data_2JP0
# 
_entry.id   2JP0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JP0         
RCSB  RCSB100108   
WWPDB D_1000100108 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
15189 BMRB 'chemical shift assignments'                    unspecified 
2JOP  PDB  'solution structure calculated using Xplor-NIH' unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JP0 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-04-16 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garza-Garcia, A.' 1 
'Harris, R.'       2 
'Esposito, D.'     3 
'Driscoll, P.C.'   4 
'Rieping, W.'      5 
# 
_citation.id                        primary 
_citation.title                     
;Three-dimensional solution structure and conformational plasticity of the N-terminal scavenger receptor cysteine-rich domain of human CD5
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            378 
_citation.page_first                129 
_citation.page_last                 144 
_citation.year                      2008 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18339402 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2008.02.006 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Garza-Garcia, A.' 1 
primary 'Esposito, D.'     2 
primary 'Rieping, W.'      3 
primary 'Harris, R.'       4 
primary 'Briggs, C.'       5 
primary 'Brown, M.H.'      6 
primary 'Driscoll, P.C.'   7 
# 
_cell.entry_id           2JP0 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2JP0 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'T-cell surface glycoprotein CD5' 
_entity.formula_weight             14758.563 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'V88D, V97K' 
_entity.pdbx_fragment              'residues 25-134' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Lymphocyte antigen T1/Leu- 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGGSHHHHHHSSGLVPRGSHMRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQR
LNCGDPLSLGPFLKTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGGSHHHHHHSSGLVPRGSHMRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQR
LNCGDPLSLGPFLKTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ARG n 
1 23  LEU n 
1 24  SER n 
1 25  TRP n 
1 26  TYR n 
1 27  ASP n 
1 28  PRO n 
1 29  ASP n 
1 30  PHE n 
1 31  GLN n 
1 32  ALA n 
1 33  ARG n 
1 34  LEU n 
1 35  THR n 
1 36  ARG n 
1 37  SER n 
1 38  ASN n 
1 39  SER n 
1 40  LYS n 
1 41  CYS n 
1 42  GLN n 
1 43  GLY n 
1 44  GLN n 
1 45  LEU n 
1 46  GLU n 
1 47  VAL n 
1 48  TYR n 
1 49  LEU n 
1 50  LYS n 
1 51  ASP n 
1 52  GLY n 
1 53  TRP n 
1 54  HIS n 
1 55  MET n 
1 56  VAL n 
1 57  CYS n 
1 58  SER n 
1 59  GLN n 
1 60  SER n 
1 61  TRP n 
1 62  GLY n 
1 63  ARG n 
1 64  SER n 
1 65  SER n 
1 66  LYS n 
1 67  GLN n 
1 68  TRP n 
1 69  GLU n 
1 70  ASP n 
1 71  PRO n 
1 72  SER n 
1 73  GLN n 
1 74  ALA n 
1 75  SER n 
1 76  LYS n 
1 77  VAL n 
1 78  CYS n 
1 79  GLN n 
1 80  ARG n 
1 81  LEU n 
1 82  ASN n 
1 83  CYS n 
1 84  GLY n 
1 85  ASP n 
1 86  PRO n 
1 87  LEU n 
1 88  SER n 
1 89  LEU n 
1 90  GLY n 
1 91  PRO n 
1 92  PHE n 
1 93  LEU n 
1 94  LYS n 
1 95  THR n 
1 96  TYR n 
1 97  THR n 
1 98  PRO n 
1 99  GLN n 
1 100 SER n 
1 101 SER n 
1 102 ILE n 
1 103 ILE n 
1 104 CYS n 
1 105 TYR n 
1 106 GLY n 
1 107 GLN n 
1 108 LEU n 
1 109 GLY n 
1 110 SER n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 CYS n 
1 115 SER n 
1 116 HIS n 
1 117 SER n 
1 118 ARG n 
1 119 ASN n 
1 120 ASP n 
1 121 MET n 
1 122 CYS n 
1 123 HIS n 
1 124 SER n 
1 125 LEU n 
1 126 GLY n 
1 127 LEU n 
1 128 THR n 
1 129 CYS n 
1 130 LEU n 
1 131 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'CD5, LEU1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pet15b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CD5_HUMAN 
_struct_ref.pdbx_db_accession          P06127 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSS
IICYGQLGSFSNCSHSRNDMCHSLGLTCLE
;
_struct_ref.pdbx_align_begin           25 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JP0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 22 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 131 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06127 
_struct_ref_seq.db_align_beg                  25 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  134 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       25 
_struct_ref_seq.pdbx_auth_seq_align_end       134 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JP0 MET A 1  ? UNP P06127 ?   ?  'CLONING ARTIFACT' 4  1  
1 2JP0 GLY A 2  ? UNP P06127 ?   ?  'CLONING ARTIFACT' 5  2  
1 2JP0 GLY A 3  ? UNP P06127 ?   ?  'CLONING ARTIFACT' 6  3  
1 2JP0 SER A 4  ? UNP P06127 ?   ?  'CLONING ARTIFACT' 7  4  
1 2JP0 HIS A 5  ? UNP P06127 ?   ?  'EXPRESSION TAG'   8  5  
1 2JP0 HIS A 6  ? UNP P06127 ?   ?  'EXPRESSION TAG'   9  6  
1 2JP0 HIS A 7  ? UNP P06127 ?   ?  'EXPRESSION TAG'   10 7  
1 2JP0 HIS A 8  ? UNP P06127 ?   ?  'EXPRESSION TAG'   11 8  
1 2JP0 HIS A 9  ? UNP P06127 ?   ?  'EXPRESSION TAG'   12 9  
1 2JP0 HIS A 10 ? UNP P06127 ?   ?  'EXPRESSION TAG'   13 10 
1 2JP0 SER A 11 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 14 11 
1 2JP0 SER A 12 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 15 12 
1 2JP0 GLY A 13 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 16 13 
1 2JP0 LEU A 14 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 17 14 
1 2JP0 VAL A 15 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 18 15 
1 2JP0 PRO A 16 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 19 16 
1 2JP0 ARG A 17 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 20 17 
1 2JP0 GLY A 18 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 21 18 
1 2JP0 SER A 19 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 22 19 
1 2JP0 HIS A 20 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 23 20 
1 2JP0 MET A 21 ? UNP P06127 ?   ?  'CLONING ARTIFACT' 24 21 
1 2JP0 ASP A 85 ? UNP P06127 VAL 88 ENGINEERED         88 22 
1 2JP0 LYS A 94 ? UNP P06127 VAL 97 ENGINEERED         97 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '3D 1H-15N NOESY' 
1 3  1 '3D 1H-15N TOCSY' 
1 4  2 '2D 1H-15N HSQC'  
1 5  2 '3D HNCA'         
1 6  2 '3D HNCO'         
1 7  2 '3D HA(CACO)NH'   
1 8  2 '3D CBCA(CO)NH'   
1 9  2 '3D HNCACB'       
1 10 3 '2D 1H-13C HSQC'  
1 11 3 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.2 
_pdbx_nmr_exptl_sample_conditions.pH                  5.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         318 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-15N] CD5d1, 50 mM sodium phosphate, 200 mM sodium chloride, 1 mM EDTA, 90% H2O/10% D2O'        1 '90% H2O/10% D2O' 
'1 mM [U-13C; U-15N] CD5d1, 1 mM EDTA, 50 mM sodium phosphate, 200 mM sodium chloride, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
'1 mM [U-13C; U-15N] CD5d1, 1 mM EDTA, 50 mM sodium phosphate, 200 mM sodium chloride, 100% D2O'        3 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Varian INOVA     1 'Varian INOVA'     
500 Varian UNITYPLUS 2 'Varian UnityPlus' 
800 Varian INOVA     3 'Varian INOVA'     
# 
_pdbx_nmr_refine.entry_id           2JP0 
_pdbx_nmr_refine.method             'Inferential structure determination' 
_pdbx_nmr_refine.details            
'A Bayesian inference was used to derive a probabilty distribution that represents the structure and its precision.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             50 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JP0 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JP0 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing           NMRPipe                             3.3 1 
Kraulis                                             'data analysis'      ANSIG                               3.3 2 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution' CNS                                 1.1 3 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution' X-PLOR_NIH                          ?   4 
Rieping                                             refinement           Inferential_Structure_Determination ?   5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JP0 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JP0 
_struct.title                     
;Solution structure of the N-terminal extraceullular domain of the lymphocyte receptor CD5 calculated using inferential structure determination (ISD)
;
_struct.pdbx_descriptor           'T-cell surface glycoprotein CD5' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JP0 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
'CD5, domain 1, scavenger receptor cysteine rich, SRCR, Inferential Structure Determination, IMMUNE SYSTEM' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ALA 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        74 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        81 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ALA 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         77 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         84 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 41  SG ? ? ? 1_555 A CYS 83  SG ? ? A CYS 44  A CYS 86  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 57  SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 60  A CYS 125 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf3 disulf ? ? A CYS 78  SG ? ? ? 1_555 A CYS 129 SG ? ? A CYS 81  A CYS 132 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4 disulf ? ? A CYS 104 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 107 A CYS 117 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 32  ? LEU A 34  ? ALA A 35  LEU A 37  
A 2 LEU A 45  ? TYR A 48  ? LEU A 48  TYR A 51  
A 3 TRP A 53  ? MET A 55  ? TRP A 56  MET A 58  
B 1 GLN A 42  ? GLY A 43  ? GLN A 45  GLY A 46  
B 2 LEU A 125 ? CYS A 129 ? LEU A 128 CYS A 132 
B 3 PRO A 86  ? PRO A 91  ? PRO A 89  PRO A 94  
C 1 ILE A 102 ? ILE A 103 ? ILE A 105 ILE A 106 
C 2 SER A 115 ? HIS A 116 ? SER A 118 HIS A 119 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 33  ? N ARG A 36  O GLU A 46  ? O GLU A 49  
A 2 3 N VAL A 47  ? N VAL A 50  O HIS A 54  ? O HIS A 57  
B 1 2 N GLY A 43  ? N GLY A 46  O LEU A 127 ? O LEU A 130 
B 2 3 O GLY A 126 ? O GLY A 129 N GLY A 90  ? N GLY A 93  
C 1 2 N ILE A 103 ? N ILE A 106 O SER A 115 ? O SER A 118 
# 
_atom_sites.entry_id                    2JP0 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ARG A 1 22  ? -11.406 -2.266  11.981  1.00 0.00 ? 25  ARG A N    1  
ATOM 2     C CA   . ARG A 1 22  ? -10.447 -2.721  13.018  1.00 0.00 ? 25  ARG A CA   1  
ATOM 3     C C    . ARG A 1 22  ? -9.071  -2.124  12.772  1.00 0.00 ? 25  ARG A C    1  
ATOM 4     O O    . ARG A 1 22  ? -8.387  -1.713  13.708  1.00 0.00 ? 25  ARG A O    1  
ATOM 5     C CB   . ARG A 1 22  ? -10.358 -4.252  13.049  1.00 0.00 ? 25  ARG A CB   1  
ATOM 6     C CG   . ARG A 1 22  ? -11.666 -4.930  13.426  1.00 0.00 ? 25  ARG A CG   1  
ATOM 7     C CD   . ARG A 1 22  ? -12.141 -4.499  14.804  1.00 0.00 ? 25  ARG A CD   1  
ATOM 8     N NE   . ARG A 1 22  ? -13.518 -4.910  15.063  1.00 0.00 ? 25  ARG A NE   1  
ATOM 9     C CZ   . ARG A 1 22  ? -14.409 -4.149  15.687  1.00 0.00 ? 25  ARG A CZ   1  
ATOM 10    N NH1  . ARG A 1 22  ? -14.069 -2.939  16.111  1.00 0.00 ? 25  ARG A NH1  1  
ATOM 11    N NH2  . ARG A 1 22  ? -15.641 -4.584  15.881  1.00 0.00 ? 25  ARG A NH2  1  
ATOM 12    H HA   . ARG A 1 22  ? -10.803 -2.371  13.976  1.00 0.00 ? 25  ARG A HA   1  
ATOM 13    H HB2  . ARG A 1 22  ? -10.063 -4.605  12.072  1.00 0.00 ? 25  ARG A HB2  1  
ATOM 14    H HB3  . ARG A 1 22  ? -9.607  -4.541  13.769  1.00 0.00 ? 25  ARG A HB3  1  
ATOM 15    H HG2  . ARG A 1 22  ? -12.421 -4.670  12.699  1.00 0.00 ? 25  ARG A HG2  1  
ATOM 16    H HG3  . ARG A 1 22  ? -11.518 -6.001  13.425  1.00 0.00 ? 25  ARG A HG3  1  
ATOM 17    H HD2  . ARG A 1 22  ? -11.498 -4.946  15.549  1.00 0.00 ? 25  ARG A HD2  1  
ATOM 18    H HD3  . ARG A 1 22  ? -12.076 -3.424  14.875  1.00 0.00 ? 25  ARG A HD3  1  
ATOM 19    H HE   . ARG A 1 22  ? -13.796 -5.807  14.751  1.00 0.00 ? 25  ARG A HE   1  
ATOM 20    H HH12 . ARG A 1 22  ? -13.971 -2.767  17.099  1.00 0.00 ? 25  ARG A HH12 1  
ATOM 21    H HH21 . ARG A 1 22  ? -15.913 -5.496  15.555  1.00 0.00 ? 25  ARG A HH21 1  
ATOM 22    H HH22 . ARG A 1 22  ? -16.311 -4.002  16.363  1.00 0.00 ? 25  ARG A HH22 1  
ATOM 23    N N    . LEU A 1 23  ? -8.665  -2.083  11.510  1.00 0.00 ? 26  LEU A N    1  
ATOM 24    C CA   . LEU A 1 23  ? -7.392  -1.492  11.127  1.00 0.00 ? 26  LEU A CA   1  
ATOM 25    C C    . LEU A 1 23  ? -7.576  -0.644  9.879   1.00 0.00 ? 26  LEU A C    1  
ATOM 26    O O    . LEU A 1 23  ? -8.177  -1.092  8.907   1.00 0.00 ? 26  LEU A O    1  
ATOM 27    C CB   . LEU A 1 23  ? -6.341  -2.574  10.850  1.00 0.00 ? 26  LEU A CB   1  
ATOM 28    C CG   . LEU A 1 23  ? -5.925  -3.430  12.050  1.00 0.00 ? 26  LEU A CG   1  
ATOM 29    C CD1  . LEU A 1 23  ? -4.980  -4.532  11.608  1.00 0.00 ? 26  LEU A CD1  1  
ATOM 30    C CD2  . LEU A 1 23  ? -5.263  -2.575  13.120  1.00 0.00 ? 26  LEU A CD2  1  
ATOM 31    H H    . LEU A 1 23  ? -9.243  -2.451  10.808  1.00 0.00 ? 26  LEU A H    1  
ATOM 32    H HA   . LEU A 1 23  ? -7.056  -0.865  11.938  1.00 0.00 ? 26  LEU A HA   1  
ATOM 33    H HB2  . LEU A 1 23  ? -6.731  -3.232  10.086  1.00 0.00 ? 26  LEU A HB2  1  
ATOM 34    H HB3  . LEU A 1 23  ? -5.458  -2.091  10.459  1.00 0.00 ? 26  LEU A HB3  1  
ATOM 35    H HG   . LEU A 1 23  ? -6.802  -3.892  12.481  1.00 0.00 ? 26  LEU A HG   1  
ATOM 36    H HD11 . LEU A 1 23  ? -4.101  -4.092  11.159  1.00 0.00 ? 26  LEU A HD11 1  
ATOM 37    H HD12 . LEU A 1 23  ? -4.689  -5.119  12.466  1.00 0.00 ? 26  LEU A HD12 1  
ATOM 38    H HD13 . LEU A 1 23  ? -5.475  -5.165  10.888  1.00 0.00 ? 26  LEU A HD13 1  
ATOM 39    H HD21 . LEU A 1 23  ? -5.983  -1.884  13.529  1.00 0.00 ? 26  LEU A HD21 1  
ATOM 40    H HD22 . LEU A 1 23  ? -4.891  -3.215  13.908  1.00 0.00 ? 26  LEU A HD22 1  
ATOM 41    H HD23 . LEU A 1 23  ? -4.439  -2.027  12.687  1.00 0.00 ? 26  LEU A HD23 1  
ATOM 42    N N    . SER A 1 24  ? -7.082  0.575   9.920   1.00 0.00 ? 27  SER A N    1  
ATOM 43    C CA   . SER A 1 24  ? -7.102  1.451   8.765   1.00 0.00 ? 27  SER A CA   1  
ATOM 44    C C    . SER A 1 24  ? -5.790  2.214   8.696   1.00 0.00 ? 27  SER A C    1  
ATOM 45    O O    . SER A 1 24  ? -5.132  2.419   9.716   1.00 0.00 ? 27  SER A O    1  
ATOM 46    C CB   . SER A 1 24  ? -8.277  2.429   8.859   1.00 0.00 ? 27  SER A CB   1  
ATOM 47    O OG   . SER A 1 24  ? -8.188  3.233   10.022  1.00 0.00 ? 27  SER A OG   1  
ATOM 48    H H    . SER A 1 24  ? -6.698  0.913   10.765  1.00 0.00 ? 27  SER A H    1  
ATOM 49    H HA   . SER A 1 24  ? -7.208  0.844   7.877   1.00 0.00 ? 27  SER A HA   1  
ATOM 50    H HB2  . SER A 1 24  ? -8.278  3.074   7.992   1.00 0.00 ? 27  SER A HB2  1  
ATOM 51    H HB3  . SER A 1 24  ? -9.202  1.872   8.893   1.00 0.00 ? 27  SER A HB3  1  
ATOM 52    H HG   . SER A 1 24  ? -7.769  2.725   10.738  1.00 0.00 ? 27  SER A HG   1  
ATOM 53    N N    . TRP A 1 25  ? -5.408  2.637   7.499   1.00 0.00 ? 28  TRP A N    1  
ATOM 54    C CA   . TRP A 1 25  ? -4.155  3.356   7.321   1.00 0.00 ? 28  TRP A CA   1  
ATOM 55    C C    . TRP A 1 25  ? -4.220  4.760   7.918   1.00 0.00 ? 28  TRP A C    1  
ATOM 56    O O    . TRP A 1 25  ? -3.251  5.516   7.853   1.00 0.00 ? 28  TRP A O    1  
ATOM 57    C CB   . TRP A 1 25  ? -3.742  3.411   5.840   1.00 0.00 ? 28  TRP A CB   1  
ATOM 58    C CG   . TRP A 1 25  ? -4.755  4.011   4.898   1.00 0.00 ? 28  TRP A CG   1  
ATOM 59    C CD1  . TRP A 1 25  ? -5.816  4.819   5.206   1.00 0.00 ? 28  TRP A CD1  1  
ATOM 60    C CD2  . TRP A 1 25  ? -4.775  3.859   3.471   1.00 0.00 ? 28  TRP A CD2  1  
ATOM 61    N NE1  . TRP A 1 25  ? -6.495  5.167   4.063   1.00 0.00 ? 28  TRP A NE1  1  
ATOM 62    C CE2  . TRP A 1 25  ? -5.875  4.591   2.985   1.00 0.00 ? 28  TRP A CE2  1  
ATOM 63    C CE3  . TRP A 1 25  ? -3.968  3.172   2.557   1.00 0.00 ? 28  TRP A CE3  1  
ATOM 64    C CZ2  . TRP A 1 25  ? -6.189  4.653   1.626   1.00 0.00 ? 28  TRP A CZ2  1  
ATOM 65    C CZ3  . TRP A 1 25  ? -4.280  3.237   1.210   1.00 0.00 ? 28  TRP A CZ3  1  
ATOM 66    C CH2  . TRP A 1 25  ? -5.380  3.974   0.756   1.00 0.00 ? 28  TRP A CH2  1  
ATOM 67    H H    . TRP A 1 25  ? -5.976  2.452   6.715   1.00 0.00 ? 28  TRP A H    1  
ATOM 68    H HA   . TRP A 1 25  ? -3.400  2.804   7.864   1.00 0.00 ? 28  TRP A HA   1  
ATOM 69    H HB2  . TRP A 1 25  ? -2.840  3.998   5.758   1.00 0.00 ? 28  TRP A HB2  1  
ATOM 70    H HB3  . TRP A 1 25  ? -3.533  2.404   5.505   1.00 0.00 ? 28  TRP A HB3  1  
ATOM 71    H HD1  . TRP A 1 25  ? -6.073  5.128   6.207   1.00 0.00 ? 28  TRP A HD1  1  
ATOM 72    H HE1  . TRP A 1 25  ? -7.293  5.739   4.026   1.00 0.00 ? 28  TRP A HE1  1  
ATOM 73    H HE3  . TRP A 1 25  ? -3.114  2.599   2.887   1.00 0.00 ? 28  TRP A HE3  1  
ATOM 74    H HZ2  . TRP A 1 25  ? -7.033  5.217   1.259   1.00 0.00 ? 28  TRP A HZ2  1  
ATOM 75    H HZ3  . TRP A 1 25  ? -3.666  2.715   0.489   1.00 0.00 ? 28  TRP A HZ3  1  
ATOM 76    H HH2  . TRP A 1 25  ? -5.584  3.995   -0.303  1.00 0.00 ? 28  TRP A HH2  1  
ATOM 77    N N    . TYR A 1 26  ? -5.355  5.091   8.522   1.00 0.00 ? 29  TYR A N    1  
ATOM 78    C CA   . TYR A 1 26  ? -5.559  6.405   9.102   1.00 0.00 ? 29  TYR A CA   1  
ATOM 79    C C    . TYR A 1 26  ? -5.262  6.379   10.598  1.00 0.00 ? 29  TYR A C    1  
ATOM 80    O O    . TYR A 1 26  ? -5.021  7.422   11.209  1.00 0.00 ? 29  TYR A O    1  
ATOM 81    C CB   . TYR A 1 26  ? -6.997  6.863   8.865   1.00 0.00 ? 29  TYR A CB   1  
ATOM 82    C CG   . TYR A 1 26  ? -7.101  8.314   8.464   1.00 0.00 ? 29  TYR A CG   1  
ATOM 83    C CD1  . TYR A 1 26  ? -7.138  9.326   9.416   1.00 0.00 ? 29  TYR A CD1  1  
ATOM 84    C CD2  . TYR A 1 26  ? -7.156  8.671   7.124   1.00 0.00 ? 29  TYR A CD2  1  
ATOM 85    C CE1  . TYR A 1 26  ? -7.230  10.653  9.041   1.00 0.00 ? 29  TYR A CE1  1  
ATOM 86    C CE2  . TYR A 1 26  ? -7.246  9.992   6.744   1.00 0.00 ? 29  TYR A CE2  1  
ATOM 87    C CZ   . TYR A 1 26  ? -7.283  10.980  7.702   1.00 0.00 ? 29  TYR A CZ   1  
ATOM 88    O OH   . TYR A 1 26  ? -7.371  12.301  7.317   1.00 0.00 ? 29  TYR A OH   1  
ATOM 89    H H    . TYR A 1 26  ? -6.071  4.427   8.587   1.00 0.00 ? 29  TYR A H    1  
ATOM 90    H HA   . TYR A 1 26  ? -4.883  7.095   8.619   1.00 0.00 ? 29  TYR A HA   1  
ATOM 91    H HB2  . TYR A 1 26  ? -7.435  6.267   8.076   1.00 0.00 ? 29  TYR A HB2  1  
ATOM 92    H HB3  . TYR A 1 26  ? -7.564  6.727   9.772   1.00 0.00 ? 29  TYR A HB3  1  
ATOM 93    H HD1  . TYR A 1 26  ? -7.093  9.065   10.464  1.00 0.00 ? 29  TYR A HD1  1  
ATOM 94    H HD2  . TYR A 1 26  ? -7.129  7.895   6.371   1.00 0.00 ? 29  TYR A HD2  1  
ATOM 95    H HE1  . TYR A 1 26  ? -7.257  11.426  9.796   1.00 0.00 ? 29  TYR A HE1  1  
ATOM 96    H HE2  . TYR A 1 26  ? -7.287  10.246  5.695   1.00 0.00 ? 29  TYR A HE2  1  
ATOM 97    H HH   . TYR A 1 26  ? -6.694  12.820  7.788   1.00 0.00 ? 29  TYR A HH   1  
ATOM 98    N N    . ASP A 1 27  ? -5.255  5.180   11.174  1.00 0.00 ? 30  ASP A N    1  
ATOM 99    C CA   . ASP A 1 27  ? -5.043  5.016   12.610  1.00 0.00 ? 30  ASP A CA   1  
ATOM 100   C C    . ASP A 1 27  ? -3.627  5.417   13.003  1.00 0.00 ? 30  ASP A C    1  
ATOM 101   O O    . ASP A 1 27  ? -2.668  5.140   12.279  1.00 0.00 ? 30  ASP A O    1  
ATOM 102   C CB   . ASP A 1 27  ? -5.285  3.566   13.038  1.00 0.00 ? 30  ASP A CB   1  
ATOM 103   C CG   . ASP A 1 27  ? -6.709  3.106   12.819  1.00 0.00 ? 30  ASP A CG   1  
ATOM 104   O OD1  . ASP A 1 27  ? -7.631  3.728   13.377  1.00 0.00 ? 30  ASP A OD1  1  
ATOM 105   O OD2  . ASP A 1 27  ? -6.913  2.099   12.108  1.00 0.00 ? 30  ASP A OD2  1  
ATOM 106   H H    . ASP A 1 27  ? -5.394  4.380   10.621  1.00 0.00 ? 30  ASP A H    1  
ATOM 107   H HA   . ASP A 1 27  ? -5.745  5.654   13.122  1.00 0.00 ? 30  ASP A HA   1  
ATOM 108   H HB2  . ASP A 1 27  ? -4.633  2.920   12.478  1.00 0.00 ? 30  ASP A HB2  1  
ATOM 109   H HB3  . ASP A 1 27  ? -5.058  3.469   14.088  1.00 0.00 ? 30  ASP A HB3  1  
ATOM 110   N N    . PRO A 1 28  ? -3.484  6.081   14.163  1.00 0.00 ? 31  PRO A N    1  
ATOM 111   C CA   . PRO A 1 28  ? -2.180  6.471   14.711  1.00 0.00 ? 31  PRO A CA   1  
ATOM 112   C C    . PRO A 1 28  ? -1.344  5.257   15.103  1.00 0.00 ? 31  PRO A C    1  
ATOM 113   O O    . PRO A 1 28  ? -0.119  5.336   15.202  1.00 0.00 ? 31  PRO A O    1  
ATOM 114   C CB   . PRO A 1 28  ? -2.528  7.296   15.957  1.00 0.00 ? 31  PRO A CB   1  
ATOM 115   C CG   . PRO A 1 28  ? -3.970  7.637   15.815  1.00 0.00 ? 31  PRO A CG   1  
ATOM 116   C CD   . PRO A 1 28  ? -4.587  6.520   15.026  1.00 0.00 ? 31  PRO A CD   1  
ATOM 117   H HA   . PRO A 1 28  ? -1.623  7.079   14.016  1.00 0.00 ? 31  PRO A HA   1  
ATOM 118   H HB2  . PRO A 1 28  ? -2.351  6.705   16.843  1.00 0.00 ? 31  PRO A HB2  1  
ATOM 119   H HB3  . PRO A 1 28  ? -1.916  8.186   15.985  1.00 0.00 ? 31  PRO A HB3  1  
ATOM 120   H HG2  . PRO A 1 28  ? -4.426  7.703   16.789  1.00 0.00 ? 31  PRO A HG2  1  
ATOM 121   H HG3  . PRO A 1 28  ? -4.075  8.573   15.286  1.00 0.00 ? 31  PRO A HG3  1  
ATOM 122   H HD2  . PRO A 1 28  ? -4.908  5.722   15.678  1.00 0.00 ? 31  PRO A HD2  1  
ATOM 123   H HD3  . PRO A 1 28  ? -5.413  6.887   14.437  1.00 0.00 ? 31  PRO A HD3  1  
ATOM 124   N N    . ASP A 1 29  ? -2.022  4.140   15.336  1.00 0.00 ? 32  ASP A N    1  
ATOM 125   C CA   . ASP A 1 29  ? -1.356  2.887   15.682  1.00 0.00 ? 32  ASP A CA   1  
ATOM 126   C C    . ASP A 1 29  ? -0.869  2.175   14.429  1.00 0.00 ? 32  ASP A C    1  
ATOM 127   O O    . ASP A 1 29  ? -0.019  1.283   14.499  1.00 0.00 ? 32  ASP A O    1  
ATOM 128   C CB   . ASP A 1 29  ? -2.300  1.957   16.452  1.00 0.00 ? 32  ASP A CB   1  
ATOM 129   C CG   . ASP A 1 29  ? -2.712  2.514   17.796  1.00 0.00 ? 32  ASP A CG   1  
ATOM 130   O OD1  . ASP A 1 29  ? -1.949  2.348   18.770  1.00 0.00 ? 32  ASP A OD1  1  
ATOM 131   O OD2  . ASP A 1 29  ? -3.806  3.113   17.886  1.00 0.00 ? 32  ASP A OD2  1  
ATOM 132   H H    . ASP A 1 29  ? -2.999  4.162   15.284  1.00 0.00 ? 32  ASP A H    1  
ATOM 133   H HA   . ASP A 1 29  ? -0.506  3.123   16.305  1.00 0.00 ? 32  ASP A HA   1  
ATOM 134   H HB2  . ASP A 1 29  ? -3.191  1.792   15.866  1.00 0.00 ? 32  ASP A HB2  1  
ATOM 135   H HB3  . ASP A 1 29  ? -1.802  1.012   16.612  1.00 0.00 ? 32  ASP A HB3  1  
ATOM 136   N N    . PHE A 1 30  ? -1.405  2.575   13.281  1.00 0.00 ? 33  PHE A N    1  
ATOM 137   C CA   . PHE A 1 30  ? -1.093  1.914   12.027  1.00 0.00 ? 33  PHE A CA   1  
ATOM 138   C C    . PHE A 1 30  ? 0.320   2.258   11.582  1.00 0.00 ? 33  PHE A C    1  
ATOM 139   O O    . PHE A 1 30  ? 0.709   3.429   11.524  1.00 0.00 ? 33  PHE A O    1  
ATOM 140   C CB   . PHE A 1 30  ? -2.103  2.305   10.942  1.00 0.00 ? 33  PHE A CB   1  
ATOM 141   C CG   . PHE A 1 30  ? -1.913  1.575   9.643   1.00 0.00 ? 33  PHE A CG   1  
ATOM 142   C CD1  . PHE A 1 30  ? -2.362  0.271   9.496   1.00 0.00 ? 33  PHE A CD1  1  
ATOM 143   C CD2  . PHE A 1 30  ? -1.296  2.195   8.569   1.00 0.00 ? 33  PHE A CD2  1  
ATOM 144   C CE1  . PHE A 1 30  ? -2.202  -0.399  8.300   1.00 0.00 ? 33  PHE A CE1  1  
ATOM 145   C CE2  . PHE A 1 30  ? -1.132  1.529   7.372   1.00 0.00 ? 33  PHE A CE2  1  
ATOM 146   C CZ   . PHE A 1 30  ? -1.586  0.231   7.236   1.00 0.00 ? 33  PHE A CZ   1  
ATOM 147   H H    . PHE A 1 30  ? -2.009  3.344   13.277  1.00 0.00 ? 33  PHE A H    1  
ATOM 148   H HA   . PHE A 1 30  ? -1.154  0.848   12.192  1.00 0.00 ? 33  PHE A HA   1  
ATOM 149   H HB2  . PHE A 1 30  ? -3.101  2.089   11.294  1.00 0.00 ? 33  PHE A HB2  1  
ATOM 150   H HB3  . PHE A 1 30  ? -2.018  3.365   10.740  1.00 0.00 ? 33  PHE A HB3  1  
ATOM 151   H HD1  . PHE A 1 30  ? -2.842  -0.222  10.328  1.00 0.00 ? 33  PHE A HD1  1  
ATOM 152   H HD2  . PHE A 1 30  ? -0.939  3.209   8.674   1.00 0.00 ? 33  PHE A HD2  1  
ATOM 153   H HE1  . PHE A 1 30  ? -2.556  -1.414  8.198   1.00 0.00 ? 33  PHE A HE1  1  
ATOM 154   H HE2  . PHE A 1 30  ? -0.653  2.024   6.542   1.00 0.00 ? 33  PHE A HE2  1  
ATOM 155   H HZ   . PHE A 1 30  ? -1.462  -0.290  6.299   1.00 0.00 ? 33  PHE A HZ   1  
ATOM 156   N N    . GLN A 1 31  ? 1.084   1.229   11.275  1.00 0.00 ? 34  GLN A N    1  
ATOM 157   C CA   . GLN A 1 31  ? 2.460   1.394   10.851  1.00 0.00 ? 34  GLN A CA   1  
ATOM 158   C C    . GLN A 1 31  ? 2.622   0.937   9.413   1.00 0.00 ? 34  GLN A C    1  
ATOM 159   O O    . GLN A 1 31  ? 2.124   -0.122  9.030   1.00 0.00 ? 34  GLN A O    1  
ATOM 160   C CB   . GLN A 1 31  ? 3.386   0.607   11.778  1.00 0.00 ? 34  GLN A CB   1  
ATOM 161   C CG   . GLN A 1 31  ? 3.495   1.208   13.166  1.00 0.00 ? 34  GLN A CG   1  
ATOM 162   C CD   . GLN A 1 31  ? 4.042   0.233   14.181  1.00 0.00 ? 34  GLN A CD   1  
ATOM 163   O OE1  . GLN A 1 31  ? 5.255   0.125   14.371  1.00 0.00 ? 34  GLN A OE1  1  
ATOM 164   N NE2  . GLN A 1 31  ? 3.146   -0.472  14.853  1.00 0.00 ? 34  GLN A NE2  1  
ATOM 165   H H    . GLN A 1 31  ? 0.706   0.323   11.322  1.00 0.00 ? 34  GLN A H    1  
ATOM 166   H HA   . GLN A 1 31  ? 2.705   2.444   10.914  1.00 0.00 ? 34  GLN A HA   1  
ATOM 167   H HB2  . GLN A 1 31  ? 3.010   -0.400  11.875  1.00 0.00 ? 34  GLN A HB2  1  
ATOM 168   H HB3  . GLN A 1 31  ? 4.372   0.572   11.343  1.00 0.00 ? 34  GLN A HB3  1  
ATOM 169   H HG2  . GLN A 1 31  ? 4.151   2.063   13.123  1.00 0.00 ? 34  GLN A HG2  1  
ATOM 170   H HG3  . GLN A 1 31  ? 2.513   1.524   13.486  1.00 0.00 ? 34  GLN A HG3  1  
ATOM 171   H HE21 . GLN A 1 31  ? 2.197   -0.318  14.656  1.00 0.00 ? 34  GLN A HE21 1  
ATOM 172   H HE22 . GLN A 1 31  ? 3.465   -1.122  15.522  1.00 0.00 ? 34  GLN A HE22 1  
ATOM 173   N N    . ALA A 1 32  ? 3.302   1.747   8.618   1.00 0.00 ? 35  ALA A N    1  
ATOM 174   C CA   . ALA A 1 32  ? 3.519   1.434   7.219   1.00 0.00 ? 35  ALA A CA   1  
ATOM 175   C C    . ALA A 1 32  ? 4.821   2.044   6.737   1.00 0.00 ? 35  ALA A C    1  
ATOM 176   O O    . ALA A 1 32  ? 5.332   2.996   7.334   1.00 0.00 ? 35  ALA A O    1  
ATOM 177   C CB   . ALA A 1 32  ? 2.360   1.939   6.373   1.00 0.00 ? 35  ALA A CB   1  
ATOM 178   H H    . ALA A 1 32  ? 3.678   2.576   8.982   1.00 0.00 ? 35  ALA A H    1  
ATOM 179   H HA   . ALA A 1 32  ? 3.573   0.358   7.119   1.00 0.00 ? 35  ALA A HA   1  
ATOM 180   H HB1  . ALA A 1 32  ? 2.289   3.013   6.467   1.00 0.00 ? 35  ALA A HB1  1  
ATOM 181   H HB2  . ALA A 1 32  ? 2.526   1.678   5.337   1.00 0.00 ? 35  ALA A HB2  1  
ATOM 182   H HB3  . ALA A 1 32  ? 1.442   1.488   6.714   1.00 0.00 ? 35  ALA A HB3  1  
ATOM 183   N N    . ARG A 1 33  ? 5.358   1.484   5.671   1.00 0.00 ? 36  ARG A N    1  
ATOM 184   C CA   . ARG A 1 33  ? 6.563   1.998   5.059   1.00 0.00 ? 36  ARG A CA   1  
ATOM 185   C C    . ARG A 1 33  ? 6.518   1.767   3.562   1.00 0.00 ? 36  ARG A C    1  
ATOM 186   O O    . ARG A 1 33  ? 5.850   0.852   3.085   1.00 0.00 ? 36  ARG A O    1  
ATOM 187   C CB   . ARG A 1 33  ? 7.812   1.321   5.637   1.00 0.00 ? 36  ARG A CB   1  
ATOM 188   C CG   . ARG A 1 33  ? 7.909   -0.169  5.329   1.00 0.00 ? 36  ARG A CG   1  
ATOM 189   C CD   . ARG A 1 33  ? 9.308   -0.709  5.600   1.00 0.00 ? 36  ARG A CD   1  
ATOM 190   N NE   . ARG A 1 33  ? 9.776   -0.396  6.950   1.00 0.00 ? 36  ARG A NE   1  
ATOM 191   C CZ   . ARG A 1 33  ? 11.054  -0.423  7.318   1.00 0.00 ? 36  ARG A CZ   1  
ATOM 192   N NH1  . ARG A 1 33  ? 11.996  -0.709  6.430   1.00 0.00 ? 36  ARG A NH1  1  
ATOM 193   N NH2  . ARG A 1 33  ? 11.400  -0.154  8.566   1.00 0.00 ? 36  ARG A NH2  1  
ATOM 194   H H    . ARG A 1 33  ? 4.925   0.693   5.275   1.00 0.00 ? 36  ARG A H    1  
ATOM 195   H HA   . ARG A 1 33  ? 6.613   3.058   5.250   1.00 0.00 ? 36  ARG A HA   1  
ATOM 196   H HB2  . ARG A 1 33  ? 8.686   1.808   5.232   1.00 0.00 ? 36  ARG A HB2  1  
ATOM 197   H HB3  . ARG A 1 33  ? 7.807   1.443   6.712   1.00 0.00 ? 36  ARG A HB3  1  
ATOM 198   H HG2  . ARG A 1 33  ? 7.205   -0.704  5.948   1.00 0.00 ? 36  ARG A HG2  1  
ATOM 199   H HG3  . ARG A 1 33  ? 7.666   -0.329  4.288   1.00 0.00 ? 36  ARG A HG3  1  
ATOM 200   H HD2  . ARG A 1 33  ? 9.293   -1.783  5.478   1.00 0.00 ? 36  ARG A HD2  1  
ATOM 201   H HD3  . ARG A 1 33  ? 9.994   -0.277  4.882   1.00 0.00 ? 36  ARG A HD3  1  
ATOM 202   H HE   . ARG A 1 33  ? 9.092   -0.157  7.623   1.00 0.00 ? 36  ARG A HE   1  
ATOM 203   H HH12 . ARG A 1 33  ? 12.601  0.020   6.088   1.00 0.00 ? 36  ARG A HH12 1  
ATOM 204   H HH21 . ARG A 1 33  ? 10.700  0.078   9.244   1.00 0.00 ? 36  ARG A HH21 1  
ATOM 205   H HH22 . ARG A 1 33  ? 12.370  -0.192  8.837   1.00 0.00 ? 36  ARG A HH22 1  
ATOM 206   N N    . LEU A 1 34  ? 7.198   2.618   2.828   1.00 0.00 ? 37  LEU A N    1  
ATOM 207   C CA   . LEU A 1 34  ? 7.416   2.393   1.419   1.00 0.00 ? 37  LEU A CA   1  
ATOM 208   C C    . LEU A 1 34  ? 8.715   1.629   1.266   1.00 0.00 ? 37  LEU A C    1  
ATOM 209   O O    . LEU A 1 34  ? 9.740   2.030   1.823   1.00 0.00 ? 37  LEU A O    1  
ATOM 210   C CB   . LEU A 1 34  ? 7.465   3.724   0.672   1.00 0.00 ? 37  LEU A CB   1  
ATOM 211   C CG   . LEU A 1 34  ? 6.185   4.556   0.780   1.00 0.00 ? 37  LEU A CG   1  
ATOM 212   C CD1  . LEU A 1 34  ? 6.383   5.928   0.161   1.00 0.00 ? 37  LEU A CD1  1  
ATOM 213   C CD2  . LEU A 1 34  ? 5.028   3.834   0.108   1.00 0.00 ? 37  LEU A CD2  1  
ATOM 214   H H    . LEU A 1 34  ? 7.573   3.420   3.245   1.00 0.00 ? 37  LEU A H    1  
ATOM 215   H HA   . LEU A 1 34  ? 6.601   1.792   1.038   1.00 0.00 ? 37  LEU A HA   1  
ATOM 216   H HB2  . LEU A 1 34  ? 8.288   4.305   1.064   1.00 0.00 ? 37  LEU A HB2  1  
ATOM 217   H HB3  . LEU A 1 34  ? 7.649   3.523   -0.372  1.00 0.00 ? 37  LEU A HB3  1  
ATOM 218   H HG   . LEU A 1 34  ? 5.937   4.691   1.825   1.00 0.00 ? 37  LEU A HG   1  
ATOM 219   H HD11 . LEU A 1 34  ? 6.665   5.819   -0.874  1.00 0.00 ? 37  LEU A HD11 1  
ATOM 220   H HD12 . LEU A 1 34  ? 5.463   6.491   0.228   1.00 0.00 ? 37  LEU A HD12 1  
ATOM 221   H HD13 . LEU A 1 34  ? 7.164   6.452   0.693   1.00 0.00 ? 37  LEU A HD13 1  
ATOM 222   H HD21 . LEU A 1 34  ? 5.296   3.595   -0.910  1.00 0.00 ? 37  LEU A HD21 1  
ATOM 223   H HD22 . LEU A 1 34  ? 4.810   2.924   0.648   1.00 0.00 ? 37  LEU A HD22 1  
ATOM 224   H HD23 . LEU A 1 34  ? 4.157   4.472   0.113   1.00 0.00 ? 37  LEU A HD23 1  
ATOM 225   N N    . THR A 1 35  ? 8.656   0.511   0.559   1.00 0.00 ? 38  THR A N    1  
ATOM 226   C CA   . THR A 1 35  ? 9.794   -0.382  0.447   1.00 0.00 ? 38  THR A CA   1  
ATOM 227   C C    . THR A 1 35  ? 11.013  0.338   -0.114  1.00 0.00 ? 38  THR A C    1  
ATOM 228   O O    . THR A 1 35  ? 10.883  1.310   -0.864  1.00 0.00 ? 38  THR A O    1  
ATOM 229   C CB   . THR A 1 35  ? 9.462   -1.606  -0.426  1.00 0.00 ? 38  THR A CB   1  
ATOM 230   O OG1  . THR A 1 35  ? 8.959   -1.175  -1.695  1.00 0.00 ? 38  THR A OG1  1  
ATOM 231   C CG2  . THR A 1 35  ? 8.434   -2.496  0.260   1.00 0.00 ? 38  THR A CG2  1  
ATOM 232   H H    . THR A 1 35  ? 7.821   0.282   0.093   1.00 0.00 ? 38  THR A H    1  
ATOM 233   H HA   . THR A 1 35  ? 10.032  -0.734  1.440   1.00 0.00 ? 38  THR A HA   1  
ATOM 234   H HB   . THR A 1 35  ? 10.365  -2.177  -0.580  1.00 0.00 ? 38  THR A HB   1  
ATOM 235   H HG1  . THR A 1 35  ? 9.189   -1.825  -2.370  1.00 0.00 ? 38  THR A HG1  1  
ATOM 236   H HG21 . THR A 1 35  ? 8.807   -2.799  1.228   1.00 0.00 ? 38  THR A HG21 1  
ATOM 237   H HG22 . THR A 1 35  ? 8.252   -3.371  -0.348  1.00 0.00 ? 38  THR A HG22 1  
ATOM 238   H HG23 . THR A 1 35  ? 7.511   -1.949  0.385   1.00 0.00 ? 38  THR A HG23 1  
ATOM 239   N N    . ARG A 1 36  ? 12.188  -0.162  0.264   1.00 0.00 ? 39  ARG A N    1  
ATOM 240   C CA   . ARG A 1 36  ? 13.467  0.457   -0.083  1.00 0.00 ? 39  ARG A CA   1  
ATOM 241   C C    . ARG A 1 36  ? 13.503  0.902   -1.542  1.00 0.00 ? 39  ARG A C    1  
ATOM 242   O O    . ARG A 1 36  ? 13.692  2.088   -1.813  1.00 0.00 ? 39  ARG A O    1  
ATOM 243   C CB   . ARG A 1 36  ? 14.612  -0.511  0.225   1.00 0.00 ? 39  ARG A CB   1  
ATOM 244   C CG   . ARG A 1 36  ? 14.877  -0.670  1.717   1.00 0.00 ? 39  ARG A CG   1  
ATOM 245   C CD   . ARG A 1 36  ? 15.397  -2.056  2.054   1.00 0.00 ? 39  ARG A CD   1  
ATOM 246   N NE   . ARG A 1 36  ? 14.363  -3.083  1.904   1.00 0.00 ? 39  ARG A NE   1  
ATOM 247   C CZ   . ARG A 1 36  ? 14.620  -4.350  1.591   1.00 0.00 ? 39  ARG A CZ   1  
ATOM 248   N NH1  . ARG A 1 36  ? 15.871  -4.738  1.387   1.00 0.00 ? 39  ARG A NH1  1  
ATOM 249   N NH2  . ARG A 1 36  ? 13.634  -5.230  1.480   1.00 0.00 ? 39  ARG A NH2  1  
ATOM 250   H H    . ARG A 1 36  ? 12.193  -0.983  0.792   1.00 0.00 ? 39  ARG A H    1  
ATOM 251   H HA   . ARG A 1 36  ? 13.580  1.331   0.541   1.00 0.00 ? 39  ARG A HA   1  
ATOM 252   H HB2  . ARG A 1 36  ? 14.376  -1.482  -0.188  1.00 0.00 ? 39  ARG A HB2  1  
ATOM 253   H HB3  . ARG A 1 36  ? 15.514  -0.142  -0.239  1.00 0.00 ? 39  ARG A HB3  1  
ATOM 254   H HG2  . ARG A 1 36  ? 15.613  0.060   2.018   1.00 0.00 ? 39  ARG A HG2  1  
ATOM 255   H HG3  . ARG A 1 36  ? 13.957  -0.497  2.258   1.00 0.00 ? 39  ARG A HG3  1  
ATOM 256   H HD2  . ARG A 1 36  ? 16.219  -2.289  1.394   1.00 0.00 ? 39  ARG A HD2  1  
ATOM 257   H HD3  . ARG A 1 36  ? 15.747  -2.059  3.076   1.00 0.00 ? 39  ARG A HD3  1  
ATOM 258   H HE   . ARG A 1 36  ? 13.434  -2.811  2.058   1.00 0.00 ? 39  ARG A HE   1  
ATOM 259   H HH12 . ARG A 1 36  ? 16.200  -5.612  1.782   1.00 0.00 ? 39  ARG A HH12 1  
ATOM 260   H HH21 . ARG A 1 36  ? 12.678  -4.948  1.632   1.00 0.00 ? 39  ARG A HH21 1  
ATOM 261   H HH22 . ARG A 1 36  ? 13.838  -6.184  1.245   1.00 0.00 ? 39  ARG A HH22 1  
ATOM 262   N N    . SER A 1 37  ? 13.318  -0.052  -2.458  1.00 0.00 ? 40  SER A N    1  
ATOM 263   C CA   . SER A 1 37  ? 13.157  0.231   -3.891  1.00 0.00 ? 40  SER A CA   1  
ATOM 264   C C    . SER A 1 37  ? 14.237  1.183   -4.434  1.00 0.00 ? 40  SER A C    1  
ATOM 265   O O    . SER A 1 37  ? 15.326  0.751   -4.823  1.00 0.00 ? 40  SER A O    1  
ATOM 266   C CB   . SER A 1 37  ? 11.750  0.799   -4.146  1.00 0.00 ? 40  SER A CB   1  
ATOM 267   O OG   . SER A 1 37  ? 11.478  0.936   -5.531  1.00 0.00 ? 40  SER A OG   1  
ATOM 268   H H    . SER A 1 37  ? 13.282  -0.988  -2.156  1.00 0.00 ? 40  SER A H    1  
ATOM 269   H HA   . SER A 1 37  ? 13.243  -0.709  -4.417  1.00 0.00 ? 40  SER A HA   1  
ATOM 270   H HB2  . SER A 1 37  ? 11.017  0.135   -3.715  1.00 0.00 ? 40  SER A HB2  1  
ATOM 271   H HB3  . SER A 1 37  ? 11.669  1.769   -3.679  1.00 0.00 ? 40  SER A HB3  1  
ATOM 272   H HG   . SER A 1 37  ? 11.077  1.797   -5.693  1.00 0.00 ? 40  SER A HG   1  
ATOM 273   N N    . ASN A 1 38  ? 13.930  2.476   -4.446  1.00 0.00 ? 41  ASN A N    1  
ATOM 274   C CA   . ASN A 1 38  ? 14.848  3.491   -4.955  1.00 0.00 ? 41  ASN A CA   1  
ATOM 275   C C    . ASN A 1 38  ? 14.832  4.715   -4.045  1.00 0.00 ? 41  ASN A C    1  
ATOM 276   O O    . ASN A 1 38  ? 15.874  5.302   -3.753  1.00 0.00 ? 41  ASN A O    1  
ATOM 277   C CB   . ASN A 1 38  ? 14.468  3.882   -6.388  1.00 0.00 ? 41  ASN A CB   1  
ATOM 278   C CG   . ASN A 1 38  ? 15.338  4.995   -6.949  1.00 0.00 ? 41  ASN A CG   1  
ATOM 279   O OD1  . ASN A 1 38  ? 15.013  6.177   -6.822  1.00 0.00 ? 41  ASN A OD1  1  
ATOM 280   N ND2  . ASN A 1 38  ? 16.447  4.626   -7.571  1.00 0.00 ? 41  ASN A ND2  1  
ATOM 281   H H    . ASN A 1 38  ? 13.068  2.758   -4.083  1.00 0.00 ? 41  ASN A H    1  
ATOM 282   H HA   . ASN A 1 38  ? 15.843  3.070   -4.955  1.00 0.00 ? 41  ASN A HA   1  
ATOM 283   H HB2  . ASN A 1 38  ? 14.570  3.018   -7.028  1.00 0.00 ? 41  ASN A HB2  1  
ATOM 284   H HB3  . ASN A 1 38  ? 13.441  4.211   -6.401  1.00 0.00 ? 41  ASN A HB3  1  
ATOM 285   H HD21 . ASN A 1 38  ? 16.649  3.666   -7.632  1.00 0.00 ? 41  ASN A HD21 1  
ATOM 286   H HD22 . ASN A 1 38  ? 17.022  5.328   -7.955  1.00 0.00 ? 41  ASN A HD22 1  
ATOM 287   N N    . SER A 1 39  ? 13.643  5.078   -3.587  1.00 0.00 ? 42  SER A N    1  
ATOM 288   C CA   . SER A 1 39  ? 13.467  6.205   -2.689  1.00 0.00 ? 42  SER A CA   1  
ATOM 289   C C    . SER A 1 39  ? 12.502  5.810   -1.580  1.00 0.00 ? 42  SER A C    1  
ATOM 290   O O    . SER A 1 39  ? 11.538  5.088   -1.826  1.00 0.00 ? 42  SER A O    1  
ATOM 291   C CB   . SER A 1 39  ? 12.924  7.411   -3.463  1.00 0.00 ? 42  SER A CB   1  
ATOM 292   O OG   . SER A 1 39  ? 12.732  8.531   -2.614  1.00 0.00 ? 42  SER A OG   1  
ATOM 293   H H    . SER A 1 39  ? 12.854  4.569   -3.853  1.00 0.00 ? 42  SER A H    1  
ATOM 294   H HA   . SER A 1 39  ? 14.426  6.451   -2.257  1.00 0.00 ? 42  SER A HA   1  
ATOM 295   H HB2  . SER A 1 39  ? 13.624  7.683   -4.239  1.00 0.00 ? 42  SER A HB2  1  
ATOM 296   H HB3  . SER A 1 39  ? 11.979  7.148   -3.910  1.00 0.00 ? 42  SER A HB3  1  
ATOM 297   H HG   . SER A 1 39  ? 12.029  9.096   -2.980  1.00 0.00 ? 42  SER A HG   1  
ATOM 298   N N    . LYS A 1 40  ? 12.762  6.274   -0.363  1.00 0.00 ? 43  LYS A N    1  
ATOM 299   C CA   . LYS A 1 40  ? 11.937  5.899   0.783   1.00 0.00 ? 43  LYS A CA   1  
ATOM 300   C C    . LYS A 1 40  ? 10.597  6.638   0.764   1.00 0.00 ? 43  LYS A C    1  
ATOM 301   O O    . LYS A 1 40  ? 9.731   6.393   1.599   1.00 0.00 ? 43  LYS A O    1  
ATOM 302   C CB   . LYS A 1 40  ? 12.678  6.135   2.114   1.00 0.00 ? 43  LYS A CB   1  
ATOM 303   C CG   . LYS A 1 40  ? 12.724  7.581   2.599   1.00 0.00 ? 43  LYS A CG   1  
ATOM 304   C CD   . LYS A 1 40  ? 13.544  8.481   1.690   1.00 0.00 ? 43  LYS A CD   1  
ATOM 305   C CE   . LYS A 1 40  ? 13.853  9.810   2.362   1.00 0.00 ? 43  LYS A CE   1  
ATOM 306   N NZ   . LYS A 1 40  ? 12.623  10.485  2.858   1.00 0.00 ? 43  LYS A NZ   1  
ATOM 307   H H    . LYS A 1 40  ? 13.528  6.873   -0.230  1.00 0.00 ? 43  LYS A H    1  
ATOM 308   H HA   . LYS A 1 40  ? 11.735  4.841   0.691   1.00 0.00 ? 43  LYS A HA   1  
ATOM 309   H HB2  . LYS A 1 40  ? 12.197  5.548   2.881   1.00 0.00 ? 43  LYS A HB2  1  
ATOM 310   H HB3  . LYS A 1 40  ? 13.696  5.788   2.003   1.00 0.00 ? 43  LYS A HB3  1  
ATOM 311   H HG2  . LYS A 1 40  ? 11.714  7.962   2.641   1.00 0.00 ? 43  LYS A HG2  1  
ATOM 312   H HG3  . LYS A 1 40  ? 13.154  7.598   3.590   1.00 0.00 ? 43  LYS A HG3  1  
ATOM 313   H HD2  . LYS A 1 40  ? 14.472  7.985   1.449   1.00 0.00 ? 43  LYS A HD2  1  
ATOM 314   H HD3  . LYS A 1 40  ? 12.986  8.668   0.784   1.00 0.00 ? 43  LYS A HD3  1  
ATOM 315   H HE2  . LYS A 1 40  ? 14.516  9.632   3.196   1.00 0.00 ? 43  LYS A HE2  1  
ATOM 316   H HE3  . LYS A 1 40  ? 14.344  10.455  1.647   1.00 0.00 ? 43  LYS A HE3  1  
ATOM 317   H HZ1  . LYS A 1 40  ? 12.022  10.755  2.050   1.00 0.00 ? 43  LYS A HZ1  1  
ATOM 318   H HZ3  . LYS A 1 40  ? 12.881  11.355  3.371   1.00 0.00 ? 43  LYS A HZ3  1  
ATOM 319   N N    . CYS A 1 41  ? 10.434  7.544   -0.193  1.00 0.00 ? 44  CYS A N    1  
ATOM 320   C CA   . CYS A 1 41  ? 9.156   8.212   -0.396  1.00 0.00 ? 44  CYS A CA   1  
ATOM 321   C C    . CYS A 1 41  ? 8.555   7.786   -1.732  1.00 0.00 ? 44  CYS A C    1  
ATOM 322   O O    . CYS A 1 41  ? 7.658   8.442   -2.260  1.00 0.00 ? 44  CYS A O    1  
ATOM 323   C CB   . CYS A 1 41  ? 9.313   9.736   -0.357  1.00 0.00 ? 44  CYS A CB   1  
ATOM 324   S SG   . CYS A 1 41  ? 9.998   10.392  1.203   1.00 0.00 ? 44  CYS A SG   1  
ATOM 325   H H    . CYS A 1 41  ? 11.191  7.770   -0.774  1.00 0.00 ? 44  CYS A H    1  
ATOM 326   H HA   . CYS A 1 41  ? 8.491   7.906   0.397   1.00 0.00 ? 44  CYS A HA   1  
ATOM 327   H HB2  . CYS A 1 41  ? 9.974   10.040  -1.155  1.00 0.00 ? 44  CYS A HB2  1  
ATOM 328   H HB3  . CYS A 1 41  ? 8.346   10.192  -0.509  1.00 0.00 ? 44  CYS A HB3  1  
ATOM 329   N N    . GLN A 1 42  ? 9.054   6.680   -2.273  1.00 0.00 ? 45  GLN A N    1  
ATOM 330   C CA   . GLN A 1 42  ? 8.564   6.157   -3.544  1.00 0.00 ? 45  GLN A CA   1  
ATOM 331   C C    . GLN A 1 42  ? 8.902   4.677   -3.676  1.00 0.00 ? 45  GLN A C    1  
ATOM 332   O O    . GLN A 1 42  ? 9.993   4.305   -4.120  1.00 0.00 ? 45  GLN A O    1  
ATOM 333   C CB   . GLN A 1 42  ? 9.157   6.940   -4.719  1.00 0.00 ? 45  GLN A CB   1  
ATOM 334   C CG   . GLN A 1 42  ? 8.750   6.403   -6.087  1.00 0.00 ? 45  GLN A CG   1  
ATOM 335   C CD   . GLN A 1 42  ? 9.347   7.206   -7.228  1.00 0.00 ? 45  GLN A CD   1  
ATOM 336   O OE1  . GLN A 1 42  ? 9.575   8.407   -7.102  1.00 0.00 ? 45  GLN A OE1  1  
ATOM 337   N NE2  . GLN A 1 42  ? 9.603   6.549   -8.351  1.00 0.00 ? 45  GLN A NE2  1  
ATOM 338   H H    . GLN A 1 42  ? 9.765   6.194   -1.798  1.00 0.00 ? 45  GLN A H    1  
ATOM 339   H HA   . GLN A 1 42  ? 7.489   6.271   -3.551  1.00 0.00 ? 45  GLN A HA   1  
