.00 0.00 ? 58 HIS A ND1  3  
ATOM 3262  C CD2  . HIS A 1 58 ? 1.778   8.266   -2.236  1.00 0.00 ? 58 HIS A CD2  3  
ATOM 3263  C CE1  . HIS A 1 58 ? 0.740   6.641   -1.250  1.00 0.00 ? 58 HIS A CE1  3  
ATOM 3264  N NE2  . HIS A 1 58 ? 1.114   7.910   -1.067  1.00 0.00 ? 58 HIS A NE2  3  
ATOM 3265  H H    . HIS A 1 58 ? 2.595   4.073   -3.284  1.00 0.00 ? 58 HIS A H    3  
ATOM 3266  H HA   . HIS A 1 58 ? 3.419   5.522   -5.588  1.00 0.00 ? 58 HIS A HA   3  
ATOM 3267  H HB2  . HIS A 1 58 ? 3.040   7.858   -4.689  1.00 0.00 ? 58 HIS A HB2  3  
ATOM 3268  H HB3  . HIS A 1 58 ? 1.570   7.043   -5.209  1.00 0.00 ? 58 HIS A HB3  3  
ATOM 3269  H HD1  . HIS A 1 58 ? 0.958   5.278   -2.807  1.00 0.00 ? 58 HIS A HD1  3  
ATOM 3270  H HD2  . HIS A 1 58 ? 2.216   9.235   -2.432  1.00 0.00 ? 58 HIS A HD2  3  
ATOM 3271  H HE1  . HIS A 1 58 ? 0.197   6.058   -0.522  1.00 0.00 ? 58 HIS A HE1  3  
ATOM 3272  N N    . THR A 1 59 ? 5.206   6.832   -3.956  1.00 0.00 ? 59 THR A N    3  
ATOM 3273  C CA   . THR A 1 59 ? 6.448   7.033   -3.151  1.00 0.00 ? 59 THR A CA   3  
ATOM 3274  C C    . THR A 1 59 ? 7.168   5.700   -2.929  1.00 0.00 ? 59 THR A C    3  
ATOM 3275  O O    . THR A 1 59 ? 7.053   5.093   -1.882  1.00 0.00 ? 59 THR A O    3  
ATOM 3276  C CB   . THR A 1 59 ? 6.080   7.637   -1.793  1.00 0.00 ? 59 THR A CB   3  
ATOM 3277  O OG1  . THR A 1 59 ? 5.345   8.836   -1.993  1.00 0.00 ? 59 THR A OG1  3  
ATOM 3278  C CG2  . THR A 1 59 ? 7.356   7.940   -1.006  1.00 0.00 ? 59 THR A CG2  3  
ATOM 3279  H H    . THR A 1 59 ? 4.989   7.460   -4.677  1.00 0.00 ? 59 THR A H    3  
ATOM 3280  H HA   . THR A 1 59 ? 7.106   7.711   -3.673  1.00 0.00 ? 59 THR A HA   3  
ATOM 3281  H HB   . THR A 1 59 ? 5.479   6.933   -1.237  1.00 0.00 ? 59 THR A HB   3  
ATOM 3282  H HG1  . THR A 1 59 ? 5.930   9.477   -2.403  1.00 0.00 ? 59 THR A HG1  3  
ATOM 3283  H HG21 . THR A 1 59 ? 7.998   8.579   -1.595  1.00 0.00 ? 59 THR A HG21 3  
ATOM 3284  H HG22 . THR A 1 59 ? 7.871   7.018   -0.785  1.00 0.00 ? 59 THR A HG22 3  
ATOM 3285  H HG23 . THR A 1 59 ? 7.100   8.441   -0.084  1.00 0.00 ? 59 THR A HG23 3  
ATOM 3286  N N    . PHE A 1 60 ? 7.925   5.249   -3.898  1.00 0.00 ? 60 PHE A N    3  
ATOM 3287  C CA   . PHE A 1 60 ? 8.676   3.960   -3.743  1.00 0.00 ? 60 PHE A CA   3  
ATOM 3288  C C    . PHE A 1 60 ? 10.147  4.289   -3.410  1.00 0.00 ? 60 PHE A C    3  
ATOM 3289  O O    . PHE A 1 60 ? 10.617  5.356   -3.754  1.00 0.00 ? 60 PHE A O    3  
ATOM 3290  C CB   . PHE A 1 60 ? 8.606   3.174   -5.071  1.00 0.00 ? 60 PHE A CB   3  
ATOM 3291  C CG   . PHE A 1 60 ? 7.411   2.240   -5.059  1.00 0.00 ? 60 PHE A CG   3  
ATOM 3292  C CD1  . PHE A 1 60 ? 6.117   2.765   -4.960  1.00 0.00 ? 60 PHE A CD1  3  
ATOM 3293  C CD2  . PHE A 1 60 ? 7.598   0.853   -5.141  1.00 0.00 ? 60 PHE A CD2  3  
ATOM 3294  C CE1  . PHE A 1 60 ? 5.012   1.906   -4.943  1.00 0.00 ? 60 PHE A CE1  3  
ATOM 3295  C CE2  . PHE A 1 60 ? 6.494   -0.005  -5.125  1.00 0.00 ? 60 PHE A CE2  3  
ATOM 3296  C CZ   . PHE A 1 60 ? 5.201   0.521   -5.025  1.00 0.00 ? 60 PHE A CZ   3  
ATOM 3297  H H    . PHE A 1 60 ? 8.010   5.765   -4.726  1.00 0.00 ? 60 PHE A H    3  
ATOM 3298  H HA   . PHE A 1 60 ? 8.234   3.381   -2.946  1.00 0.00 ? 60 PHE A HA   3  
ATOM 3299  H HB2  . PHE A 1 60 ? 8.505   3.869   -5.888  1.00 0.00 ? 60 PHE A HB2  3  
ATOM 3300  H HB3  . PHE A 1 60 ? 9.510   2.597   -5.207  1.00 0.00 ? 60 PHE A HB3  3  
ATOM 3301  H HD1  . PHE A 1 60 ? 5.971   3.833   -4.897  1.00 0.00 ? 60 PHE A HD1  3  
ATOM 3302  H HD2  . PHE A 1 60 ? 8.597   0.446   -5.217  1.00 0.00 ? 60 PHE A HD2  3  
ATOM 3303  H HE1  . PHE A 1 60 ? 4.015   2.310   -4.867  1.00 0.00 ? 60 PHE A HE1  3  
ATOM 3304  H HE2  . PHE A 1 60 ? 6.639   -1.074  -5.188  1.00 0.00 ? 60 PHE A HE2  3  
ATOM 3305  H HZ   . PHE A 1 60 ? 4.349   -0.142  -5.011  1.00 0.00 ? 60 PHE A HZ   3  
ATOM 3306  N N    . PRO A 1 61 ? 10.846  3.373   -2.764  1.00 0.00 ? 61 PRO A N    3  
ATOM 3307  C CA   . PRO A 1 61 ? 12.264  3.598   -2.418  1.00 0.00 ? 61 PRO A CA   3  
ATOM 3308  C C    . PRO A 1 61 ? 13.065  3.926   -3.688  1.00 0.00 ? 61 PRO A C    3  
ATOM 3309  O O    . PRO A 1 61 ? 13.820  4.877   -3.729  1.00 0.00 ? 61 PRO A O    3  
ATOM 3310  C CB   . PRO A 1 61 ? 12.734  2.268   -1.777  1.00 0.00 ? 61 PRO A CB   3  
ATOM 3311  C CG   . PRO A 1 61 ? 11.530  1.282   -1.815  1.00 0.00 ? 61 PRO A CG   3  
ATOM 3312  C CD   . PRO A 1 61 ? 10.304  2.066   -2.332  1.00 0.00 ? 61 PRO A CD   3  
ATOM 3313  H HA   . PRO A 1 61 ? 12.350  4.404   -1.705  1.00 0.00 ? 61 PRO A HA   3  
ATOM 3314  H HB2  . PRO A 1 61 ? 13.570  1.856   -2.332  1.00 0.00 ? 61 PRO A HB2  3  
ATOM 3315  H HB3  . PRO A 1 61 ? 13.030  2.437   -0.751  1.00 0.00 ? 61 PRO A HB3  3  
ATOM 3316  H HG2  . PRO A 1 61 ? 11.751  0.456   -2.483  1.00 0.00 ? 61 PRO A HG2  3  
ATOM 3317  H HG3  . PRO A 1 61 ? 11.329  0.900   -0.822  1.00 0.00 ? 61 PRO A HG3  3  
ATOM 3318  H HD2  . PRO A 1 61 ? 9.843   1.550   -3.162  1.00 0.00 ? 61 PRO A HD2  3  
ATOM 3319  H HD3  . PRO A 1 61 ? 9.590   2.209   -1.533  1.00 0.00 ? 61 PRO A HD3  3  
ATOM 3320  N N    . SER A 1 62 ? 12.903  3.145   -4.721  1.00 0.00 ? 62 SER A N    3  
ATOM 3321  C CA   . SER A 1 62 ? 13.653  3.411   -5.982  1.00 0.00 ? 62 SER A CA   3  
ATOM 3322  C C    . SER A 1 62 ? 13.329  4.821   -6.480  1.00 0.00 ? 62 SER A C    3  
ATOM 3323  O O    . SER A 1 62 ? 14.134  5.726   -6.380  1.00 0.00 ? 62 SER A O    3  
ATOM 3324  C CB   . SER A 1 62 ? 13.246  2.388   -7.044  1.00 0.00 ? 62 SER A CB   3  
ATOM 3325  O OG   . SER A 1 62 ? 11.859  2.525   -7.321  1.00 0.00 ? 62 SER A OG   3  
ATOM 3326  H H    . SER A 1 62 ? 12.289  2.382   -4.669  1.00 0.00 ? 62 SER A H    3  
ATOM 3327  H HA   . SER A 1 62 ? 14.714  3.331   -5.793  1.00 0.00 ? 62 SER A HA   3  
ATOM 3328  H HB2  . SER A 1 62 ? 13.807  2.562   -7.947  1.00 0.00 ? 62 SER A HB2  3  
ATOM 3329  H HB3  . SER A 1 62 ? 13.455  1.391   -6.679  1.00 0.00 ? 62 SER A HB3  3  
ATOM 3330  H HG   . SER A 1 62 ? 11.422  1.712   -7.055  1.00 0.00 ? 62 SER A HG   3  
ATOM 3331  N N    . ARG A 1 63 ? 12.154  5.017   -7.014  1.00 0.00 ? 63 ARG A N    3  
ATOM 3332  C CA   . ARG A 1 63 ? 11.779  6.369   -7.515  1.00 0.00 ? 63 ARG A CA   3  
ATOM 3333  C C    . ARG A 1 63 ? 10.322  6.355   -7.985  1.00 0.00 ? 63 ARG A C    3  
ATOM 3334  O O    . ARG A 1 63 ? 10.031  6.575   -9.144  1.00 0.00 ? 63 ARG A O    3  
ATOM 3335  C CB   . ARG A 1 63 ? 12.693  6.758   -8.683  1.00 0.00 ? 63 ARG A CB   3  
ATOM 3336  C CG   . ARG A 1 63 ? 12.812  5.587   -9.660  1.00 0.00 ? 63 ARG A CG   3  
ATOM 3337  C CD   . ARG A 1 63 ? 13.670  6.006   -10.855 1.00 0.00 ? 63 ARG A CD   3  
ATOM 3338  N NE   . ARG A 1 63 ? 13.716  4.896   -11.849 1.00 0.00 ? 63 ARG A NE   3  
ATOM 3339  C CZ   . ARG A 1 63 ? 14.134  5.126   -13.064 1.00 0.00 ? 63 ARG A CZ   3  
ATOM 3340  N NH1  . ARG A 1 63 ? 14.514  6.326   -13.408 1.00 0.00 ? 63 ARG A NH1  3  
ATOM 3341  N NH2  . ARG A 1 63 ? 14.173  4.155   -13.935 1.00 0.00 ? 63 ARG A NH2  3  
ATOM 3342  H H    . ARG A 1 63 ? 11.518  4.274   -7.083  1.00 0.00 ? 63 ARG A H    3  
ATOM 3343  H HA   . ARG A 1 63 ? 11.890  7.089   -6.719  1.00 0.00 ? 63 ARG A HA   3  
ATOM 3344  H HB2  . ARG A 1 63 ? 12.275  7.613   -9.195  1.00 0.00 ? 63 ARG A HB2  3  
ATOM 3345  H HB3  . ARG A 1 63 ? 13.672  7.009   -8.304  1.00 0.00 ? 63 ARG A HB3  3  
ATOM 3346  H HG2  . ARG A 1 63 ? 13.273  4.747   -9.161  1.00 0.00 ? 63 ARG A HG2  3  
ATOM 3347  H HG3  . ARG A 1 63 ? 11.828  5.305   -10.006 1.00 0.00 ? 63 ARG A HG3  3  
ATOM 3348  H HD2  . ARG A 1 63 ? 13.240  6.883   -11.315 1.00 0.00 ? 63 ARG A HD2  3  
ATOM 3349  H HD3  . ARG A 1 63 ? 14.671  6.229   -10.518 1.00 0.00 ? 63 ARG A HD3  3  
ATOM 3350  H HE   . ARG A 1 63 ? 13.431  3.995   -11.591 1.00 0.00 ? 63 ARG A HE   3  
ATOM 3351  H HH11 . ARG A 1 63 ? 14.486  7.070   -12.742 1.00 0.00 ? 63 ARG A HH11 3  
ATOM 3352  H HH12 . ARG A 1 63 ? 14.834  6.501   -14.340 1.00 0.00 ? 63 ARG A HH12 3  
ATOM 3353  H HH21 . ARG A 1 63 ? 13.882  3.235   -13.672 1.00 0.00 ? 63 ARG A HH21 3  
ATOM 3354  H HH22 . ARG A 1 63 ? 14.492  4.330   -14.866 1.00 0.00 ? 63 ARG A HH22 3  
ATOM 3355  N N    . GLY A 1 64 ? 9.406   6.099   -7.092  1.00 0.00 ? 64 GLY A N    3  
ATOM 3356  C CA   . GLY A 1 64 ? 7.967   6.074   -7.483  1.00 0.00 ? 64 GLY A CA   3  
ATOM 3357  C C    . GLY A 1 64 ? 7.759   5.081   -8.629  1.00 0.00 ? 64 GLY A C    3  
ATOM 3358  O O    . GLY A 1 64 ? 7.743   5.451   -9.786  1.00 0.00 ? 64 GLY A O    3  
ATOM 3359  H H    . GLY A 1 64 ? 9.663   5.926   -6.163  1.00 0.00 ? 64 GLY A H    3  
ATOM 3360  H HA2  . GLY A 1 64 ? 7.369   5.777   -6.633  1.00 0.00 ? 64 GLY A HA2  3  
ATOM 3361  H HA3  . GLY A 1 64 ? 7.666   7.059   -7.808  1.00 0.00 ? 64 GLY A HA3  3  
ATOM 3362  N N    . ASN A 1 65 ? 7.596   3.822   -8.319  1.00 0.00 ? 65 ASN A N    3  
ATOM 3363  C CA   . ASN A 1 65 ? 7.385   2.812   -9.394  1.00 0.00 ? 65 ASN A CA   3  
ATOM 3364  C C    . ASN A 1 65 ? 5.911   2.824   -9.813  1.00 0.00 ? 65 ASN A C    3  
ATOM 3365  O O    . ASN A 1 65 ? 5.592   2.911   -10.982 1.00 0.00 ? 65 ASN A O    3  
ATOM 3366  C CB   . ASN A 1 65 ? 7.777   1.421   -8.881  1.00 0.00 ? 65 ASN A CB   3  
ATOM 3367  C CG   . ASN A 1 65 ? 7.486   0.377   -9.959  1.00 0.00 ? 65 ASN A CG   3  
ATOM 3368  O OD1  . ASN A 1 65 ? 6.342   0.064   -10.227 1.00 0.00 ? 65 ASN A OD1  3  
ATOM 3369  N ND2  . ASN A 1 65 ? 8.480   -0.181  -10.595 1.00 0.00 ? 65 ASN A ND2  3  
ATOM 3370  H H    . ASN A 1 65 ? 7.607   3.542   -7.382  1.00 0.00 ? 65 ASN A H    3  
ATOM 3371  H HA   . ASN A 1 65 ? 7.998   3.063   -10.248 1.00 0.00 ? 65 ASN A HA   3  
ATOM 3372  H HB2  . ASN A 1 65 ? 8.833   1.411   -8.647  1.00 0.00 ? 65 ASN A HB2  3  
ATOM 3373  H HB3  . ASN A 1 65 ? 7.213   1.185   -7.993  1.00 0.00 ? 65 ASN A HB3  3  
ATOM 3374  H HD21 . ASN A 1 65 ? 9.403   0.071   -10.378 1.00 0.00 ? 65 ASN A HD21 3  
ATOM 3375  H HD22 . ASN A 1 65 ? 8.305   -0.851  -11.287 1.00 0.00 ? 65 ASN A HD22 3  
ATOM 3376  N N    . LEU A 1 66 ? 5.006   2.738   -8.872  1.00 0.00 ? 66 LEU A N    3  
ATOM 3377  C CA   . LEU A 1 66 ? 3.560   2.747   -9.231  1.00 0.00 ? 66 LEU A CA   3  
ATOM 3378  C C    . LEU A 1 66 ? 3.187   4.182   -9.643  1.00 0.00 ? 66 LEU A C    3  
ATOM 3379  O O    . LEU A 1 66 ? 3.291   5.109   -8.864  1.00 0.00 ? 66 LEU A O    3  
ATOM 3380  C CB   . LEU A 1 66 ? 2.714   2.290   -8.008  1.00 0.00 ? 66 LEU A CB   3  
ATOM 3381  C CG   . LEU A 1 66 ? 2.223   0.823   -8.152  1.00 0.00 ? 66 LEU A CG   3  
ATOM 3382  C CD1  . LEU A 1 66 ? 1.352   0.640   -9.414  1.00 0.00 ? 66 LEU A CD1  3  
ATOM 3383  C CD2  . LEU A 1 66 ? 3.417   -0.146  -8.202  1.00 0.00 ? 66 LEU A CD2  3  
ATOM 3384  H H    . LEU A 1 66 ? 5.275   2.663   -7.936  1.00 0.00 ? 66 LEU A H    3  
ATOM 3385  H HA   . LEU A 1 66 ? 3.397   2.085   -10.067 1.00 0.00 ? 66 LEU A HA   3  
ATOM 3386  H HB2  . LEU A 1 66 ? 3.319   2.368   -7.116  1.00 0.00 ? 66 LEU A HB2  3  
ATOM 3387  H HB3  . LEU A 1 66 ? 1.852   2.934   -7.899  1.00 0.00 ? 66 LEU A HB3  3  
ATOM 3388  H HG   . LEU A 1 66 ? 1.619   0.583   -7.287  1.00 0.00 ? 66 LEU A HG   3  
ATOM 3389  H HD11 . LEU A 1 66 ? 0.567   -0.072  -9.202  1.00 0.00 ? 66 LEU A HD11 3  
ATOM 3390  H HD12 . LEU A 1 66 ? 1.953   0.268   -10.233 1.00 0.00 ? 66 LEU A HD12 3  
ATOM 3391  H HD13 . LEU A 1 66 ? 0.910   1.580   -9.695  1.00 0.00 ? 66 LEU A HD13 3  
ATOM 3392  H HD21 . LEU A 1 66 ? 4.023   -0.021  -7.320  1.00 0.00 ? 66 LEU A HD21 3  
ATOM 3393  H HD22 . LEU A 1 66 ? 4.009   0.052   -9.083  1.00 0.00 ? 66 LEU A HD22 3  
ATOM 3394  H HD23 . LEU A 1 66 ? 3.050   -1.160  -8.241  1.00 0.00 ? 66 LEU A HD23 3  
ATOM 3395  N N    . ASP A 1 67 ? 2.755   4.362   -10.859 1.00 0.00 ? 67 ASP A N    3  
ATOM 3396  C CA   . ASP A 1 67 ? 2.376   5.725   -11.327 1.00 0.00 ? 67 ASP A CA   3  
ATOM 3397  C C    . ASP A 1 67 ? 0.984   6.085   -10.800 1.00 0.00 ? 67 ASP A C    3  
ATOM 3398  O O    . ASP A 1 67 ? 0.325   6.964   -11.317 1.00 0.00 ? 67 ASP A O    3  
ATOM 3399  C CB   . ASP A 1 67 ? 2.363   5.754   -12.857 1.00 0.00 ? 67 ASP A CB   3  
ATOM 3400  C CG   . ASP A 1 67 ? 3.761   5.424   -13.383 1.00 0.00 ? 67 ASP A CG   3  
ATOM 3401  O OD1  . ASP A 1 67 ? 4.358   4.490   -12.873 1.00 0.00 ? 67 ASP A OD1  3  
ATOM 3402  O OD2  . ASP A 1 67 ? 4.211   6.111   -14.285 1.00 0.00 ? 67 ASP A OD2  3  
ATOM 3403  H H    . ASP A 1 67 ? 2.677   3.595   -11.457 1.00 0.00 ? 67 ASP A H    3  
ATOM 3404  H HA   . ASP A 1 67 ? 3.095   6.444   -10.961 1.00 0.00 ? 67 ASP A HA   3  
ATOM 3405  H HB2  . ASP A 1 67 ? 1.657   5.023   -13.224 1.00 0.00 ? 67 ASP A HB2  3  
ATOM 3406  H HB3  . ASP A 1 67 ? 2.076   6.737   -13.196 1.00 0.00 ? 67 ASP A HB3  3  
ATOM 3407  N N    . ASP A 1 68 ? 0.531   5.417   -9.773  1.00 0.00 ? 68 ASP A N    3  
ATOM 3408  C CA   . ASP A 1 68 ? -0.817  5.735   -9.221  1.00 0.00 ? 68 ASP A CA   3  
ATOM 3409  C C    . ASP A 1 68 ? -0.744  7.050   -8.443  1.00 0.00 ? 68 ASP A C    3  
ATOM 3410  O O    . ASP A 1 68 ? 0.203   7.797   -8.565  1.00 0.00 ? 68 ASP A O    3  
ATOM 3411  C CB   . ASP A 1 68 ? -1.275  4.606   -8.292  1.00 0.00 ? 68 ASP A CB   3  
ATOM 3412  C CG   . ASP A 1 68 ? -0.927  3.255   -8.915  1.00 0.00 ? 68 ASP A CG   3  
ATOM 3413  O OD1  . ASP A 1 68 ? -0.930  3.168   -10.132 1.00 0.00 ? 68 ASP A OD1  3  
ATOM 3414  O OD2  . ASP A 1 68 ? -0.666  2.331   -8.163  1.00 0.00 ? 68 ASP A OD2  3  
ATOM 3415  H H    . ASP A 1 68 ? 1.076   4.712   -9.365  1.00 0.00 ? 68 ASP A H    3  
ATOM 3416  H HA   . ASP A 1 68 ? -1.520  5.838   -10.034 1.00 0.00 ? 68 ASP A HA   3  
ATOM 3417  H HB2  . ASP A 1 68 ? -0.782  4.700   -7.337  1.00 0.00 ? 68 ASP A HB2  3  
ATOM 3418  H HB3  . ASP A 1 68 ? -2.343  4.670   -8.152  1.00 0.00 ? 68 ASP A HB3  3  
ATOM 3419  N N    . PHE A 1 69 ? -1.736  7.335   -7.641  1.00 0.00 ? 69 PHE A N    3  
ATOM 3420  C CA   . PHE A 1 69 ? -1.729  8.602   -6.855  1.00 0.00 ? 69 PHE A CA   3  
ATOM 3421  C C    . PHE A 1 69 ? -3.099  8.768   -6.199  1.00 0.00 ? 69 PHE A C    3  
ATOM 3422  O O    . PHE A 1 69 ? -3.457  9.835   -5.738  1.00 0.00 ? 69 PHE A O    3  
ATOM 3423  C CB   . PHE A 1 69 ? -1.450  9.800   -7.788  1.00 0.00 ? 69 PHE A CB   3  
ATOM 3424  C CG   . PHE A 1 69 ? -2.043  9.539   -9.159  1.00 0.00 ? 69 PHE A CG   3  
ATOM 3425  C CD1  . PHE A 1 69 ? -3.433  9.439   -9.315  1.00 0.00 ? 69 PHE A CD1  3  
ATOM 3426  C CD2  . PHE A 1 69 ? -1.205  9.400   -10.275 1.00 0.00 ? 69 PHE A CD2  3  
ATOM 3427  C CE1  . PHE A 1 69 ? -3.982  9.201   -10.581 1.00 0.00 ? 69 PHE A CE1  3  
ATOM 3428  C CE2  . PHE A 1 69 ? -1.756  9.161   -11.540 1.00 0.00 ? 69 PHE A CE2  3  
ATOM 3429  C CZ   . PHE A 1 69 ? -3.143  9.061   -11.694 1.00 0.00 ? 69 PHE A CZ   3  
ATOM 3430  H H    . PHE A 1 69 ? -2.491  6.711   -7.551  1.00 0.00 ? 69 PHE A H    3  
ATOM 3431  H HA   . PHE A 1 69 ? -0.966  8.550   -6.093  1.00 0.00 ? 69 PHE A HA   3  
ATOM 3432  H HB2  . PHE A 1 69 ? -1.892  10.696  -7.373  1.00 0.00 ? 69 PHE A HB2  3  
ATOM 3433  H HB3  . PHE A 1 69 ? -0.383  9.944   -7.878  1.00 0.00 ? 69 PHE A HB3  3  
ATOM 3434  H HD1  . PHE A 1 69 ? -4.083  9.549   -8.461  1.00 0.00 ? 69 PHE A HD1  3  
ATOM 3435  H HD2  . PHE A 1 69 ? -0.134  9.478   -10.160 1.00 0.00 ? 69 PHE A HD2  3  
ATOM 3436  H HE1  . PHE A 1 69 ? -5.052  9.123   -10.700 1.00 0.00 ? 69 PHE A HE1  3  
ATOM 3437  H HE2  . PHE A 1 69 ? -1.110  9.055   -12.399 1.00 0.00 ? 69 PHE A HE2  3  
ATOM 3438  H HZ   . PHE A 1 69 ? -3.567  8.878   -12.669 1.00 0.00 ? 69 PHE A HZ   3  
ATOM 3439  N N    . PHE A 1 70 ? -3.875  7.721   -6.172  1.00 0.00 ? 70 PHE A N    3  
ATOM 3440  C CA   . PHE A 1 70 ? -5.232  7.810   -5.569  1.00 0.00 ? 70 PHE A CA   3  
ATOM 3441  C C    . PHE A 1 70 ? -5.163  8.541   -4.223  1.00 0.00 ? 70 PHE A C    3  
ATOM 3442  O O    . PHE A 1 70 ? -5.509  9.702   -4.120  1.00 0.00 ? 70 PHE A O    3  
ATOM 3443  C CB   . PHE A 1 70 ? -5.793  6.395   -5.364  1.00 0.00 ? 70 PHE A CB   3  
ATOM 3444  C CG   . PHE A 1 70 ? -6.373  5.878   -6.664  1.00 0.00 ? 70 PHE A CG   3  
ATOM 3445  C CD1  . PHE A 1 70 ? -5.522  5.419   -7.675  1.00 0.00 ? 70 PHE A CD1  3  
ATOM 3446  C CD2  . PHE A 1 70 ? -7.761  5.860   -6.856  1.00 0.00 ? 70 PHE A CD2  3  
ATOM 3447  C CE1  . PHE A 1 70 ? -6.056  4.941   -8.878  1.00 0.00 ? 70 PHE A CE1  3  
ATOM 3448  C CE2  . PHE A 1 70 ? -8.295  5.382   -8.059  1.00 0.00 ? 70 PHE A CE2  3  
ATOM 3449  C CZ   . PHE A 1 70 ? -7.443  4.923   -9.069  1.00 0.00 ? 70 PHE A CZ   3  
ATOM 3450  H H    . PHE A 1 70 ? -3.568  6.876   -6.562  1.00 0.00 ? 70 PHE A H    3  
ATOM 3451  H HA   . PHE A 1 70 ? -5.874  8.358   -6.238  1.00 0.00 ? 70 PHE A HA   3  
ATOM 3452  H HB2  . PHE A 1 70 ? -4.998  5.739   -5.042  1.00 0.00 ? 70 PHE A HB2  3  
ATOM 3453  H HB3  . PHE A 1 70 ? -6.568  6.416   -4.610  1.00 0.00 ? 70 PHE A HB3  3  
ATOM 3454  H HD1  . PHE A 1 70 ? -4.454  5.433   -7.527  1.00 0.00 ? 70 PHE A HD1  3  
ATOM 3455  H HD2  . PHE A 1 70 ? -8.417  6.214   -6.075  1.00 0.00 ? 70 PHE A HD2  3  
ATOM 3456  H HE1  . PHE A 1 70 ? -5.399  4.586   -9.657  1.00 0.00 ? 70 PHE A HE1  3  
ATOM 3457  H HE2  . PHE A 1 70 ? -9.365  5.368   -8.206  1.00 0.00 ? 70 PHE A HE2  3  
ATOM 3458  H HZ   . PHE A 1 70 ? -7.855  4.554   -9.997  1.00 0.00 ? 70 PHE A HZ   3  
ATOM 3459  N N    . HIS A 1 71 ? -4.733  7.872   -3.189  1.00 0.00 ? 71 HIS A N    3  
ATOM 3460  C CA   . HIS A 1 71 ? -4.659  8.533   -1.855  1.00 0.00 ? 71 HIS A CA   3  
ATOM 3461  C C    . HIS A 1 71 ? -6.040  9.091   -1.500  1.00 0.00 ? 71 HIS A C    3  
ATOM 3462  O O    . HIS A 1 71 ? -6.167  10.027  -0.735  1.00 0.00 ? 71 HIS A O    3  
ATOM 3463  C CB   . HIS A 1 71 ? -3.640  9.674   -1.907  1.00 0.00 ? 71 HIS A CB   3  
ATOM 3464  C CG   . HIS A 1 71 ? -2.401  9.201   -2.614  1.00 0.00 ? 71 HIS A CG   3  
ATOM 3465  N ND1  . HIS A 1 71 ? -2.230  7.880   -2.999  1.00 0.00 ? 71 HIS A ND1  3  
ATOM 3466  C CD2  . HIS A 1 71 ? -1.262  9.857   -3.011  1.00 0.00 ? 71 HIS A CD2  3  
ATOM 3467  C CE1  . HIS A 1 71 ? -1.030  7.785   -3.599  1.00 0.00 ? 71 HIS A CE1  3  
ATOM 3468  N NE2  . HIS A 1 71 ? -0.397  8.962   -3.634  1.00 0.00 ? 71 HIS A NE2  3  
ATOM 3469  H H    . HIS A 1 71 ? -4.466  6.935   -3.289  1.00 0.00 ? 71 HIS A H    3  
ATOM 3470  H HA   . HIS A 1 71 ? -4.358  7.811   -1.110  1.00 0.00 ? 71 HIS A HA   3  
ATOM 3471  H HB2  . HIS A 1 71 ? -4.063  10.512  -2.441  1.00 0.00 ? 71 HIS A HB2  3  
ATOM 3472  H HB3  . HIS A 1 71 ? -3.388  9.977   -0.902  1.00 0.00 ? 71 HIS A HB3  3  
ATOM 3473  H HD1  . HIS A 1 71 ? -2.866  7.149   -2.859  1.00 0.00 ? 71 HIS A HD1  3  
ATOM 3474  H HD2  . HIS A 1 71 ? -1.070  10.910  -2.866  1.00 0.00 ? 71 HIS A HD2  3  
ATOM 3475  H HE1  . HIS A 1 71 ? -0.629  6.869   -4.008  1.00 0.00 ? 71 HIS A HE1  3  
ATOM 3476  N N    . ARG A 1 72 ? -7.074  8.523   -2.060  1.00 0.00 ? 72 ARG A N    3  
ATOM 3477  C CA   . ARG A 1 72 ? -8.461  9.005   -1.779  1.00 0.00 ? 72 ARG A CA   3  
ATOM 3478  C C    . ARG A 1 72 ? -9.102  8.119   -0.701  1.00 0.00 ? 72 ARG A C    3  
ATOM 3479  O O    . ARG A 1 72 ? -9.228  6.922   -0.864  1.00 0.00 ? 72 ARG A O    3  
ATOM 3480  C CB   . ARG A 1 72 ? -9.274  8.937   -3.084  1.00 0.00 ? 72 ARG A CB   3  
ATOM 3481  C CG   . ARG A 1 72 ? -10.780 8.959   -2.786  1.00 0.00 ? 72 ARG A CG   3  
ATOM 3482  C CD   . ARG A 1 72 ? -11.571 9.258   -4.065  1.00 0.00 ? 72 ARG A CD   3  
ATOM 3483  N NE   . ARG A 1 72 ? -11.015 10.469  -4.759  1.00 0.00 ? 72 ARG A NE   3  
ATOM 3484  C CZ   . ARG A 1 72 ? -10.902 11.621  -4.151  1.00 0.00 ? 72 ARG A CZ   3  
ATOM 3485  N NH1  . ARG A 1 72 ? -11.449 11.813  -2.982  1.00 0.00 ? 72 ARG A NH1  3  
ATOM 3486  N NH2  . ARG A 1 72 ? -10.286 12.607  -4.744  1.00 0.00 ? 72 ARG A NH2  3  
ATOM 3487  H H    . ARG A 1 72 ? -6.940  7.773   -2.677  1.00 0.00 ? 72 ARG A H    3  
ATOM 3488  H HA   . ARG A 1 72 ? -8.431  10.029  -1.430  1.00 0.00 ? 72 ARG A HA   3  
ATOM 3489  H HB2  . ARG A 1 72 ? -9.015  9.783   -3.703  1.00 0.00 ? 72 ARG A HB2  3  
ATOM 3490  H HB3  . ARG A 1 72 ? -9.029  8.025   -3.608  1.00 0.00 ? 72 ARG A HB3  3  
ATOM 3491  H HG2  . ARG A 1 72 ? -11.074 7.990   -2.406  1.00 0.00 ? 72 ARG A HG2  3  
ATOM 3492  H HG3  . ARG A 1 72 ? -10.988 9.707   -2.042  1.00 0.00 ? 72 ARG A HG3  3  
ATOM 3493  H HD2  . ARG A 1 72 ? -11.475 8.429   -4.739  1.00 0.00 ? 72 ARG A HD2  3  
ATOM 3494  H HD3  . ARG A 1 72 ? -12.623 9.387   -3.813  1.00 0.00 ? 72 ARG A HD3  3  
ATOM 3495  H HE   . ARG A 1 72 ? -10.678 10.379  -5.675  1.00 0.00 ? 72 ARG A HE   3  
ATOM 3496  H HH11 . ARG A 1 72 ? -11.964 11.077  -2.545  1.00 0.00 ? 72 ARG A HH11 3  
ATOM 3497  H HH12 . ARG A 1 72 ? -11.353 12.696  -2.525  1.00 0.00 ? 72 ARG A HH12 3  
ATOM 3498  H HH21 . ARG A 1 72 ? -9.905  12.480  -5.660  1.00 0.00 ? 72 ARG A HH21 3  
ATOM 3499  H HH22 . ARG A 1 72 ? -10.197 13.490  -4.284  1.00 0.00 ? 72 ARG A HH22 3  
ATOM 3500  N N    . ASP A 1 73 ? -9.513  8.701   0.395   1.00 0.00 ? 73 ASP A N    3  
ATOM 3501  C CA   . ASP A 1 73 ? -10.148 7.896   1.477   1.00 0.00 ? 73 ASP A CA   3  
ATOM 3502  C C    . ASP A 1 73 ? -10.722 8.834   2.541   1.00 0.00 ? 73 ASP A C    3  
ATOM 3503  O O    . ASP A 1 73 ? -10.537 10.034  2.490   1.00 0.00 ? 73 ASP A O    3  
ATOM 3504  C CB   . ASP A 1 73 ? -9.100  6.983   2.117   1.00 0.00 ? 73 ASP A CB   3  
ATOM 3505  C CG   . ASP A 1 73 ? -9.773  6.077   3.150   1.00 0.00 ? 73 ASP A CG   3  
ATOM 3506  O OD1  . ASP A 1 73 ? -10.743 5.427   2.796   1.00 0.00 ? 73 ASP A OD1  3  
ATOM 3507  O OD2  . ASP A 1 73 ? -9.308  6.050   4.277   1.00 0.00 ? 73 ASP A OD2  3  
ATOM 3508  H H    . ASP A 1 73 ? -9.405  9.669   0.504   1.00 0.00 ? 73 ASP A H    3  
ATOM 3509  H HA   . ASP A 1 73 ? -10.947 7.296   1.062   1.00 0.00 ? 73 ASP A HA   3  
ATOM 3510  H HB2  . ASP A 1 73 ? -8.636  6.377   1.354   1.00 0.00 ? 73 ASP A HB2  3  
ATOM 3511  H HB3  . ASP A 1 73 ? -8.350  7.585   2.606   1.00 0.00 ? 73 ASP A HB3  3  
ATOM 3512  N N    . LYS A 1 74 ? -11.418 8.295   3.507   1.00 0.00 ? 74 LYS A N    3  
ATOM 3513  C CA   . LYS A 1 74 ? -12.006 9.156   4.577   1.00 0.00 ? 74 LYS A CA   3  
ATOM 3514  C C    . LYS A 1 74 ? -10.947 9.438   5.648   1.00 0.00 ? 74 LYS A C    3  
ATOM 3515  O O    . LYS A 1 74 ? -10.438 8.540   6.287   1.00 0.00 ? 74 LYS A O    3  
ATOM 3516  C CB   . LYS A 1 74 ? -13.218 8.454   5.215   1.00 0.00 ? 74 LYS A CB   3  
ATOM 3517  C CG   . LYS A 1 74 ? -12.934 6.954   5.404   1.00 0.00 ? 74 LYS A CG   3  
ATOM 3518  C CD   . LYS A 1 74 ? -13.866 6.381   6.477   1.00 0.00 ? 74 LYS A CD   3  
ATOM 3519  C CE   . LYS A 1 74 ? -13.624 4.876   6.613   1.00 0.00 ? 74 LYS A CE   3  
ATOM 3520  N NZ   . LYS A 1 74 ? -14.600 4.300   7.581   1.00 0.00 ? 74 LYS A NZ   3  
ATOM 3521  H H    . LYS A 1 74 ? -11.553 7.327   3.525   1.00 0.00 ? 74 LYS A H    3  
ATOM 3522  H HA   . LYS A 1 74 ? -12.328 10.093  4.144   1.00 0.00 ? 74 LYS A HA   3  
ATOM 3523  H HB2  . LYS A 1 74 ? -13.428 8.906   6.175   1.00 0.00 ? 74 LYS A HB2  3  
ATOM 3524  H HB3  . LYS A 1 74 ? -14.077 8.573   4.571   1.00 0.00 ? 74 LYS A HB3  3  
ATOM 3525  H HG2  . LYS A 1 74 ? -13.106 6.436   4.472   1.00 0.00 ? 74 LYS A HG2  3  
ATOM 3526  H HG3  . LYS A 1 74 ? -11.909 6.813   5.711   1.00 0.00 ? 74 LYS A HG3  3  
ATOM 3527  H HD2  . LYS A 1 74 ? -13.667 6.865   7.422   1.00 0.00 ? 74 LYS A HD2  3  
ATOM 3528  H HD3  . LYS A 1 74 ? -14.892 6.555   6.193   1.00 0.00 ? 74 LYS A HD3  3  
ATOM 3529  H HE2  . LYS A 1 74 ? -13.750 4.403   5.650   1.00 0.00 ? 74 LYS A HE2  3  
ATOM 3530  H HE3  . LYS A 1 74 ? -12.618 4.704   6.969   1.00 0.00 ? 74 LYS A HE3  3  
ATOM 3531  H HZ1  . LYS A 1 74 ? -14.492 3.268   7.609   1.00 0.00 ? 74 LYS A HZ1  3  
ATOM 3532  H HZ2  . LYS A 1 74 ? -15.567 4.538   7.282   1.00 0.00 ? 74 LYS A HZ2  3  
ATOM 3533  H HZ3  . LYS A 1 74 ? -14.421 4.695   8.528   1.00 0.00 ? 74 LYS A HZ3  3  
ATOM 3534  N N    . ASP A 1 75 ? -10.612 10.685  5.847   1.00 0.00 ? 75 ASP A N    3  
ATOM 3535  C CA   . ASP A 1 75 ? -9.588  11.027  6.874   1.00 0.00 ? 75 ASP A CA   3  
ATOM 3536  C C    . ASP A 1 75 ? -9.540  12.545  7.059   1.00 0.00 ? 75 ASP A C    3  
ATOM 3537  O O    . ASP A 1 75 ? -9.123  13.274  6.181   1.00 0.00 ? 75 ASP A O    3  
ATOM 3538  C CB   . ASP A 1 75 ? -8.217  10.526  6.418   1.00 0.00 ? 75 ASP A CB   3  
ATOM 3539  C CG   . ASP A 1 75 ? -7.182  10.809  7.509   1.00 0.00 ? 75 ASP A CG   3  
ATOM 3540  O OD1  . ASP A 1 75 ? -6.777  11.954  7.631   1.00 0.00 ? 75 ASP A OD1  3  
ATOM 3541  O OD2  . ASP A 1 75 ? -6.812  9.877   8.204   1.00 0.00 ? 75 ASP A OD2  3  
ATOM 3542  H H    . ASP A 1 75 ? -11.035 11.395  5.320   1.00 0.00 ? 75 ASP A H    3  
ATOM 3543  H HA   . ASP A 1 75 ? -9.849  10.558  7.812   1.00 0.00 ? 75 ASP A HA   3  
ATOM 3544  H HB2  . ASP A 1 75 ? -8.266  9.462   6.234   1.00 0.00 ? 75 ASP A HB2  3  
ATOM 3545  H HB3  . ASP A 1 75 ? -7.930  11.035  5.511   1.00 0.00 ? 75 ASP A HB3  3  
ATOM 3546  N N    . ASP A 1 76 ? -9.965  13.027  8.194   1.00 0.00 ? 76 ASP A N    3  
ATOM 3547  C CA   . ASP A 1 76 ? -9.944  14.497  8.436   1.00 0.00 ? 76 ASP A CA   3  
ATOM 3548  C C    . ASP A 1 76 ? -8.503  15.007  8.349   1.00 0.00 ? 76 ASP A C    3  
ATOM 3549  O O    . ASP A 1 76 ? -7.653  14.632  9.132   1.00 0.00 ? 76 ASP A O    3  
ATOM 3550  C CB   . ASP A 1 76 ? -10.506 14.792  9.827   1.00 0.00 ? 76 ASP A CB   3  
ATOM 3551  C CG   . ASP A 1 76 ? -11.968 14.348  9.893   1.00 0.00 ? 76 ASP A CG   3  
ATOM 3552  O OD1  . ASP A 1 76 ? -12.207 13.154  9.809   1.00 0.00 ? 76 ASP A OD1  3  
ATOM 3553  O OD2  . ASP A 1 76 ? -12.823 15.207  10.025  1.00 0.00 ? 76 ASP A OD2  3  
ATOM 3554  H H    . ASP A 1 76 ? -10.298 12.421  8.890   1.00 0.00 ? 76 ASP A H    3  
ATOM 3555  H HA   . ASP A 1 76 ? -10.548 14.993  7.690   1.00 0.00 ? 76 ASP A HA   3  
ATOM 3556  H HB2  . ASP A 1 76 ? -9.931  14.255  10.568  1.00 0.00 ? 76 ASP A HB2  3  
ATOM 3557  H HB3  . ASP A 1 76 ? -10.445 15.852  10.023  1.00 0.00 ? 76 ASP A HB3  3  
ATOM 3558  N N    . PHE A 1 77 ? -8.221  15.861  7.402   1.00 0.00 ? 77 PHE A N    3  
ATOM 3559  C CA   . PHE A 1 77 ? -6.836  16.393  7.268   1.00 0.00 ? 77 PHE A CA   3  
ATOM 3560  C C    . PHE A 1 77 ? -6.497  17.248  8.491   1.00 0.00 ? 77 PHE A C    3  
ATOM 3561  O O    . PHE A 1 77 ? -7.037  18.319  8.680   1.00 0.00 ? 77 PHE A O    3  
ATOM 3562  C CB   . PHE A 1 77 ? -6.738  17.250  6.003   1.00 0.00 ? 77 PHE A CB   3  
ATOM 3563  C CG   . PHE A 1 77 ? -7.287  16.478  4.828   1.00 0.00 ? 77 PHE A CG   3  
ATOM 3564  C CD1  . PHE A 1 77 ? -6.464  15.583  4.133   1.00 0.00 ? 77 PHE A CD1  3  
ATOM 3565  C CD2  . PHE A 1 77 ? -8.618  16.655  4.434   1.00 0.00 ? 77 PHE A CD2  3  
ATOM 3566  C CE1  . PHE A 1 77 ? -6.972  14.867  3.042   1.00 0.00 ? 77 PHE A CE1  3  
ATOM 3567  C CE2  . PHE A 1 77 ? -9.127  15.938  3.344   1.00 0.00 ? 77 PHE A CE2  3  
ATOM 3568  C CZ   . PHE A 1 77 ? -8.304  15.045  2.648   1.00 0.00 ? 77 PHE A CZ   3  
ATOM 3569  H H    . PHE A 1 77 ? -8.921  16.151  6.780   1.00 0.00 ? 77 PHE A H    3  
ATOM 3570  H HA   . PHE A 1 77 ? -6.140  15.570  7.200   1.00 0.00 ? 77 PHE A HA   3  
ATOM 3571  H HB2  . PHE A 1 77 ? -7.311  18.156  6.138   1.00 0.00 ? 77 PHE A HB2  3  
ATOM 3572  H HB3  . PHE A 1 77 ? -5.705  17.501  5.818   1.00 0.00 ? 77 PHE A HB3  3  
ATOM 3573  H HD1  . PHE A 1 77 ? -5.437  15.446  4.437   1.00 0.00 ? 77 PHE A HD1  3  
ATOM 3574  H HD2  . PHE A 1 77 ? -9.253  17.345  4.970   1.00 0.00 ? 77 PHE A HD2  3  
ATOM 3575  H HE1  . PHE A 1 77 ? -6.337  14.178  2.506   1.00 0.00 ? 77 PHE A HE1  3  
ATOM 3576  H HE2  . PHE A 1 77 ? -10.155 16.075  3.040   1.00 0.00 ? 77 PHE A HE2  3  
ATOM 3577  H HZ   . PHE A 1 77 ? -8.696  14.492  1.807   1.00 0.00 ? 77 PHE A HZ   3  
ATOM 3578  N N    . PHE A 1 78 ? -5.605  16.783  9.322   1.00 0.00 ? 78 PHE A N    3  
ATOM 3579  C CA   . PHE A 1 78 ? -5.232  17.568  10.531  1.00 0.00 ? 78 PHE A CA   3  
ATOM 3580  C C    . PHE A 1 78 ? -4.713  18.943  10.106  1.00 0.00 ? 78 PHE A C    3  
ATOM 3581  O O    . PHE A 1 78 ? -4.391  19.167  8.957   1.00 0.00 ? 78 PHE A O    3  
ATOM 3582  C CB   . PHE A 1 78 ? -4.139  16.826  11.302  1.00 0.00 ? 78 PHE A CB   3  
ATOM 3583  C CG   . PHE A 1 78 ? -4.583  15.407  11.566  1.00 0.00 ? 78 PHE A CG   3  
ATOM 3584  C CD1  . PHE A 1 78 ? -5.418  15.127  12.654  1.00 0.00 ? 78 PHE A CD1  3  
ATOM 3585  C CD2  . PHE A 1 78 ? -4.160  14.373  10.724  1.00 0.00 ? 78 PHE A CD2  3  
ATOM 3586  C CE1  . PHE A 1 78 ? -5.830  13.812  12.900  1.00 0.00 ? 78 PHE A CE1  3  
ATOM 3587  C CE2  . PHE A 1 78 ? -4.573  13.057  10.968  1.00 0.00 ? 78 PHE A CE2  3  
ATOM 3588  C CZ   . PHE A 1 78 ? -5.407  12.777  12.057  1.00 0.00 ? 78 PHE A CZ   3  
ATOM 3589  H H    . PHE A 1 78 ? -5.182  15.916  9.150   1.00 0.00 ? 78 PHE A H    3  
ATOM 3590  H HA   . PHE A 1 78 ? -6.100  17.689  11.163  1.00 0.00 ? 78 PHE A HA   3  
ATOM 3591  H HB2  . PHE A 1 78 ? -3.230  16.816  10.718  1.00 0.00 ? 78 PHE A HB2  3  
ATOM 3592  H HB3  . PHE A 1 78 ? -3.957  17.327  12.241  1.00 0.00 ? 78 PHE A HB3  3  
ATOM 3593  H HD1  . PHE A 1 78 ? -5.743  15.925  13.305  1.00 0.00 ? 78 PHE A HD1  3  
ATOM 3594  H HD2  . PHE A 1 78 ? -3.516  14.589  9.884   1.00 0.00 ? 78 PHE A HD2  3  
ATOM 3595  H HE1  . PHE A 1 78 ? -6.473  13.595  13.740  1.00 0.00 ? 78 PHE A HE1  3  
ATOM 3596  H HE2  . PHE A 1 78 ? -4.247  12.259  10.318  1.00 0.00 ? 78 PHE A HE2  3  
ATOM 3597  H HZ   . PHE A 1 78 ? -5.725  11.762  12.246  1.00 0.00 ? 78 PHE A HZ   3  
ATOM 3598  N N    . THR A 1 79 ? -4.630  19.865  11.026  1.00 0.00 ? 79 THR A N    3  
ATOM 3599  C CA   . THR A 1 79 ? -4.132  21.225  10.672  1.00 0.00 ? 79 THR A CA   3  
ATOM 3600  C C    . THR A 1 79 ? -2.634  21.154  10.362  1.00 0.00 ? 79 THR A C    3  
ATOM 3601  O O    . THR A 1 79 ? -1.888  20.742  11.234  1.00 0.00 ? 79 THR A O    3  
ATOM 3602  C CB   . THR A 1 79 ? -4.364  22.176  11.849  1.00 0.00 ? 79 THR A CB   3  
ATOM 3603  O OG1  . THR A 1 79 ? -5.734  22.137  12.222  1.00 0.00 ? 79 THR A OG1  3  
ATOM 3604  C CG2  . THR A 1 79 ? -3.986  23.600  11.440  1.00 0.00 ? 79 THR A CG2  3  
ATOM 3605  O OXT  . THR A 1 79 ? -2.261  21.515  9.258   1.00 0.00 ? 79 THR A OXT  3  
ATOM 3606  H H    . THR A 1 79 ? -4.894  19.665  11.947  1.00 0.00 ? 79 THR A H    3  
ATOM 3607  H HA   . THR A 1 79 ? -4.662  21.588  9.805   1.00 0.00 ? 79 THR A HA   3  
ATOM 3608  H HB   . THR A 1 79 ? -3.754  21.871  12.684  1.00 0.00 ? 79 THR A HB   3  
ATOM 3609  H HG1  . THR A 1 79 ? -6.108  23.009  12.073  1.00 0.00 ? 79 THR A HG1  3  
ATOM 3610  H HG21 . THR A 1 79 ? -4.251  24.284  12.231  1.00 0.00 ? 79 THR A HG21 3  
ATOM 3611  H HG22 . THR A 1 79 ? -4.516  23.868  10.538  1.00 0.00 ? 79 THR A HG22 3  
ATOM 3612  H HG23 . THR A 1 79 ? -2.921  23.651  11.260  1.00 0.00 ? 79 THR A HG23 3  
ATOM 3613  N N    . MET A 1 1  ? -11.401 -10.732 26.334  1.00 0.00 ? 1  MET A N    4  
ATOM 3614  C CA   . MET A 1 1  ? -10.479 -11.007 25.195  1.00 0.00 ? 1  MET A CA   4  
ATOM 3615  C C    . MET A 1 1  ? -9.310  -10.022 25.236  1.00 0.00 ? 1  MET A C    4  
ATOM 3616  O O    . MET A 1 1  ? -8.779  -9.718  26.287  1.00 0.00 ? 1  MET A O    4  
ATOM 3617  C CB   . MET A 1 1  ? -11.237 -10.845 23.875  1.00 0.00 ? 1  MET A CB   4  
ATOM 3618  C CG   . MET A 1 1  ? -12.448 -11.781 23.860  1.00 0.00 ? 1  MET A CG   4  
ATOM 3619  S SD   . MET A 1 1  ? -13.745 -11.106 24.929  1.00 0.00 ? 1  MET A SD   4  
ATOM 3620  C CE   . MET A 1 1  ? -14.557 -10.080 23.679  1.00 0.00 ? 1  MET A CE   4  
ATOM 3621  H H1   . MET A 1 1  ? -11.875 -9.819  26.183  1.00 0.00 ? 1  MET A H1   4  
ATOM 3622  H H2   . MET A 1 1  ? -10.856 -10.701 27.220  1.00 0.00 ? 1  MET A H2   4  
ATOM 3623  H H3   . MET A 1 1  ? -12.116 -11.485 26.392  1.00 0.00 ? 1  MET A H3   4  
ATOM 3624  H HA   . MET A 1 1  ? -10.103 -12.017 25.273  1.00 0.00 ? 1  MET A HA   4  
ATOM 3625  H HB2  . MET A 1 1  ? -11.569 -9.823  23.774  1.00 0.00 ? 1  MET A HB2  4  
ATOM 3626  H HB3  . MET A 1 1  ? -10.584 -11.094 23.053  1.00 0.00 ? 1  MET A HB3  4  
ATOM 3627  H HG2  . MET A 1 1  ? -12.822 -11.869 22.851  1.00 0.00 ? 1  MET A HG2  4  
ATOM 3628  H HG3  . MET A 1 1  ? -12.155 -12.756 24.221  1.00 0.00 ? 1  MET A HG3  4  
ATOM 3629  H HE1  . MET A 1 1  ? -15.307 -9.463  24.155  1.00 0.00 ? 1  MET A HE1  4  
ATOM 3630  H HE2  . MET A 1 1  ? -15.022 -10.716 22.939  1.00 0.00 ? 1  MET A HE2  4  
ATOM 3631  H HE3  . MET A 1 1  ? -13.826 -9.449  23.200  1.00 0.00 ? 1  MET A HE3  4  
ATOM 3632  N N    . ILE A 1 2  ? -8.904  -9.520  24.103  1.00 0.00 ? 2  ILE A N    4  
ATOM 3633  C CA   . ILE A 1 2  ? -7.769  -8.555  24.078  1.00 0.00 ? 2  ILE A CA   4  
ATOM 3634  C C    . ILE A 1 2  ? -6.577  -9.150  24.830  1.00 0.00 ? 2  ILE A C    4  
ATOM 3635  O O    . ILE A 1 2  ? -6.358  -8.866  25.990  1.00 0.00 ? 2  ILE A O    4  
ATOM 3636  C CB   . ILE A 1 2  ? -8.197  -7.249  24.752  1.00 0.00 ? 2  ILE A CB   4  
ATOM 3637  C CG1  . ILE A 1 2  ? -9.452  -6.708  24.063  1.00 0.00 ? 2  ILE A CG1  4  
ATOM 3638  C CG2  . ILE A 1 2  ? -7.070  -6.221  24.635  1.00 0.00 ? 2  ILE A CG2  4  
ATOM 3639  C CD1  . ILE A 1 2  ? -9.996  -5.518  24.853  1.00 0.00 ? 2  ILE A CD1  4  
ATOM 3640  H H    . ILE A 1 2  ? -9.346  -9.778  23.267  1.00 0.00 ? 2  ILE A H    4  
ATOM 3641  H HA   . ILE A 1 2  ? -7.487  -8.357  23.055  1.00 0.00 ? 2  ILE A HA   4  
ATOM 3642  H HB   . ILE A 1 2  ? -8.407  -7.435  25.795  1.00 0.00 ? 2  ILE A HB   4  
ATOM 3643  H HG12 . ILE A 1 2  ? -9.204  -6.394  23.060  1.00 0.00 ? 2  ILE A HG12 4  
ATOM 3644  H HG13 . ILE A 1 2  ? -10.202 -7.484  24.022  1.00 0.00 ? 2  ILE A HG13 4  
ATOM 3645  H HG21 . ILE A 1 2  ? -7.394  -5.282  25.058  1.00 0.00 ? 2  ILE A HG21 4  
ATOM 3646  H HG22 . ILE A 1 2  ? -6.819  -6.080  23.594  1.00 0.00 ? 2  ILE A HG22 4  
ATOM 3647  H HG23 . ILE A 1 2  ? -6.201  -6.576  25.169  1.00 0.00 ? 2  ILE A HG23 4  
ATOM 3648  H HD11 . ILE A 1 2  ? -10.946 -5.215  24.440  1.00 0.00 ? 2  ILE A HD11 4  
ATOM 3649  H HD12 . ILE A 1 2  ? -9.298  -4.696  24.791  1.00 0.00 ? 2  ILE A HD12 4  
ATOM 3650  H HD13 . ILE A 1 2  ? -10.127 -5.801  25.887  1.00 0.00 ? 2  ILE A HD13 4  
ATOM 3651  N N    . ASP A 1 3  ? -5.805  -9.975  24.177  1.00 0.00 ? 3  ASP A N    4  
ATOM 3652  C CA   . ASP A 1 3  ? -4.628  -10.588 24.855  1.00 0.00 ? 3  ASP A CA   4  
ATOM 3653  C C    . ASP A 1 3  ? -3.582  -9.507  25.138  1.00 0.00 ? 3  ASP A C    4  
ATOM 3654  O O    . ASP A 1 3  ? -3.911  -8.370  25.412  1.00 0.00 ? 3  ASP A O    4  
ATOM 3655  C CB   . ASP A 1 3  ? -4.020  -11.661 23.948  1.00 0.00 ? 3  ASP A CB   4  
ATOM 3656  C CG   . ASP A 1 3  ? -5.102  -12.666 23.550  1.00 0.00 ? 3  ASP A CG   4  
ATOM 3657  O OD1  . ASP A 1 3  ? -5.482  -13.463 24.393  1.00 0.00 ? 3  ASP A OD1  4  
ATOM 3658  O OD2  . ASP A 1 3  ? -5.532  -12.623 22.410  1.00 0.00 ? 3  ASP A OD2  4  
ATOM 3659  H H    . ASP A 1 3  ? -5.999  -10.191 23.240  1.00 0.00 ? 3  ASP A H    4  
ATOM 3660  H HA   . ASP A 1 3  ? -4.942  -11.038 25.785  1.00 0.00 ? 3  ASP A HA   4  
ATOM 3661  H HB2  . ASP A 1 3  ? -3.615  -11.195 23.061  1.00 0.00 ? 3  ASP A HB2  4  
ATOM 3662  H HB3  . ASP A 1 3  ? -3.231  -12.175 24.478  1.00 0.00 ? 3  ASP A HB3  4  
ATOM 3663  N N    . ASN A 1 4  ? -2.325  -9.852  25.075  1.00 0.00 ? 4  ASN A N    4  
ATOM 3664  C CA   . ASN A 1 4  ? -1.262  -8.843  25.342  1.00 0.00 ? 4  ASN A CA   4  
ATOM 3665  C C    . ASN A 1 4  ? 0.096   -9.405  24.918  1.00 0.00 ? 4  ASN A C    4  
ATOM 3666  O O    . ASN A 1 4  ? 0.434   -10.532 25.219  1.00 0.00 ? 4  ASN A O    4  
ATOM 3667  C CB   . ASN A 1 4  ? -1.233  -8.516  26.836  1.00 0.00 ? 4  ASN A CB   4  
ATOM 3668  C CG   . ASN A 1 4  ? -0.220  -7.399  27.096  1.00 0.00 ? 4  ASN A CG   4  
ATOM 3669  O OD1  . ASN A 1 4  ? 0.596   -7.096  26.248  1.00 0.00 ? 4  ASN A OD1  4  
ATOM 3670  N ND2  . ASN A 1 4  ? -0.237  -6.772  28.240  1.00 0.00 ? 4  ASN A ND2  4  
ATOM 3671  H H    . ASN A 1 4  ? -2.081  -10.775 24.852  1.00 0.00 ? 4  ASN A H    4  
ATOM 3672  H HA   . ASN A 1 4  ? -1.470  -7.944  24.781  1.00 0.00 ? 4  ASN A HA   4  
ATOM 3673  H HB2  . ASN A 1 4  ? -2.215  -8.193  27.153  1.00 0.00 ? 4  ASN A HB2  4  
ATOM 3674  H HB3  . ASN A 1 4  ? -0.946  -9.396  27.392  1.00 0.00 ? 4  ASN A HB3  4  
ATOM 3675  H HD21 . ASN A 1 4  ? -0.894  -7.017  28.923  1.00 0.00 ? 4  ASN A HD21 4  
ATOM 3676  H HD22 . ASN A 1 4  ? 0.408   -6.056  28.415  1.00 0.00 ? 4  ASN A HD22 4  
ATOM 3677  N N    . GLU A 1 5  ? 0.878   -8.628  24.219  1.00 0.00 ? 5  GLU A N    4  
ATOM 3678  C CA   . GLU A 1 5  ? 2.214   -9.116  23.774  1.00 0.00 ? 5  GLU A CA   4  
ATOM 3679  C C    . GLU A 1 5  ? 2.982   -7.967  23.117  1.00 0.00 ? 5  GLU A C    4  
ATOM 3680  O O    . GLU A 1 5  ? 2.548   -6.832  23.127  1.00 0.00 ? 5  GLU A O    4  
ATOM 3681  C CB   . GLU A 1 5  ? 2.032   -10.251 22.763  1.00 0.00 ? 5  GLU A CB   4  
ATOM 3682  C CG   . GLU A 1 5  ? 1.085   -9.798  21.650  1.00 0.00 ? 5  GLU A CG   4  
ATOM 3683  C CD   . GLU A 1 5  ? 0.898   -10.936 20.645  1.00 0.00 ? 5  GLU A CD   4  
ATOM 3684  O OE1  . GLU A 1 5  ? 0.680   -12.054 21.080  1.00 0.00 ? 5  GLU A OE1  4  
ATOM 3685  O OE2  . GLU A 1 5  ? 0.974   -10.669 19.457  1.00 0.00 ? 5  GLU A OE2  4  
ATOM 3686  H H    . GLU A 1 5  ? 0.586   -7.721  23.986  1.00 0.00 ? 5  GLU A H    4  
ATOM 3687  H HA   . GLU A 1 5  ? 2.768   -9.479  24.628  1.00 0.00 ? 5  GLU A HA   4  
ATOM 3688  H HB2  . GLU A 1 5  ? 2.991   -10.511 22.339  1.00 0.00 ? 5  GLU A HB2  4  
ATOM 3689  H HB3  . GLU A 1 5  ? 1.613   -11.113 23.261  1.00 0.00 ? 5  GLU A HB3  4  
ATOM 3690  H HG2  . GLU A 1 5  ? 0.129   -9.532  22.078  1.00 0.00 ? 5  GLU A HG2  4  
ATOM 3691  H HG3  . GLU A 1 5  ? 1.506   -8.941  21.147  1.00 0.00 ? 5  GLU A HG3  4  
ATOM 3692  N N    . LYS A 1 6  ? 4.119   -8.251  22.542  1.00 0.00 ? 6  LYS A N    4  
ATOM 3693  C CA   . LYS A 1 6  ? 4.910   -7.174  21.884  1.00 0.00 ? 6  LYS A CA   4  
ATOM 3694  C C    . LYS A 1 6  ? 4.185   -6.718  20.615  1.00 0.00 ? 6  LYS A C    4  
ATOM 3695  O O    . LYS A 1 6  ? 4.790   -6.518  19.581  1.00 0.00 ? 6  LYS A O    4  
ATOM 3696  C CB   . LYS A 1 6  ? 6.296   -7.710  21.517  1.00 0.00 ? 6  LYS A CB   4  
ATOM 3697  C CG   . LYS A 1 6  ? 7.054   -8.078  22.795  1.00 0.00 ? 6  LYS A CG   4  
ATOM 3698  C CD   . LYS A 1 6  ? 8.272   -8.933  22.440  1.00 0.00 ? 6  LYS A CD   4  
ATOM 3699  C CE   . LYS A 1 6  ? 9.256   -8.108  21.606  1.00 0.00 ? 6  LYS A CE   4  
ATOM 3700  N NZ   . LYS A 1 6  ? 10.588  -8.778  21.603  1.00 0.00 ? 6  LYS A NZ   4  
ATOM 3701  H H    . LYS A 1 6  ? 4.452   -9.173  22.543  1.00 0.00 ? 6  LYS A H    4  
ATOM 3702  H HA   . LYS A 1 6  ? 5.013   -6.337  22.560  1.00 0.00 ? 6  LYS A HA   4  
ATOM 3703  H HB2  . LYS A 1 6  ? 6.189   -8.586  20.895  1.00 0.00 ? 6  LYS A HB2  4  
ATOM 3704  H HB3  . LYS A 1 6  ? 6.845   -6.951  20.981  1.00 0.00 ? 6  LYS A HB3  4  
ATOM 3705  H HG2  . LYS A 1 6  ? 7.377   -7.175  23.293  1.00 0.00 ? 6  LYS A HG2  4  
ATOM 3706  H HG3  . LYS A 1 6  ? 6.403   -8.637  23.451  1.00 0.00 ? 6  LYS A HG3  4  
ATOM 3707  H HD2  . LYS A 1 6  ? 8.757   -9.262  23.348  1.00 0.00 ? 6  LYS A HD2  4  
ATOM 3708  H HD3  . LYS A 1 6  ? 7.954   -9.793  21.869  1.00 0.00 ? 6  LYS A HD3  4  
ATOM 3709  H HE2  . LYS A 1 6  ? 8.892   -8.029  20.593  1.00 0.00 ? 6  LYS A HE2  4  
ATOM 3710  H HE3  . LYS A 1 6  ? 9.352   -7.120  22.032  1.00 0.00 ? 6  LYS A HE3  4  
ATOM 3711  H HZ1  . LYS A 1 6  ? 10.482  -9.760  21.283  1.00 0.00 ? 6  LYS A HZ1  4  
ATOM 3712  H HZ2  . LYS A 1 6  ? 10.982  -8.771  22.565  1.00 0.00 ? 6  LYS A HZ2  4  
ATOM 3713  H HZ3  . LYS A 1 6  ? 11.230  -8.269  20.961  1.00 0.00 ? 6  LYS A HZ3  4  
ATOM 3714  N N    . VAL A 1 7  ? 2.888   -6.565  20.691  1.00 0.00 ? 7  VAL A N    4  
ATOM 3715  C CA   . VAL A 1 7  ? 2.099   -6.135  19.497  1.00 0.00 ? 7  VAL A CA   4  
ATOM 3716  C C    . VAL A 1 7  ? 2.837   -5.028  18.736  1.00 0.00 ? 7  VAL A C    4  
ATOM 3717  O O    . VAL A 1 7  ? 3.325   -4.078  19.315  1.00 0.00 ? 7  VAL A O    4  
ATOM 3718  C CB   . VAL A 1 7  ? 0.736   -5.611  19.954  1.00 0.00 ? 7  VAL A CB   4  
ATOM 3719  C CG1  . VAL A 1 7  ? 0.934   -4.406  20.876  1.00 0.00 ? 7  VAL A CG1  4  
ATOM 3720  C CG2  . VAL A 1 7  ? -0.081  -5.186  18.731  1.00 0.00 ? 7  VAL A CG2  4  
ATOM 3721  H H    . VAL A 1 7  ? 2.427   -6.750  21.536  1.00 0.00 ? 7  VAL A H    4  
ATOM 3722  H HA   . VAL A 1 7  ? 1.952   -6.981  18.842  1.00 0.00 ? 7  VAL A HA   4  
ATOM 3723  H HB   . VAL A 1 7  ? 0.212   -6.390  20.487  1.00 0.00 ? 7  VAL A HB   4  
ATOM 3724  H HG11 . VAL A 1 7  ? 0.005   -4.183  21.380  1.00 0.00 ? 7  VAL A HG11 4  
ATOM 3725  H HG12 . VAL A 1 7  ? 1.241   -3.552  20.291  1.00 0.00 ? 7  VAL A HG12 4  
ATOM 3726  H HG13 . VAL A 1 7  ? 1.694   -4.634  21.608  1.00 0.00 ? 7  VAL A HG13 4  
ATOM 3727  H HG21 . VAL A 1 7  ? 0.351   -4.295  18.301  1.00 0.00 ? 7  VAL A HG21 4  
ATOM 3728  H HG22 . VAL A 1 7  ? -1.099  -4.983  19.031  1.00 0.00 ? 7  VAL A HG22 4  
ATOM 3729  H HG23 . VAL A 1 7  ? -0.074  -5.979  17.999  1.00 0.00 ? 7  VAL A HG23 4  
ATOM 3730  N N    . THR A 1 8  ? 2.916   -5.152  17.439  1.00 0.00 ? 8  THR A N    4  
ATOM 3731  C CA   . THR A 1 8  ? 3.616   -4.118  16.624  1.00 0.00 ? 8  THR A CA   4  
ATOM 3732  C C    . THR A 1 8  ? 3.099   -4.176  15.185  1.00 0.00 ? 8  THR A C    4  
ATOM 3733  O O    . THR A 1 8  ? 2.785   -5.231  14.673  1.00 0.00 ? 8  THR A O    4  
ATOM 3734  C CB   . THR A 1 8  ? 5.122   -4.387  16.639  1.00 0.00 ? 8  THR A CB   4  
ATOM 3735  O OG1  . THR A 1 8  ? 5.581   -4.433  17.983  1.00 0.00 ? 8  THR A OG1  4  
ATOM 3736  C CG2  . THR A 1 8  ? 5.849   -3.270  15.887  1.00 0.00 ? 8  THR A CG2  4  
ATOM 3737  H H    . THR A 1 8  ? 2.511   -5.931  17.004  1.00 0.00 ? 8  THR A H    4  
ATOM 3738  H HA   . THR A 1 8  ? 3.420   -3.139  17.037  1.00 0.00 ? 8  THR A HA   4  
ATOM 3739  H HB   . THR A 1 8  ? 5.325   -5.331  16.156  1.00 0.00 ? 8  THR A HB   4  
ATOM 3740  H HG1  . THR A 1 8  ? 5.086   -3.782  18.487  1.00 0.00 ? 8  THR A HG1  4  
ATOM 3741  H HG21 . THR A 1 8  ? 6.916   -3.394  16.004  1.00 0.00 ? 8  THR A HG21 4  
ATOM 3742  H HG22 . THR A 1 8  ? 5.551   -2.313  16.289  1.00 0.00 ? 8  THR A HG22 4  
ATOM 3743  H HG23 . THR A 1 8  ? 5.594   -3.316  14.839  1.00 0.00 ? 8  THR A HG23 4  
ATOM 3744  N N    . SER A 1 9  ? 3.014   -3.050  14.529  1.00 0.00 ? 9  SER A N    4  
ATOM 3745  C CA   . SER A 1 9  ? 2.520   -3.038  13.122  1.00 0.00 ? 9  SER A CA   4  
ATOM 3746  C C    . SER A 1 9  ? 2.618   -1.611  12.571  1.00 0.00 ? 9  SER A C    4  
ATOM 3747  O O    . SER A 1 9  ? 3.409   -1.326  11.694  1.00 0.00 ? 9  SER A O    4  
ATOM 3748  C CB   . SER A 1 9  ? 1.059   -3.502  13.087  1.00 0.00 ? 9  SER A CB   4  
ATOM 3749  O OG   . SER A 1 9  ? 1.013   -4.920  13.159  1.00 0.00 ? 9  SER A OG   4  
ATOM 3750  H H    . SER A 1 9  ? 3.278   -2.209  14.957  1.00 0.00 ? 9  SER A H    4  
ATOM 3751  H HA   . SER A 1 9  ? 3.125   -3.701  12.520  1.00 0.00 ? 9  SER A HA   4  
ATOM 3752  H HB2  . SER A 1 9  ? 0.528   -3.088  13.927  1.00 0.00 ? 9  SER A HB2  4  
ATOM 3753  H HB3  . SER A 1 9  ? 0.592   -3.164  12.169  1.00 0.00 ? 9  SER A HB3  4  
ATOM 3754  H HG   . SER A 1 9  ? 0.840   -5.166  14.071  1.00 0.00 ? 9  SER A HG   4  
ATOM 3755  N N    . GLY A 1 10 ? 1.819   -0.715  13.083  1.00 0.00 ? 10 GLY A N    4  
ATOM 3756  C CA   . GLY A 1 10 ? 1.863   0.692   12.594  1.00 0.00 ? 10 GLY A CA   4  
ATOM 3757  C C    . GLY A 1 10 ? 0.729   1.492   13.238  1.00 0.00 ? 10 GLY A C    4  
ATOM 3758  O O    . GLY A 1 10 ? -0.011  2.186   12.570  1.00 0.00 ? 10 GLY A O    4  
ATOM 3759  H H    . GLY A 1 10 ? 1.191   -0.971  13.790  1.00 0.00 ? 10 GLY A H    4  
ATOM 3760  H HA2  . GLY A 1 10 ? 2.813   1.135   12.859  1.00 0.00 ? 10 GLY A HA2  4  
ATOM 3761  H HA3  . GLY A 1 10 ? 1.744   0.705   11.522  1.00 0.00 ? 10 GLY A HA3  4  
ATOM 3762  N N    . HIS A 1 11 ? 0.586   1.400   14.533  1.00 0.00 ? 11 HIS A N    4  
ATOM 3763  C CA   . HIS A 1 11 ? -0.501  2.157   15.216  1.00 0.00 ? 11 HIS A CA   4  
ATOM 3764  C C    . HIS A 1 11 ? -1.833  1.879   14.515  1.00 0.00 ? 11 HIS A C    4  
ATOM 3765  O O    . HIS A 1 11 ? -2.186  0.744   14.259  1.00 0.00 ? 11 HIS A O    4  
ATOM 3766  C CB   . HIS A 1 11 ? -0.194  3.655   15.158  1.00 0.00 ? 11 HIS A CB   4  
ATOM 3767  C CG   . HIS A 1 11 ? 1.168   3.911   15.744  1.00 0.00 ? 11 HIS A CG   4  
ATOM 3768  N ND1  . HIS A 1 11 ? 2.334   3.675   15.033  1.00 0.00 ? 11 HIS A ND1  4  
ATOM 3769  C CD2  . HIS A 1 11 ? 1.565   4.383   16.970  1.00 0.00 ? 11 HIS A CD2  4  
ATOM 3770  C CE1  . HIS A 1 11 ? 3.368   4.002   15.830  1.00 0.00 ? 11 HIS A CE1  4  
ATOM 3771  N NE2  . HIS A 1 11 ? 2.955   4.439   17.023  1.00 0.00 ? 11 HIS A NE2  4  
ATOM 3772  H H    . HIS A 1 11 ? 1.193   0.835   15.054  1.00 0.00 ? 11 HIS A H    4  
ATOM 3773  H HA   . HIS A 1 11 ? -0.565  1.841   16.248  1.00 0.00 ? 11 HIS A HA   4  
ATOM 3774  H HB2  . HIS A 1 11 ? -0.213  3.986   14.131  1.00 0.00 ? 11 HIS A HB2  4  
ATOM 3775  H HB3  . HIS A 1 11 ? -0.937  4.197   15.725  1.00 0.00 ? 11 HIS A HB3  4  
ATOM 3776  H HD1  . HIS A 1 11 ? 2.395   3.334   14.117  1.00 0.00 ? 11 HIS A HD1  4  
ATOM 3777  H HD2  . HIS A 1 11 ? 0.900   4.667   17.772  1.00 0.00 ? 11 HIS A HD2  4  
ATOM 3778  H HE1  . HIS A 1 11 ? 4.406   3.920   15.541  1.00 0.00 ? 11 HIS A HE1  4  
ATOM 3779  N N    . THR A 1 12 ? -2.576  2.905   14.201  1.00 0.00 ? 12 THR A N    4  
ATOM 3780  C CA   . THR A 1 12 ? -3.882  2.697   13.516  1.00 0.00 ? 12 THR A CA   4  
ATOM 3781  C C    . THR A 1 12 ? -3.680  1.793   12.299  1.00 0.00 ? 12 THR A C    4  
ATOM 3782  O O    . THR A 1 12 ? -4.466  0.905   12.040  1.00 0.00 ? 12 THR A O    4  
ATOM 3783  C CB   . THR A 1 12 ? -4.441  4.048   13.062  1.00 0.00 ? 12 THR A CB   4  
ATOM 3784  O OG1  . THR A 1 12 ? -3.529  4.657   12.159  1.00 0.00 ? 12 THR A OG1  4  
ATOM 3785  C CG2  . THR A 1 12 ? -4.640  4.954   14.279  1.00 0.00 ? 12 THR A CG2  4  
ATOM 3786  H H    . THR A 1 12 ? -2.274  3.813   14.415  1.00 0.00 ? 12 THR A H    4  
ATOM 3787  H HA   . THR A 1 12 ? -4.576  2.232   14.200  1.00 0.00 ? 12 THR A HA   4  
ATOM 3788  H HB   . THR A 1 12 ? -5.391  3.899   12.572  1.00 0.00 ? 12 THR A HB   4  
ATOM 3789  H HG1  . THR A 1 12 ? -2.639  4.470   12.465  1.00 0.00 ? 12 THR A HG1  4  
ATOM 3790  H HG21 . THR A 1 12 ? -5.081  5.887   13.964  1.00 0.00 ? 12 THR A HG21 4  
ATOM 3791  H HG22 . THR A 1 12 ? -3.684  5.146   14.744  1.00 0.00 ? 12 THR A HG22 4  
ATOM 3792  H HG23 . THR A 1 12 ? -5.293  4.467   14.987  1.00 0.00 ? 12 THR A HG23 4  
ATOM 3793  N N    . THR A 1 13 ? -2.636  2.021   11.546  1.00 0.00 ? 13 THR A N    4  
ATOM 3794  C CA   . THR A 1 13 ? -2.376  1.184   10.337  1.00 0.00 ? 13 THR A CA   4  
ATOM 3795  C C    . THR A 1 13 ? -3.462  1.452   9.292   1.00 0.00 ? 13 THR A C    4  
ATOM 3796  O O    . THR A 1 13 ? -3.871  2.577   9.081   1.00 0.00 ? 13 THR A O    4  
ATOM 3797  C CB   . THR A 1 13 ? -2.369  -0.305  10.723  1.00 0.00 ? 13 THR A CB   4  
ATOM 3798  O OG1  . THR A 1 13 ? -1.785  -0.453  12.010  1.00 0.00 ? 13 THR A OG1  4  
ATOM 3799  C CG2  . THR A 1 13 ? -1.555  -1.105  9.701   1.00 0.00 ? 13 THR A CG2  4  
ATOM 3800  H H    . THR A 1 13 ? -2.024  2.753   11.771  1.00 0.00 ? 13 THR A H    4  
ATOM 3801  H HA   . THR A 1 13 ? -1.413  1.456   9.925   1.00 0.00 ? 13 THR A HA   4  
ATOM 3802  H HB   . THR A 1 13 ? -3.379  -0.684  10.743  1.00 0.00 ? 13 THR A HB   4  
ATOM 3803  H HG1  . THR A 1 13 ? -2.469  -0.756  12.613  1.00 0.00 ? 13 THR A HG1  4  
ATOM 3804  H HG21 . THR A 1 13 ? -1.784  -2.156  9.801   1.00 0.00 ? 13 THR A HG21 4  
ATOM 3805  H HG22 . THR A 1 13 ? -0.501  -0.947  9.876   1.00 0.00 ? 13 THR A HG22 4  
ATOM 3806  H HG23 . THR A 1 13 ? -1.807  -0.775  8.704   1.00 0.00 ? 13 THR A HG23 4  
ATOM 3807  N N    . THR A 1 14 ? -3.933  0.428   8.632   1.00 0.00 ? 14 THR A N    4  
ATOM 3808  C CA   . THR A 1 14 ? -4.990  0.633   7.602   1.00 0.00 ? 14 THR A CA   4  
ATOM 3809  C C    . THR A 1 14 ? -5.665  -0.703  7.283   1.00 0.00 ? 14 THR A C    4  
ATOM 3810  O O    . THR A 1 14 ? -5.130  -1.760  7.552   1.00 0.00 ? 14 THR A O    4  
ATOM 3811  C CB   . THR A 1 14 ? -4.358  1.201   6.329   1.00 0.00 ? 14 THR A CB   4  
ATOM 3812  O OG1  . THR A 1 14 ? -3.678  2.410   6.640   1.00 0.00 ? 14 THR A OG1  4  
ATOM 3813  C CG2  . THR A 1 14 ? -5.448  1.479   5.293   1.00 0.00 ? 14 THR A CG2  4  
ATOM 3814  H H    . THR A 1 14 ? -3.591  -0.472  8.813   1.00 0.00 ? 14 THR A H    4  
ATOM 3815  H HA   . THR A 1 14 ? -5.727  1.328   7.977   1.00 0.00 ? 14 THR A HA   4  
ATOM 3816  H HB   . THR A 1 14 ? -3.656  0.487   5.925   1.00 0.00 ? 14 THR A HB   4  
ATOM 3817  H HG1  . THR A 1 14 ? -4.057  2.766   7.446   1.00 0.00 ? 14 THR A HG1  4  
ATOM 3818  H HG21 . THR A 1 14 ? -5.046  2.093   4.502   1.00 0.00 ? 14 THR A HG21 4  
ATOM 3819  H HG22 . THR A 1 14 ? -6.271  1.994   5.766   1.00 0.00 ? 14 THR A HG22 4  
ATOM 3820  H HG23 . THR A 1 14 ? -5.800  0.544   4.881   1.00 0.00 ? 14 THR A HG23 4  
ATOM 3821  N N    . THR A 1 15 ? -6.839  -0.659  6.707   1.00 0.00 ? 15 THR A N    4  
ATOM 3822  C CA   . THR A 1 15 ? -7.568  -1.919  6.359   1.00 0.00 ? 15 THR A CA   4  
ATOM 3823  C C    . THR A 1 15 ? -7.433  -2.183  4.858   1.00 0.00 ? 15 THR A C    4  
ATOM 3824  O O    . THR A 1 15 ? -7.641  -1.303  4.046   1.00 0.00 ? 15 THR A O    4  
ATOM 3825  C CB   . THR A 1 15 ? -9.049  -1.760  6.712   1.00 0.00 ? 15 THR A CB   4  
ATOM 3826  O OG1  . THR A 1 15 ? -9.567  -0.606  6.065   1.00 0.00 ? 15 THR A OG1  4  
ATOM 3827  C CG2  . THR A 1 15 ? -9.203  -1.611  8.225   1.00 0.00 ? 15 THR A CG2  4  
ATOM 3828  H H    . THR A 1 15 ? -7.245  0.209   6.498   1.00 0.00 ? 15 THR A H    4  
ATOM 3829  H HA   . THR A 1 15 ? -7.156  -2.753  6.910   1.00 0.00 ? 15 THR A HA   4  
ATOM 3830  H HB   . THR A 1 15 ? -9.594  -2.631  6.383   1.00 0.00 ? 15 THR A HB   4  
ATOM 3831  H HG1  . THR A 1 15 ? -9.531  0.124   6.688   1.00 0.00 ? 15 THR A HG1  4  
ATOM 3832  H HG21 . THR A 1 15 ? -8.744  -2.456  8.718   1.00 0.00 ? 15 THR A HG21 4  
ATOM 3833  H HG22 . THR A 1 15 ? -10.252 -1.572  8.479   1.00 0.00 ? 15 THR A HG22 4  
ATOM 3834  H HG23 . THR A 1 15 ? -8.720  -0.700  8.548   1.00 0.00 ? 15 THR A HG23 4  
ATOM 3835  N N    . ARG A 1 16 ? -7.088  -3.392  4.485   1.00 0.00 ? 16 ARG A N    4  
ATOM 3836  C CA   . ARG A 1 16 ? -6.934  -3.738  3.039   1.00 0.00 ? 16 ARG A CA   4  
ATOM 3837  C C    . ARG A 1 16 ? -7.926  -4.853  2.690   1.00 0.00 ? 16 ARG A C    4  
ATOM 3838  O O    . ARG A 1 16 ? -8.430  -5.525  3.566   1.00 0.00 ? 16 ARG A O    4  
ATOM 3839  C CB   . ARG A 1 16 ? -5.499  -4.213  2.798   1.00 0.00 ? 16 ARG A CB   4  
ATOM 3840  C CG   . ARG A 1 16 ? -4.533  -3.310  3.567   1.00 0.00 ? 16 ARG A CG   4  
ATOM 3841  C CD   . ARG A 1 16 ? -3.092  -3.639  3.166   1.00 0.00 ? 16 ARG A CD   4  
ATOM 3842  N NE   . ARG A 1 16 ? -2.166  -2.650  3.785   1.00 0.00 ? 16 ARG A NE   4  
ATOM 3843  C CZ   . ARG A 1 16 ? -0.885  -2.894  3.833   1.00 0.00 ? 16 ARG A CZ   4  
ATOM 3844  N NH1  . ARG A 1 16 ? -0.414  -4.005  3.339   1.00 0.00 ? 16 ARG A NH1  4  
ATOM 3845  N NH2  . ARG A 1 16 ? -0.074  -2.025  4.374   1.00 0.00 ? 16 ARG A NH2  4  
ATOM 3846  H H    . ARG A 1 16 ? -6.927  -4.081  5.163   1.00 0.00 ? 16 ARG A H    4  
ATOM 3847  H HA   . ARG A 1 16 ? -7.137  -2.877  2.422   1.00 0.00 ? 16 ARG A HA   4  
ATOM 3848  H HB2  . ARG A 1 16 ? -5.392  -5.231  3.144   1.00 0.00 ? 16 ARG A HB2  4  
ATOM 3849  H HB3  . ARG A 1 16 ? -5.273  -4.161  1.744   1.00 0.00 ? 16 ARG A HB3  4  
ATOM 3850  H HG2  . ARG A 1 16 ? -4.745  -2.277  3.334   1.00 0.00 ? 16 ARG A HG2  4  
ATOM 3851  H HG3  . ARG A 1 16 ? -4.655  -3.473  4.627   1.00 0.00 ? 16 ARG A HG3  4  
ATOM 3852  H HD2  . ARG A 1 16 ? -2.841  -4.631  3.511   1.00 0.00 ? 16 ARG A HD2  4  
ATOM 3853  H HD3  . ARG A 1 16 ? -2.999  -3.597  2.091   1.00 0.00 ? 16 ARG A HD3  4  
ATOM 3854  H HE   . ARG A 1 16 ? -2.520  -1.813  4.156   1.00 0.00 ? 16 ARG A HE   4  
ATOM 3855  H HH11 . ARG A 1 16 ? -1.034  -4.670  2.924   1.00 0.00 ? 16 ARG A HH11 4  
ATOM 3856  H HH12 . ARG A 1 16 ? 0.568   -4.192  3.376   1.00 0.00 ? 16 ARG A HH12 4  
ATOM 3857  H HH21 . ARG A 1 16 ? -0.435  -1.173  4.753   1.00 0.00 ? 16 ARG A HH21 4  
ATOM 3858  H HH22 . ARG A 1 16 ? 0.907   -2.214  4.411   1.00 0.00 ? 16 ARG A HH22 4  
ATOM 3859  N N    . ARG A 1 17 ? -8.228  -5.029  1.423   1.00 0.00 ? 17 ARG A N    4  
ATOM 3860  C CA   . ARG A 1 17 ? -9.213  -6.084  1.004   1.00 0.00 ? 17 ARG A CA   4  
ATOM 3861  C C    . ARG A 1 17 ? -10.640 -5.530  1.158   1.00 0.00 ? 17 ARG A C    4  
ATOM 3862  O O    . ARG A 1 17 ? -11.603 -6.267  1.221   1.00 0.00 ? 17 ARG A O    4  
ATOM 3863  C CB   . ARG A 1 17 ? -9.041  -7.360  1.856   1.00 0.00 ? 17 ARG A CB   4  
ATOM 3864  C CG   . ARG A 1 17 ? -9.458  -8.595  1.047   1.00 0.00 ? 17 ARG A CG   4  
ATOM 3865  C CD   . ARG A 1 17 ? -9.568  -9.805  1.976   1.00 0.00 ? 17 ARG A CD   4  
ATOM 3866  N NE   . ARG A 1 17 ? -10.140 -10.958 1.225   1.00 0.00 ? 17 ARG A NE   4  
ATOM 3867  C CZ   . ARG A 1 17 ? -10.055 -12.163 1.717   1.00 0.00 ? 17 ARG A CZ   4  
ATOM 3868  N NH1  . ARG A 1 17 ? -9.465  -12.356 2.867   1.00 0.00 ? 17 ARG A NH1  4  
ATOM 3869  N NH2  . ARG A 1 17 ? -10.558 -13.174 1.063   1.00 0.00 ? 17 ARG A NH2  4  
ATOM 3870  H H    . ARG A 1 17 ? -7.820  -4.444  0.741   1.00 0.00 ? 17 ARG A H    4  
ATOM 3871  H HA   . ARG A 1 17 ? -9.041  -6.320  -0.038  1.00 0.00 ? 17 ARG A HA   4  
ATOM 3872  H HB2  . ARG A 1 17 ? -8.006  -7.458  2.148   1.00 0.00 ? 17 ARG A HB2  4  
ATOM 3873  H HB3  . ARG A 1 17 ? -9.657  -7.295  2.742   1.00 0.00 ? 17 ARG A HB3  4  
ATOM 3874  H HG2  . ARG A 1 17 ? -10.414 -8.411  0.578   1.00 0.00 ? 17 ARG A HG2  4  
ATOM 3875  H HG3  . ARG A 1 17 ? -8.717  -8.793  0.286   1.00 0.00 ? 17 ARG A HG3  4  
ATOM 3876  H HD2  . ARG A 1 17 ? -8.588  -10.067 2.344   1.00 0.00 ? 17 ARG A HD2  4  
ATOM 3877  H HD3  . ARG A 1 17 ? -10.212 -9.564  2.808   1.00 0.00 ? 17 ARG A HD3  4  
ATOM 3878  H HE   . ARG A 1 17 ? -10.582 -10.811 0.362   1.00 0.00 ? 17 ARG A HE   4  
ATOM 3879  H HH11 . ARG A 1 17 ? -9.080  -11.581 3.367   1.00 0.00 ? 17 ARG A HH11 4  
ATOM 3880  H HH12 . ARG A 1 17 ? -9.400  -13.279 3.246   1.00 0.00 ? 17 ARG A HH12 4  
ATOM 3881  H HH21 . ARG A 1 17 ? -11.009 -13.025 0.184   1.00 0.00 ? 17 ARG A HH21 4  
ATOM 3882  H HH22 . ARG A 1 17 ? -10.493 -14.097 1.442   1.00 0.00 ? 17 ARG A HH22 4  
ATOM 3883  N N    . SER A 1 18 ? -10.768 -4.230  1.191   1.00 0.00 ? 18 SER A N    4  
ATOM 3884  C CA   . SER A 1 18 ? -12.108 -3.572  1.310   1.00 0.00 ? 18 SER A CA   4  
ATOM 3885  C C    . SER A 1 18 ? -12.139 -2.481  0.236   1.00 0.00 ? 18 SER A C    4  
ATOM 3886  O O    . SER A 1 18 ? -13.156 -1.927  -0.124  1.00 0.00 ? 18 SER A O    4  
ATOM 3887  C CB   . SER A 1 18 ? -12.243 -2.970  2.711   1.00 0.00 ? 18 SER A CB   4  
ATOM 3888  O OG   . SER A 1 18 ? -11.610 -1.697  2.742   1.00 0.00 ? 18 SER A OG   4  
ATOM 3889  H H    . SER A 1 18 ? -9.968  -3.667  1.116   1.00 0.00 ? 18 SER A H    4  
ATOM 3890  H HA   . SER A 1 18 ? -12.898 -4.289  1.130   1.00 0.00 ? 18 SER A HA   4  
ATOM 3891  H HB2  . SER A 1 18 ? -13.283 -2.864  2.965   1.00 0.00 ? 18 SER A HB2  4  
ATOM 3892  H HB3  . SER A 1 18 ? -11.771 -3.631  3.428   1.00 0.00 ? 18 SER A HB3  4  
ATOM 3893  H HG   . SER A 1 18 ? -11.009 -1.681  3.492   1.00 0.00 ? 18 SER A HG   4  
ATOM 3894  N N    . CYS A 1 19 ? -10.981 -2.257  -0.300  1.00 0.00 ? 19 CYS A N    4  
ATOM 3895  C CA   . CYS A 1 19 ? -10.783 -1.288  -1.412  1.00 0.00 ? 19 CYS A CA   4  
ATOM 3896  C C    . CYS A 1 19 ? -9.597  -1.810  -2.219  1.00 0.00 ? 19 CYS A C    4  
ATOM 3897  O O    . CYS A 1 19 ? -8.886  -2.684  -1.765  1.00 0.00 ? 19 CYS A O    4  
ATOM 3898  C CB   . CYS A 1 19 ? -10.524 0.135   -0.854  1.00 0.00 ? 19 CYS A CB   4  
ATOM 3899  S SG   . CYS A 1 19 ? -11.990 1.180   -1.137  1.00 0.00 ? 19 CYS A SG   4  
ATOM 3900  H H    . CYS A 1 19 ? -10.252 -2.815  0.037   1.00 0.00 ? 19 CYS A H    4  
ATOM 3901  H HA   . CYS A 1 19 ? -11.664 -1.286  -2.041  1.00 0.00 ? 19 CYS A HA   4  
ATOM 3902  H HB2  . CYS A 1 19 ? -10.332 0.072   0.206   1.00 0.00 ? 19 CYS A HB2  4  
ATOM 3903  H HB3  . CYS A 1 19 ? -9.669  0.580   -1.344  1.00 0.00 ? 19 CYS A HB3  4  
ATOM 3904  N N    . SER A 1 20 ? -9.348  -1.307  -3.391  1.00 0.00 ? 20 SER A N    4  
ATOM 3905  C CA   . SER A 1 20 ? -8.183  -1.834  -4.142  1.00 0.00 ? 20 SER A CA   4  
ATOM 3906  C C    . SER A 1 20 ? -6.916  -1.417  -3.389  1.00 0.00 ? 20 SER A C    4  
ATOM 3907  O O    . SER A 1 20 ? -6.652  -0.245  -3.213  1.00 0.00 ? 20 SER A O    4  
ATOM 3908  C CB   . SER A 1 20 ? -8.197  -1.263  -5.576  1.00 0.00 ? 20 SER A CB   4  
ATOM 3909  O OG   . SER A 1 20 ? -9.299  -0.375  -5.708  1.00 0.00 ? 20 SER A OG   4  
ATOM 3910  H H    . SER A 1 20 ? -9.897  -0.589  -3.771  1.00 0.00 ? 20 SER A H    4  
ATOM 3911  H HA   . SER A 1 20 ? -8.238  -2.914  -4.174  1.00 0.00 ? 20 SER A HA   4  
ATOM 3912  H HB2  . SER A 1 20 ? -7.285  -0.723  -5.778  1.00 0.00 ? 20 SER A HB2  4  
ATOM 3913  H HB3  . SER A 1 20 ? -8.292  -2.073  -6.290  1.00 0.00 ? 20 SER A HB3  4  
ATOM 3914  H HG   . SER A 1 20 ? -9.910  -0.756  -6.345  1.00 0.00 ? 20 SER A HG   4  
ATOM 3915  N N    . LYS A 1 21 ? -6.133  -2.368  -2.944  1.00 0.00 ? 21 LYS A N    4  
ATOM 3916  C CA   . LYS A 1 21 ? -4.876  -2.031  -2.197  1.00 0.00 ? 21 LYS A CA   4  
ATOM 3917  C C    . LYS A 1 21 ? -3.744  -2.903  -2.724  1.00 0.00 ? 21 LYS A C    4  
ATOM 3918  O O    . LYS A 1 21 ? -3.744  -4.110  -2.584  1.00 0.00 ? 21 LYS A O    4  
ATOM 3919  C CB   . LYS A 1 21 ? -5.065  -2.255  -0.684  1.00 0.00 ? 21 LYS A CB   4  
ATOM 3920  C CG   . LYS A 1 21 ? -5.851  -1.073  -0.074  1.00 0.00 ? 21 LYS A CG   4  
ATOM 3921  C CD   . LYS A 1 21 ? -4.893  0.056   0.330   1.00 0.00 ? 21 LYS A CD   4  
ATOM 3922  C CE   . LYS A 1 21 ? -5.699  1.233   0.883   1.00 0.00 ? 21 LYS A CE   4  
ATOM 3923  N NZ   . LYS A 1 21 ? -6.596  0.752   1.972   1.00 0.00 ? 21 LYS A NZ   4  
ATOM 3924  H H    . LYS A 1 21 ? -6.373  -3.309  -3.106  1.00 0.00 ? 21 LYS A H    4  
ATOM 3925  H HA   . LYS A 1 21 ? -4.616  -0.996  -2.371  1.00 0.00 ? 21 LYS A HA   4  
ATOM 3926  H HB2  . LYS A 1 21 ? -5.609  -3.174  -0.515  1.00 0.00 ? 21 LYS A HB2  4  
ATOM 3927  H HB3  . LYS A 1 21 ? -4.097  -2.325  -0.208  1.00 0.00 ? 21 LYS A HB3  4  
ATOM 3928  H HG2  . LYS A 1 21 ? -6.564  -0.695  -0.793  1.00 0.00 ? 21 LYS A HG2  4  
ATOM 3929  H HG3  . LYS A 1 21 ? -6.380  -1.411  0.802   1.00 0.00 ? 21 LYS A HG3  4  
ATOM 3930  H HD2  . LYS A 1 21 ? -4.212  -0.302  1.087   1.00 0.00 ? 21 LYS A HD2  4  
ATOM 3931  H HD3  . LYS A 1 21 ? -4.332  0.383   -0.532  1.00 0.00 ? 21 LYS A HD3  4  
ATOM 3932  H HE2  . LYS A 1 21 ? -5.025  1.979   1.277   1.00 0.00 ? 21 LYS A HE2  4  
ATOM 3933  H HE3  . LYS A 1 21 ? -6.294  1.667   0.092   1.00 0.00 ? 21 LYS A HE3  4  
ATOM 3934  H HZ1  . LYS A 1 21 ? -6.100  0.036   2.540   1.00 0.00 ? 21 LYS A HZ1  4  
ATOM 3935  H HZ2  . LYS A 1 21 ? -7.450  0.329   1.557   1.00 0.00 ? 21 LYS A HZ2  4  
ATOM 3936  H HZ3  . LYS A 1 21 ? -6.866  1.552   2.579   1.00 0.00 ? 21 LYS A HZ3  4  
ATOM 3937  N N    . VAL A 1 22 ? -2.777  -2.272  -3.332  1.00 0.00 ? 22 VAL A N    4  
ATOM 3938  C CA   . VAL A 1 22 ? -1.606  -3.009  -3.894  1.00 0.00 ? 22 VAL A CA   4  
ATOM 3939  C C    . VAL A 1 22 ? -0.308  -2.403  -3.357  1.00 0.00 ? 22 VAL A C    4  
ATOM 3940  O O    . VAL A 1 22 ? -0.028  -1.240  -3.573  1.00 0.00 ? 22 VAL A O    4  
ATOM 3941  C CB   . VAL A 1 22 ? -1.659  -2.907  -5.417  1.00 0.00 ? 22 VAL A CB   4  
ATOM 3942  C CG1  . VAL A 1 22 ? -0.745  -3.965  -6.037  1.00 0.00 ? 22 VAL A CG1  4  
ATOM 3943  C CG2  . VAL A 1 22 ? -3.103  -3.146  -5.873  1.00 0.00 ? 22 VAL A CG2  4  
ATOM 3944  H H    . VAL A 1 22 ? -2.833  -1.295  -3.385  1.00 0.00 ? 22 VAL A H    4  
ATOM 3945  H HA   . VAL A 1 22 ? -1.653  -4.049  -3.607  1.00 0.00 ? 22 VAL A HA   4  
ATOM 3946  H HB   . VAL A 1 22 ? -1.338  -1.923  -5.727  1.00 0.00 ? 22 VAL A HB   4  
ATOM 3947  H HG11 . VAL A 1 22 ? -0.621  -3.763  -7.091  1.00 0.00 ? 22 VAL A HG11 4  
ATOM 3948  H HG12 . VAL A 1 22 ? -1.187  -4.943  -5.907  1.00 0.00 ? 22 VAL A HG12 4  
ATOM 3949  H HG13 . VAL A 1 22 ? 0.219   -3.939  -5.549  1.00 0.00 ? 22 VAL A HG13 4  
ATOM 3950  H HG21 . VAL A 1 22 ? -3.123  -3.318  -6.938  1.00 0.00 ? 22 VAL A HG21 4  
ATOM 3951  H HG22 . VAL A 1 22 ? -3.704  -2.280  -5.635  1.00 0.00 ? 22 VAL A HG22 4  
ATOM 3952  H HG23 . VAL A 1 22 ? -3.505  -4.010  -5.360  1.00 0.00 ? 22 VAL A HG23 4  
ATOM 3953  N N    . ILE A 1 23 ? 0.486   -3.179  -2.656  1.00 0.00 ? 23 ILE A N    4  
ATOM 3954  C CA   . ILE A 1 23 ? 1.773   -2.653  -2.097  1.00 0.00 ? 23 ILE A CA   4  
ATOM 3955  C C    . ILE A 1 23 ? 2.937   -3.481  -2.650  1.00 0.00 ? 23 ILE A C    4  
ATOM 3956  O O    . ILE A 1 23 ? 3.102   -4.638  -2.317  1.00 0.00 ? 23 ILE A O    4  
ATOM 3957  C CB   . ILE A 1 23 ? 1.749   -2.766  -0.565  1.00 0.00 ? 23 ILE A CB   4  
ATOM 3958  C CG1  . ILE A 1 23 ? 0.716   -1.783  0.018   1.00 0.00 ? 23 ILE A CG1  4  
ATOM 3959  C CG2  . ILE A 1 23 ? 3.132   -2.421  -0.005  1.00 0.00 ? 23 ILE A CG2  4  
ATOM 3960  C CD1  . ILE A 1 23 ? -0.727  -2.250  -0.261  1.00 0.00 ? 23 ILE A CD1  4  
ATOM 3961  H H    . ILE A 1 23 ? 0.233   -4.112  -2.489  1.00 0.00 ? 23 ILE A H    4  
ATOM 3962  H HA   . ILE A 1 23 ? 1.912   -1.617  -2.375  1.00 0.00 ? 23 ILE A HA   4  
ATOM 3963  H HB   . ILE A 1 23 ? 1.492   -3.776  -0.282  1.00 0.00 ? 23 ILE A HB   4  
ATOM 3964  H HG12 . ILE A 1 23 ? 0.863   -1.710  1.086   1.00 0.00 ? 23 ILE A HG12 4  
ATOM 3965  H HG13 . ILE A 1 23 ? 0.865   -0.809  -0.426  1.00 0.00 ? 23 ILE A HG13 4  
ATOM 3966  H HG21 . ILE A 1 23 ? 3.497   -1.523  -0.481  1.00 0.00 ? 23 ILE A HG21 4  
ATOM 3967  H HG22 . ILE A 1 23 ? 3.814   -3.236  -0.202  1.00 0.00 ? 23 ILE A HG22 4  
ATOM 3968  H HG23 . ILE A 1 23 ? 3.060   -2.261  1.061   1.00 0.00 ? 23 ILE A HG23 4  
ATOM 3969  H HD11 . ILE A 1 23 ? -0.737  -3.280  -0.591  1.00 0.00 ? 23 ILE A HD11 4  
ATOM 3970  H HD12 . ILE A 1 23 ? -1.163  -1.625  -1.025  1.00 0.00 ? 23 ILE A HD12 4  
ATOM 3971  H HD13 . ILE A 1 23 ? -1.310  -2.163  0.643   1.00 0.00 ? 23 ILE A HD13 4  
ATOM 3972  N N    . THR A 1 24 ? 3.749   -2.881  -3.484  1.00 0.00 ? 24 THR A N    4  
ATOM 3973  C CA   . THR A 1 24 ? 4.927   -3.593  -4.072  1.00 0.00 ? 24 THR A CA   4  
ATOM 3974  C C    . THR A 1 24 ? 6.195   -2.798  -3.754  1.00 0.00 ? 24 THR A C    4  
ATOM 3975  O O    . THR A 1 24 ? 6.405   -1.720  -4.274  1.00 0.00 ? 24 THR A O    4  
ATOM 3976  C CB   . THR A 1 24 ? 4.749   -3.699  -5.595  1.00 0.00 ? 24 THR A CB   4  
ATOM 3977  O OG1  . THR A 1 24 ? 5.895   -4.325  -6.155  1.00 0.00 ? 24 THR A OG1  4  
ATOM 3978  C CG2  . THR A 1 24 ? 4.576   -2.304  -6.217  1.00 0.00 ? 24 THR A CG2  4  
ATOM 3979  H H    . THR A 1 24 ? 3.586   -1.949  -3.714  1.00 0.00 ? 24 THR A H    4  
ATOM 3980  H HA   . THR A 1 24 ? 5.011   -4.582  -3.654  1.00 0.00 ? 24 THR A HA   4  
ATOM 3981  H HB   . THR A 1 24 ? 3.876   -4.296  -5.811  1.00 0.00 ? 24 THR A HB   4  
ATOM 3982  H HG1  . THR A 1 24 ? 6.673   -3.940  -5.746  1.00 0.00 ? 24 THR A HG1  4  
ATOM 3983  H HG21 . THR A 1 24 ? 4.007   -2.387  -7.132  1.00 0.00 ? 24 THR A HG21 4  
ATOM 3984  H HG22 . THR A 1 24 ? 5.547   -1.887  -6.440  1.00 0.00 ? 24 THR A HG22 4  
ATOM 3985  H HG23 . THR A 1 24 ? 4.054   -1.656  -5.529  1.00 0.00 ? 24 THR A HG23 4  
ATOM 3986  N N    . LYS A 1 25 ? 7.058   -3.329  -2.920  1.00 0.00 ? 25 LYS A N    4  
ATOM 3987  C CA   . LYS A 1 25 ? 8.330   -2.628  -2.584  1.00 0.00 ? 25 LYS A CA   4  
ATOM 3988  C C    . LYS A 1 25 ? 9.457   -3.571  -2.943  1.00 0.00 ? 25 LYS A C    4  
ATOM 3989  O O    . LYS A 1 25 ? 9.656   -4.571  -2.283  1.00 0.00 ? 25 LYS A O    4  
ATOM 3990  C CB   . LYS A 1 25 ? 8.375   -2.321  -1.085  1.00 0.00 ? 25 LYS A CB   4  
ATOM 3991  C CG   . LYS A 1 25 ? 7.069   -1.649  -0.656  1.00 0.00 ? 25 LYS A CG   4  
ATOM 3992  C CD   . LYS A 1 25 ? 7.163   -1.248  0.818   1.00 0.00 ? 25 LYS A CD   4  
ATOM 3993  C CE   . LYS A 1 25 ? 6.026   -0.284  1.162   1.00 0.00 ? 25 LYS A CE   4  
ATOM 3994  N NZ   . LYS A 1 25 ? 6.203   0.216   2.555   1.00 0.00 ? 25 LYS A NZ   4  
ATOM 3995  H H    . LYS A 1 25 ? 6.890   -4.218  -2.537  1.00 0.00 ? 25 LYS A H    4  
ATOM 3996  H HA   . LYS A 1 25 ? 8.429   -1.708  -3.152  1.00 0.00 ? 25 LYS A HA   4  
ATOM 3997  H HB2  . LYS A 1 25 ? 8.507   -3.240  -0.533  1.00 0.00 ? 25 LYS A HB2  4  
ATOM 3998  H HB3  . LYS A 1 25 ? 9.202   -1.657  -0.879  1.00 0.00 ? 25 LYS A HB3  4  
ATOM 3999  H HG2  . LYS A 1 25 ? 6.901   -0.769  -1.261  1.00 0.00 ? 25 LYS A HG2  4  
ATOM 4000  H HG3  . LYS A 1 25 ? 6.249   -2.339  -0.788  1.00 0.00 ? 25 LYS A HG3  4  
ATOM 4001  H HD2  . LYS A 1 25 ? 7.087   -2.130  1.436   1.00 0.00 ? 25 LYS A HD2  4  
ATOM 4002  H HD3  . LYS A 1 25 ? 8.110   -0.762  0.999   1.00 0.00 ? 25 LYS A HD3  4  
ATOM 4003  H HE2  . LYS A 1 25 ? 6.039   0.549   0.477   1.00 0.00 ? 25 LYS A HE2  4  
ATOM 4004  H HE3  . LYS A 1 25 ? 5.081   -0.800  1.084   1.00 0.00 ? 25 LYS A HE3  4  
ATOM 4005  H HZ1  . LYS A 1 25 ? 5.809   1.175   2.633   1.00 0.00 ? 25 LYS A HZ1  4  
ATOM 4006  H HZ2  . LYS A 1 25 ? 7.217   0.241   2.788   1.00 0.00 ? 25 LYS A HZ2  4  
ATOM 4007  H HZ3  . LYS A 1 25 ? 5.710   -0.419  3.216   1.00 0.00 ? 25 LYS A HZ3  4  
ATOM 4008  N N    . THR A 1 26 ? 10.192  -3.284  -3.978  1.00 0.00 ? 26 THR A N    4  
ATOM 4009  C CA   . THR A 1 26 ? 11.301  -4.195  -4.368  1.00 0.00 ? 26 THR A CA   4  
ATOM 4010  C C    . THR A 1 26 ? 12.630  -3.579  -3.926  1.00 0.00 ? 26 THR A C    4  
ATOM 4011  O O    . THR A 1 26 ? 12.992  -2.506  -4.369  1.00 0.00 ? 26 THR A O    4  
ATOM 4012  C CB   . THR A 1 26 ? 11.304  -4.364  -5.889  1.00 0.00 ? 26 THR A CB   4  
ATOM 4013  O OG1  . THR A 1 26 ? 10.035  -4.843  -6.313  1.00 0.00 ? 26 THR A OG1  4  
ATOM 4014  C CG2  . THR A 1 26 ? 12.389  -5.361  -6.294  1.00 0.00 ? 26 THR A CG2  4  
ATOM 4015  H H    . THR A 1 26 ? 10.011  -2.476  -4.502  1.00 0.00 ? 26 THR A H    4  
ATOM 4016  H HA   . THR A 1 26 ? 11.159  -5.162  -3.899  1.00 0.00 ? 26 THR A HA   4  
ATOM 4017  H HB   . THR A 1 26 ? 11.504  -3.412  -6.357  1.00 0.00 ? 26 THR A HB   4  
ATOM 4018  H HG1  . THR A 1 26 ? 9.417   -4.108  -6.287  1.00 0.00 ? 26 THR A HG1  4  
ATOM 4019  H HG21 . THR A 1 26 ? 12.223  -6.300  -5.787  1.00 0.00 ? 26 THR A HG21 4  
ATOM 4020  H HG22 . THR A 1 26 ? 13.357  -4.971  -6.018  1.00 0.00 ? 26 THR A HG22 4  
ATOM 4021  H HG23 . THR A 1 26 ? 12.355  -5.519  -7.361  1.00 0.00 ? 26 THR A HG23 4  
ATOM 4022  N N    . VAL A 1 27 ? 13.361  -4.233  -3.054  1.00 0.00 ? 27 VAL A N    4  
ATOM 4023  C CA   . VAL A 1 27 ? 14.667  -3.664  -2.582  1.00 0.00 ? 27 VAL A CA   4  
ATOM 4024  C C    . VAL A 1 27 ? 15.830  -4.433  -3.212  1.00 0.00 ? 27 VAL A C    4  
ATOM 4025  O O    . VAL A 1 27 ? 16.061  -5.589  -2.919  1.00 0.00 ? 27 VAL A O    4  
ATOM 4026  C CB   . VAL A 1 27 ? 14.752  -3.783  -1.059  1.00 0.00 ? 27 VAL A CB   4  
ATOM 4027  C CG1  . VAL A 1 27 ? 15.927  -2.945  -0.549  1.00 0.00 ? 27 VAL A CG1  4  
ATOM 4028  C CG2  . VAL A 1 27 ? 13.454  -3.268  -0.435  1.00 0.00 ? 27 VAL A CG2  4  
ATOM 4029  H H    . VAL A 1 27 ? 13.054  -5.093  -2.697  1.00 0.00 ? 27 VAL A H    4  
ATOM 4030  H HA   . VAL A 1 27 ? 14.741  -2.621  -2.858  1.00 0.00 ? 27 VAL A HA   4  
ATOM 4031  H HB   . VAL A 1 27 ? 14.903  -4.817  -0.785  1.00 0.00 ? 27 VAL A HB   4  
ATOM 4032  H HG11 . VAL A 1 27 ? 15.819  -1.927  -0.893  1.00 0.00 ? 27 VAL A HG11 4  
ATOM 4033  H HG12 . VAL A 1 27 ? 16.852  -3.356  -0.925  1.00 0.00 ? 27 VAL A HG12 4  
ATOM 4034  H HG13 . VAL A 1 27 ? 15.938  -2.961  0.531   1.00 0.00 ? 27 VAL A HG13 4  
ATOM 4035  H HG21 . VAL A 1 27 ? 13.558  -3.238  0.640   1.00 0.00 ? 27 VAL A HG21 4  
ATOM 4036  H HG22 . VAL A 1 27 ? 12.641  -3.928  -0.699  1.00 0.00 ? 27 VAL A HG22 4  
ATOM 4037  H HG23 . VAL A 1 27 ? 13.246  -2.275  -0.803  1.00 0.00 ? 27 VAL A HG23 4  
ATOM 4038  N N    . THR A 1 28 ? 16.570  -3.777  -4.069  1.00 0.00 ? 28 THR A N    4  
ATOM 4039  C CA   . THR A 1 28 ? 17.743  -4.434  -4.729  1.00 0.00 ? 28 THR A CA   4  
ATOM 4040  C C    . THR A 1 28 ? 19.039  -3.857  -4.158  1.00 0.00 ? 28 THR A C    4  
ATOM 4041  O O    . THR A 1 28 ? 19.429  -2.755  -4.489  1.00 0.00 ? 28 THR A O    4  
ATOM 4042  C CB   . THR A 1 28 ? 17.694  -4.158  -6.235  1.00 0.00 ? 28 THR A CB   4  
ATOM 4043  O OG1  . THR A 1 28 ? 17.483  -2.770  -6.453  1.00 0.00 ? 28 THR A OG1  4  
ATOM 4044  C CG2  . THR A 1 28 ? 16.552  -4.956  -6.867  1.00 0.00 ? 28 THR A CG2  4  
ATOM 4045  H H    . THR A 1 28 ? 16.342  -2.842  -4.256  1.00 0.00 ? 28 THR A H    4  
ATOM 4046  H HA   . THR A 1 28 ? 17.721  -5.502  -4.560  1.00 0.00 ? 28 THR A HA   4  
ATOM 4047  H HB   . THR A 1 28 ? 18.627  -4.456  -6.686  1.00 0.00 ? 28 THR A HB   4  
ATOM 4048  H HG1  . THR A 1 28 ? 16.562  -2.645  -6.695  1.00 0.00 ? 28 THR A HG1  4  
ATOM 4049  H HG21 . THR A 1 28 ? 16.610  -4.876  -7.942  1.00 0.00 ? 28 THR A HG21 4  
ATOM 4050  H HG22 . THR A 1 28 ? 15.607  -4.560  -6.527  1.00 0.00 ? 28 THR A HG22 4  
ATOM 4051  H HG23 . THR A 1 28 ? 16.634  -5.993  -6.578  1.00 0.00 ? 28 THR A HG23 4  
ATOM 4052  N N    . ASN A 1 29 ? 19.717  -4.586  -3.305  1.00 0.00 ? 29 ASN A N    4  
ATOM 4053  C CA   . ASN A 1 29 ? 20.994  -4.072  -2.719  1.00 0.00 ? 29 ASN A CA   4  
ATOM 4054  C C    . ASN A 1 29 ? 22.177  -4.662  -3.486  1.00 0.00 ? 29 ASN A C    4  
ATOM 4055  O O    . ASN A 1 29 ? 22.365  -5.865  -3.537  1.00 0.00 ? 29 ASN A O    4  
ATOM 4056  C CB   . ASN A 1 29 ? 21.085  -4.487  -1.251  1.00 0.00 ? 29 ASN A CB   4  
ATOM 4057  C CG   . ASN A 1 29 ? 22.343  -3.880  -0.626  1.00 0.00 ? 29 ASN A CG   4  
ATOM 4058  O OD1  . ASN A 1 29 ? 22.668  -4.163  0.510   1.00 0.00 ? 29 ASN A OD1  4  
ATOM 4059  N ND2  . ASN A 1 29 ? 23.068  -3.052  -1.325  1.00 0.00 ? 29 ASN A ND2  4  
ATOM 4060  H H    . ASN A 1 29 ? 19.392  -5.470  -3.035  1.00 0.00 ? 29 ASN A H    4  
ATOM 4061  H HA   . ASN A 1 29 ? 21.025  -2.992  -2.787  1.00 0.00 ? 29 ASN A HA   4  
ATOM 4062  H HB2  . ASN A 1 29 ? 20.212  -4.134  -0.721  1.00 0.00 ? 29 ASN A HB2  4  
ATOM 4063  H HB3  . ASN A 1 29 ? 21.136  -5.561  -1.186  1.00 0.00 ? 29 ASN A HB3  4  
ATOM 4064  H HD21 . ASN A 1 29 ? 22.807  -2.823  -2.241  1.00 0.00 ? 29 ASN A HD21 4  
ATOM 4065  H HD22 . ASN A 1 29 ? 23.876  -2.658  -0.933  1.00 0.00 ? 29 ASN A HD22 4  
ATOM 4066  N N    . ALA A 1 30 ? 22.966  -3.818  -4.091  1.00 0.00 ? 30 ALA A N    4  
ATOM 4067  C CA   . ALA A 1 30 ? 24.138  -4.293  -4.879  1.00 0.00 ? 30 ALA A CA   4  
ATOM 4068  C C    . ALA A 1 30 ? 24.951  -5.324  -4.090  1.00 0.00 ? 30 ALA A C    4  
ATOM 4069  O O    . ALA A 1 30 ? 25.801  -5.993  -4.641  1.00 0.00 ? 30 ALA A O    4  
ATOM 4070  C CB   . ALA A 1 30 ? 25.034  -3.100  -5.219  1.00 0.00 ? 30 ALA A CB   4  
ATOM 4071  H H    . ALA A 1 30 ? 22.784  -2.856  -4.042  1.00 0.00 ? 30 ALA A H    4  
ATOM 4072  H HA   . ALA A 1 30 ? 23.790  -4.743  -5.796  1.00 0.00 ? 30 ALA A HA   4  
ATOM 4073  H HB1  . ALA A 1 30 ? 24.461  -2.363  -5.762  1.00 0.00 ? 30 ALA A HB1  4  
ATOM 4074  H HB2  . ALA A 1 30 ? 25.861  -3.433  -5.828  1.00 0.00 ? 30 ALA A HB2  4  
ATOM 4075  H HB3  . ALA A 1 30 ? 25.412  -2.662  -4.308  1.00 0.00 ? 30 ALA A HB3  4  
ATOM 4076  N N    . ASP A 1 31 ? 24.719  -5.465  -2.813  1.00 0.00 ? 31 ASP A N    4  
ATOM 4077  C CA   . ASP A 1 31 ? 25.515  -6.457  -2.037  1.00 0.00 ? 31 ASP A CA   4  
ATOM 4078  C C    . ASP A 1 31 ? 25.081  -7.875  -2.426  1.00 0.00 ? 31 ASP A C    4  
ATOM 4079  O O    . ASP A 1 31 ? 25.688  -8.847  -2.023  1.00 0.00 ? 31 ASP A O    4  
ATOM 4080  C CB   . ASP A 1 31 ? 25.300  -6.235  -0.534  1.00 0.00 ? 31 ASP A CB   4  
ATOM 4081  C CG   . ASP A 1 31 ? 26.128  -5.035  -0.068  1.00 0.00 ? 31 ASP A CG   4  
ATOM 4082  O OD1  . ASP A 1 31 ? 27.339  -5.090  -0.196  1.00 0.00 ? 31 ASP A OD1  4  
ATOM 4083  O OD2  . ASP A 1 31 ? 25.534  -4.081  0.409   1.00 0.00 ? 31 ASP A OD2  4  
ATOM 4084  H H    . ASP A 1 31 ? 24.039  -4.924  -2.359  1.00 0.00 ? 31 ASP A H    4  
ATOM 4085  H HA   . ASP A 1 31 ? 26.563  -6.332  -2.272  1.00 0.00 ? 31 ASP A HA   4  
ATOM 4086  H HB2  . ASP A 1 31 ? 24.255  -6.044  -0.343  1.00 0.00 ? 31 ASP A HB2  4  
ATOM 4087  H HB3  . ASP A 1 31 ? 25.611  -7.115  0.010   1.00 0.00 ? 31 ASP A HB3  4  
ATOM 4088  N N    . GLY A 1 32 ? 24.045  -8.001  -3.223  1.00 0.00 ? 32 GLY A N    4  
ATOM 4089  C CA   . GLY A 1 32 ? 23.579  -9.357  -3.664  1.00 0.00 ? 32 GLY A CA   4  
ATOM 4090  C C    . GLY A 1 32 ? 22.309  -9.764  -2.911  1.00 0.00 ? 32 GLY A C    4  
ATOM 4091  O O    . GLY A 1 32 ? 21.845  -10.880 -3.033  1.00 0.00 ? 32 GLY A O    4  
ATOM 4092  H H    . GLY A 1 32 ? 23.576  -7.201  -3.542  1.00 0.00 ? 32 GLY A H    4  
ATOM 4093  H HA2  . GLY A 1 32 ? 23.367  -9.329  -4.723  1.00 0.00 ? 32 GLY A HA2  4  
ATOM 4094  H HA3  . GLY A 1 32 ? 24.350  -10.091 -3.478  1.00 0.00 ? 32 GLY A HA3  4  
ATOM 4095  N N    . ARG A 1 33 ? 21.736  -8.877  -2.139  1.00 0.00 ? 33 ARG A N    4  
ATOM 4096  C CA   . ARG A 1 33 ? 20.490  -9.230  -1.387  1.00 0.00 ? 33 ARG A CA   4  
ATOM 4097  C C    . ARG A 1 33 ? 19.274  -8.766  -2.185  1.00 0.00 ? 33 ARG A C    4  
ATOM 4098  O O    . ARG A 1 33 ? 19.354  -7.858  -2.988  1.00 0.00 ? 33 ARG A O    4  
ATOM 4099  C CB   . ARG A 1 33 ? 20.513  -8.543  -0.006  1.00 0.00 ? 33 ARG A CB   4  
ATOM 4100  C CG   . ARG A 1 33 ? 21.226  -9.448  1.013   1.00 0.00 ? 33 ARG A CG   4  
ATOM 4101  C CD   . ARG A 1 33 ? 21.812  -8.603  2.149   1.00 0.00 ? 33 ARG A CD   4  
ATOM 4102  N NE   . ARG A 1 33 ? 20.847  -7.530  2.520   1.00 0.00 ? 33 ARG A NE   4  
ATOM 4103  C CZ   . ARG A 1 33 ? 20.991  -6.883  3.645   1.00 0.00 ? 33 ARG A CZ   4  
ATOM 4104  N NH1  . ARG A 1 33 ? 21.980  -7.177  4.444   1.00 0.00 ? 33 ARG A NH1  4  
ATOM 4105  N NH2  . ARG A 1 33 ? 20.148  -5.941  3.970   1.00 0.00 ? 33 ARG A NH2  4  
ATOM 4106  H H    . ARG A 1 33 ? 22.119  -7.981  -2.053  1.00 0.00 ? 33 ARG A H    4  
ATOM 4107  H HA   . ARG A 1 33 ? 20.431  -10.304 -1.256  1.00 0.00 ? 33 ARG A HA   4  
ATOM 4108  H HB2  . ARG A 1 33 ? 21.039  -7.604  -0.089  1.00 0.00 ? 33 ARG A HB2  4  
ATOM 4109  H HB3  . ARG A 1 33 ? 19.502  -8.358  0.329   1.00 0.00 ? 33 ARG A HB3  4  
ATOM 4110  H HG2  . ARG A 1 33 ? 20.519  -10.155 1.421   1.00 0.00 ? 33 ARG A HG2  4  
ATOM 4111  H HG3  . ARG A 1 33 ? 22.021  -9.983  0.518   1.00 0.00 ? 33 ARG A HG3  4  
ATOM 4112  H HD2  . ARG A 1 33 ? 21.997  -9.232  3.007   1.00 0.00 ? 33 ARG A HD2  4  
ATOM 4113  H HD3  . ARG A 1 33 ? 22.739  -8.156  1.825   1.00 0.00 ? 33 ARG A HD3  4  
ATOM 4114  H HE   . ARG A 1 33 ? 20.104  -7.309  1.921   1.00 0.00 ? 33 ARG A HE   4  
ATOM 4115  H HH11 . ARG A 1 33 ? 22.626  -7.900  4.196   1.00 0.00 ? 33 ARG A HH11 4  
ATOM 4116  H HH12 . ARG A 1 33 ? 22.091  -6.682  5.306   1.00 0.00 ? 33 ARG A HH12 4  
ATOM 4117  H HH21 . ARG A 1 33 ? 19.391  -5.715  3.358   1.00 0.00 ? 33 ARG A HH21 4  
ATOM 4118  H HH22 . ARG A 1 33 ? 20.260  -5.445  4.831   1.00 0.00 ? 33 ARG A HH22 4  
ATOM 4119  N N    . THR A 1 34 ? 18.149  -9.386  -1.969  1.00 0.00 ? 34 THR A N    4  
ATOM 4120  C CA   . THR A 1 34 ? 16.923  -8.986  -2.720  1.00 0.00 ? 34 THR A CA   4  
ATOM 4121  C C    . THR A 1 34 ? 15.667  -9.405  -1.949  1.00 0.00 ? 34 THR A C    4  
ATOM 4122  O O    . THR A 1 34 ? 15.373  -10.576 -1.806  1.00 0.00 ? 34 THR A O    4  
ATOM 4123  C CB   . THR A 1 34 ? 16.915  -9.670  -4.093  1.00 0.00 ? 34 THR A CB   4  
ATOM 4124  O OG1  . THR A 1 34 ? 17.148  -11.061 -3.926  1.00 0.00 ? 34 THR A OG1  4  
ATOM 4125  C CG2  . THR A 1 34 ? 18.008  -9.075  -4.987  1.00 0.00 ? 34 THR A CG2  4  
ATOM 4126  H H    . THR A 1 34 ? 18.114  -10.117 -1.314  1.00 0.00 ? 34 THR A H    4  
ATOM 4127  H HA   . THR A 1 34 ? 16.915  -7.914  -2.852  1.00 0.00 ? 34 THR A HA   4  
ATOM 4128  H HB   . THR A 1 34 ? 15.955  -9.521  -4.562  1.00 0.00 ? 34 THR A HB   4  
ATOM 4129  H HG1  . THR A 1 34 ? 16.626  -11.529 -4.580  1.00 0.00 ? 34 THR A HG1  4  
ATOM 4130  H HG21 . THR A 1 34 ? 18.972  -9.452  -4.678  1.00 0.00 ? 34 THR A HG21 4  
ATOM 4131  H HG22 . THR A 1 34 ? 17.998  -7.999  -4.908  1.00 0.00 ? 34 THR A HG22 4  
ATOM 4132  H HG23 . THR A 1 34 ? 17.826  -9.360  -6.013  1.00 0.00 ? 34 THR A HG23 4  
ATOM 4133  N N    . GLU A 1 35 ? 14.913  -8.445  -1.477  1.00 0.00 ? 35 GLU A N    4  
ATOM 4134  C CA   . GLU A 1 35 ? 13.646  -8.740  -0.734  1.00 0.00 ? 35 GLU A CA   4  
ATOM 4135  C C    . GLU A 1 35 ? 12.491  -8.160  -1.552  1.00 0.00 ? 35 GLU A C    4  
ATOM 4136  O O    . GLU A 1 35 ? 12.627  -7.104  -2.138  1.00 0.00 ? 35 GLU A O    4  
ATOM 4137  C CB   . GLU A 1 35 ? 13.693  -8.066  0.642   1.00 0.00 ? 35 GLU A CB   4  
ATOM 4138  C CG   . GLU A 1 35 ? 15.023  -8.389  1.327   1.00 0.00 ? 35 GLU A CG   4  
ATOM 4139  C CD   . GLU A 1 35 ? 15.143  -9.901  1.525   1.00 0.00 ? 35 GLU A CD   4  
ATOM 4140  O OE1  . GLU A 1 35 ? 14.184  -10.494 1.992   1.00 0.00 ? 35 GLU A OE1  4  
ATOM 4141  O OE2  . GLU A 1 35 ? 16.190  -10.439 1.208   1.00 0.00 ? 35 GLU A OE2  4  
ATOM 4142  H H    . GLU A 1 35 ? 15.173  -7.512  -1.630  1.00 0.00 ? 35 GLU A H    4  
ATOM 4143  H HA   . GLU A 1 35 ? 13.513  -9.808  -0.618  1.00 0.00 ? 35 GLU A HA   4  
ATOM 4144  H HB2  . GLU A 1 35 ? 13.601  -6.997  0.521   1.00 0.00 ? 35 GLU A HB2  4  
ATOM 4145  H HB3  . GLU A 1 35 ? 12.881  -8.430  1.252   1.00 0.00 ? 35 GLU A HB3  4  
ATOM 4146  H HG2  . GLU A 1 35 ? 15.839  -8.039  0.711   1.00 0.00 ? 35 GLU A HG2  4  
ATOM 4147  H HG3  . GLU A 1 35 ? 15.061  -7.897  2.287   1.00 0.00 ? 35 GLU A HG3  4  
ATOM 4148  N N    . THR A 1 36 ? 11.358  -8.827  -1.614  1.00 0.00 ? 36 THR A N    4  
ATOM 4149  C CA   . THR A 1 36 ? 10.217  -8.294  -2.410  1.00 0.00 ? 36 THR A CA   4  
ATOM 4150  C C    . THR A 1 36 ? 8.959   -8.333  -1.559  1.00 0.00 ? 36 THR A C    4  
ATOM 4151  O O    . THR A 1 36 ? 8.429   -9.385  -1.260  1.00 0.00 ? 36 THR A O    4  
ATOM 4152  C CB   . THR A 1 36 ? 10.015  -9.166  -3.651  1.00 0.00 ? 36 THR A CB   4  
ATOM 4153  O OG1  . THR A 1 36 ? 9.563   -10.453 -3.256  1.00 0.00 ? 36 THR A OG1  4  
ATOM 4154  C CG2  . THR A 1 36 ? 11.338  -9.298  -4.407  1.00 0.00 ? 36 THR A CG2  4  
ATOM 4155  H H    . THR A 1 36 ? 11.248  -9.679  -1.142  1.00 0.00 ? 36 THR A H    4  
ATOM 4156  H HA   . THR A 1 36 ? 10.407  -7.274  -2.715  1.00 0.00 ? 36 THR A HA   4  
ATOM 4157  H HB   . THR A 1 36 ? 9.281   -8.709  -4.297  1.00 0.00 ? 36 THR A HB   4  
ATOM 4158  H HG1  . THR A 1 36 ? 9.121   -10.856 -4.007  1.00 0.00 ? 36 THR A HG1  4  
ATOM 4159  H HG21 . THR A 1 36 ? 11.209  -9.968  -5.245  1.00 0.00 ? 36 THR A HG21 4  
ATOM 4160  H HG22 . THR A 1 36 ? 12.094  -9.692  -3.745  1.00 0.00 ? 36 THR A HG22 4  
ATOM 4161  H HG23 . THR A 1 36 ? 11.645  -8.328  -4.767  1.00 0.00 ? 36 THR A HG23 4  
ATOM 4162  N N    . THR A 1 37 ? 8.448   -7.189  -1.208  1.00 0.00 ? 37 THR A N    4  
ATOM 4163  C CA   . THR A 1 37 ? 7.187   -7.142  -0.419  1.00 0.00 ? 37 THR A CA   4  
ATOM 4164  C C    . THR A 1 37 ? 6.075   -6.875  -1.417  1.00 0.00 ? 37 THR A C    4  
ATOM 4165  O O    . THR A 1 37 ? 5.967   -5.790  -1.944  1.00 0.00 ? 37 THR A O    4  
ATOM 4166  C CB   . THR A 1 37 ? 7.251   -6.004  0.605   1.00 0.00 ? 37 THR A CB   4  
ATOM 4167  O OG1  . THR A 1 37 ? 8.485   -6.070  1.306   1.00 0.00 ? 37 THR A OG1  4  
ATOM 4168  C CG2  . THR A 1 37 ? 6.092   -6.139  1.594   1.00 0.00 ? 37 THR A CG2  4  
ATOM 4169  H H    . THR A 1 37 ? 8.871   -6.352  -1.505  1.00 0.00 ? 37 THR A H    4  
ATOM 4170  H HA   . THR A 1 37 ? 7.010   -8.089  0.087   1.00 0.00 ? 37 THR A HA   4  
ATOM 4171  H HB   . THR A 1 37 ? 7.175   -5.056  0.097   1.00 0.00 ? 37 THR A HB   4  
ATOM 4172  H HG1  . THR A 1 37 ? 9.174   -5.738  0.726   1.00 0.00 ? 37 THR A HG1  4  
ATOM 4173  H HG21 . THR A 1 37 ? 5.157   -5.980  1.077   1.00 0.00 ? 37 THR A HG21 4  
ATOM 4174  H HG22 . THR A 1 37 ? 6.200   -5.404  2.378   1.00 0.00 ? 37 THR A HG22 4  
ATOM 4175  H HG23 . THR A 1 37 ? 6.101   -7.129  2.026   1.00 0.00 ? 37 THR A HG23 4  
ATOM 4176  N N    . LYS A 1 38 ? 5.254   -7.852  -1.689  1.00 0.00 ? 38 LYS A N    4  
ATOM 4177  C CA   . LYS A 1 38 ? 4.138   -7.665  -2.675  1.00 0.00 ? 38 LYS A CA   4  
ATOM 4178  C C    . LYS A 1 38 ? 2.802   -8.018  -2.019  1.00 0.00 ? 38 LYS A C    4  
ATOM 4179  O O    . LYS A 1 38 ? 2.119   -8.933  -2.436  1.00 0.00 ? 38 LYS A O    4  
ATOM 4180  C CB   . LYS A 1 38 ? 4.367   -8.588  -3.876  1.00 0.00 ? 38 LYS A CB   4  
ATOM 4181  C CG   . LYS A 1 38 ? 5.744   -8.305  -4.486  1.00 0.00 ? 38 LYS A CG   4  
ATOM 4182  C CD   . LYS A 1 38 ? 5.992   -9.235  -5.688  1.00 0.00 ? 38 LYS A CD   4  
ATOM 4183  C CE   . LYS A 1 38 ? 5.359   -8.646  -6.955  1.00 0.00 ? 38 LYS A CE   4  
ATOM 4184  N NZ   . LYS A 1 38 ? 5.922   -7.289  -7.208  1.00 0.00 ? 38 LYS A NZ   4  
ATOM 4185  H H    . LYS A 1 38 ? 5.350   -8.716  -1.242  1.00 0.00 ? 38 LYS A H    4  
ATOM 4186  H HA   . LYS A 1 38 ? 4.104   -6.641  -3.017  1.00 0.00 ? 38 LYS A HA   4  
ATOM 4187  H HB2  . LYS A 1 38 ? 4.320   -9.618  -3.550  1.00 0.00 ? 38 LYS A HB2  4  
ATOM 4188  H HB3  . LYS A 1 38 ? 3.601   -8.410  -4.615  1.00 0.00 ? 38 LYS A HB3  4  
ATOM 4189  H HG2  . LYS A 1 38 ? 5.788   -7.273  -4.806  1.00 0.00 ? 38 LYS A HG2  4  
ATOM 4190  H HG3  . LYS A 1 38 ? 6.504   -8.477  -3.740  1.00 0.00 ? 38 LYS A HG3  4  
ATOM 4191  H HD2  . LYS A 1 38 ? 7.057   -9.342  -5.841  1.00 0.00 ? 38 LYS A HD2  4  
ATOM 4192  H HD3  . LYS A 1 38 ? 5.562   -10.206 -5.492  1.00 0.00 ? 38 LYS A HD3  4  
ATOM 4193  H HE2  . LYS A 1 38 ? 5.577   -9.288  -7.796  1.00 0.00 ? 38 LYS A HE2  4  
ATOM 4194  H HE3  . LYS A 1 38 ? 4.290   -8.575  -6.827  1.00 0.00 ? 38 LYS A HE3  4  
ATOM 4195  H HZ1  . LYS A 1 38 ? 6.019   -7.139  -8.232  1.00 0.00 ? 38 LYS A HZ1  4  
ATOM 4196  H HZ2  . LYS A 1 38 ? 6.855   -7.212  -6.758  1.00 0.00 ? 38 LYS A HZ2  4  
ATOM 4197  H HZ3  . LYS A 1 38 ? 5.283   -6.570  -6.810  1.00 0.00 ? 38 LYS A HZ3  4  
ATOM 4198  N N    . GLU A 1 39 ? 2.415   -7.295  -1.007  1.00 0.00 ? 39 GLU A N    4  
ATOM 4199  C CA   . GLU A 1 39 ? 1.113   -7.583  -0.341  1.00 0.00 ? 39 GLU A CA   4  
ATOM 4200  C C    . GLU A 1 39 ? -0.019  -7.069  -1.240  1.00 0.00 ? 39 GLU A C    4  
ATOM 4201  O O    . GLU A 1 39 ? -0.498  -5.967  -1.066  1.00 0.00 ? 39 GLU A O    4  
ATOM 4202  C CB   . GLU A 1 39 ? 1.059   -6.860  1.007   1.00 0.00 ? 39 GLU A CB   4  
ATOM 4203  C CG   . GLU A 1 39 ? 2.171   -7.390  1.914   1.00 0.00 ? 39 GLU A CG   4  
ATOM 4204  C CD   . GLU A 1 39 ? 1.887   -8.850  2.271   1.00 0.00 ? 39 GLU A CD   4  
ATOM 4205  O OE1  . GLU A 1 39 ? 2.325   -9.716  1.530   1.00 0.00 ? 39 GLU A OE1  4  
ATOM 4206  O OE2  . GLU A 1 39 ? 1.238   -9.079  3.277   1.00 0.00 ? 39 GLU A OE2  4  
ATOM 4207  H H    . GLU A 1 39 ? 2.972   -6.552  -0.692  1.00 0.00 ? 39 GLU A H    4  
ATOM 4208  H HA   . GLU A 1 39 ? 1.013   -8.648  -0.183  1.00 0.00 ? 39 GLU A HA   4  
ATOM 4209  H HB2  . GLU A 1 39 ? 1.193   -5.800  0.852   1.00 0.00 ? 39 GLU A HB2  4  
ATOM 4210  H HB3  . GLU A 1 39 ? 0.101   -7.037  1.472   1.00 0.00 ? 39 GLU A HB3  4  
ATOM 4211  H HG2  . GLU A 1 39 ? 3.119   -7.320  1.400   1.00 0.00 ? 39 GLU A HG2  4  
ATOM 4212  H HG3  . GLU A 1 39 ? 2.208   -6.801  2.819   1.00 0.00 ? 39 GLU A HG3  4  
ATOM 4213  N N    . VAL A 1 40 ? -0.450  -7.850  -2.209  1.00 0.00 ? 40 VAL A N    4  
ATOM 4214  C CA   . VAL A 1 40 ? -1.543  -7.389  -3.123  1.00 0.00 ? 40 VAL A CA   4  
ATOM 4215  C C    . VAL A 1 40 ? -2.879  -8.013  -2.700  1.00 0.00 ? 40 VAL A C    4  
ATOM 4216  O O    . VAL A 1 40 ? -3.045  -9.216  -2.713  1.00 0.00 ? 40 VAL A O    4  
ATOM 4217  C CB   . VAL A 1 40 ? -1.207  -7.806  -4.559  1.00 0.00 ? 40 VAL A CB   4  
ATOM 4218  C CG1  . VAL A 1 40 ? 0.187   -7.283  -4.920  1.00 0.00 ? 40 VAL A CG1  4  
ATOM 4219  C CG2  . VAL A 1 40 ? -1.234  -9.340  -4.686  1.00 0.00 ? 40 VAL A CG2  4  
ATOM 4220  H H    . VAL A 1 40 ? -0.053  -8.737  -2.340  1.00 0.00 ? 40 VAL A H    4  
ATOM 4221  H HA   . VAL A 1 40 ? -1.625  -6.313  -3.082  1.00 0.00 ? 40 VAL A HA   4  
ATOM 4222  H HB   . VAL A 1 40 ? -1.933  -7.376  -5.235  1.00 0.00 ? 40 VAL A HB   4  
ATOM 4223  H HG11 . VAL A 1 40 ? 0.335   -7.357  -5.987  1.00 0.00 ? 40 VAL A HG11 4  
ATOM 4224  H HG12 . VAL A 1 40 ? 0.935   -7.872  -4.411  1.00 0.00 ? 40 VAL A HG12 4  
ATOM 4225  H HG13 . VAL A 1 40 ? 0.274   -6.250  -4.615  1.00 0.00 ? 40 VAL A HG13 4  
ATOM 4226  H HG21 . VAL A 1 40 ? -0.852  -9.788  -3.780  1.00 0.00 ? 40 VAL A HG21 4  
ATOM 4227  H HG22 . VAL A 1 40 ? -0.620  -9.648  -5.523  1.00 0.00 ? 40 VAL A HG22 4  
ATOM 4228  H HG23 . VAL A 1 40 ? -2.248  -9.670  -4.853  1.00 0.00 ? 40 VAL A HG23 4  
ATOM 4229  N N    . VAL A 1 41 ? -3.844  -7.193  -2.352  1.00 0.00 ? 41 VAL A N    4  
ATOM 4230  C CA   . VAL A 1 41 ? -5.191  -7.720  -1.962  1.00 0.00 ? 41 VAL A CA   4  
ATOM 4231  C C    . VAL A 1 41 ? -6.272  -6.872  -2.638  1.00 0.00 ? 41 VAL A C    4  
ATOM 4232  O O    . VAL A 1 41 ? -6.452  -5.711  -2.321  1.00 0.00 ? 41 VAL A O    4  
ATOM 4233  C CB   . VAL A 1 41 ? -5.361  -7.669  -0.434  1.00 0.00 ? 41 VAL A CB   4  
ATOM 4234  C CG1  . VAL A 1 41 ? -4.617  -8.843  0.205   1.00 0.00 ? 41 VAL A CG1  4  
ATOM 4235  C CG2  . VAL A 1 41 ? -4.795  -6.360  0.126   1.00 0.00 ? 41 VAL A CG2  4  
ATOM 4236  H H    . VAL A 1 41 ? -3.688  -6.226  -2.388  1.00 0.00 ? 41 VAL A H    4  
ATOM 4237  H HA   . VAL A 1 41 ? -5.295  -8.744  -2.299  1.00 0.00 ? 41 VAL A HA   4  
ATOM 4238  H HB   . VAL A 1 41 ? -6.412  -7.740  -0.189  1.00 0.00 ? 41 VAL A HB   4  
ATOM 4239  H HG11 . VAL A 1 41 ? -3.588  -8.839  -0.122  1.00 0.00 ? 41 VAL A HG11 4  
ATOM 4240  H HG12 . VAL A 1 41 ? -5.085  -9.771  -0.094  1.00 0.00 ? 41 VAL A HG12 4  
ATOM 4241  H HG13 . VAL A 1 41 ? -4.655  -8.751  1.280   1.00 0.00 ? 41 VAL A HG13 4  
ATOM 4242  H HG21 . VAL A 1 41 ? -5.369  -5.526  -0.249  1.00 0.00 ? 41 VAL A HG21 4  
ATOM 4243  H HG22 . VAL A 1 41 ? -3.763  -6.252  -0.170  1.00 0.00 ? 41 VAL A HG22 4  
ATOM 4244  H HG23 . VAL A 1 41 ? -4.855  -6.381  1.203   1.00 0.00 ? 41 VAL A HG23 4  
ATOM 4245  N N    . LYS A 1 42 ? -6.988  -7.439  -3.580  1.00 0.00 ? 42 LYS A N    4  
ATOM 4246  C CA   . LYS A 1 42 ? -8.058  -6.673  -4.295  1.00 0.00 ? 42 LYS A CA   4  
ATOM 4247  C C    . LYS A 1 42 ? -9.429  -7.197  -3.871  1.00 0.00 ? 42 LYS A C    4  
ATOM 4248  O O    . LYS A 1 42 ? -9.771  -8.338  -4.110  1.00 0.00 ? 42 LYS A O    4  
ATOM 4249  C CB   . LYS A 1 42 ? -7.888  -6.860  -5.804  1.00 0.00 ? 42 LYS A CB   4  
ATOM 4250  C CG   . LYS A 1 42 ? -6.694  -6.033  -6.285  1.00 0.00 ? 42 LYS A CG   4  
ATOM 4251  C CD   . LYS A 1 42 ? -6.342  -6.430  -7.721  1.00 0.00 ? 42 LYS A CD   4  
ATOM 4252  C CE   . LYS A 1 42 ? -5.099  -5.662  -8.173  1.00 0.00 ? 42 LYS A CE   4  
ATOM 4253  N NZ   . LYS A 1 42 ? -5.374  -4.198  -8.122  1.00 0.00 ? 42 LYS A NZ   4  
ATOM 4254  H H    . LYS A 1 42 ? -6.808  -8.368  -3.834  1.00 0.00 ? 42 LYS A H    4  
ATOM 4255  H HA   . LYS A 1 42 ? -7.991  -5.620  -4.057  1.00 0.00 ? 42 LYS A HA   4  
ATOM 4256  H HB2  . LYS A 1 42 ? -7.714  -7.904  -6.020  1.00 0.00 ? 42 LYS A HB2  4  
ATOM 4257  H HB3  . LYS A 1 42 ? -8.781  -6.529  -6.312  1.00 0.00 ? 42 LYS A HB3  4  
ATOM 4258  H HG2  . LYS A 1 42 ? -6.947  -4.983  -6.253  1.00 0.00 ? 42 LYS A HG2  4  
ATOM 4259  H HG3  . LYS A 1 42 ? -5.846  -6.218  -5.644  1.00 0.00 ? 42 LYS A HG3  4  
ATOM 4260  H HD2  . LYS A 1 42 ? -6.146  -7.492  -7.762  1.00 0.00 ? 42 LYS A HD2  4  
ATOM 4261  H HD3  . LYS A 1 42 ? -7.168  -6.191  -8.373  1.00 0.00 ? 42 LYS A HD3  4  
ATOM 4262  H HE2  . LYS A 1 42 ? -4.273  -5.897  -7.519  1.00 0.00 ? 42 LYS A HE2  4  
ATOM 4263  H HE3  . LYS A 1 42 ? -4.848  -5.946  -9.185  1.00 0.00 ? 42 LYS A HE3  4  
ATOM 4264  H HZ1  . LYS A 1 42 ? -6.316  -4.007  -8.520  1.00 0.00 ? 42 LYS A HZ1  4  
ATOM 4265  H HZ2  . LYS A 1 42 ? -4.657  -3.691  -8.678  1.00 0.00 ? 42 LYS A HZ2  4  
ATOM 4266  H HZ3  . LYS A 1 42 ? -5.342  -3.875  -7.134  1.00 0.00 ? 42 LYS A HZ3  4  
ATOM 4267  N N    . SER A 1 43 ? -10.217 -6.372  -3.240  1.00 0.00 ? 43 SER A N    4  
ATOM 4268  C CA   . SER A 1 43 ? -11.566 -6.818  -2.796  1.00 0.00 ? 43 SER A CA   4  
ATOM 4269  C C    . SER A 1 43 ? -12.438 -7.115  -4.016  1.00 0.00 ? 43 SER A C    4  
ATOM 4270  O O    . SER A 1 43 ? -12.068 -6.844  -5.141  1.00 0.00 ? 43 SER A O    4  
ATOM 4271  C CB   . SER A 1 43 ? -12.215 -5.713  -1.961  1.00 0.00 ? 43 SER A CB   4  
ATOM 4272  O OG   . SER A 1 43 ? -13.284 -6.264  -1.202  1.00 0.00 ? 43 SER A OG   4  
ATOM 4273  H H    . SER A 1 43 ? -9.920  -5.457  -3.052  1.00 0.00 ? 43 SER A H    4  
ATOM 4274  H HA   . SER A 1 43 ? -11.470 -7.712  -2.197  1.00 0.00 ? 43 SER A HA   4  
ATOM 4275  H HB2  . SER A 1 43 ? -11.486 -5.291  -1.291  1.00 0.00 ? 43 SER A HB2  4  
ATOM 4276  H HB3  . SER A 1 43 ? -12.588 -4.936  -2.615  1.00 0.00 ? 43 SER A HB3  4  
ATOM 4277  H HG   . SER A 1 43 ? -14.083 -5.781  -1.421  1.00 0.00 ? 43 SER A HG   4  
ATOM 4278  N N    . GLU A 1 44 ? -13.603 -7.663  -3.797  1.00 0.00 ? 44 GLU A N    4  
ATOM 4279  C CA   . GLU A 1 44 ? -14.521 -7.977  -4.937  1.00 0.00 ? 44 GLU A CA   4  
ATOM 4280  C C    . GLU A 1 44 ? -15.965 -7.794  -4.467  1.00 0.00 ? 44 GLU A C    4  
ATOM 4281  O O    . GLU A 1 44 ? -16.268 -7.947  -3.300  1.00 0.00 ? 44 GLU A O    4  
ATOM 4282  C CB   . GLU A 1 44 ? -14.297 -9.427  -5.408  1.00 0.00 ? 44 GLU A CB   4  
ATOM 4283  C CG   . GLU A 1 44 ? -14.756 -9.578  -6.863  1.00 0.00 ? 44 GLU A CG   4  
ATOM 4284  C CD   . GLU A 1 44 ? -13.779 -8.847  -7.786  1.00 0.00 ? 44 GLU A CD   4  
ATOM 4285  O OE1  . GLU A 1 44 ? -12.755 -8.401  -7.297  1.00 0.00 ? 44 GLU A OE1  4  
ATOM 4286  O OE2  . GLU A 1 44 ? -14.073 -8.748  -8.966  1.00 0.00 ? 44 GLU A OE2  4  
ATOM 4287  H H    . GLU A 1 44 ? -13.879 -7.866  -2.878  1.00 0.00 ? 44 GLU A H    4  
ATOM 4288  H HA   . GLU A 1 44 ? -14.327 -7.294  -5.755  1.00 0.00 ? 44 GLU A HA   4  
ATOM 4289  H HB2  . GLU A 1 44 ? -13.246 -9.666  -5.339  1.00 0.00 ? 44 GLU A HB2  4  
ATOM 4290  H HB3  . GLU A 1 44 ? -14.861 -10.109 -4.787  1.00 0.00 ? 44 GLU A HB3  4  
ATOM 4291  H HG2  . GLU A 1 44 ? -14.785 -10.625 -7.124  1.00 0.00 ? 44 GLU A HG2  4  
ATOM 4292  H HG3  . GLU A 1 44 ? -15.742 -9.151  -6.975  1.00 0.00 ? 44 GLU A HG3  4  
ATOM 4293  N N    . ASP A 1 45 ? -16.858 -7.470  -5.363  1.00 0.00 ? 45 ASP A N    4  
ATOM 4294  C CA   . ASP A 1 45 ? -18.283 -7.277  -4.964  1.00 0.00 ? 45 ASP A CA   4  
ATOM 4295  C C    . ASP A 1 45 ? -18.351 -6.425  -3.692  1.00 0.00 ? 45 ASP A C    4  
ATOM 4296  O O    . ASP A 1 45 ? -19.236 -6.583  -2.874  1.00 0.00 ? 45 ASP A O    4  
ATOM 4297  C CB   . ASP A 1 45 ? -18.927 -8.640  -4.700  1.00 0.00 ? 45 ASP A CB   4  
ATOM 4298  C CG   . ASP A 1 45 ? -18.807 -9.512  -5.951  1.00 0.00 ? 45 ASP A CG   4  
ATOM 4299  O OD1  . ASP A 1 45 ? -19.506 -9.236  -6.911  1.00 0.00 ? 45 ASP A OD1  4  
ATOM 4300  O OD2  . ASP A 1 45 ? -18.017 -10.442 -5.926  1.00 0.00 ? 45 ASP A OD2  4  
ATOM 4301  H H    . ASP A 1 45 ? -16.592 -7.359  -6.300  1.00 0.00 ? 45 ASP A H    4  
ATOM 4302  H HA   . ASP A 1 45 ? -18.814 -6.777  -5.761  1.00 0.00 ? 45 ASP A HA   4  
ATOM 4303  H HB2  . ASP A 1 45 ? -18.422 -9.121  -3.874  1.00 0.00 ? 45 ASP A HB2  4  
ATOM 4304  H HB3  . ASP A 1 45 ? -19.970 -8.505  -4.456  1.00 0.00 ? 45 ASP A HB3  4  
ATOM 4305  N N    . GLY A 1 46 ? -17.418 -5.525  -3.514  1.00 0.00 ? 46 GLY A N    4  
ATOM 4306  C CA   . GLY A 1 46 ? -17.430 -4.671  -2.291  1.00 0.00 ? 46 GLY A CA   4  
ATOM 4307  C C    . GLY A 1 46 ? -16.547 -3.438  -2.511  1.00 0.00 ? 46 GLY A C    4  
ATOM 4308  O O    . GLY A 1 46 ? -15.911 -3.291  -3.536  1.00 0.00 ? 46 GLY A O    4  
ATOM 4309  H H    . GLY A 1 46 ? -16.711 -5.413  -4.183  1.00 0.00 ? 46 GLY A H    4  
ATOM 4310  H HA2  . GLY A 1 46 ? -18.443 -4.356  -2.083  1.00 0.00 ? 46 GLY A HA2  4  
ATOM 4311  H HA3  . GLY A 1 46 ? -17.050 -5.236  -1.454  1.00 0.00 ? 46 GLY A HA3  4  
ATOM 4312  N N    . SER A 1 47 ? -16.510 -2.548  -1.555  1.00 0.00 ? 47 SER A N    4  
ATOM 4313  C CA   . SER A 1 47 ? -15.677 -1.320  -1.701  1.00 0.00 ? 47 SER A CA   4  
ATOM 4314  C C    . SER A 1 47 ? -15.444 -0.709  -0.312  1.00 0.00 ? 47 SER A C    4  
ATOM 4315  O O    . SER A 1 47 ? -16.010 -1.155  0.666   1.00 0.00 ? 47 SER A O    4  
ATOM 4316  C CB   . SER A 1 47 ? -16.421 -0.321  -2.595  1.00 0.00 ? 47 SER A CB   4  
ATOM 4317  O OG   . SER A 1 47 ? -17.772 -0.226  -2.166  1.00 0.00 ? 47 SER A OG   4  
ATOM 4318  H H    . SER A 1 47 ? -17.035 -2.685  -0.739  1.00 0.00 ? 47 SER A H    4  
ATOM 4319  H HA   . SER A 1 47 ? -14.728 -1.574  -2.150  1.00 0.00 ? 47 SER A HA   4  
ATOM 4320  H HB2  . SER A 1 47 ? -15.959 0.648   -2.528  1.00 0.00 ? 47 SER A HB2  4  
ATOM 4321  H HB3  . SER A 1 47 ? -16.382 -0.664  -3.621  1.00 0.00 ? 47 SER A HB3  4  
ATOM 4322  H HG   . SER A 1 47 ? -18.168 -1.098  -2.236  1.00 0.00 ? 47 SER A HG   4  
ATOM 4323  N N    . ASP A 1 48 ? -14.634 0.316   -0.209  1.00 0.00 ? 48 ASP A N    4  
ATOM 4324  C CA   . ASP A 1 48 ? -14.395 0.951   1.122   1.00 0.00 ? 48 ASP A CA   4  
ATOM 4325  C C    . ASP A 1 48 ? -13.945 2.385   0.880   1.00 0.00 ? 48 ASP A C    4  
ATOM 4326  O O    . ASP A 1 48 ? -13.507 3.088   1.770   1.00 0.00 ? 48 ASP A O    4  
ATOM 4327  C CB   . ASP A 1 48 ? -13.318 0.183   1.877   1.00 0.00 ? 48 ASP A CB   4  
ATOM 4328  C CG   . ASP A 1 48 ? -13.182 0.748   3.290   1.00 0.00 ? 48 ASP A CG   4  
ATOM 4329  O OD1  . ASP A 1 48 ? -14.062 0.492   4.096   1.00 0.00 ? 48 ASP A OD1  4  