ATOM 340   H HB2  . GLN A 1 42  ? 8.833   7.966   -4.649  1.00 0.00 ? 45  GLN A HB2  1  
ATOM 341   H HB3  . GLN A 1 42  ? 10.232  6.907   -4.650  1.00 0.00 ? 45  GLN A HB3  1  
ATOM 342   H HG2  . GLN A 1 42  ? 9.085   5.379   -6.173  1.00 0.00 ? 45  GLN A HG2  1  
ATOM 343   H HG3  . GLN A 1 42  ? 7.674   6.435   -6.168  1.00 0.00 ? 45  GLN A HG3  1  
ATOM 344   H HE21 . GLN A 1 42  ? 9.394   5.594   -8.388  1.00 0.00 ? 45  GLN A HE21 1  
ATOM 345   H HE22 . GLN A 1 42  ? 10.001  7.049   -9.106  1.00 0.00 ? 45  GLN A HE22 1  
ATOM 346   N N    . GLY A 1 43  ? 7.956   3.839   -3.298  1.00 0.00 ? 46  GLY A N    1  
ATOM 347   C CA   . GLY A 1 43  ? 8.164   2.408   -3.354  1.00 0.00 ? 46  GLY A CA   1  
ATOM 348   C C    . GLY A 1 43  ? 6.865   1.651   -3.190  1.00 0.00 ? 46  GLY A C    1  
ATOM 349   O O    . GLY A 1 43  ? 5.782   2.237   -3.298  1.00 0.00 ? 46  GLY A O    1  
ATOM 350   H H    . GLY A 1 43  ? 7.097   4.194   -2.980  1.00 0.00 ? 46  GLY A H    1  
ATOM 351   H HA2  . GLY A 1 43  ? 8.605   2.154   -4.308  1.00 0.00 ? 46  GLY A HA2  1  
ATOM 352   H HA3  . GLY A 1 43  ? 8.843   2.121   -2.563  1.00 0.00 ? 46  GLY A HA3  1  
ATOM 353   N N    . GLN A 1 44  ? 6.963   0.357   -2.931  1.00 0.00 ? 47  GLN A N    1  
ATOM 354   C CA   . GLN A 1 44  ? 5.786   -0.464  -2.697  1.00 0.00 ? 47  GLN A CA   1  
ATOM 355   C C    . GLN A 1 44  ? 5.287   -0.254  -1.272  1.00 0.00 ? 47  GLN A C    1  
ATOM 356   O O    . GLN A 1 44  ? 6.080   -0.051  -0.355  1.00 0.00 ? 47  GLN A O    1  
ATOM 357   C CB   . GLN A 1 44  ? 6.091   -1.951  -2.936  1.00 0.00 ? 47  GLN A CB   1  
ATOM 358   C CG   . GLN A 1 44  ? 6.240   -2.342  -4.406  1.00 0.00 ? 47  GLN A CG   1  
ATOM 359   C CD   . GLN A 1 44  ? 7.516   -1.830  -5.051  1.00 0.00 ? 47  GLN A CD   1  
ATOM 360   O OE1  . GLN A 1 44  ? 8.545   -1.668  -4.394  1.00 0.00 ? 47  GLN A OE1  1  
ATOM 361   N NE2  . GLN A 1 44  ? 7.462   -1.579  -6.349  1.00 0.00 ? 47  GLN A NE2  1  
ATOM 362   H H    . GLN A 1 44  ? 7.855   -0.057  -2.870  1.00 0.00 ? 47  GLN A H    1  
ATOM 363   H HA   . GLN A 1 44  ? 5.018   -0.147  -3.384  1.00 0.00 ? 47  GLN A HA   1  
ATOM 364   H HB2  . GLN A 1 44  ? 7.012   -2.202  -2.430  1.00 0.00 ? 47  GLN A HB2  1  
ATOM 365   H HB3  . GLN A 1 44  ? 5.290   -2.540  -2.512  1.00 0.00 ? 47  GLN A HB3  1  
ATOM 366   H HG2  . GLN A 1 44  ? 6.236   -3.418  -4.474  1.00 0.00 ? 47  GLN A HG2  1  
ATOM 367   H HG3  . GLN A 1 44  ? 5.396   -1.948  -4.954  1.00 0.00 ? 47  GLN A HG3  1  
ATOM 368   H HE21 . GLN A 1 44  ? 6.610   -1.731  -6.820  1.00 0.00 ? 47  GLN A HE21 1  
ATOM 369   H HE22 . GLN A 1 44  ? 8.273   -1.258  -6.792  1.00 0.00 ? 47  GLN A HE22 1  
ATOM 370   N N    . LEU A 1 45  ? 3.976   -0.284  -1.094  1.00 0.00 ? 48  LEU A N    1  
ATOM 371   C CA   . LEU A 1 45  ? 3.386   -0.065  0.218   1.00 0.00 ? 48  LEU A CA   1  
ATOM 372   C C    . LEU A 1 45  ? 3.503   -1.321  1.073   1.00 0.00 ? 48  LEU A C    1  
ATOM 373   O O    . LEU A 1 45  ? 2.898   -2.353  0.777   1.00 0.00 ? 48  LEU A O    1  
ATOM 374   C CB   . LEU A 1 45  ? 1.918   0.355   0.087   1.00 0.00 ? 48  LEU A CB   1  
ATOM 375   C CG   . LEU A 1 45  ? 1.218   0.723   1.402   1.00 0.00 ? 48  LEU A CG   1  
ATOM 376   C CD1  . LEU A 1 45  ? 1.866   1.941   2.045   1.00 0.00 ? 48  LEU A CD1  1  
ATOM 377   C CD2  . LEU A 1 45  ? -0.263  0.971   1.156   1.00 0.00 ? 48  LEU A CD2  1  
ATOM 378   H H    . LEU A 1 45  ? 3.390   -0.458  -1.863  1.00 0.00 ? 48  LEU A H    1  
ATOM 379   H HA   . LEU A 1 45  ? 3.937   0.729   0.696   1.00 0.00 ? 48  LEU A HA   1  
ATOM 380   H HB2  . LEU A 1 45  ? 1.868   1.210   -0.572  1.00 0.00 ? 48  LEU A HB2  1  
ATOM 381   H HB3  . LEU A 1 45  ? 1.371   -0.462  -0.366  1.00 0.00 ? 48  LEU A HB3  1  
ATOM 382   H HG   . LEU A 1 45  ? 1.309   -0.105  2.092   1.00 0.00 ? 48  LEU A HG   1  
ATOM 383   H HD11 . LEU A 1 45  ? 1.845   2.769   1.354   1.00 0.00 ? 48  LEU A HD11 1  
ATOM 384   H HD12 . LEU A 1 45  ? 1.323   2.206   2.942   1.00 0.00 ? 48  LEU A HD12 1  
ATOM 385   H HD13 . LEU A 1 45  ? 2.889   1.713   2.301   1.00 0.00 ? 48  LEU A HD13 1  
ATOM 386   H HD21 . LEU A 1 45  ? -0.381  1.808   0.484   1.00 0.00 ? 48  LEU A HD21 1  
ATOM 387   H HD22 . LEU A 1 45  ? -0.707  0.089   0.716   1.00 0.00 ? 48  LEU A HD22 1  
ATOM 388   H HD23 . LEU A 1 45  ? -0.751  1.191   2.093   1.00 0.00 ? 48  LEU A HD23 1  
ATOM 389   N N    . GLU A 1 46  ? 4.300   -1.223  2.125   1.00 0.00 ? 49  GLU A N    1  
ATOM 390   C CA   . GLU A 1 46  ? 4.490   -2.322  3.055   1.00 0.00 ? 49  GLU A CA   1  
ATOM 391   C C    . GLU A 1 46  ? 3.842   -1.950  4.384   1.00 0.00 ? 49  GLU A C    1  
ATOM 392   O O    . GLU A 1 46  ? 4.192   -0.936  4.991   1.00 0.00 ? 49  GLU A O    1  
ATOM 393   C CB   . GLU A 1 46  ? 5.988   -2.603  3.238   1.00 0.00 ? 49  GLU A CB   1  
ATOM 394   C CG   . GLU A 1 46  ? 6.322   -4.043  3.598   1.00 0.00 ? 49  GLU A CG   1  
ATOM 395   C CD   . GLU A 1 46  ? 7.819   -4.293  3.644   1.00 0.00 ? 49  GLU A CD   1  
ATOM 396   O OE1  . GLU A 1 46  ? 8.486   -3.779  4.564   1.00 0.00 ? 49  GLU A OE1  1  
ATOM 397   O OE2  . GLU A 1 46  ? 8.338   -5.004  2.753   1.00 0.00 ? 49  GLU A OE2  1  
ATOM 398   H H    . GLU A 1 46  ? 4.773   -0.376  2.288   1.00 0.00 ? 49  GLU A H    1  
ATOM 399   H HA   . GLU A 1 46  ? 4.002   -3.195  2.651   1.00 0.00 ? 49  GLU A HA   1  
ATOM 400   H HB2  . GLU A 1 46  ? 6.504   -2.357  2.323   1.00 0.00 ? 49  GLU A HB2  1  
ATOM 401   H HB3  . GLU A 1 46  ? 6.360   -1.969  4.029   1.00 0.00 ? 49  GLU A HB3  1  
ATOM 402   H HG2  . GLU A 1 46  ? 5.901   -4.267  4.566   1.00 0.00 ? 49  GLU A HG2  1  
ATOM 403   H HG3  . GLU A 1 46  ? 5.889   -4.697  2.856   1.00 0.00 ? 49  GLU A HG3  1  
ATOM 404   N N    . VAL A 1 47  ? 2.883   -2.752  4.817   1.00 0.00 ? 50  VAL A N    1  
ATOM 405   C CA   . VAL A 1 47  ? 2.092   -2.426  5.995   1.00 0.00 ? 50  VAL A CA   1  
ATOM 406   C C    . VAL A 1 47  ? 2.316   -3.427  7.120   1.00 0.00 ? 50  VAL A C    1  
ATOM 407   O O    . VAL A 1 47  ? 2.692   -4.576  6.884   1.00 0.00 ? 50  VAL A O    1  
ATOM 408   C CB   . VAL A 1 47  ? 0.582   -2.365  5.667   1.00 0.00 ? 50  VAL A CB   1  
ATOM 409   C CG1  . VAL A 1 47  ? 0.305   -1.311  4.607   1.00 0.00 ? 50  VAL A CG1  1  
ATOM 410   C CG2  . VAL A 1 47  ? 0.064   -3.723  5.218   1.00 0.00 ? 50  VAL A CG2  1  
ATOM 411   H H    . VAL A 1 47  ? 2.709   -3.595  4.339   1.00 0.00 ? 50  VAL A H    1  
ATOM 412   H HA   . VAL A 1 47  ? 2.400   -1.448  6.336   1.00 0.00 ? 50  VAL A HA   1  
ATOM 413   H HB   . VAL A 1 47  ? 0.055   -2.085  6.568   1.00 0.00 ? 50  VAL A HB   1  
ATOM 414   H HG11 . VAL A 1 47  ? -0.757  -1.269  4.411   1.00 0.00 ? 50  VAL A HG11 1  
ATOM 415   H HG12 . VAL A 1 47  ? 0.644   -0.348  4.957   1.00 0.00 ? 50  VAL A HG12 1  
ATOM 416   H HG13 . VAL A 1 47  ? 0.828   -1.571  3.697   1.00 0.00 ? 50  VAL A HG13 1  
ATOM 417   H HG21 . VAL A 1 47  ? 0.276   -4.458  5.979   1.00 0.00 ? 50  VAL A HG21 1  
ATOM 418   H HG22 . VAL A 1 47  ? -1.001  -3.667  5.059   1.00 0.00 ? 50  VAL A HG22 1  
ATOM 419   H HG23 . VAL A 1 47  ? 0.551   -4.007  4.298   1.00 0.00 ? 50  VAL A HG23 1  
ATOM 420   N N    . TYR A 1 48  ? 2.084   -2.977  8.343   1.00 0.00 ? 51  TYR A N    1  
ATOM 421   C CA   . TYR A 1 48  ? 2.258   -3.814  9.518   1.00 0.00 ? 51  TYR A CA   1  
ATOM 422   C C    . TYR A 1 48  ? 0.943   -4.484  9.906   1.00 0.00 ? 51  TYR A C    1  
ATOM 423   O O    . TYR A 1 48  ? -0.037  -3.813  10.232  1.00 0.00 ? 51  TYR A O    1  
ATOM 424   C CB   . TYR A 1 48  ? 2.793   -2.968  10.684  1.00 0.00 ? 51  TYR A CB   1  
ATOM 425   C CG   . TYR A 1 48  ? 2.874   -3.704  12.007  1.00 0.00 ? 51  TYR A CG   1  
ATOM 426   C CD1  . TYR A 1 48  ? 3.940   -4.547  12.301  1.00 0.00 ? 51  TYR A CD1  1  
ATOM 427   C CD2  . TYR A 1 48  ? 1.878   -3.551  12.966  1.00 0.00 ? 51  TYR A CD2  1  
ATOM 428   C CE1  . TYR A 1 48  ? 4.010   -5.212  13.511  1.00 0.00 ? 51  TYR A CE1  1  
ATOM 429   C CE2  . TYR A 1 48  ? 1.943   -4.214  14.174  1.00 0.00 ? 51  TYR A CE2  1  
ATOM 430   C CZ   . TYR A 1 48  ? 3.007   -5.042  14.441  1.00 0.00 ? 51  TYR A CZ   1  
ATOM 431   O OH   . TYR A 1 48  ? 3.077   -5.698  15.649  1.00 0.00 ? 51  TYR A OH   1  
ATOM 432   H H    . TYR A 1 48  ? 1.787   -2.047  8.459   1.00 0.00 ? 51  TYR A H    1  
ATOM 433   H HA   . TYR A 1 48  ? 2.980   -4.579  9.279   1.00 0.00 ? 51  TYR A HA   1  
ATOM 434   H HB2  . TYR A 1 48  ? 3.786   -2.618  10.439  1.00 0.00 ? 51  TYR A HB2  1  
ATOM 435   H HB3  . TYR A 1 48  ? 2.143   -2.116  10.820  1.00 0.00 ? 51  TYR A HB3  1  
ATOM 436   H HD1  . TYR A 1 48  ? 4.723   -4.680  11.569  1.00 0.00 ? 51  TYR A HD1  1  
ATOM 437   H HD2  . TYR A 1 48  ? 1.042   -2.901  12.756  1.00 0.00 ? 51  TYR A HD2  1  
ATOM 438   H HE1  . TYR A 1 48  ? 4.846   -5.861  13.722  1.00 0.00 ? 51  TYR A HE1  1  
ATOM 439   H HE2  . TYR A 1 48  ? 1.158   -4.085  14.903  1.00 0.00 ? 51  TYR A HE2  1  
ATOM 440   H HH   . TYR A 1 48  ? 3.960   -5.566  16.032  1.00 0.00 ? 51  TYR A HH   1  
ATOM 441   N N    . LEU A 1 49  ? 0.926   -5.807  9.848   1.00 0.00 ? 52  LEU A N    1  
ATOM 442   C CA   . LEU A 1 49  ? -0.215  -6.582  10.317  1.00 0.00 ? 52  LEU A CA   1  
ATOM 443   C C    . LEU A 1 49  ? 0.132   -7.239  11.650  1.00 0.00 ? 52  LEU A C    1  
ATOM 444   O O    . LEU A 1 49  ? 1.233   -7.036  12.164  1.00 0.00 ? 52  LEU A O    1  
ATOM 445   C CB   . LEU A 1 49  ? -0.602  -7.659  9.295   1.00 0.00 ? 52  LEU A CB   1  
ATOM 446   C CG   . LEU A 1 49  ? -0.932  -7.157  7.887   1.00 0.00 ? 52  LEU A CG   1  
ATOM 447   C CD1  . LEU A 1 49  ? -1.179  -8.332  6.957   1.00 0.00 ? 52  LEU A CD1  1  
ATOM 448   C CD2  . LEU A 1 49  ? -2.146  -6.239  7.910   1.00 0.00 ? 52  LEU A CD2  1  
ATOM 449   H H    . LEU A 1 49  ? 1.707   -6.277  9.484   1.00 0.00 ? 52  LEU A H    1  
ATOM 450   H HA   . LEU A 1 49  ? -1.046  -5.907  10.460  1.00 0.00 ? 52  LEU A HA   1  
ATOM 451   H HB2  . LEU A 1 49  ? 0.213   -8.361  9.219   1.00 0.00 ? 52  LEU A HB2  1  
ATOM 452   H HB3  . LEU A 1 49  ? -1.467  -8.184  9.670   1.00 0.00 ? 52  LEU A HB3  1  
ATOM 453   H HG   . LEU A 1 49  ? -0.091  -6.596  7.503   1.00 0.00 ? 52  LEU A HG   1  
ATOM 454   H HD11 . LEU A 1 49  ? -0.283  -8.932  6.887   1.00 0.00 ? 52  LEU A HD11 1  
ATOM 455   H HD12 . LEU A 1 49  ? -1.987  -8.934  7.344   1.00 0.00 ? 52  LEU A HD12 1  
ATOM 456   H HD13 . LEU A 1 49  ? -1.444  -7.965  5.977   1.00 0.00 ? 52  LEU A HD13 1  
ATOM 457   H HD21 . LEU A 1 49  ? -2.370  -5.912  6.906   1.00 0.00 ? 52  LEU A HD21 1  
ATOM 458   H HD22 . LEU A 1 49  ? -2.994  -6.775  8.311   1.00 0.00 ? 52  LEU A HD22 1  
ATOM 459   H HD23 . LEU A 1 49  ? -1.938  -5.379  8.528   1.00 0.00 ? 52  LEU A HD23 1  
ATOM 460   N N    . LYS A 1 50  ? -0.787  -8.028  12.201  1.00 0.00 ? 53  LYS A N    1  
ATOM 461   C CA   . LYS A 1 50  ? -0.526  -8.754  13.447  1.00 0.00 ? 53  LYS A CA   1  
ATOM 462   C C    . LYS A 1 50  ? 0.711   -9.633  13.293  1.00 0.00 ? 53  LYS A C    1  
ATOM 463   O O    . LYS A 1 50  ? 1.581   -9.673  14.166  1.00 0.00 ? 53  LYS A O    1  
ATOM 464   C CB   . LYS A 1 50  ? -1.723  -9.633  13.834  1.00 0.00 ? 53  LYS A CB   1  
ATOM 465   C CG   . LYS A 1 50  ? -3.013  -8.869  14.081  1.00 0.00 ? 53  LYS A CG   1  
ATOM 466   C CD   . LYS A 1 50  ? -4.138  -9.816  14.466  1.00 0.00 ? 53  LYS A CD   1  
ATOM 467   C CE   . LYS A 1 50  ? -5.446  -9.076  14.682  1.00 0.00 ? 53  LYS A CE   1  
ATOM 468   N NZ   . LYS A 1 50  ? -6.553  -10.009 15.026  1.00 0.00 ? 53  LYS A NZ   1  
ATOM 469   H H    . LYS A 1 50  ? -1.657  -8.123  11.765  1.00 0.00 ? 53  LYS A H    1  
ATOM 470   H HA   . LYS A 1 50  ? -0.348  -8.028  14.225  1.00 0.00 ? 53  LYS A HA   1  
ATOM 471   H HB2  . LYS A 1 50  ? -1.904  -10.343 13.042  1.00 0.00 ? 53  LYS A HB2  1  
ATOM 472   H HB3  . LYS A 1 50  ? -1.476  -10.175 14.735  1.00 0.00 ? 53  LYS A HB3  1  
ATOM 473   H HG2  . LYS A 1 50  ? -2.858  -8.162  14.882  1.00 0.00 ? 53  LYS A HG2  1  
ATOM 474   H HG3  . LYS A 1 50  ? -3.290  -8.344  13.181  1.00 0.00 ? 53  LYS A HG3  1  
ATOM 475   H HD2  . LYS A 1 50  ? -4.272  -10.539 13.675  1.00 0.00 ? 53  LYS A HD2  1  
ATOM 476   H HD3  . LYS A 1 50  ? -3.868  -10.326 15.378  1.00 0.00 ? 53  LYS A HD3  1  
ATOM 477   H HE2  . LYS A 1 50  ? -5.318  -8.371  15.489  1.00 0.00 ? 53  LYS A HE2  1  
ATOM 478   H HE3  . LYS A 1 50  ? -5.701  -8.546  13.776  1.00 0.00 ? 53  LYS A HE3  1  
ATOM 479   H HZ1  . LYS A 1 50  ? -7.442  -9.471  15.122  1.00 0.00 ? 53  LYS A HZ1  1  
ATOM 480   H HZ3  . LYS A 1 50  ? -6.674  -10.702 14.254  1.00 0.00 ? 53  LYS A HZ3  1  
ATOM 481   N N    . ASP A 1 51  ? 0.767   -10.334 12.168  1.00 0.00 ? 54  ASP A N    1  
ATOM 482   C CA   . ASP A 1 51  ? 1.890   -11.202 11.838  1.00 0.00 ? 54  ASP A CA   1  
ATOM 483   C C    . ASP A 1 51  ? 3.168   -10.392 11.675  1.00 0.00 ? 54  ASP A C    1  
ATOM 484   O O    . ASP A 1 51  ? 4.214   -10.732 12.224  1.00 0.00 ? 54  ASP A O    1  
ATOM 485   C CB   . ASP A 1 51  ? 1.605   -11.958 10.540  1.00 0.00 ? 54  ASP A CB   1  
ATOM 486   C CG   . ASP A 1 51  ? 0.227   -12.585 10.523  1.00 0.00 ? 54  ASP A CG   1  
ATOM 487   O OD1  . ASP A 1 51  ? -0.748  -11.867 10.215  1.00 0.00 ? 54  ASP A OD1  1  
ATOM 488   O OD2  . ASP A 1 51  ? 0.111   -13.791 10.826  1.00 0.00 ? 54  ASP A OD2  1  
ATOM 489   H H    . ASP A 1 51  ? 0.011   -10.282 11.541  1.00 0.00 ? 54  ASP A H    1  
ATOM 490   H HA   . ASP A 1 51  ? 2.018   -11.910 12.643  1.00 0.00 ? 54  ASP A HA   1  
ATOM 491   H HB2  . ASP A 1 51  ? 1.676   -11.272 9.709   1.00 0.00 ? 54  ASP A HB2  1  
ATOM 492   H HB3  . ASP A 1 51  ? 2.339   -12.743 10.419  1.00 0.00 ? 54  ASP A HB3  1  
ATOM 493   N N    . GLY A 1 52  ? 3.067   -9.308  10.927  1.00 0.00 ? 55  GLY A N    1  
ATOM 494   C CA   . GLY A 1 52  ? 4.223   -8.486  10.656  1.00 0.00 ? 55  GLY A CA   1  
ATOM 495   C C    . GLY A 1 52  ? 4.072   -7.700  9.374   1.00 0.00 ? 55  GLY A C    1  
ATOM 496   O O    . GLY A 1 52  ? 2.951   -7.505  8.889   1.00 0.00 ? 55  GLY A O    1  
ATOM 497   H H    . GLY A 1 52  ? 2.196   -9.056  10.561  1.00 0.00 ? 55  GLY A H    1  
ATOM 498   H HA2  . GLY A 1 52  ? 4.365   -7.796  11.476  1.00 0.00 ? 55  GLY A HA2  1  
ATOM 499   H HA3  . GLY A 1 52  ? 5.092   -9.121  10.578  1.00 0.00 ? 55  GLY A HA3  1  
ATOM 500   N N    . TRP A 1 53  ? 5.193   -7.281  8.808   1.00 0.00 ? 56  TRP A N    1  
ATOM 501   C CA   . TRP A 1 53  ? 5.189   -6.433  7.623   1.00 0.00 ? 56  TRP A CA   1  
ATOM 502   C C    . TRP A 1 53  ? 4.807   -7.221  6.379   1.00 0.00 ? 56  TRP A C    1  
ATOM 503   O O    . TRP A 1 53  ? 5.357   -8.289  6.108   1.00 0.00 ? 56  TRP A O    1  
ATOM 504   C CB   . TRP A 1 53  ? 6.554   -5.765  7.444   1.00 0.00 ? 56  TRP A CB   1  
ATOM 505   C CG   . TRP A 1 53  ? 6.846   -4.770  8.524   1.00 0.00 ? 56  TRP A CG   1  
ATOM 506   C CD1  . TRP A 1 53  ? 7.572   -4.977  9.662   1.00 0.00 ? 56  TRP A CD1  1  
ATOM 507   C CD2  . TRP A 1 53  ? 6.397   -3.413  8.574   1.00 0.00 ? 56  TRP A CD2  1  
ATOM 508   N NE1  . TRP A 1 53  ? 7.598   -3.830  10.416  1.00 0.00 ? 56  TRP A NE1  1  
ATOM 509   C CE2  . TRP A 1 53  ? 6.885   -2.856  9.768   1.00 0.00 ? 56  TRP A CE2  1  
ATOM 510   C CE3  . TRP A 1 53  ? 5.627   -2.615  7.722   1.00 0.00 ? 56  TRP A CE3  1  
ATOM 511   C CZ2  . TRP A 1 53  ? 6.630   -1.535  10.131  1.00 0.00 ? 56  TRP A CZ2  1  
ATOM 512   C CZ3  . TRP A 1 53  ? 5.375   -1.309  8.085   1.00 0.00 ? 56  TRP A CZ3  1  
ATOM 513   C CH2  . TRP A 1 53  ? 5.873   -0.779  9.279   1.00 0.00 ? 56  TRP A CH2  1  
ATOM 514   H H    . TRP A 1 53  ? 6.053   -7.566  9.186   1.00 0.00 ? 56  TRP A H    1  
ATOM 515   H HA   . TRP A 1 53  ? 4.447   -5.664  7.779   1.00 0.00 ? 56  TRP A HA   1  
ATOM 516   H HB2  . TRP A 1 53  ? 7.327   -6.519  7.461   1.00 0.00 ? 56  TRP A HB2  1  
ATOM 517   H HB3  . TRP A 1 53  ? 6.580   -5.249  6.493   1.00 0.00 ? 56  TRP A HB3  1  
ATOM 518   H HD1  . TRP A 1 53  ? 8.048   -5.911  9.921   1.00 0.00 ? 56  TRP A HD1  1  
ATOM 519   H HE1  . TRP A 1 53  ? 8.058   -3.724  11.284  1.00 0.00 ? 56  TRP A HE1  1  
ATOM 520   H HE3  . TRP A 1 53  ? 5.234   -3.002  6.794   1.00 0.00 ? 56  TRP A HE3  1  
ATOM 521   H HZ2  . TRP A 1 53  ? 7.008   -1.111  11.048  1.00 0.00 ? 56  TRP A HZ2  1  
ATOM 522   H HZ3  . TRP A 1 53  ? 4.780   -0.678  7.439   1.00 0.00 ? 56  TRP A HZ3  1  
ATOM 523   H HH2  . TRP A 1 53  ? 5.646   0.249   9.519   1.00 0.00 ? 56  TRP A HH2  1  
ATOM 524   N N    . HIS A 1 54  ? 3.838   -6.696  5.645   1.00 0.00 ? 57  HIS A N    1  
ATOM 525   C CA   . HIS A 1 54  ? 3.352   -7.328  4.427   1.00 0.00 ? 57  HIS A CA   1  
ATOM 526   C C    . HIS A 1 54  ? 3.087   -6.275  3.356   1.00 0.00 ? 57  HIS A C    1  
ATOM 527   O O    . HIS A 1 54  ? 2.619   -5.180  3.656   1.00 0.00 ? 57  HIS A O    1  
ATOM 528   C CB   . HIS A 1 54  ? 2.070   -8.121  4.711   1.00 0.00 ? 57  HIS A CB   1  
ATOM 529   C CG   . HIS A 1 54  ? 2.299   -9.392  5.472   1.00 0.00 ? 57  HIS A CG   1  
ATOM 530   N ND1  . HIS A 1 54  ? 2.344   -9.447  6.850   1.00 0.00 ? 57  HIS A ND1  1  
ATOM 531   C CD2  . HIS A 1 54  ? 2.497   -10.663 5.043   1.00 0.00 ? 57  HIS A CD2  1  
ATOM 532   C CE1  . HIS A 1 54  ? 2.560   -10.692 7.232   1.00 0.00 ? 57  HIS A CE1  1  
ATOM 533   N NE2  . HIS A 1 54  ? 2.657   -11.448 6.157   1.00 0.00 ? 57  HIS A NE2  1  
ATOM 534   H H    . HIS A 1 54  ? 3.430   -5.842  5.934   1.00 0.00 ? 57  HIS A H    1  
ATOM 535   H HA   . HIS A 1 54  ? 4.116   -8.005  4.077   1.00 0.00 ? 57  HIS A HA   1  
ATOM 536   H HB2  . HIS A 1 54  ? 1.397   -7.507  5.290   1.00 0.00 ? 57  HIS A HB2  1  
ATOM 537   H HB3  . HIS A 1 54  ? 1.600   -8.376  3.773   1.00 0.00 ? 57  HIS A HB3  1  
ATOM 538   H HD1  . HIS A 1 54  ? 2.247   -8.683  7.457   1.00 0.00 ? 57  HIS A HD1  1  
ATOM 539   H HD2  . HIS A 1 54  ? 2.525   -10.995 4.014   1.00 0.00 ? 57  HIS A HD2  1  
ATOM 540   H HE1  . HIS A 1 54  ? 2.640   -11.032 8.254   1.00 0.00 ? 57  HIS A HE1  1  
ATOM 541   N N    . MET A 1 55  ? 3.396   -6.614  2.114   1.00 0.00 ? 58  MET A N    1  
ATOM 542   C CA   . MET A 1 55  ? 3.205   -5.705  0.991   1.00 0.00 ? 58  MET A CA   1  
ATOM 543   C C    . MET A 1 55  ? 1.748   -5.712  0.553   1.00 0.00 ? 58  MET A C    1  
ATOM 544   O O    . MET A 1 55  ? 1.063   -6.719  0.695   1.00 0.00 ? 58  MET A O    1  
ATOM 545   C CB   . MET A 1 55  ? 4.085   -6.127  -0.190  1.00 0.00 ? 58  MET A CB   1  
ATOM 546   C CG   . MET A 1 55  ? 5.579   -6.054  0.084   1.00 0.00 ? 58  MET A CG   1  
ATOM 547   S SD   . MET A 1 55  ? 6.552   -6.800  -1.240  1.00 0.00 ? 58  MET A SD   1  
ATOM 548   C CE   . MET A 1 55  ? 5.919   -5.923  -2.670  1.00 0.00 ? 58  MET A CE   1  
ATOM 549   H H    . MET A 1 55  ? 3.744   -7.513  1.942   1.00 0.00 ? 58  MET A H    1  
ATOM 550   H HA   . MET A 1 55  ? 3.482   -4.713  1.310   1.00 0.00 ? 58  MET A HA   1  
ATOM 551   H HB2  . MET A 1 55  ? 3.843   -7.144  -0.457  1.00 0.00 ? 58  MET A HB2  1  
ATOM 552   H HB3  . MET A 1 55  ? 3.865   -5.486  -1.031  1.00 0.00 ? 58  MET A HB3  1  
ATOM 553   H HG2  . MET A 1 55  ? 5.866   -5.019  0.186   1.00 0.00 ? 58  MET A HG2  1  
ATOM 554   H HG3  . MET A 1 55  ? 5.790   -6.577  1.007   1.00 0.00 ? 58  MET A HG3  1  
ATOM 555   H HE1  . MET A 1 55  ? 6.428   -6.269  -3.556  1.00 0.00 ? 58  MET A HE1  1  
ATOM 556   H HE2  . MET A 1 55  ? 4.858   -6.109  -2.767  1.00 0.00 ? 58  MET A HE2  1  
ATOM 557   H HE3  . MET A 1 55  ? 6.088   -4.863  -2.548  1.00 0.00 ? 58  MET A HE3  1  
ATOM 558   N N    . VAL A 1 56  ? 1.277   -4.601  0.013   1.00 0.00 ? 59  VAL A N    1  
ATOM 559   C CA   . VAL A 1 56  ? -0.093  -4.525  -0.472  1.00 0.00 ? 59  VAL A CA   1  
ATOM 560   C C    . VAL A 1 56  ? -0.135  -4.748  -1.984  1.00 0.00 ? 59  VAL A C    1  
ATOM 561   O O    . VAL A 1 56  ? 0.662   -4.175  -2.731  1.00 0.00 ? 59  VAL A O    1  
ATOM 562   C CB   . VAL A 1 56  ? -0.748  -3.165  -0.131  1.00 0.00 ? 59  VAL A CB   1  
ATOM 563   C CG1  . VAL A 1 56  ? -2.199  -3.128  -0.591  1.00 0.00 ? 59  VAL A CG1  1  
ATOM 564   C CG2  . VAL A 1 56  ? -0.663  -2.883  1.361   1.00 0.00 ? 59  VAL A CG2  1  
ATOM 565   H H    . VAL A 1 56  ? 1.863   -3.815  -0.064  1.00 0.00 ? 59  VAL A H    1  
ATOM 566   H HA   . VAL A 1 56  ? -0.661  -5.308  0.012   1.00 0.00 ? 59  VAL A HA   1  
ATOM 567   H HB   . VAL A 1 56  ? -0.208  -2.388  -0.652  1.00 0.00 ? 59  VAL A HB   1  
ATOM 568   H HG11 . VAL A 1 56  ? -2.759  -3.895  -0.077  1.00 0.00 ? 59  VAL A HG11 1  
ATOM 569   H HG12 . VAL A 1 56  ? -2.620  -2.161  -0.364  1.00 0.00 ? 59  VAL A HG12 1  
ATOM 570   H HG13 . VAL A 1 56  ? -2.244  -3.301  -1.656  1.00 0.00 ? 59  VAL A HG13 1  
ATOM 571   H HG21 . VAL A 1 56  ? -1.140  -3.682  1.907   1.00 0.00 ? 59  VAL A HG21 1  
ATOM 572   H HG22 . VAL A 1 56  ? 0.372   -2.809  1.657   1.00 0.00 ? 59  VAL A HG22 1  
ATOM 573   H HG23 . VAL A 1 56  ? -1.166  -1.952  1.577   1.00 0.00 ? 59  VAL A HG23 1  
ATOM 574   N N    . CYS A 1 57  ? -1.051  -5.601  -2.421  1.00 0.00 ? 60  CYS A N    1  
ATOM 575   C CA   . CYS A 1 57  ? -1.225  -5.893  -3.838  1.00 0.00 ? 60  CYS A CA   1  
ATOM 576   C C    . CYS A 1 57  ? -2.255  -4.929  -4.427  1.00 0.00 ? 60  CYS A C    1  
ATOM 577   O O    . CYS A 1 57  ? -3.290  -4.675  -3.810  1.00 0.00 ? 60  CYS A O    1  
ATOM 578   C CB   . CYS A 1 57  ? -1.680  -7.350  -4.009  1.00 0.00 ? 60  CYS A CB   1  
ATOM 579   S SG   . CYS A 1 57  ? -1.593  -7.998  -5.711  1.00 0.00 ? 60  CYS A SG   1  
ATOM 580   H H    . CYS A 1 57  ? -1.639  -6.045  -1.770  1.00 0.00 ? 60  CYS A H    1  
ATOM 581   H HA   . CYS A 1 57  ? -0.276  -5.749  -4.334  1.00 0.00 ? 60  CYS A HA   1  
ATOM 582   H HB2  . CYS A 1 57  ? -1.063  -7.986  -3.391  1.00 0.00 ? 60  CYS A HB2  1  
ATOM 583   H HB3  . CYS A 1 57  ? -2.709  -7.433  -3.682  1.00 0.00 ? 60  CYS A HB3  1  
ATOM 584   N N    . SER A 1 58  ? -1.978  -4.392  -5.613  1.00 0.00 ? 61  SER A N    1  
ATOM 585   C CA   . SER A 1 58  ? -2.858  -3.401  -6.233  1.00 0.00 ? 61  SER A CA   1  
ATOM 586   C C    . SER A 1 58  ? -4.065  -4.062  -6.910  1.00 0.00 ? 61  SER A C    1  
ATOM 587   O O    . SER A 1 58  ? -4.469  -3.693  -8.013  1.00 0.00 ? 61  SER A O    1  
ATOM 588   C CB   . SER A 1 58  ? -2.069  -2.542  -7.223  1.00 0.00 ? 61  SER A CB   1  
ATOM 589   O OG   . SER A 1 58  ? -1.210  -3.333  -8.023  1.00 0.00 ? 61  SER A OG   1  
ATOM 590   H H    . SER A 1 58  ? -1.162  -4.673  -6.089  1.00 0.00 ? 61  SER A H    1  
ATOM 591   H HA   . SER A 1 58  ? -3.224  -2.762  -5.445  1.00 0.00 ? 61  SER A HA   1  
ATOM 592   H HB2  . SER A 1 58  ? -2.756  -2.017  -7.868  1.00 0.00 ? 61  SER A HB2  1  
ATOM 593   H HB3  . SER A 1 58  ? -1.469  -1.829  -6.676  1.00 0.00 ? 61  SER A HB3  1  
ATOM 594   H HG   . SER A 1 58  ? -0.304  -3.017  -7.929  1.00 0.00 ? 61  SER A HG   1  
ATOM 595   N N    . GLN A 1 59  ? -4.621  -5.048  -6.225  1.00 0.00 ? 62  GLN A N    1  
ATOM 596   C CA   . GLN A 1 59  ? -5.854  -5.705  -6.632  1.00 0.00 ? 62  GLN A CA   1  
ATOM 597   C C    . GLN A 1 59  ? -6.780  -5.751  -5.415  1.00 0.00 ? 62  GLN A C    1  
ATOM 598   O O    . GLN A 1 59  ? -7.664  -6.596  -5.298  1.00 0.00 ? 62  GLN A O    1  
ATOM 599   C CB   . GLN A 1 59  ? -5.542  -7.121  -7.144  1.00 0.00 ? 62  GLN A CB   1  
ATOM 600   C CG   . GLN A 1 59  ? -6.717  -7.837  -7.796  1.00 0.00 ? 62  GLN A CG   1  
ATOM 601   C CD   . GLN A 1 59  ? -7.208  -7.147  -9.053  1.00 0.00 ? 62  GLN A CD   1  
ATOM 602   O OE1  . GLN A 1 59  ? -6.729  -7.416  -10.152 1.00 0.00 ? 62  GLN A OE1  1  
ATOM 603   N NE2  . GLN A 1 59  ? -8.177  -6.260  -8.901  1.00 0.00 ? 62  GLN A NE2  1  
ATOM 604   H H    . GLN A 1 59  ? -4.178  -5.352  -5.401  1.00 0.00 ? 62  GLN A H    1  
ATOM 605   H HA   . GLN A 1 59  ? -6.315  -5.122  -7.417  1.00 0.00 ? 62  GLN A HA   1  
ATOM 606   H HB2  . GLN A 1 59  ? -4.746  -7.059  -7.870  1.00 0.00 ? 62  GLN A HB2  1  
ATOM 607   H HB3  . GLN A 1 59  ? -5.206  -7.721  -6.311  1.00 0.00 ? 62  GLN A HB3  1  
ATOM 608   H HG2  . GLN A 1 59  ? -6.413  -8.840  -8.051  1.00 0.00 ? 62  GLN A HG2  1  
ATOM 609   H HG3  . GLN A 1 59  ? -7.530  -7.880  -7.086  1.00 0.00 ? 62  GLN A HG3  1  
ATOM 610   H HE21 . GLN A 1 59  ? -8.517  -6.097  -7.996  1.00 0.00 ? 62  GLN A HE21 1  
ATOM 611   H HE22 . GLN A 1 59  ? -8.517  -5.805  -9.697  1.00 0.00 ? 62  GLN A HE22 1  
ATOM 612   N N    . SER A 1 60  ? -6.567  -4.799  -4.512  1.00 0.00 ? 63  SER A N    1  
ATOM 613   C CA   . SER A 1 60  ? -7.197  -4.818  -3.204  1.00 0.00 ? 63  SER A CA   1  
ATOM 614   C C    . SER A 1 60  ? -8.407  -3.891  -3.170  1.00 0.00 ? 63  SER A C    1  
ATOM 615   O O    . SER A 1 60  ? -8.510  -2.965  -3.974  1.00 0.00 ? 63  SER A O    1  
ATOM 616   C CB   . SER A 1 60  ? -6.174  -4.395  -2.139  1.00 0.00 ? 63  SER A CB   1  
ATOM 617   O OG   . SER A 1 60  ? -6.679  -4.579  -0.829  1.00 0.00 ? 63  SER A OG   1  
ATOM 618   H H    . SER A 1 60  ? -5.986  -4.047  -4.743  1.00 0.00 ? 63  SER A H    1  
ATOM 619   H HA   . SER A 1 60  ? -7.520  -5.829  -3.003  1.00 0.00 ? 63  SER A HA   1  
ATOM 620   H HB2  . SER A 1 60  ? -5.277  -4.984  -2.249  1.00 0.00 ? 63  SER A HB2  1  
ATOM 621   H HB3  . SER A 1 60  ? -5.935  -3.347  -2.271  1.00 0.00 ? 63  SER A HB3  1  
ATOM 622   H HG   . SER A 1 60  ? -6.926  -3.723  -0.460  1.00 0.00 ? 63  SER A HG   1  
ATOM 623   N N    . TRP A 1 61  ? -9.320  -4.165  -2.238  1.00 0.00 ? 64  TRP A N    1  
ATOM 624   C CA   . TRP A 1 61  ? -10.513 -3.340  -2.010  1.00 0.00 ? 64  TRP A CA   1  
ATOM 625   C C    . TRP A 1 61  ? -11.392 -3.251  -3.254  1.00 0.00 ? 64  TRP A C    1  
ATOM 626   O O    . TRP A 1 61  ? -12.176 -2.312  -3.404  1.00 0.00 ? 64  TRP A O    1  
ATOM 627   C CB   . TRP A 1 61  ? -10.120 -1.934  -1.542  1.00 0.00 ? 64  TRP A CB   1  
ATOM 628   C CG   . TRP A 1 61  ? -9.297  -1.935  -0.287  1.00 0.00 ? 64  TRP A CG   1  
ATOM 629   C CD1  . TRP A 1 61  ? -9.706  -2.295  0.964   1.00 0.00 ? 64  TRP A CD1  1  
ATOM 630   C CD2  . TRP A 1 61  ? -7.923  -1.552  -0.163  1.00 0.00 ? 64  TRP A CD2  1  
ATOM 631   N NE1  . TRP A 1 61  ? -8.668  -2.164  1.855   1.00 0.00 ? 64  TRP A NE1  1  
ATOM 632   C CE2  . TRP A 1 61  ? -7.565  -1.711  1.187   1.00 0.00 ? 64  TRP A CE2  1  
ATOM 633   C CE3  . TRP A 1 61  ? -6.960  -1.095  -1.066  1.00 0.00 ? 64  TRP A CE3  1  
ATOM 634   C CZ2  . TRP A 1 61  ? -6.287  -1.424  1.656   1.00 0.00 ? 64  TRP A CZ2  1  
ATOM 635   C CZ3  . TRP A 1 61  ? -5.693  -0.813  -0.598  1.00 0.00 ? 64  TRP A CZ3  1  
ATOM 636   C CH2  . TRP A 1 61  ? -5.366  -0.979  0.751   1.00 0.00 ? 64  TRP A CH2  1  
ATOM 637   H H    . TRP A 1 61  ? -9.184  -4.958  -1.668  1.00 0.00 ? 64  TRP A H    1  
ATOM 638   H HA   . TRP A 1 61  ? -11.086 -3.815  -1.228  1.00 0.00 ? 64  TRP A HA   1  
ATOM 639   H HB2  . TRP A 1 61  ? -9.544  -1.450  -2.318  1.00 0.00 ? 64  TRP A HB2  1  
ATOM 640   H HB3  . TRP A 1 61  ? -11.018 -1.358  -1.354  1.00 0.00 ? 64  TRP A HB3  1  
ATOM 641   H HD1  . TRP A 1 61  ? -10.702 -2.632  1.207   1.00 0.00 ? 64  TRP A HD1  1  
ATOM 642   H HE1  . TRP A 1 61  ? -8.712  -2.365  2.822   1.00 0.00 ? 64  TRP A HE1  1  
ATOM 643   H HE3  . TRP A 1 61  ? -7.194  -0.962  -2.110  1.00 0.00 ? 64  TRP A HE3  1  
ATOM 644   H HZ2  . TRP A 1 61  ? -6.019  -1.549  2.694   1.00 0.00 ? 64  TRP A HZ2  1  
ATOM 645   H HZ3  . TRP A 1 61  ? -4.936  -0.457  -1.279  1.00 0.00 ? 64  TRP A HZ3  1  
ATOM 646   H HH2  . TRP A 1 61  ? -4.363  -0.746  1.071   1.00 0.00 ? 64  TRP A HH2  1  
ATOM 647   N N    . GLY A 1 62  ? -11.266 -4.231  -4.137  1.00 0.00 ? 65  GLY A N    1  
ATOM 648   C CA   . GLY A 1 62  ? -12.043 -4.230  -5.359  1.00 0.00 ? 65  GLY A CA   1  
ATOM 649   C C    . GLY A 1 62  ? -11.599 -3.154  -6.331  1.00 0.00 ? 65  GLY A C    1  
ATOM 650   O O    . GLY A 1 62  ? -12.391 -2.674  -7.144  1.00 0.00 ? 65  GLY A O    1  
ATOM 651   H H    . GLY A 1 62  ? -10.644 -4.964  -3.954  1.00 0.00 ? 65  GLY A H    1  
ATOM 652   H HA2  . GLY A 1 62  ? -11.947 -5.195  -5.837  1.00 0.00 ? 65  GLY A HA2  1  
ATOM 653   H HA3  . GLY A 1 62  ? -13.081 -4.067  -5.112  1.00 0.00 ? 65  GLY A HA3  1  
ATOM 654   N N    . ARG A 1 63  ? -10.337 -2.756  -6.237  1.00 0.00 ? 66  ARG A N    1  
ATOM 655   C CA   . ARG A 1 63  ? -9.779  -1.776  -7.152  1.00 0.00 ? 66  ARG A CA   1  
ATOM 656   C C    . ARG A 1 63  ? -8.922  -2.488  -8.186  1.00 0.00 ? 66  ARG A C    1  
ATOM 657   O O    . ARG A 1 63  ? -8.297  -3.505  -7.885  1.00 0.00 ? 66  ARG A O    1  
ATOM 658   C CB   . ARG A 1 63  ? -8.941  -0.739  -6.396  1.00 0.00 ? 66  ARG A CB   1  
ATOM 659   C CG   . ARG A 1 63  ? -9.690  -0.035  -5.270  1.00 0.00 ? 66  ARG A CG   1  
ATOM 660   C CD   . ARG A 1 63  ? -10.907 0.736   -5.779  1.00 0.00 ? 66  ARG A CD   1  
ATOM 661   N NE   . ARG A 1 63  ? -10.542 1.814   -6.702  1.00 0.00 ? 66  ARG A NE   1  
ATOM 662   C CZ   . ARG A 1 63  ? -11.384 2.349   -7.583  1.00 0.00 ? 66  ARG A CZ   1  
ATOM 663   N NH1  . ARG A 1 63  ? -12.612 1.862   -7.704  1.00 0.00 ? 66  ARG A NH1  1  
ATOM 664   N NH2  . ARG A 1 63  ? -10.998 3.353   -8.357  1.00 0.00 ? 66  ARG A NH2  1  
ATOM 665   H H    . ARG A 1 63  ? -9.762  -3.139  -5.538  1.00 0.00 ? 66  ARG A H    1  
ATOM 666   H HA   . ARG A 1 63  ? -10.596 -1.282  -7.654  1.00 0.00 ? 66  ARG A HA   1  
ATOM 667   H HB2  . ARG A 1 63  ? -8.078  -1.233  -5.972  1.00 0.00 ? 66  ARG A HB2  1  
ATOM 668   H HB3  . ARG A 1 63  ? -8.605  0.012   -7.097  1.00 0.00 ? 66  ARG A HB3  1  
ATOM 669   H HG2  . ARG A 1 63  ? -10.018 -0.776  -4.556  1.00 0.00 ? 66  ARG A HG2  1  
ATOM 670   H HG3  . ARG A 1 63  ? -9.014  0.655   -4.785  1.00 0.00 ? 66  ARG A HG3  1  
ATOM 671   H HD2  . ARG A 1 63  ? -11.568 0.052   -6.288  1.00 0.00 ? 66  ARG A HD2  1  
ATOM 672   H HD3  . ARG A 1 63  ? -11.424 1.164   -4.933  1.00 0.00 ? 66  ARG A HD3  1  
ATOM 673   H HE   . ARG A 1 63  ? -9.627  2.163   -6.646  1.00 0.00 ? 66  ARG A HE   1  
ATOM 674   H HH12 . ARG A 1 63  ? -13.257 1.901   -6.919  1.00 0.00 ? 66  ARG A HH12 1  
ATOM 675   H HH21 . ARG A 1 63  ? -10.070 3.716   -8.287  1.00 0.00 ? 66  ARG A HH21 1  
ATOM 676   H HH22 . ARG A 1 63  ? -11.643 3.757   -9.020  1.00 0.00 ? 66  ARG A HH22 1  
ATOM 677   N N    . SER A 1 64  ? -8.906  -1.964  -9.399  1.00 0.00 ? 67  SER A N    1  
ATOM 678   C CA   . SER A 1 64  ? -8.163  -2.579  -10.482 1.00 0.00 ? 67  SER A CA   1  
ATOM 679   C C    . SER A 1 64  ? -6.750  -2.007  -10.532 1.00 0.00 ? 67  SER A C    1  
ATOM 680   O O    . SER A 1 64  ? -6.497  -0.914  -10.021 1.00 0.00 ? 67  SER A O    1  
ATOM 681   C CB   . SER A 1 64  ? -8.892  -2.344  -11.805 1.00 0.00 ? 67  SER A CB   1  
ATOM 682   O OG   . SER A 1 64  ? -8.399  -3.193  -12.830 1.00 0.00 ? 67  SER A OG   1  
ATOM 683   H H    . SER A 1 64  ? -9.398  -1.134  -9.570  1.00 0.00 ? 67  SER A H    1  
ATOM 684   H HA   . SER A 1 64  ? -8.110  -3.639  -10.290 1.00 0.00 ? 67  SER A HA   1  
ATOM 685   H HB2  . SER A 1 64  ? -9.946  -2.540  -11.673 1.00 0.00 ? 67  SER A HB2  1  
ATOM 686   H HB3  . SER A 1 64  ? -8.752  -1.317  -12.108 1.00 0.00 ? 67  SER A HB3  1  
ATOM 687   H HG   . SER A 1 64  ? -9.014  -3.936  -12.950 1.00 0.00 ? 67  SER A HG   1  
ATOM 688   N N    . SER A 1 65  ? -5.835  -2.744  -11.156 1.00 0.00 ? 68  SER A N    1  
ATOM 689   C CA   . SER A 1 65  ? -4.430  -2.358  -11.204 1.00 0.00 ? 68  SER A CA   1  
ATOM 690   C C    . SER A 1 65  ? -4.175  -1.259  -12.240 1.00 0.00 ? 68  SER A C    1  
ATOM 691   O O    . SER A 1 65  ? -3.333  -1.400  -13.130 1.00 0.00 ? 68  SER A O    1  
ATOM 692   C CB   . SER A 1 65  ? -3.577  -3.582  -11.511 1.00 0.00 ? 68  SER A CB   1  
ATOM 693   O OG   . SER A 1 65  ? -3.777  -4.600  -10.540 1.00 0.00 ? 68  SER A OG   1  
ATOM 694   H H    . SER A 1 65  ? -6.115  -3.571  -11.600 1.00 0.00 ? 68  SER A H    1  
ATOM 695   H HA   . SER A 1 65  ? -4.157  -1.983  -10.228 1.00 0.00 ? 68  SER A HA   1  
ATOM 696   H HB2  . SER A 1 65  ? -3.848  -3.971  -12.481 1.00 0.00 ? 68  SER A HB2  1  
ATOM 697   H HB3  . SER A 1 65  ? -2.535  -3.302  -11.512 1.00 0.00 ? 68  SER A HB3  1  
ATOM 698   H HG   . SER A 1 65  ? -4.163  -4.209  -9.739  1.00 0.00 ? 68  SER A HG   1  
ATOM 699   N N    . LYS A 1 66  ? -4.909  -0.166  -12.106 1.00 0.00 ? 69  LYS A N    1  
ATOM 700   C CA   . LYS A 1 66  ? -4.735  1.010   -12.944 1.00 0.00 ? 69  LYS A CA   1  
ATOM 701   C C    . LYS A 1 66  ? -4.833  2.248   -12.061 1.00 0.00 ? 69  LYS A C    1  
ATOM 702   O O    . LYS A 1 66  ? -5.562  2.243   -11.065 1.00 0.00 ? 69  LYS A O    1  
ATOM 703   C CB   . LYS A 1 66  ? -5.794  1.056   -14.056 1.00 0.00 ? 69  LYS A CB   1  
ATOM 704   C CG   . LYS A 1 66  ? -5.767  -0.159  -14.976 1.00 0.00 ? 69  LYS A CG   1  
ATOM 705   C CD   . LYS A 1 66  ? -6.770  -0.034  -16.111 1.00 0.00 ? 69  LYS A CD   1  
ATOM 706   C CE   . LYS A 1 66  ? -6.821  -1.303  -16.952 1.00 0.00 ? 69  LYS A CE   1  
ATOM 707   N NZ   . LYS A 1 66  ? -5.498  -1.632  -17.552 1.00 0.00 ? 69  LYS A NZ   1  
ATOM 708   H H    . LYS A 1 66  ? -5.593  -0.144  -11.397 1.00 0.00 ? 69  LYS A H    1  
ATOM 709   H HA   . LYS A 1 66  ? -3.750  0.966   -13.383 1.00 0.00 ? 69  LYS A HA   1  
ATOM 710   H HB2  . LYS A 1 66  ? -6.773  1.118   -13.605 1.00 0.00 ? 69  LYS A HB2  1  
ATOM 711   H HB3  . LYS A 1 66  ? -5.632  1.939   -14.659 1.00 0.00 ? 69  LYS A HB3  1  
ATOM 712   H HG2  . LYS A 1 66  ? -4.777  -0.256  -15.397 1.00 0.00 ? 69  LYS A HG2  1  
ATOM 713   H HG3  . LYS A 1 66  ? -5.998  -1.041  -14.396 1.00 0.00 ? 69  LYS A HG3  1  
ATOM 714   H HD2  . LYS A 1 66  ? -7.749  0.148   -15.694 1.00 0.00 ? 69  LYS A HD2  1  
ATOM 715   H HD3  . LYS A 1 66  ? -6.486  0.794   -16.742 1.00 0.00 ? 69  LYS A HD3  1  
ATOM 716   H HE2  . LYS A 1 66  ? -7.133  -2.123  -16.325 1.00 0.00 ? 69  LYS A HE2  1  
ATOM 717   H HE3  . LYS A 1 66  ? -7.541  -1.163  -17.745 1.00 0.00 ? 69  LYS A HE3  1  
ATOM 718   H HZ1  . LYS A 1 66  ? -5.567  -2.543  -18.061 1.00 0.00 ? 69  LYS A HZ1  1  
ATOM 719   H HZ3  . LYS A 1 66  ? -5.244  -0.896  -18.249 1.00 0.00 ? 69  LYS A HZ3  1  
ATOM 720   N N    . GLN A 1 67  ? -4.095  3.293   -12.413 1.00 0.00 ? 70  GLN A N    1  
ATOM 721   C CA   . GLN A 1 67  ? -3.983  4.471   -11.562 1.00 0.00 ? 70  GLN A CA   1  
ATOM 722   C C    . GLN A 1 67  ? -5.323  5.185   -11.410 1.00 0.00 ? 70  GLN A C    1  
ATOM 723   O O    . GLN A 1 67  ? -5.881  5.700   -12.381 1.00 0.00 ? 70  GLN A O    1  
ATOM 724   C CB   . GLN A 1 67  ? -2.931  5.442   -12.112 1.00 0.00 ? 70  GLN A CB   1  
ATOM 725   C CG   . GLN A 1 67  ? -2.830  6.727   -11.304 1.00 0.00 ? 70  GLN A CG   1  
ATOM 726   C CD   . GLN A 1 67  ? -1.727  7.652   -11.775 1.00 0.00 ? 70  GLN A CD   1  
ATOM 727   O OE1  . GLN A 1 67  ? -1.370  7.673   -12.949 1.00 0.00 ? 70  GLN A OE1  1  
ATOM 728   N NE2  . GLN A 1 67  ? -1.186  8.436   -10.855 1.00 0.00 ? 70  GLN A NE2  1  
ATOM 729   H H    . GLN A 1 67  ? -3.626  3.278   -13.279 1.00 0.00 ? 70  GLN A H    1  
ATOM 730   H HA   . GLN A 1 67  ? -3.663  4.134   -10.589 1.00 0.00 ? 70  GLN A HA   1  
ATOM 731   H HB2  . GLN A 1 67  ? -1.966  4.955   -12.103 1.00 0.00 ? 70  GLN A HB2  1  
ATOM 732   H HB3  . GLN A 1 67  ? -3.188  5.699   -13.129 1.00 0.00 ? 70  GLN A HB3  1  
ATOM 733   H HG2  . GLN A 1 67  ? -3.768  7.254   -11.378 1.00 0.00 ? 70  GLN A HG2  1  
ATOM 734   H HG3  . GLN A 1 67  ? -2.646  6.470   -10.271 1.00 0.00 ? 70  GLN A HG3  1  
ATOM 735   H HE21 . GLN A 1 67  ? -1.527  8.373   -9.934  1.00 0.00 ? 70  GLN A HE21 1  
ATOM 736   H HE22 . GLN A 1 67  ? -0.474  9.052   -11.130 1.00 0.00 ? 70  GLN A HE22 1  
ATOM 737   N N    . TRP A 1 68  ? -5.831  5.205   -10.184 1.00 0.00 ? 71  TRP A N    1  
ATOM 738   C CA   . TRP A 1 68  ? -7.064  5.913   -9.874  1.00 0.00 ? 71  TRP A CA   1  
ATOM 739   C C    . TRP A 1 68  ? -6.782  7.395   -9.629  1.00 0.00 ? 71  TRP A C    1  
ATOM 740   O O    . TRP A 1 68  ? -5.625  7.812   -9.531  1.00 0.00 ? 71  TRP A O    1  
ATOM 741   C CB   . TRP A 1 68  ? -7.765  5.276   -8.665  1.00 0.00 ? 71  TRP A CB   1  
ATOM 742   C CG   . TRP A 1 68  ? -6.843  4.918   -7.542  1.00 0.00 ? 71  TRP A CG   1  
ATOM 743   C CD1  . TRP A 1 68  ? -6.360  5.752   -6.577  1.00 0.00 ? 71  TRP A CD1  1  
ATOM 744   C CD2  . TRP A 1 68  ? -6.302  3.622   -7.261  1.00 0.00 ? 71  TRP A CD2  1  
ATOM 745   N NE1  . TRP A 1 68  ? -5.550  5.055   -5.715  1.00 0.00 ? 71  TRP A NE1  1  
ATOM 746   C CE2  . TRP A 1 68  ? -5.495  3.744   -6.116  1.00 0.00 ? 71  TRP A CE2  1  
ATOM 747   C CE3  . TRP A 1 68  ? -6.416  2.369   -7.875  1.00 0.00 ? 71  TRP A CE3  1  
ATOM 748   C CZ2  . TRP A 1 68  ? -4.816  2.659   -5.566  1.00 0.00 ? 71  TRP A CZ2  1  
ATOM 749   C CZ3  . TRP A 1 68  ? -5.741  1.295   -7.329  1.00 0.00 ? 71  TRP A CZ3  1  
ATOM 750   C CH2  . TRP A 1 68  ? -4.948  1.447   -6.188  1.00 0.00 ? 71  TRP A CH2  1  
ATOM 751   H H    . TRP A 1 68  ? -5.364  4.729   -9.464  1.00 0.00 ? 71  TRP A H    1  
ATOM 752   H HA   . TRP A 1 68  ? -7.710  5.826   -10.736 1.00 0.00 ? 71  TRP A HA   1  
ATOM 753   H HB2  . TRP A 1 68  ? -8.500  5.970   -8.281  1.00 0.00 ? 71  TRP A HB2  1  
ATOM 754   H HB3  . TRP A 1 68  ? -8.267  4.375   -8.986  1.00 0.00 ? 71  TRP A HB3  1  
ATOM 755   H HD1  . TRP A 1 68  ? -6.590  6.805   -6.514  1.00 0.00 ? 71  TRP A HD1  1  
ATOM 756   H HE1  . TRP A 1 68  ? -5.085  5.436   -4.938  1.00 0.00 ? 71  TRP A HE1  1  
ATOM 757   H HE3  . TRP A 1 68  ? -7.023  2.235   -8.757  1.00 0.00 ? 71  TRP A HE3  1  
ATOM 758   H HZ2  . TRP A 1 68  ? -4.198  2.757   -4.685  1.00 0.00 ? 71  TRP A HZ2  1  
ATOM 759   H HZ3  . TRP A 1 68  ? -5.818  0.320   -7.787  1.00 0.00 ? 71  TRP A HZ3  1  
ATOM 760   H HH2  . TRP A 1 68  ? -4.438  0.580   -5.799  1.00 0.00 ? 71  TRP A HH2  1  
ATOM 761   N N    . GLU A 1 69  ? -7.850  8.173   -9.518  1.00 0.00 ? 72  GLU A N    1  
ATOM 762   C CA   . GLU A 1 69  ? -7.760  9.629   -9.597  1.00 0.00 ? 72  GLU A CA   1  
ATOM 763   C C    . GLU A 1 69  ? -7.419  10.298  -8.263  1.00 0.00 ? 72  GLU A C    1  
ATOM 764   O O    . GLU A 1 69  ? -7.140  11.496  -8.234  1.00 0.00 ? 72  GLU A O    1  
ATOM 765   C CB   . GLU A 1 69  ? -9.079  10.198  -10.125 1.00 0.00 ? 72  GLU A CB   1  
ATOM 766   C CG   . GLU A 1 69  ? -9.460  9.695   -11.508 1.00 0.00 ? 72  GLU A CG   1  
ATOM 767   C CD   . GLU A 1 69  ? -10.805 10.220  -11.961 1.00 0.00 ? 72  GLU A CD   1  
ATOM 768   O OE1  . GLU A 1 69  ? -11.830 9.841   -11.356 1.00 0.00 ? 72  GLU A OE1  1  
ATOM 769   O OE2  . GLU A 1 69  ? -10.848 11.018  -12.922 1.00 0.00 ? 72  GLU A OE2  1  
ATOM 770   H H    . GLU A 1 69  ? -8.734  7.754   -9.379  1.00 0.00 ? 72  GLU A H    1  
ATOM 771   H HA   . GLU A 1 69  ? -6.980  9.866   -10.306 1.00 0.00 ? 72  GLU A HA   1  
ATOM 772   H HB2  . GLU A 1 69  ? -9.869  9.929   -9.439  1.00 0.00 ? 72  GLU A HB2  1  
ATOM 773   H HB3  . GLU A 1 69  ? -9.003  11.274  -10.165 1.00 0.00 ? 72  GLU A HB3  1  
ATOM 774   H HG2  . GLU A 1 69  ? -8.710  10.017  -12.214 1.00 0.00 ? 72  GLU A HG2  1  
ATOM 775   H HG3  . GLU A 1 69  ? -9.498  8.617   -11.492 1.00 0.00 ? 72  GLU A HG3  1  
ATOM 776   N N    . ASP A 1 70  ? -7.432  9.551   -7.166  1.00 0.00 ? 73  ASP A N    1  
ATOM 777   C CA   . ASP A 1 70  ? -7.201  10.161  -5.855  1.00 0.00 ? 73  ASP A CA   1  
ATOM 778   C C    . ASP A 1 70  ? -6.022  9.521   -5.136  1.00 0.00 ? 73  ASP A C    1  
ATOM 779   O O    . ASP A 1 70  ? -6.111  8.384   -4.669  1.00 0.00 ? 73  ASP A O    1  
ATOM 780   C CB   . ASP A 1 70  ? -8.445  10.058  -4.971  1.00 0.00 ? 73  ASP A CB   1  
ATOM 781   C CG   . ASP A 1 70  ? -8.333  10.917  -3.720  1.00 0.00 ? 73  ASP A CG   1  
ATOM 782   O OD1  . ASP A 1 70  ? -7.421  10.682  -2.901  1.00 0.00 ? 73  ASP A OD1  1  
ATOM 783   O OD2  . ASP A 1 70  ? -9.164  11.834  -3.548  1.00 0.00 ? 73  ASP A OD2  1  
ATOM 784   H H    . ASP A 1 70  ? -7.583  8.587   -7.233  1.00 0.00 ? 73  ASP A H    1  
ATOM 785   H HA   . ASP A 1 70  ? -6.979  11.205  -6.016  1.00 0.00 ? 73  ASP A HA   1  
ATOM 786   H HB2  . ASP A 1 70  ? -9.309  10.384  -5.532  1.00 0.00 ? 73  ASP A HB2  1  
ATOM 787   H HB3  . ASP A 1 70  ? -8.581  9.029   -4.669  1.00 0.00 ? 73  ASP A HB3  1  
ATOM 788   N N    . PRO A 1 71  ? -4.886  10.232  -5.062  1.00 0.00 ? 74  PRO A N    1  
ATOM 789   C CA   . PRO A 1 71  ? -3.744  9.809   -4.270  1.00 0.00 ? 74  PRO A CA   1  
ATOM 790   C C    . PRO A 1 71  ? -3.709  10.466  -2.888  1.00 0.00 ? 74  PRO A C    1  
ATOM 791   O O    . PRO A 1 71  ? -2.920  10.081  -2.024  1.00 0.00 ? 74  PRO A O    1  
ATOM 792   C CB   . PRO A 1 71  ? -2.580  10.302  -5.120  1.00 0.00 ? 74  PRO A CB   1  
ATOM 793   C CG   . PRO A 1 71  ? -3.078  11.560  -5.758  1.00 0.00 ? 74  PRO A CG   1  
ATOM 794   C CD   . PRO A 1 71  ? -4.591  11.477  -5.795  1.00 0.00 ? 74  PRO A CD   1  
ATOM 795   H HA   . PRO A 1 71  ? -3.700  8.739   -4.169  1.00 0.00 ? 74  PRO A HA   1  
ATOM 796   H HB2  . PRO A 1 71  ? -1.724  10.489  -4.489  1.00 0.00 ? 74  PRO A HB2  1  
ATOM 797   H HB3  . PRO A 1 71  ? -2.336  9.558   -5.860  1.00 0.00 ? 74  PRO A HB3  1  
ATOM 798   H HG2  . PRO A 1 71  ? -2.768  12.412  -5.172  1.00 0.00 ? 74  PRO A HG2  1  
ATOM 799   H HG3  . PRO A 1 71  ? -2.684  11.636  -6.760  1.00 0.00 ? 74  PRO A HG3  1  
ATOM 800   H HD2  . PRO A 1 71  ? -5.027  12.332  -5.296  1.00 0.00 ? 74  PRO A HD2  1  
ATOM 801   H HD3  . PRO A 1 71  ? -4.941  11.416  -6.815  1.00 0.00 ? 74  PRO A HD3  1  
ATOM 802   N N    . SER A 1 72  ? -4.587  11.439  -2.683  1.00 0.00 ? 75  SER A N    1  
ATOM 803   C CA   . SER A 1 72  ? -4.556  12.275  -1.492  1.00 0.00 ? 75  SER A CA   1  
ATOM 804   C C    . SER A 1 72  ? -4.962  11.503  -0.242  1.00 0.00 ? 75  SER A C    1  
ATOM 805   O O    . SER A 1 72  ? -4.625  11.899  0.875   1.00 0.00 ? 75  SER A O    1  
ATOM 806   C CB   . SER A 1 72  ? -5.474  13.480  -1.683  1.00 0.00 ? 75  SER A CB   1  
ATOM 807   O OG   . SER A 1 72  ? -5.159  14.170  -2.881  1.00 0.00 ? 75  SER A OG   1  
ATOM 808   H H    . SER A 1 72  ? -5.284  11.597  -3.355  1.00 0.00 ? 75  SER A H    1  
ATOM 809   H HA   . SER A 1 72  ? -3.546  12.627  -1.367  1.00 0.00 ? 75  SER A HA   1  
ATOM 810   H HB2  . SER A 1 72  ? -6.499  13.144  -1.731  1.00 0.00 ? 75  SER A HB2  1  
ATOM 811   H HB3  . SER A 1 72  ? -5.351  14.153  -0.849  1.00 0.00 ? 75  SER A HB3  1  
ATOM 812   H HG   . SER A 1 72  ? -5.941  14.181  -3.456  1.00 0.00 ? 75  SER A HG   1  
ATOM 813   N N    . GLN A 1 73  ? -5.668  10.392  -0.427  1.00 0.00 ? 76  GLN A N    1  
ATOM 814   C CA   . GLN A 1 73  ? -6.100  9.565   0.696   1.00 0.00 ? 76  GLN A CA   1  
ATOM 815   C C    . GLN A 1 73  ? -4.901  8.988   1.449   1.00 0.00 ? 76  GLN A C    1  
ATOM 816   O O    . GLN A 1 73  ? -5.040  8.488   2.564   1.00 0.00 ? 76  GLN A O    1  
ATOM 817   C CB   . GLN A 1 73  ? -7.001  8.427   0.205   1.00 0.00 ? 76  GLN A CB   1  
ATOM 818   C CG   . GLN A 1 73  ? -8.177  8.902   -0.632  1.00 0.00 ? 76  GLN A CG   1  
ATOM 819   C CD   . GLN A 1 73  ? -9.068  9.892   0.096   1.00 0.00 ? 76  GLN A CD   1  
ATOM 820   O OE1  . GLN A 1 73  ? -9.252  9.815   1.312   1.00 0.00 ? 76  GLN A OE1  1  
ATOM 821   N NE2  . GLN A 1 73  ? -9.602  10.852  -0.641  1.00 0.00 ? 76  GLN A NE2  1  
ATOM 822   H H    . GLN A 1 73  ? -5.923  10.131  -1.340  1.00 0.00 ? 76  GLN A H    1  
ATOM 823   H HA   . GLN A 1 73  ? -6.664  10.193  1.369   1.00 0.00 ? 76  GLN A HA   1  
ATOM 824   H HB2  . GLN A 1 73  ? -6.411  7.749   -0.398  1.00 0.00 ? 76  GLN A HB2  1  
ATOM 825   H HB3  . GLN A 1 73  ? -7.387  7.891   1.060   1.00 0.00 ? 76  GLN A HB3  1  
ATOM 826   H HG2  . GLN A 1 73  ? -7.798  9.377   -1.523  1.00 0.00 ? 76  GLN A HG2  1  
ATOM 827   H HG3  . GLN A 1 73  ? -8.771  8.043   -0.911  1.00 0.00 ? 76  GLN A HG3  1  
ATOM 828   H HE21 . GLN A 1 73  ? -9.388  10.871  -1.605  1.00 0.00 ? 76  GLN A HE21 1  
ATOM 829   H HE22 . GLN A 1 73  ? -10.186 11.506  -0.205  1.00 0.00 ? 76  GLN A HE22 1  
ATOM 830   N N    . ALA A 1 74  ? -3.722  9.082   0.844   1.00 0.00 ? 77  ALA A N    1  
ATOM 831   C CA   . ALA A 1 74  ? -2.517  8.517   1.431   1.00 0.00 ? 77  ALA A CA   1  
ATOM 832   C C    . ALA A 1 74  ? -1.586  9.594   1.987   1.00 0.00 ? 77  ALA A C    1  
ATOM 833   O O    . ALA A 1 74  ? -0.425  9.316   2.291   1.00 0.00 ? 77  ALA A O    1  
ATOM 834   C CB   . ALA A 1 74  ? -1.785  7.673   0.401   1.00 0.00 ? 77  ALA A CB   1  
ATOM 835   H H    . ALA A 1 74  ? -3.663  9.544   -0.021  1.00 0.00 ? 77  ALA A H    1  
ATOM 836   H HA   . ALA A 1 74  ? -2.820  7.868   2.239   1.00 0.00 ? 77  ALA A HA   1  
ATOM 837   H HB1  . ALA A 1 74  ? -2.451  6.916   0.013   1.00 0.00 ? 77  ALA A HB1  1  
ATOM 838   H HB2  . ALA A 1 74  ? -1.449  8.306   -0.408  1.00 0.00 ? 77  ALA A HB2  1  
ATOM 839   H HB3  . ALA A 1 74  ? -0.934  7.197   0.864   1.00 0.00 ? 77  ALA A HB3  1  
ATOM 840   N N    . SER A 1 75  ? -2.092  10.816  2.128   1.00 0.00 ? 78  SER A N    1  
ATOM 841   C CA   . SER A 1 75  ? -1.287  11.918  2.662   1.00 0.00 ? 78  SER A CA   1  
ATOM 842   C C    . SER A 1 75  ? -0.768  11.589  4.063   1.00 0.00 ? 78  SER A C    1  
ATOM 843   O O    . SER A 1 75  ? 0.393   11.854  4.385   1.00 0.00 ? 78  SER A O    1  
ATOM 844   C CB   . SER A 1 75  ? -2.103  13.212  2.698   1.00 0.00 ? 78  SER A CB   1  
ATOM 845   O OG   . SER A 1 75  ? -2.597  13.541  1.411   1.00 0.00 ? 78  SER A OG   1  
ATOM 846   H H    . SER A 1 75  ? -3.022  10.984  1.865   1.00 0.00 ? 78  SER A H    1  
ATOM 847   H HA   . SER A 1 75  ? -0.444  12.055  2.004   1.00 0.00 ? 78  SER A HA   1  
ATOM 848   H HB2  . SER A 1 75  ? -2.940  13.088  3.370   1.00 0.00 ? 78  SER A HB2  1  
ATOM 849   H HB3  . SER A 1 75  ? -1.476  14.020  3.047   1.00 0.00 ? 78  SER A HB3  1  
ATOM 850   H HG   . SER A 1 75  ? -3.408  13.043  1.243   1.00 0.00 ? 78  SER A HG   1  
ATOM 851   N N    . LYS A 1 76  ? -1.628  10.992  4.882   1.00 0.00 ? 79  LYS A N    1  
ATOM 852   C CA   . LYS A 1 76  ? -1.262  10.602  6.239   1.00 0.00 ? 79  LYS A CA   1  
ATOM 853   C C    . LYS A 1 76  ? -0.138  9.564   6.219   1.00 0.00 ? 79  LYS A C    1  
ATOM 854   O O    . LYS A 1 76  ? 0.704   9.533   7.117   1.00 0.00 ? 79  LYS A O    1  
ATOM 855   C CB   . LYS A 1 76  ? -2.507  10.075  6.975   1.00 0.00 ? 79  LYS A CB   1  
ATOM 856   C CG   . LYS A 1 76  ? -2.287  9.657   8.424   1.00 0.00 ? 79  LYS A CG   1  
ATOM 857   C CD   . LYS A 1 76  ? -1.838  8.207   8.530   1.00 0.00 ? 79  LYS A CD   1  
ATOM 858   C CE   . LYS A 1 76  ? -1.854  7.709   9.965   1.00 0.00 ? 79  LYS A CE   1  
ATOM 859   N NZ   . LYS A 1 76  ? -1.524  6.261   10.045  1.00 0.00 ? 79  LYS A NZ   1  
ATOM 860   H H    . LYS A 1 76  ? -2.547  10.819  4.567   1.00 0.00 ? 79  LYS A H    1  
ATOM 861   H HA   . LYS A 1 76  ? -0.903  11.486  6.747   1.00 0.00 ? 79  LYS A HA   1  
ATOM 862   H HB2  . LYS A 1 76  ? -3.260  10.849  6.966   1.00 0.00 ? 79  LYS A HB2  1  
ATOM 863   H HB3  . LYS A 1 76  ? -2.886  9.220   6.434   1.00 0.00 ? 79  LYS A HB3  1  
ATOM 864   H HG2  . LYS A 1 76  ? -1.529  10.291  8.859   1.00 0.00 ? 79  LYS A HG2  1  
ATOM 865   H HG3  . LYS A 1 76  ? -3.213  9.778   8.965   1.00 0.00 ? 79  LYS A HG3  1  
ATOM 866   H HD2  . LYS A 1 76  ? -2.502  7.593   7.942   1.00 0.00 ? 79  LYS A HD2  1  
ATOM 867   H HD3  . LYS A 1 76  ? -0.832  8.125   8.141   1.00 0.00 ? 79  LYS A HD3  1  
ATOM 868   H HE2  . LYS A 1 76  ? -1.126  8.266   10.536  1.00 0.00 ? 79  LYS A HE2  1  
ATOM 869   H HE3  . LYS A 1 76  ? -2.837  7.869   10.380  1.00 0.00 ? 79  LYS A HE3  1  
ATOM 870   H HZ1  . LYS A 1 76  ? -2.108  5.740   9.355   1.00 0.00 ? 79  LYS A HZ1  1  
ATOM 871   H HZ3  . LYS A 1 76  ? -1.764  5.905   10.997  1.00 0.00 ? 79  LYS A HZ3  1  
ATOM 872   N N    . VAL A 1 77  ? -0.111  8.733   5.183   1.00 0.00 ? 80  VAL A N    1  
ATOM 873   C CA   . VAL A 1 77  ? 0.933   7.723   5.047   1.00 0.00 ? 80  VAL A CA   1  
ATOM 874   C C    . VAL A 1 77  ? 2.270   8.381   4.720   1.00 0.00 ? 80  VAL A C    1  
ATOM 875   O O    . VAL A 1 77  ? 3.287   8.075   5.344   1.00 0.00 ? 80  VAL A O    1  
ATOM 876   C CB   . VAL A 1 77  ? 0.586   6.669   3.968   1.00 0.00 ? 80  VAL A CB   1  
ATOM 877   C CG1  . VAL A 1 77  ? 1.758   5.721   3.743   1.00 0.00 ? 80  VAL A CG1  1  
ATOM 878   C CG2  . VAL A 1 77  ? -0.657  5.884   4.369   1.00 0.00 ? 80  VAL A CG2  1  
ATOM 879   H H    . VAL A 1 77  ? -0.798  8.809   4.488   1.00 0.00 ? 80  VAL A H    1  
ATOM 880   H HA   . VAL A 1 77  ? 1.023   7.217   5.999   1.00 0.00 ? 80  VAL A HA   1  
ATOM 881   H HB   . VAL A 1 77  ? 0.381   7.185   3.041   1.00 0.00 ? 80  VAL A HB   1  
ATOM 882   H HG11 . VAL A 1 77  ? 1.500   5.008   2.973   1.00 0.00 ? 80  VAL A HG11 1  
ATOM 883   H HG12 . VAL A 1 77  ? 2.624   6.287   3.432   1.00 0.00 ? 80  VAL A HG12 1  
ATOM 884   H HG13 . VAL A 1 77  ? 1.980   5.197   4.661   1.00 0.00 ? 80  VAL A HG13 1  
ATOM 885   H HG21 . VAL A 1 77  ? -0.460  5.340   5.282   1.00 0.00 ? 80  VAL A HG21 1  
ATOM 886   H HG22 . VAL A 1 77  ? -1.480  6.564   4.528   1.00 0.00 ? 80  VAL A HG22 1  
ATOM 887   H HG23 . VAL A 1 77  ? -0.913  5.186   3.584   1.00 0.00 ? 80  VAL A HG23 1  
ATOM 888   N N    . CYS A 1 78  ? 2.261   9.299   3.757   1.00 0.00 ? 81  CYS A N    1  
ATOM 889   C CA   . CYS A 1 78  ? 3.460   10.061  3.418   1.00 0.00 ? 81  CYS A CA   1  
ATOM 890   C C    . CYS A 1 78  ? 3.969   10.810  4.652   1.00 0.00 ? 81  CYS A C    1  
ATOM 891   O O    . CYS A 1 78  ? 5.173   10.911  4.882   1.00 0.00 ? 81  CYS A O    1  
ATOM 892   C CB   . CYS A 1 78  ? 3.170   11.057  2.284   1.00 0.00 ? 81  CYS A CB   1  
ATOM 893   S SG   . CYS A 1 78  ? 2.572   10.300  0.734   1.00 0.00 ? 81  CYS A SG   1  
ATOM 894   H H    . CYS A 1 78  ? 1.432   9.462   3.254   1.00 0.00 ? 81  CYS A H    1  
ATOM 895   H HA   . CYS A 1 78  ? 4.221   9.363   3.094   1.00 0.00 ? 81  CYS A HA   1  
ATOM 896   H HB2  . CYS A 1 78  ? 2.414   11.753  2.616   1.00 0.00 ? 81  CYS A HB2  1  
ATOM 897   H HB3  . CYS A 1 78  ? 4.071   11.603  2.057   1.00 0.00 ? 81  CYS A HB3  1  
ATOM 898   N N    . GLN A 1 79  ? 3.029   11.310  5.451   1.00 0.00 ? 82  GLN A N    1  
ATOM 899   C CA   . GLN A 1 79  ? 3.344   12.010  6.692   1.00 0.00 ? 82  GLN A CA   1  
ATOM 900   C C    . GLN A 1 79  ? 4.058   11.086  7.682   1.00 0.00 ? 82  GLN A C    1  
ATOM 901   O O    . GLN A 1 79  ? 4.979   11.504  8.383   1.00 0.00 ? 82  GLN A O    1  
ATOM 902   C CB   . GLN A 1 79  ? 2.053   12.561  7.310   1.00 0.00 ? 82  GLN A CB   1  
ATOM 903   C CG   . GLN A 1 79  ? 2.234   13.251  8.654   1.00 0.00 ? 82  GLN A CG   1  
ATOM 904   C CD   . GLN A 1 79  ? 3.026   14.545  8.570   1.00 0.00 ? 82  GLN A CD   1  
ATOM 905   O OE1  . GLN A 1 79  ? 3.910   14.704  7.730   1.00 0.00 ? 82  GLN A OE1  1  
ATOM 906   N NE2  . GLN A 1 79  ? 2.706   15.483  9.445   1.00 0.00 ? 82  GLN A NE2  1  
ATOM 907   H H    . GLN A 1 79  ? 2.086   11.213  5.189   1.00 0.00 ? 82  GLN A H    1  
ATOM 908   H HA   . GLN A 1 79  ? 3.998   12.834  6.452   1.00 0.00 ? 82  GLN A HA   1  
ATOM 909   H HB2  . GLN A 1 79  ? 1.623   13.275  6.624   1.00 0.00 ? 82  GLN A HB2  1  
ATOM 910   H HB3  . GLN A 1 79  ? 1.357   11.744  7.442   1.00 0.00 ? 82  GLN A HB3  1  
ATOM 911   H HG2  . GLN A 1 79  ? 1.260   13.474  9.062   1.00 0.00 ? 82  GLN A HG2  1  
ATOM 912   H HG3  . GLN A 1 79  ? 2.751   12.575  9.318   1.00 0.00 ? 82  GLN A HG3  1  
ATOM 913   H HE21 . GLN A 1 79  ? 1.990   15.294  10.085  1.00 0.00 ? 82  GLN A HE21 1  
ATOM 914   H HE22 . GLN A 1 79  ? 3.198   16.331  9.421   1.00 0.00 ? 82  GLN A HE22 1  
ATOM 915   N N    . ARG A 1 80  ? 3.640   9.826   7.715   1.00 0.00 ? 83  ARG A N    1  
ATOM 916   C CA   . ARG A 1 80  ? 4.226   8.842   8.623   1.00 0.00 ? 83  ARG A CA   1  
ATOM 917   C C    . ARG A 1 80  ? 5.690   8.581   8.281   1.00 0.00 ? 83  ARG A C    1  
ATOM 918   O O    . ARG A 1 80  ? 6.479   8.204   9.148   1.00 0.00 ? 83  ARG A O    1  
ATOM 919   C CB   . ARG A 1 80  ? 3.436   7.527   8.577   1.00 0.00 ? 83  ARG A CB   1  
ATOM 920   C CG   . ARG A 1 80  ? 2.049   7.618   9.197   1.00 0.00 ? 83  ARG A CG   1  
ATOM 921   C CD   . ARG A 1 80  ? 2.107   7.579   10.717  1.00 0.00 ? 83  ARG A CD   1  
ATOM 922   N NE   . ARG A 1 80  ? 2.234   6.215   11.237  1.00 0.00 ? 83  ARG A NE   1  
ATOM 923   C CZ   . ARG A 1 80  ? 3.207   5.819   12.054  1.00 0.00 ? 83  ARG A CZ   1  
ATOM 924   N NH1  . ARG A 1 80  ? 4.184   6.657   12.375  1.00 0.00 ? 83  ARG A NH1  1  
ATOM 925   N NH2  . ARG A 1 80  ? 3.204   4.594   12.554  1.00 0.00 ? 83  ARG A NH2  1  
ATOM 926   H H    . ARG A 1 80  ? 2.919   9.548   7.110   1.00 0.00 ? 83  ARG A H    1  
ATOM 927   H HA   . ARG A 1 80  ? 4.175   9.248   9.619   1.00 0.00 ? 83  ARG A HA   1  
ATOM 928   H HB2  . ARG A 1 80  ? 3.326   7.224   7.546   1.00 0.00 ? 83  ARG A HB2  1  
ATOM 929   H HB3  . ARG A 1 80  ? 3.994   6.767   9.106   1.00 0.00 ? 83  ARG A HB3  1  
ATOM 930   H HG2  . ARG A 1 80  ? 1.588   8.545   8.890   1.00 0.00 ? 83  ARG A HG2  1  
ATOM 931   H HG3  . ARG A 1 80  ? 1.454   6.787   8.848   1.00 0.00 ? 83  ARG A HG3  1  
ATOM 932   H HD2  . ARG A 1 80  ? 2.957   8.155   11.047  1.00 0.00 ? 83  ARG A HD2  1  
ATOM 933   H HD3  . ARG A 1 80  ? 1.203   8.020   11.110  1.00 0.00 ? 83  ARG A HD3  1  
ATOM 934   H HE   . ARG A 1 80  ? 1.534   5.571   10.991  1.00 0.00 ? 83  ARG A HE   1  
ATOM 935   H HH12 . ARG A 1 80  ? 5.143   6.441   12.124  1.00 0.00 ? 83  ARG A HH12 1  
ATOM 936   H HH21 . ARG A 1 80  ? 2.467   3.957   12.319  1.00 0.00 ? 83  ARG A HH21 1  
ATOM 937   H HH22 . ARG A 1 80  ? 3.944   4.299   13.181  1.00 0.00 ? 83  ARG A HH22 1  
ATOM 938   N N    . LEU A 1 81  ? 6.048   8.782   7.021   1.00 0.00 ? 84  LEU A N    1  
ATOM 939   C CA   . LEU A 1 81  ? 7.423   8.574   6.575   1.00 0.00 ? 84  LEU A CA   1  
ATOM 940   C C    . LEU A 1 81  ? 8.173   9.898   6.455   1.00 0.00 ? 84  LEU A C    1  
ATOM 941   O O    . LEU A 1 81  ? 9.303   9.940   5.963   1.00 0.00 ? 84  LEU A O    1  
ATOM 942   C CB   . LEU A 1 81  ? 7.461   7.837   5.231   1.00 0.00 ? 84  LEU A CB   1  
ATOM 943   C CG   . LEU A 1 81  ? 7.199   6.328   5.289   1.00 0.00 ? 84  LEU A CG   1  
ATOM 944   C CD1  . LEU A 1 81  ? 5.751   6.029   5.642   1.00 0.00 ? 84  LEU A CD1  1  
ATOM 945   C CD2  . LEU A 1 81  ? 7.564   5.688   3.963   1.00 0.00 ? 84  LEU A CD2  1  
ATOM 946   H H    . LEU A 1 81  ? 5.371   9.069   6.369   1.00 0.00 ? 84  LEU A H    1  
ATOM 947   H HA   . LEU A 1 81  ? 7.915   7.965   7.317   1.00 0.00 ? 84  LEU A HA   1  
ATOM 948   H HB2  . LEU A 1 81  ? 6.720   8.281   4.582   1.00 0.00 ? 84  LEU A HB2  1  
ATOM 949   H HB3  . LEU A 1 81  ? 8.435   7.990   4.791   1.00 0.00 ? 84  LEU A HB3  1  
ATOM 950   H HG   . LEU A 1 81  ? 7.826   5.893   6.051   1.00 0.00 ? 84  LEU A HG   1  
ATOM 951   H HD11 . LEU A 1 81  ? 5.101   6.456   4.891   1.00 0.00 ? 84  LEU A HD11 1  
ATOM 952   H HD12 . LEU A 1 81  ? 5.601   4.962   5.679   1.00 0.00 ? 84  LEU A HD12 1  
ATOM 953   H HD13 . LEU A 1 81  ? 5.520   6.459   6.606   1.00 0.00 ? 84  LEU A HD13 1  
ATOM 954   H HD21 . LEU A 1 81  ? 8.620   5.819   3.777   1.00 0.00 ? 84  LEU A HD21 1  
ATOM 955   H HD22 . LEU A 1 81  ? 7.333   4.633   3.995   1.00 0.00 ? 84  LEU A HD22 1  
ATOM 956   H HD23 . LEU A 1 81  ? 6.998   6.155   3.171   1.00 0.00 ? 84  LEU A HD23 1  
ATOM 957   N N    . ASN A 1 82  ? 7.532   10.973  6.916   1.00 0.00 ? 85  ASN A N    1  
ATOM 958   C CA   . ASN A 1 82  ? 8.107   12.321  6.864   1.00 0.00 ? 85  ASN A CA   1  
ATOM 959   C C    . ASN A 1 82  ? 8.424   12.726  5.419   1.00 0.00 ? 85  ASN A C    1  
ATOM 960   O O    . ASN A 1 82  ? 9.491   13.264  5.117   1.00 0.00 ? 85  ASN A O    1  
ATOM 961   C CB   . ASN A 1 82  ? 9.360   12.412  7.750   1.00 0.00 ? 85  ASN A CB   1  
ATOM 962   C CG   . ASN A 1 82  ? 9.910   13.827  7.864   1.00 0.00 ? 85  ASN A CG   1  
ATOM 963   O OD1  . ASN A 1 82  ? 9.173   14.809  7.764   1.00 0.00 ? 85  ASN A OD1  1  
ATOM 964   N ND2  . ASN A 1 82  ? 11.215  13.942  8.068   1.00 0.00 ? 85  ASN A ND2  1  
ATOM 965   H H    . ASN A 1 82  ? 6.643   10.856  7.313   1.00 0.00 ? 85  ASN A H    1  
ATOM 966   H HA   . ASN A 1 82  ? 7.362   13.001  7.248   1.00 0.00 ? 85  ASN A HA   1  
ATOM 967   H HB2  . ASN A 1 82  ? 9.115   12.065  8.743   1.00 0.00 ? 85  ASN A HB2  1  
ATOM 968   H HB3  . ASN A 1 82  ? 10.128  11.779  7.334   1.00 0.00 ? 85  ASN A HB3  1  
ATOM 969   H HD21 . ASN A 1 82  ? 11.747  13.122  8.133   1.00 0.00 ? 85  ASN A HD21 1  
ATOM 970   H HD22 . ASN A 1 82  ? 11.592  14.842  8.144   1.00 0.00 ? 85  ASN A HD22 1  
ATOM 971   N N    . CYS A 1 83  ? 7.490   12.451  4.525   1.00 0.00 ? 86  CYS A N    1  
ATOM 972   C CA   . CYS A 1 83  ? 7.620   12.849  3.131   1.00 0.00 ? 86  CYS A CA   1  
ATOM 973   C C    . CYS A 1 83  ? 6.617   13.960  2.824   1.00 0.00 ? 86  CYS A C    1  
ATOM 974   O O    . CYS A 1 83  ? 5.909   14.425  3.721   1.00 0.00 ? 86  CYS A O    1  
ATOM 975   C CB   . CYS A 1 83  ? 7.395   11.646  2.204   1.00 0.00 ? 86  CYS A CB   1  
ATOM 976   S SG   . CYS A 1 83  ? 8.480   10.217  2.545   1.00 0.00 ? 86  CYS A SG   1  
ATOM 977   H H    . CYS A 1 83  ? 6.686   11.966  4.807   1.00 0.00 ? 86  CYS A H    1  
ATOM 978   H HA   . CYS A 1 83  ? 8.618   13.231  2.985   1.00 0.00 ? 86  CYS A HA   1  
ATOM 979   H HB2  . CYS A 1 83  ? 6.374   11.310  2.309   1.00 0.00 ? 86  CYS A HB2  1  
ATOM 980   H HB3  . CYS A 1 83  ? 7.565   11.951  1.181   1.00 0.00 ? 86  CYS A HB3  1  
ATOM 981   N N    . GLY A 1 84  ? 6.561   14.392  1.574   1.00 0.00 ? 87  GLY A N    1  
ATOM 982   C CA   . GLY A 1 84  ? 5.634   15.438  1.193   1.00 0.00 ? 87  GLY A CA   1  
ATOM 983   C C    . GLY A 1 84  ? 4.317   14.891  0.675   1.00 0.00 ? 87  GLY A C    1  
ATOM 984   O O    . GLY A 1 84  ? 3.956   13.749  0.961   1.00 0.00 ? 87  GLY A O    1  
ATOM 985   H H    . GLY A 1 84  ? 7.159   14.000  0.899   1.00 0.00 ? 87  GLY A H    1  
ATOM 986   H HA2  . GLY A 1 84  ? 5.439   16.061  2.054   1.00 0.00 ? 87  GLY A HA2  1  
ATOM 987   H HA3  . GLY A 1 84  ? 6.090   16.041  0.424   1.00 0.00 ? 87  GLY A HA3  1  
ATOM 988   N N    . ASP A 1 85  ? 3.610   15.711  -0.096  1.00 0.00 ? 88  ASP A N    1  
ATOM 989   C CA   . ASP A 1 85  ? 2.293   15.354  -0.635  1.00 0.00 ? 88  ASP A CA   1  
ATOM 990   C C    . ASP A 1 85  ? 2.404   14.174  -1.607  1.00 0.00 ? 88  ASP A C    1  
ATOM 991   O O    . ASP A 1 85  ? 3.436   13.997  -2.262  1.00 0.00 ? 88  ASP A O    1  
ATOM 992   C CB   . ASP A 1 85  ? 1.683   16.563  -1.357  1.00 0.00 ? 88  ASP A CB   1  
ATOM 993   C CG   . ASP A 1 85  ? 0.230   16.807  -0.999  1.00 0.00 ? 88  ASP A CG   1  
ATOM 994   O OD1  . ASP A 1 85  ? -0.029  17.421  0.056   1.00 0.00 ? 88  ASP A OD1  1  
ATOM 995   O OD2  . ASP A 1 85  ? -0.659  16.411  -1.783  1.00 0.00 ? 88  ASP A OD2  1  
ATOM 996   H H    . ASP A 1 85  ? 3.983   16.590  -0.311  1.00 0.00 ? 88  ASP A H    1  
ATOM 997   H HA   . ASP A 1 85  ? 1.657   15.074  0.188   1.00 0.00 ? 88  ASP A HA   1  
ATOM 998   H HB2  . ASP A 1 85  ? 2.242   17.446  -1.100  1.00 0.00 ? 88  ASP A HB2  1  
ATOM 999   H HB3  . ASP A 1 85  ? 1.744   16.399  -2.421  1.00 0.00 ? 88  ASP A HB3  1  
ATOM 1000  N N    . PRO A 1 86  ? 1.346   13.348  -1.705  1.00 0.00 ? 89  PRO A N    1  
ATOM 1001  C CA   . PRO A 1 86  ? 1.326   12.184  -2.588  1.00 0.00 ? 89  PRO A CA   1  
ATOM 1002  C C    . PRO A 1 86  ? 1.114   12.566  -4.050  1.00 0.00 ? 89  PRO A C    1  
ATOM 1003  O O    . PRO A 1 86  ? 0.083   13.133  -4.415  1.00 0.00 ? 89  PRO A O    1  
ATOM 1004  C CB   . PRO A 1 86  ? 0.141   11.345  -2.086  1.00 0.00 ? 89  PRO A CB   1  
ATOM 1005  C CG   . PRO A 1 86  ? -0.449  12.082  -0.927  1.00 0.00 ? 89  PRO A CG   1  
ATOM 1006  C CD   . PRO A 1 86  ? 0.086   13.485  -0.973  1.00 0.00 ? 89  PRO A CD   1  
ATOM 1007  H HA   . PRO A 1 86  ? 2.235   11.610  -2.498  1.00 0.00 ? 89  PRO A HA   1  
ATOM 1008  H HB2  . PRO A 1 86  ? -0.579  11.232  -2.880  1.00 0.00 ? 89  PRO A HB2  1  
ATOM 1009  H HB3  . PRO A 1 86  ? 0.497   10.373  -1.785  1.00 0.00 ? 89  PRO A HB3  1  
ATOM 1010  H HG2  . PRO A 1 86  ? -1.526  12.092  -1.014  1.00 0.00 ? 89  PRO A HG2  1  
ATOM 1011  H HG3  . PRO A 1 86  ? -0.155  11.601  -0.004  1.00 0.00 ? 89  PRO A HG3  1  
ATOM 1012  H HD2  . PRO A 1 86  ? -0.594  14.133  -1.503  1.00 0.00 ? 89  PRO A HD2  1  
ATOM 1013  H HD3  . PRO A 1 86  ? 0.260   13.855  0.023   1.00 0.00 ? 89  PRO A HD3  1  
ATOM 1014  N N    . LEU A 1 87  ? 2.093   12.245  -4.880  1.00 0.00 ? 90  LEU A N    1  
ATOM 1015  C CA   . LEU A 1 87  ? 2.034   12.537  -6.304  1.00 0.00 ? 90  LEU A CA   1  
ATOM 1016  C C    . LEU A 1 87  ? 1.184   11.511  -7.036  1.00 0.00 ? 90  LEU A C    1  
ATOM 1017  O O    . LEU A 1 87  ? 0.421   11.851  -7.942  1.00 0.00 ? 90  LEU A O    1  
ATOM 1018  C CB   . LEU A 1 87  ? 3.440   12.534  -6.901  1.00 0.00 ? 90  LEU A CB   1  
ATOM 1019  C CG   . LEU A 1 87  ? 4.374   13.625  -6.382  1.00 0.00 ? 90  LEU A CG   1  
ATOM 1020  C CD1  . LEU A 1 87  ? 5.797   13.370  -6.854  1.00 0.00 ? 90  LEU A CD1  1  
ATOM 1021  C CD2  . LEU A 1 87  ? 3.900   14.997  -6.837  1.00 0.00 ? 90  LEU A CD2  1  
ATOM 1022  H H    . LEU A 1 87  ? 2.888   11.792  -4.519  1.00 0.00 ? 90  LEU A H    1  
ATOM 1023  H HA   . LEU A 1 87  ? 1.596   13.513  -6.429  1.00 0.00 ? 90  LEU A HA   1  
ATOM 1024  H HB2  . LEU A 1 87  ? 3.890   11.577  -6.692  1.00 0.00 ? 90  LEU A HB2  1  
ATOM 1025  H HB3  . LEU A 1 87  ? 3.353   12.642  -7.970  1.00 0.00 ? 90  LEU A HB3  1  
ATOM 1026  H HG   . LEU A 1 87  ? 4.372   13.611  -5.302  1.00 0.00 ? 90  LEU A HG   1  
ATOM 1027  H HD11 . LEU A 1 87  ? 6.111   12.387  -6.537  1.00 0.00 ? 90  LEU A HD11 1  
ATOM 1028  H HD12 . LEU A 1 87  ? 5.837   13.430  -7.932  1.00 0.00 ? 90  LEU A HD12 1  
ATOM 1029  H HD13 . LEU A 1 87  ? 6.455   14.113  -6.428  1.00 0.00 ? 90  LEU A HD13 1  
ATOM 1030  H HD21 . LEU A 1 87  ? 4.595   15.749  -6.494  1.00 0.00 ? 90  LEU A HD21 1  
ATOM 1031  H HD22 . LEU A 1 87  ? 3.848   15.021  -7.916  1.00 0.00 ? 90  LEU A HD22 1  
ATOM 1032  H HD23 . LEU A 1 87  ? 2.922   15.196  -6.427  1.00 0.00 ? 90  LEU A HD23 1  
ATOM 1033  N N    . SER A 1 88  ? 1.327   10.253  -6.650  1.00 0.00 ? 91  SER A N    1  
ATOM 1034  C CA   . SER A 1 88  ? 0.633   9.166   -7.322  1.00 0.00 ? 91  SER A CA   1  
ATOM 1035  C C    . SER A 1 88  ? 0.425   7.987   -6.381  1.00 0.00 ? 91  SER A C    1  
ATOM 1036  O O    . SER A 1 88  ? 1.199   7.785   -5.441  1.00 0.00 ? 91  SER A O    1  
ATOM 1037  C CB   . SER A 1 88  ? 1.420   8.708   -8.551  1.00 0.00 ? 91  SER A CB   1  
ATOM 1038  O OG   . SER A 1 88  ? 1.588   9.768   -9.479  1.00 0.00 ? 91  SER A OG   1  
ATOM 1039  H H    . SER A 1 88  ? 1.903   10.050  -5.884  1.00 0.00 ? 91  SER A H    1  
ATOM 1040  H HA   . SER A 1 88  ? -0.329  9.533   -7.640  1.00 0.00 ? 91  SER A HA   1  
ATOM 1041  H HB2  . SER A 1 88  ? 2.393   8.358   -8.243  1.00 0.00 ? 91  SER A HB2  1  
ATOM 1042  H HB3  . SER A 1 88  ? 0.886   7.903   -9.037  1.00 0.00 ? 91  SER A HB3  1  
ATOM 1043  H HG   . SER A 1 88  ? 1.236   10.586  -9.098  1.00 0.00 ? 91  SER A HG   1  
ATOM 1044  N N    . LEU A 1 89  ? -0.621  7.224   -6.651  1.00 0.00 ? 92  LEU A N    1  
ATOM 1045  C CA   . LEU A 1 89  ? -0.959  6.044   -5.869  1.00 0.00 ? 92  LEU A CA   1  
ATOM 1046  C C    . LEU A 1 89  ? -1.591  5.015   -6.806  1.00 0.00 ? 92  LEU A C    1  
ATOM 1047  O O    . LEU A 1 89  ? -2.665  5.258   -7.364  1.00 0.00 ? 92  LEU A O    1  
ATOM 1048  C CB   . LEU A 1 89  ? -1.946  6.432   -4.757  1.00 0.00 ? 92  LEU A CB   1  
ATOM 1049  C CG   . LEU A 1 89  ? -1.936  5.568   -3.484  1.00 0.00 ? 92  LEU A CG   1  
ATOM 1050  C CD1  . LEU A 1 89  ? -2.989  6.063   -2.502  1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1051  C CD2  . LEU A 1 89  ? -2.176  4.100   -3.794  1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1052  H H    . LEU A 1 89  ? -1.196  7.463   -7.416  1.00 0.00 ? 92  LEU A H    1  
ATOM 1053  H HA   . LEU A 1 89  ? -0.053  5.643   -5.438  1.00 0.00 ? 92  LEU A HA   1  
ATOM 1054  H HB2  . LEU A 1 89  ? -1.730  7.450   -4.464  1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1055  H HB3  . LEU A 1 89  ? -2.941  6.401   -5.174  1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1056  H HG   . LEU A 1 89  ? -0.969  5.658   -3.007  1.00 0.00 ? 92  LEU A HG   1  
ATOM 1057  H HD11 . LEU A 1 89  ? -2.978  5.442   -1.617  1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1058  H HD12 . LEU A 1 89  ? -2.775  7.086   -2.225  1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1059  H HD13 . LEU A 1 89  ? -3.965  6.011   -2.962  1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1060  H HD21 . LEU A 1 89  ? -2.255  3.545   -2.870  1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1061  H HD22 . LEU A 1 89  ? -3.094  3.996   -4.355  1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1062  H HD23 . LEU A 1 89  ? -1.353  3.713   -4.377  1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1063  N N    . GLY A 1 90  ? -0.918  3.890   -7.009  1.00 0.00 ? 93  GLY A N    1  
ATOM 1064  C CA   . GLY A 1 90  ? -1.435  2.872   -7.909  1.00 0.00 ? 93  GLY A CA   1  
ATOM 1065  C C    . GLY A 1 90  ? -0.472  1.714   -8.075  1.00 0.00 ? 93  GLY A C    1  
ATOM 1066  O O    . GLY A 1 90  ? 0.399   1.517   -7.234  1.00 0.00 ? 93  GLY A O    1  
ATOM 1067  H H    . GLY A 1 90  ? -0.061  3.747   -6.545  1.00 0.00 ? 93  GLY A H    1  
ATOM 1068  H HA2  . GLY A 1 90  ? -2.372  2.497   -7.516  1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1069  H HA3  . GLY A 1 90  ? -1.613  3.321   -8.877  1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1070  N N    . PRO A 1 91  ? -0.602  0.923   -9.151  1.00 0.00 ? 94  PRO A N    1  
ATOM 1071  C CA   . PRO A 1 91  ? 0.291   -0.211  -9.408  1.00 0.00 ? 94  PRO A CA   1  
ATOM 1072  C C    . PRO A 1 91  ? 1.702   0.244   -9.779  1.00 0.00 ? 94  PRO A C    1  
ATOM 1073  O O    . PRO A 1 91  ? 1.918   0.838   -10.838 1.00 0.00 ? 94  PRO A O    1  
ATOM 1074  C CB   . PRO A 1 91  ? -0.371  -0.933  -10.583 1.00 0.00 ? 94  PRO A CB   1  
ATOM 1075  C CG   . PRO A 1 91  ? -1.175  0.115   -11.269 1.00 0.00 ? 94  PRO A CG   1  
ATOM 1076  C CD   . PRO A 1 91  ? -1.626  1.069   -10.199 1.00 0.00 ? 94  PRO A CD   1  
ATOM 1077  H HA   . PRO A 1 91  ? 0.341   -0.873  -8.553  1.00 0.00 ? 94  PRO A HA   1  
ATOM 1078  H HB2  . PRO A 1 91  ? 0.391   -1.337  -11.237 1.00 0.00 ? 94  PRO A HB2  1  
ATOM 1079  H HB3  . PRO A 1 91  ? -0.997  -1.733  -10.214 1.00 0.00 ? 94  PRO A HB3  1  
ATOM 1080  H HG2  . PRO A 1 91  ? -0.562  0.630   -11.993 1.00 0.00 ? 94  PRO A HG2  1  
ATOM 1081  H HG3  . PRO A 1 91  ? -2.029  -0.335  -11.754 1.00 0.00 ? 94  PRO A HG3  1  
ATOM 1082  H HD2  . PRO A 1 91  ? -1.647  2.078   -10.580 1.00 0.00 ? 94  PRO A HD2  1  
ATOM 1083  H HD3  . PRO A 1 91  ? -2.600  0.786   -9.824  1.00 0.00 ? 94  PRO A HD3  1  
ATOM 1084  N N    . PHE A 1 92  ? 2.652   -0.043  -8.901  1.00 0.00 ? 95  PHE A N    1  
ATOM 1085  C CA   . PHE A 1 92  ? 4.031   0.370   -9.100  1.00 0.00 ? 95  PHE A CA   1  
ATOM 1086  C C    . PHE A 1 92  ? 4.915   -0.852  -9.320  1.00 0.00 ? 95  PHE A C    1  
ATOM 1087  O O    . PHE A 1 92  ? 5.395   -1.459  -8.357  1.00 0.00 ? 95  PHE A O    1  
ATOM 1088  C CB   . PHE A 1 92  ? 4.526   1.164   -7.889  1.00 0.00 ? 95  PHE A CB   1  
ATOM 1089  C CG   . PHE A 1 92  ? 5.840   1.865   -8.108  1.00 0.00 ? 95  PHE A CG   1  
ATOM 1090  C CD1  . PHE A 1 92  ? 5.903   3.025   -8.865  1.00 0.00 ? 95  PHE A CD1  1  
ATOM 1091  C CD2  . PHE A 1 92  ? 7.011   1.369   -7.555  1.00 0.00 ? 95  PHE A CD2  1  
ATOM 1092  C CE1  . PHE A 1 92  ? 7.107   3.676   -9.066  1.00 0.00 ? 95  PHE A CE1  1  
ATOM 1093  C CE2  . PHE A 1 92  ? 8.216   2.015   -7.752  1.00 0.00 ? 95  PHE A CE2  1  
ATOM 1094  C CZ   . PHE A 1 92  ? 8.264   3.169   -8.509  1.00 0.00 ? 95  PHE A CZ   1  
ATOM 1095  H H    . PHE A 1 92  ? 2.420   -0.566  -8.101  1.00 0.00 ? 95  PHE A H    1  
ATOM 1096  H HA   . PHE A 1 92  ? 4.071   0.999   -9.978  1.00 0.00 ? 95  PHE A HA   1  
ATOM 1097  H HB2  . PHE A 1 92  ? 3.790   1.912   -7.631  1.00 0.00 ? 95  PHE A HB2  1  
ATOM 1098  H HB3  . PHE A 1 92  ? 4.647   0.485   -7.056  1.00 0.00 ? 95  PHE A HB3  1  
ATOM 1099  H HD1  . PHE A 1 92  ? 4.998   3.422   -9.301  1.00 0.00 ? 95  PHE A HD1  1  
ATOM 1100  H HD2  . PHE A 1 92  ? 6.977   0.467   -6.962  1.00 0.00 ? 95  PHE A HD2  1  
ATOM 1101  H HE1  . PHE A 1 92  ? 7.142   4.580   -9.657  1.00 0.00 ? 95  PHE A HE1  1  
ATOM 1102  H HE2  . PHE A 1 92  ? 9.121   1.617   -7.317  1.00 0.00 ? 95  PHE A HE2  1  
ATOM 1103  H HZ   . PHE A 1 92  ? 9.206   3.673   -8.665  1.00 0.00 ? 95  PHE A HZ   1  
ATOM 1104  N N    . LEU A 1 93  ? 5.102   -1.211  -10.590 1.00 0.00 ? 96  LEU A N    1  
ATOM 1105  C CA   . LEU A 1 93  ? 5.940   -2.349  -10.976 1.00 0.00 ? 96  LEU A CA   1  
ATOM 1106  C C    . LEU A 1 93  ? 5.298   -3.670  -10.561 1.00 0.00 ? 96  LEU A C    1  
ATOM 1107  O O    . LEU A 1 93  ? 4.188   -3.699  -10.022 1.00 0.00 ? 96  LEU A O    1  
ATOM 1108  C CB   . LEU A 1 93  ? 7.345   -2.228  -10.371 1.00 0.00 ? 96  LEU A CB   1  
ATOM 1109  C CG   . LEU A 1 93  ? 8.146   -1.001  -10.824 1.00 0.00 ? 96  LEU A CG   1  
ATOM 1110  C CD1  . LEU A 1 93  ? 9.514   -0.980  -10.161 1.00 0.00 ? 96  LEU A CD1  1  
ATOM 1111  C CD2  . LEU A 1 93  ? 8.293   -0.984  -12.338 1.00 0.00 ? 96  LEU A CD2  1  
ATOM 1112  H H    . LEU A 1 93  ? 4.650   -0.701  -11.291 1.00 0.00 ? 96  LEU A H    1  
ATOM 1113  H HA   . LEU A 1 93  ? 6.029   -2.338  -12.054 1.00 0.00 ? 96  LEU A HA   1  
ATOM 1114  H HB2  . LEU A 1 93  ? 7.245   -2.191  -9.294  1.00 0.00 ? 96  LEU A HB2  1  
ATOM 1115  H HB3  . LEU A 1 93  ? 7.905   -3.114  -10.634 1.00 0.00 ? 96  LEU A HB3  1  
ATOM 1116  H HG   . LEU A 1 93  ? 7.618   -0.105  -10.527 1.00 0.00 ? 96  LEU A HG   1  
ATOM 1117  H HD11 . LEU A 1 93  ? 10.070  -1.857  -10.456 1.00 0.00 ? 96  LEU A HD11 1  
ATOM 1118  H HD12 . LEU A 1 93  ? 10.050  -0.095  -10.473 1.00 0.00 ? 96  LEU A HD12 1  
ATOM 1119  H HD13 . LEU A 1 93  ? 9.397   -0.971  -9.088  1.00 0.00 ? 96  LEU A HD13 1  
ATOM 1120  H HD21 . LEU A 1 93  ? 8.864   -0.115  -12.633 1.00 0.00 ? 96  LEU A HD21 1  
ATOM 1121  H HD22 . LEU A 1 93  ? 8.807   -1.877  -12.662 1.00 0.00 ? 96  LEU A HD22 1  
ATOM 1122  H HD23 . LEU A 1 93  ? 7.316   -0.946  -12.796 1.00 0.00 ? 96  LEU A HD23 1  
ATOM 1123  N N    . LYS A 1 94  ? 5.990   -4.762  -10.830 1.00 0.00 ? 97  LYS A N    1  
ATOM 1124  C CA   . LYS A 1 94  ? 5.471   -6.084  -10.531 1.00 0.00 ? 97  LYS A CA   1  
ATOM 1125  C C    . LYS A 1 94  ? 6.510   -6.898  -9.772  1.00 0.00 ? 97  LYS A C    1  
ATOM 1126  O O    . LYS A 1 94  ? 7.357   -7.556  -10.372 1.00 0.00 ? 97  LYS A O    1  
ATOM 1127  C CB   . LYS A 1 94  ? 5.083   -6.784  -11.834 1.00 0.00 ? 97  LYS A CB   1  
ATOM 1128  C CG   . LYS A 1 94  ? 4.370   -8.113  -11.648 1.00 0.00 ? 97  LYS A CG   1  
ATOM 1129  C CD   . LYS A 1 94  ? 4.070   -8.759  -12.993 1.00 0.00 ? 97  LYS A CD   1  
ATOM 1130  C CE   . LYS A 1 94  ? 3.154   -7.892  -13.844 1.00 0.00 ? 97  LYS A CE   1  
ATOM 1131  N NZ   . LYS A 1 94  ? 3.026   -8.413  -15.229 1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1132  H H    . LYS A 1 94  ? 6.879   -4.678  -11.248 1.00 0.00 ? 97  LYS A H    1  
ATOM 1133  H HA   . LYS A 1 94  ? 4.595   -5.966  -9.914  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1134  H HB2  . LYS A 1 94  ? 4.432   -6.130  -12.395 1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1135  H HB3  . LYS A 1 94  ? 5.980   -6.961  -12.408 1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1136  H HG2  . LYS A 1 94  ? 5.002   -8.774  -11.073 1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1137  H HG3  . LYS A 1 94  ? 3.441   -7.948  -11.120 1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1138  H HD2  . LYS A 1 94  ? 5.000   -8.909  -13.523 1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1139  H HD3  . LYS A 1 94  ? 3.594   -9.715  -12.824 1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1140  H HE2  . LYS A 1 94  ? 2.175   -7.869  -13.388 1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1141  H HE3  . LYS A 1 94  ? 3.556   -6.890  -13.880 1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1142  H HZ1  . LYS A 1 94  ? 2.719   -9.409  -15.198 1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1143  H HZ3  . LYS A 1 94  ? 3.962   -8.379  -15.697 1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1144  N N    . THR A 1 95  ? 6.442   -6.837  -8.453  1.00 0.00 ? 98  THR A N    1  
ATOM 1145  C CA   . THR A 1 95  ? 7.408   -7.518  -7.603  1.00 0.00 ? 98  THR A CA   1  
ATOM 1146  C C    . THR A 1 95  ? 7.076   -9.007  -7.481  1.00 0.00 ? 98  THR A C    1  
ATOM 1147  O O    . THR A 1 95  ? 7.948   -9.855  -7.659  1.00 0.00 ? 98  THR A O    1  
ATOM 1148  C CB   . THR A 1 95  ? 7.437   -6.875  -6.203  1.00 0.00 ? 98  THR A CB   1  
ATOM 1149  O OG1  . THR A 1 95  ? 7.429   -5.446  -6.328  1.00 0.00 ? 98  THR A OG1  1  
ATOM 1150  C CG2  . THR A 1 95  ? 8.669   -7.313  -5.425  1.00 0.00 ? 98  THR A CG2  1  
ATOM 1151  H H    . THR A 1 95  ? 5.726   -6.310  -8.034  1.00 0.00 ? 98  THR A H    1  
ATOM 1152  H HA   . THR A 1 95  ? 8.385   -7.411  -8.050  1.00 0.00 ? 98  THR A HA   1  
ATOM 1153  H HB   . THR A 1 95  ? 6.557   -7.186  -5.659  1.00 0.00 ? 98  THR A HB   1  
ATOM 1154  H HG1  . THR A 1 95  ? 8.147   -5.170  -6.928  1.00 0.00 ? 98  THR A HG1  1  
ATOM 1155  H HG21 . THR A 1 95  ? 8.718   -8.392  -5.406  1.00 0.00 ? 98  THR A HG21 1  
ATOM 1156  H HG22 . THR A 1 95  ? 8.612   -6.935  -4.415  1.00 0.00 ? 98  THR A HG22 1  
ATOM 1157  H HG23 . THR A 1 95  ? 9.555   -6.922  -5.904  1.00 0.00 ? 98  THR A HG23 1  
ATOM 1158  N N    . TYR A 1 96  ? 5.808   -9.306  -7.199  1.00 0.00 ? 99  TYR A N    1  
ATOM 1159  C CA   . TYR A 1 96  ? 5.327   -10.686 -7.043  1.00 0.00 ? 99  TYR A CA   1  
ATOM 1160  C C    . TYR A 1 96  ? 5.976   -11.407 -5.863  1.00 0.00 ? 99  TYR A C    1  
ATOM 1161  O O    . TYR A 1 96  ? 7.133   -11.825 -5.920  1.00 0.00 ? 99  TYR A O    1  
ATOM 1162  C CB   . TYR A 1 96  ? 5.532   -11.505 -8.318  1.00 0.00 ? 99  TYR A CB   1  
ATOM 1163  C CG   . TYR A 1 96  ? 4.255   -11.710 -9.103  1.00 0.00 ? 99  TYR A CG   1  
ATOM 1164  C CD1  . TYR A 1 96  ? 3.149   -12.315 -8.514  1.00 0.00 ? 99  TYR A CD1  1  
ATOM 1165  C CD2  . TYR A 1 96  ? 4.149   -11.296 -10.421 1.00 0.00 ? 99  TYR A CD2  1  
ATOM 1166  C CE1  . TYR A 1 96  ? 1.978   -12.500 -9.221  1.00 0.00 ? 99  TYR A CE1  1  
ATOM 1167  C CE2  . TYR A 1 96  ? 2.980   -11.478 -11.132 1.00 0.00 ? 99  TYR A CE2  1  
ATOM 1168  C CZ   . TYR A 1 96  ? 1.899   -12.081 -10.529 1.00 0.00 ? 99  TYR A CZ   1  
ATOM 1169  O OH   . TYR A 1 96  ? 0.733   -12.263 -11.237 1.00 0.00 ? 99  TYR A OH   1  
ATOM 1170  H H    . TYR A 1 96  ? 5.170   -8.572  -7.092  1.00 0.00 ? 99  TYR A H    1  
ATOM 1171  H HA   . TYR A 1 96  ? 4.265   -10.627 -6.852  1.00 0.00 ? 99  TYR A HA   1  
ATOM 1172  H HB2  . TYR A 1 96  ? 6.241   -10.997 -8.955  1.00 0.00 ? 99  TYR A HB2  1  
ATOM 1173  H HB3  . TYR A 1 96  ? 5.921   -12.476 -8.055  1.00 0.00 ? 99  TYR A HB3  1  
ATOM 1174  H HD1  . TYR A 1 96  ? 3.214   -12.643 -7.487  1.00 0.00 ? 99  TYR A HD1  1  
ATOM 1175  H HD2  . TYR A 1 96  ? 4.999   -10.827 -10.895 1.00 0.00 ? 99  TYR A HD2  1  
ATOM 1176  H HE1  . TYR A 1 96  ? 1.130   -12.973 -8.746  1.00 0.00 ? 99  TYR A HE1  1  
ATOM 1177  H HE2  . TYR A 1 96  ? 2.916   -11.145 -12.158 1.00 0.00 ? 99  TYR A HE2  1  
ATOM 1178  H HH   . TYR A 1 96  ? 0.941   -12.661 -12.099 1.00 0.00 ? 99  TYR A HH   1  
ATOM 1179  N N    . THR A 1 97  ? 5.215   -11.546 -4.789  1.00 0.00 ? 100 THR A N    1  
ATOM 1180  C CA   . THR A 1 97  ? 5.630   -12.339 -3.644  1.00 0.00 ? 100 THR A CA   1  
ATOM 1181  C C    . THR A 1 97  ? 4.392   -12.920 -2.960  1.00 0.00 ? 100 THR A C    1  
ATOM 1182  O O    . THR A 1 97  ? 3.902   -12.354 -1.978  1.00 0.00 ? 100 THR A O    1  
ATOM 1183  C CB   . THR A 1 97  ? 6.437   -11.500 -2.630  1.00 0.00 ? 100 THR A CB   1  
ATOM 1184  O OG1  . THR A 1 97  ? 7.470   -10.769 -3.305  1.00 0.00 ? 100 THR A OG1  1  
ATOM 1185  C CG2  . THR A 1 97  ? 7.064   -12.395 -1.567  1.00 0.00 ? 100 THR A CG2  1  
ATOM 1186  H H    . THR A 1 97  ? 4.342   -11.105 -4.763  1.00 0.00 ? 100 THR A H    1  
ATOM 1187  H HA   . THR A 1 97  ? 6.251   -13.149 -4.000  1.00 0.00 ? 100 THR A HA   1  
ATOM 1188  H HB   . THR A 1 97  ? 5.768   -10.805 -2.146  1.00 0.00 ? 100 THR A HB   1  
ATOM 1189  H HG1  . THR A 1 97  ? 7.523   -11.068 -4.223  1.00 0.00 ? 100 THR A HG1  1  
ATOM 1190  H HG21 . THR A 1 97  ? 7.589   -11.787 -0.847  1.00 0.00 ? 100 THR A HG21 1  
ATOM 1191  H HG22 . THR A 1 97  ? 7.757   -13.078 -2.036  1.00 0.00 ? 100 THR A HG22 1  
ATOM 1192  H HG23 . THR A 1 97  ? 6.289   -12.959 -1.068  1.00 0.00 ? 100 THR A HG23 1  
ATOM 1193  N N    . PRO A 1 98  ? 3.865   -14.047 -3.489  1.00 0.00 ? 101 PRO A N    1  
ATOM 1194  C CA   . PRO A 1 98  ? 2.616   -14.677 -3.012  1.00 0.00 ? 101 PRO A CA   1  
ATOM 1195  C C    . PRO A 1 98  ? 2.722   -15.214 -1.587  1.00 0.00 ? 101 PRO A C    1  
ATOM 1196  O O    . PRO A 1 98  ? 2.696   -16.425 -1.353  1.00 0.00 ? 101 PRO A O    1  
ATOM 1197  C CB   . PRO A 1 98  ? 2.380   -15.828 -4.003  1.00 0.00 ? 101 PRO A CB   1  
ATOM 1198  C CG   . PRO A 1 98  ? 3.260   -15.528 -5.168  1.00 0.00 ? 101 PRO A CG   1  
ATOM 1199  C CD   . PRO A 1 98  ? 4.446   -14.802 -4.606  1.00 0.00 ? 101 PRO A CD   1  
ATOM 1200  H HA   . PRO A 1 98  ? 1.789   -13.985 -3.064  1.00 0.00 ? 101 PRO A HA   1  
ATOM 1201  H HB2  . PRO A 1 98  ? 2.650   -16.765 -3.539  1.00 0.00 ? 101 PRO A HB2  1  
ATOM 1202  H HB3  . PRO A 1 98  ? 1.339   -15.850 -4.292  1.00 0.00 ? 101 PRO A HB3  1  
ATOM 1203  H HG2  . PRO A 1 98  ? 3.571   -16.449 -5.640  1.00 0.00 ? 101 PRO A HG2  1  
ATOM 1204  H HG3  . PRO A 1 98  ? 2.738   -14.900 -5.874  1.00 0.00 ? 101 PRO A HG3  1  
ATOM 1205  H HD2  . PRO A 1 98  ? 5.189   -15.505 -4.256  1.00 0.00 ? 101 PRO A HD2  1  
ATOM 1206  H HD3  . PRO A 1 98  ? 4.869   -14.137 -5.344  1.00 0.00 ? 101 PRO A HD3  1  
ATOM 1207  N N    . GLN A 1 99  ? 2.828   -14.288 -0.652  1.00 0.00 ? 102 GLN A N    1  
ATOM 1208  C CA   . GLN A 1 99  ? 2.950   -14.577 0.764   1.00 0.00 ? 102 GLN A CA   1  
ATOM 1209  C C    . GLN A 1 99  ? 3.081   -13.251 1.492   1.00 0.00 ? 102 GLN A C    1  
ATOM 1210  O O    . GLN A 1 99  ? 2.368   -12.975 2.452   1.00 0.00 ? 102 GLN A O    1  
ATOM 1211  C CB   . GLN A 1 99  ? 4.175   -15.464 1.040   1.00 0.00 ? 102 GLN A CB   1  
ATOM 1212  C CG   . GLN A 1 99  ? 4.292   -15.951 2.480   1.00 0.00 ? 102 GLN A CG   1  
ATOM 1213  C CD   . GLN A 1 99  ? 4.825   -14.897 3.437   1.00 0.00 ? 102 GLN A CD   1  
ATOM 1214  O OE1  . GLN A 1 99  ? 5.622   -14.035 3.054   1.00 0.00 ? 102 GLN A OE1  1  
ATOM 1215  N NE2  . GLN A 1 99  ? 4.378   -14.947 4.683   1.00 0.00 ? 102 GLN A NE2  1  
ATOM 1216  H H    . GLN A 1 99  ? 2.830   -13.346 -0.935  1.00 0.00 ? 102 GLN A H    1  
ATOM 1217  H HA   . GLN A 1 99  ? 2.050   -15.080 1.090   1.00 0.00 ? 102 GLN A HA   1  
ATOM 1218  H HB2  . GLN A 1 99  ? 4.126   -16.329 0.395   1.00 0.00 ? 102 GLN A HB2  1  
ATOM 1219  H HB3  . GLN A 1 99  ? 5.068   -14.902 0.801   1.00 0.00 ? 102 GLN A HB3  1  
ATOM 1220  H HG2  . GLN A 1 99  ? 3.312   -16.254 2.818   1.00 0.00 ? 102 GLN A HG2  1  
ATOM 1221  H HG3  . GLN A 1 99  ? 4.955   -16.803 2.500   1.00 0.00 ? 102 GLN A HG3  1  
ATOM 1222  H HE21 . GLN A 1 99  ? 3.732   -15.655 4.918   1.00 0.00 ? 102 GLN A HE21 1  
ATOM 1223  H HE22 . GLN A 1 99  ? 4.706   -14.279 5.318   1.00 0.00 ? 102 GLN A HE22 1  
ATOM 1224  N N    . SER A 1 100 ? 3.986   -12.425 0.998   1.00 0.00 ? 103 SER A N    1  
ATOM 1225  C CA   . SER A 1 100 ? 4.219   -11.120 1.580   1.00 0.00 ? 103 SER A CA   1  
ATOM 1226  C C    . SER A 1 100 ? 3.182   -10.117 1.090   1.00 0.00 ? 103 SER A C    1  
ATOM 1227  O O    . SER A 1 100 ? 2.766   -9.242  1.841   1.00 0.00 ? 103 SER A O    1  
ATOM 1228  C CB   . SER A 1 100 ? 5.626   -10.638 1.244   1.00 0.00 ? 103 SER A CB   1  
ATOM 1229  O OG   . SER A 1 100 ? 6.598   -11.579 1.670   1.00 0.00 ? 103 SER A OG   1  
ATOM 1230  H H    . SER A 1 100 ? 4.518   -12.705 0.225   1.00 0.00 ? 103 SER A H    1  
ATOM 1231  H HA   . SER A 1 100 ? 4.128   -11.217 2.651   1.00 0.00 ? 103 SER A HA   1  
ATOM 1232  H HB2  . SER A 1 100 ? 5.716   -10.506 0.176   1.00 0.00 ? 103 SER A HB2  1  
ATOM 1233  H HB3  . SER A 1 100 ? 5.810   -9.697  1.741   1.00 0.00 ? 103 SER A HB3  1  
ATOM 1234  H HG   . SER A 1 100 ? 6.172   -12.270 2.201   1.00 0.00 ? 103 SER A HG   1  
ATOM 1235  N N    . SER A 1 101 ? 2.764   -10.243 -0.165  1.00 0.00 ? 104 SER A N    1  
ATOM 1236  C CA   . SER A 1 101 ? 1.752   -9.354  -0.712  1.00 0.00 ? 104 SER A CA   1  
ATOM 1237  C C    . SER A 1 101 ? 0.351   -9.826  -0.322  1.00 0.00 ? 104 SER A C    1  
ATOM 1238  O O    . SER A 1 101 ? 0.025   -11.012 -0.429  1.00 0.00 ? 104 SER A O    1  
ATOM 1239  C CB   . SER A 1 101 ? 1.899   -9.258  -2.235  1.00 0.00 ? 104 SER A CB   1  
ATOM 1240  O OG   . SER A 1 101 ? 2.032   -10.542 -2.823  1.00 0.00 ? 104 SER A OG   1  
ATOM 1241  H H    . SER A 1 101 ? 3.141   -10.949 -0.735  1.00 0.00 ? 104 SER A H    1  
ATOM 1242  H HA   . SER A 1 101 ? 1.919   -8.374  -0.284  1.00 0.00 ? 104 SER A HA   1  
ATOM 1243  H HB2  . SER A 1 101 ? 1.028   -8.774  -2.649  1.00 0.00 ? 104 SER A HB2  1  
ATOM 1244  H HB3  . SER A 1 101 ? 2.779   -8.676  -2.472  1.00 0.00 ? 104 SER A HB3  1  
ATOM 1245  H HG   . SER A 1 101 ? 1.158   -10.887 -3.057  1.00 0.00 ? 104 SER A HG   1  
ATOM 1246  N N    . ILE A 1 102 ? -0.469  -8.895  0.144   1.00 0.00 ? 105 ILE A N    1  
ATOM 1247  C CA   . ILE A 1 102 ? -1.808  -9.214  0.617   1.00 0.00 ? 105 ILE A CA   1  