ATOM 4330  O OD2  . ASP A 1 48 ? -12.202 1.428   3.544   1.00 0.00 ? 48 ASP A OD2  4  
ATOM 4331  H H    . ASP A 1 48 ? -14.192 0.696   -1.002  1.00 0.00 ? 48 ASP A H    4  
ATOM 4332  H HA   . ASP A 1 48 ? -15.313 0.951   1.693   1.00 0.00 ? 48 ASP A HA   4  
ATOM 4333  H HB2  . ASP A 1 48 ? -13.602 -0.853  1.926   1.00 0.00 ? 48 ASP A HB2  4  
ATOM 4334  H HB3  . ASP A 1 48 ? -12.375 0.277   1.360   1.00 0.00 ? 48 ASP A HB3  4  
ATOM 4335  N N    . CYS A 1 49 ? -14.074 2.809   -0.340  1.00 0.00 ? 49 CYS A N    4  
ATOM 4336  C CA   . CYS A 1 49 ? -13.698 4.188   -0.748  1.00 0.00 ? 49 CYS A CA   4  
ATOM 4337  C C    . CYS A 1 49 ? -15.010 4.856   -1.197  1.00 0.00 ? 49 CYS A C    4  
ATOM 4338  O O    . CYS A 1 49 ? -15.940 4.150   -1.532  1.00 0.00 ? 49 CYS A O    4  
ATOM 4339  C CB   . CYS A 1 49 ? -12.684 4.053   -1.903  1.00 0.00 ? 49 CYS A CB   4  
ATOM 4340  S SG   . CYS A 1 49 ? -11.269 3.059   -1.337  1.00 0.00 ? 49 CYS A SG   4  
ATOM 4341  H H    . CYS A 1 49 ? -14.442 2.201   -1.015  1.00 0.00 ? 49 CYS A H    4  
ATOM 4342  H HA   . CYS A 1 49 ? -13.261 4.731   0.081   1.00 0.00 ? 49 CYS A HA   4  
ATOM 4343  H HB2  . CYS A 1 49 ? -13.159 3.557   -2.737  1.00 0.00 ? 49 CYS A HB2  4  
ATOM 4344  H HB3  . CYS A 1 49 ? -12.330 5.020   -2.218  1.00 0.00 ? 49 CYS A HB3  4  
ATOM 4345  N N    . GLY A 1 50 ? -15.132 6.178   -1.181  1.00 0.00 ? 50 GLY A N    4  
ATOM 4346  C CA   . GLY A 1 50 ? -16.432 6.835   -1.591  1.00 0.00 ? 50 GLY A CA   4  
ATOM 4347  C C    . GLY A 1 50 ? -17.195 5.987   -2.627  1.00 0.00 ? 50 GLY A C    4  
ATOM 4348  O O    . GLY A 1 50 ? -18.207 5.395   -2.312  1.00 0.00 ? 50 GLY A O    4  
ATOM 4349  H H    . GLY A 1 50 ? -14.389 6.753   -0.888  1.00 0.00 ? 50 GLY A H    4  
ATOM 4350  H HA2  . GLY A 1 50 ? -17.055 6.951   -0.714  1.00 0.00 ? 50 GLY A HA2  4  
ATOM 4351  H HA3  . GLY A 1 50 ? -16.232 7.815   -2.005  1.00 0.00 ? 50 GLY A HA3  4  
ATOM 4352  N N    . ASP A 1 51 ? -16.735 5.912   -3.853  1.00 0.00 ? 51 ASP A N    4  
ATOM 4353  C CA   . ASP A 1 51 ? -17.471 5.091   -4.857  1.00 0.00 ? 51 ASP A CA   4  
ATOM 4354  C C    . ASP A 1 51 ? -16.548 4.735   -6.025  1.00 0.00 ? 51 ASP A C    4  
ATOM 4355  O O    . ASP A 1 51 ? -16.720 5.212   -7.128  1.00 0.00 ? 51 ASP A O    4  
ATOM 4356  C CB   . ASP A 1 51 ? -18.669 5.885   -5.384  1.00 0.00 ? 51 ASP A CB   4  
ATOM 4357  C CG   . ASP A 1 51 ? -19.535 4.982   -6.264  1.00 0.00 ? 51 ASP A CG   4  
ATOM 4358  O OD1  . ASP A 1 51 ? -19.759 3.847   -5.877  1.00 0.00 ? 51 ASP A OD1  4  
ATOM 4359  O OD2  . ASP A 1 51 ? -19.963 5.442   -7.311  1.00 0.00 ? 51 ASP A OD2  4  
ATOM 4360  H H    . ASP A 1 51 ? -15.922 6.393   -4.113  1.00 0.00 ? 51 ASP A H    4  
ATOM 4361  H HA   . ASP A 1 51 ? -17.823 4.182   -4.391  1.00 0.00 ? 51 ASP A HA   4  
ATOM 4362  H HB2  . ASP A 1 51 ? -19.255 6.247   -4.551  1.00 0.00 ? 51 ASP A HB2  4  
ATOM 4363  H HB3  . ASP A 1 51 ? -18.318 6.723   -5.967  1.00 0.00 ? 51 ASP A HB3  4  
ATOM 4364  N N    . ALA A 1 52 ? -15.575 3.894   -5.796  1.00 0.00 ? 52 ALA A N    4  
ATOM 4365  C CA   . ALA A 1 52 ? -14.654 3.508   -6.902  1.00 0.00 ? 52 ALA A CA   4  
ATOM 4366  C C    . ALA A 1 52 ? -13.679 2.442   -6.404  1.00 0.00 ? 52 ALA A C    4  
ATOM 4367  O O    . ALA A 1 52 ? -13.598 1.369   -6.961  1.00 0.00 ? 52 ALA A O    4  
ATOM 4368  C CB   . ALA A 1 52 ? -13.874 4.738   -7.371  1.00 0.00 ? 52 ALA A CB   4  
ATOM 4369  H H    . ALA A 1 52 ? -15.451 3.513   -4.901  1.00 0.00 ? 52 ALA A H    4  
ATOM 4370  H HA   . ALA A 1 52 ? -15.231 3.113   -7.726  1.00 0.00 ? 52 ALA A HA   4  
ATOM 4371  H HB1  . ALA A 1 52 ? -13.035 4.425   -7.976  1.00 0.00 ? 52 ALA A HB1  4  
ATOM 4372  H HB2  . ALA A 1 52 ? -13.513 5.285   -6.512  1.00 0.00 ? 52 ALA A HB2  4  
ATOM 4373  H HB3  . ALA A 1 52 ? -14.521 5.375   -7.956  1.00 0.00 ? 52 ALA A HB3  4  
ATOM 4374  N N    . ASP A 1 53 ? -12.917 2.768   -5.385  1.00 0.00 ? 53 ASP A N    4  
ATOM 4375  C CA   . ASP A 1 53 ? -11.888 1.830   -4.821  1.00 0.00 ? 53 ASP A CA   4  
ATOM 4376  C C    . ASP A 1 53 ? -10.574 2.072   -5.557  1.00 0.00 ? 53 ASP A C    4  
ATOM 4377  O O    . ASP A 1 53 ? -10.557 2.288   -6.750  1.00 0.00 ? 53 ASP A O    4  
ATOM 4378  C CB   . ASP A 1 53 ? -12.305 0.354   -4.955  1.00 0.00 ? 53 ASP A CB   4  
ATOM 4379  C CG   . ASP A 1 53 ? -13.797 0.202   -4.644  1.00 0.00 ? 53 ASP A CG   4  
ATOM 4380  O OD1  . ASP A 1 53 ? -14.396 1.176   -4.217  1.00 0.00 ? 53 ASP A OD1  4  
ATOM 4381  O OD2  . ASP A 1 53 ? -14.314 -0.885  -4.839  1.00 0.00 ? 53 ASP A OD2  4  
ATOM 4382  H H    . ASP A 1 53 ? -12.995 3.670   -5.012  1.00 0.00 ? 53 ASP A H    4  
ATOM 4383  H HA   . ASP A 1 53 ? -11.746 2.061   -3.776  1.00 0.00 ? 53 ASP A HA   4  
ATOM 4384  H HB2  . ASP A 1 53 ? -12.100 0.003   -5.955  1.00 0.00 ? 53 ASP A HB2  4  
ATOM 4385  H HB3  . ASP A 1 53 ? -11.738 -0.237  -4.252  1.00 0.00 ? 53 ASP A HB3  4  
ATOM 4386  N N    . PHE A 1 54 ? -9.469  2.050   -4.861  1.00 0.00 ? 54 PHE A N    4  
ATOM 4387  C CA   . PHE A 1 54 ? -8.163  2.299   -5.553  1.00 0.00 ? 54 PHE A CA   4  
ATOM 4388  C C    . PHE A 1 54 ? -7.028  2.420   -4.521  1.00 0.00 ? 54 PHE A C    4  
ATOM 4389  O O    . PHE A 1 54 ? -7.203  2.160   -3.347  1.00 0.00 ? 54 PHE A O    4  
ATOM 4390  C CB   . PHE A 1 54 ? -8.265  3.613   -6.380  1.00 0.00 ? 54 PHE A CB   4  
ATOM 4391  C CG   . PHE A 1 54 ? -8.398  3.311   -7.865  1.00 0.00 ? 54 PHE A CG   4  
ATOM 4392  C CD1  . PHE A 1 54 ? -7.417  2.550   -8.513  1.00 0.00 ? 54 PHE A CD1  4  
ATOM 4393  C CD2  . PHE A 1 54 ? -9.496  3.797   -8.591  1.00 0.00 ? 54 PHE A CD2  4  
ATOM 4394  C CE1  . PHE A 1 54 ? -7.533  2.275   -9.881  1.00 0.00 ? 54 PHE A CE1  4  
ATOM 4395  C CE2  . PHE A 1 54 ? -9.611  3.521   -9.958  1.00 0.00 ? 54 PHE A CE2  4  
ATOM 4396  C CZ   . PHE A 1 54 ? -8.630  2.759   -10.603 1.00 0.00 ? 54 PHE A CZ   4  
ATOM 4397  H H    . PHE A 1 54 ? -9.502  1.872   -3.891  1.00 0.00 ? 54 PHE A H    4  
ATOM 4398  H HA   . PHE A 1 54 ? -7.949  1.469   -6.209  1.00 0.00 ? 54 PHE A HA   4  
ATOM 4399  H HB2  . PHE A 1 54 ? -9.128  4.171   -6.052  1.00 0.00 ? 54 PHE A HB2  4  
ATOM 4400  H HB3  . PHE A 1 54 ? -7.381  4.218   -6.226  1.00 0.00 ? 54 PHE A HB3  4  
ATOM 4401  H HD1  . PHE A 1 54 ? -6.569  2.176   -7.958  1.00 0.00 ? 54 PHE A HD1  4  
ATOM 4402  H HD2  . PHE A 1 54 ? -10.255 4.384   -8.094  1.00 0.00 ? 54 PHE A HD2  4  
ATOM 4403  H HE1  . PHE A 1 54 ? -6.776  1.687   -10.379 1.00 0.00 ? 54 PHE A HE1  4  
ATOM 4404  H HE2  . PHE A 1 54 ? -10.456 3.895   -10.516 1.00 0.00 ? 54 PHE A HE2  4  
ATOM 4405  H HZ   . PHE A 1 54 ? -8.719  2.546   -11.658 1.00 0.00 ? 54 PHE A HZ   4  
ATOM 4406  N N    . ASP A 1 55 ? -5.867  2.820   -4.976  1.00 0.00 ? 55 ASP A N    4  
ATOM 4407  C CA   . ASP A 1 55 ? -4.691  2.976   -4.069  1.00 0.00 ? 55 ASP A CA   4  
ATOM 4408  C C    . ASP A 1 55 ? -3.488  3.429   -4.900  1.00 0.00 ? 55 ASP A C    4  
ATOM 4409  O O    . ASP A 1 55 ? -3.049  2.730   -5.792  1.00 0.00 ? 55 ASP A O    4  
ATOM 4410  C CB   . ASP A 1 55 ? -4.366  1.637   -3.406  1.00 0.00 ? 55 ASP A CB   4  
ATOM 4411  C CG   . ASP A 1 55 ? -4.377  0.531   -4.462  1.00 0.00 ? 55 ASP A CG   4  
ATOM 4412  O OD1  . ASP A 1 55 ? -5.334  0.470   -5.217  1.00 0.00 ? 55 ASP A OD1  4  
ATOM 4413  O OD2  . ASP A 1 55 ? -3.429  -0.235  -4.499  1.00 0.00 ? 55 ASP A OD2  4  
ATOM 4414  H H    . ASP A 1 55 ? -5.769  3.022   -5.930  1.00 0.00 ? 55 ASP A H    4  
ATOM 4415  H HA   . ASP A 1 55 ? -4.910  3.715   -3.311  1.00 0.00 ? 55 ASP A HA   4  
ATOM 4416  H HB2  . ASP A 1 55 ? -3.386  1.689   -2.954  1.00 0.00 ? 55 ASP A HB2  4  
ATOM 4417  H HB3  . ASP A 1 55 ? -5.099  1.417   -2.647  1.00 0.00 ? 55 ASP A HB3  4  
ATOM 4418  N N    . TRP A 1 56 ? -2.954  4.595   -4.622  1.00 0.00 ? 56 TRP A N    4  
ATOM 4419  C CA   . TRP A 1 56 ? -1.779  5.106   -5.405  1.00 0.00 ? 56 TRP A CA   4  
ATOM 4420  C C    . TRP A 1 56 ? -0.522  5.096   -4.530  1.00 0.00 ? 56 TRP A C    4  
ATOM 4421  O O    . TRP A 1 56 ? 0.545   5.480   -4.965  1.00 0.00 ? 56 TRP A O    4  
ATOM 4422  C CB   . TRP A 1 56 ? -2.067  6.537   -5.865  1.00 0.00 ? 56 TRP A CB   4  
ATOM 4423  C CG   . TRP A 1 56 ? -3.083  6.513   -6.962  1.00 0.00 ? 56 TRP A CG   4  
ATOM 4424  C CD1  . TRP A 1 56 ? -4.371  6.124   -6.818  1.00 0.00 ? 56 TRP A CD1  4  
ATOM 4425  C CD2  . TRP A 1 56 ? -2.921  6.880   -8.363  1.00 0.00 ? 56 TRP A CD2  4  
ATOM 4426  N NE1  . TRP A 1 56 ? -5.009  6.229   -8.040  1.00 0.00 ? 56 TRP A NE1  4  
ATOM 4427  C CE2  . TRP A 1 56 ? -4.157  6.692   -9.024  1.00 0.00 ? 56 TRP A CE2  4  
ATOM 4428  C CE3  . TRP A 1 56 ? -1.832  7.355   -9.117  1.00 0.00 ? 56 TRP A CE3  4  
ATOM 4429  C CZ2  . TRP A 1 56 ? -4.309  6.962   -10.384 1.00 0.00 ? 56 TRP A CZ2  4  
ATOM 4430  C CZ3  . TRP A 1 56 ? -1.981  7.628   -10.486 1.00 0.00 ? 56 TRP A CZ3  4  
ATOM 4431  C CH2  . TRP A 1 56 ? -3.216  7.432   -11.119 1.00 0.00 ? 56 TRP A CH2  4  
ATOM 4432  H H    . TRP A 1 56 ? -3.332  5.141   -3.902  1.00 0.00 ? 56 TRP A H    4  
ATOM 4433  H HA   . TRP A 1 56 ? -1.609  4.482   -6.273  1.00 0.00 ? 56 TRP A HA   4  
ATOM 4434  H HB2  . TRP A 1 56 ? -2.447  7.113   -5.033  1.00 0.00 ? 56 TRP A HB2  4  
ATOM 4435  H HB3  . TRP A 1 56 ? -1.155  6.988   -6.229  1.00 0.00 ? 56 TRP A HB3  4  
ATOM 4436  H HD1  . TRP A 1 56 ? -4.826  5.786   -5.899  1.00 0.00 ? 56 TRP A HD1  4  
ATOM 4437  H HE1  . TRP A 1 56 ? -5.949  6.009   -8.208  1.00 0.00 ? 56 TRP A HE1  4  
ATOM 4438  H HE3  . TRP A 1 56 ? -0.875  7.508   -8.639  1.00 0.00 ? 56 TRP A HE3  4  
ATOM 4439  H HZ2  . TRP A 1 56 ? -5.263  6.810   -10.867 1.00 0.00 ? 56 TRP A HZ2  4  
ATOM 4440  H HZ3  . TRP A 1 56 ? -1.138  7.991   -11.056 1.00 0.00 ? 56 TRP A HZ3  4  
ATOM 4441  H HH2  . TRP A 1 56 ? -3.325  7.644   -12.172 1.00 0.00 ? 56 TRP A HH2  4  
ATOM 4442  N N    . HIS A 1 57 ? -0.629  4.652   -3.307  1.00 0.00 ? 57 HIS A N    4  
ATOM 4443  C CA   . HIS A 1 57 ? 0.574   4.615   -2.424  1.00 0.00 ? 57 HIS A CA   4  
ATOM 4444  C C    . HIS A 1 57 ? 1.406   3.372   -2.750  1.00 0.00 ? 57 HIS A C    4  
ATOM 4445  O O    . HIS A 1 57 ? 1.168   2.299   -2.233  1.00 0.00 ? 57 HIS A O    4  
ATOM 4446  C CB   . HIS A 1 57 ? 0.142   4.568   -0.953  1.00 0.00 ? 57 HIS A CB   4  
ATOM 4447  C CG   . HIS A 1 57 ? -0.686  3.335   -0.706  1.00 0.00 ? 57 HIS A CG   4  
ATOM 4448  N ND1  . HIS A 1 57 ? -0.237  2.292   0.091   1.00 0.00 ? 57 HIS A ND1  4  
ATOM 4449  C CD2  . HIS A 1 57 ? -1.933  2.962   -1.142  1.00 0.00 ? 57 HIS A CD2  4  
ATOM 4450  C CE1  . HIS A 1 57 ? -1.200  1.352   0.108   1.00 0.00 ? 57 HIS A CE1  4  
ATOM 4451  N NE2  . HIS A 1 57 ? -2.255  1.710   -0.627  1.00 0.00 ? 57 HIS A NE2  4  
ATOM 4452  H H    . HIS A 1 57 ? -1.490  4.335   -2.975  1.00 0.00 ? 57 HIS A H    4  
ATOM 4453  H HA   . HIS A 1 57 ? 1.169   5.497   -2.595  1.00 0.00 ? 57 HIS A HA   4  
ATOM 4454  H HB2  . HIS A 1 57 ? 1.020   4.541   -0.324  1.00 0.00 ? 57 HIS A HB2  4  
ATOM 4455  H HB3  . HIS A 1 57 ? -0.440  5.447   -0.718  1.00 0.00 ? 57 HIS A HB3  4  
ATOM 4456  H HD1  . HIS A 1 57 ? 0.624   2.248   0.556   1.00 0.00 ? 57 HIS A HD1  4  
ATOM 4457  H HD2  . HIS A 1 57 ? -2.568  3.550   -1.787  1.00 0.00 ? 57 HIS A HD2  4  
ATOM 4458  H HE1  . HIS A 1 57 ? -1.127  0.421   0.651   1.00 0.00 ? 57 HIS A HE1  4  
ATOM 4459  N N    . HIS A 1 58 ? 2.381   3.509   -3.606  1.00 0.00 ? 58 HIS A N    4  
ATOM 4460  C CA   . HIS A 1 58 ? 3.227   2.334   -3.964  1.00 0.00 ? 58 HIS A CA   4  
ATOM 4461  C C    . HIS A 1 58 ? 4.420   2.801   -4.803  1.00 0.00 ? 58 HIS A C    4  
ATOM 4462  O O    . HIS A 1 58 ? 5.146   3.694   -4.417  1.00 0.00 ? 58 HIS A O    4  
ATOM 4463  C CB   . HIS A 1 58 ? 2.393   1.330   -4.763  1.00 0.00 ? 58 HIS A CB   4  
ATOM 4464  C CG   . HIS A 1 58 ? 1.812   2.009   -5.974  1.00 0.00 ? 58 HIS A CG   4  
ATOM 4465  N ND1  . HIS A 1 58 ? 1.022   1.334   -6.891  1.00 0.00 ? 58 HIS A ND1  4  
ATOM 4466  C CD2  . HIS A 1 58 ? 1.896   3.300   -6.430  1.00 0.00 ? 58 HIS A CD2  4  
ATOM 4467  C CE1  . HIS A 1 58 ? 0.664   2.214   -7.844  1.00 0.00 ? 58 HIS A CE1  4  
ATOM 4468  N NE2  . HIS A 1 58 ? 1.170   3.428   -7.611  1.00 0.00 ? 58 HIS A NE2  4  
ATOM 4469  H H    . HIS A 1 58 ? 2.558   4.382   -4.014  1.00 0.00 ? 58 HIS A H    4  
ATOM 4470  H HA   . HIS A 1 58 ? 3.586   1.863   -3.060  1.00 0.00 ? 58 HIS A HA   4  
ATOM 4471  H HB2  . HIS A 1 58 ? 3.021   0.509   -5.076  1.00 0.00 ? 58 HIS A HB2  4  
ATOM 4472  H HB3  . HIS A 1 58 ? 1.592   0.955   -4.145  1.00 0.00 ? 58 HIS A HB3  4  
ATOM 4473  H HD1  . HIS A 1 58 ? 0.769   0.388   -6.851  1.00 0.00 ? 58 HIS A HD1  4  
ATOM 4474  H HD2  . HIS A 1 58 ? 2.441   4.098   -5.946  1.00 0.00 ? 58 HIS A HD2  4  
ATOM 4475  H HE1  . HIS A 1 58 ? 0.043   1.969   -8.693  1.00 0.00 ? 58 HIS A HE1  4  
ATOM 4476  N N    . THR A 1 59 ? 4.638   2.186   -5.939  1.00 0.00 ? 59 THR A N    4  
ATOM 4477  C CA   . THR A 1 59 ? 5.798   2.576   -6.802  1.00 0.00 ? 59 THR A CA   4  
ATOM 4478  C C    . THR A 1 59 ? 7.070   1.959   -6.191  1.00 0.00 ? 59 THR A C    4  
ATOM 4479  O O    . THR A 1 59 ? 7.117   1.672   -5.011  1.00 0.00 ? 59 THR A O    4  
ATOM 4480  C CB   . THR A 1 59 ? 5.904   4.126   -6.864  1.00 0.00 ? 59 THR A CB   4  
ATOM 4481  O OG1  . THR A 1 59 ? 4.638   4.692   -6.561  1.00 0.00 ? 59 THR A OG1  4  
ATOM 4482  C CG2  . THR A 1 59 ? 6.332   4.608   -8.262  1.00 0.00 ? 59 THR A CG2  4  
ATOM 4483  H H    . THR A 1 59 ? 4.050   1.452   -6.210  1.00 0.00 ? 59 THR A H    4  
ATOM 4484  H HA   . THR A 1 59 ? 5.650   2.171   -7.792  1.00 0.00 ? 59 THR A HA   4  
ATOM 4485  H HB   . THR A 1 59 ? 6.625   4.472   -6.138  1.00 0.00 ? 59 THR A HB   4  
ATOM 4486  H HG1  . THR A 1 59 ? 4.784   5.493   -6.052  1.00 0.00 ? 59 THR A HG1  4  
ATOM 4487  H HG21 . THR A 1 59 ? 7.383   4.419   -8.407  1.00 0.00 ? 59 THR A HG21 4  
ATOM 4488  H HG22 . THR A 1 59 ? 6.149   5.670   -8.341  1.00 0.00 ? 59 THR A HG22 4  
ATOM 4489  H HG23 . THR A 1 59 ? 5.762   4.094   -9.020  1.00 0.00 ? 59 THR A HG23 4  
ATOM 4490  N N    . PHE A 1 60 ? 8.095   1.750   -6.973  1.00 0.00 ? 60 PHE A N    4  
ATOM 4491  C CA   . PHE A 1 60 ? 9.340   1.151   -6.414  1.00 0.00 ? 60 PHE A CA   4  
ATOM 4492  C C    . PHE A 1 60 ? 10.064  2.207   -5.552  1.00 0.00 ? 60 PHE A C    4  
ATOM 4493  O O    . PHE A 1 60 ? 9.991   3.380   -5.862  1.00 0.00 ? 60 PHE A O    4  
ATOM 4494  C CB   . PHE A 1 60 ? 10.249  0.722   -7.570  1.00 0.00 ? 60 PHE A CB   4  
ATOM 4495  C CG   . PHE A 1 60 ? 9.471   -0.151  -8.524  1.00 0.00 ? 60 PHE A CG   4  
ATOM 4496  C CD1  . PHE A 1 60 ? 9.377   -1.529  -8.295  1.00 0.00 ? 60 PHE A CD1  4  
ATOM 4497  C CD2  . PHE A 1 60 ? 8.839   0.418   -9.635  1.00 0.00 ? 60 PHE A CD2  4  
ATOM 4498  C CE1  . PHE A 1 60 ? 8.653   -2.338  -9.179  1.00 0.00 ? 60 PHE A CE1  4  
ATOM 4499  C CE2  . PHE A 1 60 ? 8.116   -0.390  -10.520 1.00 0.00 ? 60 PHE A CE2  4  
ATOM 4500  C CZ   . PHE A 1 60 ? 8.021   -1.768  -10.292 1.00 0.00 ? 60 PHE A CZ   4  
ATOM 4501  H H    . PHE A 1 60 ? 8.049   1.989   -7.919  1.00 0.00 ? 60 PHE A H    4  
ATOM 4502  H HA   . PHE A 1 60 ? 9.073   0.291   -5.827  1.00 0.00 ? 60 PHE A HA   4  
ATOM 4503  H HB2  . PHE A 1 60 ? 10.604  1.598   -8.092  1.00 0.00 ? 60 PHE A HB2  4  
ATOM 4504  H HB3  . PHE A 1 60 ? 11.091  0.169   -7.184  1.00 0.00 ? 60 PHE A HB3  4  
ATOM 4505  H HD1  . PHE A 1 60 ? 9.864   -1.969  -7.437  1.00 0.00 ? 60 PHE A HD1  4  
ATOM 4506  H HD2  . PHE A 1 60 ? 8.911   1.481   -9.811  1.00 0.00 ? 60 PHE A HD2  4  
ATOM 4507  H HE1  . PHE A 1 60 ? 8.582   -3.401  -9.003  1.00 0.00 ? 60 PHE A HE1  4  
ATOM 4508  H HE2  . PHE A 1 60 ? 7.628   0.049   -11.378 1.00 0.00 ? 60 PHE A HE2  4  
ATOM 4509  H HZ   . PHE A 1 60 ? 7.463   -2.392  -10.973 1.00 0.00 ? 60 PHE A HZ   4  
ATOM 4510  N N    . PRO A 1 61 ? 10.751  1.789   -4.499  1.00 0.00 ? 61 PRO A N    4  
ATOM 4511  C CA   . PRO A 1 61 ? 11.475  2.744   -3.636  1.00 0.00 ? 61 PRO A CA   4  
ATOM 4512  C C    . PRO A 1 61 ? 12.483  3.541   -4.476  1.00 0.00 ? 61 PRO A C    4  
ATOM 4513  O O    . PRO A 1 61 ? 12.780  4.684   -4.189  1.00 0.00 ? 61 PRO A O    4  
ATOM 4514  C CB   . PRO A 1 61 ? 12.188  1.868   -2.577  1.00 0.00 ? 61 PRO A CB   4  
ATOM 4515  C CG   . PRO A 1 61 ? 11.885  0.382   -2.922  1.00 0.00 ? 61 PRO A CG   4  
ATOM 4516  C CD   . PRO A 1 61 ? 10.868  0.374   -4.084  1.00 0.00 ? 61 PRO A CD   4  
ATOM 4517  H HA   . PRO A 1 61 ? 10.778  3.416   -3.156  1.00 0.00 ? 61 PRO A HA   4  
ATOM 4518  H HB2  . PRO A 1 61 ? 13.259  2.046   -2.597  1.00 0.00 ? 61 PRO A HB2  4  
ATOM 4519  H HB3  . PRO A 1 61 ? 11.804  2.096   -1.590  1.00 0.00 ? 61 PRO A HB3  4  
ATOM 4520  H HG2  . PRO A 1 61 ? 12.799  -0.118  -3.223  1.00 0.00 ? 61 PRO A HG2  4  
ATOM 4521  H HG3  . PRO A 1 61 ? 11.463  -0.122  -2.061  1.00 0.00 ? 61 PRO A HG3  4  
ATOM 4522  H HD2  . PRO A 1 61 ? 11.230  -0.235  -4.901  1.00 0.00 ? 61 PRO A HD2  4  
ATOM 4523  H HD3  . PRO A 1 61 ? 9.911   0.009   -3.737  1.00 0.00 ? 61 PRO A HD3  4  
ATOM 4524  N N    . SER A 1 62 ? 13.012  2.940   -5.508  1.00 0.00 ? 62 SER A N    4  
ATOM 4525  C CA   . SER A 1 62 ? 14.002  3.654   -6.366  1.00 0.00 ? 62 SER A CA   4  
ATOM 4526  C C    . SER A 1 62 ? 13.490  5.063   -6.682  1.00 0.00 ? 62 SER A C    4  
ATOM 4527  O O    . SER A 1 62 ? 14.245  6.015   -6.703  1.00 0.00 ? 62 SER A O    4  
ATOM 4528  C CB   . SER A 1 62 ? 14.198  2.878   -7.670  1.00 0.00 ? 62 SER A CB   4  
ATOM 4529  O OG   . SER A 1 62 ? 14.765  1.608   -7.378  1.00 0.00 ? 62 SER A OG   4  
ATOM 4530  H H    . SER A 1 62 ? 12.760  2.017   -5.717  1.00 0.00 ? 62 SER A H    4  
ATOM 4531  H HA   . SER A 1 62 ? 14.945  3.724   -5.845  1.00 0.00 ? 62 SER A HA   4  
ATOM 4532  H HB2  . SER A 1 62 ? 13.248  2.738   -8.156  1.00 0.00 ? 62 SER A HB2  4  
ATOM 4533  H HB3  . SER A 1 62 ? 14.856  3.436   -8.325  1.00 0.00 ? 62 SER A HB3  4  
ATOM 4534  H HG   . SER A 1 62 ? 14.150  0.933   -7.675  1.00 0.00 ? 62 SER A HG   4  
ATOM 4535  N N    . ARG A 1 63 ? 12.210  5.201   -6.922  1.00 0.00 ? 63 ARG A N    4  
ATOM 4536  C CA   . ARG A 1 63 ? 11.630  6.547   -7.233  1.00 0.00 ? 63 ARG A CA   4  
ATOM 4537  C C    . ARG A 1 63 ? 10.883  7.071   -6.002  1.00 0.00 ? 63 ARG A C    4  
ATOM 4538  O O    . ARG A 1 63 ? 9.927   7.813   -6.112  1.00 0.00 ? 63 ARG A O    4  
ATOM 4539  C CB   . ARG A 1 63 ? 10.656  6.415   -8.414  1.00 0.00 ? 63 ARG A CB   4  
ATOM 4540  C CG   . ARG A 1 63 ? 10.452  7.781   -9.077  1.00 0.00 ? 63 ARG A CG   4  
ATOM 4541  C CD   . ARG A 1 63 ? 9.527   7.630   -10.287 1.00 0.00 ? 63 ARG A CD   4  
ATOM 4542  N NE   . ARG A 1 63 ? 8.125   7.434   -9.819  1.00 0.00 ? 63 ARG A NE   4  
ATOM 4543  C CZ   . ARG A 1 63 ? 7.133   7.575   -10.655 1.00 0.00 ? 63 ARG A CZ   4  
ATOM 4544  N NH1  . ARG A 1 63 ? 7.368   7.884   -11.902 1.00 0.00 ? 63 ARG A NH1  4  
ATOM 4545  N NH2  . ARG A 1 63 ? 5.906   7.407   -10.245 1.00 0.00 ? 63 ARG A NH2  4  
ATOM 4546  H H    . ARG A 1 63 ? 11.623  4.416   -6.894  1.00 0.00 ? 63 ARG A H    4  
ATOM 4547  H HA   . ARG A 1 63 ? 12.421  7.239   -7.494  1.00 0.00 ? 63 ARG A HA   4  
ATOM 4548  H HB2  . ARG A 1 63 ? 11.064  5.725   -9.138  1.00 0.00 ? 63 ARG A HB2  4  
ATOM 4549  H HB3  . ARG A 1 63 ? 9.705   6.042   -8.062  1.00 0.00 ? 63 ARG A HB3  4  
ATOM 4550  H HG2  . ARG A 1 63 ? 10.007  8.464   -8.368  1.00 0.00 ? 63 ARG A HG2  4  
ATOM 4551  H HG3  . ARG A 1 63 ? 11.405  8.170   -9.402  1.00 0.00 ? 63 ARG A HG3  4  
ATOM 4552  H HD2  . ARG A 1 63 ? 9.583   8.519   -10.896 1.00 0.00 ? 63 ARG A HD2  4  
ATOM 4553  H HD3  . ARG A 1 63 ? 9.835   6.774   -10.870 1.00 0.00 ? 63 ARG A HD3  4  
ATOM 4554  H HE   . ARG A 1 63 ? 7.949   7.202   -8.885  1.00 0.00 ? 63 ARG A HE   4  
ATOM 4555  H HH11 . ARG A 1 63 ? 8.308   8.012   -12.216 1.00 0.00 ? 63 ARG A HH11 4  
ATOM 4556  H HH12 . ARG A 1 63 ? 6.607   7.993   -12.542 1.00 0.00 ? 63 ARG A HH12 4  
ATOM 4557  H HH21 . ARG A 1 63 ? 5.725   7.170   -9.291  1.00 0.00 ? 63 ARG A HH21 4  
ATOM 4558  H HH22 . ARG A 1 63 ? 5.145   7.515   -10.885 1.00 0.00 ? 63 ARG A HH22 4  
ATOM 4559  N N    . GLY A 1 64 ? 11.310  6.690   -4.829  1.00 0.00 ? 64 GLY A N    4  
ATOM 4560  C CA   . GLY A 1 64 ? 10.623  7.167   -3.594  1.00 0.00 ? 64 GLY A CA   4  
ATOM 4561  C C    . GLY A 1 64 ? 9.142   6.793   -3.657  1.00 0.00 ? 64 GLY A C    4  
ATOM 4562  O O    . GLY A 1 64 ? 8.371   7.396   -4.377  1.00 0.00 ? 64 GLY A O    4  
ATOM 4563  H H    . GLY A 1 64 ? 12.082  6.090   -4.760  1.00 0.00 ? 64 GLY A H    4  
ATOM 4564  H HA2  . GLY A 1 64 ? 11.078  6.704   -2.728  1.00 0.00 ? 64 GLY A HA2  4  
ATOM 4565  H HA3  . GLY A 1 64 ? 10.718  8.239   -3.520  1.00 0.00 ? 64 GLY A HA3  4  
ATOM 4566  N N    . ASN A 1 65 ? 8.737   5.798   -2.915  1.00 0.00 ? 65 ASN A N    4  
ATOM 4567  C CA   . ASN A 1 65 ? 7.305   5.381   -2.938  1.00 0.00 ? 65 ASN A CA   4  
ATOM 4568  C C    . ASN A 1 65 ? 6.399   6.595   -2.727  1.00 0.00 ? 65 ASN A C    4  
ATOM 4569  O O    . ASN A 1 65 ? 6.823   7.626   -2.242  1.00 0.00 ? 65 ASN A O    4  
ATOM 4570  C CB   . ASN A 1 65 ? 7.058   4.362   -1.822  1.00 0.00 ? 65 ASN A CB   4  
ATOM 4571  C CG   . ASN A 1 65 ? 7.553   4.932   -0.493  1.00 0.00 ? 65 ASN A CG   4  
ATOM 4572  O OD1  . ASN A 1 65 ? 8.649   4.631   -0.060  1.00 0.00 ? 65 ASN A OD1  4  
ATOM 4573  N ND2  . ASN A 1 65 ? 6.789   5.749   0.180   1.00 0.00 ? 65 ASN A ND2  4  
ATOM 4574  H H    . ASN A 1 65 ? 9.371   5.317   -2.344  1.00 0.00 ? 65 ASN A H    4  
ATOM 4575  H HA   . ASN A 1 65 ? 7.081   4.927   -3.890  1.00 0.00 ? 65 ASN A HA   4  
ATOM 4576  H HB2  . ASN A 1 65 ? 5.999   4.155   -1.755  1.00 0.00 ? 65 ASN A HB2  4  
ATOM 4577  H HB3  . ASN A 1 65 ? 7.590   3.450   -2.043  1.00 0.00 ? 65 ASN A HB3  4  
ATOM 4578  H HD21 . ASN A 1 65 ? 5.906   5.993   -0.170  1.00 0.00 ? 65 ASN A HD21 4  
ATOM 4579  H HD22 . ASN A 1 65 ? 7.099   6.120   1.032   1.00 0.00 ? 65 ASN A HD22 4  
ATOM 4580  N N    . LEU A 1 66 ? 5.148   6.475   -3.088  1.00 0.00 ? 66 LEU A N    4  
ATOM 4581  C CA   . LEU A 1 66 ? 4.192   7.610   -2.915  1.00 0.00 ? 66 LEU A CA   4  
ATOM 4582  C C    . LEU A 1 66 ? 3.546   7.509   -1.528  1.00 0.00 ? 66 LEU A C    4  
ATOM 4583  O O    . LEU A 1 66 ? 2.450   7.015   -1.373  1.00 0.00 ? 66 LEU A O    4  
ATOM 4584  C CB   . LEU A 1 66 ? 3.122   7.523   -4.021  1.00 0.00 ? 66 LEU A CB   4  
ATOM 4585  C CG   . LEU A 1 66 ? 1.986   8.541   -3.793  1.00 0.00 ? 66 LEU A CG   4  
ATOM 4586  C CD1  . LEU A 1 66 ? 2.556   9.909   -3.401  1.00 0.00 ? 66 LEU A CD1  4  
ATOM 4587  C CD2  . LEU A 1 66 ? 1.181   8.691   -5.091  1.00 0.00 ? 66 LEU A CD2  4  
ATOM 4588  H H    . LEU A 1 66 ? 4.834   5.631   -3.475  1.00 0.00 ? 66 LEU A H    4  
ATOM 4589  H HA   . LEU A 1 66 ? 4.726   8.547   -2.999  1.00 0.00 ? 66 LEU A HA   4  
ATOM 4590  H HB2  . LEU A 1 66 ? 3.588   7.721   -4.975  1.00 0.00 ? 66 LEU A HB2  4  
ATOM 4591  H HB3  . LEU A 1 66 ? 2.706   6.527   -4.031  1.00 0.00 ? 66 LEU A HB3  4  
ATOM 4592  H HG   . LEU A 1 66 ? 1.331   8.183   -3.012  1.00 0.00 ? 66 LEU A HG   4  
ATOM 4593  H HD11 . LEU A 1 66 ? 3.386   10.153  -4.047  1.00 0.00 ? 66 LEU A HD11 4  
ATOM 4594  H HD12 . LEU A 1 66 ? 2.894   9.880   -2.377  1.00 0.00 ? 66 LEU A HD12 4  
ATOM 4595  H HD13 . LEU A 1 66 ? 1.788   10.662  -3.503  1.00 0.00 ? 66 LEU A HD13 4  
ATOM 4596  H HD21 . LEU A 1 66 ? 1.745   9.281   -5.798  1.00 0.00 ? 66 LEU A HD21 4  
ATOM 4597  H HD22 . LEU A 1 66 ? 0.245   9.184   -4.877  1.00 0.00 ? 66 LEU A HD22 4  
ATOM 4598  H HD23 . LEU A 1 66 ? 0.987   7.717   -5.510  1.00 0.00 ? 66 LEU A HD23 4  
ATOM 4599  N N    . ASP A 1 67 ? 4.223   7.968   -0.511  1.00 0.00 ? 67 ASP A N    4  
ATOM 4600  C CA   . ASP A 1 67 ? 3.641   7.892   0.858   1.00 0.00 ? 67 ASP A CA   4  
ATOM 4601  C C    . ASP A 1 67 ? 2.238   8.502   0.843   1.00 0.00 ? 67 ASP A C    4  
ATOM 4602  O O    . ASP A 1 67 ? 2.070   9.698   0.968   1.00 0.00 ? 67 ASP A O    4  
ATOM 4603  C CB   . ASP A 1 67 ? 4.526   8.671   1.835   1.00 0.00 ? 67 ASP A CB   4  
ATOM 4604  C CG   . ASP A 1 67 ? 3.984   8.509   3.255   1.00 0.00 ? 67 ASP A CG   4  
ATOM 4605  O OD1  . ASP A 1 67 ? 4.325   7.524   3.890   1.00 0.00 ? 67 ASP A OD1  4  
ATOM 4606  O OD2  . ASP A 1 67 ? 3.236   9.371   3.685   1.00 0.00 ? 67 ASP A OD2  4  
ATOM 4607  H H    . ASP A 1 67 ? 5.113   8.359   -0.647  1.00 0.00 ? 67 ASP A H    4  
ATOM 4608  H HA   . ASP A 1 67 ? 3.584   6.860   1.169   1.00 0.00 ? 67 ASP A HA   4  
ATOM 4609  H HB2  . ASP A 1 67 ? 5.536   8.290   1.788   1.00 0.00 ? 67 ASP A HB2  4  
ATOM 4610  H HB3  . ASP A 1 67 ? 4.523   9.717   1.568   1.00 0.00 ? 67 ASP A HB3  4  
ATOM 4611  N N    . ASP A 1 68 ? 1.227   7.688   0.685   1.00 0.00 ? 68 ASP A N    4  
ATOM 4612  C CA   . ASP A 1 68 ? -0.168  8.221   0.655   1.00 0.00 ? 68 ASP A CA   4  
ATOM 4613  C C    . ASP A 1 68 ? -1.135  7.157   1.180   1.00 0.00 ? 68 ASP A C    4  
ATOM 4614  O O    . ASP A 1 68 ? -1.001  6.677   2.286   1.00 0.00 ? 68 ASP A O    4  
ATOM 4615  C CB   . ASP A 1 68 ? -0.540  8.590   -0.784  1.00 0.00 ? 68 ASP A CB   4  
ATOM 4616  C CG   . ASP A 1 68 ? -1.904  9.284   -0.798  1.00 0.00 ? 68 ASP A CG   4  
ATOM 4617  O OD1  . ASP A 1 68 ? -1.960  10.443  -0.420  1.00 0.00 ? 68 ASP A OD1  4  
ATOM 4618  O OD2  . ASP A 1 68 ? -2.868  8.645   -1.186  1.00 0.00 ? 68 ASP A OD2  4  
ATOM 4619  H H    . ASP A 1 68 ? 1.385   6.727   0.582   1.00 0.00 ? 68 ASP A H    4  
ATOM 4620  H HA   . ASP A 1 68 ? -0.236  9.100   1.279   1.00 0.00 ? 68 ASP A HA   4  
ATOM 4621  H HB2  . ASP A 1 68 ? 0.207   9.256   -1.188  1.00 0.00 ? 68 ASP A HB2  4  
ATOM 4622  H HB3  . ASP A 1 68 ? -0.589  7.694   -1.384  1.00 0.00 ? 68 ASP A HB3  4  
ATOM 4623  N N    . PHE A 1 69 ? -2.108  6.784   0.394   1.00 0.00 ? 69 PHE A N    4  
ATOM 4624  C CA   . PHE A 1 69 ? -3.085  5.754   0.841   1.00 0.00 ? 69 PHE A CA   4  
ATOM 4625  C C    . PHE A 1 69 ? -4.187  5.628   -0.223  1.00 0.00 ? 69 PHE A C    4  
ATOM 4626  O O    . PHE A 1 69 ? -4.414  4.568   -0.772  1.00 0.00 ? 69 PHE A O    4  
ATOM 4627  C CB   . PHE A 1 69 ? -3.694  6.176   2.204   1.00 0.00 ? 69 PHE A CB   4  
ATOM 4628  C CG   . PHE A 1 69 ? -3.054  5.401   3.344   1.00 0.00 ? 69 PHE A CG   4  
ATOM 4629  C CD1  . PHE A 1 69 ? -3.109  4.001   3.355   1.00 0.00 ? 69 PHE A CD1  4  
ATOM 4630  C CD2  . PHE A 1 69 ? -2.415  6.082   4.392   1.00 0.00 ? 69 PHE A CD2  4  
ATOM 4631  C CE1  . PHE A 1 69 ? -2.526  3.284   4.407   1.00 0.00 ? 69 PHE A CE1  4  
ATOM 4632  C CE2  . PHE A 1 69 ? -1.832  5.364   5.442   1.00 0.00 ? 69 PHE A CE2  4  
ATOM 4633  C CZ   . PHE A 1 69 ? -1.887  3.965   5.450   1.00 0.00 ? 69 PHE A CZ   4  
ATOM 4634  H H    . PHE A 1 69 ? -2.194  7.179   -0.495  1.00 0.00 ? 69 PHE A H    4  
ATOM 4635  H HA   . PHE A 1 69 ? -2.576  4.809   0.935   1.00 0.00 ? 69 PHE A HA   4  
ATOM 4636  H HB2  . PHE A 1 69 ? -3.524  7.232   2.352   1.00 0.00 ? 69 PHE A HB2  4  
ATOM 4637  H HB3  . PHE A 1 69 ? -4.758  5.989   2.206   1.00 0.00 ? 69 PHE A HB3  4  
ATOM 4638  H HD1  . PHE A 1 69 ? -3.601  3.474   2.551   1.00 0.00 ? 69 PHE A HD1  4  
ATOM 4639  H HD2  . PHE A 1 69 ? -2.372  7.162   4.388   1.00 0.00 ? 69 PHE A HD2  4  
ATOM 4640  H HE1  . PHE A 1 69 ? -2.568  2.205   4.413   1.00 0.00 ? 69 PHE A HE1  4  
ATOM 4641  H HE2  . PHE A 1 69 ? -1.340  5.889   6.247   1.00 0.00 ? 69 PHE A HE2  4  
ATOM 4642  H HZ   . PHE A 1 69 ? -1.438  3.411   6.261   1.00 0.00 ? 69 PHE A HZ   4  
ATOM 4643  N N    . PHE A 1 70 ? -4.871  6.702   -0.516  1.00 0.00 ? 70 PHE A N    4  
ATOM 4644  C CA   . PHE A 1 70 ? -5.952  6.645   -1.545  1.00 0.00 ? 70 PHE A CA   4  
ATOM 4645  C C    . PHE A 1 70 ? -6.108  8.024   -2.194  1.00 0.00 ? 70 PHE A C    4  
ATOM 4646  O O    . PHE A 1 70 ? -5.635  9.019   -1.683  1.00 0.00 ? 70 PHE A O    4  
ATOM 4647  C CB   . PHE A 1 70 ? -7.274  6.226   -0.882  1.00 0.00 ? 70 PHE A CB   4  
ATOM 4648  C CG   . PHE A 1 70 ? -7.375  6.845   0.496   1.00 0.00 ? 70 PHE A CG   4  
ATOM 4649  C CD1  . PHE A 1 70 ? -7.555  8.227   0.632   1.00 0.00 ? 70 PHE A CD1  4  
ATOM 4650  C CD2  . PHE A 1 70 ? -7.294  6.036   1.638   1.00 0.00 ? 70 PHE A CD2  4  
ATOM 4651  C CE1  . PHE A 1 70 ? -7.651  8.800   1.907   1.00 0.00 ? 70 PHE A CE1  4  
ATOM 4652  C CE2  . PHE A 1 70 ? -7.390  6.609   2.911   1.00 0.00 ? 70 PHE A CE2  4  
ATOM 4653  C CZ   . PHE A 1 70 ? -7.569  7.990   3.045   1.00 0.00 ? 70 PHE A CZ   4  
ATOM 4654  H H    . PHE A 1 70 ? -4.672  7.546   -0.061  1.00 0.00 ? 70 PHE A H    4  
ATOM 4655  H HA   . PHE A 1 70 ? -5.689  5.923   -2.306  1.00 0.00 ? 70 PHE A HA   4  
ATOM 4656  H HB2  . PHE A 1 70 ? -8.106  6.557   -1.488  1.00 0.00 ? 70 PHE A HB2  4  
ATOM 4657  H HB3  . PHE A 1 70 ? -7.304  5.150   -0.796  1.00 0.00 ? 70 PHE A HB3  4  
ATOM 4658  H HD1  . PHE A 1 70 ? -7.620  8.854   -0.246  1.00 0.00 ? 70 PHE A HD1  4  
ATOM 4659  H HD2  . PHE A 1 70 ? -7.155  4.970   1.535   1.00 0.00 ? 70 PHE A HD2  4  
ATOM 4660  H HE1  . PHE A 1 70 ? -7.790  9.866   2.010   1.00 0.00 ? 70 PHE A HE1  4  
ATOM 4661  H HE2  . PHE A 1 70 ? -7.325  5.985   3.791   1.00 0.00 ? 70 PHE A HE2  4  
ATOM 4662  H HZ   . PHE A 1 70 ? -7.643  8.432   4.028   1.00 0.00 ? 70 PHE A HZ   4  
ATOM 4663  N N    . HIS A 1 71 ? -6.769  8.086   -3.317  1.00 0.00 ? 71 HIS A N    4  
ATOM 4664  C CA   . HIS A 1 71 ? -6.957  9.397   -4.001  1.00 0.00 ? 71 HIS A CA   4  
ATOM 4665  C C    . HIS A 1 71 ? -8.088  9.277   -5.022  1.00 0.00 ? 71 HIS A C    4  
ATOM 4666  O O    . HIS A 1 71 ? -8.995  10.085  -5.060  1.00 0.00 ? 71 HIS A O    4  
ATOM 4667  C CB   . HIS A 1 71 ? -5.663  9.787   -4.719  1.00 0.00 ? 71 HIS A CB   4  
ATOM 4668  C CG   . HIS A 1 71 ? -5.834  11.135  -5.365  1.00 0.00 ? 71 HIS A CG   4  
ATOM 4669  N ND1  . HIS A 1 71 ? -5.948  12.300  -4.624  1.00 0.00 ? 71 HIS A ND1  4  
ATOM 4670  C CD2  . HIS A 1 71 ? -5.911  11.518  -6.681  1.00 0.00 ? 71 HIS A CD2  4  
ATOM 4671  C CE1  . HIS A 1 71 ? -6.087  13.320  -5.490  1.00 0.00 ? 71 HIS A CE1  4  
ATOM 4672  N NE2  . HIS A 1 71 ? -6.071  12.899  -6.758  1.00 0.00 ? 71 HIS A NE2  4  
ATOM 4673  H H    . HIS A 1 71 ? -7.143  7.270   -3.709  1.00 0.00 ? 71 HIS A H    4  
ATOM 4674  H HA   . HIS A 1 71 ? -7.207  10.152  -3.272  1.00 0.00 ? 71 HIS A HA   4  
ATOM 4675  H HB2  . HIS A 1 71 ? -4.855  9.829   -4.005  1.00 0.00 ? 71 HIS A HB2  4  
ATOM 4676  H HB3  . HIS A 1 71 ? -5.436  9.052   -5.477  1.00 0.00 ? 71 HIS A HB3  4  
ATOM 4677  H HD1  . HIS A 1 71 ? -5.928  12.370  -3.646  1.00 0.00 ? 71 HIS A HD1  4  
ATOM 4678  H HD2  . HIS A 1 71 ? -5.857  10.850  -7.528  1.00 0.00 ? 71 HIS A HD2  4  
ATOM 4679  H HE1  . HIS A 1 71 ? -6.198  14.353  -5.198  1.00 0.00 ? 71 HIS A HE1  4  
ATOM 4680  N N    . ARG A 1 72 ? -8.042  8.271   -5.852  1.00 0.00 ? 72 ARG A N    4  
ATOM 4681  C CA   . ARG A 1 72 ? -9.113  8.095   -6.872  1.00 0.00 ? 72 ARG A CA   4  
ATOM 4682  C C    . ARG A 1 72 ? -10.395 7.625   -6.184  1.00 0.00 ? 72 ARG A C    4  
ATOM 4683  O O    . ARG A 1 72 ? -10.696 6.448   -6.146  1.00 0.00 ? 72 ARG A O    4  
ATOM 4684  C CB   . ARG A 1 72 ? -8.670  7.049   -7.896  1.00 0.00 ? 72 ARG A CB   4  
ATOM 4685  C CG   . ARG A 1 72 ? -7.499  7.598   -8.725  1.00 0.00 ? 72 ARG A CG   4  
ATOM 4686  C CD   . ARG A 1 72 ? -7.959  8.775   -9.607  1.00 0.00 ? 72 ARG A CD   4  
ATOM 4687  N NE   . ARG A 1 72 ? -7.740  10.059  -8.880  1.00 0.00 ? 72 ARG A NE   4  
ATOM 4688  C CZ   . ARG A 1 72 ? -7.769  11.189  -9.533  1.00 0.00 ? 72 ARG A CZ   4  
ATOM 4689  N NH1  . ARG A 1 72 ? -7.995  11.194  -10.818 1.00 0.00 ? 72 ARG A NH1  4  
ATOM 4690  N NH2  . ARG A 1 72 ? -7.574  12.314  -8.901  1.00 0.00 ? 72 ARG A NH2  4  
ATOM 4691  H H    . ARG A 1 72 ? -7.302  7.630   -5.804  1.00 0.00 ? 72 ARG A H    4  
ATOM 4692  H HA   . ARG A 1 72 ? -9.297  9.034   -7.369  1.00 0.00 ? 72 ARG A HA   4  
ATOM 4693  H HB2  . ARG A 1 72 ? -8.354  6.154   -7.378  1.00 0.00 ? 72 ARG A HB2  4  
ATOM 4694  H HB3  . ARG A 1 72 ? -9.496  6.812   -8.551  1.00 0.00 ? 72 ARG A HB3  4  
ATOM 4695  H HG2  . ARG A 1 72 ? -6.720  7.937   -8.057  1.00 0.00 ? 72 ARG A HG2  4  
ATOM 4696  H HG3  . ARG A 1 72 ? -7.110  6.810   -9.354  1.00 0.00 ? 72 ARG A HG3  4  
ATOM 4697  H HD2  . ARG A 1 72 ? -7.385  8.786   -10.523 1.00 0.00 ? 72 ARG A HD2  4  
ATOM 4698  H HD3  . ARG A 1 72 ? -9.009  8.674   -9.846  1.00 0.00 ? 72 ARG A HD3  4  
ATOM 4699  H HE   . ARG A 1 72 ? -7.573  10.054  -7.914  1.00 0.00 ? 72 ARG A HE   4  
ATOM 4700  H HH11 . ARG A 1 72 ? -8.145  10.331  -11.302 1.00 0.00 ? 72 ARG A HH11 4  
ATOM 4701  H HH12 . ARG A 1 72 ? -8.018  12.059  -11.318 1.00 0.00 ? 72 ARG A HH12 4  
ATOM 4702  H HH21 . ARG A 1 72 ? -7.401  12.312  -7.916  1.00 0.00 ? 72 ARG A HH21 4  
ATOM 4703  H HH22 . ARG A 1 72 ? -7.596  13.180  -9.402  1.00 0.00 ? 72 ARG A HH22 4  
ATOM 4704  N N    . ASP A 1 73 ? -11.152 8.535   -5.637  1.00 0.00 ? 73 ASP A N    4  
ATOM 4705  C CA   . ASP A 1 73 ? -12.412 8.140   -4.950  1.00 0.00 ? 73 ASP A CA   4  
ATOM 4706  C C    . ASP A 1 73 ? -13.257 9.386   -4.679  1.00 0.00 ? 73 ASP A C    4  
ATOM 4707  O O    . ASP A 1 73 ? -12.752 10.488  -4.612  1.00 0.00 ? 73 ASP A O    4  
ATOM 4708  C CB   . ASP A 1 73 ? -12.076 7.452   -3.627  1.00 0.00 ? 73 ASP A CB   4  
ATOM 4709  C CG   . ASP A 1 73 ? -11.189 8.372   -2.785  1.00 0.00 ? 73 ASP A CG   4  
ATOM 4710  O OD1  . ASP A 1 73 ? -9.989  8.367   -3.003  1.00 0.00 ? 73 ASP A OD1  4  
ATOM 4711  O OD2  . ASP A 1 73 ? -11.726 9.064   -1.935  1.00 0.00 ? 73 ASP A OD2  4  
ATOM 4712  H H    . ASP A 1 73 ? -10.891 9.479   -5.676  1.00 0.00 ? 73 ASP A H    4  
ATOM 4713  H HA   . ASP A 1 73 ? -12.967 7.459   -5.579  1.00 0.00 ? 73 ASP A HA   4  
ATOM 4714  H HB2  . ASP A 1 73 ? -12.988 7.238   -3.089  1.00 0.00 ? 73 ASP A HB2  4  
ATOM 4715  H HB3  . ASP A 1 73 ? -11.549 6.531   -3.825  1.00 0.00 ? 73 ASP A HB3  4  
ATOM 4716  N N    . LYS A 1 74 ? -14.541 9.219   -4.521  1.00 0.00 ? 74 LYS A N    4  
ATOM 4717  C CA   . LYS A 1 74 ? -15.418 10.393  -4.255  1.00 0.00 ? 74 LYS A CA   4  
ATOM 4718  C C    . LYS A 1 74 ? -16.826 9.905   -3.912  1.00 0.00 ? 74 LYS A C    4  
ATOM 4719  O O    . LYS A 1 74 ? -17.120 8.728   -3.985  1.00 0.00 ? 74 LYS A O    4  
ATOM 4720  C CB   . LYS A 1 74 ? -15.472 11.282  -5.498  1.00 0.00 ? 74 LYS A CB   4  
ATOM 4721  C CG   . LYS A 1 74 ? -15.824 10.432  -6.720  1.00 0.00 ? 74 LYS A CG   4  
ATOM 4722  C CD   . LYS A 1 74 ? -15.932 11.331  -7.954  1.00 0.00 ? 74 LYS A CD   4  
ATOM 4723  C CE   . LYS A 1 74 ? -16.177 10.467  -9.193  1.00 0.00 ? 74 LYS A CE   4  
ATOM 4724  N NZ   . LYS A 1 74 ? -15.036 9.526   -9.377  1.00 0.00 ? 74 LYS A NZ   4  
ATOM 4725  H H    . LYS A 1 74 ? -14.929 8.321   -4.579  1.00 0.00 ? 74 LYS A H    4  
ATOM 4726  H HA   . LYS A 1 74 ? -15.021 10.957  -3.424  1.00 0.00 ? 74 LYS A HA   4  
ATOM 4727  H HB2  . LYS A 1 74 ? -16.224 12.046  -5.361  1.00 0.00 ? 74 LYS A HB2  4  
ATOM 4728  H HB3  . LYS A 1 74 ? -14.510 11.747  -5.651  1.00 0.00 ? 74 LYS A HB3  4  
ATOM 4729  H HG2  . LYS A 1 74 ? -15.053 9.692   -6.878  1.00 0.00 ? 74 LYS A HG2  4  
ATOM 4730  H HG3  . LYS A 1 74 ? -16.769 9.936   -6.554  1.00 0.00 ? 74 LYS A HG3  4  
ATOM 4731  H HD2  . LYS A 1 74 ? -16.754 12.021  -7.826  1.00 0.00 ? 74 LYS A HD2  4  
ATOM 4732  H HD3  . LYS A 1 74 ? -15.013 11.882  -8.078  1.00 0.00 ? 74 LYS A HD3  4  
ATOM 4733  H HE2  . LYS A 1 74 ? -17.090 9.905   -9.066  1.00 0.00 ? 74 LYS A HE2  4  
ATOM 4734  H HE3  . LYS A 1 74 ? -16.263 11.103  -10.062 1.00 0.00 ? 74 LYS A HE3  4  
ATOM 4735  H HZ1  . LYS A 1 74 ? -15.141 9.027   -10.281 1.00 0.00 ? 74 LYS A HZ1  4  
ATOM 4736  H HZ2  . LYS A 1 74 ? -15.027 8.837   -8.600  1.00 0.00 ? 74 LYS A HZ2  4  
ATOM 4737  H HZ3  . LYS A 1 74 ? -14.143 10.061  -9.376  1.00 0.00 ? 74 LYS A HZ3  4  
ATOM 4738  N N    . ASP A 1 75 ? -17.700 10.799  -3.540  1.00 0.00 ? 75 ASP A N    4  
ATOM 4739  C CA   . ASP A 1 75 ? -19.088 10.384  -3.192  1.00 0.00 ? 75 ASP A CA   4  
ATOM 4740  C C    . ASP A 1 75 ? -20.024 11.587  -3.311  1.00 0.00 ? 75 ASP A C    4  
ATOM 4741  O O    . ASP A 1 75 ? -19.599 12.692  -3.585  1.00 0.00 ? 75 ASP A O    4  
ATOM 4742  C CB   . ASP A 1 75 ? -19.114 9.852   -1.757  1.00 0.00 ? 75 ASP A CB   4  
ATOM 4743  C CG   . ASP A 1 75 ? -20.517 9.344   -1.424  1.00 0.00 ? 75 ASP A CG   4  
ATOM 4744  O OD1  . ASP A 1 75 ? -20.822 8.221   -1.792  1.00 0.00 ? 75 ASP A OD1  4  
ATOM 4745  O OD2  . ASP A 1 75 ? -21.264 10.086  -0.807  1.00 0.00 ? 75 ASP A OD2  4  
ATOM 4746  H H    . ASP A 1 75 ? -17.444 11.743  -3.487  1.00 0.00 ? 75 ASP A H    4  
ATOM 4747  H HA   . ASP A 1 75 ? -19.414 9.607   -3.869  1.00 0.00 ? 75 ASP A HA   4  
ATOM 4748  H HB2  . ASP A 1 75 ? -18.405 9.042   -1.661  1.00 0.00 ? 75 ASP A HB2  4  
ATOM 4749  H HB3  . ASP A 1 75 ? -18.849 10.646  -1.074  1.00 0.00 ? 75 ASP A HB3  4  
ATOM 4750  N N    . ASP A 1 76 ? -21.298 11.384  -3.109  1.00 0.00 ? 76 ASP A N    4  
ATOM 4751  C CA   . ASP A 1 76 ? -22.258 12.518  -3.213  1.00 0.00 ? 76 ASP A CA   4  
ATOM 4752  C C    . ASP A 1 76 ? -21.876 13.606  -2.210  1.00 0.00 ? 76 ASP A C    4  
ATOM 4753  O O    . ASP A 1 76 ? -20.997 13.429  -1.390  1.00 0.00 ? 76 ASP A O    4  
ATOM 4754  C CB   . ASP A 1 76 ? -23.672 12.021  -2.905  1.00 0.00 ? 76 ASP A CB   4  
ATOM 4755  C CG   . ASP A 1 76 ? -24.668 13.164  -3.112  1.00 0.00 ? 76 ASP A CG   4  
ATOM 4756  O OD1  . ASP A 1 76 ? -24.522 13.881  -4.088  1.00 0.00 ? 76 ASP A OD1  4  
ATOM 4757  O OD2  . ASP A 1 76 ? -25.559 13.303  -2.290  1.00 0.00 ? 76 ASP A OD2  4  
ATOM 4758  H H    . ASP A 1 76 ? -21.622 10.485  -2.891  1.00 0.00 ? 76 ASP A H    4  
ATOM 4759  H HA   . ASP A 1 76 ? -22.229 12.923  -4.213  1.00 0.00 ? 76 ASP A HA   4  
ATOM 4760  H HB2  . ASP A 1 76 ? -23.919 11.203  -3.566  1.00 0.00 ? 76 ASP A HB2  4  
ATOM 4761  H HB3  . ASP A 1 76 ? -23.721 11.685  -1.880  1.00 0.00 ? 76 ASP A HB3  4  
ATOM 4762  N N    . PHE A 1 77 ? -22.533 14.732  -2.266  1.00 0.00 ? 77 PHE A N    4  
ATOM 4763  C CA   . PHE A 1 77 ? -22.212 15.831  -1.314  1.00 0.00 ? 77 PHE A CA   4  
ATOM 4764  C C    . PHE A 1 77 ? -22.579 15.394  0.106   1.00 0.00 ? 77 PHE A C    4  
ATOM 4765  O O    . PHE A 1 77 ? -23.539 14.680  0.317   1.00 0.00 ? 77 PHE A O    4  
ATOM 4766  C CB   . PHE A 1 77 ? -23.013 17.079  -1.686  1.00 0.00 ? 77 PHE A CB   4  
ATOM 4767  C CG   . PHE A 1 77 ? -22.673 18.198  -0.732  1.00 0.00 ? 77 PHE A CG   4  
ATOM 4768  C CD1  . PHE A 1 77 ? -21.534 18.983  -0.952  1.00 0.00 ? 77 PHE A CD1  4  
ATOM 4769  C CD2  . PHE A 1 77 ? -23.496 18.452  0.371   1.00 0.00 ? 77 PHE A CD2  4  
ATOM 4770  C CE1  . PHE A 1 77 ? -21.218 20.021  -0.067  1.00 0.00 ? 77 PHE A CE1  4  
ATOM 4771  C CE2  . PHE A 1 77 ? -23.180 19.491  1.256   1.00 0.00 ? 77 PHE A CE2  4  
ATOM 4772  C CZ   . PHE A 1 77 ? -22.042 20.275  1.036   1.00 0.00 ? 77 PHE A CZ   4  
ATOM 4773  H H    . PHE A 1 77 ? -23.241 14.854  -2.933  1.00 0.00 ? 77 PHE A H    4  
ATOM 4774  H HA   . PHE A 1 77 ? -21.156 16.051  -1.362  1.00 0.00 ? 77 PHE A HA   4  
ATOM 4775  H HB2  . PHE A 1 77 ? -22.767 17.378  -2.695  1.00 0.00 ? 77 PHE A HB2  4  
ATOM 4776  H HB3  . PHE A 1 77 ? -24.069 16.862  -1.623  1.00 0.00 ? 77 PHE A HB3  4  
ATOM 4777  H HD1  . PHE A 1 77 ? -20.900 18.787  -1.803  1.00 0.00 ? 77 PHE A HD1  4  
ATOM 4778  H HD2  . PHE A 1 77 ? -24.374 17.848  0.541   1.00 0.00 ? 77 PHE A HD2  4  
ATOM 4779  H HE1  . PHE A 1 77 ? -20.341 20.627  -0.236  1.00 0.00 ? 77 PHE A HE1  4  
ATOM 4780  H HE2  . PHE A 1 77 ? -23.815 19.687  2.108   1.00 0.00 ? 77 PHE A HE2  4  
ATOM 4781  H HZ   . PHE A 1 77 ? -21.798 21.076  1.719   1.00 0.00 ? 77 PHE A HZ   4  
ATOM 4782  N N    . PHE A 1 78 ? -21.823 15.817  1.080   1.00 0.00 ? 78 PHE A N    4  
ATOM 4783  C CA   . PHE A 1 78 ? -22.131 15.425  2.484   1.00 0.00 ? 78 PHE A CA   4  
ATOM 4784  C C    . PHE A 1 78 ? -21.278 16.257  3.441   1.00 0.00 ? 78 PHE A C    4  
ATOM 4785  O O    . PHE A 1 78 ? -21.203 15.981  4.622   1.00 0.00 ? 78 PHE A O    4  
ATOM 4786  C CB   . PHE A 1 78 ? -21.816 13.940  2.682   1.00 0.00 ? 78 PHE A CB   4  
ATOM 4787  C CG   . PHE A 1 78 ? -22.184 13.535  4.088   1.00 0.00 ? 78 PHE A CG   4  
ATOM 4788  C CD1  . PHE A 1 78 ? -23.525 13.302  4.419   1.00 0.00 ? 78 PHE A CD1  4  
ATOM 4789  C CD2  . PHE A 1 78 ? -21.189 13.394  5.064   1.00 0.00 ? 78 PHE A CD2  4  
ATOM 4790  C CE1  . PHE A 1 78 ? -23.869 12.929  5.724   1.00 0.00 ? 78 PHE A CE1  4  
ATOM 4791  C CE2  . PHE A 1 78 ? -21.534 13.022  6.368   1.00 0.00 ? 78 PHE A CE2  4  
ATOM 4792  C CZ   . PHE A 1 78 ? -22.874 12.789  6.698   1.00 0.00 ? 78 PHE A CZ   4  
ATOM 4793  H H    . PHE A 1 78 ? -21.054 16.393  0.890   1.00 0.00 ? 78 PHE A H    4  
ATOM 4794  H HA   . PHE A 1 78 ? -23.177 15.601  2.687   1.00 0.00 ? 78 PHE A HA   4  
ATOM 4795  H HB2  . PHE A 1 78 ? -22.386 13.355  1.975   1.00 0.00 ? 78 PHE A HB2  4  
ATOM 4796  H HB3  . PHE A 1 78 ? -20.761 13.772  2.523   1.00 0.00 ? 78 PHE A HB3  4  
ATOM 4797  H HD1  . PHE A 1 78 ? -24.294 13.410  3.668   1.00 0.00 ? 78 PHE A HD1  4  
ATOM 4798  H HD2  . PHE A 1 78 ? -20.155 13.574  4.809   1.00 0.00 ? 78 PHE A HD2  4  
ATOM 4799  H HE1  . PHE A 1 78 ? -24.903 12.749  5.978   1.00 0.00 ? 78 PHE A HE1  4  
ATOM 4800  H HE2  . PHE A 1 78 ? -20.766 12.914  7.120   1.00 0.00 ? 78 PHE A HE2  4  
ATOM 4801  H HZ   . PHE A 1 78 ? -23.140 12.502  7.704   1.00 0.00 ? 78 PHE A HZ   4  
ATOM 4802  N N    . THR A 1 79 ? -20.632 17.274  2.943   1.00 0.00 ? 79 THR A N    4  
ATOM 4803  C CA   . THR A 1 79 ? -19.784 18.120  3.826   1.00 0.00 ? 79 THR A CA   4  
ATOM 4804  C C    . THR A 1 79 ? -19.438 19.425  3.103   1.00 0.00 ? 79 THR A C    4  
ATOM 4805  O O    . THR A 1 79 ? -19.940 20.457  3.515   1.00 0.00 ? 79 THR A O    4  
ATOM 4806  C CB   . THR A 1 79 ? -18.496 17.366  4.163   1.00 0.00 ? 79 THR A CB   4  
ATOM 4807  O OG1  . THR A 1 79 ? -18.824 16.105  4.732   1.00 0.00 ? 79 THR A OG1  4  
ATOM 4808  C CG2  . THR A 1 79 ? -17.671 18.178  5.161   1.00 0.00 ? 79 THR A CG2  4  
ATOM 4809  O OXT  . THR A 1 79 ? -18.678 19.368  2.151   1.00 0.00 ? 79 THR A OXT  4  
ATOM 4810  H H    . THR A 1 79 ? -20.705 17.480  1.987   1.00 0.00 ? 79 THR A H    4  
ATOM 4811  H HA   . THR A 1 79 ? -20.320 18.343  4.735   1.00 0.00 ? 79 THR A HA   4  
ATOM 4812  H HB   . THR A 1 79 ? -17.920 17.216  3.263   1.00 0.00 ? 79 THR A HB   4  
ATOM 4813  H HG1  . THR A 1 79 ? -18.591 16.130  5.662   1.00 0.00 ? 79 THR A HG1  4  
ATOM 4814  H HG21 . THR A 1 79 ? -16.819 17.596  5.482   1.00 0.00 ? 79 THR A HG21 4  
ATOM 4815  H HG22 . THR A 1 79 ? -18.282 18.424  6.016   1.00 0.00 ? 79 THR A HG22 4  
ATOM 4816  H HG23 . THR A 1 79 ? -17.329 19.087  4.688   1.00 0.00 ? 79 THR A HG23 4  
ATOM 4817  N N    . MET A 1 1  ? -5.161  -2.725  22.057  1.00 0.00 ? 1  MET A N    5  
ATOM 4818  C CA   . MET A 1 1  ? -4.554  -2.171  23.301  1.00 0.00 ? 1  MET A CA   5  
ATOM 4819  C C    . MET A 1 1  ? -5.252  -2.775  24.522  1.00 0.00 ? 1  MET A C    5  
ATOM 4820  O O    . MET A 1 1  ? -4.667  -3.530  25.273  1.00 0.00 ? 1  MET A O    5  
ATOM 4821  C CB   . MET A 1 1  ? -4.721  -0.650  23.318  1.00 0.00 ? 1  MET A CB   5  
ATOM 4822  C CG   . MET A 1 1  ? -4.030  -0.046  22.095  1.00 0.00 ? 1  MET A CG   5  
ATOM 4823  S SD   . MET A 1 1  ? -2.238  -0.236  22.259  1.00 0.00 ? 1  MET A SD   5  
ATOM 4824  C CE   . MET A 1 1  ? -1.771  0.741   20.810  1.00 0.00 ? 1  MET A CE   5  
ATOM 4825  H H1   . MET A 1 1  ? -5.579  -3.655  22.259  1.00 0.00 ? 1  MET A H1   5  
ATOM 4826  H H2   . MET A 1 1  ? -4.424  -2.825  21.328  1.00 0.00 ? 1  MET A H2   5  
ATOM 4827  H H3   . MET A 1 1  ? -5.901  -2.080  21.716  1.00 0.00 ? 1  MET A H3   5  
ATOM 4828  H HA   . MET A 1 1  ? -3.503  -2.418  23.329  1.00 0.00 ? 1  MET A HA   5  
ATOM 4829  H HB2  . MET A 1 1  ? -5.774  -0.405  23.296  1.00 0.00 ? 1  MET A HB2  5  
ATOM 4830  H HB3  . MET A 1 1  ? -4.277  -0.249  24.215  1.00 0.00 ? 1  MET A HB3  5  
ATOM 4831  H HG2  . MET A 1 1  ? -4.365  -0.555  21.203  1.00 0.00 ? 1  MET A HG2  5  
ATOM 4832  H HG3  . MET A 1 1  ? -4.276  1.003   22.023  1.00 0.00 ? 1  MET A HG3  5  
ATOM 4833  H HE1  . MET A 1 1  ? -2.296  0.369   19.941  1.00 0.00 ? 1  MET A HE1  5  
ATOM 4834  H HE2  . MET A 1 1  ? -0.704  0.666   20.654  1.00 0.00 ? 1  MET A HE2  5  
ATOM 4835  H HE3  . MET A 1 1  ? -2.037  1.774   20.971  1.00 0.00 ? 1  MET A HE3  5  
ATOM 4836  N N    . ILE A 1 2  ? -6.499  -2.449  24.725  1.00 0.00 ? 2  ILE A N    5  
ATOM 4837  C CA   . ILE A 1 2  ? -7.233  -3.005  25.898  1.00 0.00 ? 2  ILE A CA   5  
ATOM 4838  C C    . ILE A 1 2  ? -7.345  -4.524  25.755  1.00 0.00 ? 2  ILE A C    5  
ATOM 4839  O O    . ILE A 1 2  ? -7.488  -5.047  24.668  1.00 0.00 ? 2  ILE A O    5  
ATOM 4840  C CB   . ILE A 1 2  ? -8.633  -2.394  25.959  1.00 0.00 ? 2  ILE A CB   5  
ATOM 4841  C CG1  . ILE A 1 2  ? -9.302  -2.513  24.587  1.00 0.00 ? 2  ILE A CG1  5  
ATOM 4842  C CG2  . ILE A 1 2  ? -8.530  -0.918  26.348  1.00 0.00 ? 2  ILE A CG2  5  
ATOM 4843  C CD1  . ILE A 1 2  ? -10.750 -2.028  24.682  1.00 0.00 ? 2  ILE A CD1  5  
ATOM 4844  H H    . ILE A 1 2  ? -6.954  -1.838  24.108  1.00 0.00 ? 2  ILE A H    5  
ATOM 4845  H HA   . ILE A 1 2  ? -6.696  -2.767  26.804  1.00 0.00 ? 2  ILE A HA   5  
ATOM 4846  H HB   . ILE A 1 2  ? -9.223  -2.920  26.696  1.00 0.00 ? 2  ILE A HB   5  
ATOM 4847  H HG12 . ILE A 1 2  ? -8.764  -1.907  23.872  1.00 0.00 ? 2  ILE A HG12 5  
ATOM 4848  H HG13 . ILE A 1 2  ? -9.289  -3.544  24.269  1.00 0.00 ? 2  ILE A HG13 5  
ATOM 4849  H HG21 . ILE A 1 2  ? -9.521  -0.507  26.469  1.00 0.00 ? 2  ILE A HG21 5  
ATOM 4850  H HG22 . ILE A 1 2  ? -8.007  -0.377  25.574  1.00 0.00 ? 2  ILE A HG22 5  
ATOM 4851  H HG23 . ILE A 1 2  ? -7.988  -0.828  27.279  1.00 0.00 ? 2  ILE A HG23 5  
ATOM 4852  H HD11 . ILE A 1 2  ? -11.257 -2.562  25.470  1.00 0.00 ? 2  ILE A HD11 5  
ATOM 4853  H HD12 . ILE A 1 2  ? -11.251 -2.210  23.743  1.00 0.00 ? 2  ILE A HD12 5  
ATOM 4854  H HD13 . ILE A 1 2  ? -10.762 -0.970  24.898  1.00 0.00 ? 2  ILE A HD13 5  
ATOM 4855  N N    . ASP A 1 3  ? -7.283  -5.237  26.847  1.00 0.00 ? 3  ASP A N    5  
ATOM 4856  C CA   . ASP A 1 3  ? -7.387  -6.722  26.773  1.00 0.00 ? 3  ASP A CA   5  
ATOM 4857  C C    . ASP A 1 3  ? -8.842  -7.119  26.517  1.00 0.00 ? 3  ASP A C    5  
ATOM 4858  O O    . ASP A 1 3  ? -9.439  -7.852  27.280  1.00 0.00 ? 3  ASP A O    5  
ATOM 4859  C CB   . ASP A 1 3  ? -6.917  -7.333  28.095  1.00 0.00 ? 3  ASP A CB   5  
ATOM 4860  C CG   . ASP A 1 3  ? -7.738  -6.752  29.247  1.00 0.00 ? 3  ASP A CG   5  
ATOM 4861  O OD1  . ASP A 1 3  ? -7.905  -5.544  29.280  1.00 0.00 ? 3  ASP A OD1  5  
ATOM 4862  O OD2  . ASP A 1 3  ? -8.188  -7.525  30.077  1.00 0.00 ? 3  ASP A OD2  5  
ATOM 4863  H H    . ASP A 1 3  ? -7.167  -4.797  27.715  1.00 0.00 ? 3  ASP A H    5  
ATOM 4864  H HA   . ASP A 1 3  ? -6.767  -7.087  25.967  1.00 0.00 ? 3  ASP A HA   5  
ATOM 4865  H HB2  . ASP A 1 3  ? -7.048  -8.405  28.062  1.00 0.00 ? 3  ASP A HB2  5  
ATOM 4866  H HB3  . ASP A 1 3  ? -5.874  -7.102  28.247  1.00 0.00 ? 3  ASP A HB3  5  
ATOM 4867  N N    . ASN A 1 4  ? -9.418  -6.640  25.449  1.00 0.00 ? 4  ASN A N    5  
ATOM 4868  C CA   . ASN A 1 4  ? -10.833 -6.989  25.144  1.00 0.00 ? 4  ASN A CA   5  
ATOM 4869  C C    . ASN A 1 4  ? -11.178 -6.528  23.727  1.00 0.00 ? 4  ASN A C    5  
ATOM 4870  O O    . ASN A 1 4  ? -11.653 -5.429  23.518  1.00 0.00 ? 4  ASN A O    5  
ATOM 4871  C CB   . ASN A 1 4  ? -11.759 -6.294  26.145  1.00 0.00 ? 4  ASN A CB   5  
ATOM 4872  C CG   . ASN A 1 4  ? -13.203 -6.728  25.891  1.00 0.00 ? 4  ASN A CG   5  
ATOM 4873  O OD1  . ASN A 1 4  ? -13.482 -7.903  25.758  1.00 0.00 ? 4  ASN A OD1  5  
ATOM 4874  N ND2  . ASN A 1 4  ? -14.140 -5.824  25.817  1.00 0.00 ? 4  ASN A ND2  5  
ATOM 4875  H H    . ASN A 1 4  ? -8.919  -6.049  24.847  1.00 0.00 ? 4  ASN A H    5  
ATOM 4876  H HA   . ASN A 1 4  ? -10.964 -8.059  25.216  1.00 0.00 ? 4  ASN A HA   5  
ATOM 4877  H HB2  . ASN A 1 4  ? -11.471 -6.567  27.150  1.00 0.00 ? 4  ASN A HB2  5  
ATOM 4878  H HB3  . ASN A 1 4  ? -11.680 -5.224  26.025  1.00 0.00 ? 4  ASN A HB3  5  
ATOM 4879  H HD21 . ASN A 1 4  ? -13.916 -4.875  25.925  1.00 0.00 ? 4  ASN A HD21 5  
ATOM 4880  H HD22 . ASN A 1 4  ? -15.069 -6.091  25.655  1.00 0.00 ? 4  ASN A HD22 5  
ATOM 4881  N N    . GLU A 1 5  ? -10.943 -7.359  22.749  1.00 0.00 ? 5  GLU A N    5  
ATOM 4882  C CA   . GLU A 1 5  ? -11.258 -6.967  21.345  1.00 0.00 ? 5  GLU A CA   5  
ATOM 4883  C C    . GLU A 1 5  ? -12.773 -6.829  21.184  1.00 0.00 ? 5  GLU A C    5  
ATOM 4884  O O    . GLU A 1 5  ? -13.540 -7.551  21.789  1.00 0.00 ? 5  GLU A O    5  
ATOM 4885  C CB   . GLU A 1 5  ? -10.737 -8.041  20.387  1.00 0.00 ? 5  GLU A CB   5  
ATOM 4886  C CG   . GLU A 1 5  ? -9.217  -8.156  20.526  1.00 0.00 ? 5  GLU A CG   5  
ATOM 4887  C CD   . GLU A 1 5  ? -8.694  -9.212  19.550  1.00 0.00 ? 5  GLU A CD   5  
ATOM 4888  O OE1  . GLU A 1 5  ? -8.566  -8.896  18.379  1.00 0.00 ? 5  GLU A OE1  5  
ATOM 4889  O OE2  . GLU A 1 5  ? -8.428  -10.318 19.992  1.00 0.00 ? 5  GLU A OE2  5  
ATOM 4890  H H    . GLU A 1 5  ? -10.560 -8.242  22.936  1.00 0.00 ? 5  GLU A H    5  
ATOM 4891  H HA   . GLU A 1 5  ? -10.784 -6.024  21.121  1.00 0.00 ? 5  GLU A HA   5  
ATOM 4892  H HB2  . GLU A 1 5  ? -11.194 -8.989  20.627  1.00 0.00 ? 5  GLU A HB2  5  
ATOM 4893  H HB3  . GLU A 1 5  ? -10.983 -7.768  19.373  1.00 0.00 ? 5  GLU A HB3  5  
ATOM 4894  H HG2  . GLU A 1 5  ? -8.763  -7.200  20.303  1.00 0.00 ? 5  GLU A HG2  5  
ATOM 4895  H HG3  . GLU A 1 5  ? -8.969  -8.446  21.536  1.00 0.00 ? 5  GLU A HG3  5  
ATOM 4896  N N    . LYS A 1 6  ? -13.210 -5.906  20.371  1.00 0.00 ? 6  LYS A N    5  
ATOM 4897  C CA   . LYS A 1 6  ? -14.676 -5.723  20.173  1.00 0.00 ? 6  LYS A CA   5  
ATOM 4898  C C    . LYS A 1 6  ? -14.906 -4.740  19.021  1.00 0.00 ? 6  LYS A C    5  
ATOM 4899  O O    . LYS A 1 6  ? -14.422 -3.626  19.037  1.00 0.00 ? 6  LYS A O    5  
ATOM 4900  C CB   . LYS A 1 6  ? -15.296 -5.172  21.464  1.00 0.00 ? 6  LYS A CB   5  
ATOM 4901  C CG   . LYS A 1 6  ? -16.762 -4.778  21.232  1.00 0.00 ? 6  LYS A CG   5  
ATOM 4902  C CD   . LYS A 1 6  ? -17.527 -5.945  20.596  1.00 0.00 ? 6  LYS A CD   5  
ATOM 4903  C CE   . LYS A 1 6  ? -19.032 -5.747  20.799  1.00 0.00 ? 6  LYS A CE   5  
ATOM 4904  N NZ   . LYS A 1 6  ? -19.773 -6.852  20.128  1.00 0.00 ? 6  LYS A NZ   5  
ATOM 4905  H H    . LYS A 1 6  ? -12.575 -5.333  19.895  1.00 0.00 ? 6  LYS A H    5  
ATOM 4906  H HA   . LYS A 1 6  ? -15.124 -6.675  19.931  1.00 0.00 ? 6  LYS A HA   5  
ATOM 4907  H HB2  . LYS A 1 6  ? -15.247 -5.930  22.233  1.00 0.00 ? 6  LYS A HB2  5  
ATOM 4908  H HB3  . LYS A 1 6  ? -14.740 -4.303  21.784  1.00 0.00 ? 6  LYS A HB3  5  
ATOM 4909  H HG2  . LYS A 1 6  ? -17.213 -4.527  22.181  1.00 0.00 ? 6  LYS A HG2  5  
ATOM 4910  H HG3  . LYS A 1 6  ? -16.807 -3.921  20.578  1.00 0.00 ? 6  LYS A HG3  5  
ATOM 4911  H HD2  . LYS A 1 6  ? -17.312 -5.983  19.539  1.00 0.00 ? 6  LYS A HD2  5  
ATOM 4912  H HD3  . LYS A 1 6  ? -17.224 -6.873  21.060  1.00 0.00 ? 6  LYS A HD3  5  
ATOM 4913  H HE2  . LYS A 1 6  ? -19.256 -5.751  21.855  1.00 0.00 ? 6  LYS A HE2  5  
ATOM 4914  H HE3  . LYS A 1 6  ? -19.330 -4.801  20.371  1.00 0.00 ? 6  LYS A HE3  5  
ATOM 4915  H HZ1  . LYS A 1 6  ? -19.096 -7.511  19.695  1.00 0.00 ? 6  LYS A HZ1  5  
ATOM 4916  H HZ2  . LYS A 1 6  ? -20.391 -6.458  19.391  1.00 0.00 ? 6  LYS A HZ2  5  
ATOM 4917  H HZ3  . LYS A 1 6  ? -20.349 -7.358  20.832  1.00 0.00 ? 6  LYS A HZ3  5  
ATOM 4918  N N    . VAL A 1 7  ? -15.642 -5.145  18.020  1.00 0.00 ? 7  VAL A N    5  
ATOM 4919  C CA   . VAL A 1 7  ? -15.904 -4.236  16.864  1.00 0.00 ? 7  VAL A CA   5  
ATOM 4920  C C    . VAL A 1 7  ? -17.261 -4.580  16.246  1.00 0.00 ? 7  VAL A C    5  
ATOM 4921  O O    . VAL A 1 7  ? -17.636 -5.733  16.149  1.00 0.00 ? 7  VAL A O    5  
ATOM 4922  C CB   . VAL A 1 7  ? -14.807 -4.418  15.814  1.00 0.00 ? 7  VAL A CB   5  
ATOM 4923  C CG1  . VAL A 1 7  ? -13.471 -3.938  16.383  1.00 0.00 ? 7  VAL A CG1  5  
ATOM 4924  C CG2  . VAL A 1 7  ? -14.698 -5.898  15.443  1.00 0.00 ? 7  VAL A CG2  5  
ATOM 4925  H H    . VAL A 1 7  ? -16.023 -6.048  18.027  1.00 0.00 ? 7  VAL A H    5  
ATOM 4926  H HA   . VAL A 1 7  ? -15.914 -3.209  17.201  1.00 0.00 ? 7  VAL A HA   5  
ATOM 4927  H HB   . VAL A 1 7  ? -15.051 -3.841  14.935  1.00 0.00 ? 7  VAL A HB   5  
ATOM 4928  H HG11 . VAL A 1 7  ? -13.603 -2.972  16.850  1.00 0.00 ? 7  VAL A HG11 5  
ATOM 4929  H HG12 . VAL A 1 7  ? -12.748 -3.855  15.584  1.00 0.00 ? 7  VAL A HG12 5  
ATOM 4930  H HG13 . VAL A 1 7  ? -13.116 -4.647  17.117  1.00 0.00 ? 7  VAL A HG13 5  
ATOM 4931  H HG21 . VAL A 1 7  ? -15.627 -6.227  15.001  1.00 0.00 ? 7  VAL A HG21 5  
ATOM 4932  H HG22 . VAL A 1 7  ? -14.496 -6.479  16.330  1.00 0.00 ? 7  VAL A HG22 5  
ATOM 4933  H HG23 . VAL A 1 7  ? -13.895 -6.033  14.733  1.00 0.00 ? 7  VAL A HG23 5  
ATOM 4934  N N    . THR A 1 8  ? -18.001 -3.591  15.828  1.00 0.00 ? 8  THR A N    5  
ATOM 4935  C CA   . THR A 1 8  ? -19.333 -3.863  15.218  1.00 0.00 ? 8  THR A CA   5  
ATOM 4936  C C    . THR A 1 8  ? -19.147 -4.593  13.886  1.00 0.00 ? 8  THR A C    5  
ATOM 4937  O O    . THR A 1 8  ? -19.252 -5.801  13.809  1.00 0.00 ? 8  THR A O    5  
ATOM 4938  C CB   . THR A 1 8  ? -20.064 -2.539  14.977  1.00 0.00 ? 8  THR A CB   5  
ATOM 4939  O OG1  . THR A 1 8  ? -20.198 -1.844  16.208  1.00 0.00 ? 8  THR A OG1  5  
ATOM 4940  C CG2  . THR A 1 8  ? -21.449 -2.818  14.392  1.00 0.00 ? 8  THR A CG2  5  
ATOM 4941  H H    . THR A 1 8  ? -17.682 -2.668  15.914  1.00 0.00 ? 8  THR A H    5  
ATOM 4942  H HA   . THR A 1 8  ? -19.916 -4.478  15.887  1.00 0.00 ? 8  THR A HA   5  
ATOM 4943  H HB   . THR A 1 8  ? -19.500 -1.937  14.282  1.00 0.00 ? 8  THR A HB   5  
ATOM 4944  H HG1  . THR A 1 8  ? -19.320 -1.593  16.504  1.00 0.00 ? 8  THR A HG1  5  
ATOM 4945  H HG21 . THR A 1 8  ? -21.967 -3.532  15.016  1.00 0.00 ? 8  THR A HG21 5  
ATOM 4946  H HG22 . THR A 1 8  ? -21.345 -3.221  13.395  1.00 0.00 ? 8  THR A HG22 5  
ATOM 4947  H HG23 . THR A 1 8  ? -22.015 -1.898  14.352  1.00 0.00 ? 8  THR A HG23 5  
ATOM 4948  N N    . SER A 1 9  ? -18.873 -3.869  12.835  1.00 0.00 ? 9  SER A N    5  
ATOM 4949  C CA   . SER A 1 9  ? -18.682 -4.523  11.509  1.00 0.00 ? 9  SER A CA   5  
ATOM 4950  C C    . SER A 1 9  ? -17.369 -5.308  11.511  1.00 0.00 ? 9  SER A C    5  
ATOM 4951  O O    . SER A 1 9  ? -17.359 -6.519  11.413  1.00 0.00 ? 9  SER A O    5  
ATOM 4952  C CB   . SER A 1 9  ? -18.635 -3.454  10.417  1.00 0.00 ? 9  SER A CB   5  
ATOM 4953  O OG   . SER A 1 9  ? -17.476 -2.649  10.597  1.00 0.00 ? 9  SER A OG   5  
ATOM 4954  H H    . SER A 1 9  ? -18.793 -2.896  12.917  1.00 0.00 ? 9  SER A H    5  
ATOM 4955  H HA   . SER A 1 9  ? -19.504 -5.196  11.318  1.00 0.00 ? 9  SER A HA   5  
ATOM 4956  H HB2  . SER A 1 9  ? -18.591 -3.926  9.450   1.00 0.00 ? 9  SER A HB2  5  
ATOM 4957  H HB3  . SER A 1 9  ? -19.525 -2.841  10.476  1.00 0.00 ? 9  SER A HB3  5  
ATOM 4958  H HG   . SER A 1 9  ? -17.743 -1.841  11.042  1.00 0.00 ? 9  SER A HG   5  
ATOM 4959  N N    . GLY A 1 10 ? -16.260 -4.628  11.621  1.00 0.00 ? 10 GLY A N    5  
ATOM 4960  C CA   . GLY A 1 10 ? -14.950 -5.339  11.628  1.00 0.00 ? 10 GLY A CA   5  
ATOM 4961  C C    . GLY A 1 10 ? -13.813 -4.315  11.629  1.00 0.00 ? 10 GLY A C    5  
ATOM 4962  O O    . GLY A 1 10 ? -13.979 -3.197  12.071  1.00 0.00 ? 10 GLY A O    5  
ATOM 4963  H H    . GLY A 1 10 ? -16.289 -3.653  11.699  1.00 0.00 ? 10 GLY A H    5  
ATOM 4964  H HA2  . GLY A 1 10 ? -14.881 -5.957  12.511  1.00 0.00 ? 10 GLY A HA2  5  
ATOM 4965  H HA3  . GLY A 1 10 ? -14.871 -5.958  10.747  1.00 0.00 ? 10 GLY A HA3  5  
ATOM 4966  N N    . HIS A 1 11 ? -12.658 -4.701  11.150  1.00 0.00 ? 11 HIS A N    5  
ATOM 4967  C CA   . HIS A 1 11 ? -11.486 -3.770  11.123  1.00 0.00 ? 11 HIS A CA   5  
ATOM 4968  C C    . HIS A 1 11 ? -11.928 -2.366  10.695  1.00 0.00 ? 11 HIS A C    5  
ATOM 4969  O O    . HIS A 1 11 ? -11.922 -2.028  9.527   1.00 0.00 ? 11 HIS A O    5  
ATOM 4970  C CB   . HIS A 1 11 ? -10.444 -4.298  10.135  1.00 0.00 ? 11 HIS A CB   5  
ATOM 4971  C CG   . HIS A 1 11 ? -9.968  -5.652  10.583  1.00 0.00 ? 11 HIS A CG   5  
ATOM 4972  N ND1  . HIS A 1 11 ? -9.912  -6.737  9.724   1.00 0.00 ? 11 HIS A ND1  5  
ATOM 4973  C CD2  . HIS A 1 11 ? -9.522  -6.112  11.798  1.00 0.00 ? 11 HIS A CD2  5  
ATOM 4974  C CE1  . HIS A 1 11 ? -9.449  -7.788  10.426  1.00 0.00 ? 11 HIS A CE1  5  
ATOM 4975  N NE2  . HIS A 1 11 ? -9.195  -7.460  11.696  1.00 0.00 ? 11 HIS A NE2  5  
ATOM 4976  H H    . HIS A 1 11 ? -12.560 -5.619  10.819  1.00 0.00 ? 11 HIS A H    5  
ATOM 4977  H HA   . HIS A 1 11 ? -11.049 -3.721  12.109  1.00 0.00 ? 11 HIS A HA   5  
ATOM 4978  H HB2  . HIS A 1 11 ? -10.887 -4.378  9.154   1.00 0.00 ? 11 HIS A HB2  5  
ATOM 4979  H HB3  . HIS A 1 11 ? -9.606  -3.616  10.098  1.00 0.00 ? 11 HIS A HB3  5  
ATOM 4980  H HD1  . HIS A 1 11 ? -10.165 -6.740  8.777   1.00 0.00 ? 11 HIS A HD1  5  
ATOM 4981  H HD2  . HIS A 1 11 ? -9.438  -5.517  12.696  1.00 0.00 ? 11 HIS A HD2  5  
ATOM 4982  H HE1  . HIS A 1 11 ? -9.300  -8.774  10.013  1.00 0.00 ? 11 HIS A HE1  5  
ATOM 4983  N N    . THR A 1 12 ? -12.312 -1.548  11.637  1.00 0.00 ? 12 THR A N    5  
ATOM 4984  C CA   . THR A 1 12 ? -12.760 -0.167  11.298  1.00 0.00 ? 12 THR A CA   5  
ATOM 4985  C C    . THR A 1 12 ? -11.538 0.726   11.072  1.00 0.00 ? 12 THR A C    5  
ATOM 4986  O O    . THR A 1 12 ? -11.581 1.669   10.308  1.00 0.00 ? 12 THR A O    5  
ATOM 4987  C CB   . THR A 1 12 ? -13.597 0.395   12.449  1.00 0.00 ? 12 THR A CB   5  
ATOM 4988  O OG1  . THR A 1 12 ? -14.646 -0.512  12.756  1.00 0.00 ? 12 THR A OG1  5  
ATOM 4989  C CG2  . THR A 1 12 ? -14.191 1.743   12.038  1.00 0.00 ? 12 THR A CG2  5  
ATOM 4990  H H    . THR A 1 12 ? -12.315 -1.854  12.568  1.00 0.00 ? 12 THR A H    5  
ATOM 4991  H HA   . THR A 1 12 ? -13.356 -0.194  10.398  1.00 0.00 ? 12 THR A HA   5  
ATOM 4992  H HB   . THR A 1 12 ? -12.972 0.531   13.317  1.00 0.00 ? 12 THR A HB   5  
ATOM 4993  H HG1  . THR A 1 12 ? -14.337 -1.099  13.451  1.00 0.00 ? 12 THR A HG1  5  
ATOM 4994  H HG21 . THR A 1 12 ? -13.394 2.462   11.909  1.00 0.00 ? 12 THR A HG21 5  
ATOM 4995  H HG22 . THR A 1 12 ? -14.866 2.089   12.807  1.00 0.00 ? 12 THR A HG22 5  
ATOM 4996  H HG23 . THR A 1 12 ? -14.730 1.632   11.109  1.00 0.00 ? 12 THR A HG23 5  
ATOM 4997  N N    . THR A 1 13 ? -10.451 0.438   11.733  1.00 0.00 ? 13 THR A N    5  
ATOM 4998  C CA   . THR A 1 13 ? -9.231  1.274   11.556  1.00 0.00 ? 13 THR A CA   5  
ATOM 4999  C C    . THR A 1 13 ? -8.750  1.178   10.107  1.00 0.00 ? 13 THR A C    5  
ATOM 5000  O O    . THR A 1 13 ? -9.208  1.898   9.242   1.00 0.00 ? 13 THR A O    5  
ATOM 5001  C CB   . THR A 1 13 ? -8.129  0.771   12.492  1.00 0.00 ? 13 THR A CB   5  
ATOM 5002  O OG1  . THR A 1 13 ? -7.844  -0.590  12.197  1.00 0.00 ? 13 THR A OG1  5  
ATOM 5003  C CG2  . THR A 1 13 ? -8.594  0.896   13.943  1.00 0.00 ? 13 THR A CG2  5  
ATOM 5004  H H    . THR A 1 13 ? -10.437 -0.326  12.346  1.00 0.00 ? 13 THR A H    5  
ATOM 5005  H HA   . THR A 1 13 ? -9.461  2.303   11.791  1.00 0.00 ? 13 THR A HA   5  
ATOM 5006  H HB   . THR A 1 13 ? -7.238  1.365   12.352  1.00 0.00 ? 13 THR A HB   5  
ATOM 5007  H HG1  . THR A 1 13 ? -8.648  -0.994  11.863  1.00 0.00 ? 13 THR A HG1  5  
ATOM 5008  H HG21 . THR A 1 13 ? -8.824  1.928   14.160  1.00 0.00 ? 13 THR A HG21 5  
ATOM 5009  H HG22 . THR A 1 13 ? -7.810  0.555   14.603  1.00 0.00 ? 13 THR A HG22 5  
ATOM 5010  H HG23 . THR A 1 13 ? -9.477  0.292   14.091  1.00 0.00 ? 13 THR A HG23 5  
ATOM 5011  N N    . THR A 1 14 ? -7.830  0.294   9.835   1.00 0.00 ? 14 THR A N    5  
ATOM 5012  C CA   . THR A 1 14 ? -7.318  0.152   8.442   1.00 0.00 ? 14 THR A CA   5  
ATOM 5013  C C    . THR A 1 14 ? -8.292  -0.698  7.623   1.00 0.00 ? 14 THR A C    5  
ATOM 5014  O O    . THR A 1 14 ? -9.192  -1.317  8.155   1.00 0.00 ? 14 THR A O    5  
ATOM 5015  C CB   . THR A 1 14 ? -5.947  -0.526  8.472   1.00 0.00 ? 14 THR A CB   5  
ATOM 5016  O OG1  . THR A 1 14 ? -6.065  -1.801  9.088   1.00 0.00 ? 14 THR A OG1  5  
ATOM 5017  C CG2  . THR A 1 14 ? -4.967  0.338   9.265   1.00 0.00 ? 14 THR A CG2  5  
ATOM 5018  H H    . THR A 1 14 ? -7.474  -0.277  10.547  1.00 0.00 ? 14 THR A H    5  
ATOM 5019  H HA   . THR A 1 14 ? -7.226  1.129   7.990   1.00 0.00 ? 14 THR A HA   5  
ATOM 5020  H HB   . THR A 1 14 ? -5.582  -0.645  7.464   1.00 0.00 ? 14 THR A HB   5  
ATOM 5021  H HG1  . THR A 1 14 ? -6.661  -1.714  9.836   1.00 0.00 ? 14 THR A HG1  5  
ATOM 5022  H HG21 . THR A 1 14 ? -3.992  -0.128  9.262   1.00 0.00 ? 14 THR A HG21 5  
ATOM 5023  H HG22 . THR A 1 14 ? -5.316  0.436   10.282  1.00 0.00 ? 14 THR A HG22 5  
ATOM 5024  H HG23 . THR A 1 14 ? -4.900  1.316   8.811   1.00 0.00 ? 14 THR A HG23 5  
ATOM 5025  N N    . THR A 1 15 ? -8.109  -0.743  6.328   1.00 0.00 ? 15 THR A N    5  
ATOM 5026  C CA   . THR A 1 15 ? -9.009  -1.562  5.462   1.00 0.00 ? 15 THR A CA   5  
ATOM 5027  C C    . THR A 1 15 ? -8.201  -2.117  4.289   1.00 0.00 ? 15 THR A C    5  
ATOM 5028  O O    . THR A 1 15 ? -7.517  -1.384  3.601   1.00 0.00 ? 15 THR A O    5  
ATOM 5029  C CB   . THR A 1 15 ? -10.146 -0.685  4.932   1.00 0.00 ? 15 THR A CB   5  
ATOM 5030  O OG1  . THR A 1 15 ? -9.600  0.438   4.255   1.00 0.00 ? 15 THR A OG1  5  
ATOM 5031  C CG2  . THR A 1 15 ? -11.015 -0.210  6.096   1.00 0.00 ? 15 THR A CG2  5  
ATOM 5032  H H    . THR A 1 15 ? -7.366  -0.248  5.925   1.00 0.00 ? 15 THR A H    5  
ATOM 5033  H HA   . THR A 1 15 ? -9.422  -2.383  6.034   1.00 0.00 ? 15 THR A HA   5  
ATOM 5034  H HB   . THR A 1 15 ? -10.753 -1.258  4.247   1.00 0.00 ? 15 THR A HB   5  
ATOM 5035  H HG1  . THR A 1 15 ? -9.860  1.228   4.734   1.00 0.00 ? 15 THR A HG1  5  
ATOM 5036  H HG21 . THR A 1 15 ? -11.284 -1.055  6.713   1.00 0.00 ? 15 THR A HG21 5  
ATOM 5037  H HG22 . THR A 1 15 ? -11.910 0.255   5.712   1.00 0.00 ? 15 THR A HG22 5  
ATOM 5038  H HG23 . THR A 1 15 ? -10.463 0.505   6.688   1.00 0.00 ? 15 THR A HG23 5  
ATOM 5039  N N    . ARG A 1 16 ? -8.265  -3.406  4.057   1.00 0.00 ? 16 ARG A N    5  
ATOM 5040  C CA   . ARG A 1 16 ? -7.500  -4.024  2.935   1.00 0.00 ? 16 ARG A CA   5  
ATOM 5041  C C    . ARG A 1 16 ? -8.457  -4.909  2.117   1.00 0.00 ? 16 ARG A C    5  
ATOM 5042  O O    . ARG A 1 16 ? -9.245  -5.632  2.691   1.00 0.00 ? 16 ARG A O    5  
ATOM 5043  C CB   . ARG A 1 16 ? -6.384  -4.897  3.538   1.00 0.00 ? 16 ARG A CB   5  
ATOM 5044  C CG   . ARG A 1 16 ? -5.131  -4.052  3.795   1.00 0.00 ? 16 ARG A CG   5  
ATOM 5045  C CD   . ARG A 1 16 ? -4.090  -4.898  4.533   1.00 0.00 ? 16 ARG A CD   5  
ATOM 5046  N NE   . ARG A 1 16 ? -2.989  -4.021  5.020   1.00 0.00 ? 16 ARG A NE   5  
ATOM 5047  C CZ   . ARG A 1 16 ? -2.153  -4.462  5.921   1.00 0.00 ? 16 ARG A CZ   5  
ATOM 5048  N NH1  . ARG A 1 16 ? -2.285  -5.670  6.397   1.00 0.00 ? 16 ARG A NH1  5  
ATOM 5049  N NH2  . ARG A 1 16 ? -1.186  -3.696  6.347   1.00 0.00 ? 16 ARG A NH2  5  
ATOM 5050  H H    . ARG A 1 16 ? -8.810  -3.982  4.626   1.00 0.00 ? 16 ARG A H    5  
ATOM 5051  H HA   . ARG A 1 16 ? -7.069  -3.259  2.302   1.00 0.00 ? 16 ARG A HA   5  
ATOM 5052  H HB2  . ARG A 1 16 ? -6.728  -5.314  4.474   1.00 0.00 ? 16 ARG A HB2  5  
ATOM 5053  H HB3  . ARG A 1 16 ? -6.140  -5.701  2.863   1.00 0.00 ? 16 ARG A HB3  5  
ATOM 5054  H HG2  . ARG A 1 16 ? -4.722  -3.718  2.852   1.00 0.00 ? 16 ARG A HG2  5  
ATOM 5055  H HG3  . ARG A 1 16 ? -5.391  -3.197  4.399   1.00 0.00 ? 16 ARG A HG3  5  
ATOM 5056  H HD2  . ARG A 1 16 ? -4.557  -5.388  5.374   1.00 0.00 ? 16 ARG A HD2  5  
ATOM 5057  H HD3  . ARG A 1 16 ? -3.689  -5.641  3.861   1.00 0.00 ? 16 ARG A HD3  5  
ATOM 5058  H HE   . ARG A 1 16 ? -2.890  -3.114  4.664   1.00 0.00 ? 16 ARG A HE   5  
ATOM 5059  H HH11 . ARG A 1 16 ? -3.026  -6.258  6.072   1.00 0.00 ? 16 ARG A HH11 5  
ATOM 5060  H HH12 . ARG A 1 16 ? -1.645  -6.008  7.087   1.00 0.00 ? 16 ARG A HH12 5  
ATOM 5061  H HH21 . ARG A 1 16 ? -1.084  -2.770  5.983   1.00 0.00 ? 16 ARG A HH21 5  
ATOM 5062  H HH22 . ARG A 1 16 ? -0.547  -4.035  7.037   1.00 0.00 ? 16 ARG A HH22 5  
ATOM 5063  N N    . ARG A 1 17 ? -8.400  -4.830  0.796   1.00 0.00 ? 17 ARG A N    5  
ATOM 5064  C CA   . ARG A 1 17 ? -9.303  -5.642  -0.103  1.00 0.00 ? 17 ARG A CA   5  
ATOM 5065  C C    . ARG A 1 17 ? -10.507 -4.791  -0.532  1.00 0.00 ? 17 ARG A C    5  
ATOM 5066  O O    . ARG A 1 17 ? -10.544 -4.291  -1.638  1.00 0.00 ? 17 ARG A O    5  
ATOM 5067  C CB   . ARG A 1 17 ? -9.785  -6.938  0.585   1.00 0.00 ? 17 ARG A CB   5  
ATOM 5068  C CG   . ARG A 1 17 ? -10.209 -7.975  -0.463  1.00 0.00 ? 17 ARG A CG   5  
ATOM 5069  C CD   . ARG A 1 17 ? -10.422 -9.332  0.213   1.00 0.00 ? 17 ARG A CD   5  
ATOM 5070  N NE   . ARG A 1 17 ? -11.630 -9.270  1.083   1.00 0.00 ? 17 ARG A NE   5  
ATOM 5071  C CZ   . ARG A 1 17 ? -12.175 -10.371 1.522   1.00 0.00 ? 17 ARG A CZ   5  
ATOM 5072  N NH1  . ARG A 1 17 ? -11.659 -11.527 1.202   1.00 0.00 ? 17 ARG A NH1  5  
ATOM 5073  N NH2  . ARG A 1 17 ? -13.235 -10.318 2.281   1.00 0.00 ? 17 ARG A NH2  5  
ATOM 5074  H H    . ARG A 1 17 ? -7.768  -4.199  0.381   1.00 0.00 ? 17 ARG A H    5  
ATOM 5075  H HA   . ARG A 1 17 ? -8.744  -5.900  -0.987  1.00 0.00 ? 17 ARG A HA   5  
ATOM 5076  H HB2  . ARG A 1 17 ? -8.983  -7.348  1.181   1.00 0.00 ? 17 ARG A HB2  5  
ATOM 5077  H HB3  . ARG A 1 17 ? -10.631 -6.716  1.220   1.00 0.00 ? 17 ARG A HB3  5  
ATOM 5078  H HG2  . ARG A 1 17 ? -11.132 -7.660  -0.925  1.00 0.00 ? 17 ARG A HG2  5  
ATOM 5079  H HG3  . ARG A 1 17 ? -9.442  -8.071  -1.216  1.00 0.00 ? 17 ARG A HG3  5  
ATOM 5080  H HD2  . ARG A 1 17 ? -10.564 -10.091 -0.542  1.00 0.00 ? 17 ARG A HD2  5  
ATOM 5081  H HD3  . ARG A 1 17 ? -9.558  -9.577  0.812   1.00 0.00 ? 17 ARG A HD3  5  
ATOM 5082  H HE   . ARG A 1 17 ? -12.016 -8.402  1.325   1.00 0.00 ? 17 ARG A HE   5  
ATOM 5083  H HH11 . ARG A 1 17 ? -10.846 -11.568 0.621   1.00 0.00 ? 17 ARG A HH11 5  
ATOM 5084  H HH12 . ARG A 1 17 ? -12.076 -12.371 1.538   1.00 0.00 ? 17 ARG A HH12 5  
ATOM 5085  H HH21 . ARG A 1 17 ? -13.630 -9.433  2.525   1.00 0.00 ? 17 ARG A HH21 5  
ATOM 5086  H HH22 . ARG A 1 17 ? -13.652 -11.162 2.616   1.00 0.00 ? 17 ARG A HH22 5  
ATOM 5087  N N    . SER A 1 18 ? -11.487 -4.621  0.324   1.00 0.00 ? 18 SER A N    5  
ATOM 5088  C CA   . SER A 1 18 ? -12.691 -3.789  -0.050  1.00 0.00 ? 18 SER A CA   5  
ATOM 5089  C C    . SER A 1 18 ? -12.228 -2.529  -0.791  1.00 0.00 ? 18 SER A C    5  
ATOM 5090  O O    . SER A 1 18 ? -12.957 -1.929  -1.556  1.00 0.00 ? 18 SER A O    5  
ATOM 5091  C CB   . SER A 1 18 ? -13.443 -3.382  1.219   1.00 0.00 ? 18 SER A CB   5  
ATOM 5092  O OG   . SER A 1 18 ? -14.400 -2.381  0.897   1.00 0.00 ? 18 SER A OG   5  
ATOM 5093  H H    . SER A 1 18 ? -11.430 -5.040  1.211   1.00 0.00 ? 18 SER A H    5  
ATOM 5094  H HA   . SER A 1 18 ? -13.349 -4.363  -0.693  1.00 0.00 ? 18 SER A HA   5  
ATOM 5095  H HB2  . SER A 1 18 ? -13.950 -4.239  1.631   1.00 0.00 ? 18 SER A HB2  5  
ATOM 5096  H HB3  . SER A 1 18 ? -12.738 -3.000  1.947   1.00 0.00 ? 18 SER A HB3  5  
ATOM 5097  H HG   . SER A 1 18 ? -14.058 -1.537  1.198   1.00 0.00 ? 18 SER A HG   5  
ATOM 5098  N N    . CYS A 1 19 ? -10.999 -2.162  -0.572  1.00 0.00 ? 19 CYS A N    5  
ATOM 5099  C CA   . CYS A 1 19 ? -10.405 -0.970  -1.255  1.00 0.00 ? 19 CYS A CA   5  
ATOM 5100  C C    . CYS A 1 19 ? -9.102  -1.411  -1.909  1.00 0.00 ? 19 CYS A C    5  
ATOM 5101  O O    . CYS A 1 19 ? -8.476  -2.355  -1.467  1.00 0.00 ? 19 CYS A O    5  
ATOM 5102  C CB   . CYS A 1 19 ? -10.113 0.137   -0.236  1.00 0.00 ? 19 CYS A CB   5  
ATOM 5103  S SG   . CYS A 1 19 ? -11.576 0.431   0.786   1.00 0.00 ? 19 CYS A SG   5  
ATOM 5104  H H    . CYS A 1 19 ? -10.471 -2.714  0.041   1.00 0.00 ? 19 CYS A H    5  
ATOM 5105  H HA   . CYS A 1 19 ? -11.080 -0.598  -2.014  1.00 0.00 ? 19 CYS A HA   5  
ATOM 5106  H HB2  . CYS A 1 19 ? -9.287  -0.161  0.394   1.00 0.00 ? 19 CYS A HB2  5  
ATOM 5107  H HB3  . CYS A 1 19 ? -9.852  1.046   -0.760  1.00 0.00 ? 19 CYS A HB3  5  
ATOM 5108  N N    . SER A 1 20 ? -8.666  -0.752  -2.945  1.00 0.00 ? 20 SER A N    5  
ATOM 5109  C CA   . SER A 1 20 ? -7.388  -1.180  -3.572  1.00 0.00 ? 20 SER A CA   5  
ATOM 5110  C C    . SER A 1 20 ? -6.243  -0.763  -2.656  1.00 0.00 ? 20 SER A C    5  
ATOM 5111  O O    . SER A 1 20 ? -6.053  0.402   -2.369  1.00 0.00 ? 20 SER A O    5  
ATOM 5112  C CB   . SER A 1 20 ? -7.216  -0.527  -4.947  1.00 0.00 ? 20 SER A CB   5  
ATOM 5113  O OG   . SER A 1 20 ? -8.408  -0.701  -5.701  1.00 0.00 ? 20 SER A OG   5  
ATOM 5114  H H    . SER A 1 20 ? -9.155  0.020   -3.299  1.00 0.00 ? 20 SER A H    5  
ATOM 5115  H HA   . SER A 1 20 ? -7.385  -2.255  -3.681  1.00 0.00 ? 20 SER A HA   5  
ATOM 5116  H HB2  . SER A 1 20 ? -7.014  0.525   -4.832  1.00 0.00 ? 20 SER A HB2  5  
ATOM 5117  H HB3  . SER A 1 20 ? -6.385  -0.993  -5.460  1.00 0.00 ? 20 SER A HB3  5  
ATOM 5118  H HG   . SER A 1 20 ? -8.374  -1.567  -6.115  1.00 0.00 ? 20 SER A HG   5  
ATOM 5119  N N    . LYS A 1 21 ? -5.483  -1.714  -2.190  1.00 0.00 ? 21 LYS A N    5  
ATOM 5120  C CA   . LYS A 1 21 ? -4.337  -1.401  -1.274  1.00 0.00 ? 21 LYS A CA   5  
ATOM 5121  C C    . LYS A 1 21 ? -3.131  -2.216  -1.720  1.00 0.00 ? 21 LYS A C    5  
ATOM 5122  O O    . LYS A 1 21 ? -3.154  -3.431  -1.712  1.00 0.00 ? 21 LYS A O    5  
ATOM 5123  C CB   . LYS A 1 21 ? -4.692  -1.760  0.185   1.00 0.00 ? 21 LYS A CB   5  
ATOM 5124  C CG   . LYS A 1 21 ? -5.648  -0.705  0.781   1.00 0.00 ? 21 LYS A CG   5  
ATOM 5125  C CD   . LYS A 1 21 ? -4.848  0.462   1.373   1.00 0.00 ? 21 LYS A CD   5  
ATOM 5126  C CE   . LYS A 1 21 ? -5.814  1.487   1.966   1.00 0.00 ? 21 LYS A CE   5  
ATOM 5127  N NZ   . LYS A 1 21 ? -6.716  1.996   0.895   1.00 0.00 ? 21 LYS A NZ   5  
ATOM 5128  H H    . LYS A 1 21 ? -5.670  -2.646  -2.440  1.00 0.00 ? 21 LYS A H    5  
ATOM 5129  H HA   . LYS A 1 21 ? -4.091  -0.349  -1.337  1.00 0.00 ? 21 LYS A HA   5  
ATOM 5130  H HB2  . LYS A 1 21 ? -5.167  -2.730  0.214   1.00 0.00 ? 21 LYS A HB2  5  
ATOM 5131  H HB3  . LYS A 1 21 ? -3.786  -1.795  0.773   1.00 0.00 ? 21 LYS A HB3  5  
ATOM 5132  H HG2  . LYS A 1 21 ? -6.307  -0.329  0.013   1.00 0.00 ? 21 LYS A HG2  5  
ATOM 5133  H HG3  . LYS A 1 21 ? -6.238  -1.159  1.565   1.00 0.00 ? 21 LYS A HG3  5  
ATOM 5134  H HD2  . LYS A 1 21 ? -4.192  0.093   2.148   1.00 0.00 ? 21 LYS A HD2  5  
ATOM 5135  H HD3  . LYS A 1 21 ? -4.262  0.929   0.597   1.00 0.00 ? 21 LYS A HD3  5  
ATOM 5136  H HE2  . LYS A 1 21 ? -6.404  1.020   2.741   1.00 0.00 ? 21 LYS A HE2  5  
ATOM 5137  H HE3  . LYS A 1 21 ? -5.254  2.310   2.385   1.00 0.00 ? 21 LYS A HE3  5  
ATOM 5138  H HZ1  . LYS A 1 21 ? -6.221  1.966   -0.019  1.00 0.00 ? 21 LYS A HZ1  5  
ATOM 5139  H HZ2  . LYS A 1 21 ? -6.990  2.976   1.106   1.00 0.00 ? 21 LYS A HZ2  5  
ATOM 5140  H HZ3  . LYS A 1 21 ? -7.569  1.399   0.847   1.00 0.00 ? 21 LYS A HZ3  5  
ATOM 5141  N N    . VAL A 1 22 ? -2.074  -1.550  -2.106  1.00 0.00 ? 22 VAL A N    5  
ATOM 5142  C CA   . VAL A 1 22 ? -0.843  -2.272  -2.554  1.00 0.00 ? 22 VAL A CA   5  
ATOM 5143  C C    . VAL A 1 22 ? 0.363   -1.798  -1.745  1.00 0.00 ? 22 VAL A C    5  
ATOM 5144  O O    . VAL A 1 22 ? 0.749   -0.649  -1.821  1.00 0.00 ? 22 VAL A O    5  
ATOM 5145  C CB   . VAL A 1 22 ? -0.616  -1.974  -4.032  1.00 0.00 ? 22 VAL A CB   5  
ATOM 5146  C CG1  . VAL A 1 22 ? 0.478   -2.892  -4.577  1.00 0.00 ? 22 VAL A CG1  5  
ATOM 5147  C CG2  . VAL A 1 22 ? -1.921  -2.218  -4.797  1.00 0.00 ? 22 VAL A CG2  5  
ATOM 5148  H H    . VAL A 1 22 ? -2.099  -0.565  -2.071  1.00 0.00 ? 22 VAL A H    5  
ATOM 5149  H HA   . VAL A 1 22 ? -0.963  -3.338  -2.424  1.00 0.00 ? 22 VAL A HA   5  
ATOM 5150  H HB   . VAL A 1 22 ? -0.316  -0.945  -4.147  1.00 0.00 ? 22 VAL A HB   5  
ATOM 5151  H HG11 . VAL A 1 22 ? 0.201   -3.922  -4.406  1.00 0.00 ? 22 VAL A HG11 5  
ATOM 5152  H HG12 . VAL A 1 22 ? 1.409   -2.681  -4.072  1.00 0.00 ? 22 VAL A HG12 5  
ATOM 5153  H HG13 . VAL A 1 22 ? 0.596   -2.722  -5.637  1.00 0.00 ? 22 VAL A HG13 5  
ATOM 5154  H HG21 . VAL A 1 22 ? -2.621  -1.426  -4.578  1.00 0.00 ? 22 VAL A HG21 5  
ATOM 5155  H HG22 . VAL A 1 22 ? -2.344  -3.166  -4.494  1.00 0.00 ? 22 VAL A HG22 5  
ATOM 5156  H HG23 . VAL A 1 22 ? -1.719  -2.238  -5.858  1.00 0.00 ? 22 VAL A HG23 5  
ATOM 5157  N N    . ILE A 1 23 ? 0.974   -2.677  -0.983  1.00 0.00 ? 23 ILE A N    5  
ATOM 5158  C CA   . ILE A 1 23 ? 2.175   -2.285  -0.180  1.00 0.00 ? 23 ILE A CA   5  
ATOM 5159  C C    . ILE A 1 23 ? 3.359   -3.135  -0.649  1.00 0.00 ? 23 ILE A C    5  
ATOM 5160  O O    . ILE A 1 23 ? 3.435   -4.319  -0.385  1.00 0.00 ? 23 ILE A O    5  
ATOM 5161  C CB   . ILE A 1 23 ? 1.912   -2.550  1.308   1.00 0.00 ? 23 ILE A CB   5  
ATOM 5162  C CG1  . ILE A 1 23 ? 0.802   -1.614  1.826   1.00 0.00 ? 23 ILE A CG1  5  
ATOM 5163  C CG2  . ILE A 1 23 ? 3.194   -2.289  2.100   1.00 0.00 ? 23 ILE A CG2  5  
ATOM 5164  C CD1  . ILE A 1 23 ? -0.579  -2.017  1.267   1.00 0.00 ? 23 ILE A CD1  5  
ATOM 5165  H H    . ILE A 1 23 ? 0.648   -3.602  -0.939  1.00 0.00 ? 23 ILE A H    5  
ATOM 5166  H HA   . ILE A 1 23 ? 2.406   -1.237  -0.324  1.00 0.00 ? 23 ILE A HA   5  
ATOM 5167  H HB   . ILE A 1 23 ? 1.616   -3.579  1.443   1.00 0.00 ? 23 ILE A HB   5  
ATOM 5168  H HG12 . ILE A 1 23 ? 0.775   -1.664  2.906   1.00 0.00 ? 23 ILE A HG12 5  
ATOM 5169  H HG13 . ILE A 1 23 ? 1.025   -0.599  1.527   1.00 0.00 ? 23 ILE A HG13 5  
ATOM 5170  H HG21 . ILE A 1 23 ? 3.897   -3.089  1.921   1.00 0.00 ? 23 ILE A HG21 5  
ATOM 5171  H HG22 . ILE A 1 23 ? 2.964   -2.240  3.153   1.00 0.00 ? 23 ILE A HG22 5  
ATOM 5172  H HG23 . ILE A 1 23 ? 3.629   -1.352  1.782   1.00 0.00 ? 23 ILE A HG23 5  
ATOM 5173  H HD11 . ILE A 1 23 ? -1.307  -1.989  2.066   1.00 0.00 ? 23 ILE A HD11 5  
ATOM 5174  H HD12 . ILE A 1 23 ? -0.546  -3.014  0.851   1.00 0.00 ? 23 ILE A HD12 5  
ATOM 5175  H HD13 . ILE A 1 23 ? -0.872  -1.318  0.498   1.00 0.00 ? 23 ILE A HD13 5  
ATOM 5176  N N    . THR A 1 24 ? 4.275   -2.525  -1.355  1.00 0.00 ? 24 THR A N    5  
ATOM 5177  C CA   . THR A 1 24 ? 5.469   -3.253  -1.877  1.00 0.00 ? 24 THR A CA   5  
ATOM 5178  C C    . THR A 1 24 ? 6.742   -2.490  -1.518  1.00 0.00 ? 24 THR A C    5  
ATOM 5179  O O    . THR A 1 24 ? 6.939   -1.370  -1.947  1.00 0.00 ? 24 THR A O    5  
ATOM 5180  C CB   . THR A 1 24 ? 5.358   -3.373  -3.398  1.00 0.00 ? 24 THR A CB   5  
ATOM 5181  O OG1  . THR A 1 24 ? 4.178   -4.091  -3.728  1.00 0.00 ? 24 THR A OG1  5  
ATOM 5182  C CG2  . THR A 1 24 ? 6.579   -4.115  -3.946  1.00 0.00 ? 24 THR A CG2  5  
ATOM 5183  H H    . THR A 1 24 ? 4.170   -1.582  -1.542  1.00 0.00 ? 24 THR A H    5  
ATOM 5184  H HA   . THR A 1 24 ? 5.513   -4.235  -1.450  1.00 0.00 ? 24 THR A HA   5  
ATOM 5185  H HB   . THR A 1 24 ? 5.315   -2.388  -3.832  1.00 0.00 ? 24 THR A HB   5  
ATOM 5186  H HG1  . THR A 1 24 ? 3.783   -3.675  -4.498  1.00 0.00 ? 24 THR A HG1  5  
ATOM 5187  H HG21 . THR A 1 24 ? 7.436   -3.458  -3.932  1.00 0.00 ? 24 THR A HG21 5  
ATOM 5188  H HG22 . THR A 1 24 ? 6.383   -4.428  -4.961  1.00 0.00 ? 24 THR A HG22 5  
ATOM 5189  H HG23 . THR A 1 24 ? 6.778   -4.981  -3.334  1.00 0.00 ? 24 THR A HG23 5  
ATOM 5190  N N    . LYS A 1 25 ? 7.632   -3.101  -0.777  1.00 0.00 ? 25 LYS A N    5  
ATOM 5191  C CA   . LYS A 1 25 ? 8.922   -2.444  -0.433  1.00 0.00 ? 25 LYS A CA   5  
ATOM 5192  C C    . LYS A 1 25 ? 9.990   -3.345  -1.014  1.00 0.00 ? 25 LYS A C    5  
ATOM 5193  O O    . LYS A 1 25 ? 10.204  -4.436  -0.524  1.00 0.00 ? 25 LYS A O    5  
ATOM 5194  C CB   . LYS A 1 25 ? 9.074   -2.346  1.098   1.00 0.00 ? 25 LYS A CB   5  
ATOM 5195  C CG   . LYS A 1 25 ? 10.099  -1.264  1.452   1.00 0.00 ? 25 LYS A CG   5  
ATOM 5196  C CD   . LYS A 1 25 ? 10.509  -1.406  2.919   1.00 0.00 ? 25 LYS A CD   5  
ATOM 5197  C CE   . LYS A 1 25 ? 9.262   -1.388  3.804   1.00 0.00 ? 25 LYS A CE   5  
ATOM 5198  N NZ   . LYS A 1 25 ? 8.314   -0.350  3.309   1.00 0.00 ? 25 LYS A NZ   5  
ATOM 5199  H H    . LYS A 1 25 ? 7.479   -4.029  -0.488  1.00 0.00 ? 25 LYS A H    5  
ATOM 5200  H HA   . LYS A 1 25 ? 8.991   -1.456  -0.883  1.00 0.00 ? 25 LYS A HA   5  
ATOM 5201  H HB2  . LYS A 1 25 ? 8.120   -2.090  1.536   1.00 0.00 ? 25 LYS A HB2  5  
ATOM 5202  H HB3  . LYS A 1 25 ? 9.405   -3.295  1.494   1.00 0.00 ? 25 LYS A HB3  5  
ATOM 5203  H HG2  . LYS A 1 25 ? 10.971  -1.374  0.823   1.00 0.00 ? 25 LYS A HG2  5  
ATOM 5204  H HG3  . LYS A 1 25 ? 9.663   -0.289  1.294   1.00 0.00 ? 25 LYS A HG3  5  
ATOM 5205  H HD2  . LYS A 1 25 ? 11.036  -2.340  3.057   1.00 0.00 ? 25 LYS A HD2  5  
ATOM 5206  H HD3  . LYS A 1 25 ? 11.154  -0.585  3.193   1.00 0.00 ? 25 LYS A HD3  5  
ATOM 5207  H HE2  . LYS A 1 25 ? 8.784   -2.356  3.772   1.00 0.00 ? 25 LYS A HE2  5  
ATOM 5208  H HE3  . LYS A 1 25 ? 9.546   -1.160  4.821   1.00 0.00 ? 25 LYS A HE3  5  
ATOM 5209  H HZ1  . LYS A 1 25 ? 8.837   0.369   2.771   1.00 0.00 ? 25 LYS A HZ1  5  
ATOM 5210  H HZ2  . LYS A 1 25 ? 7.840   0.101   4.117   1.00 0.00 ? 25 LYS A HZ2  5  
ATOM 5211  H HZ3  . LYS A 1 25 ? 7.603   -0.796  2.694   1.00 0.00 ? 25 LYS A HZ3  5  
ATOM 5212  N N    . THR A 1 26 ? 10.644  -2.929  -2.064  1.00 0.00 ? 26 THR A N    5  
ATOM 5213  C CA   . THR A 1 26 ? 11.679  -3.803  -2.685  1.00 0.00 ? 26 THR A CA   5  
ATOM 5214  C C    . THR A 1 26 ? 13.046  -3.132  -2.569  1.00 0.00 ? 26 THR A C    5  
ATOM 5215  O O    . THR A 1 26 ? 13.257  -2.054  -3.091  1.00 0.00 ? 26 THR A O    5  
ATOM 5216  C CB   . THR A 1 26 ? 11.346  -4.004  -4.164  1.00 0.00 ? 26 THR A CB   5  
ATOM 5217  O OG1  . THR A 1 26 ? 10.053  -4.577  -4.283  1.00 0.00 ? 26 THR A OG1  5  
ATOM 5218  C CG2  . THR A 1 26 ? 12.378  -4.935  -4.800  1.00 0.00 ? 26 THR A CG2  5  
ATOM 5219  H H    . THR A 1 26 ? 10.450  -2.053  -2.458  1.00 0.00 ? 26 THR A H    5  
ATOM 5220  H HA   . THR A 1 26 ? 11.692  -4.761  -2.190  1.00 0.00 ? 26 THR A HA   5  
ATOM 5221  H HB   . THR A 1 26 ? 11.366  -3.052  -4.672  1.00 0.00 ? 26 THR A HB   5  
ATOM 5222  H HG1  . THR A 1 26 ? 10.005  -5.032  -5.128  1.00 0.00 ? 26 THR A HG1  5  
ATOM 5223  H HG21 . THR A 1 26 ? 12.046  -5.221  -5.787  1.00 0.00 ? 26 THR A HG21 5  
ATOM 5224  H HG22 . THR A 1 26 ? 12.492  -5.818  -4.188  1.00 0.00 ? 26 THR A HG22 5  
ATOM 5225  H HG23 . THR A 1 26 ? 13.327  -4.425  -4.874  1.00 0.00 ? 26 THR A HG23 5  
ATOM 5226  N N    . VAL A 1 27 ? 13.979  -3.760  -1.895  1.00 0.00 ? 27 VAL A N    5  
ATOM 5227  C CA   . VAL A 1 27 ? 15.343  -3.157  -1.749  1.00 0.00 ? 27 VAL A CA   5  
ATOM 5228  C C    . VAL A 1 27 ? 16.370  -4.028  -2.469  1.00 0.00 ? 27 VAL A C    5  
ATOM 5229  O O    . VAL A 1 27 ? 16.715  -5.108  -2.026  1.00 0.00 ? 27 VAL A O    5  
ATOM 5230  C CB   . VAL A 1 27 ? 15.699  -3.080  -0.262  1.00 0.00 ? 27 VAL A CB   5  
ATOM 5231  C CG1  . VAL A 1 27 ? 16.968  -2.242  -0.083  1.00 0.00 ? 27 VAL A CG1  5  
ATOM 5232  C CG2  . VAL A 1 27 ? 14.547  -2.424  0.501   1.00 0.00 ? 27 VAL A CG2  5  
ATOM 5233  H H    . VAL A 1 27 ? 13.781  -4.628  -1.488  1.00 0.00 ? 27 VAL A H    5  
ATOM 5234  H HA   . VAL A 1 27 ? 15.364  -2.161  -2.170  1.00 0.00 ? 27 VAL A HA   5  
ATOM 5235  H HB   . VAL A 1 27 ? 15.870  -4.076  0.122   1.00 0.00 ? 27 VAL A HB   5  
ATOM 5236  H HG11 . VAL A 1 27 ? 17.800  -2.744  -0.552  1.00 0.00 ? 27 VAL A HG11 5  
ATOM 5237  H HG12 . VAL A 1 27 ? 17.169  -2.115  0.970   1.00 0.00 ? 27 VAL A HG12 5  
ATOM 5238  H HG13 . VAL A 1 27 ? 16.826  -1.274  -0.541  1.00 0.00 ? 27 VAL A HG13 5  
ATOM 5239  H HG21 . VAL A 1 27 ? 14.814  -2.326  1.543   1.00 0.00 ? 27 VAL A HG21 5  
ATOM 5240  H HG22 . VAL A 1 27 ? 13.662  -3.037  0.413   1.00 0.00 ? 27 VAL A HG22 5  
ATOM 5241  H HG23 . VAL A 1 27 ? 14.350  -1.446  0.086   1.00 0.00 ? 27 VAL A HG23 5  
ATOM 5242  N N    . THR A 1 28 ? 16.862  -3.555  -3.585  1.00 0.00 ? 28 THR A N    5  
ATOM 5243  C CA   . THR A 1 28 ? 17.874  -4.335  -4.357  1.00 0.00 ? 28 THR A CA   5  
ATOM 5244  C C    . THR A 1 28 ? 19.276  -3.909  -3.922  1.00 0.00 ? 28 THR A C    5  
ATOM 5245  O O    . THR A 1 28 ? 19.728  -2.825  -4.238  1.00 0.00 ? 28 THR A O    5  
ATOM 5246  C CB   . THR A 1 28 ? 17.698  -4.054  -5.852  1.00 0.00 ? 28 THR A CB   5  
ATOM 5247  O OG1  . THR A 1 28 ? 16.372  -4.383  -6.241  1.00 0.00 ? 28 THR A OG1  5  
ATOM 5248  C CG2  . THR A 1 28 ? 18.692  -4.897  -6.653  1.00 0.00 ? 28 THR A CG2  5  
ATOM 5249  H H    . THR A 1 28 ? 16.542  -2.687  -3.914  1.00 0.00 ? 28 THR A H    5  
ATOM 5250  H HA   . THR A 1 28 ? 17.746  -5.390  -4.172  1.00 0.00 ? 28 THR A HA   5  
ATOM 5251  H HB   . THR A 1 28 ? 17.882  -3.008  -6.046  1.00 0.00 ? 28 THR A HB   5  
ATOM 5252  H HG1  . THR A 1 28 ? 16.343  -5.324  -6.428  1.00 0.00 ? 28 THR A HG1  5  
ATOM 5253  H HG21 . THR A 1 28 ? 18.564  -5.940  -6.402  1.00 0.00 ? 28 THR A HG21 5  
ATOM 5254  H HG22 . THR A 1 28 ? 19.699  -4.590  -6.416  1.00 0.00 ? 28 THR A HG22 5  
ATOM 5255  H HG23 . THR A 1 28 ? 18.513  -4.757  -7.710  1.00 0.00 ? 28 THR A HG23 5  
ATOM 5256  N N    . ASN A 1 29 ? 19.971  -4.744  -3.189  1.00 0.00 ? 29 ASN A N    5  
ATOM 5257  C CA   . ASN A 1 29 ? 21.343  -4.378  -2.727  1.00 0.00 ? 29 ASN A CA   5  
ATOM 5258  C C    . ASN A 1 29 ? 22.384  -4.947  -3.694  1.00 0.00 ? 29 ASN A C    5  
ATOM 5259  O O    . ASN A 1 29 ? 22.530  -6.148  -3.836  1.00 0.00 ? 29 ASN A O    5  
ATOM 5260  C CB   . ASN A 1 29 ? 21.576  -4.960  -1.331  1.00 0.00 ? 29 ASN A CB   5  
ATOM 5261  C CG   . ASN A 1 29 ? 22.987  -4.610  -0.858  1.00 0.00 ? 29 ASN A CG   5  
ATOM 5262  O OD1  . ASN A 1 29 ? 23.405  -5.024  0.205   1.00 0.00 ? 29 ASN A OD1  5  
ATOM 5263  N ND2  . ASN A 1 29 ? 23.746  -3.859  -1.609  1.00 0.00 ? 29 ASN A ND2  5  
ATOM 5264  H H    . ASN A 1 29 ? 19.594  -5.610  -2.928  1.00 0.00 ? 29 ASN A H    5  
ATOM 5265  H HA   . ASN A 1 29 ? 21.443  -3.302  -2.686  1.00 0.00 ? 29 ASN A HA   5  
ATOM 5266  H HB2  . ASN A 1 29 ? 20.851  -4.546  -0.644  1.00 0.00 ? 29 ASN A HB2  5  
ATOM 5267  H HB3  . ASN A 1 29 ? 21.465  -6.034  -1.365  1.00 0.00 ? 29 ASN A HB3  5  
ATOM 5268  H HD21 . ASN A 1 29 ? 23.409  -3.525  -2.467  1.00 0.00 ? 29 ASN A HD21 5  
ATOM 5269  H HD22 . ASN A 1 29 ? 24.652  -3.628  -1.315  1.00 0.00 ? 29 ASN A HD22 5  
ATOM 5270  N N    . ALA A 1 30 ? 23.108  -4.087  -4.355  1.00 0.00 ? 30 ALA A N    5  
ATOM 5271  C CA   . ALA A 1 30 ? 24.151  -4.538  -5.319  1.00 0.00 ? 30 ALA A CA   5  
ATOM 5272  C C    . ALA A 1 30 ? 25.046  -5.603  -4.684  1.00 0.00 ? 30 ALA A C    5  
ATOM 5273  O O    . ALA A 1 30 ? 25.859  -6.212  -5.352  1.00 0.00 ? 30 ALA A O    5  
ATOM 5274  C CB   . ALA A 1 30 ? 25.007  -3.339  -5.734  1.00 0.00 ? 30 ALA A CB   5  
ATOM 5275  H H    . ALA A 1 30 ? 22.971  -3.125  -4.222  1.00 0.00 ? 30 ALA A H    5  
ATOM 5276  H HA   . ALA A 1 30 ? 23.671  -4.950  -6.194  1.00 0.00 ? 30 ALA A HA   5  
ATOM 5277  H HB1  . ALA A 1 30 ? 25.736  -3.654  -6.466  1.00 0.00 ? 30 ALA A HB1  5  
ATOM 5278  H HB2  . ALA A 1 30 ? 25.515  -2.943  -4.868  1.00 0.00 ? 30 ALA A HB2  5  
ATOM 5279  H HB3  . ALA A 1 30 ? 24.375  -2.575  -6.162  1.00 0.00 ? 30 ALA A HB3  5  
ATOM 5280  N N    . ASP A 1 31 ? 24.929  -5.826  -3.404  1.00 0.00 ? 31 ASP A N    5  
ATOM 5281  C CA   . ASP A 1 31 ? 25.807  -6.839  -2.758  1.00 0.00 ? 31 ASP A CA   5  
ATOM 5282  C C    . ASP A 1 31 ? 25.424  -8.241  -3.247  1.00 0.00 ? 31 ASP A C    5  
ATOM 5283  O O    . ASP A 1 31 ? 25.997  -9.228  -2.833  1.00 0.00 ? 31 ASP A O    5  
ATOM 5284  C CB   . ASP A 1 31 ? 25.651  -6.760  -1.235  1.00 0.00 ? 31 ASP A CB   5  
ATOM 5285  C CG   . ASP A 1 31 ? 26.400  -5.534  -0.707  1.00 0.00 ? 31 ASP A CG   5  
ATOM 5286  O OD1  . ASP A 1 31 ? 26.289  -4.487  -1.323  1.00 0.00 ? 31 ASP A OD1  5  
ATOM 5287  O OD2  . ASP A 1 31 ? 27.070  -5.663  0.304   1.00 0.00 ? 31 ASP A OD2  5  
ATOM 5288  H H    . ASP A 1 31 ? 24.281  -5.323  -2.869  1.00 0.00 ? 31 ASP A H    5  
ATOM 5289  H HA   . ASP A 1 31 ? 26.836  -6.641  -3.023  1.00 0.00 ? 31 ASP A HA   5  
ATOM 5290  H HB2  . ASP A 1 31 ? 24.605  -6.677  -0.983  1.00 0.00 ? 31 ASP A HB2  5  
ATOM 5291  H HB3  . ASP A 1 31 ? 26.061  -7.650  -0.783  1.00 0.00 ? 31 ASP A HB3  5  
ATOM 5292  N N    . GLY A 1 32 ? 24.479  -8.336  -4.150  1.00 0.00 ? 32 GLY A N    5  
ATOM 5293  C CA   . GLY A 1 32 ? 24.086  -9.675  -4.692  1.00 0.00 ? 32 GLY A CA   5  
ATOM 5294  C C    . GLY A 1 32 ? 22.878  -10.237 -3.941  1.00 0.00 ? 32 GLY A C    5  
ATOM 5295  O O    . GLY A 1 32 ? 22.508  -11.379 -4.133  1.00 0.00 ? 32 GLY A O    5  
ATOM 5296  H H    . GLY A 1 32 ? 24.040  -7.526  -4.486  1.00 0.00 ? 32 GLY A H    5  
ATOM 5297  H HA2  . GLY A 1 32 ? 23.835  -9.570  -5.738  1.00 0.00 ? 32 GLY A HA2  5  
ATOM 5298  H HA3  . GLY A 1 32 ? 24.915  -10.364 -4.596  1.00 0.00 ? 32 GLY A HA3  5  
ATOM 5299  N N    . ARG A 1 33 ? 22.261  -9.462  -3.084  1.00 0.00 ? 33 ARG A N    5  
ATOM 5300  C CA   . ARG A 1 33 ? 21.076  -9.971  -2.318  1.00 0.00 ? 33 ARG A CA   5  
ATOM 5301  C C    . ARG A 1 33 ? 19.979  -8.910  -2.315  1.00 0.00 ? 33 ARG A C    5  
ATOM 5302  O O    . ARG A 1 33 ? 20.231  -7.737  -2.513  1.00 0.00 ? 33 ARG A O    5  
ATOM 5303  C CB   . ARG A 1 33 ? 21.497  -10.276 -0.874  1.00 0.00 ? 33 ARG A CB   5  
ATOM 5304  C CG   . ARG A 1 33 ? 21.954  -8.978  -0.161  1.00 0.00 ? 33 ARG A CG   5  
ATOM 5305  C CD   . ARG A 1 33 ? 20.854  -8.457  0.775   1.00 0.00 ? 33 ARG A CD   5  
ATOM 5306  N NE   . ARG A 1 33 ? 21.276  -7.149  1.351   1.00 0.00 ? 33 ARG A NE   5  
ATOM 5307  C CZ   . ARG A 1 33 ? 20.398  -6.377  1.931   1.00 0.00 ? 33 ARG A CZ   5  
ATOM 5308  N NH1  . ARG A 1 33 ? 19.150  -6.750  2.008   1.00 0.00 ? 33 ARG A NH1  5  
ATOM 5309  N NH2  . ARG A 1 33 ? 20.769  -5.231  2.434   1.00 0.00 ? 33 ARG A NH2  5  
ATOM 5310  H H    . ARG A 1 33 ? 22.577  -8.546  -2.935  1.00 0.00 ? 33 ARG A H    5  
ATOM 5311  H HA   . ARG A 1 33 ? 20.693  -10.873 -2.777  1.00 0.00 ? 33 ARG A HA   5  
ATOM 5312  H HB2  . ARG A 1 33 ? 20.663  -10.717 -0.346  1.00 0.00 ? 33 ARG A HB2  5  
ATOM 5313  H HB3  . ARG A 1 33 ? 22.316  -10.983 -0.890  1.00 0.00 ? 33 ARG A HB3  5  
ATOM 5314  H HG2  . ARG A 1 33 ? 22.842  -9.179  0.423   1.00 0.00 ? 33 ARG A HG2  5  
ATOM 5315  H HG3  . ARG A 1 33 ? 22.181  -8.217  -0.893  1.00 0.00 ? 33 ARG A HG3  5  
ATOM 5316  H HD2  . ARG A 1 33 ? 19.937  -8.327  0.218   1.00 0.00 ? 33 ARG A HD2  5  
ATOM 5317  H HD3  . ARG A 1 33 ? 20.693  -9.166  1.572   1.00 0.00 ? 33 ARG A HD3  5  
ATOM 5318  H HE   . ARG A 1 33 ? 22.212  -6.868  1.293   1.00 0.00 ? 33 ARG A HE   5  
ATOM 5319  H HH11 . ARG A 1 33 ? 18.866  -7.628  1.621   1.00 0.00 ? 33 ARG A HH11 5  
ATOM 5320  H HH12 . ARG A 1 33 ? 18.478  -6.158  2.452   1.00 0.00 ? 33 ARG A HH12 5  
ATOM 5321  H HH21 . ARG A 1 33 ? 21.724  -4.945  2.373   1.00 0.00 ? 33 ARG A HH21 5  
ATOM 5322  H HH22 . ARG A 1 33 ? 20.096  -4.639  2.877   1.00 0.00 ? 33 ARG A HH22 5  
ATOM 5323  N N    . THR A 1 34 ? 18.757  -9.314  -2.099  1.00 0.00 ? 34 THR A N    5  
ATOM 5324  C CA   . THR A 1 34 ? 17.637  -8.331  -2.092  1.00 0.00 ? 34 THR A CA   5  
ATOM 5325  C C    . THR A 1 34 ? 16.442  -8.895  -1.318  1.00 0.00 ? 34 THR A C    5  
ATOM 5326  O O    . THR A 1 34 ? 16.146  -10.072 -1.377  1.00 0.00 ? 34 THR A O    5  
ATOM 5327  C CB   . THR A 1 34 ? 17.212  -8.044  -3.534  1.00 0.00 ? 34 THR A CB   5  
ATOM 5328  O OG1  . THR A 1 34 ? 16.203  -7.043  -3.540  1.00 0.00 ? 34 THR A OG1  5  
ATOM 5329  C CG2  . THR A 1 34 ? 16.668  -9.323  -4.171  1.00 0.00 ? 34 THR A CG2  5  
ATOM 5330  H H    . THR A 1 34 ? 18.579  -10.263 -1.949  1.00 0.00 ? 34 THR A H    5  
ATOM 5331  H HA   . THR A 1 34 ? 17.964  -7.414  -1.627  1.00 0.00 ? 34 THR A HA   5  
ATOM 5332  H HB   . THR A 1 34 ? 18.065  -7.701  -4.100  1.00 0.00 ? 34 THR A HB   5  
ATOM 5333  H HG1  . THR A 1 34 ? 15.804  -7.028  -4.413  1.00 0.00 ? 34 THR A HG1  5  
ATOM 5334  H HG21 . THR A 1 34 ? 15.699  -9.550  -3.753  1.00 0.00 ? 34 THR A HG21 5  
ATOM 5335  H HG22 . THR A 1 34 ? 17.346  -10.140 -3.974  1.00 0.00 ? 34 THR A HG22 5  
ATOM 5336  H HG23 . THR A 1 34 ? 16.575  -9.183  -5.238  1.00 0.00 ? 34 THR A HG23 5  
ATOM 5337  N N    . GLU A 1 35 ? 15.741  -8.046  -0.611  1.00 0.00 ? 35 GLU A N    5  
ATOM 5338  C CA   . GLU A 1 35 ? 14.535  -8.484  0.164   1.00 0.00 ? 35 GLU A CA   5  
ATOM 5339  C C    . GLU A 1 35 ? 13.312  -7.849  -0.504  1.00 0.00 ? 35 GLU A C    5  
ATOM 5340  O O    . GLU A 1 35 ? 13.399  -6.742  -0.997  1.00 0.00 ? 35 GLU A O    5  
ATOM 5341  C CB   . GLU A 1 35 ? 14.658  -7.984  1.609   1.00 0.00 ? 35 GLU A CB   5  
ATOM 5342  C CG   . GLU A 1 35 ? 16.008  -8.418  2.186   1.00 0.00 ? 35 GLU A CG   5  
ATOM 5343  C CD   . GLU A 1 35 ? 16.058  -9.944  2.272   1.00 0.00 ? 35 GLU A CD   5  
ATOM 5344  O OE1  . GLU A 1 35 ? 15.059  -10.530 2.656   1.00 0.00 ? 35 GLU A OE1  5  
ATOM 5345  O OE2  . GLU A 1 35 ? 17.096  -10.502 1.953   1.00 0.00 ? 35 GLU A OE2  5  
ATOM 5346  H H    . GLU A 1 35 ? 16.001  -7.098  -0.604  1.00 0.00 ? 35 GLU A H    5  
ATOM 5347  H HA   . GLU A 1 35 ? 14.444  -9.562  0.151   1.00 0.00 ? 35 GLU A HA   5  
ATOM 5348  H HB2  . GLU A 1 35 ? 14.591  -6.906  1.623   1.00 0.00 ? 35 GLU A HB2  5  
ATOM 5349  H HB3  . GLU A 1 35 ? 13.864  -8.400  2.209   1.00 0.00 ? 35 GLU A HB3  5  
ATOM 5350  H HG2  . GLU A 1 35 ? 16.804  -8.065  1.547   1.00 0.00 ? 35 GLU A HG2  5  
ATOM 5351  H HG3  . GLU A 1 35 ? 16.127  -8.000  3.175   1.00 0.00 ? 35 GLU A HG3  5  
ATOM 5352  N N    . THR A 1 36 ? 12.175  -8.517  -0.542  1.00 0.00 ? 36 THR A N    5  
ATOM 5353  C CA   . THR A 1 36 ? 10.982  -7.914  -1.192  1.00 0.00 ? 36 THR A CA   5  
ATOM 5354  C C    . THR A 1 36 ? 9.786   -8.077  -0.273  1.00 0.00 ? 36 THR A C    5  
ATOM 5355  O O    . THR A 1 36 ? 9.273   -9.163  -0.090  1.00 0.00 ? 36 THR A O    5  
ATOM 5356  C CB   . THR A 1 36 ? 10.710  -8.637  -2.515  1.00 0.00 ? 36 THR A CB   5  
ATOM 5357  O OG1  . THR A 1 36 ? 11.867  -8.569  -3.336  1.00 0.00 ? 36 THR A OG1  5  
ATOM 5358  C CG2  . THR A 1 36 ? 9.533   -7.973  -3.232  1.00 0.00 ? 36 THR A CG2  5  
ATOM 5359  H H    . THR A 1 36 ? 12.091  -9.409  -0.143  1.00 0.00 ? 36 THR A H    5  
ATOM 5360  H HA   . THR A 1 36 ? 11.140  -6.864  -1.384  1.00 0.00 ? 36 THR A HA   5  
ATOM 5361  H HB   . THR A 1 36 ? 10.469  -9.670  -2.317  1.00 0.00 ? 36 THR A HB   5  
ATOM 5362  H HG1  . THR A 1 36 ? 12.303  -7.730  -3.168  1.00 0.00 ? 36 THR A HG1  5  
ATOM 5363  H HG21 . THR A 1 36 ? 9.448   -8.375  -4.230  1.00 0.00 ? 36 THR A HG21 5  
ATOM 5364  H HG22 . THR A 1 36 ? 9.699   -6.908  -3.284  1.00 0.00 ? 36 THR A HG22 5  
ATOM 5365  H HG23 . THR A 1 36 ? 8.622   -8.170  -2.687  1.00 0.00 ? 36 THR A HG23 5  
ATOM 5366  N N    . THR A 1 37 ? 9.298   -6.996  0.264   1.00 0.00 ? 37 THR A N    5  
ATOM 5367  C CA   . THR A 1 37 ? 8.088   -7.079  1.123   1.00 0.00 ? 37 THR A CA   5  
ATOM 5368  C C    . THR A 1 37 ? 6.926   -6.767  0.204   1.00 0.00 ? 37 THR A C    5  
ATOM 5369  O O    . THR A 1 37 ? 6.843   -5.686  -0.330  1.00 0.00 ? 37 THR A O    5  
ATOM 5370  C CB   . THR A 1 37 ? 8.159   -6.043  2.254   1.00 0.00 ? 37 THR A CB   5  
ATOM 5371  O OG1  . THR A 1 37 ? 9.468   -6.036  2.806   1.00 0.00 ? 37 THR A OG1  5  
ATOM 5372  C CG2  . THR A 1 37 ? 7.145   -6.406  3.344   1.00 0.00 ? 37 THR A CG2  5  
ATOM 5373  H H    . THR A 1 37 ? 9.696   -6.120  0.056   1.00 0.00 ? 37 THR A H    5  
ATOM 5374  H HA   . THR A 1 37 ? 7.974   -8.080  1.535   1.00 0.00 ? 37 THR A HA   5  
ATOM 5375  H HB   . THR A 1 37 ? 7.927   -5.064  1.867   1.00 0.00 ? 37 THR A HB   5  
ATOM 5376  H HG1  . THR A 1 37 ? 9.612   -5.179  3.211   1.00 0.00 ? 37 THR A HG1  5  
ATOM 5377  H HG21 . THR A 1 37 ? 7.331   -7.413  3.689   1.00 0.00 ? 37 THR A HG21 5  
ATOM 5378  H HG22 . THR A 1 37 ? 6.146   -6.341  2.941   1.00 0.00 ? 37 THR A HG22 5  
ATOM 5379  H HG23 . THR A 1 37 ? 7.246   -5.718  4.171   1.00 0.00 ? 37 THR A HG23 5  
ATOM 5380  N N    . LYS A 1 38 ? 6.043   -7.700  -0.005  1.00 0.00 ? 38 LYS A N    5  
ATOM 5381  C CA   . LYS A 1 38 ? 4.882   -7.461  -0.922  1.00 0.00 ? 38 LYS A CA   5  
ATOM 5382  C C    . LYS A 1 38 ? 3.577   -7.851  -0.229  1.00 0.00 ? 38 LYS A C    5  
ATOM 5383  O O    . LYS A 1 38 ? 3.537   -8.725  0.615   1.00 0.00 ? 38 LYS A O    5  
ATOM 5384  C CB   . LYS A 1 38 ? 5.058   -8.311  -2.182  1.00 0.00 ? 38 LYS A CB   5  
ATOM 5385  C CG   . LYS A 1 38 ? 5.286   -9.773  -1.792  1.00 0.00 ? 38 LYS A CG   5  
ATOM 5386  C CD   . LYS A 1 38 ? 5.357   -10.632 -3.055  1.00 0.00 ? 38 LYS A CD   5  
ATOM 5387  C CE   . LYS A 1 38 ? 5.526   -12.101 -2.666  1.00 0.00 ? 38 LYS A CE   5  
ATOM 5388  N NZ   . LYS A 1 38 ? 6.918   -12.334 -2.188  1.00 0.00 ? 38 LYS A NZ   5  
ATOM 5389  H H    . LYS A 1 38 ? 6.125   -8.565  0.431   1.00 0.00 ? 38 LYS A H    5  
ATOM 5390  H HA   . LYS A 1 38 ? 4.831   -6.421  -1.202  1.00 0.00 ? 38 LYS A HA   5  
ATOM 5391  H HB2  . LYS A 1 38 ? 4.169   -8.236  -2.792  1.00 0.00 ? 38 LYS A HB2  5  
ATOM 5392  H HB3  . LYS A 1 38 ? 5.909   -7.954  -2.742  1.00 0.00 ? 38 LYS A HB3  5  
ATOM 5393  H HG2  . LYS A 1 38 ? 6.214   -9.858  -1.244  1.00 0.00 ? 38 LYS A HG2  5  
ATOM 5394  H HG3  . LYS A 1 38 ? 4.470   -10.114 -1.173  1.00 0.00 ? 38 LYS A HG3  5  
ATOM 5395  H HD2  . LYS A 1 38 ? 4.447   -10.511 -3.624  1.00 0.00 ? 38 LYS A HD2  5  
ATOM 5396  H HD3  . LYS A 1 38 ? 6.200   -10.321 -3.654  1.00 0.00 ? 38 LYS A HD3  5  
ATOM 5397  H HE2  . LYS A 1 38 ? 4.829   -12.347 -1.878  1.00 0.00 ? 38 LYS A HE2  5  