ATOM 1248  C C    . ILE A 1 102 ? -2.878  -8.477  -0.183  1.00 0.00 ? 105 ILE A C    1  
ATOM 1249  O O    . ILE A 1 102 ? -2.593  -7.504  -0.887  1.00 0.00 ? 105 ILE A O    1  
ATOM 1250  C CB   . ILE A 1 102 ? -1.981  -8.866  2.113   1.00 0.00 ? 105 ILE A CB   1  
ATOM 1251  C CG1  . ILE A 1 102 ? -1.626  -7.392  2.358   1.00 0.00 ? 105 ILE A CG1  1  
ATOM 1252  C CG2  . ILE A 1 102 ? -1.137  -9.792  2.982   1.00 0.00 ? 105 ILE A CG2  1  
ATOM 1253  C CD1  . ILE A 1 102 ? -1.860  -6.923  3.776   1.00 0.00 ? 105 ILE A CD1  1  
ATOM 1254  H H    . ILE A 1 102 ? -0.161  -7.962  0.173   1.00 0.00 ? 105 ILE A H    1  
ATOM 1255  H HA   . ILE A 1 102 ? -1.955  -10.275 0.498   1.00 0.00 ? 105 ILE A HA   1  
ATOM 1256  H HB   . ILE A 1 102 ? -3.015  -9.023  2.373   1.00 0.00 ? 105 ILE A HB   1  
ATOM 1257  H HG12 . ILE A 1 102 ? -0.582  -7.237  2.132   1.00 0.00 ? 105 ILE A HG12 1  
ATOM 1258  H HG13 . ILE A 1 102 ? -2.226  -6.776  1.703   1.00 0.00 ? 105 ILE A HG13 1  
ATOM 1259  H HG21 . ILE A 1 102 ? -1.188  -9.469  4.012   1.00 0.00 ? 105 ILE A HG21 1  
ATOM 1260  H HG22 . ILE A 1 102 ? -1.512  -10.801 2.903   1.00 0.00 ? 105 ILE A HG22 1  
ATOM 1261  H HG23 . ILE A 1 102 ? -0.111  -9.765  2.647   1.00 0.00 ? 105 ILE A HG23 1  
ATOM 1262  H HD11 . ILE A 1 102 ? -2.898  -7.057  4.033   1.00 0.00 ? 105 ILE A HD11 1  
ATOM 1263  H HD12 . ILE A 1 102 ? -1.246  -7.499  4.452   1.00 0.00 ? 105 ILE A HD12 1  
ATOM 1264  H HD13 . ILE A 1 102 ? -1.600  -5.879  3.856   1.00 0.00 ? 105 ILE A HD13 1  
ATOM 1265  N N    . ILE A 1 103 ? -4.104  -8.958  -0.063  1.00 0.00 ? 106 ILE A N    1  
ATOM 1266  C CA   . ILE A 1 103 ? -5.261  -8.346  -0.691  1.00 0.00 ? 106 ILE A CA   1  
ATOM 1267  C C    . ILE A 1 103 ? -6.376  -8.193  0.342   1.00 0.00 ? 106 ILE A C    1  
ATOM 1268  O O    . ILE A 1 103 ? -6.775  -9.164  0.989   1.00 0.00 ? 106 ILE A O    1  
ATOM 1269  C CB   . ILE A 1 103 ? -5.762  -9.179  -1.899  1.00 0.00 ? 106 ILE A CB   1  
ATOM 1270  C CG1  . ILE A 1 103 ? -4.839  -8.971  -3.101  1.00 0.00 ? 106 ILE A CG1  1  
ATOM 1271  C CG2  . ILE A 1 103 ? -7.199  -8.822  -2.261  1.00 0.00 ? 106 ILE A CG2  1  
ATOM 1272  C CD1  . ILE A 1 103 ? -5.222  -9.791  -4.317  1.00 0.00 ? 106 ILE A CD1  1  
ATOM 1273  H H    . ILE A 1 103 ? -4.242  -9.765  0.490   1.00 0.00 ? 106 ILE A H    1  
ATOM 1274  H HA   . ILE A 1 103 ? -4.969  -7.367  -1.046  1.00 0.00 ? 106 ILE A HA   1  
ATOM 1275  H HB   . ILE A 1 103 ? -5.736  -10.221 -1.619  1.00 0.00 ? 106 ILE A HB   1  
ATOM 1276  H HG12 . ILE A 1 103 ? -4.864  -7.929  -3.385  1.00 0.00 ? 106 ILE A HG12 1  
ATOM 1277  H HG13 . ILE A 1 103 ? -3.830  -9.239  -2.819  1.00 0.00 ? 106 ILE A HG13 1  
ATOM 1278  H HG21 . ILE A 1 103 ? -7.828  -8.940  -1.391  1.00 0.00 ? 106 ILE A HG21 1  
ATOM 1279  H HG22 . ILE A 1 103 ? -7.242  -7.801  -2.599  1.00 0.00 ? 106 ILE A HG22 1  
ATOM 1280  H HG23 . ILE A 1 103 ? -7.545  -9.477  -3.047  1.00 0.00 ? 106 ILE A HG23 1  
ATOM 1281  H HD11 . ILE A 1 103 ? -6.201  -9.490  -4.659  1.00 0.00 ? 106 ILE A HD11 1  
ATOM 1282  H HD12 . ILE A 1 103 ? -4.501  -9.627  -5.104  1.00 0.00 ? 106 ILE A HD12 1  
ATOM 1283  H HD13 . ILE A 1 103 ? -5.239  -10.838 -4.056  1.00 0.00 ? 106 ILE A HD13 1  
ATOM 1284  N N    . CYS A 1 104 ? -6.850  -6.972  0.514   1.00 0.00 ? 107 CYS A N    1  
ATOM 1285  C CA   . CYS A 1 104 ? -7.884  -6.684  1.495   1.00 0.00 ? 107 CYS A CA   1  
ATOM 1286  C C    . CYS A 1 104 ? -9.242  -6.573  0.808   1.00 0.00 ? 107 CYS A C    1  
ATOM 1287  O O    . CYS A 1 104 ? -9.332  -6.136  -0.341  1.00 0.00 ? 107 CYS A O    1  
ATOM 1288  C CB   . CYS A 1 104 ? -7.557  -5.378  2.225   1.00 0.00 ? 107 CYS A CB   1  
ATOM 1289  S SG   . CYS A 1 104 ? -5.855  -5.298  2.873   1.00 0.00 ? 107 CYS A SG   1  
ATOM 1290  H H    . CYS A 1 104 ? -6.502  -6.236  -0.041  1.00 0.00 ? 107 CYS A H    1  
ATOM 1291  H HA   . CYS A 1 104 ? -7.910  -7.498  2.208   1.00 0.00 ? 107 CYS A HA   1  
ATOM 1292  H HB2  . CYS A 1 104 ? -7.684  -4.550  1.541   1.00 0.00 ? 107 CYS A HB2  1  
ATOM 1293  H HB3  . CYS A 1 104 ? -8.233  -5.257  3.060   1.00 0.00 ? 107 CYS A HB3  1  
ATOM 1294  N N    . TYR A 1 105 ? -10.292 -6.984  1.502   1.00 0.00 ? 108 TYR A N    1  
ATOM 1295  C CA   . TYR A 1 105 ? -11.641 -6.877  0.973   1.00 0.00 ? 108 TYR A CA   1  
ATOM 1296  C C    . TYR A 1 105 ? -12.500 -6.029  1.901   1.00 0.00 ? 108 TYR A C    1  
ATOM 1297  O O    . TYR A 1 105 ? -12.407 -6.155  3.124   1.00 0.00 ? 108 TYR A O    1  
ATOM 1298  C CB   . TYR A 1 105 ? -12.271 -8.261  0.797   1.00 0.00 ? 108 TYR A CB   1  
ATOM 1299  C CG   . TYR A 1 105 ? -11.593 -9.120  -0.254  1.00 0.00 ? 108 TYR A CG   1  
ATOM 1300  C CD1  . TYR A 1 105 ? -11.842 -8.916  -1.606  1.00 0.00 ? 108 TYR A CD1  1  
ATOM 1301  C CD2  . TYR A 1 105 ? -10.705 -10.132 0.103   1.00 0.00 ? 108 TYR A CD2  1  
ATOM 1302  C CE1  . TYR A 1 105 ? -11.231 -9.692  -2.571  1.00 0.00 ? 108 TYR A CE1  1  
ATOM 1303  C CE2  . TYR A 1 105 ? -10.089 -10.914 -0.859  1.00 0.00 ? 108 TYR A CE2  1  
ATOM 1304  C CZ   . TYR A 1 105 ? -10.356 -10.689 -2.194  1.00 0.00 ? 108 TYR A CZ   1  
ATOM 1305  O OH   . TYR A 1 105 ? -9.744  -11.463 -3.157  1.00 0.00 ? 108 TYR A OH   1  
ATOM 1306  H H    . TYR A 1 105 ? -10.161 -7.359  2.397   1.00 0.00 ? 108 TYR A H    1  
ATOM 1307  H HA   . TYR A 1 105 ? -11.581 -6.391  0.011   1.00 0.00 ? 108 TYR A HA   1  
ATOM 1308  H HB2  . TYR A 1 105 ? -12.226 -8.790  1.737   1.00 0.00 ? 108 TYR A HB2  1  
ATOM 1309  H HB3  . TYR A 1 105 ? -13.306 -8.141  0.508   1.00 0.00 ? 108 TYR A HB3  1  
ATOM 1310  H HD1  . TYR A 1 105 ? -12.526 -8.134  -1.899  1.00 0.00 ? 108 TYR A HD1  1  
ATOM 1311  H HD2  . TYR A 1 105 ? -10.499 -10.309 1.147   1.00 0.00 ? 108 TYR A HD2  1  
ATOM 1312  H HE1  . TYR A 1 105 ? -11.441 -9.516  -3.616  1.00 0.00 ? 108 TYR A HE1  1  
ATOM 1313  H HE2  . TYR A 1 105 ? -9.404  -11.694 -0.562  1.00 0.00 ? 108 TYR A HE2  1  
ATOM 1314  H HH   . TYR A 1 105 ? -9.773  -12.390 -2.894  1.00 0.00 ? 108 TYR A HH   1  
ATOM 1315  N N    . GLY A 1 106 ? -13.325 -5.168  1.325   1.00 0.00 ? 109 GLY A N    1  
ATOM 1316  C CA   . GLY A 1 106 ? -14.171 -4.308  2.122   1.00 0.00 ? 109 GLY A CA   1  
ATOM 1317  C C    . GLY A 1 106 ? -14.139 -2.866  1.659   1.00 0.00 ? 109 GLY A C    1  
ATOM 1318  O O    . GLY A 1 106 ? -14.497 -2.561  0.518   1.00 0.00 ? 109 GLY A O    1  
ATOM 1319  H H    . GLY A 1 106 ? -13.368 -5.121  0.341   1.00 0.00 ? 109 GLY A H    1  
ATOM 1320  H HA2  . GLY A 1 106 ? -15.189 -4.667  2.068   1.00 0.00 ? 109 GLY A HA2  1  
ATOM 1321  H HA3  . GLY A 1 106 ? -13.841 -4.350  3.150   1.00 0.00 ? 109 GLY A HA3  1  
ATOM 1322  N N    . GLN A 1 107 ? -13.711 -1.981  2.547   1.00 0.00 ? 110 GLN A N    1  
ATOM 1323  C CA   . GLN A 1 107 ? -13.674 -0.554  2.264   1.00 0.00 ? 110 GLN A CA   1  
ATOM 1324  C C    . GLN A 1 107 ? -12.232 -0.084  2.076   1.00 0.00 ? 110 GLN A C    1  
ATOM 1325  O O    . GLN A 1 107 ? -11.352 -0.422  2.872   1.00 0.00 ? 110 GLN A O    1  
ATOM 1326  C CB   . GLN A 1 107 ? -14.332 0.215   3.415   1.00 0.00 ? 110 GLN A CB   1  
ATOM 1327  C CG   . GLN A 1 107 ? -15.233 1.369   2.979   1.00 0.00 ? 110 GLN A CG   1  
ATOM 1328  C CD   . GLN A 1 107 ? -14.489 2.501   2.297   1.00 0.00 ? 110 GLN A CD   1  
ATOM 1329  O OE1  . GLN A 1 107 ? -14.012 3.428   2.948   1.00 0.00 ? 110 GLN A OE1  1  
ATOM 1330  N NE2  . GLN A 1 107 ? -14.404 2.445   0.977   1.00 0.00 ? 110 GLN A NE2  1  
ATOM 1331  H H    . GLN A 1 107 ? -13.417 -2.300  3.433   1.00 0.00 ? 110 GLN A H    1  
ATOM 1332  H HA   . GLN A 1 107 ? -14.225 -0.377  1.355   1.00 0.00 ? 110 GLN A HA   1  
ATOM 1333  H HB2  . GLN A 1 107 ? -14.927 -0.476  3.992   1.00 0.00 ? 110 GLN A HB2  1  
ATOM 1334  H HB3  . GLN A 1 107 ? -13.554 0.616   4.049   1.00 0.00 ? 110 GLN A HB3  1  
ATOM 1335  H HG2  . GLN A 1 107 ? -15.975 0.990   2.293   1.00 0.00 ? 110 GLN A HG2  1  
ATOM 1336  H HG3  . GLN A 1 107 ? -15.730 1.765   3.854   1.00 0.00 ? 110 GLN A HG3  1  
ATOM 1337  H HE21 . GLN A 1 107 ? -14.823 1.685   0.514   1.00 0.00 ? 110 GLN A HE21 1  
ATOM 1338  H HE22 . GLN A 1 107 ? -13.931 3.166   0.515   1.00 0.00 ? 110 GLN A HE22 1  
ATOM 1339  N N    . LEU A 1 108 ? -12.010 0.684   1.013   1.00 0.00 ? 111 LEU A N    1  
ATOM 1340  C CA   . LEU A 1 108 ? -10.699 1.251   0.700   1.00 0.00 ? 111 LEU A CA   1  
ATOM 1341  C C    . LEU A 1 108 ? -10.108 1.974   1.904   1.00 0.00 ? 111 LEU A C    1  
ATOM 1342  O O    . LEU A 1 108 ? -10.637 2.990   2.354   1.00 0.00 ? 111 LEU A O    1  
ATOM 1343  C CB   . LEU A 1 108 ? -10.820 2.227   -0.479  1.00 0.00 ? 111 LEU A CB   1  
ATOM 1344  C CG   . LEU A 1 108 ? -9.549  3.013   -0.828  1.00 0.00 ? 111 LEU A CG   1  
ATOM 1345  C CD1  . LEU A 1 108 ? -8.474  2.094   -1.389  1.00 0.00 ? 111 LEU A CD1  1  
ATOM 1346  C CD2  . LEU A 1 108 ? -9.866  4.127   -1.815  1.00 0.00 ? 111 LEU A CD2  1  
ATOM 1347  H H    . LEU A 1 108 ? -12.762 0.878   0.410   1.00 0.00 ? 111 LEU A H    1  
ATOM 1348  H HA   . LEU A 1 108 ? -10.044 0.439   0.424   1.00 0.00 ? 111 LEU A HA   1  
ATOM 1349  H HB2  . LEU A 1 108 ? -11.121 1.668   -1.352  1.00 0.00 ? 111 LEU A HB2  1  
ATOM 1350  H HB3  . LEU A 1 108 ? -11.599 2.937   -0.246  1.00 0.00 ? 111 LEU A HB3  1  
ATOM 1351  H HG   . LEU A 1 108 ? -9.161  3.467   0.071   1.00 0.00 ? 111 LEU A HG   1  
ATOM 1352  H HD11 . LEU A 1 108 ? -8.188  1.372   -0.639  1.00 0.00 ? 111 LEU A HD11 1  
ATOM 1353  H HD12 . LEU A 1 108 ? -8.857  1.581   -2.259  1.00 0.00 ? 111 LEU A HD12 1  
ATOM 1354  H HD13 . LEU A 1 108 ? -7.613  2.681   -1.671  1.00 0.00 ? 111 LEU A HD13 1  
ATOM 1355  H HD21 . LEU A 1 108 ? -8.960  4.663   -2.053  1.00 0.00 ? 111 LEU A HD21 1  
ATOM 1356  H HD22 . LEU A 1 108 ? -10.281 3.702   -2.716  1.00 0.00 ? 111 LEU A HD22 1  
ATOM 1357  H HD23 . LEU A 1 108 ? -10.580 4.805   -1.372  1.00 0.00 ? 111 LEU A HD23 1  
ATOM 1358  N N    . GLY A 1 109 ? -9.012  1.439   2.422   1.00 0.00 ? 112 GLY A N    1  
ATOM 1359  C CA   . GLY A 1 109 ? -8.350  2.050   3.554   1.00 0.00 ? 112 GLY A CA   1  
ATOM 1360  C C    . GLY A 1 109 ? -8.326  1.139   4.762   1.00 0.00 ? 112 GLY A C    1  
ATOM 1361  O O    . GLY A 1 109 ? -7.511  1.320   5.667   1.00 0.00 ? 112 GLY A O    1  
ATOM 1362  H H    . GLY A 1 109 ? -8.651  0.614   2.032   1.00 0.00 ? 112 GLY A H    1  
ATOM 1363  H HA2  . GLY A 1 109 ? -7.332  2.290   3.276   1.00 0.00 ? 112 GLY A HA2  1  
ATOM 1364  H HA3  . GLY A 1 109 ? -8.869  2.962   3.813   1.00 0.00 ? 112 GLY A HA3  1  
ATOM 1365  N N    . SER A 1 110 ? -9.219  0.157   4.775   1.00 0.00 ? 113 SER A N    1  
ATOM 1366  C CA   . SER A 1 110 ? -9.289  -0.781  5.879   1.00 0.00 ? 113 SER A CA   1  
ATOM 1367  C C    . SER A 1 110 ? -8.367  -1.973  5.635   1.00 0.00 ? 113 SER A C    1  
ATOM 1368  O O    . SER A 1 110 ? -8.413  -2.607  4.579   1.00 0.00 ? 113 SER A O    1  
ATOM 1369  C CB   . SER A 1 110 ? -10.727 -1.264  6.089   1.00 0.00 ? 113 SER A CB   1  
ATOM 1370  O OG   . SER A 1 110 ? -10.836 -2.076  7.251   1.00 0.00 ? 113 SER A OG   1  
ATOM 1371  H H    . SER A 1 110 ? -9.850  0.066   4.026   1.00 0.00 ? 113 SER A H    1  
ATOM 1372  H HA   . SER A 1 110 ? -8.961  -0.264  6.769   1.00 0.00 ? 113 SER A HA   1  
ATOM 1373  H HB2  . SER A 1 110 ? -11.381 -0.410  6.200   1.00 0.00 ? 113 SER A HB2  1  
ATOM 1374  H HB3  . SER A 1 110 ? -11.037 -1.842  5.232   1.00 0.00 ? 113 SER A HB3  1  
ATOM 1375  H HG   . SER A 1 110 ? -11.346 -1.601  7.926   1.00 0.00 ? 113 SER A HG   1  
ATOM 1376  N N    . PHE A 1 111 ? -7.535  -2.258  6.624   1.00 0.00 ? 114 PHE A N    1  
ATOM 1377  C CA   . PHE A 1 111 ? -6.630  -3.402  6.591   1.00 0.00 ? 114 PHE A CA   1  
ATOM 1378  C C    . PHE A 1 111 ? -7.038  -4.397  7.668   1.00 0.00 ? 114 PHE A C    1  
ATOM 1379  O O    . PHE A 1 111 ? -6.203  -5.088  8.254   1.00 0.00 ? 114 PHE A O    1  
ATOM 1380  C CB   . PHE A 1 111 ? -5.181  -2.953  6.822   1.00 0.00 ? 114 PHE A CB   1  
ATOM 1381  C CG   . PHE A 1 111 ? -4.598  -2.160  5.685   1.00 0.00 ? 114 PHE A CG   1  
ATOM 1382  C CD1  . PHE A 1 111 ? -4.767  -0.787  5.621   1.00 0.00 ? 114 PHE A CD1  1  
ATOM 1383  C CD2  . PHE A 1 111 ? -3.878  -2.790  4.682   1.00 0.00 ? 114 PHE A CD2  1  
ATOM 1384  C CE1  . PHE A 1 111 ? -4.230  -0.056  4.579   1.00 0.00 ? 114 PHE A CE1  1  
ATOM 1385  C CE2  . PHE A 1 111 ? -3.338  -2.063  3.642   1.00 0.00 ? 114 PHE A CE2  1  
ATOM 1386  C CZ   . PHE A 1 111 ? -3.515  -0.694  3.589   1.00 0.00 ? 114 PHE A CZ   1  
ATOM 1387  H H    . PHE A 1 111 ? -7.542  -1.683  7.422   1.00 0.00 ? 114 PHE A H    1  
ATOM 1388  H HA   . PHE A 1 111 ? -6.713  -3.873  5.622   1.00 0.00 ? 114 PHE A HA   1  
ATOM 1389  H HB2  . PHE A 1 111 ? -5.141  -2.335  7.706   1.00 0.00 ? 114 PHE A HB2  1  
ATOM 1390  H HB3  . PHE A 1 111 ? -4.564  -3.825  6.976   1.00 0.00 ? 114 PHE A HB3  1  
ATOM 1391  H HD1  . PHE A 1 111 ? -5.325  -0.284  6.398   1.00 0.00 ? 114 PHE A HD1  1  
ATOM 1392  H HD2  . PHE A 1 111 ? -3.740  -3.860  4.719   1.00 0.00 ? 114 PHE A HD2  1  
ATOM 1393  H HE1  . PHE A 1 111 ? -4.372  1.013   4.538   1.00 0.00 ? 114 PHE A HE1  1  
ATOM 1394  H HE2  . PHE A 1 111 ? -2.777  -2.563  2.866   1.00 0.00 ? 114 PHE A HE2  1  
ATOM 1395  H HZ   . PHE A 1 111 ? -3.093  -0.125  2.774   1.00 0.00 ? 114 PHE A HZ   1  
ATOM 1396  N N    . SER A 1 112 ? -8.335  -4.448  7.930   1.00 0.00 ? 115 SER A N    1  
ATOM 1397  C CA   . SER A 1 112 ? -8.880  -5.289  8.981   1.00 0.00 ? 115 SER A CA   1  
ATOM 1398  C C    . SER A 1 112 ? -8.868  -6.760  8.567   1.00 0.00 ? 115 SER A C    1  
ATOM 1399  O O    . SER A 1 112 ? -9.865  -7.281  8.064   1.00 0.00 ? 115 SER A O    1  
ATOM 1400  C CB   . SER A 1 112 ? -10.303 -4.837  9.320   1.00 0.00 ? 115 SER A CB   1  
ATOM 1401  O OG   . SER A 1 112 ? -10.332 -3.449  9.634   1.00 0.00 ? 115 SER A OG   1  
ATOM 1402  H H    . SER A 1 112 ? -8.946  -3.903  7.394   1.00 0.00 ? 115 SER A H    1  
ATOM 1403  H HA   . SER A 1 112 ? -8.257  -5.170  9.855   1.00 0.00 ? 115 SER A HA   1  
ATOM 1404  H HB2  . SER A 1 112 ? -10.950 -5.017  8.474   1.00 0.00 ? 115 SER A HB2  1  
ATOM 1405  H HB3  . SER A 1 112 ? -10.664 -5.394  10.174  1.00 0.00 ? 115 SER A HB3  1  
ATOM 1406  H HG   . SER A 1 112 ? -10.404 -2.938  8.808   1.00 0.00 ? 115 SER A HG   1  
ATOM 1407  N N    . ASN A 1 113 ? -7.721  -7.405  8.776   1.00 0.00 ? 116 ASN A N    1  
ATOM 1408  C CA   . ASN A 1 113 ? -7.541  -8.830  8.488   1.00 0.00 ? 116 ASN A CA   1  
ATOM 1409  C C    . ASN A 1 113 ? -7.653  -9.108  6.991   1.00 0.00 ? 116 ASN A C    1  
ATOM 1410  O O    . ASN A 1 113 ? -8.684  -9.575  6.500   1.00 0.00 ? 116 ASN A O    1  
ATOM 1411  C CB   . ASN A 1 113 ? -8.550  -9.681  9.272   1.00 0.00 ? 116 ASN A CB   1  
ATOM 1412  C CG   . ASN A 1 113 ? -8.330  -9.619  10.773  1.00 0.00 ? 116 ASN A CG   1  
ATOM 1413  O OD1  . ASN A 1 113 ? -7.201  -9.473  11.247  1.00 0.00 ? 116 ASN A OD1  1  
ATOM 1414  N ND2  . ASN A 1 113 ? -9.408  -9.728  11.531  1.00 0.00 ? 116 ASN A ND2  1  
ATOM 1415  H H    . ASN A 1 113 ? -6.960  -6.896  9.129   1.00 0.00 ? 116 ASN A H    1  
ATOM 1416  H HA   . ASN A 1 113 ? -6.544  -9.100  8.807   1.00 0.00 ? 116 ASN A HA   1  
ATOM 1417  H HB2  . ASN A 1 113 ? -9.547  -9.325  9.060   1.00 0.00 ? 116 ASN A HB2  1  
ATOM 1418  H HB3  . ASN A 1 113 ? -8.467  -10.712 8.956   1.00 0.00 ? 116 ASN A HB3  1  
ATOM 1419  H HD21 . ASN A 1 113 ? -10.278 -9.843  11.090  1.00 0.00 ? 116 ASN A HD21 1  
ATOM 1420  H HD22 . ASN A 1 113 ? -9.297  -9.690  12.503  1.00 0.00 ? 116 ASN A HD22 1  
ATOM 1421  N N    . CYS A 1 114 ? -6.577  -8.826  6.273   1.00 0.00 ? 117 CYS A N    1  
ATOM 1422  C CA   . CYS A 1 114 ? -6.534  -9.017  4.830   1.00 0.00 ? 117 CYS A CA   1  
ATOM 1423  C C    . CYS A 1 114 ? -6.096  -10.439 4.494   1.00 0.00 ? 117 CYS A C    1  
ATOM 1424  O O    . CYS A 1 114 ? -5.564  -11.152 5.350   1.00 0.00 ? 117 CYS A O    1  
ATOM 1425  C CB   . CYS A 1 114 ? -5.568  -8.006  4.218   1.00 0.00 ? 117 CYS A CB   1  
ATOM 1426  S SG   . CYS A 1 114 ? -5.952  -6.279  4.648   1.00 0.00 ? 117 CYS A SG   1  
ATOM 1427  H H    . CYS A 1 114 ? -5.782  -8.479  6.728   1.00 0.00 ? 117 CYS A H    1  
ATOM 1428  H HA   . CYS A 1 114 ? -7.527  -8.847  4.436   1.00 0.00 ? 117 CYS A HA   1  
ATOM 1429  H HB2  . CYS A 1 114 ? -4.569  -8.219  4.568   1.00 0.00 ? 117 CYS A HB2  1  
ATOM 1430  H HB3  . CYS A 1 114 ? -5.595  -8.091  3.142   1.00 0.00 ? 117 CYS A HB3  1  
ATOM 1431  N N    . SER A 1 115 ? -6.319  -10.846 3.252   1.00 0.00 ? 118 SER A N    1  
ATOM 1432  C CA   . SER A 1 115 ? -5.999  -12.194 2.811   1.00 0.00 ? 118 SER A CA   1  
ATOM 1433  C C    . SER A 1 115 ? -4.742  -12.196 1.948   1.00 0.00 ? 118 SER A C    1  
ATOM 1434  O O    . SER A 1 115 ? -4.348  -11.165 1.407   1.00 0.00 ? 118 SER A O    1  
ATOM 1435  C CB   . SER A 1 115 ? -7.182  -12.768 2.031   1.00 0.00 ? 118 SER A CB   1  
ATOM 1436  O OG   . SER A 1 115 ? -8.357  -12.763 2.827   1.00 0.00 ? 118 SER A OG   1  
ATOM 1437  H H    . SER A 1 115 ? -6.707  -10.217 2.603   1.00 0.00 ? 118 SER A H    1  
ATOM 1438  H HA   . SER A 1 115 ? -5.826  -12.801 3.687   1.00 0.00 ? 118 SER A HA   1  
ATOM 1439  H HB2  . SER A 1 115 ? -7.355  -12.172 1.145   1.00 0.00 ? 118 SER A HB2  1  
ATOM 1440  H HB3  . SER A 1 115 ? -6.961  -13.786 1.745   1.00 0.00 ? 118 SER A HB3  1  
ATOM 1441  H HG   . SER A 1 115 ? -8.130  -13.058 3.723   1.00 0.00 ? 118 SER A HG   1  
ATOM 1442  N N    . HIS A 1 116 ? -4.112  -13.357 1.833   1.00 0.00 ? 119 HIS A N    1  
ATOM 1443  C CA   . HIS A 1 116 ? -2.908  -13.504 1.020   1.00 0.00 ? 119 HIS A CA   1  
ATOM 1444  C C    . HIS A 1 116 ? -3.258  -13.494 -0.464  1.00 0.00 ? 119 HIS A C    1  
ATOM 1445  O O    . HIS A 1 116 ? -4.341  -13.931 -0.857  1.00 0.00 ? 119 HIS A O    1  
ATOM 1446  C CB   . HIS A 1 116 ? -2.169  -14.798 1.382   1.00 0.00 ? 119 HIS A CB   1  
ATOM 1447  C CG   . HIS A 1 116 ? -1.508  -14.757 2.725   1.00 0.00 ? 119 HIS A CG   1  
ATOM 1448  N ND1  . HIS A 1 116 ? -2.155  -15.090 3.893   1.00 0.00 ? 119 HIS A ND1  1  
ATOM 1449  C CD2  . HIS A 1 116 ? -0.248  -14.416 3.080   1.00 0.00 ? 119 HIS A CD2  1  
ATOM 1450  C CE1  . HIS A 1 116 ? -1.324  -14.954 4.909   1.00 0.00 ? 119 HIS A CE1  1  
ATOM 1451  N NE2  . HIS A 1 116 ? -0.160  -14.548 4.443   1.00 0.00 ? 119 HIS A NE2  1  
ATOM 1452  H H    . HIS A 1 116 ? -4.469  -14.141 2.306   1.00 0.00 ? 119 HIS A H    1  
ATOM 1453  H HA   . HIS A 1 116 ? -2.266  -12.663 1.231   1.00 0.00 ? 119 HIS A HA   1  
ATOM 1454  H HB2  . HIS A 1 116 ? -2.873  -15.616 1.386   1.00 0.00 ? 119 HIS A HB2  1  
ATOM 1455  H HB3  . HIS A 1 116 ? -1.407  -14.990 0.641   1.00 0.00 ? 119 HIS A HB3  1  
ATOM 1456  H HD1  . HIS A 1 116 ? -3.095  -15.378 3.968   1.00 0.00 ? 119 HIS A HD1  1  
ATOM 1457  H HD2  . HIS A 1 116 ? 0.542   -14.095 2.415   1.00 0.00 ? 119 HIS A HD2  1  
ATOM 1458  H HE1  . HIS A 1 116 ? -1.560  -15.139 5.946   1.00 0.00 ? 119 HIS A HE1  1  
ATOM 1459  N N    . SER A 1 117 ? -2.342  -12.986 -1.280  1.00 0.00 ? 120 SER A N    1  
ATOM 1460  C CA   . SER A 1 117 ? -2.564  -12.879 -2.716  1.00 0.00 ? 120 SER A CA   1  
ATOM 1461  C C    . SER A 1 117 ? -2.441  -14.239 -3.405  1.00 0.00 ? 120 SER A C    1  
ATOM 1462  O O    . SER A 1 117 ? -1.471  -14.514 -4.116  1.00 0.00 ? 120 SER A O    1  
ATOM 1463  C CB   . SER A 1 117 ? -1.579  -11.874 -3.315  1.00 0.00 ? 120 SER A CB   1  
ATOM 1464  O OG   . SER A 1 117 ? -0.267  -12.080 -2.811  1.00 0.00 ? 120 SER A OG   1  
ATOM 1465  H H    . SER A 1 117 ? -1.491  -12.674 -0.911  1.00 0.00 ? 120 SER A H    1  
ATOM 1466  H HA   . SER A 1 117 ? -3.568  -12.508 -2.862  1.00 0.00 ? 120 SER A HA   1  
ATOM 1467  H HB2  . SER A 1 117 ? -1.562  -11.987 -4.388  1.00 0.00 ? 120 SER A HB2  1  
ATOM 1468  H HB3  . SER A 1 117 ? -1.894  -10.873 -3.062  1.00 0.00 ? 120 SER A HB3  1  
ATOM 1469  H HG   . SER A 1 117 ? -0.204  -11.712 -1.919  1.00 0.00 ? 120 SER A HG   1  
ATOM 1470  N N    . ARG A 1 118 ? -3.435  -15.089 -3.187  1.00 0.00 ? 121 ARG A N    1  
ATOM 1471  C CA   . ARG A 1 118 ? -3.476  -16.401 -3.813  1.00 0.00 ? 121 ARG A CA   1  
ATOM 1472  C C    . ARG A 1 118 ? -4.163  -16.289 -5.172  1.00 0.00 ? 121 ARG A C    1  
ATOM 1473  O O    . ARG A 1 118 ? -5.209  -16.895 -5.410  1.00 0.00 ? 121 ARG A O    1  
ATOM 1474  C CB   . ARG A 1 118 ? -4.224  -17.395 -2.917  1.00 0.00 ? 121 ARG A CB   1  
ATOM 1475  C CG   . ARG A 1 118 ? -3.903  -18.852 -3.214  1.00 0.00 ? 121 ARG A CG   1  
ATOM 1476  C CD   . ARG A 1 118 ? -2.461  -19.189 -2.862  1.00 0.00 ? 121 ARG A CD   1  
ATOM 1477  N NE   . ARG A 1 118 ? -2.168  -18.918 -1.452  1.00 0.00 ? 121 ARG A NE   1  
ATOM 1478  C CZ   . ARG A 1 118 ? -1.044  -19.275 -0.838  1.00 0.00 ? 121 ARG A CZ   1  
ATOM 1479  N NH1  . ARG A 1 118 ? -0.109  -19.948 -1.491  1.00 0.00 ? 121 ARG A NH1  1  
ATOM 1480  N NH2  . ARG A 1 118 ? -0.862  -18.979 0.442   1.00 0.00 ? 121 ARG A NH2  1  
ATOM 1481  H H    . ARG A 1 118 ? -4.160  -14.825 -2.582  1.00 0.00 ? 121 ARG A H    1  
ATOM 1482  H HA   . ARG A 1 118 ? -2.462  -16.741 -3.956  1.00 0.00 ? 121 ARG A HA   1  
ATOM 1483  H HB2  . ARG A 1 118 ? -3.970  -17.198 -1.886  1.00 0.00 ? 121 ARG A HB2  1  
ATOM 1484  H HB3  . ARG A 1 118 ? -5.285  -17.250 -3.050  1.00 0.00 ? 121 ARG A HB3  1  
ATOM 1485  H HG2  . ARG A 1 118 ? -4.561  -19.481 -2.633  1.00 0.00 ? 121 ARG A HG2  1  
ATOM 1486  H HG3  . ARG A 1 118 ? -4.060  -19.038 -4.266  1.00 0.00 ? 121 ARG A HG3  1  
ATOM 1487  H HD2  . ARG A 1 118 ? -2.292  -20.237 -3.060  1.00 0.00 ? 121 ARG A HD2  1  
ATOM 1488  H HD3  . ARG A 1 118 ? -1.803  -18.595 -3.479  1.00 0.00 ? 121 ARG A HD3  1  
ATOM 1489  H HE   . ARG A 1 118 ? -2.858  -18.435 -0.931  1.00 0.00 ? 121 ARG A HE   1  
ATOM 1490  H HH12 . ARG A 1 118 ? 0.100   -19.728 -2.457  1.00 0.00 ? 121 ARG A HH12 1  
ATOM 1491  H HH21 . ARG A 1 118 ? -1.571  -18.486 0.954   1.00 0.00 ? 121 ARG A HH21 1  
ATOM 1492  H HH22 . ARG A 1 118 ? -0.007  -19.247 0.907   1.00 0.00 ? 121 ARG A HH22 1  
ATOM 1493  N N    . ASN A 1 119 ? -3.577  -15.483 -6.046  1.00 0.00 ? 122 ASN A N    1  
ATOM 1494  C CA   . ASN A 1 119 ? -4.141  -15.232 -7.363  1.00 0.00 ? 122 ASN A CA   1  
ATOM 1495  C C    . ASN A 1 119 ? -3.037  -15.235 -8.419  1.00 0.00 ? 122 ASN A C    1  
ATOM 1496  O O    . ASN A 1 119 ? -1.850  -15.139 -8.094  1.00 0.00 ? 122 ASN A O    1  
ATOM 1497  C CB   . ASN A 1 119 ? -4.894  -13.891 -7.372  1.00 0.00 ? 122 ASN A CB   1  
ATOM 1498  C CG   . ASN A 1 119 ? -3.987  -12.683 -7.193  1.00 0.00 ? 122 ASN A CG   1  
ATOM 1499  O OD1  . ASN A 1 119 ? -2.931  -12.760 -6.569  1.00 0.00 ? 122 ASN A OD1  1  
ATOM 1500  N ND2  . ASN A 1 119 ? -4.407  -11.550 -7.731  1.00 0.00 ? 122 ASN A ND2  1  
ATOM 1501  H H    . ASN A 1 119 ? -2.735  -15.041 -5.797  1.00 0.00 ? 122 ASN A H    1  
ATOM 1502  H HA   . ASN A 1 119 ? -4.836  -16.027 -7.582  1.00 0.00 ? 122 ASN A HA   1  
ATOM 1503  H HB2  . ASN A 1 119 ? -5.411  -13.783 -8.312  1.00 0.00 ? 122 ASN A HB2  1  
ATOM 1504  H HB3  . ASN A 1 119 ? -5.618  -13.893 -6.572  1.00 0.00 ? 122 ASN A HB3  1  
ATOM 1505  H HD21 . ASN A 1 119 ? -5.272  -11.553 -8.211  1.00 0.00 ? 122 ASN A HD21 1  
ATOM 1506  H HD22 . ASN A 1 119 ? -3.848  -10.753 -7.630  1.00 0.00 ? 122 ASN A HD22 1  
ATOM 1507  N N    . ASP A 1 120 ? -3.429  -15.354 -9.683  1.00 0.00 ? 123 ASP A N    1  
ATOM 1508  C CA   . ASP A 1 120 ? -2.469  -15.443 -10.781 1.00 0.00 ? 123 ASP A CA   1  
ATOM 1509  C C    . ASP A 1 120 ? -2.257  -14.085 -11.448 1.00 0.00 ? 123 ASP A C    1  
ATOM 1510  O O    . ASP A 1 120 ? -1.795  -14.009 -12.589 1.00 0.00 ? 123 ASP A O    1  
ATOM 1511  C CB   . ASP A 1 120 ? -2.938  -16.471 -11.821 1.00 0.00 ? 123 ASP A CB   1  
ATOM 1512  C CG   . ASP A 1 120 ? -4.220  -16.059 -12.523 1.00 0.00 ? 123 ASP A CG   1  
ATOM 1513  O OD1  . ASP A 1 120 ? -5.272  -15.972 -11.856 1.00 0.00 ? 123 ASP A OD1  1  
ATOM 1514  O OD2  . ASP A 1 120 ? -4.187  -15.831 -13.752 1.00 0.00 ? 123 ASP A OD2  1  
ATOM 1515  H H    . ASP A 1 120 ? -4.389  -15.399 -9.887  1.00 0.00 ? 123 ASP A H    1  
ATOM 1516  H HA   . ASP A 1 120 ? -1.528  -15.772 -10.366 1.00 0.00 ? 123 ASP A HA   1  
ATOM 1517  H HB2  . ASP A 1 120 ? -2.167  -16.592 -12.568 1.00 0.00 ? 123 ASP A HB2  1  
ATOM 1518  H HB3  . ASP A 1 120 ? -3.108  -17.420 -11.331 1.00 0.00 ? 123 ASP A HB3  1  
ATOM 1519  N N    . MET A 1 121 ? -2.595  -13.018 -10.734 1.00 0.00 ? 124 MET A N    1  
ATOM 1520  C CA   . MET A 1 121 ? -2.405  -11.661 -11.241 1.00 0.00 ? 124 MET A CA   1  
ATOM 1521  C C    . MET A 1 121 ? -2.274  -10.655 -10.098 1.00 0.00 ? 124 MET A C    1  
ATOM 1522  O O    . MET A 1 121 ? -3.149  -9.817  -9.881  1.00 0.00 ? 124 MET A O    1  
ATOM 1523  C CB   . MET A 1 121 ? -3.550  -11.251 -12.180 1.00 0.00 ? 124 MET A CB   1  
ATOM 1524  C CG   . MET A 1 121 ? -4.942  -11.469 -11.606 1.00 0.00 ? 124 MET A CG   1  
ATOM 1525  S SD   . MET A 1 121 ? -6.225  -10.617 -12.547 1.00 0.00 ? 124 MET A SD   1  
ATOM 1526  C CE   . MET A 1 121 ? -5.896  -11.212 -14.202 1.00 0.00 ? 124 MET A CE   1  
ATOM 1527  H H    . MET A 1 121 ? -2.976  -13.142 -9.843  1.00 0.00 ? 124 MET A H    1  
ATOM 1528  H HA   . MET A 1 121 ? -1.482  -11.655 -11.801 1.00 0.00 ? 124 MET A HA   1  
ATOM 1529  H HB2  . MET A 1 121 ? -3.445  -10.203 -12.413 1.00 0.00 ? 124 MET A HB2  1  
ATOM 1530  H HB3  . MET A 1 121 ? -3.468  -11.821 -13.093 1.00 0.00 ? 124 MET A HB3  1  
ATOM 1531  H HG2  . MET A 1 121 ? -5.157  -12.526 -11.614 1.00 0.00 ? 124 MET A HG2  1  
ATOM 1532  H HG3  . MET A 1 121 ? -4.960  -11.105 -10.591 1.00 0.00 ? 124 MET A HG3  1  
ATOM 1533  H HE1  . MET A 1 121 ? -6.006  -12.286 -14.228 1.00 0.00 ? 124 MET A HE1  1  
ATOM 1534  H HE2  . MET A 1 121 ? -6.594  -10.762 -14.891 1.00 0.00 ? 124 MET A HE2  1  
ATOM 1535  H HE3  . MET A 1 121 ? -4.888  -10.947 -14.486 1.00 0.00 ? 124 MET A HE3  1  
ATOM 1536  N N    . CYS A 1 122 ? -1.181  -10.739 -9.364  1.00 0.00 ? 125 CYS A N    1  
ATOM 1537  C CA   . CYS A 1 122 ? -0.928  -9.790  -8.290  1.00 0.00 ? 125 CYS A CA   1  
ATOM 1538  C C    . CYS A 1 122 ? 0.067   -8.736  -8.754  1.00 0.00 ? 125 CYS A C    1  
ATOM 1539  O O    . CYS A 1 122 ? 1.099   -9.055  -9.347  1.00 0.00 ? 125 CYS A O    1  
ATOM 1540  C CB   . CYS A 1 122 ? -0.407  -10.494 -7.033  1.00 0.00 ? 125 CYS A CB   1  
ATOM 1541  S SG   . CYS A 1 122 ? -0.097  -9.374  -5.622  1.00 0.00 ? 125 CYS A SG   1  
ATOM 1542  H H    . CYS A 1 122 ? -0.521  -11.439 -9.559  1.00 0.00 ? 125 CYS A H    1  
ATOM 1543  H HA   . CYS A 1 122 ? -1.864  -9.302  -8.058  1.00 0.00 ? 125 CYS A HA   1  
ATOM 1544  H HB2  . CYS A 1 122 ? -1.132  -11.230 -6.714  1.00 0.00 ? 125 CYS A HB2  1  
ATOM 1545  H HB3  . CYS A 1 122 ? 0.522   -10.990 -7.267  1.00 0.00 ? 125 CYS A HB3  1  
ATOM 1546  N N    . HIS A 1 123 ? -0.259  -7.482  -8.498  1.00 0.00 ? 126 HIS A N    1  
ATOM 1547  C CA   . HIS A 1 123 ? 0.591   -6.369  -8.885  1.00 0.00 ? 126 HIS A CA   1  
ATOM 1548  C C    . HIS A 1 123 ? 0.968   -5.583  -7.639  1.00 0.00 ? 126 HIS A C    1  
ATOM 1549  O O    . HIS A 1 123 ? 0.221   -5.570  -6.663  1.00 0.00 ? 126 HIS A O    1  
ATOM 1550  C CB   . HIS A 1 123 ? -0.134  -5.469  -9.893  1.00 0.00 ? 126 HIS A CB   1  
ATOM 1551  C CG   . HIS A 1 123 ? -0.562  -6.184  -11.138 1.00 0.00 ? 126 HIS A CG   1  
ATOM 1552  N ND1  . HIS A 1 123 ? -1.879  -6.289  -11.532 1.00 0.00 ? 126 HIS A ND1  1  
ATOM 1553  C CD2  . HIS A 1 123 ? 0.162   -6.829  -12.082 1.00 0.00 ? 126 HIS A CD2  1  
ATOM 1554  C CE1  . HIS A 1 123 ? -1.948  -6.971  -12.659 1.00 0.00 ? 126 HIS A CE1  1  
ATOM 1555  N NE2  . HIS A 1 123 ? -0.723  -7.308  -13.016 1.00 0.00 ? 126 HIS A NE2  1  
ATOM 1556  H H    . HIS A 1 123 ? -1.089  -7.296  -8.010  1.00 0.00 ? 126 HIS A H    1  
ATOM 1557  H HA   . HIS A 1 123 ? 1.485   -6.770  -9.339  1.00 0.00 ? 126 HIS A HA   1  
ATOM 1558  H HB2  . HIS A 1 123 ? -1.018  -5.056  -9.427  1.00 0.00 ? 126 HIS A HB2  1  
ATOM 1559  H HB3  . HIS A 1 123 ? 0.524   -4.660  -10.184 1.00 0.00 ? 126 HIS A HB3  1  
ATOM 1560  H HD1  . HIS A 1 123 ? -2.656  -5.905  -11.057 1.00 0.00 ? 126 HIS A HD1  1  
ATOM 1561  H HD2  . HIS A 1 123 ? 1.236   -6.949  -12.095 1.00 0.00 ? 126 HIS A HD2  1  
ATOM 1562  H HE1  . HIS A 1 123 ? -2.852  -7.208  -13.200 1.00 0.00 ? 126 HIS A HE1  1  
ATOM 1563  N N    . SER A 1 124 ? 2.121   -4.941  -7.658  1.00 0.00 ? 127 SER A N    1  
ATOM 1564  C CA   . SER A 1 124 ? 2.594   -4.212  -6.492  1.00 0.00 ? 127 SER A CA   1  
ATOM 1565  C C    . SER A 1 124 ? 1.895   -2.859  -6.379  1.00 0.00 ? 127 SER A C    1  
ATOM 1566  O O    . SER A 1 124 ? 1.707   -2.163  -7.379  1.00 0.00 ? 127 SER A O    1  
ATOM 1567  C CB   . SER A 1 124 ? 4.108   -4.016  -6.580  1.00 0.00 ? 127 SER A CB   1  
ATOM 1568  O OG   . SER A 1 124 ? 4.771   -5.256  -6.767  1.00 0.00 ? 127 SER A OG   1  
ATOM 1569  H H    . SER A 1 124 ? 2.670   -4.952  -8.472  1.00 0.00 ? 127 SER A H    1  
ATOM 1570  H HA   . SER A 1 124 ? 2.364   -4.801  -5.616  1.00 0.00 ? 127 SER A HA   1  
ATOM 1571  H HB2  . SER A 1 124 ? 4.338   -3.368  -7.414  1.00 0.00 ? 127 SER A HB2  1  
ATOM 1572  H HB3  . SER A 1 124 ? 4.466   -3.566  -5.662  1.00 0.00 ? 127 SER A HB3  1  
ATOM 1573  H HG   . SER A 1 124 ? 5.694   -5.170  -6.478  1.00 0.00 ? 127 SER A HG   1  
ATOM 1574  N N    . LEU A 1 125 ? 1.484   -2.501  -5.169  1.00 0.00 ? 128 LEU A N    1  
ATOM 1575  C CA   . LEU A 1 125 ? 0.902   -1.186  -4.927  1.00 0.00 ? 128 LEU A CA   1  
ATOM 1576  C C    . LEU A 1 125 ? 2.003   -0.203  -4.551  1.00 0.00 ? 128 LEU A C    1  
ATOM 1577  O O    . LEU A 1 125 ? 2.795   -0.466  -3.645  1.00 0.00 ? 128 LEU A O    1  
ATOM 1578  C CB   . LEU A 1 125 ? -0.147  -1.246  -3.814  1.00 0.00 ? 128 LEU A CB   1  
ATOM 1579  C CG   . LEU A 1 125 ? -0.857  0.078   -3.519  1.00 0.00 ? 128 LEU A CG   1  
ATOM 1580  C CD1  . LEU A 1 125 ? -1.740  0.488   -4.688  1.00 0.00 ? 128 LEU A CD1  1  
ATOM 1581  C CD2  . LEU A 1 125 ? -1.679  -0.029  -2.245  1.00 0.00 ? 128 LEU A CD2  1  
ATOM 1582  H H    . LEU A 1 125 ? 1.574   -3.132  -4.421  1.00 0.00 ? 128 LEU A H    1  
ATOM 1583  H HA   . LEU A 1 125 ? 0.433   -0.858  -5.842  1.00 0.00 ? 128 LEU A HA   1  
ATOM 1584  H HB2  . LEU A 1 125 ? -0.894  -1.977  -4.089  1.00 0.00 ? 128 LEU A HB2  1  
ATOM 1585  H HB3  . LEU A 1 125 ? 0.340   -1.575  -2.909  1.00 0.00 ? 128 LEU A HB3  1  
ATOM 1586  H HG   . LEU A 1 125 ? -0.114  0.852   -3.376  1.00 0.00 ? 128 LEU A HG   1  
ATOM 1587  H HD11 . LEU A 1 125 ? -2.432  -0.309  -4.913  1.00 0.00 ? 128 LEU A HD11 1  
ATOM 1588  H HD12 . LEU A 1 125 ? -2.292  1.381   -4.428  1.00 0.00 ? 128 LEU A HD12 1  
ATOM 1589  H HD13 . LEU A 1 125 ? -1.126  0.687   -5.554  1.00 0.00 ? 128 LEU A HD13 1  
ATOM 1590  H HD21 . LEU A 1 125 ? -2.437  -0.789  -2.370  1.00 0.00 ? 128 LEU A HD21 1  
ATOM 1591  H HD22 . LEU A 1 125 ? -1.033  -0.296  -1.422  1.00 0.00 ? 128 LEU A HD22 1  
ATOM 1592  H HD23 . LEU A 1 125 ? -2.150  0.920   -2.042  1.00 0.00 ? 128 LEU A HD23 1  
ATOM 1593  N N    . GLY A 1 126 ? 2.052   0.917   -5.250  1.00 0.00 ? 129 GLY A N    1  
ATOM 1594  C CA   . GLY A 1 126 ? 3.092   1.889   -5.014  1.00 0.00 ? 129 GLY A CA   1  
ATOM 1595  C C    . GLY A 1 126 ? 2.546   3.245   -4.644  1.00 0.00 ? 129 GLY A C    1  
ATOM 1596  O O    . GLY A 1 126 ? 1.488   3.656   -5.128  1.00 0.00 ? 129 GLY A O    1  
ATOM 1597  H H    . GLY A 1 126 ? 1.360   1.096   -5.930  1.00 0.00 ? 129 GLY A H    1  
ATOM 1598  H HA2  . GLY A 1 126 ? 3.723   1.537   -4.213  1.00 0.00 ? 129 GLY A HA2  1  
ATOM 1599  H HA3  . GLY A 1 126 ? 3.688   1.990   -5.910  1.00 0.00 ? 129 GLY A HA3  1  
ATOM 1600  N N    . LEU A 1 127 ? 3.269   3.935   -3.782  1.00 0.00 ? 130 LEU A N    1  
ATOM 1601  C CA   . LEU A 1 127 ? 2.903   5.275   -3.379  1.00 0.00 ? 130 LEU A CA   1  
ATOM 1602  C C    . LEU A 1 127 ? 4.082   6.213   -3.619  1.00 0.00 ? 130 LEU A C    1  
ATOM 1603  O O    . LEU A 1 127 ? 5.205   5.937   -3.195  1.00 0.00 ? 130 LEU A O    1  
ATOM 1604  C CB   . LEU A 1 127 ? 2.498   5.287   -1.902  1.00 0.00 ? 130 LEU A CB   1  
ATOM 1605  C CG   . LEU A 1 127 ? 2.081   6.648   -1.339  1.00 0.00 ? 130 LEU A CG   1  
ATOM 1606  C CD1  . LEU A 1 127 ? 0.864   7.193   -2.069  1.00 0.00 ? 130 LEU A CD1  1  
ATOM 1607  C CD2  . LEU A 1 127 ? 1.801   6.536   0.151   1.00 0.00 ? 130 LEU A CD2  1  
ATOM 1608  H H    . LEU A 1 127 ? 4.081   3.531   -3.403  1.00 0.00 ? 130 LEU A H    1  
ATOM 1609  H HA   . LEU A 1 127 ? 2.063   5.590   -3.984  1.00 0.00 ? 130 LEU A HA   1  
ATOM 1610  H HB2  . LEU A 1 127 ? 1.673   4.599   -1.774  1.00 0.00 ? 130 LEU A HB2  1  
ATOM 1611  H HB3  . LEU A 1 127 ? 3.338   4.927   -1.323  1.00 0.00 ? 130 LEU A HB3  1  
ATOM 1612  H HG   . LEU A 1 127 ? 2.891   7.351   -1.475  1.00 0.00 ? 130 LEU A HG   1  
ATOM 1613  H HD11 . LEU A 1 127 ? 1.123   7.406   -3.095  1.00 0.00 ? 130 LEU A HD11 1  
ATOM 1614  H HD12 . LEU A 1 127 ? 0.069   6.463   -2.041  1.00 0.00 ? 130 LEU A HD12 1  
ATOM 1615  H HD13 . LEU A 1 127 ? 0.534   8.101   -1.588  1.00 0.00 ? 130 LEU A HD13 1  
ATOM 1616  H HD21 . LEU A 1 127 ? 1.497   7.499   0.535   1.00 0.00 ? 130 LEU A HD21 1  
ATOM 1617  H HD22 . LEU A 1 127 ? 1.011   5.818   0.316   1.00 0.00 ? 130 LEU A HD22 1  
ATOM 1618  H HD23 . LEU A 1 127 ? 2.695   6.211   0.663   1.00 0.00 ? 130 LEU A HD23 1  
ATOM 1619  N N    . THR A 1 128 ? 3.835   7.294   -4.335  1.00 0.00 ? 131 THR A N    1  
ATOM 1620  C CA   . THR A 1 128 ? 4.871   8.271   -4.613  1.00 0.00 ? 131 THR A CA   1  
ATOM 1621  C C    . THR A 1 128 ? 4.600   9.560   -3.847  1.00 0.00 ? 131 THR A C    1  
ATOM 1622  O O    . THR A 1 128 ? 3.661   10.286  -4.160  1.00 0.00 ? 131 THR A O    1  
ATOM 1623  C CB   . THR A 1 128 ? 4.956   8.568   -6.124  1.00 0.00 ? 131 THR A CB   1  
ATOM 1624  O OG1  . THR A 1 128 ? 5.124   7.341   -6.845  1.00 0.00 ? 131 THR A OG1  1  
ATOM 1625  C CG2  . THR A 1 128 ? 6.112   9.510   -6.440  1.00 0.00 ? 131 THR A CG2  1  
ATOM 1626  H H    . THR A 1 128 ? 2.927   7.444   -4.685  1.00 0.00 ? 131 THR A H    1  
ATOM 1627  H HA   . THR A 1 128 ? 5.818   7.858   -4.288  1.00 0.00 ? 131 THR A HA   1  
ATOM 1628  H HB   . THR A 1 128 ? 4.034   9.036   -6.435  1.00 0.00 ? 131 THR A HB   1  
ATOM 1629  H HG1  . THR A 1 128 ? 5.230   6.617   -6.218  1.00 0.00 ? 131 THR A HG1  1  
ATOM 1630  H HG21 . THR A 1 128 ? 7.045   9.050   -6.152  1.00 0.00 ? 131 THR A HG21 1  
ATOM 1631  H HG22 . THR A 1 128 ? 5.981   10.434  -5.895  1.00 0.00 ? 131 THR A HG22 1  
ATOM 1632  H HG23 . THR A 1 128 ? 6.125   9.719   -7.499  1.00 0.00 ? 131 THR A HG23 1  
ATOM 1633  N N    . CYS A 1 129 ? 5.409   9.820   -2.836  1.00 0.00 ? 132 CYS A N    1  
ATOM 1634  C CA   . CYS A 1 129 ? 5.290   11.037  -2.045  1.00 0.00 ? 132 CYS A CA   1  
ATOM 1635  C C    . CYS A 1 129 ? 6.440   11.972  -2.395  1.00 0.00 ? 132 CYS A C    1  
ATOM 1636  O O    . CYS A 1 129 ? 7.531   11.513  -2.740  1.00 0.00 ? 132 CYS A O    1  
ATOM 1637  C CB   . CYS A 1 129 ? 5.328   10.704  -0.548  1.00 0.00 ? 132 CYS A CB   1  
ATOM 1638  S SG   . CYS A 1 129 ? 4.200   9.359   -0.043  1.00 0.00 ? 132 CYS A SG   1  
ATOM 1639  H H    . CYS A 1 129 ? 6.120   9.176   -2.614  1.00 0.00 ? 132 CYS A H    1  
ATOM 1640  H HA   . CYS A 1 129 ? 4.353   11.513  -2.289  1.00 0.00 ? 132 CYS A HA   1  
ATOM 1641  H HB2  . CYS A 1 129 ? 6.332   10.403  -0.281  1.00 0.00 ? 132 CYS A HB2  1  
ATOM 1642  H HB3  . CYS A 1 129 ? 5.064   11.586  0.020   1.00 0.00 ? 132 CYS A HB3  1  
ATOM 1643  N N    . LEU A 1 130 ? 6.192   13.277  -2.336  1.00 0.00 ? 133 LEU A N    1  
ATOM 1644  C CA   . LEU A 1 130 ? 7.239   14.263  -2.583  1.00 0.00 ? 133 LEU A CA   1  
ATOM 1645  C C    . LEU A 1 130 ? 8.357   14.128  -1.558  1.00 0.00 ? 133 LEU A C    1  
ATOM 1646  O O    . LEU A 1 130 ? 8.137   13.622  -0.456  1.00 0.00 ? 133 LEU A O    1  
ATOM 1647  C CB   . LEU A 1 130 ? 6.669   15.685  -2.545  1.00 0.00 ? 133 LEU A CB   1  
ATOM 1648  C CG   . LEU A 1 130 ? 5.865   16.108  -3.777  1.00 0.00 ? 133 LEU A CG   1  
ATOM 1649  C CD1  . LEU A 1 130 ? 5.192   17.449  -3.538  1.00 0.00 ? 133 LEU A CD1  1  
ATOM 1650  C CD2  . LEU A 1 130 ? 6.763   16.194  -5.002  1.00 0.00 ? 133 LEU A CD2  1  
ATOM 1651  H H    . LEU A 1 130 ? 5.282   13.585  -2.127  1.00 0.00 ? 133 LEU A H    1  
ATOM 1652  H HA   . LEU A 1 130 ? 7.642   14.074  -3.564  1.00 0.00 ? 133 LEU A HA   1  
ATOM 1653  H HB2  . LEU A 1 130 ? 6.028   15.768  -1.680  1.00 0.00 ? 133 LEU A HB2  1  
ATOM 1654  H HB3  . LEU A 1 130 ? 7.490   16.377  -2.427  1.00 0.00 ? 133 LEU A HB3  1  
ATOM 1655  H HG   . LEU A 1 130 ? 5.097   15.374  -3.973  1.00 0.00 ? 133 LEU A HG   1  
ATOM 1656  H HD11 . LEU A 1 130 ? 5.940   18.186  -3.286  1.00 0.00 ? 133 LEU A HD11 1  
ATOM 1657  H HD12 . LEU A 1 130 ? 4.672   17.753  -4.433  1.00 0.00 ? 133 LEU A HD12 1  
ATOM 1658  H HD13 . LEU A 1 130 ? 4.488   17.359  -2.726  1.00 0.00 ? 133 LEU A HD13 1  
ATOM 1659  H HD21 . LEU A 1 130 ? 7.169   15.218  -5.225  1.00 0.00 ? 133 LEU A HD21 1  
ATOM 1660  H HD22 . LEU A 1 130 ? 6.185   16.542  -5.844  1.00 0.00 ? 133 LEU A HD22 1  
ATOM 1661  H HD23 . LEU A 1 130 ? 7.570   16.885  -4.810  1.00 0.00 ? 133 LEU A HD23 1  
ATOM 1662  N N    . GLU A 1 131 ? 9.548   14.571  -1.939  1.00 0.00 ? 134 GLU A N    1  
ATOM 1663  C CA   . GLU A 1 131 ? 10.724  14.514  -1.074  1.00 0.00 ? 134 GLU A CA   1  
ATOM 1664  C C    . GLU A 1 131 ? 10.439  15.154  0.282   1.00 0.00 ? 134 GLU A C    1  
ATOM 1665  O O    . GLU A 1 131 ? 10.319  16.395  0.339   1.00 0.00 ? 134 GLU A O    1  
ATOM 1666  C CB   . GLU A 1 131 ? 11.923  15.224  -1.725  1.00 0.00 ? 134 GLU A CB   1  
ATOM 1667  C CG   . GLU A 1 131 ? 12.260  14.754  -3.135  1.00 0.00 ? 134 GLU A CG   1  
ATOM 1668  C CD   . GLU A 1 131 ? 11.380  15.389  -4.197  1.00 0.00 ? 134 GLU A CD   1  
ATOM 1669  O OE1  . GLU A 1 131 ? 11.732  16.481  -4.689  1.00 0.00 ? 134 GLU A OE1  1  
ATOM 1670  O OE2  . GLU A 1 131 ? 10.336  14.804  -4.547  1.00 0.00 ? 134 GLU A OE2  1  
ATOM 1671  O OXT  . GLU A 1 131 ? 10.358  14.419  1.288   1.00 0.00 ? 134 GLU A OXT  1  
ATOM 1672  H H    . GLU A 1 131 ? 9.645   14.937  -2.848  1.00 0.00 ? 134 GLU A H    1  
ATOM 1673  H HA   . GLU A 1 131 ? 10.972  13.473  -0.922  1.00 0.00 ? 134 GLU A HA   1  
ATOM 1674  H HB2  . GLU A 1 131 ? 11.714  16.282  -1.770  1.00 0.00 ? 134 GLU A HB2  1  
ATOM 1675  H HB3  . GLU A 1 131 ? 12.794  15.070  -1.105  1.00 0.00 ? 134 GLU A HB3  1  
ATOM 1676  H HG2  . GLU A 1 131 ? 13.287  15.007  -3.348  1.00 0.00 ? 134 GLU A HG2  1  
ATOM 1677  H HG3  . GLU A 1 131 ? 12.139  13.681  -3.183  1.00 0.00 ? 134 GLU A HG3  1  
ATOM 1678  N N    . ARG A 1 22  ? -9.766  -2.539  14.313  1.00 0.00 ? 25  ARG A N    2  
ATOM 1679  C CA   . ARG A 1 22  ? -9.611  -2.012  12.942  1.00 0.00 ? 25  ARG A CA   2  
ATOM 1680  C C    . ARG A 1 22  ? -8.160  -1.627  12.693  1.00 0.00 ? 25  ARG A C    2  
ATOM 1681  O O    . ARG A 1 22  ? -7.460  -1.208  13.612  1.00 0.00 ? 25  ARG A O    2  
ATOM 1682  C CB   . ARG A 1 22  ? -10.511 -0.787  12.730  1.00 0.00 ? 25  ARG A CB   2  
ATOM 1683  C CG   . ARG A 1 22  ? -10.103 0.426   13.558  1.00 0.00 ? 25  ARG A CG   2  
ATOM 1684  C CD   . ARG A 1 22  ? -10.995 1.625   13.281  1.00 0.00 ? 25  ARG A CD   2  
ATOM 1685  N NE   . ARG A 1 22  ? -10.512 2.830   13.959  1.00 0.00 ? 25  ARG A NE   2  
ATOM 1686  C CZ   . ARG A 1 22  ? -11.281 3.873   14.261  1.00 0.00 ? 25  ARG A CZ   2  
ATOM 1687  N NH1  . ARG A 1 22  ? -12.566 3.872   13.928  1.00 0.00 ? 25  ARG A NH1  2  
ATOM 1688  N NH2  . ARG A 1 22  ? -10.771 4.916   14.900  1.00 0.00 ? 25  ARG A NH2  2  
ATOM 1689  H HA   . ARG A 1 22  ? -9.893  -2.787  12.244  1.00 0.00 ? 25  ARG A HA   2  
ATOM 1690  H HB2  . ARG A 1 22  ? -10.484 -0.509  11.688  1.00 0.00 ? 25  ARG A HB2  2  
ATOM 1691  H HB3  . ARG A 1 22  ? -11.526 -1.052  12.997  1.00 0.00 ? 25  ARG A HB3  2  
ATOM 1692  H HG2  . ARG A 1 22  ? -10.172 0.175   14.604  1.00 0.00 ? 25  ARG A HG2  2  
ATOM 1693  H HG3  . ARG A 1 22  ? -9.082  0.686   13.315  1.00 0.00 ? 25  ARG A HG3  2  
ATOM 1694  H HD2  . ARG A 1 22  ? -11.018 1.804   12.216  1.00 0.00 ? 25  ARG A HD2  2  
ATOM 1695  H HD3  . ARG A 1 22  ? -11.993 1.402   13.630  1.00 0.00 ? 25  ARG A HD3  2  
ATOM 1696  H HE   . ARG A 1 22  ? -9.550  2.856   14.203  1.00 0.00 ? 25  ARG A HE   2  
ATOM 1697  H HH12 . ARG A 1 22  ? -12.931 4.578   13.301  1.00 0.00 ? 25  ARG A HH12 2  
ATOM 1698  H HH21 . ARG A 1 22  ? -9.800  4.924   15.165  1.00 0.00 ? 25  ARG A HH21 2  
ATOM 1699  H HH22 . ARG A 1 22  ? -11.351 5.704   15.121  1.00 0.00 ? 25  ARG A HH22 2  
ATOM 1700  N N    . LEU A 1 23  ? -7.705  -1.791  11.461  1.00 0.00 ? 26  LEU A N    2  
ATOM 1701  C CA   . LEU A 1 23  ? -6.369  -1.352  11.081  1.00 0.00 ? 26  LEU A CA   2  
ATOM 1702  C C    . LEU A 1 23  ? -6.449  -0.430  9.876   1.00 0.00 ? 26  LEU A C    2  
ATOM 1703  O O    . LEU A 1 23  ? -6.133  -0.826  8.761   1.00 0.00 ? 26  LEU A O    2  
ATOM 1704  C CB   . LEU A 1 23  ? -5.446  -2.535  10.757  1.00 0.00 ? 26  LEU A CB   2  
ATOM 1705  C CG   . LEU A 1 23  ? -5.034  -3.407  11.946  1.00 0.00 ? 26  LEU A CG   2  
ATOM 1706  C CD1  . LEU A 1 23  ? -6.134  -4.393  12.301  1.00 0.00 ? 26  LEU A CD1  2  
ATOM 1707  C CD2  . LEU A 1 23  ? -3.732  -4.132  11.644  1.00 0.00 ? 26  LEU A CD2  2  
ATOM 1708  H H    . LEU A 1 23  ? -8.279  -2.220  10.788  1.00 0.00 ? 26  LEU A H    2  
ATOM 1709  H HA   . LEU A 1 23  ? -5.955  -0.803  11.913  1.00 0.00 ? 26  LEU A HA   2  
ATOM 1710  H HB2  . LEU A 1 23  ? -5.947  -3.163  10.035  1.00 0.00 ? 26  LEU A HB2  2  
ATOM 1711  H HB3  . LEU A 1 23  ? -4.549  -2.142  10.300  1.00 0.00 ? 26  LEU A HB3  2  
ATOM 1712  H HG   . LEU A 1 23  ? -4.869  -2.773  12.804  1.00 0.00 ? 26  LEU A HG   2  
ATOM 1713  H HD11 . LEU A 1 23  ? -6.354  -5.010  11.443  1.00 0.00 ? 26  LEU A HD11 2  
ATOM 1714  H HD12 . LEU A 1 23  ? -5.808  -5.016  13.120  1.00 0.00 ? 26  LEU A HD12 2  
ATOM 1715  H HD13 . LEU A 1 23  ? -7.021  -3.849  12.592  1.00 0.00 ? 26  LEU A HD13 2  
ATOM 1716  H HD21 . LEU A 1 23  ? -2.944  -3.408  11.498  1.00 0.00 ? 26  LEU A HD21 2  
ATOM 1717  H HD22 . LEU A 1 23  ? -3.478  -4.779  12.471  1.00 0.00 ? 26  LEU A HD22 2  
ATOM 1718  H HD23 . LEU A 1 23  ? -3.849  -4.723  10.747  1.00 0.00 ? 26  LEU A HD23 2  
ATOM 1719  N N    . SER A 1 24  ? -6.885  0.792   10.094  1.00 0.00 ? 27  SER A N    2  
ATOM 1720  C CA   . SER A 1 24  ? -6.983  1.756   9.013   1.00 0.00 ? 27  SER A CA   2  
ATOM 1721  C C    . SER A 1 24  ? -5.742  2.638   9.015   1.00 0.00 ? 27  SER A C    2  
ATOM 1722  O O    . SER A 1 24  ? -5.109  2.816   10.056  1.00 0.00 ? 27  SER A O    2  
ATOM 1723  C CB   . SER A 1 24  ? -8.245  2.599   9.182   1.00 0.00 ? 27  SER A CB   2  
ATOM 1724  O OG   . SER A 1 24  ? -9.377  1.767   9.390   1.00 0.00 ? 27  SER A OG   2  
ATOM 1725  H H    . SER A 1 24  ? -7.122  1.070   11.011  1.00 0.00 ? 27  SER A H    2  
ATOM 1726  H HA   . SER A 1 24  ? -7.033  1.216   8.080   1.00 0.00 ? 27  SER A HA   2  
ATOM 1727  H HB2  . SER A 1 24  ? -8.130  3.254   10.031  1.00 0.00 ? 27  SER A HB2  2  
ATOM 1728  H HB3  . SER A 1 24  ? -8.406  3.187   8.292   1.00 0.00 ? 27  SER A HB3  2  
ATOM 1729  H HG   . SER A 1 24  ? -9.099  0.967   9.847   1.00 0.00 ? 27  SER A HG   2  
ATOM 1730  N N    . TRP A 1 25  ? -5.391  3.193   7.859   1.00 0.00 ? 28  TRP A N    2  
ATOM 1731  C CA   . TRP A 1 25  ? -4.190  4.025   7.747   1.00 0.00 ? 28  TRP A CA   2  
ATOM 1732  C C    . TRP A 1 25  ? -4.377  5.404   8.387   1.00 0.00 ? 28  TRP A C    2  
ATOM 1733  O O    . TRP A 1 25  ? -3.697  6.368   8.030   1.00 0.00 ? 28  TRP A O    2  
ATOM 1734  C CB   . TRP A 1 25  ? -3.727  4.148   6.285   1.00 0.00 ? 28  TRP A CB   2  
ATOM 1735  C CG   . TRP A 1 25  ? -4.798  4.515   5.291   1.00 0.00 ? 28  TRP A CG   2  
ATOM 1736  C CD1  . TRP A 1 25  ? -5.969  5.180   5.525   1.00 0.00 ? 28  TRP A CD1  2  
ATOM 1737  C CD2  . TRP A 1 25  ? -4.771  4.244   3.883   1.00 0.00 ? 28  TRP A CD2  2  
ATOM 1738  N NE1  . TRP A 1 25  ? -6.676  5.321   4.354   1.00 0.00 ? 28  TRP A NE1  2  
ATOM 1739  C CE2  . TRP A 1 25  ? -5.960  4.757   3.333   1.00 0.00 ? 28  TRP A CE2  2  
ATOM 1740  C CE3  . TRP A 1 25  ? -3.858  3.611   3.034   1.00 0.00 ? 28  TRP A CE3  2  
ATOM 1741  C CZ2  . TRP A 1 25  ? -6.258  4.659   1.976   1.00 0.00 ? 28  TRP A CZ2  2  
ATOM 1742  C CZ3  . TRP A 1 25  ? -4.154  3.515   1.687   1.00 0.00 ? 28  TRP A CZ3  2  
ATOM 1743  C CH2  . TRP A 1 25  ? -5.346  4.037   1.171   1.00 0.00 ? 28  TRP A CH2  2  
ATOM 1744  H H    . TRP A 1 25  ? -5.941  3.031   7.060   1.00 0.00 ? 28  TRP A H    2  
ATOM 1745  H HA   . TRP A 1 25  ? -3.413  3.515   8.300   1.00 0.00 ? 28  TRP A HA   2  
ATOM 1746  H HB2  . TRP A 1 25  ? -2.963  4.908   6.229   1.00 0.00 ? 28  TRP A HB2  2  
ATOM 1747  H HB3  . TRP A 1 25  ? -3.302  3.201   5.977   1.00 0.00 ? 28  TRP A HB3  2  
ATOM 1748  H HD1  . TRP A 1 25  ? -6.286  5.528   6.497   1.00 0.00 ? 28  TRP A HD1  2  
ATOM 1749  H HE1  . TRP A 1 25  ? -7.552  5.761   4.263   1.00 0.00 ? 28  TRP A HE1  2  
ATOM 1750  H HE3  . TRP A 1 25  ? -2.932  3.203   3.415   1.00 0.00 ? 28  TRP A HE3  2  
ATOM 1751  H HZ2  . TRP A 1 25  ? -7.172  5.055   1.561   1.00 0.00 ? 28  TRP A HZ2  2  
ATOM 1752  H HZ3  . TRP A 1 25  ? -3.459  3.031   1.016   1.00 0.00 ? 28  TRP A HZ3  2  
ATOM 1753  H HH2  . TRP A 1 25  ? -5.536  3.939   0.112   1.00 0.00 ? 28  TRP A HH2  2  
ATOM 1754  N N    . TYR A 1 26  ? -5.302  5.484   9.332   1.00 0.00 ? 29  TYR A N    2  
ATOM 1755  C CA   . TYR A 1 26  ? -5.474  6.667   10.156  1.00 0.00 ? 29  TYR A CA   2  
ATOM 1756  C C    . TYR A 1 26  ? -5.582  6.277   11.629  1.00 0.00 ? 29  TYR A C    2  
ATOM 1757  O O    . TYR A 1 26  ? -6.048  7.055   12.462  1.00 0.00 ? 29  TYR A O    2  
ATOM 1758  C CB   . TYR A 1 26  ? -6.695  7.479   9.715   1.00 0.00 ? 29  TYR A CB   2  
ATOM 1759  C CG   . TYR A 1 26  ? -6.401  8.412   8.557   1.00 0.00 ? 29  TYR A CG   2  
ATOM 1760  C CD1  . TYR A 1 26  ? -5.833  9.660   8.782   1.00 0.00 ? 29  TYR A CD1  2  
ATOM 1761  C CD2  . TYR A 1 26  ? -6.673  8.044   7.243   1.00 0.00 ? 29  TYR A CD2  2  
ATOM 1762  C CE1  . TYR A 1 26  ? -5.545  10.515  7.735   1.00 0.00 ? 29  TYR A CE1  2  
ATOM 1763  C CE2  . TYR A 1 26  ? -6.382  8.893   6.188   1.00 0.00 ? 29  TYR A CE2  2  
ATOM 1764  C CZ   . TYR A 1 26  ? -5.819  10.127  6.439   1.00 0.00 ? 29  TYR A CZ   2  
ATOM 1765  O OH   . TYR A 1 26  ? -5.517  10.974  5.393   1.00 0.00 ? 29  TYR A OH   2  
ATOM 1766  H H    . TYR A 1 26  ? -5.889  4.715   9.481   1.00 0.00 ? 29  TYR A H    2  
ATOM 1767  H HA   . TYR A 1 26  ? -4.591  7.276   10.032  1.00 0.00 ? 29  TYR A HA   2  
ATOM 1768  H HB2  . TYR A 1 26  ? -7.480  6.802   9.411   1.00 0.00 ? 29  TYR A HB2  2  
ATOM 1769  H HB3  . TYR A 1 26  ? -7.041  8.074   10.548  1.00 0.00 ? 29  TYR A HB3  2  
ATOM 1770  H HD1  . TYR A 1 26  ? -5.618  9.965   9.797   1.00 0.00 ? 29  TYR A HD1  2  
ATOM 1771  H HD2  . TYR A 1 26  ? -7.115  7.077   7.049   1.00 0.00 ? 29  TYR A HD2  2  
ATOM 1772  H HE1  . TYR A 1 26  ? -5.104  11.479  7.933   1.00 0.00 ? 29  TYR A HE1  2  
ATOM 1773  H HE2  . TYR A 1 26  ? -6.600  8.588   5.176   1.00 0.00 ? 29  TYR A HE2  2  
ATOM 1774  H HH   . TYR A 1 26  ? -6.294  11.077  4.825   1.00 0.00 ? 29  TYR A HH   2  
ATOM 1775  N N    . ASP A 1 27  ? -5.157  5.055   11.938  1.00 0.00 ? 30  ASP A N    2  
ATOM 1776  C CA   . ASP A 1 27  ? -5.067  4.591   13.318  1.00 0.00 ? 30  ASP A CA   2  
ATOM 1777  C C    . ASP A 1 27  ? -3.624  4.698   13.790  1.00 0.00 ? 30  ASP A C    2  
ATOM 1778  O O    . ASP A 1 27  ? -2.692  4.452   13.021  1.00 0.00 ? 30  ASP A O    2  
ATOM 1779  C CB   . ASP A 1 27  ? -5.541  3.138   13.456  1.00 0.00 ? 30  ASP A CB   2  
ATOM 1780  C CG   . ASP A 1 27  ? -7.039  2.976   13.290  1.00 0.00 ? 30  ASP A CG   2  
ATOM 1781  O OD1  . ASP A 1 27  ? -7.783  3.290   14.245  1.00 0.00 ? 30  ASP A OD1  2  
ATOM 1782  O OD2  . ASP A 1 27  ? -7.484  2.536   12.211  1.00 0.00 ? 30  ASP A OD2  2  
ATOM 1783  H H    . ASP A 1 27  ? -4.886  4.446   11.217  1.00 0.00 ? 30  ASP A H    2  
ATOM 1784  H HA   . ASP A 1 27  ? -5.689  5.231   13.928  1.00 0.00 ? 30  ASP A HA   2  
ATOM 1785  H HB2  . ASP A 1 27  ? -5.051  2.540   12.708  1.00 0.00 ? 30  ASP A HB2  2  
ATOM 1786  H HB3  . ASP A 1 27  ? -5.267  2.770   14.433  1.00 0.00 ? 30  ASP A HB3  2  
ATOM 1787  N N    . PRO A 1 28  ? -3.420  5.059   15.064  1.00 0.00 ? 31  PRO A N    2  
ATOM 1788  C CA   . PRO A 1 28  ? -2.081  5.282   15.628  1.00 0.00 ? 31  PRO A CA   2  
ATOM 1789  C C    . PRO A 1 28  ? -1.288  3.988   15.783  1.00 0.00 ? 31  PRO A C    2  
ATOM 1790  O O    . PRO A 1 28  ? -0.067  4.008   15.943  1.00 0.00 ? 31  PRO A O    2  
ATOM 1791  C CB   . PRO A 1 28  ? -2.373  5.901   16.997  1.00 0.00 ? 31  PRO A CB   2  
ATOM 1792  C CG   . PRO A 1 28  ? -3.732  5.412   17.355  1.00 0.00 ? 31  PRO A CG   2  
ATOM 1793  C CD   . PRO A 1 28  ? -4.483  5.274   16.060  1.00 0.00 ? 31  PRO A CD   2  
ATOM 1794  H HA   . PRO A 1 28  ? -1.515  5.980   15.030  1.00 0.00 ? 31  PRO A HA   2  
ATOM 1795  H HB2  . PRO A 1 28  ? -1.633  5.569   17.710  1.00 0.00 ? 31  PRO A HB2  2  
ATOM 1796  H HB3  . PRO A 1 28  ? -2.349  6.977   16.921  1.00 0.00 ? 31  PRO A HB3  2  
ATOM 1797  H HG2  . PRO A 1 28  ? -3.658  4.455   17.848  1.00 0.00 ? 31  PRO A HG2  2  
ATOM 1798  H HG3  . PRO A 1 28  ? -4.222  6.129   17.996  1.00 0.00 ? 31  PRO A HG3  2  
ATOM 1799  H HD2  . PRO A 1 28  ? -5.149  4.424   16.097  1.00 0.00 ? 31  PRO A HD2  2  
ATOM 1800  H HD3  . PRO A 1 28  ? -5.034  6.176   15.842  1.00 0.00 ? 31  PRO A HD3  2  
ATOM 1801  N N    . ASP A 1 29  ? -1.993  2.869   15.735  1.00 0.00 ? 32  ASP A N    2  
ATOM 1802  C CA   . ASP A 1 29  ? -1.364  1.560   15.870  1.00 0.00 ? 32  ASP A CA   2  
ATOM 1803  C C    . ASP A 1 29  ? -0.958  1.012   14.510  1.00 0.00 ? 32  ASP A C    2  
ATOM 1804  O O    . ASP A 1 29  ? -0.265  -0.001  14.424  1.00 0.00 ? 32  ASP A O    2  
ATOM 1805  C CB   . ASP A 1 29  ? -2.311  0.575   16.554  1.00 0.00 ? 32  ASP A CB   2  
ATOM 1806  C CG   . ASP A 1 29  ? -2.731  1.036   17.931  1.00 0.00 ? 32  ASP A CG   2  
ATOM 1807  O OD1  . ASP A 1 29  ? -3.703  1.810   18.029  1.00 0.00 ? 32  ASP A OD1  2  
ATOM 1808  O OD2  . ASP A 1 29  ? -2.092  0.628   18.924  1.00 0.00 ? 32  ASP A OD2  2  
ATOM 1809  H H    . ASP A 1 29  ? -2.966  2.924   15.621  1.00 0.00 ? 32  ASP A H    2  
ATOM 1810  H HA   . ASP A 1 29  ? -0.479  1.677   16.477  1.00 0.00 ? 32  ASP A HA   2  
ATOM 1811  H HB2  . ASP A 1 29  ? -3.197  0.460   15.949  1.00 0.00 ? 32  ASP A HB2  2  
ATOM 1812  H HB3  . ASP A 1 29  ? -1.818  -0.381  16.650  1.00 0.00 ? 32  ASP A HB3  2  
ATOM 1813  N N    . PHE A 1 30  ? -1.385  1.685   13.451  1.00 0.00 ? 33  PHE A N    2  
ATOM 1814  C CA   . PHE A 1 30  ? -1.108  1.226   12.104  1.00 0.00 ? 33  PHE A CA   2  
ATOM 1815  C C    . PHE A 1 30  ? 0.308   1.608   11.691  1.00 0.00 ? 33  PHE A C    2  
ATOM 1816  O O    . PHE A 1 30  ? 0.653   2.788   11.632  1.00 0.00 ? 33  PHE A O    2  
ATOM 1817  C CB   . PHE A 1 30  ? -2.126  1.812   11.121  1.00 0.00 ? 33  PHE A CB   2  
ATOM 1818  C CG   . PHE A 1 30  ? -2.006  1.256   9.734   1.00 0.00 ? 33  PHE A CG   2  
ATOM 1819  C CD1  . PHE A 1 30  ? -2.503  -0.001  9.438   1.00 0.00 ? 33  PHE A CD1  2  
ATOM 1820  C CD2  . PHE A 1 30  ? -1.398  1.989   8.726   1.00 0.00 ? 33  PHE A CD2  2  
ATOM 1821  C CE1  . PHE A 1 30  ? -2.399  -0.519  8.164   1.00 0.00 ? 33  PHE A CE1  2  
ATOM 1822  C CE2  . PHE A 1 30  ? -1.291  1.476   7.448   1.00 0.00 ? 33  PHE A CE2  2  
ATOM 1823  C CZ   . PHE A 1 30  ? -1.792  0.221   7.168   1.00 0.00 ? 33  PHE A CZ   2  
ATOM 1824  H H    . PHE A 1 30  ? -1.887  2.516   13.578  1.00 0.00 ? 33  PHE A H    2  
ATOM 1825  H HA   . PHE A 1 30  ? -1.195  0.149   12.097  1.00 0.00 ? 33  PHE A HA   2  
ATOM 1826  H HB2  . PHE A 1 30  ? -3.126  1.601   11.477  1.00 0.00 ? 33  PHE A HB2  2  
ATOM 1827  H HB3  . PHE A 1 30  ? -1.987  2.883   11.065  1.00 0.00 ? 33  PHE A HB3  2  
ATOM 1828  H HD1  . PHE A 1 30  ? -2.977  -0.581  10.217  1.00 0.00 ? 33  PHE A HD1  2  
ATOM 1829  H HD2  . PHE A 1 30  ? -1.003  2.970   8.946   1.00 0.00 ? 33  PHE A HD2  2  
ATOM 1830  H HE1  . PHE A 1 30  ? -2.792  -1.502  7.947   1.00 0.00 ? 33  PHE A HE1  2  
ATOM 1831  H HE2  . PHE A 1 30  ? -0.818  2.057   6.669   1.00 0.00 ? 33  PHE A HE2  2  
ATOM 1832  H HZ   . PHE A 1 30  ? -1.713  -0.181  6.168   1.00 0.00 ? 33  PHE A HZ   2  
ATOM 1833  N N    . GLN A 1 31  ? 1.122   0.602   11.413  1.00 0.00 ? 34  GLN A N    2  
ATOM 1834  C CA   . GLN A 1 31  ? 2.495   0.817   10.987  1.00 0.00 ? 34  GLN A CA   2  
ATOM 1835  C C    . GLN A 1 31  ? 2.625   0.572   9.490   1.00 0.00 ? 34  GLN A C    2  
ATOM 1836  O O    . GLN A 1 31  ? 2.056   -0.383  8.959   1.00 0.00 ? 34  GLN A O    2  
ATOM 1837  C CB   . GLN A 1 31  ? 3.438   -0.114  11.751  1.00 0.00 ? 34  GLN A CB   2  
ATOM 1838  C CG   . GLN A 1 31  ? 3.631   0.261   13.209  1.00 0.00 ? 34  GLN A CG   2  
ATOM 1839  C CD   . GLN A 1 31  ? 4.370   1.573   13.377  1.00 0.00 ? 34  GLN A CD   2  
ATOM 1840  O OE1  . GLN A 1 31  ? 3.763   2.643   13.461  1.00 0.00 ? 34  GLN A OE1  2  
ATOM 1841  N NE2  . GLN A 1 31  ? 5.690   1.498   13.421  1.00 0.00 ? 34  GLN A NE2  2  
ATOM 1842  H H    . GLN A 1 31  ? 0.785   -0.317  11.485  1.00 0.00 ? 34  GLN A H    2  
ATOM 1843  H HA   . GLN A 1 31  ? 2.758   1.843   11.203  1.00 0.00 ? 34  GLN A HA   2  
ATOM 1844  H HB2  . GLN A 1 31  ? 3.041   -1.115  11.715  1.00 0.00 ? 34  GLN A HB2  2  
ATOM 1845  H HB3  . GLN A 1 31  ? 4.402   -0.104  11.270  1.00 0.00 ? 34  GLN A HB3  2  
ATOM 1846  H HG2  . GLN A 1 31  ? 2.662   0.348   13.678  1.00 0.00 ? 34  GLN A HG2  2  
ATOM 1847  H HG3  . GLN A 1 31  ? 4.197   -0.518  13.694  1.00 0.00 ? 34  GLN A HG3  2  
ATOM 1848  H HE21 . GLN A 1 31  ? 6.109   0.607   13.347  1.00 0.00 ? 34  GLN A HE21 2  
ATOM 1849  H HE22 . GLN A 1 31  ? 6.201   2.331   13.511  1.00 0.00 ? 34  GLN A HE22 2  
ATOM 1850  N N    . ALA A 1 32  ? 3.369   1.433   8.811   1.00 0.00 ? 35  ALA A N    2  
ATOM 1851  C CA   . ALA A 1 32  ? 3.574   1.296   7.375   1.00 0.00 ? 35  ALA A CA   2  
ATOM 1852  C C    . ALA A 1 32  ? 4.955   1.794   6.976   1.00 0.00 ? 35  ALA A C    2  
ATOM 1853  O O    . ALA A 1 32  ? 5.589   2.547   7.717   1.00 0.00 ? 35  ALA A O    2  
ATOM 1854  C CB   . ALA A 1 32  ? 2.496   2.051   6.607   1.00 0.00 ? 35  ALA A CB   2  
ATOM 1855  H H    . ALA A 1 32  ? 3.800   2.175   9.285   1.00 0.00 ? 35  ALA A H    2  
ATOM 1856  H HA   . ALA A 1 32  ? 3.495   0.248   7.127   1.00 0.00 ? 35  ALA A HA   2  
ATOM 1857  H HB1  . ALA A 1 32  ? 2.574   3.107   6.821   1.00 0.00 ? 35  ALA A HB1  2  
ATOM 1858  H HB2  . ALA A 1 32  ? 2.626   1.889   5.547   1.00 0.00 ? 35  ALA A HB2  2  
ATOM 1859  H HB3  . ALA A 1 32  ? 1.525   1.694   6.911   1.00 0.00 ? 35  ALA A HB3  2  
ATOM 1860  N N    . ARG A 1 33  ? 5.425   1.352   5.818   1.00 0.00 ? 36  ARG A N    2  
ATOM 1861  C CA   . ARG A 1 33  ? 6.707   1.779   5.293   1.00 0.00 ? 36  ARG A CA   2  
ATOM 1862  C C    . ARG A 1 33  ? 6.698   1.686   3.770   1.00 0.00 ? 36  ARG A C    2  
ATOM 1863  O O    . ARG A 1 33  ? 5.919   0.923   3.191   1.00 0.00 ? 36  ARG A O    2  
ATOM 1864  C CB   . ARG A 1 33  ? 7.834   0.899   5.849   1.00 0.00 ? 36  ARG A CB   2  
ATOM 1865  C CG   . ARG A 1 33  ? 7.874   -0.494  5.239   1.00 0.00 ? 36  ARG A CG   2  
ATOM 1866  C CD   . ARG A 1 33  ? 9.078   -1.287  5.718   1.00 0.00 ? 36  ARG A CD   2  
ATOM 1867  N NE   . ARG A 1 33  ? 8.887   -1.808  7.070   1.00 0.00 ? 36  ARG A NE   2  
ATOM 1868  C CZ   . ARG A 1 33  ? 9.837   -1.830  7.998   1.00 0.00 ? 36  ARG A CZ   2  
ATOM 1869  N NH1  . ARG A 1 33  ? 11.031  -1.320  7.742   1.00 0.00 ? 36  ARG A NH1  2  
ATOM 1870  N NH2  . ARG A 1 33  ? 9.601   -2.364  9.186   1.00 0.00 ? 36  ARG A NH2  2  
ATOM 1871  H H    . ARG A 1 33  ? 4.893   0.708   5.299   1.00 0.00 ? 36  ARG A H    2  
ATOM 1872  H HA   . ARG A 1 33  ? 6.872   2.804   5.586   1.00 0.00 ? 36  ARG A HA   2  
ATOM 1873  H HB2  . ARG A 1 33  ? 8.781   1.379   5.656   1.00 0.00 ? 36  ARG A HB2  2  
ATOM 1874  H HB3  . ARG A 1 33  ? 7.703   0.796   6.917   1.00 0.00 ? 36  ARG A HB3  2  
ATOM 1875  H HG2  . ARG A 1 33  ? 6.977   -1.022  5.525   1.00 0.00 ? 36  ARG A HG2  2  
ATOM 1876  H HG3  . ARG A 1 33  ? 7.912   -0.404  4.163   1.00 0.00 ? 36  ARG A HG3  2  
ATOM 1877  H HD2  . ARG A 1 33  ? 9.241   -2.114  5.043   1.00 0.00 ? 36  ARG A HD2  2  
ATOM 1878  H HD3  . ARG A 1 33  ? 9.946   -0.639  5.711   1.00 0.00 ? 36  ARG A HD3  2  
ATOM 1879  H HE   . ARG A 1 33  ? 8.007   -2.184  7.282   1.00 0.00 ? 36  ARG A HE   2  
ATOM 1880  H HH12 . ARG A 1 33  ? 11.125  -0.332  7.531   1.00 0.00 ? 36  ARG A HH12 2  
ATOM 1881  H HH21 . ARG A 1 33  ? 8.705   -2.752  9.397   1.00 0.00 ? 36  ARG A HH21 2  
ATOM 1882  H HH22 . ARG A 1 33  ? 10.331  -2.385  9.884   1.00 0.00 ? 36  ARG A HH22 2  
ATOM 1883  N N    . LEU A 1 34  ? 7.545   2.469   3.135   1.00 0.00 ? 37  LEU A N    2  
ATOM 1884  C CA   . LEU A 1 34  ? 7.763   2.356   1.706   1.00 0.00 ? 37  LEU A CA   2  
ATOM 1885  C C    . LEU A 1 34  ? 9.103   1.683   1.464   1.00 0.00 ? 37  LEU A C    2  
ATOM 1886  O O    . LEU A 1 34  ? 10.124  2.106   2.011   1.00 0.00 ? 37  LEU A O    2  
ATOM 1887  C CB   . LEU A 1 34  ? 7.726   3.730   1.037   1.00 0.00 ? 37  LEU A CB   2  
ATOM 1888  C CG   . LEU A 1 34  ? 6.374   4.447   1.108   1.00 0.00 ? 37  LEU A CG   2  
ATOM 1889  C CD1  . LEU A 1 34  ? 6.464   5.833   0.490   1.00 0.00 ? 37  LEU A CD1  2  
ATOM 1890  C CD2  . LEU A 1 34  ? 5.303   3.625   0.411   1.00 0.00 ? 37  LEU A CD2  2  
ATOM 1891  H H    . LEU A 1 34  ? 8.042   3.141   3.638   1.00 0.00 ? 37  LEU A H    2  
ATOM 1892  H HA   . LEU A 1 34  ? 6.981   1.737   1.295   1.00 0.00 ? 37  LEU A HA   2  
ATOM 1893  H HB2  . LEU A 1 34  ? 8.468   4.355   1.510   1.00 0.00 ? 37  LEU A HB2  2  
ATOM 1894  H HB3  . LEU A 1 34  ? 7.988   3.606   -0.004  1.00 0.00 ? 37  LEU A HB3  2  
ATOM 1895  H HG   . LEU A 1 34  ? 6.090   4.560   2.144   1.00 0.00 ? 37  LEU A HG   2  
ATOM 1896  H HD11 . LEU A 1 34  ? 6.775   5.747   -0.540  1.00 0.00 ? 37  LEU A HD11 2  
ATOM 1897  H HD12 . LEU A 1 34  ? 5.496   6.312   0.534   1.00 0.00 ? 37  LEU A HD12 2  
ATOM 1898  H HD13 . LEU A 1 34  ? 7.183   6.426   1.036   1.00 0.00 ? 37  LEU A HD13 2  
ATOM 1899  H HD21 . LEU A 1 34  ? 5.594   3.451   -0.615  1.00 0.00 ? 37  LEU A HD21 2  
ATOM 1900  H HD22 . LEU A 1 34  ? 5.190   2.678   0.918   1.00 0.00 ? 37  LEU A HD22 2  
ATOM 1901  H HD23 . LEU A 1 34  ? 4.365   4.159   0.433   1.00 0.00 ? 37  LEU A HD23 2  
ATOM 1902  N N    . THR A 1 35  ? 9.085   0.618   0.678   1.00 0.00 ? 38  THR A N    2  
ATOM 1903  C CA   . THR A 1 35  ? 10.287  -0.158  0.413   1.00 0.00 ? 38  THR A CA   2  
ATOM 1904  C C    . THR A 1 35  ? 11.333  0.691   -0.304  1.00 0.00 ? 38  THR A C    2  
ATOM 1905  O O    . THR A 1 35  ? 10.995  1.638   -1.016  1.00 0.00 ? 38  THR A O    2  
ATOM 1906  C CB   . THR A 1 35  ? 9.971   -1.407  -0.434  1.00 0.00 ? 38  THR A CB   2  
ATOM 1907  O OG1  . THR A 1 35  ? 9.406   -1.017  -1.690  1.00 0.00 ? 38  THR A OG1  2  
ATOM 1908  C CG2  . THR A 1 35  ? 9.005   -2.330  0.302   1.00 0.00 ? 38  THR A CG2  2  
ATOM 1909  H H    . THR A 1 35  ? 8.237   0.348   0.257   1.00 0.00 ? 38  THR A H    2  
ATOM 1910  H HA   . THR A 1 35  ? 10.690  -0.484  1.363   1.00 0.00 ? 38  THR A HA   2  
ATOM 1911  H HB   . THR A 1 35  ? 10.892  -1.944  -0.614  1.00 0.00 ? 38  THR A HB   2  
ATOM 1912  H HG1  . THR A 1 35  ? 10.063  -1.139  -2.389  1.00 0.00 ? 38  THR A HG1  2  
ATOM 1913  H HG21 . THR A 1 35  ? 9.454   -2.656  1.229   1.00 0.00 ? 38  THR A HG21 2  
ATOM 1914  H HG22 . THR A 1 35  ? 8.786   -3.189  -0.314  1.00 0.00 ? 38  THR A HG22 2  
ATOM 1915  H HG23 . THR A 1 35  ? 8.089   -1.798  0.517   1.00 0.00 ? 38  THR A HG23 2  
ATOM 1916  N N    . ARG A 1 36  ? 12.599  0.335   -0.134  1.00 0.00 ? 39  ARG A N    2  
ATOM 1917  C CA   . ARG A 1 36  ? 13.698  1.119   -0.691  1.00 0.00 ? 39  ARG A CA   2  
ATOM 1918  C C    . ARG A 1 36  ? 13.887  0.802   -2.170  1.00 0.00 ? 39  ARG A C    2  
ATOM 1919  O O    . ARG A 1 36  ? 14.995  0.503   -2.618  1.00 0.00 ? 39  ARG A O    2  
ATOM 1920  C CB   . ARG A 1 36  ? 14.996  0.844   0.074   1.00 0.00 ? 39  ARG A CB   2  
ATOM 1921  C CG   . ARG A 1 36  ? 14.919  1.186   1.554   1.00 0.00 ? 39  ARG A CG   2  
ATOM 1922  C CD   . ARG A 1 36  ? 16.175  0.744   2.283   1.00 0.00 ? 39  ARG A CD   2  
ATOM 1923  N NE   . ARG A 1 36  ? 16.413  -0.692  2.134   1.00 0.00 ? 39  ARG A NE   2  
ATOM 1924  C CZ   . ARG A 1 36  ? 17.623  -1.243  2.132   1.00 0.00 ? 39  ARG A CZ   2  
ATOM 1925  N NH1  . ARG A 1 36  ? 18.694  -0.475  2.272   1.00 0.00 ? 39  ARG A NH1  2  
ATOM 1926  N NH2  . ARG A 1 36  ? 17.766  -2.548  1.981   1.00 0.00 ? 39  ARG A NH2  2  
ATOM 1927  H H    . ARG A 1 36  ? 12.801  -0.491  0.361   1.00 0.00 ? 39  ARG A H    2  
ATOM 1928  H HA   . ARG A 1 36  ? 13.444  2.164   -0.588  1.00 0.00 ? 39  ARG A HA   2  
ATOM 1929  H HB2  . ARG A 1 36  ? 15.242  -0.204  -0.019  1.00 0.00 ? 39  ARG A HB2  2  
ATOM 1930  H HB3  . ARG A 1 36  ? 15.790  1.429   -0.366  1.00 0.00 ? 39  ARG A HB3  2  
ATOM 1931  H HG2  . ARG A 1 36  ? 14.808  2.256   1.661   1.00 0.00 ? 39  ARG A HG2  2  
ATOM 1932  H HG3  . ARG A 1 36  ? 14.065  0.687   1.988   1.00 0.00 ? 39  ARG A HG3  2  
ATOM 1933  H HD2  . ARG A 1 36  ? 17.020  1.283   1.880   1.00 0.00 ? 39  ARG A HD2  2  
ATOM 1934  H HD3  . ARG A 1 36  ? 16.067  0.975   3.332   1.00 0.00 ? 39  ARG A HD3  2  
ATOM 1935  H HE   . ARG A 1 36  ? 15.627  -1.271  2.020   1.00 0.00 ? 39  ARG A HE   2  
ATOM 1936  H HH12 . ARG A 1 36  ? 19.516  -0.833  2.748   1.00 0.00 ? 39  ARG A HH12 2  
ATOM 1937  H HH21 . ARG A 1 36  ? 16.957  -3.137  1.864   1.00 0.00 ? 39  ARG A HH21 2  
ATOM 1938  H HH22 . ARG A 1 36  ? 18.688  -2.958  1.975   1.00 0.00 ? 39  ARG A HH22 2  
ATOM 1939  N N    . SER A 1 37  ? 12.796  0.860   -2.916  1.00 0.00 ? 40  SER A N    2  
ATOM 1940  C CA   . SER A 1 37  ? 12.821  0.590   -4.343  1.00 0.00 ? 40  SER A CA   2  
ATOM 1941  C C    . SER A 1 37  ? 13.451  1.761   -5.092  1.00 0.00 ? 40  SER A C    2  
ATOM 1942  O O    . SER A 1 37  ? 14.291  1.571   -5.971  1.00 0.00 ? 40  SER A O    2  
ATOM 1943  C CB   . SER A 1 37  ? 11.400  0.333   -4.838  1.00 0.00 ? 40  SER A CB   2  
ATOM 1944  O OG   . SER A 1 37  ? 10.782  -0.695  -4.078  1.00 0.00 ? 40  SER A OG   2  
ATOM 1945  H H    . SER A 1 37  ? 11.941  1.090   -2.487  1.00 0.00 ? 40  SER A H    2  
ATOM 1946  H HA   . SER A 1 37  ? 13.420  -0.293  -4.507  1.00 0.00 ? 40  SER A HA   2  
ATOM 1947  H HB2  . SER A 1 37  ? 10.819  1.236   -4.740  1.00 0.00 ? 40  SER A HB2  2  
ATOM 1948  H HB3  . SER A 1 37  ? 11.425  0.035   -5.873  1.00 0.00 ? 40  SER A HB3  2  
ATOM 1949  H HG   . SER A 1 37  ? 9.895   -0.869  -4.436  1.00 0.00 ? 40  SER A HG   2  
ATOM 1950  N N    . ASN A 1 38  ? 13.042  2.972   -4.735  1.00 0.00 ? 41  ASN A N    2  
ATOM 1951  C CA   . ASN A 1 38  ? 13.631  4.172   -5.313  1.00 0.00 ? 41  ASN A CA   2  
ATOM 1952  C C    . ASN A 1 38  ? 14.191  5.054   -4.215  1.00 0.00 ? 41  ASN A C    2  
ATOM 1953  O O    . ASN A 1 38  ? 15.397  5.292   -4.148  1.00 0.00 ? 41  ASN A O    2  
ATOM 1954  C CB   . ASN A 1 38  ? 12.610  4.958   -6.139  1.00 0.00 ? 41  ASN A CB   2  
ATOM 1955  C CG   . ASN A 1 38  ? 12.187  4.247   -7.409  1.00 0.00 ? 41  ASN A CG   2  
ATOM 1956  O OD1  . ASN A 1 38  ? 11.077  4.439   -7.898  1.00 0.00 ? 41  ASN A OD1  2  
ATOM 1957  N ND2  . ASN A 1 38  ? 13.063  3.421   -7.954  1.00 0.00 ? 41  ASN A ND2  2  
ATOM 1958  H H    . ASN A 1 38  ? 12.332  3.062   -4.065  1.00 0.00 ? 41  ASN A H    2  
ATOM 1959  H HA   . ASN A 1 38  ? 14.439  3.864   -5.958  1.00 0.00 ? 41  ASN A HA   2  
ATOM 1960  H HB2  . ASN A 1 38  ? 11.728  5.127   -5.539  1.00 0.00 ? 41  ASN A HB2  2  
ATOM 1961  H HB3  . ASN A 1 38  ? 13.040  5.911   -6.410  1.00 0.00 ? 41  ASN A HB3  2  
ATOM 1962  H HD21 . ASN A 1 38  ? 13.934  3.304   -7.514  1.00 0.00 ? 41  ASN A HD21 2  
ATOM 1963  H HD22 . ASN A 1 38  ? 12.811  2.964   -8.784  1.00 0.00 ? 41  ASN A HD22 2  
ATOM 1964  N N    . SER A 1 39  ? 13.308  5.515   -3.344  1.00 0.00 ? 42  SER A N    2  
ATOM 1965  C CA   . SER A 1 39  ? 13.698  6.367   -2.239  1.00 0.00 ? 42  SER A CA   2  
ATOM 1966  C C    . SER A 1 39  ? 12.709  6.198   -1.090  1.00 0.00 ? 42  SER A C    2  
ATOM 1967  O O    . SER A 1 39  ? 11.802  5.369   -1.178  1.00 0.00 ? 42  SER A O    2  
ATOM 1968  C CB   . SER A 1 39  ? 13.764  7.825   -2.698  1.00 0.00 ? 42  SER A CB   2  
ATOM 1969  O OG   . SER A 1 39  ? 14.356  8.654   -1.710  1.00 0.00 ? 42  SER A OG   2  
ATOM 1970  H H    . SER A 1 39  ? 12.362  5.273   -3.443  1.00 0.00 ? 42  SER A H    2  
ATOM 1971  H HA   . SER A 1 39  ? 14.676  6.055   -1.905  1.00 0.00 ? 42  SER A HA   2  
ATOM 1972  H HB2  . SER A 1 39  ? 14.354  7.886   -3.600  1.00 0.00 ? 42  SER A HB2  2  
ATOM 1973  H HB3  . SER A 1 39  ? 12.765  8.181   -2.898  1.00 0.00 ? 42  SER A HB3  2  
ATOM 1974  H HG   . SER A 1 39  ? 13.766  9.414   -1.536  1.00 0.00 ? 42  SER A HG   2  
ATOM 1975  N N    . LYS A 1 40  ? 12.862  6.976   -0.033  1.00 0.00 ? 43  LYS A N    2  
ATOM 1976  C CA   . LYS A 1 40  ? 12.025  6.810   1.152   1.00 0.00 ? 43  LYS A CA   2  
ATOM 1977  C C    . LYS A 1 40  ? 10.576  7.213   0.872   1.00 0.00 ? 43  LYS A C    2  
ATOM 1978  O O    . LYS A 1 40  ? 9.645   6.617   1.410   1.00 0.00 ? 43  LYS A O    2  
ATOM 1979  C CB   . LYS A 1 40  ? 12.588  7.601   2.344   1.00 0.00 ? 43  LYS A CB   2  
ATOM 1980  C CG   . LYS A 1 40  ? 12.518  9.113   2.195   1.00 0.00 ? 43  LYS A CG   2  
ATOM 1981  C CD   . LYS A 1 40  ? 13.124  9.814   3.399   1.00 0.00 ? 43  LYS A CD   2  
ATOM 1982  C CE   . LYS A 1 40  ? 12.977  11.324  3.305   1.00 0.00 ? 43  LYS A CE   2  
ATOM 1983  N NZ   . LYS A 1 40  ? 11.553  11.758  3.393   1.00 0.00 ? 43  LYS A NZ   2  
ATOM 1984  H H    . LYS A 1 40  ? 13.546  7.679   -0.051  1.00 0.00 ? 43  LYS A H    2  
ATOM 1985  H HA   . LYS A 1 40  ? 12.037  5.761   1.404   1.00 0.00 ? 43  LYS A HA   2  
ATOM 1986  H HB2  . LYS A 1 40  ? 12.034  7.327   3.230   1.00 0.00 ? 43  LYS A HB2  2  
ATOM 1987  H HB3  . LYS A 1 40  ? 13.623  7.325   2.482   1.00 0.00 ? 43  LYS A HB3  2  
ATOM 1988  H HG2  . LYS A 1 40  ? 13.065  9.404   1.311   1.00 0.00 ? 43  LYS A HG2  2  
ATOM 1989  H HG3  . LYS A 1 40  ? 11.484  9.411   2.096   1.00 0.00 ? 43  LYS A HG3  2  
ATOM 1990  H HD2  . LYS A 1 40  ? 12.628  9.469   4.294   1.00 0.00 ? 43  LYS A HD2  2  
ATOM 1991  H HD3  . LYS A 1 40  ? 14.175  9.569   3.451   1.00 0.00 ? 43  LYS A HD3  2  
ATOM 1992  H HE2  . LYS A 1 40  ? 13.532  11.776  4.114   1.00 0.00 ? 43  LYS A HE2  2  
ATOM 1993  H HE3  . LYS A 1 40  ? 13.388  11.652  2.361   1.00 0.00 ? 43  LYS A HE3  2  
ATOM 1994  H HZ1  . LYS A 1 40  ? 11.005  11.326  2.620   1.00 0.00 ? 43  LYS A HZ1  2  
ATOM 1995  H HZ3  . LYS A 1 40  ? 11.501  12.796  3.285   1.00 0.00 ? 43  LYS A HZ3  2  
ATOM 1996  N N    . CYS A 1 41  ? 10.382  8.206   0.011   1.00 0.00 ? 44  CYS A N    2  
ATOM 1997  C CA   . CYS A 1 41  ? 9.040   8.691   -0.283  1.00 0.00 ? 44  CYS A CA   2  
ATOM 1998  C C    . CYS A 1 41  ? 8.477   8.077   -1.566  1.00 0.00 ? 44  CYS A C    2  
ATOM 1999  O O    . CYS A 1 41  ? 7.532   8.613   -2.147  1.00 0.00 ? 44  CYS A O    2  
ATOM 2000  C CB   . CYS A 1 41  ? 9.036   10.216  -0.402  1.00 0.00 ? 44  CYS A CB   2  
ATOM 2001  S SG   . CYS A 1 41  ? 9.578   11.091  1.103   1.00 0.00 ? 44  CYS A SG   2  
ATOM 2002  H H    . CYS A 1 41  ? 11.156  8.630   -0.425  1.00 0.00 ? 44  CYS A H    2  
ATOM 2003  H HA   . CYS A 1 41  ? 8.402   8.409   0.543   1.00 0.00 ? 44  CYS A HA   2  
ATOM 2004  H HB2  . CYS A 1 41  ? 9.695   10.508  -1.206  1.00 0.00 ? 44  CYS A HB2  2  
ATOM 2005  H HB3  . CYS A 1 41  ? 8.032   10.548  -0.631  1.00 0.00 ? 44  CYS A HB3  2  
ATOM 2006  N N    . GLN A 1 42  ? 9.045   6.961   -2.016  1.00 0.00 ? 45  GLN A N    2  
ATOM 2007  C CA   . GLN A 1 42  ? 8.552   6.308   -3.224  1.00 0.00 ? 45  GLN A CA   2  
ATOM 2008  C C    . GLN A 1 42  ? 9.010   4.855   -3.315  1.00 0.00 ? 45  GLN A C    2  
ATOM 2009  O O    . GLN A 1 42  ? 10.202  4.563   -3.452  1.00 0.00 ? 45  GLN A O    2  
ATOM 2010  C CB   . GLN A 1 42  ? 8.970   7.090   -4.475  1.00 0.00 ? 45  GLN A CB   2  
ATOM 2011  C CG   . GLN A 1 42  ? 10.445  7.450   -4.527  1.00 0.00 ? 45  GLN A CG   2  
ATOM 2012  C CD   . GLN A 1 42  ? 10.812  8.241   -5.769  1.00 0.00 ? 45  GLN A CD   2  
ATOM 2013  O OE1  . GLN A 1 42  ? 11.934  8.155   -6.264  1.00 0.00 ? 45  GLN A OE1  2  
ATOM 2014  N NE2  . GLN A 1 42  ? 9.871   9.021   -6.276  1.00 0.00 ? 45  GLN A NE2  2  
ATOM 2015  H H    . GLN A 1 42  ? 9.801   6.567   -1.527  1.00 0.00 ? 45  GLN A H    2  
ATOM 2016  H HA   . GLN A 1 42  ? 7.472   6.313   -3.165  1.00 0.00 ? 45  GLN A HA   2  
ATOM 2017  H HB2  . GLN A 1 42  ? 8.737   6.501   -5.348  1.00 0.00 ? 45  GLN A HB2  2  
ATOM 2018  H HB3  . GLN A 1 42  ? 8.402   8.007   -4.511  1.00 0.00 ? 45  GLN A HB3  2  
ATOM 2019  H HG2  . GLN A 1 42  ? 10.684  8.045   -3.659  1.00 0.00 ? 45  GLN A HG2  2  
ATOM 2020  H HG3  . GLN A 1 42  ? 11.024  6.541   -4.511  1.00 0.00 ? 45  GLN A HG3  2  
ATOM 2021  H HE21 . GLN A 1 42  ? 9.002   9.049   -5.827  1.00 0.00 ? 45  GLN A HE21 2  
ATOM 2022  H HE22 . GLN A 1 42  ? 10.082  9.539   -7.080  1.00 0.00 ? 45  GLN A HE22 2  
ATOM 2023  N N    . GLY A 1 43  ? 8.044   3.952   -3.245  1.00 0.00 ? 46  GLY A N    2  
ATOM 2024  C CA   . GLY A 1 43  ? 8.327   2.535   -3.336  1.00 0.00 ? 46  GLY A CA   2  
ATOM 2025  C C    . GLY A 1 43  ? 7.081   1.705   -3.096  1.00 0.00 ? 46  GLY A C    2  
ATOM 2026  O O    . GLY A 1 43  ? 5.967   2.223   -3.205  1.00 0.00 ? 46  GLY A O    2  
ATOM 2027  H H    . GLY A 1 43  ? 7.114   4.255   -3.129  1.00 0.00 ? 46  GLY A H    2  
ATOM 2028  H HA2  . GLY A 1 43  ? 8.708   2.319   -4.324  1.00 0.00 ? 46  GLY A HA2  2  
ATOM 2029  H HA3  . GLY A 1 43  ? 9.075   2.274   -2.601  1.00 0.00 ? 46  GLY A HA3  2  
ATOM 2030  N N    . GLN A 1 44  ? 7.258   0.427   -2.774  1.00 0.00 ? 47  GLN A N    2  
ATOM 2031  C CA   . GLN A 1 44  ? 6.131   -0.453  -2.490  1.00 0.00 ? 47  GLN A CA   2  
ATOM 2032  C C    . GLN A 1 44  ? 5.563   -0.140  -1.116  1.00 0.00 ? 47  GLN A C    2  
ATOM 2033  O O    . GLN A 1 44  ? 6.310   0.162   -0.181  1.00 0.00 ? 47  GLN A O    2  
ATOM 2034  C CB   . GLN A 1 44  ? 6.538   -1.934  -2.538  1.00 0.00 ? 47  GLN A CB   2  
ATOM 2035  C CG   . GLN A 1 44  ? 6.471   -2.578  -3.919  1.00 0.00 ? 47  GLN A CG   2  
ATOM 2036  C CD   . GLN A 1 44  ? 7.680   -2.299  -4.793  1.00 0.00 ? 47  GLN A CD   2  
ATOM 2037  O OE1  . GLN A 1 44  ? 8.306   -1.245  -4.710  1.00 0.00 ? 47  GLN A OE1  2  
ATOM 2038  N NE2  . GLN A 1 44  ? 8.029   -3.262  -5.633  1.00 0.00 ? 47  GLN A NE2  2  
ATOM 2039  H H    . GLN A 1 44  ? 8.171   0.068   -2.705  1.00 0.00 ? 47  GLN A H    2  
ATOM 2040  H HA   . GLN A 1 44  ? 5.373   -0.272  -3.232  1.00 0.00 ? 47  GLN A HA   2  
ATOM 2041  H HB2  . GLN A 1 44  ? 7.552   -2.024  -2.178  1.00 0.00 ? 47  GLN A HB2  2  
ATOM 2042  H HB3  . GLN A 1 44  ? 5.886   -2.489  -1.876  1.00 0.00 ? 47  GLN A HB3  2  
ATOM 2043  H HG2  . GLN A 1 44  ? 6.388   -3.648  -3.791  1.00 0.00 ? 47  GLN A HG2  2  
ATOM 2044  H HG3  . GLN A 1 44  ? 5.590   -2.213  -4.425  1.00 0.00 ? 47  GLN A HG3  2  
ATOM 2045  H HE21 . GLN A 1 44  ? 7.497   -4.087  -5.641  1.00 0.00 ? 47  GLN A HE21 2  
ATOM 2046  H HE22 . GLN A 1 44  ? 8.801   -3.112  -6.215  1.00 0.00 ? 47  GLN A HE22 2  
ATOM 2047  N N    . LEU A 1 45  ? 4.247   -0.212  -0.994  1.00 0.00 ? 48  LEU A N    2  
ATOM 2048  C CA   . LEU A 1 45  ? 3.595   0.031   0.282   1.00 0.00 ? 48  LEU A CA   2  
ATOM 2049  C C    . LEU A 1 45  ? 3.566   -1.253  1.098   1.00 0.00 ? 48  LEU A C    2  
ATOM 2050  O O    . LEU A 1 45  ? 2.811   -2.183  0.799   1.00 0.00 ? 48  LEU A O    2  
ATOM 2051  C CB   . LEU A 1 45  ? 2.172   0.564   0.081   1.00 0.00 ? 48  LEU A CB   2  
ATOM 2052  C CG   . LEU A 1 45  ? 1.428   0.955   1.365   1.00 0.00 ? 48  LEU A CG   2  
ATOM 2053  C CD1  . LEU A 1 45  ? 2.120   2.121   2.060   1.00 0.00 ? 48  LEU A CD1  2  
ATOM 2054  C CD2  . LEU A 1 45  ? -0.016  1.303   1.048   1.00 0.00 ? 48  LEU A CD2  2  
ATOM 2055  H H    . LEU A 1 45  ? 3.702   -0.443  -1.778  1.00 0.00 ? 48  LEU A H    2  
ATOM 2056  H HA   . LEU A 1 45  ? 4.176   0.767   0.816   1.00 0.00 ? 48  LEU A HA   2  
ATOM 2057  H HB2  . LEU A 1 45  ? 2.226   1.437   -0.559  1.00 0.00 ? 48  LEU A HB2  2  
ATOM 2058  H HB3  . LEU A 1 45  ? 1.594   -0.198  -0.422  1.00 0.00 ? 48  LEU A HB3  2  
ATOM 2059  H HG   . LEU A 1 45  ? 1.429   0.114   2.045   1.00 0.00 ? 48  LEU A HG   2  
ATOM 2060  H HD11 . LEU A 1 45  ? 3.114   1.828   2.359   1.00 0.00 ? 48  LEU A HD11 2  
ATOM 2061  H HD12 . LEU A 1 45  ? 2.181   2.960   1.382   1.00 0.00 ? 48  LEU A HD12 2  
ATOM 2062  H HD13 . LEU A 1 45  ? 1.553   2.408   2.935   1.00 0.00 ? 48  LEU A HD13 2  
ATOM 2063  H HD21 . LEU A 1 45  ? -0.488  0.467   0.557   1.00 0.00 ? 48  LEU A HD21 2  
ATOM 2064  H HD22 . LEU A 1 45  ? -0.544  1.527   1.965   1.00 0.00 ? 48  LEU A HD22 2  
ATOM 2065  H HD23 . LEU A 1 45  ? -0.043  2.163   0.398   1.00 0.00 ? 48  LEU A HD23 2  
ATOM 2066  N N    . GLU A 1 46  ? 4.409   -1.308  2.113   1.00 0.00 ? 49  GLU A N    2  
ATOM 2067  C CA   . GLU A 1 46  ? 4.467   -2.459  2.989   1.00 0.00 ? 49  GLU A CA   2  
ATOM 2068  C C    . GLU A 1 46  ? 3.897   -2.069  4.345   1.00 0.00 ? 49  GLU A C    2  
ATOM 2069  O O    . GLU A 1 46  ? 4.357   -1.110  4.968   1.00 0.00 ? 49  GLU A O    2  
ATOM 2070  C CB   . GLU A 1 46  ? 5.912   -2.950  3.125   1.00 0.00 ? 49  GLU A CB   2  
ATOM 2071  C CG   . GLU A 1 46  ? 6.037   -4.414  3.512   1.00 0.00 ? 49  GLU A CG   2  
ATOM 2072  C CD   . GLU A 1 46  ? 7.469   -4.825  3.782   1.00 0.00 ? 49  GLU A CD   2  
ATOM 2073  O OE1  . GLU A 1 46  ? 8.215   -5.078  2.810   1.00 0.00 ? 49  GLU A OE1  2  
ATOM 2074  O OE2  . GLU A 1 46  ? 7.851   -4.912  4.968   1.00 0.00 ? 49  GLU A OE2  2  
ATOM 2075  H H    . GLU A 1 46  ? 5.000   -0.542  2.285   1.00 0.00 ? 49  GLU A H    2  
ATOM 2076  H HA   . GLU A 1 46  ? 3.859   -3.239  2.560   1.00 0.00 ? 49  GLU A HA   2  
ATOM 2077  H HB2  . GLU A 1 46  ? 6.418   -2.808  2.182   1.00 0.00 ? 49  GLU A HB2  2  
ATOM 2078  H HB3  . GLU A 1 46  ? 6.405   -2.361  3.881   1.00 0.00 ? 49  GLU A HB3  2  
ATOM 2079  H HG2  . GLU A 1 46  ? 5.450   -4.593  4.401   1.00 0.00 ? 49  GLU A HG2  2  
ATOM 2080  H HG3  . GLU A 1 46  ? 5.656   -5.020  2.703   1.00 0.00 ? 49  GLU A HG3  2  
ATOM 2081  N N    . VAL A 1 47  ? 2.886   -2.794  4.789   1.00 0.00 ? 50  VAL A N    2  
ATOM 2082  C CA   . VAL A 1 47  ? 2.158   -2.426  5.994   1.00 0.00 ? 50  VAL A CA   2  
ATOM 2083  C C    . VAL A 1 47  ? 2.251   -3.512  7.056   1.00 0.00 ? 50  VAL A C    2  
ATOM 2084  O O    . VAL A 1 47  ? 2.472   -4.683  6.748   1.00 0.00 ? 50  VAL A O    2  
ATOM 2085  C CB   . VAL A 1 47  ? 0.670   -2.145  5.695   1.00 0.00 ? 50  VAL A CB   2  
ATOM 2086  C CG1  . VAL A 1 47  ? 0.524   -0.982  4.724   1.00 0.00 ? 50  VAL A CG1  2  
ATOM 2087  C CG2  . VAL A 1 47  ? -0.023  -3.388  5.153   1.00 0.00 ? 50  VAL A CG2  2  
ATOM 2088  H H    . VAL A 1 47  ? 2.633   -3.610  4.303   1.00 0.00 ? 50  VAL A H    2  
ATOM 2089  H HA   . VAL A 1 47  ? 2.600   -1.521  6.382   1.00 0.00 ? 50  VAL A HA   2  
ATOM 2090  H HB   . VAL A 1 47  ? 0.189   -1.868  6.622   1.00 0.00 ? 50  VAL A HB   2  
ATOM 2091  H HG11 . VAL A 1 47  ? -0.524  -0.799  4.538   1.00 0.00 ? 50  VAL A HG11 2  
ATOM 2092  H HG12 . VAL A 1 47  ? 0.975   -0.098  5.151   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 2093  H HG13 . VAL A 1 47  ? 1.017   -1.226  3.793   1.00 0.00 ? 50  VAL A HG13 2  
ATOM 2094  H HG21 . VAL A 1 47  ? 0.445   -3.685  4.226   1.00 0.00 ? 50  VAL A HG21 2  
ATOM 2095  H HG22 . VAL A 1 47  ? 0.061   -4.187  5.871   1.00 0.00 ? 50  VAL A HG22 2  
ATOM 2096  H HG23 . VAL A 1 47  ? -1.065  -3.171  4.975   1.00 0.00 ? 50  VAL A HG23 2  
ATOM 2097  N N    . TYR A 1 48  ? 2.090   -3.108  8.309   1.00 0.00 ? 51  TYR A N    2  
ATOM 2098  C CA   . TYR A 1 48  ? 2.096   -4.038  9.424   1.00 0.00 ? 51  TYR A CA   2  
ATOM 2099  C C    . TYR A 1 48  ? 0.678   -4.489  9.737   1.00 0.00 ? 51  TYR A C    2  
ATOM 2100  O O    . TYR A 1 48  ? -0.127  -3.719  10.260  1.00 0.00 ? 51  TYR A O    2  
ATOM 2101  C CB   . TYR A 1 48  ? 2.726   -3.388  10.663  1.00 0.00 ? 51  TYR A CB   2  
ATOM 2102  C CG   . TYR A 1 48  ? 2.709   -4.267  11.903  1.00 0.00 ? 51  TYR A CG   2  
ATOM 2103  C CD1  . TYR A 1 48  ? 3.651   -5.275  12.080  1.00 0.00 ? 51  TYR A CD1  2  
ATOM 2104  C CD2  . TYR A 1 48  ? 1.751   -4.085  12.897  1.00 0.00 ? 51  TYR A CD2  2  
ATOM 2105  C CE1  . TYR A 1 48  ? 3.638   -6.074  13.209  1.00 0.00 ? 51  TYR A CE1  2  
ATOM 2106  C CE2  . TYR A 1 48  ? 1.734   -4.881  14.028  1.00 0.00 ? 51  TYR A CE2  2  
ATOM 2107  C CZ   . TYR A 1 48  ? 2.678   -5.873  14.179  1.00 0.00 ? 51  TYR A CZ   2  
ATOM 2108  O OH   . TYR A 1 48  ? 2.663   -6.671  15.305  1.00 0.00 ? 51  TYR A OH   2  
ATOM 2109  H H    . TYR A 1 48  ? 1.954   -2.147  8.487   1.00 0.00 ? 51  TYR A H    2  
ATOM 2110  H HA   . TYR A 1 48  ? 2.682   -4.898  9.142   1.00 0.00 ? 51  TYR A HA   2  
ATOM 2111  H HB2  . TYR A 1 48  ? 3.757   -3.138  10.447  1.00 0.00 ? 51  TYR A HB2  2  
ATOM 2112  H HB3  . TYR A 1 48  ? 2.184   -2.482  10.892  1.00 0.00 ? 51  TYR A HB3  2  
ATOM 2113  H HD1  . TYR A 1 48  ? 4.402   -5.432  11.320  1.00 0.00 ? 51  TYR A HD1  2  
ATOM 2114  H HD2  . TYR A 1 48  ? 1.008   -3.309  12.776  1.00 0.00 ? 51  TYR A HD2  2  
ATOM 2115  H HE1  . TYR A 1 48  ? 4.377   -6.851  13.326  1.00 0.00 ? 51  TYR A HE1  2  
ATOM 2116  H HE2  . TYR A 1 48  ? 0.983   -4.724  14.788  1.00 0.00 ? 51  TYR A HE2  2  
ATOM 2117  H HH   . TYR A 1 48  ? 3.540   -6.672  15.705  1.00 0.00 ? 51  TYR A HH   2  
ATOM 2118  N N    . LEU A 1 49  ? 0.374   -5.730  9.398   1.00 0.00 ? 52  LEU A N    2  
ATOM 2119  C CA   . LEU A 1 49  ? -0.908  -6.312  9.740   1.00 0.00 ? 52  LEU A CA   2  
ATOM 2120  C C    . LEU A 1 49  ? -0.842  -6.874  11.153  1.00 0.00 ? 52  LEU A C    2  
ATOM 2121  O O    . LEU A 1 49  ? 0.225   -6.870  11.769  1.00 0.00 ? 52  LEU A O    2  
ATOM 2122  C CB   . LEU A 1 49  ? -1.282  -7.433  8.764   1.00 0.00 ? 52  LEU A CB   2  
ATOM 2123  C CG   . LEU A 1 49  ? -1.315  -7.051  7.284   1.00 0.00 ? 52  LEU A CG   2  
ATOM 2124  C CD1  . LEU A 1 49  ? -1.577  -8.284  6.435   1.00 0.00 ? 52  LEU A CD1  2  
ATOM 2125  C CD2  . LEU A 1 49  ? -2.378  -5.995  7.026   1.00 0.00 ? 52  LEU A CD2  2  
ATOM 2126  H H    . LEU A 1 49  ? 1.033   -6.272  8.912   1.00 0.00 ? 52  LEU A H    2  
ATOM 2127  H HA   . LEU A 1 49  ? -1.657  -5.536  9.701   1.00 0.00 ? 52  LEU A HA   2  
ATOM 2128  H HB2  . LEU A 1 49  ? -0.571  -8.233  8.886   1.00 0.00 ? 52  LEU A HB2  2  
ATOM 2129  H HB3  . LEU A 1 49  ? -2.259  -7.803  9.034   1.00 0.00 ? 52  LEU A HB3  2  
ATOM 2130  H HG   . LEU A 1 49  ? -0.355  -6.645  7.000   1.00 0.00 ? 52  LEU A HG   2  
ATOM 2131  H HD11 . LEU A 1 49  ? -1.539  -8.016  5.390   1.00 0.00 ? 52  LEU A HD11 2  
ATOM 2132  H HD12 . LEU A 1 49  ? -0.825  -9.031  6.642   1.00 0.00 ? 52  LEU A HD12 2  
ATOM 2133  H HD13 . LEU A 1 49  ? -2.554  -8.681  6.668   1.00 0.00 ? 52  LEU A HD13 2  
ATOM 2134  H HD21 . LEU A 1 49  ? -2.144  -5.103  7.590   1.00 0.00 ? 52  LEU A HD21 2  
ATOM 2135  H HD22 . LEU A 1 49  ? -2.403  -5.759  5.972   1.00 0.00 ? 52  LEU A HD22 2  
ATOM 2136  H HD23 . LEU A 1 49  ? -3.342  -6.374  7.332   1.00 0.00 ? 52  LEU A HD23 2  
ATOM 2137  N N    . LYS A 1 50  ? -1.961  -7.371  11.652  1.00 0.00 ? 53  LYS A N    2  
ATOM 2138  C CA   . LYS A 1 50  ? -2.004  -7.992  12.974  1.00 0.00 ? 53  LYS A CA   2  
ATOM 2139  C C    . LYS A 1 50  ? -0.976  -9.118  13.047  1.00 0.00 ? 53  LYS A C    2  
ATOM 2140  O O    . LYS A 1 50  ? -0.304  -9.313  14.062  1.00 0.00 ? 53  LYS A O    2  
ATOM 2141  C CB   . LYS A 1 50  ? -3.403  -8.566  13.283  1.00 0.00 ? 53  LYS A CB   2  
ATOM 2142  C CG   . LYS A 1 50  ? -4.554  -7.969  12.473  1.00 0.00 ? 53  LYS A CG   2  
ATOM 2143  C CD   . LYS A 1 50  ? -4.589  -8.516  11.046  1.00 0.00 ? 53  LYS A CD   2  
ATOM 2144  C CE   . LYS A 1 50  ? -4.794  -10.023 11.031  1.00 0.00 ? 53  LYS A CE   2  
ATOM 2145  N NZ   . LYS A 1 50  ? -4.547  -10.607 9.684   1.00 0.00 ? 53  LYS A NZ   2  
ATOM 2146  H H    . LYS A 1 50  ? -2.781  -7.314  11.126  1.00 0.00 ? 53  LYS A H    2  
ATOM 2147  H HA   . LYS A 1 50  ? -1.756  -7.240  13.707  1.00 0.00 ? 53  LYS A HA   2  
ATOM 2148  H HB2  . LYS A 1 50  ? -3.385  -9.629  13.096  1.00 0.00 ? 53  LYS A HB2  2  
ATOM 2149  H HB3  . LYS A 1 50  ? -3.615  -8.406  14.331  1.00 0.00 ? 53  LYS A HB3  2  
ATOM 2150  H HG2  . LYS A 1 50  ? -5.487  -8.213  12.959  1.00 0.00 ? 53  LYS A HG2  2  
ATOM 2151  H HG3  . LYS A 1 50  ? -4.438  -6.895  12.437  1.00 0.00 ? 53  LYS A HG3  2  
ATOM 2152  H HD2  . LYS A 1 50  ? -5.402  -8.047  10.512  1.00 0.00 ? 53  LYS A HD2  2  
ATOM 2153  H HD3  . LYS A 1 50  ? -3.655  -8.283  10.559  1.00 0.00 ? 53  LYS A HD3  2  
ATOM 2154  H HE2  . LYS A 1 50  ? -4.113  -10.474 11.739  1.00 0.00 ? 53  LYS A HE2  2  
ATOM 2155  H HE3  . LYS A 1 50  ? -5.810  -10.236 11.326  1.00 0.00 ? 53  LYS A HE3  2  
ATOM 2156  H HZ1  . LYS A 1 50  ? -4.825  -11.614 9.694   1.00 0.00 ? 53  LYS A HZ1  2  
ATOM 2157  H HZ3  . LYS A 1 50  ? -3.522  -10.561 9.469   1.00 0.00 ? 53  LYS A HZ3  2  
ATOM 2158  N N    . ASP A 1 51  ? -0.852  -9.841  11.946  1.00 0.00 ? 54  ASP A N    2  
ATOM 2159  C CA   . ASP A 1 51  ? 0.030   -10.996 11.865  1.00 0.00 ? 54  ASP A CA   2  
ATOM 2160  C C    . ASP A 1 51  ? 1.453   -10.621 11.441  1.00 0.00 ? 54  ASP A C    2  