ATOM 5398  H HE3  . LYS A 1 38 ? 5.331   -12.725 -3.526  1.00 0.00 ? 38 LYS A HE3  5  
ATOM 5399  H HZ1  . LYS A 1 38 ? 7.170   -13.333 -2.325  1.00 0.00 ? 38 LYS A HZ1  5  
ATOM 5400  H HZ2  . LYS A 1 38 ? 6.982   -12.098 -1.178  1.00 0.00 ? 38 LYS A HZ2  5  
ATOM 5401  H HZ3  . LYS A 1 38 ? 7.574   -11.732 -2.729  1.00 0.00 ? 38 LYS A HZ3  5  
ATOM 5402  N N    . GLU A 1 39 ? 2.508   -7.203  -0.594  1.00 0.00 ? 39 GLU A N    5  
ATOM 5403  C CA   . GLU A 1 39 ? 1.183   -7.506  0.011   1.00 0.00 ? 39 GLU A CA   5  
ATOM 5404  C C    . GLU A 1 39 ? 0.106   -6.870  -0.876  1.00 0.00 ? 39 GLU A C    5  
ATOM 5405  O O    . GLU A 1 39 ? -0.317  -5.756  -0.637  1.00 0.00 ? 39 GLU A O    5  
ATOM 5406  C CB   . GLU A 1 39 ? 1.110   -6.902  1.415   1.00 0.00 ? 39 GLU A CB   5  
ATOM 5407  C CG   . GLU A 1 39 ? -0.122  -7.444  2.141   1.00 0.00 ? 39 GLU A CG   5  
ATOM 5408  C CD   . GLU A 1 39 ? 0.106   -8.910  2.510   1.00 0.00 ? 39 GLU A CD   5  
ATOM 5409  O OE1  . GLU A 1 39 ? 0.971   -9.167  3.331   1.00 0.00 ? 39 GLU A OE1  5  
ATOM 5410  O OE2  . GLU A 1 39 ? -0.589  -9.752  1.965   1.00 0.00 ? 39 GLU A OE2  5  
ATOM 5411  H H    . GLU A 1 39 ? 2.577   -6.507  -1.281  1.00 0.00 ? 39 GLU A H    5  
ATOM 5412  H HA   . GLU A 1 39 ? 1.040   -8.576  0.068   1.00 0.00 ? 39 GLU A HA   5  
ATOM 5413  H HB2  . GLU A 1 39 ? 2.000   -7.166  1.966   1.00 0.00 ? 39 GLU A HB2  5  
ATOM 5414  H HB3  . GLU A 1 39 ? 1.038   -5.829  1.340   1.00 0.00 ? 39 GLU A HB3  5  
ATOM 5415  H HG2  . GLU A 1 39 ? -0.291  -6.867  3.039   1.00 0.00 ? 39 GLU A HG2  5  
ATOM 5416  H HG3  . GLU A 1 39 ? -0.984  -7.366  1.496   1.00 0.00 ? 39 GLU A HG3  5  
ATOM 5417  N N    . VAL A 1 40 ? -0.330  -7.552  -1.911  1.00 0.00 ? 40 VAL A N    5  
ATOM 5418  C CA   . VAL A 1 40 ? -1.362  -6.964  -2.820  1.00 0.00 ? 40 VAL A CA   5  
ATOM 5419  C C    . VAL A 1 40 ? -2.747  -7.523  -2.479  1.00 0.00 ? 40 VAL A C    5  
ATOM 5420  O O    . VAL A 1 40 ? -2.996  -8.706  -2.605  1.00 0.00 ? 40 VAL A O    5  
ATOM 5421  C CB   . VAL A 1 40 ? -1.010  -7.330  -4.265  1.00 0.00 ? 40 VAL A CB   5  
ATOM 5422  C CG1  . VAL A 1 40 ? -1.799  -6.442  -5.231  1.00 0.00 ? 40 VAL A CG1  5  
ATOM 5423  C CG2  . VAL A 1 40 ? 0.490   -7.118  -4.490  1.00 0.00 ? 40 VAL A CG2  5  
ATOM 5424  H H    . VAL A 1 40 ? 0.025   -8.449  -2.096  1.00 0.00 ? 40 VAL A H    5  
ATOM 5425  H HA   . VAL A 1 40 ? -1.371  -5.886  -2.721  1.00 0.00 ? 40 VAL A HA   5  
ATOM 5426  H HB   . VAL A 1 40 ? -1.258  -8.366  -4.445  1.00 0.00 ? 40 VAL A HB   5  
ATOM 5427  H HG11 . VAL A 1 40 ? -1.500  -5.413  -5.102  1.00 0.00 ? 40 VAL A HG11 5  
ATOM 5428  H HG12 . VAL A 1 40 ? -2.855  -6.539  -5.028  1.00 0.00 ? 40 VAL A HG12 5  
ATOM 5429  H HG13 . VAL A 1 40 ? -1.599  -6.751  -6.247  1.00 0.00 ? 40 VAL A HG13 5  
ATOM 5430  H HG21 . VAL A 1 40 ? 0.700   -7.123  -5.550  1.00 0.00 ? 40 VAL A HG21 5  
ATOM 5431  H HG22 . VAL A 1 40 ? 1.042   -7.912  -4.010  1.00 0.00 ? 40 VAL A HG22 5  
ATOM 5432  H HG23 . VAL A 1 40 ? 0.787   -6.168  -4.069  1.00 0.00 ? 40 VAL A HG23 5  
ATOM 5433  N N    . VAL A 1 41 ? -3.664  -6.669  -2.093  1.00 0.00 ? 41 VAL A N    5  
ATOM 5434  C CA   . VAL A 1 41 ? -5.058  -7.126  -1.793  1.00 0.00 ? 41 VAL A CA   5  
ATOM 5435  C C    . VAL A 1 41 ? -6.034  -6.161  -2.467  1.00 0.00 ? 41 VAL A C    5  
ATOM 5436  O O    . VAL A 1 41 ? -6.189  -5.030  -2.046  1.00 0.00 ? 41 VAL A O    5  
ATOM 5437  C CB   . VAL A 1 41 ? -5.294  -7.148  -0.271  1.00 0.00 ? 41 VAL A CB   5  
ATOM 5438  C CG1  . VAL A 1 41 ? -4.338  -8.166  0.364   1.00 0.00 ? 41 VAL A CG1  5  
ATOM 5439  C CG2  . VAL A 1 41 ? -5.061  -5.742  0.349   1.00 0.00 ? 41 VAL A CG2  5  
ATOM 5440  H H    . VAL A 1 41 ? -3.442  -5.715  -2.053  1.00 0.00 ? 41 VAL A H    5  
ATOM 5441  H HA   . VAL A 1 41 ? -5.216  -8.120  -2.194  1.00 0.00 ? 41 VAL A HA   5  
ATOM 5442  H HB   . VAL A 1 41 ? -6.313  -7.464  -0.080  1.00 0.00 ? 41 VAL A HB   5  
ATOM 5443  H HG11 . VAL A 1 41 ? -4.549  -8.246  1.420   1.00 0.00 ? 41 VAL A HG11 5  
ATOM 5444  H HG12 . VAL A 1 41 ? -3.318  -7.839  0.225   1.00 0.00 ? 41 VAL A HG12 5  
ATOM 5445  H HG13 . VAL A 1 41 ? -4.474  -9.130  -0.104  1.00 0.00 ? 41 VAL A HG13 5  
ATOM 5446  H HG21 . VAL A 1 41 ? -4.495  -5.828  1.266   1.00 0.00 ? 41 VAL A HG21 5  
ATOM 5447  H HG22 . VAL A 1 41 ? -6.017  -5.278  0.567   1.00 0.00 ? 41 VAL A HG22 5  
ATOM 5448  H HG23 . VAL A 1 41 ? -4.516  -5.118  -0.339  1.00 0.00 ? 41 VAL A HG23 5  
ATOM 5449  N N    . LYS A 1 42 ? -6.685  -6.596  -3.520  1.00 0.00 ? 42 LYS A N    5  
ATOM 5450  C CA   . LYS A 1 42 ? -7.650  -5.710  -4.252  1.00 0.00 ? 42 LYS A CA   5  
ATOM 5451  C C    . LYS A 1 42 ? -9.049  -6.324  -4.214  1.00 0.00 ? 42 LYS A C    5  
ATOM 5452  O O    . LYS A 1 42 ? -9.221  -7.501  -4.455  1.00 0.00 ? 42 LYS A O    5  
ATOM 5453  C CB   . LYS A 1 42 ? -7.205  -5.578  -5.711  1.00 0.00 ? 42 LYS A CB   5  
ATOM 5454  C CG   . LYS A 1 42 ? -5.911  -4.766  -5.785  1.00 0.00 ? 42 LYS A CG   5  
ATOM 5455  C CD   . LYS A 1 42 ? -5.382  -4.786  -7.220  1.00 0.00 ? 42 LYS A CD   5  
ATOM 5456  C CE   . LYS A 1 42 ? -4.064  -4.013  -7.293  1.00 0.00 ? 42 LYS A CE   5  
ATOM 5457  N NZ   . LYS A 1 42 ? -3.615  -3.932  -8.712  1.00 0.00 ? 42 LYS A NZ   5  
ATOM 5458  H H    . LYS A 1 42 ? -6.523  -7.505  -3.846  1.00 0.00 ? 42 LYS A H    5  
ATOM 5459  H HA   . LYS A 1 42 ? -7.678  -4.729  -3.798  1.00 0.00 ? 42 LYS A HA   5  
ATOM 5460  H HB2  . LYS A 1 42 ? -7.038  -6.562  -6.125  1.00 0.00 ? 42 LYS A HB2  5  
ATOM 5461  H HB3  . LYS A 1 42 ? -7.976  -5.075  -6.276  1.00 0.00 ? 42 LYS A HB3  5  
ATOM 5462  H HG2  . LYS A 1 42 ? -6.109  -3.746  -5.486  1.00 0.00 ? 42 LYS A HG2  5  
ATOM 5463  H HG3  . LYS A 1 42 ? -5.175  -5.200  -5.124  1.00 0.00 ? 42 LYS A HG3  5  
ATOM 5464  H HD2  . LYS A 1 42 ? -5.218  -5.809  -7.527  1.00 0.00 ? 42 LYS A HD2  5  
ATOM 5465  H HD3  . LYS A 1 42 ? -6.104  -4.324  -7.876  1.00 0.00 ? 42 LYS A HD3  5  
ATOM 5466  H HE2  . LYS A 1 42 ? -4.209  -3.017  -6.903  1.00 0.00 ? 42 LYS A HE2  5  
ATOM 5467  H HE3  . LYS A 1 42 ? -3.315  -4.524  -6.707  1.00 0.00 ? 42 LYS A HE3  5  
ATOM 5468  H HZ1  . LYS A 1 42 ? -3.869  -3.003  -9.104  1.00 0.00 ? 42 LYS A HZ1  5  
ATOM 5469  H HZ2  . LYS A 1 42 ? -4.080  -4.678  -9.267  1.00 0.00 ? 42 LYS A HZ2  5  
ATOM 5470  H HZ3  . LYS A 1 42 ? -2.583  -4.058  -8.756  1.00 0.00 ? 42 LYS A HZ3  5  
ATOM 5471  N N    . SER A 1 43 ? -10.043 -5.532  -3.902  1.00 0.00 ? 43 SER A N    5  
ATOM 5472  C CA   . SER A 1 43 ? -11.446 -6.048  -3.835  1.00 0.00 ? 43 SER A CA   5  
ATOM 5473  C C    . SER A 1 43 ? -11.707 -7.065  -4.952  1.00 0.00 ? 43 SER A C    5  
ATOM 5474  O O    . SER A 1 43 ? -11.975 -6.707  -6.081  1.00 0.00 ? 43 SER A O    5  
ATOM 5475  C CB   . SER A 1 43 ? -12.420 -4.880  -3.987  1.00 0.00 ? 43 SER A CB   5  
ATOM 5476  O OG   . SER A 1 43 ? -13.710 -5.289  -3.556  1.00 0.00 ? 43 SER A OG   5  
ATOM 5477  H H    . SER A 1 43 ? -9.868  -4.590  -3.691  1.00 0.00 ? 43 SER A H    5  
ATOM 5478  H HA   . SER A 1 43 ? -11.608 -6.519  -2.880  1.00 0.00 ? 43 SER A HA   5  
ATOM 5479  H HB2  . SER A 1 43 ? -12.091 -4.050  -3.384  1.00 0.00 ? 43 SER A HB2  5  
ATOM 5480  H HB3  . SER A 1 43 ? -12.456 -4.573  -5.025  1.00 0.00 ? 43 SER A HB3  5  
ATOM 5481  H HG   . SER A 1 43 ? -13.604 -6.056  -2.989  1.00 0.00 ? 43 SER A HG   5  
ATOM 5482  N N    . GLU A 1 44 ? -11.643 -8.331  -4.638  1.00 0.00 ? 44 GLU A N    5  
ATOM 5483  C CA   . GLU A 1 44 ? -11.900 -9.369  -5.678  1.00 0.00 ? 44 GLU A CA   5  
ATOM 5484  C C    . GLU A 1 44 ? -13.410 -9.515  -5.865  1.00 0.00 ? 44 GLU A C    5  
ATOM 5485  O O    . GLU A 1 44 ? -13.874 -10.289 -6.677  1.00 0.00 ? 44 GLU A O    5  
ATOM 5486  C CB   . GLU A 1 44 ? -11.311 -10.713 -5.233  1.00 0.00 ? 44 GLU A CB   5  
ATOM 5487  C CG   . GLU A 1 44 ? -9.786  -10.679 -5.360  1.00 0.00 ? 44 GLU A CG   5  
ATOM 5488  C CD   . GLU A 1 44 ? -9.194  -11.946 -4.742  1.00 0.00 ? 44 GLU A CD   5  
ATOM 5489  O OE1  . GLU A 1 44 ? -9.096  -11.998 -3.527  1.00 0.00 ? 44 GLU A OE1  5  
ATOM 5490  O OE2  . GLU A 1 44 ? -8.848  -12.843 -5.492  1.00 0.00 ? 44 GLU A OE2  5  
ATOM 5491  H H    . GLU A 1 44 ? -11.434 -8.597  -3.718  1.00 0.00 ? 44 GLU A H    5  
ATOM 5492  H HA   . GLU A 1 44 ? -11.448 -9.066  -6.612  1.00 0.00 ? 44 GLU A HA   5  
ATOM 5493  H HB2  . GLU A 1 44 ? -11.584 -10.904 -4.204  1.00 0.00 ? 44 GLU A HB2  5  
ATOM 5494  H HB3  . GLU A 1 44 ? -11.703 -11.501 -5.859  1.00 0.00 ? 44 GLU A HB3  5  
ATOM 5495  H HG2  . GLU A 1 44 ? -9.514  -10.626 -6.405  1.00 0.00 ? 44 GLU A HG2  5  
ATOM 5496  H HG3  . GLU A 1 44 ? -9.400  -9.814  -4.844  1.00 0.00 ? 44 GLU A HG3  5  
ATOM 5497  N N    . ASP A 1 45 ? -14.176 -8.765  -5.118  1.00 0.00 ? 45 ASP A N    5  
ATOM 5498  C CA   . ASP A 1 45 ? -15.660 -8.839  -5.234  1.00 0.00 ? 45 ASP A CA   5  
ATOM 5499  C C    . ASP A 1 45 ? -16.274 -7.651  -4.485  1.00 0.00 ? 45 ASP A C    5  
ATOM 5500  O O    . ASP A 1 45 ? -17.106 -7.818  -3.617  1.00 0.00 ? 45 ASP A O    5  
ATOM 5501  C CB   . ASP A 1 45 ? -16.164 -10.152 -4.611  1.00 0.00 ? 45 ASP A CB   5  
ATOM 5502  C CG   . ASP A 1 45 ? -16.016 -11.299 -5.615  1.00 0.00 ? 45 ASP A CG   5  
ATOM 5503  O OD1  . ASP A 1 45 ? -16.310 -11.082 -6.779  1.00 0.00 ? 45 ASP A OD1  5  
ATOM 5504  O OD2  . ASP A 1 45 ? -15.611 -12.373 -5.201  1.00 0.00 ? 45 ASP A OD2  5  
ATOM 5505  H H    . ASP A 1 45 ? -13.768 -8.142  -4.480  1.00 0.00 ? 45 ASP A H    5  
ATOM 5506  H HA   . ASP A 1 45 ? -15.946 -8.794  -6.276  1.00 0.00 ? 45 ASP A HA   5  
ATOM 5507  H HB2  . ASP A 1 45 ? -15.583 -10.374 -3.727  1.00 0.00 ? 45 ASP A HB2  5  
ATOM 5508  H HB3  . ASP A 1 45 ? -17.205 -10.052 -4.340  1.00 0.00 ? 45 ASP A HB3  5  
ATOM 5509  N N    . GLY A 1 46 ? -15.868 -6.452  -4.810  1.00 0.00 ? 46 GLY A N    5  
ATOM 5510  C CA   . GLY A 1 46 ? -16.430 -5.264  -4.109  1.00 0.00 ? 46 GLY A CA   5  
ATOM 5511  C C    . GLY A 1 46 ? -16.064 -3.996  -4.882  1.00 0.00 ? 46 GLY A C    5  
ATOM 5512  O O    . GLY A 1 46 ? -16.852 -3.474  -5.643  1.00 0.00 ? 46 GLY A O    5  
ATOM 5513  H H    . GLY A 1 46 ? -15.195 -6.328  -5.512  1.00 0.00 ? 46 GLY A H    5  
ATOM 5514  H HA2  . GLY A 1 46 ? -17.506 -5.356  -4.054  1.00 0.00 ? 46 GLY A HA2  5  
ATOM 5515  H HA3  . GLY A 1 46 ? -16.022 -5.205  -3.112  1.00 0.00 ? 46 GLY A HA3  5  
ATOM 5516  N N    . SER A 1 47 ? -14.870 -3.494  -4.696  1.00 0.00 ? 47 SER A N    5  
ATOM 5517  C CA   . SER A 1 47 ? -14.459 -2.261  -5.423  1.00 0.00 ? 47 SER A CA   5  
ATOM 5518  C C    . SER A 1 47 ? -15.500 -1.168  -5.190  1.00 0.00 ? 47 SER A C    5  
ATOM 5519  O O    . SER A 1 47 ? -15.905 -0.478  -6.104  1.00 0.00 ? 47 SER A O    5  
ATOM 5520  C CB   . SER A 1 47 ? -14.355 -2.560  -6.918  1.00 0.00 ? 47 SER A CB   5  
ATOM 5521  O OG   . SER A 1 47 ? -13.777 -1.444  -7.581  1.00 0.00 ? 47 SER A OG   5  
ATOM 5522  H H    . SER A 1 47 ? -14.244 -3.925  -4.079  1.00 0.00 ? 47 SER A H    5  
ATOM 5523  H HA   . SER A 1 47 ? -13.499 -1.929  -5.054  1.00 0.00 ? 47 SER A HA   5  
ATOM 5524  H HB2  . SER A 1 47 ? -13.732 -3.425  -7.071  1.00 0.00 ? 47 SER A HB2  5  
ATOM 5525  H HB3  . SER A 1 47 ? -15.343 -2.756  -7.314  1.00 0.00 ? 47 SER A HB3  5  
ATOM 5526  H HG   . SER A 1 47 ? -13.655 -0.745  -6.935  1.00 0.00 ? 47 SER A HG   5  
ATOM 5527  N N    . ASP A 1 48 ? -15.953 -1.018  -3.974  1.00 0.00 ? 48 ASP A N    5  
ATOM 5528  C CA   . ASP A 1 48 ? -16.987 0.018   -3.681  1.00 0.00 ? 48 ASP A CA   5  
ATOM 5529  C C    . ASP A 1 48 ? -16.837 0.518   -2.241  1.00 0.00 ? 48 ASP A C    5  
ATOM 5530  O O    . ASP A 1 48 ? -17.682 0.273   -1.403  1.00 0.00 ? 48 ASP A O    5  
ATOM 5531  C CB   . ASP A 1 48 ? -18.378 -0.594  -3.859  1.00 0.00 ? 48 ASP A CB   5  
ATOM 5532  C CG   . ASP A 1 48 ? -19.432 0.514   -3.811  1.00 0.00 ? 48 ASP A CG   5  
ATOM 5533  O OD1  . ASP A 1 48 ? -19.463 1.315   -4.730  1.00 0.00 ? 48 ASP A OD1  5  
ATOM 5534  O OD2  . ASP A 1 48 ? -20.189 0.544   -2.855  1.00 0.00 ? 48 ASP A OD2  5  
ATOM 5535  H H    . ASP A 1 48 ? -15.628 -1.600  -3.258  1.00 0.00 ? 48 ASP A H    5  
ATOM 5536  H HA   . ASP A 1 48 ? -16.875 0.849   -4.361  1.00 0.00 ? 48 ASP A HA   5  
ATOM 5537  H HB2  . ASP A 1 48 ? -18.429 -1.101  -4.812  1.00 0.00 ? 48 ASP A HB2  5  
ATOM 5538  H HB3  . ASP A 1 48 ? -18.565 -1.300  -3.064  1.00 0.00 ? 48 ASP A HB3  5  
ATOM 5539  N N    . CYS A 1 49 ? -15.776 1.231   -1.956  1.00 0.00 ? 49 CYS A N    5  
ATOM 5540  C CA   . CYS A 1 49 ? -15.564 1.773   -0.575  1.00 0.00 ? 49 CYS A CA   5  
ATOM 5541  C C    . CYS A 1 49 ? -15.167 3.252   -0.701  1.00 0.00 ? 49 CYS A C    5  
ATOM 5542  O O    . CYS A 1 49 ? -14.443 3.631   -1.595  1.00 0.00 ? 49 CYS A O    5  
ATOM 5543  C CB   . CYS A 1 49 ? -14.464 0.951   0.124   1.00 0.00 ? 49 CYS A CB   5  
ATOM 5544  S SG   . CYS A 1 49 ? -12.820 1.505   -0.392  1.00 0.00 ? 49 CYS A SG   5  
ATOM 5545  H H    . CYS A 1 49 ? -15.118 1.422   -2.656  1.00 0.00 ? 49 CYS A H    5  
ATOM 5546  H HA   . CYS A 1 49 ? -16.482 1.703   -0.006  1.00 0.00 ? 49 CYS A HA   5  
ATOM 5547  H HB2  . CYS A 1 49 ? -14.554 1.058   1.194   1.00 0.00 ? 49 CYS A HB2  5  
ATOM 5548  H HB3  . CYS A 1 49 ? -14.585 -0.090  -0.137  1.00 0.00 ? 49 CYS A HB3  5  
ATOM 5549  N N    . GLY A 1 50 ? -15.671 4.102   0.156   1.00 0.00 ? 50 GLY A N    5  
ATOM 5550  C CA   . GLY A 1 50 ? -15.348 5.558   0.031   1.00 0.00 ? 50 GLY A CA   5  
ATOM 5551  C C    . GLY A 1 50 ? -16.379 6.163   -0.924  1.00 0.00 ? 50 GLY A C    5  
ATOM 5552  O O    . GLY A 1 50 ? -17.356 5.518   -1.249  1.00 0.00 ? 50 GLY A O    5  
ATOM 5553  H H    . GLY A 1 50 ? -16.287 3.790   0.850   1.00 0.00 ? 50 GLY A H    5  
ATOM 5554  H HA2  . GLY A 1 50 ? -15.411 6.039   1.000   1.00 0.00 ? 50 GLY A HA2  5  
ATOM 5555  H HA3  . GLY A 1 50 ? -14.356 5.683   -0.378  1.00 0.00 ? 50 GLY A HA3  5  
ATOM 5556  N N    . ASP A 1 51 ? -16.206 7.370   -1.400  1.00 0.00 ? 51 ASP A N    5  
ATOM 5557  C CA   . ASP A 1 51 ? -17.221 7.921   -2.335  1.00 0.00 ? 51 ASP A CA   5  
ATOM 5558  C C    . ASP A 1 51 ? -17.123 7.187   -3.673  1.00 0.00 ? 51 ASP A C    5  
ATOM 5559  O O    . ASP A 1 51 ? -17.731 7.576   -4.651  1.00 0.00 ? 51 ASP A O    5  
ATOM 5560  C CB   . ASP A 1 51 ? -16.955 9.413   -2.555  1.00 0.00 ? 51 ASP A CB   5  
ATOM 5561  C CG   . ASP A 1 51 ? -15.493 9.618   -2.960  1.00 0.00 ? 51 ASP A CG   5  
ATOM 5562  O OD1  . ASP A 1 51 ? -14.986 8.798   -3.708  1.00 0.00 ? 51 ASP A OD1  5  
ATOM 5563  O OD2  . ASP A 1 51 ? -14.908 10.591  -2.516  1.00 0.00 ? 51 ASP A OD2  5  
ATOM 5564  H H    . ASP A 1 51 ? -15.429 7.924   -1.173  1.00 0.00 ? 51 ASP A H    5  
ATOM 5565  H HA   . ASP A 1 51 ? -18.208 7.787   -1.919  1.00 0.00 ? 51 ASP A HA   5  
ATOM 5566  H HB2  . ASP A 1 51 ? -17.601 9.782   -3.339  1.00 0.00 ? 51 ASP A HB2  5  
ATOM 5567  H HB3  . ASP A 1 51 ? -17.153 9.954   -1.641  1.00 0.00 ? 51 ASP A HB3  5  
ATOM 5568  N N    . ALA A 1 52 ? -16.368 6.123   -3.724  1.00 0.00 ? 52 ALA A N    5  
ATOM 5569  C CA   . ALA A 1 52 ? -16.239 5.366   -5.001  1.00 0.00 ? 52 ALA A CA   5  
ATOM 5570  C C    . ALA A 1 52 ? -15.455 4.068   -4.757  1.00 0.00 ? 52 ALA A C    5  
ATOM 5571  O O    . ALA A 1 52 ? -16.033 3.009   -4.666  1.00 0.00 ? 52 ALA A O    5  
ATOM 5572  C CB   . ALA A 1 52 ? -15.522 6.239   -6.042  1.00 0.00 ? 52 ALA A CB   5  
ATOM 5573  H H    . ALA A 1 52 ? -15.889 5.818   -2.925  1.00 0.00 ? 52 ALA A H    5  
ATOM 5574  H HA   . ALA A 1 52 ? -17.226 5.118   -5.365  1.00 0.00 ? 52 ALA A HA   5  
ATOM 5575  H HB1  . ALA A 1 52 ? -16.238 6.896   -6.513  1.00 0.00 ? 52 ALA A HB1  5  
ATOM 5576  H HB2  . ALA A 1 52 ? -15.064 5.611   -6.795  1.00 0.00 ? 52 ALA A HB2  5  
ATOM 5577  H HB3  . ALA A 1 52 ? -14.761 6.832   -5.556  1.00 0.00 ? 52 ALA A HB3  5  
ATOM 5578  N N    . ASP A 1 53 ? -14.148 4.146   -4.653  1.00 0.00 ? 53 ASP A N    5  
ATOM 5579  C CA   . ASP A 1 53 ? -13.314 2.920   -4.419  1.00 0.00 ? 53 ASP A CA   5  
ATOM 5580  C C    . ASP A 1 53 ? -11.858 3.230   -4.779  1.00 0.00 ? 53 ASP A C    5  
ATOM 5581  O O    . ASP A 1 53 ? -11.514 4.343   -5.116  1.00 0.00 ? 53 ASP A O    5  
ATOM 5582  C CB   . ASP A 1 53 ? -13.805 1.750   -5.293  1.00 0.00 ? 53 ASP A CB   5  
ATOM 5583  C CG   . ASP A 1 53 ? -14.293 2.278   -6.644  1.00 0.00 ? 53 ASP A CG   5  
ATOM 5584  O OD1  . ASP A 1 53 ? -13.464 2.739   -7.412  1.00 0.00 ? 53 ASP A OD1  5  
ATOM 5585  O OD2  . ASP A 1 53 ? -15.487 2.213   -6.887  1.00 0.00 ? 53 ASP A OD2  5  
ATOM 5586  H H    . ASP A 1 53 ? -13.709 5.016   -4.724  1.00 0.00 ? 53 ASP A H    5  
ATOM 5587  H HA   . ASP A 1 53 ? -13.370 2.638   -3.380  1.00 0.00 ? 53 ASP A HA   5  
ATOM 5588  H HB2  . ASP A 1 53 ? -12.995 1.050   -5.455  1.00 0.00 ? 53 ASP A HB2  5  
ATOM 5589  H HB3  . ASP A 1 53 ? -14.611 1.240   -4.793  1.00 0.00 ? 53 ASP A HB3  5  
ATOM 5590  N N    . PHE A 1 54 ? -11.012 2.236   -4.722  1.00 0.00 ? 54 PHE A N    5  
ATOM 5591  C CA   . PHE A 1 54 ? -9.570  2.437   -5.076  1.00 0.00 ? 54 PHE A CA   5  
ATOM 5592  C C    . PHE A 1 54 ? -8.831  3.153   -3.935  1.00 0.00 ? 54 PHE A C    5  
ATOM 5593  O O    . PHE A 1 54 ? -9.294  3.152   -2.816  1.00 0.00 ? 54 PHE A O    5  
ATOM 5594  C CB   . PHE A 1 54 ? -9.469  3.267   -6.375  1.00 0.00 ? 54 PHE A CB   5  
ATOM 5595  C CG   . PHE A 1 54 ? -8.225  2.879   -7.149  1.00 0.00 ? 54 PHE A CG   5  
ATOM 5596  C CD1  . PHE A 1 54 ? -8.150  1.624   -7.766  1.00 0.00 ? 54 PHE A CD1  5  
ATOM 5597  C CD2  . PHE A 1 54 ? -7.150  3.773   -7.249  1.00 0.00 ? 54 PHE A CD2  5  
ATOM 5598  C CE1  . PHE A 1 54 ? -7.002  1.263   -8.481  1.00 0.00 ? 54 PHE A CE1  5  
ATOM 5599  C CE2  . PHE A 1 54 ? -6.002  3.411   -7.965  1.00 0.00 ? 54 PHE A CE2  5  
ATOM 5600  C CZ   . PHE A 1 54 ? -5.929  2.156   -8.581  1.00 0.00 ? 54 PHE A CZ   5  
ATOM 5601  H H    . PHE A 1 54 ? -11.332 1.343   -4.454  1.00 0.00 ? 54 PHE A H    5  
ATOM 5602  H HA   . PHE A 1 54 ? -9.117  1.470   -5.232  1.00 0.00 ? 54 PHE A HA   5  
ATOM 5603  H HB2  . PHE A 1 54 ? -10.339 3.076   -6.986  1.00 0.00 ? 54 PHE A HB2  5  
ATOM 5604  H HB3  . PHE A 1 54 ? -9.428  4.322   -6.137  1.00 0.00 ? 54 PHE A HB3  5  
ATOM 5605  H HD1  . PHE A 1 54 ? -8.978  0.936   -7.689  1.00 0.00 ? 54 PHE A HD1  5  
ATOM 5606  H HD2  . PHE A 1 54 ? -7.207  4.741   -6.774  1.00 0.00 ? 54 PHE A HD2  5  
ATOM 5607  H HE1  . PHE A 1 54 ? -6.945  0.295   -8.957  1.00 0.00 ? 54 PHE A HE1  5  
ATOM 5608  H HE2  . PHE A 1 54 ? -5.174  4.100   -8.042  1.00 0.00 ? 54 PHE A HE2  5  
ATOM 5609  H HZ   . PHE A 1 54 ? -5.043  1.877   -9.133  1.00 0.00 ? 54 PHE A HZ   5  
ATOM 5610  N N    . ASP A 1 55 ? -7.687  3.747   -4.254  1.00 0.00 ? 55 ASP A N    5  
ATOM 5611  C CA   . ASP A 1 55 ? -6.816  4.500   -3.266  1.00 0.00 ? 55 ASP A CA   5  
ATOM 5612  C C    . ASP A 1 55 ? -5.415  3.861   -3.236  1.00 0.00 ? 55 ASP A C    5  
ATOM 5613  O O    . ASP A 1 55 ? -5.231  2.740   -3.667  1.00 0.00 ? 55 ASP A O    5  
ATOM 5614  C CB   . ASP A 1 55 ? -7.398  4.506   -1.841  1.00 0.00 ? 55 ASP A CB   5  
ATOM 5615  C CG   . ASP A 1 55 ? -6.477  5.312   -0.921  1.00 0.00 ? 55 ASP A CG   5  
ATOM 5616  O OD1  . ASP A 1 55 ? -5.730  6.130   -1.432  1.00 0.00 ? 55 ASP A OD1  5  
ATOM 5617  O OD2  . ASP A 1 55 ? -6.541  5.103   0.279   1.00 0.00 ? 55 ASP A OD2  5  
ATOM 5618  H H    . ASP A 1 55 ? -7.387  3.696   -5.184  1.00 0.00 ? 55 ASP A H    5  
ATOM 5619  H HA   . ASP A 1 55 ? -6.718  5.521   -3.608  1.00 0.00 ? 55 ASP A HA   5  
ATOM 5620  H HB2  . ASP A 1 55 ? -8.376  4.969   -1.848  1.00 0.00 ? 55 ASP A HB2  5  
ATOM 5621  H HB3  . ASP A 1 55 ? -7.472  3.493   -1.469  1.00 0.00 ? 55 ASP A HB3  5  
ATOM 5622  N N    . TRP A 1 56 ? -4.430  4.573   -2.731  1.00 0.00 ? 56 TRP A N    5  
ATOM 5623  C CA   . TRP A 1 56 ? -3.034  4.028   -2.660  1.00 0.00 ? 56 TRP A CA   5  
ATOM 5624  C C    . TRP A 1 56 ? -2.536  3.650   -4.062  1.00 0.00 ? 56 TRP A C    5  
ATOM 5625  O O    . TRP A 1 56 ? -3.128  2.838   -4.744  1.00 0.00 ? 56 TRP A O    5  
ATOM 5626  C CB   . TRP A 1 56 ? -2.996  2.792   -1.734  1.00 0.00 ? 56 TRP A CB   5  
ATOM 5627  C CG   . TRP A 1 56 ? -2.819  3.220   -0.309  1.00 0.00 ? 56 TRP A CG   5  
ATOM 5628  C CD1  . TRP A 1 56 ? -3.825  3.498   0.550   1.00 0.00 ? 56 TRP A CD1  5  
ATOM 5629  C CD2  . TRP A 1 56 ? -1.581  3.424   0.430   1.00 0.00 ? 56 TRP A CD2  5  
ATOM 5630  N NE1  . TRP A 1 56 ? -3.283  3.861   1.771   1.00 0.00 ? 56 TRP A NE1  5  
ATOM 5631  C CE2  . TRP A 1 56 ? -1.903  3.830   1.746   1.00 0.00 ? 56 TRP A CE2  5  
ATOM 5632  C CE3  . TRP A 1 56 ? -0.222  3.296   0.089   1.00 0.00 ? 56 TRP A CE3  5  
ATOM 5633  C CZ2  . TRP A 1 56 ? -0.912  4.101   2.692   1.00 0.00 ? 56 TRP A CZ2  5  
ATOM 5634  C CZ3  . TRP A 1 56 ? 0.778   3.569   1.038   1.00 0.00 ? 56 TRP A CZ3  5  
ATOM 5635  C CH2  . TRP A 1 56 ? 0.433   3.970   2.336   1.00 0.00 ? 56 TRP A CH2  5  
ATOM 5636  H H    . TRP A 1 56 ? -4.611  5.476   -2.393  1.00 0.00 ? 56 TRP A H    5  
ATOM 5637  H HA   . TRP A 1 56 ? -2.382  4.794   -2.261  1.00 0.00 ? 56 TRP A HA   5  
ATOM 5638  H HB2  . TRP A 1 56 ? -3.920  2.243   -1.826  1.00 0.00 ? 56 TRP A HB2  5  
ATOM 5639  H HB3  . TRP A 1 56 ? -2.171  2.150   -2.015  1.00 0.00 ? 56 TRP A HB3  5  
ATOM 5640  H HD1  . TRP A 1 56 ? -4.878  3.446   0.321   1.00 0.00 ? 56 TRP A HD1  5  
ATOM 5641  H HE1  . TRP A 1 56 ? -3.798  4.111   2.566   1.00 0.00 ? 56 TRP A HE1  5  
ATOM 5642  H HE3  . TRP A 1 56 ? 0.054   2.989   -0.908  1.00 0.00 ? 56 TRP A HE3  5  
ATOM 5643  H HZ2  . TRP A 1 56 ? -1.183  4.410   3.690   1.00 0.00 ? 56 TRP A HZ2  5  
ATOM 5644  H HZ3  . TRP A 1 56 ? 1.817   3.468   0.766   1.00 0.00 ? 56 TRP A HZ3  5  
ATOM 5645  H HH2  . TRP A 1 56 ? 1.206   4.177   3.062   1.00 0.00 ? 56 TRP A HH2  5  
ATOM 5646  N N    . HIS A 1 57 ? -1.459  4.260   -4.497  1.00 0.00 ? 57 HIS A N    5  
ATOM 5647  C CA   . HIS A 1 57 ? -0.901  3.983   -5.860  1.00 0.00 ? 57 HIS A CA   5  
ATOM 5648  C C    . HIS A 1 57 ? -0.631  2.489   -6.060  1.00 0.00 ? 57 HIS A C    5  
ATOM 5649  O O    . HIS A 1 57 ? -1.517  1.663   -5.957  1.00 0.00 ? 57 HIS A O    5  
ATOM 5650  C CB   . HIS A 1 57 ? 0.411   4.761   -6.029  1.00 0.00 ? 57 HIS A CB   5  
ATOM 5651  C CG   . HIS A 1 57 ? 1.303   4.468   -4.852  1.00 0.00 ? 57 HIS A CG   5  
ATOM 5652  N ND1  . HIS A 1 57 ? 1.176   5.140   -3.646  1.00 0.00 ? 57 HIS A ND1  5  
ATOM 5653  C CD2  . HIS A 1 57 ? 2.324   3.565   -4.672  1.00 0.00 ? 57 HIS A CD2  5  
ATOM 5654  C CE1  . HIS A 1 57 ? 2.094   4.634   -2.801  1.00 0.00 ? 57 HIS A CE1  5  
ATOM 5655  N NE2  . HIS A 1 57 ? 2.820   3.672   -3.375  1.00 0.00 ? 57 HIS A NE2  5  
ATOM 5656  H H    . HIS A 1 57 ? -1.018  4.935   -3.943  1.00 0.00 ? 57 HIS A H    5  
ATOM 5657  H HA   . HIS A 1 57 ? -1.596  4.312   -6.606  1.00 0.00 ? 57 HIS A HA   5  
ATOM 5658  H HB2  . HIS A 1 57 ? 0.898   4.454   -6.944  1.00 0.00 ? 57 HIS A HB2  5  
ATOM 5659  H HB3  . HIS A 1 57 ? 0.208   5.821   -6.075  1.00 0.00 ? 57 HIS A HB3  5  
ATOM 5660  H HD1  . HIS A 1 57 ? 0.535   5.853   -3.445  1.00 0.00 ? 57 HIS A HD1  5  
ATOM 5661  H HD2  . HIS A 1 57 ? 2.693   2.881   -5.421  1.00 0.00 ? 57 HIS A HD2  5  
ATOM 5662  H HE1  . HIS A 1 57 ? 2.228   4.968   -1.782  1.00 0.00 ? 57 HIS A HE1  5  
ATOM 5663  N N    . HIS A 1 58 ? 0.589   2.142   -6.376  1.00 0.00 ? 58 HIS A N    5  
ATOM 5664  C CA   . HIS A 1 58 ? 0.933   0.705   -6.622  1.00 0.00 ? 58 HIS A CA   5  
ATOM 5665  C C    . HIS A 1 58 ? 2.314   0.358   -6.042  1.00 0.00 ? 58 HIS A C    5  
ATOM 5666  O O    . HIS A 1 58 ? 2.415   -0.250  -4.996  1.00 0.00 ? 58 HIS A O    5  
ATOM 5667  C CB   . HIS A 1 58 ? 0.938   0.437   -8.130  1.00 0.00 ? 58 HIS A CB   5  
ATOM 5668  C CG   . HIS A 1 58 ? -0.270  1.076   -8.756  1.00 0.00 ? 58 HIS A CG   5  
ATOM 5669  N ND1  . HIS A 1 58 ? -0.355  2.443   -8.976  1.00 0.00 ? 58 HIS A ND1  5  
ATOM 5670  C CD2  . HIS A 1 58 ? -1.452  0.549   -9.215  1.00 0.00 ? 58 HIS A CD2  5  
ATOM 5671  C CE1  . HIS A 1 58 ? -1.549  2.689   -9.542  1.00 0.00 ? 58 HIS A CE1  5  
ATOM 5672  N NE2  . HIS A 1 58 ? -2.258  1.569   -9.711  1.00 0.00 ? 58 HIS A NE2  5  
ATOM 5673  H H    . HIS A 1 58 ? 1.273   2.837   -6.473  1.00 0.00 ? 58 HIS A H    5  
ATOM 5674  H HA   . HIS A 1 58 ? 0.193   0.070   -6.160  1.00 0.00 ? 58 HIS A HA   5  
ATOM 5675  H HB2  . HIS A 1 58 ? 1.833   0.852   -8.571  1.00 0.00 ? 58 HIS A HB2  5  
ATOM 5676  H HB3  . HIS A 1 58 ? 0.912   -0.628  -8.307  1.00 0.00 ? 58 HIS A HB3  5  
ATOM 5677  H HD1  . HIS A 1 58 ? 0.332   3.107   -8.758  1.00 0.00 ? 58 HIS A HD1  5  
ATOM 5678  H HD2  . HIS A 1 58 ? -1.716  -0.498  -9.194  1.00 0.00 ? 58 HIS A HD2  5  
ATOM 5679  H HE1  . HIS A 1 58 ? -1.893  3.672   -9.828  1.00 0.00 ? 58 HIS A HE1  5  
ATOM 5680  N N    . THR A 1 59 ? 3.378   0.705   -6.725  1.00 0.00 ? 59 THR A N    5  
ATOM 5681  C CA   . THR A 1 59 ? 4.735   0.347   -6.210  1.00 0.00 ? 59 THR A CA   5  
ATOM 5682  C C    . THR A 1 59 ? 5.801   1.242   -6.857  1.00 0.00 ? 59 THR A C    5  
ATOM 5683  O O    . THR A 1 59 ? 5.753   1.521   -8.038  1.00 0.00 ? 59 THR A O    5  
ATOM 5684  C CB   . THR A 1 59 ? 5.006   -1.122  -6.571  1.00 0.00 ? 59 THR A CB   5  
ATOM 5685  O OG1  . THR A 1 59 ? 4.137   -1.954  -5.817  1.00 0.00 ? 59 THR A OG1  5  
ATOM 5686  C CG2  . THR A 1 59 ? 6.461   -1.497  -6.271  1.00 0.00 ? 59 THR A CG2  5  
ATOM 5687  H H    . THR A 1 59 ? 3.284   1.172   -7.580  1.00 0.00 ? 59 THR A H    5  
ATOM 5688  H HA   . THR A 1 59 ? 4.762   0.466   -5.137  1.00 0.00 ? 59 THR A HA   5  
ATOM 5689  H HB   . THR A 1 59 ? 4.814   -1.269  -7.622  1.00 0.00 ? 59 THR A HB   5  
ATOM 5690  H HG1  . THR A 1 59 ? 3.499   -1.392  -5.373  1.00 0.00 ? 59 THR A HG1  5  
ATOM 5691  H HG21 . THR A 1 59 ? 6.581   -2.565  -6.369  1.00 0.00 ? 59 THR A HG21 5  
ATOM 5692  H HG22 . THR A 1 59 ? 6.714   -1.201  -5.265  1.00 0.00 ? 59 THR A HG22 5  
ATOM 5693  H HG23 . THR A 1 59 ? 7.117   -0.999  -6.970  1.00 0.00 ? 59 THR A HG23 5  
ATOM 5694  N N    . PHE A 1 60 ? 6.778   1.679   -6.095  1.00 0.00 ? 60 PHE A N    5  
ATOM 5695  C CA   . PHE A 1 60 ? 7.856   2.536   -6.674  1.00 0.00 ? 60 PHE A CA   5  
ATOM 5696  C C    . PHE A 1 60 ? 8.964   1.616   -7.243  1.00 0.00 ? 60 PHE A C    5  
ATOM 5697  O O    . PHE A 1 60 ? 9.121   0.508   -6.768  1.00 0.00 ? 60 PHE A O    5  
ATOM 5698  C CB   . PHE A 1 60 ? 8.438   3.437   -5.575  1.00 0.00 ? 60 PHE A CB   5  
ATOM 5699  C CG   . PHE A 1 60 ? 8.435   2.700   -4.257  1.00 0.00 ? 60 PHE A CG   5  
ATOM 5700  C CD1  . PHE A 1 60 ? 7.323   2.782   -3.412  1.00 0.00 ? 60 PHE A CD1  5  
ATOM 5701  C CD2  . PHE A 1 60 ? 9.549   1.942   -3.878  1.00 0.00 ? 60 PHE A CD2  5  
ATOM 5702  C CE1  . PHE A 1 60 ? 7.323   2.104   -2.188  1.00 0.00 ? 60 PHE A CE1  5  
ATOM 5703  C CE2  . PHE A 1 60 ? 9.548   1.262   -2.654  1.00 0.00 ? 60 PHE A CE2  5  
ATOM 5704  C CZ   . PHE A 1 60 ? 8.435   1.344   -1.809  1.00 0.00 ? 60 PHE A CZ   5  
ATOM 5705  H H    . PHE A 1 60 ? 6.806   1.428   -5.148  1.00 0.00 ? 60 PHE A H    5  
ATOM 5706  H HA   . PHE A 1 60 ? 7.431   3.145   -7.455  1.00 0.00 ? 60 PHE A HA   5  
ATOM 5707  H HB2  . PHE A 1 60 ? 9.450   3.715   -5.828  1.00 0.00 ? 60 PHE A HB2  5  
ATOM 5708  H HB3  . PHE A 1 60 ? 7.835   4.329   -5.485  1.00 0.00 ? 60 PHE A HB3  5  
ATOM 5709  H HD1  . PHE A 1 60 ? 6.464   3.368   -3.705  1.00 0.00 ? 60 PHE A HD1  5  
ATOM 5710  H HD2  . PHE A 1 60 ? 10.407  1.879   -4.530  1.00 0.00 ? 60 PHE A HD2  5  
ATOM 5711  H HE1  . PHE A 1 60 ? 6.464   2.166   -1.536  1.00 0.00 ? 60 PHE A HE1  5  
ATOM 5712  H HE2  . PHE A 1 60 ? 10.408  0.677   -2.362  1.00 0.00 ? 60 PHE A HE2  5  
ATOM 5713  H HZ   . PHE A 1 60 ? 8.436   0.822   -0.864  1.00 0.00 ? 60 PHE A HZ   5  
ATOM 5714  N N    . PRO A 1 61 ? 9.702   2.076   -8.241  1.00 0.00 ? 61 PRO A N    5  
ATOM 5715  C CA   . PRO A 1 61 ? 10.780  1.260   -8.847  1.00 0.00 ? 61 PRO A CA   5  
ATOM 5716  C C    . PRO A 1 61 ? 11.924  1.007   -7.843  1.00 0.00 ? 61 PRO A C    5  
ATOM 5717  O O    . PRO A 1 61 ? 12.896  1.736   -7.807  1.00 0.00 ? 61 PRO A O    5  
ATOM 5718  C CB   . PRO A 1 61 ? 11.278  2.100   -10.047 1.00 0.00 ? 61 PRO A CB   5  
ATOM 5719  C CG   . PRO A 1 61 ? 10.659  3.517   -9.901  1.00 0.00 ? 61 PRO A CG   5  
ATOM 5720  C CD   . PRO A 1 61 ? 9.533   3.418   -8.850  1.00 0.00 ? 61 PRO A CD   5  
ATOM 5721  H HA   . PRO A 1 61 ? 10.382  0.319   -9.197  1.00 0.00 ? 61 PRO A HA   5  
ATOM 5722  H HB2  . PRO A 1 61 ? 12.361  2.163   -10.048 1.00 0.00 ? 61 PRO A HB2  5  
ATOM 5723  H HB3  . PRO A 1 61 ? 10.943  1.655   -10.974 1.00 0.00 ? 61 PRO A HB3  5  
ATOM 5724  H HG2  . PRO A 1 61 ? 11.418  4.217   -9.569  1.00 0.00 ? 61 PRO A HG2  5  
ATOM 5725  H HG3  . PRO A 1 61 ? 10.251  3.846   -10.848 1.00 0.00 ? 61 PRO A HG3  5  
ATOM 5726  H HD2  . PRO A 1 61 ? 9.638   4.195   -8.104  1.00 0.00 ? 61 PRO A HD2  5  
ATOM 5727  H HD3  . PRO A 1 61 ? 8.571   3.486   -9.337  1.00 0.00 ? 61 PRO A HD3  5  
ATOM 5728  N N    . SER A 1 62 ? 11.829  -0.032  -7.052  1.00 0.00 ? 62 SER A N    5  
ATOM 5729  C CA   . SER A 1 62 ? 12.915  -0.352  -6.080  1.00 0.00 ? 62 SER A CA   5  
ATOM 5730  C C    . SER A 1 62 ? 13.043  0.752   -5.028  1.00 0.00 ? 62 SER A C    5  
ATOM 5731  O O    . SER A 1 62 ? 13.160  0.480   -3.850  1.00 0.00 ? 62 SER A O    5  
ATOM 5732  C CB   . SER A 1 62 ? 14.245  -0.519  -6.826  1.00 0.00 ? 62 SER A CB   5  
ATOM 5733  O OG   . SER A 1 62 ? 14.005  -1.164  -8.070  1.00 0.00 ? 62 SER A OG   5  
ATOM 5734  H H    . SER A 1 62 ? 11.054  -0.622  -7.107  1.00 0.00 ? 62 SER A H    5  
ATOM 5735  H HA   . SER A 1 62 ? 12.674  -1.280  -5.583  1.00 0.00 ? 62 SER A HA   5  
ATOM 5736  H HB2  . SER A 1 62 ? 14.692  0.444   -7.010  1.00 0.00 ? 62 SER A HB2  5  
ATOM 5737  H HB3  . SER A 1 62 ? 14.921  -1.115  -6.227  1.00 0.00 ? 62 SER A HB3  5  
ATOM 5738  H HG   . SER A 1 62 ? 13.778  -0.491  -8.714  1.00 0.00 ? 62 SER A HG   5  
ATOM 5739  N N    . ARG A 1 63 ? 13.032  1.994   -5.430  1.00 0.00 ? 63 ARG A N    5  
ATOM 5740  C CA   . ARG A 1 63 ? 13.163  3.105   -4.448  1.00 0.00 ? 63 ARG A CA   5  
ATOM 5741  C C    . ARG A 1 63 ? 12.369  4.301   -4.975  1.00 0.00 ? 63 ARG A C    5  
ATOM 5742  O O    . ARG A 1 63 ? 12.405  4.606   -6.151  1.00 0.00 ? 63 ARG A O    5  
ATOM 5743  C CB   . ARG A 1 63 ? 14.647  3.480   -4.319  1.00 0.00 ? 63 ARG A CB   5  
ATOM 5744  C CG   . ARG A 1 63 ? 15.403  2.343   -3.631  1.00 0.00 ? 63 ARG A CG   5  
ATOM 5745  C CD   . ARG A 1 63 ? 16.831  2.795   -3.323  1.00 0.00 ? 63 ARG A CD   5  
ATOM 5746  N NE   . ARG A 1 63 ? 17.552  1.704   -2.609  1.00 0.00 ? 63 ARG A NE   5  
ATOM 5747  C CZ   . ARG A 1 63 ? 18.852  1.743   -2.504  1.00 0.00 ? 63 ARG A CZ   5  
ATOM 5748  N NH1  . ARG A 1 63 ? 19.519  2.739   -3.020  1.00 0.00 ? 63 ARG A NH1  5  
ATOM 5749  N NH2  . ARG A 1 63 ? 19.485  0.786   -1.881  1.00 0.00 ? 63 ARG A NH2  5  
ATOM 5750  H H    . ARG A 1 63 ? 12.945  2.218   -6.381  1.00 0.00 ? 63 ARG A H    5  
ATOM 5751  H HA   . ARG A 1 63 ? 12.775  2.802   -3.486  1.00 0.00 ? 63 ARG A HA   5  
ATOM 5752  H HB2  . ARG A 1 63 ? 15.061  3.641   -5.304  1.00 0.00 ? 63 ARG A HB2  5  
ATOM 5753  H HB3  . ARG A 1 63 ? 14.750  4.381   -3.735  1.00 0.00 ? 63 ARG A HB3  5  
ATOM 5754  H HG2  . ARG A 1 63 ? 14.901  2.081   -2.711  1.00 0.00 ? 63 ARG A HG2  5  
ATOM 5755  H HG3  . ARG A 1 63 ? 15.432  1.483   -4.282  1.00 0.00 ? 63 ARG A HG3  5  
ATOM 5756  H HD2  . ARG A 1 63 ? 17.343  3.020   -4.246  1.00 0.00 ? 63 ARG A HD2  5  
ATOM 5757  H HD3  . ARG A 1 63 ? 16.804  3.677   -2.702  1.00 0.00 ? 63 ARG A HD3  5  
ATOM 5758  H HE   . ARG A 1 63 ? 17.051  0.958   -2.219  1.00 0.00 ? 63 ARG A HE   5  
ATOM 5759  H HH11 . ARG A 1 63 ? 19.034  3.472   -3.497  1.00 0.00 ? 63 ARG A HH11 5  
ATOM 5760  H HH12 . ARG A 1 63 ? 20.516  2.769   -2.940  1.00 0.00 ? 63 ARG A HH12 5  
ATOM 5761  H HH21 . ARG A 1 63 ? 18.973  0.025   -1.484  1.00 0.00 ? 63 ARG A HH21 5  
ATOM 5762  H HH22 . ARG A 1 63 ? 20.482  0.816   -1.800  1.00 0.00 ? 63 ARG A HH22 5  
ATOM 5763  N N    . GLY A 1 64 ? 11.653  4.988   -4.128  1.00 0.00 ? 64 GLY A N    5  
ATOM 5764  C CA   . GLY A 1 64 ? 10.870  6.162   -4.601  1.00 0.00 ? 64 GLY A CA   5  
ATOM 5765  C C    . GLY A 1 64 ? 9.971   6.646   -3.465  1.00 0.00 ? 64 GLY A C    5  
ATOM 5766  O O    . GLY A 1 64 ? 10.163  6.290   -2.319  1.00 0.00 ? 64 GLY A O    5  
ATOM 5767  H H    . GLY A 1 64 ? 11.632  4.750   -3.179  1.00 0.00 ? 64 GLY A H    5  
ATOM 5768  H HA2  . GLY A 1 64 ? 11.546  6.953   -4.894  1.00 0.00 ? 64 GLY A HA2  5  
ATOM 5769  H HA3  . GLY A 1 64 ? 10.258  5.877   -5.443  1.00 0.00 ? 64 GLY A HA3  5  
ATOM 5770  N N    . ASN A 1 65 ? 8.993   7.456   -3.763  1.00 0.00 ? 65 ASN A N    5  
ATOM 5771  C CA   . ASN A 1 65 ? 8.089   7.959   -2.690  1.00 0.00 ? 65 ASN A CA   5  
ATOM 5772  C C    . ASN A 1 65 ? 6.722   8.290   -3.287  1.00 0.00 ? 65 ASN A C    5  
ATOM 5773  O O    . ASN A 1 65 ? 6.224   9.390   -3.145  1.00 0.00 ? 65 ASN A O    5  
ATOM 5774  C CB   . ASN A 1 65 ? 8.691   9.221   -2.067  1.00 0.00 ? 65 ASN A CB   5  
ATOM 5775  C CG   . ASN A 1 65 ? 9.032   10.221  -3.172  1.00 0.00 ? 65 ASN A CG   5  
ATOM 5776  O OD1  . ASN A 1 65 ? 8.613   11.361  -3.127  1.00 0.00 ? 65 ASN A OD1  5  
ATOM 5777  N ND2  . ASN A 1 65 ? 9.780   9.840   -4.172  1.00 0.00 ? 65 ASN A ND2  5  
ATOM 5778  H H    . ASN A 1 65 ? 8.855   7.736   -4.692  1.00 0.00 ? 65 ASN A H    5  
ATOM 5779  H HA   . ASN A 1 65 ? 7.972   7.202   -1.926  1.00 0.00 ? 65 ASN A HA   5  
ATOM 5780  H HB2  . ASN A 1 65 ? 7.976   9.662   -1.388  1.00 0.00 ? 65 ASN A HB2  5  
ATOM 5781  H HB3  . ASN A 1 65 ? 9.590   8.963   -1.527  1.00 0.00 ? 65 ASN A HB3  5  
ATOM 5782  H HD21 . ASN A 1 65 ? 10.117  8.921   -4.209  1.00 0.00 ? 65 ASN A HD21 5  
ATOM 5783  H HD22 . ASN A 1 65 ? 10.004  10.474  -4.885  1.00 0.00 ? 65 ASN A HD22 5  
ATOM 5784  N N    . LEU A 1 66 ? 6.104   7.351   -3.952  1.00 0.00 ? 66 LEU A N    5  
ATOM 5785  C CA   . LEU A 1 66 ? 4.768   7.630   -4.547  1.00 0.00 ? 66 LEU A CA   5  
ATOM 5786  C C    . LEU A 1 66 ? 3.822   8.069   -3.423  1.00 0.00 ? 66 LEU A C    5  
ATOM 5787  O O    . LEU A 1 66 ? 3.200   9.110   -3.495  1.00 0.00 ? 66 LEU A O    5  
ATOM 5788  C CB   . LEU A 1 66 ? 4.233   6.355   -5.235  1.00 0.00 ? 66 LEU A CB   5  
ATOM 5789  C CG   . LEU A 1 66 ? 3.270   6.707   -6.388  1.00 0.00 ? 66 LEU A CG   5  
ATOM 5790  C CD1  . LEU A 1 66 ? 2.181   7.663   -5.894  1.00 0.00 ? 66 LEU A CD1  5  
ATOM 5791  C CD2  . LEU A 1 66 ? 4.035   7.350   -7.565  1.00 0.00 ? 66 LEU A CD2  5  
ATOM 5792  H H    . LEU A 1 66 ? 6.517   6.468   -4.056  1.00 0.00 ? 66 LEU A H    5  
ATOM 5793  H HA   . LEU A 1 66 ? 4.866   8.425   -5.267  1.00 0.00 ? 66 LEU A HA   5  
ATOM 5794  H HB2  . LEU A 1 66 ? 5.063   5.788   -5.626  1.00 0.00 ? 66 LEU A HB2  5  
ATOM 5795  H HB3  . LEU A 1 66 ? 3.708   5.748   -4.513  1.00 0.00 ? 66 LEU A HB3  5  
ATOM 5796  H HG   . LEU A 1 66 ? 2.795   5.797   -6.729  1.00 0.00 ? 66 LEU A HG   5  
ATOM 5797  H HD11 . LEU A 1 66 ? 2.607   8.636   -5.706  1.00 0.00 ? 66 LEU A HD11 5  
ATOM 5798  H HD12 . LEU A 1 66 ? 1.751   7.274   -4.988  1.00 0.00 ? 66 LEU A HD12 5  
ATOM 5799  H HD13 . LEU A 1 66 ? 1.412   7.749   -6.648  1.00 0.00 ? 66 LEU A HD13 5  
ATOM 5800  H HD21 . LEU A 1 66 ? 4.094   8.421   -7.430  1.00 0.00 ? 66 LEU A HD21 5  
ATOM 5801  H HD22 . LEU A 1 66 ? 3.511   7.139   -8.486  1.00 0.00 ? 66 LEU A HD22 5  
ATOM 5802  H HD23 . LEU A 1 66 ? 5.033   6.942   -7.624  1.00 0.00 ? 66 LEU A HD23 5  
ATOM 5803  N N    . ASP A 1 67 ? 3.722   7.283   -2.382  1.00 0.00 ? 67 ASP A N    5  
ATOM 5804  C CA   . ASP A 1 67 ? 2.825   7.647   -1.245  1.00 0.00 ? 67 ASP A CA   5  
ATOM 5805  C C    . ASP A 1 67 ? 1.393   7.797   -1.761  1.00 0.00 ? 67 ASP A C    5  
ATOM 5806  O O    . ASP A 1 67 ? 1.171   8.107   -2.910  1.00 0.00 ? 67 ASP A O    5  
ATOM 5807  C CB   . ASP A 1 67 ? 3.291   8.968   -0.623  1.00 0.00 ? 67 ASP A CB   5  
ATOM 5808  C CG   . ASP A 1 67 ? 2.644   9.144   0.752   1.00 0.00 ? 67 ASP A CG   5  
ATOM 5809  O OD1  . ASP A 1 67 ? 1.495   9.551   0.795   1.00 0.00 ? 67 ASP A OD1  5  
ATOM 5810  O OD2  . ASP A 1 67 ? 3.308   8.871   1.738   1.00 0.00 ? 67 ASP A OD2  5  
ATOM 5811  H H    . ASP A 1 67 ? 4.241   6.453   -2.345  1.00 0.00 ? 67 ASP A H    5  
ATOM 5812  H HA   . ASP A 1 67 ? 2.858   6.866   -0.499  1.00 0.00 ? 67 ASP A HA   5  
ATOM 5813  H HB2  . ASP A 1 67 ? 4.366   8.954   -0.516  1.00 0.00 ? 67 ASP A HB2  5  
ATOM 5814  H HB3  . ASP A 1 67 ? 3.004   9.790   -1.262  1.00 0.00 ? 67 ASP A HB3  5  
ATOM 5815  N N    . ASP A 1 68 ? 0.414   7.578   -0.926  1.00 0.00 ? 68 ASP A N    5  
ATOM 5816  C CA   . ASP A 1 68 ? -0.996  7.711   -1.393  1.00 0.00 ? 68 ASP A CA   5  
ATOM 5817  C C    . ASP A 1 68 ? -1.153  9.017   -2.173  1.00 0.00 ? 68 ASP A C    5  
ATOM 5818  O O    . ASP A 1 68 ? -0.414  9.962   -1.975  1.00 0.00 ? 68 ASP A O    5  
ATOM 5819  C CB   . ASP A 1 68 ? -1.945  7.723   -0.196  1.00 0.00 ? 68 ASP A CB   5  
ATOM 5820  C CG   . ASP A 1 68 ? -1.463  8.755   0.826   1.00 0.00 ? 68 ASP A CG   5  
ATOM 5821  O OD1  . ASP A 1 68 ? -1.172  9.868   0.421   1.00 0.00 ? 68 ASP A OD1  5  
ATOM 5822  O OD2  . ASP A 1 68 ? -1.395  8.415   1.995   1.00 0.00 ? 68 ASP A OD2  5  
ATOM 5823  H H    . ASP A 1 68 ? 0.604   7.326   0.003   1.00 0.00 ? 68 ASP A H    5  
ATOM 5824  H HA   . ASP A 1 68 ? -1.241  6.879   -2.036  1.00 0.00 ? 68 ASP A HA   5  
ATOM 5825  H HB2  . ASP A 1 68 ? -2.939  7.983   -0.532  1.00 0.00 ? 68 ASP A HB2  5  
ATOM 5826  H HB3  . ASP A 1 68 ? -1.962  6.746   0.262   1.00 0.00 ? 68 ASP A HB3  5  
ATOM 5827  N N    . PHE A 1 69 ? -2.103  9.080   -3.060  1.00 0.00 ? 69 PHE A N    5  
ATOM 5828  C CA   . PHE A 1 69 ? -2.299  10.323  -3.849  1.00 0.00 ? 69 PHE A CA   5  
ATOM 5829  C C    . PHE A 1 69 ? -3.705  10.299  -4.431  1.00 0.00 ? 69 PHE A C    5  
ATOM 5830  O O    . PHE A 1 69 ? -4.392  11.299  -4.472  1.00 0.00 ? 69 PHE A O    5  
ATOM 5831  C CB   . PHE A 1 69 ? -1.272  10.382  -4.982  1.00 0.00 ? 69 PHE A CB   5  
ATOM 5832  C CG   . PHE A 1 69 ? -1.470  11.650  -5.777  1.00 0.00 ? 69 PHE A CG   5  
ATOM 5833  C CD1  . PHE A 1 69 ? -0.831  12.832  -5.381  1.00 0.00 ? 69 PHE A CD1  5  
ATOM 5834  C CD2  . PHE A 1 69 ? -2.291  11.645  -6.912  1.00 0.00 ? 69 PHE A CD2  5  
ATOM 5835  C CE1  . PHE A 1 69 ? -1.014  14.007  -6.119  1.00 0.00 ? 69 PHE A CE1  5  
ATOM 5836  C CE2  . PHE A 1 69 ? -2.473  12.821  -7.650  1.00 0.00 ? 69 PHE A CE2  5  
ATOM 5837  C CZ   . PHE A 1 69 ? -1.834  14.002  -7.253  1.00 0.00 ? 69 PHE A CZ   5  
ATOM 5838  H H    . PHE A 1 69 ? -2.693  8.307   -3.209  1.00 0.00 ? 69 PHE A H    5  
ATOM 5839  H HA   . PHE A 1 69 ? -2.185  11.184  -3.207  1.00 0.00 ? 69 PHE A HA   5  
ATOM 5840  H HB2  . PHE A 1 69 ? -0.276  10.369  -4.564  1.00 0.00 ? 69 PHE A HB2  5  
ATOM 5841  H HB3  . PHE A 1 69 ? -1.400  9.528   -5.630  1.00 0.00 ? 69 PHE A HB3  5  
ATOM 5842  H HD1  . PHE A 1 69 ? -0.198  12.835  -4.506  1.00 0.00 ? 69 PHE A HD1  5  
ATOM 5843  H HD2  . PHE A 1 69 ? -2.783  10.734  -7.217  1.00 0.00 ? 69 PHE A HD2  5  
ATOM 5844  H HE1  . PHE A 1 69 ? -0.521  14.918  -5.813  1.00 0.00 ? 69 PHE A HE1  5  
ATOM 5845  H HE2  . PHE A 1 69 ? -3.106  12.816  -8.524  1.00 0.00 ? 69 PHE A HE2  5  
ATOM 5846  H HZ   . PHE A 1 69 ? -1.974  14.908  -7.822  1.00 0.00 ? 69 PHE A HZ   5  
ATOM 5847  N N    . PHE A 1 70 ? -4.140  9.152   -4.868  1.00 0.00 ? 70 PHE A N    5  
ATOM 5848  C CA   . PHE A 1 70 ? -5.505  9.055   -5.432  1.00 0.00 ? 70 PHE A CA   5  
ATOM 5849  C C    . PHE A 1 70 ? -6.498  9.546   -4.380  1.00 0.00 ? 70 PHE A C    5  
ATOM 5850  O O    . PHE A 1 70 ? -7.218  10.501  -4.593  1.00 0.00 ? 70 PHE A O    5  
ATOM 5851  C CB   . PHE A 1 70 ? -5.807  7.600   -5.803  1.00 0.00 ? 70 PHE A CB   5  
ATOM 5852  C CG   . PHE A 1 70 ? -5.057  7.240   -7.065  1.00 0.00 ? 70 PHE A CG   5  
ATOM 5853  C CD1  . PHE A 1 70 ? -3.741  6.765   -6.987  1.00 0.00 ? 70 PHE A CD1  5  
ATOM 5854  C CD2  . PHE A 1 70 ? -5.676  7.385   -8.312  1.00 0.00 ? 70 PHE A CD2  5  
ATOM 5855  C CE1  . PHE A 1 70 ? -3.046  6.434   -8.157  1.00 0.00 ? 70 PHE A CE1  5  
ATOM 5856  C CE2  . PHE A 1 70 ? -4.981  7.054   -9.481  1.00 0.00 ? 70 PHE A CE2  5  
ATOM 5857  C CZ   . PHE A 1 70 ? -3.666  6.579   -9.404  1.00 0.00 ? 70 PHE A CZ   5  
ATOM 5858  H H    . PHE A 1 70 ? -3.570  8.356   -4.816  1.00 0.00 ? 70 PHE A H    5  
ATOM 5859  H HA   . PHE A 1 70 ? -5.571  9.674   -6.308  1.00 0.00 ? 70 PHE A HA   5  
ATOM 5860  H HB2  . PHE A 1 70 ? -5.492  6.952   -4.998  1.00 0.00 ? 70 PHE A HB2  5  
ATOM 5861  H HB3  . PHE A 1 70 ? -6.867  7.483   -5.968  1.00 0.00 ? 70 PHE A HB3  5  
ATOM 5862  H HD1  . PHE A 1 70 ? -3.263  6.653   -6.025  1.00 0.00 ? 70 PHE A HD1  5  
ATOM 5863  H HD2  . PHE A 1 70 ? -6.690  7.751   -8.373  1.00 0.00 ? 70 PHE A HD2  5  
ATOM 5864  H HE1  . PHE A 1 70 ? -2.033  6.068   -8.097  1.00 0.00 ? 70 PHE A HE1  5  
ATOM 5865  H HE2  . PHE A 1 70 ? -5.458  7.165   -10.444 1.00 0.00 ? 70 PHE A HE2  5  
ATOM 5866  H HZ   . PHE A 1 70 ? -3.130  6.324   -10.306 1.00 0.00 ? 70 PHE A HZ   5  
ATOM 5867  N N    . HIS A 1 71 ? -6.539  8.900   -3.245  1.00 0.00 ? 71 HIS A N    5  
ATOM 5868  C CA   . HIS A 1 71 ? -7.476  9.325   -2.169  1.00 0.00 ? 71 HIS A CA   5  
ATOM 5869  C C    . HIS A 1 71 ? -8.901  9.389   -2.717  1.00 0.00 ? 71 HIS A C    5  
ATOM 5870  O O    . HIS A 1 71 ? -9.750  10.080  -2.187  1.00 0.00 ? 71 HIS A O    5  
ATOM 5871  C CB   . HIS A 1 71 ? -7.062  10.698  -1.631  1.00 0.00 ? 71 HIS A CB   5  
ATOM 5872  C CG   . HIS A 1 71 ? -5.767  10.568  -0.877  1.00 0.00 ? 71 HIS A CG   5  
ATOM 5873  N ND1  . HIS A 1 71 ? -5.674  9.873   0.319   1.00 0.00 ? 71 HIS A ND1  5  
ATOM 5874  C CD2  . HIS A 1 71 ? -4.503  11.038  -1.137  1.00 0.00 ? 71 HIS A CD2  5  
ATOM 5875  C CE1  . HIS A 1 71 ? -4.394  9.945   0.731   1.00 0.00 ? 71 HIS A CE1  5  
ATOM 5876  N NE2  . HIS A 1 71 ? -3.638  10.643  -0.120  1.00 0.00 ? 71 HIS A NE2  5  
ATOM 5877  H H    . HIS A 1 71 ? -5.958  8.126   -3.092  1.00 0.00 ? 71 HIS A H    5  
ATOM 5878  H HA   . HIS A 1 71 ? -7.436  8.604   -1.366  1.00 0.00 ? 71 HIS A HA   5  
ATOM 5879  H HB2  . HIS A 1 71 ? -6.933  11.386  -2.452  1.00 0.00 ? 71 HIS A HB2  5  
ATOM 5880  H HB3  . HIS A 1 71 ? -7.827  11.070  -0.967  1.00 0.00 ? 71 HIS A HB3  5  
ATOM 5881  H HD1  . HIS A 1 71 ? -6.406  9.414   0.781   1.00 0.00 ? 71 HIS A HD1  5  
ATOM 5882  H HD2  . HIS A 1 71 ? -4.222  11.624  -1.999  1.00 0.00 ? 71 HIS A HD2  5  
ATOM 5883  H HE1  . HIS A 1 71 ? -4.024  9.492   1.639   1.00 0.00 ? 71 HIS A HE1  5  
ATOM 5884  N N    . ARG A 1 72 ? -9.174  8.667   -3.768  1.00 0.00 ? 72 ARG A N    5  
ATOM 5885  C CA   . ARG A 1 72 ? -10.548 8.679   -4.340  1.00 0.00 ? 72 ARG A CA   5  
ATOM 5886  C C    . ARG A 1 72 ? -11.493 7.960   -3.376  1.00 0.00 ? 72 ARG A C    5  
ATOM 5887  O O    . ARG A 1 72 ? -12.154 7.005   -3.734  1.00 0.00 ? 72 ARG A O    5  
ATOM 5888  C CB   . ARG A 1 72 ? -10.542 7.954   -5.692  1.00 0.00 ? 72 ARG A CB   5  
ATOM 5889  C CG   . ARG A 1 72 ? -9.564  8.645   -6.661  1.00 0.00 ? 72 ARG A CG   5  
ATOM 5890  C CD   . ARG A 1 72 ? -10.257 9.813   -7.371  1.00 0.00 ? 72 ARG A CD   5  
ATOM 5891  N NE   . ARG A 1 72 ? -9.272  10.523  -8.234  1.00 0.00 ? 72 ARG A NE   5  
ATOM 5892  C CZ   . ARG A 1 72 ? -9.686  11.355  -9.151  1.00 0.00 ? 72 ARG A CZ   5  
ATOM 5893  N NH1  . ARG A 1 72 ? -10.964 11.562  -9.313  1.00 0.00 ? 72 ARG A NH1  5  
ATOM 5894  N NH2  . ARG A 1 72 ? -8.823  11.978  -9.904  1.00 0.00 ? 72 ARG A NH2  5  
ATOM 5895  H H    . ARG A 1 72 ? -8.478  8.111   -4.175  1.00 0.00 ? 72 ARG A H    5  
ATOM 5896  H HA   . ARG A 1 72 ? -10.876 9.698   -4.473  1.00 0.00 ? 72 ARG A HA   5  
ATOM 5897  H HB2  . ARG A 1 72 ? -10.232 6.927   -5.542  1.00 0.00 ? 72 ARG A HB2  5  
ATOM 5898  H HB3  . ARG A 1 72 ? -11.537 7.967   -6.111  1.00 0.00 ? 72 ARG A HB3  5  
ATOM 5899  H HG2  . ARG A 1 72 ? -8.708  9.015   -6.112  1.00 0.00 ? 72 ARG A HG2  5  
ATOM 5900  H HG3  . ARG A 1 72 ? -9.230  7.931   -7.399  1.00 0.00 ? 72 ARG A HG3  5  
ATOM 5901  H HD2  . ARG A 1 72 ? -11.063 9.435   -7.982  1.00 0.00 ? 72 ARG A HD2  5  
ATOM 5902  H HD3  . ARG A 1 72 ? -10.653 10.501  -6.639  1.00 0.00 ? 72 ARG A HD3  5  
ATOM 5903  H HE   . ARG A 1 72 ? -8.312  10.367  -8.112  1.00 0.00 ? 72 ARG A HE   5  
ATOM 5904  H HH11 . ARG A 1 72 ? -11.625 11.084  -8.736  1.00 0.00 ? 72 ARG A HH11 5  
ATOM 5905  H HH12 . ARG A 1 72 ? -11.281 12.198  -10.016 1.00 0.00 ? 72 ARG A HH12 5  
ATOM 5906  H HH21 . ARG A 1 72 ? -7.843  11.818  -9.780  1.00 0.00 ? 72 ARG A HH21 5  
ATOM 5907  H HH22 . ARG A 1 72 ? -9.141  12.615  -10.607 1.00 0.00 ? 72 ARG A HH22 5  
ATOM 5908  N N    . ASP A 1 73 ? -11.554 8.407   -2.149  1.00 0.00 ? 73 ASP A N    5  
ATOM 5909  C CA   . ASP A 1 73 ? -12.447 7.746   -1.155  1.00 0.00 ? 73 ASP A CA   5  
ATOM 5910  C C    . ASP A 1 73 ? -12.787 8.732   -0.034  1.00 0.00 ? 73 ASP A C    5  
ATOM 5911  O O    . ASP A 1 73 ? -12.815 8.378   1.128   1.00 0.00 ? 73 ASP A O    5  
ATOM 5912  C CB   . ASP A 1 73 ? -11.726 6.528   -0.565  1.00 0.00 ? 73 ASP A CB   5  
ATOM 5913  C CG   . ASP A 1 73 ? -11.767 5.371   -1.568  1.00 0.00 ? 73 ASP A CG   5  
ATOM 5914  O OD1  . ASP A 1 73 ? -12.787 5.212   -2.218  1.00 0.00 ? 73 ASP A OD1  5  
ATOM 5915  O OD2  . ASP A 1 73 ? -10.778 4.664   -1.668  1.00 0.00 ? 73 ASP A OD2  5  
ATOM 5916  H H    . ASP A 1 73 ? -11.007 9.174   -1.881  1.00 0.00 ? 73 ASP A H    5  
ATOM 5917  H HA   . ASP A 1 73 ? -13.359 7.427   -1.642  1.00 0.00 ? 73 ASP A HA   5  
ATOM 5918  H HB2  . ASP A 1 73 ? -10.698 6.787   -0.358  1.00 0.00 ? 73 ASP A HB2  5  
ATOM 5919  H HB3  . ASP A 1 73 ? -12.212 6.226   0.350   1.00 0.00 ? 73 ASP A HB3  5  
ATOM 5920  N N    . LYS A 1 74 ? -13.047 9.966   -0.370  1.00 0.00 ? 74 LYS A N    5  
ATOM 5921  C CA   . LYS A 1 74 ? -13.384 10.970  0.680   1.00 0.00 ? 74 LYS A CA   5  
ATOM 5922  C C    . LYS A 1 74 ? -14.484 10.411  1.584   1.00 0.00 ? 74 LYS A C    5  
ATOM 5923  O O    . LYS A 1 74 ? -15.199 9.498   1.219   1.00 0.00 ? 74 LYS A O    5  
ATOM 5924  C CB   . LYS A 1 74 ? -13.874 12.259  0.018   1.00 0.00 ? 74 LYS A CB   5  
ATOM 5925  C CG   . LYS A 1 74 ? -14.096 13.330  1.087   1.00 0.00 ? 74 LYS A CG   5  
ATOM 5926  C CD   . LYS A 1 74 ? -14.309 14.687  0.414   1.00 0.00 ? 74 LYS A CD   5  
ATOM 5927  C CE   . LYS A 1 74 ? -14.493 15.765  1.484   1.00 0.00 ? 74 LYS A CE   5  
ATOM 5928  N NZ   . LYS A 1 74 ? -13.335 15.737  2.422   1.00 0.00 ? 74 LYS A NZ   5  
ATOM 5929  H H    . LYS A 1 74 ? -13.019 10.236  -1.313  1.00 0.00 ? 74 LYS A H    5  
ATOM 5930  H HA   . LYS A 1 74 ? -12.505 11.180  1.271   1.00 0.00 ? 74 LYS A HA   5  
ATOM 5931  H HB2  . LYS A 1 74 ? -13.133 12.603  -0.690  1.00 0.00 ? 74 LYS A HB2  5  
ATOM 5932  H HB3  . LYS A 1 74 ? -14.803 12.069  -0.498  1.00 0.00 ? 74 LYS A HB3  5  
ATOM 5933  H HG2  . LYS A 1 74 ? -14.967 13.078  1.674   1.00 0.00 ? 74 LYS A HG2  5  
ATOM 5934  H HG3  . LYS A 1 74 ? -13.230 13.381  1.730   1.00 0.00 ? 74 LYS A HG3  5  
ATOM 5935  H HD2  . LYS A 1 74 ? -13.449 14.927  -0.195  1.00 0.00 ? 74 LYS A HD2  5  
ATOM 5936  H HD3  . LYS A 1 74 ? -15.190 14.647  -0.208  1.00 0.00 ? 74 LYS A HD3  5  
ATOM 5937  H HE2  . LYS A 1 74 ? -14.551 16.734  1.012   1.00 0.00 ? 74 LYS A HE2  5  
ATOM 5938  H HE3  . LYS A 1 74 ? -15.405 15.576  2.032   1.00 0.00 ? 74 LYS A HE3  5  
ATOM 5939  H HZ1  . LYS A 1 74 ? -13.372 14.868  2.991   1.00 0.00 ? 74 LYS A HZ1  5  
ATOM 5940  H HZ2  . LYS A 1 74 ? -13.378 16.563  3.052   1.00 0.00 ? 74 LYS A HZ2  5  
ATOM 5941  H HZ3  . LYS A 1 74 ? -12.449 15.760  1.878   1.00 0.00 ? 74 LYS A HZ3  5  
ATOM 5942  N N    . ASP A 1 75 ? -14.627 10.952  2.764   1.00 0.00 ? 75 ASP A N    5  
ATOM 5943  C CA   . ASP A 1 75 ? -15.681 10.451  3.692   1.00 0.00 ? 75 ASP A CA   5  
ATOM 5944  C C    . ASP A 1 75 ? -15.904 11.472  4.809   1.00 0.00 ? 75 ASP A C    5  
ATOM 5945  O O    . ASP A 1 75 ? -15.315 12.535  4.820   1.00 0.00 ? 75 ASP A O    5  
ATOM 5946  C CB   . ASP A 1 75 ? -15.234 9.120   4.301   1.00 0.00 ? 75 ASP A CB   5  
ATOM 5947  C CG   . ASP A 1 75 ? -16.398 8.493   5.069   1.00 0.00 ? 75 ASP A CG   5  
ATOM 5948  O OD1  . ASP A 1 75 ? -17.475 8.401   4.504   1.00 0.00 ? 75 ASP A OD1  5  
ATOM 5949  O OD2  . ASP A 1 75 ? -16.193 8.116   6.211   1.00 0.00 ? 75 ASP A OD2  5  
ATOM 5950  H H    . ASP A 1 75 ? -14.040 11.687  3.040   1.00 0.00 ? 75 ASP A H    5  
ATOM 5951  H HA   . ASP A 1 75 ? -16.602 10.307  3.147   1.00 0.00 ? 75 ASP A HA   5  
ATOM 5952  H HB2  . ASP A 1 75 ? -14.919 8.451   3.512   1.00 0.00 ? 75 ASP A HB2  5  
ATOM 5953  H HB3  . ASP A 1 75 ? -14.410 9.292   4.977   1.00 0.00 ? 75 ASP A HB3  5  
ATOM 5954  N N    . ASP A 1 76 ? -16.748 11.157  5.753   1.00 0.00 ? 76 ASP A N    5  
ATOM 5955  C CA   . ASP A 1 76 ? -17.007 12.107  6.872   1.00 0.00 ? 76 ASP A CA   5  
ATOM 5956  C C    . ASP A 1 76 ? -17.634 11.350  8.043   1.00 0.00 ? 76 ASP A C    5  
ATOM 5957  O O    . ASP A 1 76 ? -18.648 11.749  8.581   1.00 0.00 ? 76 ASP A O    5  
ATOM 5958  C CB   . ASP A 1 76 ? -17.962 13.206  6.401   1.00 0.00 ? 76 ASP A CB   5  
ATOM 5959  C CG   . ASP A 1 76 ? -19.236 12.573  5.839   1.00 0.00 ? 76 ASP A CG   5  
ATOM 5960  O OD1  . ASP A 1 76 ? -19.807 11.733  6.516   1.00 0.00 ? 76 ASP A OD1  5  
ATOM 5961  O OD2  . ASP A 1 76 ? -19.621 12.939  4.741   1.00 0.00 ? 76 ASP A OD2  5  
ATOM 5962  H H    . ASP A 1 76 ? -17.212 10.294  5.726   1.00 0.00 ? 76 ASP A H    5  
ATOM 5963  H HA   . ASP A 1 76 ? -16.075 12.551  7.189   1.00 0.00 ? 76 ASP A HA   5  
ATOM 5964  H HB2  . ASP A 1 76 ? -18.215 13.843  7.236   1.00 0.00 ? 76 ASP A HB2  5  
ATOM 5965  H HB3  . ASP A 1 76 ? -17.484 13.793  5.632   1.00 0.00 ? 76 ASP A HB3  5  
ATOM 5966  N N    . PHE A 1 77 ? -17.040 10.259  8.444   1.00 0.00 ? 77 PHE A N    5  
ATOM 5967  C CA   . PHE A 1 77 ? -17.602 9.478   9.580   1.00 0.00 ? 77 PHE A CA   5  
ATOM 5968  C C    . PHE A 1 77 ? -17.500 10.302  10.864  1.00 0.00 ? 77 PHE A C    5  
ATOM 5969  O O    . PHE A 1 77 ? -17.960 9.896   11.912  1.00 0.00 ? 77 PHE A O    5  
ATOM 5970  C CB   . PHE A 1 77 ? -16.815 8.178   9.747   1.00 0.00 ? 77 PHE A CB   5  
ATOM 5971  C CG   . PHE A 1 77 ? -17.432 7.357   10.853  1.00 0.00 ? 77 PHE A CG   5  
ATOM 5972  C CD1  . PHE A 1 77 ? -18.489 6.484   10.569  1.00 0.00 ? 77 PHE A CD1  5  
ATOM 5973  C CD2  . PHE A 1 77 ? -16.951 7.471   12.162  1.00 0.00 ? 77 PHE A CD2  5  
ATOM 5974  C CE1  . PHE A 1 77 ? -19.064 5.724   11.594  1.00 0.00 ? 77 PHE A CE1  5  
ATOM 5975  C CE2  . PHE A 1 77 ? -17.526 6.711   13.188  1.00 0.00 ? 77 PHE A CE2  5  
ATOM 5976  C CZ   . PHE A 1 77 ? -18.583 5.839   12.904  1.00 0.00 ? 77 PHE A CZ   5  
ATOM 5977  H H    . PHE A 1 77 ? -16.222 9.955   7.996   1.00 0.00 ? 77 PHE A H    5  
ATOM 5978  H HA   . PHE A 1 77 ? -18.639 9.248   9.381   1.00 0.00 ? 77 PHE A HA   5  
ATOM 5979  H HB2  . PHE A 1 77 ? -16.842 7.618   8.823   1.00 0.00 ? 77 PHE A HB2  5  
ATOM 5980  H HB3  . PHE A 1 77 ? -15.790 8.407   10.000  1.00 0.00 ? 77 PHE A HB3  5  
ATOM 5981  H HD1  . PHE A 1 77 ? -18.859 6.396   9.559   1.00 0.00 ? 77 PHE A HD1  5  
ATOM 5982  H HD2  . PHE A 1 77 ? -16.135 8.144   12.382  1.00 0.00 ? 77 PHE A HD2  5  
ATOM 5983  H HE1  . PHE A 1 77 ? -19.879 5.051   11.375  1.00 0.00 ? 77 PHE A HE1  5  
ATOM 5984  H HE2  . PHE A 1 77 ? -17.154 6.799   14.198  1.00 0.00 ? 77 PHE A HE2  5  
ATOM 5985  H HZ   . PHE A 1 77 ? -19.027 5.252   13.695  1.00 0.00 ? 77 PHE A HZ   5  
ATOM 5986  N N    . PHE A 1 78 ? -16.899 11.457  10.790  1.00 0.00 ? 78 PHE A N    5  
ATOM 5987  C CA   . PHE A 1 78 ? -16.765 12.308  12.007  1.00 0.00 ? 78 PHE A CA   5  
ATOM 5988  C C    . PHE A 1 78 ? -18.153 12.752  12.475  1.00 0.00 ? 78 PHE A C    5  
ATOM 5989  O O    . PHE A 1 78 ? -18.653 13.783  12.072  1.00 0.00 ? 78 PHE A O    5  
ATOM 5990  C CB   . PHE A 1 78 ? -15.920 13.539  11.676  1.00 0.00 ? 78 PHE A CB   5  
ATOM 5991  C CG   . PHE A 1 78 ? -14.525 13.105  11.292  1.00 0.00 ? 78 PHE A CG   5  
ATOM 5992  C CD1  . PHE A 1 78 ? -13.568 12.869  12.286  1.00 0.00 ? 78 PHE A CD1  5  
ATOM 5993  C CD2  . PHE A 1 78 ? -14.190 12.940  9.943   1.00 0.00 ? 78 PHE A CD2  5  
ATOM 5994  C CE1  . PHE A 1 78 ? -12.275 12.466  11.930  1.00 0.00 ? 78 PHE A CE1  5  
ATOM 5995  C CE2  . PHE A 1 78 ? -12.897 12.538  9.588   1.00 0.00 ? 78 PHE A CE2  5  
ATOM 5996  C CZ   . PHE A 1 78 ? -11.939 12.301  10.581  1.00 0.00 ? 78 PHE A CZ   5  
ATOM 5997  H H    . PHE A 1 78 ? -16.534 11.766  9.935   1.00 0.00 ? 78 PHE A H    5  
ATOM 5998  H HA   . PHE A 1 78 ? -16.285 11.741  12.791  1.00 0.00 ? 78 PHE A HA   5  
ATOM 5999  H HB2  . PHE A 1 78 ? -16.370 14.074  10.851  1.00 0.00 ? 78 PHE A HB2  5  
ATOM 6000  H HB3  . PHE A 1 78 ? -15.871 14.185  12.540  1.00 0.00 ? 78 PHE A HB3  5  
ATOM 6001  H HD1  . PHE A 1 78 ? -13.827 12.996  13.326  1.00 0.00 ? 78 PHE A HD1  5  
ATOM 6002  H HD2  . PHE A 1 78 ? -14.928 13.122  9.177   1.00 0.00 ? 78 PHE A HD2  5  
ATOM 6003  H HE1  . PHE A 1 78 ? -11.536 12.284  12.697  1.00 0.00 ? 78 PHE A HE1  5  
ATOM 6004  H HE2  . PHE A 1 78 ? -12.638 12.410  8.546   1.00 0.00 ? 78 PHE A HE2  5  
ATOM 6005  H HZ   . PHE A 1 78 ? -10.942 11.990  10.307  1.00 0.00 ? 78 PHE A HZ   5  
ATOM 6006  N N    . THR A 1 79 ? -18.779 11.982  13.323  1.00 0.00 ? 79 THR A N    5  
ATOM 6007  C CA   . THR A 1 79 ? -20.133 12.364  13.816  1.00 0.00 ? 79 THR A CA   5  
ATOM 6008  C C    . THR A 1 79 ? -20.044 13.697  14.562  1.00 0.00 ? 79 THR A C    5  
ATOM 6009  O O    . THR A 1 79 ? -21.078 14.318  14.749  1.00 0.00 ? 79 THR A O    5  
ATOM 6010  C CB   . THR A 1 79 ? -20.657 11.283  14.763  1.00 0.00 ? 79 THR A CB   5  
ATOM 6011  O OG1  . THR A 1 79 ? -19.798 11.187  15.892  1.00 0.00 ? 79 THR A OG1  5  
ATOM 6012  C CG2  . THR A 1 79 ? -20.699 9.939   14.036  1.00 0.00 ? 79 THR A CG2  5  
ATOM 6013  O OXT  . THR A 1 79 ? -18.945 14.073  14.934  1.00 0.00 ? 79 THR A OXT  5  
ATOM 6014  H H    . THR A 1 79 ? -18.359 11.154  13.638  1.00 0.00 ? 79 THR A H    5  
ATOM 6015  H HA   . THR A 1 79 ? -20.805 12.465  12.977  1.00 0.00 ? 79 THR A HA   5  
ATOM 6016  H HB   . THR A 1 79 ? -21.653 11.541  15.090  1.00 0.00 ? 79 THR A HB   5  
ATOM 6017  H HG1  . THR A 1 79 ? -19.032 10.669  15.637  1.00 0.00 ? 79 THR A HG1  5  
ATOM 6018  H HG21 . THR A 1 79 ? -19.706 9.678   13.703  1.00 0.00 ? 79 THR A HG21 5  
ATOM 6019  H HG22 . THR A 1 79 ? -21.358 10.012  13.183  1.00 0.00 ? 79 THR A HG22 5  
ATOM 6020  H HG23 . THR A 1 79 ? -21.064 9.176   14.708  1.00 0.00 ? 79 THR A HG23 5  
ATOM 6021  N N    . MET A 1 1  ? -28.365 15.791  20.391  1.00 0.00 ? 1  MET A N    6  
ATOM 6022  C CA   . MET A 1 1  ? -27.748 14.647  21.121  1.00 0.00 ? 1  MET A CA   6  
ATOM 6023  C C    . MET A 1 1  ? -26.700 13.979  20.229  1.00 0.00 ? 1  MET A C    6  
ATOM 6024  O O    . MET A 1 1  ? -25.552 14.376  20.201  1.00 0.00 ? 1  MET A O    6  
ATOM 6025  C CB   . MET A 1 1  ? -28.832 13.630  21.484  1.00 0.00 ? 1  MET A CB   6  
ATOM 6026  C CG   . MET A 1 1  ? -29.798 14.251  22.494  1.00 0.00 ? 1  MET A CG   6  
ATOM 6027  S SD   . MET A 1 1  ? -31.149 13.093  22.828  1.00 0.00 ? 1  MET A SD   6  
ATOM 6028  C CE   . MET A 1 1  ? -31.766 13.892  24.330  1.00 0.00 ? 1  MET A CE   6  
ATOM 6029  H H1   . MET A 1 1  ? -29.400 15.731  20.464  1.00 0.00 ? 1  MET A H1   6  
ATOM 6030  H H2   . MET A 1 1  ? -28.085 15.753  19.389  1.00 0.00 ? 1  MET A H2   6  
ATOM 6031  H H3   . MET A 1 1  ? -28.041 16.685  20.809  1.00 0.00 ? 1  MET A H3   6  
ATOM 6032  H HA   . MET A 1 1  ? -27.276 15.009  22.023  1.00 0.00 ? 1  MET A HA   6  
ATOM 6033  H HB2  . MET A 1 1  ? -29.374 13.347  20.592  1.00 0.00 ? 1  MET A HB2  6  
ATOM 6034  H HB3  . MET A 1 1  ? -28.373 12.754  21.919  1.00 0.00 ? 1  MET A HB3  6  
ATOM 6035  H HG2  . MET A 1 1  ? -29.272 14.465  23.412  1.00 0.00 ? 1  MET A HG2  6  
ATOM 6036  H HG3  . MET A 1 1  ? -30.203 15.167  22.089  1.00 0.00 ? 1  MET A HG3  6  
ATOM 6037  H HE1  . MET A 1 1  ? -31.068 13.727  25.138  1.00 0.00 ? 1  MET A HE1  6  
ATOM 6038  H HE2  . MET A 1 1  ? -32.730 13.474  24.588  1.00 0.00 ? 1  MET A HE2  6  
ATOM 6039  H HE3  . MET A 1 1  ? -31.871 14.951  24.159  1.00 0.00 ? 1  MET A HE3  6  
ATOM 6040  N N    . ILE A 1 2  ? -27.084 12.967  19.501  1.00 0.00 ? 2  ILE A N    6  
ATOM 6041  C CA   . ILE A 1 2  ? -26.109 12.275  18.612  1.00 0.00 ? 2  ILE A CA   6  
ATOM 6042  C C    . ILE A 1 2  ? -24.896 11.832  19.433  1.00 0.00 ? 2  ILE A C    6  
ATOM 6043  O O    . ILE A 1 2  ? -23.772 12.193  19.144  1.00 0.00 ? 2  ILE A O    6  
ATOM 6044  C CB   . ILE A 1 2  ? -25.655 13.233  17.508  1.00 0.00 ? 2  ILE A CB   6  
ATOM 6045  C CG1  . ILE A 1 2  ? -26.876 13.936  16.912  1.00 0.00 ? 2  ILE A CG1  6  
ATOM 6046  C CG2  . ILE A 1 2  ? -24.935 12.447  16.412  1.00 0.00 ? 2  ILE A CG2  6  
ATOM 6047  C CD1  . ILE A 1 2  ? -26.433 14.840  15.759  1.00 0.00 ? 2  ILE A CD1  6  
ATOM 6048  H H    . ILE A 1 2  ? -28.016 12.663  19.537  1.00 0.00 ? 2  ILE A H    6  
ATOM 6049  H HA   . ILE A 1 2  ? -26.578 11.411  18.167  1.00 0.00 ? 2  ILE A HA   6  
ATOM 6050  H HB   . ILE A 1 2  ? -24.981 13.968  17.926  1.00 0.00 ? 2  ILE A HB   6  
ATOM 6051  H HG12 . ILE A 1 2  ? -27.573 13.197  16.544  1.00 0.00 ? 2  ILE A HG12 6  
ATOM 6052  H HG13 . ILE A 1 2  ? -27.354 14.536  17.672  1.00 0.00 ? 2  ILE A HG13 6  
ATOM 6053  H HG21 . ILE A 1 2  ? -24.429 13.133  15.750  1.00 0.00 ? 2  ILE A HG21 6  
ATOM 6054  H HG22 . ILE A 1 2  ? -25.656 11.870  15.851  1.00 0.00 ? 2  ILE A HG22 6  
ATOM 6055  H HG23 . ILE A 1 2  ? -24.213 11.781  16.861  1.00 0.00 ? 2  ILE A HG23 6  
ATOM 6056  H HD11 . ILE A 1 2  ? -26.131 14.231  14.920  1.00 0.00 ? 2  ILE A HD11 6  
ATOM 6057  H HD12 . ILE A 1 2  ? -25.600 15.450  16.080  1.00 0.00 ? 2  ILE A HD12 6  
ATOM 6058  H HD13 . ILE A 1 2  ? -27.254 15.478  15.466  1.00 0.00 ? 2  ILE A HD13 6  
ATOM 6059  N N    . ASP A 1 3  ? -25.114 11.051  20.457  1.00 0.00 ? 3  ASP A N    6  
ATOM 6060  C CA   . ASP A 1 3  ? -23.975 10.583  21.299  1.00 0.00 ? 3  ASP A CA   6  
ATOM 6061  C C    . ASP A 1 3  ? -23.321 9.366   20.645  1.00 0.00 ? 3  ASP A C    6  
ATOM 6062  O O    . ASP A 1 3  ? -23.345 8.275   21.180  1.00 0.00 ? 3  ASP A O    6  
ATOM 6063  C CB   . ASP A 1 3  ? -24.492 10.198  22.686  1.00 0.00 ? 3  ASP A CB   6  
ATOM 6064  C CG   . ASP A 1 3  ? -25.105 11.425  23.363  1.00 0.00 ? 3  ASP A CG   6  
ATOM 6065  O OD1  . ASP A 1 3  ? -24.347 12.273  23.807  1.00 0.00 ? 3  ASP A OD1  6  
ATOM 6066  O OD2  . ASP A 1 3  ? -26.321 11.497  23.426  1.00 0.00 ? 3  ASP A OD2  6  
ATOM 6067  H H    . ASP A 1 3  ? -26.029 10.772  20.673  1.00 0.00 ? 3  ASP A H    6  
ATOM 6068  H HA   . ASP A 1 3  ? -23.247 11.375  21.394  1.00 0.00 ? 3  ASP A HA   6  
ATOM 6069  H HB2  . ASP A 1 3  ? -25.243 9.427   22.589  1.00 0.00 ? 3  ASP A HB2  6  
ATOM 6070  H HB3  . ASP A 1 3  ? -23.673 9.829   23.286  1.00 0.00 ? 3  ASP A HB3  6  
ATOM 6071  N N    . ASN A 1 4  ? -22.737 9.540   19.491  1.00 0.00 ? 4  ASN A N    6  
ATOM 6072  C CA   . ASN A 1 4  ? -22.082 8.390   18.807  1.00 0.00 ? 4  ASN A CA   6  
ATOM 6073  C C    . ASN A 1 4  ? -20.882 7.921   19.632  1.00 0.00 ? 4  ASN A C    6  
ATOM 6074  O O    . ASN A 1 4  ? -20.963 6.959   20.370  1.00 0.00 ? 4  ASN A O    6  
ATOM 6075  C CB   . ASN A 1 4  ? -21.610 8.825   17.418  1.00 0.00 ? 4  ASN A CB   6  
ATOM 6076  C CG   . ASN A 1 4  ? -22.813 9.280   16.590  1.00 0.00 ? 4  ASN A CG   6  
ATOM 6077  O OD1  . ASN A 1 4  ? -22.656 9.927   15.574  1.00 0.00 ? 4  ASN A OD1  6  
ATOM 6078  N ND2  . ASN A 1 4  ? -24.017 8.967   16.984  1.00 0.00 ? 4  ASN A ND2  6  
ATOM 6079  H H    . ASN A 1 4  ? -22.728 10.428  19.076  1.00 0.00 ? 4  ASN A H    6  
ATOM 6080  H HA   . ASN A 1 4  ? -22.790 7.580   18.708  1.00 0.00 ? 4  ASN A HA   6  
ATOM 6081  H HB2  . ASN A 1 4  ? -20.909 9.642   17.516  1.00 0.00 ? 4  ASN A HB2  6  
ATOM 6082  H HB3  . ASN A 1 4  ? -21.129 7.994   16.924  1.00 0.00 ? 4  ASN A HB3  6  
ATOM 6083  H HD21 . ASN A 1 4  ? -24.144 8.445   17.804  1.00 0.00 ? 4  ASN A HD21 6  
ATOM 6084  H HD22 . ASN A 1 4  ? -24.793 9.253   16.460  1.00 0.00 ? 4  ASN A HD22 6  
ATOM 6085  N N    . GLU A 1 5  ? -19.769 8.593   19.514  1.00 0.00 ? 5  GLU A N    6  
ATOM 6086  C CA   . GLU A 1 5  ? -18.567 8.182   20.293  1.00 0.00 ? 5  GLU A CA   6  
ATOM 6087  C C    . GLU A 1 5  ? -18.276 6.703   20.031  1.00 0.00 ? 5  GLU A C    6  
ATOM 6088  O O    . GLU A 1 5  ? -18.685 5.838   20.781  1.00 0.00 ? 5  GLU A O    6  
ATOM 6089  C CB   . GLU A 1 5  ? -18.832 8.398   21.789  1.00 0.00 ? 5  GLU A CB   6  
ATOM 6090  C CG   . GLU A 1 5  ? -17.514 8.334   22.570  1.00 0.00 ? 5  GLU A CG   6  
ATOM 6091  C CD   . GLU A 1 5  ? -16.997 6.895   22.590  1.00 0.00 ? 5  GLU A CD   6  
ATOM 6092  O OE1  . GLU A 1 5  ? -17.465 6.128   23.416  1.00 0.00 ? 5  GLU A OE1  6  
ATOM 6093  O OE2  . GLU A 1 5  ? -16.140 6.583   21.780  1.00 0.00 ? 5  GLU A OE2  6  
ATOM 6094  H H    . GLU A 1 5  ? -19.724 9.366   18.915  1.00 0.00 ? 5  GLU A H    6  
ATOM 6095  H HA   . GLU A 1 5  ? -17.720 8.776   19.985  1.00 0.00 ? 5  GLU A HA   6  
ATOM 6096  H HB2  . GLU A 1 5  ? -19.290 9.365   21.935  1.00 0.00 ? 5  GLU A HB2  6  
ATOM 6097  H HB3  . GLU A 1 5  ? -19.498 7.628   22.148  1.00 0.00 ? 5  GLU A HB3  6  
ATOM 6098  H HG2  . GLU A 1 5  ? -16.782 8.975   22.102  1.00 0.00 ? 5  GLU A HG2  6  
ATOM 6099  H HG3  . GLU A 1 5  ? -17.684 8.666   23.584  1.00 0.00 ? 5  GLU A HG3  6  
ATOM 6100  N N    . LYS A 1 6  ? -17.569 6.406   18.972  1.00 0.00 ? 6  LYS A N    6  
ATOM 6101  C CA   . LYS A 1 6  ? -17.242 4.981   18.649  1.00 0.00 ? 6  LYS A CA   6  
ATOM 6102  C C    . LYS A 1 6  ? -15.808 4.904   18.121  1.00 0.00 ? 6  LYS A C    6  
ATOM 6103  O O    . LYS A 1 6  ? -15.274 3.835   17.903  1.00 0.00 ? 6  LYS A O    6  
ATOM 6104  C CB   . LYS A 1 6  ? -18.205 4.463   17.578  1.00 0.00 ? 6  LYS A CB   6  
ATOM 6105  C CG   . LYS A 1 6  ? -19.583 4.221   18.198  1.00 0.00 ? 6  LYS A CG   6  
ATOM 6106  C CD   . LYS A 1 6  ? -20.607 3.951   17.089  1.00 0.00 ? 6  LYS A CD   6  
ATOM 6107  C CE   . LYS A 1 6  ? -20.267 2.644   16.361  1.00 0.00 ? 6  LYS A CE   6  
ATOM 6108  N NZ   . LYS A 1 6  ? -19.222 2.906   15.331  1.00 0.00 ? 6  LYS A NZ   6  
ATOM 6109  H H    . LYS A 1 6  ? -17.250 7.122   18.383  1.00 0.00 ? 6  LYS A H    6  
ATOM 6110  H HA   . LYS A 1 6  ? -17.329 4.372   19.538  1.00 0.00 ? 6  LYS A HA   6  
ATOM 6111  H HB2  . LYS A 1 6  ? -18.289 5.193   16.785  1.00 0.00 ? 6  LYS A HB2  6  
ATOM 6112  H HB3  . LYS A 1 6  ? -17.826 3.536   17.175  1.00 0.00 ? 6  LYS A HB3  6  
ATOM 6113  H HG2  . LYS A 1 6  ? -19.534 3.370   18.861  1.00 0.00 ? 6  LYS A HG2  6  
ATOM 6114  H HG3  . LYS A 1 6  ? -19.884 5.094   18.756  1.00 0.00 ? 6  LYS A HG3  6  
ATOM 6115  H HD2  . LYS A 1 6  ? -21.593 3.873   17.525  1.00 0.00 ? 6  LYS A HD2  6  
ATOM 6116  H HD3  . LYS A 1 6  ? -20.592 4.767   16.383  1.00 0.00 ? 6  LYS A HD3  6  
ATOM 6117  H HE2  . LYS A 1 6  ? -19.899 1.915   17.069  1.00 0.00 ? 6  LYS A HE2  6  
ATOM 6118  H HE3  . LYS A 1 6  ? -21.154 2.261   15.881  1.00 0.00 ? 6  LYS A HE3  6  
ATOM 6119  H HZ1  . LYS A 1 6  ? -19.184 3.924   15.125  1.00 0.00 ? 6  LYS A HZ1  6  
ATOM 6120  H HZ2  . LYS A 1 6  ? -19.455 2.387   14.460  1.00 0.00 ? 6  LYS A HZ2  6  
ATOM 6121  H HZ3  . LYS A 1 6  ? -18.297 2.589   15.687  1.00 0.00 ? 6  LYS A HZ3  6  
ATOM 6122  N N    . VAL A 1 7  ? -15.182 6.029   17.913  1.00 0.00 ? 7  VAL A N    6  
ATOM 6123  C CA   . VAL A 1 7  ? -13.784 6.021   17.400  1.00 0.00 ? 7  VAL A CA   6  
ATOM 6124  C C    . VAL A 1 7  ? -12.883 5.275   18.387  1.00 0.00 ? 7  VAL A C    6  
ATOM 6125  O O    . VAL A 1 7  ? -12.331 4.241   18.074  1.00 0.00 ? 7  VAL A O    6  
ATOM 6126  C CB   . VAL A 1 7  ? -13.290 7.460   17.246  1.00 0.00 ? 7  VAL A CB   6  
ATOM 6127  C CG1  . VAL A 1 7  ? -11.917 7.458   16.570  1.00 0.00 ? 7  VAL A CG1  6  
ATOM 6128  C CG2  . VAL A 1 7  ? -14.280 8.248   16.386  1.00 0.00 ? 7  VAL A CG2  6  
ATOM 6129  H H    . VAL A 1 7  ? -15.631 6.881   18.097  1.00 0.00 ? 7  VAL A H    6  
ATOM 6130  H HA   . VAL A 1 7  ? -13.756 5.526   16.441  1.00 0.00 ? 7  VAL A HA   6  
ATOM 6131  H HB   . VAL A 1 7  ? -13.210 7.920   18.221  1.00 0.00 ? 7  VAL A HB   6  
ATOM 6132  H HG11 . VAL A 1 7  ? -11.613 8.476   16.372  1.00 0.00 ? 7  VAL A HG11 6  
ATOM 6133  H HG12 . VAL A 1 7  ? -11.974 6.911   15.642  1.00 0.00 ? 7  VAL A HG12 6  
ATOM 6134  H HG13 . VAL A 1 7  ? -11.196 6.989   17.223  1.00 0.00 ? 7  VAL A HG13 6  
ATOM 6135  H HG21 . VAL A 1 7  ? -14.377 7.773   15.421  1.00 0.00 ? 7  VAL A HG21 6  
ATOM 6136  H HG22 . VAL A 1 7  ? -13.920 9.258   16.254  1.00 0.00 ? 7  VAL A HG22 6  
ATOM 6137  H HG23 . VAL A 1 7  ? -15.244 8.271   16.874  1.00 0.00 ? 7  VAL A HG23 6  
ATOM 6138  N N    . THR A 1 8  ? -12.725 5.800   19.572  1.00 0.00 ? 8  THR A N    6  
ATOM 6139  C CA   . THR A 1 8  ? -11.855 5.130   20.582  1.00 0.00 ? 8  THR A CA   6  
ATOM 6140  C C    . THR A 1 8  ? -12.208 3.642   20.671  1.00 0.00 ? 8  THR A C    6  
ATOM 6141  O O    . THR A 1 8  ? -13.038 3.237   21.460  1.00 0.00 ? 8  THR A O    6  
ATOM 6142  C CB   . THR A 1 8  ? -12.067 5.785   21.949  1.00 0.00 ? 8  THR A CB   6  
ATOM 6143  O OG1  . THR A 1 8  ? -13.415 5.601   22.356  1.00 0.00 ? 8  THR A OG1  6  
ATOM 6144  C CG2  . THR A 1 8  ? -11.759 7.280   21.854  1.00 0.00 ? 8  THR A CG2  6  
ATOM 6145  H H    . THR A 1 8  ? -13.175 6.642   19.796  1.00 0.00 ? 8  THR A H    6  
ATOM 6146  H HA   . THR A 1 8  ? -10.821 5.236   20.291  1.00 0.00 ? 8  THR A HA   6  
ATOM 6147  H HB   . THR A 1 8  ? -11.407 5.331   22.673  1.00 0.00 ? 8  THR A HB   6  
ATOM 6148  H HG1  . THR A 1 8  ? -13.679 4.710   22.115  1.00 0.00 ? 8  THR A HG1  6  
ATOM 6149  H HG21 . THR A 1 8  ? -10.736 7.417   21.535  1.00 0.00 ? 8  THR A HG21 6  
ATOM 6150  H HG22 . THR A 1 8  ? -11.899 7.739   22.822  1.00 0.00 ? 8  THR A HG22 6  
ATOM 6151  H HG23 . THR A 1 8  ? -12.424 7.739   21.138  1.00 0.00 ? 8  THR A HG23 6  
ATOM 6152  N N    . SER A 1 9  ? -11.585 2.829   19.863  1.00 0.00 ? 9  SER A N    6  
ATOM 6153  C CA   . SER A 1 9  ? -11.883 1.369   19.897  1.00 0.00 ? 9  SER A CA   6  
ATOM 6154  C C    . SER A 1 9  ? -10.810 0.610   19.115  1.00 0.00 ? 9  SER A C    6  
ATOM 6155  O O    . SER A 1 9  ? -10.412 1.011   18.039  1.00 0.00 ? 9  SER A O    6  
ATOM 6156  C CB   . SER A 1 9  ? -13.251 1.114   19.263  1.00 0.00 ? 9  SER A CB   6  
ATOM 6157  O OG   . SER A 1 9  ? -14.247 1.822   19.993  1.00 0.00 ? 9  SER A OG   6  
ATOM 6158  H H    . SER A 1 9  ? -10.924 3.182   19.232  1.00 0.00 ? 9  SER A H    6  
ATOM 6159  H HA   . SER A 1 9  ? -11.892 1.027   20.922  1.00 0.00 ? 9  SER A HA   6  
ATOM 6160  H HB2  . SER A 1 9  ? -13.249 1.459   18.243  1.00 0.00 ? 9  SER A HB2  6  
ATOM 6161  H HB3  . SER A 1 9  ? -13.465 0.053   19.282  1.00 0.00 ? 9  SER A HB3  6  
ATOM 6162  H HG   . SER A 1 9  ? -14.504 1.282   20.744  1.00 0.00 ? 9  SER A HG   6  
ATOM 6163  N N    . GLY A 1 10 ? -10.340 -0.485  19.646  1.00 0.00 ? 10 GLY A N    6  
ATOM 6164  C CA   . GLY A 1 10 ? -9.292  -1.269  18.933  1.00 0.00 ? 10 GLY A CA   6  
ATOM 6165  C C    . GLY A 1 10 ? -8.051  -0.398  18.733  1.00 0.00 ? 10 GLY A C    6  
ATOM 6166  O O    . GLY A 1 10 ? -8.068  0.563   17.989  1.00 0.00 ? 10 GLY A O    6  
ATOM 6167  H H    . GLY A 1 10 ? -10.675 -0.792  20.514  1.00 0.00 ? 10 GLY A H    6  
ATOM 6168  H HA2  . GLY A 1 10 ? -9.034  -2.139  19.518  1.00 0.00 ? 10 GLY A HA2  6  
ATOM 6169  H HA3  . GLY A 1 10 ? -9.668  -1.580  17.970  1.00 0.00 ? 10 GLY A HA3  6  
ATOM 6170  N N    . HIS A 1 11 ? -6.973  -0.725  19.391  1.00 0.00 ? 11 HIS A N    6  
ATOM 6171  C CA   . HIS A 1 11 ? -5.732  0.085   19.238  1.00 0.00 ? 11 HIS A CA   6  
ATOM 6172  C C    . HIS A 1 11 ? -5.341  0.141   17.760  1.00 0.00 ? 11 HIS A C    6  
ATOM 6173  O O    . HIS A 1 11 ? -4.889  1.155   17.266  1.00 0.00 ? 11 HIS A O    6  
ATOM 6174  C CB   . HIS A 1 11 ? -4.599  -0.562  20.037  1.00 0.00 ? 11 HIS A CB   6  
ATOM 6175  C CG   . HIS A 1 11 ? -3.411  0.360   20.058  1.00 0.00 ? 11 HIS A CG   6  
ATOM 6176  N ND1  . HIS A 1 11 ? -3.043  1.116   18.956  1.00 0.00 ? 11 HIS A ND1  6  
ATOM 6177  C CD2  . HIS A 1 11 ? -2.499  0.661   21.040  1.00 0.00 ? 11 HIS A CD2  6  
ATOM 6178  C CE1  . HIS A 1 11 ? -1.953  1.828   19.298  1.00 0.00 ? 11 HIS A CE1  6  
ATOM 6179  N NE2  . HIS A 1 11 ? -1.580  1.588   20.559  1.00 0.00 ? 11 HIS A NE2  6  
ATOM 6180  H H    . HIS A 1 11 ? -6.980  -1.504  19.986  1.00 0.00 ? 11 HIS A H    6  
ATOM 6181  H HA   . HIS A 1 11 ? -5.905  1.085   19.604  1.00 0.00 ? 11 HIS A HA   6  
ATOM 6182  H HB2  . HIS A 1 11 ? -4.930  -0.747  21.048  1.00 0.00 ? 11 HIS A HB2  6  
ATOM 6183  H HB3  . HIS A 1 11 ? -4.319  -1.497  19.574  1.00 0.00 ? 11 HIS A HB3  6  
ATOM 6184  H HD1  . HIS A 1 11 ? -3.494  1.130   18.087  1.00 0.00 ? 11 HIS A HD1  6  
ATOM 6185  H HD2  . HIS A 1 11 ? -2.497  0.242   22.036  1.00 0.00 ? 11 HIS A HD2  6  
ATOM 6186  H HE1  . HIS A 1 11 ? -1.442  2.510   18.635  1.00 0.00 ? 11 HIS A HE1  6  
ATOM 6187  N N    . THR A 1 12 ? -5.508  -0.942  17.053  1.00 0.00 ? 12 THR A N    6  
ATOM 6188  C CA   . THR A 1 12 ? -5.144  -0.953  15.609  1.00 0.00 ? 12 THR A CA   6  
ATOM 6189  C C    . THR A 1 12 ? -5.554  -2.290  14.993  1.00 0.00 ? 12 THR A C    6  
ATOM 6190  O O    . THR A 1 12 ? -5.796  -3.257  15.689  1.00 0.00 ? 12 THR A O    6  
ATOM 6191  C CB   . THR A 1 12 ? -3.631  -0.768  15.468  1.00 0.00 ? 12 THR A CB   6  
ATOM 6192  O OG1  . THR A 1 12 ? -3.243  -1.061  14.133  1.00 0.00 ? 12 THR A OG1  6  
ATOM 6193  C CG2  . THR A 1 12 ? -2.911  -1.711  16.433  1.00 0.00 ? 12 THR A CG2  6  
ATOM 6194  H H    . THR A 1 12 ? -5.873  -1.749  17.471  1.00 0.00 ? 12 THR A H    6  
ATOM 6195  H HA   . THR A 1 12 ? -5.655  -0.148  15.100  1.00 0.00 ? 12 THR A HA   6  
ATOM 6196  H HB   . THR A 1 12 ? -3.369  0.252   15.704  1.00 0.00 ? 12 THR A HB   6  
ATOM 6197  H HG1  . THR A 1 12 ? -2.298  -0.909  14.060  1.00 0.00 ? 12 THR A HG1  6  
ATOM 6198  H HG21 . THR A 1 12 ? -3.117  -1.412  17.450  1.00 0.00 ? 12 THR A HG21 6  
ATOM 6199  H HG22 . THR A 1 12 ? -1.846  -1.665  16.253  1.00 0.00 ? 12 THR A HG22 6  
ATOM 6200  H HG23 . THR A 1 12 ? -3.259  -2.721  16.275  1.00 0.00 ? 12 THR A HG23 6  
ATOM 6201  N N    . THR A 1 13 ? -5.632  -2.358  13.692  1.00 0.00 ? 13 THR A N    6  
ATOM 6202  C CA   . THR A 1 13 ? -6.026  -3.637  13.036  1.00 0.00 ? 13 THR A CA   6  
ATOM 6203  C C    . THR A 1 13 ? -5.814  -3.523  11.525  1.00 0.00 ? 13 THR A C    6  
ATOM 6204  O O    . THR A 1 13 ? -6.127  -2.518  10.919  1.00 0.00 ? 13 THR A O    6  
ATOM 6205  C CB   . THR A 1 13 ? -7.501  -3.926  13.326  1.00 0.00 ? 13 THR A CB   6  
ATOM 6206  O OG1  . THR A 1 13 ? -7.944  -4.990  12.495  1.00 0.00 ? 13 THR A OG1  6  
ATOM 6207  C CG2  . THR A 1 13 ? -8.335  -2.674  13.045  1.00 0.00 ? 13 THR A CG2  6  
ATOM 6208  H H    . THR A 1 13 ? -5.432  -1.568  13.147  1.00 0.00 ? 13 THR A H    6  
ATOM 6209  H HA   . THR A 1 13 ? -5.419  -4.441  13.425  1.00 0.00 ? 13 THR A HA   6  
ATOM 6210  H HB   . THR A 1 13 ? -7.616  -4.206  14.361  1.00 0.00 ? 13 THR A HB   6  
ATOM 6211  H HG1  . THR A 1 13 ? -8.866  -4.834  12.280  1.00 0.00 ? 13 THR A HG1  6  
ATOM 6212  H HG21 . THR A 1 13 ? -8.215  -2.386  12.012  1.00 0.00 ? 13 THR A HG21 6  
ATOM 6213  H HG22 . THR A 1 13 ? -8.003  -1.870  13.685  1.00 0.00 ? 13 THR A HG22 6  
ATOM 6214  H HG23 . THR A 1 13 ? -9.376  -2.884  13.242  1.00 0.00 ? 13 THR A HG23 6  
ATOM 6215  N N    . THR A 1 14 ? -5.282  -4.546  10.911  1.00 0.00 ? 14 THR A N    6  
ATOM 6216  C CA   . THR A 1 14 ? -5.050  -4.498  9.439   1.00 0.00 ? 14 THR A CA   6  
ATOM 6217  C C    . THR A 1 14 ? -6.341  -4.868  8.707   1.00 0.00 ? 14 THR A C    6  
ATOM 6218  O O    . THR A 1 14 ? -7.117  -5.682  9.170   1.00 0.00 ? 14 THR A O    6  
ATOM 6219  C CB   . THR A 1 14 ? -3.946  -5.491  9.066   1.00 0.00 ? 14 THR A CB   6  
ATOM 6220  O OG1  . THR A 1 14 ? -2.806  -5.258  9.883   1.00 0.00 ? 14 THR A OG1  6  
ATOM 6221  C CG2  . THR A 1 14 ? -3.568  -5.311  7.594   1.00 0.00 ? 14 THR A CG2  6  
ATOM 6222  H H    . THR A 1 14 ? -5.036  -5.347  11.420  1.00 0.00 ? 14 THR A H    6  
ATOM 6223  H HA   . THR A 1 14 ? -4.747  -3.500  9.153   1.00 0.00 ? 14 THR A HA   6  
ATOM 6224  H HB   . THR A 1 14 ? -4.300  -6.499  9.221   1.00 0.00 ? 14 THR A HB   6  
ATOM 6225  H HG1  . THR A 1 14 ? -2.296  -6.071  9.919   1.00 0.00 ? 14 THR A HG1  6  
ATOM 6226  H HG21 . THR A 1 14 ? -4.374  -5.667  6.969   1.00 0.00 ? 14 THR A HG21 6  
ATOM 6227  H HG22 . THR A 1 14 ? -2.670  -5.873  7.382   1.00 0.00 ? 14 THR A HG22 6  
ATOM 6228  H HG23 . THR A 1 14 ? -3.393  -4.263  7.394   1.00 0.00 ? 14 THR A HG23 6  
ATOM 6229  N N    . THR A 1 15 ? -6.581  -4.276  7.566   1.00 0.00 ? 15 THR A N    6  
ATOM 6230  C CA   . THR A 1 15 ? -7.825  -4.591  6.800   1.00 0.00 ? 15 THR A CA   6  
ATOM 6231  C C    . THR A 1 15 ? -7.535  -4.526  5.298   1.00 0.00 ? 15 THR A C    6  
ATOM 6232  O O    . THR A 1 15 ? -6.973  -3.569  4.809   1.00 0.00 ? 15 THR A O    6  
ATOM 6233  C CB   . THR A 1 15 ? -8.909  -3.568  7.151   1.00 0.00 ? 15 THR A CB   6  
ATOM 6234  O OG1  . THR A 1 15 ? -9.897  -3.555  6.130   1.00 0.00 ? 15 THR A OG1  6  
ATOM 6235  C CG2  . THR A 1 15 ? -8.280  -2.180  7.274   1.00 0.00 ? 15 THR A CG2  6  
ATOM 6236  H H    . THR A 1 15 ? -5.940  -3.625  7.212   1.00 0.00 ? 15 THR A H    6  
ATOM 6237  H HA   . THR A 1 15 ? -8.173  -5.583  7.053   1.00 0.00 ? 15 THR A HA   6  
ATOM 6238  H HB   . THR A 1 15 ? -9.366  -3.835  8.091   1.00 0.00 ? 15 THR A HB   6  
ATOM 6239  H HG1  . THR A 1 15 ? -9.856  -2.704  5.688   1.00 0.00 ? 15 THR A HG1  6  
ATOM 6240  H HG21 . THR A 1 15 ? -9.059  -1.440  7.383   1.00 0.00 ? 15 THR A HG21 6  
ATOM 6241  H HG22 . THR A 1 15 ? -7.702  -1.966  6.388   1.00 0.00 ? 15 THR A HG22 6  
ATOM 6242  H HG23 . THR A 1 15 ? -7.635  -2.152  8.141   1.00 0.00 ? 15 THR A HG23 6  
ATOM 6243  N N    . ARG A 1 16 ? -7.925  -5.534  4.562   1.00 0.00 ? 16 ARG A N    6  
ATOM 6244  C CA   . ARG A 1 16 ? -7.686  -5.534  3.089   1.00 0.00 ? 16 ARG A CA   6  
ATOM 6245  C C    . ARG A 1 16 ? -8.769  -6.383  2.420   1.00 0.00 ? 16 ARG A C    6  
ATOM 6246  O O    . ARG A 1 16 ? -9.336  -7.242  3.058   1.00 0.00 ? 16 ARG A O    6  
ATOM 6247  C CB   . ARG A 1 16 ? -6.301  -6.117  2.786   1.00 0.00 ? 16 ARG A CB   6  
ATOM 6248  C CG   . ARG A 1 16 ? -6.150  -7.486  3.457   1.00 0.00 ? 16 ARG A CG   6  
ATOM 6249  C CD   . ARG A 1 16 ? -4.699  -7.957  3.339   1.00 0.00 ? 16 ARG A CD   6  
ATOM 6250  N NE   . ARG A 1 16 ? -3.830  -7.128  4.220   1.00 0.00 ? 16 ARG A NE   6  
ATOM 6251  C CZ   . ARG A 1 16 ? -2.635  -7.545  4.538   1.00 0.00 ? 16 ARG A CZ   6  
ATOM 6252  N NH1  . ARG A 1 16 ? -2.207  -8.697  4.098   1.00 0.00 ? 16 ARG A NH1  6  
ATOM 6253  N NH2  . ARG A 1 16 ? -1.867  -6.811  5.296   1.00 0.00 ? 16 ARG A NH2  6  
ATOM 6254  H H    . ARG A 1 16 ? -8.385  -6.293  4.977   1.00 0.00 ? 16 ARG A H    6  
ATOM 6255  H HA   . ARG A 1 16 ? -7.743  -4.524  2.716   1.00 0.00 ? 16 ARG A HA   6  
ATOM 6256  H HB2  . ARG A 1 16 ? -6.185  -6.228  1.718   1.00 0.00 ? 16 ARG A HB2  6  
ATOM 6257  H HB3  . ARG A 1 16 ? -5.540  -5.450  3.162   1.00 0.00 ? 16 ARG A HB3  6  
ATOM 6258  H HG2  . ARG A 1 16 ? -6.418  -7.408  4.501   1.00 0.00 ? 16 ARG A HG2  6  
ATOM 6259  H HG3  . ARG A 1 16 ? -6.798  -8.199  2.970   1.00 0.00 ? 16 ARG A HG3  6  
ATOM 6260  H HD2  . ARG A 1 16 ? -4.633  -8.994  3.638   1.00 0.00 ? 16 ARG A HD2  6  
ATOM 6261  H HD3  . ARG A 1 16 ? -4.369  -7.855  2.317   1.00 0.00 ? 16 ARG A HD3  6  
ATOM 6262  H HE   . ARG A 1 16 ? -4.154  -6.266  4.556   1.00 0.00 ? 16 ARG A HE   6  
ATOM 6263  H HH11 . ARG A 1 16 ? -2.795  -9.260  3.518   1.00 0.00 ? 16 ARG A HH11 6  
ATOM 6264  H HH12 . ARG A 1 16 ? -1.291  -9.016  4.341   1.00 0.00 ? 16 ARG A HH12 6  
ATOM 6265  H HH21 . ARG A 1 16 ? -2.194  -5.930  5.635   1.00 0.00 ? 16 ARG A HH21 6  
ATOM 6266  H HH22 . ARG A 1 16 ? -0.951  -7.133  5.540   1.00 0.00 ? 16 ARG A HH22 6  
ATOM 6267  N N    . ARG A 1 17 ? -9.063  -6.109  1.156   1.00 0.00 ? 17 ARG A N    6  
ATOM 6268  C CA   . ARG A 1 17 ? -10.133 -6.847  0.376   1.00 0.00 ? 17 ARG A CA   6  
ATOM 6269  C C    . ARG A 1 17 ? -11.335 -5.915  0.179   1.00 0.00 ? 17 ARG A C    6  
ATOM 6270  O O    . ARG A 1 17 ? -11.659 -5.562  -0.936  1.00 0.00 ? 17 ARG A O    6  
ATOM 6271  C CB   . ARG A 1 17 ? -10.578 -8.157  1.064   1.00 0.00 ? 17 ARG A CB   6  
ATOM 6272  C CG   . ARG A 1 17 ? -11.389 -9.027  0.090   1.00 0.00 ? 17 ARG A CG   6  
ATOM 6273  C CD   . ARG A 1 17 ? -11.378 -10.484 0.567   1.00 0.00 ? 17 ARG A CD   6  
ATOM 6274  N NE   . ARG A 1 17 ? -11.452 -10.521 2.056   1.00 0.00 ? 17 ARG A NE   6  
ATOM 6275  C CZ   . ARG A 1 17 ? -11.728 -11.641 2.668   1.00 0.00 ? 17 ARG A CZ   6  
ATOM 6276  N NH1  . ARG A 1 17 ? -11.927 -12.731 1.977   1.00 0.00 ? 17 ARG A NH1  6  
ATOM 6277  N NH2  . ARG A 1 17 ? -11.800 -11.672 3.970   1.00 0.00 ? 17 ARG A NH2  6  
ATOM 6278  H H    . ARG A 1 17 ? -8.590  -5.370  0.707   1.00 0.00 ? 17 ARG A H    6  
ATOM 6279  H HA   . ARG A 1 17 ? -9.733  -7.079  -0.597  1.00 0.00 ? 17 ARG A HA   6  
ATOM 6280  H HB2  . ARG A 1 17 ? -9.704  -8.707  1.383   1.00 0.00 ? 17 ARG A HB2  6  
ATOM 6281  H HB3  . ARG A 1 17 ? -11.193 -7.922  1.921   1.00 0.00 ? 17 ARG A HB3  6  
ATOM 6282  H HG2  . ARG A 1 17 ? -12.407 -8.670  0.055   1.00 0.00 ? 17 ARG A HG2  6  
ATOM 6283  H HG3  . ARG A 1 17 ? -10.954 -8.976  -0.896  1.00 0.00 ? 17 ARG A HG3  6  
ATOM 6284  H HD2  . ARG A 1 17 ? -12.226 -11.007 0.154   1.00 0.00 ? 17 ARG A HD2  6  
ATOM 6285  H HD3  . ARG A 1 17 ? -10.467 -10.964 0.239   1.00 0.00 ? 17 ARG A HD3  6  
ATOM 6286  H HE   . ARG A 1 17 ? -11.297 -9.705  2.574   1.00 0.00 ? 17 ARG A HE   6  
ATOM 6287  H HH11 . ARG A 1 17 ? -11.868 -12.707 0.979   1.00 0.00 ? 17 ARG A HH11 6  
ATOM 6288  H HH12 . ARG A 1 17 ? -12.137 -13.588 2.446   1.00 0.00 ? 17 ARG A HH12 6  
ATOM 6289  H HH21 . ARG A 1 17 ? -11.645 -10.838 4.500   1.00 0.00 ? 17 ARG A HH21 6  
ATOM 6290  H HH22 . ARG A 1 17 ? -12.011 -12.530 4.439   1.00 0.00 ? 17 ARG A HH22 6  
ATOM 6291  N N    . SER A 1 18 ? -11.995 -5.522  1.248   1.00 0.00 ? 18 SER A N    6  
ATOM 6292  C CA   . SER A 1 18 ? -13.191 -4.594  1.129   1.00 0.00 ? 18 SER A CA   6  
ATOM 6293  C C    . SER A 1 18 ? -12.942 -3.578  0.006   1.00 0.00 ? 18 SER A C    6  
ATOM 6294  O O    . SER A 1 18 ? -13.849 -3.125  -0.664  1.00 0.00 ? 18 SER A O    6  
ATOM 6295  C CB   . SER A 1 18 ? -13.394 -3.851  2.450   1.00 0.00 ? 18 SER A CB   6  
ATOM 6296  O OG   . SER A 1 18 ? -13.405 -4.788  3.520   1.00 0.00 ? 18 SER A OG   6  
ATOM 6297  H H    . SER A 1 18 ? -11.707 -5.848  2.129   1.00 0.00 ? 18 SER A H    6  
ATOM 6298  H HA   . SER A 1 18 ? -14.081 -5.170  0.896   1.00 0.00 ? 18 SER A HA   6  
ATOM 6299  H HB2  . SER A 1 18 ? -12.590 -3.151  2.601   1.00 0.00 ? 18 SER A HB2  6  
ATOM 6300  H HB3  . SER A 1 18 ? -14.333 -3.314  2.419   1.00 0.00 ? 18 SER A HB3  6  
ATOM 6301  H HG   . SER A 1 18 ? -14.291 -4.805  3.889   1.00 0.00 ? 18 SER A HG   6  
ATOM 6302  N N    . CYS A 1 19 ? -11.697 -3.286  -0.229  1.00 0.00 ? 19 CYS A N    6  
ATOM 6303  C CA   . CYS A 1 19 ? -11.325 -2.373  -1.340  1.00 0.00 ? 19 CYS A CA   6  
ATOM 6304  C C    . CYS A 1 19 ? -9.983  -2.814  -1.911  1.00 0.00 ? 19 CYS A C    6  
ATOM 6305  O O    . CYS A 1 19 ? -9.293  -3.630  -1.336  1.00 0.00 ? 19 CYS A O    6  
ATOM 6306  C CB   . CYS A 1 19 ? -11.251 -0.928  -0.850  1.00 0.00 ? 19 CYS A CB   6  
ATOM 6307  S SG   . CYS A 1 19 ? -11.553 0.161   -2.260  1.00 0.00 ? 19 CYS A SG   6  
ATOM 6308  H H    . CYS A 1 19 ? -11.024 -3.737  0.315   1.00 0.00 ? 19 CYS A H    6  
ATOM 6309  H HA   . CYS A 1 19 ? -12.073 -2.445  -2.121  1.00 0.00 ? 19 CYS A HA   6  
ATOM 6310  H HB2  . CYS A 1 19 ? -12.004 -0.763  -0.094  1.00 0.00 ? 19 CYS A HB2  6  
ATOM 6311  H HB3  . CYS A 1 19 ? -10.271 -0.725  -0.437  1.00 0.00 ? 19 CYS A HB3  6  
ATOM 6312  N N    . SER A 1 20 ? -9.608  -2.293  -3.042  1.00 0.00 ? 20 SER A N    6  
ATOM 6313  C CA   . SER A 1 20 ? -8.312  -2.707  -3.634  1.00 0.00 ? 20 SER A CA   6  
ATOM 6314  C C    . SER A 1 20 ? -7.186  -2.293  -2.691  1.00 0.00 ? 20 SER A C    6  
ATOM 6315  O O    . SER A 1 20 ? -6.999  -1.126  -2.406  1.00 0.00 ? 20 SER A O    6  
ATOM 6316  C CB   . SER A 1 20 ? -8.128  -2.026  -4.993  1.00 0.00 ? 20 SER A CB   6  
ATOM 6317  O OG   . SER A 1 20 ? -9.353  -2.078  -5.713  1.00 0.00 ? 20 SER A OG   6  
ATOM 6318  H H    . SER A 1 20 ? -10.177 -1.640  -3.500  1.00 0.00 ? 20 SER A H    6  
ATOM 6319  H HA   . SER A 1 20 ? -8.299  -3.779  -3.763  1.00 0.00 ? 20 SER A HA   6  
ATOM 6320  H HB2  . SER A 1 20 ? -7.845  -0.996  -4.851  1.00 0.00 ? 20 SER A HB2  6  
ATOM 6321  H HB3  . SER A 1 20 ? -7.352  -2.536  -5.548  1.00 0.00 ? 20 SER A HB3  6  
ATOM 6322  H HG   . SER A 1 20 ? -10.070 -2.082  -5.075  1.00 0.00 ? 20 SER A HG   6  
ATOM 6323  N N    . LYS A 1 21 ? -6.428  -3.248  -2.210  1.00 0.00 ? 21 LYS A N    6  
ATOM 6324  C CA   . LYS A 1 21 ? -5.290  -2.931  -1.282  1.00 0.00 ? 21 LYS A CA   6  
ATOM 6325  C C    . LYS A 1 21 ? -4.045  -3.632  -1.808  1.00 0.00 ? 21 LYS A C    6  
ATOM 6326  O O    . LYS A 1 21 ? -3.948  -4.843  -1.814  1.00 0.00 ? 21 LYS A O    6  
ATOM 6327  C CB   . LYS A 1 21 ? -5.592  -3.402  0.158   1.00 0.00 ? 21 LYS A CB   6  
ATOM 6328  C CG   . LYS A 1 21 ? -6.696  -2.517  0.813   1.00 0.00 ? 21 LYS A CG   6  
ATOM 6329  C CD   . LYS A 1 21 ? -6.300  -2.141  2.248   1.00 0.00 ? 21 LYS A CD   6  
ATOM 6330  C CE   . LYS A 1 21 ? -7.504  -1.532  2.972   1.00 0.00 ? 21 LYS A CE   6  
ATOM 6331  N NZ   . LYS A 1 21 ? -8.104  -0.461  2.127   1.00 0.00 ? 21 LYS A NZ   6  
ATOM 6332  H H    . LYS A 1 21 ? -6.601  -4.181  -2.471  1.00 0.00 ? 21 LYS A H    6  
ATOM 6333  H HA   . LYS A 1 21 ? -5.104  -1.863  -1.278  1.00 0.00 ? 21 LYS A HA   6  
ATOM 6334  H HB2  . LYS A 1 21 ? -5.917  -4.434  0.141   1.00 0.00 ? 21 LYS A HB2  6  
ATOM 6335  H HB3  . LYS A 1 21 ? -4.681  -3.334  0.739   1.00 0.00 ? 21 LYS A HB3  6  
ATOM 6336  H HG2  . LYS A 1 21 ? -6.835  -1.609  0.242   1.00 0.00 ? 21 LYS A HG2  6  
ATOM 6337  H HG3  . LYS A 1 21 ? -7.629  -3.063  0.840   1.00 0.00 ? 21 LYS A HG3  6  
ATOM 6338  H HD2  . LYS A 1 21 ? -5.968  -3.023  2.772   1.00 0.00 ? 21 LYS A HD2  6  
ATOM 6339  H HD3  . LYS A 1 21 ? -5.500  -1.420  2.221   1.00 0.00 ? 21 LYS A HD3  6  
ATOM 6340  H HE2  . LYS A 1 21 ? -8.242  -2.297  3.158   1.00 0.00 ? 21 LYS A HE2  6  
ATOM 6341  H HE3  . LYS A 1 21 ? -7.182  -1.108  3.912   1.00 0.00 ? 21 LYS A HE3  6  
ATOM 6342  H HZ1  . LYS A 1 21 ? -7.411  -0.149  1.419   1.00 0.00 ? 21 LYS A HZ1  6  
ATOM 6343  H HZ2  . LYS A 1 21 ? -8.372  0.346   2.726   1.00 0.00 ? 21 LYS A HZ2  6  
ATOM 6344  H HZ3  . LYS A 1 21 ? -8.950  -0.833  1.647   1.00 0.00 ? 21 LYS A HZ3  6  
ATOM 6345  N N    . VAL A 1 22 ? -3.092  -2.858  -2.245  1.00 0.00 ? 22 VAL A N    6  
ATOM 6346  C CA   . VAL A 1 22 ? -1.820  -3.428  -2.782  1.00 0.00 ? 22 VAL A CA   6  
ATOM 6347  C C    . VAL A 1 22 ? -0.634  -2.794  -2.059  1.00 0.00 ? 22 VAL A C    6  
ATOM 6348  O O    . VAL A 1 22 ? -0.435  -1.598  -2.128  1.00 0.00 ? 22 VAL A O    6  
ATOM 6349  C CB   . VAL A 1 22 ? -1.747  -3.125  -4.276  1.00 0.00 ? 22 VAL A CB   6  
ATOM 6350  C CG1  . VAL A 1 22 ? -0.619  -3.941  -4.907  1.00 0.00 ? 22 VAL A CG1  6  
ATOM 6351  C CG2  . VAL A 1 22 ? -3.082  -3.501  -4.926  1.00 0.00 ? 22 VAL A CG2  6  
ATOM 6352  H H    . VAL A 1 22 ? -3.221  -1.889  -2.186  1.00 0.00 ? 22 VAL A H    6  
ATOM 6353  H HA   . VAL A 1 22 ? -1.799  -4.500  -2.633  1.00 0.00 ? 22 VAL A HA   6  
ATOM 6354  H HB   . VAL A 1 22 ? -1.555  -2.072  -4.422  1.00 0.00 ? 22 VAL A HB   6  
ATOM 6355  H HG11 . VAL A 1 22 ? 0.330   -3.599  -4.523  1.00 0.00 ? 22 VAL A HG11 6  
ATOM 6356  H HG12 . VAL A 1 22 ? -0.642  -3.815  -5.979  1.00 0.00 ? 22 VAL A HG12 6  
ATOM 6357  H HG13 . VAL A 1 22 ? -0.752  -4.984  -4.664  1.00 0.00 ? 22 VAL A HG13 6  
ATOM 6358  H HG21 . VAL A 1 22 ? -3.868  -2.878  -4.523  1.00 0.00 ? 22 VAL A HG21 6  
ATOM 6359  H HG22 . VAL A 1 22 ? -3.304  -4.538  -4.718  1.00 0.00 ? 22 VAL A HG22 6  
ATOM 6360  H HG23 . VAL A 1 22 ? -3.017  -3.355  -5.994  1.00 0.00 ? 22 VAL A HG23 6  
ATOM 6361  N N    . ILE A 1 23 ? 0.155   -3.580  -1.363  1.00 0.00 ? 23 ILE A N    6  
ATOM 6362  C CA   . ILE A 1 23 ? 1.335   -3.015  -0.629  1.00 0.00 ? 23 ILE A CA   6  
ATOM 6363  C C    . ILE A 1 23 ? 2.620   -3.638  -1.189  1.00 0.00 ? 23 ILE A C    6  
ATOM 6364  O O    . ILE A 1 23 ? 2.896   -4.804  -0.988  1.00 0.00 ? 23 ILE A O    6  
ATOM 6365  C CB   . ILE A 1 23 ? 1.210   -3.350  0.865   1.00 0.00 ? 23 ILE A CB   6  
ATOM 6366  C CG1  . ILE A 1 23 ? 0.007   -2.602  1.478   1.00 0.00 ? 23 ILE A CG1  6  
ATOM 6367  C CG2  . ILE A 1 23 ? 2.486   -2.920  1.589   1.00 0.00 ? 23 ILE A CG2  6  
ATOM 6368  C CD1  . ILE A 1 23 ? -1.333  -3.194  0.991   1.00 0.00 ? 23 ILE A CD1  6  
ATOM 6369  H H    . ILE A 1 23 ? -0.026  -4.543  -1.308  1.00 0.00 ? 23 ILE A H    6  
ATOM 6370  H HA   . ILE A 1 23 ? 1.379   -1.941  -0.752  1.00 0.00 ? 23 ILE A HA   6  
ATOM 6371  H HB   . ILE A 1 23 ? 1.076   -4.415  0.986   1.00 0.00 ? 23 ILE A HB   6  
ATOM 6372  H HG12 . ILE A 1 23 ? 0.056   -2.679  2.555   1.00 0.00 ? 23 ILE A HG12 6  
ATOM 6373  H HG13 . ILE A 1 23 ? 0.056   -1.558  1.197   1.00 0.00 ? 23 ILE A HG13 6  
ATOM 6374  H HG21 . ILE A 1 23 ? 2.314   -2.922  2.656   1.00 0.00 ? 23 ILE A HG21 6  
ATOM 6375  H HG22 . ILE A 1 23 ? 2.761   -1.926  1.271   1.00 0.00 ? 23 ILE A HG22 6  
ATOM 6376  H HG23 . ILE A 1 23 ? 3.284   -3.607  1.352   1.00 0.00 ? 23 ILE A HG23 6  
ATOM 6377  H HD11 . ILE A 1 23 ? -1.180  -4.168  0.546   1.00 0.00 ? 23 ILE A HD11 6  
ATOM 6378  H HD12 . ILE A 1 23 ? -1.774  -2.531  0.262   1.00 0.00 ? 23 ILE A HD12 6  
ATOM 6379  H HD13 . ILE A 1 23 ? -2.006  -3.293  1.831   1.00 0.00 ? 23 ILE A HD13 6  
ATOM 6380  N N    . THR A 1 24 ? 3.406   -2.855  -1.889  1.00 0.00 ? 24 THR A N    6  
ATOM 6381  C CA   . THR A 1 24 ? 4.688   -3.360  -2.475  1.00 0.00 ? 24 THR A CA   6  
ATOM 6382  C C    . THR A 1 24 ? 5.840   -2.445  -2.046  1.00 0.00 ? 24 THR A C    6  
ATOM 6383  O O    . THR A 1 24 ? 5.941   -1.324  -2.503  1.00 0.00 ? 24 THR A O    6  
ATOM 6384  C CB   . THR A 1 24 ? 4.584   -3.348  -4.002  1.00 0.00 ? 24 THR A CB   6  
ATOM 6385  O OG1  . THR A 1 24 ? 4.231   -2.043  -4.442  1.00 0.00 ? 24 THR A OG1  6  
ATOM 6386  C CG2  . THR A 1 24 ? 3.517   -4.346  -4.452  1.00 0.00 ? 24 THR A CG2  6  
ATOM 6387  H H    . THR A 1 24 ? 3.150   -1.925  -2.022  1.00 0.00 ? 24 THR A H    6  
ATOM 6388  H HA   . THR A 1 24 ? 4.881   -4.363  -2.140  1.00 0.00 ? 24 THR A HA   6  
ATOM 6389  H HB   . THR A 1 24 ? 5.535   -3.627  -4.431  1.00 0.00 ? 24 THR A HB   6  
ATOM 6390  H HG1  . THR A 1 24 ? 3.380   -1.821  -4.057  1.00 0.00 ? 24 THR A HG1  6  
ATOM 6391  H HG21 . THR A 1 24 ? 3.798   -5.340  -4.139  1.00 0.00 ? 24 THR A HG21 6  
ATOM 6392  H HG22 . THR A 1 24 ? 3.430   -4.319  -5.529  1.00 0.00 ? 24 THR A HG22 6  
ATOM 6393  H HG23 . THR A 1 24 ? 2.568   -4.083  -4.008  1.00 0.00 ? 24 THR A HG23 6  
ATOM 6394  N N    . LYS A 1 25 ? 6.731   -2.921  -1.207  1.00 0.00 ? 25 LYS A N    6  
ATOM 6395  C CA   . LYS A 1 25 ? 7.902   -2.094  -0.790  1.00 0.00 ? 25 LYS A CA   6  
ATOM 6396  C C    . LYS A 1 25 ? 9.139   -2.890  -1.141  1.00 0.00 ? 25 LYS A C    6  
ATOM 6397  O O    . LYS A 1 25 ? 9.440   -3.877  -0.499  1.00 0.00 ? 25 LYS A O    6  
ATOM 6398  C CB   . LYS A 1 25 ? 7.866   -1.846  0.722   1.00 0.00 ? 25 LYS A CB   6  
ATOM 6399  C CG   . LYS A 1 25 ? 6.532   -1.208  1.115   1.00 0.00 ? 25 LYS A CG   6  
ATOM 6400  C CD   . LYS A 1 25 ? 6.558   -0.860  2.607   1.00 0.00 ? 25 LYS A CD   6  
ATOM 6401  C CE   . LYS A 1 25 ? 5.396   0.078   2.941   1.00 0.00 ? 25 LYS A CE   6  
ATOM 6402  N NZ   . LYS A 1 25 ? 4.109   -0.658  2.801   1.00 0.00 ? 25 LYS A NZ   6  
ATOM 6403  H H    . LYS A 1 25 ? 6.663   -3.848  -0.885  1.00 0.00 ? 25 LYS A H    6  
ATOM 6404  H HA   . LYS A 1 25 ? 7.917   -1.145  -1.318  1.00 0.00 ? 25 LYS A HA   6  
ATOM 6405  H HB2  . LYS A 1 25 ? 7.985   -2.783  1.242   1.00 0.00 ? 25 LYS A HB2  6  
ATOM 6406  H HB3  . LYS A 1 25 ? 8.673   -1.182  0.993   1.00 0.00 ? 25 LYS A HB3  6  
ATOM 6407  H HG2  . LYS A 1 25 ? 6.379   -0.309  0.534   1.00 0.00 ? 25 LYS A HG2  6  
ATOM 6408  H HG3  . LYS A 1 25 ? 5.729   -1.903  0.923   1.00 0.00 ? 25 LYS A HG3  6  
ATOM 6409  H HD2  . LYS A 1 25 ? 6.466   -1.766  3.187   1.00 0.00 ? 25 LYS A HD2  6  
ATOM 6410  H HD3  . LYS A 1 25 ? 7.491   -0.372  2.847   1.00 0.00 ? 25 LYS A HD3  6  
ATOM 6411  H HE2  . LYS A 1 25 ? 5.499   0.430   3.956   1.00 0.00 ? 25 LYS A HE2  6  
ATOM 6412  H HE3  . LYS A 1 25 ? 5.405   0.920   2.266   1.00 0.00 ? 25 LYS A HE3  6  
ATOM 6413  H HZ1  . LYS A 1 25 ? 3.434   -0.319  3.516   1.00 0.00 ? 25 LYS A HZ1  6  
ATOM 6414  H HZ2  . LYS A 1 25 ? 4.273   -1.676  2.939   1.00 0.00 ? 25 LYS A HZ2  6  
ATOM 6415  H HZ3  . LYS A 1 25 ? 3.718   -0.496  1.850   1.00 0.00 ? 25 LYS A HZ3  6  
ATOM 6416  N N    . THR A 1 26 ? 9.857   -2.493  -2.151  1.00 0.00 ? 26 THR A N    6  
ATOM 6417  C CA   . THR A 1 26 ? 11.077  -3.255  -2.540  1.00 0.00 ? 26 THR A CA   6  
ATOM 6418  C C    . THR A 1 26 ? 12.311  -2.440  -2.155  1.00 0.00 ? 26 THR A C    6  
ATOM 6419  O O    . THR A 1 26 ? 12.485  -1.329  -2.615  1.00 0.00 ? 26 THR A O    6  
ATOM 6420  C CB   . THR A 1 26 ? 11.080  -3.485  -4.053  1.00 0.00 ? 26 THR A CB   6  
ATOM 6421  O OG1  . THR A 1 26 ? 10.921  -2.241  -4.718  1.00 0.00 ? 26 THR A OG1  6  
ATOM 6422  C CG2  . THR A 1 26 ? 9.933   -4.422  -4.435  1.00 0.00 ? 26 THR A CG2  6  
ATOM 6423  H H    . THR A 1 26 ? 9.588   -1.700  -2.662  1.00 0.00 ? 26 THR A H    6  
ATOM 6424  H HA   . THR A 1 26 ? 11.084  -4.211  -2.032  1.00 0.00 ? 26 THR A HA   6  
ATOM 6425  H HB   . THR A 1 26 ? 12.017  -3.932  -4.346  1.00 0.00 ? 26 THR A HB   6  
ATOM 6426  H HG1  . THR A 1 26 ? 11.197  -1.545  -4.117  1.00 0.00 ? 26 THR A HG1  6  
ATOM 6427  H HG21 . THR A 1 26 ? 9.038   -4.138  -3.900  1.00 0.00 ? 26 THR A HG21 6  
ATOM 6428  H HG22 . THR A 1 26 ? 10.198  -5.438  -4.179  1.00 0.00 ? 26 THR A HG22 6  
ATOM 6429  H HG23 . THR A 1 26 ? 9.753   -4.356  -5.498  1.00 0.00 ? 26 THR A HG23 6  
ATOM 6430  N N    . VAL A 1 27 ? 13.171  -2.969  -1.318  1.00 0.00 ? 27 VAL A N    6  
ATOM 6431  C CA   . VAL A 1 27 ? 14.393  -2.203  -0.909  1.00 0.00 ? 27 VAL A CA   6  
ATOM 6432  C C    . VAL A 1 27 ? 15.629  -2.792  -1.593  1.00 0.00 ? 27 VAL A C    6  
ATOM 6433  O O    . VAL A 1 27 ? 16.071  -3.880  -1.280  1.00 0.00 ? 27 VAL A O    6  
ATOM 6434  C CB   . VAL A 1 27 ? 14.565  -2.301  0.609   1.00 0.00 ? 27 VAL A CB   6  
ATOM 6435  C CG1  . VAL A 1 27 ? 15.617  -1.289  1.069   1.00 0.00 ? 27 VAL A CG1  6  
ATOM 6436  C CG2  . VAL A 1 27 ? 13.231  -1.993  1.293   1.00 0.00 ? 27 VAL A CG2  6  
ATOM 6437  H H    . VAL A 1 27 ? 13.020  -3.867  -0.954  1.00 0.00 ? 27 VAL A H    6  
ATOM 6438  H HA   . VAL A 1 27 ? 14.295  -1.162  -1.187  1.00 0.00 ? 27 VAL A HA   6  
ATOM 6439  H HB   . VAL A 1 27 ? 14.887  -3.298  0.874   1.00 0.00 ? 27 VAL A HB   6  
ATOM 6440  H HG11 . VAL A 1 27 ? 15.332  -0.300  0.742   1.00 0.00 ? 27 VAL A HG11 6  
ATOM 6441  H HG12 . VAL A 1 27 ? 16.575  -1.548  0.644   1.00 0.00 ? 27 VAL A HG12 6  
ATOM 6442  H HG13 . VAL A 1 27 ? 15.684  -1.305  2.148   1.00 0.00 ? 27 VAL A HG13 6  
ATOM 6443  H HG21 . VAL A 1 27 ? 12.519  -2.770  1.059   1.00 0.00 ? 27 VAL A HG21 6  
ATOM 6444  H HG22 . VAL A 1 27 ? 12.857  -1.043  0.941   1.00 0.00 ? 27 VAL A HG22 6  
ATOM 6445  H HG23 . VAL A 1 27 ? 13.377  -1.948  2.363   1.00 0.00 ? 27 VAL A HG23 6  
ATOM 6446  N N    . THR A 1 28 ? 16.189  -2.062  -2.522  1.00 0.00 ? 28 THR A N    6  
ATOM 6447  C CA   . THR A 1 28 ? 17.408  -2.547  -3.242  1.00 0.00 ? 28 THR A CA   6  
ATOM 6448  C C    . THR A 1 28 ? 18.635  -1.819  -2.693  1.00 0.00 ? 28 THR A C    6  
ATOM 6449  O O    . THR A 1 28 ? 18.850  -0.655  -2.973  1.00 0.00 ? 28 THR A O    6  
ATOM 6450  C CB   . THR A 1 28 ? 17.267  -2.246  -4.737  1.00 0.00 ? 28 THR A CB   6  
ATOM 6451  O OG1  . THR A 1 28 ? 16.071  -2.835  -5.226  1.00 0.00 ? 28 THR A OG1  6  
ATOM 6452  C CG2  . THR A 1 28 ? 18.467  -2.821  -5.491  1.00 0.00 ? 28 THR A CG2  6  
ATOM 6453  H H    . THR A 1 28 ? 15.786  -1.193  -2.735  1.00 0.00 ? 28 THR A H    6  
ATOM 6454  H HA   . THR A 1 28 ? 17.528  -3.613  -3.100  1.00 0.00 ? 28 THR A HA   6  
ATOM 6455  H HB   . THR A 1 28 ? 17.231  -1.177  -4.889  1.00 0.00 ? 28 THR A HB   6  
ATOM 6456  H HG1  . THR A 1 28 ? 15.368  -2.641  -4.602  1.00 0.00 ? 28 THR A HG1  6  
ATOM 6457  H HG21 . THR A 1 28 ? 19.372  -2.341  -5.148  1.00 0.00 ? 28 THR A HG21 6  
ATOM 6458  H HG22 . THR A 1 28 ? 18.345  -2.645  -6.549  1.00 0.00 ? 28 THR A HG22 6  
ATOM 6459  H HG23 . THR A 1 28 ? 18.532  -3.882  -5.308  1.00 0.00 ? 28 THR A HG23 6  
ATOM 6460  N N    . ASN A 1 29 ? 19.444  -2.486  -1.905  1.00 0.00 ? 29 ASN A N    6  
ATOM 6461  C CA   . ASN A 1 29 ? 20.655  -1.828  -1.326  1.00 0.00 ? 29 ASN A CA   6  
ATOM 6462  C C    . ASN A 1 29 ? 21.891  -2.216  -2.142  1.00 0.00 ? 29 ASN A C    6  
ATOM 6463  O O    . ASN A 1 29 ? 22.253  -3.376  -2.235  1.00 0.00 ? 29 ASN A O    6  
ATOM 6464  C CB   . ASN A 1 29 ? 20.835  -2.293  0.120   1.00 0.00 ? 29 ASN A CB   6  
ATOM 6465  C CG   . ASN A 1 29 ? 22.105  -1.674  0.708   1.00 0.00 ? 29 ASN A CG   6  
ATOM 6466  O OD1  . ASN A 1 29 ? 22.452  -1.936  1.843   1.00 0.00 ? 29 ASN A OD1  6  