ATOM 2161  O O    . ASP A 1 51  ? 2.374   -11.418 11.604  1.00 0.00 ? 54  ASP A O    2  
ATOM 2162  C CB   . ASP A 1 51  ? -0.552  -12.024 10.895  1.00 0.00 ? 54  ASP A CB   2  
ATOM 2163  C CG   . ASP A 1 51  ? -0.841  -11.432 9.530   1.00 0.00 ? 54  ASP A CG   2  
ATOM 2164  O OD1  . ASP A 1 51  ? -1.861  -10.720 9.394   1.00 0.00 ? 54  ASP A OD1  2  
ATOM 2165  O OD2  . ASP A 1 51  ? -0.049  -11.673 8.596   1.00 0.00 ? 54  ASP A OD2  2  
ATOM 2166  H H    . ASP A 1 51  ? -1.387  -9.599  11.158  1.00 0.00 ? 54  ASP A H    2  
ATOM 2167  H HA   . ASP A 1 51  ? 0.074   -11.438 12.848  1.00 0.00 ? 54  ASP A HA   2  
ATOM 2168  H HB2  . ASP A 1 51  ? 0.154   -12.834 10.772  1.00 0.00 ? 54  ASP A HB2  2  
ATOM 2169  H HB3  . ASP A 1 51  ? -1.474  -12.415 11.301  1.00 0.00 ? 54  ASP A HB3  2  
ATOM 2170  N N    . GLY A 1 52  ? 1.643   -9.424  10.894  1.00 0.00 ? 55  GLY A N    2  
ATOM 2171  C CA   . GLY A 1 52  ? 2.986   -9.005  10.527  1.00 0.00 ? 55  GLY A CA   2  
ATOM 2172  C C    . GLY A 1 52  ? 3.043   -8.168  9.260   1.00 0.00 ? 55  GLY A C    2  
ATOM 2173  O O    . GLY A 1 52  ? 2.015   -7.907  8.630   1.00 0.00 ? 55  GLY A O    2  
ATOM 2174  H H    . GLY A 1 52  ? 0.882   -8.827  10.746  1.00 0.00 ? 55  GLY A H    2  
ATOM 2175  H HA2  . GLY A 1 52  ? 3.400   -8.426  11.339  1.00 0.00 ? 55  GLY A HA2  2  
ATOM 2176  H HA3  . GLY A 1 52  ? 3.595   -9.887  10.388  1.00 0.00 ? 55  GLY A HA3  2  
ATOM 2177  N N    . TRP A 1 53  ? 4.258   -7.771  8.885   1.00 0.00 ? 56  TRP A N    2  
ATOM 2178  C CA   . TRP A 1 53  ? 4.490   -6.891  7.736   1.00 0.00 ? 56  TRP A CA   2  
ATOM 2179  C C    . TRP A 1 53  ? 4.233   -7.611  6.415   1.00 0.00 ? 56  TRP A C    2  
ATOM 2180  O O    . TRP A 1 53  ? 4.740   -8.709  6.187   1.00 0.00 ? 56  TRP A O    2  
ATOM 2181  C CB   . TRP A 1 53  ? 5.927   -6.354  7.758   1.00 0.00 ? 56  TRP A CB   2  
ATOM 2182  C CG   . TRP A 1 53  ? 6.175   -5.336  8.830   1.00 0.00 ? 56  TRP A CG   2  
ATOM 2183  C CD1  . TRP A 1 53  ? 6.612   -5.569  10.102  1.00 0.00 ? 56  TRP A CD1  2  
ATOM 2184  C CD2  . TRP A 1 53  ? 6.006   -3.918  8.717   1.00 0.00 ? 56  TRP A CD2  2  
ATOM 2185  N NE1  . TRP A 1 53  ? 6.713   -4.384  10.791  1.00 0.00 ? 56  TRP A NE1  2  
ATOM 2186  C CE2  . TRP A 1 53  ? 6.349   -3.356  9.961   1.00 0.00 ? 56  TRP A CE2  2  
ATOM 2187  C CE3  . TRP A 1 53  ? 5.597   -3.068  7.685   1.00 0.00 ? 56  TRP A CE3  2  
ATOM 2188  C CZ2  . TRP A 1 53  ? 6.291   -1.985  10.199  1.00 0.00 ? 56  TRP A CZ2  2  
ATOM 2189  C CZ3  . TRP A 1 53  ? 5.541   -1.711  7.926   1.00 0.00 ? 56  TRP A CZ3  2  
ATOM 2190  C CH2  . TRP A 1 53  ? 5.888   -1.180  9.172   1.00 0.00 ? 56  TRP A CH2  2  
ATOM 2191  H H    . TRP A 1 53  ? 5.033   -8.090  9.393   1.00 0.00 ? 56  TRP A H    2  
ATOM 2192  H HA   . TRP A 1 53  ? 3.808   -6.060  7.816   1.00 0.00 ? 56  TRP A HA   2  
ATOM 2193  H HB2  . TRP A 1 53  ? 6.607   -7.178  7.921   1.00 0.00 ? 56  TRP A HB2  2  
ATOM 2194  H HB3  . TRP A 1 53  ? 6.149   -5.898  6.805   1.00 0.00 ? 56  TRP A HB3  2  
ATOM 2195  H HD1  . TRP A 1 53  ? 6.836   -6.548  10.500  1.00 0.00 ? 56  TRP A HD1  2  
ATOM 2196  H HE1  . TRP A 1 53  ? 7.000   -4.288  11.731  1.00 0.00 ? 56  TRP A HE1  2  
ATOM 2197  H HE3  . TRP A 1 53  ? 5.326   -3.455  6.714   1.00 0.00 ? 56  TRP A HE3  2  
ATOM 2198  H HZ2  . TRP A 1 53  ? 6.555   -1.559  11.154  1.00 0.00 ? 56  TRP A HZ2  2  
ATOM 2199  H HZ3  . TRP A 1 53  ? 5.227   -1.040  7.143   1.00 0.00 ? 56  TRP A HZ3  2  
ATOM 2200  H HH2  . TRP A 1 53  ? 5.827   -0.111  9.311   1.00 0.00 ? 56  TRP A HH2  2  
ATOM 2201  N N    . HIS A 1 54  ? 3.442   -6.983  5.551   1.00 0.00 ? 57  HIS A N    2  
ATOM 2202  C CA   . HIS A 1 54  ? 3.120   -7.541  4.239   1.00 0.00 ? 57  HIS A CA   2  
ATOM 2203  C C    . HIS A 1 54  ? 2.962   -6.432  3.199   1.00 0.00 ? 57  HIS A C    2  
ATOM 2204  O O    . HIS A 1 54  ? 2.688   -5.283  3.542   1.00 0.00 ? 57  HIS A O    2  
ATOM 2205  C CB   . HIS A 1 54  ? 1.834   -8.372  4.306   1.00 0.00 ? 57  HIS A CB   2  
ATOM 2206  C CG   . HIS A 1 54  ? 2.013   -9.725  4.923   1.00 0.00 ? 57  HIS A CG   2  
ATOM 2207  N ND1  . HIS A 1 54  ? 1.813   -9.976  6.263   1.00 0.00 ? 57  HIS A ND1  2  
ATOM 2208  C CD2  . HIS A 1 54  ? 2.369   -10.912 4.370   1.00 0.00 ? 57  HIS A CD2  2  
ATOM 2209  C CE1  . HIS A 1 54  ? 2.038   -11.252 6.509   1.00 0.00 ? 57  HIS A CE1  2  
ATOM 2210  N NE2  . HIS A 1 54  ? 2.375   -11.845 5.378   1.00 0.00 ? 57  HIS A NE2  2  
ATOM 2211  H H    . HIS A 1 54  ? 3.062   -6.106  5.802   1.00 0.00 ? 57  HIS A H    2  
ATOM 2212  H HA   . HIS A 1 54  ? 3.938   -8.181  3.942   1.00 0.00 ? 57  HIS A HA   2  
ATOM 2213  H HB2  . HIS A 1 54  ? 1.103   -7.839  4.895   1.00 0.00 ? 57  HIS A HB2  2  
ATOM 2214  H HB3  . HIS A 1 54  ? 1.453   -8.510  3.305   1.00 0.00 ? 57  HIS A HB3  2  
ATOM 2215  H HD1  . HIS A 1 54  ? 1.549   -9.315  6.937   1.00 0.00 ? 57  HIS A HD1  2  
ATOM 2216  H HD2  . HIS A 1 54  ? 2.603   -11.090 3.331   1.00 0.00 ? 57  HIS A HD2  2  
ATOM 2217  H HE1  . HIS A 1 54  ? 1.959   -11.730 7.475   1.00 0.00 ? 57  HIS A HE1  2  
ATOM 2218  N N    . MET A 1 55  ? 3.126   -6.793  1.932   1.00 0.00 ? 58  MET A N    2  
ATOM 2219  C CA   . MET A 1 55  ? 3.061   -5.832  0.833   1.00 0.00 ? 58  MET A CA   2  
ATOM 2220  C C    . MET A 1 55  ? 1.639   -5.725  0.289   1.00 0.00 ? 58  MET A C    2  
ATOM 2221  O O    . MET A 1 55  ? 0.963   -6.735  0.106   1.00 0.00 ? 58  MET A O    2  
ATOM 2222  C CB   . MET A 1 55  ? 4.002   -6.257  -0.298  1.00 0.00 ? 58  MET A CB   2  
ATOM 2223  C CG   . MET A 1 55  ? 5.480   -6.213  0.064   1.00 0.00 ? 58  MET A CG   2  
ATOM 2224  S SD   . MET A 1 55  ? 6.517   -7.011  -1.182  1.00 0.00 ? 58  MET A SD   2  
ATOM 2225  C CE   . MET A 1 55  ? 6.001   -6.142  -2.661  1.00 0.00 ? 58  MET A CE   2  
ATOM 2226  H H    . MET A 1 55  ? 3.286   -7.742  1.724   1.00 0.00 ? 58  MET A H    2  
ATOM 2227  H HA   . MET A 1 55  ? 3.371   -4.873  1.211   1.00 0.00 ? 58  MET A HA   2  
ATOM 2228  H HB2  . MET A 1 55  ? 3.759   -7.267  -0.589  1.00 0.00 ? 58  MET A HB2  2  
ATOM 2229  H HB3  . MET A 1 55  ? 3.843   -5.605  -1.145  1.00 0.00 ? 58  MET A HB3  2  
ATOM 2230  H HG2  . MET A 1 55  ? 5.785   -5.182  0.160   1.00 0.00 ? 58  MET A HG2  2  
ATOM 2231  H HG3  . MET A 1 55  ? 5.622   -6.718  1.008   1.00 0.00 ? 58  MET A HG3  2  
ATOM 2232  H HE1  . MET A 1 55  ? 6.216   -5.088  -2.554  1.00 0.00 ? 58  MET A HE1  2  
ATOM 2233  H HE2  . MET A 1 55  ? 6.533   -6.534  -3.512  1.00 0.00 ? 58  MET A HE2  2  
ATOM 2234  H HE3  . MET A 1 55  ? 4.936   -6.283  -2.803  1.00 0.00 ? 58  MET A HE3  2  
ATOM 2235  N N    . VAL A 1 56  ? 1.195   -4.507  0.012   1.00 0.00 ? 59  VAL A N    2  
ATOM 2236  C CA   . VAL A 1 56  ? -0.164  -4.280  -0.472  1.00 0.00 ? 59  VAL A CA   2  
ATOM 2237  C C    . VAL A 1 56  ? -0.253  -4.498  -1.987  1.00 0.00 ? 59  VAL A C    2  
ATOM 2238  O O    . VAL A 1 56  ? 0.661   -4.138  -2.731  1.00 0.00 ? 59  VAL A O    2  
ATOM 2239  C CB   . VAL A 1 56  ? -0.651  -2.852  -0.121  1.00 0.00 ? 59  VAL A CB   2  
ATOM 2240  C CG1  . VAL A 1 56  ? -2.066  -2.607  -0.631  1.00 0.00 ? 59  VAL A CG1  2  
ATOM 2241  C CG2  . VAL A 1 56  ? -0.584  -2.620  1.380   1.00 0.00 ? 59  VAL A CG2  2  
ATOM 2242  H H    . VAL A 1 56  ? 1.797   -3.737  0.130   1.00 0.00 ? 59  VAL A H    2  
ATOM 2243  H HA   . VAL A 1 56  ? -0.812  -4.989  0.021   1.00 0.00 ? 59  VAL A HA   2  
ATOM 2244  H HB   . VAL A 1 56  ? 0.008   -2.142  -0.602  1.00 0.00 ? 59  VAL A HB   2  
ATOM 2245  H HG11 . VAL A 1 56  ? -2.391  -1.622  -0.330  1.00 0.00 ? 59  VAL A HG11 2  
ATOM 2246  H HG12 . VAL A 1 56  ? -2.080  -2.678  -1.708  1.00 0.00 ? 59  VAL A HG12 2  
ATOM 2247  H HG13 . VAL A 1 56  ? -2.733  -3.348  -0.212  1.00 0.00 ? 59  VAL A HG13 2  
ATOM 2248  H HG21 . VAL A 1 56  ? -1.185  -3.362  1.886   1.00 0.00 ? 59  VAL A HG21 2  
ATOM 2249  H HG22 . VAL A 1 56  ? 0.439   -2.694  1.715   1.00 0.00 ? 59  VAL A HG22 2  
ATOM 2250  H HG23 . VAL A 1 56  ? -0.965  -1.635  1.610   1.00 0.00 ? 59  VAL A HG23 2  
ATOM 2251  N N    . CYS A 1 57  ? -1.350  -5.108  -2.430  1.00 0.00 ? 60  CYS A N    2  
ATOM 2252  C CA   . CYS A 1 57  ? -1.600  -5.322  -3.853  1.00 0.00 ? 60  CYS A CA   2  
ATOM 2253  C C    . CYS A 1 57  ? -2.557  -4.244  -4.365  1.00 0.00 ? 60  CYS A C    2  
ATOM 2254  O O    . CYS A 1 57  ? -3.491  -3.858  -3.665  1.00 0.00 ? 60  CYS A O    2  
ATOM 2255  C CB   . CYS A 1 57  ? -2.203  -6.714  -4.067  1.00 0.00 ? 60  CYS A CB   2  
ATOM 2256  S SG   . CYS A 1 57  ? -2.019  -7.367  -5.758  1.00 0.00 ? 60  CYS A SG   2  
ATOM 2257  H H    . CYS A 1 57  ? -2.015  -5.422  -1.782  1.00 0.00 ? 60  CYS A H    2  
ATOM 2258  H HA   . CYS A 1 57  ? -0.659  -5.249  -4.380  1.00 0.00 ? 60  CYS A HA   2  
ATOM 2259  H HB2  . CYS A 1 57  ? -1.721  -7.413  -3.396  1.00 0.00 ? 60  CYS A HB2  2  
ATOM 2260  H HB3  . CYS A 1 57  ? -3.261  -6.678  -3.841  1.00 0.00 ? 60  CYS A HB3  2  
ATOM 2261  N N    . SER A 1 58  ? -2.313  -3.755  -5.581  1.00 0.00 ? 61  SER A N    2  
ATOM 2262  C CA   . SER A 1 58  ? -3.070  -2.631  -6.131  1.00 0.00 ? 61  SER A CA   2  
ATOM 2263  C C    . SER A 1 58  ? -4.533  -2.987  -6.405  1.00 0.00 ? 61  SER A C    2  
ATOM 2264  O O    . SER A 1 58  ? -5.396  -2.113  -6.413  1.00 0.00 ? 61  SER A O    2  
ATOM 2265  C CB   . SER A 1 58  ? -2.400  -2.139  -7.413  1.00 0.00 ? 61  SER A CB   2  
ATOM 2266  O OG   . SER A 1 58  ? -2.341  -3.169  -8.388  1.00 0.00 ? 61  SER A OG   2  
ATOM 2267  H H    . SER A 1 58  ? -1.593  -4.151  -6.125  1.00 0.00 ? 61  SER A H    2  
ATOM 2268  H HA   . SER A 1 58  ? -3.046  -1.834  -5.404  1.00 0.00 ? 61  SER A HA   2  
ATOM 2269  H HB2  . SER A 1 58  ? -2.960  -1.308  -7.817  1.00 0.00 ? 61  SER A HB2  2  
ATOM 2270  H HB3  . SER A 1 58  ? -1.392  -1.816  -7.187  1.00 0.00 ? 61  SER A HB3  2  
ATOM 2271  H HG   . SER A 1 58  ? -2.997  -2.995  -9.067  1.00 0.00 ? 61  SER A HG   2  
ATOM 2272  N N    . GLN A 1 59  ? -4.810  -4.268  -6.615  1.00 0.00 ? 62  GLN A N    2  
ATOM 2273  C CA   . GLN A 1 59  ? -6.169  -4.713  -6.909  1.00 0.00 ? 62  GLN A CA   2  
ATOM 2274  C C    . GLN A 1 59  ? -6.921  -5.049  -5.623  1.00 0.00 ? 62  GLN A C    2  
ATOM 2275  O O    . GLN A 1 59  ? -7.870  -5.834  -5.626  1.00 0.00 ? 62  GLN A O    2  
ATOM 2276  C CB   . GLN A 1 59  ? -6.139  -5.924  -7.843  1.00 0.00 ? 62  GLN A CB   2  
ATOM 2277  C CG   . GLN A 1 59  ? -5.419  -7.128  -7.265  1.00 0.00 ? 62  GLN A CG   2  
ATOM 2278  C CD   . GLN A 1 59  ? -5.329  -8.275  -8.249  1.00 0.00 ? 62  GLN A CD   2  
ATOM 2279  O OE1  . GLN A 1 59  ? -6.214  -9.125  -8.318  1.00 0.00 ? 62  GLN A OE1  2  
ATOM 2280  N NE2  . GLN A 1 59  ? -4.259  -8.303  -9.026  1.00 0.00 ? 62  GLN A NE2  2  
ATOM 2281  H H    . GLN A 1 59  ? -4.089  -4.927  -6.569  1.00 0.00 ? 62  GLN A H    2  
ATOM 2282  H HA   . GLN A 1 59  ? -6.680  -3.901  -7.406  1.00 0.00 ? 62  GLN A HA   2  
ATOM 2283  H HB2  . GLN A 1 59  ? -7.154  -6.214  -8.068  1.00 0.00 ? 62  GLN A HB2  2  
ATOM 2284  H HB3  . GLN A 1 59  ? -5.644  -5.642  -8.762  1.00 0.00 ? 62  GLN A HB3  2  
ATOM 2285  H HG2  . GLN A 1 59  ? -4.420  -6.833  -6.982  1.00 0.00 ? 62  GLN A HG2  2  
ATOM 2286  H HG3  . GLN A 1 59  ? -5.956  -7.463  -6.390  1.00 0.00 ? 62  GLN A HG3  2  
ATOM 2287  H HE21 . GLN A 1 59  ? -3.596  -7.594  -8.923  1.00 0.00 ? 62  GLN A HE21 2  
ATOM 2288  H HE22 . GLN A 1 59  ? -4.169  -9.041  -9.670  1.00 0.00 ? 62  GLN A HE22 2  
ATOM 2289  N N    . SER A 1 60  ? -6.493  -4.441  -4.528  1.00 0.00 ? 63  SER A N    2  
ATOM 2290  C CA   . SER A 1 60  ? -7.100  -4.676  -3.232  1.00 0.00 ? 63  SER A CA   2  
ATOM 2291  C C    . SER A 1 60  ? -8.390  -3.864  -3.105  1.00 0.00 ? 63  SER A C    2  
ATOM 2292  O O    . SER A 1 60  ? -8.605  -2.919  -3.858  1.00 0.00 ? 63  SER A O    2  
ATOM 2293  C CB   . SER A 1 60  ? -6.113  -4.286  -2.124  1.00 0.00 ? 63  SER A CB   2  
ATOM 2294  O OG   . SER A 1 60  ? -6.589  -4.663  -0.847  1.00 0.00 ? 63  SER A OG   2  
ATOM 2295  H H    . SER A 1 60  ? -5.754  -3.801  -4.598  1.00 0.00 ? 63  SER A H    2  
ATOM 2296  H HA   . SER A 1 60  ? -7.333  -5.730  -3.153  1.00 0.00 ? 63  SER A HA   2  
ATOM 2297  H HB2  . SER A 1 60  ? -5.163  -4.774  -2.297  1.00 0.00 ? 63  SER A HB2  2  
ATOM 2298  H HB3  . SER A 1 60  ? -5.973  -3.213  -2.135  1.00 0.00 ? 63  SER A HB3  2  
ATOM 2299  H HG   . SER A 1 60  ? -7.137  -3.952  -0.491  1.00 0.00 ? 63  SER A HG   2  
ATOM 2300  N N    . TRP A 1 61  ? -9.246  -4.251  -2.159  1.00 0.00 ? 64  TRP A N    2  
ATOM 2301  C CA   . TRP A 1 61  ? -10.506 -3.547  -1.888  1.00 0.00 ? 64  TRP A CA   2  
ATOM 2302  C C    . TRP A 1 61  ? -11.385 -3.465  -3.137  1.00 0.00 ? 64  TRP A C    2  
ATOM 2303  O O    . TRP A 1 61  ? -12.155 -2.518  -3.311  1.00 0.00 ? 64  TRP A O    2  
ATOM 2304  C CB   . TRP A 1 61  ? -10.236 -2.144  -1.336  1.00 0.00 ? 64  TRP A CB   2  
ATOM 2305  C CG   . TRP A 1 61  ? -9.375  -2.142  -0.106  1.00 0.00 ? 64  TRP A CG   2  
ATOM 2306  C CD1  . TRP A 1 61  ? -9.725  -2.554  1.147   1.00 0.00 ? 64  TRP A CD1  2  
ATOM 2307  C CD2  . TRP A 1 61  ? -8.018  -1.700  -0.018  1.00 0.00 ? 64  TRP A CD2  2  
ATOM 2308  N NE1  . TRP A 1 61  ? -8.666  -2.396  2.009   1.00 0.00 ? 64  TRP A NE1  2  
ATOM 2309  C CE2  . TRP A 1 61  ? -7.607  -1.875  1.316   1.00 0.00 ? 64  TRP A CE2  2  
ATOM 2310  C CE3  . TRP A 1 61  ? -7.109  -1.176  -0.940  1.00 0.00 ? 64  TRP A CE3  2  
ATOM 2311  C CZ2  . TRP A 1 61  ? -6.330  -1.542  1.747   1.00 0.00 ? 64  TRP A CZ2  2  
ATOM 2312  C CZ3  . TRP A 1 61  ? -5.840  -0.848  -0.510  1.00 0.00 ? 64  TRP A CZ3  2  
ATOM 2313  C CH2  . TRP A 1 61  ? -5.462  -1.032  0.823   1.00 0.00 ? 64  TRP A CH2  2  
ATOM 2314  H H    . TRP A 1 61  ? -9.024  -5.041  -1.616  1.00 0.00 ? 64  TRP A H    2  
ATOM 2315  H HA   . TRP A 1 61  ? -11.036 -4.116  -1.142  1.00 0.00 ? 64  TRP A HA   2  
ATOM 2316  H HB2  . TRP A 1 61  ? -9.734  -1.559  -2.094  1.00 0.00 ? 64  TRP A HB2  2  
ATOM 2317  H HB3  . TRP A 1 61  ? -11.177 -1.671  -1.087  1.00 0.00 ? 64  TRP A HB3  2  
ATOM 2318  H HD1  . TRP A 1 61  ? -10.698 -2.944  1.411   1.00 0.00 ? 64  TRP A HD1  2  
ATOM 2319  H HE1  . TRP A 1 61  ? -8.669  -2.622  2.971   1.00 0.00 ? 64  TRP A HE1  2  
ATOM 2320  H HE3  . TRP A 1 61  ? -7.385  -1.027  -1.972  1.00 0.00 ? 64  TRP A HE3  2  
ATOM 2321  H HZ2  . TRP A 1 61  ? -6.019  -1.679  2.772   1.00 0.00 ? 64  TRP A HZ2  2  
ATOM 2322  H HZ3  . TRP A 1 61  ? -5.125  -0.443  -1.208  1.00 0.00 ? 64  TRP A HZ3  2  
ATOM 2323  H HH2  . TRP A 1 61  ? -4.457  -0.761  1.116   1.00 0.00 ? 64  TRP A HH2  2  
ATOM 2324  N N    . GLY A 1 62  ? -11.266 -4.467  -4.002  1.00 0.00 ? 65  GLY A N    2  
ATOM 2325  C CA   . GLY A 1 62  ? -12.072 -4.515  -5.207  1.00 0.00 ? 65  GLY A CA   2  
ATOM 2326  C C    . GLY A 1 62  ? -11.708 -3.434  -6.211  1.00 0.00 ? 65  GLY A C    2  
ATOM 2327  O O    . GLY A 1 62  ? -12.484 -3.148  -7.124  1.00 0.00 ? 65  GLY A O    2  
ATOM 2328  H H    . GLY A 1 62  ? -10.628 -5.190  -3.813  1.00 0.00 ? 65  GLY A H    2  
ATOM 2329  H HA2  . GLY A 1 62  ? -11.941 -5.481  -5.674  1.00 0.00 ? 65  GLY A HA2  2  
ATOM 2330  H HA3  . GLY A 1 62  ? -13.110 -4.400  -4.935  1.00 0.00 ? 65  GLY A HA3  2  
ATOM 2331  N N    . ARG A 1 63  ? -10.538 -2.819  -6.043  1.00 0.00 ? 66  ARG A N    2  
ATOM 2332  C CA   . ARG A 1 63  ? -10.079 -1.796  -6.977  1.00 0.00 ? 66  ARG A CA   2  
ATOM 2333  C C    . ARG A 1 63  ? -9.621  -2.455  -8.270  1.00 0.00 ? 66  ARG A C    2  
ATOM 2334  O O    . ARG A 1 63  ? -9.322  -3.652  -8.293  1.00 0.00 ? 66  ARG A O    2  
ATOM 2335  C CB   . ARG A 1 63  ? -8.921  -0.976  -6.391  1.00 0.00 ? 66  ARG A CB   2  
ATOM 2336  C CG   . ARG A 1 63  ? -9.245  -0.222  -5.104  1.00 0.00 ? 66  ARG A CG   2  
ATOM 2337  C CD   . ARG A 1 63  ? -10.445 0.705   -5.255  1.00 0.00 ? 66  ARG A CD   2  
ATOM 2338  N NE   . ARG A 1 63  ? -11.710 0.008   -5.032  1.00 0.00 ? 66  ARG A NE   2  
ATOM 2339  C CZ   . ARG A 1 63  ? -12.860 0.628   -4.787  1.00 0.00 ? 66  ARG A CZ   2  
ATOM 2340  N NH1  . ARG A 1 63  ? -12.899 1.950   -4.721  1.00 0.00 ? 66  ARG A NH1  2  
ATOM 2341  N NH2  . ARG A 1 63  ? -13.967 -0.065  -4.585  1.00 0.00 ? 66  ARG A NH2  2  
ATOM 2342  H H    . ARG A 1 63  ? -9.964  -3.069  -5.285  1.00 0.00 ? 66  ARG A H    2  
ATOM 2343  H HA   . ARG A 1 63  ? -10.910 -1.139  -7.189  1.00 0.00 ? 66  ARG A HA   2  
ATOM 2344  H HB2  . ARG A 1 63  ? -8.097  -1.644  -6.185  1.00 0.00 ? 66  ARG A HB2  2  
ATOM 2345  H HB3  . ARG A 1 63  ? -8.602  -0.254  -7.129  1.00 0.00 ? 66  ARG A HB3  2  
ATOM 2346  H HG2  . ARG A 1 63  ? -9.460  -0.939  -4.327  1.00 0.00 ? 66  ARG A HG2  2  
ATOM 2347  H HG3  . ARG A 1 63  ? -8.382  0.364   -4.821  1.00 0.00 ? 66  ARG A HG3  2  
ATOM 2348  H HD2  . ARG A 1 63  ? -10.358 1.505   -4.536  1.00 0.00 ? 66  ARG A HD2  2  
ATOM 2349  H HD3  . ARG A 1 63  ? -10.443 1.118   -6.253  1.00 0.00 ? 66  ARG A HD3  2  
ATOM 2350  H HE   . ARG A 1 63  ? -11.697 -0.975  -5.062  1.00 0.00 ? 66  ARG A HE   2  
ATOM 2351  H HH12 . ARG A 1 63  ? -12.965 2.499   -5.567  1.00 0.00 ? 66  ARG A HH12 2  
ATOM 2352  H HH21 . ARG A 1 63  ? -13.948 -1.066  -4.608  1.00 0.00 ? 66  ARG A HH21 2  
ATOM 2353  H HH22 . ARG A 1 63  ? -14.835 0.414   -4.417  1.00 0.00 ? 66  ARG A HH22 2  
ATOM 2354  N N    . SER A 1 64  ? -9.579  -1.679  -9.340  1.00 0.00 ? 67  SER A N    2  
ATOM 2355  C CA   . SER A 1 64  ? -9.108  -2.167  -10.620 1.00 0.00 ? 67  SER A CA   2  
ATOM 2356  C C    . SER A 1 64  ? -7.596  -2.360  -10.583 1.00 0.00 ? 67  SER A C    2  
ATOM 2357  O O    . SER A 1 64  ? -6.899  -1.715  -9.799  1.00 0.00 ? 67  SER A O    2  
ATOM 2358  C CB   . SER A 1 64  ? -9.505  -1.178  -11.716 1.00 0.00 ? 67  SER A CB   2  
ATOM 2359  O OG   . SER A 1 64  ? -9.248  0.157   -11.313 1.00 0.00 ? 67  SER A OG   2  
ATOM 2360  H H    . SER A 1 64  ? -9.862  -0.746  -9.269  1.00 0.00 ? 67  SER A H    2  
ATOM 2361  H HA   . SER A 1 64  ? -9.580  -3.118  -10.810 1.00 0.00 ? 67  SER A HA   2  
ATOM 2362  H HB2  . SER A 1 64  ? -8.937  -1.389  -12.609 1.00 0.00 ? 67  SER A HB2  2  
ATOM 2363  H HB3  . SER A 1 64  ? -10.561 -1.282  -11.928 1.00 0.00 ? 67  SER A HB3  2  
ATOM 2364  H HG   . SER A 1 64  ? -9.669  0.769   -11.935 1.00 0.00 ? 67  SER A HG   2  
ATOM 2365  N N    . SER A 1 65  ? -7.089  -3.256  -11.418 1.00 0.00 ? 68  SER A N    2  
ATOM 2366  C CA   . SER A 1 65  ? -5.662  -3.548  -11.446 1.00 0.00 ? 68  SER A CA   2  
ATOM 2367  C C    . SER A 1 65  ? -4.897  -2.480  -12.229 1.00 0.00 ? 68  SER A C    2  
ATOM 2368  O O    . SER A 1 65  ? -4.100  -2.789  -13.115 1.00 0.00 ? 68  SER A O    2  
ATOM 2369  C CB   . SER A 1 65  ? -5.425  -4.934  -12.048 1.00 0.00 ? 68  SER A CB   2  
ATOM 2370  O OG   . SER A 1 65  ? -6.074  -5.936  -11.279 1.00 0.00 ? 68  SER A OG   2  
ATOM 2371  H H    . SER A 1 65  ? -7.690  -3.730  -12.038 1.00 0.00 ? 68  SER A H    2  
ATOM 2372  H HA   . SER A 1 65  ? -5.309  -3.545  -10.426 1.00 0.00 ? 68  SER A HA   2  
ATOM 2373  H HB2  . SER A 1 65  ? -5.815  -4.961  -13.055 1.00 0.00 ? 68  SER A HB2  2  
ATOM 2374  H HB3  . SER A 1 65  ? -4.365  -5.139  -12.066 1.00 0.00 ? 68  SER A HB3  2  
ATOM 2375  H HG   . SER A 1 65  ? -6.844  -5.552  -10.830 1.00 0.00 ? 68  SER A HG   2  
ATOM 2376  N N    . LYS A 1 66  ? -5.136  -1.227  -11.877 1.00 0.00 ? 69  LYS A N    2  
ATOM 2377  C CA   . LYS A 1 66  ? -4.503  -0.100  -12.531 1.00 0.00 ? 69  LYS A CA   2  
ATOM 2378  C C    . LYS A 1 66  ? -4.341  1.030   -11.514 1.00 0.00 ? 69  LYS A C    2  
ATOM 2379  O O    . LYS A 1 66  ? -4.530  0.817   -10.318 1.00 0.00 ? 69  LYS A O    2  
ATOM 2380  C CB   . LYS A 1 66  ? -5.353  0.344   -13.730 1.00 0.00 ? 69  LYS A CB   2  
ATOM 2381  C CG   . LYS A 1 66  ? -4.581  1.118   -14.791 1.00 0.00 ? 69  LYS A CG   2  
ATOM 2382  C CD   . LYS A 1 66  ? -5.427  1.354   -16.032 1.00 0.00 ? 69  LYS A CD   2  
ATOM 2383  C CE   . LYS A 1 66  ? -4.623  2.033   -17.129 1.00 0.00 ? 69  LYS A CE   2  
ATOM 2384  N NZ   . LYS A 1 66  ? -3.406  1.256   -17.487 1.00 0.00 ? 69  LYS A NZ   2  
ATOM 2385  H H    . LYS A 1 66  ? -5.759  -1.054  -11.133 1.00 0.00 ? 69  LYS A H    2  
ATOM 2386  H HA   . LYS A 1 66  ? -3.527  -0.410  -12.874 1.00 0.00 ? 69  LYS A HA   2  
ATOM 2387  H HB2  . LYS A 1 66  ? -5.779  -0.532  -14.196 1.00 0.00 ? 69  LYS A HB2  2  
ATOM 2388  H HB3  . LYS A 1 66  ? -6.156  0.974   -13.371 1.00 0.00 ? 69  LYS A HB3  2  
ATOM 2389  H HG2  . LYS A 1 66  ? -4.282  2.072   -14.383 1.00 0.00 ? 69  LYS A HG2  2  
ATOM 2390  H HG3  . LYS A 1 66  ? -3.703  0.552   -15.068 1.00 0.00 ? 69  LYS A HG3  2  
ATOM 2391  H HD2  . LYS A 1 66  ? -5.788  0.406   -16.398 1.00 0.00 ? 69  LYS A HD2  2  
ATOM 2392  H HD3  . LYS A 1 66  ? -6.265  1.985   -15.770 1.00 0.00 ? 69  LYS A HD3  2  
ATOM 2393  H HE2  . LYS A 1 66  ? -5.247  2.131   -18.006 1.00 0.00 ? 69  LYS A HE2  2  
ATOM 2394  H HE3  . LYS A 1 66  ? -4.329  3.015   -16.788 1.00 0.00 ? 69  LYS A HE3  2  
ATOM 2395  H HZ1  . LYS A 1 66  ? -2.866  1.770   -18.219 1.00 0.00 ? 69  LYS A HZ1  2  
ATOM 2396  H HZ3  . LYS A 1 66  ? -3.686  0.330   -17.879 1.00 0.00 ? 69  LYS A HZ3  2  
ATOM 2397  N N    . GLN A 1 67  ? -3.982  2.215   -11.977 1.00 0.00 ? 70  GLN A N    2  
ATOM 2398  C CA   . GLN A 1 67  ? -3.753  3.334   -11.079 1.00 0.00 ? 70  GLN A CA   2  
ATOM 2399  C C    . GLN A 1 67  ? -5.009  4.192   -10.949 1.00 0.00 ? 70  GLN A C    2  
ATOM 2400  O O    . GLN A 1 67  ? -5.617  4.578   -11.949 1.00 0.00 ? 70  GLN A O    2  
ATOM 2401  C CB   . GLN A 1 67  ? -2.577  4.180   -11.571 1.00 0.00 ? 70  GLN A CB   2  
ATOM 2402  C CG   . GLN A 1 67  ? -2.269  5.373   -10.677 1.00 0.00 ? 70  GLN A CG   2  
ATOM 2403  C CD   . GLN A 1 67  ? -1.019  6.118   -11.097 1.00 0.00 ? 70  GLN A CD   2  
ATOM 2404  O OE1  . GLN A 1 67  ? -0.333  6.706   -10.266 1.00 0.00 ? 70  GLN A OE1  2  
ATOM 2405  N NE2  . GLN A 1 67  ? -0.717  6.104   -12.386 1.00 0.00 ? 70  GLN A NE2  2  
ATOM 2406  H H    . GLN A 1 67  ? -3.883  2.346   -12.939 1.00 0.00 ? 70  GLN A H    2  
ATOM 2407  H HA   . GLN A 1 67  ? -3.508  2.928   -10.109 1.00 0.00 ? 70  GLN A HA   2  
ATOM 2408  H HB2  . GLN A 1 67  ? -1.696  3.557   -11.618 1.00 0.00 ? 70  GLN A HB2  2  
ATOM 2409  H HB3  . GLN A 1 67  ? -2.802  4.548   -12.562 1.00 0.00 ? 70  GLN A HB3  2  
ATOM 2410  H HG2  . GLN A 1 67  ? -3.104  6.056   -10.714 1.00 0.00 ? 70  GLN A HG2  2  
ATOM 2411  H HG3  . GLN A 1 67  ? -2.137  5.021   -9.665  1.00 0.00 ? 70  GLN A HG3  2  
ATOM 2412  H HE21 . GLN A 1 67  ? -1.314  5.623   -12.996 1.00 0.00 ? 70  GLN A HE21 2  
ATOM 2413  H HE22 . GLN A 1 67  ? 0.093   6.572   -12.679 1.00 0.00 ? 70  GLN A HE22 2  
ATOM 2414  N N    . TRP A 1 68  ? -5.391  4.481   -9.711  1.00 0.00 ? 71  TRP A N    2  
ATOM 2415  C CA   . TRP A 1 68  ? -6.568  5.294   -9.441  1.00 0.00 ? 71  TRP A CA   2  
ATOM 2416  C C    . TRP A 1 68  ? -6.174  6.767   -9.354  1.00 0.00 ? 71  TRP A C    2  
ATOM 2417  O O    . TRP A 1 68  ? -5.003  7.094   -9.152  1.00 0.00 ? 71  TRP A O    2  
ATOM 2418  C CB   . TRP A 1 68  ? -7.247  4.826   -8.145  1.00 0.00 ? 71  TRP A CB   2  
ATOM 2419  C CG   . TRP A 1 68  ? -8.566  5.482   -7.885  1.00 0.00 ? 71  TRP A CG   2  
ATOM 2420  C CD1  . TRP A 1 68  ? -8.869  6.318   -6.853  1.00 0.00 ? 71  TRP A CD1  2  
ATOM 2421  C CD2  . TRP A 1 68  ? -9.757  5.367   -8.675  1.00 0.00 ? 71  TRP A CD2  2  
ATOM 2422  N NE1  . TRP A 1 68  ? -10.176 6.725   -6.945  1.00 0.00 ? 71  TRP A NE1  2  
ATOM 2423  C CE2  . TRP A 1 68  ? -10.745 6.154   -8.055  1.00 0.00 ? 71  TRP A CE2  2  
ATOM 2424  C CE3  . TRP A 1 68  ? -10.085 4.668   -9.840  1.00 0.00 ? 71  TRP A CE3  2  
ATOM 2425  C CZ2  . TRP A 1 68  ? -12.034 6.268   -8.567  1.00 0.00 ? 71  TRP A CZ2  2  
ATOM 2426  C CZ3  . TRP A 1 68  ? -11.365 4.783   -10.347 1.00 0.00 ? 71  TRP A CZ3  2  
ATOM 2427  C CH2  . TRP A 1 68  ? -12.327 5.575   -9.711  1.00 0.00 ? 71  TRP A CH2  2  
ATOM 2428  H H    . TRP A 1 68  ? -4.860  4.151   -8.957  1.00 0.00 ? 71  TRP A H    2  
ATOM 2429  H HA   . TRP A 1 68  ? -7.255  5.166   -10.264 1.00 0.00 ? 71  TRP A HA   2  
ATOM 2430  H HB2  . TRP A 1 68  ? -7.413  3.758   -8.198  1.00 0.00 ? 71  TRP A HB2  2  
ATOM 2431  H HB3  . TRP A 1 68  ? -6.598  5.043   -7.311  1.00 0.00 ? 71  TRP A HB3  2  
ATOM 2432  H HD1  . TRP A 1 68  ? -8.172  6.604   -6.080  1.00 0.00 ? 71  TRP A HD1  2  
ATOM 2433  H HE1  . TRP A 1 68  ? -10.634 7.334   -6.310  1.00 0.00 ? 71  TRP A HE1  2  
ATOM 2434  H HE3  . TRP A 1 68  ? -9.355  4.053   -10.344 1.00 0.00 ? 71  TRP A HE3  2  
ATOM 2435  H HZ2  . TRP A 1 68  ? -12.788 6.875   -8.087  1.00 0.00 ? 71  TRP A HZ2  2  
ATOM 2436  H HZ3  . TRP A 1 68  ? -11.636 4.253   -11.248 1.00 0.00 ? 71  TRP A HZ3  2  
ATOM 2437  H HH2  . TRP A 1 68  ? -13.314 5.633   -10.143 1.00 0.00 ? 71  TRP A HH2  2  
ATOM 2438  N N    . GLU A 1 69  ? -7.149  7.654   -9.499  1.00 0.00 ? 72  GLU A N    2  
ATOM 2439  C CA   . GLU A 1 69  ? -6.872  9.079   -9.596  1.00 0.00 ? 72  GLU A CA   2  
ATOM 2440  C C    . GLU A 1 69  ? -7.139  9.797   -8.275  1.00 0.00 ? 72  GLU A C    2  
ATOM 2441  O O    . GLU A 1 69  ? -7.697  10.897  -8.257  1.00 0.00 ? 72  GLU A O    2  
ATOM 2442  C CB   . GLU A 1 69  ? -7.719  9.701   -10.701 1.00 0.00 ? 72  GLU A CB   2  
ATOM 2443  C CG   . GLU A 1 69  ? -7.489  9.090   -12.071 1.00 0.00 ? 72  GLU A CG   2  
ATOM 2444  C CD   . GLU A 1 69  ? -8.333  9.745   -13.137 1.00 0.00 ? 72  GLU A CD   2  
ATOM 2445  O OE1  . GLU A 1 69  ? -9.569  9.584   -13.103 1.00 0.00 ? 72  GLU A OE1  2  
ATOM 2446  O OE2  . GLU A 1 69  ? -7.762  10.428  -14.012 1.00 0.00 ? 72  GLU A OE2  2  
ATOM 2447  H H    . GLU A 1 69  ? -8.081  7.343   -9.529  1.00 0.00 ? 72  GLU A H    2  
ATOM 2448  H HA   . GLU A 1 69  ? -5.828  9.197   -9.850  1.00 0.00 ? 72  GLU A HA   2  
ATOM 2449  H HB2  . GLU A 1 69  ? -8.763  9.580   -10.450 1.00 0.00 ? 72  GLU A HB2  2  
ATOM 2450  H HB3  . GLU A 1 69  ? -7.495  10.757  -10.759 1.00 0.00 ? 72  GLU A HB3  2  
ATOM 2451  H HG2  . GLU A 1 69  ? -6.448  9.207   -12.335 1.00 0.00 ? 72  GLU A HG2  2  
ATOM 2452  H HG3  . GLU A 1 69  ? -7.734  8.039   -12.033 1.00 0.00 ? 72  GLU A HG3  2  
ATOM 2453  N N    . ASP A 1 70  ? -6.750  9.176   -7.174  1.00 0.00 ? 73  ASP A N    2  
ATOM 2454  C CA   . ASP A 1 70  ? -6.882  9.804   -5.864  1.00 0.00 ? 73  ASP A CA   2  
ATOM 2455  C C    . ASP A 1 70  ? -5.871  9.209   -4.891  1.00 0.00 ? 73  ASP A C    2  
ATOM 2456  O O    . ASP A 1 70  ? -6.199  8.332   -4.093  1.00 0.00 ? 73  ASP A O    2  
ATOM 2457  C CB   . ASP A 1 70  ? -8.303  9.644   -5.316  1.00 0.00 ? 73  ASP A CB   2  
ATOM 2458  C CG   . ASP A 1 70  ? -8.554  10.514  -4.096  1.00 0.00 ? 73  ASP A CG   2  
ATOM 2459  O OD1  . ASP A 1 70  ? -8.694  11.745  -4.256  1.00 0.00 ? 73  ASP A OD1  2  
ATOM 2460  O OD2  . ASP A 1 70  ? -8.635  9.976   -2.975  1.00 0.00 ? 73  ASP A OD2  2  
ATOM 2461  H H    . ASP A 1 70  ? -6.362  8.278   -7.239  1.00 0.00 ? 73  ASP A H    2  
ATOM 2462  H HA   . ASP A 1 70  ? -6.671  10.857  -5.983  1.00 0.00 ? 73  ASP A HA   2  
ATOM 2463  H HB2  . ASP A 1 70  ? -9.011  9.919   -6.084  1.00 0.00 ? 73  ASP A HB2  2  
ATOM 2464  H HB3  . ASP A 1 70  ? -8.459  8.612   -5.039  1.00 0.00 ? 73  ASP A HB3  2  
ATOM 2465  N N    . PRO A 1 71  ? -4.612  9.666   -4.959  1.00 0.00 ? 74  PRO A N    2  
ATOM 2466  C CA   . PRO A 1 71  ? -3.550  9.176   -4.085  1.00 0.00 ? 74  PRO A CA   2  
ATOM 2467  C C    . PRO A 1 71  ? -3.587  9.839   -2.715  1.00 0.00 ? 74  PRO A C    2  
ATOM 2468  O O    . PRO A 1 71  ? -2.910  9.410   -1.780  1.00 0.00 ? 74  PRO A O    2  
ATOM 2469  C CB   . PRO A 1 71  ? -2.283  9.566   -4.839  1.00 0.00 ? 74  PRO A CB   2  
ATOM 2470  C CG   . PRO A 1 71  ? -2.653  10.810  -5.571  1.00 0.00 ? 74  PRO A CG   2  
ATOM 2471  C CD   . PRO A 1 71  ? -4.120  10.693  -5.900  1.00 0.00 ? 74  PRO A CD   2  
ATOM 2472  H HA   . PRO A 1 71  ? -3.593  8.105   -3.970  1.00 0.00 ? 74  PRO A HA   2  
ATOM 2473  H HB2  . PRO A 1 71  ? -1.481  9.743   -4.138  1.00 0.00 ? 74  PRO A HB2  2  
ATOM 2474  H HB3  . PRO A 1 71  ? -2.008  8.776   -5.521  1.00 0.00 ? 74  PRO A HB3  2  
ATOM 2475  H HG2  . PRO A 1 71  ? -2.476  11.669  -4.941  1.00 0.00 ? 74  PRO A HG2  2  
ATOM 2476  H HG3  . PRO A 1 71  ? -2.072  10.885  -6.476  1.00 0.00 ? 74  PRO A HG3  2  
ATOM 2477  H HD2  . PRO A 1 71  ? -4.618  11.639  -5.734  1.00 0.00 ? 74  PRO A HD2  2  
ATOM 2478  H HD3  . PRO A 1 71  ? -4.251  10.372  -6.923  1.00 0.00 ? 74  PRO A HD3  2  
ATOM 2479  N N    . SER A 1 72  ? -4.410  10.875  -2.606  1.00 0.00 ? 75  SER A N    2  
ATOM 2480  C CA   . SER A 1 72  ? -4.502  11.686  -1.402  1.00 0.00 ? 75  SER A CA   2  
ATOM 2481  C C    . SER A 1 72  ? -5.023  10.884  -0.208  1.00 0.00 ? 75  SER A C    2  
ATOM 2482  O O    . SER A 1 72  ? -4.949  11.340  0.933   1.00 0.00 ? 75  SER A O    2  
ATOM 2483  C CB   . SER A 1 72  ? -5.403  12.884  -1.676  1.00 0.00 ? 75  SER A CB   2  
ATOM 2484  O OG   . SER A 1 72  ? -5.039  13.506  -2.899  1.00 0.00 ? 75  SER A OG   2  
ATOM 2485  H H    . SER A 1 72  ? -4.969  11.113  -3.375  1.00 0.00 ? 75  SER A H    2  
ATOM 2486  H HA   . SER A 1 72  ? -3.511  12.044  -1.172  1.00 0.00 ? 75  SER A HA   2  
ATOM 2487  H HB2  . SER A 1 72  ? -6.430  12.556  -1.738  1.00 0.00 ? 75  SER A HB2  2  
ATOM 2488  H HB3  . SER A 1 72  ? -5.299  13.601  -0.874  1.00 0.00 ? 75  SER A HB3  2  
ATOM 2489  H HG   . SER A 1 72  ? -5.714  14.155  -3.148  1.00 0.00 ? 75  SER A HG   2  
ATOM 2490  N N    . GLN A 1 73  ? -5.537  9.683   -0.477  1.00 0.00 ? 76  GLN A N    2  
ATOM 2491  C CA   . GLN A 1 73  ? -5.983  8.780   0.581   1.00 0.00 ? 76  GLN A CA   2  
ATOM 2492  C C    . GLN A 1 73  ? -4.838  8.446   1.537   1.00 0.00 ? 76  GLN A C    2  
ATOM 2493  O O    . GLN A 1 73  ? -5.061  8.129   2.702   1.00 0.00 ? 76  GLN A O    2  
ATOM 2494  C CB   . GLN A 1 73  ? -6.533  7.481   -0.018  1.00 0.00 ? 76  GLN A CB   2  
ATOM 2495  C CG   . GLN A 1 73  ? -7.806  7.653   -0.829  1.00 0.00 ? 76  GLN A CG   2  
ATOM 2496  C CD   . GLN A 1 73  ? -8.951  8.208   -0.007  1.00 0.00 ? 76  GLN A CD   2  
ATOM 2497  O OE1  . GLN A 1 73  ? -9.693  7.461   0.635   1.00 0.00 ? 76  GLN A OE1  2  
ATOM 2498  N NE2  . GLN A 1 73  ? -9.121  9.519   -0.046  1.00 0.00 ? 76  GLN A NE2  2  
ATOM 2499  H H    . GLN A 1 73  ? -5.624  9.402   -1.412  1.00 0.00 ? 76  GLN A H    2  
ATOM 2500  H HA   . GLN A 1 73  ? -6.768  9.274   1.133   1.00 0.00 ? 76  GLN A HA   2  
ATOM 2501  H HB2  . GLN A 1 73  ? -5.780  7.048   -0.662  1.00 0.00 ? 76  GLN A HB2  2  
ATOM 2502  H HB3  . GLN A 1 73  ? -6.737  6.790   0.788   1.00 0.00 ? 76  GLN A HB3  2  
ATOM 2503  H HG2  . GLN A 1 73  ? -7.608  8.333   -1.645  1.00 0.00 ? 76  GLN A HG2  2  
ATOM 2504  H HG3  . GLN A 1 73  ? -8.099  6.693   -1.225  1.00 0.00 ? 76  GLN A HG3  2  
ATOM 2505  H HE21 . GLN A 1 73  ? -8.509  10.048  -0.606  1.00 0.00 ? 76  GLN A HE21 2  
ATOM 2506  H HE22 . GLN A 1 73  ? -9.850  9.909   0.480   1.00 0.00 ? 76  GLN A HE22 2  
ATOM 2507  N N    . ALA A 1 74  ? -3.612  8.537   1.037   1.00 0.00 ? 77  ALA A N    2  
ATOM 2508  C CA   . ALA A 1 74  ? -2.436  8.172   1.816   1.00 0.00 ? 77  ALA A CA   2  
ATOM 2509  C C    . ALA A 1 74  ? -1.701  9.407   2.337   1.00 0.00 ? 77  ALA A C    2  
ATOM 2510  O O    . ALA A 1 74  ? -0.496  9.359   2.597   1.00 0.00 ? 77  ALA A O    2  
ATOM 2511  C CB   . ALA A 1 74  ? -1.503  7.313   0.974   1.00 0.00 ? 77  ALA A CB   2  
ATOM 2512  H H    . ALA A 1 74  ? -3.493  8.863   0.118   1.00 0.00 ? 77  ALA A H    2  
ATOM 2513  H HA   . ALA A 1 74  ? -2.768  7.583   2.658   1.00 0.00 ? 77  ALA A HA   2  
ATOM 2514  H HB1  . ALA A 1 74  ? -2.041  6.453   0.603   1.00 0.00 ? 77  ALA A HB1  2  
ATOM 2515  H HB2  . ALA A 1 74  ? -1.136  7.894   0.139   1.00 0.00 ? 77  ALA A HB2  2  
ATOM 2516  H HB3  . ALA A 1 74  ? -0.669  6.984   1.576   1.00 0.00 ? 77  ALA A HB3  2  
ATOM 2517  N N    . SER A 1 75  ? -2.436  10.505  2.496   1.00 0.00 ? 78  SER A N    2  
ATOM 2518  C CA   . SER A 1 75  ? -1.860  11.767  2.959   1.00 0.00 ? 78  SER A CA   2  
ATOM 2519  C C    . SER A 1 75  ? -1.108  11.585  4.283   1.00 0.00 ? 78  SER A C    2  
ATOM 2520  O O    . SER A 1 75  ? 0.038   12.022  4.422   1.00 0.00 ? 78  SER A O    2  
ATOM 2521  C CB   . SER A 1 75  ? -2.960  12.829  3.115   1.00 0.00 ? 78  SER A CB   2  
ATOM 2522  O OG   . SER A 1 75  ? -2.409  14.099  3.428   1.00 0.00 ? 78  SER A OG   2  
ATOM 2523  H H    . SER A 1 75  ? -3.393  10.469  2.283   1.00 0.00 ? 78  SER A H    2  
ATOM 2524  H HA   . SER A 1 75  ? -1.158  12.102  2.210   1.00 0.00 ? 78  SER A HA   2  
ATOM 2525  H HB2  . SER A 1 75  ? -3.512  12.910  2.191   1.00 0.00 ? 78  SER A HB2  2  
ATOM 2526  H HB3  . SER A 1 75  ? -3.630  12.534  3.909   1.00 0.00 ? 78  SER A HB3  2  
ATOM 2527  H HG   . SER A 1 75  ? -3.108  14.683  3.765   1.00 0.00 ? 78  SER A HG   2  
ATOM 2528  N N    . LYS A 1 76  ? -1.749  10.922  5.245   1.00 0.00 ? 79  LYS A N    2  
ATOM 2529  C CA   . LYS A 1 76  ? -1.150  10.715  6.562   1.00 0.00 ? 79  LYS A CA   2  
ATOM 2530  C C    . LYS A 1 76  ? 0.138   9.899   6.462   1.00 0.00 ? 79  LYS A C    2  
ATOM 2531  O O    . LYS A 1 76  ? 1.111   10.175  7.168   1.00 0.00 ? 79  LYS A O    2  
ATOM 2532  C CB   . LYS A 1 76  ? -2.138  10.010  7.492   1.00 0.00 ? 79  LYS A CB   2  
ATOM 2533  C CG   . LYS A 1 76  ? -1.664  9.914   8.932   1.00 0.00 ? 79  LYS A CG   2  
ATOM 2534  C CD   . LYS A 1 76  ? -1.577  11.286  9.585   1.00 0.00 ? 79  LYS A CD   2  
ATOM 2535  C CE   . LYS A 1 76  ? -1.029  11.202  11.002  1.00 0.00 ? 79  LYS A CE   2  
ATOM 2536  N NZ   . LYS A 1 76  ? -1.844  10.307  11.866  1.00 0.00 ? 79  LYS A NZ   2  
ATOM 2537  H H    . LYS A 1 76  ? -2.647  10.568  5.066   1.00 0.00 ? 79  LYS A H    2  
ATOM 2538  H HA   . LYS A 1 76  ? -0.912  11.684  6.974   1.00 0.00 ? 79  LYS A HA   2  
ATOM 2539  H HB2  . LYS A 1 76  ? -3.073  10.551  7.481   1.00 0.00 ? 79  LYS A HB2  2  
ATOM 2540  H HB3  . LYS A 1 76  ? -2.307  9.009   7.126   1.00 0.00 ? 79  LYS A HB3  2  
ATOM 2541  H HG2  . LYS A 1 76  ? -2.357  9.304   9.489   1.00 0.00 ? 79  LYS A HG2  2  
ATOM 2542  H HG3  . LYS A 1 76  ? -0.686  9.455   8.945   1.00 0.00 ? 79  LYS A HG3  2  
ATOM 2543  H HD2  . LYS A 1 76  ? -0.927  11.915  8.995   1.00 0.00 ? 79  LYS A HD2  2  
ATOM 2544  H HD3  . LYS A 1 76  ? -2.566  11.719  9.618   1.00 0.00 ? 79  LYS A HD3  2  
ATOM 2545  H HE2  . LYS A 1 76  ? -0.018  10.824  10.961  1.00 0.00 ? 79  LYS A HE2  2  
ATOM 2546  H HE3  . LYS A 1 76  ? -1.024  12.193  11.429  1.00 0.00 ? 79  LYS A HE3  2  
ATOM 2547  H HZ1  . LYS A 1 76  ? -2.830  10.655  11.891  1.00 0.00 ? 79  LYS A HZ1  2  
ATOM 2548  H HZ3  . LYS A 1 76  ? -1.469  10.334  12.839  1.00 0.00 ? 79  LYS A HZ3  2  
ATOM 2549  N N    . VAL A 1 77  ? 0.146   8.911   5.575   1.00 0.00 ? 80  VAL A N    2  
ATOM 2550  C CA   . VAL A 1 77  ? 1.301   8.037   5.416   1.00 0.00 ? 80  VAL A CA   2  
ATOM 2551  C C    . VAL A 1 77  ? 2.511   8.829   4.935   1.00 0.00 ? 80  VAL A C    2  
ATOM 2552  O O    . VAL A 1 77  ? 3.563   8.804   5.571   1.00 0.00 ? 80  VAL A O    2  
ATOM 2553  C CB   . VAL A 1 77  ? 1.014   6.873   4.438   1.00 0.00 ? 80  VAL A CB   2  
ATOM 2554  C CG1  . VAL A 1 77  ? 2.262   6.028   4.217   1.00 0.00 ? 80  VAL A CG1  2  
ATOM 2555  C CG2  . VAL A 1 77  ? -0.126  6.007   4.957   1.00 0.00 ? 80  VAL A CG2  2  
ATOM 2556  H H    . VAL A 1 77  ? -0.637  8.777   5.002   1.00 0.00 ? 80  VAL A H    2  
ATOM 2557  H HA   . VAL A 1 77  ? 1.528   7.617   6.387   1.00 0.00 ? 80  VAL A HA   2  
ATOM 2558  H HB   . VAL A 1 77  ? 0.715   7.293   3.490   1.00 0.00 ? 80  VAL A HB   2  
ATOM 2559  H HG11 . VAL A 1 77  ? 2.596   5.625   5.162   1.00 0.00 ? 80  VAL A HG11 2  
ATOM 2560  H HG12 . VAL A 1 77  ? 2.035   5.218   3.541   1.00 0.00 ? 80  VAL A HG12 2  
ATOM 2561  H HG13 . VAL A 1 77  ? 3.044   6.644   3.793   1.00 0.00 ? 80  VAL A HG13 2  
ATOM 2562  H HG21 . VAL A 1 77  ? 0.156   5.573   5.906   1.00 0.00 ? 80  VAL A HG21 2  
ATOM 2563  H HG22 . VAL A 1 77  ? -1.010  6.611   5.087   1.00 0.00 ? 80  VAL A HG22 2  
ATOM 2564  H HG23 . VAL A 1 77  ? -0.329  5.218   4.249   1.00 0.00 ? 80  VAL A HG23 2  
ATOM 2565  N N    . CYS A 1 78  ? 2.350   9.557   3.834   1.00 0.00 ? 81  CYS A N    2  
ATOM 2566  C CA   . CYS A 1 78  ? 3.445   10.349  3.284   1.00 0.00 ? 81  CYS A CA   2  
ATOM 2567  C C    . CYS A 1 78  ? 3.920   11.388  4.294   1.00 0.00 ? 81  CYS A C    2  
ATOM 2568  O O    . CYS A 1 78  ? 5.120   11.535  4.531   1.00 0.00 ? 81  CYS A O    2  
ATOM 2569  C CB   . CYS A 1 78  ? 3.016   11.055  1.991   1.00 0.00 ? 81  CYS A CB   2  
ATOM 2570  S SG   . CYS A 1 78  ? 2.381   9.945   0.694   1.00 0.00 ? 81  CYS A SG   2  
ATOM 2571  H H    . CYS A 1 78  ? 1.477   9.561   3.381   1.00 0.00 ? 81  CYS A H    2  
ATOM 2572  H HA   . CYS A 1 78  ? 4.262   9.676   3.065   1.00 0.00 ? 81  CYS A HA   2  
ATOM 2573  H HB2  . CYS A 1 78  ? 2.241   11.767  2.219   1.00 0.00 ? 81  CYS A HB2  2  
ATOM 2574  H HB3  . CYS A 1 78  ? 3.866   11.581  1.580   1.00 0.00 ? 81  CYS A HB3  2  
ATOM 2575  N N    . GLN A 1 79  ? 2.971   12.083  4.912   1.00 0.00 ? 82  GLN A N    2  
ATOM 2576  C CA   . GLN A 1 79  ? 3.293   13.189  5.806   1.00 0.00 ? 82  GLN A CA   2  
ATOM 2577  C C    . GLN A 1 79  ? 4.112   12.725  7.009   1.00 0.00 ? 82  GLN A C    2  
ATOM 2578  O O    . GLN A 1 79  ? 5.082   13.378  7.392   1.00 0.00 ? 82  GLN A O    2  
ATOM 2579  C CB   . GLN A 1 79  ? 2.011   13.888  6.268   1.00 0.00 ? 82  GLN A CB   2  
ATOM 2580  C CG   . GLN A 1 79  ? 2.259   15.052  7.213   1.00 0.00 ? 82  GLN A CG   2  
ATOM 2581  C CD   . GLN A 1 79  ? 1.009   15.859  7.503   1.00 0.00 ? 82  GLN A CD   2  
ATOM 2582  O OE1  . GLN A 1 79  ? 1.081   17.059  7.762   1.00 0.00 ? 82  GLN A OE1  2  
ATOM 2583  N NE2  . GLN A 1 79  ? -0.144  15.207  7.463   1.00 0.00 ? 82  GLN A NE2  2  
ATOM 2584  H H    . GLN A 1 79  ? 2.028   11.849  4.760   1.00 0.00 ? 82  GLN A H    2  
ATOM 2585  H HA   . GLN A 1 79  ? 3.886   13.893  5.243   1.00 0.00 ? 82  GLN A HA   2  
ATOM 2586  H HB2  . GLN A 1 79  ? 1.487   14.263  5.401   1.00 0.00 ? 82  GLN A HB2  2  
ATOM 2587  H HB3  . GLN A 1 79  ? 1.382   13.169  6.774   1.00 0.00 ? 82  GLN A HB3  2  
ATOM 2588  H HG2  . GLN A 1 79  ? 2.638   14.664  8.149   1.00 0.00 ? 82  GLN A HG2  2  
ATOM 2589  H HG3  . GLN A 1 79  ? 2.999   15.707  6.775   1.00 0.00 ? 82  GLN A HG3  2  
ATOM 2590  H HE21 . GLN A 1 79  ? -0.126  14.251  7.255   1.00 0.00 ? 82  GLN A HE21 2  
ATOM 2591  H HE22 . GLN A 1 79  ? -0.967  15.710  7.640   1.00 0.00 ? 82  GLN A HE22 2  
ATOM 2592  N N    . ARG A 1 80  ? 3.741   11.592  7.595   1.00 0.00 ? 83  ARG A N    2  
ATOM 2593  C CA   . ARG A 1 80  ? 4.450   11.091  8.769   1.00 0.00 ? 83  ARG A CA   2  
ATOM 2594  C C    . ARG A 1 80  ? 5.810   10.505  8.406   1.00 0.00 ? 83  ARG A C    2  
ATOM 2595  O O    . ARG A 1 80  ? 6.673   10.351  9.269   1.00 0.00 ? 83  ARG A O    2  
ATOM 2596  C CB   . ARG A 1 80  ? 3.613   10.065  9.524   1.00 0.00 ? 83  ARG A CB   2  
ATOM 2597  C CG   . ARG A 1 80  ? 2.565   10.681  10.441  1.00 0.00 ? 83  ARG A CG   2  
ATOM 2598  C CD   . ARG A 1 80  ? 3.197   11.570  11.513  1.00 0.00 ? 83  ARG A CD   2  
ATOM 2599  N NE   . ARG A 1 80  ? 3.508   12.916  11.021  1.00 0.00 ? 83  ARG A NE   2  
ATOM 2600  C CZ   . ARG A 1 80  ? 4.660   13.549  11.251  1.00 0.00 ? 83  ARG A CZ   2  
ATOM 2601  N NH1  . ARG A 1 80  ? 5.636   12.944  11.913  1.00 0.00 ? 83  ARG A NH1  2  
ATOM 2602  N NH2  . ARG A 1 80  ? 4.843   14.789  10.820  1.00 0.00 ? 83  ARG A NH2  2  
ATOM 2603  H H    . ARG A 1 80  ? 2.979   11.083  7.233   1.00 0.00 ? 83  ARG A H    2  
ATOM 2604  H HA   . ARG A 1 80  ? 4.615   11.938  9.418   1.00 0.00 ? 83  ARG A HA   2  
ATOM 2605  H HB2  . ARG A 1 80  ? 3.107   9.433   8.808   1.00 0.00 ? 83  ARG A HB2  2  
ATOM 2606  H HB3  . ARG A 1 80  ? 4.270   9.455   10.125  1.00 0.00 ? 83  ARG A HB3  2  
ATOM 2607  H HG2  . ARG A 1 80  ? 1.890   11.276  9.846   1.00 0.00 ? 83  ARG A HG2  2  
ATOM 2608  H HG3  . ARG A 1 80  ? 2.015   9.886   10.924  1.00 0.00 ? 83  ARG A HG3  2  
ATOM 2609  H HD2  . ARG A 1 80  ? 2.509   11.655  12.342  1.00 0.00 ? 83  ARG A HD2  2  
ATOM 2610  H HD3  . ARG A 1 80  ? 4.110   11.103  11.854  1.00 0.00 ? 83  ARG A HD3  2  
ATOM 2611  H HE   . ARG A 1 80  ? 2.800   13.384  10.516  1.00 0.00 ? 83  ARG A HE   2  
ATOM 2612  H HH12 . ARG A 1 80  ? 5.829   11.963  11.759  1.00 0.00 ? 83  ARG A HH12 2  
ATOM 2613  H HH21 . ARG A 1 80  ? 4.117   15.267  10.316  1.00 0.00 ? 83  ARG A HH21 2  
ATOM 2614  H HH22 . ARG A 1 80  ? 5.708   15.259  11.004  1.00 0.00 ? 83  ARG A HH22 2  
ATOM 2615  N N    . LEU A 1 81  ? 6.002   10.187  7.135   1.00 0.00 ? 84  LEU A N    2  
ATOM 2616  C CA   . LEU A 1 81  ? 7.299   9.727   6.652   1.00 0.00 ? 84  LEU A CA   2  
ATOM 2617  C C    . LEU A 1 81  ? 8.163   10.914  6.234   1.00 0.00 ? 84  LEU A C    2  
ATOM 2618  O O    . LEU A 1 81  ? 9.214   10.742  5.616   1.00 0.00 ? 84  LEU A O    2  
ATOM 2619  C CB   . LEU A 1 81  ? 7.135   8.752   5.484   1.00 0.00 ? 84  LEU A CB   2  
ATOM 2620  C CG   . LEU A 1 81  ? 7.038   7.271   5.868   1.00 0.00 ? 84  LEU A CG   2  
ATOM 2621  C CD1  . LEU A 1 81  ? 5.805   6.996   6.711   1.00 0.00 ? 84  LEU A CD1  2  
ATOM 2622  C CD2  . LEU A 1 81  ? 7.027   6.410   4.619   1.00 0.00 ? 84  LEU A CD2  2  
ATOM 2623  H H    . LEU A 1 81  ? 5.253   10.257  6.503   1.00 0.00 ? 84  LEU A H    2  
ATOM 2624  H HA   . LEU A 1 81  ? 7.787   9.214   7.466   1.00 0.00 ? 84  LEU A HA   2  
ATOM 2625  H HB2  . LEU A 1 81  ? 6.237   9.021   4.946   1.00 0.00 ? 84  LEU A HB2  2  
ATOM 2626  H HB3  . LEU A 1 81  ? 7.979   8.873   4.823   1.00 0.00 ? 84  LEU A HB3  2  
ATOM 2627  H HG   . LEU A 1 81  ? 7.905   7.001   6.451   1.00 0.00 ? 84  LEU A HG   2  
ATOM 2628  H HD11 . LEU A 1 81  ? 5.862   7.565   7.627   1.00 0.00 ? 84  LEU A HD11 2  
ATOM 2629  H HD12 . LEU A 1 81  ? 4.922   7.284   6.160   1.00 0.00 ? 84  LEU A HD12 2  
ATOM 2630  H HD13 . LEU A 1 81  ? 5.756   5.942   6.943   1.00 0.00 ? 84  LEU A HD13 2  
ATOM 2631  H HD21 . LEU A 1 81  ? 7.945   6.560   4.072   1.00 0.00 ? 84  LEU A HD21 2  
ATOM 2632  H HD22 . LEU A 1 81  ? 6.939   5.370   4.898   1.00 0.00 ? 84  LEU A HD22 2  
ATOM 2633  H HD23 . LEU A 1 81  ? 6.189   6.689   3.998   1.00 0.00 ? 84  LEU A HD23 2  
ATOM 2634  N N    . ASN A 1 82  ? 7.708   12.114  6.600   1.00 0.00 ? 85  ASN A N    2  
ATOM 2635  C CA   . ASN A 1 82  ? 8.397   13.361  6.266   1.00 0.00 ? 85  ASN A CA   2  
ATOM 2636  C C    . ASN A 1 82  ? 8.400   13.595  4.764   1.00 0.00 ? 85  ASN A C    2  
ATOM 2637  O O    . ASN A 1 82  ? 9.370   14.095  4.194   1.00 0.00 ? 85  ASN A O    2  
ATOM 2638  C CB   . ASN A 1 82  ? 9.826   13.389  6.823   1.00 0.00 ? 85  ASN A CB   2  
ATOM 2639  C CG   . ASN A 1 82  ? 9.856   13.630  8.320   1.00 0.00 ? 85  ASN A CG   2  
ATOM 2640  O OD1  . ASN A 1 82  ? 9.860   14.776  8.776   1.00 0.00 ? 85  ASN A OD1  2  
ATOM 2641  N ND2  . ASN A 1 82  ? 9.899   12.558  9.093   1.00 0.00 ? 85  ASN A ND2  2  
ATOM 2642  H H    . ASN A 1 82  ? 6.871   12.163  7.111   1.00 0.00 ? 85  ASN A H    2  
ATOM 2643  H HA   . ASN A 1 82  ? 7.837   14.162  6.726   1.00 0.00 ? 85  ASN A HA   2  
ATOM 2644  H HB2  . ASN A 1 82  ? 10.301  12.442  6.621   1.00 0.00 ? 85  ASN A HB2  2  
ATOM 2645  H HB3  . ASN A 1 82  ? 10.380  14.178  6.336   1.00 0.00 ? 85  ASN A HB3  2  
ATOM 2646  H HD21 . ASN A 1 82  ? 9.911   11.672  8.662   1.00 0.00 ? 85  ASN A HD21 2  
ATOM 2647  H HD22 . ASN A 1 82  ? 9.912   12.685  10.064  1.00 0.00 ? 85  ASN A HD22 2  
ATOM 2648  N N    . CYS A 1 83  ? 7.301   13.228  4.133   1.00 0.00 ? 86  CYS A N    2  
ATOM 2649  C CA   . CYS A 1 83  ? 7.114   13.460  2.719   1.00 0.00 ? 86  CYS A CA   2  
ATOM 2650  C C    . CYS A 1 83  ? 5.936   14.404  2.520   1.00 0.00 ? 86  CYS A C    2  
ATOM 2651  O O    . CYS A 1 83  ? 5.135   14.606  3.434   1.00 0.00 ? 86  CYS A O    2  
ATOM 2652  C CB   . CYS A 1 83  ? 6.859   12.134  1.995   1.00 0.00 ? 86  CYS A CB   2  
ATOM 2653  S SG   . CYS A 1 83  ? 8.050   10.814  2.409   1.00 0.00 ? 86  CYS A SG   2  
ATOM 2654  H H    . CYS A 1 83  ? 6.585   12.786  4.637   1.00 0.00 ? 86  CYS A H    2  
ATOM 2655  H HA   . CYS A 1 83  ? 8.009   13.921  2.328   1.00 0.00 ? 86  CYS A HA   2  
ATOM 2656  H HB2  . CYS A 1 83  ? 5.874   11.778  2.256   1.00 0.00 ? 86  CYS A HB2  2  
ATOM 2657  H HB3  . CYS A 1 83  ? 6.906   12.299  0.929   1.00 0.00 ? 86  CYS A HB3  2  
ATOM 2658  N N    . GLY A 1 84  ? 5.835   14.978  1.337   1.00 0.00 ? 87  GLY A N    2  
ATOM 2659  C CA   . GLY A 1 84  ? 4.750   15.891  1.051   1.00 0.00 ? 87  GLY A CA   2  
ATOM 2660  C C    . GLY A 1 84  ? 3.542   15.183  0.478   1.00 0.00 ? 87  GLY A C    2  
ATOM 2661  O O    . GLY A 1 84  ? 3.317   14.005  0.756   1.00 0.00 ? 87  GLY A O    2  
ATOM 2662  H H    . GLY A 1 84  ? 6.503   14.779  0.645   1.00 0.00 ? 87  GLY A H    2  
ATOM 2663  H HA2  . GLY A 1 84  ? 4.462   16.389  1.964   1.00 0.00 ? 87  GLY A HA2  2  
ATOM 2664  H HA3  . GLY A 1 84  ? 5.094   16.630  0.341   1.00 0.00 ? 87  GLY A HA3  2  
ATOM 2665  N N    . ASP A 1 85  ? 2.775   15.904  -0.328  1.00 0.00 ? 88  ASP A N    2  
ATOM 2666  C CA   . ASP A 1 85  ? 1.558   15.368  -0.937  1.00 0.00 ? 88  ASP A CA   2  
ATOM 2667  C C    . ASP A 1 85  ? 1.843   14.110  -1.750  1.00 0.00 ? 88  ASP A C    2  
ATOM 2668  O O    . ASP A 1 85  ? 2.926   13.959  -2.327  1.00 0.00 ? 88  ASP A O    2  
ATOM 2669  C CB   . ASP A 1 85  ? 0.912   16.413  -1.851  1.00 0.00 ? 88  ASP A CB   2  
ATOM 2670  C CG   . ASP A 1 85  ? 0.496   17.671  -1.119  1.00 0.00 ? 88  ASP A CG   2  
ATOM 2671  O OD1  . ASP A 1 85  ? 1.367   18.519  -0.836  1.00 0.00 ? 88  ASP A OD1  2  
ATOM 2672  O OD2  . ASP A 1 85  ? -0.711  17.827  -0.835  1.00 0.00 ? 88  ASP A OD2  2  
ATOM 2673  H H    . ASP A 1 85  ? 3.026   16.833  -0.513  1.00 0.00 ? 88  ASP A H    2  
ATOM 2674  H HA   . ASP A 1 85  ? 0.871   15.125  -0.143  1.00 0.00 ? 88  ASP A HA   2  
ATOM 2675  H HB2  . ASP A 1 85  ? 1.608   16.683  -2.623  1.00 0.00 ? 88  ASP A HB2  2  
ATOM 2676  H HB3  . ASP A 1 85  ? 0.033   15.979  -2.305  1.00 0.00 ? 88  ASP A HB3  2  
ATOM 2677  N N    . PRO A 1 86  ? 0.870   13.188  -1.802  1.00 0.00 ? 89  PRO A N    2  
ATOM 2678  C CA   . PRO A 1 86  ? 0.974   11.970  -2.595  1.00 0.00 ? 89  PRO A CA   2  
ATOM 2679  C C    . PRO A 1 86  ? 0.759   12.254  -4.081  1.00 0.00 ? 89  PRO A C    2  
ATOM 2680  O O    . PRO A 1 86  ? -0.260  12.821  -4.474  1.00 0.00 ? 89  PRO A O    2  
ATOM 2681  C CB   . PRO A 1 86  ? -0.139  11.063  -2.047  1.00 0.00 ? 89  PRO A CB   2  
ATOM 2682  C CG   . PRO A 1 86  ? -0.785  11.814  -0.925  1.00 0.00 ? 89  PRO A CG   2  
ATOM 2683  C CD   . PRO A 1 86  ? -0.413  13.258  -1.097  1.00 0.00 ? 89  PRO A CD   2  
ATOM 2684  H HA   . PRO A 1 86  ? 1.933   11.494  -2.457  1.00 0.00 ? 89  PRO A HA   2  
ATOM 2685  H HB2  . PRO A 1 86  ? -0.845  10.849  -2.831  1.00 0.00 ? 89  PRO A HB2  2  
ATOM 2686  H HB3  . PRO A 1 86  ? 0.294   10.140  -1.695  1.00 0.00 ? 89  PRO A HB3  2  
ATOM 2687  H HG2  . PRO A 1 86  ? -1.858  11.696  -0.979  1.00 0.00 ? 89  PRO A HG2  2  
ATOM 2688  H HG3  . PRO A 1 86  ? -0.418  11.442  0.021   1.00 0.00 ? 89  PRO A HG3  2  
ATOM 2689  H HD2  . PRO A 1 86  ? -1.152  13.773  -1.690  1.00 0.00 ? 89  PRO A HD2  2  
ATOM 2690  H HD3  . PRO A 1 86  ? -0.300  13.734  -0.138  1.00 0.00 ? 89  PRO A HD3  2  
ATOM 2691  N N    . LEU A 1 87  ? 1.726   11.864  -4.895  1.00 0.00 ? 90  LEU A N    2  
ATOM 2692  C CA   . LEU A 1 87  ? 1.695   12.140  -6.322  1.00 0.00 ? 90  LEU A CA   2  
ATOM 2693  C C    . LEU A 1 87  ? 0.973   11.035  -7.078  1.00 0.00 ? 90  LEU A C    2  
ATOM 2694  O O    . LEU A 1 87  ? 0.056   11.293  -7.856  1.00 0.00 ? 90  LEU A O    2  
ATOM 2695  C CB   . LEU A 1 87  ? 3.122   12.281  -6.856  1.00 0.00 ? 90  LEU A CB   2  
ATOM 2696  C CG   . LEU A 1 87  ? 3.926   13.453  -6.289  1.00 0.00 ? 90  LEU A CG   2  
ATOM 2697  C CD1  . LEU A 1 87  ? 5.365   13.401  -6.786  1.00 0.00 ? 90  LEU A CD1  2  
ATOM 2698  C CD2  . LEU A 1 87  ? 3.277   14.782  -6.659  1.00 0.00 ? 90  LEU A CD2  2  
ATOM 2699  H H    . LEU A 1 87  ? 2.487   11.365  -4.525  1.00 0.00 ? 90  LEU A H    2  
ATOM 2700  H HA   . LEU A 1 87  ? 1.169   13.068  -6.472  1.00 0.00 ? 90  LEU A HA   2  
ATOM 2701  H HB2  . LEU A 1 87  ? 3.653   11.370  -6.631  1.00 0.00 ? 90  LEU A HB2  2  
ATOM 2702  H HB3  . LEU A 1 87  ? 3.073   12.388  -7.929  1.00 0.00 ? 90  LEU A HB3  2  
ATOM 2703  H HG   . LEU A 1 87  ? 3.945   13.379  -5.212  1.00 0.00 ? 90  LEU A HG   2  
ATOM 2704  H HD11 . LEU A 1 87  ? 5.376   13.435  -7.865  1.00 0.00 ? 90  LEU A HD11 2  
ATOM 2705  H HD12 . LEU A 1 87  ? 5.913   14.247  -6.394  1.00 0.00 ? 90  LEU A HD12 2  
ATOM 2706  H HD13 . LEU A 1 87  ? 5.830   12.486  -6.450  1.00 0.00 ? 90  LEU A HD13 2  
ATOM 2707  H HD21 . LEU A 1 87  ? 3.195   14.859  -7.733  1.00 0.00 ? 90  LEU A HD21 2  
ATOM 2708  H HD22 . LEU A 1 87  ? 2.292   14.838  -6.217  1.00 0.00 ? 90  LEU A HD22 2  
ATOM 2709  H HD23 . LEU A 1 87  ? 3.882   15.594  -6.285  1.00 0.00 ? 90  LEU A HD23 2  
ATOM 2710  N N    . SER A 1 88  ? 1.392   9.805   -6.844  1.00 0.00 ? 91  SER A N    2  
ATOM 2711  C CA   . SER A 1 88  ? 0.834   8.664   -7.542  1.00 0.00 ? 91  SER A CA   2  
ATOM 2712  C C    . SER A 1 88  ? 0.670   7.478   -6.596  1.00 0.00 ? 91  SER A C    2  
ATOM 2713  O O    . SER A 1 88  ? 1.464   7.298   -5.667  1.00 0.00 ? 91  SER A O    2  
ATOM 2714  C CB   . SER A 1 88  ? 1.728   8.301   -8.730  1.00 0.00 ? 91  SER A CB   2  
ATOM 2715  O OG   . SER A 1 88  ? 3.100   8.319   -8.366  1.00 0.00 ? 91  SER A OG   2  
ATOM 2716  H H    . SER A 1 88  ? 2.093   9.657   -6.175  1.00 0.00 ? 91  SER A H    2  
ATOM 2717  H HA   . SER A 1 88  ? -0.140  8.950   -7.913  1.00 0.00 ? 91  SER A HA   2  
ATOM 2718  H HB2  . SER A 1 88  ? 1.475   7.310   -9.079  1.00 0.00 ? 91  SER A HB2  2  
ATOM 2719  H HB3  . SER A 1 88  ? 1.570   9.013   -9.527  1.00 0.00 ? 91  SER A HB3  2  
ATOM 2720  H HG   . SER A 1 88  ? 3.498   7.468   -8.582  1.00 0.00 ? 91  SER A HG   2  
ATOM 2721  N N    . LEU A 1 89  ? -0.363  6.682   -6.838  1.00 0.00 ? 92  LEU A N    2  
ATOM 2722  C CA   . LEU A 1 89  ? -0.691  5.551   -5.982  1.00 0.00 ? 92  LEU A CA   2  
ATOM 2723  C C    . LEU A 1 89  ? -1.339  4.462   -6.831  1.00 0.00 ? 92  LEU A C    2  
ATOM 2724  O O    . LEU A 1 89  ? -2.431  4.649   -7.368  1.00 0.00 ? 92  LEU A O    2  
ATOM 2725  C CB   . LEU A 1 89  ? -1.643  6.010   -4.863  1.00 0.00 ? 92  LEU A CB   2  
ATOM 2726  C CG   . LEU A 1 89  ? -1.770  5.087   -3.636  1.00 0.00 ? 92  LEU A CG   2  
ATOM 2727  C CD1  . LEU A 1 89  ? -2.502  5.804   -2.509  1.00 0.00 ? 92  LEU A CD1  2  
ATOM 2728  C CD2  . LEU A 1 89  ? -2.503  3.800   -3.982  1.00 0.00 ? 92  LEU A CD2  2  
ATOM 2729  H H    . LEU A 1 89  ? -0.920  6.851   -7.630  1.00 0.00 ? 92  LEU A H    2  
ATOM 2730  H HA   . LEU A 1 89  ? 0.225   5.173   -5.546  1.00 0.00 ? 92  LEU A HA   2  
ATOM 2731  H HB2  . LEU A 1 89  ? -1.305  6.976   -4.521  1.00 0.00 ? 92  LEU A HB2  2  
ATOM 2732  H HB3  . LEU A 1 89  ? -2.629  6.128   -5.294  1.00 0.00 ? 92  LEU A HB3  2  
ATOM 2733  H HG   . LEU A 1 89  ? -0.779  4.827   -3.282  1.00 0.00 ? 92  LEU A HG   2  
ATOM 2734  H HD11 . LEU A 1 89  ? -2.606  5.136   -1.666  1.00 0.00 ? 92  LEU A HD11 2  
ATOM 2735  H HD12 . LEU A 1 89  ? -1.940  6.677   -2.209  1.00 0.00 ? 92  LEU A HD12 2  
ATOM 2736  H HD13 . LEU A 1 89  ? -3.482  6.106   -2.849  1.00 0.00 ? 92  LEU A HD13 2  
ATOM 2737  H HD21 . LEU A 1 89  ? -1.924  3.238   -4.702  1.00 0.00 ? 92  LEU A HD21 2  
ATOM 2738  H HD22 . LEU A 1 89  ? -2.634  3.209   -3.086  1.00 0.00 ? 92  LEU A HD22 2  
ATOM 2739  H HD23 . LEU A 1 89  ? -3.469  4.037   -4.401  1.00 0.00 ? 92  LEU A HD23 2  
ATOM 2740  N N    . GLY A 1 90  ? -0.654  3.339   -6.968  1.00 0.00 ? 93  GLY A N    2  
ATOM 2741  C CA   . GLY A 1 90  ? -1.170  2.255   -7.780  1.00 0.00 ? 93  GLY A CA   2  
ATOM 2742  C C    . GLY A 1 90  ? -0.129  1.180   -8.012  1.00 0.00 ? 93  GLY A C    2  
ATOM 2743  O O    . GLY A 1 90  ? 0.676   0.912   -7.126  1.00 0.00 ? 93  GLY A O    2  
ATOM 2744  H H    . GLY A 1 90  ? 0.214   3.246   -6.512  1.00 0.00 ? 93  GLY A H    2  
ATOM 2745  H HA2  . GLY A 1 90  ? -2.024  1.815   -7.280  1.00 0.00 ? 93  GLY A HA2  2  
ATOM 2746  H HA3  . GLY A 1 90  ? -1.484  2.651   -8.736  1.00 0.00 ? 93  GLY A HA3  2  
ATOM 2747  N N    . PRO A 1 91  ? -0.113  0.542   -9.191  1.00 0.00 ? 94  PRO A N    2  
ATOM 2748  C CA   . PRO A 1 91  ? 0.867   -0.499  -9.502  1.00 0.00 ? 94  PRO A CA   2  
ATOM 2749  C C    . PRO A 1 91  ? 2.265   0.084   -9.712  1.00 0.00 ? 94  PRO A C    2  
ATOM 2750  O O    . PRO A 1 91  ? 2.555   0.676   -10.752 1.00 0.00 ? 94  PRO A O    2  
ATOM 2751  C CB   . PRO A 1 91  ? 0.331   -1.122  -10.794 1.00 0.00 ? 94  PRO A CB   2  
ATOM 2752  C CG   . PRO A 1 91  ? -0.474  -0.046  -11.434 1.00 0.00 ? 94  PRO A CG   2  
ATOM 2753  C CD   . PRO A 1 91  ? -1.039  0.786   -10.312 1.00 0.00 ? 94  PRO A CD   2  
ATOM 2754  H HA   . PRO A 1 91  ? 0.904   -1.249  -8.723  1.00 0.00 ? 94  PRO A HA   2  
ATOM 2755  H HB2  . PRO A 1 91  ? 1.157   -1.425  -11.421 1.00 0.00 ? 94  PRO A HB2  2  
ATOM 2756  H HB3  . PRO A 1 91  ? -0.279  -1.979  -10.555 1.00 0.00 ? 94  PRO A HB3  2  
ATOM 2757  H HG2  . PRO A 1 91  ? 0.160   0.557   -12.066 1.00 0.00 ? 94  PRO A HG2  2  
ATOM 2758  H HG3  . PRO A 1 91  ? -1.274  -0.485  -12.015 1.00 0.00 ? 94  PRO A HG3  2  
ATOM 2759  H HD2  . PRO A 1 91  ? -1.042  1.830   -10.585 1.00 0.00 ? 94  PRO A HD2  2  
ATOM 2760  H HD3  . PRO A 1 91  ? -2.039  0.456   -10.066 1.00 0.00 ? 94  PRO A HD3  2  
ATOM 2761  N N    . PHE A 1 92  ? 3.124   -0.081  -8.716  1.00 0.00 ? 95  PHE A N    2  
ATOM 2762  C CA   . PHE A 1 92  ? 4.465   0.488   -8.766  1.00 0.00 ? 95  PHE A CA   2  
ATOM 2763  C C    . PHE A 1 92  ? 5.408   -0.442  -9.517  1.00 0.00 ? 95  PHE A C    2  
ATOM 2764  O O    . PHE A 1 92  ? 6.120   -0.021  -10.431 1.00 0.00 ? 95  PHE A O    2  
ATOM 2765  C CB   . PHE A 1 92  ? 4.984   0.734   -7.346  1.00 0.00 ? 95  PHE A CB   2  
ATOM 2766  C CG   . PHE A 1 92  ? 6.310   1.438   -7.287  1.00 0.00 ? 95  PHE A CG   2  
ATOM 2767  C CD1  . PHE A 1 92  ? 6.377   2.822   -7.326  1.00 0.00 ? 95  PHE A CD1  2  
ATOM 2768  C CD2  . PHE A 1 92  ? 7.489   0.716   -7.182  1.00 0.00 ? 95  PHE A CD2  2  
ATOM 2769  C CE1  . PHE A 1 92  ? 7.594   3.471   -7.262  1.00 0.00 ? 95  PHE A CE1  2  
ATOM 2770  C CE2  . PHE A 1 92  ? 8.707   1.362   -7.120  1.00 0.00 ? 95  PHE A CE2  2  
ATOM 2771  C CZ   . PHE A 1 92  ? 8.759   2.739   -7.159  1.00 0.00 ? 95  PHE A CZ   2  
ATOM 2772  H H    . PHE A 1 92  ? 2.851   -0.606  -7.931  1.00 0.00 ? 95  PHE A H    2  
ATOM 2773  H HA   . PHE A 1 92  ? 4.409   1.431   -9.290  1.00 0.00 ? 95  PHE A HA   2  
ATOM 2774  H HB2  . PHE A 1 92  ? 4.268   1.341   -6.810  1.00 0.00 ? 95  PHE A HB2  2  
ATOM 2775  H HB3  . PHE A 1 92  ? 5.089   -0.215  -6.838  1.00 0.00 ? 95  PHE A HB3  2  
ATOM 2776  H HD1  . PHE A 1 92  ? 5.468   3.396   -7.409  1.00 0.00 ? 95  PHE A HD1  2  
ATOM 2777  H HD2  . PHE A 1 92  ? 7.451   -0.363  -7.151  1.00 0.00 ? 95  PHE A HD2  2  
ATOM 2778  H HE1  . PHE A 1 92  ? 7.634   4.551   -7.294  1.00 0.00 ? 95  PHE A HE1  2  
ATOM 2779  H HE2  . PHE A 1 92  ? 9.620   0.789   -7.039  1.00 0.00 ? 95  PHE A HE2  2  
ATOM 2780  H HZ   . PHE A 1 92  ? 9.711   3.245   -7.111  1.00 0.00 ? 95  PHE A HZ   2  
ATOM 2781  N N    . LEU A 1 93  ? 5.393   -1.708  -9.132  1.00 0.00 ? 96  LEU A N    2  
ATOM 2782  C CA   . LEU A 1 93  ? 6.267   -2.708  -9.723  1.00 0.00 ? 96  LEU A CA   2  
ATOM 2783  C C    . LEU A 1 93  ? 5.623   -4.080  -9.581  1.00 0.00 ? 96  LEU A C    2  
ATOM 2784  O O    . LEU A 1 93  ? 4.853   -4.316  -8.653  1.00 0.00 ? 96  LEU A O    2  
ATOM 2785  C CB   . LEU A 1 93  ? 7.639   -2.676  -9.031  1.00 0.00 ? 96  LEU A CB   2  
ATOM 2786  C CG   . LEU A 1 93  ? 8.661   -3.718  -9.513  1.00 0.00 ? 96  LEU A CG   2  
ATOM 2787  C CD1  . LEU A 1 93  ? 8.966   -3.543  -10.994 1.00 0.00 ? 96  LEU A CD1  2  
ATOM 2788  C CD2  . LEU A 1 93  ? 9.943   -3.621  -8.699  1.00 0.00 ? 96  LEU A CD2  2  
ATOM 2789  H H    . LEU A 1 93  ? 4.762   -1.986  -8.434  1.00 0.00 ? 96  LEU A H    2  
ATOM 2790  H HA   . LEU A 1 93  ? 6.383   -2.477  -10.772 1.00 0.00 ? 96  LEU A HA   2  
ATOM 2791  H HB2  . LEU A 1 93  ? 8.064   -1.694  -9.177  1.00 0.00 ? 96  LEU A HB2  2  
ATOM 2792  H HB3  . LEU A 1 93  ? 7.482   -2.824  -7.973  1.00 0.00 ? 96  LEU A HB3  2  
ATOM 2793  H HG   . LEU A 1 93  ? 8.248   -4.707  -9.371  1.00 0.00 ? 96  LEU A HG   2  
ATOM 2794  H HD11 . LEU A 1 93  ? 9.727   -4.250  -11.290 1.00 0.00 ? 96  LEU A HD11 2  
ATOM 2795  H HD12 . LEU A 1 93  ? 8.070   -3.717  -11.571 1.00 0.00 ? 96  LEU A HD12 2  
ATOM 2796  H HD13 . LEU A 1 93  ? 9.321   -2.539  -11.173 1.00 0.00 ? 96  LEU A HD13 2  
ATOM 2797  H HD21 . LEU A 1 93  ? 10.366  -2.634  -8.808  1.00 0.00 ? 96  LEU A HD21 2  
ATOM 2798  H HD22 . LEU A 1 93  ? 9.726   -3.807  -7.658  1.00 0.00 ? 96  LEU A HD22 2  
ATOM 2799  H HD23 . LEU A 1 93  ? 10.650  -4.355  -9.056  1.00 0.00 ? 96  LEU A HD23 2  
ATOM 2800  N N    . LYS A 1 94  ? 5.921   -4.975  -10.505 1.00 0.00 ? 97  LYS A N    2  
ATOM 2801  C CA   . LYS A 1 94  ? 5.342   -6.305  -10.477 1.00 0.00 ? 97  LYS A CA   2  
ATOM 2802  C C    . LYS A 1 94  ? 6.302   -7.288  -9.818  1.00 0.00 ? 97  LYS A C    2  
ATOM 2803  O O    . LYS A 1 94  ? 7.049   -7.992  -10.495 1.00 0.00 ? 97  LYS A O    2  
ATOM 2804  C CB   . LYS A 1 94  ? 4.979   -6.765  -11.890 1.00 0.00 ? 97  LYS A CB   2  
ATOM 2805  C CG   . LYS A 1 94  ? 3.915   -5.906  -12.563 1.00 0.00 ? 97  LYS A CG   2  
ATOM 2806  C CD   . LYS A 1 94  ? 3.532   -6.460  -13.927 1.00 0.00 ? 97  LYS A CD   2  
ATOM 2807  C CE   . LYS A 1 94  ? 4.708   -6.460  -14.892 1.00 0.00 ? 97  LYS A CE   2  
ATOM 2808  N NZ   . LYS A 1 94  ? 4.356   -7.101  -16.188 1.00 0.00 ? 97  LYS A NZ   2  
ATOM 2809  H H    . LYS A 1 94  ? 6.558   -4.742  -11.212 1.00 0.00 ? 97  LYS A H    2  
ATOM 2810  H HA   . LYS A 1 94  ? 4.442   -6.256  -9.882  1.00 0.00 ? 97  LYS A HA   2  
ATOM 2811  H HB2  . LYS A 1 94  ? 5.868   -6.741  -12.501 1.00 0.00 ? 97  LYS A HB2  2  
ATOM 2812  H HB3  . LYS A 1 94  ? 4.615   -7.782  -11.843 1.00 0.00 ? 97  LYS A HB3  2  
ATOM 2813  H HG2  . LYS A 1 94  ? 3.036   -5.883  -11.937 1.00 0.00 ? 97  LYS A HG2  2  
ATOM 2814  H HG3  . LYS A 1 94  ? 4.297   -4.903  -12.685 1.00 0.00 ? 97  LYS A HG3  2  
ATOM 2815  H HD2  . LYS A 1 94  ? 3.183   -7.474  -13.804 1.00 0.00 ? 97  LYS A HD2  2  
ATOM 2816  H HD3  . LYS A 1 94  ? 2.739   -5.853  -14.337 1.00 0.00 ? 97  LYS A HD3  2  
ATOM 2817  H HE2  . LYS A 1 94  ? 5.008   -5.439  -15.077 1.00 0.00 ? 97  LYS A HE2  2  
ATOM 2818  H HE3  . LYS A 1 94  ? 5.526   -7.000  -14.443 1.00 0.00 ? 97  LYS A HE3  2  
ATOM 2819  H HZ1  . LYS A 1 94  ? 5.157   -7.010  -16.852 1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 2820  H HZ3  . LYS A 1 94  ? 3.534   -6.612  -16.609 1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 2821  N N    . THR A 1 95  ? 6.289   -7.304  -8.492  1.00 0.00 ? 98  THR A N    2  
ATOM 2822  C CA   . THR A 1 95  ? 7.125   -8.216  -7.729  1.00 0.00 ? 98  THR A CA   2  
ATOM 2823  C C    . THR A 1 95  ? 6.575   -9.644  -7.813  1.00 0.00 ? 98  THR A C    2  
ATOM 2824  O O    . THR A 1 95  ? 7.331   -10.614 -7.784  1.00 0.00 ? 98  THR A O    2  
ATOM 2825  C CB   . THR A 1 95  ? 7.210   -7.765  -6.254  1.00 0.00 ? 98  THR A CB   2  
ATOM 2826  O OG1  . THR A 1 95  ? 7.525   -6.365  -6.195  1.00 0.00 ? 98  THR A OG1  2  
ATOM 2827  C CG2  . THR A 1 95  ? 8.266   -8.555  -5.494  1.00 0.00 ? 98  THR A CG2  2  
ATOM 2828  H H    . THR A 1 95  ? 5.714   -6.671  -8.012  1.00 0.00 ? 98  THR A H    2  
ATOM 2829  H HA   . THR A 1 95  ? 8.117   -8.195  -8.152  1.00 0.00 ? 98  THR A HA   2  
ATOM 2830  H HB   . THR A 1 95  ? 6.251   -7.930  -5.786  1.00 0.00 ? 98  THR A HB   2  
ATOM 2831  H HG1  . THR A 1 95  ? 8.489   -6.249  -6.254  1.00 0.00 ? 98  THR A HG1  2  
ATOM 2832  H HG21 . THR A 1 95  ? 8.009   -9.603  -5.508  1.00 0.00 ? 98  THR A HG21 2  
ATOM 2833  H HG22 . THR A 1 95  ? 8.309   -8.209  -4.472  1.00 0.00 ? 98  THR A HG22 2  
ATOM 2834  H HG23 . THR A 1 95  ? 9.230   -8.414  -5.963  1.00 0.00 ? 98  THR A HG23 2  
ATOM 2835  N N    . TYR A 1 96  ? 5.245   -9.742  -7.916  1.00 0.00 ? 99  TYR A N    2  
ATOM 2836  C CA   . TYR A 1 96  ? 4.531   -11.015 -8.119  1.00 0.00 ? 99  TYR A CA   2  
ATOM 2837  C C    . TYR A 1 96  ? 4.545   -11.935 -6.897  1.00 0.00 ? 99  TYR A C    2  
ATOM 2838  O O    . TYR A 1 96  ? 3.647   -12.758 -6.757  1.00 0.00 ? 99  TYR A O    2  
ATOM 2839  C CB   . TYR A 1 96  ? 5.073   -11.775 -9.335  1.00 0.00 ? 99  TYR A CB   2  
ATOM 2840  C CG   . TYR A 1 96  ? 4.621   -11.212 -10.665 1.00 0.00 ? 99  TYR A CG   2  
ATOM 2841  C CD1  . TYR A 1 96  ? 3.275   -11.196 -11.010 1.00 0.00 ? 99  TYR A CD1  2  
ATOM 2842  C CD2  . TYR A 1 96  ? 5.536   -10.711 -11.580 1.00 0.00 ? 99  TYR A CD2  2  
ATOM 2843  C CE1  . TYR A 1 96  ? 2.856   -10.698 -12.226 1.00 0.00 ? 99  TYR A CE1  2  
ATOM 2844  C CE2  . TYR A 1 96  ? 5.124   -10.208 -12.798 1.00 0.00 ? 99  TYR A CE2  2  
ATOM 2845  C CZ   . TYR A 1 96  ? 3.784   -10.204 -13.116 1.00 0.00 ? 99  TYR A CZ   2  
ATOM 2846  O OH   . TYR A 1 96  ? 3.370   -9.710  -14.330 1.00 0.00 ? 99  TYR A OH   2  
ATOM 2847  H H    . TYR A 1 96  ? 4.718   -8.919  -7.860  1.00 0.00 ? 99  TYR A H    2  
ATOM 2848  H HA   . TYR A 1 96  ? 3.502   -10.763 -8.321  1.00 0.00 ? 99  TYR A HA   2  
ATOM 2849  H HB2  . TYR A 1 96  ? 6.151   -11.745 -9.313  1.00 0.00 ? 99  TYR A HB2  2  
ATOM 2850  H HB3  . TYR A 1 96  ? 4.748   -12.804 -9.280  1.00 0.00 ? 99  TYR A HB3  2  
ATOM 2851  H HD1  . TYR A 1 96  ? 2.549   -11.584 -10.310 1.00 0.00 ? 99  TYR A HD1  2  
ATOM 2852  H HD2  . TYR A 1 96  ? 6.588   -10.716 -11.329 1.00 0.00 ? 99  TYR A HD2  2  
ATOM 2853  H HE1  . TYR A 1 96  ? 1.805   -10.695 -12.476 1.00 0.00 ? 99  TYR A HE1  2  
ATOM 2854  H HE2  . TYR A 1 96  ? 5.851   -9.821  -13.495 1.00 0.00 ? 99  TYR A HE2  2  
ATOM 2855  H HH   . TYR A 1 96  ? 3.864   -10.148 -15.039 1.00 0.00 ? 99  TYR A HH   2  
ATOM 2856  N N    . THR A 1 97  ? 5.553   -11.805 -6.036  1.00 0.00 ? 100 THR A N    2  
ATOM 2857  C CA   . THR A 1 97  ? 5.702   -12.668 -4.863  1.00 0.00 ? 100 THR A CA   2  
ATOM 2858  C C    . THR A 1 97  ? 4.409   -12.743 -4.037  1.00 0.00 ? 100 THR A C    2  
ATOM 2859  O O    . THR A 1 97  ? 4.037   -11.785 -3.349  1.00 0.00 ? 100 THR A O    2  
ATOM 2860  C CB   . THR A 1 97  ? 6.853   -12.177 -3.961  1.00 0.00 ? 100 THR A CB   2  
ATOM 2861  O OG1  . THR A 1 97  ? 8.002   -11.866 -4.765  1.00 0.00 ? 100 THR A OG1  2  
ATOM 2862  C CG2  . THR A 1 97  ? 7.226   -13.238 -2.931  1.00 0.00 ? 100 THR A CG2  2  
ATOM 2863  H H    . THR A 1 97  ? 6.235   -11.124 -6.209  1.00 0.00 ? 100 THR A H    2  
ATOM 2864  H HA   . THR A 1 97  ? 5.949   -13.659 -5.214  1.00 0.00 ? 100 THR A HA   2  
ATOM 2865  H HB   . THR A 1 97  ? 6.531   -11.287 -3.441  1.00 0.00 ? 100 THR A HB   2  
ATOM 2866  H HG1  . THR A 1 97  ? 8.519   -11.179 -4.331  1.00 0.00 ? 100 THR A HG1  2  
ATOM 2867  H HG21 . THR A 1 97  ? 7.552   -14.134 -3.437  1.00 0.00 ? 100 THR A HG21 2  
ATOM 2868  H HG22 . THR A 1 97  ? 6.364   -13.463 -2.318  1.00 0.00 ? 100 THR A HG22 2  
ATOM 2869  H HG23 . THR A 1 97  ? 8.024   -12.867 -2.306  1.00 0.00 ? 100 THR A HG23 2  
ATOM 2870  N N    . PRO A 1 98  ? 3.715   -13.894 -4.102  1.00 0.00 ? 101 PRO A N    2  
ATOM 2871  C CA   . PRO A 1 98  ? 2.435   -14.106 -3.415  1.00 0.00 ? 101 PRO A CA   2  
ATOM 2872  C C    . PRO A 1 98  ? 2.586   -14.149 -1.898  1.00 0.00 ? 101 PRO A C    2  
ATOM 2873  O O    . PRO A 1 98  ? 1.699   -13.721 -1.164  1.00 0.00 ? 101 PRO A O    2  
ATOM 2874  C CB   . PRO A 1 98  ? 1.956   -15.470 -3.940  1.00 0.00 ? 101 PRO A CB   2  
ATOM 2875  C CG   . PRO A 1 98  ? 2.804   -15.757 -5.132  1.00 0.00 ? 101 PRO A CG   2  
ATOM 2876  C CD   . PRO A 1 98  ? 4.114   -15.080 -4.870  1.00 0.00 ? 101 PRO A CD   2  
ATOM 2877  H HA   . PRO A 1 98  ? 1.718   -13.345 -3.679  1.00 0.00 ? 101 PRO A HA   2  
ATOM 2878  H HB2  . PRO A 1 98  ? 2.090   -16.219 -3.172  1.00 0.00 ? 101 PRO A HB2  2  
ATOM 2879  H HB3  . PRO A 1 98  ? 0.911   -15.406 -4.205  1.00 0.00 ? 101 PRO A HB3  2  
ATOM 2880  H HG2  . PRO A 1 98  ? 2.943   -16.822 -5.237  1.00 0.00 ? 101 PRO A HG2  2  
ATOM 2881  H HG3  . PRO A 1 98  ? 2.343   -15.348 -6.019  1.00 0.00 ? 101 PRO A HG3  2  
ATOM 2882  H HD2  . PRO A 1 98  ? 4.762   -15.720 -4.287  1.00 0.00 ? 101 PRO A HD2  2  
ATOM 2883  H HD3  . PRO A 1 98  ? 4.589   -14.799 -5.798  1.00 0.00 ? 101 PRO A HD3  2  
ATOM 2884  N N    . GLN A 1 99  ? 3.718   -14.668 -1.437  1.00 0.00 ? 102 GLN A N    2  
ATOM 2885  C CA   . GLN A 1 99  ? 3.984   -14.794 -0.007  1.00 0.00 ? 102 GLN A CA   2  
ATOM 2886  C C    . GLN A 1 99  ? 4.080   -13.422 0.656   1.00 0.00 ? 102 GLN A C    2  
ATOM 2887  O O    . GLN A 1 99  ? 3.707   -13.252 1.816   1.00 0.00 ? 102 GLN A O    2  
ATOM 2888  C CB   . GLN A 1 99  ? 5.283   -15.574 0.226   1.00 0.00 ? 102 GLN A CB   2  
ATOM 2889  C CG   . GLN A 1 99  ? 5.537   -15.928 1.683   1.00 0.00 ? 102 GLN A CG   2  
ATOM 2890  C CD   . GLN A 1 99  ? 4.517   -16.906 2.242   1.00 0.00 ? 102 GLN A CD   2  
ATOM 2891  O OE1  . GLN A 1 99  ? 4.193   -16.872 3.430   1.00 0.00 ? 102 GLN A OE1  2  
ATOM 2892  N NE2  . GLN A 1 99  ? 4.021   -17.802 1.401   1.00 0.00 ? 102 GLN A NE2  2  
ATOM 2893  H H    . GLN A 1 99  ? 4.387   -14.992 -2.080  1.00 0.00 ? 102 GLN A H    2  
ATOM 2894  H HA   . GLN A 1 99  ? 3.162   -15.337 0.436   1.00 0.00 ? 102 GLN A HA   2  
ATOM 2895  H HB2  . GLN A 1 99  ? 5.244   -16.492 -0.341  1.00 0.00 ? 102 GLN A HB2  2  
ATOM 2896  H HB3  . GLN A 1 99  ? 6.113   -14.978 -0.126  1.00 0.00 ? 102 GLN A HB3  2  
ATOM 2897  H HG2  . GLN A 1 99  ? 6.517   -16.372 1.765   1.00 0.00 ? 102 GLN A HG2  2  
ATOM 2898  H HG3  . GLN A 1 99  ? 5.504   -15.022 2.269   1.00 0.00 ? 102 GLN A HG3  2  
ATOM 2899  H HE21 . GLN A 1 99  ? 4.337   -17.791 0.471   1.00 0.00 ? 102 GLN A HE21 2  
ATOM 2900  H HE22 . GLN A 1 99  ? 3.355   -18.443 1.743   1.00 0.00 ? 102 GLN A HE22 2  
ATOM 2901  N N    . SER A 1 100 ? 4.576   -12.450 -0.091  1.00 0.00 ? 103 SER A N    2  
ATOM 2902  C CA   . SER A 1 100 ? 4.807   -11.121 0.448   1.00 0.00 ? 103 SER A CA   2  
ATOM 2903  C C    . SER A 1 100 ? 3.568   -10.236 0.319   1.00 0.00 ? 103 SER A C    2  
ATOM 2904  O O    . SER A 1 100 ? 3.311   -9.391  1.178   1.00 0.00 ? 103 SER A O    2  
ATOM 2905  C CB   . SER A 1 100 ? 5.986   -10.472 -0.277  1.00 0.00 ? 103 SER A CB   2  
ATOM 2906  O OG   . SER A 1 100 ? 7.117   -11.326 -0.274  1.00 0.00 ? 103 SER A OG   2  
ATOM 2907  H H    . SER A 1 100 ? 4.796   -12.631 -1.027  1.00 0.00 ? 103 SER A H    2  
ATOM 2908  H HA   . SER A 1 100 ? 5.054   -11.224 1.494   1.00 0.00 ? 103 SER A HA   2  
ATOM 2909  H HB2  . SER A 1 100 ? 5.707   -10.266 -1.300  1.00 0.00 ? 103 SER A HB2  2  
ATOM 2910  H HB3  . SER A 1 100 ? 6.245   -9.549  0.218   1.00 0.00 ? 103 SER A HB3  2  
ATOM 2911  H HG   . SER A 1 100 ? 7.696   -11.093 0.468   1.00 0.00 ? 103 SER A HG   2  
ATOM 2912  N N    . SER A 1 101 ? 2.794   -10.444 -0.738  1.00 0.00 ? 104 SER A N    2  
ATOM 2913  C CA   . SER A 1 101 ? 1.696   -9.543  -1.061  1.00 0.00 ? 104 SER A CA   2  
ATOM 2914  C C    . SER A 1 101 ? 0.372   -9.997  -0.434  1.00 0.00 ? 104 SER A C    2  
ATOM 2915  O O    . SER A 1 101 ? 0.186   -11.173 -0.103  1.00 0.00 ? 104 SER A O    2  
ATOM 2916  C CB   . SER A 1 101 ? 1.564   -9.412  -2.582  1.00 0.00 ? 104 SER A CB   2  
ATOM 2917  O OG   . SER A 1 101 ? 1.485   -10.683 -3.207  1.00 0.00 ? 104 SER A OG   2  
ATOM 2918  H H    . SER A 1 101 ? 2.949   -11.231 -1.301  1.00 0.00 ? 104 SER A H    2  
ATOM 2919  H HA   . SER A 1 101 ? 1.948   -8.573  -0.654  1.00 0.00 ? 104 SER A HA   2  
ATOM 2920  H HB2  . SER A 1 101 ? 0.670   -8.853  -2.816  1.00 0.00 ? 104 SER A HB2  2  
ATOM 2921  H HB3  . SER A 1 101 ? 2.425   -8.886  -2.972  1.00 0.00 ? 104 SER A HB3  2  
ATOM 2922  H HG   . SER A 1 101 ? 2.378   -11.027 -3.354  1.00 0.00 ? 104 SER A HG   2  
ATOM 2923  N N    . ILE A 1 102 ? -0.540  -9.043  -0.254  1.00 0.00 ? 105 ILE A N    2  
ATOM 2924  C CA   . ILE A 1 102 ? -1.851  -9.310  0.321   1.00 0.00 ? 105 ILE A CA   2  
ATOM 2925  C C    . ILE A 1 102 ? -2.953  -8.609  -0.468  1.00 0.00 ? 105 ILE A C    2  
ATOM 2926  O O    . ILE A 1 102 ? -2.730  -7.564  -1.085  1.00 0.00 ? 105 ILE A O    2  
ATOM 2927  C CB   . ILE A 1 102 ? -1.948  -8.845  1.792   1.00 0.00 ? 105 ILE A CB   2  
ATOM 2928  C CG1  . ILE A 1 102 ? -1.491  -7.385  1.913   1.00 0.00 ? 105 ILE A CG1  2  
ATOM 2929  C CG2  . ILE A 1 102 ? -1.137  -9.758  2.703   1.00 0.00 ? 105 ILE A CG2  2  
ATOM 2930  C CD1  . ILE A 1 102 ? -1.704  -6.772  3.280   1.00 0.00 ? 105 ILE A CD1  2  
ATOM 2931  H H    . ILE A 1 102 ? -0.320  -8.122  -0.517  1.00 0.00 ? 105 ILE A H    2  
ATOM 2932  H HA   . ILE A 1 102 ? -2.019  -10.375 0.290   1.00 0.00 ? 105 ILE A HA   2  
ATOM 2933  H HB   . ILE A 1 102 ? -2.981  -8.912  2.093   1.00 0.00 ? 105 ILE A HB   2  
ATOM 2934  H HG12 . ILE A 1 102 ? -0.438  -7.326  1.692   1.00 0.00 ? 105 ILE A HG12 2  
ATOM 2935  H HG13 . ILE A 1 102 ? -2.035  -6.790  1.196   1.00 0.00 ? 105 ILE A HG13 2  
ATOM 2936  H HG21 . ILE A 1 102 ? -0.125  -9.827  2.337   1.00 0.00 ? 105 ILE A HG21 2  
ATOM 2937  H HG22 . ILE A 1 102 ? -1.136  -9.356  3.704   1.00 0.00 ? 105 ILE A HG22 2  
ATOM 2938  H HG23 . ILE A 1 102 ? -1.582  -10.739 2.714   1.00 0.00 ? 105 ILE A HG23 2  
ATOM 2939  H HD11 . ILE A 1 102 ? -2.757  -6.777  3.518   1.00 0.00 ? 105 ILE A HD11 2  
ATOM 2940  H HD12 . ILE A 1 102 ? -1.166  -7.343  4.021   1.00 0.00 ? 105 ILE A HD12 2  
ATOM 2941  H HD13 . ILE A 1 102 ? -1.342  -5.756  3.278   1.00 0.00 ? 105 ILE A HD13 2  
ATOM 2942  N N    . ILE A 1 103 ? -4.138  -9.192  -0.435  1.00 0.00 ? 106 ILE A N    2  
ATOM 2943  C CA   . ILE A 1 103 ? -5.321  -8.596  -1.030  1.00 0.00 ? 106 ILE A CA   2  
ATOM 2944  C C    . ILE A 1 103 ? -6.368  -8.384  0.054   1.00 0.00 ? 106 ILE A C    2  
ATOM 2945  O O    . ILE A 1 103 ? -6.840  -9.336  0.673   1.00 0.00 ? 106 ILE A O    2  
ATOM 2946  C CB   . ILE A 1 103 ? -5.894  -9.477  -2.166  1.00 0.00 ? 106 ILE A CB   2  
ATOM 2947  C CG1  . ILE A 1 103 ? -5.016  -9.358  -3.413  1.00 0.00 ? 106 ILE A CG1  2  
ATOM 2948  C CG2  . ILE A 1 103 ? -7.336  -9.093  -2.485  1.00 0.00 ? 106 ILE A CG2  2  
ATOM 2949  C CD1  . ILE A 1 103 ? -5.424  -10.284 -4.539  1.00 0.00 ? 106 ILE A CD1  2  
ATOM 2950  H H    . ILE A 1 103 ? -4.226  -10.059 0.025   1.00 0.00 ? 106 ILE A H    2  
ATOM 2951  H HA   . ILE A 1 103 ? -5.040  -7.637  -1.445  1.00 0.00 ? 106 ILE A HA   2  
ATOM 2952  H HB   . ILE A 1 103 ? -5.886  -10.502 -1.832  1.00 0.00 ? 106 ILE A HB   2  
ATOM 2953  H HG12 . ILE A 1 103 ? -5.072  -8.345  -3.787  1.00 0.00 ? 106 ILE A HG12 2  
ATOM 2954  H HG13 . ILE A 1 103 ? -3.994  -9.585  -3.147  1.00 0.00 ? 106 ILE A HG13 2  
ATOM 2955  H HG21 . ILE A 1 103 ? -7.364  -8.086  -2.870  1.00 0.00 ? 106 ILE A HG21 2  
ATOM 2956  H HG22 . ILE A 1 103 ? -7.734  -9.772  -3.226  1.00 0.00 ? 106 ILE A HG22 2  
ATOM 2957  H HG23 . ILE A 1 103 ? -7.932  -9.152  -1.585  1.00 0.00 ? 106 ILE A HG23 2  
ATOM 2958  H HD11 . ILE A 1 103 ? -4.750  -10.157 -5.373  1.00 0.00 ? 106 ILE A HD11 2  
ATOM 2959  H HD12 . ILE A 1 103 ? -5.383  -11.308 -4.198  1.00 0.00 ? 106 ILE A HD12 2  
ATOM 2960  H HD13 . ILE A 1 103 ? -6.431  -10.049 -4.851  1.00 0.00 ? 106 ILE A HD13 2  
ATOM 2961  N N    . CYS A 1 104 ? -6.707  -7.136  0.304   1.00 0.00 ? 107 CYS A N    2  
ATOM 2962  C CA   . CYS A 1 104 ? -7.627  -6.812  1.376   1.00 0.00 ? 107 CYS A CA   2  
ATOM 2963  C C    . CYS A 1 104 ? -9.019  -6.579  0.812   1.00 0.00 ? 107 CYS A C    2  
ATOM 2964  O O    . CYS A 1 104 ? -9.173  -6.299  -0.376  1.00 0.00 ? 107 CYS A O    2  
ATOM 2965  C CB   . CYS A 1 104 ? -7.144  -5.571  2.131   1.00 0.00 ? 107 CYS A CB   2  
ATOM 2966  S SG   . CYS A 1 104 ? -7.375  -5.661  3.933   1.00 0.00 ? 107 CYS A SG   2  
ATOM 2967  H H    . CYS A 1 104 ? -6.347  -6.412  -0.258  1.00 0.00 ? 107 CYS A H    2  
ATOM 2968  H HA   . CYS A 1 104 ? -7.659  -7.651  2.055   1.00 0.00 ? 107 CYS A HA   2  
ATOM 2969  H HB2  . CYS A 1 104 ? -6.089  -5.429  1.945   1.00 0.00 ? 107 CYS A HB2  2  
ATOM 2970  H HB3  . CYS A 1 104 ? -7.690  -4.707  1.774   1.00 0.00 ? 107 CYS A HB3  2  
ATOM 2971  N N    . TYR A 1 105 ? -10.027 -6.703  1.655   1.00 0.00 ? 108 TYR A N    2  
ATOM 2972  C CA   . TYR A 1 105 ? -11.402 -6.516  1.231   1.00 0.00 ? 108 TYR A CA   2  
ATOM 2973  C C    . TYR A 1 105 ? -12.128 -5.589  2.193   1.00 0.00 ? 108 TYR A C    2  
ATOM 2974  O O    . TYR A 1 105 ? -11.733 -5.459  3.352   1.00 0.00 ? 108 TYR A O    2  
ATOM 2975  C CB   . TYR A 1 105 ? -12.124 -7.867  1.122   1.00 0.00 ? 108 TYR A CB   2  
ATOM 2976  C CG   . TYR A 1 105 ? -11.948 -8.770  2.327   1.00 0.00 ? 108 TYR A CG   2  
ATOM 2977  C CD1  . TYR A 1 105 ? -12.794 -8.677  3.428   1.00 0.00 ? 108 TYR A CD1  2  
ATOM 2978  C CD2  . TYR A 1 105 ? -10.938 -9.723  2.357   1.00 0.00 ? 108 TYR A CD2  2  
ATOM 2979  C CE1  . TYR A 1 105 ? -12.633 -9.506  4.523   1.00 0.00 ? 108 TYR A CE1  2  
ATOM 2980  C CE2  . TYR A 1 105 ? -10.772 -10.553 3.446   1.00 0.00 ? 108 TYR A CE2  2  
ATOM 2981  C CZ   . TYR A 1 105 ? -11.621 -10.443 4.526   1.00 0.00 ? 108 TYR A CZ   2  
ATOM 2982  O OH   . TYR A 1 105 ? -11.456 -11.272 5.613   1.00 0.00 ? 108 TYR A OH   2  
ATOM 2983  H H    . TYR A 1 105 ? -9.845  -6.914  2.595   1.00 0.00 ? 108 TYR A H    2  
ATOM 2984  H HA   . TYR A 1 105 ? -11.381 -6.053  0.257   1.00 0.00 ? 108 TYR A HA   2  
ATOM 2985  H HB2  . TYR A 1 105 ? -13.181 -7.691  0.997   1.00 0.00 ? 108 TYR A HB2  2  
ATOM 2986  H HB3  . TYR A 1 105 ? -11.750 -8.393  0.255   1.00 0.00 ? 108 TYR A HB3  2  
ATOM 2987  H HD1  . TYR A 1 105 ? -13.586 -7.943  3.423   1.00 0.00 ? 108 TYR A HD1  2  
ATOM 2988  H HD2  . TYR A 1 105 ? -10.273 -9.810  1.511   1.00 0.00 ? 108 TYR A HD2  2  
ATOM 2989  H HE1  . TYR A 1 105 ? -13.298 -9.419  5.370   1.00 0.00 ? 108 TYR A HE1  2  
ATOM 2990  H HE2  . TYR A 1 105 ? -9.980  -11.287 3.447   1.00 0.00 ? 108 TYR A HE2  2  
ATOM 2991  H HH   . TYR A 1 105 ? -10.519 -11.320 5.836   1.00 0.00 ? 108 TYR A HH   2  
ATOM 2992  N N    . GLY A 1 106 ? -13.171 -4.934  1.707   1.00 0.00 ? 109 GLY A N    2  
ATOM 2993  C CA   . GLY A 1 106 ? -13.922 -4.016  2.537   1.00 0.00 ? 109 GLY A CA   2  
ATOM 2994  C C    . GLY A 1 106 ? -13.832 -2.589  2.039   1.00 0.00 ? 109 GLY A C    2  
ATOM 2995  O O    . GLY A 1 106 ? -14.127 -2.314  0.875   1.00 0.00 ? 109 GLY A O    2  
ATOM 2996  H H    . GLY A 1 106 ? -13.433 -5.070  0.773   1.00 0.00 ? 109 GLY A H    2  
ATOM 2997  H HA2  . GLY A 1 106 ? -14.958 -4.319  2.548   1.00 0.00 ? 109 GLY A HA2  2  
ATOM 2998  H HA3  . GLY A 1 106 ? -13.534 -4.060  3.543   1.00 0.00 ? 109 GLY A HA3  2  
ATOM 2999  N N    . GLN A 1 107 ? -13.412 -1.689  2.914   1.00 0.00 ? 110 GLN A N    2  
ATOM 3000  C CA   . GLN A 1 107 ? -13.338 -0.271  2.585   1.00 0.00 ? 110 GLN A CA   2  
ATOM 3001  C C    . GLN A 1 107 ? -11.903 0.142   2.282   1.00 0.00 ? 110 GLN A C    2  
ATOM 3002  O O    . GLN A 1 107 ? -10.964 -0.321  2.934   1.00 0.00 ? 110 GLN A O    2  
ATOM 3003  C CB   . GLN A 1 107 ? -13.888 0.565   3.742   1.00 0.00 ? 110 GLN A CB   2  
ATOM 3004  C CG   . GLN A 1 107 ? -15.368 0.338   4.012   1.00 0.00 ? 110 GLN A CG   2  
ATOM 3005  C CD   . GLN A 1 107 ? -16.243 0.694   2.828   1.00 0.00 ? 110 GLN A CD   2  
ATOM 3006  O OE1  . GLN A 1 107 ? -16.543 -0.148  1.981   1.00 0.00 ? 110 GLN A OE1  2  
ATOM 3007  N NE2  . GLN A 1 107 ? -16.642 1.952   2.752   1.00 0.00 ? 110 GLN A NE2  2  
ATOM 3008  H H    . GLN A 1 107 ? -13.138 -1.984  3.807   1.00 0.00 ? 110 GLN A H    2  
ATOM 3009  H HA   . GLN A 1 107 ? -13.944 -0.102  1.711   1.00 0.00 ? 110 GLN A HA   2  
ATOM 3010  H HB2  . GLN A 1 107 ? -13.339 0.319   4.639   1.00 0.00 ? 110 GLN A HB2  2  
ATOM 3011  H HB3  . GLN A 1 107 ? -13.741 1.612   3.515   1.00 0.00 ? 110 GLN A HB3  2  
ATOM 3012  H HG2  . GLN A 1 107 ? -15.522 -0.702  4.250   1.00 0.00 ? 110 GLN A HG2  2  
ATOM 3013  H HG3  . GLN A 1 107 ? -15.665 0.946   4.853   1.00 0.00 ? 110 GLN A HG3  2  
ATOM 3014  H HE21 . GLN A 1 107 ? -16.347 2.577   3.453   1.00 0.00 ? 110 GLN A HE21 2  
ATOM 3015  H HE22 . GLN A 1 107 ? -17.231 2.211   2.004   1.00 0.00 ? 110 GLN A HE22 2  
ATOM 3016  N N    . LEU A 1 108 ? -11.746 1.011   1.288   1.00 0.00 ? 111 LEU A N    2  
ATOM 3017  C CA   . LEU A 1 108 ? -10.434 1.496   0.877   1.00 0.00 ? 111 LEU A CA   2  
ATOM 3018  C C    . LEU A 1 108 ? -9.761  2.261   2.012   1.00 0.00 ? 111 LEU A C    2  
ATOM 3019  O O    . LEU A 1 108 ? -10.085 3.420   2.280   1.00 0.00 ? 111 LEU A O    2  
ATOM 3020  C CB   . LEU A 1 108 ? -10.575 2.395   -0.361  1.00 0.00 ? 111 LEU A CB   2  
ATOM 3021  C CG   . LEU A 1 108 ? -9.289  3.081   -0.849  1.00 0.00 ? 111 LEU A CG   2  
ATOM 3022  C CD1  . LEU A 1 108 ? -8.262  2.059   -1.312  1.00 0.00 ? 111 LEU A CD1  2  
ATOM 3023  C CD2  . LEU A 1 108 ? -9.603  4.061   -1.973  1.00 0.00 ? 111 LEU A CD2  2  
ATOM 3024  H H    . LEU A 1 108 ? -12.539 1.341   0.818   1.00 0.00 ? 111 LEU A H    2  
ATOM 3025  H HA   . LEU A 1 108 ? -9.829  0.639   0.627   1.00 0.00 ? 111 LEU A HA   2  
ATOM 3026  H HB2  . LEU A 1 108 ? -10.963 1.794   -1.169  1.00 0.00 ? 111 LEU A HB2  2  
ATOM 3027  H HB3  . LEU A 1 108 ? -11.297 3.163   -0.132  1.00 0.00 ? 111 LEU A HB3  2  
ATOM 3028  H HG   . LEU A 1 108 ? -8.857  3.640   -0.032  1.00 0.00 ? 111 LEU A HG   2  
ATOM 3029  H HD11 . LEU A 1 108 ? -8.684  1.453   -2.099  1.00 0.00 ? 111 LEU A HD11 2  
ATOM 3030  H HD12 . LEU A 1 108 ? -7.386  2.573   -1.686  1.00 0.00 ? 111 LEU A HD12 2  
ATOM 3031  H HD13 . LEU A 1 108 ? -7.979  1.428   -0.484  1.00 0.00 ? 111 LEU A HD13 2  
ATOM 3032  H HD21 . LEU A 1 108 ? -10.073 3.534   -2.791  1.00 0.00 ? 111 LEU A HD21 2  
ATOM 3033  H HD22 . LEU A 1 108 ? -10.271 4.827   -1.608  1.00 0.00 ? 111 LEU A HD22 2  
ATOM 3034  H HD23 . LEU A 1 108 ? -8.687  4.518   -2.318  1.00 0.00 ? 111 LEU A HD23 2  
ATOM 3035  N N    . GLY A 1 109 ? -8.827  1.599   2.676   1.00 0.00 ? 112 GLY A N    2  
ATOM 3036  C CA   . GLY A 1 109 ? -8.135  2.211   3.788   1.00 0.00 ? 112 GLY A CA   2  
ATOM 3037  C C    . GLY A 1 109 ? -8.129  1.330   5.019   1.00 0.00 ? 112 GLY A C    2  
ATOM 3038  O O    . GLY A 1 109 ? -7.398  1.593   5.972   1.00 0.00 ? 112 GLY A O    2  
ATOM 3039  H H    . GLY A 1 109 ? -8.605  0.686   2.405   1.00 0.00 ? 112 GLY A H    2  
ATOM 3040  H HA2  . GLY A 1 109 ? -7.113  2.408   3.495   1.00 0.00 ? 112 GLY A HA2  2  
ATOM 3041  H HA3  . GLY A 1 109 ? -8.618  3.148   4.029   1.00 0.00 ? 112 GLY A HA3  2  
ATOM 3042  N N    . SER A 1 110 ? -8.946  0.284   5.005   1.00 0.00 ? 113 SER A N    2  
ATOM 3043  C CA   . SER A 1 110 ? -9.013  -0.631  6.130   1.00 0.00 ? 113 SER A CA   2  
ATOM 3044  C C    . SER A 1 110 ? -8.198  -1.893  5.847   1.00 0.00 ? 113 SER A C    2  
ATOM 3045  O O    . SER A 1 110 ? -8.461  -2.617  4.883   1.00 0.00 ? 113 SER A O    2  
ATOM 3046  C CB   . SER A 1 110 ? -10.468 -0.987  6.441   1.00 0.00 ? 113 SER A CB   2  
ATOM 3047  O OG   . SER A 1 110 ? -10.576 -1.700  7.663   1.00 0.00 ? 113 SER A OG   2  
ATOM 3048  H H    . SER A 1 110 ? -9.520  0.126   4.224   1.00 0.00 ? 113 SER A H    2  
ATOM 3049  H HA   . SER A 1 110 ? -8.587  -0.130  6.984   1.00 0.00 ? 113 SER A HA   2  
ATOM 3050  H HB2  . SER A 1 110 ? -11.048 -0.080  6.519   1.00 0.00 ? 113 SER A HB2  2  
ATOM 3051  H HB3  . SER A 1 110 ? -10.864 -1.598  5.644   1.00 0.00 ? 113 SER A HB3  2  
ATOM 3052  H HG   . SER A 1 110 ? -11.201 -1.238  8.248   1.00 0.00 ? 113 SER A HG   2  
ATOM 3053  N N    . PHE A 1 111 ? -7.203  -2.131  6.687   1.00 0.00 ? 114 PHE A N    2  
ATOM 3054  C CA   . PHE A 1 111 ? -6.344  -3.305  6.585   1.00 0.00 ? 114 PHE A CA   2  
ATOM 3055  C C    . PHE A 1 111 ? -6.619  -4.241  7.757   1.00 0.00 ? 114 PHE A C    2  
ATOM 3056  O O    . PHE A 1 111 ? -5.725  -4.946  8.229   1.00 0.00 ? 114 PHE A O    2  
ATOM 3057  C CB   . PHE A 1 111 ? -4.867  -2.897  6.617   1.00 0.00 ? 114 PHE A CB   2  
ATOM 3058  C CG   . PHE A 1 111 ? -4.436  -1.973  5.507   1.00 0.00 ? 114 PHE A CG   2  
ATOM 3059  C CD1  . PHE A 1 111 ? -4.661  -0.606  5.593   1.00 0.00 ? 114 PHE A CD1  2  
ATOM 3060  C CD2  . PHE A 1 111 ? -3.780  -2.469  4.391   1.00 0.00 ? 114 PHE A CD2  2  
ATOM 3061  C CE1  . PHE A 1 111 ? -4.243  0.246   4.590   1.00 0.00 ? 114 PHE A CE1  2  
ATOM 3062  C CE2  . PHE A 1 111 ? -3.365  -1.619  3.383   1.00 0.00 ? 114 PHE A CE2  2  
ATOM 3063  C CZ   . PHE A 1 111 ? -3.594  -0.261  3.485   1.00 0.00 ? 114 PHE A CZ   2  
ATOM 3064  H H    . PHE A 1 111 ? -7.034  -1.489  7.414   1.00 0.00 ? 114 PHE A H    2  
ATOM 3065  H HA   . PHE A 1 111 ? -6.560  -3.812  5.657   1.00 0.00 ? 114 PHE A HA   2  
ATOM 3066  H HB2  . PHE A 1 111 ? -4.664  -2.398  7.553   1.00 0.00 ? 114 PHE A HB2  2  
ATOM 3067  H HB3  . PHE A 1 111 ? -4.262  -3.789  6.562   1.00 0.00 ? 114 PHE A HB3  2  
ATOM 3068  H HD1  . PHE A 1 111 ? -5.170  -0.205  6.457   1.00 0.00 ? 114 PHE A HD1  2  
ATOM 3069  H HD2  . PHE A 1 111 ? -3.602  -3.529  4.307   1.00 0.00 ? 114 PHE A HD2  2  
ATOM 3070  H HE1  . PHE A 1 111 ? -4.425  1.308   4.671   1.00 0.00 ? 114 PHE A HE1  2  
ATOM 3071  H HE2  . PHE A 1 111 ? -2.858  -2.017  2.516   1.00 0.00 ? 114 PHE A HE2  2  
ATOM 3072  H HZ   . PHE A 1 111 ? -3.266  0.404   2.699   1.00 0.00 ? 114 PHE A HZ   2  