ATOM 6467  N ND2  . ASN A 1 29 ? 22.818  -0.861  -0.020  1.00 0.00 ? 29 ASN A ND2  6  
ATOM 6468  H H    . ASN A 1 29 ? 19.255  -3.419  -1.670  1.00 0.00 ? 29 ASN A H    6  
ATOM 6469  H HA   . ASN A 1 29 ? 20.538  -0.752  -1.344  1.00 0.00 ? 29 ASN A HA   6  
ATOM 6470  H HB2  . ASN A 1 29 ? 19.980  -1.983  0.705   1.00 0.00 ? 29 ASN A HB2  6  
ATOM 6471  H HB3  . ASN A 1 29 ? 20.915  -3.368  0.144   1.00 0.00 ? 29 ASN A HB3  6  
ATOM 6472  H HD21 . ASN A 1 29 ? 22.539  -0.649  -0.936  1.00 0.00 ? 29 ASN A HD21 6  
ATOM 6473  H HD22 . ASN A 1 29 ? 23.633  -0.462  0.348   1.00 0.00 ? 29 ASN A HD22 6  
ATOM 6474  N N    . ALA A 1 30 ? 22.535  -1.245  -2.729  1.00 0.00 ? 30 ALA A N    6  
ATOM 6475  C CA   . ALA A 1 30 ? 23.749  -1.513  -3.551  1.00 0.00 ? 30 ALA A CA   6  
ATOM 6476  C C    . ALA A 1 30 ? 24.720  -2.423  -2.796  1.00 0.00 ? 30 ALA A C    6  
ATOM 6477  O O    . ALA A 1 30 ? 25.669  -2.926  -3.363  1.00 0.00 ? 30 ALA A O    6  
ATOM 6478  C CB   . ALA A 1 30 ? 24.444  -0.189  -3.872  1.00 0.00 ? 30 ALA A CB   6  
ATOM 6479  H H    . ALA A 1 30 ? 22.215  -0.324  -2.634  1.00 0.00 ? 30 ALA A H    6  
ATOM 6480  H HA   . ALA A 1 30 ? 23.457  -1.992  -4.473  1.00 0.00 ? 30 ALA A HA   6  
ATOM 6481  H HB1  . ALA A 1 30 ? 23.753  0.468   -4.382  1.00 0.00 ? 30 ALA A HB1  6  
ATOM 6482  H HB2  . ALA A 1 30 ? 25.298  -0.375  -4.508  1.00 0.00 ? 30 ALA A HB2  6  
ATOM 6483  H HB3  . ALA A 1 30 ? 24.773  0.277   -2.955  1.00 0.00 ? 30 ALA A HB3  6  
ATOM 6484  N N    . ASP A 1 31 ? 24.510  -2.637  -1.527  1.00 0.00 ? 31 ASP A N    6  
ATOM 6485  C CA   . ASP A 1 31 ? 25.448  -3.512  -0.770  1.00 0.00 ? 31 ASP A CA   6  
ATOM 6486  C C    . ASP A 1 31 ? 25.223  -4.974  -1.175  1.00 0.00 ? 31 ASP A C    6  
ATOM 6487  O O    . ASP A 1 31 ? 25.947  -5.857  -0.760  1.00 0.00 ? 31 ASP A O    6  
ATOM 6488  C CB   . ASP A 1 31 ? 25.219  -3.338  0.738   1.00 0.00 ? 31 ASP A CB   6  
ATOM 6489  C CG   . ASP A 1 31 ? 25.884  -2.043  1.211   1.00 0.00 ? 31 ASP A CG   6  
ATOM 6490  O OD1  . ASP A 1 31 ? 25.271  -0.999  1.066   1.00 0.00 ? 31 ASP A OD1  6  
ATOM 6491  O OD2  . ASP A 1 31 ? 26.995  -2.118  1.709   1.00 0.00 ? 31 ASP A OD2  6  
ATOM 6492  H H    . ASP A 1 31 ? 23.740  -2.234  -1.073  1.00 0.00 ? 31 ASP A H    6  
ATOM 6493  H HA   . ASP A 1 31 ? 26.464  -3.234  -1.013  1.00 0.00 ? 31 ASP A HA   6  
ATOM 6494  H HB2  . ASP A 1 31 ? 24.160  -3.289  0.940   1.00 0.00 ? 31 ASP A HB2  6  
ATOM 6495  H HB3  . ASP A 1 31 ? 25.650  -4.174  1.268   1.00 0.00 ? 31 ASP A HB3  6  
ATOM 6496  N N    . GLY A 1 32 ? 24.237  -5.234  -2.002  1.00 0.00 ? 32 GLY A N    6  
ATOM 6497  C CA   . GLY A 1 32 ? 23.974  -6.637  -2.463  1.00 0.00 ? 32 GLY A CA   6  
ATOM 6498  C C    . GLY A 1 32 ? 22.758  -7.227  -1.742  1.00 0.00 ? 32 GLY A C    6  
ATOM 6499  O O    . GLY A 1 32 ? 22.428  -8.383  -1.922  1.00 0.00 ? 32 GLY A O    6  
ATOM 6500  H H    . GLY A 1 32 ? 23.672  -4.504  -2.333  1.00 0.00 ? 32 GLY A H    6  
ATOM 6501  H HA2  . GLY A 1 32 ? 23.783  -6.628  -3.527  1.00 0.00 ? 32 GLY A HA2  6  
ATOM 6502  H HA3  . GLY A 1 32 ? 24.837  -7.258  -2.267  1.00 0.00 ? 32 GLY A HA3  6  
ATOM 6503  N N    . ARG A 1 33 ? 22.084  -6.454  -0.929  1.00 0.00 ? 33 ARG A N    6  
ATOM 6504  C CA   . ARG A 1 33 ? 20.888  -6.986  -0.202  1.00 0.00 ? 33 ARG A CA   6  
ATOM 6505  C C    . ARG A 1 33 ? 19.623  -6.630  -0.980  1.00 0.00 ? 33 ARG A C    6  
ATOM 6506  O O    . ARG A 1 33 ? 19.585  -5.675  -1.731  1.00 0.00 ? 33 ARG A O    6  
ATOM 6507  C CB   . ARG A 1 33 ? 20.835  -6.373  1.212   1.00 0.00 ? 33 ARG A CB   6  
ATOM 6508  C CG   . ARG A 1 33 ? 21.550  -7.312  2.195   1.00 0.00 ? 33 ARG A CG   6  
ATOM 6509  C CD   . ARG A 1 33 ? 21.817  -6.612  3.545   1.00 0.00 ? 33 ARG A CD   6  
ATOM 6510  N NE   . ARG A 1 33 ? 23.149  -7.046  4.077   1.00 0.00 ? 33 ARG A NE   6  
ATOM 6511  C CZ   . ARG A 1 33 ? 23.480  -8.311  4.128   1.00 0.00 ? 33 ARG A CZ   6  
ATOM 6512  N NH1  . ARG A 1 33 ? 22.598  -9.239  3.875   1.00 0.00 ? 33 ARG A NH1  6  
ATOM 6513  N NH2  . ARG A 1 33 ? 24.688  -8.649  4.487   1.00 0.00 ? 33 ARG A NH2  6  
ATOM 6514  H H    . ARG A 1 33 ? 22.361  -5.526  -0.795  1.00 0.00 ? 33 ARG A H    6  
ATOM 6515  H HA   . ARG A 1 33 ? 20.955  -8.065  -0.130  1.00 0.00 ? 33 ARG A HA   6  
ATOM 6516  H HB2  . ARG A 1 33 ? 21.328  -5.414  1.198   1.00 0.00 ? 33 ARG A HB2  6  
ATOM 6517  H HB3  . ARG A 1 33 ? 19.807  -6.246  1.525   1.00 0.00 ? 33 ARG A HB3  6  
ATOM 6518  H HG2  . ARG A 1 33 ? 20.930  -8.183  2.354   1.00 0.00 ? 33 ARG A HG2  6  
ATOM 6519  H HG3  . ARG A 1 33 ? 22.485  -7.619  1.756   1.00 0.00 ? 33 ARG A HG3  6  
ATOM 6520  H HD2  . ARG A 1 33 ? 21.849  -5.545  3.413   1.00 0.00 ? 33 ARG A HD2  6  
ATOM 6521  H HD3  . ARG A 1 33 ? 21.023  -6.858  4.244   1.00 0.00 ? 33 ARG A HD3  6  
ATOM 6522  H HE   . ARG A 1 33 ? 23.800  -6.367  4.349   1.00 0.00 ? 33 ARG A HE   6  
ATOM 6523  H HH11 . ARG A 1 33 ? 21.662  -8.989  3.644   1.00 0.00 ? 33 ARG A HH11 6  
ATOM 6524  H HH12 . ARG A 1 33 ? 22.863  -10.202 3.913   1.00 0.00 ? 33 ARG A HH12 6  
ATOM 6525  H HH21 . ARG A 1 33 ? 25.357  -7.945  4.721   1.00 0.00 ? 33 ARG A HH21 6  
ATOM 6526  H HH22 . ARG A 1 33 ? 24.944  -9.615  4.529   1.00 0.00 ? 33 ARG A HH22 6  
ATOM 6527  N N    . THR A 1 34 ? 18.591  -7.401  -0.803  1.00 0.00 ? 34 THR A N    6  
ATOM 6528  C CA   . THR A 1 34 ? 17.321  -7.120  -1.531  1.00 0.00 ? 34 THR A CA   6  
ATOM 6529  C C    . THR A 1 34 ? 16.140  -7.798  -0.829  1.00 0.00 ? 34 THR A C    6  
ATOM 6530  O O    . THR A 1 34 ? 16.040  -9.008  -0.792  1.00 0.00 ? 34 THR A O    6  
ATOM 6531  C CB   . THR A 1 34 ? 17.433  -7.648  -2.963  1.00 0.00 ? 34 THR A CB   6  
ATOM 6532  O OG1  . THR A 1 34 ? 16.131  -7.860  -3.491  1.00 0.00 ? 34 THR A OG1  6  
ATOM 6533  C CG2  . THR A 1 34 ? 18.208  -8.967  -2.964  1.00 0.00 ? 34 THR A CG2  6  
ATOM 6534  H H    . THR A 1 34 ? 18.654  -8.162  -0.187  1.00 0.00 ? 34 THR A H    6  
ATOM 6535  H HA   . THR A 1 34 ? 17.152  -6.053  -1.557  1.00 0.00 ? 34 THR A HA   6  
ATOM 6536  H HB   . THR A 1 34 ? 17.956  -6.928  -3.573  1.00 0.00 ? 34 THR A HB   6  
ATOM 6537  H HG1  . THR A 1 34 ? 16.157  -8.645  -4.041  1.00 0.00 ? 34 THR A HG1  6  
ATOM 6538  H HG21 . THR A 1 34 ? 19.233  -8.781  -2.677  1.00 0.00 ? 34 THR A HG21 6  
ATOM 6539  H HG22 . THR A 1 34 ? 18.184  -9.398  -3.954  1.00 0.00 ? 34 THR A HG22 6  
ATOM 6540  H HG23 . THR A 1 34 ? 17.758  -9.651  -2.262  1.00 0.00 ? 34 THR A HG23 6  
ATOM 6541  N N    . GLU A 1 35 ? 15.231  -7.020  -0.298  1.00 0.00 ? 35 GLU A N    6  
ATOM 6542  C CA   . GLU A 1 35 ? 14.024  -7.590  0.382   1.00 0.00 ? 35 GLU A CA   6  
ATOM 6543  C C    . GLU A 1 35 ? 12.797  -7.187  -0.434  1.00 0.00 ? 35 GLU A C    6  
ATOM 6544  O O    . GLU A 1 35 ? 12.782  -6.134  -1.041  1.00 0.00 ? 35 GLU A O    6  
ATOM 6545  C CB   . GLU A 1 35 ? 13.911  -7.014  1.797   1.00 0.00 ? 35 GLU A CB   6  
ATOM 6546  C CG   . GLU A 1 35 ? 12.710  -7.637  2.511   1.00 0.00 ? 35 GLU A CG   6  
ATOM 6547  C CD   . GLU A 1 35 ? 12.610  -7.073  3.930   1.00 0.00 ? 35 GLU A CD   6  
ATOM 6548  O OE1  . GLU A 1 35 ? 12.656  -5.862  4.069   1.00 0.00 ? 35 GLU A OE1  6  
ATOM 6549  O OE2  . GLU A 1 35 ? 12.489  -7.863  4.852   1.00 0.00 ? 35 GLU A OE2  6  
ATOM 6550  H H    . GLU A 1 35 ? 15.333  -6.047  -0.363  1.00 0.00 ? 35 GLU A H    6  
ATOM 6551  H HA   . GLU A 1 35 ? 14.089  -8.669  0.431   1.00 0.00 ? 35 GLU A HA   6  
ATOM 6552  H HB2  . GLU A 1 35 ? 14.815  -7.237  2.348   1.00 0.00 ? 35 GLU A HB2  6  
ATOM 6553  H HB3  . GLU A 1 35 ? 13.779  -5.944  1.740   1.00 0.00 ? 35 GLU A HB3  6  
ATOM 6554  H HG2  . GLU A 1 35 ? 11.806  -7.404  1.967   1.00 0.00 ? 35 GLU A HG2  6  
ATOM 6555  H HG3  . GLU A 1 35 ? 12.835  -8.708  2.560   1.00 0.00 ? 35 GLU A HG3  6  
ATOM 6556  N N    . THR A 1 36 ? 11.767  -8.004  -0.470  1.00 0.00 ? 36 THR A N    6  
ATOM 6557  C CA   . THR A 1 36 ? 10.557  -7.650  -1.257  1.00 0.00 ? 36 THR A CA   6  
ATOM 6558  C C    . THR A 1 36 ? 9.332   -7.877  -0.389  1.00 0.00 ? 36 THR A C    6  
ATOM 6559  O O    . THR A 1 36 ? 8.974   -8.998  -0.086  1.00 0.00 ? 36 THR A O    6  
ATOM 6560  C CB   . THR A 1 36 ? 10.477  -8.545  -2.497  1.00 0.00 ? 36 THR A CB   6  
ATOM 6561  O OG1  . THR A 1 36 ? 11.562  -8.247  -3.364  1.00 0.00 ? 36 THR A OG1  6  
ATOM 6562  C CG2  . THR A 1 36 ? 9.155   -8.296  -3.228  1.00 0.00 ? 36 THR A CG2  6  
ATOM 6563  H H    . THR A 1 36 ? 11.780  -8.851  0.021   1.00 0.00 ? 36 THR A H    6  
ATOM 6564  H HA   . THR A 1 36 ? 10.588  -6.613  -1.562  1.00 0.00 ? 36 THR A HA   6  
ATOM 6565  H HB   . THR A 1 36 ? 10.527  -9.581  -2.200  1.00 0.00 ? 36 THR A HB   6  
ATOM 6566  H HG1  . THR A 1 36 ? 11.623  -7.292  -3.446  1.00 0.00 ? 36 THR A HG1  6  
ATOM 6567  H HG21 . THR A 1 36 ? 8.350   -8.768  -2.686  1.00 0.00 ? 36 THR A HG21 6  
ATOM 6568  H HG22 . THR A 1 36 ? 9.210   -8.711  -4.223  1.00 0.00 ? 36 THR A HG22 6  
ATOM 6569  H HG23 . THR A 1 36 ? 8.972   -7.234  -3.291  1.00 0.00 ? 36 THR A HG23 6  
ATOM 6570  N N    . THR A 1 37 ? 8.659   -6.825  -0.027  1.00 0.00 ? 37 THR A N    6  
ATOM 6571  C CA   . THR A 1 37 ? 7.416   -6.964  0.780   1.00 0.00 ? 37 THR A CA   6  
ATOM 6572  C C    . THR A 1 37 ? 6.270   -6.731  -0.185  1.00 0.00 ? 37 THR A C    6  
ATOM 6573  O O    . THR A 1 37 ? 6.042   -5.624  -0.617  1.00 0.00 ? 37 THR A O    6  
ATOM 6574  C CB   . THR A 1 37 ? 7.387   -5.910  1.892   1.00 0.00 ? 37 THR A CB   6  
ATOM 6575  O OG1  . THR A 1 37 ? 8.654   -5.867  2.532   1.00 0.00 ? 37 THR A OG1  6  
ATOM 6576  C CG2  . THR A 1 37 ? 6.308   -6.271  2.914   1.00 0.00 ? 37 THR A CG2  6  
ATOM 6577  H H    . THR A 1 37 ? 8.944   -5.932  -0.326  1.00 0.00 ? 37 THR A H    6  
ATOM 6578  H HA   . THR A 1 37 ? 7.339   -7.961  1.210   1.00 0.00 ? 37 THR A HA   6  
ATOM 6579  H HB   . THR A 1 37 ? 7.165   -4.944  1.469   1.00 0.00 ? 37 THR A HB   6  
ATOM 6580  H HG1  . THR A 1 37 ? 8.875   -4.946  2.691   1.00 0.00 ? 37 THR A HG1  6  
ATOM 6581  H HG21 . THR A 1 37 ? 6.483   -7.271  3.284   1.00 0.00 ? 37 THR A HG21 6  
ATOM 6582  H HG22 . THR A 1 37 ? 5.337   -6.228  2.443   1.00 0.00 ? 37 THR A HG22 6  
ATOM 6583  H HG23 . THR A 1 37 ? 6.341   -5.572  3.735   1.00 0.00 ? 37 THR A HG23 6  
ATOM 6584  N N    . LYS A 1 38 ? 5.557   -7.763  -0.535  1.00 0.00 ? 38 LYS A N    6  
ATOM 6585  C CA   . LYS A 1 38 ? 4.415   -7.615  -1.498  1.00 0.00 ? 38 LYS A CA   6  
ATOM 6586  C C    . LYS A 1 38 ? 3.137   -8.188  -0.885  1.00 0.00 ? 38 LYS A C    6  
ATOM 6587  O O    . LYS A 1 38 ? 3.171   -9.079  -0.059  1.00 0.00 ? 38 LYS A O    6  
ATOM 6588  C CB   . LYS A 1 38 ? 4.738   -8.377  -2.787  1.00 0.00 ? 38 LYS A CB   6  
ATOM 6589  C CG   . LYS A 1 38 ? 5.053   -9.840  -2.451  1.00 0.00 ? 38 LYS A CG   6  
ATOM 6590  C CD   . LYS A 1 38 ? 5.479   -10.604 -3.725  1.00 0.00 ? 38 LYS A CD   6  
ATOM 6591  C CE   . LYS A 1 38 ? 4.250   -11.169 -4.455  1.00 0.00 ? 38 LYS A CE   6  
ATOM 6592  N NZ   . LYS A 1 38 ? 3.448   -10.055 -5.030  1.00 0.00 ? 38 LYS A NZ   6  
ATOM 6593  H H    . LYS A 1 38 ? 5.756   -8.643  -0.160  1.00 0.00 ? 38 LYS A H    6  
ATOM 6594  H HA   . LYS A 1 38 ? 4.255   -6.574  -1.735  1.00 0.00 ? 38 LYS A HA   6  
ATOM 6595  H HB2  . LYS A 1 38 ? 3.888   -8.331  -3.449  1.00 0.00 ? 38 LYS A HB2  6  
ATOM 6596  H HB3  . LYS A 1 38 ? 5.594   -7.926  -3.266  1.00 0.00 ? 38 LYS A HB3  6  
ATOM 6597  H HG2  . LYS A 1 38 ? 5.860   -9.869  -1.731  1.00 0.00 ? 38 LYS A HG2  6  
ATOM 6598  H HG3  . LYS A 1 38 ? 4.179   -10.305 -2.022  1.00 0.00 ? 38 LYS A HG3  6  
ATOM 6599  H HD2  . LYS A 1 38 ? 6.012   -9.938  -4.388  1.00 0.00 ? 38 LYS A HD2  6  
ATOM 6600  H HD3  . LYS A 1 38 ? 6.130   -11.421 -3.448  1.00 0.00 ? 38 LYS A HD3  6  
ATOM 6601  H HE2  . LYS A 1 38 ? 4.578   -11.820 -5.252  1.00 0.00 ? 38 LYS A HE2  6  
ATOM 6602  H HE3  . LYS A 1 38 ? 3.642   -11.733 -3.762  1.00 0.00 ? 38 LYS A HE3  6  
ATOM 6603  H HZ1  . LYS A 1 38 ? 4.078   -9.268  -5.283  1.00 0.00 ? 38 LYS A HZ1  6  
ATOM 6604  H HZ2  . LYS A 1 38 ? 2.754   -9.728  -4.328  1.00 0.00 ? 38 LYS A HZ2  6  
ATOM 6605  H HZ3  . LYS A 1 38 ? 2.949   -10.389 -5.880  1.00 0.00 ? 38 LYS A HZ3  6  
ATOM 6606  N N    . GLU A 1 39 ? 2.009   -7.679  -1.293  1.00 0.00 ? 39 GLU A N    6  
ATOM 6607  C CA   . GLU A 1 39 ? 0.714   -8.176  -0.753  1.00 0.00 ? 39 GLU A CA   6  
ATOM 6608  C C    . GLU A 1 39 ? -0.423  -7.668  -1.651  1.00 0.00 ? 39 GLU A C    6  
ATOM 6609  O O    . GLU A 1 39 ? -1.024  -6.649  -1.374  1.00 0.00 ? 39 GLU A O    6  
ATOM 6610  C CB   . GLU A 1 39 ? 0.515   -7.637  0.664   1.00 0.00 ? 39 GLU A CB   6  
ATOM 6611  C CG   . GLU A 1 39 ? -0.650  -8.369  1.331   1.00 0.00 ? 39 GLU A CG   6  
ATOM 6612  C CD   . GLU A 1 39 ? -0.239  -9.809  1.641   1.00 0.00 ? 39 GLU A CD   6  
ATOM 6613  O OE1  . GLU A 1 39 ? 0.601   -9.992  2.506   1.00 0.00 ? 39 GLU A OE1  6  
ATOM 6614  O OE2  . GLU A 1 39 ? -0.775  -10.706 1.009   1.00 0.00 ? 39 GLU A OE2  6  
ATOM 6615  H H    . GLU A 1 39 ? 2.014   -6.961  -1.961  1.00 0.00 ? 39 GLU A H    6  
ATOM 6616  H HA   . GLU A 1 39 ? 0.719   -9.257  -0.730  1.00 0.00 ? 39 GLU A HA   6  
ATOM 6617  H HB2  . GLU A 1 39 ? 1.417   -7.795  1.239   1.00 0.00 ? 39 GLU A HB2  6  
ATOM 6618  H HB3  . GLU A 1 39 ? 0.296   -6.582  0.620   1.00 0.00 ? 39 GLU A HB3  6  
ATOM 6619  H HG2  . GLU A 1 39 ? -0.914  -7.863  2.247   1.00 0.00 ? 39 GLU A HG2  6  
ATOM 6620  H HG3  . GLU A 1 39 ? -1.500  -8.374  0.664   1.00 0.00 ? 39 GLU A HG3  6  
ATOM 6621  N N    . VAL A 1 40 ? -0.729  -8.359  -2.725  1.00 0.00 ? 40 VAL A N    6  
ATOM 6622  C CA   . VAL A 1 40 ? -1.828  -7.889  -3.623  1.00 0.00 ? 40 VAL A CA   6  
ATOM 6623  C C    . VAL A 1 40 ? -3.146  -8.549  -3.202  1.00 0.00 ? 40 VAL A C    6  
ATOM 6624  O O    . VAL A 1 40 ? -3.297  -9.751  -3.285  1.00 0.00 ? 40 VAL A O    6  
ATOM 6625  C CB   . VAL A 1 40 ? -1.499  -8.286  -5.068  1.00 0.00 ? 40 VAL A CB   6  
ATOM 6626  C CG1  . VAL A 1 40 ? -2.345  -7.456  -6.039  1.00 0.00 ? 40 VAL A CG1  6  
ATOM 6627  C CG2  . VAL A 1 40 ? -0.012  -8.032  -5.340  1.00 0.00 ? 40 VAL A CG2  6  
ATOM 6628  H H    . VAL A 1 40 ? -0.242  -9.183  -2.940  1.00 0.00 ? 40 VAL A H    6  
ATOM 6629  H HA   . VAL A 1 40 ? -1.923  -6.812  -3.558  1.00 0.00 ? 40 VAL A HA   6  
ATOM 6630  H HB   . VAL A 1 40 ? -1.716  -9.335  -5.213  1.00 0.00 ? 40 VAL A HB   6  
ATOM 6631  H HG11 . VAL A 1 40 ? -2.222  -7.840  -7.042  1.00 0.00 ? 40 VAL A HG11 6  
ATOM 6632  H HG12 . VAL A 1 40 ? -2.026  -6.425  -6.006  1.00 0.00 ? 40 VAL A HG12 6  
ATOM 6633  H HG13 . VAL A 1 40 ? -3.385  -7.520  -5.755  1.00 0.00 ? 40 VAL A HG13 6  
ATOM 6634  H HG21 . VAL A 1 40 ? 0.576   -8.803  -4.862  1.00 0.00 ? 40 VAL A HG21 6  
ATOM 6635  H HG22 . VAL A 1 40 ? 0.268   -7.068  -4.943  1.00 0.00 ? 40 VAL A HG22 6  
ATOM 6636  H HG23 . VAL A 1 40 ? 0.169   -8.051  -6.404  1.00 0.00 ? 40 VAL A HG23 6  
ATOM 6637  N N    . VAL A 1 41 ? -4.108  -7.767  -2.774  1.00 0.00 ? 41 VAL A N    6  
ATOM 6638  C CA   . VAL A 1 41 ? -5.432  -8.340  -2.375  1.00 0.00 ? 41 VAL A CA   6  
ATOM 6639  C C    . VAL A 1 41 ? -6.544  -7.478  -2.992  1.00 0.00 ? 41 VAL A C    6  
ATOM 6640  O O    . VAL A 1 41 ? -6.799  -6.377  -2.545  1.00 0.00 ? 41 VAL A O    6  
ATOM 6641  C CB   . VAL A 1 41 ? -5.524  -8.329  -0.834  1.00 0.00 ? 41 VAL A CB   6  
ATOM 6642  C CG1  . VAL A 1 41 ? -6.984  -8.409  -0.373  1.00 0.00 ? 41 VAL A CG1  6  
ATOM 6643  C CG2  . VAL A 1 41 ? -4.753  -9.527  -0.267  1.00 0.00 ? 41 VAL A CG2  6  
ATOM 6644  H H    . VAL A 1 41 ? -3.971  -6.797  -2.747  1.00 0.00 ? 41 VAL A H    6  
ATOM 6645  H HA   . VAL A 1 41 ? -5.528  -9.355  -2.739  1.00 0.00 ? 41 VAL A HA   6  
ATOM 6646  H HB   . VAL A 1 41 ? -5.085  -7.416  -0.460  1.00 0.00 ? 41 VAL A HB   6  
ATOM 6647  H HG11 . VAL A 1 41 ? -7.021  -8.666  0.676   1.00 0.00 ? 41 VAL A HG11 6  
ATOM 6648  H HG12 . VAL A 1 41 ? -7.505  -9.160  -0.948  1.00 0.00 ? 41 VAL A HG12 6  
ATOM 6649  H HG13 . VAL A 1 41 ? -7.455  -7.450  -0.523  1.00 0.00 ? 41 VAL A HG13 6  
ATOM 6650  H HG21 . VAL A 1 41 ? -5.125  -10.439 -0.711  1.00 0.00 ? 41 VAL A HG21 6  
ATOM 6651  H HG22 . VAL A 1 41 ? -4.890  -9.568  0.805   1.00 0.00 ? 41 VAL A HG22 6  
ATOM 6652  H HG23 . VAL A 1 41 ? -3.702  -9.419  -0.492  1.00 0.00 ? 41 VAL A HG23 6  
ATOM 6653  N N    . LYS A 1 42 ? -7.196  -7.968  -4.021  1.00 0.00 ? 42 LYS A N    6  
ATOM 6654  C CA   . LYS A 1 42 ? -8.286  -7.181  -4.688  1.00 0.00 ? 42 LYS A CA   6  
ATOM 6655  C C    . LYS A 1 42 ? -9.617  -7.932  -4.583  1.00 0.00 ? 42 LYS A C    6  
ATOM 6656  O O    . LYS A 1 42 ? -9.711  -9.095  -4.920  1.00 0.00 ? 42 LYS A O    6  
ATOM 6657  C CB   . LYS A 1 42 ? -7.936  -6.997  -6.167  1.00 0.00 ? 42 LYS A CB   6  
ATOM 6658  C CG   . LYS A 1 42 ? -6.735  -6.055  -6.300  1.00 0.00 ? 42 LYS A CG   6  
ATOM 6659  C CD   . LYS A 1 42 ? -6.131  -6.186  -7.700  1.00 0.00 ? 42 LYS A CD   6  
ATOM 6660  C CE   . LYS A 1 42 ? -7.212  -5.929  -8.753  1.00 0.00 ? 42 LYS A CE   6  
ATOM 6661  N NZ   . LYS A 1 42 ? -8.021  -4.741  -8.356  1.00 0.00 ? 42 LYS A NZ   6  
ATOM 6662  H H    . LYS A 1 42 ? -6.949  -8.846  -4.379  1.00 0.00 ? 42 LYS A H    6  
ATOM 6663  H HA   . LYS A 1 42 ? -8.388  -6.210  -4.223  1.00 0.00 ? 42 LYS A HA   6  
ATOM 6664  H HB2  . LYS A 1 42 ? -7.693  -7.957  -6.600  1.00 0.00 ? 42 LYS A HB2  6  
ATOM 6665  H HB3  . LYS A 1 42 ? -8.782  -6.573  -6.686  1.00 0.00 ? 42 LYS A HB3  6  
ATOM 6666  H HG2  . LYS A 1 42 ? -7.058  -5.037  -6.140  1.00 0.00 ? 42 LYS A HG2  6  
ATOM 6667  H HG3  . LYS A 1 42 ? -5.989  -6.315  -5.563  1.00 0.00 ? 42 LYS A HG3  6  
ATOM 6668  H HD2  . LYS A 1 42 ? -5.334  -5.465  -7.817  1.00 0.00 ? 42 LYS A HD2  6  
ATOM 6669  H HD3  . LYS A 1 42 ? -5.736  -7.182  -7.830  1.00 0.00 ? 42 LYS A HD3  6  
ATOM 6670  H HE2  . LYS A 1 42 ? -6.745  -5.743  -9.708  1.00 0.00 ? 42 LYS A HE2  6  
ATOM 6671  H HE3  . LYS A 1 42 ? -7.854  -6.794  -8.828  1.00 0.00 ? 42 LYS A HE3  6  
ATOM 6672  H HZ1  . LYS A 1 42 ? -8.700  -5.015  -7.618  1.00 0.00 ? 42 LYS A HZ1  6  
ATOM 6673  H HZ2  . LYS A 1 42 ? -8.539  -4.382  -9.183  1.00 0.00 ? 42 LYS A HZ2  6  
ATOM 6674  H HZ3  . LYS A 1 42 ? -7.390  -3.998  -7.991  1.00 0.00 ? 42 LYS A HZ3  6  
ATOM 6675  N N    . SER A 1 43 ? -10.649 -7.271  -4.129  1.00 0.00 ? 43 SER A N    6  
ATOM 6676  C CA   . SER A 1 43 ? -11.978 -7.942  -4.016  1.00 0.00 ? 43 SER A CA   6  
ATOM 6677  C C    . SER A 1 43 ? -12.718 -7.834  -5.352  1.00 0.00 ? 43 SER A C    6  
ATOM 6678  O O    . SER A 1 43 ? -12.144 -7.485  -6.364  1.00 0.00 ? 43 SER A O    6  
ATOM 6679  C CB   . SER A 1 43 ? -12.805 -7.256  -2.926  1.00 0.00 ? 43 SER A CB   6  
ATOM 6680  O OG   . SER A 1 43 ? -14.153 -7.699  -3.003  1.00 0.00 ? 43 SER A OG   6  
ATOM 6681  H H    . SER A 1 43 ? -10.554 -6.331  -3.867  1.00 0.00 ? 43 SER A H    6  
ATOM 6682  H HA   . SER A 1 43 ? -11.841 -8.984  -3.762  1.00 0.00 ? 43 SER A HA   6  
ATOM 6683  H HB2  . SER A 1 43 ? -12.408 -7.510  -1.962  1.00 0.00 ? 43 SER A HB2  6  
ATOM 6684  H HB3  . SER A 1 43 ? -12.757 -6.184  -3.062  1.00 0.00 ? 43 SER A HB3  6  
ATOM 6685  H HG   . SER A 1 43 ? -14.705 -7.045  -2.568  1.00 0.00 ? 43 SER A HG   6  
ATOM 6686  N N    . GLU A 1 44 ? -13.993 -8.126  -5.359  1.00 0.00 ? 44 GLU A N    6  
ATOM 6687  C CA   . GLU A 1 44 ? -14.786 -8.039  -6.624  1.00 0.00 ? 44 GLU A CA   6  
ATOM 6688  C C    . GLU A 1 44 ? -16.190 -7.518  -6.303  1.00 0.00 ? 44 GLU A C    6  
ATOM 6689  O O    . GLU A 1 44 ? -17.175 -8.205  -6.480  1.00 0.00 ? 44 GLU A O    6  
ATOM 6690  C CB   . GLU A 1 44 ? -14.887 -9.426  -7.271  1.00 0.00 ? 44 GLU A CB   6  
ATOM 6691  C CG   . GLU A 1 44 ? -15.282 -10.472 -6.220  1.00 0.00 ? 44 GLU A CG   6  
ATOM 6692  C CD   . GLU A 1 44 ? -14.077 -10.792 -5.333  1.00 0.00 ? 44 GLU A CD   6  
ATOM 6693  O OE1  . GLU A 1 44 ? -13.146 -11.403 -5.831  1.00 0.00 ? 44 GLU A OE1  6  
ATOM 6694  O OE2  . GLU A 1 44 ? -14.105 -10.417 -4.172  1.00 0.00 ? 44 GLU A OE2  6  
ATOM 6695  H H    . GLU A 1 44 ? -14.431 -8.403  -4.529  1.00 0.00 ? 44 GLU A H    6  
ATOM 6696  H HA   . GLU A 1 44 ? -14.304 -7.357  -7.313  1.00 0.00 ? 44 GLU A HA   6  
ATOM 6697  H HB2  . GLU A 1 44 ? -15.633 -9.404  -8.051  1.00 0.00 ? 44 GLU A HB2  6  
ATOM 6698  H HB3  . GLU A 1 44 ? -13.931 -9.693  -7.697  1.00 0.00 ? 44 GLU A HB3  6  
ATOM 6699  H HG2  . GLU A 1 44 ? -16.087 -10.087 -5.612  1.00 0.00 ? 44 GLU A HG2  6  
ATOM 6700  H HG3  . GLU A 1 44 ? -15.608 -11.372 -6.718  1.00 0.00 ? 44 GLU A HG3  6  
ATOM 6701  N N    . ASP A 1 45 ? -16.284 -6.301  -5.830  1.00 0.00 ? 45 ASP A N    6  
ATOM 6702  C CA   . ASP A 1 45 ? -17.619 -5.719  -5.489  1.00 0.00 ? 45 ASP A CA   6  
ATOM 6703  C C    . ASP A 1 45 ? -17.649 -4.242  -5.891  1.00 0.00 ? 45 ASP A C    6  
ATOM 6704  O O    . ASP A 1 45 ? -17.525 -3.361  -5.065  1.00 0.00 ? 45 ASP A O    6  
ATOM 6705  C CB   . ASP A 1 45 ? -17.857 -5.840  -3.982  1.00 0.00 ? 45 ASP A CB   6  
ATOM 6706  C CG   . ASP A 1 45 ? -16.662 -5.254  -3.227  1.00 0.00 ? 45 ASP A CG   6  
ATOM 6707  O OD1  . ASP A 1 45 ? -15.872 -4.563  -3.850  1.00 0.00 ? 45 ASP A OD1  6  
ATOM 6708  O OD2  . ASP A 1 45 ? -16.557 -5.505  -2.037  1.00 0.00 ? 45 ASP A OD2  6  
ATOM 6709  H H    . ASP A 1 45 ? -15.473 -5.768  -5.697  1.00 0.00 ? 45 ASP A H    6  
ATOM 6710  H HA   . ASP A 1 45 ? -18.400 -6.249  -6.020  1.00 0.00 ? 45 ASP A HA   6  
ATOM 6711  H HB2  . ASP A 1 45 ? -18.753 -5.300  -3.714  1.00 0.00 ? 45 ASP A HB2  6  
ATOM 6712  H HB3  . ASP A 1 45 ? -17.970 -6.881  -3.717  1.00 0.00 ? 45 ASP A HB3  6  
ATOM 6713  N N    . GLY A 1 46 ? -17.821 -3.967  -7.156  1.00 0.00 ? 46 GLY A N    6  
ATOM 6714  C CA   . GLY A 1 46 ? -17.865 -2.548  -7.614  1.00 0.00 ? 46 GLY A CA   6  
ATOM 6715  C C    . GLY A 1 46 ? -16.533 -1.860  -7.303  1.00 0.00 ? 46 GLY A C    6  
ATOM 6716  O O    . GLY A 1 46 ? -15.970 -2.024  -6.240  1.00 0.00 ? 46 GLY A O    6  
ATOM 6717  H H    . GLY A 1 46 ? -17.925 -4.697  -7.801  1.00 0.00 ? 46 GLY A H    6  
ATOM 6718  H HA2  . GLY A 1 46 ? -18.046 -2.522  -8.680  1.00 0.00 ? 46 GLY A HA2  6  
ATOM 6719  H HA3  . GLY A 1 46 ? -18.661 -2.030  -7.101  1.00 0.00 ? 46 GLY A HA3  6  
ATOM 6720  N N    . SER A 1 47 ? -16.026 -1.090  -8.228  1.00 0.00 ? 47 SER A N    6  
ATOM 6721  C CA   . SER A 1 47 ? -14.732 -0.391  -7.991  1.00 0.00 ? 47 SER A CA   6  
ATOM 6722  C C    . SER A 1 47 ? -14.975 0.873   -7.164  1.00 0.00 ? 47 SER A C    6  
ATOM 6723  O O    . SER A 1 47 ? -15.600 1.812   -7.615  1.00 0.00 ? 47 SER A O    6  
ATOM 6724  C CB   . SER A 1 47 ? -14.107 -0.008  -9.333  1.00 0.00 ? 47 SER A CB   6  
ATOM 6725  O OG   . SER A 1 47 ? -13.831 -1.187  -10.075 1.00 0.00 ? 47 SER A OG   6  
ATOM 6726  H H    . SER A 1 47 ? -16.497 -0.976  -9.078  1.00 0.00 ? 47 SER A H    6  
ATOM 6727  H HA   . SER A 1 47 ? -14.060 -1.046  -7.456  1.00 0.00 ? 47 SER A HA   6  
ATOM 6728  H HB2  . SER A 1 47 ? -14.793 0.610   -9.888  1.00 0.00 ? 47 SER A HB2  6  
ATOM 6729  H HB3  . SER A 1 47 ? -13.192 0.543   -9.158  1.00 0.00 ? 47 SER A HB3  6  
ATOM 6730  H HG   . SER A 1 47 ? -14.667 -1.548  -10.380 1.00 0.00 ? 47 SER A HG   6  
ATOM 6731  N N    . ASP A 1 48 ? -14.480 0.905   -5.955  1.00 0.00 ? 48 ASP A N    6  
ATOM 6732  C CA   . ASP A 1 48 ? -14.670 2.107   -5.088  1.00 0.00 ? 48 ASP A CA   6  
ATOM 6733  C C    . ASP A 1 48 ? -13.418 2.298   -4.231  1.00 0.00 ? 48 ASP A C    6  
ATOM 6734  O O    . ASP A 1 48 ? -13.473 2.284   -3.023  1.00 0.00 ? 48 ASP A O    6  
ATOM 6735  C CB   . ASP A 1 48 ? -15.886 1.897   -4.184  1.00 0.00 ? 48 ASP A CB   6  
ATOM 6736  C CG   . ASP A 1 48 ? -17.108 1.562   -5.042  1.00 0.00 ? 48 ASP A CG   6  
ATOM 6737  O OD1  . ASP A 1 48 ? -17.207 0.426   -5.478  1.00 0.00 ? 48 ASP A OD1  6  
ATOM 6738  O OD2  . ASP A 1 48 ? -17.923 2.445   -5.250  1.00 0.00 ? 48 ASP A OD2  6  
ATOM 6739  H H    . ASP A 1 48 ? -13.977 0.136   -5.615  1.00 0.00 ? 48 ASP A H    6  
ATOM 6740  H HA   . ASP A 1 48 ? -14.821 2.984   -5.702  1.00 0.00 ? 48 ASP A HA   6  
ATOM 6741  H HB2  . ASP A 1 48 ? -15.690 1.084   -3.499  1.00 0.00 ? 48 ASP A HB2  6  
ATOM 6742  H HB3  . ASP A 1 48 ? -16.079 2.801   -3.624  1.00 0.00 ? 48 ASP A HB3  6  
ATOM 6743  N N    . CYS A 1 49 ? -12.290 2.474   -4.868  1.00 0.00 ? 49 CYS A N    6  
ATOM 6744  C CA   . CYS A 1 49 ? -10.998 2.668   -4.136  1.00 0.00 ? 49 CYS A CA   6  
ATOM 6745  C C    . CYS A 1 49 ? -10.396 4.008   -4.561  1.00 0.00 ? 49 CYS A C    6  
ATOM 6746  O O    . CYS A 1 49 ? -10.487 4.403   -5.707  1.00 0.00 ? 49 CYS A O    6  
ATOM 6747  C CB   . CYS A 1 49 ? -10.041 1.504   -4.496  1.00 0.00 ? 49 CYS A CB   6  
ATOM 6748  S SG   . CYS A 1 49 ? -9.718  0.487   -3.031  1.00 0.00 ? 49 CYS A SG   6  
ATOM 6749  H H    . CYS A 1 49 ? -12.291 2.481   -5.840  1.00 0.00 ? 49 CYS A H    6  
ATOM 6750  H HA   . CYS A 1 49 ? -11.173 2.685   -3.068  1.00 0.00 ? 49 CYS A HA   6  
ATOM 6751  H HB2  . CYS A 1 49 ? -10.502 0.890   -5.255  1.00 0.00 ? 49 CYS A HB2  6  
ATOM 6752  H HB3  . CYS A 1 49 ? -9.103  1.887   -4.875  1.00 0.00 ? 49 CYS A HB3  6  
ATOM 6753  N N    . GLY A 1 50 ? -9.790  4.714   -3.650  1.00 0.00 ? 50 GLY A N    6  
ATOM 6754  C CA   . GLY A 1 50 ? -9.198  6.032   -4.020  1.00 0.00 ? 50 GLY A CA   6  
ATOM 6755  C C    . GLY A 1 50 ? -10.323 7.053   -4.175  1.00 0.00 ? 50 GLY A C    6  
ATOM 6756  O O    . GLY A 1 50 ? -10.112 8.246   -4.088  1.00 0.00 ? 50 GLY A O    6  
ATOM 6757  H H    . GLY A 1 50 ? -9.734  4.384   -2.725  1.00 0.00 ? 50 GLY A H    6  
ATOM 6758  H HA2  . GLY A 1 50 ? -8.516  6.356   -3.249  1.00 0.00 ? 50 GLY A HA2  6  
ATOM 6759  H HA3  . GLY A 1 50 ? -8.669  5.941   -4.956  1.00 0.00 ? 50 GLY A HA3  6  
ATOM 6760  N N    . ASP A 1 51 ? -11.523 6.587   -4.408  1.00 0.00 ? 51 ASP A N    6  
ATOM 6761  C CA   . ASP A 1 51 ? -12.679 7.515   -4.575  1.00 0.00 ? 51 ASP A CA   6  
ATOM 6762  C C    . ASP A 1 51 ? -13.458 7.612   -3.261  1.00 0.00 ? 51 ASP A C    6  
ATOM 6763  O O    . ASP A 1 51 ? -14.161 8.573   -3.023  1.00 0.00 ? 51 ASP A O    6  
ATOM 6764  C CB   . ASP A 1 51 ? -13.602 6.979   -5.672  1.00 0.00 ? 51 ASP A CB   6  
ATOM 6765  C CG   . ASP A 1 51 ? -12.862 6.987   -7.011  1.00 0.00 ? 51 ASP A CG   6  
ATOM 6766  O OD1  . ASP A 1 51 ? -11.744 6.501   -7.050  1.00 0.00 ? 51 ASP A OD1  6  
ATOM 6767  O OD2  . ASP A 1 51 ? -13.426 7.478   -7.974  1.00 0.00 ? 51 ASP A OD2  6  
ATOM 6768  H H    . ASP A 1 51 ? -11.667 5.621   -4.475  1.00 0.00 ? 51 ASP A H    6  
ATOM 6769  H HA   . ASP A 1 51 ? -12.326 8.497   -4.856  1.00 0.00 ? 51 ASP A HA   6  
ATOM 6770  H HB2  . ASP A 1 51 ? -13.901 5.970   -5.430  1.00 0.00 ? 51 ASP A HB2  6  
ATOM 6771  H HB3  . ASP A 1 51 ? -14.479 7.606   -5.744  1.00 0.00 ? 51 ASP A HB3  6  
ATOM 6772  N N    . ALA A 1 52 ? -13.360 6.627   -2.403  1.00 0.00 ? 52 ALA A N    6  
ATOM 6773  C CA   . ALA A 1 52 ? -14.120 6.691   -1.117  1.00 0.00 ? 52 ALA A CA   6  
ATOM 6774  C C    . ALA A 1 52 ? -13.429 5.820   -0.065  1.00 0.00 ? 52 ALA A C    6  
ATOM 6775  O O    . ALA A 1 52 ? -13.253 6.222   1.068   1.00 0.00 ? 52 ALA A O    6  
ATOM 6776  C CB   . ALA A 1 52 ? -15.546 6.182   -1.344  1.00 0.00 ? 52 ALA A CB   6  
ATOM 6777  H H    . ALA A 1 52 ? -12.805 5.839   -2.595  1.00 0.00 ? 52 ALA A H    6  
ATOM 6778  H HA   . ALA A 1 52 ? -14.156 7.713   -0.769  1.00 0.00 ? 52 ALA A HA   6  
ATOM 6779  H HB1  . ALA A 1 52 ? -15.512 5.163   -1.701  1.00 0.00 ? 52 ALA A HB1  6  
ATOM 6780  H HB2  . ALA A 1 52 ? -16.037 6.804   -2.078  1.00 0.00 ? 52 ALA A HB2  6  
ATOM 6781  H HB3  . ALA A 1 52 ? -16.093 6.221   -0.415  1.00 0.00 ? 52 ALA A HB3  6  
ATOM 6782  N N    . ASP A 1 53 ? -13.029 4.630   -0.428  1.00 0.00 ? 53 ASP A N    6  
ATOM 6783  C CA   . ASP A 1 53 ? -12.338 3.756   0.582   1.00 0.00 ? 53 ASP A CA   6  
ATOM 6784  C C    . ASP A 1 53 ? -10.929 4.302   0.803   1.00 0.00 ? 53 ASP A C    6  
ATOM 6785  O O    . ASP A 1 53 ? -10.764 5.455   1.141   1.00 0.00 ? 53 ASP A O    6  
ATOM 6786  C CB   . ASP A 1 53 ? -12.262 2.288   0.133   1.00 0.00 ? 53 ASP A CB   6  
ATOM 6787  C CG   . ASP A 1 53 ? -13.601 1.859   -0.473  1.00 0.00 ? 53 ASP A CG   6  
ATOM 6788  O OD1  . ASP A 1 53 ? -14.461 2.709   -0.631  1.00 0.00 ? 53 ASP A OD1  6  
ATOM 6789  O OD2  . ASP A 1 53 ? -13.743 0.683   -0.766  1.00 0.00 ? 53 ASP A OD2  6  
ATOM 6790  H H    . ASP A 1 53 ? -13.182 4.340   -1.356  1.00 0.00 ? 53 ASP A H    6  
ATOM 6791  H HA   . ASP A 1 53 ? -12.880 3.812   1.516   1.00 0.00 ? 53 ASP A HA   6  
ATOM 6792  H HB2  . ASP A 1 53 ? -11.471 2.164   -0.590  1.00 0.00 ? 53 ASP A HB2  6  
ATOM 6793  H HB3  . ASP A 1 53 ? -12.052 1.667   0.993   1.00 0.00 ? 53 ASP A HB3  6  
ATOM 6794  N N    . PHE A 1 54 ? -9.905  3.507   0.618   1.00 0.00 ? 54 PHE A N    6  
ATOM 6795  C CA   . PHE A 1 54 ? -8.532  4.061   0.835   1.00 0.00 ? 54 PHE A CA   6  
ATOM 6796  C C    . PHE A 1 54 ? -7.451  3.015   0.532   1.00 0.00 ? 54 PHE A C    6  
ATOM 6797  O O    . PHE A 1 54 ? -7.727  1.902   0.131   1.00 0.00 ? 54 PHE A O    6  
ATOM 6798  C CB   . PHE A 1 54 ? -8.403  4.528   2.297   1.00 0.00 ? 54 PHE A CB   6  
ATOM 6799  C CG   . PHE A 1 54 ? -9.199  3.605   3.193   1.00 0.00 ? 54 PHE A CG   6  
ATOM 6800  C CD1  . PHE A 1 54 ? -8.694  2.340   3.519   1.00 0.00 ? 54 PHE A CD1  6  
ATOM 6801  C CD2  . PHE A 1 54 ? -10.443 4.012   3.697   1.00 0.00 ? 54 PHE A CD2  6  
ATOM 6802  C CE1  . PHE A 1 54 ? -9.431  1.485   4.346   1.00 0.00 ? 54 PHE A CE1  6  
ATOM 6803  C CE2  . PHE A 1 54 ? -11.178 3.156   4.524   1.00 0.00 ? 54 PHE A CE2  6  
ATOM 6804  C CZ   . PHE A 1 54 ? -10.672 1.891   4.849   1.00 0.00 ? 54 PHE A CZ   6  
ATOM 6805  H H    . PHE A 1 54 ? -10.037 2.567   0.337   1.00 0.00 ? 54 PHE A H    6  
ATOM 6806  H HA   . PHE A 1 54 ? -8.389  4.909   0.183   1.00 0.00 ? 54 PHE A HA   6  
ATOM 6807  H HB2  . PHE A 1 54 ? -7.365  4.514   2.598   1.00 0.00 ? 54 PHE A HB2  6  
ATOM 6808  H HB3  . PHE A 1 54 ? -8.786  5.534   2.390   1.00 0.00 ? 54 PHE A HB3  6  
ATOM 6809  H HD1  . PHE A 1 54 ? -7.737  2.026   3.132   1.00 0.00 ? 54 PHE A HD1  6  
ATOM 6810  H HD2  . PHE A 1 54 ? -10.832 4.988   3.446   1.00 0.00 ? 54 PHE A HD2  6  
ATOM 6811  H HE1  . PHE A 1 54 ? -9.041  0.509   4.597   1.00 0.00 ? 54 PHE A HE1  6  
ATOM 6812  H HE2  . PHE A 1 54 ? -12.136 3.469   4.911   1.00 0.00 ? 54 PHE A HE2  6  
ATOM 6813  H HZ   . PHE A 1 54 ? -11.240 1.230   5.486   1.00 0.00 ? 54 PHE A HZ   6  
ATOM 6814  N N    . ASP A 1 55 ? -6.214  3.396   0.734   1.00 0.00 ? 55 ASP A N    6  
ATOM 6815  C CA   . ASP A 1 55 ? -5.060  2.481   0.485   1.00 0.00 ? 55 ASP A CA   6  
ATOM 6816  C C    . ASP A 1 55 ? -4.900  2.217   -1.015  1.00 0.00 ? 55 ASP A C    6  
ATOM 6817  O O    . ASP A 1 55 ? -5.845  1.904   -1.711  1.00 0.00 ? 55 ASP A O    6  
ATOM 6818  C CB   . ASP A 1 55 ? -5.264  1.152   1.225   1.00 0.00 ? 55 ASP A CB   6  
ATOM 6819  C CG   . ASP A 1 55 ? -3.911  0.455   1.404   1.00 0.00 ? 55 ASP A CG   6  
ATOM 6820  O OD1  . ASP A 1 55 ? -3.445  -0.144  0.448   1.00 0.00 ? 55 ASP A OD1  6  
ATOM 6821  O OD2  . ASP A 1 55 ? -3.367  0.533   2.492   1.00 0.00 ? 55 ASP A OD2  6  
ATOM 6822  H H    . ASP A 1 55 ? -6.041  4.303   1.060   1.00 0.00 ? 55 ASP A H    6  
ATOM 6823  H HA   . ASP A 1 55 ? -4.160  2.955   0.851   1.00 0.00 ? 55 ASP A HA   6  
ATOM 6824  H HB2  . ASP A 1 55 ? -5.702  1.344   2.194   1.00 0.00 ? 55 ASP A HB2  6  
ATOM 6825  H HB3  . ASP A 1 55 ? -5.921  0.514   0.653   1.00 0.00 ? 55 ASP A HB3  6  
ATOM 6826  N N    . TRP A 1 56 ? -3.695  2.334   -1.506  1.00 0.00 ? 56 TRP A N    6  
ATOM 6827  C CA   . TRP A 1 56 ? -3.431  2.086   -2.954  1.00 0.00 ? 56 TRP A CA   6  
ATOM 6828  C C    . TRP A 1 56 ? -1.984  1.596   -3.102  1.00 0.00 ? 56 TRP A C    6  
ATOM 6829  O O    . TRP A 1 56 ? -1.706  0.418   -2.998  1.00 0.00 ? 56 TRP A O    6  
ATOM 6830  C CB   . TRP A 1 56 ? -3.640  3.399   -3.747  1.00 0.00 ? 56 TRP A CB   6  
ATOM 6831  C CG   . TRP A 1 56 ? -5.003  3.417   -4.375  1.00 0.00 ? 56 TRP A CG   6  
ATOM 6832  C CD1  . TRP A 1 56 ? -6.064  4.118   -3.916  1.00 0.00 ? 56 TRP A CD1  6  
ATOM 6833  C CD2  . TRP A 1 56 ? -5.461  2.713   -5.565  1.00 0.00 ? 56 TRP A CD2  6  
ATOM 6834  N NE1  . TRP A 1 56 ? -7.145  3.888   -4.749  1.00 0.00 ? 56 TRP A NE1  6  
ATOM 6835  C CE2  . TRP A 1 56 ? -6.822  3.030   -5.781  1.00 0.00 ? 56 TRP A CE2  6  
ATOM 6836  C CE3  . TRP A 1 56 ? -4.832  1.839   -6.470  1.00 0.00 ? 56 TRP A CE3  6  
ATOM 6837  C CZ2  . TRP A 1 56 ? -7.534  2.499   -6.858  1.00 0.00 ? 56 TRP A CZ2  6  
ATOM 6838  C CZ3  . TRP A 1 56 ? -5.545  1.303   -7.555  1.00 0.00 ? 56 TRP A CZ3  6  
ATOM 6839  C CH2  . TRP A 1 56 ? -6.894  1.632   -7.748  1.00 0.00 ? 56 TRP A CH2  6  
ATOM 6840  H H    . TRP A 1 56 ? -2.954  2.581   -0.913  1.00 0.00 ? 56 TRP A H    6  
ATOM 6841  H HA   . TRP A 1 56 ? -4.101  1.318   -3.317  1.00 0.00 ? 56 TRP A HA   6  
ATOM 6842  H HB2  . TRP A 1 56 ? -3.550  4.239   -3.076  1.00 0.00 ? 56 TRP A HB2  6  
ATOM 6843  H HB3  . TRP A 1 56 ? -2.893  3.485   -4.525  1.00 0.00 ? 56 TRP A HB3  6  
ATOM 6844  H HD1  . TRP A 1 56 ? -6.068  4.751   -3.040  1.00 0.00 ? 56 TRP A HD1  6  
ATOM 6845  H HE1  . TRP A 1 56 ? -8.037  4.279   -4.638  1.00 0.00 ? 56 TRP A HE1  6  
ATOM 6846  H HE3  . TRP A 1 56 ? -3.793  1.580   -6.331  1.00 0.00 ? 56 TRP A HE3  6  
ATOM 6847  H HZ2  . TRP A 1 56 ? -8.573  2.756   -7.002  1.00 0.00 ? 56 TRP A HZ2  6  
ATOM 6848  H HZ3  . TRP A 1 56 ? -5.052  0.633   -8.243  1.00 0.00 ? 56 TRP A HZ3  6  
ATOM 6849  H HH2  . TRP A 1 56 ? -7.438  1.216   -8.583  1.00 0.00 ? 56 TRP A HH2  6  
ATOM 6850  N N    . HIS A 1 57 ? -1.060  2.492   -3.332  1.00 0.00 ? 57 HIS A N    6  
ATOM 6851  C CA   . HIS A 1 57 ? 0.365   2.078   -3.475  1.00 0.00 ? 57 HIS A CA   6  
ATOM 6852  C C    . HIS A 1 57 ? 0.463   0.854   -4.394  1.00 0.00 ? 57 HIS A C    6  
ATOM 6853  O O    . HIS A 1 57 ? 0.351   -0.271  -3.949  1.00 0.00 ? 57 HIS A O    6  
ATOM 6854  C CB   . HIS A 1 57 ? 0.936   1.730   -2.094  1.00 0.00 ? 57 HIS A CB   6  
ATOM 6855  C CG   . HIS A 1 57 ? 0.398   2.689   -1.065  1.00 0.00 ? 57 HIS A CG   6  
ATOM 6856  N ND1  . HIS A 1 57 ? 0.455   2.417   0.294   1.00 0.00 ? 57 HIS A ND1  6  
ATOM 6857  C CD2  . HIS A 1 57 ? -0.208  3.916   -1.176  1.00 0.00 ? 57 HIS A CD2  6  
ATOM 6858  C CE1  . HIS A 1 57 ? -0.102  3.458   0.939   1.00 0.00 ? 57 HIS A CE1  6  
ATOM 6859  N NE2  . HIS A 1 57 ? -0.524  4.399   0.092   1.00 0.00 ? 57 HIS A NE2  6  
ATOM 6860  H H    . HIS A 1 57 ? -1.303  3.440   -3.404  1.00 0.00 ? 57 HIS A H    6  
ATOM 6861  H HA   . HIS A 1 57 ? 0.933   2.892   -3.902  1.00 0.00 ? 57 HIS A HA   6  
ATOM 6862  H HB2  . HIS A 1 57 ? 0.650   0.722   -1.825  1.00 0.00 ? 57 HIS A HB2  6  
ATOM 6863  H HB3  . HIS A 1 57 ? 2.012   1.802   -2.122  1.00 0.00 ? 57 HIS A HB3  6  
ATOM 6864  H HD1  . HIS A 1 57 ? 0.831   1.613   0.708   1.00 0.00 ? 57 HIS A HD1  6  
ATOM 6865  H HD2  . HIS A 1 57 ? -0.408  4.432   -2.103  1.00 0.00 ? 57 HIS A HD2  6  
ATOM 6866  H HE1  . HIS A 1 57 ? -0.198  3.523   2.013   1.00 0.00 ? 57 HIS A HE1  6  
ATOM 6867  N N    . HIS A 1 58 ? 0.677   1.068   -5.670  1.00 0.00 ? 58 HIS A N    6  
ATOM 6868  C CA   . HIS A 1 58 ? 0.792   -0.077  -6.635  1.00 0.00 ? 58 HIS A CA   6  
ATOM 6869  C C    . HIS A 1 58 ? 2.151   -0.008  -7.336  1.00 0.00 ? 58 HIS A C    6  
ATOM 6870  O O    . HIS A 1 58 ? 2.734   1.048   -7.468  1.00 0.00 ? 58 HIS A O    6  
ATOM 6871  C CB   . HIS A 1 58 ? -0.341  0.005   -7.673  1.00 0.00 ? 58 HIS A CB   6  
ATOM 6872  C CG   . HIS A 1 58 ? -0.088  1.126   -8.648  1.00 0.00 ? 58 HIS A CG   6  
ATOM 6873  N ND1  . HIS A 1 58 ? -0.543  1.078   -9.956  1.00 0.00 ? 58 HIS A ND1  6  
ATOM 6874  C CD2  . HIS A 1 58 ? 0.570   2.326   -8.524  1.00 0.00 ? 58 HIS A CD2  6  
ATOM 6875  C CE1  . HIS A 1 58 ? -0.154  2.214   -10.563 1.00 0.00 ? 58 HIS A CE1  6  
ATOM 6876  N NE2  . HIS A 1 58 ? 0.528   3.010   -9.734  1.00 0.00 ? 58 HIS A NE2  6  
ATOM 6877  H H    . HIS A 1 58 ? 0.767   1.987   -5.996  1.00 0.00 ? 58 HIS A H    6  
ATOM 6878  H HA   . HIS A 1 58 ? 0.720   -1.018  -6.106  1.00 0.00 ? 58 HIS A HA   6  
ATOM 6879  H HB2  . HIS A 1 58 ? -0.395  -0.929  -8.213  1.00 0.00 ? 58 HIS A HB2  6  
ATOM 6880  H HB3  . HIS A 1 58 ? -1.279  0.176   -7.165  1.00 0.00 ? 58 HIS A HB3  6  
ATOM 6881  H HD1  . HIS A 1 58 ? -1.053  0.350   -10.365 1.00 0.00 ? 58 HIS A HD1  6  
ATOM 6882  H HD2  . HIS A 1 58 ? 1.048   2.684   -7.625  1.00 0.00 ? 58 HIS A HD2  6  
ATOM 6883  H HE1  . HIS A 1 58 ? -0.366  2.454   -11.594 1.00 0.00 ? 58 HIS A HE1  6  
ATOM 6884  N N    . THR A 1 59 ? 2.657   -1.129  -7.780  1.00 0.00 ? 59 THR A N    6  
ATOM 6885  C CA   . THR A 1 59 ? 3.980   -1.139  -8.470  1.00 0.00 ? 59 THR A CA   6  
ATOM 6886  C C    . THR A 1 59 ? 5.061   -0.621  -7.516  1.00 0.00 ? 59 THR A C    6  
ATOM 6887  O O    . THR A 1 59 ? 4.927   0.425   -6.912  1.00 0.00 ? 59 THR A O    6  
ATOM 6888  C CB   . THR A 1 59 ? 3.919   -0.250  -9.716  1.00 0.00 ? 59 THR A CB   6  
ATOM 6889  O OG1  . THR A 1 59 ? 2.706   -0.498  -10.412 1.00 0.00 ? 59 THR A OG1  6  
ATOM 6890  C CG2  . THR A 1 59 ? 5.106   -0.562  -10.629 1.00 0.00 ? 59 THR A CG2  6  
ATOM 6891  H H    . THR A 1 59 ? 2.165   -1.968  -7.657  1.00 0.00 ? 59 THR A H    6  
ATOM 6892  H HA   . THR A 1 59 ? 4.219   -2.151  -8.763  1.00 0.00 ? 59 THR A HA   6  
ATOM 6893  H HB   . THR A 1 59 ? 3.960   0.785   -9.424  1.00 0.00 ? 59 THR A HB   6  
ATOM 6894  H HG1  . THR A 1 59 ? 2.657   -1.438  -10.598 1.00 0.00 ? 59 THR A HG1  6  
ATOM 6895  H HG21 . THR A 1 59 ? 5.029   0.027   -11.532 1.00 0.00 ? 59 THR A HG21 6  
ATOM 6896  H HG22 . THR A 1 59 ? 5.099   -1.612  -10.883 1.00 0.00 ? 59 THR A HG22 6  
ATOM 6897  H HG23 . THR A 1 59 ? 6.027   -0.321  -10.119 1.00 0.00 ? 59 THR A HG23 6  
ATOM 6898  N N    . PHE A 1 60 ? 6.118   -1.366  -7.349  1.00 0.00 ? 60 PHE A N    6  
ATOM 6899  C CA   . PHE A 1 60 ? 7.195   -0.945  -6.403  1.00 0.00 ? 60 PHE A CA   6  
ATOM 6900  C C    . PHE A 1 60 ? 7.828   0.381   -6.889  1.00 0.00 ? 60 PHE A C    6  
ATOM 6901  O O    . PHE A 1 60 ? 7.760   0.689   -8.063  1.00 0.00 ? 60 PHE A O    6  
ATOM 6902  C CB   . PHE A 1 60 ? 8.272   -2.057  -6.338  1.00 0.00 ? 60 PHE A CB   6  
ATOM 6903  C CG   . PHE A 1 60 ? 8.231   -2.888  -7.604  1.00 0.00 ? 60 PHE A CG   6  
ATOM 6904  C CD1  . PHE A 1 60 ? 8.606   -2.317  -8.826  1.00 0.00 ? 60 PHE A CD1  6  
ATOM 6905  C CD2  . PHE A 1 60 ? 7.818   -4.227  -7.557  1.00 0.00 ? 60 PHE A CD2  6  
ATOM 6906  C CE1  . PHE A 1 60 ? 8.570   -3.081  -9.998  1.00 0.00 ? 60 PHE A CE1  6  
ATOM 6907  C CE2  . PHE A 1 60 ? 7.781   -4.991  -8.730  1.00 0.00 ? 60 PHE A CE2  6  
ATOM 6908  C CZ   . PHE A 1 60 ? 8.157   -4.418  -9.950  1.00 0.00 ? 60 PHE A CZ   6  
ATOM 6909  H H    . PHE A 1 60 ? 6.186   -2.228  -7.809  1.00 0.00 ? 60 PHE A H    6  
ATOM 6910  H HA   . PHE A 1 60 ? 6.756   -0.811  -5.429  1.00 0.00 ? 60 PHE A HA   6  
ATOM 6911  H HB2  . PHE A 1 60 ? 9.253   -1.615  -6.240  1.00 0.00 ? 60 PHE A HB2  6  
ATOM 6912  H HB3  . PHE A 1 60 ? 8.083   -2.694  -5.485  1.00 0.00 ? 60 PHE A HB3  6  
ATOM 6913  H HD1  . PHE A 1 60 ? 8.922   -1.285  -8.863  1.00 0.00 ? 60 PHE A HD1  6  
ATOM 6914  H HD2  . PHE A 1 60 ? 7.527   -4.671  -6.616  1.00 0.00 ? 60 PHE A HD2  6  
ATOM 6915  H HE1  . PHE A 1 60 ? 8.859   -2.639  -10.940 1.00 0.00 ? 60 PHE A HE1  6  
ATOM 6916  H HE2  . PHE A 1 60 ? 7.463   -6.023  -8.693  1.00 0.00 ? 60 PHE A HE2  6  
ATOM 6917  H HZ   . PHE A 1 60 ? 8.129   -5.007  -10.855 1.00 0.00 ? 60 PHE A HZ   6  
ATOM 6918  N N    . PRO A 1 61 ? 8.420   1.137   -5.973  1.00 0.00 ? 61 PRO A N    6  
ATOM 6919  C CA   . PRO A 1 61 ? 9.050   2.429   -6.322  1.00 0.00 ? 61 PRO A CA   6  
ATOM 6920  C C    . PRO A 1 61 ? 10.084  2.241   -7.441  1.00 0.00 ? 61 PRO A C    6  
ATOM 6921  O O    . PRO A 1 61 ? 10.204  3.073   -8.320  1.00 0.00 ? 61 PRO A O    6  
ATOM 6922  C CB   . PRO A 1 61 ? 9.719   2.915   -5.012  1.00 0.00 ? 61 PRO A CB   6  
ATOM 6923  C CG   . PRO A 1 61 ? 9.462   1.832   -3.926  1.00 0.00 ? 61 PRO A CG   6  
ATOM 6924  C CD   . PRO A 1 61 ? 8.519   0.775   -4.539  1.00 0.00 ? 61 PRO A CD   6  
ATOM 6925  H HA   . PRO A 1 61 ? 8.294   3.133   -6.633  1.00 0.00 ? 61 PRO A HA   6  
ATOM 6926  H HB2  . PRO A 1 61 ? 10.786  3.049   -5.158  1.00 0.00 ? 61 PRO A HB2  6  
ATOM 6927  H HB3  . PRO A 1 61 ? 9.278   3.853   -4.698  1.00 0.00 ? 61 PRO A HB3  6  
ATOM 6928  H HG2  . PRO A 1 61 ? 10.400  1.370   -3.638  1.00 0.00 ? 61 PRO A HG2  6  
ATOM 6929  H HG3  . PRO A 1 61 ? 8.996   2.278   -3.057  1.00 0.00 ? 61 PRO A HG3  6  
ATOM 6930  H HD2  . PRO A 1 61 ? 8.933   -0.218  -4.423  1.00 0.00 ? 61 PRO A HD2  6  
ATOM 6931  H HD3  . PRO A 1 61 ? 7.544   0.833   -4.076  1.00 0.00 ? 61 PRO A HD3  6  
ATOM 6932  N N    . SER A 1 62 ? 10.834  1.166   -7.410  1.00 0.00 ? 62 SER A N    6  
ATOM 6933  C CA   . SER A 1 62 ? 11.866  0.930   -8.467  1.00 0.00 ? 62 SER A CA   6  
ATOM 6934  C C    . SER A 1 62 ? 11.306  1.312   -9.842  1.00 0.00 ? 62 SER A C    6  
ATOM 6935  O O    . SER A 1 62 ? 12.016  1.795   -10.701 1.00 0.00 ? 62 SER A O    6  
ATOM 6936  C CB   . SER A 1 62 ? 12.263  -0.547  -8.471  1.00 0.00 ? 62 SER A CB   6  
ATOM 6937  O OG   . SER A 1 62 ? 11.254  -1.304  -9.124  1.00 0.00 ? 62 SER A OG   6  
ATOM 6938  H H    . SER A 1 62 ? 10.724  0.516   -6.683  1.00 0.00 ? 62 SER A H    6  
ATOM 6939  H HA   . SER A 1 62 ? 12.737  1.533   -8.257  1.00 0.00 ? 62 SER A HA   6  
ATOM 6940  H HB2  . SER A 1 62 ? 13.194  -0.671  -8.996  1.00 0.00 ? 62 SER A HB2  6  
ATOM 6941  H HB3  . SER A 1 62 ? 12.381  -0.889  -7.450  1.00 0.00 ? 62 SER A HB3  6  
ATOM 6942  H HG   . SER A 1 62 ? 11.626  -2.158  -9.355  1.00 0.00 ? 62 SER A HG   6  
ATOM 6943  N N    . ARG A 1 63 ? 10.032  1.105   -10.051 1.00 0.00 ? 63 ARG A N    6  
ATOM 6944  C CA   . ARG A 1 63 ? 9.415   1.461   -11.366 1.00 0.00 ? 63 ARG A CA   6  
ATOM 6945  C C    . ARG A 1 63 ? 7.962   1.903   -11.128 1.00 0.00 ? 63 ARG A C    6  
ATOM 6946  O O    . ARG A 1 63 ? 7.098   1.706   -11.958 1.00 0.00 ? 63 ARG A O    6  
ATOM 6947  C CB   . ARG A 1 63 ? 9.468   0.223   -12.300 1.00 0.00 ? 63 ARG A CB   6  
ATOM 6948  C CG   . ARG A 1 63 ? 10.172  0.575   -13.624 1.00 0.00 ? 63 ARG A CG   6  
ATOM 6949  C CD   . ARG A 1 63 ? 9.390   1.674   -14.375 1.00 0.00 ? 63 ARG A CD   6  
ATOM 6950  N NE   . ARG A 1 63 ? 9.319   1.341   -15.835 1.00 0.00 ? 63 ARG A NE   6  
ATOM 6951  C CZ   . ARG A 1 63 ? 10.384  0.970   -16.499 1.00 0.00 ? 63 ARG A CZ   6  
ATOM 6952  N NH1  . ARG A 1 63 ? 11.560  1.002   -15.935 1.00 0.00 ? 63 ARG A NH1  6  
ATOM 6953  N NH2  . ARG A 1 63 ? 10.273  0.603   -17.746 1.00 0.00 ? 63 ARG A NH2  6  
ATOM 6954  H H    . ARG A 1 63 ? 9.480   0.712   -9.343  1.00 0.00 ? 63 ARG A H    6  
ATOM 6955  H HA   . ARG A 1 63 ? 9.963   2.285   -11.808 1.00 0.00 ? 63 ARG A HA   6  
ATOM 6956  H HB2  . ARG A 1 63 ? 10.019  -0.564  -11.808 1.00 0.00 ? 63 ARG A HB2  6  
ATOM 6957  H HB3  . ARG A 1 63 ? 8.467   -0.128  -12.515 1.00 0.00 ? 63 ARG A HB3  6  
ATOM 6958  H HG2  . ARG A 1 63 ? 11.172  0.921   -13.405 1.00 0.00 ? 63 ARG A HG2  6  
ATOM 6959  H HG3  . ARG A 1 63 ? 10.229  -0.310  -14.241 1.00 0.00 ? 63 ARG A HG3  6  
ATOM 6960  H HD2  . ARG A 1 63 ? 8.380   1.731   -14.002 1.00 0.00 ? 63 ARG A HD2  6  
ATOM 6961  H HD3  . ARG A 1 63 ? 9.875   2.635   -14.224 1.00 0.00 ? 63 ARG A HD3  6  
ATOM 6962  H HE   . ARG A 1 63 ? 8.453   1.369   -16.292 1.00 0.00 ? 63 ARG A HE   6  
ATOM 6963  H HH11 . ARG A 1 63 ? 11.655  1.313   -14.994 1.00 0.00 ? 63 ARG A HH11 6  
ATOM 6964  H HH12 . ARG A 1 63 ? 12.367  0.713   -16.450 1.00 0.00 ? 63 ARG A HH12 6  
ATOM 6965  H HH21 . ARG A 1 63 ? 9.378   0.606   -18.191 1.00 0.00 ? 63 ARG A HH21 6  
ATOM 6966  H HH22 . ARG A 1 63 ? 11.085  0.320   -18.257 1.00 0.00 ? 63 ARG A HH22 6  
ATOM 6967  N N    . GLY A 1 64 ? 7.693   2.500   -9.996  1.00 0.00 ? 64 GLY A N    6  
ATOM 6968  C CA   . GLY A 1 64 ? 6.302   2.955   -9.696  1.00 0.00 ? 64 GLY A CA   6  
ATOM 6969  C C    . GLY A 1 64 ? 6.086   4.363   -10.254 1.00 0.00 ? 64 GLY A C    6  
ATOM 6970  O O    . GLY A 1 64 ? 6.889   4.871   -11.012 1.00 0.00 ? 64 GLY A O    6  
ATOM 6971  H H    . GLY A 1 64 ? 8.407   2.647   -9.341  1.00 0.00 ? 64 GLY A H    6  
ATOM 6972  H HA2  . GLY A 1 64 ? 5.594   2.276   -10.149 1.00 0.00 ? 64 GLY A HA2  6  
ATOM 6973  H HA3  . GLY A 1 64 ? 6.153   2.971   -8.627  1.00 0.00 ? 64 GLY A HA3  6  
ATOM 6974  N N    . ASN A 1 65 ? 5.004   4.996   -9.887  1.00 0.00 ? 65 ASN A N    6  
ATOM 6975  C CA   . ASN A 1 65 ? 4.737   6.370   -10.401 1.00 0.00 ? 65 ASN A CA   6  
ATOM 6976  C C    . ASN A 1 65 ? 3.605   7.016   -9.595  1.00 0.00 ? 65 ASN A C    6  
ATOM 6977  O O    . ASN A 1 65 ? 3.672   8.175   -9.237  1.00 0.00 ? 65 ASN A O    6  
ATOM 6978  C CB   . ASN A 1 65 ? 4.331   6.292   -11.874 1.00 0.00 ? 65 ASN A CB   6  
ATOM 6979  C CG   . ASN A 1 65 ? 3.149   5.333   -12.027 1.00 0.00 ? 65 ASN A CG   6  
ATOM 6980  O OD1  . ASN A 1 65 ? 2.041   5.649   -11.641 1.00 0.00 ? 65 ASN A OD1  6  
ATOM 6981  N ND2  . ASN A 1 65 ? 3.339   4.165   -12.578 1.00 0.00 ? 65 ASN A ND2  6  
ATOM 6982  H H    . ASN A 1 65 ? 4.367   4.569   -9.277  1.00 0.00 ? 65 ASN A H    6  
ATOM 6983  H HA   . ASN A 1 65 ? 5.631   6.969   -10.307 1.00 0.00 ? 65 ASN A HA   6  
ATOM 6984  H HB2  . ASN A 1 65 ? 4.046   7.275   -12.222 1.00 0.00 ? 65 ASN A HB2  6  
ATOM 6985  H HB3  . ASN A 1 65 ? 5.163   5.930   -12.459 1.00 0.00 ? 65 ASN A HB3  6  
ATOM 6986  H HD21 . ASN A 1 65 ? 4.233   3.910   -12.889 1.00 0.00 ? 65 ASN A HD21 6  
ATOM 6987  H HD22 . ASN A 1 65 ? 2.589   3.544   -12.680 1.00 0.00 ? 65 ASN A HD22 6  
ATOM 6988  N N    . LEU A 1 66 ? 2.564   6.281   -9.311  1.00 0.00 ? 66 LEU A N    6  
ATOM 6989  C CA   . LEU A 1 66 ? 1.433   6.866   -8.534  1.00 0.00 ? 66 LEU A CA   6  
ATOM 6990  C C    . LEU A 1 66 ? 1.976   7.527   -7.267  1.00 0.00 ? 66 LEU A C    6  
ATOM 6991  O O    . LEU A 1 66 ? 1.498   8.561   -6.849  1.00 0.00 ? 66 LEU A O    6  
ATOM 6992  C CB   . LEU A 1 66 ? 0.442   5.758   -8.153  1.00 0.00 ? 66 LEU A CB   6  
ATOM 6993  C CG   . LEU A 1 66 ? -0.757  6.348   -7.391  1.00 0.00 ? 66 LEU A CG   6  
ATOM 6994  C CD1  . LEU A 1 66 ? -1.514  7.354   -8.278  1.00 0.00 ? 66 LEU A CD1  6  
ATOM 6995  C CD2  . LEU A 1 66 ? -1.697  5.205   -6.987  1.00 0.00 ? 66 LEU A CD2  6  
ATOM 6996  H H    . LEU A 1 66 ? 2.523   5.349   -9.611  1.00 0.00 ? 66 LEU A H    6  
ATOM 6997  H HA   . LEU A 1 66 ? 0.932   7.606   -9.140  1.00 0.00 ? 66 LEU A HA   6  
ATOM 6998  H HB2  . LEU A 1 66 ? 0.088   5.271   -9.050  1.00 0.00 ? 66 LEU A HB2  6  
ATOM 6999  H HB3  . LEU A 1 66 ? 0.938   5.033   -7.525  1.00 0.00 ? 66 LEU A HB3  6  
ATOM 7000  H HG   . LEU A 1 66 ? -0.405  6.851   -6.503  1.00 0.00 ? 66 LEU A HG   6  
ATOM 7001  H HD11 . LEU A 1 66 ? -1.480  7.031   -9.310  1.00 0.00 ? 66 LEU A HD11 6  
ATOM 7002  H HD12 . LEU A 1 66 ? -1.053  8.327   -8.192  1.00 0.00 ? 66 LEU A HD12 6  
ATOM 7003  H HD13 . LEU A 1 66 ? -2.544  7.421   -7.957  1.00 0.00 ? 66 LEU A HD13 6  
ATOM 7004  H HD21 . LEU A 1 66 ? -2.568  5.613   -6.497  1.00 0.00 ? 66 LEU A HD21 6  
ATOM 7005  H HD22 . LEU A 1 66 ? -1.183  4.537   -6.312  1.00 0.00 ? 66 LEU A HD22 6  
ATOM 7006  H HD23 . LEU A 1 66 ? -2.001  4.661   -7.869  1.00 0.00 ? 66 LEU A HD23 6  
ATOM 7007  N N    . ASP A 1 67 ? 2.957   6.922   -6.647  1.00 0.00 ? 67 ASP A N    6  
ATOM 7008  C CA   . ASP A 1 67 ? 3.540   7.485   -5.390  1.00 0.00 ? 67 ASP A CA   6  
ATOM 7009  C C    . ASP A 1 67 ? 2.637   7.098   -4.214  1.00 0.00 ? 67 ASP A C    6  
ATOM 7010  O O    . ASP A 1 67 ? 1.444   7.333   -4.230  1.00 0.00 ? 67 ASP A O    6  
ATOM 7011  C CB   . ASP A 1 67 ? 3.662   9.021   -5.489  1.00 0.00 ? 67 ASP A CB   6  
ATOM 7012  C CG   . ASP A 1 67 ? 4.838   9.512   -4.636  1.00 0.00 ? 67 ASP A CG   6  
ATOM 7013  O OD1  . ASP A 1 67 ? 5.022   8.981   -3.553  1.00 0.00 ? 67 ASP A OD1  6  
ATOM 7014  O OD2  . ASP A 1 67 ? 5.534   10.410  -5.080  1.00 0.00 ? 67 ASP A OD2  6  
ATOM 7015  H H    . ASP A 1 67 ? 3.304   6.076   -7.002  1.00 0.00 ? 67 ASP A H    6  
ATOM 7016  H HA   . ASP A 1 67 ? 4.520   7.050   -5.237  1.00 0.00 ? 67 ASP A HA   6  
ATOM 7017  H HB2  . ASP A 1 67 ? 3.830   9.299   -6.519  1.00 0.00 ? 67 ASP A HB2  6  
ATOM 7018  H HB3  . ASP A 1 67 ? 2.753   9.487   -5.137  1.00 0.00 ? 67 ASP A HB3  6  
ATOM 7019  N N    . ASP A 1 68 ? 3.194   6.491   -3.203  1.00 0.00 ? 68 ASP A N    6  
ATOM 7020  C CA   . ASP A 1 68 ? 2.370   6.071   -2.034  1.00 0.00 ? 68 ASP A CA   6  
ATOM 7021  C C    . ASP A 1 68 ? 1.434   7.203   -1.609  1.00 0.00 ? 68 ASP A C    6  
ATOM 7022  O O    . ASP A 1 68 ? 1.704   8.368   -1.829  1.00 0.00 ? 68 ASP A O    6  
ATOM 7023  C CB   . ASP A 1 68 ? 3.285   5.712   -0.864  1.00 0.00 ? 68 ASP A CB   6  
ATOM 7024  C CG   . ASP A 1 68 ? 4.219   4.571   -1.271  1.00 0.00 ? 68 ASP A CG   6  
ATOM 7025  O OD1  . ASP A 1 68 ? 4.694   4.594   -2.394  1.00 0.00 ? 68 ASP A OD1  6  
ATOM 7026  O OD2  . ASP A 1 68 ? 4.444   3.695   -0.453  1.00 0.00 ? 68 ASP A OD2  6  
ATOM 7027  H H    . ASP A 1 68 ? 4.155   6.301   -3.216  1.00 0.00 ? 68 ASP A H    6  
ATOM 7028  H HA   . ASP A 1 68 ? 1.785   5.206   -2.304  1.00 0.00 ? 68 ASP A HA   6  
ATOM 7029  H HB2  . ASP A 1 68 ? 3.870   6.577   -0.587  1.00 0.00 ? 68 ASP A HB2  6  
ATOM 7030  H HB3  . ASP A 1 68 ? 2.683   5.401   -0.023  1.00 0.00 ? 68 ASP A HB3  6  
ATOM 7031  N N    . PHE A 1 69 ? 0.337   6.863   -0.993  1.00 0.00 ? 69 PHE A N    6  
ATOM 7032  C CA   . PHE A 1 69 ? -0.629  7.904   -0.535  1.00 0.00 ? 69 PHE A CA   6  
ATOM 7033  C C    . PHE A 1 69 ? -1.464  7.329   0.616   1.00 0.00 ? 69 PHE A C    6  
ATOM 7034  O O    . PHE A 1 69 ? -2.562  6.847   0.419   1.00 0.00 ? 69 PHE A O    6  
ATOM 7035  C CB   . PHE A 1 69 ? -1.549  8.303   -1.705  1.00 0.00 ? 69 PHE A CB   6  
ATOM 7036  C CG   . PHE A 1 69 ? -0.922  9.433   -2.499  1.00 0.00 ? 69 PHE A CG   6  
ATOM 7037  C CD1  . PHE A 1 69 ? -0.704  10.674  -1.888  1.00 0.00 ? 69 PHE A CD1  6  
ATOM 7038  C CD2  . PHE A 1 69 ? -0.562  9.240   -3.840  1.00 0.00 ? 69 PHE A CD2  6  
ATOM 7039  C CE1  . PHE A 1 69 ? -0.128  11.721  -2.617  1.00 0.00 ? 69 PHE A CE1  6  
ATOM 7040  C CE2  . PHE A 1 69 ? 0.015   10.289  -4.566  1.00 0.00 ? 69 PHE A CE2  6  
ATOM 7041  C CZ   . PHE A 1 69 ? 0.233   11.529  -3.955  1.00 0.00 ? 69 PHE A CZ   6  
ATOM 7042  H H    . PHE A 1 69 ? 0.149   5.915   -0.825  1.00 0.00 ? 69 PHE A H    6  
ATOM 7043  H HA   . PHE A 1 69 ? -0.085  8.768   -0.180  1.00 0.00 ? 69 PHE A HA   6  
ATOM 7044  H HB2  . PHE A 1 69 ? -1.698  7.449   -2.349  1.00 0.00 ? 69 PHE A HB2  6  
ATOM 7045  H HB3  . PHE A 1 69 ? -2.507  8.630   -1.322  1.00 0.00 ? 69 PHE A HB3  6  
ATOM 7046  H HD1  . PHE A 1 69 ? -0.982  10.824  -0.856  1.00 0.00 ? 69 PHE A HD1  6  
ATOM 7047  H HD2  . PHE A 1 69 ? -0.729  8.283   -4.313  1.00 0.00 ? 69 PHE A HD2  6  
ATOM 7048  H HE1  . PHE A 1 69 ? 0.040   12.678  -2.145  1.00 0.00 ? 69 PHE A HE1  6  
ATOM 7049  H HE2  . PHE A 1 69 ? 0.292   10.141  -5.600  1.00 0.00 ? 69 PHE A HE2  6  
ATOM 7050  H HZ   . PHE A 1 69 ? 0.676   12.337  -4.516  1.00 0.00 ? 69 PHE A HZ   6  
ATOM 7051  N N    . PHE A 1 70 ? -0.948  7.373   1.813   1.00 0.00 ? 70 PHE A N    6  
ATOM 7052  C CA   . PHE A 1 70 ? -1.707  6.827   2.974   1.00 0.00 ? 70 PHE A CA   6  
ATOM 7053  C C    . PHE A 1 70 ? -3.109  7.438   3.002   1.00 0.00 ? 70 PHE A C    6  
ATOM 7054  O O    . PHE A 1 70 ? -3.284  8.622   2.799   1.00 0.00 ? 70 PHE A O    6  
ATOM 7055  C CB   . PHE A 1 70 ? -0.974  7.174   4.269   1.00 0.00 ? 70 PHE A CB   6  
ATOM 7056  C CG   . PHE A 1 70 ? 0.450   6.675   4.191   1.00 0.00 ? 70 PHE A CG   6  
ATOM 7057  C CD1  . PHE A 1 70 ? 0.757   5.372   4.600   1.00 0.00 ? 70 PHE A CD1  6  
ATOM 7058  C CD2  . PHE A 1 70 ? 1.460   7.515   3.710   1.00 0.00 ? 70 PHE A CD2  6  
ATOM 7059  C CE1  . PHE A 1 70 ? 2.077   4.909   4.526   1.00 0.00 ? 70 PHE A CE1  6  
ATOM 7060  C CE2  . PHE A 1 70 ? 2.779   7.052   3.637   1.00 0.00 ? 70 PHE A CE2  6  
ATOM 7061  C CZ   . PHE A 1 70 ? 3.088   5.750   4.045   1.00 0.00 ? 70 PHE A CZ   6  
ATOM 7062  H H    . PHE A 1 70 ? -0.060  7.764   1.950   1.00 0.00 ? 70 PHE A H    6  
ATOM 7063  H HA   . PHE A 1 70 ? -1.784  5.755   2.880   1.00 0.00 ? 70 PHE A HA   6  
ATOM 7064  H HB2  . PHE A 1 70 ? -0.973  8.246   4.407   1.00 0.00 ? 70 PHE A HB2  6  
ATOM 7065  H HB3  . PHE A 1 70 ? -1.474  6.705   5.104   1.00 0.00 ? 70 PHE A HB3  6  
ATOM 7066  H HD1  . PHE A 1 70 ? -0.023  4.724   4.972   1.00 0.00 ? 70 PHE A HD1  6  
ATOM 7067  H HD2  . PHE A 1 70 ? 1.223   8.521   3.395   1.00 0.00 ? 70 PHE A HD2  6  
ATOM 7068  H HE1  . PHE A 1 70 ? 2.314   3.904   4.841   1.00 0.00 ? 70 PHE A HE1  6  
ATOM 7069  H HE2  . PHE A 1 70 ? 3.559   7.700   3.265   1.00 0.00 ? 70 PHE A HE2  6  
ATOM 7070  H HZ   . PHE A 1 70 ? 4.105   5.392   3.988   1.00 0.00 ? 70 PHE A HZ   6  
ATOM 7071  N N    . HIS A 1 71 ? -4.109  6.636   3.254   1.00 0.00 ? 71 HIS A N    6  
ATOM 7072  C CA   . HIS A 1 71 ? -5.503  7.164   3.295   1.00 0.00 ? 71 HIS A CA   6  
ATOM 7073  C C    . HIS A 1 71 ? -5.848  7.789   1.941   1.00 0.00 ? 71 HIS A C    6  
ATOM 7074  O O    . HIS A 1 71 ? -4.977  8.204   1.206   1.00 0.00 ? 71 HIS A O    6  
ATOM 7075  C CB   . HIS A 1 71 ? -5.619  8.223   4.397   1.00 0.00 ? 71 HIS A CB   6  
ATOM 7076  C CG   . HIS A 1 71 ? -4.887  7.753   5.624   1.00 0.00 ? 71 HIS A CG   6  
ATOM 7077  N ND1  . HIS A 1 71 ? -4.001  8.566   6.311   1.00 0.00 ? 71 HIS A ND1  6  
ATOM 7078  C CD2  . HIS A 1 71 ? -4.899  6.557   6.299   1.00 0.00 ? 71 HIS A CD2  6  
ATOM 7079  C CE1  . HIS A 1 71 ? -3.519  7.856   7.348   1.00 0.00 ? 71 HIS A CE1  6  
ATOM 7080  N NE2  . HIS A 1 71 ? -4.035  6.624   7.387   1.00 0.00 ? 71 HIS A NE2  6  
ATOM 7081  H H    . HIS A 1 71 ? -3.942  5.682   3.413   1.00 0.00 ? 71 HIS A H    6  
ATOM 7082  H HA   . HIS A 1 71 ? -6.185  6.353   3.503   1.00 0.00 ? 71 HIS A HA   6  
ATOM 7083  H HB2  . HIS A 1 71 ? -5.188  9.152   4.055   1.00 0.00 ? 71 HIS A HB2  6  
ATOM 7084  H HB3  . HIS A 1 71 ? -6.661  8.377   4.638   1.00 0.00 ? 71 HIS A HB3  6  
ATOM 7085  H HD1  . HIS A 1 71 ? -3.766  9.490   6.083   1.00 0.00 ? 71 HIS A HD1  6  
ATOM 7086  H HD2  . HIS A 1 71 ? -5.489  5.695   6.025   1.00 0.00 ? 71 HIS A HD2  6  
ATOM 7087  H HE1  . HIS A 1 71 ? -2.805  8.236   8.062   1.00 0.00 ? 71 HIS A HE1  6  
ATOM 7088  N N    . ARG A 1 72 ? -7.112  7.865   1.612   1.00 0.00 ? 72 ARG A N    6  
ATOM 7089  C CA   . ARG A 1 72 ? -7.534  8.470   0.309   1.00 0.00 ? 72 ARG A CA   6  
ATOM 7090  C C    . ARG A 1 72 ? -9.025  8.160   0.097   1.00 0.00 ? 72 ARG A C    6  
ATOM 7091  O O    . ARG A 1 72 ? -9.423  7.018   -0.008  1.00 0.00 ? 72 ARG A O    6  
ATOM 7092  C CB   . ARG A 1 72 ? -6.688  7.886   -0.861  1.00 0.00 ? 72 ARG A CB   6  
ATOM 7093  C CG   . ARG A 1 72 ? -5.758  8.961   -1.455  1.00 0.00 ? 72 ARG A CG   6  
ATOM 7094  C CD   . ARG A 1 72 ? -6.557  9.885   -2.377  1.00 0.00 ? 72 ARG A CD   6  
ATOM 7095  N NE   . ARG A 1 72 ? -6.861  9.173   -3.650  1.00 0.00 ? 72 ARG A NE   6  
ATOM 7096  C CZ   . ARG A 1 72 ? -7.775  9.639   -4.457  1.00 0.00 ? 72 ARG A CZ   6  
ATOM 7097  N NH1  . ARG A 1 72 ? -8.424  10.728  -4.149  1.00 0.00 ? 72 ARG A NH1  6  
ATOM 7098  N NH2  . ARG A 1 72 ? -8.041  9.014   -5.572  1.00 0.00 ? 72 ARG A NH2  6  
ATOM 7099  H H    . ARG A 1 72 ? -7.798  7.534   2.230   1.00 0.00 ? 72 ARG A H    6  
ATOM 7100  H HA   . ARG A 1 72 ? -7.407  9.543   0.364   1.00 0.00 ? 72 ARG A HA   6  
ATOM 7101  H HB2  . ARG A 1 72 ? -6.094  7.062   -0.502  1.00 0.00 ? 72 ARG A HB2  6  
ATOM 7102  H HB3  . ARG A 1 72 ? -7.342  7.525   -1.641  1.00 0.00 ? 72 ARG A HB3  6  
ATOM 7103  H HG2  . ARG A 1 72 ? -5.319  9.544   -0.659  1.00 0.00 ? 72 ARG A HG2  6  
ATOM 7104  H HG3  . ARG A 1 72 ? -4.974  8.482   -2.022  1.00 0.00 ? 72 ARG A HG3  6  
ATOM 7105  H HD2  . ARG A 1 72 ? -7.481  10.167  -1.893  1.00 0.00 ? 72 ARG A HD2  6  
ATOM 7106  H HD3  . ARG A 1 72 ? -5.978  10.770  -2.590  1.00 0.00 ? 72 ARG A HD3  6  
ATOM 7107  H HE   . ARG A 1 72 ? -6.376  8.354   -3.882  1.00 0.00 ? 72 ARG A HE   6  
ATOM 7108  H HH11 . ARG A 1 72 ? -8.220  11.207  -3.295  1.00 0.00 ? 72 ARG A HH11 6  
ATOM 7109  H HH12 . ARG A 1 72 ? -9.124  11.085  -4.767  1.00 0.00 ? 72 ARG A HH12 6  
ATOM 7110  H HH21 . ARG A 1 72 ? -7.546  8.179   -5.808  1.00 0.00 ? 72 ARG A HH21 6  
ATOM 7111  H HH22 . ARG A 1 72 ? -8.742  9.372   -6.190  1.00 0.00 ? 72 ARG A HH22 6  
ATOM 7112  N N    . ASP A 1 73 ? -9.846  9.170   0.040   1.00 0.00 ? 73 ASP A N    6  
ATOM 7113  C CA   . ASP A 1 73 ? -11.308 8.948   -0.155  1.00 0.00 ? 73 ASP A CA   6  
ATOM 7114  C C    . ASP A 1 73 ? -11.922 10.215  -0.759  1.00 0.00 ? 73 ASP A C    6  
ATOM 7115  O O    . ASP A 1 73 ? -11.856 11.280  -0.178  1.00 0.00 ? 73 ASP A O    6  
ATOM 7116  C CB   . ASP A 1 73 ? -11.957 8.668   1.202   1.00 0.00 ? 73 ASP A CB   6  
ATOM 7117  C CG   . ASP A 1 73 ? -11.665 9.827   2.157   1.00 0.00 ? 73 ASP A CG   6  
ATOM 7118  O OD1  . ASP A 1 73 ? -10.646 9.776   2.826   1.00 0.00 ? 73 ASP A OD1  6  
ATOM 7119  O OD2  . ASP A 1 73 ? -12.467 10.745  2.203   1.00 0.00 ? 73 ASP A OD2  6  
ATOM 7120  H H    . ASP A 1 73 ? -9.500  10.083  0.132   1.00 0.00 ? 73 ASP A H    6  
ATOM 7121  H HA   . ASP A 1 73 ? -11.472 8.102   -0.818  1.00 0.00 ? 73 ASP A HA   6  
ATOM 7122  H HB2  . ASP A 1 73 ? -13.024 8.565   1.078   1.00 0.00 ? 73 ASP A HB2  6  
ATOM 7123  H HB3  . ASP A 1 73 ? -11.552 7.756   1.614   1.00 0.00 ? 73 ASP A HB3  6  
ATOM 7124  N N    . LYS A 1 74 ? -12.519 10.117  -1.917  1.00 0.00 ? 74 LYS A N    6  
ATOM 7125  C CA   . LYS A 1 74 ? -13.131 11.329  -2.544  1.00 0.00 ? 74 LYS A CA   6  
ATOM 7126  C C    . LYS A 1 74 ? -14.562 11.498  -2.032  1.00 0.00 ? 74 LYS A C    6  
ATOM 7127  O O    . LYS A 1 74 ? -15.369 10.593  -2.103  1.00 0.00 ? 74 LYS A O    6  
ATOM 7128  C CB   . LYS A 1 74 ? -13.147 11.173  -4.068  1.00 0.00 ? 74 LYS A CB   6  
ATOM 7129  C CG   . LYS A 1 74 ? -13.411 12.533  -4.719  1.00 0.00 ? 74 LYS A CG   6  
ATOM 7130  C CD   . LYS A 1 74 ? -13.392 12.384  -6.242  1.00 0.00 ? 74 LYS A CD   6  
ATOM 7131  C CE   . LYS A 1 74 ? -13.680 13.739  -6.891  1.00 0.00 ? 74 LYS A CE   6  
ATOM 7132  N NZ   . LYS A 1 74 ? -15.086 14.139  -6.602  1.00 0.00 ? 74 LYS A NZ   6  
ATOM 7133  H H    . LYS A 1 74 ? -12.567 9.251   -2.370  1.00 0.00 ? 74 LYS A H    6  
ATOM 7134  H HA   . LYS A 1 74 ? -12.552 12.204  -2.280  1.00 0.00 ? 74 LYS A HA   6  
ATOM 7135  H HB2  . LYS A 1 74 ? -12.191 10.793  -4.400  1.00 0.00 ? 74 LYS A HB2  6  
ATOM 7136  H HB3  . LYS A 1 74 ? -13.926 10.484  -4.354  1.00 0.00 ? 74 LYS A HB3  6  
ATOM 7137  H HG2  . LYS A 1 74 ? -14.378 12.900  -4.405  1.00 0.00 ? 74 LYS A HG2  6  
ATOM 7138  H HG3  . LYS A 1 74 ? -12.645 13.231  -4.418  1.00 0.00 ? 74 LYS A HG3  6  
ATOM 7139  H HD2  . LYS A 1 74 ? -12.419 12.032  -6.556  1.00 0.00 ? 74 LYS A HD2  6  
ATOM 7140  H HD3  . LYS A 1 74 ? -14.146 11.674  -6.544  1.00 0.00 ? 74 LYS A HD3  6  
ATOM 7141  H HE2  . LYS A 1 74 ? -13.005 14.481  -6.490  1.00 0.00 ? 74 LYS A HE2  6  
ATOM 7142  H HE3  . LYS A 1 74 ? -13.539 13.663  -7.958  1.00 0.00 ? 74 LYS A HE3  6  
ATOM 7143  H HZ1  . LYS A 1 74 ? -15.175 15.173  -6.677  1.00 0.00 ? 74 LYS A HZ1  6  
ATOM 7144  H HZ2  . LYS A 1 74 ? -15.342 13.841  -5.640  1.00 0.00 ? 74 LYS A HZ2  6  
ATOM 7145  H HZ3  . LYS A 1 74 ? -15.723 13.685  -7.287  1.00 0.00 ? 74 LYS A HZ3  6  
ATOM 7146  N N    . ASP A 1 75 ? -14.884 12.657  -1.516  1.00 0.00 ? 75 ASP A N    6  
ATOM 7147  C CA   . ASP A 1 75 ? -16.265 12.894  -0.995  1.00 0.00 ? 75 ASP A CA   6  
ATOM 7148  C C    . ASP A 1 75 ? -17.112 13.560  -2.080  1.00 0.00 ? 75 ASP A C    6  
ATOM 7149  O O    . ASP A 1 75 ? -17.874 12.913  -2.770  1.00 0.00 ? 75 ASP A O    6  
ATOM 7150  C CB   . ASP A 1 75 ? -16.196 13.813  0.227   1.00 0.00 ? 75 ASP A CB   6  
ATOM 7151  C CG   . ASP A 1 75 ? -15.400 13.128  1.338   1.00 0.00 ? 75 ASP A CG   6  
ATOM 7152  O OD1  . ASP A 1 75 ? -15.718 11.994  1.656   1.00 0.00 ? 75 ASP A OD1  6  
ATOM 7153  O OD2  . ASP A 1 75 ? -14.485 13.749  1.853   1.00 0.00 ? 75 ASP A OD2  6  
ATOM 7154  H H    . ASP A 1 75 ? -14.218 13.373  -1.470  1.00 0.00 ? 75 ASP A H    6  
ATOM 7155  H HA   . ASP A 1 75 ? -16.719 11.954  -0.710  1.00 0.00 ? 75 ASP A HA   6  
ATOM 7156  H HB2  . ASP A 1 75 ? -15.712 14.740  -0.047  1.00 0.00 ? 75 ASP A HB2  6  
ATOM 7157  H HB3  . ASP A 1 75 ? -17.196 14.020  0.578   1.00 0.00 ? 75 ASP A HB3  6  
ATOM 7158  N N    . ASP A 1 76 ? -16.987 14.850  -2.235  1.00 0.00 ? 76 ASP A N    6  
ATOM 7159  C CA   . ASP A 1 76 ? -17.786 15.561  -3.274  1.00 0.00 ? 76 ASP A CA   6  
ATOM 7160  C C    . ASP A 1 76 ? -17.088 16.869  -3.650  1.00 0.00 ? 76 ASP A C    6  
ATOM 7161  O O    . ASP A 1 76 ? -15.887 17.002  -3.520  1.00 0.00 ? 76 ASP A O    6  
ATOM 7162  C CB   . ASP A 1 76 ? -19.180 15.869  -2.722  1.00 0.00 ? 76 ASP A CB   6  
ATOM 7163  C CG   . ASP A 1 76 ? -19.852 14.568  -2.277  1.00 0.00 ? 76 ASP A CG   6  
ATOM 7164  O OD1  . ASP A 1 76 ? -20.518 13.958  -3.096  1.00 0.00 ? 76 ASP A OD1  6  
ATOM 7165  O OD2  . ASP A 1 76 ? -19.690 14.206  -1.123  1.00 0.00 ? 76 ASP A OD2  6  
ATOM 7166  H H    . ASP A 1 76 ? -16.368 15.354  -1.666  1.00 0.00 ? 76 ASP A H    6  
ATOM 7167  H HA   . ASP A 1 76 ? -17.876 14.937  -4.151  1.00 0.00 ? 76 ASP A HA   6  
ATOM 7168  H HB2  . ASP A 1 76 ? -19.092 16.537  -1.877  1.00 0.00 ? 76 ASP A HB2  6  
ATOM 7169  H HB3  . ASP A 1 76 ? -19.777 16.335  -3.490  1.00 0.00 ? 76 ASP A HB3  6  
ATOM 7170  N N    . PHE A 1 77 ? -17.829 17.837  -4.115  1.00 0.00 ? 77 PHE A N    6  
ATOM 7171  C CA   . PHE A 1 77 ? -17.206 19.135  -4.499  1.00 0.00 ? 77 PHE A CA   6  
ATOM 7172  C C    . PHE A 1 77 ? -16.685 19.840  -3.246  1.00 0.00 ? 77 PHE A C    6  
ATOM 7173  O O    . PHE A 1 77 ? -16.854 19.368  -2.140  1.00 0.00 ? 77 PHE A O    6  
ATOM 7174  C CB   . PHE A 1 77 ? -18.251 20.020  -5.184  1.00 0.00 ? 77 PHE A CB   6  
ATOM 7175  C CG   . PHE A 1 77 ? -18.796 19.308  -6.400  1.00 0.00 ? 77 PHE A CG   6  
ATOM 7176  C CD1  . PHE A 1 77 ? -18.137 19.422  -7.630  1.00 0.00 ? 77 PHE A CD1  6  
ATOM 7177  C CD2  . PHE A 1 77 ? -19.956 18.535  -6.297  1.00 0.00 ? 77 PHE A CD2  6  
ATOM 7178  C CE1  . PHE A 1 77 ? -18.641 18.762  -8.757  1.00 0.00 ? 77 PHE A CE1  6  
ATOM 7179  C CE2  . PHE A 1 77 ? -20.461 17.874  -7.423  1.00 0.00 ? 77 PHE A CE2  6  
ATOM 7180  C CZ   . PHE A 1 77 ? -19.803 17.988  -8.653  1.00 0.00 ? 77 PHE A CZ   6  
ATOM 7181  H H    . PHE A 1 77 ? -18.796 17.710  -4.212  1.00 0.00 ? 77 PHE A H    6  
ATOM 7182  H HA   . PHE A 1 77 ? -16.387 18.955  -5.178  1.00 0.00 ? 77 PHE A HA   6  
ATOM 7183  H HB2  . PHE A 1 77 ? -19.057 20.224  -4.494  1.00 0.00 ? 77 PHE A HB2  6  
ATOM 7184  H HB3  . PHE A 1 77 ? -17.792 20.950  -5.487  1.00 0.00 ? 77 PHE A HB3  6  
ATOM 7185  H HD1  . PHE A 1 77 ? -17.240 20.019  -7.710  1.00 0.00 ? 77 PHE A HD1  6  
ATOM 7186  H HD2  . PHE A 1 77 ? -20.465 18.447  -5.347  1.00 0.00 ? 77 PHE A HD2  6  
ATOM 7187  H HE1  . PHE A 1 77 ? -18.134 18.850  -9.707  1.00 0.00 ? 77 PHE A HE1  6  
ATOM 7188  H HE2  . PHE A 1 77 ? -21.357 17.278  -7.343  1.00 0.00 ? 77 PHE A HE2  6  
ATOM 7189  H HZ   . PHE A 1 77 ? -20.192 17.479  -9.523  1.00 0.00 ? 77 PHE A HZ   6  
ATOM 7190  N N    . PHE A 1 78 ? -16.049 20.968  -3.410  1.00 0.00 ? 78 PHE A N    6  
ATOM 7191  C CA   . PHE A 1 78 ? -15.517 21.702  -2.227  1.00 0.00 ? 78 PHE A CA   6  
ATOM 7192  C C    . PHE A 1 78 ? -16.680 22.158  -1.344  1.00 0.00 ? 78 PHE A C    6  
ATOM 7193  O O    . PHE A 1 78 ? -17.257 23.207  -1.552  1.00 0.00 ? 78 PHE A O    6  
ATOM 7194  C CB   . PHE A 1 78 ? -14.726 22.924  -2.697  1.00 0.00 ? 78 PHE A CB   6  
ATOM 7195  C CG   . PHE A 1 78 ? -13.693 22.496  -3.713  1.00 0.00 ? 78 PHE A CG   6  
ATOM 7196  C CD1  . PHE A 1 78 ? -12.429 22.069  -3.288  1.00 0.00 ? 78 PHE A CD1  6  
ATOM 7197  C CD2  . PHE A 1 78 ? -14.000 22.525  -5.079  1.00 0.00 ? 78 PHE A CD2  6  
ATOM 7198  C CE1  . PHE A 1 78 ? -11.472 21.671  -4.230  1.00 0.00 ? 78 PHE A CE1  6  
ATOM 7199  C CE2  . PHE A 1 78 ? -13.044 22.127  -6.020  1.00 0.00 ? 78 PHE A CE2  6  
ATOM 7200  C CZ   . PHE A 1 78 ? -11.779 21.699  -5.595  1.00 0.00 ? 78 PHE A CZ   6  
ATOM 7201  H H    . PHE A 1 78 ? -15.923 21.334  -4.311  1.00 0.00 ? 78 PHE A H    6  
ATOM 7202  H HA   . PHE A 1 78 ? -14.869 21.051  -1.661  1.00 0.00 ? 78 PHE A HA   6  
ATOM 7203  H HB2  . PHE A 1 78 ? -15.400 23.638  -3.149  1.00 0.00 ? 78 PHE A HB2  6  
ATOM 7204  H HB3  . PHE A 1 78 ? -14.231 23.380  -1.853  1.00 0.00 ? 78 PHE A HB3  6  
ATOM 7205  H HD1  . PHE A 1 78 ? -12.193 22.047  -2.235  1.00 0.00 ? 78 PHE A HD1  6  
ATOM 7206  H HD2  . PHE A 1 78 ? -14.975 22.854  -5.406  1.00 0.00 ? 78 PHE A HD2  6  
ATOM 7207  H HE1  . PHE A 1 78 ? -10.497 21.342  -3.902  1.00 0.00 ? 78 PHE A HE1  6  
ATOM 7208  H HE2  . PHE A 1 78 ? -13.280 22.149  -7.073  1.00 0.00 ? 78 PHE A HE2  6  
ATOM 7209  H HZ   . PHE A 1 78 ? -11.041 21.392  -6.321  1.00 0.00 ? 78 PHE A HZ   6  
ATOM 7210  N N    . THR A 1 79 ? -17.029 21.378  -0.357  1.00 0.00 ? 79 THR A N    6  
ATOM 7211  C CA   . THR A 1 79 ? -18.155 21.767  0.537   1.00 0.00 ? 79 THR A CA   6  
ATOM 7212  C C    . THR A 1 79 ? -19.377 22.129  -0.308  1.00 0.00 ? 79 THR A C    6  
ATOM 7213  O O    . THR A 1 79 ? -19.445 21.677  -1.439  1.00 0.00 ? 79 THR A O    6  
ATOM 7214  C CB   . THR A 1 79 ? -17.741 22.976  1.380   1.00 0.00 ? 79 THR A CB   6  
ATOM 7215  O OG1  . THR A 1 79 ? -17.782 24.147  0.577   1.00 0.00 ? 79 THR A OG1  6  
ATOM 7216  C CG2  . THR A 1 79 ? -16.322 22.769  1.912   1.00 0.00 ? 79 THR A CG2  6  
ATOM 7217  O OXT  . THR A 1 79 ? -20.224 22.852  0.190   1.00 0.00 ? 79 THR A OXT  6  
ATOM 7218  H H    . THR A 1 79 ? -16.551 20.536  -0.207  1.00 0.00 ? 79 THR A H    6  
ATOM 7219  H HA   . THR A 1 79 ? -18.399 20.941  1.189   1.00 0.00 ? 79 THR A HA   6  
ATOM 7220  H HB   . THR A 1 79 ? -18.420 23.085  2.212   1.00 0.00 ? 79 THR A HB   6  
ATOM 7221  H HG1  . THR A 1 79 ? -18.673 24.239  0.232   1.00 0.00 ? 79 THR A HG1  6  
ATOM 7222  H HG21 . THR A 1 79 ? -16.069 23.574  2.585   1.00 0.00 ? 79 THR A HG21 6  
ATOM 7223  H HG22 . THR A 1 79 ? -15.626 22.757  1.086   1.00 0.00 ? 79 THR A HG22 6  
ATOM 7224  H HG23 . THR A 1 79 ? -16.270 21.827  2.440   1.00 0.00 ? 79 THR A HG23 6  
ATOM 7225  N N    . MET A 1 1  ? 14.713  19.768  7.312   1.00 0.00 ? 1  MET A N    7  
ATOM 7226  C CA   . MET A 1 1  ? 13.467  19.535  8.095   1.00 0.00 ? 1  MET A CA   7  
ATOM 7227  C C    . MET A 1 1  ? 12.668  18.397  7.456   1.00 0.00 ? 1  MET A C    7  
ATOM 7228  O O    . MET A 1 1  ? 12.914  18.009  6.331   1.00 0.00 ? 1  MET A O    7  
ATOM 7229  C CB   . MET A 1 1  ? 12.621  20.810  8.100   1.00 0.00 ? 1  MET A CB   7  
ATOM 7230  C CG   . MET A 1 1  ? 12.342  21.243  6.660   1.00 0.00 ? 1  MET A CG   7  
ATOM 7231  S SD   . MET A 1 1  ? 11.480  22.834  6.664   1.00 0.00 ? 1  MET A SD   7  
ATOM 7232  C CE   . MET A 1 1  ? 10.782  22.717  4.999   1.00 0.00 ? 1  MET A CE   7  
ATOM 7233  H H1   . MET A 1 1  ? 14.684  19.207  6.438   1.00 0.00 ? 1  MET A H1   7  
ATOM 7234  H H2   . MET A 1 1  ? 15.538  19.483  7.881   1.00 0.00 ? 1  MET A H2   7  
ATOM 7235  H H3   . MET A 1 1  ? 14.788  20.776  7.072   1.00 0.00 ? 1  MET A H3   7  
ATOM 7236  H HA   . MET A 1 1  ? 13.723  19.269  9.111   1.00 0.00 ? 1  MET A HA   7  
ATOM 7237  H HB2  . MET A 1 1  ? 11.687  20.620  8.608   1.00 0.00 ? 1  MET A HB2  7  
ATOM 7238  H HB3  . MET A 1 1  ? 13.156  21.595  8.613   1.00 0.00 ? 1  MET A HB3  7  
ATOM 7239  H HG2  . MET A 1 1  ? 13.276  21.340  6.126   1.00 0.00 ? 1  MET A HG2  7  
ATOM 7240  H HG3  . MET A 1 1  ? 11.726  20.501  6.174   1.00 0.00 ? 1  MET A HG3  7  
ATOM 7241  H HE1  . MET A 1 1  ? 11.566  22.468  4.297   1.00 0.00 ? 1  MET A HE1  7  
ATOM 7242  H HE2  . MET A 1 1  ? 10.337  23.665  4.728   1.00 0.00 ? 1  MET A HE2  7  
ATOM 7243  H HE3  . MET A 1 1  ? 10.026  21.949  4.976   1.00 0.00 ? 1  MET A HE3  7  
ATOM 7244  N N    . ILE A 1 2  ? 11.714  17.857  8.165   1.00 0.00 ? 2  ILE A N    7  
ATOM 7245  C CA   . ILE A 1 2  ? 10.902  16.744  7.596   1.00 0.00 ? 2  ILE A CA   7  
ATOM 7246  C C    . ILE A 1 2  ? 10.345  17.168  6.233   1.00 0.00 ? 2  ILE A C    7  
ATOM 7247  O O    . ILE A 1 2  ? 9.548   18.080  6.130   1.00 0.00 ? 2  ILE A O    7  
ATOM 7248  C CB   . ILE A 1 2  ? 9.747   16.413  8.555   1.00 0.00 ? 2  ILE A CB   7  
ATOM 7249  C CG1  . ILE A 1 2  ? 9.201   17.707  9.166   1.00 0.00 ? 2  ILE A CG1  7  
ATOM 7250  C CG2  . ILE A 1 2  ? 10.254  15.505  9.680   1.00 0.00 ? 2  ILE A CG2  7  
ATOM 7251  C CD1  . ILE A 1 2  ? 7.875   17.417  9.873   1.00 0.00 ? 2  ILE A CD1  7  
ATOM 7252  H H    . ILE A 1 2  ? 11.532  18.184  9.071   1.00 0.00 ? 2  ILE A H    7  
ATOM 7253  H HA   . ILE A 1 2  ? 11.528  15.874  7.467   1.00 0.00 ? 2  ILE A HA   7  
ATOM 7254  H HB   . ILE A 1 2  ? 8.960   15.907  8.016   1.00 0.00 ? 2  ILE A HB   7  
ATOM 7255  H HG12 . ILE A 1 2  ? 9.912   18.097  9.879   1.00 0.00 ? 2  ILE A HG12 7  
ATOM 7256  H HG13 . ILE A 1 2  ? 9.038   18.435  8.387   1.00 0.00 ? 2  ILE A HG13 7  
ATOM 7257  H HG21 . ILE A 1 2  ? 11.049  16.002  10.215  1.00 0.00 ? 2  ILE A HG21 7  
ATOM 7258  H HG22 . ILE A 1 2  ? 10.626  14.583  9.258   1.00 0.00 ? 2  ILE A HG22 7  
ATOM 7259  H HG23 . ILE A 1 2  ? 9.443   15.287  10.360  1.00 0.00 ? 2  ILE A HG23 7  
ATOM 7260  H HD11 . ILE A 1 2  ? 7.464   18.338  10.257  1.00 0.00 ? 2  ILE A HD11 7  
ATOM 7261  H HD12 . ILE A 1 2  ? 8.045   16.731  10.689  1.00 0.00 ? 2  ILE A HD12 7  
ATOM 7262  H HD13 . ILE A 1 2  ? 7.182   16.977  9.171   1.00 0.00 ? 2  ILE A HD13 7  
ATOM 7263  N N    . ASP A 1 3  ? 10.762  16.515  5.183   1.00 0.00 ? 3  ASP A N    7  
ATOM 7264  C CA   . ASP A 1 3  ? 10.260  16.881  3.827   1.00 0.00 ? 3  ASP A CA   7  
ATOM 7265  C C    . ASP A 1 3  ? 8.758   16.607  3.748   1.00 0.00 ? 3  ASP A C    7  
ATOM 7266  O O    . ASP A 1 3  ? 7.962   17.506  3.554   1.00 0.00 ? 3  ASP A O    7  
ATOM 7267  C CB   . ASP A 1 3  ? 10.985  16.044  2.771   1.00 0.00 ? 3  ASP A CB   7  
ATOM 7268  C CG   . ASP A 1 3  ? 12.483  16.351  2.815   1.00 0.00 ? 3  ASP A CG   7  
ATOM 7269  O OD1  . ASP A 1 3  ? 13.113  15.992  3.796   1.00 0.00 ? 3  ASP A OD1  7  
ATOM 7270  O OD2  . ASP A 1 3  ? 12.975  16.940  1.866   1.00 0.00 ? 3  ASP A OD2  7  
ATOM 7271  H H    . ASP A 1 3  ? 11.408  15.784  5.284   1.00 0.00 ? 3  ASP A H    7  
ATOM 7272  H HA   . ASP A 1 3  ? 10.445  17.929  3.646   1.00 0.00 ? 3  ASP A HA   7  
ATOM 7273  H HB2  . ASP A 1 3  ? 10.826  14.995  2.973   1.00 0.00 ? 3  ASP A HB2  7  
ATOM 7274  H HB3  . ASP A 1 3  ? 10.599  16.286  1.793   1.00 0.00 ? 3  ASP A HB3  7  
ATOM 7275  N N    . ASN A 1 4  ? 8.361   15.373  3.894   1.00 0.00 ? 4  ASN A N    7  
ATOM 7276  C CA   . ASN A 1 4  ? 6.911   15.042  3.824   1.00 0.00 ? 4  ASN A CA   7  
ATOM 7277  C C    . ASN A 1 4  ? 6.233   15.437  5.138   1.00 0.00 ? 4  ASN A C    7  
ATOM 7278  O O    . ASN A 1 4  ? 6.730   15.162  6.212   1.00 0.00 ? 4  ASN A O    7  
ATOM 7279  C CB   . ASN A 1 4  ? 6.743   13.539  3.595   1.00 0.00 ? 4  ASN A CB   7  
ATOM 7280  C CG   . ASN A 1 4  ? 7.430   13.143  2.288   1.00 0.00 ? 4  ASN A CG   7  
ATOM 7281  O OD1  . ASN A 1 4  ? 8.348   12.347  2.286   1.00 0.00 ? 4  ASN A OD1  7  
ATOM 7282  N ND2  . ASN A 1 4  ? 7.021   13.670  1.165   1.00 0.00 ? 4  ASN A ND2  7  
ATOM 7283  H H    . ASN A 1 4  ? 9.018   14.662  4.049   1.00 0.00 ? 4  ASN A H    7  
ATOM 7284  H HA   . ASN A 1 4  ? 6.456   15.583  3.008   1.00 0.00 ? 4  ASN A HA   7  
ATOM 7285  H HB2  . ASN A 1 4  ? 7.191   12.998  4.417   1.00 0.00 ? 4  ASN A HB2  7  
ATOM 7286  H HB3  . ASN A 1 4  ? 5.692   13.298  3.535   1.00 0.00 ? 4  ASN A HB3  7  
ATOM 7287  H HD21 . ASN A 1 4  ? 6.282   14.312  1.166   1.00 0.00 ? 4  ASN A HD21 7  
ATOM 7288  H HD22 . ASN A 1 4  ? 7.455   13.423  0.321   1.00 0.00 ? 4  ASN A HD22 7  
ATOM 7289  N N    . GLU A 1 5  ? 5.100   16.081  5.061   1.00 0.00 ? 5  GLU A N    7  
ATOM 7290  C CA   . GLU A 1 5  ? 4.393   16.493  6.305   1.00 0.00 ? 5  GLU A CA   7  
ATOM 7291  C C    . GLU A 1 5  ? 4.162   15.267  7.191   1.00 0.00 ? 5  GLU A C    7  
ATOM 7292  O O    . GLU A 1 5  ? 4.072   14.153  6.713   1.00 0.00 ? 5  GLU A O    7  
ATOM 7293  C CB   . GLU A 1 5  ? 3.045   17.121  5.943   1.00 0.00 ? 5  GLU A CB   7  
ATOM 7294  C CG   . GLU A 1 5  ? 2.384   17.674  7.207   1.00 0.00 ? 5  GLU A CG   7  
ATOM 7295  C CD   . GLU A 1 5  ? 1.106   18.424  6.829   1.00 0.00 ? 5  GLU A CD   7  
ATOM 7296  O OE1  . GLU A 1 5  ? 1.195   19.347  6.037   1.00 0.00 ? 5  GLU A OE1  7  
ATOM 7297  O OE2  . GLU A 1 5  ? 0.057   18.061  7.339   1.00 0.00 ? 5  GLU A OE2  7  
ATOM 7298  H H    . GLU A 1 5  ? 4.715   16.294  4.185   1.00 0.00 ? 5  GLU A H    7  
ATOM 7299  H HA   . GLU A 1 5  ? 4.995   17.214  6.839   1.00 0.00 ? 5  GLU A HA   7  
ATOM 7300  H HB2  . GLU A 1 5  ? 3.200   17.924  5.236   1.00 0.00 ? 5  GLU A HB2  7  
ATOM 7301  H HB3  . GLU A 1 5  ? 2.404   16.372  5.503   1.00 0.00 ? 5  GLU A HB3  7  
ATOM 7302  H HG2  . GLU A 1 5  ? 2.142   16.859  7.873   1.00 0.00 ? 5  GLU A HG2  7  
ATOM 7303  H HG3  . GLU A 1 5  ? 3.063   18.353  7.701   1.00 0.00 ? 5  GLU A HG3  7  
ATOM 7304  N N    . LYS A 1 6  ? 4.066   15.463  8.476   1.00 0.00 ? 6  LYS A N    7  
ATOM 7305  C CA   . LYS A 1 6  ? 3.843   14.309  9.391   1.00 0.00 ? 6  LYS A CA   7  
ATOM 7306  C C    . LYS A 1 6  ? 3.548   14.826  10.799  1.00 0.00 ? 6  LYS A C    7  
ATOM 7307  O O    . LYS A 1 6  ? 4.204   15.722  11.292  1.00 0.00 ? 6  LYS A O    7  
ATOM 7308  C CB   . LYS A 1 6  ? 5.097   13.433  9.421   1.00 0.00 ? 6  LYS A CB   7  
ATOM 7309  C CG   . LYS A 1 6  ? 4.827   12.179  10.257  1.00 0.00 ? 6  LYS A CG   7  
ATOM 7310  C CD   . LYS A 1 6  ? 6.045   11.256  10.198  1.00 0.00 ? 6  LYS A CD   7  
ATOM 7311  C CE   . LYS A 1 6  ? 5.771   9.995   11.020  1.00 0.00 ? 6  LYS A CE   7  
ATOM 7312  N NZ   . LYS A 1 6  ? 5.438   10.378  12.421  1.00 0.00 ? 6  LYS A NZ   7  
ATOM 7313  H H    . LYS A 1 6  ? 4.142   16.369  8.842   1.00 0.00 ? 6  LYS A H    7  
ATOM 7314  H HA   . LYS A 1 6  ? 3.005   13.725  9.038   1.00 0.00 ? 6  LYS A HA   7  
ATOM 7315  H HB2  . LYS A 1 6  ? 5.360   13.145  8.414   1.00 0.00 ? 6  LYS A HB2  7  
ATOM 7316  H HB3  . LYS A 1 6  ? 5.912   13.987  9.861   1.00 0.00 ? 6  LYS A HB3  7  
ATOM 7317  H HG2  . LYS A 1 6  ? 4.639   12.465  11.282  1.00 0.00 ? 6  LYS A HG2  7  
ATOM 7318  H HG3  . LYS A 1 6  ? 3.965   11.663  9.862   1.00 0.00 ? 6  LYS A HG3  7  
ATOM 7319  H HD2  . LYS A 1 6  ? 6.238   10.982  9.171   1.00 0.00 ? 6  LYS A HD2  7  
ATOM 7320  H HD3  . LYS A 1 6  ? 6.904   11.767  10.603  1.00 0.00 ? 6  LYS A HD3  7  
ATOM 7321  H HE2  . LYS A 1 6  ? 4.940   9.456   10.587  1.00 0.00 ? 6  LYS A HE2  7  
ATOM 7322  H HE3  . LYS A 1 6  ? 6.648   9.366   11.017  1.00 0.00 ? 6  LYS A HE3  7  
ATOM 7323  H HZ1  . LYS A 1 6  ? 6.093   11.118  12.744  1.00 0.00 ? 6  LYS A HZ1  7  
ATOM 7324  H HZ2  . LYS A 1 6  ? 5.526   9.546   13.038  1.00 0.00 ? 6  LYS A HZ2  7  
ATOM 7325  H HZ3  . LYS A 1 6  ? 4.462   10.737  12.459  1.00 0.00 ? 6  LYS A HZ3  7  
ATOM 7326  N N    . VAL A 1 7  ? 2.566   14.269  11.454  1.00 0.00 ? 7  VAL A N    7  
ATOM 7327  C CA   . VAL A 1 7  ? 2.234   14.731  12.831  1.00 0.00 ? 7  VAL A CA   7  
ATOM 7328  C C    . VAL A 1 7  ? 3.314   14.249  13.802  1.00 0.00 ? 7  VAL A C    7  
ATOM 7329  O O    . VAL A 1 7  ? 4.187   14.999  14.193  1.00 0.00 ? 7  VAL A O    7  
ATOM 7330  C CB   . VAL A 1 7  ? 0.876   14.161  13.246  1.00 0.00 ? 7  VAL A CB   7  
ATOM 7331  C CG1  . VAL A 1 7  ? 0.430   14.810  14.558  1.00 0.00 ? 7  VAL A CG1  7  
ATOM 7332  C CG2  . VAL A 1 7  ? -0.155  14.461  12.155  1.00 0.00 ? 7  VAL A CG2  7  
ATOM 7333  H H    . VAL A 1 7  ? 2.048   13.546  11.041  1.00 0.00 ? 7  VAL A H    7  
ATOM 7334  H HA   . VAL A 1 7  ? 2.191   15.810  12.846  1.00 0.00 ? 7  VAL A HA   7  
ATOM 7335  H HB   . VAL A 1 7  ? 0.959   13.093  13.383  1.00 0.00 ? 7  VAL A HB   7  
ATOM 7336  H HG11 . VAL A 1 7  ? -0.484  14.344  14.897  1.00 0.00 ? 7  VAL A HG11 7  
ATOM 7337  H HG12 . VAL A 1 7  ? 0.260   15.864  14.399  1.00 0.00 ? 7  VAL A HG12 7  
ATOM 7338  H HG13 . VAL A 1 7  ? 1.199   14.677  15.304  1.00 0.00 ? 7  VAL A HG13 7  
ATOM 7339  H HG21 . VAL A 1 7  ? 0.105   13.921  11.256  1.00 0.00 ? 7  VAL A HG21 7  
ATOM 7340  H HG22 . VAL A 1 7  ? -0.162  15.521  11.949  1.00 0.00 ? 7  VAL A HG22 7  
ATOM 7341  H HG23 . VAL A 1 7  ? -1.134  14.152  12.490  1.00 0.00 ? 7  VAL A HG23 7  
ATOM 7342  N N    . THR A 1 8  ? 3.266   13.005  14.193  1.00 0.00 ? 8  THR A N    7  
ATOM 7343  C CA   . THR A 1 8  ? 4.293   12.479  15.135  1.00 0.00 ? 8  THR A CA   7  
ATOM 7344  C C    . THR A 1 8  ? 4.305   10.951  15.068  1.00 0.00 ? 8  THR A C    7  
ATOM 7345  O O    . THR A 1 8  ? 5.125   10.299  15.682  1.00 0.00 ? 8  THR A O    7  
ATOM 7346  C CB   . THR A 1 8  ? 3.955   12.924  16.561  1.00 0.00 ? 8  THR A CB   7  
ATOM 7347  O OG1  . THR A 1 8  ? 4.937   12.422  17.457  1.00 0.00 ? 8  THR A OG1  7  
ATOM 7348  C CG2  . THR A 1 8  ? 2.579   12.382  16.953  1.00 0.00 ? 8  THR A CG2  7  
ATOM 7349  H H    . THR A 1 8  ? 2.556   12.413  13.867  1.00 0.00 ? 8  THR A H    7  
ATOM 7350  H HA   . THR A 1 8  ? 5.264   12.860  14.860  1.00 0.00 ? 8  THR A HA   7  
ATOM 7351  H HB   . THR A 1 8  ? 3.939   14.002  16.609  1.00 0.00 ? 8  THR A HB   7  
ATOM 7352  H HG1  . THR A 1 8  ? 5.582   11.932  16.944  1.00 0.00 ? 8  THR A HG1  7  
ATOM 7353  H HG21 . THR A 1 8  ? 2.641   11.314  17.099  1.00 0.00 ? 8  THR A HG21 7  
ATOM 7354  H HG22 . THR A 1 8  ? 1.870   12.598  16.168  1.00 0.00 ? 8  THR A HG22 7  
ATOM 7355  H HG23 . THR A 1 8  ? 2.256   12.852  17.870  1.00 0.00 ? 8  THR A HG23 7  
ATOM 7356  N N    . SER A 1 9  ? 3.398   10.376  14.325  1.00 0.00 ? 9  SER A N    7  
ATOM 7357  C CA   . SER A 1 9  ? 3.355   8.892   14.215  1.00 0.00 ? 9  SER A CA   7  
ATOM 7358  C C    . SER A 1 9  ? 2.396   8.491   13.094  1.00 0.00 ? 9  SER A C    7  
ATOM 7359  O O    . SER A 1 9  ? 2.221   9.209   12.128  1.00 0.00 ? 9  SER A O    7  
ATOM 7360  C CB   . SER A 1 9  ? 2.868   8.297   15.537  1.00 0.00 ? 9  SER A CB   7  
ATOM 7361  O OG   . SER A 1 9  ? 2.764   6.885   15.407  1.00 0.00 ? 9  SER A OG   7  
ATOM 7362  H H    . SER A 1 9  ? 2.747   10.922  13.838  1.00 0.00 ? 9  SER A H    7  
ATOM 7363  H HA   . SER A 1 9  ? 4.345   8.517   13.995  1.00 0.00 ? 9  SER A HA   7  
ATOM 7364  H HB2  . SER A 1 9  ? 3.570   8.530   16.321  1.00 0.00 ? 9  SER A HB2  7  
ATOM 7365  H HB3  . SER A 1 9  ? 1.902   8.719   15.786  1.00 0.00 ? 9  SER A HB3  7  
ATOM 7366  H HG   . SER A 1 9  ? 3.552   6.493   15.791  1.00 0.00 ? 9  SER A HG   7  
ATOM 7367  N N    . GLY A 1 10 ? 1.771   7.353   13.212  1.00 0.00 ? 10 GLY A N    7  
ATOM 7368  C CA   . GLY A 1 10 ? 0.822   6.910   12.152  1.00 0.00 ? 10 GLY A CA   7  
ATOM 7369  C C    . GLY A 1 10 ? 0.422   5.455   12.402  1.00 0.00 ? 10 GLY A C    7  
ATOM 7370  O O    . GLY A 1 10 ? 1.229   4.639   12.803  1.00 0.00 ? 10 GLY A O    7  
ATOM 7371  H H    . GLY A 1 10 ? 1.925   6.789   13.999  1.00 0.00 ? 10 GLY A H    7  
ATOM 7372  H HA2  . GLY A 1 10 ? -0.058  7.536   12.172  1.00 0.00 ? 10 GLY A HA2  7  
ATOM 7373  H HA3  . GLY A 1 10 ? 1.299   6.987   11.187  1.00 0.00 ? 10 GLY A HA3  7  
ATOM 7374  N N    . HIS A 1 11 ? -0.817  5.120   12.167  1.00 0.00 ? 11 HIS A N    7  
ATOM 7375  C CA   . HIS A 1 11 ? -1.262  3.716   12.389  1.00 0.00 ? 11 HIS A CA   7  
ATOM 7376  C C    . HIS A 1 11 ? -0.596  2.809   11.353  1.00 0.00 ? 11 HIS A C    7  
ATOM 7377  O O    . HIS A 1 11 ? -0.293  3.228   10.253  1.00 0.00 ? 11 HIS A O    7  
ATOM 7378  C CB   . HIS A 1 11 ? -2.782  3.627   12.243  1.00 0.00 ? 11 HIS A CB   7  
ATOM 7379  C CG   . HIS A 1 11 ? -3.438  4.576   13.208  1.00 0.00 ? 11 HIS A CG   7  
ATOM 7380  N ND1  . HIS A 1 11 ? -4.811  4.771   13.232  1.00 0.00 ? 11 HIS A ND1  7  
ATOM 7381  C CD2  . HIS A 1 11 ? -2.926  5.389   14.188  1.00 0.00 ? 11 HIS A CD2  7  
ATOM 7382  C CE1  . HIS A 1 11 ? -5.074  5.670   14.198  1.00 0.00 ? 11 HIS A CE1  7  
ATOM 7383  N NE2  . HIS A 1 11 ? -3.961  6.080   14.812  1.00 0.00 ? 11 HIS A NE2  7  
ATOM 7384  H H    . HIS A 1 11 ? -1.454  5.791   11.841  1.00 0.00 ? 11 HIS A H    7  
ATOM 7385  H HA   . HIS A 1 11 ? -0.975  3.400   13.382  1.00 0.00 ? 11 HIS A HA   7  
ATOM 7386  H HB2  . HIS A 1 11 ? -3.063  3.892   11.233  1.00 0.00 ? 11 HIS A HB2  7  
ATOM 7387  H HB3  . HIS A 1 11 ? -3.106  2.619   12.453  1.00 0.00 ? 11 HIS A HB3  7  
ATOM 7388  H HD1  . HIS A 1 11 ? -5.468  4.335   12.652  1.00 0.00 ? 11 HIS A HD1  7  
ATOM 7389  H HD2  . HIS A 1 11 ? -1.880  5.479   14.437  1.00 0.00 ? 11 HIS A HD2  7  
ATOM 7390  H HE1  . HIS A 1 11 ? -6.067  6.018   14.448  1.00 0.00 ? 11 HIS A HE1  7  
ATOM 7391  N N    . THR A 1 12 ? -0.363  1.572   11.692  1.00 0.00 ? 12 THR A N    7  
ATOM 7392  C CA   . THR A 1 12 ? 0.284   0.645   10.721  1.00 0.00 ? 12 THR A CA   7  
ATOM 7393  C C    . THR A 1 12 ? -0.733  0.229   9.655   1.00 0.00 ? 12 THR A C    7  
ATOM 7394  O O    . THR A 1 12 ? -1.303  1.055   8.971   1.00 0.00 ? 12 THR A O    7  
ATOM 7395  C CB   . THR A 1 12 ? 0.795   -0.593  11.459  1.00 0.00 ? 12 THR A CB   7  
ATOM 7396  O OG1  . THR A 1 12 ? -0.309  -1.327  11.971  1.00 0.00 ? 12 THR A OG1  7  
ATOM 7397  C CG2  . THR A 1 12 ? 1.703   -0.164  12.613  1.00 0.00 ? 12 THR A CG2  7  
ATOM 7398  H H    . THR A 1 12 ? -0.614  1.252   12.584  1.00 0.00 ? 12 THR A H    7  
ATOM 7399  H HA   . THR A 1 12 ? 1.114   1.148   10.246  1.00 0.00 ? 12 THR A HA   7  
ATOM 7400  H HB   . THR A 1 12 ? 1.356   -1.214  10.778  1.00 0.00 ? 12 THR A HB   7  
ATOM 7401  H HG1  . THR A 1 12 ? -1.012  -0.704  12.172  1.00 0.00 ? 12 THR A HG1  7  
ATOM 7402  H HG21 . THR A 1 12 ? 2.571   0.344   12.218  1.00 0.00 ? 12 THR A HG21 7  
ATOM 7403  H HG22 . THR A 1 12 ? 2.017   -1.035  13.168  1.00 0.00 ? 12 THR A HG22 7  
ATOM 7404  H HG23 . THR A 1 12 ? 1.161   0.503   13.267  1.00 0.00 ? 12 THR A HG23 7  
ATOM 7405  N N    . THR A 1 13 ? -0.968  -1.047  9.509   1.00 0.00 ? 13 THR A N    7  
ATOM 7406  C CA   . THR A 1 13 ? -1.947  -1.514  8.488   1.00 0.00 ? 13 THR A CA   7  
ATOM 7407  C C    . THR A 1 13 ? -2.372  -2.947  8.808   1.00 0.00 ? 13 THR A C    7  
ATOM 7408  O O    . THR A 1 13 ? -1.706  -3.651  9.541   1.00 0.00 ? 13 THR A O    7  
ATOM 7409  C CB   . THR A 1 13 ? -1.299  -1.470  7.102   1.00 0.00 ? 13 THR A CB   7  
ATOM 7410  O OG1  . THR A 1 13 ? -0.765  -0.173  6.871   1.00 0.00 ? 13 THR A OG1  7  
ATOM 7411  C CG2  . THR A 1 13 ? -2.347  -1.789  6.035   1.00 0.00 ? 13 THR A CG2  7  
ATOM 7412  H H    . THR A 1 13 ? -0.499  -1.699  10.071  1.00 0.00 ? 13 THR A H    7  
ATOM 7413  H HA   . THR A 1 13 ? -2.814  -0.869  8.499   1.00 0.00 ? 13 THR A HA   7  
ATOM 7414  H HB   . THR A 1 13 ? -0.506  -2.200  7.052   1.00 0.00 ? 13 THR A HB   7  
ATOM 7415  H HG1  . THR A 1 13 ? -0.085  -0.011  7.530   1.00 0.00 ? 13 THR A HG1  7  
ATOM 7416  H HG21 . THR A 1 13 ? -1.949  -1.557  5.058   1.00 0.00 ? 13 THR A HG21 7  
ATOM 7417  H HG22 . THR A 1 13 ? -3.233  -1.198  6.213   1.00 0.00 ? 13 THR A HG22 7  
ATOM 7418  H HG23 . THR A 1 13 ? -2.598  -2.838  6.082   1.00 0.00 ? 13 THR A HG23 7  
ATOM 7419  N N    . THR A 1 14 ? -3.477  -3.386  8.268   1.00 0.00 ? 14 THR A N    7  
ATOM 7420  C CA   . THR A 1 14 ? -3.939  -4.777  8.548   1.00 0.00 ? 14 THR A CA   7  
ATOM 7421  C C    . THR A 1 14 ? -5.208  -5.075  7.746   1.00 0.00 ? 14 THR A C    7  
ATOM 7422  O O    . THR A 1 14 ? -5.558  -6.216  7.523   1.00 0.00 ? 14 THR A O    7  
ATOM 7423  C CB   . THR A 1 14 ? -4.241  -4.923  10.042  1.00 0.00 ? 14 THR A CB   7  
ATOM 7424  O OG1  . THR A 1 14 ? -5.017  -6.095  10.252  1.00 0.00 ? 14 THR A OG1  7  
ATOM 7425  C CG2  . THR A 1 14 ? -5.019  -3.701  10.533  1.00 0.00 ? 14 THR A CG2  7  
ATOM 7426  H H    . THR A 1 14 ? -3.999  -2.803  7.679   1.00 0.00 ? 14 THR A H    7  
ATOM 7427  H HA   . THR A 1 14 ? -3.165  -5.475  8.270   1.00 0.00 ? 14 THR A HA   7  
ATOM 7428  H HB   . THR A 1 14 ? -3.316  -5.000  10.592  1.00 0.00 ? 14 THR A HB   7  
ATOM 7429  H HG1  . THR A 1 14 ? -4.415  -6.839  10.329  1.00 0.00 ? 14 THR A HG1  7  
ATOM 7430  H HG21 . THR A 1 14 ? -5.903  -3.570  9.927   1.00 0.00 ? 14 THR A HG21 7  
ATOM 7431  H HG22 . THR A 1 14 ? -4.395  -2.822  10.454  1.00 0.00 ? 14 THR A HG22 7  
ATOM 7432  H HG23 . THR A 1 14 ? -5.307  -3.846  11.563  1.00 0.00 ? 14 THR A HG23 7  
ATOM 7433  N N    . THR A 1 15 ? -5.914  -4.058  7.329   1.00 0.00 ? 15 THR A N    7  
ATOM 7434  C CA   . THR A 1 15 ? -7.176  -4.284  6.563   1.00 0.00 ? 15 THR A CA   7  
ATOM 7435  C C    . THR A 1 15 ? -6.883  -4.387  5.063   1.00 0.00 ? 15 THR A C    7  
ATOM 7436  O O    . THR A 1 15 ? -6.236  -3.539  4.482   1.00 0.00 ? 15 THR A O    7  
ATOM 7437  C CB   . THR A 1 15 ? -8.127  -3.111  6.808   1.00 0.00 ? 15 THR A CB   7  
ATOM 7438  O OG1  . THR A 1 15 ? -8.368  -2.984  8.202   1.00 0.00 ? 15 THR A OG1  7  
ATOM 7439  C CG2  . THR A 1 15 ? -9.449  -3.362  6.080   1.00 0.00 ? 15 THR A CG2  7  
ATOM 7440  H H    . THR A 1 15 ? -5.624  -3.146  7.540   1.00 0.00 ? 15 THR A H    7  
ATOM 7441  H HA   . THR A 1 15 ? -7.645  -5.198  6.898   1.00 0.00 ? 15 THR A HA   7  
ATOM 7442  H HB   . THR A 1 15 ? -7.683  -2.201  6.435   1.00 0.00 ? 15 THR A HB   7  
ATOM 7443  H HG1  . THR A 1 15 ? -7.712  -3.510  8.665   1.00 0.00 ? 15 THR A HG1  7  
ATOM 7444  H HG21 . THR A 1 15 ? -9.845  -4.322  6.374   1.00 0.00 ? 15 THR A HG21 7  
ATOM 7445  H HG22 . THR A 1 15 ? -9.281  -3.351  5.014   1.00 0.00 ? 15 THR A HG22 7  
ATOM 7446  H HG23 . THR A 1 15 ? -10.155 -2.586  6.341   1.00 0.00 ? 15 THR A HG23 7  
ATOM 7447  N N    . ARG A 1 16 ? -7.377  -5.422  4.432   1.00 0.00 ? 16 ARG A N    7  
ATOM 7448  C CA   . ARG A 1 16 ? -7.161  -5.598  2.968   1.00 0.00 ? 16 ARG A CA   7  
ATOM 7449  C C    . ARG A 1 16 ? -8.328  -6.414  2.404   1.00 0.00 ? 16 ARG A C    7  
ATOM 7450  O O    . ARG A 1 16 ? -8.942  -7.156  3.136   1.00 0.00 ? 16 ARG A O    7  
ATOM 7451  C CB   . ARG A 1 16 ? -5.848  -6.355  2.721   1.00 0.00 ? 16 ARG A CB   7  
ATOM 7452  C CG   . ARG A 1 16 ? -5.799  -7.653  3.573   1.00 0.00 ? 16 ARG A CG   7  
ATOM 7453  C CD   . ARG A 1 16 ? -4.851  -7.481  4.767   1.00 0.00 ? 16 ARG A CD   7  
ATOM 7454  N NE   . ARG A 1 16 ? -3.440  -7.525  4.285   1.00 0.00 ? 16 ARG A NE   7  
ATOM 7455  C CZ   . ARG A 1 16 ? -2.471  -7.134  5.066   1.00 0.00 ? 16 ARG A CZ   7  
ATOM 7456  N NH1  . ARG A 1 16 ? -2.733  -6.726  6.275   1.00 0.00 ? 16 ARG A NH1  7  
ATOM 7457  N NH2  . ARG A 1 16 ? -1.238  -7.157  4.639   1.00 0.00 ? 16 ARG A NH2  7  
ATOM 7458  H H    . ARG A 1 16 ? -7.904  -6.084  4.924   1.00 0.00 ? 16 ARG A H    7  
ATOM 7459  H HA   . ARG A 1 16 ? -7.123  -4.634  2.486   1.00 0.00 ? 16 ARG A HA   7  
ATOM 7460  H HB2  . ARG A 1 16 ? -5.783  -6.608  1.671   1.00 0.00 ? 16 ARG A HB2  7  
ATOM 7461  H HB3  . ARG A 1 16 ? -5.016  -5.713  2.980   1.00 0.00 ? 16 ARG A HB3  7  
ATOM 7462  H HG2  . ARG A 1 16 ? -6.789  -7.892  3.941   1.00 0.00 ? 16 ARG A HG2  7  
ATOM 7463  H HG3  . ARG A 1 16 ? -5.447  -8.473  2.962   1.00 0.00 ? 16 ARG A HG3  7  
ATOM 7464  H HD2  . ARG A 1 16 ? -5.037  -6.531  5.244   1.00 0.00 ? 16 ARG A HD2  7  
ATOM 7465  H HD3  . ARG A 1 16 ? -5.017  -8.278  5.478   1.00 0.00 ? 16 ARG A HD3  7  
ATOM 7466  H HE   . ARG A 1 16 ? -3.242  -7.842  3.379   1.00 0.00 ? 16 ARG A HE   7  
ATOM 7467  H HH11 . ARG A 1 16 ? -3.678  -6.712  6.604   1.00 0.00 ? 16 ARG A HH11 7  
ATOM 7468  H HH12 . ARG A 1 16 ? -1.991  -6.426  6.874   1.00 0.00 ? 16 ARG A HH12 7  
ATOM 7469  H HH21 . ARG A 1 16 ? -1.035  -7.473  3.714   1.00 0.00 ? 16 ARG A HH21 7  
ATOM 7470  H HH22 . ARG A 1 16 ? -0.496  -6.856  5.239   1.00 0.00 ? 16 ARG A HH22 7  
ATOM 7471  N N    . ARG A 1 17 ? -8.634  -6.249  1.123   1.00 0.00 ? 17 ARG A N    7  
ATOM 7472  C CA   . ARG A 1 17 ? -9.776  -6.983  0.443   1.00 0.00 ? 17 ARG A CA   7  
ATOM 7473  C C    . ARG A 1 17 ? -10.929 -6.002  0.184   1.00 0.00 ? 17 ARG A C    7  
ATOM 7474  O O    . ARG A 1 17 ? -11.189 -5.648  -0.947  1.00 0.00 ? 17 ARG A O    7  
ATOM 7475  C CB   . ARG A 1 17 ? -10.290 -8.177  1.274   1.00 0.00 ? 17 ARG A CB   7  
ATOM 7476  C CG   . ARG A 1 17 ? -11.199 -9.070  0.418   1.00 0.00 ? 17 ARG A CG   7  
ATOM 7477  C CD   . ARG A 1 17 ? -11.389 -10.419 1.117   1.00 0.00 ? 17 ARG A CD   7  
ATOM 7478  N NE   . ARG A 1 17 ? -12.193 -11.323 0.248   1.00 0.00 ? 17 ARG A NE   7  
ATOM 7479  C CZ   . ARG A 1 17 ? -12.222 -12.605 0.492   1.00 0.00 ? 17 ARG A CZ   7  
ATOM 7480  N NH1  . ARG A 1 17 ? -11.544 -13.093 1.496   1.00 0.00 ? 17 ARG A NH1  7  
ATOM 7481  N NH2  . ARG A 1 17 ? -12.927 -13.398 -0.266  1.00 0.00 ? 17 ARG A NH2  7  
ATOM 7482  H H    . ARG A 1 17 ? -8.110  -5.604  0.592   1.00 0.00 ? 17 ARG A H    7  
ATOM 7483  H HA   . ARG A 1 17 ? -9.421  -7.344  -0.508  1.00 0.00 ? 17 ARG A HA   7  
ATOM 7484  H HB2  . ARG A 1 17 ? -9.451  -8.761  1.620   1.00 0.00 ? 17 ARG A HB2  7  
ATOM 7485  H HB3  . ARG A 1 17 ? -10.857 -7.812  2.118   1.00 0.00 ? 17 ARG A HB3  7  
ATOM 7486  H HG2  . ARG A 1 17 ? -12.160 -8.592  0.298   1.00 0.00 ? 17 ARG A HG2  7  
ATOM 7487  H HG3  . ARG A 1 17 ? -10.749 -9.230  -0.549  1.00 0.00 ? 17 ARG A HG3  7  
ATOM 7488  H HD2  . ARG A 1 17 ? -10.424 -10.866 1.305   1.00 0.00 ? 17 ARG A HD2  7  
ATOM 7489  H HD3  . ARG A 1 17 ? -11.904 -10.270 2.054   1.00 0.00 ? 17 ARG A HD3  7  
ATOM 7490  H HE   . ARG A 1 17 ? -12.700 -10.956 -0.506  1.00 0.00 ? 17 ARG A HE   7  
ATOM 7491  H HH11 . ARG A 1 17 ? -11.004 -12.484 2.077   1.00 0.00 ? 17 ARG A HH11 7  
ATOM 7492  H HH12 . ARG A 1 17 ? -11.567 -14.074 1.683   1.00 0.00 ? 17 ARG A HH12 7  
ATOM 7493  H HH21 . ARG A 1 17 ? -13.445 -13.025 -1.036  1.00 0.00 ? 17 ARG A HH21 7  
ATOM 7494  H HH22 . ARG A 1 17 ? -12.949 -14.380 -0.079  1.00 0.00 ? 17 ARG A HH22 7  
ATOM 7495  N N    . SER A 1 18 ? -11.625 -5.589  1.223   1.00 0.00 ? 18 SER A N    7  
ATOM 7496  C CA   . SER A 1 18 ? -12.792 -4.627  1.069   1.00 0.00 ? 18 SER A CA   7  
ATOM 7497  C C    . SER A 1 18 ? -12.540 -3.663  -0.099  1.00 0.00 ? 18 SER A C    7  
ATOM 7498  O O    . SER A 1 18 ? -13.449 -3.226  -0.775  1.00 0.00 ? 18 SER A O    7  
ATOM 7499  C CB   . SER A 1 18 ? -12.957 -3.824  2.360   1.00 0.00 ? 18 SER A CB   7  
ATOM 7500  O OG   . SER A 1 18 ? -14.021 -2.894  2.201   1.00 0.00 ? 18 SER A OG   7  
ATOM 7501  H H    . SER A 1 18 ? -11.389 -5.940  2.111   1.00 0.00 ? 18 SER A H    7  
ATOM 7502  H HA   . SER A 1 18 ? -13.704 -5.184  0.875   1.00 0.00 ? 18 SER A HA   7  
ATOM 7503  H HB2  . SER A 1 18 ? -13.187 -4.489  3.175   1.00 0.00 ? 18 SER A HB2  7  
ATOM 7504  H HB3  . SER A 1 18 ? -12.035 -3.299  2.577   1.00 0.00 ? 18 SER A HB3  7  
ATOM 7505  H HG   . SER A 1 18 ? -14.431 -3.056  1.349   1.00 0.00 ? 18 SER A HG   7  
ATOM 7506  N N    . CYS A 1 19 ? -11.295 -3.395  -0.368  1.00 0.00 ? 19 CYS A N    7  
ATOM 7507  C CA   . CYS A 1 19 ? -10.936 -2.531  -1.529  1.00 0.00 ? 19 CYS A CA   7  
ATOM 7508  C C    . CYS A 1 19 ? -9.594  -3.002  -2.084  1.00 0.00 ? 19 CYS A C    7  
ATOM 7509  O O    . CYS A 1 19 ? -8.921  -3.816  -1.482  1.00 0.00 ? 19 CYS A O    7  
ATOM 7510  C CB   . CYS A 1 19 ? -10.865 -1.060  -1.104  1.00 0.00 ? 19 CYS A CB   7  
ATOM 7511  S SG   . CYS A 1 19 ? -10.644 0.027   -2.552  1.00 0.00 ? 19 CYS A SG   7  
ATOM 7512  H H    . CYS A 1 19 ? -10.616 -3.837  0.178   1.00 0.00 ? 19 CYS A H    7  
ATOM 7513  H HA   . CYS A 1 19 ? -11.691 -2.654  -2.288  1.00 0.00 ? 19 CYS A HA   7  
ATOM 7514  H HB2  . CYS A 1 19 ? -11.780 -0.793  -0.597  1.00 0.00 ? 19 CYS A HB2  7  
ATOM 7515  H HB3  . CYS A 1 19 ? -10.033 -0.927  -0.428  1.00 0.00 ? 19 CYS A HB3  7  
ATOM 7516  N N    . SER A 1 20 ? -9.196  -2.518  -3.224  1.00 0.00 ? 20 SER A N    7  
ATOM 7517  C CA   . SER A 1 20 ? -7.901  -2.966  -3.794  1.00 0.00 ? 20 SER A CA   7  
ATOM 7518  C C    . SER A 1 20 ? -6.765  -2.504  -2.885  1.00 0.00 ? 20 SER A C    7  
ATOM 7519  O O    . SER A 1 20 ? -6.568  -1.323  -2.675  1.00 0.00 ? 20 SER A O    7  
ATOM 7520  C CB   . SER A 1 20 ? -7.721  -2.369  -5.192  1.00 0.00 ? 20 SER A CB   7  
ATOM 7521  O OG   . SER A 1 20 ? -8.954  -2.444  -5.895  1.00 0.00 ? 20 SER A OG   7  
ATOM 7522  H H    . SER A 1 20 ? -9.741  -1.867  -3.704  1.00 0.00 ? 20 SER A H    7  
ATOM 7523  H HA   . SER A 1 20 ? -7.893  -4.046  -3.860  1.00 0.00 ? 20 SER A HA   7  
ATOM 7524  H HB2  . SER A 1 20 ? -7.421  -1.337  -5.112  1.00 0.00 ? 20 SER A HB2  7  
ATOM 7525  H HB3  . SER A 1 20 ? -6.957  -2.923  -5.723  1.00 0.00 ? 20 SER A HB3  7  
ATOM 7526  H HG   . SER A 1 20 ? -9.525  -1.744  -5.568  1.00 0.00 ? 20 SER A HG   7  
ATOM 7527  N N    . LYS A 1 21 ? -6.007  -3.429  -2.356  1.00 0.00 ? 21 LYS A N    7  
ATOM 7528  C CA   . LYS A 1 21 ? -4.859  -3.062  -1.463  1.00 0.00 ? 21 LYS A CA   7  
ATOM 7529  C C    . LYS A 1 21 ? -3.637  -3.857  -1.906  1.00 0.00 ? 21 LYS A C    7  
ATOM 7530  O O    . LYS A 1 21 ? -3.586  -5.066  -1.797  1.00 0.00 ? 21 LYS A O    7  
ATOM 7531  C CB   . LYS A 1 21 ? -5.189  -3.369  0.014   1.00 0.00 ? 21 LYS A CB   7  
ATOM 7532  C CG   . LYS A 1 21 ? -6.057  -2.238  0.605   1.00 0.00 ? 21 LYS A CG   7  
ATOM 7533  C CD   . LYS A 1 21 ? -5.166  -1.116  1.158   1.00 0.00 ? 21 LYS A CD   7  
ATOM 7534  C CE   . LYS A 1 21 ? -6.023  0.110   1.474   1.00 0.00 ? 21 LYS A CE   7  
ATOM 7535  N NZ   . LYS A 1 21 ? -6.934  -0.202  2.611   1.00 0.00 ? 21 LYS A NZ   7  
ATOM 7536  H H    . LYS A 1 21 ? -6.189  -4.374  -2.555  1.00 0.00 ? 21 LYS A H    7  
ATOM 7537  H HA   . LYS A 1 21 ? -4.639  -2.008  -1.569  1.00 0.00 ? 21 LYS A HA   7  
ATOM 7538  H HB2  . LYS A 1 21 ? -5.723  -4.306  0.084   1.00 0.00 ? 21 LYS A HB2  7  
ATOM 7539  H HB3  . LYS A 1 21 ? -4.269  -3.446  0.578   1.00 0.00 ? 21 LYS A HB3  7  
ATOM 7540  H HG2  . LYS A 1 21 ? -6.704  -1.835  -0.161  1.00 0.00 ? 21 LYS A HG2  7  
ATOM 7541  H HG3  . LYS A 1 21 ? -6.662  -2.633  1.406   1.00 0.00 ? 21 LYS A HG3  7  
ATOM 7542  H HD2  . LYS A 1 21 ? -4.679  -1.457  2.060   1.00 0.00 ? 21 LYS A HD2  7  
ATOM 7543  H HD3  . LYS A 1 21 ? -4.419  -0.851  0.426   1.00 0.00 ? 21 LYS A HD3  7  
ATOM 7544  H HE2  . LYS A 1 21 ? -5.383  0.938   1.743   1.00 0.00 ? 21 LYS A HE2  7  
ATOM 7545  H HE3  . LYS A 1 21 ? -6.609  0.376   0.606   1.00 0.00 ? 21 LYS A HE3  7  
ATOM 7546  H HZ1  . LYS A 1 21 ? -7.467  0.650   2.875   1.00 0.00 ? 21 LYS A HZ1  7  
ATOM 7547  H HZ2  . LYS A 1 21 ? -6.375  -0.524  3.426   1.00 0.00 ? 21 LYS A HZ2  7  
ATOM 7548  H HZ3  . LYS A 1 21 ? -7.597  -0.953  2.328   1.00 0.00 ? 21 LYS A HZ3  7  
ATOM 7549  N N    . VAL A 1 22 ? -2.649  -3.162  -2.398  1.00 0.00 ? 22 VAL A N    7  
ATOM 7550  C CA   . VAL A 1 22 ? -1.392  -3.827  -2.856  1.00 0.00 ? 22 VAL A CA   7  
ATOM 7551  C C    . VAL A 1 22 ? -0.198  -3.182  -2.160  1.00 0.00 ? 22 VAL A C    7  
ATOM 7552  O O    . VAL A 1 22 ? 0.066   -2.008  -2.335  1.00 0.00 ? 22 VAL A O    7  
ATOM 7553  C CB   . VAL A 1 22 ? -1.264  -3.665  -4.369  1.00 0.00 ? 22 VAL A CB   7  
ATOM 7554  C CG1  . VAL A 1 22 ? 0.012   -4.361  -4.851  1.00 0.00 ? 22 VAL A CG1  7  
ATOM 7555  C CG2  . VAL A 1 22 ? -2.483  -4.300  -5.046  1.00 0.00 ? 22 VAL A CG2  7  
ATOM 7556  H H    . VAL A 1 22 ? -2.743  -2.187  -2.425  1.00 0.00 ? 22 VAL A H    7  
ATOM 7557  H HA   . VAL A 1 22 ? -1.419  -4.881  -2.612  1.00 0.00 ? 22 VAL A HA   7  
ATOM 7558  H HB   . VAL A 1 22 ? -1.217  -2.616  -4.619  1.00 0.00 ? 22 VAL A HB   7  
ATOM 7559  H HG11 . VAL A 1 22 ? 0.102   -5.324  -4.370  1.00 0.00 ? 22 VAL A HG11 7  
ATOM 7560  H HG12 . VAL A 1 22 ? 0.869   -3.753  -4.600  1.00 0.00 ? 22 VAL A HG12 7  
ATOM 7561  H HG13 . VAL A 1 22 ? -0.033  -4.495  -5.922  1.00 0.00 ? 22 VAL A HG13 7  
ATOM 7562  H HG21 . VAL A 1 22 ? -3.383  -3.988  -4.535  1.00 0.00 ? 22 VAL A HG21 7  
ATOM 7563  H HG22 . VAL A 1 22 ? -2.401  -5.376  -5.001  1.00 0.00 ? 22 VAL A HG22 7  
ATOM 7564  H HG23 . VAL A 1 22 ? -2.528  -3.986  -6.077  1.00 0.00 ? 22 VAL A HG23 7  
ATOM 7565  N N    . ILE A 1 23 ? 0.534   -3.936  -1.379  1.00 0.00 ? 23 ILE A N    7  
ATOM 7566  C CA   . ILE A 1 23 ? 1.725   -3.369  -0.672  1.00 0.00 ? 23 ILE A CA   7  
ATOM 7567  C C    . ILE A 1 23 ? 2.983   -3.999  -1.275  1.00 0.00 ? 23 ILE A C    7  
ATOM 7568  O O    . ILE A 1 23 ? 3.246   -5.171  -1.090  1.00 0.00 ? 23 ILE A O    7  
ATOM 7569  C CB   . ILE A 1 23 ? 1.643   -3.714  0.822   1.00 0.00 ? 23 ILE A CB   7  
ATOM 7570  C CG1  . ILE A 1 23 ? 0.491   -2.930  1.481   1.00 0.00 ? 23 ILE A CG1  7  
ATOM 7571  C CG2  . ILE A 1 23 ? 2.958   -3.336  1.508   1.00 0.00 ? 23 ILE A CG2  7  
ATOM 7572  C CD1  . ILE A 1 23 ? -0.878  -3.417  0.965   1.00 0.00 ? 23 ILE A CD1  7  
ATOM 7573  H H    . ILE A 1 23 ? 0.304   -4.882  -1.252  1.00 0.00 ? 23 ILE A H    7  
ATOM 7574  H HA   . ILE A 1 23 ? 1.766   -2.295  -0.793  1.00 0.00 ? 23 ILE A HA   7  
ATOM 7575  H HB   . ILE A 1 23 ? 1.472   -4.774  0.938   1.00 0.00 ? 23 ILE A HB   7  
ATOM 7576  H HG12 . ILE A 1 23 ? 0.535   -3.068  2.552   1.00 0.00 ? 23 ILE A HG12 7  
ATOM 7577  H HG13 . ILE A 1 23 ? 0.601   -1.877  1.256   1.00 0.00 ? 23 ILE A HG13 7  
ATOM 7578  H HG21 . ILE A 1 23 ? 3.725   -4.044  1.229   1.00 0.00 ? 23 ILE A HG21 7  
ATOM 7579  H HG22 . ILE A 1 23 ? 2.823   -3.355  2.579   1.00 0.00 ? 23 ILE A HG22 7  
ATOM 7580  H HG23 . ILE A 1 23 ? 3.254   -2.345  1.199   1.00 0.00 ? 23 ILE A HG23 7  
ATOM 7581  H HD11 . ILE A 1 23 ? -0.796  -4.422  0.572   1.00 0.00 ? 23 ILE A HD11 7  
ATOM 7582  H HD12 . ILE A 1 23 ? -1.226  -2.754  0.188   1.00 0.00 ? 23 ILE A HD12 7  
ATOM 7583  H HD13 . ILE A 1 23 ? -1.588  -3.414  1.779   1.00 0.00 ? 23 ILE A HD13 7  
ATOM 7584  N N    . THR A 1 24 ? 3.757   -3.229  -2.002  1.00 0.00 ? 24 THR A N    7  
ATOM 7585  C CA   . THR A 1 24 ? 5.000   -3.764  -2.634  1.00 0.00 ? 24 THR A CA   7  
ATOM 7586  C C    . THR A 1 24 ? 6.206   -2.930  -2.188  1.00 0.00 ? 24 THR A C    7  
ATOM 7587  O O    . THR A 1 24 ? 6.360   -1.793  -2.586  1.00 0.00 ? 24 THR A O    7  
ATOM 7588  C CB   . THR A 1 24 ? 4.865   -3.670  -4.159  1.00 0.00 ? 24 THR A CB   7  
ATOM 7589  O OG1  . THR A 1 24 ? 6.158   -3.614  -4.745  1.00 0.00 ? 24 THR A OG1  7  
ATOM 7590  C CG2  . THR A 1 24 ? 4.081   -2.409  -4.529  1.00 0.00 ? 24 THR A CG2  7  
ATOM 7591  H H    . THR A 1 24 ? 3.523   -2.297  -2.143  1.00 0.00 ? 24 THR A H    7  
ATOM 7592  H HA   . THR A 1 24 ? 5.148   -4.788  -2.356  1.00 0.00 ? 24 THR A HA   7  
ATOM 7593  H HB   . THR A 1 24 ? 4.338   -4.536  -4.531  1.00 0.00 ? 24 THR A HB   7  
ATOM 7594  H HG1  . THR A 1 24 ? 6.212   -4.303  -5.411  1.00 0.00 ? 24 THR A HG1  7  
ATOM 7595  H HG21 . THR A 1 24 ? 4.516   -1.555  -4.031  1.00 0.00 ? 24 THR A HG21 7  
ATOM 7596  H HG22 . THR A 1 24 ? 3.053   -2.520  -4.217  1.00 0.00 ? 24 THR A HG22 7  
ATOM 7597  H HG23 . THR A 1 24 ? 4.120   -2.261  -5.598  1.00 0.00 ? 24 THR A HG23 7  
ATOM 7598  N N    . LYS A 1 25 ? 7.084   -3.501  -1.396  1.00 0.00 ? 25 LYS A N    7  
ATOM 7599  C CA   . LYS A 1 25 ? 8.311   -2.772  -0.955  1.00 0.00 ? 25 LYS A CA   7  
ATOM 7600  C C    . LYS A 1 25 ? 9.479   -3.611  -1.425  1.00 0.00 ? 25 LYS A C    7  
ATOM 7601  O O    . LYS A 1 25 ? 9.716   -4.683  -0.903  1.00 0.00 ? 25 LYS A O    7  
ATOM 7602  C CB   . LYS A 1 25 ? 8.334   -2.652  0.577   1.00 0.00 ? 25 LYS A CB   7  
ATOM 7603  C CG   . LYS A 1 25 ? 9.357   -1.593  0.998   1.00 0.00 ? 25 LYS A CG   7  
ATOM 7604  C CD   . LYS A 1 25 ? 9.287   -1.379  2.516   1.00 0.00 ? 25 LYS A CD   7  
ATOM 7605  C CE   . LYS A 1 25 ? 9.586   -2.693  3.252   1.00 0.00 ? 25 LYS A CE   7  
ATOM 7606  N NZ   . LYS A 1 25 ? 10.063  -2.391  4.631   1.00 0.00 ? 25 LYS A NZ   7  
ATOM 7607  H H    . LYS A 1 25 ? 6.965   -4.438  -1.124  1.00 0.00 ? 25 LYS A H    7  
ATOM 7608  H HA   . LYS A 1 25 ? 8.361   -1.786  -1.408  1.00 0.00 ? 25 LYS A HA   7  
ATOM 7609  H HB2  . LYS A 1 25 ? 7.355   -2.365  0.931   1.00 0.00 ? 25 LYS A HB2  7  
ATOM 7610  H HB3  . LYS A 1 25 ? 8.609   -3.601  1.010   1.00 0.00 ? 25 LYS A HB3  7  
ATOM 7611  H HG2  . LYS A 1 25 ? 10.349  -1.926  0.727   1.00 0.00 ? 25 LYS A HG2  7  
ATOM 7612  H HG3  . LYS A 1 25 ? 9.140   -0.662  0.495   1.00 0.00 ? 25 LYS A HG3  7  
ATOM 7613  H HD2  . LYS A 1 25 ? 10.013  -0.633  2.805   1.00 0.00 ? 25 LYS A HD2  7  
ATOM 7614  H HD3  . LYS A 1 25 ? 8.298   -1.037  2.783   1.00 0.00 ? 25 LYS A HD3  7  
ATOM 7615  H HE2  . LYS A 1 25 ? 8.686   -3.287  3.309   1.00 0.00 ? 25 LYS A HE2  7  
ATOM 7616  H HE3  . LYS A 1 25 ? 10.350  -3.244  2.720   1.00 0.00 ? 25 LYS A HE3  7  
ATOM 7617  H HZ1  . LYS A 1 25 ? 10.605  -1.503  4.624   1.00 0.00 ? 25 LYS A HZ1  7  
ATOM 7618  H HZ2  . LYS A 1 25 ? 10.674  -3.164  4.964   1.00 0.00 ? 25 LYS A HZ2  7  
ATOM 7619  H HZ3  . LYS A 1 25 ? 9.246   -2.294  5.267   1.00 0.00 ? 25 LYS A HZ3  7  
ATOM 7620  N N    . THR A 1 26 ? 10.196  -3.166  -2.418  1.00 0.00 ? 26 THR A N    7  
ATOM 7621  C CA   . THR A 1 26 ? 11.332  -3.979  -2.934  1.00 0.00 ? 26 THR A CA   7  
ATOM 7622  C C    . THR A 1 26 ? 12.657  -3.306  -2.567  1.00 0.00 ? 26 THR A C    7  
ATOM 7623  O O    . THR A 1 26 ? 12.930  -2.202  -2.995  1.00 0.00 ? 26 THR A O    7  
ATOM 7624  C CB   . THR A 1 26 ? 11.220  -4.072  -4.459  1.00 0.00 ? 26 THR A CB   7  
ATOM 7625  O OG1  . THR A 1 26 ? 9.948   -4.602  -4.804  1.00 0.00 ? 26 THR A OG1  7  
ATOM 7626  C CG2  . THR A 1 26 ? 12.319  -4.985  -5.004  1.00 0.00 ? 26 THR A CG2  7  
ATOM 7627  H H    . THR A 1 26 ? 9.972   -2.310  -2.839  1.00 0.00 ? 26 THR A H    7  
ATOM 7628  H HA   . THR A 1 26 ? 11.288  -4.976  -2.513  1.00 0.00 ? 26 THR A HA   7  
ATOM 7629  H HB   . THR A 1 26 ? 11.330  -3.088  -4.888  1.00 0.00 ? 26 THR A HB   7  
ATOM 7630  H HG1  . THR A 1 26 ? 9.597   -5.058  -4.035  1.00 0.00 ? 26 THR A HG1  7  
ATOM 7631  H HG21 . THR A 1 26 ? 12.209  -5.080  -6.074  1.00 0.00 ? 26 THR A HG21 7  
ATOM 7632  H HG22 . THR A 1 26 ? 12.238  -5.959  -4.545  1.00 0.00 ? 26 THR A HG22 7  
ATOM 7633  H HG23 . THR A 1 26 ? 13.286  -4.560  -4.778  1.00 0.00 ? 26 THR A HG23 7  
ATOM 7634  N N    . VAL A 1 27 ? 13.490  -3.961  -1.788  1.00 0.00 ? 27 VAL A N    7  
ATOM 7635  C CA   . VAL A 1 27 ? 14.812  -3.353  -1.402  1.00 0.00 ? 27 VAL A CA   7  
ATOM 7636  C C    . VAL A 1 27 ? 15.943  -4.079  -2.137  1.00 0.00 ? 27 VAL A C    7  
ATOM 7637  O O    . VAL A 1 27 ? 16.203  -5.246  -1.919  1.00 0.00 ? 27 VAL A O    7  
ATOM 7638  C CB   . VAL A 1 27 ? 15.040  -3.435  0.123   1.00 0.00 ? 27 VAL A CB   7  
ATOM 7639  C CG1  . VAL A 1 27 ? 14.203  -2.360  0.821   1.00 0.00 ? 27 VAL A CG1  7  
ATOM 7640  C CG2  . VAL A 1 27 ? 14.652  -4.817  0.679   1.00 0.00 ? 27 VAL A CG2  7  
ATOM 7641  H H    . VAL A 1 27 ? 13.252  -4.850  -1.460  1.00 0.00 ? 27 VAL A H    7  
ATOM 7642  H HA   . VAL A 1 27 ? 14.832  -2.311  -1.698  1.00 0.00 ? 27 VAL A HA   7  
ATOM 7643  H HB   . VAL A 1 27 ? 16.086  -3.250  0.330   1.00 0.00 ? 27 VAL A HB   7  
ATOM 7644  H HG11 . VAL A 1 27 ? 13.164  -2.483  0.554   1.00 0.00 ? 27 VAL A HG11 7  
ATOM 7645  H HG12 . VAL A 1 27 ? 14.541  -1.382  0.510   1.00 0.00 ? 27 VAL A HG12 7  
ATOM 7646  H HG13 . VAL A 1 27 ? 14.313  -2.455  1.891   1.00 0.00 ? 27 VAL A HG13 7  
ATOM 7647  H HG21 . VAL A 1 27 ? 14.979  -5.591  0.004   1.00 0.00 ? 27 VAL A HG21 7  
ATOM 7648  H HG22 . VAL A 1 27 ? 13.581  -4.874  0.808   1.00 0.00 ? 27 VAL A HG22 7  
ATOM 7649  H HG23 . VAL A 1 27 ? 15.130  -4.959  1.637   1.00 0.00 ? 27 VAL A HG23 7  
ATOM 7650  N N    . THR A 1 28 ? 16.609  -3.379  -3.020  1.00 0.00 ? 28 THR A N    7  
ATOM 7651  C CA   . THR A 1 28 ? 17.731  -3.997  -3.798  1.00 0.00 ? 28 THR A CA   7  
ATOM 7652  C C    . THR A 1 28 ? 19.074  -3.468  -3.294  1.00 0.00 ? 28 THR A C    7  
ATOM 7653  O O    . THR A 1 28 ? 19.449  -2.347  -3.576  1.00 0.00 ? 28 THR A O    7  
ATOM 7654  C CB   . THR A 1 28 ? 17.570  -3.638  -5.279  1.00 0.00 ? 28 THR A CB   7  
ATOM 7655  O OG1  . THR A 1 28 ? 17.224  -2.266  -5.397  1.00 0.00 ? 28 THR A OG1  7  
ATOM 7656  C CG2  . THR A 1 28 ? 16.467  -4.498  -5.900  1.00 0.00 ? 28 THR A CG2  7  
ATOM 7657  H H    . THR A 1 28 ? 16.352  -2.443  -3.160  1.00 0.00 ? 28 THR A H    7  
ATOM 7658  H HA   . THR A 1 28 ? 17.711  -5.069  -3.688  1.00 0.00 ? 28 THR A HA   7  
ATOM 7659  H HB   . THR A 1 28 ? 18.497  -3.822  -5.800  1.00 0.00 ? 28 THR A HB   7  
ATOM 7660  H HG1  . THR A 1 28 ? 16.319  -2.161  -5.097  1.00 0.00 ? 28 THR A HG1  7  
ATOM 7661  H HG21 . THR A 1 28 ? 16.697  -5.542  -5.749  1.00 0.00 ? 28 THR A HG21 7  
ATOM 7662  H HG22 . THR A 1 28 ? 16.403  -4.293  -6.958  1.00 0.00 ? 28 THR A HG22 7  
ATOM 7663  H HG23 . THR A 1 28 ? 15.523  -4.264  -5.430  1.00 0.00 ? 28 THR A HG23 7  
ATOM 7664  N N    . ASN A 1 29 ? 19.811  -4.264  -2.553  1.00 0.00 ? 29 ASN A N    7  
ATOM 7665  C CA   . ASN A 1 29 ? 21.137  -3.807  -2.035  1.00 0.00 ? 29 ASN A CA   7  
ATOM 7666  C C    . ASN A 1 29 ? 22.254  -4.400  -2.900  1.00 0.00 ? 29 ASN A C    7  
ATOM 7667  O O    . ASN A 1 29 ? 22.456  -5.606  -2.947  1.00 0.00 ? 29 ASN A O    7  
ATOM 7668  C CB   . ASN A 1 29 ? 21.307  -4.280  -0.592  1.00 0.00 ? 29 ASN A CB   7  
ATOM 7669  C CG   . ASN A 1 29 ? 22.615  -3.728  -0.019  1.00 0.00 ? 29 ASN A CG   7  
ATOM 7670  O OD1  . ASN A 1 29 ? 23.431  -3.194  -0.742  1.00 0.00 ? 29 ASN A OD1  7  
ATOM 7671  N ND2  . ASN A 1 29 ? 22.847  -3.837  1.261   1.00 0.00 ? 29 ASN A ND2  7  
ATOM 7672  H H    . ASN A 1 29 ? 19.499  -5.163  -2.318  1.00 0.00 ? 29 ASN A H    7  
ATOM 7673  H HA   . ASN A 1 29 ? 21.196  -2.727  -2.065  1.00 0.00 ? 29 ASN A HA   7  
ATOM 7674  H HB2  . ASN A 1 29 ? 20.477  -3.927  0.001   1.00 0.00 ? 29 ASN A HB2  7  
ATOM 7675  H HB3  . ASN A 1 29 ? 21.333  -5.356  -0.568  1.00 0.00 ? 29 ASN A HB3  7  
ATOM 7676  H HD21 . ASN A 1 29 ? 22.187  -4.268  1.844   1.00 0.00 ? 29 ASN A HD21 7  
ATOM 7677  H HD22 . ASN A 1 29 ? 23.681  -3.487  1.639   1.00 0.00 ? 29 ASN A HD22 7  
ATOM 7678  N N    . ALA A 1 30 ? 22.973  -3.546  -3.576  1.00 0.00 ? 30 ALA A N    7  
ATOM 7679  C CA   . ALA A 1 30 ? 24.090  -3.991  -4.458  1.00 0.00 ? 30 ALA A CA   7  
ATOM 7680  C C    . ALA A 1 30 ? 24.991  -4.985  -3.726  1.00 0.00 ? 30 ALA A C    7  
ATOM 7681  O O    . ALA A 1 30 ? 25.877  -5.572  -4.315  1.00 0.00 ? 30 ALA A O    7  
ATOM 7682  C CB   . ALA A 1 30 ? 24.917  -2.774  -4.879  1.00 0.00 ? 30 ALA A CB   7  
ATOM 7683  H H    . ALA A 1 30 ? 22.774  -2.588  -3.506  1.00 0.00 ? 30 ALA A H    7  
ATOM 7684  H HA   . ALA A 1 30 ? 23.681  -4.463  -5.339  1.00 0.00 ? 30 ALA A HA   7  
ATOM 7685  H HB1  . ALA A 1 30 ? 25.677  -3.082  -5.582  1.00 0.00 ? 30 ALA A HB1  7  
ATOM 7686  H HB2  . ALA A 1 30 ? 25.386  -2.340  -4.009  1.00 0.00 ? 30 ALA A HB2  7  
ATOM 7687  H HB3  . ALA A 1 30 ? 24.272  -2.043  -5.343  1.00 0.00 ? 30 ALA A HB3  7  
ATOM 7688  N N    . ASP A 1 31 ? 24.802  -5.169  -2.450  1.00 0.00 ? 31 ASP A N    7  
ATOM 7689  C CA   . ASP A 1 31 ? 25.685  -6.112  -1.712  1.00 0.00 ? 31 ASP A CA   7  
ATOM 7690  C C    . ASP A 1 31 ? 25.414  -7.545  -2.178  1.00 0.00 ? 31 ASP A C    7  
ATOM 7691  O O    . ASP A 1 31 ? 26.091  -8.470  -1.774  1.00 0.00 ? 31 ASP A O    7  
ATOM 7692  C CB   . ASP A 1 31 ? 25.417  -5.992  -0.208  1.00 0.00 ? 31 ASP A CB   7  
ATOM 7693  C CG   . ASP A 1 31 ? 26.194  -7.078  0.540   1.00 0.00 ? 31 ASP A CG   7  
ATOM 7694  O OD1  . ASP A 1 31 ? 27.392  -6.917  0.702   1.00 0.00 ? 31 ASP A OD1  7  
ATOM 7695  O OD2  . ASP A 1 31 ? 25.576  -8.053  0.938   1.00 0.00 ? 31 ASP A OD2  7  
ATOM 7696  H H    . ASP A 1 31 ? 24.096  -4.683  -1.973  1.00 0.00 ? 31 ASP A H    7  
ATOM 7697  H HA   . ASP A 1 31 ? 26.717  -5.863  -1.911  1.00 0.00 ? 31 ASP A HA   7  
ATOM 7698  H HB2  . ASP A 1 31 ? 25.737  -5.020  0.137   1.00 0.00 ? 31 ASP A HB2  7  
ATOM 7699  H HB3  . ASP A 1 31 ? 24.362  -6.110  -0.017  1.00 0.00 ? 31 ASP A HB3  7  
ATOM 7700  N N    . GLY A 1 32 ? 24.450  -7.741  -3.049  1.00 0.00 ? 32 GLY A N    7  
ATOM 7701  C CA   . GLY A 1 32 ? 24.170  -9.118  -3.563  1.00 0.00 ? 32 GLY A CA   7  
ATOM 7702  C C    . GLY A 1 32 ? 22.978  -9.740  -2.837  1.00 0.00 ? 32 GLY A C    7  
ATOM 7703  O O    . GLY A 1 32 ? 22.711  -10.916 -2.989  1.00 0.00 ? 32 GLY A O    7  
ATOM 7704  H H    . GLY A 1 32 ? 23.923  -6.981  -3.380  1.00 0.00 ? 32 GLY A H    7  
ATOM 7705  H HA2  . GLY A 1 32 ? 23.946  -9.060  -4.618  1.00 0.00 ? 32 GLY A HA2  7  
ATOM 7706  H HA3  . GLY A 1 32 ? 25.037  -9.748  -3.422  1.00 0.00 ? 32 GLY A HA3  7  
ATOM 7707  N N    . ARG A 1 33 ? 22.256  -8.975  -2.051  1.00 0.00 ? 33 ARG A N    7  
ATOM 7708  C CA   . ARG A 1 33 ? 21.075  -9.551  -1.319  1.00 0.00 ? 33 ARG A CA   7  
ATOM 7709  C C    . ARG A 1 33 ? 19.856  -8.662  -1.565  1.00 0.00 ? 33 ARG A C    7  
ATOM 7710  O O    . ARG A 1 33 ? 19.979  -7.475  -1.792  1.00 0.00 ? 33 ARG A O    7  
ATOM 7711  C CB   . ARG A 1 33 ? 21.404  -9.669  0.188   1.00 0.00 ? 33 ARG A CB   7  
ATOM 7712  C CG   . ARG A 1 33 ? 21.116  -8.350  0.948   1.00 0.00 ? 33 ARG A CG   7  
ATOM 7713  C CD   . ARG A 1 33 ? 19.677  -8.355  1.508   1.00 0.00 ? 33 ARG A CD   7  
ATOM 7714  N NE   . ARG A 1 33 ? 19.133  -6.961  1.522   1.00 0.00 ? 33 ARG A NE   7  
ATOM 7715  C CZ   . ARG A 1 33 ? 19.802  -5.976  2.059   1.00 0.00 ? 33 ARG A CZ   7  
ATOM 7716  N NH1  . ARG A 1 33 ? 20.884  -6.208  2.748   1.00 0.00 ? 33 ARG A NH1  7  
ATOM 7717  N NH2  . ARG A 1 33 ? 19.352  -4.756  1.952   1.00 0.00 ? 33 ARG A NH2  7  
ATOM 7718  H H    . ARG A 1 33 ? 22.484  -8.025  -1.942  1.00 0.00 ? 33 ARG A H    7  
ATOM 7719  H HA   . ARG A 1 33 ? 20.852  -10.539 -1.705  1.00 0.00 ? 33 ARG A HA   7  
ATOM 7720  H HB2  . ARG A 1 33 ? 20.814  -10.467 0.619   1.00 0.00 ? 33 ARG A HB2  7  
ATOM 7721  H HB3  . ARG A 1 33 ? 22.452  -9.916  0.294   1.00 0.00 ? 33 ARG A HB3  7  
ATOM 7722  H HG2  . ARG A 1 33 ? 21.818  -8.256  1.763   1.00 0.00 ? 33 ARG A HG2  7  
ATOM 7723  H HG3  . ARG A 1 33 ? 21.238  -7.512  0.281   1.00 0.00 ? 33 ARG A HG3  7  
ATOM 7724  H HD2  . ARG A 1 33 ? 19.042  -8.950  0.877   1.00 0.00 ? 33 ARG A HD2  7  
ATOM 7725  H HD3  . ARG A 1 33 ? 19.681  -8.785  2.507   1.00 0.00 ? 33 ARG A HD3  7  
ATOM 7726  H HE   . ARG A 1 33 ? 18.277  -6.777  1.081   1.00 0.00 ? 33 ARG A HE   7  
ATOM 7727  H HH11 . ARG A 1 33 ? 21.204  -7.143  2.876   1.00 0.00 ? 33 ARG A HH11 7  
ATOM 7728  H HH12 . ARG A 1 33 ? 21.394  -5.448  3.150   1.00 0.00 ? 33 ARG A HH12 7  
ATOM 7729  H HH21 . ARG A 1 33 ? 18.499  -4.578  1.462   1.00 0.00 ? 33 ARG A HH21 7  
ATOM 7730  H HH22 . ARG A 1 33 ? 19.862  -3.998  2.360   1.00 0.00 ? 33 ARG A HH22 7  
ATOM 7731  N N    . THR A 1 34 ? 18.682  -9.230  -1.548  1.00 0.00 ? 34 THR A N    7  
ATOM 7732  C CA   . THR A 1 34 ? 17.465  -8.412  -1.812  1.00 0.00 ? 34 THR A CA   7  
ATOM 7733  C C    . THR A 1 34 ? 16.227  -9.091  -1.219  1.00 0.00 ? 34 THR A C    7  
ATOM 7734  O O    . THR A 1 34 ? 16.086  -10.297 -1.250  1.00 0.00 ? 34 THR A O    7  
ATOM 7735  C CB   . THR A 1 34 ? 17.284  -8.257  -3.330  1.00 0.00 ? 34 THR A CB   7  
ATOM 7736  O OG1  . THR A 1 34 ? 15.901  -8.156  -3.638  1.00 0.00 ? 34 THR A OG1  7  
ATOM 7737  C CG2  . THR A 1 34 ? 17.881  -9.469  -4.051  1.00 0.00 ? 34 THR A CG2  7  
ATOM 7738  H H    . THR A 1 34 ? 18.601  -10.192 -1.380  1.00 0.00 ? 34 THR A H    7  
ATOM 7739  H HA   . THR A 1 34 ? 17.582  -7.435  -1.363  1.00 0.00 ? 34 THR A HA   7  
ATOM 7740  H HB   . THR A 1 34 ? 17.792  -7.367  -3.666  1.00 0.00 ? 34 THR A HB   7  
ATOM 7741  H HG1  . THR A 1 34 ? 15.560  -7.366  -3.213  1.00 0.00 ? 34 THR A HG1  7  
ATOM 7742  H HG21 . THR A 1 34 ? 17.511  -9.503  -5.065  1.00 0.00 ? 34 THR A HG21 7  
ATOM 7743  H HG22 . THR A 1 34 ? 17.599  -10.372 -3.532  1.00 0.00 ? 34 THR A HG22 7  
ATOM 7744  H HG23 . THR A 1 34 ? 18.960  -9.383  -4.064  1.00 0.00 ? 34 THR A HG23 7  
ATOM 7745  N N    . GLU A 1 35 ? 15.321  -8.304  -0.696  1.00 0.00 ? 35 GLU A N    7  
ATOM 7746  C CA   . GLU A 1 35 ? 14.057  -8.849  -0.105  1.00 0.00 ? 35 GLU A CA   7  
ATOM 7747  C C    . GLU A 1 35 ? 12.890  -8.294  -0.928  1.00 0.00 ? 35 GLU A C    7  
ATOM 7748  O O    . GLU A 1 35 ? 12.965  -7.184  -1.418  1.00 0.00 ? 35 GLU A O    7  
ATOM 7749  C CB   . GLU A 1 35 ? 13.942  -8.377  1.352   1.00 0.00 ? 35 GLU A CB   7  
ATOM 7750  C CG   . GLU A 1 35 ? 15.288  -8.565  2.056   1.00 0.00 ? 35 GLU A CG   7  
ATOM 7751  C CD   . GLU A 1 35 ? 15.704  -10.035 1.976   1.00 0.00 ? 35 GLU A CD   7  
ATOM 7752  O OE1  . GLU A 1 35 ? 15.030  -10.855 2.577   1.00 0.00 ? 35 GLU A OE1  7  
ATOM 7753  O OE2  . GLU A 1 35 ? 16.690  -10.317 1.313   1.00 0.00 ? 35 GLU A OE2  7  
ATOM 7754  H H    . GLU A 1 35 ? 15.467  -7.334  -0.705  1.00 0.00 ? 35 GLU A H    7  
ATOM 7755  H HA   . GLU A 1 35 ? 14.053  -9.930  -0.145  1.00 0.00 ? 35 GLU A HA   7  
ATOM 7756  H HB2  . GLU A 1 35 ? 13.670  -7.332  1.371   1.00 0.00 ? 35 GLU A HB2  7  
ATOM 7757  H HB3  . GLU A 1 35 ? 13.190  -8.953  1.868   1.00 0.00 ? 35 GLU A HB3  7  
ATOM 7758  H HG2  . GLU A 1 35 ? 16.036  -7.952  1.575   1.00 0.00 ? 35 GLU A HG2  7  
ATOM 7759  H HG3  . GLU A 1 35 ? 15.197  -8.276  3.092   1.00 0.00 ? 35 GLU A HG3  7  
ATOM 7760  N N    . THR A 1 36 ? 11.811  -9.032  -1.094  1.00 0.00 ? 36 THR A N    7  
ATOM 7761  C CA   . THR A 1 36 ? 10.668  -8.517  -1.886  1.00 0.00 ? 36 THR A CA   7  
ATOM 7762  C C    . THR A 1 36 ? 9.399   -8.741  -1.087  1.00 0.00 ? 36 THR A C    7  
ATOM 7763  O O    . THR A 1 36 ? 8.959   -9.857  -0.898  1.00 0.00 ? 36 THR A O    7  
ATOM 7764  C CB   . THR A 1 36 ? 10.575  -9.275  -3.212  1.00 0.00 ? 36 THR A CB   7  
ATOM 7765  O OG1  . THR A 1 36 ? 11.804  -9.149  -3.913  1.00 0.00 ? 36 THR A OG1  7  
ATOM 7766  C CG2  . THR A 1 36 ? 9.441   -8.690  -4.056  1.00 0.00 ? 36 THR A CG2  7  
ATOM 7767  H H    . THR A 1 36 ? 11.739  -9.923  -0.691  1.00 0.00 ? 36 THR A H    7  
ATOM 7768  H HA   . THR A 1 36 ? 10.781  -7.459  -2.081  1.00 0.00 ? 36 THR A HA   7  
ATOM 7769  H HB   . THR A 1 36 ? 10.374  -10.318 -3.019  1.00 0.00 ? 36 THR A HB   7  
ATOM 7770  H HG1  . THR A 1 36 ? 11.778  -8.329  -4.412  1.00 0.00 ? 36 THR A HG1  7  
ATOM 7771  H HG21 . THR A 1 36 ? 9.492   -9.093  -5.056  1.00 0.00 ? 36 THR A HG21 7  
ATOM 7772  H HG22 . THR A 1 36 ? 9.539   -7.616  -4.094  1.00 0.00 ? 36 THR A HG22 7  
ATOM 7773  H HG23 . THR A 1 36 ? 8.491   -8.949  -3.611  1.00 0.00 ? 36 THR A HG23 7  
ATOM 7774  N N    . THR A 1 37 ? 8.780   -7.682  -0.662  1.00 0.00 ? 37 THR A N    7  
ATOM 7775  C CA   . THR A 1 37 ? 7.498   -7.815  0.079   1.00 0.00 ? 37 THR A CA   7  
ATOM 7776  C C    . THR A 1 37 ? 6.416   -7.507  -0.931  1.00 0.00 ? 37 THR A C    7  
ATOM 7777  O O    . THR A 1 37 ? 6.342   -6.415  -1.434  1.00 0.00 ? 37 THR A O    7  
ATOM 7778  C CB   . THR A 1 37 ? 7.433   -6.804  1.227   1.00 0.00 ? 37 THR A CB   7  
ATOM 7779  O OG1  . THR A 1 37 ? 7.321   -5.495  0.690   1.00 0.00 ? 37 THR A OG1  7  
ATOM 7780  C CG2  . THR A 1 37 ? 8.696   -6.905  2.090   1.00 0.00 ? 37 THR A CG2  7  
ATOM 7781  H H    . THR A 1 37 ? 9.129   -6.790  -0.883  1.00 0.00 ? 37 THR A H    7  
ATOM 7782  H HA   . THR A 1 37 ? 7.369   -8.824  0.462   1.00 0.00 ? 37 THR A HA   7  
ATOM 7783  H HB   . THR A 1 37 ? 6.569   -7.014  1.839   1.00 0.00 ? 37 THR A HB   7  
ATOM 7784  H HG1  . THR A 1 37 ? 6.681   -5.012  1.217   1.00 0.00 ? 37 THR A HG1  7  
ATOM 7785  H HG21 . THR A 1 37 ? 8.979   -7.941  2.201   1.00 0.00 ? 37 THR A HG21 7  
ATOM 7786  H HG22 . THR A 1 37 ? 8.500   -6.481  3.064   1.00 0.00 ? 37 THR A HG22 7  
ATOM 7787  H HG23 . THR A 1 37 ? 9.501   -6.360  1.619   1.00 0.00 ? 37 THR A HG23 7  
ATOM 7788  N N    . LYS A 1 38 ? 5.598   -8.459  -1.250  1.00 0.00 ? 38 LYS A N    7  
ATOM 7789  C CA   . LYS A 1 38 ? 4.515   -8.224  -2.263  1.00 0.00 ? 38 LYS A CA   7  
ATOM 7790  C C    . LYS A 1 38 ? 3.207   -8.858  -1.784  1.00 0.00 ? 38 LYS A C    7  
ATOM 7791  O O    . LYS A 1 38 ? 2.997   -10.048 -1.917  1.00 0.00 ? 38 LYS A O    7  
ATOM 7792  C CB   . LYS A 1 38 ? 4.928   -8.857  -3.595  1.00 0.00 ? 38 LYS A CB   7  
ATOM 7793  C CG   . LYS A 1 38 ? 4.044   -8.312  -4.720  1.00 0.00 ? 38 LYS A CG   7  
ATOM 7794  C CD   . LYS A 1 38 ? 4.527   -8.865  -6.064  1.00 0.00 ? 38 LYS A CD   7  
ATOM 7795  C CE   . LYS A 1 38 ? 3.911   -8.051  -7.203  1.00 0.00 ? 38 LYS A CE   7  
ATOM 7796  N NZ   . LYS A 1 38 ? 2.425   -8.129  -7.121  1.00 0.00 ? 38 LYS A NZ   7  
ATOM 7797  H H    . LYS A 1 38 ? 5.686   -9.335  -0.831  1.00 0.00 ? 38 LYS A H    7  
ATOM 7798  H HA   . LYS A 1 38 ? 4.361   -7.163  -2.403  1.00 0.00 ? 38 LYS A HA   7  
ATOM 7799  H HB2  . LYS A 1 38 ? 5.961   -8.617  -3.800  1.00 0.00 ? 38 LYS A HB2  7  
ATOM 7800  H HB3  . LYS A 1 38 ? 4.812   -9.929  -3.536  1.00 0.00 ? 38 LYS A HB3  7  
ATOM 7801  H HG2  . LYS A 1 38 ? 3.020   -8.615  -4.551  1.00 0.00 ? 38 LYS A HG2  7  
ATOM 7802  H HG3  . LYS A 1 38 ? 4.103   -7.234  -4.734  1.00 0.00 ? 38 LYS A HG3  7  
ATOM 7803  H HD2  . LYS A 1 38 ? 5.605   -8.798  -6.114  1.00 0.00 ? 38 LYS A HD2  7  
ATOM 7804  H HD3  . LYS A 1 38 ? 4.225   -9.897  -6.157  1.00 0.00 ? 38 LYS A HD3  7  
ATOM 7805  H HE2  . LYS A 1 38 ? 4.223   -7.020  -7.119  1.00 0.00 ? 38 LYS A HE2  7  
ATOM 7806  H HE3  . LYS A 1 38 ? 4.241   -8.450  -8.151  1.00 0.00 ? 38 LYS A HE3  7  
ATOM 7807  H HZ1  . LYS A 1 38 ? 2.067   -7.335  -6.552  1.00 0.00 ? 38 LYS A HZ1  7  
ATOM 7808  H HZ2  . LYS A 1 38 ? 2.149   -9.026  -6.673  1.00 0.00 ? 38 LYS A HZ2  7  
ATOM 7809  H HZ3  . LYS A 1 38 ? 2.022   -8.080  -8.079  1.00 0.00 ? 38 LYS A HZ3  7  
ATOM 7810  N N    . GLU A 1 39 ? 2.321   -8.063  -1.238  1.00 0.00 ? 39 GLU A N    7  
ATOM 7811  C CA   . GLU A 1 39 ? 1.005   -8.589  -0.751  1.00 0.00 ? 39 GLU A CA   7  
ATOM 7812  C C    . GLU A 1 39 ? -0.113  -8.035  -1.649  1.00 0.00 ? 39 GLU A C    7  
ATOM 7813  O O    . GLU A 1 39 ? -0.607  -6.948  -1.426  1.00 0.00 ? 39 GLU A O    7  
ATOM 7814  C CB   . GLU A 1 39 ? 0.775   -8.111  0.685   1.00 0.00 ? 39 GLU A CB   7  
ATOM 7815  C CG   . GLU A 1 39 ? -0.385  -8.895  1.303   1.00 0.00 ? 39 GLU A CG   7  
ATOM 7816  C CD   . GLU A 1 39 ? 0.062   -10.331 1.587   1.00 0.00 ? 39 GLU A CD   7  
ATOM 7817  O OE1  . GLU A 1 39 ? 1.212   -10.513 1.949   1.00 0.00 ? 39 GLU A OE1  7  
ATOM 7818  O OE2  . GLU A 1 39 ? -0.755  -11.224 1.438   1.00 0.00 ? 39 GLU A OE2  7  
ATOM 7819  H H    . GLU A 1 39 ? 2.518   -7.106  -1.155  1.00 0.00 ? 39 GLU A H    7  
ATOM 7820  H HA   . GLU A 1 39 ? 1.002   -9.671  -0.770  1.00 0.00 ? 39 GLU A HA   7  
ATOM 7821  H HB2  . GLU A 1 39 ? 1.672   -8.273  1.267   1.00 0.00 ? 39 GLU A HB2  7  
ATOM 7822  H HB3  . GLU A 1 39 ? 0.534   -7.058  0.682   1.00 0.00 ? 39 GLU A HB3  7  
ATOM 7823  H HG2  . GLU A 1 39 ? -0.688  -8.422  2.225   1.00 0.00 ? 39 GLU A HG2  7  
ATOM 7824  H HG3  . GLU A 1 39 ? -1.216  -8.908  0.614   1.00 0.00 ? 39 GLU A HG3  7  
ATOM 7825  N N    . VAL A 1 40 ? -0.522  -8.763  -2.666  1.00 0.00 ? 40 VAL A N    7  
ATOM 7826  C CA   . VAL A 1 40 ? -1.607  -8.257  -3.564  1.00 0.00 ? 40 VAL A CA   7  
ATOM 7827  C C    . VAL A 1 40 ? -2.956  -8.826  -3.105  1.00 0.00 ? 40 VAL A C    7  
ATOM 7828  O O    . VAL A 1 40 ? -3.163  -10.023 -3.104  1.00 0.00 ? 40 VAL A O    7  
ATOM 7829  C CB   . VAL A 1 40 ? -1.318  -8.710  -5.005  1.00 0.00 ? 40 VAL A CB   7  
ATOM 7830  C CG1  . VAL A 1 40 ? -0.312  -7.758  -5.660  1.00 0.00 ? 40 VAL A CG1  7  
ATOM 7831  C CG2  . VAL A 1 40 ? -0.731  -10.125 -4.987  1.00 0.00 ? 40 VAL A CG2  7  
ATOM 7832  H H    . VAL A 1 40 ? -0.122  -9.642  -2.839  1.00 0.00 ? 40 VAL A H    7  
ATOM 7833  H HA   . VAL A 1 40 ? -1.642  -7.174  -3.527  1.00 0.00 ? 40 VAL A HA   7  
ATOM 7834  H HB   . VAL A 1 40 ? -2.235  -8.708  -5.579  1.00 0.00 ? 40 VAL A HB   7  
ATOM 7835  H HG11 . VAL A 1 40 ? 0.083   -8.212  -6.557  1.00 0.00 ? 40 VAL A HG11 7  
ATOM 7836  H HG12 . VAL A 1 40 ? 0.496   -7.560  -4.971  1.00 0.00 ? 40 VAL A HG12 7  
ATOM 7837  H HG13 . VAL A 1 40 ? -0.805  -6.832  -5.913  1.00 0.00 ? 40 VAL A HG13 7  
ATOM 7838  H HG21 . VAL A 1 40 ? -1.368  -10.774 -4.406  1.00 0.00 ? 40 VAL A HG21 7  
ATOM 7839  H HG22 . VAL A 1 40 ? 0.255   -10.099 -4.546  1.00 0.00 ? 40 VAL A HG22 7  
ATOM 7840  H HG23 . VAL A 1 40 ? -0.663  -10.499 -5.998  1.00 0.00 ? 40 VAL A HG23 7  
ATOM 7841  N N    . VAL A 1 41 ? -3.884  -7.974  -2.732  1.00 0.00 ? 41 VAL A N    7  
ATOM 7842  C CA   . VAL A 1 41 ? -5.233  -8.462  -2.295  1.00 0.00 ? 41 VAL A CA   7  
ATOM 7843  C C    . VAL A 1 41 ? -6.314  -7.652  -3.013  1.00 0.00 ? 41 VAL A C    7  
ATOM 7844  O O    . VAL A 1 41 ? -6.543  -6.501  -2.698  1.00 0.00 ? 41 VAL A O    7  
ATOM 7845  C CB   . VAL A 1 41 ? -5.365  -8.258  -0.782  1.00 0.00 ? 41 VAL A CB   7  
ATOM 7846  C CG1  . VAL A 1 41 ? -6.643  -8.929  -0.271  1.00 0.00 ? 41 VAL A CG1  7  
ATOM 7847  C CG2  . VAL A 1 41 ? -4.153  -8.873  -0.079  1.00 0.00 ? 41 VAL A CG2  7  
ATOM 7848  H H    . VAL A 1 41 ? -3.701  -7.014  -2.765  1.00 0.00 ? 41 VAL A H    7  
ATOM 7849  H HA   . VAL A 1 41 ? -5.352  -9.511  -2.530  1.00 0.00 ? 41 VAL A HA   7  
ATOM 7850  H HB   . VAL A 1 41 ? -5.406  -7.200  -0.567  1.00 0.00 ? 41 VAL A HB   7  
ATOM 7851  H HG11 . VAL A 1 41 ? -6.510  -10.000 -0.268  1.00 0.00 ? 41 VAL A HG11 7  
ATOM 7852  H HG12 . VAL A 1 41 ? -7.470  -8.672  -0.915  1.00 0.00 ? 41 VAL A HG12 7  
ATOM 7853  H HG13 . VAL A 1 41 ? -6.851  -8.589  0.734   1.00 0.00 ? 41 VAL A HG13 7  
ATOM 7854  H HG21 . VAL A 1 41 ? -3.248  -8.417  -0.454  1.00 0.00 ? 41 VAL A HG21 7  
ATOM 7855  H HG22 . VAL A 1 41 ? -4.127  -9.936  -0.272  1.00 0.00 ? 41 VAL A HG22 7  
ATOM 7856  H HG23 . VAL A 1 41 ? -4.228  -8.702  0.984   1.00 0.00 ? 41 VAL A HG23 7  
ATOM 7857  N N    . LYS A 1 42 ? -6.974  -8.240  -3.984  1.00 0.00 ? 42 LYS A N    7  
ATOM 7858  C CA   . LYS A 1 42 ? -8.039  -7.509  -4.744  1.00 0.00 ? 42 LYS A CA   7  
ATOM 7859  C C    . LYS A 1 42 ? -9.388  -8.206  -4.555  1.00 0.00 ? 42 LYS A C    7  
ATOM 7860  O O    . LYS A 1 42 ? -9.533  -9.381  -4.824  1.00 0.00 ? 42 LYS A O    7  
ATOM 7861  C CB   . LYS A 1 42 ? -7.681  -7.507  -6.231  1.00 0.00 ? 42 LYS A CB   7  
ATOM 7862  C CG   . LYS A 1 42 ? -6.471  -6.602  -6.464  1.00 0.00 ? 42 LYS A CG   7  
ATOM 7863  C CD   . LYS A 1 42 ? -5.959  -6.793  -7.893  1.00 0.00 ? 42 LYS A CD   7  
ATOM 7864  C CE   . LYS A 1 42 ? -4.638  -6.041  -8.069  1.00 0.00 ? 42 LYS A CE   7  
ATOM 7865  N NZ   . LYS A 1 42 ? -4.829  -4.608  -7.704  1.00 0.00 ? 42 LYS A NZ   7  
ATOM 7866  H H    . LYS A 1 42 ? -6.747  -9.159  -4.239  1.00 0.00 ? 42 LYS A H    7  
ATOM 7867  H HA   . LYS A 1 42 ? -8.116  -6.487  -4.397  1.00 0.00 ? 42 LYS A HA   7  
ATOM 7868  H HB2  . LYS A 1 42 ? -7.446  -8.514  -6.545  1.00 0.00 ? 42 LYS A HB2  7  
ATOM 7869  H HB3  . LYS A 1 42 ? -8.520  -7.138  -6.803  1.00 0.00 ? 42 LYS A HB3  7  
ATOM 7870  H HG2  . LYS A 1 42 ? -6.759  -5.571  -6.318  1.00 0.00 ? 42 LYS A HG2  7  
ATOM 7871  H HG3  . LYS A 1 42 ? -5.689  -6.860  -5.765  1.00 0.00 ? 42 LYS A HG3  7  
ATOM 7872  H HD2  . LYS A 1 42 ? -5.802  -7.846  -8.081  1.00 0.00 ? 42 LYS A HD2  7  
ATOM 7873  H HD3  . LYS A 1 42 ? -6.686  -6.407  -8.591  1.00 0.00 ? 42 LYS A HD3  7  
ATOM 7874  H HE2  . LYS A 1 42 ? -3.887  -6.478  -7.427  1.00 0.00 ? 42 LYS A HE2  7  
ATOM 7875  H HE3  . LYS A 1 42 ? -4.318  -6.111  -9.097  1.00 0.00 ? 42 LYS A HE3  7  
ATOM 7876  H HZ1  . LYS A 1 42 ? -4.550  -4.462  -6.714  1.00 0.00 ? 42 LYS A HZ1  7  
ATOM 7877  H HZ2  . LYS A 1 42 ? -5.830  -4.351  -7.820  1.00 0.00 ? 42 LYS A HZ2  7  
ATOM 7878  H HZ3  . LYS A 1 42 ? -4.243  -4.012  -8.324  1.00 0.00 ? 42 LYS A HZ3  7  
ATOM 7879  N N    . SER A 1 43 ? -10.380 -7.486  -4.101  1.00 0.00 ? 43 SER A N    7  
ATOM 7880  C CA   . SER A 1 43 ? -11.727 -8.099  -3.902  1.00 0.00 ? 43 SER A CA   7  
ATOM 7881  C C    . SER A 1 43 ? -12.560 -7.920  -5.174  1.00 0.00 ? 43 SER A C    7  
ATOM 7882  O O    . SER A 1 43 ? -12.040 -7.616  -6.230  1.00 0.00 ? 43 SER A O    7  
ATOM 7883  C CB   . SER A 1 43 ? -12.426 -7.404  -2.736  1.00 0.00 ? 43 SER A CB   7  
ATOM 7884  O OG   . SER A 1 43 ? -13.786 -7.812  -2.687  1.00 0.00 ? 43 SER A OG   7  
ATOM 7885  H H    . SER A 1 43 ? -10.240 -6.537  -3.894  1.00 0.00 ? 43 SER A H    7  
ATOM 7886  H HA   . SER A 1 43 ? -11.623 -9.153  -3.684  1.00 0.00 ? 43 SER A HA   7  
ATOM 7887  H HB2  . SER A 1 43 ? -11.943 -7.675  -1.817  1.00 0.00 ? 43 SER A HB2  7  
ATOM 7888  H HB3  . SER A 1 43 ? -12.365 -6.331  -2.869  1.00 0.00 ? 43 SER A HB3  7  
ATOM 7889  H HG   . SER A 1 43 ? -14.236 -7.271  -2.033  1.00 0.00 ? 43 SER A HG   7  
ATOM 7890  N N    . GLU A 1 44 ? -13.853 -8.096  -5.080  1.00 0.00 ? 44 GLU A N    7  
ATOM 7891  C CA   . GLU A 1 44 ? -14.730 -7.927  -6.282  1.00 0.00 ? 44 GLU A CA   7  
ATOM 7892  C C    . GLU A 1 44 ? -16.057 -7.302  -5.843  1.00 0.00 ? 44 GLU A C    7  
ATOM 7893  O O    . GLU A 1 44 ? -16.501 -7.492  -4.727  1.00 0.00 ? 44 GLU A O    7  
ATOM 7894  C CB   . GLU A 1 44 ? -14.984 -9.297  -6.943  1.00 0.00 ? 44 GLU A CB   7  
ATOM 7895  C CG   . GLU A 1 44 ? -15.318 -9.104  -8.428  1.00 0.00 ? 44 GLU A CG   7  
ATOM 7896  C CD   . GLU A 1 44 ? -14.058 -8.675  -9.182  1.00 0.00 ? 44 GLU A CD   7  
ATOM 7897  O OE1  . GLU A 1 44 ? -13.112 -9.445  -9.201  1.00 0.00 ? 44 GLU A OE1  7  
ATOM 7898  O OE2  . GLU A 1 44 ? -14.062 -7.585  -9.728  1.00 0.00 ? 44 GLU A OE2  7  
ATOM 7899  H H    . GLU A 1 44 ? -14.249 -8.333  -4.214  1.00 0.00 ? 44 GLU A H    7  
ATOM 7900  H HA   . GLU A 1 44 ? -14.248 -7.265  -6.990  1.00 0.00 ? 44 GLU A HA   7  
ATOM 7901  H HB2  . GLU A 1 44 ? -14.098 -9.907  -6.852  1.00 0.00 ? 44 GLU A HB2  7  
ATOM 7902  H HB3  . GLU A 1 44 ? -15.813 -9.795  -6.457  1.00 0.00 ? 44 GLU A HB3  7  
ATOM 7903  H HG2  . GLU A 1 44 ? -15.686 -10.034 -8.837  1.00 0.00 ? 44 GLU A HG2  7  
ATOM 7904  H HG3  . GLU A 1 44 ? -16.075 -8.341  -8.530  1.00 0.00 ? 44 GLU A HG3  7  
ATOM 7905  N N    . ASP A 1 45 ? -16.689 -6.558  -6.711  1.00 0.00 ? 45 ASP A N    7  
ATOM 7906  C CA   . ASP A 1 45 ? -17.985 -5.913  -6.350  1.00 0.00 ? 45 ASP A CA   7  
ATOM 7907  C C    . ASP A 1 45 ? -17.778 -4.984  -5.150  1.00 0.00 ? 45 ASP A C    7  
ATOM 7908  O O    . ASP A 1 45 ? -16.947 -5.227  -4.298  1.00 0.00 ? 45 ASP A O    7  
ATOM 7909  C CB   . ASP A 1 45 ? -19.015 -6.991  -5.995  1.00 0.00 ? 45 ASP A CB   7  
ATOM 7910  C CG   . ASP A 1 45 ? -20.423 -6.392  -6.041  1.00 0.00 ? 45 ASP A CG   7  
ATOM 7911  O OD1  . ASP A 1 45 ? -20.895 -6.120  -7.133  1.00 0.00 ? 45 ASP A OD1  7  
ATOM 7912  O OD2  . ASP A 1 45 ? -21.005 -6.216  -4.983  1.00 0.00 ? 45 ASP A OD2  7  
ATOM 7913  H H    . ASP A 1 45 ? -16.307 -6.425  -7.603  1.00 0.00 ? 45 ASP A H    7  
ATOM 7914  H HA   . ASP A 1 45 ? -18.343 -5.337  -7.192  1.00 0.00 ? 45 ASP A HA   7  
ATOM 7915  H HB2  . ASP A 1 45 ? -18.946 -7.803  -6.706  1.00 0.00 ? 45 ASP A HB2  7  
ATOM 7916  H HB3  . ASP A 1 45 ? -18.820 -7.367  -5.002  1.00 0.00 ? 45 ASP A HB3  7  
ATOM 7917  N N    . GLY A 1 46 ? -18.525 -3.916  -5.076  1.00 0.00 ? 46 GLY A N    7  
ATOM 7918  C CA   . GLY A 1 46 ? -18.364 -2.976  -3.931  1.00 0.00 ? 46 GLY A CA   7  
ATOM 7919  C C    . GLY A 1 46 ? -19.156 -1.696  -4.202  1.00 0.00 ? 46 GLY A C    7  
ATOM 7920  O O    . GLY A 1 46 ? -19.746 -1.530  -5.250  1.00 0.00 ? 46 GLY A O    7  
ATOM 7921  H H    . GLY A 1 46 ? -19.190 -3.732  -5.772  1.00 0.00 ? 46 GLY A H    7  
ATOM 7922  H HA2  . GLY A 1 46 ? -18.732 -3.444  -3.029  1.00 0.00 ? 46 GLY A HA2  7  
ATOM 7923  H HA3  . GLY A 1 46 ? -17.321 -2.731  -3.810  1.00 0.00 ? 46 GLY A HA3  7  
ATOM 7924  N N    . SER A 1 47 ? -19.171 -0.787  -3.262  1.00 0.00 ? 47 SER A N    7  
ATOM 7925  C CA   . SER A 1 47 ? -19.923 0.487   -3.461  1.00 0.00 ? 47 SER A CA   7  
ATOM 7926  C C    . SER A 1 47 ? -19.013 1.519   -4.128  1.00 0.00 ? 47 SER A C    7  
ATOM 7927  O O    . SER A 1 47 ? -19.386 2.160   -5.090  1.00 0.00 ? 47 SER A O    7  
ATOM 7928  C CB   . SER A 1 47 ? -20.389 1.021   -2.105  1.00 0.00 ? 47 SER A CB   7  
ATOM 7929  O OG   . SER A 1 47 ? -21.286 0.089   -1.516  1.00 0.00 ? 47 SER A OG   7  
ATOM 7930  H H    . SER A 1 47 ? -18.687 -0.941  -2.424  1.00 0.00 ? 47 SER A H    7  
ATOM 7931  H HA   . SER A 1 47 ? -20.785 0.308   -4.090  1.00 0.00 ? 47 SER A HA   7  
ATOM 7932  H HB2  . SER A 1 47 ? -19.538 1.153   -1.457  1.00 0.00 ? 47 SER A HB2  7  
ATOM 7933  H HB3  . SER A 1 47 ? -20.882 1.974   -2.245  1.00 0.00 ? 47 SER A HB3  7  
ATOM 7934  H HG   . SER A 1 47 ? -20.803 -0.724  -1.349  1.00 0.00 ? 47 SER A HG   7  
ATOM 7935  N N    . ASP A 1 48 ? -17.820 1.688   -3.625  1.00 0.00 ? 48 ASP A N    7  
ATOM 7936  C CA   . ASP A 1 48 ? -16.891 2.682   -4.232  1.00 0.00 ? 48 ASP A CA   7  
ATOM 7937  C C    . ASP A 1 48 ? -15.452 2.369   -3.810  1.00 0.00 ? 48 ASP A C    7  
ATOM 7938  O O    . ASP A 1 48 ? -14.956 2.894   -2.837  1.00 0.00 ? 48 ASP A O    7  
ATOM 7939  C CB   . ASP A 1 48 ? -17.269 4.086   -3.754  1.00 0.00 ? 48 ASP A CB   7  
ATOM 7940  C CG   . ASP A 1 48 ? -17.215 4.138   -2.226  1.00 0.00 ? 48 ASP A CG   7  
ATOM 7941  O OD1  . ASP A 1 48 ? -17.810 3.275   -1.602  1.00 0.00 ? 48 ASP A OD1  7  
ATOM 7942  O OD2  . ASP A 1 48 ? -16.579 5.040   -1.706  1.00 0.00 ? 48 ASP A OD2  7  
ATOM 7943  H H    . ASP A 1 48 ? -17.536 1.164   -2.847  1.00 0.00 ? 48 ASP A H    7  
ATOM 7944  H HA   . ASP A 1 48 ? -16.968 2.636   -5.309  1.00 0.00 ? 48 ASP A HA   7  
ATOM 7945  H HB2  . ASP A 1 48 ? -16.576 4.805   -4.166  1.00 0.00 ? 48 ASP A HB2  7  
ATOM 7946  H HB3  . ASP A 1 48 ? -18.270 4.321   -4.085  1.00 0.00 ? 48 ASP A HB3  7  
ATOM 7947  N N    . CYS A 1 49 ? -14.782 1.517   -4.547  1.00 0.00 ? 49 CYS A N    7  
ATOM 7948  C CA   . CYS A 1 49 ? -13.367 1.148   -4.215  1.00 0.00 ? 49 CYS A CA   7  
ATOM 7949  C C    . CYS A 1 49 ? -12.456 1.630   -5.346  1.00 0.00 ? 49 CYS A C    7  
ATOM 7950  O O    . CYS A 1 49 ? -12.920 2.034   -6.394  1.00 0.00 ? 49 CYS A O    7  
ATOM 7951  C CB   . CYS A 1 49 ? -13.265 -0.376  -4.085  1.00 0.00 ? 49 CYS A CB   7  
ATOM 7952  S SG   . CYS A 1 49 ? -11.528 -0.892  -4.133  1.00 0.00 ? 49 CYS A SG   7  
ATOM 7953  H H    . CYS A 1 49 ? -15.211 1.116   -5.328  1.00 0.00 ? 49 CYS A H    7  
ATOM 7954  H HA   . CYS A 1 49 ? -13.064 1.611   -3.285  1.00 0.00 ? 49 CYS A HA   7  
ATOM 7955  H HB2  . CYS A 1 49 ? -13.705 -0.689  -3.151  1.00 0.00 ? 49 CYS A HB2  7  
ATOM 7956  H HB3  . CYS A 1 49 ? -13.798 -0.840  -4.903  1.00 0.00 ? 49 CYS A HB3  7  
ATOM 7957  N N    . GLY A 1 50 ? -11.165 1.599   -5.149  1.00 0.00 ? 50 GLY A N    7  
ATOM 7958  C CA   . GLY A 1 50 ? -10.240 2.067   -6.229  1.00 0.00 ? 50 GLY A CA   7  
ATOM 7959  C C    . GLY A 1 50 ? -10.711 3.432   -6.736  1.00 0.00 ? 50 GLY A C    7  
ATOM 7960  O O    . GLY A 1 50 ? -10.268 3.911   -7.761  1.00 0.00 ? 50 GLY A O    7  
ATOM 7961  H H    . GLY A 1 50 ? -10.806 1.264   -4.293  1.00 0.00 ? 50 GLY A H    7  
ATOM 7962  H HA2  . GLY A 1 50 ? -9.233  2.155   -5.839  1.00 0.00 ? 50 GLY A HA2  7  
ATOM 7963  H HA3  . GLY A 1 50 ? -10.251 1.362   -7.046  1.00 0.00 ? 50 GLY A HA3  7  
ATOM 7964  N N    . ASP A 1 51 ? -11.611 4.062   -6.025  1.00 0.00 ? 51 ASP A N    7  
ATOM 7965  C CA   . ASP A 1 51 ? -12.120 5.392   -6.458  1.00 0.00 ? 51 ASP A CA   7  
ATOM 7966  C C    . ASP A 1 51 ? -12.415 6.247   -5.222  1.00 0.00 ? 51 ASP A C    7  
ATOM 7967  O O    . ASP A 1 51 ? -12.587 7.446   -5.321  1.00 0.00 ? 51 ASP A O    7  
ATOM 7968  C CB   . ASP A 1 51 ? -13.405 5.206   -7.267  1.00 0.00 ? 51 ASP A CB   7  
ATOM 7969  C CG   . ASP A 1 51 ? -13.140 4.253   -8.436  1.00 0.00 ? 51 ASP A CG   7  
ATOM 7970  O OD1  . ASP A 1 51 ? -12.164 4.466   -9.138  1.00 0.00 ? 51 ASP A OD1  7  
ATOM 7971  O OD2  . ASP A 1 51 ? -13.917 3.329   -8.608  1.00 0.00 ? 51 ASP A OD2  7  
ATOM 7972  H H    . ASP A 1 51 ? -11.957 3.657   -5.205  1.00 0.00 ? 51 ASP A H    7  
ATOM 7973  H HA   . ASP A 1 51 ? -11.379 5.890   -7.068  1.00 0.00 ? 51 ASP A HA   7  
ATOM 7974  H HB2  . ASP A 1 51 ? -14.175 4.793   -6.632  1.00 0.00 ? 51 ASP A HB2  7  
ATOM 7975  H HB3  . ASP A 1 51 ? -13.730 6.162   -7.653  1.00 0.00 ? 51 ASP A HB3  7  
ATOM 7976  N N    . ALA A 1 52 ? -12.472 5.652   -4.055  1.00 0.00 ? 52 ALA A N    7  
ATOM 7977  C CA   . ALA A 1 52 ? -12.752 6.454   -2.839  1.00 0.00 ? 52 ALA A CA   7  
ATOM 7978  C C    . ALA A 1 52 ? -12.274 5.687   -1.606  1.00 0.00 ? 52 ALA A C    7  
ATOM 7979  O O    . ALA A 1 52 ? -11.359 6.118   -0.943  1.00 0.00 ? 52 ALA A O    7  
ATOM 7980  C CB   . ALA A 1 52 ? -14.258 6.723   -2.740  1.00 0.00 ? 52 ALA A CB   7  
ATOM 7981  H H    . ALA A 1 52 ? -12.331 4.681   -3.975  1.00 0.00 ? 52 ALA A H    7  
ATOM 7982  H HA   . ALA A 1 52 ? -12.224 7.395   -2.900  1.00 0.00 ? 52 ALA A HA   7  
ATOM 7983  H HB1  . ALA A 1 52 ? -14.803 5.840   -3.037  1.00 0.00 ? 52 ALA A HB1  7  
ATOM 7984  H HB2  . ALA A 1 52 ? -14.519 7.543   -3.395  1.00 0.00 ? 52 ALA A HB2  7  
ATOM 7985  H HB3  . ALA A 1 52 ? -14.516 6.982   -1.723  1.00 0.00 ? 52 ALA A HB3  7  
ATOM 7986  N N    . ASP A 1 53 ? -12.915 4.572   -1.302  1.00 0.00 ? 53 ASP A N    7  
ATOM 7987  C CA   . ASP A 1 53 ? -12.562 3.731   -0.090  1.00 0.00 ? 53 ASP A CA   7  
ATOM 7988  C C    . ASP A 1 53 ? -11.237 4.143   0.568   1.00 0.00 ? 53 ASP A C    7  
ATOM 7989  O O    . ASP A 1 53 ? -11.128 5.207   1.147   1.00 0.00 ? 53 ASP A O    7  
ATOM 7990  C CB   . ASP A 1 53 ? -12.480 2.238   -0.460  1.00 0.00 ? 53 ASP A CB   7  
ATOM 7991  C CG   . ASP A 1 53 ? -13.882 1.715   -0.769  1.00 0.00 ? 53 ASP A CG   7  
ATOM 7992  O OD1  . ASP A 1 53 ? -14.831 2.444   -0.533  1.00 0.00 ? 53 ASP A OD1  7  
ATOM 7993  O OD2  . ASP A 1 53 ? -13.985 0.591   -1.227  1.00 0.00 ? 53 ASP A OD2  7  
ATOM 7994  H H    . ASP A 1 53 ? -13.671 4.287   -1.867  1.00 0.00 ? 53 ASP A H    7  
ATOM 7995  H HA   . ASP A 1 53 ? -13.348 3.855   0.630   1.00 0.00 ? 53 ASP A HA   7  
ATOM 7996  H HB2  . ASP A 1 53 ? -11.833 2.099   -1.318  1.00 0.00 ? 53 ASP A HB2  7  
ATOM 7997  H HB3  . ASP A 1 53 ? -12.077 1.686   0.378   1.00 0.00 ? 53 ASP A HB3  7  
ATOM 7998  N N    . PHE A 1 54 ? -10.240 3.286   0.522   1.00 0.00 ? 54 PHE A N    7  
ATOM 7999  C CA   . PHE A 1 54 ? -8.927  3.608   1.174   1.00 0.00 ? 54 PHE A CA   7  
ATOM 8000  C C    . PHE A 1 54 ? -7.851  3.848   0.113   1.00 0.00 ? 54 PHE A C    7  
ATOM 8001  O O    . PHE A 1 54 ? -8.100  3.776   -1.074  1.00 0.00 ? 54 PHE A O    7  
ATOM 8002  C CB   . PHE A 1 54 ? -8.509  2.433   2.061   1.00 0.00 ? 54 PHE A CB   7  
ATOM 8003  C CG   . PHE A 1 54 ? -9.518  2.267   3.172   1.00 0.00 ? 54 PHE A CG   7  
ATOM 8004  C CD1  . PHE A 1 54 ? -9.426  3.056   4.325   1.00 0.00 ? 54 PHE A CD1  7  
ATOM 8005  C CD2  . PHE A 1 54 ? -10.548 1.327   3.047   1.00 0.00 ? 54 PHE A CD2  7  
ATOM 8006  C CE1  . PHE A 1 54 ? -10.363 2.904   5.354   1.00 0.00 ? 54 PHE A CE1  7  
ATOM 8007  C CE2  . PHE A 1 54 ? -11.486 1.177   4.076   1.00 0.00 ? 54 PHE A CE2  7  
ATOM 8008  C CZ   . PHE A 1 54 ? -11.393 1.965   5.229   1.00 0.00 ? 54 PHE A CZ   7  
ATOM 8009  H H    . PHE A 1 54 ? -10.367 2.412   0.080   1.00 0.00 ? 54 PHE A H    7  
ATOM 8010  H HA   . PHE A 1 54 ? -9.022  4.494   1.787   1.00 0.00 ? 54 PHE A HA   7  
ATOM 8011  H HB2  . PHE A 1 54 ? -8.471  1.531   1.470   1.00 0.00 ? 54 PHE A HB2  7  
ATOM 8012  H HB3  . PHE A 1 54 ? -7.537  2.630   2.485   1.00 0.00 ? 54 PHE A HB3  7  
ATOM 8013  H HD1  . PHE A 1 54 ? -8.631  3.781   4.421   1.00 0.00 ? 54 PHE A HD1  7  
ATOM 8014  H HD2  . PHE A 1 54 ? -10.620 0.719   2.158   1.00 0.00 ? 54 PHE A HD2  7  
ATOM 8015  H HE1  . PHE A 1 54 ? -10.292 3.513   6.244   1.00 0.00 ? 54 PHE A HE1  7  
ATOM 8016  H HE2  . PHE A 1 54 ? -12.281 0.452   3.979   1.00 0.00 ? 54 PHE A HE2  7  
ATOM 8017  H HZ   . PHE A 1 54 ? -12.116 1.848   6.022   1.00 0.00 ? 54 PHE A HZ   7  
ATOM 8018  N N    . ASP A 1 55 ? -6.650  4.129   0.544   1.00 0.00 ? 55 ASP A N    7  
ATOM 8019  C CA   . ASP A 1 55 ? -5.535  4.374   -0.419  1.00 0.00 ? 55 ASP A CA   7  
ATOM 8020  C C    . ASP A 1 55 ? -4.201  4.198   0.316   1.00 0.00 ? 55 ASP A C    7  
ATOM 8021  O O    . ASP A 1 55 ? -4.149  4.231   1.530   1.00 0.00 ? 55 ASP A O    7  
ATOM 8022  C CB   . ASP A 1 55 ? -5.633  5.797   -0.990  1.00 0.00 ? 55 ASP A CB   7  
ATOM 8023  C CG   . ASP A 1 55 ? -4.604  5.969   -2.109  1.00 0.00 ? 55 ASP A CG   7  
ATOM 8024  O OD1  . ASP A 1 55 ? -4.841  5.454   -3.190  1.00 0.00 ? 55 ASP A OD1  7  
ATOM 8025  O OD2  . ASP A 1 55 ? -3.597  6.612   -1.867  1.00 0.00 ? 55 ASP A OD2  7  
ATOM 8026  H H    . ASP A 1 55 ? -6.481  4.172   1.512   1.00 0.00 ? 55 ASP A H    7  
ATOM 8027  H HA   . ASP A 1 55 ? -5.595  3.657   -1.225  1.00 0.00 ? 55 ASP A HA   7  
ATOM 8028  H HB2  . ASP A 1 55 ? -6.626  5.958   -1.388  1.00 0.00 ? 55 ASP A HB2  7  
ATOM 8029  H HB3  . ASP A 1 55 ? -5.436  6.520   -0.211  1.00 0.00 ? 55 ASP A HB3  7  
ATOM 8030  N N    . TRP A 1 56 ? -3.125  3.995   -0.402  1.00 0.00 ? 56 TRP A N    7  
ATOM 8031  C CA   . TRP A 1 56 ? -1.800  3.799   0.267   1.00 0.00 ? 56 TRP A CA   7  
ATOM 8032  C C    . TRP A 1 56 ? -0.693  4.450   -0.564  1.00 0.00 ? 56 TRP A C    7  
ATOM 8033  O O    . TRP A 1 56 ? 0.017   5.315   -0.094  1.00 0.00 ? 56 TRP A O    7  
ATOM 8034  C CB   . TRP A 1 56 ? -1.529  2.296   0.401   1.00 0.00 ? 56 TRP A CB   7  
ATOM 8035  C CG   . TRP A 1 56 ? -2.007  1.601   -0.833  1.00 0.00 ? 56 TRP A CG   7  
ATOM 8036  C CD1  . TRP A 1 56 ? -3.305  1.366   -1.138  1.00 0.00 ? 56 TRP A CD1  7  
ATOM 8037  C CD2  . TRP A 1 56 ? -1.223  1.051   -1.931  1.00 0.00 ? 56 TRP A CD2  7  
ATOM 8038  N NE1  . TRP A 1 56 ? -3.366  0.708   -2.353  1.00 0.00 ? 56 TRP A NE1  7  
ATOM 8039  C CE2  . TRP A 1 56 ? -2.109  0.492   -2.882  1.00 0.00 ? 56 TRP A CE2  7  
ATOM 8040  C CE3  . TRP A 1 56 ? 0.158   0.986   -2.192  1.00 0.00 ? 56 TRP A CE3  7  
ATOM 8041  C CZ2  . TRP A 1 56 ? -1.643  -0.112  -4.049  1.00 0.00 ? 56 TRP A CZ2  7  
ATOM 8042  C CZ3  . TRP A 1 56 ? 0.631   0.378   -3.368  1.00 0.00 ? 56 TRP A CZ3  7  
ATOM 8043  C CH2  . TRP A 1 56 ? -0.268  -0.169  -4.293  1.00 0.00 ? 56 TRP A CH2  7  
ATOM 8044  H H    . TRP A 1 56 ? -3.187  3.956   -1.380  1.00 0.00 ? 56 TRP A H    7  
ATOM 8045  H HA   . TRP A 1 56 ? -1.814  4.248   1.248   1.00 0.00 ? 56 TRP A HA   7  
ATOM 8046  H HB2  . TRP A 1 56 ? -0.469  2.124   0.527   1.00 0.00 ? 56 TRP A HB2  7  
ATOM 8047  H HB3  . TRP A 1 56 ? -2.061  1.910   1.259   1.00 0.00 ? 56 TRP A HB3  7  
ATOM 8048  H HD1  . TRP A 1 56 ? -4.153  1.646   -0.532  1.00 0.00 ? 56 TRP A HD1  7  
ATOM 8049  H HE1  . TRP A 1 56 ? -4.190  0.423   -2.801  1.00 0.00 ? 56 TRP A HE1  7  
ATOM 8050  H HE3  . TRP A 1 56 ? 0.858   1.404   -1.485  1.00 0.00 ? 56 TRP A HE3  7  
ATOM 8051  H HZ2  . TRP A 1 56 ? -2.341  -0.531  -4.759  1.00 0.00 ? 56 TRP A HZ2  7  
ATOM 8052  H HZ3  . TRP A 1 56 ? 1.692   0.331   -3.558  1.00 0.00 ? 56 TRP A HZ3  7  
ATOM 8053  H HH2  . TRP A 1 56 ? 0.101   -0.634  -5.195  1.00 0.00 ? 56 TRP A HH2  7  
ATOM 8054  N N    . HIS A 1 57 ? -0.532  4.021   -1.787  1.00 0.00 ? 57 HIS A N    7  
ATOM 8055  C CA   . HIS A 1 57 ? 0.538   4.591   -2.659  1.00 0.00 ? 57 HIS A CA   7  
ATOM 8056  C C    . HIS A 1 57 ? 1.873   4.583   -1.903  1.00 0.00 ? 57 HIS A C    7  
ATOM 8057  O O    . HIS A 1 57 ? 1.951   4.158   -0.768  1.00 0.00 ? 57 HIS A O    7  
ATOM 8058  C CB   . HIS A 1 57 ? 0.159   6.019   -3.088  1.00 0.00 ? 57 HIS A CB   7  
ATOM 8059  C CG   . HIS A 1 57 ? 0.448   7.010   -1.988  1.00 0.00 ? 57 HIS A CG   7  
ATOM 8060  N ND1  . HIS A 1 57 ? -0.547  7.507   -1.162  1.00 0.00 ? 57 HIS A ND1  7  
ATOM 8061  C CD2  . HIS A 1 57 ? 1.614   7.600   -1.566  1.00 0.00 ? 57 HIS A CD2  7  
ATOM 8062  C CE1  . HIS A 1 57 ? 0.032   8.355   -0.293  1.00 0.00 ? 57 HIS A CE1  7  
ATOM 8063  N NE2  . HIS A 1 57 ? 1.349   8.450   -0.496  1.00 0.00 ? 57 HIS A NE2  7  
ATOM 8064  H H    . HIS A 1 57 ? -1.111  3.310   -2.127  1.00 0.00 ? 57 HIS A H    7  
ATOM 8065  H HA   . HIS A 1 57 ? 0.634   3.972   -3.540  1.00 0.00 ? 57 HIS A HA   7  
ATOM 8066  H HB2  . HIS A 1 57 ? 0.725   6.289   -3.966  1.00 0.00 ? 57 HIS A HB2  7  
ATOM 8067  H HB3  . HIS A 1 57 ? -0.895  6.046   -3.322  1.00 0.00 ? 57 HIS A HB3  7  
ATOM 8068  H HD1  . HIS A 1 57 ? -1.500  7.281   -1.202  1.00 0.00 ? 57 HIS A HD1  7  
ATOM 8069  H HD2  . HIS A 1 57 ? 2.589   7.430   -2.000  1.00 0.00 ? 57 HIS A HD2  7  
ATOM 8070  H HE1  . HIS A 1 57 ? -0.503  8.895   0.474   1.00 0.00 ? 57 HIS A HE1  7  
ATOM 8071  N N    . HIS A 1 58 ? 2.924   5.049   -2.522  1.00 0.00 ? 58 HIS A N    7  
ATOM 8072  C CA   . HIS A 1 58 ? 4.249   5.064   -1.835  1.00 0.00 ? 58 HIS A CA   7  
ATOM 8073  C C    . HIS A 1 58 ? 5.181   6.049   -2.542  1.00 0.00 ? 58 HIS A C    7  
ATOM 8074  O O    . HIS A 1 58 ? 4.835   6.632   -3.551  1.00 0.00 ? 58 HIS A O    7  
ATOM 8075  C CB   . HIS A 1 58 ? 4.872   3.664   -1.879  1.00 0.00 ? 58 HIS A CB   7  
ATOM 8076  C CG   . HIS A 1 58 ? 4.142   2.753   -0.931  1.00 0.00 ? 58 HIS A CG   7  
ATOM 8077  N ND1  . HIS A 1 58 ? 3.921   3.089   0.396   1.00 0.00 ? 58 HIS A ND1  7  
ATOM 8078  C CD2  . HIS A 1 58 ? 3.573   1.515   -1.103  1.00 0.00 ? 58 HIS A CD2  7  
ATOM 8079  C CE1  . HIS A 1 58 ? 3.248   2.073   0.965   1.00 0.00 ? 58 HIS A CE1  7  
ATOM 8080  N NE2  . HIS A 1 58 ? 3.010   1.088   0.095   1.00 0.00 ? 58 HIS A NE2  7  
ATOM 8081  H H    . HIS A 1 58 ? 2.842   5.389   -3.439  1.00 0.00 ? 58 HIS A H    7  
ATOM 8082  H HA   . HIS A 1 58 ? 4.117   5.367   -0.807  1.00 0.00 ? 58 HIS A HA   7  
ATOM 8083  H HB2  . HIS A 1 58 ? 4.805   3.268   -2.881  1.00 0.00 ? 58 HIS A HB2  7  
ATOM 8084  H HB3  . HIS A 1 58 ? 5.910   3.725   -1.586  1.00 0.00 ? 58 HIS A HB3  7  
ATOM 8085  H HD1  . HIS A 1 58 ? 4.205   3.916   0.839   1.00 0.00 ? 58 HIS A HD1  7  
ATOM 8086  H HD2  . HIS A 1 58 ? 3.565   0.957   -2.028  1.00 0.00 ? 58 HIS A HD2  7  
ATOM 8087  H HE1  . HIS A 1 58 ? 2.938   2.056   1.999   1.00 0.00 ? 58 HIS A HE1  7  
ATOM 8088  N N    . THR A 1 59 ? 6.365   6.239   -2.019  1.00 0.00 ? 59 THR A N    7  
ATOM 8089  C CA   . THR A 1 59 ? 7.331   7.187   -2.657  1.00 0.00 ? 59 THR A CA   7  
ATOM 8090  C C    . THR A 1 59 ? 8.755   6.641   -2.502  1.00 0.00 ? 59 THR A C    7  
ATOM 8091  O O    . THR A 1 59 ? 9.686   7.376   -2.241  1.00 0.00 ? 59 THR A O    7  
ATOM 8092  C CB   . THR A 1 59 ? 7.221   8.557   -1.972  1.00 0.00 ? 59 THR A CB   7  
ATOM 8093  O OG1  . THR A 1 59 ? 5.854   8.849   -1.724  1.00 0.00 ? 59 THR A OG1  7  
ATOM 8094  C CG2  . THR A 1 59 ? 7.819   9.639   -2.875  1.00 0.00 ? 59 THR A CG2  7  
ATOM 8095  H H    . THR A 1 59 ? 6.620   5.758   -1.204  1.00 0.00 ? 59 THR A H    7  
ATOM 8096  H HA   . THR A 1 59 ? 7.100   7.290   -3.709  1.00 0.00 ? 59 THR A HA   7  
ATOM 8097  H HB   . THR A 1 59 ? 7.760   8.538   -1.036  1.00 0.00 ? 59 THR A HB   7  
ATOM 8098  H HG1  . THR A 1 59 ? 5.338   8.495   -2.452  1.00 0.00 ? 59 THR A HG1  7  
ATOM 8099  H HG21 . THR A 1 59 ? 7.249   9.698   -3.791  1.00 0.00 ? 59 THR A HG21 7  
ATOM 8100  H HG22 . THR A 1 59 ? 8.845   9.394   -3.104  1.00 0.00 ? 59 THR A HG22 7  
ATOM 8101  H HG23 . THR A 1 59 ? 7.782   10.591  -2.367  1.00 0.00 ? 59 THR A HG23 7  
ATOM 8102  N N    . PHE A 1 60 ? 8.931   5.356   -2.654  1.00 0.00 ? 60 PHE A N    7  
ATOM 8103  C CA   . PHE A 1 60 ? 10.291  4.764   -2.508  1.00 0.00 ? 60 PHE A CA   7  
ATOM 8104  C C    . PHE A 1 60 ? 11.167  5.217   -3.693  1.00 0.00 ? 60 PHE A C    7  
ATOM 8105  O O    . PHE A 1 60 ? 10.643  5.475   -4.759  1.00 0.00 ? 60 PHE A O    7  
ATOM 8106  C CB   . PHE A 1 60 ? 10.164  3.235   -2.522  1.00 0.00 ? 60 PHE A CB   7  
ATOM 8107  C CG   . PHE A 1 60 ? 9.638   2.756   -1.186  1.00 0.00 ? 60 PHE A CG   7  
ATOM 8108  C CD1  . PHE A 1 60 ? 10.463  2.797   -0.055  1.00 0.00 ? 60 PHE A CD1  7  
ATOM 8109  C CD2  . PHE A 1 60 ? 8.328   2.274   -1.078  1.00 0.00 ? 60 PHE A CD2  7  
ATOM 8110  C CE1  . PHE A 1 60 ? 9.978   2.355   1.181   1.00 0.00 ? 60 PHE A CE1  7  
ATOM 8111  C CE2  . PHE A 1 60 ? 7.843   1.832   0.159   1.00 0.00 ? 60 PHE A CE2  7  
ATOM 8112  C CZ   . PHE A 1 60 ? 8.668   1.873   1.288   1.00 0.00 ? 60 PHE A CZ   7  
ATOM 8113  H H    . PHE A 1 60 ? 8.170   4.773   -2.854  1.00 0.00 ? 60 PHE A H    7  
ATOM 8114  H HA   . PHE A 1 60 ? 10.716  5.088   -1.573  1.00 0.00 ? 60 PHE A HA   7  
ATOM 8115  H HB2  . PHE A 1 60 ? 9.478   2.942   -3.305  1.00 0.00 ? 60 PHE A HB2  7  
ATOM 8116  H HB3  . PHE A 1 60 ? 11.127  2.789   -2.711  1.00 0.00 ? 60 PHE A HB3  7  
ATOM 8117  H HD1  . PHE A 1 60 ? 11.474  3.169   -0.137  1.00 0.00 ? 60 PHE A HD1  7  
ATOM 8118  H HD2  . PHE A 1 60 ? 7.691   2.243   -1.951  1.00 0.00 ? 60 PHE A HD2  7  
ATOM 8119  H HE1  . PHE A 1 60 ? 10.614  2.386   2.054   1.00 0.00 ? 60 PHE A HE1  7  
ATOM 8120  H HE2  . PHE A 1 60 ? 6.832   1.460   0.240   1.00 0.00 ? 60 PHE A HE2  7  
ATOM 8121  H HZ   . PHE A 1 60 ? 8.293   1.532   2.242   1.00 0.00 ? 60 PHE A HZ   7  
ATOM 8122  N N    . PRO A 1 61 ? 12.472  5.298   -3.501  1.00 0.00 ? 61 PRO A N    7  
ATOM 8123  C CA   . PRO A 1 61 ? 13.375  5.715   -4.589  1.00 0.00 ? 61 PRO A CA   7  
ATOM 8124  C C    . PRO A 1 61 ? 13.109  4.862   -5.839  1.00 0.00 ? 61 PRO A C    7  
ATOM 8125  O O    . PRO A 1 61 ? 12.928  5.379   -6.924  1.00 0.00 ? 61 PRO A O    7  
ATOM 8126  C CB   . PRO A 1 61 ? 14.803  5.495   -4.034  1.00 0.00 ? 61 PRO A CB   7  
ATOM 8127  C CG   . PRO A 1 61 ? 14.660  5.032   -2.552  1.00 0.00 ? 61 PRO A CG   7  
ATOM 8128  C CD   . PRO A 1 61 ? 13.152  4.991   -2.221  1.00 0.00 ? 61 PRO A CD   7  
ATOM 8129  H HA   . PRO A 1 61 ? 13.223  6.760   -4.816  1.00 0.00 ? 61 PRO A HA   7  
ATOM 8130  H HB2  . PRO A 1 61 ? 15.320  4.736   -4.612  1.00 0.00 ? 61 PRO A HB2  7  
ATOM 8131  H HB3  . PRO A 1 61 ? 15.362  6.421   -4.072  1.00 0.00 ? 61 PRO A HB3  7  
ATOM 8132  H HG2  . PRO A 1 61 ? 15.095  4.046   -2.432  1.00 0.00 ? 61 PRO A HG2  7  
ATOM 8133  H HG3  . PRO A 1 61 ? 15.161  5.730   -1.895  1.00 0.00 ? 61 PRO A HG3  7  
ATOM 8134  H HD2  . PRO A 1 61 ? 12.870  4.012   -1.862  1.00 0.00 ? 61 PRO A HD2  7  
ATOM 8135  H HD3  . PRO A 1 61 ? 12.910  5.745   -1.485  1.00 0.00 ? 61 PRO A HD3  7  
ATOM 8136  N N    . SER A 1 62 ? 13.078  3.566   -5.695  1.00 0.00 ? 62 SER A N    7  
ATOM 8137  C CA   . SER A 1 62 ? 12.817  2.696   -6.876  1.00 0.00 ? 62 SER A CA   7  
ATOM 8138  C C    . SER A 1 62 ? 11.324  2.731   -7.207  1.00 0.00 ? 62 SER A C    7  
ATOM 8139  O O    . SER A 1 62 ? 10.499  2.292   -6.433  1.00 0.00 ? 62 SER A O    7  
ATOM 8140  C CB   . SER A 1 62 ? 13.237  1.261   -6.556  1.00 0.00 ? 62 SER A CB   7  
ATOM 8141  O OG   . SER A 1 62 ? 12.437  0.764   -5.491  1.00 0.00 ? 62 SER A OG   7  
ATOM 8142  H H    . SER A 1 62 ? 13.222  3.162   -4.813  1.00 0.00 ? 62 SER A H    7  
ATOM 8143  H HA   . SER A 1 62 ? 13.383  3.057   -7.722  1.00 0.00 ? 62 SER A HA   7  
ATOM 8144  H HB2  . SER A 1 62 ? 13.095  0.641   -7.425  1.00 0.00 ? 62 SER A HB2  7  
ATOM 8145  H HB3  . SER A 1 62 ? 14.281  1.247   -6.273  1.00 0.00 ? 62 SER A HB3  7  
ATOM 8146  H HG   . SER A 1 62 ? 11.600  1.235   -5.504  1.00 0.00 ? 62 SER A HG   7  
ATOM 8147  N N    . ARG A 1 63 ? 10.974  3.262   -8.351  1.00 0.00 ? 63 ARG A N    7  
ATOM 8148  C CA   . ARG A 1 63 ? 9.536   3.344   -8.746  1.00 0.00 ? 63 ARG A CA   7  
ATOM 8149  C C    . ARG A 1 63 ? 8.832   4.401   -7.887  1.00 0.00 ? 63 ARG A C    7  
ATOM 8150  O O    . ARG A 1 63 ? 8.243   4.101   -6.868  1.00 0.00 ? 63 ARG A O    7  
ATOM 8151  C CB   . ARG A 1 63 ? 8.858   1.972   -8.564  1.00 0.00 ? 63 ARG A CB   7  
ATOM 8152  C CG   . ARG A 1 63 ? 7.658   1.857   -9.512  1.00 0.00 ? 63 ARG A CG   7  
ATOM 8153  C CD   . ARG A 1 63 ? 6.942   0.526   -9.272  1.00 0.00 ? 63 ARG A CD   7  
ATOM 8154  N NE   . ARG A 1 63 ? 5.605   0.558   -9.930  1.00 0.00 ? 63 ARG A NE   7  
ATOM 8155  C CZ   . ARG A 1 63 ? 4.944   -0.551  -10.118 1.00 0.00 ? 63 ARG A CZ   7  
ATOM 8156  N NH1  . ARG A 1 63 ? 5.452   -1.689  -9.731  1.00 0.00 ? 63 ARG A NH1  7  
ATOM 8157  N NH2  . ARG A 1 63 ? 3.773   -0.523  -10.694 1.00 0.00 ? 63 ARG A NH2  7  
ATOM 8158  H H    . ARG A 1 63 ? 11.661  3.621   -8.950  1.00 0.00 ? 63 ARG A H    7  
ATOM 8159  H HA   . ARG A 1 63 ? 9.478   3.640   -9.785  1.00 0.00 ? 63 ARG A HA   7  
ATOM 8160  H HB2  . ARG A 1 63 ? 9.568   1.191   -8.789  1.00 0.00 ? 63 ARG A HB2  7  
ATOM 8161  H HB3  . ARG A 1 63 ? 8.515   1.863   -7.546  1.00 0.00 ? 63 ARG A HB3  7  
ATOM 8162  H HG2  . ARG A 1 63 ? 6.974   2.672   -9.328  1.00 0.00 ? 63 ARG A HG2  7  
ATOM 8163  H HG3  . ARG A 1 63 ? 8.002   1.898   -10.534 1.00 0.00 ? 63 ARG A HG3  7  
ATOM 8164  H HD2  . ARG A 1 63 ? 7.529   -0.279  -9.688  1.00 0.00 ? 63 ARG A HD2  7  
ATOM 8165  H HD3  . ARG A 1 63 ? 6.817   0.370   -8.210  1.00 0.00 ? 63 ARG A HD3  7  
ATOM 8166  H HE   . ARG A 1 63 ? 5.222   1.412   -10.221 1.00 0.00 ? 63 ARG A HE   7  
ATOM 8167  H HH11 . ARG A 1 63 ? 6.350   -1.711  -9.290  1.00 0.00 ? 63 ARG A HH11 7  
ATOM 8168  H HH12 . ARG A 1 63 ? 4.945   -2.538  -9.876  1.00 0.00 ? 63 ARG A HH12 7  
ATOM 8169  H HH21 . ARG A 1 63 ? 3.383   0.348   -10.991 1.00 0.00 ? 63 ARG A HH21 7  
ATOM 8170  H HH22 . ARG A 1 63 ? 3.266   -1.373  -10.838 1.00 0.00 ? 63 ARG A HH22 7  
ATOM 8171  N N    . GLY A 1 64 ? 8.895   5.638   -8.296  1.00 0.00 ? 64 GLY A N    7  
ATOM 8172  C CA   . GLY A 1 64 ? 8.237   6.723   -7.512  1.00 0.00 ? 64 GLY A CA   7  
ATOM 8173  C C    . GLY A 1 64 ? 6.717   6.598   -7.637  1.00 0.00 ? 64 GLY A C    7  
ATOM 8174  O O    . GLY A 1 64 ? 6.042   6.170   -6.723  1.00 0.00 ? 64 GLY A O    7  
ATOM 8175  H H    . GLY A 1 64 ? 9.379   5.851   -9.121  1.00 0.00 ? 64 GLY A H    7  
ATOM 8176  H HA2  . GLY A 1 64 ? 8.522   6.636   -6.473  1.00 0.00 ? 64 GLY A HA2  7  
ATOM 8177  H HA3  . GLY A 1 64 ? 8.549   7.683   -7.893  1.00 0.00 ? 64 GLY A HA3  7  
ATOM 8178  N N    . ASN A 1 65 ? 6.173   6.974   -8.762  1.00 0.00 ? 65 ASN A N    7  
ATOM 8179  C CA   . ASN A 1 65 ? 4.696   6.880   -8.946  1.00 0.00 ? 65 ASN A CA   7  
ATOM 8180  C C    . ASN A 1 65 ? 4.212   5.492   -8.521  1.00 0.00 ? 65 ASN A C    7  
ATOM 8181  O O    . ASN A 1 65 ? 4.968   4.541   -8.493  1.00 0.00 ? 65 ASN A O    7  
ATOM 8182  C CB   . ASN A 1 65 ? 4.351   7.112   -10.418 1.00 0.00 ? 65 ASN A CB   7  
ATOM 8183  C CG   . ASN A 1 65 ? 5.096   6.093   -11.283 1.00 0.00 ? 65 ASN A CG   7  
ATOM 8184  O OD1  . ASN A 1 65 ? 4.503   5.435   -12.114 1.00 0.00 ? 65 ASN A OD1  7  
ATOM 8185  N ND2  . ASN A 1 65 ? 6.382   5.936   -11.123 1.00 0.00 ? 65 ASN A ND2  7  
ATOM 8186  H H    . ASN A 1 65 ? 6.735   7.318   -9.488  1.00 0.00 ? 65 ASN A H    7  
ATOM 8187  H HA   . ASN A 1 65 ? 4.211   7.631   -8.341  1.00 0.00 ? 65 ASN A HA   7  
ATOM 8188  H HB2  . ASN A 1 65 ? 3.287   6.996   -10.560 1.00 0.00 ? 65 ASN A HB2  7  
ATOM 8189  H HB3  . ASN A 1 65 ? 4.647   8.109   -10.705 1.00 0.00 ? 65 ASN A HB3  7  
ATOM 8190  H HD21 . ASN A 1 65 ? 6.861   6.467   -10.453 1.00 0.00 ? 65 ASN A HD21 7  
ATOM 8191  H HD22 . ASN A 1 65 ? 6.868   5.286   -11.672 1.00 0.00 ? 65 ASN A HD22 7  
ATOM 8192  N N    . LEU A 1 66 ? 2.953   5.367   -8.188  1.00 0.00 ? 66 LEU A N    7  
ATOM 8193  C CA   . LEU A 1 66 ? 2.410   4.039   -7.763  1.00 0.00 ? 66 LEU A CA   7  
ATOM 8194  C C    . LEU A 1 66 ? 0.963   3.901   -8.265  1.00 0.00 ? 66 LEU A C    7  
ATOM 8195  O O    . LEU A 1 66 ? 0.187   3.134   -7.737  1.00 0.00 ? 66 LEU A O    7  
ATOM 8196  C CB   . LEU A 1 66 ? 2.458   3.951   -6.218  1.00 0.00 ? 66 LEU A CB   7  
ATOM 8197  C CG   . LEU A 1 66 ? 2.812   2.526   -5.735  1.00 0.00 ? 66 LEU A CG   7  
ATOM 8198  C CD1  . LEU A 1 66 ? 1.782   1.515   -6.255  1.00 0.00 ? 66 LEU A CD1  7  
ATOM 8199  C CD2  . LEU A 1 66 ? 4.230   2.127   -6.203  1.00 0.00 ? 66 LEU A CD2  7  
ATOM 8200  H H    . LEU A 1 66 ? 2.364   6.151   -8.219  1.00 0.00 ? 66 LEU A H    7  
ATOM 8201  H HA   . LEU A 1 66 ? 3.010   3.255   -8.198  1.00 0.00 ? 66 LEU A HA   7  
ATOM 8202  H HB2  . LEU A 1 66 ? 3.209   4.637   -5.855  1.00 0.00 ? 66 LEU A HB2  7  
ATOM 8203  H HB3  . LEU A 1 66 ? 1.500   4.236   -5.805  1.00 0.00 ? 66 LEU A HB3  7  
ATOM 8204  H HG   . LEU A 1 66 ? 2.785   2.516   -4.654  1.00 0.00 ? 66 LEU A HG   7  
ATOM 8205  H HD11 . LEU A 1 66 ? 1.802   1.494   -7.333  1.00 0.00 ? 66 LEU A HD11 7  
ATOM 8206  H HD12 . LEU A 1 66 ? 0.797   1.799   -5.917  1.00 0.00 ? 66 LEU A HD12 7  
ATOM 8207  H HD13 . LEU A 1 66 ? 2.021   0.533   -5.874  1.00 0.00 ? 66 LEU A HD13 7  
ATOM 8208  H HD21 . LEU A 1 66 ? 4.835   3.014   -6.342  1.00 0.00 ? 66 LEU A HD21 7  
ATOM 8209  H HD22 . LEU A 1 66 ? 4.177   1.580   -7.134  1.00 0.00 ? 66 LEU A HD22 7  
ATOM 8210  H HD23 . LEU A 1 66 ? 4.688   1.503   -5.451  1.00 0.00 ? 66 LEU A HD23 7  
ATOM 8211  N N    . ASP A 1 67 ? 0.603   4.639   -9.284  1.00 0.00 ? 67 ASP A N    7  
ATOM 8212  C CA   . ASP A 1 67 ? -0.786  4.556   -9.830  1.00 0.00 ? 67 ASP A CA   7  
ATOM 8213  C C    . ASP A 1 67 ? -1.801  4.984   -8.760  1.00 0.00 ? 67 ASP A C    7  
ATOM 8214  O O    . ASP A 1 67 ? -2.458  5.998   -8.889  1.00 0.00 ? 67 ASP A O    7  
ATOM 8215  C CB   . ASP A 1 67 ? -1.079  3.118   -10.276 1.00 0.00 ? 67 ASP A CB   7  
ATOM 8216  C CG   . ASP A 1 67 ? -2.263  3.109   -11.248 1.00 0.00 ? 67 ASP A CG   7  
ATOM 8217  O OD1  . ASP A 1 67 ? -2.166  3.763   -12.275 1.00 0.00 ? 67 ASP A OD1  7  
ATOM 8218  O OD2  . ASP A 1 67 ? -3.245  2.450   -10.949 1.00 0.00 ? 67 ASP A OD2  7  
ATOM 8219  H H    . ASP A 1 67 ? 1.250   5.249   -9.695  1.00 0.00 ? 67 ASP A H    7  
ATOM 8220  H HA   . ASP A 1 67 ? -0.869  5.219   -10.680 1.00 0.00 ? 67 ASP A HA   7  
ATOM 8221  H HB2  . ASP A 1 67 ? -0.208  2.712   -10.769 1.00 0.00 ? 67 ASP A HB2  7  
ATOM 8222  H HB3  . ASP A 1 67 ? -1.321  2.512   -9.416  1.00 0.00 ? 67 ASP A HB3  7  
ATOM 8223  N N    . ASP A 1 68 ? -1.938  4.215   -7.712  1.00 0.00 ? 68 ASP A N    7  
ATOM 8224  C CA   . ASP A 1 68 ? -2.913  4.568   -6.636  1.00 0.00 ? 68 ASP A CA   7  
ATOM 8225  C C    . ASP A 1 68 ? -2.812  6.058   -6.302  1.00 0.00 ? 68 ASP A C    7  
ATOM 8226  O O    . ASP A 1 68 ? -3.594  6.857   -6.771  1.00 0.00 ? 68 ASP A O    7  
ATOM 8227  C CB   . ASP A 1 68 ? -2.604  3.746   -5.382  1.00 0.00 ? 68 ASP A CB   7  
ATOM 8228  C CG   . ASP A 1 68 ? -2.681  2.255   -5.717  1.00 0.00 ? 68 ASP A CG   7  
ATOM 8229  O OD1  . ASP A 1 68 ? -1.757  1.759   -6.340  1.00 0.00 ? 68 ASP A OD1  7  
ATOM 8230  O OD2  . ASP A 1 68 ? -3.663  1.635   -5.344  1.00 0.00 ? 68 ASP A OD2  7  
ATOM 8231  H H    . ASP A 1 68 ? -1.400  3.399   -7.633  1.00 0.00 ? 68 ASP A H    7  
ATOM 8232  H HA   . ASP A 1 68 ? -3.914  4.343   -6.973  1.00 0.00 ? 68 ASP A HA   7  
ATOM 8233  H HB2  . ASP A 1 68 ? -1.611  3.986   -5.031  1.00 0.00 ? 68 ASP A HB2  7  
ATOM 8234  H HB3  . ASP A 1 68 ? -3.325  3.977   -4.613  1.00 0.00 ? 68 ASP A HB3  7  
ATOM 8235  N N    . PHE A 1 69 ? -1.858  6.430   -5.488  1.00 0.00 ? 69 PHE A N    7  
ATOM 8236  C CA   . PHE A 1 69 ? -1.698  7.867   -5.109  1.00 0.00 ? 69 PHE A CA   7  
ATOM 8237  C C    . PHE A 1 69 ? -2.832  8.277   -4.163  1.00 0.00 ? 69 PHE A C    7  
ATOM 8238  O O    . PHE A 1 69 ? -3.913  7.723   -4.205  1.00 0.00 ? 69 PHE A O    7  
ATOM 8239  C CB   . PHE A 1 69 ? -1.718  8.751   -6.373  1.00 0.00 ? 69 PHE A CB   7  
ATOM 8240  C CG   . PHE A 1 69 ? -0.959  10.035  -6.118  1.00 0.00 ? 69 PHE A CG   7  
ATOM 8241  C CD1  . PHE A 1 69 ? 0.414   10.103  -6.382  1.00 0.00 ? 69 PHE A CD1  7  
ATOM 8242  C CD2  . PHE A 1 69 ? -1.632  11.156  -5.618  1.00 0.00 ? 69 PHE A CD2  7  
ATOM 8243  C CE1  . PHE A 1 69 ? 1.115   11.292  -6.147  1.00 0.00 ? 69 PHE A CE1  7  
ATOM 8244  C CE2  . PHE A 1 69 ? -0.931  12.345  -5.381  1.00 0.00 ? 69 PHE A CE2  7  
ATOM 8245  C CZ   . PHE A 1 69 ? 0.441   12.413  -5.646  1.00 0.00 ? 69 PHE A CZ   7  
ATOM 8246  H H    . PHE A 1 69 ? -1.245  5.757   -5.117  1.00 0.00 ? 69 PHE A H    7  
ATOM 8247  H HA   . PHE A 1 69 ? -0.752  7.991   -4.599  1.00 0.00 ? 69 PHE A HA   7  
ATOM 8248  H HB2  . PHE A 1 69 ? -1.254  8.219   -7.189  1.00 0.00 ? 69 PHE A HB2  7  
ATOM 8249  H HB3  . PHE A 1 69 ? -2.738  8.991   -6.638  1.00 0.00 ? 69 PHE A HB3  7  
ATOM 8250  H HD1  . PHE A 1 69 ? 0.933   9.238   -6.769  1.00 0.00 ? 69 PHE A HD1  7  
ATOM 8251  H HD2  . PHE A 1 69 ? -2.691  11.104  -5.413  1.00 0.00 ? 69 PHE A HD2  7  
ATOM 8252  H HE1  . PHE A 1 69 ? 2.174   11.344  -6.351  1.00 0.00 ? 69 PHE A HE1  7  
ATOM 8253  H HE2  . PHE A 1 69 ? -1.450  13.210  -4.995  1.00 0.00 ? 69 PHE A HE2  7  
ATOM 8254  H HZ   . PHE A 1 69 ? 0.982   13.330  -5.464  1.00 0.00 ? 69 PHE A HZ   7  
ATOM 8255  N N    . PHE A 1 70 ? -2.575  9.230   -3.300  1.00 0.00 ? 70 PHE A N    7  
ATOM 8256  C CA   . PHE A 1 70 ? -3.609  9.693   -2.319  1.00 0.00 ? 70 PHE A CA   7  
ATOM 8257  C C    . PHE A 1 70 ? -5.008  9.671   -2.946  1.00 0.00 ? 70 PHE A C    7  
ATOM 8258  O O    . PHE A 1 70 ? -5.293  10.386  -3.887  1.00 0.00 ? 70 PHE A O    7  
ATOM 8259  C CB   . PHE A 1 70 ? -3.282  11.121  -1.876  1.00 0.00 ? 70 PHE A CB   7  
ATOM 8260  C CG   . PHE A 1 70 ? -4.326  11.597  -0.895  1.00 0.00 ? 70 PHE A CG   7  
ATOM 8261  C CD1  . PHE A 1 70 ? -5.493  12.215  -1.359  1.00 0.00 ? 70 PHE A CD1  7  
ATOM 8262  C CD2  . PHE A 1 70 ? -4.127  11.419  0.480   1.00 0.00 ? 70 PHE A CD2  7  
ATOM 8263  C CE1  . PHE A 1 70 ? -6.462  12.655  -0.450  1.00 0.00 ? 70 PHE A CE1  7  
ATOM 8264  C CE2  . PHE A 1 70 ? -5.097  11.859  1.390   1.00 0.00 ? 70 PHE A CE2  7  
ATOM 8265  C CZ   . PHE A 1 70 ? -6.264  12.478  0.925   1.00 0.00 ? 70 PHE A CZ   7  
ATOM 8266  H H    . PHE A 1 70 ? -1.682  9.633   -3.286  1.00 0.00 ? 70 PHE A H    7  
ATOM 8267  H HA   . PHE A 1 70 ? -3.597  9.044   -1.457  1.00 0.00 ? 70 PHE A HA   7  
ATOM 8268  H HB2  . PHE A 1 70 ? -2.310  11.136  -1.404  1.00 0.00 ? 70 PHE A HB2  7  
ATOM 8269  H HB3  . PHE A 1 70 ? -3.274  11.772  -2.737  1.00 0.00 ? 70 PHE A HB3  7  
ATOM 8270  H HD1  . PHE A 1 70 ? -5.646  12.352  -2.420  1.00 0.00 ? 70 PHE A HD1  7  
ATOM 8271  H HD2  . PHE A 1 70 ? -3.227  10.942  0.838   1.00 0.00 ? 70 PHE A HD2  7  
ATOM 8272  H HE1  . PHE A 1 70 ? -7.363  13.132  -0.807  1.00 0.00 ? 70 PHE A HE1  7  
ATOM 8273  H HE2  . PHE A 1 70 ? -4.944  11.722  2.450   1.00 0.00 ? 70 PHE A HE2  7  
ATOM 8274  H HZ   . PHE A 1 70 ? -7.011  12.817  1.627   1.00 0.00 ? 70 PHE A HZ   7  
ATOM 8275  N N    . HIS A 1 71 ? -5.880  8.851   -2.424  1.00 0.00 ? 71 HIS A N    7  
ATOM 8276  C CA   . HIS A 1 71 ? -7.262  8.770   -2.973  1.00 0.00 ? 71 HIS A CA   7  
ATOM 8277  C C    . HIS A 1 71 ? -8.196  8.212   -1.895  1.00 0.00 ? 71 HIS A C    7  
ATOM 8278  O O    . HIS A 1 71 ? -9.263  7.708   -2.183  1.00 0.00 ? 71 HIS A O    7  
ATOM 8279  C CB   . HIS A 1 71 ? -7.275  7.841   -4.191  1.00 0.00 ? 71 HIS A CB   7  
ATOM 8280  C CG   . HIS A 1 71 ? -6.670  8.547   -5.374  1.00 0.00 ? 71 HIS A CG   7  
ATOM 8281  N ND1  . HIS A 1 71 ? -5.716  7.950   -6.185  1.00 0.00 ? 71 HIS A ND1  7  
ATOM 8282  C CD2  . HIS A 1 71 ? -6.877  9.799   -5.899  1.00 0.00 ? 71 HIS A CD2  7  
ATOM 8283  C CE1  . HIS A 1 71 ? -5.390  8.836   -7.144  1.00 0.00 ? 71 HIS A CE1  7  
ATOM 8284  N NE2  . HIS A 1 71 ? -6.067  9.979   -7.016  1.00 0.00 ? 71 HIS A NE2  7  
ATOM 8285  H H    . HIS A 1 71 ? -5.623  8.288   -1.665  1.00 0.00 ? 71 HIS A H    7  
ATOM 8286  H HA   . HIS A 1 71 ? -7.596  9.756   -3.264  1.00 0.00 ? 71 HIS A HA   7  
ATOM 8287  H HB2  . HIS A 1 71 ? -6.701  6.952   -3.972  1.00 0.00 ? 71 HIS A HB2  7  
ATOM 8288  H HB3  . HIS A 1 71 ? -8.293  7.563   -4.422  1.00 0.00 ? 71 HIS A HB3  7  
ATOM 8289  H HD1  . HIS A 1 71 ? -5.348  7.049   -6.078  1.00 0.00 ? 71 HIS A HD1  7  
ATOM 8290  H HD2  . HIS A 1 71 ? -7.563  10.533  -5.505  1.00 0.00 ? 71 HIS A HD2  7  
ATOM 8291  H HE1  . HIS A 1 71 ? -4.667  8.643   -7.925  1.00 0.00 ? 71 HIS A HE1  7  
ATOM 8292  N N    . ARG A 1 72 ? -7.797  8.298   -0.655  1.00 0.00 ? 72 ARG A N    7  
ATOM 8293  C CA   . ARG A 1 72 ? -8.655  7.773   0.448   1.00 0.00 ? 72 ARG A CA   7  
ATOM 8294  C C    . ARG A 1 72 ? -10.094 8.265   0.257   1.00 0.00 ? 72 ARG A C    7  
ATOM 8295  O O    . ARG A 1 72 ? -10.358 9.142   -0.541  1.00 0.00 ? 72 ARG A O    7  
ATOM 8296  C CB   . ARG A 1 72 ? -8.110  8.271   1.791   1.00 0.00 ? 72 ARG A CB   7  
ATOM 8297  C CG   . ARG A 1 72 ? -6.639  7.858   1.930   1.00 0.00 ? 72 ARG A CG   7  
ATOM 8298  C CD   . ARG A 1 72 ? -6.086  8.295   3.305   1.00 0.00 ? 72 ARG A CD   7  
ATOM 8299  N NE   . ARG A 1 72 ? -4.704  8.849   3.140   1.00 0.00 ? 72 ARG A NE   7  
ATOM 8300  C CZ   . ARG A 1 72 ? -3.802  8.221   2.430   1.00 0.00 ? 72 ARG A CZ   7  
ATOM 8301  N NH1  . ARG A 1 72 ? -4.039  7.027   1.964   1.00 0.00 ? 72 ARG A NH1  7  
ATOM 8302  N NH2  . ARG A 1 72 ? -2.640  8.777   2.224   1.00 0.00 ? 72 ARG A NH2  7  
ATOM 8303  H H    . ARG A 1 72 ? -6.932  8.707   -0.447  1.00 0.00 ? 72 ARG A H    7  
ATOM 8304  H HA   . ARG A 1 72 ? -8.639  6.694   0.432   1.00 0.00 ? 72 ARG A HA   7  
ATOM 8305  H HB2  . ARG A 1 72 ? -8.189  9.347   1.835   1.00 0.00 ? 72 ARG A HB2  7  
ATOM 8306  H HB3  . ARG A 1 72 ? -8.678  7.834   2.597   1.00 0.00 ? 72 ARG A HB3  7  
ATOM 8307  H HG2  . ARG A 1 72 ? -6.568  6.785   1.830   1.00 0.00 ? 72 ARG A HG2  7  
ATOM 8308  H HG3  . ARG A 1 72 ? -6.063  8.329   1.147   1.00 0.00 ? 72 ARG A HG3  7  
ATOM 8309  H HD2  . ARG A 1 72 ? -6.705  9.072   3.723   1.00 0.00 ? 72 ARG A HD2  7  
ATOM 8310  H HD3  . ARG A 1 72 ? -6.081  7.445   3.981   1.00 0.00 ? 72 ARG A HD3  7  
ATOM 8311  H HE   . ARG A 1 72 ? -4.484  9.716   3.541   1.00 0.00 ? 72 ARG A HE   7  
ATOM 8312  H HH11 . ARG A 1 72 ? -4.911  6.582   2.149   1.00 0.00 ? 72 ARG A HH11 7  
ATOM 8313  H HH12 . ARG A 1 72 ? -3.346  6.557   1.418   1.00 0.00 ? 72 ARG A HH12 7  
ATOM 8314  H HH21 . ARG A 1 72 ? -2.442  9.679   2.607   1.00 0.00 ? 72 ARG A HH21 7  
ATOM 8315  H HH22 . ARG A 1 72 ? -1.947  8.301   1.681   1.00 0.00 ? 72 ARG A HH22 7  
ATOM 8316  N N    . ASP A 1 73 ? -11.028 7.699   0.978   1.00 0.00 ? 73 ASP A N    7  
ATOM 8317  C CA   . ASP A 1 73 ? -12.452 8.123   0.837   1.00 0.00 ? 73 ASP A CA   7  
ATOM 8318  C C    . ASP A 1 73 ? -12.547 9.650   0.802   1.00 0.00 ? 73 ASP A C    7  
ATOM 8319  O O    . ASP A 1 73 ? -11.591 10.353  1.065   1.00 0.00 ? 73 ASP A O    7  
ATOM 8320  C CB   . ASP A 1 73 ? -13.257 7.594   2.025   1.00 0.00 ? 73 ASP A CB   7  
ATOM 8321  C CG   . ASP A 1 73 ? -14.727 7.985   1.859   1.00 0.00 ? 73 ASP A CG   7  
ATOM 8322  O OD1  . ASP A 1 73 ? -15.229 7.869   0.754   1.00 0.00 ? 73 ASP A OD1  7  
ATOM 8323  O OD2  . ASP A 1 73 ? -15.325 8.393   2.842   1.00 0.00 ? 73 ASP A OD2  7  
ATOM 8324  H H    . ASP A 1 73 ? -10.793 6.987   1.608   1.00 0.00 ? 73 ASP A H    7  
ATOM 8325  H HA   . ASP A 1 73 ? -12.858 7.718   -0.077  1.00 0.00 ? 73 ASP A HA   7  
ATOM 8326  H HB2  . ASP A 1 73 ? -13.172 6.518   2.067   1.00 0.00 ? 73 ASP A HB2  7  
ATOM 8327  H HB3  . ASP A 1 73 ? -12.875 8.021   2.940   1.00 0.00 ? 73 ASP A HB3  7  
ATOM 8328  N N    . LYS A 1 74 ? -13.703 10.166  0.480   1.00 0.00 ? 74 LYS A N    7  
ATOM 8329  C CA   . LYS A 1 74 ? -13.883 11.648  0.423   1.00 0.00 ? 74 LYS A CA   7  
ATOM 8330  C C    . LYS A 1 74 ? -14.405 12.148  1.771   1.00 0.00 ? 74 LYS A C    7  
ATOM 8331  O O    . LYS A 1 74 ? -15.103 11.446  2.477   1.00 0.00 ? 74 LYS A O    7  
ATOM 8332  C CB   . LYS A 1 74 ? -14.893 11.993  -0.673  1.00 0.00 ? 74 LYS A CB   7  
ATOM 8333  C CG   . LYS A 1 74 ? -14.376 11.480  -2.019  1.00 0.00 ? 74 LYS A CG   7  
ATOM 8334  C CD   . LYS A 1 74 ? -15.297 11.964  -3.139  1.00 0.00 ? 74 LYS A CD   7  
ATOM 8335  C CE   . LYS A 1 74 ? -14.854 11.344  -4.466  1.00 0.00 ? 74 LYS A CE   7  
ATOM 8336  N NZ   . LYS A 1 74 ? -13.405 11.618  -4.683  1.00 0.00 ? 74 LYS A NZ   7  
ATOM 8337  H H    . LYS A 1 74 ? -14.458 9.574   0.279   1.00 0.00 ? 74 LYS A H    7  
ATOM 8338  H HA   . LYS A 1 74 ? -12.938 12.125  0.203   1.00 0.00 ? 74 LYS A HA   7  
ATOM 8339  H HB2  . LYS A 1 74 ? -15.842 11.527  -0.449  1.00 0.00 ? 74 LYS A HB2  7  
ATOM 8340  H HB3  . LYS A 1 74 ? -15.019 13.065  -0.723  1.00 0.00 ? 74 LYS A HB3  7  
ATOM 8341  H HG2  . LYS A 1 74 ? -13.376 11.854  -2.186  1.00 0.00 ? 74 LYS A HG2  7  
ATOM 8342  H HG3  . LYS A 1 74 ? -14.360 10.401  -2.010  1.00 0.00 ? 74 LYS A HG3  7  
ATOM 8343  H HD2  . LYS A 1 74 ? -16.314 11.668  -2.924  1.00 0.00 ? 74 LYS A HD2  7  
ATOM 8344  H HD3  . LYS A 1 74 ? -15.242 13.040  -3.212  1.00 0.00 ? 74 LYS A HD3  7  
ATOM 8345  H HE2  . LYS A 1 74 ? -15.018 10.277  -4.438  1.00 0.00 ? 74 LYS A HE2  7  
ATOM 8346  H HE3  . LYS A 1 74 ? -15.427 11.774  -5.274  1.00 0.00 ? 74 LYS A HE3  7  
ATOM 8347  H HZ1  . LYS A 1 74 ? -12.857 10.753  -4.503  1.00 0.00 ? 74 LYS A HZ1  7  
ATOM 8348  H HZ2  . LYS A 1 74 ? -13.092 12.365  -4.033  1.00 0.00 ? 74 LYS A HZ2  7  
ATOM 8349  H HZ3  . LYS A 1 74 ? -13.254 11.927  -5.666  1.00 0.00 ? 74 LYS A HZ3  7  
ATOM 8350  N N    . ASP A 1 75 ? -14.075 13.356  2.135   1.00 0.00 ? 75 ASP A N    7  
ATOM 8351  C CA   . ASP A 1 75 ? -14.555 13.899  3.436   1.00 0.00 ? 75 ASP A CA   7  
ATOM 8352  C C    . ASP A 1 75 ? -16.060 14.158  3.352   1.00 0.00 ? 75 ASP A C    7  
ATOM 8353  O O    . ASP A 1 75 ? -16.791 13.428  2.712   1.00 0.00 ? 75 ASP A O    7  
ATOM 8354  C CB   . ASP A 1 75 ? -13.828 15.210  3.741   1.00 0.00 ? 75 ASP A CB   7  
ATOM 8355  C CG   . ASP A 1 75 ? -14.176 16.248  2.675   1.00 0.00 ? 75 ASP A CG   7  
ATOM 8356  O OD1  . ASP A 1 75 ? -13.539 16.237  1.634   1.00 0.00 ? 75 ASP A OD1  7  
ATOM 8357  O OD2  . ASP A 1 75 ? -15.076 17.036  2.915   1.00 0.00 ? 75 ASP A OD2  7  
ATOM 8358  H H    . ASP A 1 75 ? -13.512 13.908  1.551   1.00 0.00 ? 75 ASP A H    7  
ATOM 8359  H HA   . ASP A 1 75 ? -14.355 13.183  4.220   1.00 0.00 ? 75 ASP A HA   7  
ATOM 8360  H HB2  . ASP A 1 75 ? -14.133 15.572  4.713   1.00 0.00 ? 75 ASP A HB2  7  
ATOM 8361  H HB3  . ASP A 1 75 ? -12.761 15.039  3.739   1.00 0.00 ? 75 ASP A HB3  7  
ATOM 8362  N N    . ASP A 1 76 ? -16.529 15.193  3.993   1.00 0.00 ? 76 ASP A N    7  
ATOM 8363  C CA   . ASP A 1 76 ? -17.987 15.499  3.948   1.00 0.00 ? 76 ASP A CA   7  
ATOM 8364  C C    . ASP A 1 76 ? -18.241 16.865  4.586   1.00 0.00 ? 76 ASP A C    7  
ATOM 8365  O O    . ASP A 1 76 ? -18.264 17.003  5.792   1.00 0.00 ? 76 ASP A O    7  
ATOM 8366  C CB   . ASP A 1 76 ? -18.759 14.425  4.720   1.00 0.00 ? 76 ASP A CB   7  
ATOM 8367  C CG   . ASP A 1 76 ? -20.261 14.683  4.590   1.00 0.00 ? 76 ASP A CG   7  
ATOM 8368  O OD1  . ASP A 1 76 ? -20.830 14.269  3.593   1.00 0.00 ? 76 ASP A OD1  7  
ATOM 8369  O OD2  . ASP A 1 76 ? -20.817 15.292  5.490   1.00 0.00 ? 76 ASP A OD2  7  
ATOM 8370  H H    . ASP A 1 76 ? -15.924 15.771  4.503   1.00 0.00 ? 76 ASP A H    7  
ATOM 8371  H HA   . ASP A 1 76 ? -18.320 15.513  2.921   1.00 0.00 ? 76 ASP A HA   7  
ATOM 8372  H HB2  . ASP A 1 76 ? -18.524 13.451  4.313   1.00 0.00 ? 76 ASP A HB2  7  
ATOM 8373  H HB3  . ASP A 1 76 ? -18.477 14.458  5.761   1.00 0.00 ? 76 ASP A HB3  7  
ATOM 8374  N N    . PHE A 1 77 ? -18.431 17.877  3.785   1.00 0.00 ? 77 PHE A N    7  
ATOM 8375  C CA   . PHE A 1 77 ? -18.684 19.234  4.347   1.00 0.00 ? 77 PHE A CA   7  
ATOM 8376  C C    . PHE A 1 77 ? -20.024 19.237  5.085   1.00 0.00 ? 77 PHE A C    7  
ATOM 8377  O O    . PHE A 1 77 ? -20.850 18.365  4.896   1.00 0.00 ? 77 PHE A O    7  
ATOM 8378  C CB   . PHE A 1 77 ? -18.726 20.257  3.210   1.00 0.00 ? 77 PHE A CB   7  
ATOM 8379  C CG   . PHE A 1 77 ? -17.405 20.248  2.476   1.00 0.00 ? 77 PHE A CG   7  
ATOM 8380  C CD1  . PHE A 1 77 ? -17.214 19.387  1.389   1.00 0.00 ? 77 PHE A CD1  7  
ATOM 8381  C CD2  . PHE A 1 77 ? -16.373 21.101  2.883   1.00 0.00 ? 77 PHE A CD2  7  
ATOM 8382  C CE1  . PHE A 1 77 ? -15.990 19.379  0.709   1.00 0.00 ? 77 PHE A CE1  7  
ATOM 8383  C CE2  . PHE A 1 77 ? -15.149 21.093  2.204   1.00 0.00 ? 77 PHE A CE2  7  
ATOM 8384  C CZ   . PHE A 1 77 ? -14.957 20.233  1.116   1.00 0.00 ? 77 PHE A CZ   7  
ATOM 8385  H H    . PHE A 1 77 ? -18.409 17.745  2.814   1.00 0.00 ? 77 PHE A H    7  
ATOM 8386  H HA   . PHE A 1 77 ? -17.893 19.491  5.034   1.00 0.00 ? 77 PHE A HA   7  
ATOM 8387  H HB2  . PHE A 1 77 ? -19.520 20.001  2.524   1.00 0.00 ? 77 PHE A HB2  7  
ATOM 8388  H HB3  . PHE A 1 77 ? -18.903 21.241  3.617   1.00 0.00 ? 77 PHE A HB3  7  
ATOM 8389  H HD1  . PHE A 1 77 ? -18.011 18.729  1.075   1.00 0.00 ? 77 PHE A HD1  7  
ATOM 8390  H HD2  . PHE A 1 77 ? -16.521 21.765  3.722   1.00 0.00 ? 77 PHE A HD2  7  
ATOM 8391  H HE1  . PHE A 1 77 ? -15.843 18.715  -0.130  1.00 0.00 ? 77 PHE A HE1  7  
ATOM 8392  H HE2  . PHE A 1 77 ? -14.353 21.752  2.518   1.00 0.00 ? 77 PHE A HE2  7  
ATOM 8393  H HZ   . PHE A 1 77 ? -14.014 20.227  0.592   1.00 0.00 ? 77 PHE A HZ   7  
ATOM 8394  N N    . PHE A 1 78 ? -20.247 20.209  5.925   1.00 0.00 ? 78 PHE A N    7  
ATOM 8395  C CA   . PHE A 1 78 ? -21.534 20.265  6.674   1.00 0.00 ? 78 PHE A CA   7  
ATOM 8396  C C    . PHE A 1 78 ? -22.680 20.539  5.697   1.00 0.00 ? 78 PHE A C    7  
ATOM 8397  O O    . PHE A 1 78 ? -22.475 21.045  4.612   1.00 0.00 ? 78 PHE A O    7  
ATOM 8398  C CB   . PHE A 1 78 ? -21.472 21.385  7.714   1.00 0.00 ? 78 PHE A CB   7  
ATOM 8399  C CG   . PHE A 1 78 ? -20.231 21.222  8.558   1.00 0.00 ? 78 PHE A CG   7  
ATOM 8400  C CD1  . PHE A 1 78 ? -20.249 20.378  9.675   1.00 0.00 ? 78 PHE A CD1  7  
ATOM 8401  C CD2  . PHE A 1 78 ? -19.061 21.915  8.223   1.00 0.00 ? 78 PHE A CD2  7  
ATOM 8402  C CE1  . PHE A 1 78 ? -19.098 20.227  10.457  1.00 0.00 ? 78 PHE A CE1  7  
ATOM 8403  C CE2  . PHE A 1 78 ? -17.910 21.764  9.005   1.00 0.00 ? 78 PHE A CE2  7  
ATOM 8404  C CZ   . PHE A 1 78 ? -17.929 20.920  10.123  1.00 0.00 ? 78 PHE A CZ   7  
ATOM 8405  H H    . PHE A 1 78 ? -19.569 20.902  6.065   1.00 0.00 ? 78 PHE A H    7  
ATOM 8406  H HA   . PHE A 1 78 ? -21.703 19.321  7.171   1.00 0.00 ? 78 PHE A HA   7  
ATOM 8407  H HB2  . PHE A 1 78 ? -21.443 22.341  7.211   1.00 0.00 ? 78 PHE A HB2  7  
ATOM 8408  H HB3  . PHE A 1 78 ? -22.345 21.337  8.347   1.00 0.00 ? 78 PHE A HB3  7  
ATOM 8409  H HD1  . PHE A 1 78 ? -21.151 19.844  9.932   1.00 0.00 ? 78 PHE A HD1  7  
ATOM 8410  H HD2  . PHE A 1 78 ? -19.046 22.566  7.362   1.00 0.00 ? 78 PHE A HD2  7  
ATOM 8411  H HE1  . PHE A 1 78 ? -19.112 19.576  11.318  1.00 0.00 ? 78 PHE A HE1  7  
ATOM 8412  H HE2  . PHE A 1 78 ? -17.008 22.298  8.747   1.00 0.00 ? 78 PHE A HE2  7  
ATOM 8413  H HZ   . PHE A 1 78 ? -17.041 20.804  10.726  1.00 0.00 ? 78 PHE A HZ   7  
ATOM 8414  N N    . THR A 1 79 ? -23.885 20.208  6.073   1.00 0.00 ? 79 THR A N    7  
ATOM 8415  C CA   . THR A 1 79 ? -25.041 20.450  5.165   1.00 0.00 ? 79 THR A CA   7  
ATOM 8416  C C    . THR A 1 79 ? -26.345 20.188  5.920   1.00 0.00 ? 79 THR A C    7  
ATOM 8417  O O    . THR A 1 79 ? -27.389 20.557  5.406   1.00 0.00 ? 79 THR A O    7  
ATOM 8418  C CB   . THR A 1 79 ? -24.951 19.508  3.961   1.00 0.00 ? 79 THR A CB   7  
ATOM 8419  O OG1  . THR A 1 79 ? -26.182 19.532  3.251   1.00 0.00 ? 79 THR A OG1  7  
ATOM 8420  C CG2  . THR A 1 79 ? -24.664 18.085  4.443   1.00 0.00 ? 79 THR A CG2  7  
ATOM 8421  O OXT  . THR A 1 79 ? -26.279 19.624  7.000   1.00 0.00 ? 79 THR A OXT  7  
ATOM 8422  H H    . THR A 1 79 ? -24.029 19.800  6.952   1.00 0.00 ? 79 THR A H    7  
ATOM 8423  H HA   . THR A 1 79 ? -25.022 21.474  4.824   1.00 0.00 ? 79 THR A HA   7  
ATOM 8424  H HB   . THR A 1 79 ? -24.153 19.831  3.310   1.00 0.00 ? 79 THR A HB   7  
ATOM 8425  H HG1  . THR A 1 79 ? -25.983 19.614  2.316   1.00 0.00 ? 79 THR A HG1  7  
ATOM 8426  H HG21 . THR A 1 79 ? -23.684 18.050  4.896   1.00 0.00 ? 79 THR A HG21 7  
ATOM 8427  H HG22 . THR A 1 79 ? -24.697 17.408  3.603   1.00 0.00 ? 79 THR A HG22 7  
ATOM 8428  H HG23 . THR A 1 79 ? -25.407 17.795  5.170   1.00 0.00 ? 79 THR A HG23 7  
ATOM 8429  N N    . MET A 1 1  ? 4.329   -12.368 20.061  1.00 0.00 ? 1  MET A N    8  
ATOM 8430  C CA   . MET A 1 1  ? 3.958   -13.812 20.068  1.00 0.00 ? 1  MET A CA   8  
ATOM 8431  C C    . MET A 1 1  ? 2.466   -13.957 19.764  1.00 0.00 ? 1  MET A C    8  
ATOM 8432  O O    . MET A 1 1  ? 1.753   -12.982 19.623  1.00 0.00 ? 1  MET A O    8  
ATOM 8433  C CB   . MET A 1 1  ? 4.258   -14.408 21.445  1.00 0.00 ? 1  MET A CB   8  
ATOM 8434  C CG   . MET A 1 1  ? 5.751   -14.265 21.749  1.00 0.00 ? 1  MET A CG   8  
ATOM 8435  S SD   . MET A 1 1  ? 6.105   -14.968 23.379  1.00 0.00 ? 1  MET A SD   8  
ATOM 8436  C CE   . MET A 1 1  ? 7.900   -14.748 23.337  1.00 0.00 ? 1  MET A CE   8  
ATOM 8437  H H1   . MET A 1 1  ? 3.830   -11.878 20.830  1.00 0.00 ? 1  MET A H1   8  
ATOM 8438  H H2   . MET A 1 1  ? 4.060   -11.947 19.148  1.00 0.00 ? 1  MET A H2   8  
ATOM 8439  H H3   . MET A 1 1  ? 5.355   -12.272 20.199  1.00 0.00 ? 1  MET A H3   8  
ATOM 8440  H HA   . MET A 1 1  ? 4.531   -14.334 19.316  1.00 0.00 ? 1  MET A HA   8  
ATOM 8441  H HB2  . MET A 1 1  ? 3.686   -13.884 22.196  1.00 0.00 ? 1  MET A HB2  8  
ATOM 8442  H HB3  . MET A 1 1  ? 3.990   -15.454 21.451  1.00 0.00 ? 1  MET A HB3  8  
ATOM 8443  H HG2  . MET A 1 1  ? 6.323   -14.792 20.999  1.00 0.00 ? 1  MET A HG2  8  
ATOM 8444  H HG3  . MET A 1 1  ? 6.021   -13.220 21.741  1.00 0.00 ? 1  MET A HG3  8  
ATOM 8445  H HE1  . MET A 1 1  ? 8.320   -15.034 24.290  1.00 0.00 ? 1  MET A HE1  8  
ATOM 8446  H HE2  . MET A 1 1  ? 8.130   -13.711 23.132  1.00 0.00 ? 1  MET A HE2  8  
ATOM 8447  H HE3  . MET A 1 1  ? 8.322   -15.367 22.560  1.00 0.00 ? 1  MET A HE3  8  
ATOM 8448  N N    . ILE A 1 2  ? 1.986   -15.166 19.660  1.00 0.00 ? 2  ILE A N    8  
ATOM 8449  C CA   . ILE A 1 2  ? 0.540   -15.371 19.365  1.00 0.00 ? 2  ILE A CA   8  
ATOM 8450  C C    . ILE A 1 2  ? -0.297  -14.884 20.549  1.00 0.00 ? 2  ILE A C    8  
ATOM 8451  O O    . ILE A 1 2  ? -1.348  -14.298 20.381  1.00 0.00 ? 2  ILE A O    8  
ATOM 8452  C CB   . ILE A 1 2  ? 0.272   -16.860 19.130  1.00 0.00 ? 2  ILE A CB   8  
ATOM 8453  C CG1  . ILE A 1 2  ? 1.343   -17.438 18.196  1.00 0.00 ? 2  ILE A CG1  8  
ATOM 8454  C CG2  . ILE A 1 2  ? -1.109  -17.040 18.499  1.00 0.00 ? 2  ILE A CG2  8  
ATOM 8455  C CD1  . ILE A 1 2  ? 1.469   -16.568 16.940  1.00 0.00 ? 2  ILE A CD1  8  
ATOM 8456  H H    . ILE A 1 2  ? 2.576   -15.939 19.777  1.00 0.00 ? 2  ILE A H    8  
ATOM 8457  H HA   . ILE A 1 2  ? 0.270   -14.813 18.480  1.00 0.00 ? 2  ILE A HA   8  
ATOM 8458  H HB   . ILE A 1 2  ? 0.303   -17.381 20.077  1.00 0.00 ? 2  ILE A HB   8  
ATOM 8459  H HG12 . ILE A 1 2  ? 2.292   -17.464 18.710  1.00 0.00 ? 2  ILE A HG12 8  
ATOM 8460  H HG13 . ILE A 1 2  ? 1.064   -18.441 17.907  1.00 0.00 ? 2  ILE A HG13 8  
ATOM 8461  H HG21 . ILE A 1 2  ? -1.298  -18.092 18.341  1.00 0.00 ? 2  ILE A HG21 8  
ATOM 8462  H HG22 . ILE A 1 2  ? -1.141  -16.522 17.552  1.00 0.00 ? 2  ILE A HG22 8  
ATOM 8463  H HG23 . ILE A 1 2  ? -1.862  -16.634 19.158  1.00 0.00 ? 2  ILE A HG23 8  
ATOM 8464  H HD11 . ILE A 1 2  ? 0.486   -16.301 16.583  1.00 0.00 ? 2  ILE A HD11 8  
ATOM 8465  H HD12 . ILE A 1 2  ? 1.992   -17.120 16.173  1.00 0.00 ? 2  ILE A HD12 8  
ATOM 8466  H HD13 . ILE A 1 2  ? 2.022   -15.672 17.178  1.00 0.00 ? 2  ILE A HD13 8  
ATOM 8467  N N    . ASP A 1 3  ? 0.160   -15.122 21.748  1.00 0.00 ? 3  ASP A N    8  
ATOM 8468  C CA   . ASP A 1 3  ? -0.610  -14.673 22.942  1.00 0.00 ? 3  ASP A CA   8  
ATOM 8469  C C    . ASP A 1 3  ? -0.527  -13.150 23.060  1.00 0.00 ? 3  ASP A C    8  
ATOM 8470  O O    . ASP A 1 3  ? 0.481   -12.548 22.748  1.00 0.00 ? 3  ASP A O    8  
ATOM 8471  C CB   . ASP A 1 3  ? -0.018  -15.313 24.199  1.00 0.00 ? 3  ASP A CB   8  
ATOM 8472  C CG   . ASP A 1 3  ? -0.885  -14.960 25.409  1.00 0.00 ? 3  ASP A CG   8  
ATOM 8473  O OD1  . ASP A 1 3  ? -1.041  -13.780 25.677  1.00 0.00 ? 3  ASP A OD1  8  
ATOM 8474  O OD2  . ASP A 1 3  ? -1.377  -15.876 26.048  1.00 0.00 ? 3  ASP A OD2  8  
ATOM 8475  H H    . ASP A 1 3  ? 1.010   -15.596 21.864  1.00 0.00 ? 3  ASP A H    8  
ATOM 8476  H HA   . ASP A 1 3  ? -1.643  -14.971 22.838  1.00 0.00 ? 3  ASP A HA   8  
ATOM 8477  H HB2  . ASP A 1 3  ? 0.010   -16.386 24.077  1.00 0.00 ? 3  ASP A HB2  8  
ATOM 8478  H HB3  . ASP A 1 3  ? 0.983   -14.942 24.357  1.00 0.00 ? 3  ASP A HB3  8  
ATOM 8479  N N    . ASN A 1 4  ? -1.580  -12.522 23.508  1.00 0.00 ? 4  ASN A N    8  
ATOM 8480  C CA   . ASN A 1 4  ? -1.560  -11.038 23.645  1.00 0.00 ? 4  ASN A CA   8  
ATOM 8481  C C    . ASN A 1 4  ? -0.817  -10.653 24.926  1.00 0.00 ? 4  ASN A C    8  
ATOM 8482  O O    . ASN A 1 4  ? -0.857  -11.362 25.912  1.00 0.00 ? 4  ASN A O    8  
ATOM 8483  C CB   . ASN A 1 4  ? -2.995  -10.511 23.711  1.00 0.00 ? 4  ASN A CB   8  
ATOM 8484  C CG   . ASN A 1 4  ? -2.973  -8.985  23.809  1.00 0.00 ? 4  ASN A CG   8  
ATOM 8485  O OD1  . ASN A 1 4  ? -2.540  -8.312  22.894  1.00 0.00 ? 4  ASN A OD1  8  
ATOM 8486  N ND2  . ASN A 1 4  ? -3.424  -8.405  24.888  1.00 0.00 ? 4  ASN A ND2  8  
ATOM 8487  H H    . ASN A 1 4  ? -2.384  -13.026 23.755  1.00 0.00 ? 4  ASN A H    8  
ATOM 8488  H HA   . ASN A 1 4  ? -1.057  -10.605 22.793  1.00 0.00 ? 4  ASN A HA   8  
ATOM 8489  H HB2  . ASN A 1 4  ? -3.529  -10.809 22.820  1.00 0.00 ? 4  ASN A HB2  8  
ATOM 8490  H HB3  . ASN A 1 4  ? -3.489  -10.919 24.581  1.00 0.00 ? 4  ASN A HB3  8  
ATOM 8491  H HD21 . ASN A 1 4  ? -3.772  -8.948  25.626  1.00 0.00 ? 4  ASN A HD21 8  
ATOM 8492  H HD22 . ASN A 1 4  ? -3.413  -7.429  24.960  1.00 0.00 ? 4  ASN A HD22 8  
ATOM 8493  N N    . GLU A 1 5  ? -0.141  -9.529  24.917  1.00 0.00 ? 5  GLU A N    8  
ATOM 8494  C CA   . GLU A 1 5  ? 0.612   -9.077  26.129  1.00 0.00 ? 5  GLU A CA   8  
ATOM 8495  C C    . GLU A 1 5  ? -0.120  -7.892  26.764  1.00 0.00 ? 5  GLU A C    8  
ATOM 8496  O O    . GLU A 1 5  ? -0.476  -6.942  26.096  1.00 0.00 ? 5  GLU A O    8  
ATOM 8497  C CB   . GLU A 1 5  ? 2.018   -8.638  25.714  1.00 0.00 ? 5  GLU A CB   8  
ATOM 8498  C CG   . GLU A 1 5  ? 2.839   -9.866  25.313  1.00 0.00 ? 5  GLU A CG   8  
ATOM 8499  C CD   . GLU A 1 5  ? 2.240   -10.489 24.051  1.00 0.00 ? 5  GLU A CD   8  
ATOM 8500  O OE1  . GLU A 1 5  ? 1.640   -9.759  23.280  1.00 0.00 ? 5  GLU A OE1  8  
ATOM 8501  O OE2  . GLU A 1 5  ? 2.392   -11.687 23.877  1.00 0.00 ? 5  GLU A OE2  8  
ATOM 8502  H H    . GLU A 1 5  ? -0.131  -8.977  24.108  1.00 0.00 ? 5  GLU A H    8  
ATOM 8503  H HA   . GLU A 1 5  ? 0.685   -9.882  26.848  1.00 0.00 ? 5  GLU A HA   8  
ATOM 8504  H HB2  . GLU A 1 5  ? 1.951   -7.959  24.877  1.00 0.00 ? 5  GLU A HB2  8  
ATOM 8505  H HB3  . GLU A 1 5  ? 2.500   -8.141  26.543  1.00 0.00 ? 5  GLU A HB3  8  
ATOM 8506  H HG2  . GLU A 1 5  ? 3.859   -9.568  25.120  1.00 0.00 ? 5  GLU A HG2  8  
ATOM 8507  H HG3  . GLU A 1 5  ? 2.819   -10.588 26.113  1.00 0.00 ? 5  GLU A HG3  8  
ATOM 8508  N N    . LYS A 1 6  ? -0.349  -7.941  28.047  1.00 0.00 ? 6  LYS A N    8  
ATOM 8509  C CA   . LYS A 1 6  ? -1.059  -6.815  28.718  1.00 0.00 ? 6  LYS A CA   8  
ATOM 8510  C C    . LYS A 1 6  ? -2.339  -6.488  27.942  1.00 0.00 ? 6  LYS A C    8  
ATOM 8511  O O    . LYS A 1 6  ? -3.077  -7.367  27.544  1.00 0.00 ? 6  LYS A O    8  
ATOM 8512  C CB   . LYS A 1 6  ? -0.145  -5.580  28.753  1.00 0.00 ? 6  LYS A CB   8  
ATOM 8513  C CG   . LYS A 1 6  ? 1.306   -6.003  29.027  1.00 0.00 ? 6  LYS A CG   8  
ATOM 8514  C CD   . LYS A 1 6  ? 1.402   -6.790  30.343  1.00 0.00 ? 6  LYS A CD   8  
ATOM 8515  C CE   . LYS A 1 6  ? 0.830   -5.963  31.502  1.00 0.00 ? 6  LYS A CE   8  
ATOM 8516  N NZ   . LYS A 1 6  ? 1.420   -6.439  32.785  1.00 0.00 ? 6  LYS A NZ   8  
ATOM 8517  H H    . LYS A 1 6  ? -0.055  -8.716  28.570  1.00 0.00 ? 6  LYS A H    8  
ATOM 8518  H HA   . LYS A 1 6  ? -1.318  -7.101  29.725  1.00 0.00 ? 6  LYS A HA   8  
ATOM 8519  H HB2  . LYS A 1 6  ? -0.191  -5.072  27.800  1.00 0.00 ? 6  LYS A HB2  8  
ATOM 8520  H HB3  . LYS A 1 6  ? -0.477  -4.909  29.530  1.00 0.00 ? 6  LYS A HB3  8  
ATOM 8521  H HG2  . LYS A 1 6  ? 1.657   -6.622  28.214  1.00 0.00 ? 6  LYS A HG2  8  
ATOM 8522  H HG3  . LYS A 1 6  ? 1.926   -5.121  29.094  1.00 0.00 ? 6  LYS A HG3  8  
ATOM 8523  H HD2  . LYS A 1 6  ? 0.852   -7.714  30.252  1.00 0.00 ? 6  LYS A HD2  8  
ATOM 8524  H HD3  . LYS A 1 6  ? 2.439   -7.013  30.546  1.00 0.00 ? 6  LYS A HD3  8  
ATOM 8525  H HE2  . LYS A 1 6  ? 1.074   -4.921  31.362  1.00 0.00 ? 6  LYS A HE2  8  
ATOM 8526  H HE3  . LYS A 1 6  ? -0.242  -6.083  31.535  1.00 0.00 ? 6  LYS A HE3  8  
ATOM 8527  H HZ1  . LYS A 1 6  ? 2.393   -6.767  32.619  1.00 0.00 ? 6  LYS A HZ1  8  
ATOM 8528  H HZ2  . LYS A 1 6  ? 0.851   -7.224  33.159  1.00 0.00 ? 6  LYS A HZ2  8  
ATOM 8529  H HZ3  . LYS A 1 6  ? 1.429   -5.658  33.472  1.00 0.00 ? 6  LYS A HZ3  8  
ATOM 8530  N N    . VAL A 1 7  ? -2.606  -5.229  27.726  1.00 0.00 ? 7  VAL A N    8  
ATOM 8531  C CA   . VAL A 1 7  ? -3.836  -4.846  26.977  1.00 0.00 ? 7  VAL A CA   8  
ATOM 8532  C C    . VAL A 1 7  ? -3.715  -3.397  26.505  1.00 0.00 ? 7  VAL A C    8  
ATOM 8533  O O    . VAL A 1 7  ? -3.134  -2.563  27.172  1.00 0.00 ? 7  VAL A O    8  
ATOM 8534  C CB   . VAL A 1 7  ? -5.053  -4.980  27.894  1.00 0.00 ? 7  VAL A CB   8  
ATOM 8535  C CG1  . VAL A 1 7  ? -4.880  -4.068  29.109  1.00 0.00 ? 7  VAL A CG1  8  
ATOM 8536  C CG2  . VAL A 1 7  ? -6.314  -4.572  27.128  1.00 0.00 ? 7  VAL A CG2  8  
ATOM 8537  H H    . VAL A 1 7  ? -1.997  -4.536  28.055  1.00 0.00 ? 7  VAL A H    8  
ATOM 8538  H HA   . VAL A 1 7  ? -3.955  -5.496  26.122  1.00 0.00 ? 7  VAL A HA   8  
ATOM 8539  H HB   . VAL A 1 7  ? -5.146  -6.005  28.223  1.00 0.00 ? 7  VAL A HB   8  
ATOM 8540  H HG11 . VAL A 1 7  ? -4.979  -3.037  28.802  1.00 0.00 ? 7  VAL A HG11 8  
ATOM 8541  H HG12 . VAL A 1 7  ? -3.902  -4.223  29.539  1.00 0.00 ? 7  VAL A HG12 8  
ATOM 8542  H HG13 . VAL A 1 7  ? -5.638  -4.298  29.843  1.00 0.00 ? 7  VAL A HG13 8  
ATOM 8543  H HG21 . VAL A 1 7  ? -6.341  -5.086  26.179  1.00 0.00 ? 7  VAL A HG21 8  
ATOM 8544  H HG22 . VAL A 1 7  ? -6.303  -3.505  26.960  1.00 0.00 ? 7  VAL A HG22 8  
ATOM 8545  H HG23 . VAL A 1 7  ? -7.187  -4.836  27.706  1.00 0.00 ? 7  VAL A HG23 8  
ATOM 8546  N N    . THR A 1 8  ? -4.258  -3.089  25.359  1.00 0.00 ? 8  THR A N    8  
ATOM 8547  C CA   . THR A 1 8  ? -4.175  -1.692  24.847  1.00 0.00 ? 8  THR A CA   8  
ATOM 8548  C C    . THR A 1 8  ? -5.067  -1.547  23.613  1.00 0.00 ? 8  THR A C    8  
ATOM 8549  O O    . THR A 1 8  ? -5.258  -2.482  22.860  1.00 0.00 ? 8  THR A O    8  
ATOM 8550  C CB   . THR A 1 8  ? -2.727  -1.370  24.470  1.00 0.00 ? 8  THR A CB   8  
ATOM 8551  O OG1  . THR A 1 8  ? -2.693  -0.161  23.724  1.00 0.00 ? 8  THR A OG1  8  
ATOM 8552  C CG2  . THR A 1 8  ? -2.151  -2.509  23.628  1.00 0.00 ? 8  THR A CG2  8  
ATOM 8553  H H    . THR A 1 8  ? -4.723  -3.775  24.837  1.00 0.00 ? 8  THR A H    8  
ATOM 8554  H HA   . THR A 1 8  ? -4.508  -1.008  25.614  1.00 0.00 ? 8  THR A HA   8  
ATOM 8555  H HB   . THR A 1 8  ? -2.137  -1.257  25.367  1.00 0.00 ? 8  THR A HB   8  
ATOM 8556  H HG1  . THR A 1 8  ? -3.418  -0.179  23.097  1.00 0.00 ? 8  THR A HG1  8  
ATOM 8557  H HG21 . THR A 1 8  ? -2.078  -3.402  24.231  1.00 0.00 ? 8  THR A HG21 8  
ATOM 8558  H HG22 . THR A 1 8  ? -1.168  -2.234  23.273  1.00 0.00 ? 8  THR A HG22 8  
ATOM 8559  H HG23 . THR A 1 8  ? -2.799  -2.696  22.785  1.00 0.00 ? 8  THR A HG23 8  
ATOM 8560  N N    . SER A 1 9  ? -5.615  -0.383  23.401  1.00 0.00 ? 9  SER A N    8  
ATOM 8561  C CA   . SER A 1 9  ? -6.494  -0.178  22.217  1.00 0.00 ? 9  SER A CA   8  
ATOM 8562  C C    . SER A 1 9  ? -5.652  -0.258  20.939  1.00 0.00 ? 9  SER A C    8  
ATOM 8563  O O    . SER A 1 9  ? -4.946  -1.220  20.711  1.00 0.00 ? 9  SER A O    8  
ATOM 8564  C CB   . SER A 1 9  ? -7.158  1.197   22.310  1.00 0.00 ? 9  SER A CB   8  
ATOM 8565  O OG   . SER A 1 9  ? -7.973  1.404   21.164  1.00 0.00 ? 9  SER A OG   8  
ATOM 8566  H H    . SER A 1 9  ? -5.448  0.358   24.021  1.00 0.00 ? 9  SER A H    8  
ATOM 8567  H HA   . SER A 1 9  ? -7.254  -0.945  22.195  1.00 0.00 ? 9  SER A HA   8  
ATOM 8568  H HB2  . SER A 1 9  ? -7.771  1.243   23.194  1.00 0.00 ? 9  SER A HB2  8  
ATOM 8569  H HB3  . SER A 1 9  ? -6.394  1.962   22.365  1.00 0.00 ? 9  SER A HB3  8  
ATOM 8570  H HG   . SER A 1 9  ? -7.968  2.343   20.962  1.00 0.00 ? 9  SER A HG   8  
ATOM 8571  N N    . GLY A 1 10 ? -5.720  0.745   20.106  1.00 0.00 ? 10 GLY A N    8  
ATOM 8572  C CA   . GLY A 1 10 ? -4.922  0.722   18.847  1.00 0.00 ? 10 GLY A CA   8  
ATOM 8573  C C    . GLY A 1 10 ? -5.520  -0.304  17.881  1.00 0.00 ? 10 GLY A C    8  
ATOM 8574  O O    . GLY A 1 10 ? -4.949  -1.349  17.641  1.00 0.00 ? 10 GLY A O    8  
ATOM 8575  H H    . GLY A 1 10 ? -6.295  1.512   20.308  1.00 0.00 ? 10 GLY A H    8  
ATOM 8576  H HA2  . GLY A 1 10 ? -4.941  1.702   18.391  1.00 0.00 ? 10 GLY A HA2  8  
ATOM 8577  H HA3  . GLY A 1 10 ? -3.902  0.447   19.071  1.00 0.00 ? 10 GLY A HA3  8  
ATOM 8578  N N    . HIS A 1 11 ? -6.664  -0.013  17.326  1.00 0.00 ? 11 HIS A N    8  
ATOM 8579  C CA   . HIS A 1 11 ? -7.297  -0.972  16.377  1.00 0.00 ? 11 HIS A CA   8  
ATOM 8580  C C    . HIS A 1 11 ? -6.485  -1.018  15.081  1.00 0.00 ? 11 HIS A C    8  
ATOM 8581  O O    . HIS A 1 11 ? -5.848  -0.055  14.701  1.00 0.00 ? 11 HIS A O    8  
ATOM 8582  C CB   . HIS A 1 11 ? -8.725  -0.515  16.069  1.00 0.00 ? 11 HIS A CB   8  
ATOM 8583  C CG   . HIS A 1 11 ? -9.491  -0.366  17.354  1.00 0.00 ? 11 HIS A CG   8  
ATOM 8584  N ND1  . HIS A 1 11 ? -10.733 0.248   17.408  1.00 0.00 ? 11 HIS A ND1  8  
ATOM 8585  C CD2  . HIS A 1 11 ? -9.204  -0.745  18.642  1.00 0.00 ? 11 HIS A CD2  8  
ATOM 8586  C CE1  . HIS A 1 11 ? -11.143 0.219   18.689  1.00 0.00 ? 11 HIS A CE1  8  
ATOM 8587  N NE2  . HIS A 1 11 ? -10.249 -0.375  19.483  1.00 0.00 ? 11 HIS A NE2  8  
ATOM 8588  H H    . HIS A 1 11 ? -7.108  0.836   17.534  1.00 0.00 ? 11 HIS A H    8  
ATOM 8589  H HA   . HIS A 1 11 ? -7.322  -1.955  16.822  1.00 0.00 ? 11 HIS A HA   8  
ATOM 8590  H HB2  . HIS A 1 11 ? -8.695  0.435   15.555  1.00 0.00 ? 11 HIS A HB2  8  
ATOM 8591  H HB3  . HIS A 1 11 ? -9.210  -1.248  15.443  1.00 0.00 ? 11 HIS A HB3  8  
ATOM 8592  H HD1  . HIS A 1 11 ? -11.222 0.632   16.651  1.00 0.00 ? 11 HIS A HD1  8  
ATOM 8593  H HD2  . HIS A 1 11 ? -8.304  -1.254  18.955  1.00 0.00 ? 11 HIS A HD2  8  
ATOM 8594  H HE1  . HIS A 1 11 ? -12.083 0.628   19.033  1.00 0.00 ? 11 HIS A HE1  8  
ATOM 8595  N N    . THR A 1 12 ? -6.502  -2.130  14.399  1.00 0.00 ? 12 THR A N    8  
ATOM 8596  C CA   . THR A 1 12 ? -5.732  -2.239  13.128  1.00 0.00 ? 12 THR A CA   8  
ATOM 8597  C C    . THR A 1 12 ? -6.196  -3.475  12.355  1.00 0.00 ? 12 THR A C    8  
ATOM 8598  O O    . THR A 1 12 ? -5.481  -4.451  12.242  1.00 0.00 ? 12 THR A O    8  
ATOM 8599  C CB   . THR A 1 12 ? -4.240  -2.363  13.445  1.00 0.00 ? 12 THR A CB   8  
ATOM 8600  O OG1  . THR A 1 12 ? -3.860  -1.327  14.339  1.00 0.00 ? 12 THR A OG1  8  
ATOM 8601  C CG2  . THR A 1 12 ? -3.430  -2.249  12.153  1.00 0.00 ? 12 THR A CG2  8  
ATOM 8602  H H    . THR A 1 12 ? -7.023  -2.895  14.723  1.00 0.00 ? 12 THR A H    8  
ATOM 8603  H HA   . THR A 1 12 ? -5.900  -1.355  12.529  1.00 0.00 ? 12 THR A HA   8  
ATOM 8604  H HB   . THR A 1 12 ? -4.048  -3.322  13.902  1.00 0.00 ? 12 THR A HB   8  
ATOM 8605  H HG1  . THR A 1 12 ? -3.263  -0.736  13.872  1.00 0.00 ? 12 THR A HG1  8  
ATOM 8606  H HG21 . THR A 1 12 ? -2.375  -2.256  12.387  1.00 0.00 ? 12 THR A HG21 8  
ATOM 8607  H HG22 . THR A 1 12 ? -3.681  -1.326  11.651  1.00 0.00 ? 12 THR A HG22 8  
ATOM 8608  H HG23 . THR A 1 12 ? -3.660  -3.084  11.508  1.00 0.00 ? 12 THR A HG23 8  
ATOM 8609  N N    . THR A 1 13 ? -7.388  -3.444  11.826  1.00 0.00 ? 13 THR A N    8  
ATOM 8610  C CA   . THR A 1 13 ? -7.899  -4.618  11.063  1.00 0.00 ? 13 THR A CA   8  
ATOM 8611  C C    . THR A 1 13 ? -7.368  -4.568  9.628   1.00 0.00 ? 13 THR A C    8  
ATOM 8612  O O    . THR A 1 13 ? -7.659  -3.657  8.879   1.00 0.00 ? 13 THR A O    8  
ATOM 8613  C CB   . THR A 1 13 ? -9.430  -4.583  11.040  1.00 0.00 ? 13 THR A CB   8  
ATOM 8614  O OG1  . THR A 1 13 ? -9.864  -3.427  10.336  1.00 0.00 ? 13 THR A OG1  8  
ATOM 8615  C CG2  . THR A 1 13 ? -9.962  -4.540  12.473  1.00 0.00 ? 13 THR A CG2  8  
ATOM 8616  H H    . THR A 1 13 ? -7.949  -2.646  11.931  1.00 0.00 ? 13 THR A H    8  
ATOM 8617  H HA   . THR A 1 13 ? -7.568  -5.530  11.537  1.00 0.00 ? 13 THR A HA   8  
ATOM 8618  H HB   . THR A 1 13 ? -9.804  -5.467  10.548  1.00 0.00 ? 13 THR A HB   8  
ATOM 8619  H HG1  . THR A 1 13 ? -10.495 -2.961  10.891  1.00 0.00 ? 13 THR A HG1  8  
ATOM 8620  H HG21 . THR A 1 13 ? -11.041 -4.482  12.455  1.00 0.00 ? 13 THR A HG21 8  
ATOM 8621  H HG22 . THR A 1 13 ? -9.564  -3.674  12.980  1.00 0.00 ? 13 THR A HG22 8  
ATOM 8622  H HG23 . THR A 1 13 ? -9.659  -5.435  12.996  1.00 0.00 ? 13 THR A HG23 8  
ATOM 8623  N N    . THR A 1 14 ? -6.593  -5.544  9.237   1.00 0.00 ? 14 THR A N    8  
ATOM 8624  C CA   . THR A 1 14 ? -6.049  -5.552  7.849   1.00 0.00 ? 14 THR A CA   8  
ATOM 8625  C C    . THR A 1 14 ? -7.151  -5.967  6.875   1.00 0.00 ? 14 THR A C    8  
ATOM 8626  O O    . THR A 1 14 ? -7.951  -6.836  7.161   1.00 0.00 ? 14 THR A O    8  
ATOM 8627  C CB   . THR A 1 14 ? -4.888  -6.545  7.760   1.00 0.00 ? 14 THR A CB   8  
ATOM 8628  O OG1  . THR A 1 14 ? -3.924  -6.236  8.759   1.00 0.00 ? 14 THR A OG1  8  
ATOM 8629  C CG2  . THR A 1 14 ? -4.241  -6.452  6.378   1.00 0.00 ? 14 THR A CG2  8  
ATOM 8630  H H    . THR A 1 14 ? -6.372  -6.272  9.854   1.00 0.00 ? 14 THR A H    8  
ATOM 8631  H HA   . THR A 1 14 ? -5.697  -4.562  7.595   1.00 0.00 ? 14 THR A HA   8  
ATOM 8632  H HB   . THR A 1 14 ? -5.257  -7.547  7.914   1.00 0.00 ? 14 THR A HB   8  
ATOM 8633  H HG1  . THR A 1 14 ? -3.843  -5.280  8.807   1.00 0.00 ? 14 THR A HG1  8  
ATOM 8634  H HG21 . THR A 1 14 ? -4.934  -6.814  5.632   1.00 0.00 ? 14 THR A HG21 8  
ATOM 8635  H HG22 . THR A 1 14 ? -3.345  -7.055  6.358   1.00 0.00 ? 14 THR A HG22 8  
ATOM 8636  H HG23 . THR A 1 14 ? -3.990  -5.424  6.167   1.00 0.00 ? 14 THR A HG23 8  
ATOM 8637  N N    . THR A 1 15 ? -7.198  -5.359  5.717   1.00 0.00 ? 15 THR A N    8  
ATOM 8638  C CA   . THR A 1 15 ? -8.246  -5.727  4.717   1.00 0.00 ? 15 THR A CA   8  
ATOM 8639  C C    . THR A 1 15 ? -7.694  -5.540  3.301   1.00 0.00 ? 15 THR A C    8  
ATOM 8640  O O    . THR A 1 15 ? -7.189  -4.490  2.961   1.00 0.00 ? 15 THR A O    8  
ATOM 8641  C CB   . THR A 1 15 ? -9.470  -4.828  4.909   1.00 0.00 ? 15 THR A CB   8  
ATOM 8642  O OG1  . THR A 1 15 ? -9.853  -4.839  6.278   1.00 0.00 ? 15 THR A OG1  8  
ATOM 8643  C CG2  . THR A 1 15 ? -10.625 -5.344  4.050   1.00 0.00 ? 15 THR A CG2  8  
ATOM 8644  H H    . THR A 1 15 ? -6.533  -4.674  5.500   1.00 0.00 ? 15 THR A H    8  
ATOM 8645  H HA   . THR A 1 15 ? -8.536  -6.760  4.853   1.00 0.00 ? 15 THR A HA   8  
ATOM 8646  H HB   . THR A 1 15 ? -9.227  -3.820  4.610   1.00 0.00 ? 15 THR A HB   8  
ATOM 8647  H HG1  . THR A 1 15 ? -9.316  -5.492  6.731   1.00 0.00 ? 15 THR A HG1  8  
ATOM 8648  H HG21 . THR A 1 15 ? -10.790 -6.391  4.260   1.00 0.00 ? 15 THR A HG21 8  
ATOM 8649  H HG22 . THR A 1 15 ? -10.378 -5.221  3.005   1.00 0.00 ? 15 THR A HG22 8  
ATOM 8650  H HG23 . THR A 1 15 ? -11.520 -4.785  4.276   1.00 0.00 ? 15 THR A HG23 8  
ATOM 8651  N N    . ARG A 1 16 ? -7.804  -6.544  2.466   1.00 0.00 ? 16 ARG A N    8  
ATOM 8652  C CA   . ARG A 1 16 ? -7.305  -6.425  1.066   1.00 0.00 ? 16 ARG A CA   8  
ATOM 8653  C C    . ARG A 1 16 ? -8.200  -7.281  0.158   1.00 0.00 ? 16 ARG A C    8  
ATOM 8654  O O    . ARG A 1 16 ? -8.716  -8.294  0.585   1.00 0.00 ? 16 ARG A O    8  
ATOM 8655  C CB   . ARG A 1 16 ? -5.852  -6.923  0.988   1.00 0.00 ? 16 ARG A CB   8  
ATOM 8656  C CG   . ARG A 1 16 ? -5.089  -6.508  2.250   1.00 0.00 ? 16 ARG A CG   8  
ATOM 8657  C CD   . ARG A 1 16 ? -3.627  -6.939  2.131   1.00 0.00 ? 16 ARG A CD   8  
ATOM 8658  N NE   . ARG A 1 16 ? -2.876  -6.483  3.335   1.00 0.00 ? 16 ARG A NE   8  
ATOM 8659  C CZ   . ARG A 1 16 ? -1.697  -6.977  3.596   1.00 0.00 ? 16 ARG A CZ   8  
ATOM 8660  N NH1  . ARG A 1 16 ? -1.170  -7.866  2.801   1.00 0.00 ? 16 ARG A NH1  8  
ATOM 8661  N NH2  . ARG A 1 16 ? -1.043  -6.579  4.654   1.00 0.00 ? 16 ARG A NH2  8  
ATOM 8662  H H    . ARG A 1 16 ? -8.227  -7.375  2.760   1.00 0.00 ? 16 ARG A H    8  
ATOM 8663  H HA   . ARG A 1 16 ? -7.352  -5.393  0.750   1.00 0.00 ? 16 ARG A HA   8  
ATOM 8664  H HB2  . ARG A 1 16 ? -5.839  -8.000  0.900   1.00 0.00 ? 16 ARG A HB2  8  
ATOM 8665  H HB3  . ARG A 1 16 ? -5.371  -6.487  0.125   1.00 0.00 ? 16 ARG A HB3  8  
ATOM 8666  H HG2  . ARG A 1 16 ? -5.138  -5.436  2.364   1.00 0.00 ? 16 ARG A HG2  8  
ATOM 8667  H HG3  . ARG A 1 16 ? -5.531  -6.984  3.112   1.00 0.00 ? 16 ARG A HG3  8  
ATOM 8668  H HD2  . ARG A 1 16 ? -3.572  -8.016  2.058   1.00 0.00 ? 16 ARG A HD2  8  
ATOM 8669  H HD3  . ARG A 1 16 ? -3.192  -6.498  1.246   1.00 0.00 ? 16 ARG A HD3  8  
ATOM 8670  H HE   . ARG A 1 16 ? -3.270  -5.812  3.932   1.00 0.00 ? 16 ARG A HE   8  
ATOM 8671  H HH11 . ARG A 1 16 ? -1.671  -8.170  1.990   1.00 0.00 ? 16 ARG A HH11 8  
ATOM 8672  H HH12 . ARG A 1 16 ? -0.267  -8.244  3.001   1.00 0.00 ? 16 ARG A HH12 8  
ATOM 8673  H HH21 . ARG A 1 16 ? -1.445  -5.896  5.263   1.00 0.00 ? 16 ARG A HH21 8  
ATOM 8674  H HH22 . ARG A 1 16 ? -0.138  -6.957  4.853   1.00 0.00 ? 16 ARG A HH22 8  
ATOM 8675  N N    . ARG A 1 17 ? -8.400  -6.874  -1.078  1.00 0.00 ? 17 ARG A N    8  
ATOM 8676  C CA   . ARG A 1 17 ? -9.277  -7.659  -2.017  1.00 0.00 ? 17 ARG A CA   8  
ATOM 8677  C C    . ARG A 1 17 ? -10.754 -7.267  -1.812  1.00 0.00 ? 17 ARG A C    8  
ATOM 8678  O O    . ARG A 1 17 ? -11.653 -8.064  -1.986  1.00 0.00 ? 17 ARG A O    8  
ATOM 8679  C CB   . ARG A 1 17 ? -9.094  -9.177  -1.793  1.00 0.00 ? 17 ARG A CB   8  
ATOM 8680  C CG   . ARG A 1 17 ? -9.317  -9.937  -3.107  1.00 0.00 ? 17 ARG A CG   8  
ATOM 8681  C CD   . ARG A 1 17 ? -9.293  -11.442 -2.835  1.00 0.00 ? 17 ARG A CD   8  
ATOM 8682  N NE   . ARG A 1 17 ? -7.914  -11.856 -2.455  1.00 0.00 ? 17 ARG A NE   8  
ATOM 8683  C CZ   . ARG A 1 17 ? -7.712  -13.018 -1.896  1.00 0.00 ? 17 ARG A CZ   8  
ATOM 8684  N NH1  . ARG A 1 17 ? -8.719  -13.816 -1.668  1.00 0.00 ? 17 ARG A NH1  8  
ATOM 8685  N NH2  . ARG A 1 17 ? -6.503  -13.381 -1.564  1.00 0.00 ? 17 ARG A NH2  8  
ATOM 8686  H H    . ARG A 1 17 ? -7.980  -6.035  -1.389  1.00 0.00 ? 17 ARG A H    8  
ATOM 8687  H HA   . ARG A 1 17 ? -8.995  -7.410  -3.030  1.00 0.00 ? 17 ARG A HA   8  
ATOM 8688  H HB2  . ARG A 1 17 ? -8.091  -9.365  -1.439  1.00 0.00 ? 17 ARG A HB2  8  
ATOM 8689  H HB3  . ARG A 1 17 ? -9.804  -9.527  -1.057  1.00 0.00 ? 17 ARG A HB3  8  
ATOM 8690  H HG2  . ARG A 1 17 ? -10.275 -9.661  -3.524  1.00 0.00 ? 17 ARG A HG2  8  
ATOM 8691  H HG3  . ARG A 1 17 ? -8.534  -9.687  -3.806  1.00 0.00 ? 17 ARG A HG3  8  
ATOM 8692  H HD2  . ARG A 1 17 ? -9.974  -11.673 -2.028  1.00 0.00 ? 17 ARG A HD2  8  
ATOM 8693  H HD3  . ARG A 1 17 ? -9.597  -11.973 -3.725  1.00 0.00 ? 17 ARG A HD3  8  
ATOM 8694  H HE   . ARG A 1 17 ? -7.157  -11.257 -2.626  1.00 0.00 ? 17 ARG A HE   8  
ATOM 8695  H HH11 . ARG A 1 17 ? -9.645  -13.538 -1.922  1.00 0.00 ? 17 ARG A HH11 8  
ATOM 8696  H HH12 . ARG A 1 17 ? -8.563  -14.707 -1.240  1.00 0.00 ? 17 ARG A HH12 8  
ATOM 8697  H HH21 . ARG A 1 17 ? -5.731  -12.769 -1.738  1.00 0.00 ? 17 ARG A HH21 8  
ATOM 8698  H HH22 . ARG A 1 17 ? -6.348  -14.271 -1.135  1.00 0.00 ? 17 ARG A HH22 8  
ATOM 8699  N N    . SER A 1 18 ? -10.994 -6.032  -1.467  1.00 0.00 ? 18 SER A N    8  
ATOM 8700  C CA   . SER A 1 18 ? -12.388 -5.525  -1.266  1.00 0.00 ? 18 SER A CA   8  
ATOM 8701  C C    . SER A 1 18 ? -12.314 -4.022  -1.506  1.00 0.00 ? 18 SER A C    8  
ATOM 8702  O O    . SER A 1 18 ? -13.222 -3.382  -1.997  1.00 0.00 ? 18 SER A O    8  
ATOM 8703  C CB   . SER A 1 18 ? -12.849 -5.810  0.165   1.00 0.00 ? 18 SER A CB   8  
ATOM 8704  O OG   . SER A 1 18 ? -12.535 -7.155  0.498   1.00 0.00 ? 18 SER A OG   8  
ATOM 8705  H H    . SER A 1 18 ? -10.245 -5.411  -1.355  1.00 0.00 ? 18 SER A H    8  
ATOM 8706  H HA   . SER A 1 18 ? -13.058 -5.984  -1.980  1.00 0.00 ? 18 SER A HA   8  
ATOM 8707  H HB2  . SER A 1 18 ? -12.344 -5.148  0.848   1.00 0.00 ? 18 SER A HB2  8  
ATOM 8708  H HB3  . SER A 1 18 ? -13.917 -5.651  0.236   1.00 0.00 ? 18 SER A HB3  8  
ATOM 8709  H HG   . SER A 1 18 ? -13.349 -7.663  0.478   1.00 0.00 ? 18 SER A HG   8  
ATOM 8710  N N    . CYS A 1 19 ? -11.170 -3.501  -1.186  1.00 0.00 ? 19 CYS A N    8  
ATOM 8711  C CA   . CYS A 1 19 ? -10.856 -2.067  -1.389  1.00 0.00 ? 19 CYS A CA   8  
ATOM 8712  C C    . CYS A 1 19 ? -9.552  -2.054  -2.177  1.00 0.00 ? 19 CYS A C    8  
ATOM 8713  O O    . CYS A 1 19 ? -8.749  -2.956  -2.033  1.00 0.00 ? 19 CYS A O    8  
ATOM 8714  C CB   . CYS A 1 19 ? -10.685 -1.374  -0.022  1.00 0.00 ? 19 CYS A CB   8  
ATOM 8715  S SG   . CYS A 1 19 ? -11.599 -2.302  1.238   1.00 0.00 ? 19 CYS A SG   8  
ATOM 8716  H H    . CYS A 1 19 ? -10.495 -4.116  -0.834  1.00 0.00 ? 19 CYS A H    8  
ATOM 8717  H HA   . CYS A 1 19 ? -11.639 -1.586  -1.964  1.00 0.00 ? 19 CYS A HA   8  
ATOM 8718  H HB2  . CYS A 1 19 ? -9.639  -1.343  0.251   1.00 0.00 ? 19 CYS A HB2  8  
ATOM 8719  H HB3  . CYS A 1 19 ? -11.071 -0.366  -0.073  1.00 0.00 ? 19 CYS A HB3  8  
ATOM 8720  N N    . SER A 1 20 ? -9.297  -1.079  -2.998  1.00 0.00 ? 20 SER A N    8  
ATOM 8721  C CA   . SER A 1 20 ? -8.000  -1.138  -3.734  1.00 0.00 ? 20 SER A CA   8  
ATOM 8722  C C    . SER A 1 20 ? -6.896  -1.078  -2.691  1.00 0.00 ? 20 SER A C    8  
ATOM 8723  O O    . SER A 1 20 ? -6.753  -0.095  -1.990  1.00 0.00 ? 20 SER A O    8  
ATOM 8724  C CB   . SER A 1 20 ? -7.844  0.034   -4.719  1.00 0.00 ? 20 SER A CB   8  
ATOM 8725  O OG   . SER A 1 20 ? -6.642  -0.147  -5.456  1.00 0.00 ? 20 SER A OG   8  
ATOM 8726  H H    . SER A 1 20 ? -9.924  -0.333  -3.118  1.00 0.00 ? 20 SER A H    8  
ATOM 8727  H HA   . SER A 1 20 ? -7.935  -2.077  -4.272  1.00 0.00 ? 20 SER A HA   8  
ATOM 8728  H HB2  . SER A 1 20 ? -8.673  0.056   -5.408  1.00 0.00 ? 20 SER A HB2  8  
ATOM 8729  H HB3  . SER A 1 20 ? -7.799  0.970   -4.172  1.00 0.00 ? 20 SER A HB3  8  
ATOM 8730  H HG   . SER A 1 20 ? -6.877  -0.298  -6.374  1.00 0.00 ? 20 SER A HG   8  
ATOM 8731  N N    . LYS A 1 21 ? -6.129  -2.132  -2.557  1.00 0.00 ? 21 LYS A N    8  
ATOM 8732  C CA   . LYS A 1 21 ? -5.039  -2.145  -1.522  1.00 0.00 ? 21 LYS A CA   8  
ATOM 8733  C C    . LYS A 1 21 ? -3.751  -2.614  -2.175  1.00 0.00 ? 21 LYS A C    8  
ATOM 8734  O O    . LYS A 1 21 ? -3.652  -3.725  -2.660  1.00 0.00 ? 21 LYS A O    8  
ATOM 8735  C CB   . LYS A 1 21 ? -5.411  -3.087  -0.354  1.00 0.00 ? 21 LYS A CB   8  
ATOM 8736  C CG   . LYS A 1 21 ? -6.389  -2.376  0.607   1.00 0.00 ? 21 LYS A CG   8  
ATOM 8737  C CD   . LYS A 1 21 ? -5.610  -1.615  1.685   1.00 0.00 ? 21 LYS A CD   8  
ATOM 8738  C CE   . LYS A 1 21 ? -6.591  -0.955  2.653   1.00 0.00 ? 21 LYS A CE   8  
ATOM 8739  N NZ   . LYS A 1 21 ? -7.264  -2.004  3.469   1.00 0.00 ? 21 LYS A NZ   8  
ATOM 8740  H H    . LYS A 1 21 ? -6.281  -2.928  -3.120  1.00 0.00 ? 21 LYS A H    8  
ATOM 8741  H HA   . LYS A 1 21 ? -4.884  -1.146  -1.134  1.00 0.00 ? 21 LYS A HA   8  
ATOM 8742  H HB2  . LYS A 1 21 ? -5.875  -3.986  -0.738  1.00 0.00 ? 21 LYS A HB2  8  
ATOM 8743  H HB3  . LYS A 1 21 ? -4.514  -3.360  0.185   1.00 0.00 ? 21 LYS A HB3  8  
ATOM 8744  H HG2  . LYS A 1 21 ? -7.007  -1.679  0.057   1.00 0.00 ? 21 LYS A HG2  8  
ATOM 8745  H HG3  . LYS A 1 21 ? -7.022  -3.108  1.082   1.00 0.00 ? 21 LYS A HG3  8  
ATOM 8746  H HD2  . LYS A 1 21 ? -4.977  -2.304  2.226   1.00 0.00 ? 21 LYS A HD2  8  
ATOM 8747  H HD3  . LYS A 1 21 ? -5.000  -0.857  1.221   1.00 0.00 ? 21 LYS A HD3  8  
ATOM 8748  H HE2  . LYS A 1 21 ? -6.056  -0.280  3.304   1.00 0.00 ? 21 LYS A HE2  8  
ATOM 8749  H HE3  . LYS A 1 21 ? -7.331  -0.404  2.094   1.00 0.00 ? 21 LYS A HE3  8  
ATOM 8750  H HZ1  . LYS A 1 21 ? -8.084  -2.375  2.949   1.00 0.00 ? 21 LYS A HZ1  8  
ATOM 8751  H HZ2  . LYS A 1 21 ? -7.583  -1.594  4.368   1.00 0.00 ? 21 LYS A HZ2  8  
ATOM 8752  H HZ3  . LYS A 1 21 ? -6.593  -2.779  3.657   1.00 0.00 ? 21 LYS A HZ3  8  
ATOM 8753  N N    . VAL A 1 22 ? -2.760  -1.765  -2.181  1.00 0.00 ? 22 VAL A N    8  
ATOM 8754  C CA   . VAL A 1 22 ? -1.452  -2.130  -2.790  1.00 0.00 ? 22 VAL A CA   8  
ATOM 8755  C C    . VAL A 1 22 ? -0.346  -1.964  -1.752  1.00 0.00 ? 22 VAL A C    8  
ATOM 8756  O O    . VAL A 1 22 ? -0.037  -0.861  -1.344  1.00 0.00 ? 22 VAL A O    8  
ATOM 8757  C CB   . VAL A 1 22 ? -1.213  -1.187  -3.971  1.00 0.00 ? 22 VAL A CB   8  
ATOM 8758  C CG1  . VAL A 1 22 ? 0.154   -1.464  -4.607  1.00 0.00 ? 22 VAL A CG1  8  
ATOM 8759  C CG2  . VAL A 1 22 ? -2.335  -1.391  -5.004  1.00 0.00 ? 22 VAL A CG2  8  
ATOM 8760  H H    . VAL A 1 22 ? -2.884  -0.888  -1.760  1.00 0.00 ? 22 VAL A H    8  
ATOM 8761  H HA   . VAL A 1 22 ? -1.466  -3.150  -3.142  1.00 0.00 ? 22 VAL A HA   8  
ATOM 8762  H HB   . VAL A 1 22 ? -1.235  -0.166  -3.618  1.00 0.00 ? 22 VAL A HB   8  
ATOM 8763  H HG11 . VAL A 1 22 ? 0.331   -2.524  -4.644  1.00 0.00 ? 22 VAL A HG11 8  
ATOM 8764  H HG12 . VAL A 1 22 ? 0.926   -0.993  -4.016  1.00 0.00 ? 22 VAL A HG12 8  
ATOM 8765  H HG13 . VAL A 1 22 ? 0.175   -1.060  -5.608  1.00 0.00 ? 22 VAL A HG13 8  
ATOM 8766  H HG21 . VAL A 1 22 ? -3.215  -0.848  -4.686  1.00 0.00 ? 22 VAL A HG21 8  
ATOM 8767  H HG22 . VAL A 1 22 ? -2.576  -2.443  -5.083  1.00 0.00 ? 22 VAL A HG22 8  
ATOM 8768  H HG23 . VAL A 1 22 ? -2.015  -1.022  -5.967  1.00 0.00 ? 22 VAL A HG23 8  
ATOM 8769  N N    . ILE A 1 23 ? 0.262   -3.048  -1.321  1.00 0.00 ? 23 ILE A N    8  
ATOM 8770  C CA   . ILE A 1 23 ? 1.361   -2.955  -0.306  1.00 0.00 ? 23 ILE A CA   8  
ATOM 8771  C C    . ILE A 1 23 ? 2.598   -3.645  -0.890  1.00 0.00 ? 23 ILE A C    8  
ATOM 8772  O O    . ILE A 1 23 ? 2.637   -4.847  -1.073  1.00 0.00 ? 23 ILE A O    8  
ATOM 8773  C CB   . ILE A 1 23 ? 0.941   -3.641  1.011   1.00 0.00 ? 23 ILE A CB   8  
ATOM 8774  C CG1  . ILE A 1 23 ? -0.363  -3.015  1.553   1.00 0.00 ? 23 ILE A CG1  8  
ATOM 8775  C CG2  . ILE A 1 23 ? 2.040   -3.448  2.066   1.00 0.00 ? 23 ILE A CG2  8  
ATOM 8776  C CD1  . ILE A 1 23 ? -1.588  -3.450  0.722   1.00 0.00 ? 23 ILE A CD1  8  
ATOM 8777  H H    . ILE A 1 23 ? -0.003  -3.938  -1.650  1.00 0.00 ? 23 ILE A H    8  
ATOM 8778  H HA   . ILE A 1 23 ? 1.602   -1.917  -0.109  1.00 0.00 ? 23 ILE A HA   8  
ATOM 8779  H HB   . ILE A 1 23 ? 0.794   -4.696  0.837   1.00 0.00 ? 23 ILE A HB   8  
ATOM 8780  H HG12 . ILE A 1 23 ? -0.506  -3.331  2.578   1.00 0.00 ? 23 ILE A HG12 8  
ATOM 8781  H HG13 . ILE A 1 23 ? -0.281  -1.936  1.530   1.00 0.00 ? 23 ILE A HG13 8  
ATOM 8782  H HG21 . ILE A 1 23 ? 2.029   -2.425  2.412   1.00 0.00 ? 23 ILE A HG21 8  
ATOM 8783  H HG22 . ILE A 1 23 ? 3.004   -3.669  1.640   1.00 0.00 ? 23 ILE A HG22 8  
ATOM 8784  H HG23 . ILE A 1 23 ? 1.857   -4.108  2.900   1.00 0.00 ? 23 ILE A HG23 8  
ATOM 8785  H HD11 . ILE A 1 23 ? -1.968  -2.601  0.176   1.00 0.00 ? 23 ILE A HD11 8  
ATOM 8786  H HD12 . ILE A 1 23 ? -2.355  -3.815  1.388   1.00 0.00 ? 23 ILE A HD12 8  
ATOM 8787  H HD13 . ILE A 1 23 ? -1.319  -4.234  0.027   1.00 0.00 ? 23 ILE A HD13 8  
ATOM 8788  N N    . THR A 1 24 ? 3.606   -2.871  -1.173  1.00 0.00 ? 24 THR A N    8  
ATOM 8789  C CA   . THR A 1 24 ? 4.876   -3.410  -1.734  1.00 0.00 ? 24 THR A CA   8  
ATOM 8790  C C    . THR A 1 24 ? 6.050   -2.799  -0.968  1.00 0.00 ? 24 THR A C    8  
ATOM 8791  O O    . THR A 1 24 ? 6.307   -1.617  -1.076  1.00 0.00 ? 24 THR A O    8  
ATOM 8792  C CB   . THR A 1 24 ? 4.979   -3.035  -3.216  1.00 0.00 ? 24 THR A CB   8  
ATOM 8793  O OG1  . THR A 1 24 ? 6.341   -3.042  -3.610  1.00 0.00 ? 24 THR A OG1  8  
ATOM 8794  C CG2  . THR A 1 24 ? 4.384   -1.642  -3.443  1.00 0.00 ? 24 THR A CG2  8  
ATOM 8795  H H    . THR A 1 24 ? 3.523   -1.924  -0.979  1.00 0.00 ? 24 THR A H    8  
ATOM 8796  H HA   . THR A 1 24 ? 4.902   -4.487  -1.629  1.00 0.00 ? 24 THR A HA   8  
ATOM 8797  H HB   . THR A 1 24 ? 4.433   -3.752  -3.807  1.00 0.00 ? 24 THR A HB   8  
ATOM 8798  H HG1  . THR A 1 24 ? 6.374   -2.975  -4.568  1.00 0.00 ? 24 THR A HG1  8  
ATOM 8799  H HG21 . THR A 1 24 ? 4.548   -1.344  -4.468  1.00 0.00 ? 24 THR A HG21 8  
ATOM 8800  H HG22 . THR A 1 24 ? 4.859   -0.933  -2.782  1.00 0.00 ? 24 THR A HG22 8  
ATOM 8801  H HG23 . THR A 1 24 ? 3.324   -1.666  -3.242  1.00 0.00 ? 24 THR A HG23 8  
ATOM 8802  N N    . LYS A 1 25 ? 6.791   -3.585  -0.230  1.00 0.00 ? 25 LYS A N    8  
ATOM 8803  C CA   . LYS A 1 25 ? 7.974   -3.042  0.496   1.00 0.00 ? 25 LYS A CA   8  
ATOM 8804  C C    . LYS A 1 25 ? 9.158   -3.820  -0.023  1.00 0.00 ? 25 LYS A C    8  
ATOM 8805  O O    . LYS A 1 25 ? 9.330   -4.977  0.305   1.00 0.00 ? 25 LYS A O    8  
ATOM 8806  C CB   . LYS A 1 25 ? 7.814   -3.268  2.007   1.00 0.00 ? 25 LYS A CB   8  
ATOM 8807  C CG   . LYS A 1 25 ? 8.881   -2.467  2.781   1.00 0.00 ? 25 LYS A CG   8  
ATOM 8808  C CD   . LYS A 1 25 ? 8.390   -1.027  3.041   1.00 0.00 ? 25 LYS A CD   8  
ATOM 8809  C CE   . LYS A 1 25 ? 7.562   -0.977  4.331   1.00 0.00 ? 25 LYS A CE   8  
ATOM 8810  N NZ   . LYS A 1 25 ? 6.892   0.349   4.442   1.00 0.00 ? 25 LYS A NZ   8  
ATOM 8811  H H    . LYS A 1 25 ? 6.607   -4.550  -0.192  1.00 0.00 ? 25 LYS A H    8  
ATOM 8812  H HA   . LYS A 1 25 ? 8.114   -1.985  0.291   1.00 0.00 ? 25 LYS A HA   8  
ATOM 8813  H HB2  . LYS A 1 25 ? 6.827   -2.951  2.312   1.00 0.00 ? 25 LYS A HB2  8  
ATOM 8814  H HB3  . LYS A 1 25 ? 7.931   -4.317  2.225   1.00 0.00 ? 25 LYS A HB3  8  
ATOM 8815  H HG2  . LYS A 1 25 ? 9.079   -2.957  3.726   1.00 0.00 ? 25 LYS A HG2  8  
ATOM 8816  H HG3  . LYS A 1 25 ? 9.795   -2.434  2.207   1.00 0.00 ? 25 LYS A HG3  8  
ATOM 8817  H HD2  . LYS A 1 25 ? 9.243   -0.371  3.141   1.00 0.00 ? 25 LYS A HD2  8  
ATOM 8818  H HD3  . LYS A 1 25 ? 7.781   -0.695  2.213   1.00 0.00 ? 25 LYS A HD3  8  
ATOM 8819  H HE2  . LYS A 1 25 ? 6.815   -1.757  4.313   1.00 0.00 ? 25 LYS A HE2  8  
ATOM 8820  H HE3  . LYS A 1 25 ? 8.212   -1.123  5.181   1.00 0.00 ? 25 LYS A HE3  8  
ATOM 8821  H HZ1  . LYS A 1 25 ? 6.898   0.660   5.434   1.00 0.00 ? 25 LYS A HZ1  8  
ATOM 8822  H HZ2  . LYS A 1 25 ? 5.909   0.270   4.112   1.00 0.00 ? 25 LYS A HZ2  8  
ATOM 8823  H HZ3  . LYS A 1 25 ? 7.400   1.044   3.856   1.00 0.00 ? 25 LYS A HZ3  8  
ATOM 8824  N N    . THR A 1 26 ? 9.959   -3.217  -0.856  1.00 0.00 ? 26 THR A N    8  
ATOM 8825  C CA   . THR A 1 26 ? 11.121  -3.946  -1.432  1.00 0.00 ? 26 THR A CA   8  
ATOM 8826  C C    . THR A 1 26 ? 12.413  -3.238  -1.040  1.00 0.00 ? 26 THR A C    8  
ATOM 8827  O O    . THR A 1 26 ? 12.510  -2.029  -1.123  1.00 0.00 ? 26 THR A O    8  
ATOM 8828  C CB   . THR A 1 26 ? 10.996  -3.965  -2.960  1.00 0.00 ? 26 THR A CB   8  
ATOM 8829  O OG1  . THR A 1 26 ? 9.869   -4.746  -3.330  1.00 0.00 ? 26 THR A OG1  8  
ATOM 8830  C CG2  . THR A 1 26 ? 12.260  -4.566  -3.579  1.00 0.00 ? 26 THR A CG2  8  
ATOM 8831  H H    . THR A 1 26 ? 9.775   -2.293  -1.128  1.00 0.00 ? 26 THR A H    8  
ATOM 8832  H HA   . THR A 1 26 ? 11.127  -4.959  -1.065  1.00 0.00 ? 26 THR A HA   8  
ATOM 8833  H HB   . THR A 1 26 ? 10.869  -2.956  -3.322  1.00 0.00 ? 26 THR A HB   8  
ATOM 8834  H HG1  . THR A 1 26 ? 9.409   -4.287  -4.037  1.00 0.00 ? 26 THR A HG1  8  
ATOM 8835  H HG21 . THR A 1 26 ? 12.510  -5.485  -3.069  1.00 0.00 ? 26 THR A HG21 8  
ATOM 8836  H HG22 . THR A 1 26 ? 13.078  -3.867  -3.480  1.00 0.00 ? 26 THR A HG22 8  
ATOM 8837  H HG23 . THR A 1 26 ? 12.087  -4.771  -4.624  1.00 0.00 ? 26 THR A HG23 8  
ATOM 8838  N N    . VAL A 1 27 ? 13.413  -3.980  -0.624  1.00 0.00 ? 27 VAL A N    8  
ATOM 8839  C CA   . VAL A 1 27 ? 14.714  -3.347  -0.236  1.00 0.00 ? 27 VAL A CA   8  
ATOM 8840  C C    . VAL A 1 27 ? 15.824  -3.855  -1.167  1.00 0.00 ? 27 VAL A C    8  
ATOM 8841  O O    . VAL A 1 27 ? 16.270  -4.982  -1.083  1.00 0.00 ? 27 VAL A O    8  
ATOM 8842  C CB   . VAL A 1 27 ? 15.032  -3.695  1.234   1.00 0.00 ? 27 VAL A CB   8  
ATOM 8843  C CG1  . VAL A 1 27 ? 14.699  -5.164  1.520   1.00 0.00 ? 27 VAL A CG1  8  
ATOM 8844  C CG2  . VAL A 1 27 ? 16.516  -3.437  1.530   1.00 0.00 ? 27 VAL A CG2  8  
ATOM 8845  H H    . VAL A 1 27 ? 13.309  -4.952  -0.576  1.00 0.00 ? 27 VAL A H    8  
ATOM 8846  H HA   . VAL A 1 27 ? 14.648  -2.271  -0.333  1.00 0.00 ? 27 VAL A HA   8  
ATOM 8847  H HB   . VAL A 1 27 ? 14.429  -3.070  1.876   1.00 0.00 ? 27 VAL A HB   8  
ATOM 8848  H HG11 . VAL A 1 27 ? 15.054  -5.784  0.713   1.00 0.00 ? 27 VAL A HG11 8  
ATOM 8849  H HG12 . VAL A 1 27 ? 13.630  -5.279  1.619   1.00 0.00 ? 27 VAL A HG12 8  
ATOM 8850  H HG13 . VAL A 1 27 ? 15.176  -5.468  2.441   1.00 0.00 ? 27 VAL A HG13 8  
ATOM 8851  H HG21 . VAL A 1 27 ? 17.113  -4.225  1.096   1.00 0.00 ? 27 VAL A HG21 8  
ATOM 8852  H HG22 . VAL A 1 27 ? 16.671  -3.415  2.599   1.00 0.00 ? 27 VAL A HG22 8  
ATOM 8853  H HG23 . VAL A 1 27 ? 16.808  -2.488  1.105   1.00 0.00 ? 27 VAL A HG23 8  
ATOM 8854  N N    . THR A 1 28 ? 16.256  -3.011  -2.065  1.00 0.00 ? 28 THR A N    8  
ATOM 8855  C CA   . THR A 1 28 ? 17.330  -3.409  -3.024  1.00 0.00 ? 28 THR A CA   8  
ATOM 8856  C C    . THR A 1 28 ? 18.694  -3.078  -2.421  1.00 0.00 ? 28 THR A C    8  
ATOM 8857  O O    . THR A 1 28 ? 19.072  -1.927  -2.322  1.00 0.00 ? 28 THR A O    8  
ATOM 8858  C CB   . THR A 1 28 ? 17.154  -2.635  -4.334  1.00 0.00 ? 28 THR A CB   8  
ATOM 8859  O OG1  . THR A 1 28 ? 15.884  -2.938  -4.894  1.00 0.00 ? 28 THR A OG1  8  
ATOM 8860  C CG2  . THR A 1 28 ? 18.256  -3.035  -5.319  1.00 0.00 ? 28 THR A CG2  8  
ATOM 8861  H H    . THR A 1 28 ? 15.837  -2.123  -2.113  1.00 0.00 ? 28 THR A H    8  
ATOM 8862  H HA   . THR A 1 28 ? 17.269  -4.469  -3.221  1.00 0.00 ? 28 THR A HA   8  
ATOM 8863  H HB   . THR A 1 28 ? 17.218  -1.576  -4.139  1.00 0.00 ? 28 THR A HB   8  
ATOM 8864  H HG1  . THR A 1 28 ? 15.705  -3.869  -4.738  1.00 0.00 ? 28 THR A HG1  8  
ATOM 8865  H HG21 . THR A 1 28 ? 18.060  -2.583  -6.280  1.00 0.00 ? 28 THR A HG21 8  
ATOM 8866  H HG22 . THR A 1 28 ? 18.273  -4.109  -5.423  1.00 0.00 ? 28 THR A HG22 8  
ATOM 8867  H HG23 . THR A 1 28 ? 19.211  -2.694  -4.948  1.00 0.00 ? 28 THR A HG23 8  
ATOM 8868  N N    . ASN A 1 29 ? 19.442  -4.073  -2.010  1.00 0.00 ? 29 ASN A N    8  
ATOM 8869  C CA   . ASN A 1 29 ? 20.782  -3.807  -1.408  1.00 0.00 ? 29 ASN A CA   8  
ATOM 8870  C C    . ASN A 1 29 ? 21.861  -3.931  -2.491  1.00 0.00 ? 29 ASN A C    8  
ATOM 8871  O O    . ASN A 1 29 ? 22.039  -4.976  -3.095  1.00 0.00 ? 29 ASN A O    8  
ATOM 8872  C CB   . ASN A 1 29 ? 21.041  -4.827  -0.287  1.00 0.00 ? 29 ASN A CB   8  
ATOM 8873  C CG   . ASN A 1 29 ? 19.721  -5.160  0.412   1.00 0.00 ? 29 ASN A CG   8  
ATOM 8874  O OD1  . ASN A 1 29 ? 18.907  -5.890  -0.118  1.00 0.00 ? 29 ASN A OD1  8  
ATOM 8875  N ND2  . ASN A 1 29 ? 19.473  -4.650  1.586   1.00 0.00 ? 29 ASN A ND2  8  
ATOM 8876  H H    . ASN A 1 29 ? 19.133  -5.000  -2.081  1.00 0.00 ? 29 ASN A H    8  
ATOM 8877  H HA   . ASN A 1 29 ? 20.807  -2.808  -0.993  1.00 0.00 ? 29 ASN A HA   8  
ATOM 8878  H HB2  . ASN A 1 29 ? 21.463  -5.732  -0.705  1.00 0.00 ? 29 ASN A HB2  8  
ATOM 8879  H HB3  . ASN A 1 29 ? 21.728  -4.408  0.432   1.00 0.00 ? 29 ASN A HB3  8  
ATOM 8880  H HD21 . ASN A 1 29 ? 20.129  -4.062  2.014   1.00 0.00 ? 29 ASN A HD21 8  
ATOM 8881  H HD22 . ASN A 1 29 ? 18.629  -4.857  2.041   1.00 0.00 ? 29 ASN A HD22 8  
ATOM 8882  N N    . ALA A 1 30 ? 22.574  -2.866  -2.738  1.00 0.00 ? 30 ALA A N    8  
ATOM 8883  C CA   . ALA A 1 30 ? 23.641  -2.874  -3.778  1.00 0.00 ? 30 ALA A CA   8  
ATOM 8884  C C    . ALA A 1 30 ? 24.535  -4.107  -3.629  1.00 0.00 ? 30 ALA A C    8  
ATOM 8885  O O    . ALA A 1 30 ? 25.358  -4.385  -4.479  1.00 0.00 ? 30 ALA A O    8  
ATOM 8886  C CB   . ALA A 1 30 ? 24.496  -1.613  -3.633  1.00 0.00 ? 30 ALA A CB   8  
ATOM 8887  H H    . ALA A 1 30 ? 22.401  -2.037  -2.242  1.00 0.00 ? 30 ALA A H    8  
ATOM 8888  H HA   . ALA A 1 30 ? 23.186  -2.882  -4.756  1.00 0.00 ? 30 ALA A HA   8  
ATOM 8889  H HB1  . ALA A 1 30 ? 23.862  -0.741  -3.692  1.00 0.00 ? 30 ALA A HB1  8  
ATOM 8890  H HB2  . ALA A 1 30 ? 25.227  -1.581  -4.426  1.00 0.00 ? 30 ALA A HB2  8  
ATOM 8891  H HB3  . ALA A 1 30 ? 25.001  -1.628  -2.678  1.00 0.00 ? 30 ALA A HB3  8  
ATOM 8892  N N    . ASP A 1 31 ? 24.409  -4.841  -2.557  1.00 0.00 ? 31 ASP A N    8  
ATOM 8893  C CA   . ASP A 1 31 ? 25.286  -6.032  -2.381  1.00 0.00 ? 31 ASP A CA   8  
ATOM 8894  C C    . ASP A 1 31 ? 24.902  -7.114  -3.395  1.00 0.00 ? 31 ASP A C    8  
ATOM 8895  O O    . ASP A 1 31 ? 25.577  -8.116  -3.520  1.00 0.00 ? 31 ASP A O    8  
ATOM 8896  C CB   . ASP A 1 31 ? 25.126  -6.578  -0.959  1.00 0.00 ? 31 ASP A CB   8  
ATOM 8897  C CG   . ASP A 1 31 ? 25.908  -7.886  -0.820  1.00 0.00 ? 31 ASP A CG   8  
ATOM 8898  O OD1  . ASP A 1 31 ? 27.126  -7.829  -0.827  1.00 0.00 ? 31 ASP A OD1  8  
ATOM 8899  O OD2  . ASP A 1 31 ? 25.274  -8.923  -0.708  1.00 0.00 ? 31 ASP A OD2  8  
ATOM 8900  H H    . ASP A 1 31 ? 23.756  -4.611  -1.866  1.00 0.00 ? 31 ASP A H    8  
ATOM 8901  H HA   . ASP A 1 31 ? 26.315  -5.745  -2.539  1.00 0.00 ? 31 ASP A HA   8  
ATOM 8902  H HB2  . ASP A 1 31 ? 25.508  -5.854  -0.252  1.00 0.00 ? 31 ASP A HB2  8  
ATOM 8903  H HB3  . ASP A 1 31 ? 24.083  -6.761  -0.756  1.00 0.00 ? 31 ASP A HB3  8  
ATOM 8904  N N    . GLY A 1 32 ? 23.836  -6.916  -4.136  1.00 0.00 ? 32 GLY A N    8  
ATOM 8905  C CA   . GLY A 1 32 ? 23.429  -7.933  -5.162  1.00 0.00 ? 32 GLY A CA   8  
ATOM 8906  C C    . GLY A 1 32 ? 22.234  -8.754  -4.669  1.00 0.00 ? 32 GLY A C    8  
ATOM 8907  O O    . GLY A 1 32 ? 21.890  -9.757  -5.262  1.00 0.00 ? 32 GLY A O    8  
ATOM 8908  H H    . GLY A 1 32 ? 23.307  -6.098  -4.026  1.00 0.00 ? 32 GLY A H    8  
ATOM 8909  H HA2  . GLY A 1 32 ? 23.153  -7.421  -6.071  1.00 0.00 ? 32 GLY A HA2  8  
ATOM 8910  H HA3  . GLY A 1 32 ? 24.254  -8.601  -5.370  1.00 0.00 ? 32 GLY A HA3  8  
ATOM 8911  N N    . ARG A 1 33 ? 21.597  -8.347  -3.595  1.00 0.00 ? 33 ARG A N    8  
ATOM 8912  C CA   . ARG A 1 33 ? 20.417  -9.123  -3.076  1.00 0.00 ? 33 ARG A CA   8  
ATOM 8913  C C    . ARG A 1 33 ? 19.260  -8.170  -2.778  1.00 0.00 ? 33 ARG A C    8  
ATOM 8914  O O    . ARG A 1 33 ? 19.454  -7.002  -2.507  1.00 0.00 ? 33 ARG A O    8  
ATOM 8915  C CB   . ARG A 1 33 ? 20.809  -9.880  -1.800  1.00 0.00 ? 33 ARG A CB   8  
ATOM 8916  C CG   . ARG A 1 33 ? 21.445  -8.923  -0.785  1.00 0.00 ? 33 ARG A CG   8  
ATOM 8917  C CD   . ARG A 1 33 ? 21.433  -9.571  0.602   1.00 0.00 ? 33 ARG A CD   8  
ATOM 8918  N NE   . ARG A 1 33 ? 22.229  -8.739  1.547   1.00 0.00 ? 33 ARG A NE   8  
ATOM 8919  C CZ   . ARG A 1 33 ? 22.124  -8.933  2.834   1.00 0.00 ? 33 ARG A CZ   8  
ATOM 8920  N NH1  . ARG A 1 33 ? 21.325  -9.857  3.291   1.00 0.00 ? 33 ARG A NH1  8  
ATOM 8921  N NH2  . ARG A 1 33 ? 22.820  -8.203  3.662   1.00 0.00 ? 33 ARG A NH2  8  
ATOM 8922  H H    . ARG A 1 33 ? 21.888  -7.529  -3.136  1.00 0.00 ? 33 ARG A H    8  
ATOM 8923  H HA   . ARG A 1 33 ? 20.090  -9.837  -3.820  1.00 0.00 ? 33 ARG A HA   8  
ATOM 8924  H HB2  . ARG A 1 33 ? 19.924  -10.327 -1.367  1.00 0.00 ? 33 ARG A HB2  8  
ATOM 8925  H HB3  . ARG A 1 33 ? 21.515  -10.658 -2.049  1.00 0.00 ? 33 ARG A HB3  8  
ATOM 8926  H HG2  . ARG A 1 33 ? 22.466  -8.719  -1.074  1.00 0.00 ? 33 ARG A HG2  8  
ATOM 8927  H HG3  . ARG A 1 33 ? 20.886  -8.001  -0.755  1.00 0.00 ? 33 ARG A HG3  8  
ATOM 8928  H HD2  . ARG A 1 33 ? 20.416  -9.643  0.957   1.00 0.00 ? 33 ARG A HD2  8  
ATOM 8929  H HD3  . ARG A 1 33 ? 21.862  -10.560 0.540   1.00 0.00 ? 33 ARG A HD3  8  
ATOM 8930  H HE   . ARG A 1 33 ? 22.831  -8.047  1.203   1.00 0.00 ? 33 ARG A HE   8  
ATOM 8931  H HH11 . ARG A 1 33 ? 20.793  -10.418 2.657   1.00 0.00 ? 33 ARG A HH11 8  
ATOM 8932  H HH12 . ARG A 1 33 ? 21.244  -10.005 4.277   1.00 0.00 ? 33 ARG A HH12 8  
ATOM 8933  H HH21 . ARG A 1 33 ? 23.434  -7.495  3.310   1.00 0.00 ? 33 ARG A HH21 8  
ATOM 8934  H HH22 . ARG A 1 33 ? 22.739  -8.351  4.648   1.00 0.00 ? 33 ARG A HH22 8  
ATOM 8935  N N    . THR A 1 34 ? 18.048  -8.664  -2.835  1.00 0.00 ? 34 THR A N    8  
ATOM 8936  C CA   . THR A 1 34 ? 16.869  -7.792  -2.565  1.00 0.00 ? 34 THR A CA   8  
ATOM 8937  C C    . THR A 1 34 ? 15.691  -8.649  -2.087  1.00 0.00 ? 34 THR A C    8  
ATOM 8938  O O    . THR A 1 34 ? 15.525  -9.778  -2.501  1.00 0.00 ? 34 THR A O    8  
ATOM 8939  C CB   . THR A 1 34 ? 16.480  -7.061  -3.853  1.00 0.00 ? 34 THR A CB   8  
ATOM 8940  O OG1  . THR A 1 34 ? 15.468  -6.106  -3.567  1.00 0.00 ? 34 THR A OG1  8  
ATOM 8941  C CG2  . THR A 1 34 ? 15.960  -8.067  -4.882  1.00 0.00 ? 34 THR A CG2  8  
ATOM 8942  H H    . THR A 1 34 ? 17.917  -9.608  -3.061  1.00 0.00 ? 34 THR A H    8  
ATOM 8943  H HA   . THR A 1 34 ? 17.119  -7.068  -1.803  1.00 0.00 ? 34 THR A HA   8  
ATOM 8944  H HB   . THR A 1 34 ? 17.345  -6.559  -4.257  1.00 0.00 ? 34 THR A HB   8  
ATOM 8945  H HG1  . THR A 1 34 ? 14.771  -6.207  -4.220  1.00 0.00 ? 34 THR A HG1  8  
ATOM 8946  H HG21 . THR A 1 34 ? 16.632  -8.911  -4.933  1.00 0.00 ? 34 THR A HG21 8  
ATOM 8947  H HG22 . THR A 1 34 ? 15.901  -7.594  -5.851  1.00 0.00 ? 34 THR A HG22 8  
ATOM 8948  H HG23 . THR A 1 34 ? 14.977  -8.407  -4.589  1.00 0.00 ? 34 THR A HG23 8  
ATOM 8949  N N    . GLU A 1 35 ? 14.873  -8.109  -1.216  1.00 0.00 ? 35 GLU A N    8  
ATOM 8950  C CA   . GLU A 1 35 ? 13.686  -8.864  -0.688  1.00 0.00 ? 35 GLU A CA   8  
ATOM 8951  C C    . GLU A 1 35 ? 12.412  -8.093  -1.066  1.00 0.00 ? 35 GLU A C    8  
ATOM 8952  O O    . GLU A 1 35 ? 12.444  -6.887  -1.188  1.00 0.00 ? 35 GLU A O    8  
ATOM 8953  C CB   . GLU A 1 35 ? 13.812  -8.972  0.845   1.00 0.00 ? 35 GLU A CB   8  
ATOM 8954  C CG   . GLU A 1 35 ? 15.290  -9.091  1.226   1.00 0.00 ? 35 GLU A CG   8  
ATOM 8955  C CD   . GLU A 1 35 ? 15.409  -9.507  2.693   1.00 0.00 ? 35 GLU A CD   8  
ATOM 8956  O OE1  . GLU A 1 35 ? 15.433  -10.699 2.951   1.00 0.00 ? 35 GLU A OE1  8  
ATOM 8957  O OE2  . GLU A 1 35 ? 15.475  -8.625  3.534   1.00 0.00 ? 35 GLU A OE2  8  
ATOM 8958  H H    . GLU A 1 35 ? 15.038  -7.192  -0.906  1.00 0.00 ? 35 GLU A H    8  
ATOM 8959  H HA   . GLU A 1 35 ? 13.648  -9.856  -1.120  1.00 0.00 ? 35 GLU A HA   8  
ATOM 8960  H HB2  . GLU A 1 35 ? 13.393  -8.090  1.310   1.00 0.00 ? 35 GLU A HB2  8  
ATOM 8961  H HB3  . GLU A 1 35 ? 13.286  -9.847  1.196   1.00 0.00 ? 35 GLU A HB3  8  
ATOM 8962  H HG2  . GLU A 1 35 ? 15.764  -9.834  0.601   1.00 0.00 ? 35 GLU A HG2  8  
ATOM 8963  H HG3  . GLU A 1 35 ? 15.776  -8.137  1.083   1.00 0.00 ? 35 GLU A HG3  8  
ATOM 8964  N N    . THR A 1 36 ? 11.288  -8.763  -1.246  1.00 0.00 ? 36 THR A N    8  
ATOM 8965  C CA   . THR A 1 36 ? 10.029  -8.053  -1.604  1.00 0.00 ? 36 THR A CA   8  
ATOM 8966  C C    . THR A 1 36 ? 8.990   -8.411  -0.558  1.00 0.00 ? 36 THR A C    8  
ATOM 8967  O O    . THR A 1 36 ? 8.539   -9.536  -0.480  1.00 0.00 ? 36 THR A O    8  
ATOM 8968  C CB   . THR A 1 36 ? 9.552   -8.521  -2.982  1.00 0.00 ? 36 THR A CB   8  
ATOM 8969  O OG1  . THR A 1 36 ? 9.347   -9.927  -2.960  1.00 0.00 ? 36 THR A OG1  8  
ATOM 8970  C CG2  . THR A 1 36 ? 10.608  -8.172  -4.033  1.00 0.00 ? 36 THR A CG2  8  
ATOM 8971  H H    . THR A 1 36 ? 11.259  -9.735  -1.135  1.00 0.00 ? 36 THR A H    8  
ATOM 8972  H HA   . THR A 1 36 ? 10.177  -6.986  -1.614  1.00 0.00 ? 36 THR A HA   8  
ATOM 8973  H HB   . THR A 1 36 ? 8.627   -8.025  -3.230  1.00 0.00 ? 36 THR A HB   8  
ATOM 8974  H HG1  . THR A 1 36 ? 10.138  -10.336 -2.602  1.00 0.00 ? 36 THR A HG1  8  
ATOM 8975  H HG21 . THR A 1 36 ? 11.548  -8.630  -3.765  1.00 0.00 ? 36 THR A HG21 8  
ATOM 8976  H HG22 . THR A 1 36 ? 10.730  -7.100  -4.078  1.00 0.00 ? 36 THR A HG22 8  
ATOM 8977  H HG23 . THR A 1 36 ? 10.290  -8.538  -4.998  1.00 0.00 ? 36 THR A HG23 8  
ATOM 8978  N N    . THR A 1 37 ? 8.601   -7.462  0.247   1.00 0.00 ? 37 THR A N    8  
ATOM 8979  C CA   . THR A 1 37 ? 7.578   -7.738  1.298   1.00 0.00 ? 37 THR A CA   8  
ATOM 8980  C C    . THR A 1 37 ? 6.245   -7.182  0.805   1.00 0.00 ? 37 THR A C    8  
ATOM 8981  O O    . THR A 1 37 ? 6.066   -5.988  0.695   1.00 0.00 ? 37 THR A O    8  
ATOM 8982  C CB   . THR A 1 37 ? 8.009   -7.049  2.620   1.00 0.00 ? 37 THR A CB   8  
ATOM 8983  O OG1  . THR A 1 37 ? 9.178   -6.281  2.380   1.00 0.00 ? 37 THR A OG1  8  
ATOM 8984  C CG2  . THR A 1 37 ? 8.316   -8.097  3.700   1.00 0.00 ? 37 THR A CG2  8  
ATOM 8985  H H    . THR A 1 37 ? 8.967   -6.552  0.157   1.00 0.00 ? 37 THR A H    8  
ATOM 8986  H HA   . THR A 1 37 ? 7.474   -8.810  1.452   1.00 0.00 ? 37 THR A HA   8  
ATOM 8987  H HB   . THR A 1 37 ? 7.223   -6.399  2.979   1.00 0.00 ? 37 THR A HB   8  
ATOM 8988  H HG1  . THR A 1 37 ? 9.252   -6.140  1.434   1.00 0.00 ? 37 THR A HG1  8  
ATOM 8989  H HG21 . THR A 1 37 ? 8.630   -7.598  4.604   1.00 0.00 ? 37 THR A HG21 8  
ATOM 8990  H HG22 . THR A 1 37 ? 9.105   -8.749  3.355   1.00 0.00 ? 37 THR A HG22 8  
ATOM 8991  H HG23 . THR A 1 37 ? 7.429   -8.679  3.900   1.00 0.00 ? 37 THR A HG23 8  
ATOM 8992  N N    . LYS A 1 38 ? 5.326   -8.057  0.512   1.00 0.00 ? 38 LYS A N    8  
ATOM 8993  C CA   . LYS A 1 38 ? 3.967   -7.657  0.022   1.00 0.00 ? 38 LYS A CA   8  
ATOM 8994  C C    . LYS A 1 38 ? 4.047   -7.178  -1.425  1.00 0.00 ? 38 LYS A C    8  
ATOM 8995  O O    . LYS A 1 38 ? 5.113   -6.933  -1.956  1.00 0.00 ? 38 LYS A O    8  
ATOM 8996  C CB   . LYS A 1 38 ? 3.348   -6.565  0.907   1.00 0.00 ? 38 LYS A CB   8  
ATOM 8997  C CG   . LYS A 1 38 ? 3.423   -6.969  2.387   1.00 0.00 ? 38 LYS A CG   8  
ATOM 8998  C CD   . LYS A 1 38 ? 2.415   -8.087  2.682   1.00 0.00 ? 38 LYS A CD   8  
ATOM 8999  C CE   . LYS A 1 38 ? 2.267   -8.248  4.197   1.00 0.00 ? 38 LYS A CE   8  
ATOM 9000  N NZ   . LYS A 1 38 ? 3.605   -8.497  4.802   1.00 0.00 ? 38 LYS A NZ   8  
ATOM 9001  H H    . LYS A 1 38 ? 5.513   -9.006  0.610   1.00 0.00 ? 38 LYS A H    8  
ATOM 9002  H HA   . LYS A 1 38 ? 3.328   -8.527  0.052   1.00 0.00 ? 38 LYS A HA   8  
ATOM 9003  H HB2  . LYS A 1 38 ? 3.867   -5.635  0.759   1.00 0.00 ? 38 LYS A HB2  8  
ATOM 9004  H HB3  . LYS A 1 38 ? 2.315   -6.436  0.629   1.00 0.00 ? 38 LYS A HB3  8  
ATOM 9005  H HG2  . LYS A 1 38 ? 4.417   -7.317  2.619   1.00 0.00 ? 38 LYS A HG2  8  
ATOM 9006  H HG3  . LYS A 1 38 ? 3.192   -6.112  3.003   1.00 0.00 ? 38 LYS A HG3  8  
ATOM 9007  H HD2  . LYS A 1 38 ? 1.456   -7.836  2.253   1.00 0.00 ? 38 LYS A HD2  8  
ATOM 9008  H HD3  . LYS A 1 38 ? 2.769   -9.014  2.259   1.00 0.00 ? 38 LYS A HD3  8  
ATOM 9009  H HE2  . LYS A 1 38 ? 1.844   -7.348  4.616   1.00 0.00 ? 38 LYS A HE2  8  
ATOM 9010  H HE3  . LYS A 1 38 ? 1.615   -9.084  4.407   1.00 0.00 ? 38 LYS A HE3  8  
ATOM 9011  H HZ1  . LYS A 1 38 ? 4.291   -7.816  4.421   1.00 0.00 ? 38 LYS A HZ1  8  
ATOM 9012  H HZ2  . LYS A 1 38 ? 3.915   -9.462  4.573   1.00 0.00 ? 38 LYS A HZ2  8  
ATOM 9013  H HZ3  . LYS A 1 38 ? 3.543   -8.388  5.836   1.00 0.00 ? 38 LYS A HZ3  8  
ATOM 9014  N N    . GLU A 1 39 ? 2.917   -7.059  -2.073  1.00 0.00 ? 39 GLU A N    8  
ATOM 9015  C CA   . GLU A 1 39 ? 2.904   -6.618  -3.496  1.00 0.00 ? 39 GLU A CA   8  
ATOM 9016  C C    . GLU A 1 39 ? 1.604   -5.862  -3.789  1.00 0.00 ? 39 GLU A C    8  
ATOM 9017  O O    . GLU A 1 39 ? 1.241   -4.942  -3.082  1.00 0.00 ? 39 GLU A O    8  
ATOM 9018  C CB   . GLU A 1 39 ? 2.995   -7.844  -4.408  1.00 0.00 ? 39 GLU A CB   8  
ATOM 9019  C CG   . GLU A 1 39 ? 4.305   -8.587  -4.140  1.00 0.00 ? 39 GLU A CG   8  
ATOM 9020  C CD   . GLU A 1 39 ? 4.544   -9.615  -5.246  1.00 0.00 ? 39 GLU A CD   8  
ATOM 9021  O OE1  . GLU A 1 39 ? 3.669   -10.437 -5.463  1.00 0.00 ? 39 GLU A OE1  8  
ATOM 9022  O OE2  . GLU A 1 39 ? 5.598   -9.562  -5.859  1.00 0.00 ? 39 GLU A OE2  8  
ATOM 9023  H H    . GLU A 1 39 ? 2.074   -7.273  -1.622  1.00 0.00 ? 39 GLU A H    8  
ATOM 9024  H HA   . GLU A 1 39 ? 3.746   -5.968  -3.686  1.00 0.00 ? 39 GLU A HA   8  
ATOM 9025  H HB2  . GLU A 1 39 ? 2.160   -8.501  -4.211  1.00 0.00 ? 39 GLU A HB2  8  
ATOM 9026  H HB3  . GLU A 1 39 ? 2.968   -7.528  -5.440  1.00 0.00 ? 39 GLU A HB3  8  
ATOM 9027  H HG2  . GLU A 1 39 ? 5.122   -7.880  -4.120  1.00 0.00 ? 39 GLU A HG2  8  
ATOM 9028  H HG3  . GLU A 1 39 ? 4.243   -9.093  -3.187  1.00 0.00 ? 39 GLU A HG3  8  
ATOM 9029  N N    . VAL A 1 40 ? 0.912   -6.235  -4.841  1.00 0.00 ? 40 VAL A N    8  
ATOM 9030  C CA   . VAL A 1 40 ? -0.362  -5.534  -5.213  1.00 0.00 ? 40 VAL A CA   8  
ATOM 9031  C C    . VAL A 1 40 ? -1.565  -6.462  -5.014  1.00 0.00 ? 40 VAL A C    8  
ATOM 9032  O O    . VAL A 1 40 ? -1.529  -7.621  -5.380  1.00 0.00 ? 40 VAL A O    8  
ATOM 9033  C CB   . VAL A 1 40 ? -0.278  -5.125  -6.690  1.00 0.00 ? 40 VAL A CB   8  
ATOM 9034  C CG1  . VAL A 1 40 ? -1.314  -4.037  -6.990  1.00 0.00 ? 40 VAL A CG1  8  
ATOM 9035  C CG2  . VAL A 1 40 ? 1.126   -4.590  -6.987  1.00 0.00 ? 40 VAL A CG2  8  
ATOM 9036  H H    . VAL A 1 40 ? 1.240   -6.968  -5.401  1.00 0.00 ? 40 VAL A H    8  
ATOM 9037  H HA   . VAL A 1 40 ? -0.491  -4.656  -4.608  1.00 0.00 ? 40 VAL A HA   8  
ATOM 9038  H HB   . VAL A 1 40 ? -0.472  -5.986  -7.314  1.00 0.00 ? 40 VAL A HB   8  
ATOM 9039  H HG11 . VAL A 1 40 ? -1.470  -3.976  -8.058  1.00 0.00 ? 40 VAL A HG11 8  
ATOM 9040  H HG12 . VAL A 1 40 ? -0.957  -3.087  -6.624  1.00 0.00 ? 40 VAL A HG12 8  
ATOM 9041  H HG13 . VAL A 1 40 ? -2.247  -4.284  -6.505  1.00 0.00 ? 40 VAL A HG13 8  
ATOM 9042  H HG21 . VAL A 1 40 ? 1.829   -5.410  -6.997  1.00 0.00 ? 40 VAL A HG21 8  
ATOM 9043  H HG22 . VAL A 1 40 ? 1.411   -3.881  -6.225  1.00 0.00 ? 40 VAL A HG22 8  
ATOM 9044  H HG23 . VAL A 1 40 ? 1.129   -4.103  -7.951  1.00 0.00 ? 40 VAL A HG23 8  
ATOM 9045  N N    . VAL A 1 41 ? -2.645  -5.949  -4.458  1.00 0.00 ? 41 VAL A N    8  
ATOM 9046  C CA   . VAL A 1 41 ? -3.872  -6.787  -4.259  1.00 0.00 ? 41 VAL A CA   8  
ATOM 9047  C C    . VAL A 1 41 ? -5.080  -6.059  -4.857  1.00 0.00 ? 41 VAL A C    8  
ATOM 9048  O O    . VAL A 1 41 ? -5.584  -5.092  -4.304  1.00 0.00 ? 41 VAL A O    8  
ATOM 9049  C CB   . VAL A 1 41 ? -4.101  -7.002  -2.757  1.00 0.00 ? 41 VAL A CB   8  
ATOM 9050  C CG1  . VAL A 1 41 ? -5.452  -7.696  -2.529  1.00 0.00 ? 41 VAL A CG1  8  
ATOM 9051  C CG2  . VAL A 1 41 ? -2.977  -7.873  -2.192  1.00 0.00 ? 41 VAL A CG2  8  
ATOM 9052  H H    . VAL A 1 41 ? -2.652  -5.005  -4.191  1.00 0.00 ? 41 VAL A H    8  
ATOM 9053  H HA   . VAL A 1 41 ? -3.756  -7.747  -4.745  1.00 0.00 ? 41 VAL A HA   8  
ATOM 9054  H HB   . VAL A 1 41 ? -4.102  -6.044  -2.255  1.00 0.00 ? 41 VAL A HB   8  
ATOM 9055  H HG11 . VAL A 1 41 ? -5.582  -8.480  -3.260  1.00 0.00 ? 41 VAL A HG11 8  
ATOM 9056  H HG12 . VAL A 1 41 ? -6.249  -6.974  -2.629  1.00 0.00 ? 41 VAL A HG12 8  
ATOM 9057  H HG13 . VAL A 1 41 ? -5.479  -8.122  -1.536  1.00 0.00 ? 41 VAL A HG13 8  
ATOM 9058  H HG21 . VAL A 1 41 ? -2.047  -7.326  -2.224  1.00 0.00 ? 41 VAL A HG21 8  
ATOM 9059  H HG22 . VAL A 1 41 ? -2.887  -8.771  -2.784  1.00 0.00 ? 41 VAL A HG22 8  
ATOM 9060  H HG23 . VAL A 1 41 ? -3.205  -8.136  -1.170  1.00 0.00 ? 41 VAL A HG23 8  
ATOM 9061  N N    . LYS A 1 42 ? -5.532  -6.514  -5.996  1.00 0.00 ? 42 LYS A N    8  
ATOM 9062  C CA   . LYS A 1 42 ? -6.696  -5.862  -6.670  1.00 0.00 ? 42 LYS A CA   8  
ATOM 9063  C C    . LYS A 1 42 ? -7.978  -6.104  -5.868  1.00 0.00 ? 42 LYS A C    8  
ATOM 9064  O O    . LYS A 1 42 ? -8.106  -7.087  -5.168  1.00 0.00 ? 42 LYS A O    8  
ATOM 9065  C CB   . LYS A 1 42 ? -6.838  -6.407  -8.112  1.00 0.00 ? 42 LYS A CB   8  
ATOM 9066  C CG   . LYS A 1 42 ? -7.714  -7.683  -8.167  1.00 0.00 ? 42 LYS A CG   8  
ATOM 9067  C CD   . LYS A 1 42 ? -7.404  -8.485  -9.448  1.00 0.00 ? 42 LYS A CD   8  
ATOM 9068  C CE   . LYS A 1 42 ? -6.222  -9.433  -9.211  1.00 0.00 ? 42 LYS A CE   8  
ATOM 9069  N NZ   . LYS A 1 42 ? -5.822  -10.056 -10.503 1.00 0.00 ? 42 LYS A NZ   8  
ATOM 9070  H H    . LYS A 1 42 ? -5.073  -7.263  -6.432  1.00 0.00 ? 42 LYS A H    8  
ATOM 9071  H HA   . LYS A 1 42 ? -6.513  -4.797  -6.716  1.00 0.00 ? 42 LYS A HA   8  
ATOM 9072  H HB2  . LYS A 1 42 ? -7.291  -5.648  -8.733  1.00 0.00 ? 42 LYS A HB2  8  
ATOM 9073  H HB3  . LYS A 1 42 ? -5.855  -6.632  -8.499  1.00 0.00 ? 42 LYS A HB3  8  
ATOM 9074  H HG2  . LYS A 1 42 ? -7.527  -8.298  -7.298  1.00 0.00 ? 42 LYS A HG2  8  
ATOM 9075  H HG3  . LYS A 1 42 ? -8.756  -7.398  -8.177  1.00 0.00 ? 42 LYS A HG3  8  
ATOM 9076  H HD2  . LYS A 1 42 ? -8.273  -9.066  -9.725  1.00 0.00 ? 42 LYS A HD2  8  
ATOM 9077  H HD3  . LYS A 1 42 ? -7.160  -7.806  -10.252 1.00 0.00 ? 42 LYS A HD3  8  
ATOM 9078  H HE2  . LYS A 1 42 ? -5.388  -8.881  -8.805  1.00 0.00 ? 42 LYS A HE2  8  
ATOM 9079  H HE3  . LYS A 1 42 ? -6.515  -10.205 -8.514  1.00 0.00 ? 42 LYS A HE3  8  
ATOM 9080  H HZ1  . LYS A 1 42 ? -5.615  -9.312  -11.198 1.00 0.00 ? 42 LYS A HZ1  8  
ATOM 9081  H HZ2  . LYS A 1 42 ? -6.599  -10.652 -10.857 1.00 0.00 ? 42 LYS A HZ2  8  
ATOM 9082  H HZ3  . LYS A 1 42 ? -4.975  -10.643 -10.357 1.00 0.00 ? 42 LYS A HZ3  8  
ATOM 9083  N N    . SER A 1 43 ? -8.935  -5.216  -5.996  1.00 0.00 ? 43 SER A N    8  
ATOM 9084  C CA   . SER A 1 43 ? -10.239 -5.375  -5.276  1.00 0.00 ? 43 SER A CA   8  
ATOM 9085  C C    . SER A 1 43 ? -11.361 -5.490  -6.308  1.00 0.00 ? 43 SER A C    8  
ATOM 9086  O O    . SER A 1 43 ? -11.416 -4.742  -7.264  1.00 0.00 ? 43 SER A O    8  
ATOM 9087  C CB   . SER A 1 43 ? -10.489 -4.151  -4.391  1.00 0.00 ? 43 SER A CB   8  
ATOM 9088  O OG   . SER A 1 43 ? -11.891 -3.950  -4.255  1.00 0.00 ? 43 SER A OG   8  
ATOM 9089  H H    . SER A 1 43 ? -8.802  -4.452  -6.599  1.00 0.00 ? 43 SER A H    8  
ATOM 9090  H HA   . SER A 1 43 ? -10.225 -6.267  -4.663  1.00 0.00 ? 43 SER A HA   8  
ATOM 9091  H HB2  . SER A 1 43 ? -10.059 -4.312  -3.417  1.00 0.00 ? 43 SER A HB2  8  
ATOM 9092  H HB3  . SER A 1 43 ? -10.032 -3.281  -4.844  1.00 0.00 ? 43 SER A HB3  8  
ATOM 9093  H HG   . SER A 1 43 ? -12.144 -3.226  -4.833  1.00 0.00 ? 43 SER A HG   8  
ATOM 9094  N N    . GLU A 1 44 ? -12.258 -6.418  -6.123  1.00 0.00 ? 44 GLU A N    8  
ATOM 9095  C CA   . GLU A 1 44 ? -13.378 -6.571  -7.098  1.00 0.00 ? 44 GLU A CA   8  
ATOM 9096  C C    . GLU A 1 44 ? -14.320 -5.374  -6.960  1.00 0.00 ? 44 GLU A C    8  
ATOM 9097  O O    . GLU A 1 44 ? -14.955 -4.956  -7.908  1.00 0.00 ? 44 GLU A O    8  
ATOM 9098  C CB   . GLU A 1 44 ? -14.150 -7.868  -6.817  1.00 0.00 ? 44 GLU A CB   8  
ATOM 9099  C CG   . GLU A 1 44 ? -13.364 -9.066  -7.357  1.00 0.00 ? 44 GLU A CG   8  
ATOM 9100  C CD   . GLU A 1 44 ? -14.172 -10.347 -7.136  1.00 0.00 ? 44 GLU A CD   8  
ATOM 9101  O OE1  . GLU A 1 44 ? -15.352 -10.340 -7.442  1.00 0.00 ? 44 GLU A OE1  8  
ATOM 9102  O OE2  . GLU A 1 44 ? -13.595 -11.313 -6.664  1.00 0.00 ? 44 GLU A OE2  8  
ATOM 9103  H H    . GLU A 1 44 ? -12.199 -7.007  -5.341  1.00 0.00 ? 44 GLU A H    8  
ATOM 9104  H HA   . GLU A 1 44 ? -12.978 -6.598  -8.102  1.00 0.00 ? 44 GLU A HA   8  
ATOM 9105  H HB2  . GLU A 1 44 ? -14.294 -7.981  -5.752  1.00 0.00 ? 44 GLU A HB2  8  
ATOM 9106  H HB3  . GLU A 1 44 ? -15.113 -7.826  -7.304  1.00 0.00 ? 44 GLU A HB3  8  
ATOM 9107  H HG2  . GLU A 1 44 ? -13.185 -8.931  -8.415  1.00 0.00 ? 44 GLU A HG2  8  
ATOM 9108  H HG3  . GLU A 1 44 ? -12.421 -9.145  -6.840  1.00 0.00 ? 44 GLU A HG3  8  
ATOM 9109  N N    . ASP A 1 45 ? -14.418 -4.828  -5.778  1.00 0.00 ? 45 ASP A N    8  
ATOM 9110  C CA   . ASP A 1 45 ? -15.321 -3.663  -5.563  1.00 0.00 ? 45 ASP A CA   8  
ATOM 9111  C C    . ASP A 1 45 ? -16.740 -4.049  -5.978  1.00 0.00 ? 45 ASP A C    8  
ATOM 9112  O O    . ASP A 1 45 ? -17.322 -3.462  -6.869  1.00 0.00 ? 45 ASP A O    8  
ATOM 9113  C CB   . ASP A 1 45 ? -14.842 -2.476  -6.403  1.00 0.00 ? 45 ASP A CB   8  
ATOM 9114  C CG   . ASP A 1 45 ? -15.579 -1.209  -5.965  1.00 0.00 ? 45 ASP A CG   8  
ATOM 9115  O OD1  . ASP A 1 45 ? -15.483 -0.865  -4.799  1.00 0.00 ? 45 ASP A OD1  8  
ATOM 9116  O OD2  . ASP A 1 45 ? -16.229 -0.606  -6.803  1.00 0.00 ? 45 ASP A OD2  8  
ATOM 9117  H H    . ASP A 1 45 ? -13.901 -5.197  -5.032  1.00 0.00 ? 45 ASP A H    8  
ATOM 9118  H HA   . ASP A 1 45 ? -15.314 -3.392  -4.518  1.00 0.00 ? 45 ASP A HA   8  
ATOM 9119  H HB2  . ASP A 1 45 ? -13.779 -2.341  -6.262  1.00 0.00 ? 45 ASP A HB2  8  
ATOM 9120  H HB3  . ASP A 1 45 ? -15.044 -2.664  -7.446  1.00 0.00 ? 45 ASP A HB3  8  
ATOM 9121  N N    . GLY A 1 46 ? -17.302 -5.036  -5.333  1.00 0.00 ? 46 GLY A N    8  
ATOM 9122  C CA   . GLY A 1 46 ? -18.687 -5.473  -5.676  1.00 0.00 ? 46 GLY A CA   8  
ATOM 9123  C C    . GLY A 1 46 ? -19.686 -4.704  -4.813  1.00 0.00 ? 46 GLY A C    8  
ATOM 9124  O O    . GLY A 1 46 ? -20.789 -5.152  -4.575  1.00 0.00 ? 46 GLY A O    8  
ATOM 9125  H H    . GLY A 1 46 ? -16.811 -5.487  -4.615  1.00 0.00 ? 46 GLY A H    8  
ATOM 9126  H HA2  . GLY A 1 46 ? -18.885 -5.278  -6.722  1.00 0.00 ? 46 GLY A HA2  8  
ATOM 9127  H HA3  . GLY A 1 46 ? -18.789 -6.530  -5.481  1.00 0.00 ? 46 GLY A HA3  8  
ATOM 9128  N N    . SER A 1 47 ? -19.309 -3.545  -4.343  1.00 0.00 ? 47 SER A N    8  
ATOM 9129  C CA   . SER A 1 47 ? -20.232 -2.740  -3.497  1.00 0.00 ? 47 SER A CA   8  
ATOM 9130  C C    . SER A 1 47 ? -19.575 -1.390  -3.199  1.00 0.00 ? 47 SER A C    8  
ATOM 9131  O O    . SER A 1 47 ? -19.720 -0.443  -3.945  1.00 0.00 ? 47 SER A O    8  
ATOM 9132  C CB   . SER A 1 47 ? -20.505 -3.477  -2.184  1.00 0.00 ? 47 SER A CB   8  
ATOM 9133  O OG   . SER A 1 47 ? -19.267 -3.843  -1.587  1.00 0.00 ? 47 SER A OG   8  
ATOM 9134  H H    . SER A 1 47 ? -18.417 -3.192  -4.548  1.00 0.00 ? 47 SER A H    8  
ATOM 9135  H HA   . SER A 1 47 ? -21.162 -2.581  -4.024  1.00 0.00 ? 47 SER A HA   8  
ATOM 9136  H HB2  . SER A 1 47 ? -21.047 -2.833  -1.513  1.00 0.00 ? 47 SER A HB2  8  
ATOM 9137  H HB3  . SER A 1 47 ? -21.095 -4.362  -2.385  1.00 0.00 ? 47 SER A HB3  8  
ATOM 9138  H HG   . SER A 1 47 ? -18.569 -3.358  -2.031  1.00 0.00 ? 47 SER A HG   8  
ATOM 9139  N N    . ASP A 1 48 ? -18.845 -1.298  -2.119  1.00 0.00 ? 48 ASP A N    8  
ATOM 9140  C CA   . ASP A 1 48 ? -18.172 -0.012  -1.777  1.00 0.00 ? 48 ASP A CA   8  
ATOM 9141  C C    . ASP A 1 48 ? -17.347 -0.202  -0.501  1.00 0.00 ? 48 ASP A C    8  
ATOM 9142  O O    . ASP A 1 48 ? -17.821 -0.743  0.478   1.00 0.00 ? 48 ASP A O    8  
ATOM 9143  C CB   . ASP A 1 48 ? -19.226 1.076   -1.546  1.00 0.00 ? 48 ASP A CB   8  
ATOM 9144  C CG   . ASP A 1 48 ? -20.360 0.515   -0.687  1.00 0.00 ? 48 ASP A CG   8  
ATOM 9145  O OD1  . ASP A 1 48 ? -20.258 0.603   0.526   1.00 0.00 ? 48 ASP A OD1  8  
ATOM 9146  O OD2  . ASP A 1 48 ? -21.313 0.010   -1.257  1.00 0.00 ? 48 ASP A OD2  8  
ATOM 9147  H H    . ASP A 1 48 ? -18.736 -2.074  -1.531  1.00 0.00 ? 48 ASP A H    8  
ATOM 9148  H HA   . ASP A 1 48 ? -17.521 0.280   -2.587  1.00 0.00 ? 48 ASP A HA   8  
ATOM 9149  H HB2  . ASP A 1 48 ? -18.771 1.915   -1.040  1.00 0.00 ? 48 ASP A HB2  8  
ATOM 9150  H HB3  . ASP A 1 48 ? -19.622 1.401   -2.496  1.00 0.00 ? 48 ASP A HB3  8  
ATOM 9151  N N    . CYS A 1 49 ? -16.114 0.243   -0.502  1.00 0.00 ? 49 CYS A N    8  
ATOM 9152  C CA   . CYS A 1 49 ? -15.250 0.096   0.713   1.00 0.00 ? 49 CYS A CA   8  
ATOM 9153  C C    . CYS A 1 49 ? -14.472 1.391   0.939   1.00 0.00 ? 49 CYS A C    8  
ATOM 9154  O O    . CYS A 1 49 ? -14.200 2.130   0.016   1.00 0.00 ? 49 CYS A O    8  
ATOM 9155  C CB   . CYS A 1 49 ? -14.261 -1.053  0.510   1.00 0.00 ? 49 CYS A CB   8  
ATOM 9156  S SG   . CYS A 1 49 ? -13.042 -1.029  1.849   1.00 0.00 ? 49 CYS A SG   8  
ATOM 9157  H H    . CYS A 1 49 ? -15.754 0.680   -1.304  1.00 0.00 ? 49 CYS A H    8  
ATOM 9158  H HA   . CYS A 1 49 ? -15.862 -0.106  1.582   1.00 0.00 ? 49 CYS A HA   8  
ATOM 9159  H HB2  . CYS A 1 49 ? -14.792 -1.993  0.522   1.00 0.00 ? 49 CYS A HB2  8  
ATOM 9160  H HB3  . CYS A 1 49 ? -13.758 -0.934  -0.438  1.00 0.00 ? 49 CYS A HB3  8  
ATOM 9161  N N    . GLY A 1 50 ? -14.105 1.663   2.164   1.00 0.00 ? 50 GLY A N    8  
ATOM 9162  C CA   . GLY A 1 50 ? -13.333 2.915   2.460   1.00 0.00 ? 50 GLY A CA   8  
ATOM 9163  C C    . GLY A 1 50 ? -13.951 4.092   1.701   1.00 0.00 ? 50 GLY A C    8  
ATOM 9164  O O    . GLY A 1 50 ? -13.255 4.923   1.157   1.00 0.00 ? 50 GLY A O    8  
ATOM 9165  H H    . GLY A 1 50 ? -14.332 1.034   2.885   1.00 0.00 ? 50 GLY A H    8  
ATOM 9166  H HA2  . GLY A 1 50 ? -13.359 3.120   3.524   1.00 0.00 ? 50 GLY A HA2  8  
ATOM 9167  H HA3  . GLY A 1 50 ? -12.307 2.790   2.145   1.00 0.00 ? 50 GLY A HA3  8  
ATOM 9168  N N    . ASP A 1 51 ? -15.256 4.155   1.657   1.00 0.00 ? 51 ASP A N    8  
ATOM 9169  C CA   . ASP A 1 51 ? -15.942 5.265   0.931   1.00 0.00 ? 51 ASP A CA   8  
ATOM 9170  C C    . ASP A 1 51 ? -15.758 5.079   -0.580  1.00 0.00 ? 51 ASP A C    8  
ATOM 9171  O O    . ASP A 1 51 ? -16.437 5.698   -1.374  1.00 0.00 ? 51 ASP A O    8  
ATOM 9172  C CB   . ASP A 1 51 ? -15.357 6.620   1.370   1.00 0.00 ? 51 ASP A CB   8  
ATOM 9173  C CG   . ASP A 1 51 ? -16.398 7.726   1.164   1.00 0.00 ? 51 ASP A CG   8  
ATOM 9174  O OD1  . ASP A 1 51 ? -17.229 7.900   2.041   1.00 0.00 ? 51 ASP A OD1  8  
ATOM 9175  O OD2  . ASP A 1 51 ? -16.346 8.378   0.134   1.00 0.00 ? 51 ASP A OD2  8  
ATOM 9176  H H    . ASP A 1 51 ? -15.789 3.464   2.101   1.00 0.00 ? 51 ASP A H    8  
ATOM 9177  H HA   . ASP A 1 51 ? -16.996 5.233   1.165   1.00 0.00 ? 51 ASP A HA   8  
ATOM 9178  H HB2  . ASP A 1 51 ? -15.089 6.573   2.415   1.00 0.00 ? 51 ASP A HB2  8  
ATOM 9179  H HB3  . ASP A 1 51 ? -14.479 6.850   0.785   1.00 0.00 ? 51 ASP A HB3  8  
ATOM 9180  N N    . ALA A 1 52 ? -14.852 4.224   -0.981  1.00 0.00 ? 52 ALA A N    8  
ATOM 9181  C CA   . ALA A 1 52 ? -14.624 3.986   -2.438  1.00 0.00 ? 52 ALA A CA   8  
ATOM 9182  C C    . ALA A 1 52 ? -13.290 3.255   -2.596  1.00 0.00 ? 52 ALA A C    8  
ATOM 9183  O O    . ALA A 1 52 ? -13.140 2.374   -3.417  1.00 0.00 ? 52 ALA A O    8  
ATOM 9184  C CB   . ALA A 1 52 ? -14.579 5.331   -3.188  1.00 0.00 ? 52 ALA A CB   8  
ATOM 9185  H H    . ALA A 1 52 ? -14.318 3.725   -0.321  1.00 0.00 ? 52 ALA A H    8  
ATOM 9186  H HA   . ALA A 1 52 ? -15.420 3.372   -2.833  1.00 0.00 ? 52 ALA A HA   8  
ATOM 9187  H HB1  . ALA A 1 52 ? -14.222 6.102   -2.522  1.00 0.00 ? 52 ALA A HB1  8  
ATOM 9188  H HB2  . ALA A 1 52 ? -15.571 5.586   -3.532  1.00 0.00 ? 52 ALA A HB2  8  
ATOM 9189  H HB3  . ALA A 1 52 ? -13.917 5.258   -4.040  1.00 0.00 ? 52 ALA A HB3  8  
ATOM 9190  N N    . ASP A 1 53 ? -12.329 3.624   -1.800  1.00 0.00 ? 53 ASP A N    8  
ATOM 9191  C CA   . ASP A 1 53 ? -10.994 2.974   -1.866  1.00 0.00 ? 53 ASP A CA   8  
ATOM 9192  C C    . ASP A 1 53 ? -10.074 3.670   -0.859  1.00 0.00 ? 53 ASP A C    8  
ATOM 9193  O O    . ASP A 1 53 ? -9.985  4.882   -0.829  1.00 0.00 ? 53 ASP A O    8  
ATOM 9194  C CB   . ASP A 1 53 ? -10.417 3.113   -3.278  1.00 0.00 ? 53 ASP A CB   8  
ATOM 9195  C CG   . ASP A 1 53 ? -10.741 4.504   -3.823  1.00 0.00 ? 53 ASP A CG   8  
ATOM 9196  O OD1  . ASP A 1 53 ? -10.033 5.433   -3.471  1.00 0.00 ? 53 ASP A OD1  8  
ATOM 9197  O OD2  . ASP A 1 53 ? -11.690 4.616   -4.578  1.00 0.00 ? 53 ASP A OD2  8  
ATOM 9198  H H    . ASP A 1 53 ? -12.489 4.336   -1.146  1.00 0.00 ? 53 ASP A H    8  
ATOM 9199  H HA   . ASP A 1 53 ? -11.091 1.928   -1.613  1.00 0.00 ? 53 ASP A HA   8  
ATOM 9200  H HB2  . ASP A 1 53 ? -9.345  2.976   -3.248  1.00 0.00 ? 53 ASP A HB2  8  
ATOM 9201  H HB3  . ASP A 1 53 ? -10.855 2.366   -3.923  1.00 0.00 ? 53 ASP A HB3  8  
ATOM 9202  N N    . PHE A 1 54 ? -9.404  2.927   -0.025  1.00 0.00 ? 54 PHE A N    8  
ATOM 9203  C CA   . PHE A 1 54 ? -8.509  3.569   0.987   1.00 0.00 ? 54 PHE A CA   8  
ATOM 9204  C C    . PHE A 1 54 ? -7.415  4.415   0.300   1.00 0.00 ? 54 PHE A C    8  
ATOM 9205  O O    . PHE A 1 54 ? -6.441  4.784   0.925   1.00 0.00 ? 54 PHE A O    8  
ATOM 9206  C CB   . PHE A 1 54 ? -7.877  2.467   1.878   1.00 0.00 ? 54 PHE A CB   8  
ATOM 9207  C CG   . PHE A 1 54 ? -6.494  2.080   1.378   1.00 0.00 ? 54 PHE A CG   8  
ATOM 9208  C CD1  . PHE A 1 54 ? -6.296  1.783   0.024   1.00 0.00 ? 54 PHE A CD1  8  
ATOM 9209  C CD2  . PHE A 1 54 ? -5.413  2.030   2.270   1.00 0.00 ? 54 PHE A CD2  8  
ATOM 9210  C CE1  . PHE A 1 54 ? -5.019  1.437   -0.438  1.00 0.00 ? 54 PHE A CE1  8  
ATOM 9211  C CE2  . PHE A 1 54 ? -4.138  1.685   1.807   1.00 0.00 ? 54 PHE A CE2  8  
ATOM 9212  C CZ   . PHE A 1 54 ? -3.941  1.389   0.453   1.00 0.00 ? 54 PHE A CZ   8  
ATOM 9213  H H    . PHE A 1 54 ? -9.501  1.949   -0.050  1.00 0.00 ? 54 PHE A H    8  
ATOM 9214  H HA   . PHE A 1 54 ? -9.109  4.220   1.608   1.00 0.00 ? 54 PHE A HA   8  
ATOM 9215  H HB2  . PHE A 1 54 ? -7.799  2.829   2.894   1.00 0.00 ? 54 PHE A HB2  8  
ATOM 9216  H HB3  . PHE A 1 54 ? -8.516  1.596   1.863   1.00 0.00 ? 54 PHE A HB3  8  
ATOM 9217  H HD1  . PHE A 1 54 ? -7.127  1.821   -0.664  1.00 0.00 ? 54 PHE A HD1  8  
ATOM 9218  H HD2  . PHE A 1 54 ? -5.564  2.259   3.315   1.00 0.00 ? 54 PHE A HD2  8  
ATOM 9219  H HE1  . PHE A 1 54 ? -4.867  1.209   -1.482  1.00 0.00 ? 54 PHE A HE1  8  
ATOM 9220  H HE2  . PHE A 1 54 ? -3.305  1.648   2.493   1.00 0.00 ? 54 PHE A HE2  8  
ATOM 9221  H HZ   . PHE A 1 54 ? -2.957  1.123   0.096   1.00 0.00 ? 54 PHE A HZ   8  
ATOM 9222  N N    . ASP A 1 55 ? -7.556  4.721   -0.965  1.00 0.00 ? 55 ASP A N    8  
ATOM 9223  C CA   . ASP A 1 55 ? -6.512  5.535   -1.659  1.00 0.00 ? 55 ASP A CA   8  
ATOM 9224  C C    . ASP A 1 55 ? -5.178  4.780   -1.646  1.00 0.00 ? 55 ASP A C    8  
ATOM 9225  O O    . ASP A 1 55 ? -4.813  4.160   -0.668  1.00 0.00 ? 55 ASP A O    8  
ATOM 9226  C CB   . ASP A 1 55 ? -6.347  6.888   -0.950  1.00 0.00 ? 55 ASP A CB   8  
ATOM 9227  C CG   . ASP A 1 55 ? -5.674  7.888   -1.895  1.00 0.00 ? 55 ASP A CG   8  
ATOM 9228  O OD1  . ASP A 1 55 ? -6.084  7.957   -3.042  1.00 0.00 ? 55 ASP A OD1  8  
ATOM 9229  O OD2  . ASP A 1 55 ? -4.760  8.565   -1.455  1.00 0.00 ? 55 ASP A OD2  8  
ATOM 9230  H H    . ASP A 1 55 ? -8.341  4.416   -1.462  1.00 0.00 ? 55 ASP A H    8  
ATOM 9231  H HA   . ASP A 1 55 ? -6.816  5.700   -2.683  1.00 0.00 ? 55 ASP A HA   8  
ATOM 9232  H HB2  . ASP A 1 55 ? -7.319  7.263   -0.662  1.00 0.00 ? 55 ASP A HB2  8  
ATOM 9233  H HB3  . ASP A 1 55 ? -5.735  6.765   -0.069  1.00 0.00 ? 55 ASP A HB3  8  
ATOM 9234  N N    . TRP A 1 56 ? -4.450  4.826   -2.733  1.00 0.00 ? 56 TRP A N    8  
ATOM 9235  C CA   . TRP A 1 56 ? -3.133  4.115   -2.806  1.00 0.00 ? 56 TRP A CA   8  
ATOM 9236  C C    . TRP A 1 56 ? -2.005  5.133   -2.574  1.00 0.00 ? 56 TRP A C    8  
ATOM 9237  O O    . TRP A 1 56 ? -2.150  6.057   -1.800  1.00 0.00 ? 56 TRP A O    8  
ATOM 9238  C CB   . TRP A 1 56 ? -2.981  3.458   -4.202  1.00 0.00 ? 56 TRP A CB   8  
ATOM 9239  C CG   . TRP A 1 56 ? -4.330  3.236   -4.809  1.00 0.00 ? 56 TRP A CG   8  
ATOM 9240  C CD1  . TRP A 1 56 ? -4.950  2.038   -4.919  1.00 0.00 ? 56 TRP A CD1  8  
ATOM 9241  C CD2  . TRP A 1 56 ? -5.233  4.219   -5.392  1.00 0.00 ? 56 TRP A CD2  8  
ATOM 9242  N NE1  . TRP A 1 56 ? -6.176  2.226   -5.533  1.00 0.00 ? 56 TRP A NE1  8  
ATOM 9243  C CE2  . TRP A 1 56 ? -6.396  3.553   -5.843  1.00 0.00 ? 56 TRP A CE2  8  
ATOM 9244  C CE3  . TRP A 1 56 ? -5.155  5.613   -5.571  1.00 0.00 ? 56 TRP A CE3  8  
ATOM 9245  C CZ2  . TRP A 1 56 ? -7.445  4.243   -6.452  1.00 0.00 ? 56 TRP A CZ2  8  
ATOM 9246  C CZ3  . TRP A 1 56 ? -6.209  6.310   -6.183  1.00 0.00 ? 56 TRP A CZ3  8  
ATOM 9247  C CH2  . TRP A 1 56 ? -7.352  5.627   -6.622  1.00 0.00 ? 56 TRP A CH2  8  
ATOM 9248  H H    . TRP A 1 56 ? -4.770  5.332   -3.509  1.00 0.00 ? 56 TRP A H    8  
ATOM 9249  H HA   . TRP A 1 56 ? -3.086  3.350   -2.040  1.00 0.00 ? 56 TRP A HA   8  
ATOM 9250  H HB2  . TRP A 1 56 ? -2.410  4.101   -4.857  1.00 0.00 ? 56 TRP A HB2  8  
ATOM 9251  H HB3  . TRP A 1 56 ? -2.473  2.509   -4.103  1.00 0.00 ? 56 TRP A HB3  8  
ATOM 9252  H HD1  . TRP A 1 56 ? -4.554  1.092   -4.582  1.00 0.00 ? 56 TRP A HD1  8  
ATOM 9253  H HE1  . TRP A 1 56 ? -6.822  1.517   -5.731  1.00 0.00 ? 56 TRP A HE1  8  
ATOM 9254  H HE3  . TRP A 1 56 ? -4.280  6.148   -5.236  1.00 0.00 ? 56 TRP A HE3  8  
ATOM 9255  H HZ2  . TRP A 1 56 ? -8.323  3.711   -6.788  1.00 0.00 ? 56 TRP A HZ2  8  
ATOM 9256  H HZ3  . TRP A 1 56 ? -6.140  7.380   -6.316  1.00 0.00 ? 56 TRP A HZ3  8  
ATOM 9257  H HH2  . TRP A 1 56 ? -8.158  6.169   -7.093  1.00 0.00 ? 56 TRP A HH2  8  
ATOM 9258  N N    . HIS A 1 57 ? -0.893  4.968   -3.253  1.00 0.00 ? 57 HIS A N    8  
ATOM 9259  C CA   . HIS A 1 57 ? 0.257   5.922   -3.110  1.00 0.00 ? 57 HIS A CA   8  
ATOM 9260  C C    . HIS A 1 57 ? 1.109   5.554   -1.888  1.00 0.00 ? 57 HIS A C    8  
ATOM 9261  O O    . HIS A 1 57 ? 0.825   4.613   -1.174  1.00 0.00 ? 57 HIS A O    8  
ATOM 9262  C CB   . HIS A 1 57 ? -0.265  7.371   -2.959  1.00 0.00 ? 57 HIS A CB   8  
ATOM 9263  C CG   . HIS A 1 57 ? 0.717   8.346   -3.564  1.00 0.00 ? 57 HIS A CG   8  
ATOM 9264  N ND1  . HIS A 1 57 ? 1.328   9.340   -2.816  1.00 0.00 ? 57 HIS A ND1  8  
ATOM 9265  C CD2  . HIS A 1 57 ? 1.200   8.486   -4.841  1.00 0.00 ? 57 HIS A CD2  8  
ATOM 9266  C CE1  . HIS A 1 57 ? 2.138   10.028  -3.642  1.00 0.00 ? 57 HIS A CE1  8  
ATOM 9267  N NE2  . HIS A 1 57 ? 2.099   9.548   -4.888  1.00 0.00 ? 57 HIS A NE2  8  
ATOM 9268  H H    . HIS A 1 57 ? -0.818  4.210   -3.876  1.00 0.00 ? 57 HIS A H    8  
ATOM 9269  H HA   . HIS A 1 57 ? 0.867   5.855   -4.000  1.00 0.00 ? 57 HIS A HA   8  
ATOM 9270  H HB2  . HIS A 1 57 ? -1.212  7.461   -3.464  1.00 0.00 ? 57 HIS A HB2  8  
ATOM 9271  H HB3  . HIS A 1 57 ? -0.400  7.607   -1.912  1.00 0.00 ? 57 HIS A HB3  8  
ATOM 9272  H HD1  . HIS A 1 57 ? 1.193   9.513   -1.862  1.00 0.00 ? 57 HIS A HD1  8  
ATOM 9273  H HD2  . HIS A 1 57 ? 0.925   7.867   -5.682  1.00 0.00 ? 57 HIS A HD2  8  
ATOM 9274  H HE1  . HIS A 1 57 ? 2.748   10.864  -3.334  1.00 0.00 ? 57 HIS A HE1  8  
ATOM 9275  N N    . HIS A 1 58 ? 2.148   6.310   -1.647  1.00 0.00 ? 58 HIS A N    8  
ATOM 9276  C CA   . HIS A 1 58 ? 3.033   6.044   -0.474  1.00 0.00 ? 58 HIS A CA   8  
ATOM 9277  C C    . HIS A 1 58 ? 3.624   4.636   -0.557  1.00 0.00 ? 58 HIS A C    8  
ATOM 9278  O O    . HIS A 1 58 ? 3.178   3.806   -1.323  1.00 0.00 ? 58 HIS A O    8  
ATOM 9279  C CB   . HIS A 1 58 ? 2.221   6.179   0.817   1.00 0.00 ? 58 HIS A CB   8  
ATOM 9280  C CG   . HIS A 1 58 ? 3.154   6.269   1.993   1.00 0.00 ? 58 HIS A CG   8  
ATOM 9281  N ND1  . HIS A 1 58 ? 3.907   7.403   2.254   1.00 0.00 ? 58 HIS A ND1  8  
ATOM 9282  C CD2  . HIS A 1 58 ? 3.468   5.375   2.987   1.00 0.00 ? 58 HIS A CD2  8  
ATOM 9283  C CE1  . HIS A 1 58 ? 4.630   7.163   3.363   1.00 0.00 ? 58 HIS A CE1  8  
ATOM 9284  N NE2  . HIS A 1 58 ? 4.400   5.942   3.851   1.00 0.00 ? 58 HIS A NE2  8  
ATOM 9285  H H    . HIS A 1 58 ? 2.345   7.066   -2.240  1.00 0.00 ? 58 HIS A H    8  
ATOM 9286  H HA   . HIS A 1 58 ? 3.836   6.766   -0.466  1.00 0.00 ? 58 HIS A HA   8  
ATOM 9287  H HB2  . HIS A 1 58 ? 1.615   7.073   0.769   1.00 0.00 ? 58 HIS A HB2  8  
ATOM 9288  H HB3  . HIS A 1 58 ? 1.582   5.317   0.933   1.00 0.00 ? 58 HIS A HB3  8  
ATOM 9289  H HD1  . HIS A 1 58 ? 3.913   8.229   1.726   1.00 0.00 ? 58 HIS A HD1  8  
ATOM 9290  H HD2  . HIS A 1 58 ? 3.054   4.381   3.082   1.00 0.00 ? 58 HIS A HD2  8  
ATOM 9291  H HE1  . HIS A 1 58 ? 5.314   7.873   3.807   1.00 0.00 ? 58 HIS A HE1  8  
ATOM 9292  N N    . THR A 1 59 ? 4.632   4.375   0.236   1.00 0.00 ? 59 THR A N    8  
ATOM 9293  C CA   . THR A 1 59 ? 5.284   3.030   0.240   1.00 0.00 ? 59 THR A CA   8  
ATOM 9294  C C    . THR A 1 59 ? 6.136   2.857   -1.023  1.00 0.00 ? 59 THR A C    8  
ATOM 9295  O O    . THR A 1 59 ? 5.879   1.997   -1.838  1.00 0.00 ? 59 THR A O    8  
ATOM 9296  C CB   . THR A 1 59 ? 4.211   1.926   0.310   1.00 0.00 ? 59 THR A CB   8  
ATOM 9297  O OG1  . THR A 1 59 ? 3.125   2.376   1.106   1.00 0.00 ? 59 THR A OG1  8  
ATOM 9298  C CG2  . THR A 1 59 ? 4.806   0.657   0.930   1.00 0.00 ? 59 THR A CG2  8  
ATOM 9299  H H    . THR A 1 59 ? 4.963   5.073   0.837   1.00 0.00 ? 59 THR A H    8  
ATOM 9300  H HA   . THR A 1 59 ? 5.926   2.960   1.108   1.00 0.00 ? 59 THR A HA   8  
ATOM 9301  H HB   . THR A 1 59 ? 3.855   1.695   -0.683  1.00 0.00 ? 59 THR A HB   8  
ATOM 9302  H HG1  . THR A 1 59 ? 2.656   3.053   0.614   1.00 0.00 ? 59 THR A HG1  8  
ATOM 9303  H HG21 . THR A 1 59 ? 5.608   0.294   0.305   1.00 0.00 ? 59 THR A HG21 8  
ATOM 9304  H HG22 . THR A 1 59 ? 4.040   -0.099  1.008   1.00 0.00 ? 59 THR A HG22 8  
ATOM 9305  H HG23 . THR A 1 59 ? 5.190   0.884   1.914   1.00 0.00 ? 59 THR A HG23 8  
ATOM 9306  N N    . PHE A 1 60 ? 7.153   3.663   -1.182  1.00 0.00 ? 60 PHE A N    8  
ATOM 9307  C CA   . PHE A 1 60 ? 8.027   3.537   -2.386  1.00 0.00 ? 60 PHE A CA   8  
ATOM 9308  C C    . PHE A 1 60 ? 8.841   2.224   -2.272  1.00 0.00 ? 60 PHE A C    8  
ATOM 9309  O O    . PHE A 1 60 ? 9.623   2.097   -1.350  1.00 0.00 ? 60 PHE A O    8  
ATOM 9310  C CB   . PHE A 1 60 ? 8.990   4.725   -2.424  1.00 0.00 ? 60 PHE A CB   8  
ATOM 9311  C CG   . PHE A 1 60 ? 8.199   6.004   -2.567  1.00 0.00 ? 60 PHE A CG   8  
ATOM 9312  C CD1  . PHE A 1 60 ? 7.824   6.457   -3.838  1.00 0.00 ? 60 PHE A CD1  8  
ATOM 9313  C CD2  . PHE A 1 60 ? 7.838   6.736   -1.429  1.00 0.00 ? 60 PHE A CD2  8  
ATOM 9314  C CE1  . PHE A 1 60 ? 7.089   7.642   -3.969  1.00 0.00 ? 60 PHE A CE1  8  
ATOM 9315  C CE2  . PHE A 1 60 ? 7.102   7.920   -1.561  1.00 0.00 ? 60 PHE A CE2  8  
ATOM 9316  C CZ   . PHE A 1 60 ? 6.728   8.373   -2.830  1.00 0.00 ? 60 PHE A CZ   8  
ATOM 9317  H H    . PHE A 1 60 ? 7.348   4.346   -0.509  1.00 0.00 ? 60 PHE A H    8  
ATOM 9318  H HA   . PHE A 1 60 ? 7.416   3.551   -3.266  1.00 0.00 ? 60 PHE A HA   8  
ATOM 9319  H HB2  . PHE A 1 60 ? 9.562   4.755   -1.508  1.00 0.00 ? 60 PHE A HB2  8  
ATOM 9320  H HB3  . PHE A 1 60 ? 9.658   4.620   -3.265  1.00 0.00 ? 60 PHE A HB3  8  
ATOM 9321  H HD1  . PHE A 1 60 ? 8.102   5.894   -4.716  1.00 0.00 ? 60 PHE A HD1  8  
ATOM 9322  H HD2  . PHE A 1 60 ? 8.127   6.386   -0.448  1.00 0.00 ? 60 PHE A HD2  8  
ATOM 9323  H HE1  . PHE A 1 60 ? 6.800   7.992   -4.950  1.00 0.00 ? 60 PHE A HE1  8  
ATOM 9324  H HE2  . PHE A 1 60 ? 6.824   8.484   -0.683  1.00 0.00 ? 60 PHE A HE2  8  
ATOM 9325  H HZ   . PHE A 1 60 ? 6.160   9.286   -2.934  1.00 0.00 ? 60 PHE A HZ   8  
ATOM 9326  N N    . PRO A 1 61 ? 8.648   1.265   -3.171  1.00 0.00 ? 61 PRO A N    8  
ATOM 9327  C CA   . PRO A 1 61 ? 9.388   -0.011  -3.082  1.00 0.00 ? 61 PRO A CA   8  
ATOM 9328  C C    . PRO A 1 61 ? 10.894  0.198   -3.292  1.00 0.00 ? 61 PRO A C    8  
ATOM 9329  O O    . PRO A 1 61 ? 11.593  -0.737  -3.623  1.00 0.00 ? 61 PRO A O    8  
ATOM 9330  C CB   . PRO A 1 61 ? 8.800   -0.898  -4.207  1.00 0.00 ? 61 PRO A CB   8  
ATOM 9331  C CG   . PRO A 1 61 ? 7.819   -0.017  -5.031  1.00 0.00 ? 61 PRO A CG   8  
ATOM 9332  C CD   . PRO A 1 61 ? 7.710   1.350   -4.318  1.00 0.00 ? 61 PRO A CD   8  
ATOM 9333  H HA   . PRO A 1 61 ? 9.212   -0.474  -2.123  1.00 0.00 ? 61 PRO A HA   8  
ATOM 9334  H HB2  . PRO A 1 61 ? 9.590   -1.274  -4.848  1.00 0.00 ? 61 PRO A HB2  8  
ATOM 9335  H HB3  . PRO A 1 61 ? 8.263   -1.731  -3.776  1.00 0.00 ? 61 PRO A HB3  8  
ATOM 9336  H HG2  . PRO A 1 61 ? 8.201   0.117   -6.036  1.00 0.00 ? 61 PRO A HG2  8  
ATOM 9337  H HG3  . PRO A 1 61 ? 6.845   -0.487  -5.073  1.00 0.00 ? 61 PRO A HG3  8  
ATOM 9338  H HD2  . PRO A 1 61 ? 8.004   2.147   -4.990  1.00 0.00 ? 61 PRO A HD2  8  
ATOM 9339  H HD3  . PRO A 1 61 ? 6.704   1.505   -3.964  1.00 0.00 ? 61 PRO A HD3  8  
ATOM 9340  N N    . SER A 1 62 ? 11.392  1.406   -3.142  1.00 0.00 ? 62 SER A N    8  
ATOM 9341  C CA   . SER A 1 62 ? 12.852  1.686   -3.360  1.00 0.00 ? 62 SER A CA   8  
ATOM 9342  C C    . SER A 1 62 ? 13.083  2.058   -4.830  1.00 0.00 ? 62 SER A C    8  
ATOM 9343  O O    . SER A 1 62 ? 14.032  2.739   -5.161  1.00 0.00 ? 62 SER A O    8  
ATOM 9344  C CB   . SER A 1 62 ? 13.725  0.480   -2.980  1.00 0.00 ? 62 SER A CB   8  
ATOM 9345  O OG   . SER A 1 62 ? 13.856  -0.382  -4.104  1.00 0.00 ? 62 SER A OG   8  
ATOM 9346  H H    . SER A 1 62 ? 10.820  2.166   -2.916  1.00 0.00 ? 62 SER A H    8  
ATOM 9347  H HA   . SER A 1 62 ? 13.133  2.532   -2.744  1.00 0.00 ? 62 SER A HA   8  
ATOM 9348  H HB2  . SER A 1 62 ? 14.704  0.820   -2.683  1.00 0.00 ? 62 SER A HB2  8  
ATOM 9349  H HB3  . SER A 1 62 ? 13.269  -0.051  -2.155  1.00 0.00 ? 62 SER A HB3  8  
ATOM 9350  H HG   . SER A 1 62 ? 14.420  0.053   -4.747  1.00 0.00 ? 62 SER A HG   8  
ATOM 9351  N N    . ARG A 1 63 ? 12.227  1.619   -5.715  1.00 0.00 ? 63 ARG A N    8  
ATOM 9352  C CA   . ARG A 1 63 ? 12.409  1.955   -7.160  1.00 0.00 ? 63 ARG A CA   8  
ATOM 9353  C C    . ARG A 1 63 ? 11.929  3.388   -7.430  1.00 0.00 ? 63 ARG A C    8  
ATOM 9354  O O    . ARG A 1 63 ? 12.233  3.970   -8.453  1.00 0.00 ? 63 ARG A O    8  
ATOM 9355  C CB   . ARG A 1 63 ? 11.610  0.970   -8.022  1.00 0.00 ? 63 ARG A CB   8  
ATOM 9356  C CG   . ARG A 1 63 ? 12.087  1.056   -9.475  1.00 0.00 ? 63 ARG A CG   8  
ATOM 9357  C CD   . ARG A 1 63 ? 11.239  0.131   -10.348 1.00 0.00 ? 63 ARG A CD   8  
ATOM 9358  N NE   . ARG A 1 63 ? 9.853   0.672   -10.442 1.00 0.00 ? 63 ARG A NE   8  
ATOM 9359  C CZ   . ARG A 1 63 ? 9.038   0.224   -11.358 1.00 0.00 ? 63 ARG A CZ   8  
ATOM 9360  N NH1  . ARG A 1 63 ? 9.436   -0.696  -12.193 1.00 0.00 ? 63 ARG A NH1  8  
ATOM 9361  N NH2  . ARG A 1 63 ? 7.825   0.697   -11.440 1.00 0.00 ? 63 ARG A NH2  8  
ATOM 9362  H H    . ARG A 1 63 ? 11.469  1.064   -5.434  1.00 0.00 ? 63 ARG A H    8  
ATOM 9363  H HA   . ARG A 1 63 ? 13.458  1.879   -7.412  1.00 0.00 ? 63 ARG A HA   8  
ATOM 9364  H HB2  . ARG A 1 63 ? 11.761  -0.035  -7.654  1.00 0.00 ? 63 ARG A HB2  8  
ATOM 9365  H HB3  . ARG A 1 63 ? 10.560  1.215   -7.977  1.00 0.00 ? 63 ARG A HB3  8  
ATOM 9366  H HG2  . ARG A 1 63 ? 11.989  2.073   -9.825  1.00 0.00 ? 63 ARG A HG2  8  
ATOM 9367  H HG3  . ARG A 1 63 ? 13.122  0.754   -9.533  1.00 0.00 ? 63 ARG A HG3  8  
ATOM 9368  H HD2  . ARG A 1 63 ? 11.670  0.072   -11.336 1.00 0.00 ? 63 ARG A HD2  8  
ATOM 9369  H HD3  . ARG A 1 63 ? 11.211  -0.855  -9.907  1.00 0.00 ? 63 ARG A HD3  8  
ATOM 9370  H HE   . ARG A 1 63 ? 9.553   1.364   -9.816  1.00 0.00 ? 63 ARG A HE   8  
ATOM 9371  H HH11 . ARG A 1 63 ? 10.366  -1.059  -12.130 1.00 0.00 ? 63 ARG A HH11 8  
ATOM 9372  H HH12 . ARG A 1 63 ? 8.812   -1.039  -12.894 1.00 0.00 ? 63 ARG A HH12 8  
ATOM 9373  H HH21 . ARG A 1 63 ? 7.519   1.402   -10.801 1.00 0.00 ? 63 ARG A HH21 8  
ATOM 9374  H HH22 . ARG A 1 63 ? 7.201   0.354   -12.142 1.00 0.00 ? 63 ARG A HH22 8  
ATOM 9375  N N    . GLY A 1 64 ? 11.189  3.966   -6.523  1.00 0.00 ? 64 GLY A N    8  
ATOM 9376  C CA   . GLY A 1 64 ? 10.700  5.359   -6.730  1.00 0.00 ? 64 GLY A CA   8  
ATOM 9377  C C    . GLY A 1 64 ? 9.499   5.359   -7.679  1.00 0.00 ? 64 GLY A C    8  
ATOM 9378  O O    . GLY A 1 64 ? 9.270   4.416   -8.409  1.00 0.00 ? 64 GLY A O    8  
ATOM 9379  H H    . GLY A 1 64 ? 10.959  3.489   -5.704  1.00 0.00 ? 64 GLY A H    8  
ATOM 9380  H HA2  . GLY A 1 64 ? 10.409  5.782   -5.778  1.00 0.00 ? 64 GLY A HA2  8  
ATOM 9381  H HA3  . GLY A 1 64 ? 11.491  5.956   -7.159  1.00 0.00 ? 64 GLY A HA3  8  
ATOM 9382  N N    . ASN A 1 65 ? 8.734   6.418   -7.674  1.00 0.00 ? 65 ASN A N    8  
ATOM 9383  C CA   . ASN A 1 65 ? 7.548   6.501   -8.575  1.00 0.00 ? 65 ASN A CA   8  
ATOM 9384  C C    . ASN A 1 65 ? 6.633   5.292   -8.360  1.00 0.00 ? 65 ASN A C    8  
ATOM 9385  O O    . ASN A 1 65 ? 6.888   4.211   -8.853  1.00 0.00 ? 65 ASN A O    8  
ATOM 9386  C CB   . ASN A 1 65 ? 8.018   6.528   -10.032 1.00 0.00 ? 65 ASN A CB   8  
ATOM 9387  C CG   . ASN A 1 65 ? 6.823   6.802   -10.948 1.00 0.00 ? 65 ASN A CG   8  
ATOM 9388  O OD1  . ASN A 1 65 ? 6.565   7.934   -11.306 1.00 0.00 ? 65 ASN A OD1  8  
ATOM 9389  N ND2  . ASN A 1 65 ? 6.079   5.806   -11.344 1.00 0.00 ? 65 ASN A ND2  8  
ATOM 9390  H H    . ASN A 1 65 ? 8.944   7.167   -7.077  1.00 0.00 ? 65 ASN A H    8  
ATOM 9391  H HA   . ASN A 1 65 ? 6.999   7.405   -8.361  1.00 0.00 ? 65 ASN A HA   8  
ATOM 9392  H HB2  . ASN A 1 65 ? 8.755   7.307   -10.158 1.00 0.00 ? 65 ASN A HB2  8  
ATOM 9393  H HB3  . ASN A 1 65 ? 8.453   5.575   -10.290 1.00 0.00 ? 65 ASN A HB3  8  
ATOM 9394  H HD21 . ASN A 1 65 ? 6.287   4.893   -11.054 1.00 0.00 ? 65 ASN A HD21 8  
ATOM 9395  H HD22 . ASN A 1 65 ? 5.311   5.971   -11.930 1.00 0.00 ? 65 ASN A HD22 8  
ATOM 9396  N N    . LEU A 1 66 ? 5.557   5.471   -7.637  1.00 0.00 ? 66 LEU A N    8  
ATOM 9397  C CA   . LEU A 1 66 ? 4.610   4.339   -7.401  1.00 0.00 ? 66 LEU A CA   8  
ATOM 9398  C C    . LEU A 1 66 ? 3.562   4.337   -8.518  1.00 0.00 ? 66 LEU A C    8  
ATOM 9399  O O    . LEU A 1 66 ? 2.749   5.235   -8.618  1.00 0.00 ? 66 LEU A O    8  
ATOM 9400  C CB   . LEU A 1 66 ? 3.921   4.521   -6.039  1.00 0.00 ? 66 LEU A CB   8  
ATOM 9401  C CG   . LEU A 1 66 ? 3.291   3.188   -5.574  1.00 0.00 ? 66 LEU A CG   8  
ATOM 9402  C CD1  . LEU A 1 66 ? 4.343   2.314   -4.879  1.00 0.00 ? 66 LEU A CD1  8  
ATOM 9403  C CD2  . LEU A 1 66 ? 2.155   3.470   -4.586  1.00 0.00 ? 66 LEU A CD2  8  
ATOM 9404  H H    . LEU A 1 66 ? 5.366   6.353   -7.258  1.00 0.00 ? 66 LEU A H    8  
ATOM 9405  H HA   . LEU A 1 66 ? 5.150   3.403   -7.415  1.00 0.00 ? 66 LEU A HA   8  
ATOM 9406  H HB2  . LEU A 1 66 ? 4.650   4.851   -5.313  1.00 0.00 ? 66 LEU A HB2  8  
ATOM 9407  H HB3  . LEU A 1 66 ? 3.148   5.271   -6.131  1.00 0.00 ? 66 LEU A HB3  8  
ATOM 9408  H HG   . LEU A 1 66 ? 2.895   2.660   -6.429  1.00 0.00 ? 66 LEU A HG   8  
ATOM 9409  H HD11 . LEU A 1 66 ? 3.860   1.447   -4.451  1.00 0.00 ? 66 LEU A HD11 8  
ATOM 9410  H HD12 . LEU A 1 66 ? 4.821   2.880   -4.093  1.00 0.00 ? 66 LEU A HD12 8  
ATOM 9411  H HD13 . LEU A 1 66 ? 5.084   1.993   -5.594  1.00 0.00 ? 66 LEU A HD13 8  
ATOM 9412  H HD21 . LEU A 1 66 ? 2.488   4.188   -3.852  1.00 0.00 ? 66 LEU A HD21 8  
ATOM 9413  H HD22 . LEU A 1 66 ? 1.872   2.553   -4.090  1.00 0.00 ? 66 LEU A HD22 8  
ATOM 9414  H HD23 . LEU A 1 66 ? 1.305   3.865   -5.121  1.00 0.00 ? 66 LEU A HD23 8  
ATOM 9415  N N    . ASP A 1 67 ? 3.586   3.346   -9.367  1.00 0.00 ? 67 ASP A N    8  
ATOM 9416  C CA   . ASP A 1 67 ? 2.603   3.293   -10.489 1.00 0.00 ? 67 ASP A CA   8  
ATOM 9417  C C    . ASP A 1 67 ? 1.175   3.264   -9.940  1.00 0.00 ? 67 ASP A C    8  
ATOM 9418  O O    . ASP A 1 67 ? 0.529   2.236   -9.920  1.00 0.00 ? 67 ASP A O    8  
ATOM 9419  C CB   . ASP A 1 67 ? 2.846   2.033   -11.321 1.00 0.00 ? 67 ASP A CB   8  
ATOM 9420  C CG   . ASP A 1 67 ? 4.282   2.034   -11.847 1.00 0.00 ? 67 ASP A CG   8  
ATOM 9421  O OD1  . ASP A 1 67 ? 4.704   3.060   -12.355 1.00 0.00 ? 67 ASP A OD1  8  
ATOM 9422  O OD2  . ASP A 1 67 ? 4.934   1.010   -11.732 1.00 0.00 ? 67 ASP A OD2  8  
ATOM 9423  H H    . ASP A 1 67 ? 4.259   2.641   -9.273  1.00 0.00 ? 67 ASP A H    8  
ATOM 9424  H HA   . ASP A 1 67 ? 2.728   4.164   -11.115 1.00 0.00 ? 67 ASP A HA   8  
ATOM 9425  H HB2  . ASP A 1 67 ? 2.687   1.159   -10.705 1.00 0.00 ? 67 ASP A HB2  8  
ATOM 9426  H HB3  . ASP A 1 67 ? 2.160   2.015   -12.154 1.00 0.00 ? 67 ASP A HB3  8  
ATOM 9427  N N    . ASP A 1 68 ? 0.672   4.387   -9.506  1.00 0.00 ? 68 ASP A N    8  
ATOM 9428  C CA   . ASP A 1 68 ? -0.718  4.426   -8.969  1.00 0.00 ? 68 ASP A CA   8  
ATOM 9429  C C    . ASP A 1 68 ? -1.254  5.856   -9.054  1.00 0.00 ? 68 ASP A C    8  
ATOM 9430  O O    . ASP A 1 68 ? -1.155  6.507   -10.075 1.00 0.00 ? 68 ASP A O    8  
ATOM 9431  C CB   . ASP A 1 68 ? -0.723  3.952   -7.512  1.00 0.00 ? 68 ASP A CB   8  
ATOM 9432  C CG   . ASP A 1 68 ? -0.312  2.479   -7.452  1.00 0.00 ? 68 ASP A CG   8  
ATOM 9433  O OD1  . ASP A 1 68 ? -0.928  1.684   -8.141  1.00 0.00 ? 68 ASP A OD1  8  
ATOM 9434  O OD2  . ASP A 1 68 ? 0.611   2.173   -6.716  1.00 0.00 ? 68 ASP A OD2  8  
ATOM 9435  H H    . ASP A 1 68 ? 1.207   5.208   -9.539  1.00 0.00 ? 68 ASP A H    8  
ATOM 9436  H HA   . ASP A 1 68 ? -1.349  3.777   -9.557  1.00 0.00 ? 68 ASP A HA   8  
ATOM 9437  H HB2  . ASP A 1 68 ? -0.030  4.546   -6.936  1.00 0.00 ? 68 ASP A HB2  8  
ATOM 9438  H HB3  . ASP A 1 68 ? -1.717  4.058   -7.103  1.00 0.00 ? 68 ASP A HB3  8  
ATOM 9439  N N    . PHE A 1 69 ? -1.826  6.346   -7.990  1.00 0.00 ? 69 PHE A N    8  
ATOM 9440  C CA   . PHE A 1 69 ? -2.376  7.727   -8.004  1.00 0.00 ? 69 PHE A CA   8  
ATOM 9441  C C    . PHE A 1 69 ? -2.467  8.242   -6.574  1.00 0.00 ? 69 PHE A C    8  
ATOM 9442  O O    . PHE A 1 69 ? -1.829  7.725   -5.681  1.00 0.00 ? 69 PHE A O    8  
ATOM 9443  C CB   . PHE A 1 69 ? -3.770  7.718   -8.635  1.00 0.00 ? 69 PHE A CB   8  
ATOM 9444  C CG   . PHE A 1 69 ? -3.674  7.227   -10.059 1.00 0.00 ? 69 PHE A CG   8  
ATOM 9445  C CD1  . PHE A 1 69 ? -3.379  8.125   -11.091 1.00 0.00 ? 69 PHE A CD1  8  
ATOM 9446  C CD2  . PHE A 1 69 ? -3.876  5.872   -10.347 1.00 0.00 ? 69 PHE A CD2  8  
ATOM 9447  C CE1  . PHE A 1 69 ? -3.286  7.670   -12.411 1.00 0.00 ? 69 PHE A CE1  8  
ATOM 9448  C CE2  . PHE A 1 69 ? -3.783  5.416   -11.668 1.00 0.00 ? 69 PHE A CE2  8  
ATOM 9449  C CZ   . PHE A 1 69 ? -3.489  6.315   -12.700 1.00 0.00 ? 69 PHE A CZ   8  
ATOM 9450  H H    . PHE A 1 69 ? -1.894  5.800   -7.185  1.00 0.00 ? 69 PHE A H    8  
ATOM 9451  H HA   . PHE A 1 69 ? -1.723  8.365   -8.575  1.00 0.00 ? 69 PHE A HA   8  
ATOM 9452  H HB2  . PHE A 1 69 ? -4.416  7.061   -8.070  1.00 0.00 ? 69 PHE A HB2  8  
ATOM 9453  H HB3  . PHE A 1 69 ? -4.176  8.718   -8.626  1.00 0.00 ? 69 PHE A HB3  8  
ATOM 9454  H HD1  . PHE A 1 69 ? -3.223  9.170   -10.868 1.00 0.00 ? 69 PHE A HD1  8  
ATOM 9455  H HD2  . PHE A 1 69 ? -4.104  5.178   -9.551  1.00 0.00 ? 69 PHE A HD2  8  
ATOM 9456  H HE1  . PHE A 1 69 ? -3.059  8.363   -13.207 1.00 0.00 ? 69 PHE A HE1  8  
ATOM 9457  H HE2  . PHE A 1 69 ? -3.940  4.371   -11.890 1.00 0.00 ? 69 PHE A HE2  8  
ATOM 9458  H HZ   . PHE A 1 69 ? -3.416  5.964   -13.718 1.00 0.00 ? 69 PHE A HZ   8  
ATOM 9459  N N    . PHE A 1 70 ? -3.259  9.251   -6.342  1.00 0.00 ? 70 PHE A N    8  
ATOM 9460  C CA   . PHE A 1 70 ? -3.386  9.789   -4.960  1.00 0.00 ? 70 PHE A CA   8  
ATOM 9461  C C    . PHE A 1 70 ? -4.507  10.827  -4.919  1.00 0.00 ? 70 PHE A C    8  
ATOM 9462  O O    . PHE A 1 70 ? -4.274  11.996  -4.685  1.00 0.00 ? 70 PHE A O    8  
ATOM 9463  C CB   . PHE A 1 70 ? -2.070  10.448  -4.545  1.00 0.00 ? 70 PHE A CB   8  
ATOM 9464  C CG   . PHE A 1 70 ? -2.223  11.044  -3.166  1.00 0.00 ? 70 PHE A CG   8  
ATOM 9465  C CD1  . PHE A 1 70 ? -2.287  10.206  -2.047  1.00 0.00 ? 70 PHE A CD1  8  
ATOM 9466  C CD2  . PHE A 1 70 ? -2.304  12.433  -3.004  1.00 0.00 ? 70 PHE A CD2  8  
ATOM 9467  C CE1  . PHE A 1 70 ? -2.432  10.755  -0.768  1.00 0.00 ? 70 PHE A CE1  8  
ATOM 9468  C CE2  . PHE A 1 70 ? -2.449  12.982  -1.724  1.00 0.00 ? 70 PHE A CE2  8  
ATOM 9469  C CZ   . PHE A 1 70 ? -2.512  12.143  -0.606  1.00 0.00 ? 70 PHE A CZ   8  
ATOM 9470  H H    . PHE A 1 70 ? -3.769  9.654   -7.076  1.00 0.00 ? 70 PHE A H    8  
ATOM 9471  H HA   . PHE A 1 70 ? -3.614  8.981   -4.281  1.00 0.00 ? 70 PHE A HA   8  
ATOM 9472  H HB2  . PHE A 1 70 ? -1.284  9.708   -4.533  1.00 0.00 ? 70 PHE A HB2  8  
ATOM 9473  H HB3  . PHE A 1 70 ? -1.819  11.228  -5.250  1.00 0.00 ? 70 PHE A HB3  8  
ATOM 9474  H HD1  . PHE A 1 70 ? -2.225  9.135   -2.171  1.00 0.00 ? 70 PHE A HD1  8  
ATOM 9475  H HD2  . PHE A 1 70 ? -2.255  13.081  -3.867  1.00 0.00 ? 70 PHE A HD2  8  
ATOM 9476  H HE1  . PHE A 1 70 ? -2.480  10.107  0.095   1.00 0.00 ? 70 PHE A HE1  8  
ATOM 9477  H HE2  . PHE A 1 70 ? -2.511  14.053  -1.600  1.00 0.00 ? 70 PHE A HE2  8  
ATOM 9478  H HZ   . PHE A 1 70 ? -2.624  12.566  0.382   1.00 0.00 ? 70 PHE A HZ   8  
ATOM 9479  N N    . HIS A 1 71 ? -5.724  10.412  -5.142  1.00 0.00 ? 71 HIS A N    8  
ATOM 9480  C CA   . HIS A 1 71 ? -6.857  11.377  -5.115  1.00 0.00 ? 71 HIS A CA   8  
ATOM 9481  C C    . HIS A 1 71 ? -8.180  10.615  -5.216  1.00 0.00 ? 71 HIS A C    8  
ATOM 9482  O O    . HIS A 1 71 ? -8.825  10.609  -6.245  1.00 0.00 ? 71 HIS A O    8  
ATOM 9483  C CB   . HIS A 1 71 ? -6.737  12.339  -6.298  1.00 0.00 ? 71 HIS A CB   8  
ATOM 9484  C CG   . HIS A 1 71 ? -7.885  13.309  -6.272  1.00 0.00 ? 71 HIS A CG   8  
ATOM 9485  N ND1  . HIS A 1 71 ? -8.392  13.820  -5.086  1.00 0.00 ? 71 HIS A ND1  8  
ATOM 9486  C CD2  . HIS A 1 71 ? -8.638  13.870  -7.273  1.00 0.00 ? 71 HIS A CD2  8  
ATOM 9487  C CE1  . HIS A 1 71 ? -9.403  14.649  -5.402  1.00 0.00 ? 71 HIS A CE1  8  
ATOM 9488  N NE2  . HIS A 1 71 ? -9.597  14.715  -6.722  1.00 0.00 ? 71 HIS A NE2  8  
ATOM 9489  H H    . HIS A 1 71 ? -5.891  9.464   -5.327  1.00 0.00 ? 71 HIS A H    8  
ATOM 9490  H HA   . HIS A 1 71 ? -6.833  11.937  -4.191  1.00 0.00 ? 71 HIS A HA   8  
ATOM 9491  H HB2  . HIS A 1 71 ? -5.805  12.881  -6.230  1.00 0.00 ? 71 HIS A HB2  8  
ATOM 9492  H HB3  . HIS A 1 71 ? -6.762  11.779  -7.222  1.00 0.00 ? 71 HIS A HB3  8  
ATOM 9493  H HD1  . HIS A 1 71 ? -8.072  13.614  -4.183  1.00 0.00 ? 71 HIS A HD1  8  
ATOM 9494  H HD2  . HIS A 1 71 ? -8.508  13.682  -8.329  1.00 0.00 ? 71 HIS A HD2  8  
ATOM 9495  H HE1  . HIS A 1 71 ? -9.987  15.194  -4.676  1.00 0.00 ? 71 HIS A HE1  8  
ATOM 9496  N N    . ARG A 1 72 ? -8.592  9.973   -4.157  1.00 0.00 ? 72 ARG A N    8  
ATOM 9497  C CA   . ARG A 1 72 ? -9.874  9.214   -4.202  1.00 0.00 ? 72 ARG A CA   8  
ATOM 9498  C C    . ARG A 1 72 ? -10.244 8.747   -2.794  1.00 0.00 ? 72 ARG A C    8  
ATOM 9499  O O    . ARG A 1 72 ? -9.965  7.630   -2.406  1.00 0.00 ? 72 ARG A O    8  
ATOM 9500  C CB   . ARG A 1 72 ? -9.715  7.997   -5.115  1.00 0.00 ? 72 ARG A CB   8  
ATOM 9501  C CG   . ARG A 1 72 ? -11.090 7.394   -5.411  1.00 0.00 ? 72 ARG A CG   8  
ATOM 9502  C CD   . ARG A 1 72 ? -10.950 6.309   -6.480  1.00 0.00 ? 72 ARG A CD   8  
ATOM 9503  N NE   . ARG A 1 72 ? -12.267 5.647   -6.692  1.00 0.00 ? 72 ARG A NE   8  
ATOM 9504  C CZ   . ARG A 1 72 ? -12.460 4.905   -7.747  1.00 0.00 ? 72 ARG A CZ   8  
ATOM 9505  N NH1  . ARG A 1 72 ? -11.499 4.746   -8.617  1.00 0.00 ? 72 ARG A NH1  8  
ATOM 9506  N NH2  . ARG A 1 72 ? -13.612 4.322   -7.934  1.00 0.00 ? 72 ARG A NH2  8  
ATOM 9507  H H    . ARG A 1 72 ? -8.060  9.989   -3.334  1.00 0.00 ? 72 ARG A H    8  
ATOM 9508  H HA   . ARG A 1 72 ? -10.656 9.854   -4.586  1.00 0.00 ? 72 ARG A HA   8  
ATOM 9509  H HB2  . ARG A 1 72 ? -9.248  8.300   -6.042  1.00 0.00 ? 72 ARG A HB2  8  
ATOM 9510  H HB3  . ARG A 1 72 ? -9.097  7.258   -4.626  1.00 0.00 ? 72 ARG A HB3  8  
ATOM 9511  H HG2  . ARG A 1 72 ? -11.494 6.962   -4.508  1.00 0.00 ? 72 ARG A HG2  8  
ATOM 9512  H HG3  . ARG A 1 72 ? -11.754 8.166   -5.770  1.00 0.00 ? 72 ARG A HG3  8  
ATOM 9513  H HD2  . ARG A 1 72 ? -10.620 6.757   -7.406  1.00 0.00 ? 72 ARG A HD2  8  
ATOM 9514  H HD3  . ARG A 1 72 ? -10.226 5.576   -6.157  1.00 0.00 ? 72 ARG A HD3  8  
ATOM 9515  H HE   . ARG A 1 72 ? -12.988 5.768   -6.039  1.00 0.00 ? 72 ARG A HE   8  
ATOM 9516  H HH11 . ARG A 1 72 ? -10.617 5.193   -8.473  1.00 0.00 ? 72 ARG A HH11 8  
ATOM 9517  H HH12 . ARG A 1 72 ? -11.645 4.177   -9.425  1.00 0.00 ? 72 ARG A HH12 8  
ATOM 9518  H HH21 . ARG A 1 72 ? -14.348 4.444   -7.267  1.00 0.00 ? 72 ARG A HH21 8  
ATOM 9519  H HH22 . ARG A 1 72 ? -13.759 3.752   -8.743  1.00 0.00 ? 72 ARG A HH22 8  
ATOM 9520  N N    . ASP A 1 73 ? -10.873 9.592   -2.025  1.00 0.00 ? 73 ASP A N    8  
ATOM 9521  C CA   . ASP A 1 73 ? -11.262 9.196   -0.643  1.00 0.00 ? 73 ASP A CA   8  
ATOM 9522  C C    . ASP A 1 73 ? -12.136 10.292  -0.030  1.00 0.00 ? 73 ASP A C    8  
ATOM 9523  O O    . ASP A 1 73 ? -12.086 11.437  -0.434  1.00 0.00 ? 73 ASP A O    8  
ATOM 9524  C CB   . ASP A 1 73 ? -10.005 9.010   0.209   1.00 0.00 ? 73 ASP A CB   8  
ATOM 9525  C CG   . ASP A 1 73 ? -10.408 8.725   1.657   1.00 0.00 ? 73 ASP A CG   8  
ATOM 9526  O OD1  . ASP A 1 73 ? -10.806 7.606   1.930   1.00 0.00 ? 73 ASP A OD1  8  
ATOM 9527  O OD2  . ASP A 1 73 ? -10.311 9.632   2.467   1.00 0.00 ? 73 ASP A OD2  8  
ATOM 9528  H H    . ASP A 1 73 ? -11.090 10.488  -2.357  1.00 0.00 ? 73 ASP A H    8  
ATOM 9529  H HA   . ASP A 1 73 ? -11.816 8.268   -0.677  1.00 0.00 ? 73 ASP A HA   8  
ATOM 9530  H HB2  . ASP A 1 73 ? -9.429  8.181   -0.176  1.00 0.00 ? 73 ASP A HB2  8  
ATOM 9531  H HB3  . ASP A 1 73 ? -9.410  9.910   0.173   1.00 0.00 ? 73 ASP A HB3  8  
ATOM 9532  N N    . LYS A 1 74 ? -12.935 9.952   0.943   1.00 0.00 ? 74 LYS A N    8  
ATOM 9533  C CA   . LYS A 1 74 ? -13.810 10.976  1.581   1.00 0.00 ? 74 LYS A CA   8  
ATOM 9534  C C    . LYS A 1 74 ? -14.474 10.376  2.822   1.00 0.00 ? 74 LYS A C    8  
ATOM 9535  O O    . LYS A 1 74 ? -15.372 9.564   2.726   1.00 0.00 ? 74 LYS A O    8  
ATOM 9536  C CB   . LYS A 1 74 ? -14.889 11.416  0.589   1.00 0.00 ? 74 LYS A CB   8  
ATOM 9537  C CG   . LYS A 1 74 ? -15.709 12.552  1.201   1.00 0.00 ? 74 LYS A CG   8  
ATOM 9538  C CD   . LYS A 1 74 ? -16.667 13.115  0.150   1.00 0.00 ? 74 LYS A CD   8  
ATOM 9539  C CE   . LYS A 1 74 ? -17.451 14.285  0.748   1.00 0.00 ? 74 LYS A CE   8  
ATOM 9540  N NZ   . LYS A 1 74 ? -18.467 14.756  -0.234  1.00 0.00 ? 74 LYS A NZ   8  
ATOM 9541  H H    . LYS A 1 74 ? -12.960 9.023   1.255   1.00 0.00 ? 74 LYS A H    8  
ATOM 9542  H HA   . LYS A 1 74 ? -13.215 11.829  1.868   1.00 0.00 ? 74 LYS A HA   8  
ATOM 9543  H HB2  . LYS A 1 74 ? -14.421 11.757  -0.323  1.00 0.00 ? 74 LYS A HB2  8  
ATOM 9544  H HB3  . LYS A 1 74 ? -15.540 10.583  0.371   1.00 0.00 ? 74 LYS A HB3  8  
ATOM 9545  H HG2  . LYS A 1 74 ? -16.274 12.178  2.041   1.00 0.00 ? 74 LYS A HG2  8  
ATOM 9546  H HG3  . LYS A 1 74 ? -15.045 13.336  1.534   1.00 0.00 ? 74 LYS A HG3  8  
ATOM 9547  H HD2  . LYS A 1 74 ? -16.103 13.459  -0.705  1.00 0.00 ? 74 LYS A HD2  8  
ATOM 9548  H HD3  . LYS A 1 74 ? -17.356 12.343  -0.159  1.00 0.00 ? 74 LYS A HD3  8  
ATOM 9549  H HE2  . LYS A 1 74 ? -17.946 13.960  1.652   1.00 0.00 ? 74 LYS A HE2  8  
ATOM 9550  H HE3  . LYS A 1 74 ? -16.772 15.091  0.979   1.00 0.00 ? 74 LYS A HE3  8  
ATOM 9551  H HZ1  . LYS A 1 74 ? -17.987 15.144  -1.071  1.00 0.00 ? 74 LYS A HZ1  8  
ATOM 9552  H HZ2  . LYS A 1 74 ? -19.054 15.495  0.201   1.00 0.00 ? 74 LYS A HZ2  8  
ATOM 9553  H HZ3  . LYS A 1 74 ? -19.070 13.956  -0.519  1.00 0.00 ? 74 LYS A HZ3  8  
ATOM 9554  N N    . ASP A 1 75 ? -14.044 10.772  3.988   1.00 0.00 ? 75 ASP A N    8  
ATOM 9555  C CA   . ASP A 1 75 ? -14.655 10.223  5.231   1.00 0.00 ? 75 ASP A CA   8  
ATOM 9556  C C    . ASP A 1 75 ? -16.063 10.798  5.403   1.00 0.00 ? 75 ASP A C    8  
ATOM 9557  O O    . ASP A 1 75 ? -16.237 11.914  5.850   1.00 0.00 ? 75 ASP A O    8  
ATOM 9558  C CB   . ASP A 1 75 ? -13.794 10.608  6.435   1.00 0.00 ? 75 ASP A CB   8  
ATOM 9559  C CG   . ASP A 1 75 ? -12.388 10.031  6.263   1.00 0.00 ? 75 ASP A CG   8  
ATOM 9560  O OD1  . ASP A 1 75 ? -12.284 8.837   6.035   1.00 0.00 ? 75 ASP A OD1  8  
ATOM 9561  O OD2  . ASP A 1 75 ? -11.440 10.791  6.363   1.00 0.00 ? 75 ASP A OD2  8  
ATOM 9562  H H    . ASP A 1 75 ? -13.320 11.430  4.046   1.00 0.00 ? 75 ASP A H    8  
ATOM 9563  H HA   . ASP A 1 75 ? -14.712 9.147   5.158   1.00 0.00 ? 75 ASP A HA   8  
ATOM 9564  H HB2  . ASP A 1 75 ? -13.736 11.686  6.507   1.00 0.00 ? 75 ASP A HB2  8  
ATOM 9565  H HB3  . ASP A 1 75 ? -14.237 10.211  7.337   1.00 0.00 ? 75 ASP A HB3  8  
ATOM 9566  N N    . ASP A 1 76 ? -17.068 10.045  5.049   1.00 0.00 ? 76 ASP A N    8  
ATOM 9567  C CA   . ASP A 1 76 ? -18.462 10.549  5.192   1.00 0.00 ? 76 ASP A CA   8  
ATOM 9568  C C    . ASP A 1 76 ? -18.878 10.484  6.664   1.00 0.00 ? 76 ASP A C    8  
ATOM 9569  O O    . ASP A 1 76 ? -18.103 10.782  7.551   1.00 0.00 ? 76 ASP A O    8  
ATOM 9570  C CB   . ASP A 1 76 ? -19.407 9.682   4.357   1.00 0.00 ? 76 ASP A CB   8  
ATOM 9571  C CG   . ASP A 1 76 ? -18.949 9.686   2.898   1.00 0.00 ? 76 ASP A CG   8  
ATOM 9572  O OD1  . ASP A 1 76 ? -17.840 10.130  2.647   1.00 0.00 ? 76 ASP A OD1  8  
ATOM 9573  O OD2  . ASP A 1 76 ? -19.713 9.245   2.056   1.00 0.00 ? 76 ASP A OD2  8  
ATOM 9574  H H    . ASP A 1 76 ? -16.905 9.148   4.691   1.00 0.00 ? 76 ASP A H    8  
ATOM 9575  H HA   . ASP A 1 76 ? -18.513 11.571  4.848   1.00 0.00 ? 76 ASP A HA   8  
ATOM 9576  H HB2  . ASP A 1 76 ? -19.395 8.670   4.736   1.00 0.00 ? 76 ASP A HB2  8  
ATOM 9577  H HB3  . ASP A 1 76 ? -20.409 10.077  4.419   1.00 0.00 ? 76 ASP A HB3  8  
ATOM 9578  N N    . PHE A 1 77 ? -20.095 10.096  6.930   1.00 0.00 ? 77 PHE A N    8  
ATOM 9579  C CA   . PHE A 1 77 ? -20.555 10.013  8.344   1.00 0.00 ? 77 PHE A CA   8  
ATOM 9580  C C    . PHE A 1 77 ? -19.798 8.893   9.060   1.00 0.00 ? 77 PHE A C    8  
ATOM 9581  O O    . PHE A 1 77 ? -19.853 7.744   8.670   1.00 0.00 ? 77 PHE A O    8  
ATOM 9582  C CB   . PHE A 1 77 ? -22.055 9.715   8.377   1.00 0.00 ? 77 PHE A CB   8  
ATOM 9583  C CG   . PHE A 1 77 ? -22.777 10.659  7.446   1.00 0.00 ? 77 PHE A CG   8  
ATOM 9584  C CD1  . PHE A 1 77 ? -23.213 11.905  7.913   1.00 0.00 ? 77 PHE A CD1  8  
ATOM 9585  C CD2  . PHE A 1 77 ? -23.011 10.288  6.117   1.00 0.00 ? 77 PHE A CD2  8  
ATOM 9586  C CE1  . PHE A 1 77 ? -23.881 12.780  7.049   1.00 0.00 ? 77 PHE A CE1  8  
ATOM 9587  C CE2  . PHE A 1 77 ? -23.679 11.164  5.254   1.00 0.00 ? 77 PHE A CE2  8  
ATOM 9588  C CZ   . PHE A 1 77 ? -24.115 12.409  5.720   1.00 0.00 ? 77 PHE A CZ   8  
ATOM 9589  H H    . PHE A 1 77 ? -20.705 9.860   6.201   1.00 0.00 ? 77 PHE A H    8  
ATOM 9590  H HA   . PHE A 1 77 ? -20.364 10.953  8.842   1.00 0.00 ? 77 PHE A HA   8  
ATOM 9591  H HB2  . PHE A 1 77 ? -22.227 8.696   8.063   1.00 0.00 ? 77 PHE A HB2  8  
ATOM 9592  H HB3  . PHE A 1 77 ? -22.427 9.848   9.383   1.00 0.00 ? 77 PHE A HB3  8  
ATOM 9593  H HD1  . PHE A 1 77 ? -23.032 12.191  8.939   1.00 0.00 ? 77 PHE A HD1  8  
ATOM 9594  H HD2  . PHE A 1 77 ? -22.674 9.327   5.758   1.00 0.00 ? 77 PHE A HD2  8  
ATOM 9595  H HE1  . PHE A 1 77 ? -24.217 13.741  7.409   1.00 0.00 ? 77 PHE A HE1  8  
ATOM 9596  H HE2  . PHE A 1 77 ? -23.859 10.877  4.228   1.00 0.00 ? 77 PHE A HE2  8  
ATOM 9597  H HZ   . PHE A 1 77 ? -24.631 13.085  5.054   1.00 0.00 ? 77 PHE A HZ   8  
ATOM 9598  N N    . PHE A 1 78 ? -19.087 9.220   10.106  1.00 0.00 ? 78 PHE A N    8  
ATOM 9599  C CA   . PHE A 1 78 ? -18.327 8.175   10.845  1.00 0.00 ? 78 PHE A CA   8  
ATOM 9600  C C    . PHE A 1 78 ? -17.771 8.770   12.140  1.00 0.00 ? 78 PHE A C    8  
ATOM 9601  O O    . PHE A 1 78 ? -17.301 9.891   12.167  1.00 0.00 ? 78 PHE A O    8  
ATOM 9602  C CB   . PHE A 1 78 ? -17.170 7.675   9.977   1.00 0.00 ? 78 PHE A CB   8  
ATOM 9603  C CG   . PHE A 1 78 ? -16.409 6.603   10.720  1.00 0.00 ? 78 PHE A CG   8  
ATOM 9604  C CD1  . PHE A 1 78 ? -16.880 5.284   10.722  1.00 0.00 ? 78 PHE A CD1  8  
ATOM 9605  C CD2  . PHE A 1 78 ? -15.235 6.928   11.409  1.00 0.00 ? 78 PHE A CD2  8  
ATOM 9606  C CE1  . PHE A 1 78 ? -16.176 4.290   11.412  1.00 0.00 ? 78 PHE A CE1  8  
ATOM 9607  C CE2  . PHE A 1 78 ? -14.531 5.934   12.100  1.00 0.00 ? 78 PHE A CE2  8  
ATOM 9608  C CZ   . PHE A 1 78 ? -15.002 4.616   12.101  1.00 0.00 ? 78 PHE A CZ   8  
ATOM 9609  H H    . PHE A 1 78 ? -19.055 10.153  10.404  1.00 0.00 ? 78 PHE A H    8  
ATOM 9610  H HA   . PHE A 1 78 ? -18.983 7.350   11.080  1.00 0.00 ? 78 PHE A HA   8  
ATOM 9611  H HB2  . PHE A 1 78 ? -17.561 7.268   9.056   1.00 0.00 ? 78 PHE A HB2  8  
ATOM 9612  H HB3  . PHE A 1 78 ? -16.506 8.497   9.753   1.00 0.00 ? 78 PHE A HB3  8  
ATOM 9613  H HD1  . PHE A 1 78 ? -17.786 5.033   10.190  1.00 0.00 ? 78 PHE A HD1  8  
ATOM 9614  H HD2  . PHE A 1 78 ? -14.872 7.944   11.408  1.00 0.00 ? 78 PHE A HD2  8  
ATOM 9615  H HE1  . PHE A 1 78 ? -16.539 3.273   11.413  1.00 0.00 ? 78 PHE A HE1  8  
ATOM 9616  H HE2  . PHE A 1 78 ? -13.625 6.184   12.631  1.00 0.00 ? 78 PHE A HE2  8  
ATOM 9617  H HZ   . PHE A 1 78 ? -14.459 3.849   12.634  1.00 0.00 ? 78 PHE A HZ   8  
ATOM 9618  N N    . THR A 1 79 ? -17.820 8.030   13.213  1.00 0.00 ? 79 THR A N    8  
ATOM 9619  C CA   . THR A 1 79 ? -17.292 8.556   14.504  1.00 0.00 ? 79 THR A CA   8  
ATOM 9620  C C    . THR A 1 79 ? -15.799 8.854   14.361  1.00 0.00 ? 79 THR A C    8  
ATOM 9621  O O    . THR A 1 79 ? -15.020 7.916   14.406  1.00 0.00 ? 79 THR A O    8  
ATOM 9622  C CB   . THR A 1 79 ? -17.502 7.512   15.604  1.00 0.00 ? 79 THR A CB   8  
ATOM 9623  O OG1  . THR A 1 79 ? -16.775 6.335   15.281  1.00 0.00 ? 79 THR A OG1  8  
ATOM 9624  C CG2  . THR A 1 79 ? -18.990 7.179   15.717  1.00 0.00 ? 79 THR A CG2  8  
ATOM 9625  O OXT  . THR A 1 79 ? -15.459 10.016  14.208  1.00 0.00 ? 79 THR A OXT  8  
ATOM 9626  H H    . THR A 1 79 ? -18.202 7.129   13.170  1.00 0.00 ? 79 THR A H    8  
ATOM 9627  H HA   . THR A 1 79 ? -17.818 9.463   14.764  1.00 0.00 ? 79 THR A HA   8  
ATOM 9628  H HB   . THR A 1 79 ? -17.153 7.906   16.545  1.00 0.00 ? 79 THR A HB   8  
ATOM 9629  H HG1  . THR A 1 79 ? -16.995 6.087   14.380  1.00 0.00 ? 79 THR A HG1  8  
ATOM 9630  H HG21 . THR A 1 79 ? -19.542 8.074   15.964  1.00 0.00 ? 79 THR A HG21 8  
ATOM 9631  H HG22 . THR A 1 79 ? -19.136 6.442   16.492  1.00 0.00 ? 79 THR A HG22 8  
ATOM 9632  H HG23 . THR A 1 79 ? -19.344 6.787   14.775  1.00 0.00 ? 79 THR A HG23 8  
ATOM 9633  N N    . MET A 1 1  ? 1.914   11.295  11.123  1.00 0.00 ? 1  MET A N    9  
ATOM 9634  C CA   . MET A 1 1  ? 1.893   12.355  10.076  1.00 0.00 ? 1  MET A CA   9  
ATOM 9635  C C    . MET A 1 1  ? 2.740   13.543  10.537  1.00 0.00 ? 1  MET A C    9  
ATOM 9636  O O    . MET A 1 1  ? 3.337   14.238  9.739   1.00 0.00 ? 1  MET A O    9  
ATOM 9637  C CB   . MET A 1 1  ? 0.452   12.816  9.844   1.00 0.00 ? 1  MET A CB   9  
ATOM 9638  C CG   . MET A 1 1  ? 0.411   13.797  8.673   1.00 0.00 ? 1  MET A CG   9  
ATOM 9639  S SD   . MET A 1 1  ? -1.309  14.203  8.284   1.00 0.00 ? 1  MET A SD   9  
ATOM 9640  C CE   . MET A 1 1  ? -0.969  15.435  7.003   1.00 0.00 ? 1  MET A CE   9  
ATOM 9641  H H1   . MET A 1 1  ? 2.898   11.042  11.341  1.00 0.00 ? 1  MET A H1   9  
ATOM 9642  H H2   . MET A 1 1  ? 1.408   10.455  10.775  1.00 0.00 ? 1  MET A H2   9  
ATOM 9643  H H3   . MET A 1 1  ? 1.451   11.648  11.984  1.00 0.00 ? 1  MET A H3   9  
ATOM 9644  H HA   . MET A 1 1  ? 2.297   11.960  9.155   1.00 0.00 ? 1  MET A HA   9  
ATOM 9645  H HB2  . MET A 1 1  ? -0.168  11.959  9.620   1.00 0.00 ? 1  MET A HB2  9  
ATOM 9646  H HB3  . MET A 1 1  ? 0.083   13.304  10.734  1.00 0.00 ? 1  MET A HB3  9  
ATOM 9647  H HG2  . MET A 1 1  ? 0.942   14.699  8.940   1.00 0.00 ? 1  MET A HG2  9  
ATOM 9648  H HG3  . MET A 1 1  ? 0.879   13.347  7.810   1.00 0.00 ? 1  MET A HG3  9  
ATOM 9649  H HE1  . MET A 1 1  ? -1.900  15.858  6.655   1.00 0.00 ? 1  MET A HE1  9  
ATOM 9650  H HE2  . MET A 1 1  ? -0.451  14.962  6.179   1.00 0.00 ? 1  MET A HE2  9  
ATOM 9651  H HE3  . MET A 1 1  ? -0.350  16.219  7.411   1.00 0.00 ? 1  MET A HE3  9  
ATOM 9652  N N    . ILE A 1 2  ? 2.797   13.783  11.818  1.00 0.00 ? 2  ILE A N    9  
ATOM 9653  C CA   . ILE A 1 2  ? 3.606   14.926  12.327  1.00 0.00 ? 2  ILE A CA   9  
ATOM 9654  C C    . ILE A 1 2  ? 3.719   14.825  13.850  1.00 0.00 ? 2  ILE A C    9  
ATOM 9655  O O    . ILE A 1 2  ? 4.719   15.192  14.434  1.00 0.00 ? 2  ILE A O    9  
ATOM 9656  C CB   . ILE A 1 2  ? 2.918   16.242  11.941  1.00 0.00 ? 2  ILE A CB   9  
ATOM 9657  C CG1  . ILE A 1 2  ? 3.695   17.440  12.513  1.00 0.00 ? 2  ILE A CG1  9  
ATOM 9658  C CG2  . ILE A 1 2  ? 1.495   16.253  12.501  1.00 0.00 ? 2  ILE A CG2  9  
ATOM 9659  C CD1  . ILE A 1 2  ? 5.148   17.418  12.022  1.00 0.00 ? 2  ILE A CD1  9  
ATOM 9660  H H    . ILE A 1 2  ? 2.308   13.210  12.445  1.00 0.00 ? 2  ILE A H    9  
ATOM 9661  H HA   . ILE A 1 2  ? 4.591   14.888  11.888  1.00 0.00 ? 2  ILE A HA   9  
ATOM 9662  H HB   . ILE A 1 2  ? 2.877   16.320  10.864  1.00 0.00 ? 2  ILE A HB   9  
ATOM 9663  H HG12 . ILE A 1 2  ? 3.224   18.356  12.186  1.00 0.00 ? 2  ILE A HG12 9  
ATOM 9664  H HG13 . ILE A 1 2  ? 3.682   17.398  13.592  1.00 0.00 ? 2  ILE A HG13 9  
ATOM 9665  H HG21 . ILE A 1 2  ? 0.980   15.354  12.194  1.00 0.00 ? 2  ILE A HG21 9  
ATOM 9666  H HG22 . ILE A 1 2  ? 0.966   17.117  12.125  1.00 0.00 ? 2  ILE A HG22 9  
ATOM 9667  H HG23 . ILE A 1 2  ? 1.533   16.295  13.580  1.00 0.00 ? 2  ILE A HG23 9  
ATOM 9668  H HD11 . ILE A 1 2  ? 5.185   17.050  11.005  1.00 0.00 ? 2  ILE A HD11 9  
ATOM 9669  H HD12 . ILE A 1 2  ? 5.734   16.774  12.660  1.00 0.00 ? 2  ILE A HD12 9  
ATOM 9670  H HD13 . ILE A 1 2  ? 5.552   18.418  12.054  1.00 0.00 ? 2  ILE A HD13 9  
ATOM 9671  N N    . ASP A 1 3  ? 2.702   14.328  14.499  1.00 0.00 ? 3  ASP A N    9  
ATOM 9672  C CA   . ASP A 1 3  ? 2.751   14.204  15.983  1.00 0.00 ? 3  ASP A CA   9  
ATOM 9673  C C    . ASP A 1 3  ? 3.736   13.097  16.368  1.00 0.00 ? 3  ASP A C    9  
ATOM 9674  O O    . ASP A 1 3  ? 4.124   12.970  17.512  1.00 0.00 ? 3  ASP A O    9  
ATOM 9675  C CB   . ASP A 1 3  ? 1.360   13.856  16.513  1.00 0.00 ? 3  ASP A CB   9  
ATOM 9676  C CG   . ASP A 1 3  ? 0.368   14.943  16.098  1.00 0.00 ? 3  ASP A CG   9  
ATOM 9677  O OD1  . ASP A 1 3  ? 0.727   16.107  16.174  1.00 0.00 ? 3  ASP A OD1  9  
ATOM 9678  O OD2  . ASP A 1 3  ? -0.735  14.595  15.709  1.00 0.00 ? 3  ASP A OD2  9  
ATOM 9679  H H    . ASP A 1 3  ? 1.903   14.036  14.010  1.00 0.00 ? 3  ASP A H    9  
ATOM 9680  H HA   . ASP A 1 3  ? 3.077   15.140  16.412  1.00 0.00 ? 3  ASP A HA   9  
ATOM 9681  H HB2  . ASP A 1 3  ? 1.046   12.906  16.105  1.00 0.00 ? 3  ASP A HB2  9  
ATOM 9682  H HB3  . ASP A 1 3  ? 1.390   13.793  17.591  1.00 0.00 ? 3  ASP A HB3  9  
ATOM 9683  N N    . ASN A 1 4  ? 4.140   12.294  15.422  1.00 0.00 ? 4  ASN A N    9  
ATOM 9684  C CA   . ASN A 1 4  ? 5.099   11.197  15.736  1.00 0.00 ? 4  ASN A CA   9  
ATOM 9685  C C    . ASN A 1 4  ? 6.402   11.795  16.273  1.00 0.00 ? 4  ASN A C    9  
ATOM 9686  O O    . ASN A 1 4  ? 6.693   12.956  16.067  1.00 0.00 ? 4  ASN A O    9  
ATOM 9687  C CB   . ASN A 1 4  ? 5.390   10.396  14.465  1.00 0.00 ? 4  ASN A CB   9  
ATOM 9688  C CG   . ASN A 1 4  ? 5.880   11.340  13.367  1.00 0.00 ? 4  ASN A CG   9  
ATOM 9689  O OD1  . ASN A 1 4  ? 7.061   11.414  13.095  1.00 0.00 ? 4  ASN A OD1  9  
ATOM 9690  N ND2  . ASN A 1 4  ? 5.014   12.070  12.718  1.00 0.00 ? 4  ASN A ND2  9  
ATOM 9691  H H    . ASN A 1 4  ? 3.815   12.413  14.506  1.00 0.00 ? 4  ASN A H    9  
ATOM 9692  H HA   . ASN A 1 4  ? 4.668   10.545  16.482  1.00 0.00 ? 4  ASN A HA   9  
ATOM 9693  H HB2  . ASN A 1 4  ? 6.152   9.658   14.673  1.00 0.00 ? 4  ASN A HB2  9  
ATOM 9694  H HB3  . ASN A 1 4  ? 4.489   9.901   14.138  1.00 0.00 ? 4  ASN A HB3  9  
ATOM 9695  H HD21 . ASN A 1 4  ? 4.061   12.010  12.937  1.00 0.00 ? 4  ASN A HD21 9  
ATOM 9696  H HD22 . ASN A 1 4  ? 5.318   12.679  12.011  1.00 0.00 ? 4  ASN A HD22 9  
ATOM 9697  N N    . GLU A 1 5  ? 7.185   11.010  16.960  1.00 0.00 ? 5  GLU A N    9  
ATOM 9698  C CA   . GLU A 1 5  ? 8.468   11.533  17.508  1.00 0.00 ? 5  GLU A CA   9  
ATOM 9699  C C    . GLU A 1 5  ? 9.404   11.901  16.356  1.00 0.00 ? 5  GLU A C    9  
ATOM 9700  O O    . GLU A 1 5  ? 9.989   12.966  16.333  1.00 0.00 ? 5  GLU A O    9  
ATOM 9701  C CB   . GLU A 1 5  ? 9.126   10.461  18.379  1.00 0.00 ? 5  GLU A CB   9  
ATOM 9702  C CG   . GLU A 1 5  ? 8.190   10.094  19.531  1.00 0.00 ? 5  GLU A CG   9  
ATOM 9703  C CD   . GLU A 1 5  ? 8.036   11.294  20.467  1.00 0.00 ? 5  GLU A CD   9  
ATOM 9704  O OE1  . GLU A 1 5  ? 9.039   11.923  20.761  1.00 0.00 ? 5  GLU A OE1  9  
ATOM 9705  O OE2  . GLU A 1 5  ? 6.917   11.564  20.873  1.00 0.00 ? 5  GLU A OE2  9  
ATOM 9706  H H    . GLU A 1 5  ? 6.932   10.077  17.114  1.00 0.00 ? 5  GLU A H    9  
ATOM 9707  H HA   . GLU A 1 5  ? 8.272   12.411  18.106  1.00 0.00 ? 5  GLU A HA   9  
ATOM 9708  H HB2  . GLU A 1 5  ? 9.324   9.583   17.779  1.00 0.00 ? 5  GLU A HB2  9  
ATOM 9709  H HB3  . GLU A 1 5  ? 10.054  10.840  18.779  1.00 0.00 ? 5  GLU A HB3  9  
ATOM 9710  H HG2  . GLU A 1 5  ? 7.223   9.819   19.136  1.00 0.00 ? 5  GLU A HG2  9  
ATOM 9711  H HG3  . GLU A 1 5  ? 8.604   9.262   20.081  1.00 0.00 ? 5  GLU A HG3  9  
ATOM 9712  N N    . LYS A 1 6  ? 9.550   11.028  15.396  1.00 0.00 ? 6  LYS A N    9  
ATOM 9713  C CA   . LYS A 1 6  ? 10.448  11.330  14.246  1.00 0.00 ? 6  LYS A CA   9  
ATOM 9714  C C    . LYS A 1 6  ? 10.186  10.327  13.120  1.00 0.00 ? 6  LYS A C    9  
ATOM 9715  O O    . LYS A 1 6  ? 10.696  10.464  12.025  1.00 0.00 ? 6  LYS A O    9  
ATOM 9716  C CB   . LYS A 1 6  ? 11.907  11.227  14.695  1.00 0.00 ? 6  LYS A CB   9  
ATOM 9717  C CG   . LYS A 1 6  ? 12.095  9.966   15.543  1.00 0.00 ? 6  LYS A CG   9  
ATOM 9718  C CD   . LYS A 1 6  ? 13.577  9.795   15.880  1.00 0.00 ? 6  LYS A CD   9  
ATOM 9719  C CE   . LYS A 1 6  ? 13.738  8.696   16.932  1.00 0.00 ? 6  LYS A CE   9  
ATOM 9720  N NZ   . LYS A 1 6  ? 13.046  7.460   16.469  1.00 0.00 ? 6  LYS A NZ   9  
ATOM 9721  H H    . LYS A 1 6  ? 9.068   10.176  15.432  1.00 0.00 ? 6  LYS A H    9  
ATOM 9722  H HA   . LYS A 1 6  ? 10.252  12.331  13.889  1.00 0.00 ? 6  LYS A HA   9  
ATOM 9723  H HB2  . LYS A 1 6  ? 12.549  11.176  13.827  1.00 0.00 ? 6  LYS A HB2  9  
ATOM 9724  H HB3  . LYS A 1 6  ? 12.165  12.094  15.283  1.00 0.00 ? 6  LYS A HB3  9  
ATOM 9725  H HG2  . LYS A 1 6  ? 11.525  10.058  16.456  1.00 0.00 ? 6  LYS A HG2  9  
ATOM 9726  H HG3  . LYS A 1 6  ? 11.752  9.105   14.989  1.00 0.00 ? 6  LYS A HG3  9  
ATOM 9727  H HD2  . LYS A 1 6  ? 14.121  9.523   14.987  1.00 0.00 ? 6  LYS A HD2  9  
ATOM 9728  H HD3  . LYS A 1 6  ? 13.967  10.723  16.271  1.00 0.00 ? 6  LYS A HD3  9  
ATOM 9729  H HE2  . LYS A 1 6  ? 14.788  8.488   17.078  1.00 0.00 ? 6  LYS A HE2  9  
ATOM 9730  H HE3  . LYS A 1 6  ? 13.303  9.025   17.865  1.00 0.00 ? 6  LYS A HE3  9  
ATOM 9731  H HZ1  . LYS A 1 6  ? 13.069  7.418   15.431  1.00 0.00 ? 6  LYS A HZ1  9  
ATOM 9732  H HZ2  . LYS A 1 6  ? 12.058  7.474   16.792  1.00 0.00 ? 6  LYS A HZ2  9  
ATOM 9733  H HZ3  . LYS A 1 6  ? 13.529  6.626   16.863  1.00 0.00 ? 6  LYS A HZ3  9  
ATOM 9734  N N    . VAL A 1 7  ? 9.394   9.319   13.381  1.00 0.00 ? 7  VAL A N    9  
ATOM 9735  C CA   . VAL A 1 7  ? 9.090   8.296   12.332  1.00 0.00 ? 7  VAL A CA   9  
ATOM 9736  C C    . VAL A 1 7  ? 7.606   7.933   12.394  1.00 0.00 ? 7  VAL A C    9  
ATOM 9737  O O    . VAL A 1 7  ? 7.029   7.810   13.457  1.00 0.00 ? 7  VAL A O    9  
ATOM 9738  C CB   . VAL A 1 7  ? 9.931   7.042   12.584  1.00 0.00 ? 7  VAL A CB   9  
ATOM 9739  C CG1  . VAL A 1 7  ? 11.399  7.339   12.277  1.00 0.00 ? 7  VAL A CG1  9  
ATOM 9740  C CG2  . VAL A 1 7  ? 9.793   6.624   14.050  1.00 0.00 ? 7  VAL A CG2  9  
ATOM 9741  H H    . VAL A 1 7  ? 8.998   9.230   14.273  1.00 0.00 ? 7  VAL A H    9  
ATOM 9742  H HA   . VAL A 1 7  ? 9.319   8.690   11.350  1.00 0.00 ? 7  VAL A HA   9  
ATOM 9743  H HB   . VAL A 1 7  ? 9.584   6.243   11.945  1.00 0.00 ? 7  VAL A HB   9  
ATOM 9744  H HG11 . VAL A 1 7  ? 11.707  8.225   12.812  1.00 0.00 ? 7  VAL A HG11 9  
ATOM 9745  H HG12 . VAL A 1 7  ? 11.519  7.499   11.216  1.00 0.00 ? 7  VAL A HG12 9  
ATOM 9746  H HG13 . VAL A 1 7  ? 12.008  6.502   12.586  1.00 0.00 ? 7  VAL A HG13 9  
ATOM 9747  H HG21 . VAL A 1 7  ? 10.136  7.425   14.687  1.00 0.00 ? 7  VAL A HG21 9  
ATOM 9748  H HG22 . VAL A 1 7  ? 10.387  5.740   14.230  1.00 0.00 ? 7  VAL A HG22 9  
ATOM 9749  H HG23 . VAL A 1 7  ? 8.757   6.411   14.268  1.00 0.00 ? 7  VAL A HG23 9  
ATOM 9750  N N    . THR A 1 8  ? 6.981   7.763   11.260  1.00 0.00 ? 8  THR A N    9  
ATOM 9751  C CA   . THR A 1 8  ? 5.534   7.412   11.251  1.00 0.00 ? 8  THR A CA   9  
ATOM 9752  C C    . THR A 1 8  ? 5.351   5.969   11.728  1.00 0.00 ? 8  THR A C    9  
ATOM 9753  O O    . THR A 1 8  ? 4.517   5.684   12.564  1.00 0.00 ? 8  THR A O    9  
ATOM 9754  C CB   . THR A 1 8  ? 4.989   7.553   9.827   1.00 0.00 ? 8  THR A CB   9  
ATOM 9755  O OG1  . THR A 1 8  ? 5.274   8.857   9.341   1.00 0.00 ? 8  THR A OG1  9  
ATOM 9756  C CG2  . THR A 1 8  ? 3.477   7.328   9.832   1.00 0.00 ? 8  THR A CG2  9  
ATOM 9757  H H    . THR A 1 8  ? 7.465   7.870   10.415  1.00 0.00 ? 8  THR A H    9  
ATOM 9758  H HA   . THR A 1 8  ? 4.997   8.079   11.909  1.00 0.00 ? 8  THR A HA   9  
ATOM 9759  H HB   . THR A 1 8  ? 5.456   6.820   9.188   1.00 0.00 ? 8  THR A HB   9  
ATOM 9760  H HG1  . THR A 1 8  ? 5.440   8.793   8.399   1.00 0.00 ? 8  THR A HG1  9  
ATOM 9761  H HG21 . THR A 1 8  ? 3.016   7.995   10.546  1.00 0.00 ? 8  THR A HG21 9  
ATOM 9762  H HG22 . THR A 1 8  ? 3.265   6.305   10.106  1.00 0.00 ? 8  THR A HG22 9  
ATOM 9763  H HG23 . THR A 1 8  ? 3.081   7.527   8.847   1.00 0.00 ? 8  THR A HG23 9  
ATOM 9764  N N    . SER A 1 9  ? 6.123   5.055   11.205  1.00 0.00 ? 9  SER A N    9  
ATOM 9765  C CA   . SER A 1 9  ? 5.990   3.634   11.630  1.00 0.00 ? 9  SER A CA   9  
ATOM 9766  C C    . SER A 1 9  ? 4.538   3.185   11.447  1.00 0.00 ? 9  SER A C    9  
ATOM 9767  O O    . SER A 1 9  ? 3.702   3.933   10.981  1.00 0.00 ? 9  SER A O    9  
ATOM 9768  C CB   . SER A 1 9  ? 6.385   3.499   13.101  1.00 0.00 ? 9  SER A CB   9  
ATOM 9769  O OG   . SER A 1 9  ? 6.527   2.122   13.424  1.00 0.00 ? 9  SER A OG   9  
ATOM 9770  H H    . SER A 1 9  ? 6.790   5.305   10.531  1.00 0.00 ? 9  SER A H    9  
ATOM 9771  H HA   . SER A 1 9  ? 6.636   3.015   11.025  1.00 0.00 ? 9  SER A HA   9  
ATOM 9772  H HB2  . SER A 1 9  ? 7.323   4.001   13.270  1.00 0.00 ? 9  SER A HB2  9  
ATOM 9773  H HB3  . SER A 1 9  ? 5.621   3.950   13.720  1.00 0.00 ? 9  SER A HB3  9  
ATOM 9774  H HG   . SER A 1 9  ? 6.424   2.028   14.373  1.00 0.00 ? 9  SER A HG   9  
ATOM 9775  N N    . GLY A 1 10 ? 4.231   1.967   11.811  1.00 0.00 ? 10 GLY A N    9  
ATOM 9776  C CA   . GLY A 1 10 ? 2.833   1.471   11.657  1.00 0.00 ? 10 GLY A CA   9  
ATOM 9777  C C    . GLY A 1 10 ? 2.308   1.832   10.266  1.00 0.00 ? 10 GLY A C    9  
ATOM 9778  O O    . GLY A 1 10 ? 3.069   2.034   9.340   1.00 0.00 ? 10 GLY A O    9  
ATOM 9779  H H    . GLY A 1 10 ? 4.920   1.380   12.186  1.00 0.00 ? 10 GLY A H    9  
ATOM 9780  H HA2  . GLY A 1 10 ? 2.818   0.397   11.781  1.00 0.00 ? 10 GLY A HA2  9  
ATOM 9781  H HA3  . GLY A 1 10 ? 2.204   1.928   12.406  1.00 0.00 ? 10 GLY A HA3  9  
ATOM 9782  N N    . HIS A 1 11 ? 1.010   1.913   10.114  1.00 0.00 ? 11 HIS A N    9  
ATOM 9783  C CA   . HIS A 1 11 ? 0.415   2.260   8.785   1.00 0.00 ? 11 HIS A CA   9  
ATOM 9784  C C    . HIS A 1 11 ? -0.689  3.302   8.986   1.00 0.00 ? 11 HIS A C    9  
ATOM 9785  O O    . HIS A 1 11 ? -1.345  3.714   8.050   1.00 0.00 ? 11 HIS A O    9  
ATOM 9786  C CB   . HIS A 1 11 ? -0.178  0.998   8.152   1.00 0.00 ? 11 HIS A CB   9  
ATOM 9787  C CG   . HIS A 1 11 ? -0.906  0.207   9.204   1.00 0.00 ? 11 HIS A CG   9  
ATOM 9788  N ND1  . HIS A 1 11 ? -0.796  -1.171  9.300   1.00 0.00 ? 11 HIS A ND1  9  
ATOM 9789  C CD2  . HIS A 1 11 ? -1.756  0.587   10.213  1.00 0.00 ? 11 HIS A CD2  9  
ATOM 9790  C CE1  . HIS A 1 11 ? -1.561  -1.567  10.335  1.00 0.00 ? 11 HIS A CE1  9  
ATOM 9791  N NE2  . HIS A 1 11 ? -2.168  -0.535  10.926  1.00 0.00 ? 11 HIS A NE2  9  
ATOM 9792  H H    . HIS A 1 11 ? 0.422   1.740   10.879  1.00 0.00 ? 11 HIS A H    9  
ATOM 9793  H HA   . HIS A 1 11 ? 1.174   2.667   8.131   1.00 0.00 ? 11 HIS A HA   9  
ATOM 9794  H HB2  . HIS A 1 11 ? -0.866  1.274   7.368   1.00 0.00 ? 11 HIS A HB2  9  
ATOM 9795  H HB3  . HIS A 1 11 ? 0.618   0.396   7.739   1.00 0.00 ? 11 HIS A HB3  9  
ATOM 9796  H HD1  . HIS A 1 11 ? -0.260  -1.751  8.722   1.00 0.00 ? 11 HIS A HD1  9  
ATOM 9797  H HD2  . HIS A 1 11 ? -2.057  1.601   10.423  1.00 0.00 ? 11 HIS A HD2  9  
ATOM 9798  H HE1  . HIS A 1 11 ? -1.669  -2.595  10.649  1.00 0.00 ? 11 HIS A HE1  9  
ATOM 9799  N N    . THR A 1 12 ? -0.893  3.733   10.201  1.00 0.00 ? 12 THR A N    9  
ATOM 9800  C CA   . THR A 1 12 ? -1.950  4.751   10.465  1.00 0.00 ? 12 THR A CA   9  
ATOM 9801  C C    . THR A 1 12 ? -3.264  4.310   9.817   1.00 0.00 ? 12 THR A C    9  
ATOM 9802  O O    . THR A 1 12 ? -3.760  4.948   8.910   1.00 0.00 ? 12 THR A O    9  
ATOM 9803  C CB   . THR A 1 12 ? -1.518  6.098   9.879   1.00 0.00 ? 12 THR A CB   9  
ATOM 9804  O OG1  . THR A 1 12 ? -0.184  6.379   10.278  1.00 0.00 ? 12 THR A OG1  9  
ATOM 9805  C CG2  . THR A 1 12 ? -2.448  7.200   10.388  1.00 0.00 ? 12 THR A CG2  9  
ATOM 9806  H H    . THR A 1 12 ? -0.350  3.389   10.940  1.00 0.00 ? 12 THR A H    9  
ATOM 9807  H HA   . THR A 1 12 ? -2.092  4.852   11.531  1.00 0.00 ? 12 THR A HA   9  
ATOM 9808  H HB   . THR A 1 12 ? -1.571  6.055   8.803   1.00 0.00 ? 12 THR A HB   9  
ATOM 9809  H HG1  . THR A 1 12 ? -0.132  7.310   10.506  1.00 0.00 ? 12 THR A HG1  9  
ATOM 9810  H HG21 . THR A 1 12 ? -2.224  8.125   9.876   1.00 0.00 ? 12 THR A HG21 9  
ATOM 9811  H HG22 . THR A 1 12 ? -2.304  7.332   11.451  1.00 0.00 ? 12 THR A HG22 9  
ATOM 9812  H HG23 . THR A 1 12 ? -3.474  6.922   10.196  1.00 0.00 ? 12 THR A HG23 9  
ATOM 9813  N N    . THR A 1 13 ? -3.830  3.229   10.281  1.00 0.00 ? 13 THR A N    9  
ATOM 9814  C CA   . THR A 1 13 ? -5.116  2.740   9.704   1.00 0.00 ? 13 THR A CA   9  
ATOM 9815  C C    . THR A 1 13 ? -4.937  2.433   8.213   1.00 0.00 ? 13 THR A C    9  
ATOM 9816  O O    . THR A 1 13 ? -4.520  3.271   7.439   1.00 0.00 ? 13 THR A O    9  
ATOM 9817  C CB   . THR A 1 13 ? -6.199  3.809   9.881   1.00 0.00 ? 13 THR A CB   9  
ATOM 9818  O OG1  . THR A 1 13 ? -6.109  4.358   11.189  1.00 0.00 ? 13 THR A OG1  9  
ATOM 9819  C CG2  . THR A 1 13 ? -7.581  3.180   9.686   1.00 0.00 ? 13 THR A CG2  9  
ATOM 9820  H H    . THR A 1 13 ? -3.409  2.736   11.017  1.00 0.00 ? 13 THR A H    9  
ATOM 9821  H HA   . THR A 1 13 ? -5.416  1.838   10.218  1.00 0.00 ? 13 THR A HA   9  
ATOM 9822  H HB   . THR A 1 13 ? -6.061  4.592   9.152   1.00 0.00 ? 13 THR A HB   9  
ATOM 9823  H HG1  . THR A 1 13 ? -5.725  5.234   11.117  1.00 0.00 ? 13 THR A HG1  9  
ATOM 9824  H HG21 . THR A 1 13 ? -7.654  2.777   8.686   1.00 0.00 ? 13 THR A HG21 9  
ATOM 9825  H HG22 . THR A 1 13 ? -8.342  3.932   9.827   1.00 0.00 ? 13 THR A HG22 9  
ATOM 9826  H HG23 . THR A 1 13 ? -7.720  2.386   10.405  1.00 0.00 ? 13 THR A HG23 9  
ATOM 9827  N N    . THR A 1 14 ? -5.256  1.236   7.807   1.00 0.00 ? 14 THR A N    9  
ATOM 9828  C CA   . THR A 1 14 ? -5.112  0.868   6.370   1.00 0.00 ? 14 THR A CA   9  
ATOM 9829  C C    . THR A 1 14 ? -5.887  -0.422  6.103   1.00 0.00 ? 14 THR A C    9  
ATOM 9830  O O    . THR A 1 14 ? -5.422  -1.508  6.385   1.00 0.00 ? 14 THR A O    9  
ATOM 9831  C CB   . THR A 1 14 ? -3.633  0.655   6.040   1.00 0.00 ? 14 THR A CB   9  
ATOM 9832  O OG1  . THR A 1 14 ? -2.909  1.839   6.342   1.00 0.00 ? 14 THR A OG1  9  
ATOM 9833  C CG2  . THR A 1 14 ? -3.481  0.326   4.555   1.00 0.00 ? 14 THR A CG2  9  
ATOM 9834  H H    . THR A 1 14 ? -5.595  0.576   8.447   1.00 0.00 ? 14 THR A H    9  
ATOM 9835  H HA   . THR A 1 14 ? -5.509  1.661   5.753   1.00 0.00 ? 14 THR A HA   9  
ATOM 9836  H HB   . THR A 1 14 ? -3.247  -0.164  6.627   1.00 0.00 ? 14 THR A HB   9  
ATOM 9837  H HG1  . THR A 1 14 ? -2.197  1.922   5.703   1.00 0.00 ? 14 THR A HG1  9  
ATOM 9838  H HG21 . THR A 1 14 ? -3.944  -0.627  4.348   1.00 0.00 ? 14 THR A HG21 9  
ATOM 9839  H HG22 . THR A 1 14 ? -2.432  0.281   4.302   1.00 0.00 ? 14 THR A HG22 9  
ATOM 9840  H HG23 . THR A 1 14 ? -3.960  1.095   3.965   1.00 0.00 ? 14 THR A HG23 9  
ATOM 9841  N N    . THR A 1 15 ? -7.076  -0.314  5.570   1.00 0.00 ? 15 THR A N    9  
ATOM 9842  C CA   . THR A 1 15 ? -7.890  -1.533  5.298   1.00 0.00 ? 15 THR A CA   9  
ATOM 9843  C C    . THR A 1 15 ? -7.555  -2.083  3.911   1.00 0.00 ? 15 THR A C    9  
ATOM 9844  O O    . THR A 1 15 ? -7.063  -1.380  3.051   1.00 0.00 ? 15 THR A O    9  
ATOM 9845  C CB   . THR A 1 15 ? -9.376  -1.174  5.351   1.00 0.00 ? 15 THR A CB   9  
ATOM 9846  O OG1  . THR A 1 15 ? -10.139 -2.252  4.825   1.00 0.00 ? 15 THR A OG1  9  
ATOM 9847  C CG2  . THR A 1 15 ? -9.630  0.085   4.520   1.00 0.00 ? 15 THR A CG2  9  
ATOM 9848  H H    . THR A 1 15 ? -7.440  0.573   5.362   1.00 0.00 ? 15 THR A H    9  
ATOM 9849  H HA   . THR A 1 15 ? -7.678  -2.286  6.044   1.00 0.00 ? 15 THR A HA   9  
ATOM 9850  H HB   . THR A 1 15 ? -9.669  -0.991  6.373   1.00 0.00 ? 15 THR A HB   9  
ATOM 9851  H HG1  . THR A 1 15 ? -10.476 -2.766  5.563   1.00 0.00 ? 15 THR A HG1  9  
ATOM 9852  H HG21 . THR A 1 15 ? -9.160  -0.022  3.554   1.00 0.00 ? 15 THR A HG21 9  
ATOM 9853  H HG22 . THR A 1 15 ? -9.216  0.941   5.031   1.00 0.00 ? 15 THR A HG22 9  
ATOM 9854  H HG23 . THR A 1 15 ? -10.693 0.223   4.391   1.00 0.00 ? 15 THR A HG23 9  
ATOM 9855  N N    . ARG A 1 16 ? -7.827  -3.340  3.694   1.00 0.00 ? 16 ARG A N    9  
ATOM 9856  C CA   . ARG A 1 16 ? -7.543  -3.962  2.373   1.00 0.00 ? 16 ARG A CA   9  
ATOM 9857  C C    . ARG A 1 16 ? -8.543  -5.100  2.144   1.00 0.00 ? 16 ARG A C    9  
ATOM 9858  O O    . ARG A 1 16 ? -9.081  -5.644  3.086   1.00 0.00 ? 16 ARG A O    9  
ATOM 9859  C CB   . ARG A 1 16 ? -6.110  -4.517  2.357   1.00 0.00 ? 16 ARG A CB   9  
ATOM 9860  C CG   . ARG A 1 16 ? -5.893  -5.475  3.545   1.00 0.00 ? 16 ARG A CG   9  
ATOM 9861  C CD   . ARG A 1 16 ? -5.874  -4.703  4.883   1.00 0.00 ? 16 ARG A CD   9  
ATOM 9862  N NE   . ARG A 1 16 ? -4.800  -5.256  5.768   1.00 0.00 ? 16 ARG A NE   9  
ATOM 9863  C CZ   . ARG A 1 16 ? -4.666  -6.544  5.949   1.00 0.00 ? 16 ARG A CZ   9  
ATOM 9864  N NH1  . ARG A 1 16 ? -5.558  -7.376  5.487   1.00 0.00 ? 16 ARG A NH1  9  
ATOM 9865  N NH2  . ARG A 1 16 ? -3.654  -6.999  6.637   1.00 0.00 ? 16 ARG A NH2  9  
ATOM 9866  H H    . ARG A 1 16 ? -8.230  -3.877  4.407   1.00 0.00 ? 16 ARG A H    9  
ATOM 9867  H HA   . ARG A 1 16 ? -7.653  -3.221  1.593   1.00 0.00 ? 16 ARG A HA   9  
ATOM 9868  H HB2  . ARG A 1 16 ? -5.948  -5.054  1.433   1.00 0.00 ? 16 ARG A HB2  9  
ATOM 9869  H HB3  . ARG A 1 16 ? -5.407  -3.700  2.420   1.00 0.00 ? 16 ARG A HB3  9  
ATOM 9870  H HG2  . ARG A 1 16 ? -6.687  -6.205  3.557   1.00 0.00 ? 16 ARG A HG2  9  
ATOM 9871  H HG3  . ARG A 1 16 ? -4.948  -5.984  3.418   1.00 0.00 ? 16 ARG A HG3  9  
ATOM 9872  H HD2  . ARG A 1 16 ? -5.654  -3.665  4.713   1.00 0.00 ? 16 ARG A HD2  9  
ATOM 9873  H HD3  . ARG A 1 16 ? -6.845  -4.784  5.364   1.00 0.00 ? 16 ARG A HD3  9  
ATOM 9874  H HE   . ARG A 1 16 ? -4.159  -4.644  6.187   1.00 0.00 ? 16 ARG A HE   9  
ATOM 9875  H HH11 . ARG A 1 16 ? -6.353  -7.032  4.995   1.00 0.00 ? 16 ARG A HH11 9  
ATOM 9876  H HH12 . ARG A 1 16 ? -5.445  -8.360  5.626   1.00 0.00 ? 16 ARG A HH12 9  
ATOM 9877  H HH21 . ARG A 1 16 ? -2.986  -6.362  7.022   1.00 0.00 ? 16 ARG A HH21 9  
ATOM 9878  H HH22 . ARG A 1 16 ? -3.547  -7.983  6.778   1.00 0.00 ? 16 ARG A HH22 9  
ATOM 9879  N N    . ARG A 1 17 ? -8.811  -5.437  0.903   1.00 0.00 ? 17 ARG A N    9  
ATOM 9880  C CA   . ARG A 1 17 ? -9.801  -6.531  0.592   1.00 0.00 ? 17 ARG A CA   9  
ATOM 9881  C C    . ARG A 1 17 ? -11.221 -5.939  0.557   1.00 0.00 ? 17 ARG A C    9  
ATOM 9882  O O    . ARG A 1 17 ? -12.196 -6.607  0.825   1.00 0.00 ? 17 ARG A O    9  
ATOM 9883  C CB   . ARG A 1 17 ? -9.711  -7.668  1.648   1.00 0.00 ? 17 ARG A CB   9  
ATOM 9884  C CG   . ARG A 1 17 ? -10.032 -9.046  1.025   1.00 0.00 ? 17 ARG A CG   9  
ATOM 9885  C CD   . ARG A 1 17 ? -11.550 -9.229  0.844   1.00 0.00 ? 17 ARG A CD   9  
ATOM 9886  N NE   . ARG A 1 17 ? -11.887 -10.689 0.879   1.00 0.00 ? 17 ARG A NE   9  
ATOM 9887  C CZ   . ARG A 1 17 ? -11.261 -11.554 0.126   1.00 0.00 ? 17 ARG A CZ   9  
ATOM 9888  N NH1  . ARG A 1 17 ? -10.469 -11.152 -0.828  1.00 0.00 ? 17 ARG A NH1  9  
ATOM 9889  N NH2  . ARG A 1 17 ? -11.480 -12.830 0.290   1.00 0.00 ? 17 ARG A NH2  9  
ATOM 9890  H H    . ARG A 1 17 ? -8.377  -4.941  0.164   1.00 0.00 ? 17 ARG A H    9  
ATOM 9891  H HA   . ARG A 1 17 ? -9.571  -6.925  -0.386  1.00 0.00 ? 17 ARG A HA   9  
ATOM 9892  H HB2  . ARG A 1 17 ? -8.708  -7.697  2.045   1.00 0.00 ? 17 ARG A HB2  9  
ATOM 9893  H HB3  . ARG A 1 17 ? -10.398 -7.468  2.456   1.00 0.00 ? 17 ARG A HB3  9  
ATOM 9894  H HG2  . ARG A 1 17 ? -9.540  -9.130  0.072   1.00 0.00 ? 17 ARG A HG2  9  
ATOM 9895  H HG3  . ARG A 1 17 ? -9.661  -9.820  1.681   1.00 0.00 ? 17 ARG A HG3  9  
ATOM 9896  H HD2  . ARG A 1 17 ? -12.074 -8.761  1.654   1.00 0.00 ? 17 ARG A HD2  9  
ATOM 9897  H HD3  . ARG A 1 17 ? -11.860 -8.775  -0.092  1.00 0.00 ? 17 ARG A HD3  9  
ATOM 9898  H HE   . ARG A 1 17 ? -12.554 -11.008 1.523   1.00 0.00 ? 17 ARG A HE   9  
ATOM 9899  H HH11 . ARG A 1 17 ? -10.339 -10.177 -0.994  1.00 0.00 ? 17 ARG A HH11 9  
ATOM 9900  H HH12 . ARG A 1 17 ? -9.990  -11.822 -1.394  1.00 0.00 ? 17 ARG A HH12 9  
ATOM 9901  H HH21 . ARG A 1 17 ? -12.124 -13.140 0.989   1.00 0.00 ? 17 ARG A HH21 9  
ATOM 9902  H HH22 . ARG A 1 17 ? -11.005 -13.496 -0.283  1.00 0.00 ? 17 ARG A HH22 9  
ATOM 9903  N N    . SER A 1 18 ? -11.338 -4.695  0.183   1.00 0.00 ? 18 SER A N    9  
ATOM 9904  C CA   . SER A 1 18 ? -12.674 -4.033  0.067   1.00 0.00 ? 18 SER A CA   9  
ATOM 9905  C C    . SER A 1 18 ? -12.601 -3.198  -1.204  1.00 0.00 ? 18 SER A C    9  
ATOM 9906  O O    . SER A 1 18 ? -13.580 -2.893  -1.856  1.00 0.00 ? 18 SER A O    9  
ATOM 9907  C CB   . SER A 1 18 ? -12.921 -3.129  1.276   1.00 0.00 ? 18 SER A CB   9  
ATOM 9908  O OG   . SER A 1 18 ? -13.044 -3.928  2.445   1.00 0.00 ? 18 SER A OG   9  
ATOM 9909  H H    . SER A 1 18 ? -10.543 -4.180  -0.068  1.00 0.00 ? 18 SER A H    9  
ATOM 9910  H HA   . SER A 1 18 ? -13.458 -4.775  -0.019  1.00 0.00 ? 18 SER A HA   9  
ATOM 9911  H HB2  . SER A 1 18 ? -12.091 -2.451  1.397   1.00 0.00 ? 18 SER A HB2  9  
ATOM 9912  H HB3  . SER A 1 18 ? -13.826 -2.559  1.119   1.00 0.00 ? 18 SER A HB3  9  
ATOM 9913  H HG   . SER A 1 18 ? -13.483 -3.403  3.119   1.00 0.00 ? 18 SER A HG   9  
ATOM 9914  N N    . CYS A 1 19 ? -11.389 -2.899  -1.562  1.00 0.00 ? 19 CYS A N    9  
ATOM 9915  C CA   . CYS A 1 19 ? -11.097 -2.154  -2.807  1.00 0.00 ? 19 CYS A CA   9  
ATOM 9916  C C    . CYS A 1 19 ? -9.717  -2.579  -3.291  1.00 0.00 ? 19 CYS A C    9  
ATOM 9917  O O    . CYS A 1 19 ? -9.018  -3.307  -2.616  1.00 0.00 ? 19 CYS A O    9  
ATOM 9918  C CB   . CYS A 1 19 ? -11.123 -0.648  -2.562  1.00 0.00 ? 19 CYS A CB   9  
ATOM 9919  S SG   . CYS A 1 19 ? -11.055 0.200   -4.160  1.00 0.00 ? 19 CYS A SG   9  
ATOM 9920  H H    . CYS A 1 19 ? -10.671 -3.246  -1.000  1.00 0.00 ? 19 CYS A H    9  
ATOM 9921  H HA   . CYS A 1 19 ? -11.830 -2.416  -3.555  1.00 0.00 ? 19 CYS A HA   9  
ATOM 9922  H HB2  . CYS A 1 19 ? -12.034 -0.379  -2.047  1.00 0.00 ? 19 CYS A HB2  9  
ATOM 9923  H HB3  . CYS A 1 19 ? -10.271 -0.362  -1.964  1.00 0.00 ? 19 CYS A HB3  9  
ATOM 9924  N N    . SER A 1 20 ? -9.312  -2.147  -4.445  1.00 0.00 ? 20 SER A N    9  
ATOM 9925  C CA   . SER A 1 20 ? -7.970  -2.558  -4.931  1.00 0.00 ? 20 SER A CA   9  
ATOM 9926  C C    . SER A 1 20 ? -6.894  -1.961  -4.021  1.00 0.00 ? 20 SER A C    9  
ATOM 9927  O O    . SER A 1 20 ? -6.704  -0.761  -3.971  1.00 0.00 ? 20 SER A O    9  
ATOM 9928  C CB   . SER A 1 20 ? -7.772  -2.052  -6.360  1.00 0.00 ? 20 SER A CB   9  
ATOM 9929  O OG   . SER A 1 20 ? -8.952  -2.301  -7.114  1.00 0.00 ? 20 SER A OG   9  
ATOM 9930  H H    . SER A 1 20 ? -9.885  -1.563  -4.985  1.00 0.00 ? 20 SER A H    9  
ATOM 9931  H HA   . SER A 1 20 ? -7.896  -3.634  -4.918  1.00 0.00 ? 20 SER A HA   9  
ATOM 9932  H HB2  . SER A 1 20 ? -7.577  -0.992  -6.346  1.00 0.00 ? 20 SER A HB2  9  
ATOM 9933  H HB3  . SER A 1 20 ? -6.931  -2.564  -6.809  1.00 0.00 ? 20 SER A HB3  9  
ATOM 9934  H HG   . SER A 1 20 ? -8.807  -1.983  -8.008  1.00 0.00 ? 20 SER A HG   9  
ATOM 9935  N N    . LYS A 1 21 ? -6.181  -2.795  -3.304  1.00 0.00 ? 21 LYS A N    9  
ATOM 9936  C CA   . LYS A 1 21 ? -5.098  -2.301  -2.392  1.00 0.00 ? 21 LYS A CA   9  
ATOM 9937  C C    . LYS A 1 21 ? -3.884  -3.212  -2.598  1.00 0.00 ? 21 LYS A C    9  
ATOM 9938  O O    . LYS A 1 21 ? -3.943  -4.406  -2.374  1.00 0.00 ? 21 LYS A O    9  
ATOM 9939  C CB   . LYS A 1 21 ? -5.580  -2.337  -0.908  1.00 0.00 ? 21 LYS A CB   9  
ATOM 9940  C CG   . LYS A 1 21 ? -5.491  -0.940  -0.271  1.00 0.00 ? 21 LYS A CG   9  
ATOM 9941  C CD   . LYS A 1 21 ? -4.026  -0.596  0.008   1.00 0.00 ? 21 LYS A CD   9  
ATOM 9942  C CE   . LYS A 1 21 ? -3.894  0.903   0.283   1.00 0.00 ? 21 LYS A CE   9  
ATOM 9943  N NZ   . LYS A 1 21 ? -2.524  1.197   0.792   1.00 0.00 ? 21 LYS A NZ   9  
ATOM 9944  H H    . LYS A 1 21 ? -6.358  -3.759  -3.355  1.00 0.00 ? 21 LYS A H    9  
ATOM 9945  H HA   . LYS A 1 21 ? -4.822  -1.291  -2.674  1.00 0.00 ? 21 LYS A HA   9  
ATOM 9946  H HB2  . LYS A 1 21 ? -6.608  -2.667  -0.870  1.00 0.00 ? 21 LYS A HB2  9  
ATOM 9947  H HB3  . LYS A 1 21 ? -4.969  -3.023  -0.334  1.00 0.00 ? 21 LYS A HB3  9  
ATOM 9948  H HG2  . LYS A 1 21 ? -5.915  -0.208  -0.942  1.00 0.00 ? 21 LYS A HG2  9  
ATOM 9949  H HG3  . LYS A 1 21 ? -6.041  -0.936  0.659   1.00 0.00 ? 21 LYS A HG3  9  
ATOM 9950  H HD2  . LYS A 1 21 ? -3.686  -1.150  0.870   1.00 0.00 ? 21 LYS A HD2  9  
ATOM 9951  H HD3  . LYS A 1 21 ? -3.424  -0.856  -0.849  1.00 0.00 ? 21 LYS A HD3  9  
ATOM 9952  H HE2  . LYS A 1 21 ? -4.066  1.454   -0.629  1.00 0.00 ? 21 LYS A HE2  9  
ATOM 9953  H HE3  . LYS A 1 21 ? -4.623  1.197   1.024   1.00 0.00 ? 21 LYS A HE3  9  
ATOM 9954  H HZ1  . LYS A 1 21 ? -2.188  2.093   0.384   1.00 0.00 ? 21 LYS A HZ1  9  
ATOM 9955  H HZ2  . LYS A 1 21 ? -1.880  0.430   0.517   1.00 0.00 ? 21 LYS A HZ2  9  
ATOM 9956  H HZ3  . LYS A 1 21 ? -2.550  1.276   1.829   1.00 0.00 ? 21 LYS A HZ3  9  
ATOM 9957  N N    . VAL A 1 22 ? -2.786  -2.645  -3.021  1.00 0.00 ? 22 VAL A N    9  
ATOM 9958  C CA   . VAL A 1 22 ? -1.544  -3.451  -3.249  1.00 0.00 ? 22 VAL A CA   9  
ATOM 9959  C C    . VAL A 1 22 ? -0.343  -2.773  -2.587  1.00 0.00 ? 22 VAL A C    9  
ATOM 9960  O O    . VAL A 1 22 ? -0.006  -1.654  -2.921  1.00 0.00 ? 22 VAL A O    9  
ATOM 9961  C CB   . VAL A 1 22 ? -1.312  -3.577  -4.754  1.00 0.00 ? 22 VAL A CB   9  
ATOM 9962  C CG1  . VAL A 1 22 ? -0.051  -4.402  -5.015  1.00 0.00 ? 22 VAL A CG1  9  
ATOM 9963  C CG2  . VAL A 1 22 ? -2.521  -4.273  -5.384  1.00 0.00 ? 22 VAL A CG2  9  
ATOM 9964  H H    . VAL A 1 22 ? -2.782  -1.673  -3.148  1.00 0.00 ? 22 VAL A H    9  
ATOM 9965  H HA   . VAL A 1 22 ? -1.662  -4.441  -2.829  1.00 0.00 ? 22 VAL A HA   9  
ATOM 9966  H HB   . VAL A 1 22 ? -1.195  -2.592  -5.184  1.00 0.00 ? 22 VAL A HB   9  
ATOM 9967  H HG11 . VAL A 1 22 ? 0.822   -3.801  -4.807  1.00 0.00 ? 22 VAL A HG11 9  
ATOM 9968  H HG12 . VAL A 1 22 ? -0.034  -4.716  -6.049  1.00 0.00 ? 22 VAL A HG12 9  
ATOM 9969  H HG13 . VAL A 1 22 ? -0.051  -5.271  -4.375  1.00 0.00 ? 22 VAL A HG13 9  
ATOM 9970  H HG21 . VAL A 1 22 ? -2.393  -4.320  -6.455  1.00 0.00 ? 22 VAL A HG21 9  
ATOM 9971  H HG22 . VAL A 1 22 ? -3.419  -3.717  -5.152  1.00 0.00 ? 22 VAL A HG22 9  
ATOM 9972  H HG23 . VAL A 1 22 ? -2.607  -5.274  -4.986  1.00 0.00 ? 22 VAL A HG23 9  
ATOM 9973  N N    . ILE A 1 23 ? 0.320   -3.436  -1.664  1.00 0.00 ? 23 ILE A N    9  
ATOM 9974  C CA   . ILE A 1 23 ? 1.517   -2.817  -0.997  1.00 0.00 ? 23 ILE A CA   9  
ATOM 9975  C C    . ILE A 1 23 ? 2.768   -3.613  -1.393  1.00 0.00 ? 23 ILE A C    9  
ATOM 9976  O O    . ILE A 1 23 ? 2.954   -4.743  -0.987  1.00 0.00 ? 23 ILE A O    9  
ATOM 9977  C CB   . ILE A 1 23 ? 1.354   -2.861  0.528   1.00 0.00 ? 23 ILE A CB   9  
ATOM 9978  C CG1  . ILE A 1 23 ? 0.141   -2.014  0.962   1.00 0.00 ? 23 ILE A CG1  9  
ATOM 9979  C CG2  . ILE A 1 23 ? 2.614   -2.298  1.184   1.00 0.00 ? 23 ILE A CG2  9  
ATOM 9980  C CD1  . ILE A 1 23 ? -1.181  -2.676  0.524   1.00 0.00 ? 23 ILE A CD1  9  
ATOM 9981  H H    . ILE A 1 23 ? 0.042   -4.342  -1.404  1.00 0.00 ? 23 ILE A H    9  
ATOM 9982  H HA   . ILE A 1 23 ? 1.637   -1.789  -1.314  1.00 0.00 ? 23 ILE A HA   9  
ATOM 9983  H HB   . ILE A 1 23 ? 1.216   -3.882  0.846   1.00 0.00 ? 23 ILE A HB   9  
ATOM 9984  H HG12 . ILE A 1 23 ? 0.148   -1.913  2.039   1.00 0.00 ? 23 ILE A HG12 9  
ATOM 9985  H HG13 . ILE A 1 23 ? 0.214   -1.030  0.516   1.00 0.00 ? 23 ILE A HG13 9  
ATOM 9986  H HG21 . ILE A 1 23 ? 3.425   -3.001  1.067   1.00 0.00 ? 23 ILE A HG21 9  
ATOM 9987  H HG22 . ILE A 1 23 ? 2.430   -2.135  2.236   1.00 0.00 ? 23 ILE A HG22 9  
ATOM 9988  H HG23 . ILE A 1 23 ? 2.877   -1.363  0.714   1.00 0.00 ? 23 ILE A HG23 9  
ATOM 9989  H HD11 . ILE A 1 23 ? -1.556  -2.180  -0.358  1.00 0.00 ? 23 ILE A HD11 9  
ATOM 9990  H HD12 . ILE A 1 23 ? -1.906  -2.582  1.320   1.00 0.00 ? 23 ILE A HD12 9  
ATOM 9991  H HD13 . ILE A 1 23 ? -1.028  -3.725  0.308   1.00 0.00 ? 23 ILE A HD13 9  
ATOM 9992  N N    . THR A 1 24 ? 3.625   -3.016  -2.186  1.00 0.00 ? 24 THR A N    9  
ATOM 9993  C CA   . THR A 1 24 ? 4.880   -3.696  -2.633  1.00 0.00 ? 24 THR A CA   9  
ATOM 9994  C C    . THR A 1 24 ? 6.083   -2.782  -2.369  1.00 0.00 ? 24 THR A C    9  
ATOM 9995  O O    . THR A 1 24 ? 6.236   -1.764  -3.015  1.00 0.00 ? 24 THR A O    9  
ATOM 9996  C CB   . THR A 1 24 ? 4.793   -3.989  -4.134  1.00 0.00 ? 24 THR A CB   9  
ATOM 9997  O OG1  . THR A 1 24 ? 3.722   -4.891  -4.377  1.00 0.00 ? 24 THR A OG1  9  
ATOM 9998  C CG2  . THR A 1 24 ? 6.106   -4.612  -4.612  1.00 0.00 ? 24 THR A CG2  9  
ATOM 9999  H H    . THR A 1 24 ? 3.441   -2.112  -2.482  1.00 0.00 ? 24 THR A H    9  
ATOM 10000 H HA   . THR A 1 24 ? 5.008   -4.620  -2.099  1.00 0.00 ? 24 THR A HA   9  
ATOM 10001 H HB   . THR A 1 24 ? 4.620   -3.071  -4.673  1.00 0.00 ? 24 THR A HB   9  
ATOM 10002 H HG1  . THR A 1 24 ? 3.249   -5.017  -3.552  1.00 0.00 ? 24 THR A HG1  9  
ATOM 10003 H HG21 . THR A 1 24 ? 5.957   -5.066  -5.581  1.00 0.00 ? 24 THR A HG21 9  
ATOM 10004 H HG22 . THR A 1 24 ? 6.426   -5.365  -3.908  1.00 0.00 ? 24 THR A HG22 9  
ATOM 10005 H HG23 . THR A 1 24 ? 6.862   -3.845  -4.687  1.00 0.00 ? 24 THR A HG23 9  
ATOM 10006 N N    . LYS A 1 25 ? 6.961   -3.150  -1.462  1.00 0.00 ? 25 LYS A N    9  
ATOM 10007 C CA   . LYS A 1 25 ? 8.180   -2.324  -1.200  1.00 0.00 ? 25 LYS A CA   9  
ATOM 10008 C C    . LYS A 1 25 ? 9.364   -3.231  -1.465  1.00 0.00 ? 25 LYS A C    9  
ATOM 10009 O O    . LYS A 1 25 ? 9.621   -4.149  -0.710  1.00 0.00 ? 25 LYS A O    9  
ATOM 10010 C CB   . LYS A 1 25 ? 8.198   -1.837  0.260   1.00 0.00 ? 25 LYS A CB   9  
ATOM 10011 C CG   . LYS A 1 25 ? 6.770   -1.549  0.728   1.00 0.00 ? 25 LYS A CG   9  
ATOM 10012 C CD   . LYS A 1 25 ? 6.804   -1.023  2.163   1.00 0.00 ? 25 LYS A CD   9  
ATOM 10013 C CE   . LYS A 1 25 ? 5.435   -0.451  2.524   1.00 0.00 ? 25 LYS A CE   9  
ATOM 10014 N NZ   . LYS A 1 25 ? 5.420   -0.066  3.965   1.00 0.00 ? 25 LYS A NZ   9  
ATOM 10015 H H    . LYS A 1 25 ? 6.851   -4.001  -0.985  1.00 0.00 ? 25 LYS A H    9  
ATOM 10016 H HA   . LYS A 1 25 ? 8.222   -1.473  -1.874  1.00 0.00 ? 25 LYS A HA   9  
ATOM 10017 H HB2  . LYS A 1 25 ? 8.640   -2.590  0.898   1.00 0.00 ? 25 LYS A HB2  9  
ATOM 10018 H HB3  . LYS A 1 25 ? 8.781   -0.929  0.327   1.00 0.00 ? 25 LYS A HB3  9  
ATOM 10019 H HG2  . LYS A 1 25 ? 6.322   -0.809  0.082   1.00 0.00 ? 25 LYS A HG2  9  
ATOM 10020 H HG3  . LYS A 1 25 ? 6.188   -2.457  0.694   1.00 0.00 ? 25 LYS A HG3  9  
ATOM 10021 H HD2  . LYS A 1 25 ? 7.047   -1.832  2.837   1.00 0.00 ? 25 LYS A HD2  9  
ATOM 10022 H HD3  . LYS A 1 25 ? 7.550   -0.247  2.245   1.00 0.00 ? 25 LYS A HD3  9  
ATOM 10023 H HE2  . LYS A 1 25 ? 5.239   0.421   1.917   1.00 0.00 ? 25 LYS A HE2  9  
ATOM 10024 H HE3  . LYS A 1 25 ? 4.675   -1.195  2.342   1.00 0.00 ? 25 LYS A HE3  9  
ATOM 10025 H HZ1  . LYS A 1 25 ? 6.319   -0.345  4.406   1.00 0.00 ? 25 LYS A HZ1  9  
ATOM 10026 H HZ2  . LYS A 1 25 ? 4.636   -0.551  4.445   1.00 0.00 ? 25 LYS A HZ2  9  
ATOM 10027 H HZ3  . LYS A 1 25 ? 5.296   0.963   4.047   1.00 0.00 ? 25 LYS A HZ3  9  
ATOM 10028 N N    . THR A 1 26 ? 10.071  -3.012  -2.534  1.00 0.00 ? 26 THR A N    9  
ATOM 10029 C CA   . THR A 1 26 ? 11.224  -3.900  -2.857  1.00 0.00 ? 26 THR A CA   9  
ATOM 10030 C C    . THR A 1 26 ? 12.541  -3.160  -2.606  1.00 0.00 ? 26 THR A C    9  
ATOM 10031 O O    . THR A 1 26 ? 12.811  -2.147  -3.221  1.00 0.00 ? 26 THR A O    9  
ATOM 10032 C CB   . THR A 1 26 ? 11.150  -4.299  -4.333  1.00 0.00 ? 26 THR A CB   9  
ATOM 10033 O OG1  . THR A 1 26 ? 10.981  -3.133  -5.128  1.00 0.00 ? 26 THR A OG1  9  
ATOM 10034 C CG2  . THR A 1 26 ? 9.966   -5.242  -4.550  1.00 0.00 ? 26 THR A CG2  9  
ATOM 10035 H H    . THR A 1 26 ? 9.825   -2.280  -3.139  1.00 0.00 ? 26 THR A H    9  
ATOM 10036 H HA   . THR A 1 26 ? 11.175  -4.792  -2.247  1.00 0.00 ? 26 THR A HA   9  
ATOM 10037 H HB   . THR A 1 26 ? 12.062  -4.801  -4.618  1.00 0.00 ? 26 THR A HB   9  
ATOM 10038 H HG1  . THR A 1 26 ? 10.984  -3.399  -6.050  1.00 0.00 ? 26 THR A HG1  9  
ATOM 10039 H HG21 . THR A 1 26 ? 10.176  -6.196  -4.087  1.00 0.00 ? 26 THR A HG21 9  
ATOM 10040 H HG22 . THR A 1 26 ? 9.807   -5.384  -5.609  1.00 0.00 ? 26 THR A HG22 9  
ATOM 10041 H HG23 . THR A 1 26 ? 9.079   -4.816  -4.107  1.00 0.00 ? 26 THR A HG23 9  
ATOM 10042 N N    . VAL A 1 27 ? 13.368  -3.655  -1.715  1.00 0.00 ? 27 VAL A N    9  
ATOM 10043 C CA   . VAL A 1 27 ? 14.675  -2.975  -1.432  1.00 0.00 ? 27 VAL A CA   9  
ATOM 10044 C C    . VAL A 1 27 ? 15.813  -3.781  -2.066  1.00 0.00 ? 27 VAL A C    9  
ATOM 10045 O O    . VAL A 1 27 ? 16.103  -4.891  -1.666  1.00 0.00 ? 27 VAL A O    9  
ATOM 10046 C CB   . VAL A 1 27 ? 14.897  -2.898  0.081   1.00 0.00 ? 27 VAL A CB   9  
ATOM 10047 C CG1  . VAL A 1 27 ? 16.063  -1.953  0.376   1.00 0.00 ? 27 VAL A CG1  9  
ATOM 10048 C CG2  . VAL A 1 27 ? 13.629  -2.368  0.755   1.00 0.00 ? 27 VAL A CG2  9  
ATOM 10049 H H    . VAL A 1 27 ? 13.138  -4.472  -1.225  1.00 0.00 ? 27 VAL A H    9  
ATOM 10050 H HA   . VAL A 1 27 ? 14.675  -1.975  -1.844  1.00 0.00 ? 27 VAL A HA   9  
ATOM 10051 H HB   . VAL A 1 27 ? 15.128  -3.882  0.463   1.00 0.00 ? 27 VAL A HB   9  
ATOM 10052 H HG11 . VAL A 1 27 ? 16.191  -1.863  1.445   1.00 0.00 ? 27 VAL A HG11 9  
ATOM 10053 H HG12 . VAL A 1 27 ? 15.852  -0.980  -0.044  1.00 0.00 ? 27 VAL A HG12 9  
ATOM 10054 H HG13 . VAL A 1 27 ? 16.966  -2.347  -0.064  1.00 0.00 ? 27 VAL A HG13 9  
ATOM 10055 H HG21 . VAL A 1 27 ? 12.838  -3.096  0.657   1.00 0.00 ? 27 VAL A HG21 9  
ATOM 10056 H HG22 . VAL A 1 27 ? 13.330  -1.444  0.283   1.00 0.00 ? 27 VAL A HG22 9  
ATOM 10057 H HG23 . VAL A 1 27 ? 13.826  -2.190  1.802   1.00 0.00 ? 27 VAL A HG23 9  
ATOM 10058 N N    . THR A 1 28 ? 16.457  -3.216  -3.054  1.00 0.00 ? 28 THR A N    9  
ATOM 10059 C CA   . THR A 1 28 ? 17.588  -3.924  -3.737  1.00 0.00 ? 28 THR A CA   9  
ATOM 10060 C C    . THR A 1 28 ? 18.919  -3.277  -3.351  1.00 0.00 ? 28 THR A C    9  
ATOM 10061 O O    . THR A 1 28 ? 19.256  -2.213  -3.831  1.00 0.00 ? 28 THR A O    9  
ATOM 10062 C CB   . THR A 1 28 ? 17.401  -3.820  -5.253  1.00 0.00 ? 28 THR A CB   9  
ATOM 10063 O OG1  . THR A 1 28 ? 16.127  -4.338  -5.608  1.00 0.00 ? 28 THR A OG1  9  
ATOM 10064 C CG2  . THR A 1 28 ? 18.495  -4.624  -5.959  1.00 0.00 ? 28 THR A CG2  9  
ATOM 10065 H H    . THR A 1 28 ? 16.183  -2.316  -3.331  1.00 0.00 ? 28 THR A H    9  
ATOM 10066 H HA   . THR A 1 28 ? 17.604  -4.966  -3.452  1.00 0.00 ? 28 THR A HA   9  
ATOM 10067 H HB   . THR A 1 28 ? 17.468  -2.787  -5.555  1.00 0.00 ? 28 THR A HB   9  
ATOM 10068 H HG1  . THR A 1 28 ? 16.262  -5.100  -6.175  1.00 0.00 ? 28 THR A HG1  9  
ATOM 10069 H HG21 . THR A 1 28 ? 19.459  -4.188  -5.743  1.00 0.00 ? 28 THR A HG21 9  
ATOM 10070 H HG22 . THR A 1 28 ? 18.323  -4.605  -7.025  1.00 0.00 ? 28 THR A HG22 9  
ATOM 10071 H HG23 . THR A 1 28 ? 18.475  -5.645  -5.609  1.00 0.00 ? 28 THR A HG23 9  
ATOM 10072 N N    . ASN A 1 29 ? 19.686  -3.903  -2.488  1.00 0.00 ? 29 ASN A N    9  
ATOM 10073 C CA   . ASN A 1 29 ? 20.999  -3.314  -2.077  1.00 0.00 ? 29 ASN A CA   9  
ATOM 10074 C C    . ASN A 1 29 ? 22.126  -3.975  -2.881  1.00 0.00 ? 29 ASN A C    9  
ATOM 10075 O O    . ASN A 1 29 ? 22.386  -5.160  -2.758  1.00 0.00 ? 29 ASN A O    9  
ATOM 10076 C CB   . ASN A 1 29 ? 21.212  -3.563  -0.576  1.00 0.00 ? 29 ASN A CB   9  
ATOM 10077 C CG   . ASN A 1 29 ? 19.866  -3.490  0.147   1.00 0.00 ? 29 ASN A CG   9  
ATOM 10078 O OD1  . ASN A 1 29 ? 18.972  -4.265  -0.130  1.00 0.00 ? 29 ASN A OD1  9  
ATOM 10079 N ND2  . ASN A 1 29 ? 19.682  -2.585  1.070   1.00 0.00 ? 29 ASN A ND2  9  
ATOM 10080 H H    . ASN A 1 29 ? 19.406  -4.754  -2.089  1.00 0.00 ? 29 ASN A H    9  
ATOM 10081 H HA   . ASN A 1 29 ? 21.001  -2.248  -2.267  1.00 0.00 ? 29 ASN A HA   9  
ATOM 10082 H HB2  . ASN A 1 29 ? 21.647  -4.541  -0.425  1.00 0.00 ? 29 ASN A HB2  9  
ATOM 10083 H HB3  . ASN A 1 29 ? 21.873  -2.809  -0.175  1.00 0.00 ? 29 ASN A HB3  9  
ATOM 10084 H HD21 . ASN A 1 29 ? 20.402  -1.960  1.293   1.00 0.00 ? 29 ASN A HD21 9  
ATOM 10085 H HD22 . ASN A 1 29 ? 18.823  -2.531  1.538   1.00 0.00 ? 29 ASN A HD22 9  
ATOM 10086 N N    . ALA A 1 30 ? 22.785  -3.208  -3.705  1.00 0.00 ? 30 ALA A N    9  
ATOM 10087 C CA   . ALA A 1 30 ? 23.895  -3.748  -4.543  1.00 0.00 ? 30 ALA A CA   9  
ATOM 10088 C C    . ALA A 1 30 ? 24.879  -4.561  -3.697  1.00 0.00 ? 30 ALA A C    9  
ATOM 10089 O O    . ALA A 1 30 ? 25.750  -5.224  -4.225  1.00 0.00 ? 30 ALA A O    9  
ATOM 10090 C CB   . ALA A 1 30 ? 24.639  -2.585  -5.202  1.00 0.00 ? 30 ALA A CB   9  
ATOM 10091 H H    . ALA A 1 30 ? 22.546  -2.262  -3.786  1.00 0.00 ? 30 ALA A H    9  
ATOM 10092 H HA   . ALA A 1 30 ? 23.481  -4.382  -5.313  1.00 0.00 ? 30 ALA A HA   9  
ATOM 10093 H HB1  . ALA A 1 30 ? 25.080  -1.961  -4.438  1.00 0.00 ? 30 ALA A HB1  9  
ATOM 10094 H HB2  . ALA A 1 30 ? 23.947  -2.000  -5.789  1.00 0.00 ? 30 ALA A HB2  9  
ATOM 10095 H HB3  . ALA A 1 30 ? 25.417  -2.973  -5.844  1.00 0.00 ? 30 ALA A HB3  9  
ATOM 10096 N N    . ASP A 1 31 ? 24.779  -4.506  -2.398  1.00 0.00 ? 31 ASP A N    9  
ATOM 10097 C CA   . ASP A 1 31 ? 25.747  -5.267  -1.557  1.00 0.00 ? 31 ASP A CA   9  
ATOM 10098 C C    . ASP A 1 31 ? 25.498  -6.772  -1.698  1.00 0.00 ? 31 ASP A C    9  
ATOM 10099 O O    . ASP A 1 31 ? 26.233  -7.576  -1.162  1.00 0.00 ? 31 ASP A O    9  
ATOM 10100 C CB   . ASP A 1 31 ? 25.582  -4.856  -0.091  1.00 0.00 ? 31 ASP A CB   9  
ATOM 10101 C CG   . ASP A 1 31 ? 26.187  -3.466  0.122   1.00 0.00 ? 31 ASP A CG   9  
ATOM 10102 O OD1  . ASP A 1 31 ? 27.392  -3.386  0.295   1.00 0.00 ? 31 ASP A OD1  9  
ATOM 10103 O OD2  . ASP A 1 31 ? 25.435  -2.506  0.107   1.00 0.00 ? 31 ASP A OD2  9  
ATOM 10104 H H    . ASP A 1 31 ? 24.091  -3.957  -1.970  1.00 0.00 ? 31 ASP A H    9  
ATOM 10105 H HA   . ASP A 1 31 ? 26.752  -5.041  -1.880  1.00 0.00 ? 31 ASP A HA   9  
ATOM 10106 H HB2  . ASP A 1 31 ? 24.532  -4.833  0.161   1.00 0.00 ? 31 ASP A HB2  9  
ATOM 10107 H HB3  . ASP A 1 31 ? 26.090  -5.568  0.542   1.00 0.00 ? 31 ASP A HB3  9  
ATOM 10108 N N    . GLY A 1 32 ? 24.484  -7.164  -2.433  1.00 0.00 ? 32 GLY A N    9  
ATOM 10109 C CA   . GLY A 1 32 ? 24.211  -8.626  -2.628  1.00 0.00 ? 32 GLY A CA   9  
ATOM 10110 C C    . GLY A 1 32 ? 23.039  -9.085  -1.757  1.00 0.00 ? 32 GLY A C    9  
ATOM 10111 O O    . GLY A 1 32 ? 22.773  -10.266 -1.655  1.00 0.00 ? 32 GLY A O    9  
ATOM 10112 H H    . GLY A 1 32 ? 23.911  -6.499  -2.869  1.00 0.00 ? 32 GLY A H    9  
ATOM 10113 H HA2  . GLY A 1 32 ? 23.966  -8.800  -3.666  1.00 0.00 ? 32 GLY A HA2  9  
ATOM 10114 H HA3  . GLY A 1 32 ? 25.089  -9.204  -2.374  1.00 0.00 ? 32 GLY A HA3  9  
ATOM 10115 N N    . ARG A 1 33 ? 22.333  -8.173  -1.130  1.00 0.00 ? 33 ARG A N    9  
ATOM 10116 C CA   . ARG A 1 33 ? 21.167  -8.577  -0.265  1.00 0.00 ? 33 ARG A CA   9  
ATOM 10117 C C    . ARG A 1 33 ? 19.951  -7.730  -0.631  1.00 0.00 ? 33 ARG A C    9  
ATOM 10118 O O    . ARG A 1 33 ? 20.069  -6.569  -0.968  1.00 0.00 ? 33 ARG A O    9  
ATOM 10119 C CB   . ARG A 1 33 ? 21.508  -8.397  1.227   1.00 0.00 ? 33 ARG A CB   9  
ATOM 10120 C CG   . ARG A 1 33 ? 21.947  -6.950  1.523   1.00 0.00 ? 33 ARG A CG   9  
ATOM 10121 C CD   . ARG A 1 33 ? 22.045  -6.710  3.051   1.00 0.00 ? 33 ARG A CD   9  
ATOM 10122 N NE   . ARG A 1 33 ? 21.424  -5.392  3.402   1.00 0.00 ? 33 ARG A NE   9  
ATOM 10123 C CZ   . ARG A 1 33 ? 21.703  -4.307  2.728   1.00 0.00 ? 33 ARG A CZ   9  
ATOM 10124 N NH1  . ARG A 1 33 ? 22.615  -4.323  1.795   1.00 0.00 ? 33 ARG A NH1  9  
ATOM 10125 N NH2  . ARG A 1 33 ? 21.091  -3.191  3.015   1.00 0.00 ? 33 ARG A NH2  9  
ATOM 10126 H H    . ARG A 1 33 ? 22.560  -7.224  -1.229  1.00 0.00 ? 33 ARG A H    9  
ATOM 10127 H HA   . ARG A 1 33 ? 20.923  -9.616  -0.444  1.00 0.00 ? 33 ARG A HA   9  
ATOM 10128 H HB2  . ARG A 1 33 ? 20.632  -8.634  1.814   1.00 0.00 ? 33 ARG A HB2  9  
ATOM 10129 H HB3  . ARG A 1 33 ? 22.306  -9.074  1.492   1.00 0.00 ? 33 ARG A HB3  9  
ATOM 10130 H HG2  . ARG A 1 33 ? 22.914  -6.780  1.073   1.00 0.00 ? 33 ARG A HG2  9  
ATOM 10131 H HG3  . ARG A 1 33 ? 21.229  -6.267  1.099   1.00 0.00 ? 33 ARG A HG3  9  
ATOM 10132 H HD2  . ARG A 1 33 ? 21.511  -7.477  3.586   1.00 0.00 ? 33 ARG A HD2  9  
ATOM 10133 H HD3  . ARG A 1 33 ? 23.088  -6.733  3.355   1.00 0.00 ? 33 ARG A HD3  9  
ATOM 10134 H HE   . ARG A 1 33 ? 20.775  -5.348  4.135   1.00 0.00 ? 33 ARG A HE   9  
ATOM 10135 H HH11 . ARG A 1 33 ? 23.108  -5.164  1.593   1.00 0.00 ? 33 ARG A HH11 9  
ATOM 10136 H HH12 . ARG A 1 33 ? 22.820  -3.489  1.283   1.00 0.00 ? 33 ARG A HH12 9  
ATOM 10137 H HH21 . ARG A 1 33 ? 20.411  -3.168  3.748   1.00 0.00 ? 33 ARG A HH21 9  
ATOM 10138 H HH22 . ARG A 1 33 ? 21.302  -2.358  2.502   1.00 0.00 ? 33 ARG A HH22 9  
ATOM 10139 N N    . THR A 1 34 ? 18.776  -8.308  -0.571  1.00 0.00 ? 34 THR A N    9  
ATOM 10140 C CA   . THR A 1 34 ? 17.540  -7.547  -0.926  1.00 0.00 ? 34 THR A CA   9  
ATOM 10141 C C    . THR A 1 34 ? 16.349  -8.078  -0.121  1.00 0.00 ? 34 THR A C    9  
ATOM 10142 O O    . THR A 1 34 ? 16.250  -9.254  0.163   1.00 0.00 ? 34 THR A O    9  
ATOM 10143 C CB   . THR A 1 34 ? 17.232  -7.729  -2.418  1.00 0.00 ? 34 THR A CB   9  
ATOM 10144 O OG1  . THR A 1 34 ? 16.587  -8.980  -2.613  1.00 0.00 ? 34 THR A OG1  9  
ATOM 10145 C CG2  . THR A 1 34 ? 18.523  -7.692  -3.240  1.00 0.00 ? 34 THR A CG2  9  
ATOM 10146 H H    . THR A 1 34 ? 18.706  -9.244  -0.288  1.00 0.00 ? 34 THR A H    9  
ATOM 10147 H HA   . THR A 1 34 ? 17.681  -6.497  -0.713  1.00 0.00 ? 34 THR A HA   9  
ATOM 10148 H HB   . THR A 1 34 ? 16.578  -6.937  -2.748  1.00 0.00 ? 34 THR A HB   9  
ATOM 10149 H HG1  . THR A 1 34 ? 16.511  -9.131  -3.558  1.00 0.00 ? 34 THR A HG1  9  
ATOM 10150 H HG21 . THR A 1 34 ? 18.281  -7.754  -4.290  1.00 0.00 ? 34 THR A HG21 9  
ATOM 10151 H HG22 . THR A 1 34 ? 19.149  -8.529  -2.966  1.00 0.00 ? 34 THR A HG22 9  
ATOM 10152 H HG23 . THR A 1 34 ? 19.047  -6.769  -3.048  1.00 0.00 ? 34 THR A HG23 9  
ATOM 10153 N N    . GLU A 1 35 ? 15.430  -7.209  0.215   1.00 0.00 ? 35 GLU A N    9  
ATOM 10154 C CA   . GLU A 1 35 ? 14.204  -7.621  0.972   1.00 0.00 ? 35 GLU A CA   9  
ATOM 10155 C C    . GLU A 1 35 ? 12.998  -7.311  0.081   1.00 0.00 ? 35 GLU A C    9  
ATOM 10156 O O    . GLU A 1 35 ? 13.014  -6.340  -0.650  1.00 0.00 ? 35 GLU A O    9  
ATOM 10157 C CB   . GLU A 1 35 ? 14.117  -6.811  2.273   1.00 0.00 ? 35 GLU A CB   9  
ATOM 10158 C CG   . GLU A 1 35 ? 15.494  -6.765  2.940   1.00 0.00 ? 35 GLU A CG   9  
ATOM 10159 C CD   . GLU A 1 35 ? 15.388  -6.029  4.276   1.00 0.00 ? 35 GLU A CD   9  
ATOM 10160 O OE1  . GLU A 1 35 ? 14.298  -5.986  4.822   1.00 0.00 ? 35 GLU A OE1  9  
ATOM 10161 O OE2  . GLU A 1 35 ? 16.399  -5.519  4.732   1.00 0.00 ? 35 GLU A OE2  9  
ATOM 10162 H H    . GLU A 1 35 ? 15.534  -6.272  -0.052  1.00 0.00 ? 35 GLU A H    9  
ATOM 10163 H HA   . GLU A 1 35 ? 14.233  -8.679  1.196   1.00 0.00 ? 35 GLU A HA   9  
ATOM 10164 H HB2  . GLU A 1 35 ? 13.792  -5.805  2.051   1.00 0.00 ? 35 GLU A HB2  9  
ATOM 10165 H HB3  . GLU A 1 35 ? 13.412  -7.276  2.946   1.00 0.00 ? 35 GLU A HB3  9  
ATOM 10166 H HG2  . GLU A 1 35 ? 15.844  -7.773  3.110   1.00 0.00 ? 35 GLU A HG2  9  
ATOM 10167 H HG3  . GLU A 1 35 ? 16.188  -6.245  2.298   1.00 0.00 ? 35 GLU A HG3  9  
ATOM 10168 N N    . THR A 1 36 ? 11.953  -8.114  0.112   1.00 0.00 ? 36 THR A N    9  
ATOM 10169 C CA   . THR A 1 36 ? 10.775  -7.839  -0.752  1.00 0.00 ? 36 THR A CA   9  
ATOM 10170 C C    . THR A 1 36 ? 9.518   -7.932  0.092   1.00 0.00 ? 36 THR A C    9  
ATOM 10171 O O    . THR A 1 36 ? 9.126   -8.997  0.528   1.00 0.00 ? 36 THR A O    9  
ATOM 10172 C CB   . THR A 1 36 ? 10.716  -8.878  -1.875  1.00 0.00 ? 36 THR A CB   9  
ATOM 10173 O OG1  . THR A 1 36 ? 10.643  -10.179 -1.312  1.00 0.00 ? 36 THR A OG1  9  
ATOM 10174 C CG2  . THR A 1 36 ? 11.972  -8.764  -2.741  1.00 0.00 ? 36 THR A CG2  9  
ATOM 10175 H H    . THR A 1 36 ? 11.934  -8.896  0.700   1.00 0.00 ? 36 THR A H    9  
ATOM 10176 H HA   . THR A 1 36 ? 10.838  -6.849  -1.181  1.00 0.00 ? 36 THR A HA   9  
ATOM 10177 H HB   . THR A 1 36 ? 9.845   -8.699  -2.486  1.00 0.00 ? 36 THR A HB   9  
ATOM 10178 H HG1  . THR A 1 36 ? 9.856   -10.222 -0.764  1.00 0.00 ? 36 THR A HG1  9  
ATOM 10179 H HG21 . THR A 1 36 ? 12.846  -8.937  -2.133  1.00 0.00 ? 36 THR A HG21 9  
ATOM 10180 H HG22 . THR A 1 36 ? 12.024  -7.775  -3.173  1.00 0.00 ? 36 THR A HG22 9  
ATOM 10181 H HG23 . THR A 1 36 ? 11.933  -9.499  -3.532  1.00 0.00 ? 36 THR A HG23 9  
ATOM 10182 N N    . THR A 1 37 ? 8.852   -6.831  0.279   1.00 0.00 ? 37 THR A N    9  
ATOM 10183 C CA   . THR A 1 37 ? 7.577   -6.844  1.045   1.00 0.00 ? 37 THR A CA   9  
ATOM 10184 C C    . THR A 1 37 ? 6.479   -6.764  0.004   1.00 0.00 ? 37 THR A C    9  
ATOM 10185 O O    . THR A 1 37 ? 6.318   -5.759  -0.647  1.00 0.00 ? 37 THR A O    9  
ATOM 10186 C CB   . THR A 1 37 ? 7.496   -5.635  1.983   1.00 0.00 ? 37 THR A CB   9  
ATOM 10187 O OG1  . THR A 1 37 ? 7.310   -4.459  1.213   1.00 0.00 ? 37 THR A OG1  9  
ATOM 10188 C CG2  . THR A 1 37 ? 8.785   -5.519  2.804   1.00 0.00 ? 37 THR A CG2  9  
ATOM 10189 H H    . THR A 1 37 ? 9.165   -5.996  -0.137  1.00 0.00 ? 37 THR A H    9  
ATOM 10190 H HA   . THR A 1 37 ? 7.474   -7.764  1.616   1.00 0.00 ? 37 THR A HA   9  
ATOM 10191 H HB   . THR A 1 37 ? 6.660   -5.758  2.654   1.00 0.00 ? 37 THR A HB   9  
ATOM 10192 H HG1  . THR A 1 37 ? 6.478   -4.061  1.477   1.00 0.00 ? 37 THR A HG1  9  
ATOM 10193 H HG21 . THR A 1 37 ? 9.116   -6.503  3.102   1.00 0.00 ? 37 THR A HG21 9  
ATOM 10194 H HG22 . THR A 1 37 ? 8.597   -4.923  3.685   1.00 0.00 ? 37 THR A HG22 9  
ATOM 10195 H HG23 . THR A 1 37 ? 9.552   -5.045  2.209   1.00 0.00 ? 37 THR A HG23 9  
ATOM 10196 N N    . LYS A 1 38 ? 5.742   -7.820  -0.169  1.00 0.00 ? 38 LYS A N    9  
ATOM 10197 C CA   . LYS A 1 38 ? 4.647   -7.839  -1.193  1.00 0.00 ? 38 LYS A CA   9  
ATOM 10198 C C    . LYS A 1 38 ? 3.312   -8.164  -0.523  1.00 0.00 ? 38 LYS A C    9  
ATOM 10199 O O    . LYS A 1 38 ? 3.250   -8.897  0.444   1.00 0.00 ? 38 LYS A O    9  
ATOM 10200 C CB   . LYS A 1 38 ? 4.953   -8.919  -2.233  1.00 0.00 ? 38 LYS A CB   9  
ATOM 10201 C CG   . LYS A 1 38 ? 6.140   -8.486  -3.093  1.00 0.00 ? 38 LYS A CG   9  
ATOM 10202 C CD   . LYS A 1 38 ? 6.550   -9.637  -4.015  1.00 0.00 ? 38 LYS A CD   9  
ATOM 10203 C CE   . LYS A 1 38 ? 7.637   -9.160  -4.977  1.00 0.00 ? 38 LYS A CE   9  
ATOM 10204 N NZ   . LYS A 1 38 ? 7.884   -10.209 -6.007  1.00 0.00 ? 38 LYS A NZ   9  
ATOM 10205 H H    . LYS A 1 38 ? 5.899   -8.610  0.378   1.00 0.00 ? 38 LYS A H    9  
ATOM 10206 H HA   . LYS A 1 38 ? 4.573   -6.880  -1.686  1.00 0.00 ? 38 LYS A HA   9  
ATOM 10207 H HB2  . LYS A 1 38 ? 5.192   -9.844  -1.730  1.00 0.00 ? 38 LYS A HB2  9  
ATOM 10208 H HB3  . LYS A 1 38 ? 4.089   -9.066  -2.864  1.00 0.00 ? 38 LYS A HB3  9  
ATOM 10209 H HG2  . LYS A 1 38 ? 5.859   -7.629  -3.690  1.00 0.00 ? 38 LYS A HG2  9  
ATOM 10210 H HG3  . LYS A 1 38 ? 6.971   -8.224  -2.456  1.00 0.00 ? 38 LYS A HG3  9  
ATOM 10211 H HD2  . LYS A 1 38 ? 6.927   -10.456 -3.419  1.00 0.00 ? 38 LYS A HD2  9  
ATOM 10212 H HD3  . LYS A 1 38 ? 5.691   -9.969  -4.580  1.00 0.00 ? 38 LYS A HD3  9  
ATOM 10213 H HE2  . LYS A 1 38 ? 7.316   -8.250  -5.461  1.00 0.00 ? 38 LYS A HE2  9  
ATOM 10214 H HE3  . LYS A 1 38 ? 8.548   -8.974  -4.427  1.00 0.00 ? 38 LYS A HE3  9  
ATOM 10215 H HZ1  . LYS A 1 38 ? 7.301   -11.044 -5.798  1.00 0.00 ? 38 LYS A HZ1  9  
ATOM 10216 H HZ2  . LYS A 1 38 ? 8.888   -10.478 -5.995  1.00 0.00 ? 38 LYS A HZ2  9  
ATOM 10217 H HZ3  . LYS A 1 38 ? 7.635   -9.837  -6.946  1.00 0.00 ? 38 LYS A HZ3  9  
ATOM 10218 N N    . GLU A 1 39 ? 2.241   -7.629  -1.041  1.00 0.00 ? 39 GLU A N    9  
ATOM 10219 C CA   . GLU A 1 39 ? 0.901   -7.906  -0.454  1.00 0.00 ? 39 GLU A CA   9  
ATOM 10220 C C    . GLU A 1 39 ? -0.178  -7.467  -1.454  1.00 0.00 ? 39 GLU A C    9  
ATOM 10221 O O    . GLU A 1 39 ? -0.692  -6.369  -1.374  1.00 0.00 ? 39 GLU A O    9  
ATOM 10222 C CB   . GLU A 1 39 ? 0.740   -7.120  0.850   1.00 0.00 ? 39 GLU A CB   9  
ATOM 10223 C CG   . GLU A 1 39 ? -0.431  -7.691  1.654   1.00 0.00 ? 39 GLU A CG   9  
ATOM 10224 C CD   . GLU A 1 39 ? -0.532  -6.966  2.996   1.00 0.00 ? 39 GLU A CD   9  
ATOM 10225 O OE1  . GLU A 1 39 ? -0.167  -5.803  3.048   1.00 0.00 ? 39 GLU A OE1  9  
ATOM 10226 O OE2  . GLU A 1 39 ? -0.971  -7.587  3.950   1.00 0.00 ? 39 GLU A OE2  9  
ATOM 10227 H H    . GLU A 1 39 ? 2.319   -7.046  -1.825  1.00 0.00 ? 39 GLU A H    9  
ATOM 10228 H HA   . GLU A 1 39 ? 0.808   -8.964  -0.249  1.00 0.00 ? 39 GLU A HA   9  
ATOM 10229 H HB2  . GLU A 1 39 ? 1.648   -7.197  1.431   1.00 0.00 ? 39 GLU A HB2  9  
ATOM 10230 H HB3  . GLU A 1 39 ? 0.545   -6.085  0.624   1.00 0.00 ? 39 GLU A HB3  9  
ATOM 10231 H HG2  . GLU A 1 39 ? -1.348  -7.554  1.099   1.00 0.00 ? 39 GLU A HG2  9  
ATOM 10232 H HG3  . GLU A 1 39 ? -0.269  -8.745  1.826   1.00 0.00 ? 39 GLU A HG3  9  
ATOM 10233 N N    . VAL A 1 40 ? -0.532  -8.307  -2.399  1.00 0.00 ? 40 VAL A N    9  
ATOM 10234 C CA   . VAL A 1 40 ? -1.580  -7.917  -3.390  1.00 0.00 ? 40 VAL A CA   9  
ATOM 10235 C C    . VAL A 1 40 ? -2.954  -8.336  -2.851  1.00 0.00 ? 40 VAL A C    9  
ATOM 10236 O O    . VAL A 1 40 ? -3.217  -9.501  -2.632  1.00 0.00 ? 40 VAL A O    9  
ATOM 10237 C CB   . VAL A 1 40 ? -1.284  -8.606  -4.736  1.00 0.00 ? 40 VAL A CB   9  
ATOM 10238 C CG1  . VAL A 1 40 ? -0.846  -10.054 -4.501  1.00 0.00 ? 40 VAL A CG1  9  
ATOM 10239 C CG2  . VAL A 1 40 ? -2.533  -8.588  -5.627  1.00 0.00 ? 40 VAL A CG2  9  
ATOM 10240 H H    . VAL A 1 40 ? -0.117  -9.194  -2.450  1.00 0.00 ? 40 VAL A H    9  
ATOM 10241 H HA   . VAL A 1 40 ? -1.564  -6.843  -3.530  1.00 0.00 ? 40 VAL A HA   9  
ATOM 10242 H HB   . VAL A 1 40 ? -0.486  -8.075  -5.233  1.00 0.00 ? 40 VAL A HB   9  
ATOM 10243 H HG11 . VAL A 1 40 ? -1.576  -10.560 -3.888  1.00 0.00 ? 40 VAL A HG11 9  
ATOM 10244 H HG12 . VAL A 1 40 ? 0.111   -10.064 -4.004  1.00 0.00 ? 40 VAL A HG12 9  
ATOM 10245 H HG13 . VAL A 1 40 ? -0.762  -10.562 -5.451  1.00 0.00 ? 40 VAL A HG13 9  
ATOM 10246 H HG21 . VAL A 1 40 ? -2.252  -8.823  -6.644  1.00 0.00 ? 40 VAL A HG21 9  
ATOM 10247 H HG22 . VAL A 1 40 ? -2.984  -7.608  -5.595  1.00 0.00 ? 40 VAL A HG22 9  
ATOM 10248 H HG23 . VAL A 1 40 ? -3.241  -9.322  -5.272  1.00 0.00 ? 40 VAL A HG23 9  
ATOM 10249 N N    . VAL A 1 41 ? -3.839  -7.389  -2.644  1.00 0.00 ? 41 VAL A N    9  
ATOM 10250 C CA   . VAL A 1 41 ? -5.206  -7.724  -2.133  1.00 0.00 ? 41 VAL A CA   9  
ATOM 10251 C C    . VAL A 1 41 ? -6.251  -6.978  -2.971  1.00 0.00 ? 41 VAL A C    9  
ATOM 10252 O O    . VAL A 1 41 ? -6.404  -5.779  -2.849  1.00 0.00 ? 41 VAL A O    9  
ATOM 10253 C CB   . VAL A 1 41 ? -5.295  -7.273  -0.667  1.00 0.00 ? 41 VAL A CB   9  
ATOM 10254 C CG1  . VAL A 1 41 ? -6.747  -7.300  -0.184  1.00 0.00 ? 41 VAL A CG1  9  
ATOM 10255 C CG2  . VAL A 1 41 ? -4.457  -8.213  0.203   1.00 0.00 ? 41 VAL A CG2  9  
ATOM 10256 H H    . VAL A 1 41 ? -3.611  -6.458  -2.846  1.00 0.00 ? 41 VAL A H    9  
ATOM 10257 H HA   . VAL A 1 41 ? -5.387  -8.789  -2.197  1.00 0.00 ? 41 VAL A HA   9  
ATOM 10258 H HB   . VAL A 1 41 ? -4.909  -6.267  -0.581  1.00 0.00 ? 41 VAL A HB   9  
ATOM 10259 H HG11 . VAL A 1 41 ? -6.765  -7.186  0.890   1.00 0.00 ? 41 VAL A HG11 9  
ATOM 10260 H HG12 . VAL A 1 41 ? -7.201  -8.240  -0.455  1.00 0.00 ? 41 VAL A HG12 9  
ATOM 10261 H HG13 . VAL A 1 41 ? -7.292  -6.488  -0.640  1.00 0.00 ? 41 VAL A HG13 9  
ATOM 10262 H HG21 . VAL A 1 41 ? -3.413  -8.107  -0.055  1.00 0.00 ? 41 VAL A HG21 9  
ATOM 10263 H HG22 . VAL A 1 41 ? -4.767  -9.233  0.033   1.00 0.00 ? 41 VAL A HG22 9  
ATOM 10264 H HG23 . VAL A 1 41 ? -4.598  -7.961  1.243   1.00 0.00 ? 41 VAL A HG23 9  
ATOM 10265 N N    . LYS A 1 42 ? -6.960  -7.673  -3.833  1.00 0.00 ? 42 LYS A N    9  
ATOM 10266 C CA   . LYS A 1 42 ? -7.986  -7.002  -4.699  1.00 0.00 ? 42 LYS A CA   9  
ATOM 10267 C C    . LYS A 1 42 ? -9.388  -7.501  -4.343  1.00 0.00 ? 42 LYS A C    9  
ATOM 10268 O O    . LYS A 1 42 ? -9.672  -8.681  -4.398  1.00 0.00 ? 42 LYS A O    9  
ATOM 10269 C CB   . LYS A 1 42 ? -7.694  -7.331  -6.163  1.00 0.00 ? 42 LYS A CB   9  
ATOM 10270 C CG   . LYS A 1 42 ? -6.449  -6.566  -6.618  1.00 0.00 ? 42 LYS A CG   9  
ATOM 10271 C CD   . LYS A 1 42 ? -6.101  -6.967  -8.053  1.00 0.00 ? 42 LYS A CD   9  
ATOM 10272 C CE   . LYS A 1 42 ? -4.886  -6.168  -8.528  1.00 0.00 ? 42 LYS A CE   9  
ATOM 10273 N NZ   . LYS A 1 42 ? -3.697  -6.536  -7.708  1.00 0.00 ? 42 LYS A NZ   9  
ATOM 10274 H H    . LYS A 1 42 ? -6.794  -8.632  -3.946  1.00 0.00 ? 42 LYS A H    9  
ATOM 10275 H HA   . LYS A 1 42 ? -7.950  -5.933  -4.564  1.00 0.00 ? 42 LYS A HA   9  
ATOM 10276 H HB2  . LYS A 1 42 ? -7.523  -8.392  -6.266  1.00 0.00 ? 42 LYS A HB2  9  
ATOM 10277 H HB3  . LYS A 1 42 ? -8.535  -7.040  -6.773  1.00 0.00 ? 42 LYS A HB3  9  
ATOM 10278 H HG2  . LYS A 1 42 ? -6.644  -5.503  -6.576  1.00 0.00 ? 42 LYS A HG2  9  
ATOM 10279 H HG3  . LYS A 1 42 ? -5.621  -6.806  -5.968  1.00 0.00 ? 42 LYS A HG3  9  
ATOM 10280 H HD2  . LYS A 1 42 ? -5.874  -8.023  -8.086  1.00 0.00 ? 42 LYS A HD2  9  
ATOM 10281 H HD3  . LYS A 1 42 ? -6.941  -6.760  -8.699  1.00 0.00 ? 42 LYS A HD3  9  
ATOM 10282 H HE2  . LYS A 1 42 ? -4.691  -6.393  -9.566  1.00 0.00 ? 42 LYS A HE2  9  
ATOM 10283 H HE3  . LYS A 1 42 ? -5.085  -5.111  -8.421  1.00 0.00 ? 42 LYS A HE3  9  
ATOM 10284 H HZ1  . LYS A 1 42 ? -3.911  -7.384  -7.147  1.00 0.00 ? 42 LYS A HZ1  9  
ATOM 10285 H HZ2  . LYS A 1 42 ? -3.459  -5.751  -7.070  1.00 0.00 ? 42 LYS A HZ2  9  
ATOM 10286 H HZ3  . LYS A 1 42 ? -2.890  -6.729  -8.337  1.00 0.00 ? 42 LYS A HZ3  9  
ATOM 10287 N N    . SER A 1 43 ? -10.271 -6.604  -3.995  1.00 0.00 ? 43 SER A N    9  
ATOM 10288 C CA   . SER A 1 43 ? -11.662 -7.015  -3.651  1.00 0.00 ? 43 SER A CA   9  
ATOM 10289 C C    . SER A 1 43 ? -12.463 -7.183  -4.944  1.00 0.00 ? 43 SER A C    9  
ATOM 10290 O O    . SER A 1 43 ? -11.932 -7.054  -6.030  1.00 0.00 ? 43 SER A O    9  
ATOM 10291 C CB   . SER A 1 43 ? -12.311 -5.935  -2.785  1.00 0.00 ? 43 SER A CB   9  
ATOM 10292 O OG   . SER A 1 43 ? -13.491 -6.457  -2.188  1.00 0.00 ? 43 SER A OG   9  
ATOM 10293 H H    . SER A 1 43 ? -10.021 -5.656  -3.967  1.00 0.00 ? 43 SER A H    9  
ATOM 10294 H HA   . SER A 1 43 ? -11.642 -7.950  -3.111  1.00 0.00 ? 43 SER A HA   9  
ATOM 10295 H HB2  . SER A 1 43 ? -11.626 -5.632  -2.012  1.00 0.00 ? 43 SER A HB2  9  
ATOM 10296 H HB3  . SER A 1 43 ? -12.555 -5.078  -3.401  1.00 0.00 ? 43 SER A HB3  9  
ATOM 10297 H HG   . SER A 1 43 ? -13.621 -7.348  -2.519  1.00 0.00 ? 43 SER A HG   9  
ATOM 10298 N N    . GLU A 1 44 ? -13.732 -7.473  -4.845  1.00 0.00 ? 44 GLU A N    9  
ATOM 10299 C CA   . GLU A 1 44 ? -14.543 -7.650  -6.086  1.00 0.00 ? 44 GLU A CA   9  
ATOM 10300 C C    . GLU A 1 44 ? -16.036 -7.543  -5.755  1.00 0.00 ? 44 GLU A C    9  
ATOM 10301 O O    . GLU A 1 44 ? -16.436 -7.629  -4.613  1.00 0.00 ? 44 GLU A O    9  
ATOM 10302 C CB   . GLU A 1 44 ? -14.244 -9.029  -6.691  1.00 0.00 ? 44 GLU A CB   9  
ATOM 10303 C CG   . GLU A 1 44 ? -14.668 -9.054  -8.164  1.00 0.00 ? 44 GLU A CG   9  
ATOM 10304 C CD   . GLU A 1 44 ? -14.257 -10.390 -8.789  1.00 0.00 ? 44 GLU A CD   9  
ATOM 10305 O OE1  . GLU A 1 44 ? -14.994 -11.349 -8.628  1.00 0.00 ? 44 GLU A OE1  9  
ATOM 10306 O OE2  . GLU A 1 44 ? -13.213 -10.430 -9.420  1.00 0.00 ? 44 GLU A OE2  9  
ATOM 10307 H H    . GLU A 1 44 ? -14.147 -7.579  -3.964  1.00 0.00 ? 44 GLU A H    9  
ATOM 10308 H HA   . GLU A 1 44 ? -14.279 -6.880  -6.796  1.00 0.00 ? 44 GLU A HA   9  
ATOM 10309 H HB2  . GLU A 1 44 ? -13.185 -9.228  -6.621  1.00 0.00 ? 44 GLU A HB2  9  
ATOM 10310 H HB3  . GLU A 1 44 ? -14.789 -9.789  -6.151  1.00 0.00 ? 44 GLU A HB3  9  
ATOM 10311 H HG2  . GLU A 1 44 ? -15.739 -8.939  -8.233  1.00 0.00 ? 44 GLU A HG2  9  
ATOM 10312 H HG3  . GLU A 1 44 ? -14.184 -8.248  -8.693  1.00 0.00 ? 44 GLU A HG3  9  
ATOM 10313 N N    . ASP A 1 45 ? -16.855 -7.393  -6.765  1.00 0.00 ? 45 ASP A N    9  
ATOM 10314 C CA   . ASP A 1 45 ? -18.335 -7.311  -6.558  1.00 0.00 ? 45 ASP A CA   9  
ATOM 10315 C C    . ASP A 1 45 ? -18.702 -6.213  -5.549  1.00 0.00 ? 45 ASP A C    9  
ATOM 10316 O O    . ASP A 1 45 ? -18.226 -6.191  -4.432  1.00 0.00 ? 45 ASP A O    9  
ATOM 10317 C CB   . ASP A 1 45 ? -18.844 -8.658  -6.040  1.00 0.00 ? 45 ASP A CB   9  
ATOM 10318 C CG   . ASP A 1 45 ? -18.328 -9.779  -6.944  1.00 0.00 ? 45 ASP A CG   9  
ATOM 10319 O OD1  . ASP A 1 45 ? -18.397 -9.619  -8.151  1.00 0.00 ? 45 ASP A OD1  9  
ATOM 10320 O OD2  . ASP A 1 45 ? -17.872 -10.778 -6.413  1.00 0.00 ? 45 ASP A OD2  9  
ATOM 10321 H H    . ASP A 1 45 ? -16.493 -7.371  -7.675  1.00 0.00 ? 45 ASP A H    9  
ATOM 10322 H HA   . ASP A 1 45 ? -18.812 -7.095  -7.501  1.00 0.00 ? 45 ASP A HA   9  
ATOM 10323 H HB2  . ASP A 1 45 ? -18.488 -8.812  -5.032  1.00 0.00 ? 45 ASP A HB2  9  
ATOM 10324 H HB3  . ASP A 1 45 ? -19.924 -8.661  -6.046  1.00 0.00 ? 45 ASP A HB3  9  
ATOM 10325 N N    . GLY A 1 46 ? -19.577 -5.314  -5.930  1.00 0.00 ? 46 GLY A N    9  
ATOM 10326 C CA   . GLY A 1 46 ? -20.013 -4.227  -4.996  1.00 0.00 ? 46 GLY A CA   9  
ATOM 10327 C C    . GLY A 1 46 ? -19.327 -2.906  -5.347  1.00 0.00 ? 46 GLY A C    9  
ATOM 10328 O O    . GLY A 1 46 ? -18.419 -2.855  -6.153  1.00 0.00 ? 46 GLY A O    9  
ATOM 10329 H H    . GLY A 1 46 ? -19.965 -5.363  -6.829  1.00 0.00 ? 46 GLY A H    9  
ATOM 10330 H HA2  . GLY A 1 46 ? -21.083 -4.101  -5.078  1.00 0.00 ? 46 GLY A HA2  9  
ATOM 10331 H HA3  . GLY A 1 46 ? -19.767 -4.494  -3.978  1.00 0.00 ? 46 GLY A HA3  9  
ATOM 10332 N N    . SER A 1 47 ? -19.760 -1.835  -4.727  1.00 0.00 ? 47 SER A N    9  
ATOM 10333 C CA   . SER A 1 47 ? -19.154 -0.493  -4.986  1.00 0.00 ? 47 SER A CA   9  
ATOM 10334 C C    . SER A 1 47 ? -18.313 -0.092  -3.774  1.00 0.00 ? 47 SER A C    9  
ATOM 10335 O O    . SER A 1 47 ? -18.632 -0.445  -2.660  1.00 0.00 ? 47 SER A O    9  
ATOM 10336 C CB   . SER A 1 47 ? -20.268 0.536   -5.189  1.00 0.00 ? 47 SER A CB   9  
ATOM 10337 O OG   . SER A 1 47 ? -21.061 0.154   -6.306  1.00 0.00 ? 47 SER A OG   9  
ATOM 10338 H H    . SER A 1 47 ? -20.487 -1.922  -4.076  1.00 0.00 ? 47 SER A H    9  
ATOM 10339 H HA   . SER A 1 47 ? -18.528 -0.526  -5.867  1.00 0.00 ? 47 SER A HA   9  
ATOM 10340 H HB2  . SER A 1 47 ? -20.890 0.575   -4.310  1.00 0.00 ? 47 SER A HB2  9  
ATOM 10341 H HB3  . SER A 1 47 ? -19.830 1.510   -5.361  1.00 0.00 ? 47 SER A HB3  9  
ATOM 10342 H HG   . SER A 1 47 ? -20.969 0.832   -6.980  1.00 0.00 ? 47 SER A HG   9  
ATOM 10343 N N    . ASP A 1 48 ? -17.253 0.651   -3.995  1.00 0.00 ? 48 ASP A N    9  
ATOM 10344 C CA   . ASP A 1 48 ? -16.358 1.111   -2.879  1.00 0.00 ? 48 ASP A CA   9  
ATOM 10345 C C    . ASP A 1 48 ? -14.961 1.361   -3.457  1.00 0.00 ? 48 ASP A C    9  
ATOM 10346 O O    . ASP A 1 48 ? -13.961 1.120   -2.811  1.00 0.00 ? 48 ASP A O    9  
ATOM 10347 C CB   . ASP A 1 48 ? -16.252 0.052   -1.759  1.00 0.00 ? 48 ASP A CB   9  
ATOM 10348 C CG   . ASP A 1 48 ? -16.186 -1.351  -2.368  1.00 0.00 ? 48 ASP A CG   9  
ATOM 10349 O OD1  . ASP A 1 48 ? -15.315 -1.578  -3.191  1.00 0.00 ? 48 ASP A OD1  9  
ATOM 10350 O OD2  . ASP A 1 48 ? -17.008 -2.174  -2.000  1.00 0.00 ? 48 ASP A OD2  9  
ATOM 10351 H H    . ASP A 1 48 ? -17.046 0.931   -4.911  1.00 0.00 ? 48 ASP A H    9  
ATOM 10352 H HA   . ASP A 1 48 ? -16.744 2.033   -2.469  1.00 0.00 ? 48 ASP A HA   9  
ATOM 10353 H HB2  . ASP A 1 48 ? -15.356 0.229   -1.177  1.00 0.00 ? 48 ASP A HB2  9  
ATOM 10354 H HB3  . ASP A 1 48 ? -17.108 0.125   -1.107  1.00 0.00 ? 48 ASP A HB3  9  
ATOM 10355 N N    . CYS A 1 49 ? -14.881 1.830   -4.678  1.00 0.00 ? 49 CYS A N    9  
ATOM 10356 C CA   . CYS A 1 49 ? -13.541 2.079   -5.299  1.00 0.00 ? 49 CYS A CA   9  
ATOM 10357 C C    . CYS A 1 49 ? -13.566 3.368   -6.125  1.00 0.00 ? 49 CYS A C    9  
ATOM 10358 O O    . CYS A 1 49 ? -14.494 3.635   -6.862  1.00 0.00 ? 49 CYS A O    9  
ATOM 10359 C CB   . CYS A 1 49 ? -13.197 0.886   -6.202  1.00 0.00 ? 49 CYS A CB   9  
ATOM 10360 S SG   . CYS A 1 49 ? -12.657 -0.502  -5.178  1.00 0.00 ? 49 CYS A SG   9  
ATOM 10361 H H    . CYS A 1 49 ? -15.697 2.012   -5.184  1.00 0.00 ? 49 CYS A H    9  
ATOM 10362 H HA   . CYS A 1 49 ? -12.790 2.175   -4.530  1.00 0.00 ? 49 CYS A HA   9  
ATOM 10363 H HB2  . CYS A 1 49 ? -14.075 0.595   -6.762  1.00 0.00 ? 49 CYS A HB2  9  
ATOM 10364 H HB3  . CYS A 1 49 ? -12.409 1.153   -6.891  1.00 0.00 ? 49 CYS A HB3  9  
ATOM 10365 N N    . GLY A 1 50 ? -12.540 4.167   -5.997  1.00 0.00 ? 50 GLY A N    9  
ATOM 10366 C CA   . GLY A 1 50 ? -12.485 5.448   -6.766  1.00 0.00 ? 50 GLY A CA   9  
ATOM 10367 C C    . GLY A 1 50 ? -13.536 6.411   -6.213  1.00 0.00 ? 50 GLY A C    9  
ATOM 10368 O O    . GLY A 1 50 ? -13.323 7.605   -6.151  1.00 0.00 ? 50 GLY A O    9  
ATOM 10369 H H    . GLY A 1 50 ? -11.821 3.913   -5.374  1.00 0.00 ? 50 GLY A H    9  
ATOM 10370 H HA2  . GLY A 1 50 ? -11.502 5.891   -6.675  1.00 0.00 ? 50 GLY A HA2  9  
ATOM 10371 H HA3  . GLY A 1 50 ? -12.696 5.253   -7.807  1.00 0.00 ? 50 GLY A HA3  9  
ATOM 10372 N N    . ASP A 1 51 ? -14.663 5.900   -5.796  1.00 0.00 ? 51 ASP A N    9  
ATOM 10373 C CA   . ASP A 1 51 ? -15.714 6.786   -5.232  1.00 0.00 ? 51 ASP A CA   9  
ATOM 10374 C C    . ASP A 1 51 ? -15.204 7.363   -3.915  1.00 0.00 ? 51 ASP A C    9  
ATOM 10375 O O    . ASP A 1 51 ? -15.300 8.548   -3.666  1.00 0.00 ? 51 ASP A O    9  
ATOM 10376 C CB   . ASP A 1 51 ? -16.988 5.978   -4.978  1.00 0.00 ? 51 ASP A CB   9  
ATOM 10377 C CG   . ASP A 1 51 ? -17.448 5.321   -6.281  1.00 0.00 ? 51 ASP A CG   9  
ATOM 10378 O OD1  . ASP A 1 51 ? -17.226 5.907   -7.327  1.00 0.00 ? 51 ASP A OD1  9  
ATOM 10379 O OD2  . ASP A 1 51 ? -18.016 4.244   -6.210  1.00 0.00 ? 51 ASP A OD2  9  
ATOM 10380 H H    . ASP A 1 51 ? -14.815 4.935   -5.838  1.00 0.00 ? 51 ASP A H    9  
ATOM 10381 H HA   . ASP A 1 51 ? -15.924 7.588   -5.925  1.00 0.00 ? 51 ASP A HA   9  
ATOM 10382 H HB2  . ASP A 1 51 ? -16.787 5.213   -4.240  1.00 0.00 ? 51 ASP A HB2  9  
ATOM 10383 H HB3  . ASP A 1 51 ? -17.764 6.633   -4.613  1.00 0.00 ? 51 ASP A HB3  9  
ATOM 10384 N N    . ALA A 1 52 ? -14.655 6.532   -3.066  1.00 0.00 ? 52 ALA A N    9  
ATOM 10385 C CA   . ALA A 1 52 ? -14.132 7.025   -1.766  1.00 0.00 ? 52 ALA A CA   9  
ATOM 10386 C C    . ALA A 1 52 ? -12.963 6.141   -1.329  1.00 0.00 ? 52 ALA A C    9  
ATOM 10387 O O    . ALA A 1 52 ? -11.865 6.617   -1.118  1.00 0.00 ? 52 ALA A O    9  
ATOM 10388 C CB   . ALA A 1 52 ? -15.240 6.965   -0.713  1.00 0.00 ? 52 ALA A CB   9  
ATOM 10389 H H    . ALA A 1 52 ? -14.585 5.577   -3.281  1.00 0.00 ? 52 ALA A H    9  
ATOM 10390 H HA   . ALA A 1 52 ? -13.790 8.046   -1.872  1.00 0.00 ? 52 ALA A HA   9  
ATOM 10391 H HB1  . ALA A 1 52 ? -14.831 7.217   0.255   1.00 0.00 ? 52 ALA A HB1  9  
ATOM 10392 H HB2  . ALA A 1 52 ? -15.653 5.968   -0.681  1.00 0.00 ? 52 ALA A HB2  9  
ATOM 10393 H HB3  . ALA A 1 52 ? -16.018 7.669   -0.969  1.00 0.00 ? 52 ALA A HB3  9  
ATOM 10394 N N    . ASP A 1 53 ? -13.185 4.862   -1.170  1.00 0.00 ? 53 ASP A N    9  
ATOM 10395 C CA   . ASP A 1 53 ? -12.071 3.970   -0.717  1.00 0.00 ? 53 ASP A CA   9  
ATOM 10396 C C    . ASP A 1 53 ? -10.891 4.052   -1.702  1.00 0.00 ? 53 ASP A C    9  
ATOM 10397 O O    . ASP A 1 53 ? -9.971  4.815   -1.498  1.00 0.00 ? 53 ASP A O    9  
ATOM 10398 C CB   . ASP A 1 53 ? -12.571 2.506   -0.561  1.00 0.00 ? 53 ASP A CB   9  
ATOM 10399 C CG   . ASP A 1 53 ? -14.099 2.485   -0.480  1.00 0.00 ? 53 ASP A CG   9  
ATOM 10400 O OD1  . ASP A 1 53 ? -14.728 2.976   -1.402  1.00 0.00 ? 53 ASP A OD1  9  
ATOM 10401 O OD2  . ASP A 1 53 ? -14.613 1.979   0.504   1.00 0.00 ? 53 ASP A OD2  9  
ATOM 10402 H H    . ASP A 1 53 ? -14.081 4.487   -1.319  1.00 0.00 ? 53 ASP A H    9  
ATOM 10403 H HA   . ASP A 1 53 ? -11.734 4.327   0.243   1.00 0.00 ? 53 ASP A HA   9  
ATOM 10404 H HB2  . ASP A 1 53 ? -12.251 1.902   -1.401  1.00 0.00 ? 53 ASP A HB2  9  
ATOM 10405 H HB3  . ASP A 1 53 ? -12.165 2.080   0.349   1.00 0.00 ? 53 ASP A HB3  9  
ATOM 10406 N N    . PHE A 1 54 ? -10.891 3.266   -2.750  1.00 0.00 ? 54 PHE A N    9  
ATOM 10407 C CA   . PHE A 1 54 ? -9.751  3.309   -3.714  1.00 0.00 ? 54 PHE A CA   9  
ATOM 10408 C C    . PHE A 1 54 ? -8.462  2.938   -2.972  1.00 0.00 ? 54 PHE A C    9  
ATOM 10409 O O    . PHE A 1 54 ? -8.189  1.776   -2.748  1.00 0.00 ? 54 PHE A O    9  
ATOM 10410 C CB   . PHE A 1 54 ? -9.635  4.711   -4.335  1.00 0.00 ? 54 PHE A CB   9  
ATOM 10411 C CG   . PHE A 1 54 ? -8.673  4.664   -5.502  1.00 0.00 ? 54 PHE A CG   9  
ATOM 10412 C CD1  . PHE A 1 54 ? -9.007  3.940   -6.652  1.00 0.00 ? 54 PHE A CD1  9  
ATOM 10413 C CD2  . PHE A 1 54 ? -7.449  5.344   -5.436  1.00 0.00 ? 54 PHE A CD2  9  
ATOM 10414 C CE1  . PHE A 1 54 ? -8.120  3.892   -7.734  1.00 0.00 ? 54 PHE A CE1  9  
ATOM 10415 C CE2  . PHE A 1 54 ? -6.561  5.297   -6.517  1.00 0.00 ? 54 PHE A CE2  9  
ATOM 10416 C CZ   . PHE A 1 54 ? -6.897  4.571   -7.667  1.00 0.00 ? 54 PHE A CZ   9  
ATOM 10417 H H    . PHE A 1 54 ? -11.629 2.633   -2.893  1.00 0.00 ? 54 PHE A H    9  
ATOM 10418 H HA   . PHE A 1 54 ? -9.925  2.588   -4.499  1.00 0.00 ? 54 PHE A HA   9  
ATOM 10419 H HB2  . PHE A 1 54 ? -10.606 5.028   -4.685  1.00 0.00 ? 54 PHE A HB2  9  
ATOM 10420 H HB3  . PHE A 1 54 ? -9.278  5.415   -3.603  1.00 0.00 ? 54 PHE A HB3  9  
ATOM 10421 H HD1  . PHE A 1 54 ? -9.951  3.416   -6.706  1.00 0.00 ? 54 PHE A HD1  9  
ATOM 10422 H HD2  . PHE A 1 54 ? -7.189  5.904   -4.549  1.00 0.00 ? 54 PHE A HD2  9  
ATOM 10423 H HE1  . PHE A 1 54 ? -8.378  3.334   -8.621  1.00 0.00 ? 54 PHE A HE1  9  
ATOM 10424 H HE2  . PHE A 1 54 ? -5.619  5.820   -6.466  1.00 0.00 ? 54 PHE A HE2  9  
ATOM 10425 H HZ   . PHE A 1 54 ? -6.212  4.535   -8.501  1.00 0.00 ? 54 PHE A HZ   9  
ATOM 10426 N N    . ASP A 1 55 ? -7.676  3.905   -2.579  1.00 0.00 ? 55 ASP A N    9  
ATOM 10427 C CA   . ASP A 1 55 ? -6.419  3.593   -1.841  1.00 0.00 ? 55 ASP A CA   9  
ATOM 10428 C C    . ASP A 1 55 ? -5.516  2.694   -2.693  1.00 0.00 ? 55 ASP A C    9  
ATOM 10429 O O    . ASP A 1 55 ? -5.870  1.585   -3.041  1.00 0.00 ? 55 ASP A O    9  
ATOM 10430 C CB   . ASP A 1 55 ? -6.762  2.884   -0.528  1.00 0.00 ? 55 ASP A CB   9  
ATOM 10431 C CG   . ASP A 1 55 ? -7.963  3.571   0.124   1.00 0.00 ? 55 ASP A CG   9  
ATOM 10432 O OD1  . ASP A 1 55 ? -7.887  4.768   0.346   1.00 0.00 ? 55 ASP A OD1  9  
ATOM 10433 O OD2  . ASP A 1 55 ? -8.938  2.888   0.389   1.00 0.00 ? 55 ASP A OD2  9  
ATOM 10434 H H    . ASP A 1 55 ? -7.915  4.834   -2.757  1.00 0.00 ? 55 ASP A H    9  
ATOM 10435 H HA   . ASP A 1 55 ? -5.898  4.514   -1.622  1.00 0.00 ? 55 ASP A HA   9  
ATOM 10436 H HB2  . ASP A 1 55 ? -7.002  1.850   -0.724  1.00 0.00 ? 55 ASP A HB2  9  
ATOM 10437 H HB3  . ASP A 1 55 ? -5.916  2.936   0.141   1.00 0.00 ? 55 ASP A HB3  9  
ATOM 10438 N N    . TRP A 1 56 ? -4.344  3.166   -3.022  1.00 0.00 ? 56 TRP A N    9  
ATOM 10439 C CA   . TRP A 1 56 ? -3.398  2.351   -3.845  1.00 0.00 ? 56 TRP A CA   9  
ATOM 10440 C C    . TRP A 1 56 ? -1.976  2.586   -3.324  1.00 0.00 ? 56 TRP A C    9  
ATOM 10441 O O    . TRP A 1 56 ? -1.578  2.045   -2.312  1.00 0.00 ? 56 TRP A O    9  
ATOM 10442 C CB   . TRP A 1 56 ? -3.490  2.791   -5.319  1.00 0.00 ? 56 TRP A CB   9  
ATOM 10443 C CG   . TRP A 1 56 ? -4.596  2.058   -6.014  1.00 0.00 ? 56 TRP A CG   9  
ATOM 10444 C CD1  . TRP A 1 56 ? -5.917  2.273   -5.822  1.00 0.00 ? 56 TRP A CD1  9  
ATOM 10445 C CD2  . TRP A 1 56 ? -4.493  1.001   -7.009  1.00 0.00 ? 56 TRP A CD2  9  
ATOM 10446 N NE1  . TRP A 1 56 ? -6.632  1.414   -6.639  1.00 0.00 ? 56 TRP A NE1  9  
ATOM 10447 C CE2  . TRP A 1 56 ? -5.797  0.609   -7.389  1.00 0.00 ? 56 TRP A CE2  9  
ATOM 10448 C CE3  . TRP A 1 56 ? -3.402  0.350   -7.615  1.00 0.00 ? 56 TRP A CE3  9  
ATOM 10449 C CZ2  . TRP A 1 56 ? -6.014  -0.393  -8.336  1.00 0.00 ? 56 TRP A CZ2  9  
ATOM 10450 C CZ3  . TRP A 1 56 ? -3.617  -0.659  -8.568  1.00 0.00 ? 56 TRP A CZ3  9  
ATOM 10451 C CH2  . TRP A 1 56 ? -4.920  -1.030  -8.927  1.00 0.00 ? 56 TRP A CH2  9  
ATOM 10452 H H    . TRP A 1 56 ? -4.079  4.062   -2.721  1.00 0.00 ? 56 TRP A H    9  
ATOM 10453 H HA   . TRP A 1 56 ? -3.639  1.299   -3.756  1.00 0.00 ? 56 TRP A HA   9  
ATOM 10454 H HB2  . TRP A 1 56 ? -3.687  3.853   -5.362  1.00 0.00 ? 56 TRP A HB2  9  
ATOM 10455 H HB3  . TRP A 1 56 ? -2.557  2.582   -5.824  1.00 0.00 ? 56 TRP A HB3  9  
ATOM 10456 H HD1  . TRP A 1 56 ? -6.345  2.997   -5.145  1.00 0.00 ? 56 TRP A HD1  9  
ATOM 10457 H HE1  . TRP A 1 56 ? -7.609  1.366   -6.691  1.00 0.00 ? 56 TRP A HE1  9  
ATOM 10458 H HE3  . TRP A 1 56 ? -2.394  0.628   -7.345  1.00 0.00 ? 56 TRP A HE3  9  
ATOM 10459 H HZ2  . TRP A 1 56 ? -7.020  -0.675  -8.609  1.00 0.00 ? 56 TRP A HZ2  9  
ATOM 10460 H HZ3  . TRP A 1 56 ? -2.772  -1.152  -9.026  1.00 0.00 ? 56 TRP A HZ3  9  
ATOM 10461 H HH2  . TRP A 1 56 ? -5.078  -1.807  -9.661  1.00 0.00 ? 56 TRP A HH2  9  
ATOM 10462 N N    . HIS A 1 57 ? -1.218  3.393   -4.012  1.00 0.00 ? 57 HIS A N    9  
ATOM 10463 C CA   . HIS A 1 57 ? 0.177   3.682   -3.576  1.00 0.00 ? 57 HIS A CA   9  
ATOM 10464 C C    . HIS A 1 57 ? 0.982   2.383   -3.519  1.00 0.00 ? 57 HIS A C    9  
ATOM 10465 O O    . HIS A 1 57 ? 0.455   1.321   -3.258  1.00 0.00 ? 57 HIS A O    9  
ATOM 10466 C CB   . HIS A 1 57 ? 0.163   4.337   -2.192  1.00 0.00 ? 57 HIS A CB   9  
ATOM 10467 C CG   . HIS A 1 57 ? 1.513   4.937   -1.903  1.00 0.00 ? 57 HIS A CG   9  
ATOM 10468 N ND1  . HIS A 1 57 ? 2.642   4.156   -1.713  1.00 0.00 ? 57 HIS A ND1  9  
ATOM 10469 C CD2  . HIS A 1 57 ? 1.929   6.238   -1.769  1.00 0.00 ? 57 HIS A CD2  9  
ATOM 10470 C CE1  . HIS A 1 57 ? 3.674   4.987   -1.475  1.00 0.00 ? 57 HIS A CE1  9  
ATOM 10471 N NE2  . HIS A 1 57 ? 3.293   6.268   -1.497  1.00 0.00 ? 57 HIS A NE2  9  
ATOM 10472 H H    . HIS A 1 57 ? -1.571  3.812   -4.823  1.00 0.00 ? 57 HIS A H    9  
ATOM 10473 H HA   . HIS A 1 57 ? 0.637   4.355   -4.285  1.00 0.00 ? 57 HIS A HA   9  
ATOM 10474 H HB2  . HIS A 1 57 ? -0.587  5.114   -2.170  1.00 0.00 ? 57 HIS A HB2  9  
ATOM 10475 H HB3  . HIS A 1 57 ? -0.066  3.595   -1.442  1.00 0.00 ? 57 HIS A HB3  9  
ATOM 10476 H HD1  . HIS A 1 57 ? 2.683   3.177   -1.745  1.00 0.00 ? 57 HIS A HD1  9  
ATOM 10477 H HD2  . HIS A 1 57 ? 1.294   7.106   -1.860  1.00 0.00 ? 57 HIS A HD2  9  
ATOM 10478 H HE1  . HIS A 1 57 ? 4.685   4.659   -1.288  1.00 0.00 ? 57 HIS A HE1  9  
ATOM 10479 N N    . HIS A 1 58 ? 2.259   2.466   -3.763  1.00 0.00 ? 58 HIS A N    9  
ATOM 10480 C CA   . HIS A 1 58 ? 3.111   1.247   -3.726  1.00 0.00 ? 58 HIS A CA   9  
ATOM 10481 C C    . HIS A 1 58 ? 4.576   1.668   -3.815  1.00 0.00 ? 58 HIS A C    9  
ATOM 10482 O O    . HIS A 1 58 ? 5.069   2.012   -4.869  1.00 0.00 ? 58 HIS A O    9  
ATOM 10483 C CB   . HIS A 1 58 ? 2.761   0.340   -4.908  1.00 0.00 ? 58 HIS A CB   9  
ATOM 10484 C CG   . HIS A 1 58 ? 2.621   1.167   -6.157  1.00 0.00 ? 58 HIS A CG   9  
ATOM 10485 N ND1  . HIS A 1 58 ? 3.720   1.656   -6.846  1.00 0.00 ? 58 HIS A ND1  9  
ATOM 10486 C CD2  . HIS A 1 58 ? 1.520   1.594   -6.856  1.00 0.00 ? 58 HIS A CD2  9  
ATOM 10487 C CE1  . HIS A 1 58 ? 3.260   2.342   -7.908  1.00 0.00 ? 58 HIS A CE1  9  
ATOM 10488 N NE2  . HIS A 1 58 ? 1.926   2.335   -7.961  1.00 0.00 ? 58 HIS A NE2  9  
ATOM 10489 H H    . HIS A 1 58 ? 2.660   3.335   -3.971  1.00 0.00 ? 58 HIS A H    9  
ATOM 10490 H HA   . HIS A 1 58 ? 2.942   0.717   -2.800  1.00 0.00 ? 58 HIS A HA   9  
ATOM 10491 H HB2  . HIS A 1 58 ? 3.545   -0.390  -5.046  1.00 0.00 ? 58 HIS A HB2  9  
ATOM 10492 H HB3  . HIS A 1 58 ? 1.829   -0.167  -4.708  1.00 0.00 ? 58 HIS A HB3  9  
ATOM 10493 H HD1  . HIS A 1 58 ? 4.660   1.529   -6.602  1.00 0.00 ? 58 HIS A HD1  9  
ATOM 10494 H HD2  . HIS A 1 58 ? 0.495   1.387   -6.588  1.00 0.00 ? 58 HIS A HD2  9  
ATOM 10495 H HE1  . HIS A 1 58 ? 3.893   2.839   -8.628  1.00 0.00 ? 58 HIS A HE1  9  
ATOM 10496 N N    . THR A 1 59 ? 5.275   1.654   -2.714  1.00 0.00 ? 59 THR A N    9  
ATOM 10497 C CA   . THR A 1 59 ? 6.707   2.064   -2.739  1.00 0.00 ? 59 THR A CA   9  
ATOM 10498 C C    . THR A 1 59 ? 7.439   1.299   -3.840  1.00 0.00 ? 59 THR A C    9  
ATOM 10499 O O    . THR A 1 59 ? 7.983   0.237   -3.612  1.00 0.00 ? 59 THR A O    9  
ATOM 10500 C CB   . THR A 1 59 ? 7.355   1.750   -1.388  1.00 0.00 ? 59 THR A CB   9  
ATOM 10501 O OG1  . THR A 1 59 ? 6.507   2.203   -0.342  1.00 0.00 ? 59 THR A OG1  9  
ATOM 10502 C CG2  . THR A 1 59 ? 8.710   2.455   -1.293  1.00 0.00 ? 59 THR A CG2  9  
ATOM 10503 H H    . THR A 1 59 ? 4.856   1.382   -1.870  1.00 0.00 ? 59 THR A H    9  
ATOM 10504 H HA   . THR A 1 59 ? 6.773   3.124   -2.932  1.00 0.00 ? 59 THR A HA   9  
ATOM 10505 H HB   . THR A 1 59 ? 7.501   0.685   -1.298  1.00 0.00 ? 59 THR A HB   9  
ATOM 10506 H HG1  . THR A 1 59 ? 6.947   2.933   0.100   1.00 0.00 ? 59 THR A HG1  9  
ATOM 10507 H HG21 . THR A 1 59 ? 8.582   3.510   -1.487  1.00 0.00 ? 59 THR A HG21 9  
ATOM 10508 H HG22 . THR A 1 59 ? 9.386   2.035   -2.023  1.00 0.00 ? 59 THR A HG22 9  
ATOM 10509 H HG23 . THR A 1 59 ? 9.118   2.318   -0.302  1.00 0.00 ? 59 THR A HG23 9  
ATOM 10510 N N    . PHE A 1 60 ? 7.467   1.833   -5.032  1.00 0.00 ? 60 PHE A N    9  
ATOM 10511 C CA   . PHE A 1 60 ? 8.180   1.133   -6.144  1.00 0.00 ? 60 PHE A CA   9  
ATOM 10512 C C    . PHE A 1 60 ? 9.673   1.510   -6.066  1.00 0.00 ? 60 PHE A C    9  
ATOM 10513 O O    . PHE A 1 60 ? 10.006  2.538   -5.513  1.00 0.00 ? 60 PHE A O    9  
ATOM 10514 C CB   . PHE A 1 60 ? 7.586   1.567   -7.512  1.00 0.00 ? 60 PHE A CB   9  
ATOM 10515 C CG   . PHE A 1 60 ? 6.640   0.504   -8.040  1.00 0.00 ? 60 PHE A CG   9  
ATOM 10516 C CD1  . PHE A 1 60 ? 5.746   -0.134  -7.172  1.00 0.00 ? 60 PHE A CD1  9  
ATOM 10517 C CD2  . PHE A 1 60 ? 6.664   0.157   -9.397  1.00 0.00 ? 60 PHE A CD2  9  
ATOM 10518 C CE1  . PHE A 1 60 ? 4.878   -1.117  -7.660  1.00 0.00 ? 60 PHE A CE1  9  
ATOM 10519 C CE2  . PHE A 1 60 ? 5.797   -0.827  -9.884  1.00 0.00 ? 60 PHE A CE2  9  
ATOM 10520 C CZ   . PHE A 1 60 ? 4.903   -1.465  -9.016  1.00 0.00 ? 60 PHE A CZ   9  
ATOM 10521 H H    . PHE A 1 60 ? 7.030   2.693   -5.191  1.00 0.00 ? 60 PHE A H    9  
ATOM 10522 H HA   . PHE A 1 60 ? 8.066   0.067   -6.009  1.00 0.00 ? 60 PHE A HA   9  
ATOM 10523 H HB2  . PHE A 1 60 ? 7.044   2.492   -7.393  1.00 0.00 ? 60 PHE A HB2  9  
ATOM 10524 H HB3  . PHE A 1 60 ? 8.383   1.717   -8.229  1.00 0.00 ? 60 PHE A HB3  9  
ATOM 10525 H HD1  . PHE A 1 60 ? 5.725   0.133   -6.126  1.00 0.00 ? 60 PHE A HD1  9  
ATOM 10526 H HD2  . PHE A 1 60 ? 7.353   0.649   -10.068 1.00 0.00 ? 60 PHE A HD2  9  
ATOM 10527 H HE1  . PHE A 1 60 ? 4.188   -1.610  -6.990  1.00 0.00 ? 60 PHE A HE1  9  
ATOM 10528 H HE2  . PHE A 1 60 ? 5.816   -1.094  -10.931 1.00 0.00 ? 60 PHE A HE2  9  
ATOM 10529 H HZ   . PHE A 1 60 ? 4.234   -2.225  -9.391  1.00 0.00 ? 60 PHE A HZ   9  
ATOM 10530 N N    . PRO A 1 61 ? 10.534  0.677   -6.613  1.00 0.00 ? 61 PRO A N    9  
ATOM 10531 C CA   . PRO A 1 61 ? 11.982  0.949   -6.586  1.00 0.00 ? 61 PRO A CA   9  
ATOM 10532 C C    . PRO A 1 61 ? 12.272  2.336   -7.180  1.00 0.00 ? 61 PRO A C    9  
ATOM 10533 O O    . PRO A 1 61 ? 11.419  2.962   -7.777  1.00 0.00 ? 61 PRO A O    9  
ATOM 10534 C CB   . PRO A 1 61 ? 12.616  -0.177  -7.441  1.00 0.00 ? 61 PRO A CB   9  
ATOM 10535 C CG   . PRO A 1 61 ? 11.456  -1.079  -7.957  1.00 0.00 ? 61 PRO A CG   9  
ATOM 10536 C CD   . PRO A 1 61 ? 10.154  -0.579  -7.297  1.00 0.00 ? 61 PRO A CD   9  
ATOM 10537 H HA   . PRO A 1 61 ? 12.351  0.896   -5.574  1.00 0.00 ? 61 PRO A HA   9  
ATOM 10538 H HB2  . PRO A 1 61 ? 13.160  0.245   -8.279  1.00 0.00 ? 61 PRO A HB2  9  
ATOM 10539 H HB3  . PRO A 1 61 ? 13.289  -0.766  -6.835  1.00 0.00 ? 61 PRO A HB3  9  
ATOM 10540 H HG2  . PRO A 1 61 ? 11.381  -0.999  -9.036  1.00 0.00 ? 61 PRO A HG2  9  
ATOM 10541 H HG3  . PRO A 1 61 ? 11.635  -2.110  -7.682  1.00 0.00 ? 61 PRO A HG3  9  
ATOM 10542 H HD2  . PRO A 1 61 ? 9.394   -0.389  -8.044  1.00 0.00 ? 61 PRO A HD2  9  
ATOM 10543 H HD3  . PRO A 1 61 ? 9.800   -1.301  -6.574  1.00 0.00 ? 61 PRO A HD3  9  
ATOM 10544 N N    . SER A 1 62 ? 13.476  2.810   -6.997  1.00 0.00 ? 62 SER A N    9  
ATOM 10545 C CA   . SER A 1 62 ? 13.861  4.154   -7.527  1.00 0.00 ? 62 SER A CA   9  
ATOM 10546 C C    . SER A 1 62 ? 13.296  4.344   -8.940  1.00 0.00 ? 62 SER A C    9  
ATOM 10547 O O    . SER A 1 62 ? 13.184  5.450   -9.429  1.00 0.00 ? 62 SER A O    9  
ATOM 10548 C CB   . SER A 1 62 ? 15.385  4.265   -7.568  1.00 0.00 ? 62 SER A CB   9  
ATOM 10549 O OG   . SER A 1 62 ? 15.901  4.140   -6.249  1.00 0.00 ? 62 SER A OG   9  
ATOM 10550 H H    . SER A 1 62 ? 14.117  2.270   -6.487  1.00 0.00 ? 62 SER A H    9  
ATOM 10551 H HA   . SER A 1 62 ? 13.464  4.920   -6.878  1.00 0.00 ? 62 SER A HA   9  
ATOM 10552 H HB2  . SER A 1 62 ? 15.789  3.478   -8.182  1.00 0.00 ? 62 SER A HB2  9  
ATOM 10553 H HB3  . SER A 1 62 ? 15.664  5.224   -7.986  1.00 0.00 ? 62 SER A HB3  9  
ATOM 10554 H HG   . SER A 1 62 ? 15.777  4.981   -5.802  1.00 0.00 ? 62 SER A HG   9  
ATOM 10555 N N    . ARG A 1 63 ? 12.934  3.275   -9.597  1.00 0.00 ? 63 ARG A N    9  
ATOM 10556 C CA   . ARG A 1 63 ? 12.371  3.398   -10.975 1.00 0.00 ? 63 ARG A CA   9  
ATOM 10557 C C    . ARG A 1 63 ? 11.040  4.157   -10.925 1.00 0.00 ? 63 ARG A C    9  
ATOM 10558 O O    . ARG A 1 63 ? 9.985   3.595   -11.146 1.00 0.00 ? 63 ARG A O    9  
ATOM 10559 C CB   . ARG A 1 63 ? 12.135  2.001   -11.557 1.00 0.00 ? 63 ARG A CB   9  
ATOM 10560 C CG   . ARG A 1 63 ? 11.772  2.117   -13.044 1.00 0.00 ? 63 ARG A CG   9  
ATOM 10561 C CD   . ARG A 1 63 ? 11.529  0.717   -13.649 1.00 0.00 ? 63 ARG A CD   9  
ATOM 10562 N NE   . ARG A 1 63 ? 12.159  0.635   -15.005 1.00 0.00 ? 63 ARG A NE   9  
ATOM 10563 C CZ   . ARG A 1 63 ? 11.982  1.579   -15.892 1.00 0.00 ? 63 ARG A CZ   9  
ATOM 10564 N NH1  . ARG A 1 63 ? 11.138  2.549   -15.670 1.00 0.00 ? 63 ARG A NH1  9  
ATOM 10565 N NH2  . ARG A 1 63 ? 12.625  1.529   -17.028 1.00 0.00 ? 63 ARG A NH2  9  
ATOM 10566 H H    . ARG A 1 63 ? 13.029  2.392   -9.182  1.00 0.00 ? 63 ARG A H    9  
ATOM 10567 H HA   . ARG A 1 63 ? 13.067  3.935   -11.600 1.00 0.00 ? 63 ARG A HA   9  
ATOM 10568 H HB2  . ARG A 1 63 ? 13.034  1.411   -11.451 1.00 0.00 ? 63 ARG A HB2  9  
ATOM 10569 H HB3  . ARG A 1 63 ? 11.324  1.520   -11.030 1.00 0.00 ? 63 ARG A HB3  9  
ATOM 10570 H HG2  . ARG A 1 63 ? 10.879  2.717   -13.139 1.00 0.00 ? 63 ARG A HG2  9  
ATOM 10571 H HG3  . ARG A 1 63 ? 12.582  2.598   -13.572 1.00 0.00 ? 63 ARG A HG3  9  
ATOM 10572 H HD2  . ARG A 1 63 ? 11.982  -0.039  -13.028 1.00 0.00 ? 63 ARG A HD2  9  
ATOM 10573 H HD3  . ARG A 1 63 ? 10.461  0.527   -13.710 1.00 0.00 ? 63 ARG A HD3  9  
ATOM 10574 H HE   . ARG A 1 63 ? 12.745  -0.121  -15.217 1.00 0.00 ? 63 ARG A HE   9  
ATOM 10575 H HH11 . ARG A 1 63 ? 10.619  2.573   -14.820 1.00 0.00 ? 63 ARG A HH11 9  
ATOM 10576 H HH12 . ARG A 1 63 ? 11.013  3.268   -16.353 1.00 0.00 ? 63 ARG A HH12 9  
ATOM 10577 H HH21 . ARG A 1 63 ? 13.248  0.769   -17.215 1.00 0.00 ? 63 ARG A HH21 9  
ATOM 10578 H HH22 . ARG A 1 63 ? 12.492  2.247   -17.710 1.00 0.00 ? 63 ARG A HH22 9  
ATOM 10579 N N    . GLY A 1 64 ? 11.080  5.431   -10.644 1.00 0.00 ? 64 GLY A N    9  
ATOM 10580 C CA   . GLY A 1 64 ? 9.817   6.226   -10.590 1.00 0.00 ? 64 GLY A CA   9  
ATOM 10581 C C    . GLY A 1 64 ? 8.984   5.810   -9.375  1.00 0.00 ? 64 GLY A C    9  
ATOM 10582 O O    . GLY A 1 64 ? 9.284   4.844   -8.703  1.00 0.00 ? 64 GLY A O    9  
ATOM 10583 H H    . GLY A 1 64 ? 11.941  5.868   -10.474 1.00 0.00 ? 64 GLY A H    9  
ATOM 10584 H HA2  . GLY A 1 64 ? 10.060  7.277   -10.517 1.00 0.00 ? 64 GLY A HA2  9  
ATOM 10585 H HA3  . GLY A 1 64 ? 9.246   6.052   -11.489 1.00 0.00 ? 64 GLY A HA3  9  
ATOM 10586 N N    . ASN A 1 65 ? 7.934   6.538   -9.091  1.00 0.00 ? 65 ASN A N    9  
ATOM 10587 C CA   . ASN A 1 65 ? 7.075   6.194   -7.922  1.00 0.00 ? 65 ASN A CA   9  
ATOM 10588 C C    . ASN A 1 65 ? 5.685   6.809   -8.114  1.00 0.00 ? 65 ASN A C    9  
ATOM 10589 O O    . ASN A 1 65 ? 5.551   7.973   -8.437  1.00 0.00 ? 65 ASN A O    9  
ATOM 10590 C CB   . ASN A 1 65 ? 7.704   6.750   -6.643  1.00 0.00 ? 65 ASN A CB   9  
ATOM 10591 C CG   . ASN A 1 65 ? 9.048   6.063   -6.391  1.00 0.00 ? 65 ASN A CG   9  
ATOM 10592 O OD1  . ASN A 1 65 ? 9.101   4.869   -6.174  1.00 0.00 ? 65 ASN A OD1  9  
ATOM 10593 N ND2  . ASN A 1 65 ? 10.144  6.771   -6.410  1.00 0.00 ? 65 ASN A ND2  9  
ATOM 10594 H H    . ASN A 1 65 ? 7.712   7.312   -9.648  1.00 0.00 ? 65 ASN A H    9  
ATOM 10595 H HA   . ASN A 1 65 ? 6.985   5.119   -7.843  1.00 0.00 ? 65 ASN A HA   9  
ATOM 10596 H HB2  . ASN A 1 65 ? 7.859   7.814   -6.752  1.00 0.00 ? 65 ASN A HB2  9  
ATOM 10597 H HB3  . ASN A 1 65 ? 7.046   6.566   -5.808  1.00 0.00 ? 65 ASN A HB3  9  
ATOM 10598 H HD21 . ASN A 1 65 ? 10.101  7.734   -6.585  1.00 0.00 ? 65 ASN A HD21 9  
ATOM 10599 H HD22 . ASN A 1 65 ? 11.009  6.340   -6.250  1.00 0.00 ? 65 ASN A HD22 9  
ATOM 10600 N N    . LEU A 1 66 ? 4.648   6.037   -7.918  1.00 0.00 ? 66 LEU A N    9  
ATOM 10601 C CA   . LEU A 1 66 ? 3.264   6.575   -8.090  1.00 0.00 ? 66 LEU A CA   9  
ATOM 10602 C C    . LEU A 1 66 ? 2.794   7.204   -6.775  1.00 0.00 ? 66 LEU A C    9  
ATOM 10603 O O    . LEU A 1 66 ? 2.452   6.514   -5.835  1.00 0.00 ? 66 LEU A O    9  
ATOM 10604 C CB   . LEU A 1 66 ? 2.322   5.427   -8.471  1.00 0.00 ? 66 LEU A CB   9  
ATOM 10605 C CG   . LEU A 1 66 ? 0.916   5.965   -8.783  1.00 0.00 ? 66 LEU A CG   9  
ATOM 10606 C CD1  . LEU A 1 66 ? 0.932   6.810   -10.070 1.00 0.00 ? 66 LEU A CD1  9  
ATOM 10607 C CD2  . LEU A 1 66 ? -0.041  4.778   -8.956  1.00 0.00 ? 66 LEU A CD2  9  
ATOM 10608 H H    . LEU A 1 66 ? 4.779   5.100   -7.659  1.00 0.00 ? 66 LEU A H    9  
ATOM 10609 H HA   . LEU A 1 66 ? 3.260   7.321   -8.870  1.00 0.00 ? 66 LEU A HA   9  
ATOM 10610 H HB2  . LEU A 1 66 ? 2.713   4.915   -9.339  1.00 0.00 ? 66 LEU A HB2  9  
ATOM 10611 H HB3  . LEU A 1 66 ? 2.260   4.732   -7.648  1.00 0.00 ? 66 LEU A HB3  9  
ATOM 10612 H HG   . LEU A 1 66 ? 0.576   6.578   -7.961  1.00 0.00 ? 66 LEU A HG   9  
ATOM 10613 H HD11 . LEU A 1 66 ? 1.640   6.394   -10.774 1.00 0.00 ? 66 LEU A HD11 9  
ATOM 10614 H HD12 . LEU A 1 66 ? 1.217   7.823   -9.832  1.00 0.00 ? 66 LEU A HD12 9  
ATOM 10615 H HD13 . LEU A 1 66 ? -0.053  6.816   -10.517 1.00 0.00 ? 66 LEU A HD13 9  
ATOM 10616 H HD21 . LEU A 1 66 ? -1.023  5.143   -9.221  1.00 0.00 ? 66 LEU A HD21 9  
ATOM 10617 H HD22 . LEU A 1 66 ? -0.099  4.226   -8.030  1.00 0.00 ? 66 LEU A HD22 9  
ATOM 10618 H HD23 . LEU A 1 66 ? 0.325   4.132   -9.739  1.00 0.00 ? 66 LEU A HD23 9  
ATOM 10619 N N    . ASP A 1 67 ? 2.770   8.509   -6.700  1.00 0.00 ? 67 ASP A N    9  
ATOM 10620 C CA   . ASP A 1 67 ? 2.318   9.184   -5.447  1.00 0.00 ? 67 ASP A CA   9  
ATOM 10621 C C    . ASP A 1 67 ? 0.816   9.465   -5.534  1.00 0.00 ? 67 ASP A C    9  
ATOM 10622 O O    . ASP A 1 67 ? 0.382   10.599  -5.462  1.00 0.00 ? 67 ASP A O    9  
ATOM 10623 C CB   . ASP A 1 67 ? 3.074   10.504  -5.279  1.00 0.00 ? 67 ASP A CB   9  
ATOM 10624 C CG   . ASP A 1 67 ? 2.881   11.365  -6.529  1.00 0.00 ? 67 ASP A CG   9  
ATOM 10625 O OD1  . ASP A 1 67 ? 3.049   10.840  -7.618  1.00 0.00 ? 67 ASP A OD1  9  
ATOM 10626 O OD2  . ASP A 1 67 ? 2.567   12.534  -6.377  1.00 0.00 ? 67 ASP A OD2  9  
ATOM 10627 H H    . ASP A 1 67 ? 3.049   9.047   -7.472  1.00 0.00 ? 67 ASP A H    9  
ATOM 10628 H HA   . ASP A 1 67 ? 2.516   8.547   -4.595  1.00 0.00 ? 67 ASP A HA   9  
ATOM 10629 H HB2  . ASP A 1 67 ? 2.691   11.030  -4.416  1.00 0.00 ? 67 ASP A HB2  9  
ATOM 10630 H HB3  . ASP A 1 67 ? 4.126   10.302  -5.143  1.00 0.00 ? 67 ASP A HB3  9  
ATOM 10631 N N    . ASP A 1 68 ? 0.018   8.444   -5.691  1.00 0.00 ? 68 ASP A N    9  
ATOM 10632 C CA   . ASP A 1 68 ? -1.456  8.654   -5.782  1.00 0.00 ? 68 ASP A CA   9  
ATOM 10633 C C    . ASP A 1 68 ? -1.984  9.167   -4.443  1.00 0.00 ? 68 ASP A C    9  
ATOM 10634 O O    . ASP A 1 68 ? -2.140  10.355  -4.240  1.00 0.00 ? 68 ASP A O    9  
ATOM 10635 C CB   . ASP A 1 68 ? -2.140  7.330   -6.136  1.00 0.00 ? 68 ASP A CB   9  
ATOM 10636 C CG   . ASP A 1 68 ? -1.507  6.194   -5.331  1.00 0.00 ? 68 ASP A CG   9  
ATOM 10637 O OD1  . ASP A 1 68 ? -0.851  6.486   -4.345  1.00 0.00 ? 68 ASP A OD1  9  
ATOM 10638 O OD2  . ASP A 1 68 ? -1.689  5.050   -5.716  1.00 0.00 ? 68 ASP A OD2  9  
ATOM 10639 H H    . ASP A 1 68 ? 0.387   7.538   -5.747  1.00 0.00 ? 68 ASP A H    9  
ATOM 10640 H HA   . ASP A 1 68 ? -1.666  9.382   -6.551  1.00 0.00 ? 68 ASP A HA   9  
ATOM 10641 H HB2  . ASP A 1 68 ? -3.194  7.393   -5.904  1.00 0.00 ? 68 ASP A HB2  9  
ATOM 10642 H HB3  . ASP A 1 68 ? -2.018  7.133   -7.191  1.00 0.00 ? 68 ASP A HB3  9  
ATOM 10643 N N    . PHE A 1 69 ? -2.255  8.282   -3.523  1.00 0.00 ? 69 PHE A N    9  
ATOM 10644 C CA   . PHE A 1 69 ? -2.765  8.706   -2.196  1.00 0.00 ? 69 PHE A CA   9  
ATOM 10645 C C    . PHE A 1 69 ? -2.471  7.607   -1.175  1.00 0.00 ? 69 PHE A C    9  
ATOM 10646 O O    . PHE A 1 69 ? -2.409  6.440   -1.508  1.00 0.00 ? 69 PHE A O    9  
ATOM 10647 C CB   . PHE A 1 69 ? -4.275  8.945   -2.272  1.00 0.00 ? 69 PHE A CB   9  
ATOM 10648 C CG   . PHE A 1 69 ? -4.569  9.983   -3.327  1.00 0.00 ? 69 PHE A CG   9  
ATOM 10649 C CD1  . PHE A 1 69 ? -4.485  11.345  -3.014  1.00 0.00 ? 69 PHE A CD1  9  
ATOM 10650 C CD2  . PHE A 1 69 ? -4.925  9.583   -4.620  1.00 0.00 ? 69 PHE A CD2  9  
ATOM 10651 C CE1  . PHE A 1 69 ? -4.756  12.307  -3.995  1.00 0.00 ? 69 PHE A CE1  9  
ATOM 10652 C CE2  . PHE A 1 69 ? -5.195  10.545  -5.601  1.00 0.00 ? 69 PHE A CE2  9  
ATOM 10653 C CZ   . PHE A 1 69 ? -5.111  11.906  -5.288  1.00 0.00 ? 69 PHE A CZ   9  
ATOM 10654 H H    . PHE A 1 69 ? -2.118  7.337   -3.699  1.00 0.00 ? 69 PHE A H    9  
ATOM 10655 H HA   . PHE A 1 69 ? -2.269  9.609   -1.900  1.00 0.00 ? 69 PHE A HA   9  
ATOM 10656 H HB2  . PHE A 1 69 ? -4.773  8.021   -2.526  1.00 0.00 ? 69 PHE A HB2  9  
ATOM 10657 H HB3  . PHE A 1 69 ? -4.632  9.295   -1.314  1.00 0.00 ? 69 PHE A HB3  9  
ATOM 10658 H HD1  . PHE A 1 69 ? -4.210  11.654  -2.016  1.00 0.00 ? 69 PHE A HD1  9  
ATOM 10659 H HD2  . PHE A 1 69 ? -4.990  8.532   -4.862  1.00 0.00 ? 69 PHE A HD2  9  
ATOM 10660 H HE1  . PHE A 1 69 ? -4.690  13.358  -3.754  1.00 0.00 ? 69 PHE A HE1  9  
ATOM 10661 H HE2  . PHE A 1 69 ? -5.470  10.235  -6.599  1.00 0.00 ? 69 PHE A HE2  9  
ATOM 10662 H HZ   . PHE A 1 69 ? -5.321  12.648  -6.045  1.00 0.00 ? 69 PHE A HZ   9  
ATOM 10663 N N    . PHE A 1 70 ? -2.282  7.966   0.063   1.00 0.00 ? 70 PHE A N    9  
ATOM 10664 C CA   . PHE A 1 70 ? -1.983  6.936   1.097   1.00 0.00 ? 70 PHE A CA   9  
ATOM 10665 C C    . PHE A 1 70 ? -3.267  6.201   1.493   1.00 0.00 ? 70 PHE A C    9  
ATOM 10666 O O    . PHE A 1 70 ? -3.244  5.034   1.827   1.00 0.00 ? 70 PHE A O    9  
ATOM 10667 C CB   . PHE A 1 70 ? -1.386  7.613   2.332   1.00 0.00 ? 70 PHE A CB   9  
ATOM 10668 C CG   . PHE A 1 70 ? -0.972  6.559   3.330   1.00 0.00 ? 70 PHE A CG   9  
ATOM 10669 C CD1  . PHE A 1 70 ? 0.314   6.007   3.272   1.00 0.00 ? 70 PHE A CD1  9  
ATOM 10670 C CD2  . PHE A 1 70 ? -1.874  6.131   4.310   1.00 0.00 ? 70 PHE A CD2  9  
ATOM 10671 C CE1  . PHE A 1 70 ? 0.696   5.026   4.195   1.00 0.00 ? 70 PHE A CE1  9  
ATOM 10672 C CE2  . PHE A 1 70 ? -1.492  5.150   5.234   1.00 0.00 ? 70 PHE A CE2  9  
ATOM 10673 C CZ   . PHE A 1 70 ? -0.206  4.598   5.176   1.00 0.00 ? 70 PHE A CZ   9  
ATOM 10674 H H    . PHE A 1 70 ? -2.331  8.912   0.314   1.00 0.00 ? 70 PHE A H    9  
ATOM 10675 H HA   . PHE A 1 70 ? -1.273  6.226   0.701   1.00 0.00 ? 70 PHE A HA   9  
ATOM 10676 H HB2  . PHE A 1 70 ? -0.523  8.195   2.042   1.00 0.00 ? 70 PHE A HB2  9  
ATOM 10677 H HB3  . PHE A 1 70 ? -2.123  8.262   2.780   1.00 0.00 ? 70 PHE A HB3  9  
ATOM 10678 H HD1  . PHE A 1 70 ? 1.009   6.338   2.515   1.00 0.00 ? 70 PHE A HD1  9  
ATOM 10679 H HD2  . PHE A 1 70 ? -2.866  6.556   4.355   1.00 0.00 ? 70 PHE A HD2  9  
ATOM 10680 H HE1  . PHE A 1 70 ? 1.688   4.601   4.150   1.00 0.00 ? 70 PHE A HE1  9  
ATOM 10681 H HE2  . PHE A 1 70 ? -2.188  4.820   5.990   1.00 0.00 ? 70 PHE A HE2  9  
ATOM 10682 H HZ   . PHE A 1 70 ? 0.089   3.841   5.888   1.00 0.00 ? 70 PHE A HZ   9  
ATOM 10683 N N    . HIS A 1 71 ? -4.387  6.872   1.460   1.00 0.00 ? 71 HIS A N    9  
ATOM 10684 C CA   . HIS A 1 71 ? -5.665  6.203   1.840   1.00 0.00 ? 71 HIS A CA   9  
ATOM 10685 C C    . HIS A 1 71 ? -6.845  7.122   1.517   1.00 0.00 ? 71 HIS A C    9  
ATOM 10686 O O    . HIS A 1 71 ? -7.347  7.825   2.371   1.00 0.00 ? 71 HIS A O    9  
ATOM 10687 C CB   . HIS A 1 71 ? -5.654  5.903   3.341   1.00 0.00 ? 71 HIS A CB   9  
ATOM 10688 C CG   . HIS A 1 71 ? -6.893  5.133   3.706   1.00 0.00 ? 71 HIS A CG   9  
ATOM 10689 N ND1  . HIS A 1 71 ? -8.076  5.761   4.066   1.00 0.00 ? 71 HIS A ND1  9  
ATOM 10690 C CD2  . HIS A 1 71 ? -7.150  3.785   3.773   1.00 0.00 ? 71 HIS A CD2  9  
ATOM 10691 C CE1  . HIS A 1 71 ? -8.980  4.801   4.331   1.00 0.00 ? 71 HIS A CE1  9  
ATOM 10692 N NE2  . HIS A 1 71 ? -8.468  3.578   4.167   1.00 0.00 ? 71 HIS A NE2  9  
ATOM 10693 H H    . HIS A 1 71 ? -4.388  7.812   1.188   1.00 0.00 ? 71 HIS A H    9  
ATOM 10694 H HA   . HIS A 1 71 ? -5.764  5.278   1.291   1.00 0.00 ? 71 HIS A HA   9  
ATOM 10695 H HB2  . HIS A 1 71 ? -4.780  5.317   3.586   1.00 0.00 ? 71 HIS A HB2  9  
ATOM 10696 H HB3  . HIS A 1 71 ? -5.632  6.830   3.894   1.00 0.00 ? 71 HIS A HB3  9  
ATOM 10697 H HD1  . HIS A 1 71 ? -8.225  6.728   4.119   1.00 0.00 ? 71 HIS A HD1  9  
ATOM 10698 H HD2  . HIS A 1 71 ? -6.436  3.005   3.553   1.00 0.00 ? 71 HIS A HD2  9  
ATOM 10699 H HE1  . HIS A 1 71 ? -9.998  4.995   4.638   1.00 0.00 ? 71 HIS A HE1  9  
ATOM 10700 N N    . ARG A 1 72 ? -7.297  7.120   0.292   1.00 0.00 ? 72 ARG A N    9  
ATOM 10701 C CA   . ARG A 1 72 ? -8.447  7.991   -0.081  1.00 0.00 ? 72 ARG A CA   9  
ATOM 10702 C C    . ARG A 1 72 ? -9.731  7.415   0.527   1.00 0.00 ? 72 ARG A C    9  
ATOM 10703 O O    . ARG A 1 72 ? -10.045 6.257   0.349   1.00 0.00 ? 72 ARG A O    9  
ATOM 10704 C CB   . ARG A 1 72 ? -8.571  8.035   -1.608  1.00 0.00 ? 72 ARG A CB   9  
ATOM 10705 C CG   . ARG A 1 72 ? -9.492  9.189   -2.033  1.00 0.00 ? 72 ARG A CG   9  
ATOM 10706 C CD   . ARG A 1 72 ? -8.850  10.552  -1.706  1.00 0.00 ? 72 ARG A CD   9  
ATOM 10707 N NE   . ARG A 1 72 ? -9.287  11.554  -2.718  1.00 0.00 ? 72 ARG A NE   9  
ATOM 10708 C CZ   . ARG A 1 72 ? -9.115  12.828  -2.490  1.00 0.00 ? 72 ARG A CZ   9  
ATOM 10709 N NH1  . ARG A 1 72 ? -8.554  13.224  -1.380  1.00 0.00 ? 72 ARG A NH1  9  
ATOM 10710 N NH2  . ARG A 1 72 ? -9.503  13.706  -3.374  1.00 0.00 ? 72 ARG A NH2  9  
ATOM 10711 H H    . ARG A 1 72 ? -6.880  6.544   -0.384  1.00 0.00 ? 72 ARG A H    9  
ATOM 10712 H HA   . ARG A 1 72 ? -8.281  8.986   0.301   1.00 0.00 ? 72 ARG A HA   9  
ATOM 10713 H HB2  . ARG A 1 72 ? -7.592  8.175   -2.043  1.00 0.00 ? 72 ARG A HB2  9  
ATOM 10714 H HB3  . ARG A 1 72 ? -8.986  7.102   -1.959  1.00 0.00 ? 72 ARG A HB3  9  
ATOM 10715 H HG2  . ARG A 1 72 ? -9.668  9.127   -3.097  1.00 0.00 ? 72 ARG A HG2  9  
ATOM 10716 H HG3  . ARG A 1 72 ? -10.436 9.104   -1.513  1.00 0.00 ? 72 ARG A HG3  9  
ATOM 10717 H HD2  . ARG A 1 72 ? -9.163  10.876  -0.724  1.00 0.00 ? 72 ARG A HD2  9  
ATOM 10718 H HD3  . ARG A 1 72 ? -7.772  10.470  -1.730  1.00 0.00 ? 72 ARG A HD3  9  
ATOM 10719 H HE   . ARG A 1 72 ? -9.707  11.258  -3.553  1.00 0.00 ? 72 ARG A HE   9  
ATOM 10720 H HH11 . ARG A 1 72 ? -8.256  12.551  -0.703  1.00 0.00 ? 72 ARG A HH11 9  
ATOM 10721 H HH12 . ARG A 1 72 ? -8.422  14.200  -1.207  1.00 0.00 ? 72 ARG A HH12 9  
ATOM 10722 H HH21 . ARG A 1 72 ? -9.931  13.403  -4.226  1.00 0.00 ? 72 ARG A HH21 9  
ATOM 10723 H HH22 . ARG A 1 72 ? -9.370  14.681  -3.201  1.00 0.00 ? 72 ARG A HH22 9  
ATOM 10724 N N    . ASP A 1 73 ? -10.473 8.211   1.246   1.00 0.00 ? 73 ASP A N    9  
ATOM 10725 C CA   . ASP A 1 73 ? -11.732 7.697   1.862   1.00 0.00 ? 73 ASP A CA   9  
ATOM 10726 C C    . ASP A 1 73 ? -12.517 8.863   2.467   1.00 0.00 ? 73 ASP A C    9  
ATOM 10727 O O    . ASP A 1 73 ? -11.983 9.930   2.699   1.00 0.00 ? 73 ASP A O    9  
ATOM 10728 C CB   . ASP A 1 73 ? -11.386 6.692   2.963   1.00 0.00 ? 73 ASP A CB   9  
ATOM 10729 C CG   . ASP A 1 73 ? -12.677 6.150   3.583   1.00 0.00 ? 73 ASP A CG   9  
ATOM 10730 O OD1  . ASP A 1 73 ? -13.552 5.758   2.830   1.00 0.00 ? 73 ASP A OD1  9  
ATOM 10731 O OD2  . ASP A 1 73 ? -12.766 6.137   4.799   1.00 0.00 ? 73 ASP A OD2  9  
ATOM 10732 H H    . ASP A 1 73 ? -10.204 9.143   1.385   1.00 0.00 ? 73 ASP A H    9  
ATOM 10733 H HA   . ASP A 1 73 ? -12.332 7.210   1.106   1.00 0.00 ? 73 ASP A HA   9  
ATOM 10734 H HB2  . ASP A 1 73 ? -10.819 5.876   2.541   1.00 0.00 ? 73 ASP A HB2  9  
ATOM 10735 H HB3  . ASP A 1 73 ? -10.801 7.181   3.727   1.00 0.00 ? 73 ASP A HB3  9  
ATOM 10736 N N    . LYS A 1 74 ? -13.784 8.667   2.727   1.00 0.00 ? 74 LYS A N    9  
ATOM 10737 C CA   . LYS A 1 74 ? -14.613 9.760   3.323   1.00 0.00 ? 74 LYS A CA   9  
ATOM 10738 C C    . LYS A 1 74 ? -14.701 9.559   4.837   1.00 0.00 ? 74 LYS A C    9  
ATOM 10739 O O    . LYS A 1 74 ? -14.070 8.683   5.394   1.00 0.00 ? 74 LYS A O    9  
ATOM 10740 C CB   . LYS A 1 74 ? -16.024 9.712   2.722   1.00 0.00 ? 74 LYS A CB   9  
ATOM 10741 C CG   . LYS A 1 74 ? -15.969 10.005  1.208   1.00 0.00 ? 74 LYS A CG   9  
ATOM 10742 C CD   . LYS A 1 74 ? -16.016 11.525  0.949   1.00 0.00 ? 74 LYS A CD   9  
ATOM 10743 C CE   . LYS A 1 74 ? -17.471 12.006  0.893   1.00 0.00 ? 74 LYS A CE   9  
ATOM 10744 N NZ   . LYS A 1 74 ? -18.075 11.606  -0.409  1.00 0.00 ? 74 LYS A NZ   9  
ATOM 10745 H H    . LYS A 1 74 ? -14.191 7.797   2.536   1.00 0.00 ? 74 LYS A H    9  
ATOM 10746 H HA   . LYS A 1 74 ? -14.164 10.721  3.113   1.00 0.00 ? 74 LYS A HA   9  
ATOM 10747 H HB2  . LYS A 1 74 ? -16.444 8.730   2.882   1.00 0.00 ? 74 LYS A HB2  9  
ATOM 10748 H HB3  . LYS A 1 74 ? -16.644 10.449  3.210   1.00 0.00 ? 74 LYS A HB3  9  
ATOM 10749 H HG2  . LYS A 1 74 ? -15.053 9.600   0.796   1.00 0.00 ? 74 LYS A HG2  9  
ATOM 10750 H HG3  . LYS A 1 74 ? -16.811 9.532   0.722   1.00 0.00 ? 74 LYS A HG3  9  
ATOM 10751 H HD2  . LYS A 1 74 ? -15.497 12.046  1.740   1.00 0.00 ? 74 LYS A HD2  9  
ATOM 10752 H HD3  . LYS A 1 74 ? -15.536 11.743  0.005   1.00 0.00 ? 74 LYS A HD3  9  
ATOM 10753 H HE2  . LYS A 1 74 ? -18.032 11.561  1.701   1.00 0.00 ? 74 LYS A HE2  9  
ATOM 10754 H HE3  . LYS A 1 74 ? -17.499 13.082  0.987   1.00 0.00 ? 74 LYS A HE3  9  
ATOM 10755 H HZ1  . LYS A 1 74 ? -18.937 12.162  -0.578  1.00 0.00 ? 74 LYS A HZ1  9  
ATOM 10756 H HZ2  . LYS A 1 74 ? -18.317 10.595  -0.383  1.00 0.00 ? 74 LYS A HZ2  9  
ATOM 10757 H HZ3  . LYS A 1 74 ? -17.394 11.780  -1.176  1.00 0.00 ? 74 LYS A HZ3  9  
ATOM 10758 N N    . ASP A 1 75 ? -15.480 10.363  5.508   1.00 0.00 ? 75 ASP A N    9  
ATOM 10759 C CA   . ASP A 1 75 ? -15.609 10.215  6.985   1.00 0.00 ? 75 ASP A CA   9  
ATOM 10760 C C    . ASP A 1 75 ? -16.704 11.151  7.499   1.00 0.00 ? 75 ASP A C    9  
ATOM 10761 O O    . ASP A 1 75 ? -16.438 12.251  7.940   1.00 0.00 ? 75 ASP A O    9  
ATOM 10762 C CB   . ASP A 1 75 ? -14.280 10.573  7.653   1.00 0.00 ? 75 ASP A CB   9  
ATOM 10763 C CG   . ASP A 1 75 ? -13.838 11.965  7.199   1.00 0.00 ? 75 ASP A CG   9  
ATOM 10764 O OD1  . ASP A 1 75 ? -13.561 12.123  6.022   1.00 0.00 ? 75 ASP A OD1  9  
ATOM 10765 O OD2  . ASP A 1 75 ? -13.785 12.850  8.037   1.00 0.00 ? 75 ASP A OD2  9  
ATOM 10766 H H    . ASP A 1 75 ? -15.983 11.062  5.040   1.00 0.00 ? 75 ASP A H    9  
ATOM 10767 H HA   . ASP A 1 75 ? -15.868 9.193   7.224   1.00 0.00 ? 75 ASP A HA   9  
ATOM 10768 H HB2  . ASP A 1 75 ? -14.403 10.566  8.727   1.00 0.00 ? 75 ASP A HB2  9  
ATOM 10769 H HB3  . ASP A 1 75 ? -13.528 9.850   7.373   1.00 0.00 ? 75 ASP A HB3  9  
ATOM 10770 N N    . ASP A 1 76 ? -17.937 10.724  7.444   1.00 0.00 ? 76 ASP A N    9  
ATOM 10771 C CA   . ASP A 1 76 ? -19.047 11.591  7.930   1.00 0.00 ? 76 ASP A CA   9  
ATOM 10772 C C    . ASP A 1 76 ? -19.098 11.542  9.460   1.00 0.00 ? 76 ASP A C    9  
ATOM 10773 O O    . ASP A 1 76 ? -18.219 12.040  10.134  1.00 0.00 ? 76 ASP A O    9  
ATOM 10774 C CB   . ASP A 1 76 ? -20.373 11.088  7.356   1.00 0.00 ? 76 ASP A CB   9  
ATOM 10775 C CG   . ASP A 1 76 ? -20.502 9.585   7.613   1.00 0.00 ? 76 ASP A CG   9  
ATOM 10776 O OD1  . ASP A 1 76 ? -19.774 9.082   8.453   1.00 0.00 ? 76 ASP A OD1  9  
ATOM 10777 O OD2  . ASP A 1 76 ? -21.327 8.962   6.965   1.00 0.00 ? 76 ASP A OD2  9  
ATOM 10778 H H    . ASP A 1 76 ? -18.131 9.834   7.085   1.00 0.00 ? 76 ASP A H    9  
ATOM 10779 H HA   . ASP A 1 76 ? -18.878 12.607  7.608   1.00 0.00 ? 76 ASP A HA   9  
ATOM 10780 H HB2  . ASP A 1 76 ? -21.192 11.607  7.833   1.00 0.00 ? 76 ASP A HB2  9  
ATOM 10781 H HB3  . ASP A 1 76 ? -20.399 11.272  6.293   1.00 0.00 ? 76 ASP A HB3  9  
ATOM 10782 N N    . PHE A 1 77 ? -20.123 10.945  10.010  1.00 0.00 ? 77 PHE A N    9  
ATOM 10783 C CA   . PHE A 1 77 ? -20.241 10.858  11.495  1.00 0.00 ? 77 PHE A CA   9  
ATOM 10784 C C    . PHE A 1 77 ? -20.266 12.266  12.095  1.00 0.00 ? 77 PHE A C    9  
ATOM 10785 O O    . PHE A 1 77 ? -19.699 13.194  11.553  1.00 0.00 ? 77 PHE A O    9  
ATOM 10786 C CB   . PHE A 1 77 ? -19.049 10.079  12.063  1.00 0.00 ? 77 PHE A CB   9  
ATOM 10787 C CG   . PHE A 1 77 ? -19.350 9.661   13.484  1.00 0.00 ? 77 PHE A CG   9  
ATOM 10788 C CD1  . PHE A 1 77 ? -19.988 8.440   13.735  1.00 0.00 ? 77 PHE A CD1  9  
ATOM 10789 C CD2  . PHE A 1 77 ? -18.989 10.495  14.549  1.00 0.00 ? 77 PHE A CD2  9  
ATOM 10790 C CE1  . PHE A 1 77 ? -20.267 8.054   15.052  1.00 0.00 ? 77 PHE A CE1  9  
ATOM 10791 C CE2  . PHE A 1 77 ? -19.268 10.109  15.865  1.00 0.00 ? 77 PHE A CE2  9  
ATOM 10792 C CZ   . PHE A 1 77 ? -19.907 8.889   16.116  1.00 0.00 ? 77 PHE A CZ   9  
ATOM 10793 H H    . PHE A 1 77 ? -20.818 10.550  9.442   1.00 0.00 ? 77 PHE A H    9  
ATOM 10794 H HA   . PHE A 1 77 ? -21.158 10.346  11.749  1.00 0.00 ? 77 PHE A HA   9  
ATOM 10795 H HB2  . PHE A 1 77 ? -18.872 9.202   11.460  1.00 0.00 ? 77 PHE A HB2  9  
ATOM 10796 H HB3  . PHE A 1 77 ? -18.170 10.707  12.054  1.00 0.00 ? 77 PHE A HB3  9  
ATOM 10797 H HD1  . PHE A 1 77 ? -20.266 7.797   12.914  1.00 0.00 ? 77 PHE A HD1  9  
ATOM 10798 H HD2  . PHE A 1 77 ? -18.496 11.436  14.355  1.00 0.00 ? 77 PHE A HD2  9  
ATOM 10799 H HE1  . PHE A 1 77 ? -20.760 7.113   15.245  1.00 0.00 ? 77 PHE A HE1  9  
ATOM 10800 H HE2  . PHE A 1 77 ? -18.989 10.752  16.686  1.00 0.00 ? 77 PHE A HE2  9  
ATOM 10801 H HZ   . PHE A 1 77 ? -20.121 8.591   17.132  1.00 0.00 ? 77 PHE A HZ   9  
ATOM 10802 N N    . PHE A 1 78 ? -20.924 12.433  13.210  1.00 0.00 ? 78 PHE A N    9  
ATOM 10803 C CA   . PHE A 1 78 ? -20.988 13.780  13.846  1.00 0.00 ? 78 PHE A CA   9  
ATOM 10804 C C    . PHE A 1 78 ? -21.323 13.628  15.330  1.00 0.00 ? 78 PHE A C    9  
ATOM 10805 O O    . PHE A 1 78 ? -22.185 12.858  15.706  1.00 0.00 ? 78 PHE A O    9  
ATOM 10806 C CB   . PHE A 1 78 ? -22.073 14.616  13.163  1.00 0.00 ? 78 PHE A CB   9  
ATOM 10807 C CG   . PHE A 1 78 ? -21.652 14.932  11.748  1.00 0.00 ? 78 PHE A CG   9  
ATOM 10808 C CD1  . PHE A 1 78 ? -20.864 16.059  11.487  1.00 0.00 ? 78 PHE A CD1  9  
ATOM 10809 C CD2  . PHE A 1 78 ? -22.050 14.097  10.697  1.00 0.00 ? 78 PHE A CD2  9  
ATOM 10810 C CE1  . PHE A 1 78 ? -20.474 16.352  10.174  1.00 0.00 ? 78 PHE A CE1  9  
ATOM 10811 C CE2  . PHE A 1 78 ? -21.660 14.390  9.385   1.00 0.00 ? 78 PHE A CE2  9  
ATOM 10812 C CZ   . PHE A 1 78 ? -20.872 15.516  9.123   1.00 0.00 ? 78 PHE A CZ   9  
ATOM 10813 H H    . PHE A 1 78 ? -21.375 11.672  13.631  1.00 0.00 ? 78 PHE A H    9  
ATOM 10814 H HA   . PHE A 1 78 ? -20.033 14.276  13.741  1.00 0.00 ? 78 PHE A HA   9  
ATOM 10815 H HB2  . PHE A 1 78 ? -22.999 14.060  13.148  1.00 0.00 ? 78 PHE A HB2  9  
ATOM 10816 H HB3  . PHE A 1 78 ? -22.216 15.537  13.709  1.00 0.00 ? 78 PHE A HB3  9  
ATOM 10817 H HD1  . PHE A 1 78 ? -20.556 16.702  12.298  1.00 0.00 ? 78 PHE A HD1  9  
ATOM 10818 H HD2  . PHE A 1 78 ? -22.658 13.227  10.898  1.00 0.00 ? 78 PHE A HD2  9  
ATOM 10819 H HE1  . PHE A 1 78 ? -19.865 17.221  9.973   1.00 0.00 ? 78 PHE A HE1  9  
ATOM 10820 H HE2  . PHE A 1 78 ? -21.968 13.746  8.573   1.00 0.00 ? 78 PHE A HE2  9  
ATOM 10821 H HZ   . PHE A 1 78 ? -20.570 15.742  8.111   1.00 0.00 ? 78 PHE A HZ   9  
ATOM 10822 N N    . THR A 1 79 ? -20.649 14.355  16.178  1.00 0.00 ? 79 THR A N    9  
ATOM 10823 C CA   . THR A 1 79 ? -20.931 14.252  17.637  1.00 0.00 ? 79 THR A CA   9  
ATOM 10824 C C    . THR A 1 79 ? -22.321 14.820  17.930  1.00 0.00 ? 79 THR A C    9  
ATOM 10825 O O    . THR A 1 79 ? -23.198 14.042  18.270  1.00 0.00 ? 79 THR A O    9  
ATOM 10826 C CB   . THR A 1 79 ? -19.881 15.046  18.417  1.00 0.00 ? 79 THR A CB   9  
ATOM 10827 O OG1  . THR A 1 79 ? -19.948 16.414  18.039  1.00 0.00 ? 79 THR A OG1  9  
ATOM 10828 C CG2  . THR A 1 79 ? -18.488 14.496  18.105  1.00 0.00 ? 79 THR A CG2  9  
ATOM 10829 O OXT  . THR A 1 79 ? -22.486 16.022  17.807  1.00 0.00 ? 79 THR A OXT  9  
ATOM 10830 H H    . THR A 1 79 ? -19.958 14.970  15.855  1.00 0.00 ? 79 THR A H    9  
ATOM 10831 H HA   . THR A 1 79 ? -20.895 13.216  17.938  1.00 0.00 ? 79 THR A HA   9  
ATOM 10832 H HB   . THR A 1 79 ? -20.071 14.954  19.475  1.00 0.00 ? 79 THR A HB   9  
ATOM 10833 H HG1  . THR A 1 79 ? -20.644 16.830  18.553  1.00 0.00 ? 79 THR A HG1  9  
ATOM 10834 H HG21 . THR A 1 79 ? -17.750 15.046  18.671  1.00 0.00 ? 79 THR A HG21 9  
ATOM 10835 H HG22 . THR A 1 79 ? -18.286 14.604  17.050  1.00 0.00 ? 79 THR A HG22 9  
ATOM 10836 H HG23 . THR A 1 79 ? -18.444 13.452  18.376  1.00 0.00 ? 79 THR A HG23 9  
ATOM 10837 N N    . MET A 1 1  ? -16.435 10.773  24.718  1.00 0.00 ? 1  MET A N    10 
ATOM 10838 C CA   . MET A 1 1  ? -15.910 12.036  25.311  1.00 0.00 ? 1  MET A CA   10 
ATOM 10839 C C    . MET A 1 1  ? -15.812 11.884  26.830  1.00 0.00 ? 1  MET A C    10 
ATOM 10840 O O    . MET A 1 1  ? -15.756 12.855  27.559  1.00 0.00 ? 1  MET A O    10 
ATOM 10841 C CB   . MET A 1 1  ? -16.857 13.189  24.973  1.00 0.00 ? 1  MET A CB   10 
ATOM 10842 C CG   . MET A 1 1  ? -18.272 12.841  25.441  1.00 0.00 ? 1  MET A CG   10 
ATOM 10843 S SD   . MET A 1 1  ? -19.423 14.124  24.886  1.00 0.00 ? 1  MET A SD   10 
ATOM 10844 C CE   . MET A 1 1  ? -19.233 15.228  26.308  1.00 0.00 ? 1  MET A CE   10 
ATOM 10845 H H1   . MET A 1 1  ? -17.187 10.392  25.327  1.00 0.00 ? 1  MET A H1   10 
ATOM 10846 H H2   . MET A 1 1  ? -15.664 10.080  24.641  1.00 0.00 ? 1  MET A H2   10 
ATOM 10847 H H3   . MET A 1 1  ? -16.823 10.968  23.773  1.00 0.00 ? 1  MET A H3   10 
ATOM 10848 H HA   . MET A 1 1  ? -14.931 12.244  24.905  1.00 0.00 ? 1  MET A HA   10 
ATOM 10849 H HB2  . MET A 1 1  ? -16.523 14.088  25.472  1.00 0.00 ? 1  MET A HB2  10 
ATOM 10850 H HB3  . MET A 1 1  ? -16.862 13.351  23.906  1.00 0.00 ? 1  MET A HB3  10 
ATOM 10851 H HG2  . MET A 1 1  ? -18.566 11.890  25.023  1.00 0.00 ? 1  MET A HG2  10 
ATOM 10852 H HG3  . MET A 1 1  ? -18.291 12.782  26.519  1.00 0.00 ? 1  MET A HG3  10 
ATOM 10853 H HE1  . MET A 1 1  ? -19.501 14.698  27.212  1.00 0.00 ? 1  MET A HE1  10 
ATOM 10854 H HE2  . MET A 1 1  ? -19.876 16.088  26.184  1.00 0.00 ? 1  MET A HE2  10 
ATOM 10855 H HE3  . MET A 1 1  ? -18.208 15.555  26.377  1.00 0.00 ? 1  MET A HE3  10 
ATOM 10856 N N    . ILE A 1 2  ? -15.794 10.672  27.313  1.00 0.00 ? 2  ILE A N    10 
ATOM 10857 C CA   . ILE A 1 2  ? -15.702 10.455  28.784  1.00 0.00 ? 2  ILE A CA   10 
ATOM 10858 C C    . ILE A 1 2  ? -14.248 10.623  29.232  1.00 0.00 ? 2  ILE A C    10 
ATOM 10859 O O    . ILE A 1 2  ? -13.868 11.643  29.773  1.00 0.00 ? 2  ILE A O    10 
ATOM 10860 C CB   . ILE A 1 2  ? -16.183 9.037   29.133  1.00 0.00 ? 2  ILE A CB   10 
ATOM 10861 C CG1  . ILE A 1 2  ? -17.688 8.882   28.803  1.00 0.00 ? 2  ILE A CG1  10 
ATOM 10862 C CG2  . ILE A 1 2  ? -15.958 8.789   30.630  1.00 0.00 ? 2  ILE A CG2  10 
ATOM 10863 C CD1  . ILE A 1 2  ? -17.880 8.459   27.339  1.00 0.00 ? 2  ILE A CD1  10 
ATOM 10864 H H    . ILE A 1 2  ? -15.841 9.902   26.708  1.00 0.00 ? 2  ILE A H    10 
ATOM 10865 H HA   . ILE A 1 2  ? -16.320 11.180  29.294  1.00 0.00 ? 2  ILE A HA   10 
ATOM 10866 H HB   . ILE A 1 2  ? -15.606 8.319   28.568  1.00 0.00 ? 2  ILE A HB   10 
ATOM 10867 H HG12 . ILE A 1 2  ? -18.123 8.128   29.444  1.00 0.00 ? 2  ILE A HG12 10 
ATOM 10868 H HG13 . ILE A 1 2  ? -18.195 9.822   28.970  1.00 0.00 ? 2  ILE A HG13 10 
ATOM 10869 H HG21 . ILE A 1 2  ? -14.903 8.655   30.819  1.00 0.00 ? 2  ILE A HG21 10 
ATOM 10870 H HG22 . ILE A 1 2  ? -16.494 7.902   30.932  1.00 0.00 ? 2  ILE A HG22 10 
ATOM 10871 H HG23 . ILE A 1 2  ? -16.319 9.637   31.194  1.00 0.00 ? 2  ILE A HG23 10 
ATOM 10872 H HD11 . ILE A 1 2  ? -17.264 7.599   27.125  1.00 0.00 ? 2  ILE A HD11 10 
ATOM 10873 H HD12 . ILE A 1 2  ? -17.606 9.272   26.686  1.00 0.00 ? 2  ILE A HD12 10 
ATOM 10874 H HD13 . ILE A 1 2  ? -18.917 8.205   27.175  1.00 0.00 ? 2  ILE A HD13 10 
ATOM 10875 N N    . ASP A 1 3  ? -13.433 9.629   29.012  1.00 0.00 ? 3  ASP A N    10 
ATOM 10876 C CA   . ASP A 1 3  ? -12.005 9.729   29.426  1.00 0.00 ? 3  ASP A CA   10 
ATOM 10877 C C    . ASP A 1 3  ? -11.230 10.550  28.393  1.00 0.00 ? 3  ASP A C    10 
ATOM 10878 O O    . ASP A 1 3  ? -11.730 11.516  27.852  1.00 0.00 ? 3  ASP A O    10 
ATOM 10879 C CB   . ASP A 1 3  ? -11.403 8.324   29.514  1.00 0.00 ? 3  ASP A CB   10 
ATOM 10880 C CG   . ASP A 1 3  ? -12.272 7.455   30.424  1.00 0.00 ? 3  ASP A CG   10 
ATOM 10881 O OD1  . ASP A 1 3  ? -12.023 7.448   31.618  1.00 0.00 ? 3  ASP A OD1  10 
ATOM 10882 O OD2  . ASP A 1 3  ? -13.171 6.809   29.911  1.00 0.00 ? 3  ASP A OD2  10 
ATOM 10883 H H    . ASP A 1 3  ? -13.760 8.815   28.575  1.00 0.00 ? 3  ASP A H    10 
ATOM 10884 H HA   . ASP A 1 3  ? -11.941 10.210  30.391  1.00 0.00 ? 3  ASP A HA   10 
ATOM 10885 H HB2  . ASP A 1 3  ? -11.364 7.887   28.527  1.00 0.00 ? 3  ASP A HB2  10 
ATOM 10886 H HB3  . ASP A 1 3  ? -10.406 8.384   29.923  1.00 0.00 ? 3  ASP A HB3  10 
ATOM 10887 N N    . ASN A 1 4  ? -10.011 10.175  28.115  1.00 0.00 ? 4  ASN A N    10 
ATOM 10888 C CA   . ASN A 1 4  ? -9.210  10.936  27.117  1.00 0.00 ? 4  ASN A CA   10 
ATOM 10889 C C    . ASN A 1 4  ? -9.972  10.989  25.792  1.00 0.00 ? 4  ASN A C    10 
ATOM 10890 O O    . ASN A 1 4  ? -10.721 10.091  25.460  1.00 0.00 ? 4  ASN A O    10 
ATOM 10891 C CB   . ASN A 1 4  ? -7.862  10.244  26.905  1.00 0.00 ? 4  ASN A CB   10 
ATOM 10892 C CG   . ASN A 1 4  ? -7.124  10.145  28.242  1.00 0.00 ? 4  ASN A CG   10 
ATOM 10893 O OD1  . ASN A 1 4  ? -7.080  11.096  28.997  1.00 0.00 ? 4  ASN A OD1  10 
ATOM 10894 N ND2  . ASN A 1 4  ? -6.537  9.025   28.569  1.00 0.00 ? 4  ASN A ND2  10 
ATOM 10895 H H    . ASN A 1 4  ? -9.626  9.392   28.561  1.00 0.00 ? 4  ASN A H    10 
ATOM 10896 H HA   . ASN A 1 4  ? -9.047  11.941  27.478  1.00 0.00 ? 4  ASN A HA   10 
ATOM 10897 H HB2  . ASN A 1 4  ? -8.025  9.252   26.508  1.00 0.00 ? 4  ASN A HB2  10 
ATOM 10898 H HB3  . ASN A 1 4  ? -7.268  10.816  26.210  1.00 0.00 ? 4  ASN A HB3  10 
ATOM 10899 H HD21 . ASN A 1 4  ? -6.573  8.258   27.960  1.00 0.00 ? 4  ASN A HD21 10 
ATOM 10900 H HD22 . ASN A 1 4  ? -6.062  8.952   29.422  1.00 0.00 ? 4  ASN A HD22 10 
ATOM 10901 N N    . GLU A 1 5  ? -9.791  12.034  25.035  1.00 0.00 ? 5  GLU A N    10 
ATOM 10902 C CA   . GLU A 1 5  ? -10.508 12.144  23.734  1.00 0.00 ? 5  GLU A CA   10 
ATOM 10903 C C    . GLU A 1 5  ? -9.924  11.134  22.743  1.00 0.00 ? 5  GLU A C    10 
ATOM 10904 O O    . GLU A 1 5  ? -10.295 9.977   22.735  1.00 0.00 ? 5  GLU A O    10 
ATOM 10905 C CB   . GLU A 1 5  ? -10.347 13.566  23.189  1.00 0.00 ? 5  GLU A CB   10 
ATOM 10906 C CG   . GLU A 1 5  ? -11.121 13.708  21.876  1.00 0.00 ? 5  GLU A CG   10 
ATOM 10907 C CD   . GLU A 1 5  ? -11.185 15.184  21.480  1.00 0.00 ? 5  GLU A CD   10 
ATOM 10908 O OE1  . GLU A 1 5  ? -10.175 15.855  21.608  1.00 0.00 ? 5  GLU A OE1  10 
ATOM 10909 O OE2  . GLU A 1 5  ? -12.244 15.618  21.057  1.00 0.00 ? 5  GLU A OE2  10 
ATOM 10910 H H    . GLU A 1 5  ? -9.184  12.748  25.322  1.00 0.00 ? 5  GLU A H    10 
ATOM 10911 H HA   . GLU A 1 5  ? -11.556 11.934  23.884  1.00 0.00 ? 5  GLU A HA   10 
ATOM 10912 H HB2  . GLU A 1 5  ? -10.733 14.272  23.911  1.00 0.00 ? 5  GLU A HB2  10 
ATOM 10913 H HB3  . GLU A 1 5  ? -9.302  13.770  23.013  1.00 0.00 ? 5  GLU A HB3  10 
ATOM 10914 H HG2  . GLU A 1 5  ? -10.623 13.147  21.099  1.00 0.00 ? 5  GLU A HG2  10 
ATOM 10915 H HG3  . GLU A 1 5  ? -12.124 13.328  22.007  1.00 0.00 ? 5  GLU A HG3  10 
ATOM 10916 N N    . LYS A 1 6  ? -9.013  11.555  21.908  1.00 0.00 ? 6  LYS A N    10 
ATOM 10917 C CA   . LYS A 1 6  ? -8.411  10.613  20.924  1.00 0.00 ? 6  LYS A CA   10 
ATOM 10918 C C    . LYS A 1 6  ? -7.237  11.297  20.224  1.00 0.00 ? 6  LYS A C    10 
ATOM 10919 O O    . LYS A 1 6  ? -7.404  11.971  19.227  1.00 0.00 ? 6  LYS A O    10 
ATOM 10920 C CB   . LYS A 1 6  ? -9.465  10.215  19.881  1.00 0.00 ? 6  LYS A CB   10 
ATOM 10921 C CG   . LYS A 1 6  ? -8.953  9.034   19.035  1.00 0.00 ? 6  LYS A CG   10 
ATOM 10922 C CD   . LYS A 1 6  ? -9.247  7.704   19.744  1.00 0.00 ? 6  LYS A CD   10 
ATOM 10923 C CE   . LYS A 1 6  ? -8.857  6.542   18.828  1.00 0.00 ? 6  LYS A CE   10 
ATOM 10924 N NZ   . LYS A 1 6  ? -9.098  5.253   19.536  1.00 0.00 ? 6  LYS A NZ   10 
ATOM 10925 H H    . LYS A 1 6  ? -8.724  12.490  21.929  1.00 0.00 ? 6  LYS A H    10 
ATOM 10926 H HA   . LYS A 1 6  ? -8.059  9.734   21.439  1.00 0.00 ? 6  LYS A HA   10 
ATOM 10927 H HB2  . LYS A 1 6  ? -10.380 9.937   20.383  1.00 0.00 ? 6  LYS A HB2  10 
ATOM 10928 H HB3  . LYS A 1 6  ? -9.657  11.058  19.233  1.00 0.00 ? 6  LYS A HB3  10 
ATOM 10929 H HG2  . LYS A 1 6  ? -9.452  9.041   18.075  1.00 0.00 ? 6  LYS A HG2  10 
ATOM 10930 H HG3  . LYS A 1 6  ? -7.888  9.128   18.881  1.00 0.00 ? 6  LYS A HG3  10 
ATOM 10931 H HD2  . LYS A 1 6  ? -8.677  7.646   20.658  1.00 0.00 ? 6  LYS A HD2  10 
ATOM 10932 H HD3  . LYS A 1 6  ? -10.300 7.640   19.970  1.00 0.00 ? 6  LYS A HD3  10 
ATOM 10933 H HE2  . LYS A 1 6  ? -9.452  6.576   17.928  1.00 0.00 ? 6  LYS A HE2  10 
ATOM 10934 H HE3  . LYS A 1 6  ? -7.810  6.621   18.571  1.00 0.00 ? 6  LYS A HE3  10 
ATOM 10935 H HZ1  . LYS A 1 6  ? -9.018  4.466   18.860  1.00 0.00 ? 6  LYS A HZ1  10 
ATOM 10936 H HZ2  . LYS A 1 6  ? -10.052 5.257   19.948  1.00 0.00 ? 6  LYS A HZ2  10 
ATOM 10937 H HZ3  . LYS A 1 6  ? -8.393  5.135   20.292  1.00 0.00 ? 6  LYS A HZ3  10 
ATOM 10938 N N    . VAL A 1 7  ? -6.050  11.131  20.738  1.00 0.00 ? 7  VAL A N    10 
ATOM 10939 C CA   . VAL A 1 7  ? -4.869  11.774  20.098  1.00 0.00 ? 7  VAL A CA   10 
ATOM 10940 C C    . VAL A 1 7  ? -4.613  11.123  18.740  1.00 0.00 ? 7  VAL A C    10 
ATOM 10941 O O    . VAL A 1 7  ? -5.204  10.116  18.402  1.00 0.00 ? 7  VAL A O    10 
ATOM 10942 C CB   . VAL A 1 7  ? -3.640  11.592  20.990  1.00 0.00 ? 7  VAL A CB   10 
ATOM 10943 C CG1  . VAL A 1 7  ? -3.846  12.350  22.303  1.00 0.00 ? 7  VAL A CG1  10 
ATOM 10944 C CG2  . VAL A 1 7  ? -3.441  10.105  21.288  1.00 0.00 ? 7  VAL A CG2  10 
ATOM 10945 H H    . VAL A 1 7  ? -5.935  10.584  21.543  1.00 0.00 ? 7  VAL A H    10 
ATOM 10946 H HA   . VAL A 1 7  ? -5.063  12.827  19.963  1.00 0.00 ? 7  VAL A HA   10 
ATOM 10947 H HB   . VAL A 1 7  ? -2.768  11.981  20.484  1.00 0.00 ? 7  VAL A HB   10 
ATOM 10948 H HG11 . VAL A 1 7  ? -4.007  13.398  22.092  1.00 0.00 ? 7  VAL A HG11 10 
ATOM 10949 H HG12 . VAL A 1 7  ? -2.969  12.240  22.924  1.00 0.00 ? 7  VAL A HG12 10 
ATOM 10950 H HG13 . VAL A 1 7  ? -4.705  11.951  22.819  1.00 0.00 ? 7  VAL A HG13 10 
ATOM 10951 H HG21 . VAL A 1 7  ? -4.344  9.700   21.719  1.00 0.00 ? 7  VAL A HG21 10 
ATOM 10952 H HG22 . VAL A 1 7  ? -2.624  9.982   21.983  1.00 0.00 ? 7  VAL A HG22 10 
ATOM 10953 H HG23 . VAL A 1 7  ? -3.214  9.582   20.370  1.00 0.00 ? 7  VAL A HG23 10 
ATOM 10954 N N    . THR A 1 8  ? -3.740  11.690  17.956  1.00 0.00 ? 8  THR A N    10 
ATOM 10955 C CA   . THR A 1 8  ? -3.449  11.102  16.619  1.00 0.00 ? 8  THR A CA   10 
ATOM 10956 C C    . THR A 1 8  ? -2.735  9.762   16.798  1.00 0.00 ? 8  THR A C    10 
ATOM 10957 O O    . THR A 1 8  ? -2.656  9.229   17.886  1.00 0.00 ? 8  THR A O    10 
ATOM 10958 C CB   . THR A 1 8  ? -2.555  12.058  15.828  1.00 0.00 ? 8  THR A CB   10 
ATOM 10959 O OG1  . THR A 1 8  ? -1.341  12.262  16.536  1.00 0.00 ? 8  THR A OG1  10 
ATOM 10960 C CG2  . THR A 1 8  ? -3.275  13.396  15.647  1.00 0.00 ? 8  THR A CG2  10 
ATOM 10961 H H    . THR A 1 8  ? -3.274  12.501  18.247  1.00 0.00 ? 8  THR A H    10 
ATOM 10962 H HA   . THR A 1 8  ? -4.375  10.948  16.085  1.00 0.00 ? 8  THR A HA   10 
ATOM 10963 H HB   . THR A 1 8  ? -2.343  11.635  14.859  1.00 0.00 ? 8  THR A HB   10 
ATOM 10964 H HG1  . THR A 1 8  ? -0.640  12.388  15.892  1.00 0.00 ? 8  THR A HG1  10 
ATOM 10965 H HG21 . THR A 1 8  ? -4.201  13.237  15.115  1.00 0.00 ? 8  THR A HG21 10 
ATOM 10966 H HG22 . THR A 1 8  ? -2.646  14.069  15.083  1.00 0.00 ? 8  THR A HG22 10 
ATOM 10967 H HG23 . THR A 1 8  ? -3.485  13.826  16.616  1.00 0.00 ? 8  THR A HG23 10 
ATOM 10968 N N    . SER A 1 9  ? -2.213  9.214   15.735  1.00 0.00 ? 9  SER A N    10 
ATOM 10969 C CA   . SER A 1 9  ? -1.504  7.908   15.843  1.00 0.00 ? 9  SER A CA   10 
ATOM 10970 C C    . SER A 1 9  ? -0.766  7.622   14.536  1.00 0.00 ? 9  SER A C    10 
ATOM 10971 O O    . SER A 1 9  ? -0.468  8.518   13.771  1.00 0.00 ? 9  SER A O    10 
ATOM 10972 C CB   . SER A 1 9  ? -2.519  6.796   16.109  1.00 0.00 ? 9  SER A CB   10 
ATOM 10973 O OG   . SER A 1 9  ? -1.840  5.551   16.200  1.00 0.00 ? 9  SER A OG   10 
ATOM 10974 H H    . SER A 1 9  ? -2.288  9.660   14.867  1.00 0.00 ? 9  SER A H    10 
ATOM 10975 H HA   . SER A 1 9  ? -0.794  7.950   16.656  1.00 0.00 ? 9  SER A HA   10 
ATOM 10976 H HB2  . SER A 1 9  ? -3.033  6.989   17.037  1.00 0.00 ? 9  SER A HB2  10 
ATOM 10977 H HB3  . SER A 1 9  ? -3.239  6.767   15.302  1.00 0.00 ? 9  SER A HB3  10 
ATOM 10978 H HG   . SER A 1 9  ? -1.632  5.393   17.124  1.00 0.00 ? 9  SER A HG   10 
ATOM 10979 N N    . GLY A 1 10 ? -0.468  6.380   14.271  1.00 0.00 ? 10 GLY A N    10 
ATOM 10980 C CA   . GLY A 1 10 ? 0.251   6.038   13.012  1.00 0.00 ? 10 GLY A CA   10 
ATOM 10981 C C    . GLY A 1 10 ? 0.599   4.549   13.011  1.00 0.00 ? 10 GLY A C    10 
ATOM 10982 O O    . GLY A 1 10 ? -0.206  3.713   13.368  1.00 0.00 ? 10 GLY A O    10 
ATOM 10983 H H    . GLY A 1 10 ? -0.717  5.672   14.902  1.00 0.00 ? 10 GLY A H    10 
ATOM 10984 H HA2  . GLY A 1 10 ? -0.381  6.263   12.165  1.00 0.00 ? 10 GLY A HA2  10 
ATOM 10985 H HA3  . GLY A 1 10 ? 1.159   6.617   12.947  1.00 0.00 ? 10 GLY A HA3  10 
ATOM 10986 N N    . HIS A 1 11 ? 1.796   4.211   12.615  1.00 0.00 ? 11 HIS A N    10 
ATOM 10987 C CA   . HIS A 1 11 ? 2.197   2.776   12.594  1.00 0.00 ? 11 HIS A CA   10 
ATOM 10988 C C    . HIS A 1 11 ? 1.153   1.962   11.827  1.00 0.00 ? 11 HIS A C    10 
ATOM 10989 O O    . HIS A 1 11 ? 0.144   1.561   12.370  1.00 0.00 ? 11 HIS A O    10 
ATOM 10990 C CB   . HIS A 1 11 ? 2.301   2.254   14.027  1.00 0.00 ? 11 HIS A CB   10 
ATOM 10991 C CG   . HIS A 1 11 ? 3.374   3.012   14.758  1.00 0.00 ? 11 HIS A CG   10 
ATOM 10992 N ND1  . HIS A 1 11 ? 3.928   4.178   14.254  1.00 0.00 ? 11 HIS A ND1  10 
ATOM 10993 C CD2  . HIS A 1 11 ? 4.006   2.783   15.956  1.00 0.00 ? 11 HIS A CD2  10 
ATOM 10994 C CE1  . HIS A 1 11 ? 4.851   4.604   15.137  1.00 0.00 ? 11 HIS A CE1  10 
ATOM 10995 N NE2  . HIS A 1 11 ? 4.938   3.790   16.193  1.00 0.00 ? 11 HIS A NE2  10 
ATOM 10996 H H    . HIS A 1 11 ? 2.431   4.902   12.333  1.00 0.00 ? 11 HIS A H    10 
ATOM 10997 H HA   . HIS A 1 11 ? 3.156   2.680   12.106  1.00 0.00 ? 11 HIS A HA   10 
ATOM 10998 H HB2  . HIS A 1 11 ? 1.355   2.392   14.531  1.00 0.00 ? 11 HIS A HB2  10 
ATOM 10999 H HB3  . HIS A 1 11 ? 2.551   1.204   14.011  1.00 0.00 ? 11 HIS A HB3  10 
ATOM 11000 H HD1  . HIS A 1 11 ? 3.693   4.613   13.408  1.00 0.00 ? 11 HIS A HD1  10 
ATOM 11001 H HD2  . HIS A 1 11 ? 3.810   1.950   16.614  1.00 0.00 ? 11 HIS A HD2  10 
ATOM 11002 H HE1  . HIS A 1 11 ? 5.447   5.495   15.007  1.00 0.00 ? 11 HIS A HE1  10 
ATOM 11003 N N    . THR A 1 12 ? 1.389   1.717   10.566  1.00 0.00 ? 12 THR A N    10 
ATOM 11004 C CA   . THR A 1 12 ? 0.415   0.929   9.758   1.00 0.00 ? 12 THR A CA   10 
ATOM 11005 C C    . THR A 1 12 ? -0.991  1.504   9.942   1.00 0.00 ? 12 THR A C    10 
ATOM 11006 O O    . THR A 1 12 ? -1.345  2.503   9.348   1.00 0.00 ? 12 THR A O    10 
ATOM 11007 C CB   . THR A 1 12 ? 0.436   -0.534  10.212  1.00 0.00 ? 12 THR A CB   10 
ATOM 11008 O OG1  . THR A 1 12 ? -0.081  -0.631  11.532  1.00 0.00 ? 12 THR A OG1  10 
ATOM 11009 C CG2  . THR A 1 12 ? 1.873   -1.059  10.186  1.00 0.00 ? 12 THR A CG2  10 
ATOM 11010 H H    . THR A 1 12 ? 2.209   2.056   10.148  1.00 0.00 ? 12 THR A H    10 
ATOM 11011 H HA   . THR A 1 12 ? 0.689   0.984   8.716   1.00 0.00 ? 12 THR A HA   10 
ATOM 11012 H HB   . THR A 1 12 ? -0.169  -1.127  9.544   1.00 0.00 ? 12 THR A HB   10 
ATOM 11013 H HG1  . THR A 1 12 ? -0.099  -1.560  11.776  1.00 0.00 ? 12 THR A HG1  10 
ATOM 11014 H HG21 . THR A 1 12 ? 2.257   -1.007  9.178   1.00 0.00 ? 12 THR A HG21 10 
ATOM 11015 H HG22 . THR A 1 12 ? 1.888   -2.084  10.525  1.00 0.00 ? 12 THR A HG22 10 
ATOM 11016 H HG23 . THR A 1 12 ? 2.488   -0.456  10.837  1.00 0.00 ? 12 THR A HG23 10 
ATOM 11017 N N    . THR A 1 13 ? -1.798  0.883   10.757  1.00 0.00 ? 13 THR A N    10 
ATOM 11018 C CA   . THR A 1 13 ? -3.181  1.394   10.973  1.00 0.00 ? 13 THR A CA   10 
ATOM 11019 C C    . THR A 1 13 ? -3.892  1.523   9.624   1.00 0.00 ? 13 THR A C    10 
ATOM 11020 O O    . THR A 1 13 ? -4.233  2.607   9.192   1.00 0.00 ? 13 THR A O    10 
ATOM 11021 C CB   . THR A 1 13 ? -3.121  2.763   11.654  1.00 0.00 ? 13 THR A CB   10 
ATOM 11022 O OG1  . THR A 1 13 ? -2.254  2.691   12.777  1.00 0.00 ? 13 THR A OG1  10 
ATOM 11023 C CG2  . THR A 1 13 ? -4.523  3.168   12.114  1.00 0.00 ? 13 THR A CG2  10 
ATOM 11024 H H    . THR A 1 13 ? -1.495  0.076   11.225  1.00 0.00 ? 13 THR A H    10 
ATOM 11025 H HA   . THR A 1 13 ? -3.725  0.703   11.599  1.00 0.00 ? 13 THR A HA   10 
ATOM 11026 H HB   . THR A 1 13 ? -2.751  3.497   10.957  1.00 0.00 ? 13 THR A HB   10 
ATOM 11027 H HG1  . THR A 1 13 ? -1.550  2.075   12.568  1.00 0.00 ? 13 THR A HG1  10 
ATOM 11028 H HG21 . THR A 1 13 ? -4.911  2.416   12.787  1.00 0.00 ? 13 THR A HG21 10 
ATOM 11029 H HG22 . THR A 1 13 ? -5.173  3.254   11.257  1.00 0.00 ? 13 THR A HG22 10 
ATOM 11030 H HG23 . THR A 1 13 ? -4.474  4.117   12.626  1.00 0.00 ? 13 THR A HG23 10 
ATOM 11031 N N    . THR A 1 14 ? -4.117  0.426   8.957   1.00 0.00 ? 14 THR A N    10 
ATOM 11032 C CA   . THR A 1 14 ? -4.806  0.481   7.638   1.00 0.00 ? 14 THR A CA   10 
ATOM 11033 C C    . THR A 1 14 ? -5.357  -0.905  7.299   1.00 0.00 ? 14 THR A C    10 
ATOM 11034 O O    . THR A 1 14 ? -4.911  -1.904  7.828   1.00 0.00 ? 14 THR A O    10 
ATOM 11035 C CB   . THR A 1 14 ? -3.812  0.913   6.558   1.00 0.00 ? 14 THR A CB   10 
ATOM 11036 O OG1  . THR A 1 14 ? -4.386  0.699   5.276   1.00 0.00 ? 14 THR A OG1  10 
ATOM 11037 C CG2  . THR A 1 14 ? -2.526  0.095   6.687   1.00 0.00 ? 14 THR A CG2  10 
ATOM 11038 H H    . THR A 1 14 ? -3.833  -0.437  9.325   1.00 0.00 ? 14 THR A H    10 
ATOM 11039 H HA   . THR A 1 14 ? -5.618  1.190   7.685   1.00 0.00 ? 14 THR A HA   10 
ATOM 11040 H HB   . THR A 1 14 ? -3.581  1.960   6.679   1.00 0.00 ? 14 THR A HB   10 
ATOM 11041 H HG1  . THR A 1 14 ? -4.399  -0.246  5.110   1.00 0.00 ? 14 THR A HG1  10 
ATOM 11042 H HG21 . THR A 1 14 ? -1.851  0.358   5.887   1.00 0.00 ? 14 THR A HG21 10 
ATOM 11043 H HG22 . THR A 1 14 ? -2.763  -0.957  6.628   1.00 0.00 ? 14 THR A HG22 10 
ATOM 11044 H HG23 . THR A 1 14 ? -2.059  0.306   7.637   1.00 0.00 ? 14 THR A HG23 10 
ATOM 11045 N N    . THR A 1 15 ? -6.332  -0.971  6.426   1.00 0.00 ? 15 THR A N    10 
ATOM 11046 C CA   . THR A 1 15 ? -6.933  -2.289  6.043   1.00 0.00 ? 15 THR A CA   10 
ATOM 11047 C C    . THR A 1 15 ? -6.917  -2.434  4.521   1.00 0.00 ? 15 THR A C    10 
ATOM 11048 O O    . THR A 1 15 ? -7.044  -1.468  3.794   1.00 0.00 ? 15 THR A O    10 
ATOM 11049 C CB   . THR A 1 15 ? -8.381  -2.342  6.539   1.00 0.00 ? 15 THR A CB   10 
ATOM 11050 O OG1  . THR A 1 15 ? -9.031  -3.475  5.980   1.00 0.00 ? 15 THR A OG1  10 
ATOM 11051 C CG2  . THR A 1 15 ? -9.116  -1.071  6.115   1.00 0.00 ? 15 THR A CG2  10 
ATOM 11052 H H    . THR A 1 15 ? -6.677  -0.147  6.021   1.00 0.00 ? 15 THR A H    10 
ATOM 11053 H HA   . THR A 1 15 ? -6.374  -3.101  6.484   1.00 0.00 ? 15 THR A HA   10 
ATOM 11054 H HB   . THR A 1 15 ? -8.391  -2.416  7.615   1.00 0.00 ? 15 THR A HB   10 
ATOM 11055 H HG1  . THR A 1 15 ? -9.968  -3.275  5.913   1.00 0.00 ? 15 THR A HG1  10 
ATOM 11056 H HG21 . THR A 1 15 ? -8.724  -0.228  6.667   1.00 0.00 ? 15 THR A HG21 10 
ATOM 11057 H HG22 . THR A 1 15 ? -10.169 -1.178  6.322   1.00 0.00 ? 15 THR A HG22 10 
ATOM 11058 H HG23 . THR A 1 15 ? -8.970  -0.907  5.057   1.00 0.00 ? 15 THR A HG23 10 
ATOM 11059 N N    . ARG A 1 16 ? -6.751  -3.641  4.035   1.00 0.00 ? 16 ARG A N    10 
ATOM 11060 C CA   . ARG A 1 16 ? -6.710  -3.880  2.557   1.00 0.00 ? 16 ARG A CA   10 
ATOM 11061 C C    . ARG A 1 16 ? -7.968  -4.658  2.145   1.00 0.00 ? 16 ARG A C    10 
ATOM 11062 O O    . ARG A 1 16 ? -8.624  -5.235  2.979   1.00 0.00 ? 16 ARG A O    10 
ATOM 11063 C CB   . ARG A 1 16 ? -5.447  -4.691  2.216   1.00 0.00 ? 16 ARG A CB   10 
ATOM 11064 C CG   . ARG A 1 16 ? -4.279  -4.240  3.118   1.00 0.00 ? 16 ARG A CG   10 
ATOM 11065 C CD   . ARG A 1 16 ? -4.339  -4.923  4.507   1.00 0.00 ? 16 ARG A CD   10 
ATOM 11066 N NE   . ARG A 1 16 ? -3.182  -5.850  4.647   1.00 0.00 ? 16 ARG A NE   10 
ATOM 11067 C CZ   . ARG A 1 16 ? -2.841  -6.291  5.827   1.00 0.00 ? 16 ARG A CZ   10 
ATOM 11068 N NH1  . ARG A 1 16 ? -3.506  -5.909  6.883   1.00 0.00 ? 16 ARG A NH1  10 
ATOM 11069 N NH2  . ARG A 1 16 ? -1.834  -7.112  5.950   1.00 0.00 ? 16 ARG A NH2  10 
ATOM 11070 H H    . ARG A 1 16 ? -6.635  -4.395  4.650   1.00 0.00 ? 16 ARG A H    10 
ATOM 11071 H HA   . ARG A 1 16 ? -6.684  -2.938  2.027   1.00 0.00 ? 16 ARG A HA   10 
ATOM 11072 H HB2  . ARG A 1 16 ? -5.635  -5.745  2.365   1.00 0.00 ? 16 ARG A HB2  10 
ATOM 11073 H HB3  . ARG A 1 16 ? -5.180  -4.519  1.184   1.00 0.00 ? 16 ARG A HB3  10 
ATOM 11074 H HG2  . ARG A 1 16 ? -3.346  -4.500  2.639   1.00 0.00 ? 16 ARG A HG2  10 
ATOM 11075 H HG3  . ARG A 1 16 ? -4.321  -3.165  3.242   1.00 0.00 ? 16 ARG A HG3  10 
ATOM 11076 H HD2  . ARG A 1 16 ? -4.288  -4.173  5.285   1.00 0.00 ? 16 ARG A HD2  10 
ATOM 11077 H HD3  . ARG A 1 16 ? -5.254  -5.485  4.615   1.00 0.00 ? 16 ARG A HD3  10 
ATOM 11078 H HE   . ARG A 1 16 ? -2.679  -6.131  3.854   1.00 0.00 ? 16 ARG A HE   10 
ATOM 11079 H HH11 . ARG A 1 16 ? -4.275  -5.280  6.790   1.00 0.00 ? 16 ARG A HH11 10 
ATOM 11080 H HH12 . ARG A 1 16 ? -3.244  -6.248  7.788   1.00 0.00 ? 16 ARG A HH12 10 
ATOM 11081 H HH21 . ARG A 1 16 ? -1.324  -7.402  5.140   1.00 0.00 ? 16 ARG A HH21 10 
ATOM 11082 H HH22 . ARG A 1 16 ? -1.573  -7.450  6.855   1.00 0.00 ? 16 ARG A HH22 10 
ATOM 11083 N N    . ARG A 1 17 ? -8.302  -4.635  0.866   1.00 0.00 ? 17 ARG A N    10 
ATOM 11084 C CA   . ARG A 1 17 ? -9.537  -5.321  0.311   1.00 0.00 ? 17 ARG A CA   10 
ATOM 11085 C C    . ARG A 1 17 ? -10.616 -4.254  0.111   1.00 0.00 ? 17 ARG A C    10 
ATOM 11086 O O    . ARG A 1 17 ? -10.395 -3.103  0.424   1.00 0.00 ? 17 ARG A O    10 
ATOM 11087 C CB   . ARG A 1 17 ? -10.093 -6.454  1.202   1.00 0.00 ? 17 ARG A CB   10 
ATOM 11088 C CG   . ARG A 1 17 ? -9.037  -7.555  1.377   1.00 0.00 ? 17 ARG A CG   10 
ATOM 11089 C CD   . ARG A 1 17 ? -9.407  -8.449  2.563   1.00 0.00 ? 17 ARG A CD   10 
ATOM 11090 N NE   . ARG A 1 17 ? -8.422  -9.564  2.662   1.00 0.00 ? 17 ARG A NE   10 
ATOM 11091 C CZ   . ARG A 1 17 ? -8.353  -10.286 3.747   1.00 0.00 ? 17 ARG A CZ   10 
ATOM 11092 N NH1  . ARG A 1 17 ? -9.155  -10.041 4.747   1.00 0.00 ? 17 ARG A NH1  10 
ATOM 11093 N NH2  . ARG A 1 17 ? -7.482  -11.255 3.831   1.00 0.00 ? 17 ARG A NH2  10 
ATOM 11094 H H    . ARG A 1 17 ? -7.740  -4.116  0.242   1.00 0.00 ? 17 ARG A H    10 
ATOM 11095 H HA   . ARG A 1 17 ? -9.285  -5.731  -0.659  1.00 0.00 ? 17 ARG A HA   10 
ATOM 11096 H HB2  . ARG A 1 17 ? -10.402 -6.068  2.157   1.00 0.00 ? 17 ARG A HB2  10 
ATOM 11097 H HB3  . ARG A 1 17 ? -10.956 -6.881  0.711   1.00 0.00 ? 17 ARG A HB3  10 
ATOM 11098 H HG2  . ARG A 1 17 ? -8.997  -8.154  0.480   1.00 0.00 ? 17 ARG A HG2  10 
ATOM 11099 H HG3  . ARG A 1 17 ? -8.073  -7.115  1.552   1.00 0.00 ? 17 ARG A HG3  10 
ATOM 11100 H HD2  . ARG A 1 17 ? -9.388  -7.868  3.474   1.00 0.00 ? 17 ARG A HD2  10 
ATOM 11101 H HD3  . ARG A 1 17 ? -10.397 -8.853  2.415   1.00 0.00 ? 17 ARG A HD3  10 
ATOM 11102 H HE   . ARG A 1 17 ? -7.821  -9.754  1.911   1.00 0.00 ? 17 ARG A HE   10 
ATOM 11103 H HH11 . ARG A 1 17 ? -9.823  -9.299  4.681   1.00 0.00 ? 17 ARG A HH11 10 
ATOM 11104 H HH12 . ARG A 1 17 ? -9.103  -10.595 5.578   1.00 0.00 ? 17 ARG A HH12 10 
ATOM 11105 H HH21 . ARG A 1 17 ? -6.869  -11.444 3.063   1.00 0.00 ? 17 ARG A HH21 10 
ATOM 11106 H HH22 . ARG A 1 17 ? -7.428  -11.810 4.661   1.00 0.00 ? 17 ARG A HH22 10 
ATOM 11107 N N    . SER A 1 18 ? -11.783 -4.620  -0.376  1.00 0.00 ? 18 SER A N    10 
ATOM 11108 C CA   . SER A 1 18 ? -12.887 -3.582  -0.585  1.00 0.00 ? 18 SER A CA   10 
ATOM 11109 C C    . SER A 1 18 ? -12.405 -2.504  -1.579  1.00 0.00 ? 18 SER A C    10 
ATOM 11110 O O    . SER A 1 18 ? -13.115 -2.099  -2.477  1.00 0.00 ? 18 SER A O    10 
ATOM 11111 C CB   . SER A 1 18 ? -13.222 -2.930  0.762   1.00 0.00 ? 18 SER A CB   10 
ATOM 11112 O OG   . SER A 1 18 ? -14.520 -2.353  0.690   1.00 0.00 ? 18 SER A OG   10 
ATOM 11113 H H    . SER A 1 18 ? -11.942 -5.578  -0.566  1.00 0.00 ? 18 SER A H    10 
ATOM 11114 H HA   . SER A 1 18 ? -13.789 -4.044  -0.988  1.00 0.00 ? 18 SER A HA   10 
ATOM 11115 H HB2  . SER A 1 18 ? -13.213 -3.678  1.537   1.00 0.00 ? 18 SER A HB2  10 
ATOM 11116 H HB3  . SER A 1 18 ? -12.490 -2.167  0.995   1.00 0.00 ? 18 SER A HB3  10 
ATOM 11117 H HG   . SER A 1 18 ? -15.159 -3.030  0.923   1.00 0.00 ? 18 SER A HG   10 
ATOM 11118 N N    . CYS A 1 19 ? -11.192 -2.062  -1.407  1.00 0.00 ? 19 CYS A N    10 
ATOM 11119 C CA   . CYS A 1 19 ? -10.590 -1.028  -2.298  1.00 0.00 ? 19 CYS A CA   10 
ATOM 11120 C C    . CYS A 1 19 ? -9.302  -1.615  -2.874  1.00 0.00 ? 19 CYS A C    10 
ATOM 11121 O O    . CYS A 1 19 ? -8.786  -2.593  -2.368  1.00 0.00 ? 19 CYS A O    10 
ATOM 11122 C CB   . CYS A 1 19 ? -10.285 0.246   -1.476  1.00 0.00 ? 19 CYS A CB   10 
ATOM 11123 S SG   . CYS A 1 19 ? -11.301 0.261   0.026   1.00 0.00 ? 19 CYS A SG   10 
ATOM 11124 H H    . CYS A 1 19 ? -10.685 -2.441  -0.665  1.00 0.00 ? 19 CYS A H    10 
ATOM 11125 H HA   . CYS A 1 19 ? -11.270 -0.791  -3.107  1.00 0.00 ? 19 CYS A HA   10 
ATOM 11126 H HB2  . CYS A 1 19 ? -9.241  0.267   -1.195  1.00 0.00 ? 19 CYS A HB2  10 
ATOM 11127 H HB3  . CYS A 1 19 ? -10.511 1.121   -2.069  1.00 0.00 ? 19 CYS A HB3  10 
ATOM 11128 N N    . SER A 1 20 ? -8.771  -1.051  -3.920  1.00 0.00 ? 20 SER A N    10 
ATOM 11129 C CA   . SER A 1 20 ? -7.520  -1.619  -4.490  1.00 0.00 ? 20 SER A CA   10 
ATOM 11130 C C    . SER A 1 20 ? -6.328  -1.163  -3.650  1.00 0.00 ? 20 SER A C    10 
ATOM 11131 O O    . SER A 1 20 ? -6.046  0.014   -3.547  1.00 0.00 ? 20 SER A O    10 
ATOM 11132 C CB   . SER A 1 20 ? -7.353  -1.136  -5.934  1.00 0.00 ? 20 SER A CB   10 
ATOM 11133 O OG   . SER A 1 20 ? -8.617  -1.149  -6.583  1.00 0.00 ? 20 SER A OG   10 
ATOM 11134 H H    . SER A 1 20 ? -9.182  -0.261  -4.330  1.00 0.00 ? 20 SER A H    10 
ATOM 11135 H HA   . SER A 1 20 ? -7.576  -2.698  -4.478  1.00 0.00 ? 20 SER A HA   10 
ATOM 11136 H HB2  . SER A 1 20 ? -6.960  -0.131  -5.943  1.00 0.00 ? 20 SER A HB2  10 
ATOM 11137 H HB3  . SER A 1 20 ? -6.665  -1.792  -6.452  1.00 0.00 ? 20 SER A HB3  10 
ATOM 11138 H HG   . SER A 1 20 ? -8.526  -0.695  -7.424  1.00 0.00 ? 20 SER A HG   10 
ATOM 11139 N N    . LYS A 1 21 ? -5.622  -2.091  -3.055  1.00 0.00 ? 21 LYS A N    10 
ATOM 11140 C CA   . LYS A 1 21 ? -4.428  -1.726  -2.219  1.00 0.00 ? 21 LYS A CA   10 
ATOM 11141 C C    . LYS A 1 21 ? -3.272  -2.637  -2.616  1.00 0.00 ? 21 LYS A C    10 
ATOM 11142 O O    . LYS A 1 21 ? -3.288  -3.826  -2.369  1.00 0.00 ? 21 LYS A O    10 
ATOM 11143 C CB   . LYS A 1 21 ? -4.734  -1.896  -0.715  1.00 0.00 ? 21 LYS A CB   10 
ATOM 11144 C CG   . LYS A 1 21 ? -5.576  -0.710  -0.201  1.00 0.00 ? 21 LYS A CG   10 
ATOM 11145 C CD   . LYS A 1 21 ? -4.665  0.458   0.201   1.00 0.00 ? 21 LYS A CD   10 
ATOM 11146 C CE   . LYS A 1 21 ? -5.517  1.585   0.788   1.00 0.00 ? 21 LYS A CE   10 
ATOM 11147 N NZ   . LYS A 1 21 ? -6.503  2.044   -0.232  1.00 0.00 ? 21 LYS A NZ   10 
ATOM 11148 H H    . LYS A 1 21 ? -5.876  -3.037  -3.159  1.00 0.00 ? 21 LYS A H    10 
ATOM 11149 H HA   . LYS A 1 21 ? -4.144  -0.701  -2.414  1.00 0.00 ? 21 LYS A HA   10 
ATOM 11150 H HB2  . LYS A 1 21 ? -5.277  -2.817  -0.555  1.00 0.00 ? 21 LYS A HB2  10 
ATOM 11151 H HB3  . LYS A 1 21 ? -3.803  -1.939  -0.166  1.00 0.00 ? 21 LYS A HB3  10 
ATOM 11152 H HG2  . LYS A 1 21 ? -6.255  -0.383  -0.973  1.00 0.00 ? 21 LYS A HG2  10 
ATOM 11153 H HG3  . LYS A 1 21 ? -6.145  -1.026  0.663   1.00 0.00 ? 21 LYS A HG3  10 
ATOM 11154 H HD2  . LYS A 1 21 ? -3.952  0.122   0.941   1.00 0.00 ? 21 LYS A HD2  10 
ATOM 11155 H HD3  . LYS A 1 21 ? -4.139  0.824   -0.667  1.00 0.00 ? 21 LYS A HD3  10 
ATOM 11156 H HE2  . LYS A 1 21 ? -6.042  1.224   1.660   1.00 0.00 ? 21 LYS A HE2  10 
ATOM 11157 H HE3  . LYS A 1 21 ? -4.879  2.409   1.068   1.00 0.00 ? 21 LYS A HE3  10 
ATOM 11158 H HZ1  . LYS A 1 21 ? -7.185  2.691   0.212   1.00 0.00 ? 21 LYS A HZ1  10 
ATOM 11159 H HZ2  . LYS A 1 21 ? -7.009  1.223   -0.619  1.00 0.00 ? 21 LYS A HZ2  10 
ATOM 11160 H HZ3  . LYS A 1 21 ? -6.002  2.537   -0.999  1.00 0.00 ? 21 LYS A HZ3  10 
ATOM 11161 N N    . VAL A 1 22 ? -2.269  -2.073  -3.239  1.00 0.00 ? 22 VAL A N    10 
ATOM 11162 C CA   . VAL A 1 22 ? -1.090  -2.875  -3.675  1.00 0.00 ? 22 VAL A CA   10 
ATOM 11163 C C    . VAL A 1 22 ? 0.183   -2.292  -3.058  1.00 0.00 ? 22 VAL A C    10 
ATOM 11164 O O    . VAL A 1 22 ? 0.549   -1.166  -3.333  1.00 0.00 ? 22 VAL A O    10 
ATOM 11165 C CB   . VAL A 1 22 ? -1.010  -2.818  -5.205  1.00 0.00 ? 22 VAL A CB   10 
ATOM 11166 C CG1  . VAL A 1 22 ? -1.947  -3.867  -5.813  1.00 0.00 ? 22 VAL A CG1  10 
ATOM 11167 C CG2  . VAL A 1 22 ? -1.438  -1.428  -5.684  1.00 0.00 ? 22 VAL A CG2  10 
ATOM 11168 H H    . VAL A 1 22 ? -2.305  -1.109  -3.406  1.00 0.00 ? 22 VAL A H    10 
ATOM 11169 H HA   . VAL A 1 22 ? -1.197  -3.902  -3.357  1.00 0.00 ? 22 VAL A HA   10 
ATOM 11170 H HB   . VAL A 1 22 ? -0.000  -3.010  -5.520  1.00 0.00 ? 22 VAL A HB   10 
ATOM 11171 H HG11 . VAL A 1 22 ? -2.967  -3.645  -5.533  1.00 0.00 ? 22 VAL A HG11 10 
ATOM 11172 H HG12 . VAL A 1 22 ? -1.678  -4.846  -5.445  1.00 0.00 ? 22 VAL A HG12 10 
ATOM 11173 H HG13 . VAL A 1 22 ? -1.856  -3.849  -6.889  1.00 0.00 ? 22 VAL A HG13 10 
ATOM 11174 H HG21 . VAL A 1 22 ? -1.234  -1.333  -6.740  1.00 0.00 ? 22 VAL A HG21 10 
ATOM 11175 H HG22 . VAL A 1 22 ? -0.887  -0.674  -5.142  1.00 0.00 ? 22 VAL A HG22 10 
ATOM 11176 H HG23 . VAL A 1 22 ? -2.496  -1.297  -5.509  1.00 0.00 ? 22 VAL A HG23 10 
ATOM 11177 N N    . ILE A 1 23 ? 0.863   -3.052  -2.228  1.00 0.00 ? 23 ILE A N    10 
ATOM 11178 C CA   . ILE A 1 23 ? 2.124   -2.551  -1.589  1.00 0.00 ? 23 ILE A CA   10 
ATOM 11179 C C    . ILE A 1 23 ? 3.275   -3.479  -1.992  1.00 0.00 ? 23 ILE A C    10 
ATOM 11180 O O    . ILE A 1 23 ? 3.347   -4.614  -1.563  1.00 0.00 ? 23 ILE A O    10 
ATOM 11181 C CB   . ILE A 1 23 ? 1.969   -2.569  -0.056  1.00 0.00 ? 23 ILE A CB   10 
ATOM 11182 C CG1  . ILE A 1 23 ? 0.943   -1.500  0.404   1.00 0.00 ? 23 ILE A CG1  10 
ATOM 11183 C CG2  . ILE A 1 23 ? 3.331   -2.278  0.590   1.00 0.00 ? 23 ILE A CG2  10 
ATOM 11184 C CD1  . ILE A 1 23 ? -0.482  -2.076  0.370   1.00 0.00 ? 23 ILE A CD1  10 
ATOM 11185 H H    . ILE A 1 23 ? 0.543   -3.956  -2.014  1.00 0.00 ? 23 ILE A H    10 
ATOM 11186 H HA   . ILE A 1 23 ? 2.344   -1.544  -1.920  1.00 0.00 ? 23 ILE A HA   10 
ATOM 11187 H HB   . ILE A 1 23 ? 1.637   -3.549  0.253   1.00 0.00 ? 23 ILE A HB   10 
ATOM 11188 H HG12 . ILE A 1 23 ? 1.170   -1.194  1.418   1.00 0.00 ? 23 ILE A HG12 10 
ATOM 11189 H HG13 . ILE A 1 23 ? 0.996   -0.636  -0.245  1.00 0.00 ? 23 ILE A HG13 10 
ATOM 11190 H HG21 . ILE A 1 23 ? 3.805   -1.456  0.075   1.00 0.00 ? 23 ILE A HG21 10 
ATOM 11191 H HG22 . ILE A 1 23 ? 3.957   -3.155  0.518   1.00 0.00 ? 23 ILE A HG22 10 
ATOM 11192 H HG23 . ILE A 1 23 ? 3.190   -2.021  1.629   1.00 0.00 ? 23 ILE A HG23 10 
ATOM 11193 H HD11 . ILE A 1 23 ? -0.769  -2.280  -0.648  1.00 0.00 ? 23 ILE A HD11 10 
ATOM 11194 H HD12 . ILE A 1 23 ? -1.169  -1.359  0.798   1.00 0.00 ? 23 ILE A HD12 10 
ATOM 11195 H HD13 . ILE A 1 23 ? -0.518  -2.990  0.944   1.00 0.00 ? 23 ILE A HD13 10 
ATOM 11196 N N    . THR A 1 24 ? 4.179   -2.996  -2.812  1.00 0.00 ? 24 THR A N    10 
ATOM 11197 C CA   . THR A 1 24 ? 5.341   -3.820  -3.257  1.00 0.00 ? 24 THR A CA   10 
ATOM 11198 C C    . THR A 1 24 ? 6.640   -3.049  -2.994  1.00 0.00 ? 24 THR A C    10 
ATOM 11199 O O    . THR A 1 24 ? 6.912   -2.057  -3.639  1.00 0.00 ? 24 THR A O    10 
ATOM 11200 C CB   . THR A 1 24 ? 5.217   -4.102  -4.757  1.00 0.00 ? 24 THR A CB   10 
ATOM 11201 O OG1  . THR A 1 24 ? 3.985   -4.764  -5.011  1.00 0.00 ? 24 THR A OG1  10 
ATOM 11202 C CG2  . THR A 1 24 ? 6.377   -4.990  -5.209  1.00 0.00 ? 24 THR A CG2  10 
ATOM 11203 H H    . THR A 1 24 ? 4.095   -2.084  -3.128  1.00 0.00 ? 24 THR A H    10 
ATOM 11204 H HA   . THR A 1 24 ? 5.359   -4.750  -2.721  1.00 0.00 ? 24 THR A HA   10 
ATOM 11205 H HB   . THR A 1 24 ? 5.247   -3.173  -5.303  1.00 0.00 ? 24 THR A HB   10 
ATOM 11206 H HG1  . THR A 1 24 ? 3.348   -4.105  -5.296  1.00 0.00 ? 24 THR A HG1  10 
ATOM 11207 H HG21 . THR A 1 24 ? 7.293   -4.416  -5.206  1.00 0.00 ? 24 THR A HG21 10 
ATOM 11208 H HG22 . THR A 1 24 ? 6.184   -5.353  -6.208  1.00 0.00 ? 24 THR A HG22 10 
ATOM 11209 H HG23 . THR A 1 24 ? 6.475   -5.828  -4.536  1.00 0.00 ? 24 THR A HG23 10 
ATOM 11210 N N    . LYS A 1 25 ? 7.464   -3.511  -2.079  1.00 0.00 ? 25 LYS A N    10 
ATOM 11211 C CA   . LYS A 1 25 ? 8.763   -2.826  -1.806  1.00 0.00 ? 25 LYS A CA   10 
ATOM 11212 C C    . LYS A 1 25 ? 9.850   -3.854  -2.031  1.00 0.00 ? 25 LYS A C    10 
ATOM 11213 O O    . LYS A 1 25 ? 9.987   -4.784  -1.260  1.00 0.00 ? 25 LYS A O    10 
ATOM 11214 C CB   . LYS A 1 25 ? 8.810   -2.341  -0.354  1.00 0.00 ? 25 LYS A CB   10 
ATOM 11215 C CG   . LYS A 1 25 ? 7.618   -1.422  -0.075  1.00 0.00 ? 25 LYS A CG   10 
ATOM 11216 C CD   . LYS A 1 25 ? 7.702   -0.901  1.363   1.00 0.00 ? 25 LYS A CD   10 
ATOM 11217 C CE   . LYS A 1 25 ? 6.763   0.296   1.533   1.00 0.00 ? 25 LYS A CE   10 
ATOM 11218 N NZ   . LYS A 1 25 ? 5.352   -0.152  1.374   1.00 0.00 ? 25 LYS A NZ   10 
ATOM 11219 H H    . LYS A 1 25 ? 7.253   -4.341  -1.597  1.00 0.00 ? 25 LYS A H    10 
ATOM 11220 H HA   . LYS A 1 25 ? 8.910   -1.988  -2.481  1.00 0.00 ? 25 LYS A HA   10 
ATOM 11221 H HB2  . LYS A 1 25 ? 8.776   -3.189  0.312   1.00 0.00 ? 25 LYS A HB2  10 
ATOM 11222 H HB3  . LYS A 1 25 ? 9.727   -1.794  -0.190  1.00 0.00 ? 25 LYS A HB3  10 
ATOM 11223 H HG2  . LYS A 1 25 ? 7.638   -0.590  -0.764  1.00 0.00 ? 25 LYS A HG2  10 
ATOM 11224 H HG3  . LYS A 1 25 ? 6.700   -1.976  -0.203  1.00 0.00 ? 25 LYS A HG3  10 
ATOM 11225 H HD2  . LYS A 1 25 ? 7.411   -1.686  2.046   1.00 0.00 ? 25 LYS A HD2  10 
ATOM 11226 H HD3  . LYS A 1 25 ? 8.715   -0.594  1.577   1.00 0.00 ? 25 LYS A HD3  10 
ATOM 11227 H HE2  . LYS A 1 25 ? 6.898   0.721   2.516   1.00 0.00 ? 25 LYS A HE2  10 
ATOM 11228 H HE3  . LYS A 1 25 ? 6.991   1.041   0.786   1.00 0.00 ? 25 LYS A HE3  10 
ATOM 11229 H HZ1  . LYS A 1 25 ? 4.714   0.557   1.788   1.00 0.00 ? 25 LYS A HZ1  10 
ATOM 11230 H HZ2  . LYS A 1 25 ? 5.219   -1.061  1.861   1.00 0.00 ? 25 LYS A HZ2  10 
ATOM 11231 H HZ3  . LYS A 1 25 ? 5.137   -0.265  0.362   1.00 0.00 ? 25 LYS A HZ3  10 
ATOM 11232 N N    . THR A 1 26 ? 10.620  -3.717  -3.074  1.00 0.00 ? 26 THR A N    10 
ATOM 11233 C CA   . THR A 1 26 ? 11.693  -4.716  -3.338  1.00 0.00 ? 26 THR A CA   10 
ATOM 11234 C C    . THR A 1 26 ? 13.050  -4.083  -3.020  1.00 0.00 ? 26 THR A C    10 
ATOM 11235 O O    . THR A 1 26 ? 13.431  -3.102  -3.628  1.00 0.00 ? 26 THR A O    10 
ATOM 11236 C CB   . THR A 1 26 ? 11.657  -5.118  -4.815  1.00 0.00 ? 26 THR A CB   10 
ATOM 11237 O OG1  . THR A 1 26 ? 10.367  -5.623  -5.135  1.00 0.00 ? 26 THR A OG1  10 
ATOM 11238 C CG2  . THR A 1 26 ? 12.710  -6.194  -5.080  1.00 0.00 ? 26 THR A CG2  10 
ATOM 11239 H H    . THR A 1 26 ? 10.488  -2.965  -3.687  1.00 0.00 ? 26 THR A H    10 
ATOM 11240 H HA   . THR A 1 26 ? 11.532  -5.594  -2.722  1.00 0.00 ? 26 THR A HA   10 
ATOM 11241 H HB   . THR A 1 26 ? 11.868  -4.255  -5.428  1.00 0.00 ? 26 THR A HB   10 
ATOM 11242 H HG1  . THR A 1 26 ? 9.916   -4.967  -5.670  1.00 0.00 ? 26 THR A HG1  10 
ATOM 11243 H HG21 . THR A 1 26 ? 12.570  -7.013  -4.390  1.00 0.00 ? 26 THR A HG21 10 
ATOM 11244 H HG22 . THR A 1 26 ? 13.695  -5.775  -4.946  1.00 0.00 ? 26 THR A HG22 10 
ATOM 11245 H HG23 . THR A 1 26 ? 12.608  -6.556  -6.093  1.00 0.00 ? 26 THR A HG23 10 
ATOM 11246 N N    . VAL A 1 27 ? 13.783  -4.622  -2.074  1.00 0.00 ? 27 VAL A N    10 
ATOM 11247 C CA   . VAL A 1 27 ? 15.116  -4.030  -1.720  1.00 0.00 ? 27 VAL A CA   10 
ATOM 11248 C C    . VAL A 1 27 ? 16.246  -4.925  -2.237  1.00 0.00 ? 27 VAL A C    10 
ATOM 11249 O O    . VAL A 1 27 ? 16.455  -6.021  -1.759  1.00 0.00 ? 27 VAL A O    10 
ATOM 11250 C CB   . VAL A 1 27 ? 15.229  -3.913  -0.197  1.00 0.00 ? 27 VAL A CB   10 
ATOM 11251 C CG1  . VAL A 1 27 ? 16.436  -3.045  0.160   1.00 0.00 ? 27 VAL A CG1  10 
ATOM 11252 C CG2  . VAL A 1 27 ? 13.958  -3.269  0.360   1.00 0.00 ? 27 VAL A CG2  10 
ATOM 11253 H H    . VAL A 1 27 ? 13.460  -5.408  -1.586  1.00 0.00 ? 27 VAL A H    10 
ATOM 11254 H HA   . VAL A 1 27 ? 15.216  -3.045  -2.156  1.00 0.00 ? 27 VAL A HA   10 
ATOM 11255 H HB   . VAL A 1 27 ? 15.356  -4.898  0.233   1.00 0.00 ? 27 VAL A HB   10 
ATOM 11256 H HG11 . VAL A 1 27 ? 16.328  -2.073  -0.299  1.00 0.00 ? 27 VAL A HG11 10 
ATOM 11257 H HG12 . VAL A 1 27 ? 17.338  -3.516  -0.203  1.00 0.00 ? 27 VAL A HG12 10 
ATOM 11258 H HG13 . VAL A 1 27 ? 16.495  -2.933  1.233   1.00 0.00 ? 27 VAL A HG13 10 
ATOM 11259 H HG21 . VAL A 1 27 ? 13.777  -2.333  -0.147  1.00 0.00 ? 27 VAL A HG21 10 
ATOM 11260 H HG22 . VAL A 1 27 ? 14.080  -3.087  1.418   1.00 0.00 ? 27 VAL A HG22 10 
ATOM 11261 H HG23 . VAL A 1 27 ? 13.119  -3.931  0.204   1.00 0.00 ? 27 VAL A HG23 10 
ATOM 11262 N N    . THR A 1 28 ? 16.980  -4.445  -3.208  1.00 0.00 ? 28 THR A N    10 
ATOM 11263 C CA   . THR A 1 28 ? 18.119  -5.239  -3.773  1.00 0.00 ? 28 THR A CA   10 
ATOM 11264 C C    . THR A 1 28 ? 19.443  -4.628  -3.309  1.00 0.00 ? 28 THR A C    10 
ATOM 11265 O O    . THR A 1 28 ? 19.853  -3.590  -3.787  1.00 0.00 ? 28 THR A O    10 
ATOM 11266 C CB   . THR A 1 28 ? 18.054  -5.194  -5.302  1.00 0.00 ? 28 THR A CB   10 
ATOM 11267 O OG1  . THR A 1 28 ? 16.782  -5.655  -5.735  1.00 0.00 ? 28 THR A OG1  10 
ATOM 11268 C CG2  . THR A 1 28 ? 19.149  -6.088  -5.888  1.00 0.00 ? 28 THR A CG2  10 
ATOM 11269 H H    . THR A 1 28 ? 16.771  -3.551  -3.555  1.00 0.00 ? 28 THR A H    10 
ATOM 11270 H HA   . THR A 1 28 ? 18.060  -6.266  -3.443  1.00 0.00 ? 28 THR A HA   10 
ATOM 11271 H HB   . THR A 1 28 ? 18.204  -4.180  -5.640  1.00 0.00 ? 28 THR A HB   10 
ATOM 11272 H HG1  . THR A 1 28 ? 16.309  -4.910  -6.112  1.00 0.00 ? 28 THR A HG1  10 
ATOM 11273 H HG21 . THR A 1 28 ? 19.064  -6.102  -6.965  1.00 0.00 ? 28 THR A HG21 10 
ATOM 11274 H HG22 . THR A 1 28 ? 19.038  -7.091  -5.503  1.00 0.00 ? 28 THR A HG22 10 
ATOM 11275 H HG23 . THR A 1 28 ? 20.118  -5.700  -5.608  1.00 0.00 ? 28 THR A HG23 10 
ATOM 11276 N N    . ASN A 1 29 ? 20.118  -5.258  -2.376  1.00 0.00 ? 29 ASN A N    10 
ATOM 11277 C CA   . ASN A 1 29 ? 21.417  -4.705  -1.878  1.00 0.00 ? 29 ASN A CA   10 
ATOM 11278 C C    . ASN A 1 29 ? 22.580  -5.426  -2.570  1.00 0.00 ? 29 ASN A C    10 
ATOM 11279 O O    . ASN A 1 29 ? 22.776  -6.618  -2.404  1.00 0.00 ? 29 ASN A O    10 
ATOM 11280 C CB   . ASN A 1 29 ? 21.501  -4.912  -0.357  1.00 0.00 ? 29 ASN A CB   10 
ATOM 11281 C CG   . ASN A 1 29 ? 20.105  -4.769  0.254   1.00 0.00 ? 29 ASN A CG   10 
ATOM 11282 O OD1  . ASN A 1 29 ? 19.833  -3.820  0.961   1.00 0.00 ? 29 ASN A OD1  10 
ATOM 11283 N ND2  . ASN A 1 29 ? 19.203  -5.680  0.008   1.00 0.00 ? 29 ASN A ND2  10 
ATOM 11284 H H    . ASN A 1 29 ? 19.771  -6.087  -1.984  1.00 0.00 ? 29 ASN A H    10 
ATOM 11285 H HA   . ASN A 1 29 ? 21.474  -3.646  -2.097  1.00 0.00 ? 29 ASN A HA   10 
ATOM 11286 H HB2  . ASN A 1 29 ? 21.885  -5.900  -0.143  1.00 0.00 ? 29 ASN A HB2  10 
ATOM 11287 H HB3  . ASN A 1 29 ? 22.156  -4.170  0.073   1.00 0.00 ? 29 ASN A HB3  10 
ATOM 11288 H HD21 . ASN A 1 29 ? 19.423  -6.446  -0.563  1.00 0.00 ? 29 ASN A HD21 10 
ATOM 11289 H HD22 . ASN A 1 29 ? 18.306  -5.598  0.394   1.00 0.00 ? 29 ASN A HD22 10 
ATOM 11290 N N    . ALA A 1 30 ? 23.344  -4.709  -3.347  1.00 0.00 ? 30 ALA A N    10 
ATOM 11291 C CA   . ALA A 1 30 ? 24.497  -5.319  -4.072  1.00 0.00 ? 30 ALA A CA   10 
ATOM 11292 C C    . ALA A 1 30 ? 25.362  -6.153  -3.121  1.00 0.00 ? 30 ALA A C    10 
ATOM 11293 O O    . ALA A 1 30 ? 26.221  -6.895  -3.553  1.00 0.00 ? 30 ALA A O    10 
ATOM 11294 C CB   . ALA A 1 30 ? 25.351  -4.209  -4.687  1.00 0.00 ? 30 ALA A CB   10 
ATOM 11295 H H    . ALA A 1 30 ? 23.161  -3.753  -3.467  1.00 0.00 ? 30 ALA A H    10 
ATOM 11296 H HA   . ALA A 1 30 ? 24.123  -5.954  -4.861  1.00 0.00 ? 30 ALA A HA   10 
ATOM 11297 H HB1  . ALA A 1 30 ? 26.161  -4.647  -5.250  1.00 0.00 ? 30 ALA A HB1  10 
ATOM 11298 H HB2  . ALA A 1 30 ? 25.753  -3.587  -3.901  1.00 0.00 ? 30 ALA A HB2  10 
ATOM 11299 H HB3  . ALA A 1 30 ? 24.740  -3.608  -5.344  1.00 0.00 ? 30 ALA A HB3  10 
ATOM 11300 N N    . ASP A 1 31 ? 25.162  -6.039  -1.838  1.00 0.00 ? 31 ASP A N    10 
ATOM 11301 C CA   . ASP A 1 31 ? 26.002  -6.829  -0.894  1.00 0.00 ? 31 ASP A CA   10 
ATOM 11302 C C    . ASP A 1 31 ? 25.601  -8.308  -0.965  1.00 0.00 ? 31 ASP A C    10 
ATOM 11303 O O    . ASP A 1 31 ? 26.157  -9.141  -0.277  1.00 0.00 ? 31 ASP A O    10 
ATOM 11304 C CB   . ASP A 1 31 ? 25.816  -6.300  0.535   1.00 0.00 ? 31 ASP A CB   10 
ATOM 11305 C CG   . ASP A 1 31 ? 26.639  -5.021  0.721   1.00 0.00 ? 31 ASP A CG   10 
ATOM 11306 O OD1  . ASP A 1 31 ? 26.171  -3.975  0.307   1.00 0.00 ? 31 ASP A OD1  10 
ATOM 11307 O OD2  . ASP A 1 31 ? 27.722  -5.113  1.273   1.00 0.00 ? 31 ASP A OD2  10 
ATOM 11308 H H    . ASP A 1 31 ? 24.470  -5.438  -1.495  1.00 0.00 ? 31 ASP A H    10 
ATOM 11309 H HA   . ASP A 1 31 ? 27.040  -6.734  -1.181  1.00 0.00 ? 31 ASP A HA   10 
ATOM 11310 H HB2  . ASP A 1 31 ? 24.775  -6.081  0.708   1.00 0.00 ? 31 ASP A HB2  10 
ATOM 11311 H HB3  . ASP A 1 31 ? 26.151  -7.044  1.243   1.00 0.00 ? 31 ASP A HB3  10 
ATOM 11312 N N    . GLY A 1 32 ? 24.657  -8.645  -1.811  1.00 0.00 ? 32 GLY A N    10 
ATOM 11313 C CA   . GLY A 1 32 ? 24.235  -10.078 -1.953  1.00 0.00 ? 32 GLY A CA   10 
ATOM 11314 C C    . GLY A 1 32 ? 22.925  -10.335 -1.204  1.00 0.00 ? 32 GLY A C    10 
ATOM 11315 O O    . GLY A 1 32 ? 22.423  -11.442 -1.189  1.00 0.00 ? 32 GLY A O    10 
ATOM 11316 H H    . GLY A 1 32 ? 24.234  -7.958  -2.367  1.00 0.00 ? 32 GLY A H    10 
ATOM 11317 H HA2  . GLY A 1 32 ? 24.091  -10.298 -3.002  1.00 0.00 ? 32 GLY A HA2  10 
ATOM 11318 H HA3  . GLY A 1 32 ? 25.003  -10.728 -1.559  1.00 0.00 ? 32 GLY A HA3  10 
ATOM 11319 N N    . ARG A 1 33 ? 22.363  -9.333  -0.579  1.00 0.00 ? 33 ARG A N    10 
ATOM 11320 C CA   . ARG A 1 33 ? 21.084  -9.535  0.170   1.00 0.00 ? 33 ARG A CA   10 
ATOM 11321 C C    . ARG A 1 33 ? 19.910  -9.145  -0.723  1.00 0.00 ? 33 ARG A C    10 
ATOM 11322 O O    . ARG A 1 33 ? 20.042  -8.352  -1.634  1.00 0.00 ? 33 ARG A O    10 
ATOM 11323 C CB   . ARG A 1 33 ? 21.095  -8.665  1.443   1.00 0.00 ? 33 ARG A CB   10 
ATOM 11324 C CG   . ARG A 1 33 ? 21.749  -9.446  2.598   1.00 0.00 ? 33 ARG A CG   10 
ATOM 11325 C CD   . ARG A 1 33 ? 22.338  -8.476  3.626   1.00 0.00 ? 33 ARG A CD   10 
ATOM 11326 N NE   . ARG A 1 33 ? 22.986  -9.253  4.722   1.00 0.00 ? 33 ARG A NE   10 
ATOM 11327 C CZ   . ARG A 1 33 ? 23.810  -8.662  5.544   1.00 0.00 ? 33 ARG A CZ   10 
ATOM 11328 N NH1  . ARG A 1 33 ? 24.073  -7.392  5.404   1.00 0.00 ? 33 ARG A NH1  10 
ATOM 11329 N NH2  . ARG A 1 33 ? 24.372  -9.342  6.505   1.00 0.00 ? 33 ARG A NH2  10 
ATOM 11330 H H    . ARG A 1 33 ? 22.781  -8.449  -0.597  1.00 0.00 ? 33 ARG A H    10 
ATOM 11331 H HA   . ARG A 1 33 ? 20.981  -10.578 0.445   1.00 0.00 ? 33 ARG A HA   10 
ATOM 11332 H HB2  . ARG A 1 33 ? 21.657  -7.763  1.251   1.00 0.00 ? 33 ARG A HB2  10 
ATOM 11333 H HB3  . ARG A 1 33 ? 20.083  -8.405  1.720   1.00 0.00 ? 33 ARG A HB3  10 
ATOM 11334 H HG2  . ARG A 1 33 ? 21.006  -10.067 3.077   1.00 0.00 ? 33 ARG A HG2  10 
ATOM 11335 H HG3  . ARG A 1 33 ? 22.535  -10.072 2.206   1.00 0.00 ? 33 ARG A HG3  10 
ATOM 11336 H HD2  . ARG A 1 33 ? 23.073  -7.845  3.148   1.00 0.00 ? 33 ARG A HD2  10 
ATOM 11337 H HD3  . ARG A 1 33 ? 21.550  -7.863  4.039   1.00 0.00 ? 33 ARG A HD3  10 
ATOM 11338 H HE   . ARG A 1 33 ? 22.791  -10.207 4.827   1.00 0.00 ? 33 ARG A HE   10 
ATOM 11339 H HH11 . ARG A 1 33 ? 23.644  -6.870  4.666   1.00 0.00 ? 33 ARG A HH11 10 
ATOM 11340 H HH12 . ARG A 1 33 ? 24.705  -6.940  6.034   1.00 0.00 ? 33 ARG A HH12 10 
ATOM 11341 H HH21 . ARG A 1 33 ? 24.171  -10.316 6.612   1.00 0.00 ? 33 ARG A HH21 10 
ATOM 11342 H HH22 . ARG A 1 33 ? 25.003  -8.889  7.135   1.00 0.00 ? 33 ARG A HH22 10 
ATOM 11343 N N    . THR A 1 34 ? 18.763  -9.706  -0.469  1.00 0.00 ? 34 THR A N    10 
ATOM 11344 C CA   . THR A 1 34 ? 17.576  -9.374  -1.307  1.00 0.00 ? 34 THR A CA   10 
ATOM 11345 C C    . THR A 1 34 ? 16.279  -9.695  -0.558  1.00 0.00 ? 34 THR A C    10 
ATOM 11346 O O    . THR A 1 34 ? 16.005  -10.828 -0.217  1.00 0.00 ? 34 THR A O    10 
ATOM 11347 C CB   . THR A 1 34 ? 17.629  -10.185 -2.608  1.00 0.00 ? 34 THR A CB   10 
ATOM 11348 O OG1  . THR A 1 34 ? 16.480  -9.890  -3.390  1.00 0.00 ? 34 THR A OG1  10 
ATOM 11349 C CG2  . THR A 1 34 ? 17.660  -11.685 -2.294  1.00 0.00 ? 34 THR A CG2  10 
ATOM 11350 H H    . THR A 1 34 ? 18.686  -10.344 0.272   1.00 0.00 ? 34 THR A H    10 
ATOM 11351 H HA   . THR A 1 34 ? 17.592  -8.321  -1.548  1.00 0.00 ? 34 THR A HA   10 
ATOM 11352 H HB   . THR A 1 34 ? 18.516  -9.919  -3.161  1.00 0.00 ? 34 THR A HB   10 
ATOM 11353 H HG1  . THR A 1 34 ? 16.607  -9.026  -3.790  1.00 0.00 ? 34 THR A HG1  10 
ATOM 11354 H HG21 . THR A 1 34 ? 18.267  -11.864 -1.418  1.00 0.00 ? 34 THR A HG21 10 
ATOM 11355 H HG22 . THR A 1 34 ? 18.078  -12.220 -3.135  1.00 0.00 ? 34 THR A HG22 10 
ATOM 11356 H HG23 . THR A 1 34 ? 16.655  -12.037 -2.114  1.00 0.00 ? 34 THR A HG23 10 
ATOM 11357 N N    . GLU A 1 35 ? 15.471  -8.693  -0.330  1.00 0.00 ? 35 GLU A N    10 
ATOM 11358 C CA   . GLU A 1 35 ? 14.159  -8.890  0.364   1.00 0.00 ? 35 GLU A CA   10 
ATOM 11359 C C    . GLU A 1 35 ? 13.067  -8.473  -0.622  1.00 0.00 ? 35 GLU A C    10 
ATOM 11360 O O    . GLU A 1 35 ? 13.250  -7.536  -1.372  1.00 0.00 ? 35 GLU A O    10 
ATOM 11361 C CB   . GLU A 1 35 ? 14.103  -7.992  1.607   1.00 0.00 ? 35 GLU A CB   10 
ATOM 11362 C CG   . GLU A 1 35 ? 15.358  -8.214  2.456   1.00 0.00 ? 35 GLU A CG   10 
ATOM 11363 C CD   . GLU A 1 35 ? 15.380  -9.656  2.967   1.00 0.00 ? 35 GLU A CD   10 
ATOM 11364 O OE1  . GLU A 1 35 ? 14.328  -10.145 3.346   1.00 0.00 ? 35 GLU A OE1  10 
ATOM 11365 O OE2  . GLU A 1 35 ? 16.447  -10.246 2.973   1.00 0.00 ? 35 GLU A OE2  10 
ATOM 11366 H H    . GLU A 1 35 ? 15.719  -7.797  -0.639  1.00 0.00 ? 35 GLU A H    10 
ATOM 11367 H HA   . GLU A 1 35 ? 14.027  -9.926  0.647   1.00 0.00 ? 35 GLU A HA   10 
ATOM 11368 H HB2  . GLU A 1 35 ? 14.055  -6.958  1.300   1.00 0.00 ? 35 GLU A HB2  10 
ATOM 11369 H HB3  . GLU A 1 35 ? 13.230  -8.235  2.192   1.00 0.00 ? 35 GLU A HB3  10 
ATOM 11370 H HG2  . GLU A 1 35 ? 16.237  -8.031  1.856   1.00 0.00 ? 35 GLU A HG2  10 
ATOM 11371 H HG3  . GLU A 1 35 ? 15.347  -7.537  3.296   1.00 0.00 ? 35 GLU A HG3  10 
ATOM 11372 N N    . THR A 1 36 ? 11.936  -9.147  -0.652  1.00 0.00 ? 36 THR A N    10 
ATOM 11373 C CA   . THR A 1 36 ? 10.866  -8.766  -1.606  1.00 0.00 ? 36 THR A CA   10 
ATOM 11374 C C    . THR A 1 36 ? 9.561   -8.686  -0.839  1.00 0.00 ? 36 THR A C    10 
ATOM 11375 O O    . THR A 1 36 ? 9.020   -9.688  -0.412  1.00 0.00 ? 36 THR A O    10 
ATOM 11376 C CB   . THR A 1 36 ? 10.767  -9.837  -2.704  1.00 0.00 ? 36 THR A CB   10 
ATOM 11377 O OG1  . THR A 1 36 ? 12.075  -10.243 -3.077  1.00 0.00 ? 36 THR A OG1  10 
ATOM 11378 C CG2  . THR A 1 36 ? 10.042  -9.271  -3.928  1.00 0.00 ? 36 THR A CG2  10 
ATOM 11379 H H    . THR A 1 36 ? 11.778  -9.902  -0.047  1.00 0.00 ? 36 THR A H    10 
ATOM 11380 H HA   . THR A 1 36 ? 11.076  -7.804  -2.054  1.00 0.00 ? 36 THR A HA   10 
ATOM 11381 H HB   . THR A 1 36 ? 10.221  -10.691 -2.331  1.00 0.00 ? 36 THR A HB   10 
ATOM 11382 H HG1  . THR A 1 36 ? 12.703  -9.724  -2.568  1.00 0.00 ? 36 THR A HG1  10 
ATOM 11383 H HG21 . THR A 1 36 ? 9.217   -8.652  -3.608  1.00 0.00 ? 36 THR A HG21 10 
ATOM 11384 H HG22 . THR A 1 36 ? 9.669   -10.084 -4.533  1.00 0.00 ? 36 THR A HG22 10 
ATOM 11385 H HG23 . THR A 1 36 ? 10.731  -8.677  -4.511  1.00 0.00 ? 36 THR A HG23 10 
ATOM 11386 N N    . THR A 1 37 ? 9.029   -7.510  -0.693  1.00 0.00 ? 37 THR A N    10 
ATOM 11387 C CA   . THR A 1 37 ? 7.730   -7.362  0.010   1.00 0.00 ? 37 THR A CA   10 
ATOM 11388 C C    . THR A 1 37 ? 6.692   -7.197  -1.076  1.00 0.00 ? 37 THR A C    10 
ATOM 11389 O O    . THR A 1 37 ? 6.730   -6.250  -1.822  1.00 0.00 ? 37 THR A O    10 
ATOM 11390 C CB   . THR A 1 37 ? 7.756   -6.120  0.907   1.00 0.00 ? 37 THR A CB   10 
ATOM 11391 O OG1  . THR A 1 37 ? 8.977   -6.088  1.632   1.00 0.00 ? 37 THR A OG1  10 
ATOM 11392 C CG2  . THR A 1 37 ? 6.580   -6.171  1.885   1.00 0.00 ? 37 THR A CG2  10 
ATOM 11393 H H    . THR A 1 37 ? 9.462   -6.718  -1.087  1.00 0.00 ? 37 THR A H    10 
ATOM 11394 H HA   . THR A 1 37 ? 7.504   -8.245  0.603   1.00 0.00 ? 37 THR A HA   10 
ATOM 11395 H HB   . THR A 1 37 ? 7.673   -5.234  0.299   1.00 0.00 ? 37 THR A HB   10 
ATOM 11396 H HG1  . THR A 1 37 ? 8.860   -5.504  2.385   1.00 0.00 ? 37 THR A HG1  10 
ATOM 11397 H HG21 . THR A 1 37 ? 5.651   -6.118  1.335   1.00 0.00 ? 37 THR A HG21 10 
ATOM 11398 H HG22 . THR A 1 37 ? 6.643   -5.335  2.567   1.00 0.00 ? 37 THR A HG22 10 
ATOM 11399 H HG23 . THR A 1 37 ? 6.615   -7.095  2.444   1.00 0.00 ? 37 THR A HG23 10 
ATOM 11400 N N    . LYS A 1 38 ? 5.784   -8.119  -1.187  1.00 0.00 ? 38 LYS A N    10 
ATOM 11401 C CA   . LYS A 1 38 ? 4.727   -8.033  -2.249  1.00 0.00 ? 38 LYS A CA   10 
ATOM 11402 C C    . LYS A 1 38 ? 3.343   -8.157  -1.605  1.00 0.00 ? 38 LYS A C    10 
ATOM 11403 O O    . LYS A 1 38 ? 2.521   -8.946  -2.024  1.00 0.00 ? 38 LYS A O    10 
ATOM 11404 C CB   . LYS A 1 38 ? 4.928   -9.175  -3.257  1.00 0.00 ? 38 LYS A CB   10 
ATOM 11405 C CG   . LYS A 1 38 ? 6.033   -8.798  -4.246  1.00 0.00 ? 38 LYS A CG   10 
ATOM 11406 C CD   . LYS A 1 38 ? 6.411   -10.022 -5.083  1.00 0.00 ? 38 LYS A CD   10 
ATOM 11407 C CE   . LYS A 1 38 ? 7.282   -9.585  -6.262  1.00 0.00 ? 38 LYS A CE   10 
ATOM 11408 N NZ   . LYS A 1 38 ? 6.466   -8.773  -7.209  1.00 0.00 ? 38 LYS A NZ   10 
ATOM 11409 H H    . LYS A 1 38 ? 5.785   -8.878  -0.574  1.00 0.00 ? 38 LYS A H    10 
ATOM 11410 H HA   . LYS A 1 38 ? 4.788   -7.084  -2.766  1.00 0.00 ? 38 LYS A HA   10 
ATOM 11411 H HB2  . LYS A 1 38 ? 5.211   -10.075 -2.728  1.00 0.00 ? 38 LYS A HB2  10 
ATOM 11412 H HB3  . LYS A 1 38 ? 4.010   -9.350  -3.800  1.00 0.00 ? 38 LYS A HB3  10 
ATOM 11413 H HG2  . LYS A 1 38 ? 5.678   -8.012  -4.898  1.00 0.00 ? 38 LYS A HG2  10 
ATOM 11414 H HG3  . LYS A 1 38 ? 6.899   -8.453  -3.704  1.00 0.00 ? 38 LYS A HG3  10 
ATOM 11415 H HD2  . LYS A 1 38 ? 6.958   -10.722 -4.469  1.00 0.00 ? 38 LYS A HD2  10 
ATOM 11416 H HD3  . LYS A 1 38 ? 5.515   -10.494 -5.456  1.00 0.00 ? 38 LYS A HD3  10 
ATOM 11417 H HE2  . LYS A 1 38 ? 8.108   -8.991  -5.900  1.00 0.00 ? 38 LYS A HE2  10 
ATOM 11418 H HE3  . LYS A 1 38 ? 7.663   -10.458 -6.772  1.00 0.00 ? 38 LYS A HE3  10 
ATOM 11419 H HZ1  . LYS A 1 38 ? 6.715   -7.770  -7.111  1.00 0.00 ? 38 LYS A HZ1  10 
ATOM 11420 H HZ2  . LYS A 1 38 ? 5.456   -8.900  -6.993  1.00 0.00 ? 38 LYS A HZ2  10 
ATOM 11421 H HZ3  . LYS A 1 38 ? 6.654   -9.086  -8.184  1.00 0.00 ? 38 LYS A HZ3  10 
ATOM 11422 N N    . GLU A 1 39 ? 3.074   -7.374  -0.597  1.00 0.00 ? 39 GLU A N    10 
ATOM 11423 C CA   . GLU A 1 39 ? 1.739   -7.439  0.057   1.00 0.00 ? 39 GLU A CA   10 
ATOM 11424 C C    . GLU A 1 39 ? 0.692   -6.885  -0.918  1.00 0.00 ? 39 GLU A C    10 
ATOM 11425 O O    . GLU A 1 39 ? 0.331   -5.726  -0.851  1.00 0.00 ? 39 GLU A O    10 
ATOM 11426 C CB   . GLU A 1 39 ? 1.755   -6.588  1.329   1.00 0.00 ? 39 GLU A CB   10 
ATOM 11427 C CG   . GLU A 1 39 ? 2.541   -7.317  2.420   1.00 0.00 ? 39 GLU A CG   10 
ATOM 11428 C CD   . GLU A 1 39 ? 2.700   -6.403  3.635   1.00 0.00 ? 39 GLU A CD   10 
ATOM 11429 O OE1  . GLU A 1 39 ? 3.649   -5.637  3.652   1.00 0.00 ? 39 GLU A OE1  10 
ATOM 11430 O OE2  . GLU A 1 39 ? 1.872   -6.485  4.526   1.00 0.00 ? 39 GLU A OE2  10 
ATOM 11431 H H    . GLU A 1 39 ? 3.745   -6.734  -0.280  1.00 0.00 ? 39 GLU A H    10 
ATOM 11432 H HA   . GLU A 1 39 ? 1.507   -8.463  0.312   1.00 0.00 ? 39 GLU A HA   10 
ATOM 11433 H HB2  . GLU A 1 39 ? 2.225   -5.638  1.122   1.00 0.00 ? 39 GLU A HB2  10 
ATOM 11434 H HB3  . GLU A 1 39 ? 0.743   -6.423  1.667   1.00 0.00 ? 39 GLU A HB3  10 
ATOM 11435 H HG2  . GLU A 1 39 ? 2.008   -8.212  2.708   1.00 0.00 ? 39 GLU A HG2  10 
ATOM 11436 H HG3  . GLU A 1 39 ? 3.517   -7.586  2.043   1.00 0.00 ? 39 GLU A HG3  10 
ATOM 11437 N N    . VAL A 1 40 ? 0.206   -7.699  -1.833  1.00 0.00 ? 40 VAL A N    10 
ATOM 11438 C CA   . VAL A 1 40 ? -0.810  -7.215  -2.823  1.00 0.00 ? 40 VAL A CA   10 
ATOM 11439 C C    . VAL A 1 40 ? -2.187  -7.798  -2.485  1.00 0.00 ? 40 VAL A C    10 
ATOM 11440 O O    . VAL A 1 40 ? -2.356  -8.996  -2.378  1.00 0.00 ? 40 VAL A O    10 
ATOM 11441 C CB   . VAL A 1 40 ? -0.393  -7.660  -4.229  1.00 0.00 ? 40 VAL A CB   10 
ATOM 11442 C CG1  . VAL A 1 40 ? 0.951   -7.016  -4.578  1.00 0.00 ? 40 VAL A CG1  10 
ATOM 11443 C CG2  . VAL A 1 40 ? -0.256  -9.186  -4.276  1.00 0.00 ? 40 VAL A CG2  10 
ATOM 11444 H H    . VAL A 1 40 ? 0.510   -8.631  -1.870  1.00 0.00 ? 40 VAL A H    10 
ATOM 11445 H HA   . VAL A 1 40 ? -0.865  -6.136  -2.798  1.00 0.00 ? 40 VAL A HA   10 
ATOM 11446 H HB   . VAL A 1 40 ? -1.140  -7.340  -4.942  1.00 0.00 ? 40 VAL A HB   10 
ATOM 11447 H HG11 . VAL A 1 40 ? 0.857   -5.941  -4.530  1.00 0.00 ? 40 VAL A HG11 10 
ATOM 11448 H HG12 . VAL A 1 40 ? 1.241   -7.308  -5.577  1.00 0.00 ? 40 VAL A HG12 10 
ATOM 11449 H HG13 . VAL A 1 40 ? 1.701   -7.345  -3.874  1.00 0.00 ? 40 VAL A HG13 10 
ATOM 11450 H HG21 . VAL A 1 40 ? -1.237  -9.634  -4.334  1.00 0.00 ? 40 VAL A HG21 10 
ATOM 11451 H HG22 . VAL A 1 40 ? 0.247   -9.534  -3.388  1.00 0.00 ? 40 VAL A HG22 10 
ATOM 11452 H HG23 . VAL A 1 40 ? 0.317   -9.472  -5.147  1.00 0.00 ? 40 VAL A HG23 10 
ATOM 11453 N N    . VAL A 1 41 ? -3.181  -6.952  -2.347  1.00 0.00 ? 41 VAL A N    10 
ATOM 11454 C CA   . VAL A 1 41 ? -4.566  -7.439  -2.052  1.00 0.00 ? 41 VAL A CA   10 
ATOM 11455 C C    . VAL A 1 41 ? -5.553  -6.672  -2.939  1.00 0.00 ? 41 VAL A C    10 
ATOM 11456 O O    . VAL A 1 41 ? -5.747  -5.483  -2.769  1.00 0.00 ? 41 VAL A O    10 
ATOM 11457 C CB   . VAL A 1 41 ? -4.886  -7.201  -0.564  1.00 0.00 ? 41 VAL A CB   10 
ATOM 11458 C CG1  . VAL A 1 41 ? -5.922  -8.220  -0.073  1.00 0.00 ? 41 VAL A CG1  10 
ATOM 11459 C CG2  . VAL A 1 41 ? -3.606  -7.355  0.261   1.00 0.00 ? 41 VAL A CG2  10 
ATOM 11460 H H    . VAL A 1 41 ? -3.017  -5.996  -2.484  1.00 0.00 ? 41 VAL A H    10 
ATOM 11461 H HA   . VAL A 1 41 ? -4.638  -8.496  -2.280  1.00 0.00 ? 41 VAL A HA   10 
ATOM 11462 H HB   . VAL A 1 41 ? -5.278  -6.203  -0.431  1.00 0.00 ? 41 VAL A HB   10 
ATOM 11463 H HG11 . VAL A 1 41 ? -6.866  -8.041  -0.566  1.00 0.00 ? 41 VAL A HG11 10 
ATOM 11464 H HG12 . VAL A 1 41 ? -6.048  -8.116  0.995   1.00 0.00 ? 41 VAL A HG12 10 
ATOM 11465 H HG13 . VAL A 1 41 ? -5.582  -9.220  -0.294  1.00 0.00 ? 41 VAL A HG13 10 
ATOM 11466 H HG21 . VAL A 1 41 ? -3.101  -8.266  -0.023  1.00 0.00 ? 41 VAL A HG21 10 
ATOM 11467 H HG22 . VAL A 1 41 ? -3.856  -7.395  1.311   1.00 0.00 ? 41 VAL A HG22 10 
ATOM 11468 H HG23 . VAL A 1 41 ? -2.956  -6.512  0.077   1.00 0.00 ? 41 VAL A HG23 10 
ATOM 11469 N N    . LYS A 1 42 ? -6.168  -7.334  -3.891  1.00 0.00 ? 42 LYS A N    10 
ATOM 11470 C CA   . LYS A 1 42 ? -7.136  -6.640  -4.806  1.00 0.00 ? 42 LYS A CA   10 
ATOM 11471 C C    . LYS A 1 42 ? -8.536  -7.242  -4.647  1.00 0.00 ? 42 LYS A C    10 
ATOM 11472 O O    . LYS A 1 42 ? -8.728  -8.436  -4.767  1.00 0.00 ? 42 LYS A O    10 
ATOM 11473 C CB   . LYS A 1 42 ? -6.663  -6.815  -6.260  1.00 0.00 ? 42 LYS A CB   10 
ATOM 11474 C CG   . LYS A 1 42 ? -5.629  -5.736  -6.607  1.00 0.00 ? 42 LYS A CG   10 
ATOM 11475 C CD   . LYS A 1 42 ? -5.201  -5.880  -8.076  1.00 0.00 ? 42 LYS A CD   10 
ATOM 11476 C CE   . LYS A 1 42 ? -4.605  -4.561  -8.579  1.00 0.00 ? 42 LYS A CE   10 
ATOM 11477 N NZ   . LYS A 1 42 ? -5.708  -3.616  -8.914  1.00 0.00 ? 42 LYS A NZ   10 
ATOM 11478 H H    . LYS A 1 42 ? -5.981  -8.288  -4.019  1.00 0.00 ? 42 LYS A H    10 
ATOM 11479 H HA   . LYS A 1 42 ? -7.185  -5.585  -4.569  1.00 0.00 ? 42 LYS A HA   10 
ATOM 11480 H HB2  . LYS A 1 42 ? -6.214  -7.790  -6.375  1.00 0.00 ? 42 LYS A HB2  10 
ATOM 11481 H HB3  . LYS A 1 42 ? -7.506  -6.726  -6.933  1.00 0.00 ? 42 LYS A HB3  10 
ATOM 11482 H HG2  . LYS A 1 42 ? -6.066  -4.759  -6.449  1.00 0.00 ? 42 LYS A HG2  10 
ATOM 11483 H HG3  . LYS A 1 42 ? -4.765  -5.849  -5.969  1.00 0.00 ? 42 LYS A HG3  10 
ATOM 11484 H HD2  . LYS A 1 42 ? -4.460  -6.662  -8.157  1.00 0.00 ? 42 LYS A HD2  10 
ATOM 11485 H HD3  . LYS A 1 42 ? -6.059  -6.136  -8.681  1.00 0.00 ? 42 LYS A HD3  10 
ATOM 11486 H HE2  . LYS A 1 42 ? -3.982  -4.128  -7.812  1.00 0.00 ? 42 LYS A HE2  10 
ATOM 11487 H HE3  . LYS A 1 42 ? -4.012  -4.748  -9.462  1.00 0.00 ? 42 LYS A HE3  10 
ATOM 11488 H HZ1  . LYS A 1 42 ? -6.388  -3.585  -8.128  1.00 0.00 ? 42 LYS A HZ1  10 
ATOM 11489 H HZ2  . LYS A 1 42 ? -6.192  -3.937  -9.775  1.00 0.00 ? 42 LYS A HZ2  10 
ATOM 11490 H HZ3  . LYS A 1 42 ? -5.314  -2.665  -9.069  1.00 0.00 ? 42 LYS A HZ3  10 
ATOM 11491 N N    . SER A 1 43 ? -9.516  -6.411  -4.401  1.00 0.00 ? 43 SER A N    10 
ATOM 11492 C CA   . SER A 1 43 ? -10.921 -6.900  -4.256  1.00 0.00 ? 43 SER A CA   10 
ATOM 11493 C C    . SER A 1 43 ? -11.693 -6.528  -5.524  1.00 0.00 ? 43 SER A C    10 
ATOM 11494 O O    . SER A 1 43 ? -12.188 -5.426  -5.659  1.00 0.00 ? 43 SER A O    10 
ATOM 11495 C CB   . SER A 1 43 ? -11.572 -6.224  -3.048  1.00 0.00 ? 43 SER A CB   10 
ATOM 11496 O OG   . SER A 1 43 ? -12.925 -6.645  -2.949  1.00 0.00 ? 43 SER A OG   10 
ATOM 11497 H H    . SER A 1 43 ? -9.328  -5.451  -4.326  1.00 0.00 ? 43 SER A H    10 
ATOM 11498 H HA   . SER A 1 43 ? -10.935 -7.973  -4.124  1.00 0.00 ? 43 SER A HA   10 
ATOM 11499 H HB2  . SER A 1 43 ? -11.045 -6.504  -2.151  1.00 0.00 ? 43 SER A HB2  10 
ATOM 11500 H HB3  . SER A 1 43 ? -11.525 -5.149  -3.171  1.00 0.00 ? 43 SER A HB3  10 
ATOM 11501 H HG   . SER A 1 43 ? -12.937 -7.605  -2.932  1.00 0.00 ? 43 SER A HG   10 
ATOM 11502 N N    . GLU A 1 44 ? -11.793 -7.432  -6.460  1.00 0.00 ? 44 GLU A N    10 
ATOM 11503 C CA   . GLU A 1 44 ? -12.531 -7.113  -7.731  1.00 0.00 ? 44 GLU A CA   10 
ATOM 11504 C C    . GLU A 1 44 ? -14.042 -7.272  -7.505  1.00 0.00 ? 44 GLU A C    10 
ATOM 11505 O O    . GLU A 1 44 ? -14.844 -6.616  -8.140  1.00 0.00 ? 44 GLU A O    10 
ATOM 11506 C CB   . GLU A 1 44 ? -12.060 -8.045  -8.882  1.00 0.00 ? 44 GLU A CB   10 
ATOM 11507 C CG   . GLU A 1 44 ? -11.969 -7.256  -10.195 1.00 0.00 ? 44 GLU A CG   10 
ATOM 11508 C CD   . GLU A 1 44 ? -11.654 -8.215  -11.345 1.00 0.00 ? 44 GLU A CD   10 
ATOM 11509 O OE1  . GLU A 1 44 ? -10.956 -9.187  -11.105 1.00 0.00 ? 44 GLU A OE1  10 
ATOM 11510 O OE2  . GLU A 1 44 ? -12.114 -7.960  -12.445 1.00 0.00 ? 44 GLU A OE2  10 
ATOM 11511 H H    . GLU A 1 44 ? -11.381 -8.314  -6.327  1.00 0.00 ? 44 GLU A H    10 
ATOM 11512 H HA   . GLU A 1 44 ? -12.330 -6.082  -7.995  1.00 0.00 ? 44 GLU A HA   10 
ATOM 11513 H HB2  . GLU A 1 44 ? -11.087 -8.445  -8.643  1.00 0.00 ? 44 GLU A HB2  10 
ATOM 11514 H HB3  . GLU A 1 44 ? -12.761 -8.863  -9.013  1.00 0.00 ? 44 GLU A HB3  10 
ATOM 11515 H HG2  . GLU A 1 44 ? -12.912 -6.763  -10.385 1.00 0.00 ? 44 GLU A HG2  10 
ATOM 11516 H HG3  . GLU A 1 44 ? -11.185 -6.519  -10.118 1.00 0.00 ? 44 GLU A HG3  10 
ATOM 11517 N N    . ASP A 1 45 ? -14.438 -8.136  -6.610  1.00 0.00 ? 45 ASP A N    10 
ATOM 11518 C CA   . ASP A 1 45 ? -15.892 -8.328  -6.357  1.00 0.00 ? 45 ASP A CA   10 
ATOM 11519 C C    . ASP A 1 45 ? -16.495 -7.024  -5.831  1.00 0.00 ? 45 ASP A C    10 
ATOM 11520 O O    . ASP A 1 45 ? -17.346 -6.424  -6.458  1.00 0.00 ? 45 ASP A O    10 
ATOM 11521 C CB   . ASP A 1 45 ? -16.088 -9.434  -5.318  1.00 0.00 ? 45 ASP A CB   10 
ATOM 11522 C CG   . ASP A 1 45 ? -15.163 -9.187  -4.126  1.00 0.00 ? 45 ASP A CG   10 
ATOM 11523 O OD1  . ASP A 1 45 ? -13.972 -9.411  -4.267  1.00 0.00 ? 45 ASP A OD1  10 
ATOM 11524 O OD2  . ASP A 1 45 ? -15.660 -8.778  -3.089  1.00 0.00 ? 45 ASP A OD2  10 
ATOM 11525 H H    . ASP A 1 45 ? -13.780 -8.656  -6.108  1.00 0.00 ? 45 ASP A H    10 
ATOM 11526 H HA   . ASP A 1 45 ? -16.384 -8.606  -7.277  1.00 0.00 ? 45 ASP A HA   10 
ATOM 11527 H HB2  . ASP A 1 45 ? -17.115 -9.435  -4.983  1.00 0.00 ? 45 ASP A HB2  10 
ATOM 11528 H HB3  . ASP A 1 45 ? -15.852 -10.390 -5.762  1.00 0.00 ? 45 ASP A HB3  10 
ATOM 11529 N N    . GLY A 1 46 ? -16.070 -6.588  -4.678  1.00 0.00 ? 46 GLY A N    10 
ATOM 11530 C CA   . GLY A 1 46 ? -16.626 -5.332  -4.102  1.00 0.00 ? 46 GLY A CA   10 
ATOM 11531 C C    . GLY A 1 46 ? -16.171 -4.119  -4.916  1.00 0.00 ? 46 GLY A C    10 
ATOM 11532 O O    . GLY A 1 46 ? -15.302 -4.207  -5.761  1.00 0.00 ? 46 GLY A O    10 
ATOM 11533 H H    . GLY A 1 46 ? -15.392 -7.094  -4.183  1.00 0.00 ? 46 GLY A H    10 
ATOM 11534 H HA2  . GLY A 1 46 ? -17.706 -5.383  -4.111  1.00 0.00 ? 46 GLY A HA2  10 
ATOM 11535 H HA3  . GLY A 1 46 ? -16.284 -5.224  -3.084  1.00 0.00 ? 46 GLY A HA3  10 
ATOM 11536 N N    . SER A 1 47 ? -16.760 -2.985  -4.655  1.00 0.00 ? 47 SER A N    10 
ATOM 11537 C CA   . SER A 1 47 ? -16.379 -1.744  -5.393  1.00 0.00 ? 47 SER A CA   10 
ATOM 11538 C C    . SER A 1 47 ? -16.843 -0.517  -4.603  1.00 0.00 ? 47 SER A C    10 
ATOM 11539 O O    . SER A 1 47 ? -17.317 0.451   -5.162  1.00 0.00 ? 47 SER A O    10 
ATOM 11540 C CB   . SER A 1 47 ? -17.046 -1.746  -6.769  1.00 0.00 ? 47 SER A CB   10 
ATOM 11541 O OG   . SER A 1 47 ? -16.782 -0.510  -7.420  1.00 0.00 ? 47 SER A OG   10 
ATOM 11542 H H    . SER A 1 47 ? -17.454 -2.959  -3.962  1.00 0.00 ? 47 SER A H    10 
ATOM 11543 H HA   . SER A 1 47 ? -15.306 -1.712  -5.513  1.00 0.00 ? 47 SER A HA   10 
ATOM 11544 H HB2  . SER A 1 47 ? -16.647 -2.551  -7.363  1.00 0.00 ? 47 SER A HB2  10 
ATOM 11545 H HB3  . SER A 1 47 ? -18.113 -1.882  -6.652  1.00 0.00 ? 47 SER A HB3  10 
ATOM 11546 H HG   . SER A 1 47 ? -15.875 -0.528  -7.735  1.00 0.00 ? 47 SER A HG   10 
ATOM 11547 N N    . ASP A 1 48 ? -16.730 -0.565  -3.303  1.00 0.00 ? 48 ASP A N    10 
ATOM 11548 C CA   . ASP A 1 48 ? -17.179 0.573   -2.455  1.00 0.00 ? 48 ASP A CA   10 
ATOM 11549 C C    . ASP A 1 48 ? -16.277 0.616   -1.214  1.00 0.00 ? 48 ASP A C    10 
ATOM 11550 O O    . ASP A 1 48 ? -15.786 -0.405  -0.776  1.00 0.00 ? 48 ASP A O    10 
ATOM 11551 C CB   . ASP A 1 48 ? -18.650 0.328   -2.060  1.00 0.00 ? 48 ASP A CB   10 
ATOM 11552 C CG   . ASP A 1 48 ? -18.735 -0.804  -1.030  1.00 0.00 ? 48 ASP A CG   10 
ATOM 11553 O OD1  . ASP A 1 48 ? -18.637 -0.513  0.150   1.00 0.00 ? 48 ASP A OD1  10 
ATOM 11554 O OD2  . ASP A 1 48 ? -18.901 -1.942  -1.441  1.00 0.00 ? 48 ASP A OD2  10 
ATOM 11555 H H    . ASP A 1 48 ? -16.368 -1.363  -2.869  1.00 0.00 ? 48 ASP A H    10 
ATOM 11556 H HA   . ASP A 1 48 ? -17.095 1.502   -3.002  1.00 0.00 ? 48 ASP A HA   10 
ATOM 11557 H HB2  . ASP A 1 48 ? -19.080 1.226   -1.645  1.00 0.00 ? 48 ASP A HB2  10 
ATOM 11558 H HB3  . ASP A 1 48 ? -19.209 0.044   -2.941  1.00 0.00 ? 48 ASP A HB3  10 
ATOM 11559 N N    . CYS A 1 49 ? -16.077 1.760   -0.608  1.00 0.00 ? 49 CYS A N    10 
ATOM 11560 C CA   . CYS A 1 49 ? -15.240 1.795   0.625   1.00 0.00 ? 49 CYS A CA   10 
ATOM 11561 C C    . CYS A 1 49 ? -15.679 2.951   1.513   1.00 0.00 ? 49 CYS A C    10 
ATOM 11562 O O    . CYS A 1 49 ? -15.881 4.057   1.054   1.00 0.00 ? 49 CYS A O    10 
ATOM 11563 C CB   . CYS A 1 49 ? -13.775 1.984   0.243   1.00 0.00 ? 49 CYS A CB   10 
ATOM 11564 S SG   . CYS A 1 49 ? -13.192 0.513   -0.640  1.00 0.00 ? 49 CYS A SG   10 
ATOM 11565 H H    . CYS A 1 49 ? -16.531 2.573   -0.915  1.00 0.00 ? 49 CYS A H    10 
ATOM 11566 H HA   . CYS A 1 49 ? -15.351 0.867   1.168   1.00 0.00 ? 49 CYS A HA   10 
ATOM 11567 H HB2  . CYS A 1 49 ? -13.697 2.851   -0.381  1.00 0.00 ? 49 CYS A HB2  10 
ATOM 11568 H HB3  . CYS A 1 49 ? -13.173 2.131   1.127   1.00 0.00 ? 49 CYS A HB3  10 
ATOM 11569 N N    . GLY A 1 50 ? -15.760 2.724   2.789   1.00 0.00 ? 50 GLY A N    10 
ATOM 11570 C CA   . GLY A 1 50 ? -16.108 3.824   3.731   1.00 0.00 ? 50 GLY A CA   10 
ATOM 11571 C C    . GLY A 1 50 ? -14.786 4.307   4.309   1.00 0.00 ? 50 GLY A C    10 
ATOM 11572 O O    . GLY A 1 50 ? -14.491 4.093   5.466   1.00 0.00 ? 50 GLY A O    10 
ATOM 11573 H H    . GLY A 1 50 ? -15.546 1.837   3.137   1.00 0.00 ? 50 GLY A H    10 
ATOM 11574 H HA2  . GLY A 1 50 ? -16.610 4.632   3.210   1.00 0.00 ? 50 GLY A HA2  10 
ATOM 11575 H HA3  . GLY A 1 50 ? -16.735 3.451   4.528   1.00 0.00 ? 50 GLY A HA3  10 
ATOM 11576 N N    . ASP A 1 51 ? -13.975 4.941   3.495   1.00 0.00 ? 51 ASP A N    10 
ATOM 11577 C CA   . ASP A 1 51 ? -12.644 5.431   3.953   1.00 0.00 ? 51 ASP A CA   10 
ATOM 11578 C C    . ASP A 1 51 ? -11.783 5.691   2.702   1.00 0.00 ? 51 ASP A C    10 
ATOM 11579 O O    . ASP A 1 51 ? -11.020 6.636   2.657   1.00 0.00 ? 51 ASP A O    10 
ATOM 11580 C CB   . ASP A 1 51 ? -11.957 4.369   4.851   1.00 0.00 ? 51 ASP A CB   10 
ATOM 11581 C CG   . ASP A 1 51 ? -12.145 4.719   6.335   1.00 0.00 ? 51 ASP A CG   10 
ATOM 11582 O OD1  . ASP A 1 51 ? -11.697 5.781   6.735   1.00 0.00 ? 51 ASP A OD1  10 
ATOM 11583 O OD2  . ASP A 1 51 ? -12.732 3.917   7.042   1.00 0.00 ? 51 ASP A OD2  10 
ATOM 11584 H H    . ASP A 1 51 ? -14.232 5.112   2.565   1.00 0.00 ? 51 ASP A H    10 
ATOM 11585 H HA   . ASP A 1 51 ? -12.769 6.358   4.497   1.00 0.00 ? 51 ASP A HA   10 
ATOM 11586 H HB2  . ASP A 1 51 ? -12.388 3.399   4.657   1.00 0.00 ? 51 ASP A HB2  10 
ATOM 11587 H HB3  . ASP A 1 51 ? -10.897 4.333   4.633   1.00 0.00 ? 51 ASP A HB3  10 
ATOM 11588 N N    . ALA A 1 52 ? -11.900 4.864   1.684   1.00 0.00 ? 52 ALA A N    10 
ATOM 11589 C CA   . ALA A 1 52 ? -11.080 5.084   0.452   1.00 0.00 ? 52 ALA A CA   10 
ATOM 11590 C C    . ALA A 1 52 ? -11.434 4.054   -0.635  1.00 0.00 ? 52 ALA A C    10 
ATOM 11591 O O    . ALA A 1 52 ? -10.936 2.945   -0.640  1.00 0.00 ? 52 ALA A O    10 
ATOM 11592 C CB   . ALA A 1 52 ? -9.594  4.954   0.802   1.00 0.00 ? 52 ALA A CB   10 
ATOM 11593 H H    . ALA A 1 52 ? -12.522 4.107   1.730   1.00 0.00 ? 52 ALA A H    10 
ATOM 11594 H HA   . ALA A 1 52 ? -11.269 6.078   0.074   1.00 0.00 ? 52 ALA A HA   10 
ATOM 11595 H HB1  . ALA A 1 52 ? -9.017  4.837   -0.104  1.00 0.00 ? 52 ALA A HB1  10 
ATOM 11596 H HB2  . ALA A 1 52 ? -9.448  4.092   1.437   1.00 0.00 ? 52 ALA A HB2  10 
ATOM 11597 H HB3  . ALA A 1 52 ? -9.267  5.842   1.321   1.00 0.00 ? 52 ALA A HB3  10 
ATOM 11598 N N    . ASP A 1 53 ? -12.272 4.428   -1.571  1.00 0.00 ? 53 ASP A N    10 
ATOM 11599 C CA   . ASP A 1 53 ? -12.646 3.492   -2.693  1.00 0.00 ? 53 ASP A CA   10 
ATOM 11600 C C    . ASP A 1 53 ? -11.496 3.398   -3.698  1.00 0.00 ? 53 ASP A C    10 
ATOM 11601 O O    . ASP A 1 53 ? -10.740 4.330   -3.889  1.00 0.00 ? 53 ASP A O    10 
ATOM 11602 C CB   . ASP A 1 53 ? -13.937 3.984   -3.403  1.00 0.00 ? 53 ASP A CB   10 
ATOM 11603 C CG   . ASP A 1 53 ? -14.689 4.962   -2.497  1.00 0.00 ? 53 ASP A CG   10 
ATOM 11604 O OD1  . ASP A 1 53 ? -14.360 6.137   -2.522  1.00 0.00 ? 53 ASP A OD1  10 
ATOM 11605 O OD2  . ASP A 1 53 ? -15.582 4.520   -1.794  1.00 0.00 ? 53 ASP A OD2  10 
ATOM 11606 H H    . ASP A 1 53 ? -12.638 5.334   -1.549  1.00 0.00 ? 53 ASP A H    10 
ATOM 11607 H HA   . ASP A 1 53 ? -12.812 2.509   -2.301  1.00 0.00 ? 53 ASP A HA   10 
ATOM 11608 H HB2  . ASP A 1 53 ? -13.688 4.481   -4.336  1.00 0.00 ? 53 ASP A HB2  10 
ATOM 11609 H HB3  . ASP A 1 53 ? -14.578 3.138   -3.617  1.00 0.00 ? 53 ASP A HB3  10 
ATOM 11610 N N    . PHE A 1 54 ? -11.362 2.264   -4.337  1.00 0.00 ? 54 PHE A N    10 
ATOM 11611 C CA   . PHE A 1 54 ? -10.267 2.085   -5.333  1.00 0.00 ? 54 PHE A CA   10 
ATOM 11612 C C    . PHE A 1 54 ? -8.925  2.462   -4.697  1.00 0.00 ? 54 PHE A C    10 
ATOM 11613 O O    . PHE A 1 54 ? -8.224  1.624   -4.168  1.00 0.00 ? 54 PHE A O    10 
ATOM 11614 C CB   . PHE A 1 54 ? -10.528 2.977   -6.549  1.00 0.00 ? 54 PHE A CB   10 
ATOM 11615 C CG   . PHE A 1 54 ? -11.659 2.394   -7.369  1.00 0.00 ? 54 PHE A CG   10 
ATOM 11616 C CD1  . PHE A 1 54 ? -12.960 2.384   -6.853  1.00 0.00 ? 54 PHE A CD1  10 
ATOM 11617 C CD2  . PHE A 1 54 ? -11.408 1.865   -8.643  1.00 0.00 ? 54 PHE A CD2  10 
ATOM 11618 C CE1  . PHE A 1 54 ? -14.009 1.845   -7.608  1.00 0.00 ? 54 PHE A CE1  10 
ATOM 11619 C CE2  . PHE A 1 54 ? -12.458 1.327   -9.397  1.00 0.00 ? 54 PHE A CE2  10 
ATOM 11620 C CZ   . PHE A 1 54 ? -13.759 1.317   -8.879  1.00 0.00 ? 54 PHE A CZ   10 
ATOM 11621 H H    . PHE A 1 54 ? -11.990 1.524   -4.159  1.00 0.00 ? 54 PHE A H    10 
ATOM 11622 H HA   . PHE A 1 54 ? -10.234 1.052   -5.647  1.00 0.00 ? 54 PHE A HA   10 
ATOM 11623 H HB2  . PHE A 1 54 ? -10.798 3.969   -6.217  1.00 0.00 ? 54 PHE A HB2  10 
ATOM 11624 H HB3  . PHE A 1 54 ? -9.634  3.032   -7.153  1.00 0.00 ? 54 PHE A HB3  10 
ATOM 11625 H HD1  . PHE A 1 54 ? -13.154 2.790   -5.872  1.00 0.00 ? 54 PHE A HD1  10 
ATOM 11626 H HD2  . PHE A 1 54 ? -10.404 1.873   -9.043  1.00 0.00 ? 54 PHE A HD2  10 
ATOM 11627 H HE1  . PHE A 1 54 ? -15.012 1.838   -7.209  1.00 0.00 ? 54 PHE A HE1  10 
ATOM 11628 H HE2  . PHE A 1 54 ? -12.264 0.920   -10.379 1.00 0.00 ? 54 PHE A HE2  10 
ATOM 11629 H HZ   . PHE A 1 54 ? -14.568 0.902   -9.462  1.00 0.00 ? 54 PHE A HZ   10 
ATOM 11630 N N    . ASP A 1 55 ? -8.562  3.717   -4.749  1.00 0.00 ? 55 ASP A N    10 
ATOM 11631 C CA   . ASP A 1 55 ? -7.264  4.152   -4.151  1.00 0.00 ? 55 ASP A CA   10 
ATOM 11632 C C    . ASP A 1 55 ? -6.109  3.430   -4.851  1.00 0.00 ? 55 ASP A C    10 
ATOM 11633 O O    . ASP A 1 55 ? -6.230  2.291   -5.257  1.00 0.00 ? 55 ASP A O    10 
ATOM 11634 C CB   . ASP A 1 55 ? -7.248  3.821   -2.652  1.00 0.00 ? 55 ASP A CB   10 
ATOM 11635 C CG   . ASP A 1 55 ? -6.153  4.636   -1.959  1.00 0.00 ? 55 ASP A CG   10 
ATOM 11636 O OD1  . ASP A 1 55 ? -5.172  4.950   -2.614  1.00 0.00 ? 55 ASP A OD1  10 
ATOM 11637 O OD2  . ASP A 1 55 ? -6.313  4.931   -0.787  1.00 0.00 ? 55 ASP A OD2  10 
ATOM 11638 H H    . ASP A 1 55 ? -9.144  4.375   -5.185  1.00 0.00 ? 55 ASP A H    10 
ATOM 11639 H HA   . ASP A 1 55 ? -7.152  5.218   -4.285  1.00 0.00 ? 55 ASP A HA   10 
ATOM 11640 H HB2  . ASP A 1 55 ? -8.206  4.068   -2.219  1.00 0.00 ? 55 ASP A HB2  10 
ATOM 11641 H HB3  . ASP A 1 55 ? -7.050  2.770   -2.513  1.00 0.00 ? 55 ASP A HB3  10 
ATOM 11642 N N    . TRP A 1 56 ? -4.986  4.088   -4.995  1.00 0.00 ? 56 TRP A N    10 
ATOM 11643 C CA   . TRP A 1 56 ? -3.815  3.449   -5.671  1.00 0.00 ? 56 TRP A CA   10 
ATOM 11644 C C    . TRP A 1 56 ? -2.859  2.881   -4.618  1.00 0.00 ? 56 TRP A C    10 
ATOM 11645 O O    . TRP A 1 56 ? -2.876  1.704   -4.323  1.00 0.00 ? 56 TRP A O    10 
ATOM 11646 C CB   . TRP A 1 56 ? -3.078  4.499   -6.507  1.00 0.00 ? 56 TRP A CB   10 
ATOM 11647 C CG   . TRP A 1 56 ? -3.950  4.935   -7.640  1.00 0.00 ? 56 TRP A CG   10 
ATOM 11648 C CD1  . TRP A 1 56 ? -4.602  6.119   -7.707  1.00 0.00 ? 56 TRP A CD1  10 
ATOM 11649 C CD2  . TRP A 1 56 ? -4.276  4.217   -8.865  1.00 0.00 ? 56 TRP A CD2  10 
ATOM 11650 N NE1  . TRP A 1 56 ? -5.308  6.173   -8.895  1.00 0.00 ? 56 TRP A NE1  10 
ATOM 11651 C CE2  . TRP A 1 56 ? -5.140  5.024   -9.643  1.00 0.00 ? 56 TRP A CE2  10 
ATOM 11652 C CE3  . TRP A 1 56 ? -3.911  2.957   -9.373  1.00 0.00 ? 56 TRP A CE3  10 
ATOM 11653 C CZ2  . TRP A 1 56 ? -5.623  4.598   -10.881 1.00 0.00 ? 56 TRP A CZ2  10 
ATOM 11654 C CZ3  . TRP A 1 56 ? -4.397  2.523   -10.617 1.00 0.00 ? 56 TRP A CZ3  10 
ATOM 11655 C CH2  . TRP A 1 56 ? -5.251  3.342   -11.370 1.00 0.00 ? 56 TRP A CH2  10 
ATOM 11656 H H    . TRP A 1 56 ? -4.914  5.007   -4.660  1.00 0.00 ? 56 TRP A H    10 
ATOM 11657 H HA   . TRP A 1 56 ? -4.150  2.650   -6.317  1.00 0.00 ? 56 TRP A HA   10 
ATOM 11658 H HB2  . TRP A 1 56 ? -2.840  5.351   -5.887  1.00 0.00 ? 56 TRP A HB2  10 
ATOM 11659 H HB3  . TRP A 1 56 ? -2.166  4.072   -6.898  1.00 0.00 ? 56 TRP A HB3  10 
ATOM 11660 H HD1  . TRP A 1 56 ? -4.576  6.894   -6.955  1.00 0.00 ? 56 TRP A HD1  10 
ATOM 11661 H HE1  . TRP A 1 56 ? -5.865  6.925   -9.188  1.00 0.00 ? 56 TRP A HE1  10 
ATOM 11662 H HE3  . TRP A 1 56 ? -3.253  2.319   -8.802  1.00 0.00 ? 56 TRP A HE3  10 
ATOM 11663 H HZ2  . TRP A 1 56 ? -6.282  5.231   -11.456 1.00 0.00 ? 56 TRP A HZ2  10 
ATOM 11664 H HZ3  . TRP A 1 56 ? -4.110  1.554   -10.997 1.00 0.00 ? 56 TRP A HZ3  10 
ATOM 11665 H HH2  . TRP A 1 56 ? -5.621  3.003   -12.326 1.00 0.00 ? 56 TRP A HH2  10 
ATOM 11666 N N    . HIS A 1 57 ? -2.023  3.716   -4.060  1.00 0.00 ? 57 HIS A N    10 
ATOM 11667 C CA   . HIS A 1 57 ? -1.051  3.251   -3.026  1.00 0.00 ? 57 HIS A CA   10 
ATOM 11668 C C    . HIS A 1 57 ? -0.012  2.333   -3.677  1.00 0.00 ? 57 HIS A C    10 
ATOM 11669 O O    . HIS A 1 57 ? -0.214  1.142   -3.805  1.00 0.00 ? 57 HIS A O    10 
ATOM 11670 C CB   . HIS A 1 57 ? -1.792  2.497   -1.908  1.00 0.00 ? 57 HIS A CB   10 
ATOM 11671 C CG   . HIS A 1 57 ? -0.965  2.511   -0.648  1.00 0.00 ? 57 HIS A CG   10 
ATOM 11672 N ND1  . HIS A 1 57 ? -1.489  2.898   0.575   1.00 0.00 ? 57 HIS A ND1  10 
ATOM 11673 C CD2  . HIS A 1 57 ? 0.348   2.190   -0.410  1.00 0.00 ? 57 HIS A CD2  10 
ATOM 11674 C CE1  . HIS A 1 57 ? -0.504  2.799   1.487   1.00 0.00 ? 57 HIS A CE1  10 
ATOM 11675 N NE2  . HIS A 1 57 ? 0.637   2.373   0.940   1.00 0.00 ? 57 HIS A NE2  10 
ATOM 11676 H H    . HIS A 1 57 ? -2.033  4.657   -4.329  1.00 0.00 ? 57 HIS A H    10 
ATOM 11677 H HA   . HIS A 1 57 ? -0.548  4.114   -2.609  1.00 0.00 ? 57 HIS A HA   10 
ATOM 11678 H HB2  . HIS A 1 57 ? -2.740  2.979   -1.719  1.00 0.00 ? 57 HIS A HB2  10 
ATOM 11679 H HB3  . HIS A 1 57 ? -1.963  1.475   -2.207  1.00 0.00 ? 57 HIS A HB3  10 
ATOM 11680 H HD1  . HIS A 1 57 ? -2.409  3.189   0.745   1.00 0.00 ? 57 HIS A HD1  10 
ATOM 11681 H HD2  . HIS A 1 57 ? 1.050   1.848   -1.154  1.00 0.00 ? 57 HIS A HD2  10 
ATOM 11682 H HE1  . HIS A 1 57 ? -0.622  3.037   2.534   1.00 0.00 ? 57 HIS A HE1  10 
ATOM 11683 N N    . HIS A 1 58 ? 1.097   2.883   -4.090  1.00 0.00 ? 58 HIS A N    10 
ATOM 11684 C CA   . HIS A 1 58 ? 2.152   2.051   -4.735  1.00 0.00 ? 58 HIS A CA   10 
ATOM 11685 C C    . HIS A 1 58 ? 3.415   2.896   -4.917  1.00 0.00 ? 58 HIS A C    10 
ATOM 11686 O O    . HIS A 1 58 ? 3.377   3.963   -5.495  1.00 0.00 ? 58 HIS A O    10 
ATOM 11687 C CB   . HIS A 1 58 ? 1.654   1.575   -6.101  1.00 0.00 ? 58 HIS A CB   10 
ATOM 11688 C CG   . HIS A 1 58 ? 2.659   0.633   -6.703  1.00 0.00 ? 58 HIS A CG   10 
ATOM 11689 N ND1  . HIS A 1 58 ? 2.413   -0.724  -6.836  1.00 0.00 ? 58 HIS A ND1  10 
ATOM 11690 C CD2  . HIS A 1 58 ? 3.916   0.838   -7.216  1.00 0.00 ? 58 HIS A CD2  10 
ATOM 11691 C CE1  . HIS A 1 58 ? 3.496   -1.280  -7.408  1.00 0.00 ? 58 HIS A CE1  10 
ATOM 11692 N NE2  . HIS A 1 58 ? 4.443   -0.371  -7.660  1.00 0.00 ? 58 HIS A NE2  10 
ATOM 11693 H H    . HIS A 1 58 ? 1.237   3.846   -3.977  1.00 0.00 ? 58 HIS A H    10 
ATOM 11694 H HA   . HIS A 1 58 ? 2.373   1.198   -4.112  1.00 0.00 ? 58 HIS A HA   10 
ATOM 11695 H HB2  . HIS A 1 58 ? 0.709   1.065   -5.981  1.00 0.00 ? 58 HIS A HB2  10 
ATOM 11696 H HB3  . HIS A 1 58 ? 1.524   2.426   -6.754  1.00 0.00 ? 58 HIS A HB3  10 
ATOM 11697 H HD1  . HIS A 1 58 ? 1.597   -1.194  -6.563  1.00 0.00 ? 58 HIS A HD1  10 
ATOM 11698 H HD2  . HIS A 1 58 ? 4.419   1.792   -7.267  1.00 0.00 ? 58 HIS A HD2  10 
ATOM 11699 H HE1  . HIS A 1 58 ? 3.589   -2.331  -7.635  1.00 0.00 ? 58 HIS A HE1  10 
ATOM 11700 N N    . THR A 1 59 ? 4.534   2.433   -4.425  1.00 0.00 ? 59 THR A N    10 
ATOM 11701 C CA   . THR A 1 59 ? 5.795   3.221   -4.569  1.00 0.00 ? 59 THR A CA   10 
ATOM 11702 C C    . THR A 1 59 ? 6.999   2.274   -4.548  1.00 0.00 ? 59 THR A C    10 
ATOM 11703 O O    . THR A 1 59 ? 7.180   1.510   -3.622  1.00 0.00 ? 59 THR A O    10 
ATOM 11704 C CB   . THR A 1 59 ? 5.915   4.209   -3.402  1.00 0.00 ? 59 THR A CB   10 
ATOM 11705 O OG1  . THR A 1 59 ? 5.822   3.499   -2.174  1.00 0.00 ? 59 THR A OG1  10 
ATOM 11706 C CG2  . THR A 1 59 ? 4.793   5.247   -3.478  1.00 0.00 ? 59 THR A CG2  10 
ATOM 11707 H H    . THR A 1 59 ? 4.545   1.570   -3.959  1.00 0.00 ? 59 THR A H    10 
ATOM 11708 H HA   . THR A 1 59 ? 5.782   3.766   -5.502  1.00 0.00 ? 59 THR A HA   10 
ATOM 11709 H HB   . THR A 1 59 ? 6.868   4.712   -3.454  1.00 0.00 ? 59 THR A HB   10 
ATOM 11710 H HG1  . THR A 1 59 ? 5.622   2.582   -2.376  1.00 0.00 ? 59 THR A HG1  10 
ATOM 11711 H HG21 . THR A 1 59 ? 5.020   6.070   -2.816  1.00 0.00 ? 59 THR A HG21 10 
ATOM 11712 H HG22 . THR A 1 59 ? 3.860   4.794   -3.180  1.00 0.00 ? 59 THR A HG22 10 
ATOM 11713 H HG23 . THR A 1 59 ? 4.709   5.614   -4.489  1.00 0.00 ? 59 THR A HG23 10 
ATOM 11714 N N    . PHE A 1 60 ? 7.831   2.327   -5.560  1.00 0.00 ? 60 PHE A N    10 
ATOM 11715 C CA   . PHE A 1 60 ? 9.038   1.435   -5.599  1.00 0.00 ? 60 PHE A CA   10 
ATOM 11716 C C    . PHE A 1 60 ? 10.250  2.236   -5.071  1.00 0.00 ? 60 PHE A C    10 
ATOM 11717 O O    . PHE A 1 60 ? 10.243  3.450   -5.138  1.00 0.00 ? 60 PHE A O    10 
ATOM 11718 C CB   . PHE A 1 60 ? 9.297   0.978   -7.060  1.00 0.00 ? 60 PHE A CB   10 
ATOM 11719 C CG   . PHE A 1 60 ? 8.803   -0.442  -7.271  1.00 0.00 ? 60 PHE A CG   10 
ATOM 11720 C CD1  . PHE A 1 60 ? 7.433   -0.723  -7.204  1.00 0.00 ? 60 PHE A CD1  10 
ATOM 11721 C CD2  . PHE A 1 60 ? 9.717   -1.474  -7.533  1.00 0.00 ? 60 PHE A CD2  10 
ATOM 11722 C CE1  . PHE A 1 60 ? 6.976   -2.032  -7.399  1.00 0.00 ? 60 PHE A CE1  10 
ATOM 11723 C CE2  . PHE A 1 60 ? 9.258   -2.782  -7.728  1.00 0.00 ? 60 PHE A CE2  10 
ATOM 11724 C CZ   . PHE A 1 60 ? 7.889   -3.060  -7.661  1.00 0.00 ? 60 PHE A CZ   10 
ATOM 11725 H H    . PHE A 1 60 ? 7.668   2.959   -6.291  1.00 0.00 ? 60 PHE A H    10 
ATOM 11726 H HA   . PHE A 1 60 ? 8.859   0.578   -4.969  1.00 0.00 ? 60 PHE A HA   10 
ATOM 11727 H HB2  . PHE A 1 60 ? 8.774   1.636   -7.736  1.00 0.00 ? 60 PHE A HB2  10 
ATOM 11728 H HB3  . PHE A 1 60 ? 10.357  1.022   -7.278  1.00 0.00 ? 60 PHE A HB3  10 
ATOM 11729 H HD1  . PHE A 1 60 ? 6.728   0.071   -7.002  1.00 0.00 ? 60 PHE A HD1  10 
ATOM 11730 H HD2  . PHE A 1 60 ? 10.773  -1.260  -7.586  1.00 0.00 ? 60 PHE A HD2  10 
ATOM 11731 H HE1  . PHE A 1 60 ? 5.921   -2.248  -7.347  1.00 0.00 ? 60 PHE A HE1  10 
ATOM 11732 H HE2  . PHE A 1 60 ? 9.962   -3.576  -7.930  1.00 0.00 ? 60 PHE A HE2  10 
ATOM 11733 H HZ   . PHE A 1 60 ? 7.537   -4.071  -7.811  1.00 0.00 ? 60 PHE A HZ   10 
ATOM 11734 N N    . PRO A 1 61 ? 11.263  1.553   -4.570  1.00 0.00 ? 61 PRO A N    10 
ATOM 11735 C CA   . PRO A 1 61 ? 12.467  2.235   -4.050  1.00 0.00 ? 61 PRO A CA   10 
ATOM 11736 C C    . PRO A 1 61 ? 13.169  2.994   -5.189  1.00 0.00 ? 61 PRO A C    10 
ATOM 11737 O O    . PRO A 1 61 ? 13.423  4.179   -5.097  1.00 0.00 ? 61 PRO A O    10 
ATOM 11738 C CB   . PRO A 1 61 ? 13.363  1.098   -3.505  1.00 0.00 ? 61 PRO A CB   10 
ATOM 11739 C CG   . PRO A 1 61 ? 12.716  -0.247  -3.941  1.00 0.00 ? 61 PRO A CG   10 
ATOM 11740 C CD   . PRO A 1 61 ? 11.303  0.076   -4.473  1.00 0.00 ? 61 PRO A CD   10 
ATOM 11741 H HA   . PRO A 1 61 ? 12.200  2.915   -3.255  1.00 0.00 ? 61 PRO A HA   10 
ATOM 11742 H HB2  . PRO A 1 61 ? 14.367  1.178   -3.907  1.00 0.00 ? 61 PRO A HB2  10 
ATOM 11743 H HB3  . PRO A 1 61 ? 13.403  1.146   -2.425  1.00 0.00 ? 61 PRO A HB3  10 
ATOM 11744 H HG2  . PRO A 1 61 ? 13.312  -0.705  -4.721  1.00 0.00 ? 61 PRO A HG2  10 
ATOM 11745 H HG3  . PRO A 1 61 ? 12.645  -0.918  -3.094  1.00 0.00 ? 61 PRO A HG3  10 
ATOM 11746 H HD2  . PRO A 1 61 ? 11.150  -0.373  -5.446  1.00 0.00 ? 61 PRO A HD2  10 
ATOM 11747 H HD3  . PRO A 1 61 ? 10.557  -0.271  -3.774  1.00 0.00 ? 61 PRO A HD3  10 
ATOM 11748 N N    . SER A 1 62 ? 13.495  2.310   -6.252  1.00 0.00 ? 62 SER A N    10 
ATOM 11749 C CA   . SER A 1 62 ? 14.194  2.976   -7.389  1.00 0.00 ? 62 SER A CA   10 
ATOM 11750 C C    . SER A 1 62 ? 13.431  4.236   -7.812  1.00 0.00 ? 62 SER A C    10 
ATOM 11751 O O    . SER A 1 62 ? 13.973  5.323   -7.816  1.00 0.00 ? 62 SER A O    10 
ATOM 11752 C CB   . SER A 1 62 ? 14.286  2.002   -8.573  1.00 0.00 ? 62 SER A CB   10 
ATOM 11753 O OG   . SER A 1 62 ? 14.219  2.731   -9.792  1.00 0.00 ? 62 SER A OG   10 
ATOM 11754 H H    . SER A 1 62 ? 13.290  1.352   -6.299  1.00 0.00 ? 62 SER A H    10 
ATOM 11755 H HA   . SER A 1 62 ? 15.191  3.256   -7.077  1.00 0.00 ? 62 SER A HA   10 
ATOM 11756 H HB2  . SER A 1 62 ? 15.220  1.466   -8.534  1.00 0.00 ? 62 SER A HB2  10 
ATOM 11757 H HB3  . SER A 1 62 ? 13.469  1.295   -8.519  1.00 0.00 ? 62 SER A HB3  10 
ATOM 11758 H HG   . SER A 1 62 ? 14.923  3.383   -9.787  1.00 0.00 ? 62 SER A HG   10 
ATOM 11759 N N    . ARG A 1 63 ? 12.184  4.105   -8.176  1.00 0.00 ? 63 ARG A N    10 
ATOM 11760 C CA   . ARG A 1 63 ? 11.411  5.306   -8.603  1.00 0.00 ? 63 ARG A CA   10 
ATOM 11761 C C    . ARG A 1 63 ? 9.930   4.946   -8.741  1.00 0.00 ? 63 ARG A C    10 
ATOM 11762 O O    . ARG A 1 63 ? 9.555   4.118   -9.548  1.00 0.00 ? 63 ARG A O    10 
ATOM 11763 C CB   . ARG A 1 63 ? 11.946  5.798   -9.952  1.00 0.00 ? 63 ARG A CB   10 
ATOM 11764 C CG   . ARG A 1 63 ? 11.207  7.079   -10.369 1.00 0.00 ? 63 ARG A CG   10 
ATOM 11765 C CD   . ARG A 1 63 ? 11.797  7.636   -11.685 1.00 0.00 ? 63 ARG A CD   10 
ATOM 11766 N NE   . ARG A 1 63 ? 11.970  9.121   -11.579 1.00 0.00 ? 63 ARG A NE   10 
ATOM 11767 C CZ   . ARG A 1 63 ? 11.013  9.887   -11.121 1.00 0.00 ? 63 ARG A CZ   10 
ATOM 11768 N NH1  . ARG A 1 63 ? 9.839   9.387   -10.848 1.00 0.00 ? 63 ARG A NH1  10 
ATOM 11769 N NH2  . ARG A 1 63 ? 11.224  11.165  -10.969 1.00 0.00 ? 63 ARG A NH2  10 
ATOM 11770 H H    . ARG A 1 63 ? 11.758  3.223   -8.174  1.00 0.00 ? 63 ARG A H    10 
ATOM 11771 H HA   . ARG A 1 63 ? 11.523  6.087   -7.866  1.00 0.00 ? 63 ARG A HA   10 
ATOM 11772 H HB2  . ARG A 1 63 ? 13.003  6.005   -9.864  1.00 0.00 ? 63 ARG A HB2  10 
ATOM 11773 H HB3  . ARG A 1 63 ? 11.789  5.035   -10.699 1.00 0.00 ? 63 ARG A HB3  10 
ATOM 11774 H HG2  . ARG A 1 63 ? 10.159  6.850   -10.507 1.00 0.00 ? 63 ARG A HG2  10 
ATOM 11775 H HG3  . ARG A 1 63 ? 11.311  7.818   -9.589  1.00 0.00 ? 63 ARG A HG3  10 
ATOM 11776 H HD2  . ARG A 1 63 ? 12.768  7.205   -11.868 1.00 0.00 ? 63 ARG A HD2  10 
ATOM 11777 H HD3  . ARG A 1 63 ? 11.140  7.386   -12.514 1.00 0.00 ? 63 ARG A HD3  10 
ATOM 11778 H HE   . ARG A 1 63 ? 12.828  9.523   -11.830 1.00 0.00 ? 63 ARG A HE   10 
ATOM 11779 H HH11 . ARG A 1 63 ? 9.663   8.417   -10.990 1.00 0.00 ? 63 ARG A HH11 10 
ATOM 11780 H HH12 . ARG A 1 63 ? 9.115   9.980   -10.495 1.00 0.00 ? 63 ARG A HH12 10 
ATOM 11781 H HH21 . ARG A 1 63 ? 12.114  11.556  -11.202 1.00 0.00 ? 63 ARG A HH21 10 
ATOM 11782 H HH22 . ARG A 1 63 ? 10.495  11.754  -10.620 1.00 0.00 ? 63 ARG A HH22 10 
ATOM 11783 N N    . GLY A 1 64 ? 9.087   5.565   -7.962  1.00 0.00 ? 64 GLY A N    10 
ATOM 11784 C CA   . GLY A 1 64 ? 7.630   5.265   -8.046  1.00 0.00 ? 64 GLY A CA   10 
ATOM 11785 C C    . GLY A 1 64 ? 6.856   6.295   -7.224  1.00 0.00 ? 64 GLY A C    10 
ATOM 11786 O O    . GLY A 1 64 ? 6.228   5.970   -6.238  1.00 0.00 ? 64 GLY A O    10 
ATOM 11787 H H    . GLY A 1 64 ? 9.412   6.230   -7.320  1.00 0.00 ? 64 GLY A H    10 
ATOM 11788 H HA2  . GLY A 1 64 ? 7.312   5.310   -9.079  1.00 0.00 ? 64 GLY A HA2  10 
ATOM 11789 H HA3  . GLY A 1 64 ? 7.440   4.278   -7.654  1.00 0.00 ? 64 GLY A HA3  10 
ATOM 11790 N N    . ASN A 1 65 ? 6.901   7.539   -7.619  1.00 0.00 ? 65 ASN A N    10 
ATOM 11791 C CA   . ASN A 1 65 ? 6.172   8.591   -6.855  1.00 0.00 ? 65 ASN A CA   10 
ATOM 11792 C C    . ASN A 1 65 ? 4.691   8.577   -7.241  1.00 0.00 ? 65 ASN A C    10 
ATOM 11793 O O    . ASN A 1 65 ? 4.135   9.584   -7.632  1.00 0.00 ? 65 ASN A O    10 
ATOM 11794 C CB   . ASN A 1 65 ? 6.772   9.962   -7.176  1.00 0.00 ? 65 ASN A CB   10 
ATOM 11795 C CG   . ASN A 1 65 ? 6.773   10.176  -8.691  1.00 0.00 ? 65 ASN A CG   10 
ATOM 11796 O OD1  . ASN A 1 65 ? 6.398   9.297   -9.441  1.00 0.00 ? 65 ASN A OD1  10 
ATOM 11797 N ND2  . ASN A 1 65 ? 7.183   11.316  -9.175  1.00 0.00 ? 65 ASN A ND2  10 
ATOM 11798 H H    . ASN A 1 65 ? 7.418   7.781   -8.416  1.00 0.00 ? 65 ASN A H    10 
ATOM 11799 H HA   . ASN A 1 65 ? 6.268   8.397   -5.796  1.00 0.00 ? 65 ASN A HA   10 
ATOM 11800 H HB2  . ASN A 1 65 ? 6.180   10.732  -6.704  1.00 0.00 ? 65 ASN A HB2  10 
ATOM 11801 H HB3  . ASN A 1 65 ? 7.785   10.008  -6.808  1.00 0.00 ? 65 ASN A HB3  10 
ATOM 11802 H HD21 . ASN A 1 65 ? 7.486   12.025  -8.570  1.00 0.00 ? 65 ASN A HD21 10 
ATOM 11803 H HD22 . ASN A 1 65 ? 7.189   11.463  -10.144 1.00 0.00 ? 65 ASN A HD22 10 
ATOM 11804 N N    . LEU A 1 66 ? 4.048   7.447   -7.130  1.00 0.00 ? 66 LEU A N    10 
ATOM 11805 C CA   . LEU A 1 66 ? 2.602   7.376   -7.487  1.00 0.00 ? 66 LEU A CA   10 
ATOM 11806 C C    . LEU A 1 66 ? 1.772   7.946   -6.333  1.00 0.00 ? 66 LEU A C    10 
ATOM 11807 O O    . LEU A 1 66 ? 0.641   7.560   -6.116  1.00 0.00 ? 66 LEU A O    10 
ATOM 11808 C CB