ATOM 3073  N N    . SER A 1 112 ? -7.860  -4.233  8.223   1.00 0.00 ? 115 SER A N    2  
ATOM 3074  C CA   . SER A 1 112 ? -8.237  -4.952  9.430   1.00 0.00 ? 115 SER A CA   2  
ATOM 3075  C C    . SER A 1 112 ? -8.022  -6.459  9.288   1.00 0.00 ? 115 SER A C    2  
ATOM 3076  O O    . SER A 1 112 ? -7.573  -7.118  10.227  1.00 0.00 ? 115 SER A O    2  
ATOM 3077  C CB   . SER A 1 112 ? -9.692  -4.647  9.777   1.00 0.00 ? 115 SER A CB   2  
ATOM 3078  O OG   . SER A 1 112 ? -9.885  -3.247  9.946   1.00 0.00 ? 115 SER A OG   2  
ATOM 3079  H H    . SER A 1 112 ? -8.546  -3.737  7.731   1.00 0.00 ? 115 SER A H    2  
ATOM 3080  H HA   . SER A 1 112 ? -7.609  -4.592  10.232  1.00 0.00 ? 115 SER A HA   2  
ATOM 3081  H HB2  . SER A 1 112 ? -10.332 -4.994  8.980   1.00 0.00 ? 115 SER A HB2  2  
ATOM 3082  H HB3  . SER A 1 112 ? -9.955  -5.148  10.697  1.00 0.00 ? 115 SER A HB3  2  
ATOM 3083  H HG   . SER A 1 112 ? -10.277 -2.877  9.141   1.00 0.00 ? 115 SER A HG   2  
ATOM 3084  N N    . ASN A 1 113 ? -8.343  -7.001  8.123   1.00 0.00 ? 116 ASN A N    2  
ATOM 3085  C CA   . ASN A 1 113 ? -8.093  -8.409  7.848   1.00 0.00 ? 116 ASN A CA   2  
ATOM 3086  C C    . ASN A 1 113 ? -7.957  -8.640  6.354   1.00 0.00 ? 116 ASN A C    2  
ATOM 3087  O O    . ASN A 1 113 ? -8.949  -8.798  5.641   1.00 0.00 ? 116 ASN A O    2  
ATOM 3088  C CB   . ASN A 1 113 ? -9.205  -9.298  8.415   1.00 0.00 ? 116 ASN A CB   2  
ATOM 3089  C CG   . ASN A 1 113 ? -8.849  -10.772 8.335   1.00 0.00 ? 116 ASN A CG   2  
ATOM 3090  O OD1  . ASN A 1 113 ? -7.678  -11.148 8.401   1.00 0.00 ? 116 ASN A OD1  2  
ATOM 3091  N ND2  . ASN A 1 113 ? -9.854  -11.620 8.198   1.00 0.00 ? 116 ASN A ND2  2  
ATOM 3092  H H    . ASN A 1 113 ? -8.757  -6.438  7.425   1.00 0.00 ? 116 ASN A H    2  
ATOM 3093  H HA   . ASN A 1 113 ? -7.161  -8.673  8.322   1.00 0.00 ? 116 ASN A HA   2  
ATOM 3094  H HB2  . ASN A 1 113 ? -9.374  -9.039  9.452   1.00 0.00 ? 116 ASN A HB2  2  
ATOM 3095  H HB3  . ASN A 1 113 ? -10.113 -9.133  7.855   1.00 0.00 ? 116 ASN A HB3  2  
ATOM 3096  H HD21 . ASN A 1 113 ? -10.768 -11.260 8.158   1.00 0.00 ? 116 ASN A HD21 2  
ATOM 3097  H HD22 . ASN A 1 113 ? -9.647  -12.579 8.143   1.00 0.00 ? 116 ASN A HD22 2  
ATOM 3098  N N    . CYS A 1 114 ? -6.725  -8.655  5.886   1.00 0.00 ? 117 CYS A N    2  
ATOM 3099  C CA   . CYS A 1 114 ? -6.449  -8.823  4.473   1.00 0.00 ? 117 CYS A CA   2  
ATOM 3100  C C    . CYS A 1 114 ? -6.086  -10.274 4.176   1.00 0.00 ? 117 CYS A C    2  
ATOM 3101  O O    . CYS A 1 114 ? -5.554  -10.978 5.036   1.00 0.00 ? 117 CYS A O    2  
ATOM 3102  C CB   . CYS A 1 114 ? -5.309  -7.893  4.060   1.00 0.00 ? 117 CYS A CB   2  
ATOM 3103  S SG   . CYS A 1 114 ? -5.528  -6.166  4.609   1.00 0.00 ? 117 CYS A SG   2  
ATOM 3104  H H    . CYS A 1 114 ? -5.977  -8.554  6.508   1.00 0.00 ? 117 CYS A H    2  
ATOM 3105  H HA   . CYS A 1 114 ? -7.341  -8.562  3.927   1.00 0.00 ? 117 CYS A HA   2  
ATOM 3106  H HB2  . CYS A 1 114 ? -4.387  -8.260  4.482   1.00 0.00 ? 117 CYS A HB2  2  
ATOM 3107  H HB3  . CYS A 1 114 ? -5.230  -7.885  2.982   1.00 0.00 ? 117 CYS A HB3  2  
ATOM 3108  N N    . SER A 1 115 ? -6.371  -10.718 2.962   1.00 0.00 ? 118 SER A N    2  
ATOM 3109  C CA   . SER A 1 115 ? -6.124  -12.094 2.575   1.00 0.00 ? 118 SER A CA   2  
ATOM 3110  C C    . SER A 1 115 ? -4.757  -12.240 1.920   1.00 0.00 ? 118 SER A C    2  
ATOM 3111  O O    . SER A 1 115 ? -4.364  -11.419 1.090   1.00 0.00 ? 118 SER A O    2  
ATOM 3112  C CB   . SER A 1 115 ? -7.216  -12.568 1.617   1.00 0.00 ? 118 SER A CB   2  
ATOM 3113  O OG   . SER A 1 115 ? -8.493  -12.501 2.231   1.00 0.00 ? 118 SER A OG   2  
ATOM 3114  H H    . SER A 1 115 ? -6.749  -10.100 2.299   1.00 0.00 ? 118 SER A H    2  
ATOM 3115  H HA   . SER A 1 115 ? -6.154  -12.702 3.468   1.00 0.00 ? 118 SER A HA   2  
ATOM 3116  H HB2  . SER A 1 115 ? -7.220  -11.943 0.737   1.00 0.00 ? 118 SER A HB2  2  
ATOM 3117  H HB3  . SER A 1 115 ? -7.023  -13.591 1.330   1.00 0.00 ? 118 SER A HB3  2  
ATOM 3118  H HG   . SER A 1 115 ? -9.172  -12.756 1.586   1.00 0.00 ? 118 SER A HG   2  
ATOM 3119  N N    . HIS A 1 116 ? -4.032  -13.279 2.317   1.00 0.00 ? 119 HIS A N    2  
ATOM 3120  C CA   . HIS A 1 116 ? -2.755  -13.616 1.701   1.00 0.00 ? 119 HIS A CA   2  
ATOM 3121  C C    . HIS A 1 116 ? -2.965  -13.837 0.205   1.00 0.00 ? 119 HIS A C    2  
ATOM 3122  O O    . HIS A 1 116 ? -3.812  -14.636 -0.192  1.00 0.00 ? 119 HIS A O    2  
ATOM 3123  C CB   . HIS A 1 116 ? -2.188  -14.876 2.365   1.00 0.00 ? 119 HIS A CB   2  
ATOM 3124  C CG   . HIS A 1 116 ? -0.782  -15.216 1.973   1.00 0.00 ? 119 HIS A CG   2  
ATOM 3125  N ND1  . HIS A 1 116 ? 0.291   -15.092 2.833   1.00 0.00 ? 119 HIS A ND1  2  
ATOM 3126  C CD2  . HIS A 1 116 ? -0.276  -15.712 0.819   1.00 0.00 ? 119 HIS A CD2  2  
ATOM 3127  C CE1  . HIS A 1 116 ? 1.388   -15.494 2.225   1.00 0.00 ? 119 HIS A CE1  2  
ATOM 3128  N NE2  . HIS A 1 116 ? 1.072   -15.878 1.004   1.00 0.00 ? 119 HIS A NE2  2  
ATOM 3129  H H    . HIS A 1 116 ? -4.367  -13.837 3.051   1.00 0.00 ? 119 HIS A H    2  
ATOM 3130  H HA   . HIS A 1 116 ? -2.073  -12.792 1.848   1.00 0.00 ? 119 HIS A HA   2  
ATOM 3131  H HB2  . HIS A 1 116 ? -2.207  -14.745 3.435   1.00 0.00 ? 119 HIS A HB2  2  
ATOM 3132  H HB3  . HIS A 1 116 ? -2.816  -15.716 2.104   1.00 0.00 ? 119 HIS A HB3  2  
ATOM 3133  H HD1  . HIS A 1 116 ? 0.255   -14.764 3.763   1.00 0.00 ? 119 HIS A HD1  2  
ATOM 3134  H HD2  . HIS A 1 116 ? -0.832  -15.930 -0.083  1.00 0.00 ? 119 HIS A HD2  2  
ATOM 3135  H HE1  . HIS A 1 116 ? 2.379   -15.503 2.653   1.00 0.00 ? 119 HIS A HE1  2  
ATOM 3136  N N    . SER A 1 117 ? -2.207  -13.124 -0.617  1.00 0.00 ? 120 SER A N    2  
ATOM 3137  C CA   . SER A 1 117 ? -2.420  -13.145 -2.058  1.00 0.00 ? 120 SER A CA   2  
ATOM 3138  C C    . SER A 1 117 ? -2.022  -14.496 -2.649  1.00 0.00 ? 120 SER A C    2  
ATOM 3139  O O    . SER A 1 117 ? -0.864  -14.725 -2.984  1.00 0.00 ? 120 SER A O    2  
ATOM 3140  C CB   . SER A 1 117 ? -1.633  -12.012 -2.726  1.00 0.00 ? 120 SER A CB   2  
ATOM 3141  O OG   . SER A 1 117 ? -1.914  -11.933 -4.113  1.00 0.00 ? 120 SER A OG   2  
ATOM 3142  H H    . SER A 1 117 ? -1.477  -12.578 -0.250  1.00 0.00 ? 120 SER A H    2  
ATOM 3143  H HA   . SER A 1 117 ? -3.473  -12.987 -2.234  1.00 0.00 ? 120 SER A HA   2  
ATOM 3144  H HB2  . SER A 1 117 ? -1.905  -11.071 -2.267  1.00 0.00 ? 120 SER A HB2  2  
ATOM 3145  H HB3  . SER A 1 117 ? -0.575  -12.183 -2.593  1.00 0.00 ? 120 SER A HB3  2  
ATOM 3146  H HG   . SER A 1 117 ? -1.090  -12.010 -4.605  1.00 0.00 ? 120 SER A HG   2  
ATOM 3147  N N    . ARG A 1 118 ? -2.990  -15.394 -2.761  1.00 0.00 ? 121 ARG A N    2  
ATOM 3148  C CA   . ARG A 1 118 ? -2.748  -16.712 -3.323  1.00 0.00 ? 121 ARG A CA   2  
ATOM 3149  C C    . ARG A 1 118 ? -2.965  -16.706 -4.829  1.00 0.00 ? 121 ARG A C    2  
ATOM 3150  O O    . ARG A 1 118 ? -3.736  -17.506 -5.360  1.00 0.00 ? 121 ARG A O    2  
ATOM 3151  C CB   . ARG A 1 118 ? -3.657  -17.757 -2.675  1.00 0.00 ? 121 ARG A CB   2  
ATOM 3152  C CG   . ARG A 1 118 ? -3.404  -17.961 -1.190  1.00 0.00 ? 121 ARG A CG   2  
ATOM 3153  C CD   . ARG A 1 118 ? -1.936  -18.243 -0.902  1.00 0.00 ? 121 ARG A CD   2  
ATOM 3154  N NE   . ARG A 1 118 ? -1.390  -19.284 -1.772  1.00 0.00 ? 121 ARG A NE   2  
ATOM 3155  C CZ   . ARG A 1 118 ? -0.517  -20.199 -1.374  1.00 0.00 ? 121 ARG A CZ   2  
ATOM 3156  N NH1  . ARG A 1 118 ? -0.180  -20.282 -0.096  1.00 0.00 ? 121 ARG A NH1  2  
ATOM 3157  N NH2  . ARG A 1 118 ? -0.008  -21.048 -2.250  1.00 0.00 ? 121 ARG A NH2  2  
ATOM 3158  H H    . ARG A 1 118 ? -3.889  -15.165 -2.448  1.00 0.00 ? 121 ARG A H    2  
ATOM 3159  H HA   . ARG A 1 118 ? -1.720  -16.971 -3.121  1.00 0.00 ? 121 ARG A HA   2  
ATOM 3160  H HB2  . ARG A 1 118 ? -4.682  -17.450 -2.804  1.00 0.00 ? 121 ARG A HB2  2  
ATOM 3161  H HB3  . ARG A 1 118 ? -3.510  -18.702 -3.176  1.00 0.00 ? 121 ARG A HB3  2  
ATOM 3162  H HG2  . ARG A 1 118 ? -3.698  -17.069 -0.660  1.00 0.00 ? 121 ARG A HG2  2  
ATOM 3163  H HG3  . ARG A 1 118 ? -3.996  -18.799 -0.847  1.00 0.00 ? 121 ARG A HG3  2  
ATOM 3164  H HD2  . ARG A 1 118 ? -1.373  -17.333 -1.050  1.00 0.00 ? 121 ARG A HD2  2  
ATOM 3165  H HD3  . ARG A 1 118 ? -1.840  -18.559 0.126   1.00 0.00 ? 121 ARG A HD3  2  
ATOM 3166  H HE   . ARG A 1 118 ? -1.671  -19.278 -2.722  1.00 0.00 ? 121 ARG A HE   2  
ATOM 3167  H HH12 . ARG A 1 118 ? 0.666   -20.768 0.176   1.00 0.00 ? 121 ARG A HH12 2  
ATOM 3168  H HH21 . ARG A 1 118 ? -0.282  -21.001 -3.216  1.00 0.00 ? 121 ARG A HH21 2  
ATOM 3169  H HH22 . ARG A 1 118 ? 0.670   -21.739 -1.957  1.00 0.00 ? 121 ARG A HH22 2  
ATOM 3170  N N    . ASN A 1 119 ? -2.296  -15.787 -5.506  1.00 0.00 ? 122 ASN A N    2  
ATOM 3171  C CA   . ASN A 1 119 ? -2.354  -15.704 -6.957  1.00 0.00 ? 122 ASN A CA   2  
ATOM 3172  C C    . ASN A 1 119 ? -1.117  -14.979 -7.471  1.00 0.00 ? 122 ASN A C    2  
ATOM 3173  O O    . ASN A 1 119 ? -0.550  -14.138 -6.775  1.00 0.00 ? 122 ASN A O    2  
ATOM 3174  C CB   . ASN A 1 119 ? -3.624  -14.978 -7.428  1.00 0.00 ? 122 ASN A CB   2  
ATOM 3175  C CG   . ASN A 1 119 ? -3.601  -13.489 -7.131  1.00 0.00 ? 122 ASN A CG   2  
ATOM 3176  O OD1  . ASN A 1 119 ? -3.107  -12.692 -7.930  1.00 0.00 ? 122 ASN A OD1  2  
ATOM 3177  N ND2  . ASN A 1 119 ? -4.155  -13.105 -5.996  1.00 0.00 ? 122 ASN A ND2  2  
ATOM 3178  H H    . ASN A 1 119 ? -1.736  -15.145 -5.014  1.00 0.00 ? 122 ASN A H    2  
ATOM 3179  H HA   . ASN A 1 119 ? -2.356  -16.711 -7.347  1.00 0.00 ? 122 ASN A HA   2  
ATOM 3180  H HB2  . ASN A 1 119 ? -3.731  -15.107 -8.493  1.00 0.00 ? 122 ASN A HB2  2  
ATOM 3181  H HB3  . ASN A 1 119 ? -4.479  -15.409 -6.931  1.00 0.00 ? 122 ASN A HB3  2  
ATOM 3182  H HD21 . ASN A 1 119 ? -4.550  -13.790 -5.419  1.00 0.00 ? 122 ASN A HD21 2  
ATOM 3183  H HD22 . ASN A 1 119 ? -4.141  -12.150 -5.774  1.00 0.00 ? 122 ASN A HD22 2  
ATOM 3184  N N    . ASP A 1 120 ? -0.700  -15.313 -8.682  1.00 0.00 ? 123 ASP A N    2  
ATOM 3185  C CA   . ASP A 1 120 ? 0.483   -14.708 -9.282  1.00 0.00 ? 123 ASP A CA   2  
ATOM 3186  C C    . ASP A 1 120 ? 0.094   -13.596 -10.252 1.00 0.00 ? 123 ASP A C    2  
ATOM 3187  O O    . ASP A 1 120 ? 0.862   -13.231 -11.141 1.00 0.00 ? 123 ASP A O    2  
ATOM 3188  C CB   . ASP A 1 120 ? 1.302   -15.777 -10.011 1.00 0.00 ? 123 ASP A CB   2  
ATOM 3189  C CG   . ASP A 1 120 ? 0.510   -16.450 -11.113 1.00 0.00 ? 123 ASP A CG   2  
ATOM 3190  O OD1  . ASP A 1 120 ? -0.357  -17.291 -10.798 1.00 0.00 ? 123 ASP A OD1  2  
ATOM 3191  O OD2  . ASP A 1 120 ? 0.746   -16.137 -12.297 1.00 0.00 ? 123 ASP A OD2  2  
ATOM 3192  H H    . ASP A 1 120 ? -1.191  -15.999 -9.189  1.00 0.00 ? 123 ASP A H    2  
ATOM 3193  H HA   . ASP A 1 120 ? 1.079   -14.288 -8.488  1.00 0.00 ? 123 ASP A HA   2  
ATOM 3194  H HB2  . ASP A 1 120 ? 2.174   -15.315 -10.450 1.00 0.00 ? 123 ASP A HB2  2  
ATOM 3195  H HB3  . ASP A 1 120 ? 1.615   -16.531 -9.303  1.00 0.00 ? 123 ASP A HB3  2  
ATOM 3196  N N    . MET A 1 121 ? -1.099  -13.053 -10.067 1.00 0.00 ? 124 MET A N    2  
ATOM 3197  C CA   . MET A 1 121 ? -1.602  -11.990 -10.929 1.00 0.00 ? 124 MET A CA   2  
ATOM 3198  C C    . MET A 1 121 ? -1.633  -10.675 -10.164 1.00 0.00 ? 124 MET A C    2  
ATOM 3199  O O    . MET A 1 121 ? -2.294  -9.717  -10.567 1.00 0.00 ? 124 MET A O    2  
ATOM 3200  C CB   . MET A 1 121 ? -3.008  -12.327 -11.449 1.00 0.00 ? 124 MET A CB   2  
ATOM 3201  C CG   . MET A 1 121 ? -3.086  -13.625 -12.240 1.00 0.00 ? 124 MET A CG   2  
ATOM 3202  S SD   . MET A 1 121 ? -4.731  -13.941 -12.908 1.00 0.00 ? 124 MET A SD   2  
ATOM 3203  C CE   . MET A 1 121 ? -4.915  -12.545 -14.015 1.00 0.00 ? 124 MET A CE   2  
ATOM 3204  H H    . MET A 1 121 ? -1.653  -13.360 -9.319  1.00 0.00 ? 124 MET A H    2  
ATOM 3205  H HA   . MET A 1 121 ? -0.928  -11.893 -11.766 1.00 0.00 ? 124 MET A HA   2  
ATOM 3206  H HB2  . MET A 1 121 ? -3.679  -12.404 -10.605 1.00 0.00 ? 124 MET A HB2  2  
ATOM 3207  H HB3  . MET A 1 121 ? -3.340  -11.521 -12.086 1.00 0.00 ? 124 MET A HB3  2  
ATOM 3208  H HG2  . MET A 1 121 ? -2.388  -13.572 -13.061 1.00 0.00 ? 124 MET A HG2  2  
ATOM 3209  H HG3  . MET A 1 121 ? -2.812  -14.445 -11.591 1.00 0.00 ? 124 MET A HG3  2  
ATOM 3210  H HE1  . MET A 1 121 ? -4.875  -11.629 -13.447 1.00 0.00 ? 124 MET A HE1  2  
ATOM 3211  H HE2  . MET A 1 121 ? -4.115  -12.555 -14.741 1.00 0.00 ? 124 MET A HE2  2  
ATOM 3212  H HE3  . MET A 1 121 ? -5.865  -12.612 -14.525 1.00 0.00 ? 124 MET A HE3  2  
ATOM 3213  N N    . CYS A 1 122 ? -0.907  -10.637 -9.062  1.00 0.00 ? 125 CYS A N    2  
ATOM 3214  C CA   . CYS A 1 122 ? -0.888  -9.466  -8.200  1.00 0.00 ? 125 CYS A CA   2  
ATOM 3215  C C    . CYS A 1 122 ? 0.113   -8.431  -8.692  1.00 0.00 ? 125 CYS A C    2  
ATOM 3216  O O    . CYS A 1 122 ? 1.243   -8.758  -9.061  1.00 0.00 ? 125 CYS A O    2  
ATOM 3217  C CB   . CYS A 1 122 ? -0.561  -9.861  -6.757  1.00 0.00 ? 125 CYS A CB   2  
ATOM 3218  S SG   . CYS A 1 122 ? -0.301  -8.444  -5.637  1.00 0.00 ? 125 CYS A SG   2  
ATOM 3219  H H    . CYS A 1 122 ? -0.365  -11.418 -8.823  1.00 0.00 ? 125 CYS A H    2  
ATOM 3220  H HA   . CYS A 1 122 ? -1.873  -9.026  -8.223  1.00 0.00 ? 125 CYS A HA   2  
ATOM 3221  H HB2  . CYS A 1 122 ? -1.373  -10.450 -6.357  1.00 0.00 ? 125 CYS A HB2  2  
ATOM 3222  H HB3  . CYS A 1 122 ? 0.342   -10.452 -6.751  1.00 0.00 ? 125 CYS A HB3  2  
ATOM 3223  N N    . HIS A 1 123 ? -0.321  -7.181  -8.708  1.00 0.00 ? 126 HIS A N    2  
ATOM 3224  C CA   . HIS A 1 123 ? 0.554   -6.065  -9.015  1.00 0.00 ? 126 HIS A CA   2  
ATOM 3225  C C    . HIS A 1 123 ? 0.813   -5.298  -7.726  1.00 0.00 ? 126 HIS A C    2  
ATOM 3226  O O    . HIS A 1 123 ? -0.125  -4.817  -7.088  1.00 0.00 ? 126 HIS A O    2  
ATOM 3227  C CB   . HIS A 1 123 ? -0.073  -5.144  -10.078 1.00 0.00 ? 126 HIS A CB   2  
ATOM 3228  C CG   . HIS A 1 123 ? -0.224  -5.775  -11.433 1.00 0.00 ? 126 HIS A CG   2  
ATOM 3229  N ND1  . HIS A 1 123 ? 0.213   -5.176  -12.598 1.00 0.00 ? 126 HIS A ND1  2  
ATOM 3230  C CD2  . HIS A 1 123 ? -0.788  -6.949  -11.811 1.00 0.00 ? 126 HIS A CD2  2  
ATOM 3231  C CE1  . HIS A 1 123 ? -0.074  -5.950  -13.627 1.00 0.00 ? 126 HIS A CE1  2  
ATOM 3232  N NE2  . HIS A 1 123 ? -0.682  -7.032  -13.177 1.00 0.00 ? 126 HIS A NE2  2  
ATOM 3233  H H    . HIS A 1 123 ? -1.256  -7.000  -8.480  1.00 0.00 ? 126 HIS A H    2  
ATOM 3234  H HA   . HIS A 1 123 ? 1.488   -6.463  -9.387  1.00 0.00 ? 126 HIS A HA   2  
ATOM 3235  H HB2  . HIS A 1 123 ? -1.055  -4.843  -9.746  1.00 0.00 ? 126 HIS A HB2  2  
ATOM 3236  H HB3  . HIS A 1 123 ? 0.547   -4.268  -10.188 1.00 0.00 ? 126 HIS A HB3  2  
ATOM 3237  H HD1  . HIS A 1 123 ? 0.667   -4.298  -12.665 1.00 0.00 ? 126 HIS A HD1  2  
ATOM 3238  H HD2  . HIS A 1 123 ? -1.235  -7.684  -11.156 1.00 0.00 ? 126 HIS A HD2  2  
ATOM 3239  H HE1  . HIS A 1 123 ? 0.156   -5.739  -14.661 1.00 0.00 ? 126 HIS A HE1  2  
ATOM 3240  N N    . SER A 1 124 ? 2.073   -5.218  -7.325  1.00 0.00 ? 127 SER A N    2  
ATOM 3241  C CA   . SER A 1 124 ? 2.424   -4.619  -6.048  1.00 0.00 ? 127 SER A CA   2  
ATOM 3242  C C    . SER A 1 124 ? 2.109   -3.125  -6.038  1.00 0.00 ? 127 SER A C    2  
ATOM 3243  O O    . SER A 1 124 ? 2.480   -2.386  -6.959  1.00 0.00 ? 127 SER A O    2  
ATOM 3244  C CB   . SER A 1 124 ? 3.900   -4.868  -5.747  1.00 0.00 ? 127 SER A CB   2  
ATOM 3245  O OG   . SER A 1 124 ? 4.197   -6.255  -5.835  1.00 0.00 ? 127 SER A OG   2  
ATOM 3246  H H    . SER A 1 124 ? 2.787   -5.562  -7.900  1.00 0.00 ? 127 SER A H    2  
ATOM 3247  H HA   . SER A 1 124 ? 1.826   -5.101  -5.288  1.00 0.00 ? 127 SER A HA   2  
ATOM 3248  H HB2  . SER A 1 124 ? 4.509   -4.334  -6.462  1.00 0.00 ? 127 SER A HB2  2  
ATOM 3249  H HB3  . SER A 1 124 ? 4.126   -4.525  -4.748  1.00 0.00 ? 127 SER A HB3  2  
ATOM 3250  H HG   . SER A 1 124 ? 3.552   -6.750  -5.319  1.00 0.00 ? 127 SER A HG   2  
ATOM 3251  N N    . LEU A 1 125 ? 1.417   -2.695  -4.993  1.00 0.00 ? 128 LEU A N    2  
ATOM 3252  C CA   . LEU A 1 125 ? 0.977   -1.318  -4.877  1.00 0.00 ? 128 LEU A CA   2  
ATOM 3253  C C    . LEU A 1 125 ? 2.118   -0.440  -4.387  1.00 0.00 ? 128 LEU A C    2  
ATOM 3254  O O    . LEU A 1 125 ? 2.793   -0.764  -3.405  1.00 0.00 ? 128 LEU A O    2  
ATOM 3255  C CB   . LEU A 1 125 ? -0.227  -1.230  -3.933  1.00 0.00 ? 128 LEU A CB   2  
ATOM 3256  C CG   . LEU A 1 125 ? -0.961  0.116   -3.903  1.00 0.00 ? 128 LEU A CG   2  
ATOM 3257  C CD1  . LEU A 1 125 ? -2.411  -0.089  -3.504  1.00 0.00 ? 128 LEU A CD1  2  
ATOM 3258  C CD2  . LEU A 1 125 ? -0.293  1.080   -2.933  1.00 0.00 ? 128 LEU A CD2  2  
ATOM 3259  H H    . LEU A 1 125 ? 1.207   -3.323  -4.264  1.00 0.00 ? 128 LEU A H    2  
ATOM 3260  H HA   . LEU A 1 125 ? 0.676   -0.982  -5.858  1.00 0.00 ? 128 LEU A HA   2  
ATOM 3261  H HB2  . LEU A 1 125 ? -0.936  -1.993  -4.220  1.00 0.00 ? 128 LEU A HB2  2  
ATOM 3262  H HB3  . LEU A 1 125 ? 0.117   -1.446  -2.934  1.00 0.00 ? 128 LEU A HB3  2  
ATOM 3263  H HG   . LEU A 1 125 ? -0.940  0.557   -4.890  1.00 0.00 ? 128 LEU A HG   2  
ATOM 3264  H HD11 . LEU A 1 125 ? -2.453  -0.567  -2.535  1.00 0.00 ? 128 LEU A HD11 2  
ATOM 3265  H HD12 . LEU A 1 125 ? -2.912  0.867   -3.457  1.00 0.00 ? 128 LEU A HD12 2  
ATOM 3266  H HD13 . LEU A 1 125 ? -2.898  -0.715  -4.236  1.00 0.00 ? 128 LEU A HD13 2  
ATOM 3267  H HD21 . LEU A 1 125 ? -0.293  0.651   -1.941  1.00 0.00 ? 128 LEU A HD21 2  
ATOM 3268  H HD22 . LEU A 1 125 ? 0.724   1.259   -3.248  1.00 0.00 ? 128 LEU A HD22 2  
ATOM 3269  H HD23 . LEU A 1 125 ? -0.836  2.013   -2.920  1.00 0.00 ? 128 LEU A HD23 2  
ATOM 3270  N N    . GLY A 1 126 ? 2.329   0.660   -5.082  1.00 0.00 ? 129 GLY A N    2  
ATOM 3271  C CA   . GLY A 1 126 ? 3.374   1.583   -4.724  1.00 0.00 ? 129 GLY A CA   2  
ATOM 3272  C C    . GLY A 1 126 ? 2.844   2.975   -4.502  1.00 0.00 ? 129 GLY A C    2  
ATOM 3273  O O    . GLY A 1 126 ? 1.836   3.368   -5.096  1.00 0.00 ? 129 GLY A O    2  
ATOM 3274  H H    . GLY A 1 126 ? 1.753   0.857   -5.857  1.00 0.00 ? 129 GLY A H    2  
ATOM 3275  H HA2  . GLY A 1 126 ? 3.850   1.239   -3.819  1.00 0.00 ? 129 GLY A HA2  2  
ATOM 3276  H HA3  . GLY A 1 126 ? 4.106   1.612   -5.519  1.00 0.00 ? 129 GLY A HA3  2  
ATOM 3277  N N    . LEU A 1 127 ? 3.520   3.714   -3.648  1.00 0.00 ? 130 LEU A N    2  
ATOM 3278  C CA   . LEU A 1 127 ? 3.114   5.064   -3.317  1.00 0.00 ? 130 LEU A CA   2  
ATOM 3279  C C    . LEU A 1 127 ? 4.264   6.029   -3.582  1.00 0.00 ? 130 LEU A C    2  
ATOM 3280  O O    . LEU A 1 127 ? 5.391   5.800   -3.145  1.00 0.00 ? 130 LEU A O    2  
ATOM 3281  C CB   . LEU A 1 127 ? 2.688   5.127   -1.847  1.00 0.00 ? 130 LEU A CB   2  
ATOM 3282  C CG   . LEU A 1 127 ? 2.207   6.492   -1.347  1.00 0.00 ? 130 LEU A CG   2  
ATOM 3283  C CD1  . LEU A 1 127 ? 0.970   6.945   -2.114  1.00 0.00 ? 130 LEU A CD1  2  
ATOM 3284  C CD2  . LEU A 1 127 ? 1.918   6.425   0.146   1.00 0.00 ? 130 LEU A CD2  2  
ATOM 3285  H H    . LEU A 1 127 ? 4.327   3.342   -3.226  1.00 0.00 ? 130 LEU A H    2  
ATOM 3286  H HA   . LEU A 1 127 ? 2.273   5.325   -3.945  1.00 0.00 ? 130 LEU A HA   2  
ATOM 3287  H HB2  . LEU A 1 127 ? 1.891   4.413   -1.699  1.00 0.00 ? 130 LEU A HB2  2  
ATOM 3288  H HB3  . LEU A 1 127 ? 3.532   4.827   -1.242  1.00 0.00 ? 130 LEU A HB3  2  
ATOM 3289  H HG   . LEU A 1 127 ? 2.986   7.223   -1.506  1.00 0.00 ? 130 LEU A HG   2  
ATOM 3290  H HD11 . LEU A 1 127 ? 0.186   6.212   -2.002  1.00 0.00 ? 130 LEU A HD11 2  
ATOM 3291  H HD12 . LEU A 1 127 ? 0.632   7.895   -1.726  1.00 0.00 ? 130 LEU A HD12 2  
ATOM 3292  H HD13 . LEU A 1 127 ? 1.214   7.053   -3.161  1.00 0.00 ? 130 LEU A HD13 2  
ATOM 3293  H HD21 . LEU A 1 127 ? 1.132   5.707   0.329   1.00 0.00 ? 130 LEU A HD21 2  
ATOM 3294  H HD22 . LEU A 1 127 ? 2.813   6.122   0.672   1.00 0.00 ? 130 LEU A HD22 2  
ATOM 3295  H HD23 . LEU A 1 127 ? 1.606   7.397   0.499   1.00 0.00 ? 130 LEU A HD23 2  
ATOM 3296  N N    . THR A 1 128 ? 3.987   7.083   -4.331  1.00 0.00 ? 131 THR A N    2  
ATOM 3297  C CA   . THR A 1 128 ? 4.983   8.098   -4.612  1.00 0.00 ? 131 THR A CA   2  
ATOM 3298  C C    . THR A 1 128 ? 4.555   9.430   -4.009  1.00 0.00 ? 131 THR A C    2  
ATOM 3299  O O    . THR A 1 128 ? 3.593   10.041  -4.463  1.00 0.00 ? 131 THR A O    2  
ATOM 3300  C CB   . THR A 1 128 ? 5.194   8.258   -6.130  1.00 0.00 ? 131 THR A CB   2  
ATOM 3301  O OG1  . THR A 1 128 ? 5.567   6.998   -6.702  1.00 0.00 ? 131 THR A OG1  2  
ATOM 3302  C CG2  . THR A 1 128 ? 6.265   9.296   -6.437  1.00 0.00 ? 131 THR A CG2  2  
ATOM 3303  H H    . THR A 1 128 ? 3.081   7.183   -4.703  1.00 0.00 ? 131 THR A H    2  
ATOM 3304  H HA   . THR A 1 128 ? 5.918   7.789   -4.164  1.00 0.00 ? 131 THR A HA   2  
ATOM 3305  H HB   . THR A 1 128 ? 4.263   8.585   -6.572  1.00 0.00 ? 131 THR A HB   2  
ATOM 3306  H HG1  . THR A 1 128 ? 5.265   6.289   -6.125  1.00 0.00 ? 131 THR A HG1  2  
ATOM 3307  H HG21 . THR A 1 128 ? 7.203   8.984   -6.003  1.00 0.00 ? 131 THR A HG21 2  
ATOM 3308  H HG22 . THR A 1 128 ? 5.974   10.250  -6.022  1.00 0.00 ? 131 THR A HG22 2  
ATOM 3309  H HG23 . THR A 1 128 ? 6.376   9.388   -7.506  1.00 0.00 ? 131 THR A HG23 2  
ATOM 3310  N N    . CYS A 1 129 ? 5.260   9.855   -2.976  1.00 0.00 ? 132 CYS A N    2  
ATOM 3311  C CA   . CYS A 1 129 ? 4.956   11.108  -2.299  1.00 0.00 ? 132 CYS A CA   2  
ATOM 3312  C C    . CYS A 1 129 ? 6.030   12.142  -2.634  1.00 0.00 ? 132 CYS A C    2  
ATOM 3313  O O    . CYS A 1 129 ? 7.158   11.777  -2.980  1.00 0.00 ? 132 CYS A O    2  
ATOM 3314  C CB   . CYS A 1 129 ? 4.895   10.878  -0.781  1.00 0.00 ? 132 CYS A CB   2  
ATOM 3315  S SG   . CYS A 1 129 ? 4.048   9.335   -0.295  1.00 0.00 ? 132 CYS A SG   2  
ATOM 3316  H H    . CYS A 1 129 ? 6.018   9.310   -2.655  1.00 0.00 ? 132 CYS A H    2  
ATOM 3317  H HA   . CYS A 1 129 ? 4.000   11.461  -2.652  1.00 0.00 ? 132 CYS A HA   2  
ATOM 3318  H HB2  . CYS A 1 129 ? 5.901   10.835  -0.388  1.00 0.00 ? 132 CYS A HB2  2  
ATOM 3319  H HB3  . CYS A 1 129 ? 4.368   11.702  -0.319  1.00 0.00 ? 132 CYS A HB3  2  
ATOM 3320  N N    . LEU A 1 130 ? 5.673   13.423  -2.564  1.00 0.00 ? 133 LEU A N    2  
ATOM 3321  C CA   . LEU A 1 130 ? 6.639   14.495  -2.783  1.00 0.00 ? 133 LEU A CA   2  
ATOM 3322  C C    . LEU A 1 130 ? 7.797   14.379  -1.801  1.00 0.00 ? 133 LEU A C    2  
ATOM 3323  O O    . LEU A 1 130 ? 7.590   14.272  -0.593  1.00 0.00 ? 133 LEU A O    2  
ATOM 3324  C CB   . LEU A 1 130 ? 5.981   15.873  -2.651  1.00 0.00 ? 133 LEU A CB   2  
ATOM 3325  C CG   . LEU A 1 130 ? 5.196   16.353  -3.875  1.00 0.00 ? 133 LEU A CG   2  
ATOM 3326  C CD1  . LEU A 1 130 ? 4.480   17.657  -3.562  1.00 0.00 ? 133 LEU A CD1  2  
ATOM 3327  C CD2  . LEU A 1 130 ? 6.119   16.543  -5.071  1.00 0.00 ? 133 LEU A CD2  2  
ATOM 3328  H H    . LEU A 1 130 ? 4.735   13.654  -2.369  1.00 0.00 ? 133 LEU A H    2  
ATOM 3329  H HA   . LEU A 1 130 ? 7.025   14.386  -3.785  1.00 0.00 ? 133 LEU A HA   2  
ATOM 3330  H HB2  . LEU A 1 130 ? 5.307   15.845  -1.808  1.00 0.00 ? 133 LEU A HB2  2  
ATOM 3331  H HB3  . LEU A 1 130 ? 6.756   16.598  -2.445  1.00 0.00 ? 133 LEU A HB3  2  
ATOM 3332  H HG   . LEU A 1 130 ? 4.453   15.613  -4.135  1.00 0.00 ? 133 LEU A HG   2  
ATOM 3333  H HD11 . LEU A 1 130 ? 3.913   17.973  -4.426  1.00 0.00 ? 133 LEU A HD11 2  
ATOM 3334  H HD12 . LEU A 1 130 ? 3.812   17.510  -2.728  1.00 0.00 ? 133 LEU A HD12 2  
ATOM 3335  H HD13 . LEU A 1 130 ? 5.208   18.415  -3.312  1.00 0.00 ? 133 LEU A HD13 2  
ATOM 3336  H HD21 . LEU A 1 130 ? 5.567   16.990  -5.884  1.00 0.00 ? 133 LEU A HD21 2  
ATOM 3337  H HD22 . LEU A 1 130 ? 6.940   17.190  -4.794  1.00 0.00 ? 133 LEU A HD22 2  
ATOM 3338  H HD23 . LEU A 1 130 ? 6.509   15.587  -5.385  1.00 0.00 ? 133 LEU A HD23 2  
ATOM 3339  N N    . GLU A 1 131 ? 9.006   14.386  -2.330  1.00 0.00 ? 134 GLU A N    2  
ATOM 3340  C CA   . GLU A 1 131 ? 10.198  14.232  -1.519  1.00 0.00 ? 134 GLU A CA   2  
ATOM 3341  C C    . GLU A 1 131 ? 11.162  15.373  -1.814  1.00 0.00 ? 134 GLU A C    2  
ATOM 3342  O O    . GLU A 1 131 ? 11.958  15.249  -2.769  1.00 0.00 ? 134 GLU A O    2  
ATOM 3343  C CB   . GLU A 1 131 ? 10.862  12.888  -1.817  1.00 0.00 ? 134 GLU A CB   2  
ATOM 3344  C CG   . GLU A 1 131 ? 12.011  12.547  -0.887  1.00 0.00 ? 134 GLU A CG   2  
ATOM 3345  C CD   . GLU A 1 131 ? 12.750  11.306  -1.331  1.00 0.00 ? 134 GLU A CD   2  
ATOM 3346  O OE1  . GLU A 1 131 ? 12.332  10.188  -0.959  1.00 0.00 ? 134 GLU A OE1  2  
ATOM 3347  O OE2  . GLU A 1 131 ? 13.749  11.442  -2.067  1.00 0.00 ? 134 GLU A OE2  2  
ATOM 3348  O OXT  . GLU A 1 131 ? 11.095  16.400  -1.113  1.00 0.00 ? 134 GLU A OXT  2  
ATOM 3349  H H    . GLU A 1 131 ? 9.105   14.511  -3.299  1.00 0.00 ? 134 GLU A H    2  
ATOM 3350  H HA   . GLU A 1 131 ? 9.911   14.270  -0.480  1.00 0.00 ? 134 GLU A HA   2  
ATOM 3351  H HB2  . GLU A 1 131 ? 10.118  12.108  -1.736  1.00 0.00 ? 134 GLU A HB2  2  
ATOM 3352  H HB3  . GLU A 1 131 ? 11.241  12.903  -2.829  1.00 0.00 ? 134 GLU A HB3  2  
ATOM 3353  H HG2  . GLU A 1 131 ? 12.703  13.377  -0.867  1.00 0.00 ? 134 GLU A HG2  2  
ATOM 3354  H HG3  . GLU A 1 131 ? 11.620  12.381  0.105   1.00 0.00 ? 134 GLU A HG3  2  
ATOM 3355  N N    . ARG A 1 22  ? -10.011 -2.660  14.018  1.00 0.00 ? 25  ARG A N    3  
ATOM 3356  C CA   . ARG A 1 22  ? -9.911  -1.428  13.204  1.00 0.00 ? 25  ARG A CA   3  
ATOM 3357  C C    . ARG A 1 22  ? -8.494  -1.244  12.696  1.00 0.00 ? 25  ARG A C    3  
ATOM 3358  O O    . ARG A 1 22  ? -7.578  -0.971  13.472  1.00 0.00 ? 25  ARG A O    3  
ATOM 3359  C CB   . ARG A 1 22  ? -10.324 -0.202  14.024  1.00 0.00 ? 25  ARG A CB   3  
ATOM 3360  C CG   . ARG A 1 22  ? -11.801 -0.165  14.366  1.00 0.00 ? 25  ARG A CG   3  
ATOM 3361  C CD   . ARG A 1 22  ? -12.654 -0.121  13.112  1.00 0.00 ? 25  ARG A CD   3  
ATOM 3362  N NE   . ARG A 1 22  ? -14.081 -0.064  13.417  1.00 0.00 ? 25  ARG A NE   3  
ATOM 3363  C CZ   . ARG A 1 22  ? -15.013 -0.668  12.687  1.00 0.00 ? 25  ARG A CZ   3  
ATOM 3364  N NH1  . ARG A 1 22  ? -14.663 -1.392  11.634  1.00 0.00 ? 25  ARG A NH1  3  
ATOM 3365  N NH2  . ARG A 1 22  ? -16.293 -0.544  12.997  1.00 0.00 ? 25  ARG A NH2  3  
ATOM 3366  H HA   . ARG A 1 22  ? -10.576 -1.526  12.357  1.00 0.00 ? 25  ARG A HA   3  
ATOM 3367  H HB2  . ARG A 1 22  ? -9.764  -0.197  14.946  1.00 0.00 ? 25  ARG A HB2  3  
ATOM 3368  H HB3  . ARG A 1 22  ? -10.084 0.689   13.463  1.00 0.00 ? 25  ARG A HB3  3  
ATOM 3369  H HG2  . ARG A 1 22  ? -12.051 -1.049  14.933  1.00 0.00 ? 25  ARG A HG2  3  
ATOM 3370  H HG3  . ARG A 1 22  ? -12.001 0.716   14.959  1.00 0.00 ? 25  ARG A HG3  3  
ATOM 3371  H HD2  . ARG A 1 22  ? -12.383 0.753   12.539  1.00 0.00 ? 25  ARG A HD2  3  
ATOM 3372  H HD3  . ARG A 1 22  ? -12.456 -1.008  12.529  1.00 0.00 ? 25  ARG A HD3  3  
ATOM 3373  H HE   . ARG A 1 22  ? -14.357 0.466   14.206  1.00 0.00 ? 25  ARG A HE   3  
ATOM 3374  H HH12 . ARG A 1 22  ? -14.854 -2.385  11.617  1.00 0.00 ? 25  ARG A HH12 3  
ATOM 3375  H HH21 . ARG A 1 22  ? -16.570 0.012   13.787  1.00 0.00 ? 25  ARG A HH21 3  
ATOM 3376  H HH22 . ARG A 1 22  ? -16.992 -1.003  12.445  1.00 0.00 ? 25  ARG A HH22 3  
ATOM 3377  N N    . LEU A 1 23  ? -8.314  -1.400  11.396  1.00 0.00 ? 26  LEU A N    3  
ATOM 3378  C CA   . LEU A 1 23  ? -7.007  -1.247  10.779  1.00 0.00 ? 26  LEU A CA   3  
ATOM 3379  C C    . LEU A 1 23  ? -7.108  -0.340  9.563   1.00 0.00 ? 26  LEU A C    3  
ATOM 3380  O O    . LEU A 1 23  ? -7.291  -0.806  8.441   1.00 0.00 ? 26  LEU A O    3  
ATOM 3381  C CB   . LEU A 1 23  ? -6.435  -2.610  10.363  1.00 0.00 ? 26  LEU A CB   3  
ATOM 3382  C CG   . LEU A 1 23  ? -6.212  -3.614  11.497  1.00 0.00 ? 26  LEU A CG   3  
ATOM 3383  C CD1  . LEU A 1 23  ? -5.739  -4.941  10.933  1.00 0.00 ? 26  LEU A CD1  3  
ATOM 3384  C CD2  . LEU A 1 23  ? -5.203  -3.081  12.504  1.00 0.00 ? 26  LEU A CD2  3  
ATOM 3385  H H    . LEU A 1 23  ? -9.091  -1.605  10.825  1.00 0.00 ? 26  LEU A H    3  
ATOM 3386  H HA   . LEU A 1 23  ? -6.348  -0.790  11.502  1.00 0.00 ? 26  LEU A HA   3  
ATOM 3387  H HB2  . LEU A 1 23  ? -7.112  -3.055  9.650   1.00 0.00 ? 26  LEU A HB2  3  
ATOM 3388  H HB3  . LEU A 1 23  ? -5.487  -2.442  9.873   1.00 0.00 ? 26  LEU A HB3  3  
ATOM 3389  H HG   . LEU A 1 23  ? -7.146  -3.782  12.011  1.00 0.00 ? 26  LEU A HG   3  
ATOM 3390  H HD11 . LEU A 1 23  ? -6.485  -5.331  10.258  1.00 0.00 ? 26  LEU A HD11 3  
ATOM 3391  H HD12 . LEU A 1 23  ? -4.811  -4.793  10.400  1.00 0.00 ? 26  LEU A HD12 3  
ATOM 3392  H HD13 . LEU A 1 23  ? -5.582  -5.640  11.742  1.00 0.00 ? 26  LEU A HD13 3  
ATOM 3393  H HD21 . LEU A 1 23  ? -4.277  -2.845  12.000  1.00 0.00 ? 26  LEU A HD21 3  
ATOM 3394  H HD22 . LEU A 1 23  ? -5.597  -2.191  12.973  1.00 0.00 ? 26  LEU A HD22 3  
ATOM 3395  H HD23 . LEU A 1 23  ? -5.021  -3.832  13.258  1.00 0.00 ? 26  LEU A HD23 3  
ATOM 3396  N N    . SER A 1 24  ? -7.011  0.957   9.784   1.00 0.00 ? 27  SER A N    3  
ATOM 3397  C CA   . SER A 1 24  ? -7.063  1.908   8.691   1.00 0.00 ? 27  SER A CA   3  
ATOM 3398  C C    . SER A 1 24  ? -5.760  2.689   8.634   1.00 0.00 ? 27  SER A C    3  
ATOM 3399  O O    . SER A 1 24  ? -5.160  2.978   9.670   1.00 0.00 ? 27  SER A O    3  
ATOM 3400  C CB   . SER A 1 24  ? -8.251  2.859   8.865   1.00 0.00 ? 27  SER A CB   3  
ATOM 3401  O OG   . SER A 1 24  ? -8.492  3.602   7.682   1.00 0.00 ? 27  SER A OG   3  
ATOM 3402  H H    . SER A 1 24  ? -6.896  1.287   10.706  1.00 0.00 ? 27  SER A H    3  
ATOM 3403  H HA   . SER A 1 24  ? -7.182  1.353   7.771   1.00 0.00 ? 27  SER A HA   3  
ATOM 3404  H HB2  . SER A 1 24  ? -9.135  2.288   9.101   1.00 0.00 ? 27  SER A HB2  3  
ATOM 3405  H HB3  . SER A 1 24  ? -8.042  3.548   9.669   1.00 0.00 ? 27  SER A HB3  3  
ATOM 3406  H HG   . SER A 1 24  ? -8.438  3.008   6.919   1.00 0.00 ? 27  SER A HG   3  
ATOM 3407  N N    . TRP A 1 25  ? -5.331  3.043   7.426   1.00 0.00 ? 28  TRP A N    3  
ATOM 3408  C CA   . TRP A 1 25  ? -4.064  3.751   7.236   1.00 0.00 ? 28  TRP A CA   3  
ATOM 3409  C C    . TRP A 1 25  ? -4.158  5.216   7.671   1.00 0.00 ? 28  TRP A C    3  
ATOM 3410  O O    . TRP A 1 25  ? -3.323  6.043   7.302   1.00 0.00 ? 28  TRP A O    3  
ATOM 3411  C CB   . TRP A 1 25  ? -3.593  3.651   5.775   1.00 0.00 ? 28  TRP A CB   3  
ATOM 3412  C CG   . TRP A 1 25  ? -4.576  4.155   4.744   1.00 0.00 ? 28  TRP A CG   3  
ATOM 3413  C CD1  . TRP A 1 25  ? -5.693  4.919   4.954   1.00 0.00 ? 28  TRP A CD1  3  
ATOM 3414  C CD2  . TRP A 1 25  ? -4.509  3.935   3.330   1.00 0.00 ? 28  TRP A CD2  3  
ATOM 3415  N NE1  . TRP A 1 25  ? -6.327  5.169   3.761   1.00 0.00 ? 28  TRP A NE1  3  
ATOM 3416  C CE2  . TRP A 1 25  ? -5.618  4.579   2.748   1.00 0.00 ? 28  TRP A CE2  3  
ATOM 3417  C CE3  . TRP A 1 25  ? -3.619  3.249   2.498   1.00 0.00 ? 28  TRP A CE3  3  
ATOM 3418  C CZ2  . TRP A 1 25  ? -5.857  4.559   1.375   1.00 0.00 ? 28  TRP A CZ2  3  
ATOM 3419  C CZ3  . TRP A 1 25  ? -3.856  3.232   1.137   1.00 0.00 ? 28  TRP A CZ3  3  
ATOM 3420  C CH2  . TRP A 1 25  ? -4.968  3.882   0.587   1.00 0.00 ? 28  TRP A CH2  3  
ATOM 3421  H H    . TRP A 1 25  ? -5.878  2.821   6.642   1.00 0.00 ? 28  TRP A H    3  
ATOM 3422  H HA   . TRP A 1 25  ? -3.332  3.262   7.865   1.00 0.00 ? 28  TRP A HA   3  
ATOM 3423  H HB2  . TRP A 1 25  ? -2.684  4.223   5.666   1.00 0.00 ? 28  TRP A HB2  3  
ATOM 3424  H HB3  . TRP A 1 25  ? -3.382  2.613   5.550   1.00 0.00 ? 28  TRP A HB3  3  
ATOM 3425  H HD1  . TRP A 1 25  ? -6.022  5.260   5.924   1.00 0.00 ? 28  TRP A HD1  3  
ATOM 3426  H HE1  . TRP A 1 25  ? -7.149  5.691   3.653   1.00 0.00 ? 28  TRP A HE1  3  
ATOM 3427  H HE3  . TRP A 1 25  ? -2.755  2.743   2.903   1.00 0.00 ? 28  TRP A HE3  3  
ATOM 3428  H HZ2  . TRP A 1 25  ? -6.709  5.056   0.933   1.00 0.00 ? 28  TRP A HZ2  3  
ATOM 3429  H HZ3  . TRP A 1 25  ? -3.177  2.707   0.480   1.00 0.00 ? 28  TRP A HZ3  3  
ATOM 3430  H HH2  . TRP A 1 25  ? -5.114  3.840   -0.483  1.00 0.00 ? 28  TRP A HH2  3  
ATOM 3431  N N    . TYR A 1 26  ? -5.181  5.528   8.453   1.00 0.00 ? 29  TYR A N    3  
ATOM 3432  C CA   . TYR A 1 26  ? -5.363  6.864   8.986   1.00 0.00 ? 29  TYR A CA   3  
ATOM 3433  C C    . TYR A 1 26  ? -5.388  6.821   10.510  1.00 0.00 ? 29  TYR A C    3  
ATOM 3434  O O    . TYR A 1 26  ? -5.652  7.828   11.166  1.00 0.00 ? 29  TYR A O    3  
ATOM 3435  C CB   . TYR A 1 26  ? -6.653  7.485   8.453   1.00 0.00 ? 29  TYR A CB   3  
ATOM 3436  C CG   . TYR A 1 26  ? -6.423  8.756   7.668   1.00 0.00 ? 29  TYR A CG   3  
ATOM 3437  C CD1  . TYR A 1 26  ? -6.108  8.712   6.314   1.00 0.00 ? 29  TYR A CD1  3  
ATOM 3438  C CD2  . TYR A 1 26  ? -6.513  10.000  8.281   1.00 0.00 ? 29  TYR A CD2  3  
ATOM 3439  C CE1  . TYR A 1 26  ? -5.890  9.871   5.595   1.00 0.00 ? 29  TYR A CE1  3  
ATOM 3440  C CE2  . TYR A 1 26  ? -6.298  11.163  7.568   1.00 0.00 ? 29  TYR A CE2  3  
ATOM 3441  C CZ   . TYR A 1 26  ? -5.987  11.093  6.226   1.00 0.00 ? 29  TYR A CZ   3  
ATOM 3442  O OH   . TYR A 1 26  ? -5.770  12.252  5.514   1.00 0.00 ? 29  TYR A OH   3  
ATOM 3443  H H    . TYR A 1 26  ? -5.829  4.832   8.683   1.00 0.00 ? 29  TYR A H    3  
ATOM 3444  H HA   . TYR A 1 26  ? -4.525  7.467   8.666   1.00 0.00 ? 29  TYR A HA   3  
ATOM 3445  H HB2  . TYR A 1 26  ? -7.147  6.777   7.802   1.00 0.00 ? 29  TYR A HB2  3  
ATOM 3446  H HB3  . TYR A 1 26  ? -7.302  7.717   9.284   1.00 0.00 ? 29  TYR A HB3  3  
ATOM 3447  H HD1  . TYR A 1 26  ? -6.034  7.753   5.822   1.00 0.00 ? 29  TYR A HD1  3  
ATOM 3448  H HD2  . TYR A 1 26  ? -6.755  10.052  9.333   1.00 0.00 ? 29  TYR A HD2  3  
ATOM 3449  H HE1  . TYR A 1 26  ? -5.647  9.817   4.545   1.00 0.00 ? 29  TYR A HE1  3  
ATOM 3450  H HE2  . TYR A 1 26  ? -6.374  12.119  8.062   1.00 0.00 ? 29  TYR A HE2  3  
ATOM 3451  H HH   . TYR A 1 26  ? -6.237  12.195  4.663   1.00 0.00 ? 29  TYR A HH   3  
ATOM 3452  N N    . ASP A 1 27  ? -5.119  5.645   11.068  1.00 0.00 ? 30  ASP A N    3  
ATOM 3453  C CA   . ASP A 1 27  ? -5.100  5.466   12.515  1.00 0.00 ? 30  ASP A CA   3  
ATOM 3454  C C    . ASP A 1 27  ? -3.679  5.590   13.040  1.00 0.00 ? 30  ASP A C    3  
ATOM 3455  O O    . ASP A 1 27  ? -2.730  5.136   12.403  1.00 0.00 ? 30  ASP A O    3  
ATOM 3456  C CB   . ASP A 1 27  ? -5.665  4.101   12.917  1.00 0.00 ? 30  ASP A CB   3  
ATOM 3457  C CG   . ASP A 1 27  ? -7.131  3.937   12.576  1.00 0.00 ? 30  ASP A CG   3  
ATOM 3458  O OD1  . ASP A 1 27  ? -7.904  4.898   12.776  1.00 0.00 ? 30  ASP A OD1  3  
ATOM 3459  O OD2  . ASP A 1 27  ? -7.523  2.835   12.135  1.00 0.00 ? 30  ASP A OD2  3  
ATOM 3460  H H    . ASP A 1 27  ? -4.917  4.876   10.492  1.00 0.00 ? 30  ASP A H    3  
ATOM 3461  H HA   . ASP A 1 27  ? -5.704  6.244   12.956  1.00 0.00 ? 30  ASP A HA   3  
ATOM 3462  H HB2  . ASP A 1 27  ? -5.111  3.329   12.411  1.00 0.00 ? 30  ASP A HB2  3  
ATOM 3463  H HB3  . ASP A 1 27  ? -5.549  3.975   13.982  1.00 0.00 ? 30  ASP A HB3  3  
ATOM 3464  N N    . PRO A 1 28  ? -3.523  6.199   14.226  1.00 0.00 ? 31  PRO A N    3  
ATOM 3465  C CA   . PRO A 1 28  ? -2.210  6.435   14.836  1.00 0.00 ? 31  PRO A CA   3  
ATOM 3466  C C    . PRO A 1 28  ? -1.530  5.146   15.292  1.00 0.00 ? 31  PRO A C    3  
ATOM 3467  O O    . PRO A 1 28  ? -0.344  5.143   15.615  1.00 0.00 ? 31  PRO A O    3  
ATOM 3468  C CB   . PRO A 1 28  ? -2.529  7.330   16.038  1.00 0.00 ? 31  PRO A CB   3  
ATOM 3469  C CG   . PRO A 1 28  ? -3.949  7.035   16.369  1.00 0.00 ? 31  PRO A CG   3  
ATOM 3470  C CD   . PRO A 1 28  ? -4.622  6.718   15.062  1.00 0.00 ? 31  PRO A CD   3  
ATOM 3471  H HA   . PRO A 1 28  ? -1.557  6.960   14.159  1.00 0.00 ? 31  PRO A HA   3  
ATOM 3472  H HB2  . PRO A 1 28  ? -1.873  7.079   16.860  1.00 0.00 ? 31  PRO A HB2  3  
ATOM 3473  H HB3  . PRO A 1 28  ? -2.395  8.366   15.766  1.00 0.00 ? 31  PRO A HB3  3  
ATOM 3474  H HG2  . PRO A 1 28  ? -4.002  6.189   17.036  1.00 0.00 ? 31  PRO A HG2  3  
ATOM 3475  H HG3  . PRO A 1 28  ? -4.405  7.902   16.823  1.00 0.00 ? 31  PRO A HG3  3  
ATOM 3476  H HD2  . PRO A 1 28  ? -5.384  5.966   15.204  1.00 0.00 ? 31  PRO A HD2  3  
ATOM 3477  H HD3  . PRO A 1 28  ? -5.046  7.610   14.627  1.00 0.00 ? 31  PRO A HD3  3  
ATOM 3478  N N    . ASP A 1 29  ? -2.286  4.054   15.314  1.00 0.00 ? 32  ASP A N    3  
ATOM 3479  C CA   . ASP A 1 29  ? -1.747  2.758   15.720  1.00 0.00 ? 32  ASP A CA   3  
ATOM 3480  C C    . ASP A 1 29  ? -1.387  1.904   14.511  1.00 0.00 ? 32  ASP A C    3  
ATOM 3481  O O    . ASP A 1 29  ? -0.936  0.767   14.659  1.00 0.00 ? 32  ASP A O    3  
ATOM 3482  C CB   . ASP A 1 29  ? -2.744  2.000   16.596  1.00 0.00 ? 32  ASP A CB   3  
ATOM 3483  C CG   . ASP A 1 29  ? -2.268  1.865   18.028  1.00 0.00 ? 32  ASP A CG   3  
ATOM 3484  O OD1  . ASP A 1 29  ? -1.301  1.112   18.273  1.00 0.00 ? 32  ASP A OD1  3  
ATOM 3485  O OD2  . ASP A 1 29  ? -2.852  2.516   18.918  1.00 0.00 ? 32  ASP A OD2  3  
ATOM 3486  H H    . ASP A 1 29  ? -3.228  4.122   15.055  1.00 0.00 ? 32  ASP A H    3  
ATOM 3487  H HA   . ASP A 1 29  ? -0.851  2.941   16.293  1.00 0.00 ? 32  ASP A HA   3  
ATOM 3488  H HB2  . ASP A 1 29  ? -3.686  2.525   16.598  1.00 0.00 ? 32  ASP A HB2  3  
ATOM 3489  H HB3  . ASP A 1 29  ? -2.888  1.010   16.189  1.00 0.00 ? 32  ASP A HB3  3  
ATOM 3490  N N    . PHE A 1 30  ? -1.574  2.455   13.318  1.00 0.00 ? 33  PHE A N    3  
ATOM 3491  C CA   . PHE A 1 30  ? -1.305  1.719   12.096  1.00 0.00 ? 33  PHE A CA   3  
ATOM 3492  C C    . PHE A 1 30  ? 0.093   2.051   11.583  1.00 0.00 ? 33  PHE A C    3  
ATOM 3493  O O    . PHE A 1 30  ? 0.394   3.202   11.274  1.00 0.00 ? 33  PHE A O    3  
ATOM 3494  C CB   . PHE A 1 30  ? -2.360  2.055   11.035  1.00 0.00 ? 33  PHE A CB   3  
ATOM 3495  C CG   . PHE A 1 30  ? -2.409  1.083   9.890   1.00 0.00 ? 33  PHE A CG   3  
ATOM 3496  C CD1  . PHE A 1 30  ? -3.142  -0.089  9.995   1.00 0.00 ? 33  PHE A CD1  3  
ATOM 3497  C CD2  . PHE A 1 30  ? -1.738  1.345   8.707   1.00 0.00 ? 33  PHE A CD2  3  
ATOM 3498  C CE1  . PHE A 1 30  ? -3.206  -0.981  8.943   1.00 0.00 ? 33  PHE A CE1  3  
ATOM 3499  C CE2  . PHE A 1 30  ? -1.796  0.455   7.651   1.00 0.00 ? 33  PHE A CE2  3  
ATOM 3500  C CZ   . PHE A 1 30  ? -2.532  -0.710  7.770   1.00 0.00 ? 33  PHE A CZ   3  
ATOM 3501  H H    . PHE A 1 30  ? -1.888  3.385   13.257  1.00 0.00 ? 33  PHE A H    3  
ATOM 3502  H HA   . PHE A 1 30  ? -1.357  0.664   12.324  1.00 0.00 ? 33  PHE A HA   3  
ATOM 3503  H HB2  . PHE A 1 30  ? -3.336  2.064   11.498  1.00 0.00 ? 33  PHE A HB2  3  
ATOM 3504  H HB3  . PHE A 1 30  ? -2.152  3.036   10.631  1.00 0.00 ? 33  PHE A HB3  3  
ATOM 3505  H HD1  . PHE A 1 30  ? -3.671  -0.303  10.913  1.00 0.00 ? 33  PHE A HD1  3  
ATOM 3506  H HD2  . PHE A 1 30  ? -1.159  2.253   8.614   1.00 0.00 ? 33  PHE A HD2  3  
ATOM 3507  H HE1  . PHE A 1 30  ? -3.781  -1.891  9.037   1.00 0.00 ? 33  PHE A HE1  3  
ATOM 3508  H HE2  . PHE A 1 30  ? -1.269  0.671   6.735   1.00 0.00 ? 33  PHE A HE2  3  
ATOM 3509  H HZ   . PHE A 1 30  ? -2.584  -1.405  6.944   1.00 0.00 ? 33  PHE A HZ   3  
ATOM 3510  N N    . GLN A 1 31  ? 0.953   1.045   11.527  1.00 0.00 ? 34  GLN A N    3  
ATOM 3511  C CA   . GLN A 1 31  ? 2.309   1.235   11.033  1.00 0.00 ? 34  GLN A CA   3  
ATOM 3512  C C    . GLN A 1 31  ? 2.395   0.869   9.558   1.00 0.00 ? 34  GLN A C    3  
ATOM 3513  O O    . GLN A 1 31  ? 1.915   -0.190  9.147   1.00 0.00 ? 34  GLN A O    3  
ATOM 3514  C CB   . GLN A 1 31  ? 3.314   0.393   11.831  1.00 0.00 ? 34  GLN A CB   3  
ATOM 3515  C CG   . GLN A 1 31  ? 3.734   0.991   13.166  1.00 0.00 ? 34  GLN A CG   3  
ATOM 3516  C CD   . GLN A 1 31  ? 2.635   0.973   14.213  1.00 0.00 ? 34  GLN A CD   3  
ATOM 3517  O OE1  . GLN A 1 31  ? 2.485   0.003   14.954  1.00 0.00 ? 34  GLN A OE1  3  
ATOM 3518  N NE2  . GLN A 1 31  ? 1.875   2.053   14.300  1.00 0.00 ? 34  GLN A NE2  3  
ATOM 3519  H H    . GLN A 1 31  ? 0.668   0.154   11.816  1.00 0.00 ? 34  GLN A H    3  
ATOM 3520  H HA   . GLN A 1 31  ? 2.558   2.280   11.147  1.00 0.00 ? 34  GLN A HA   3  
ATOM 3521  H HB2  . GLN A 1 31  ? 2.872   -0.571  12.026  1.00 0.00 ? 34  GLN A HB2  3  
ATOM 3522  H HB3  . GLN A 1 31  ? 4.199   0.253   11.230  1.00 0.00 ? 34  GLN A HB3  3  
ATOM 3523  H HG2  . GLN A 1 31  ? 4.572   0.427   13.545  1.00 0.00 ? 34  GLN A HG2  3  
ATOM 3524  H HG3  . GLN A 1 31  ? 4.039   2.014   13.002  1.00 0.00 ? 34  GLN A HG3  3  
ATOM 3525  H HE21 . GLN A 1 31  ? 2.059   2.803   13.692  1.00 0.00 ? 34  GLN A HE21 3  
ATOM 3526  H HE22 . GLN A 1 31  ? 1.151   2.057   14.962  1.00 0.00 ? 34  GLN A HE22 3  
ATOM 3527  N N    . ALA A 1 32  ? 3.005   1.742   8.769   1.00 0.00 ? 35  ALA A N    3  
ATOM 3528  C CA   . ALA A 1 32  ? 3.194   1.493   7.348   1.00 0.00 ? 35  ALA A CA   3  
ATOM 3529  C C    . ALA A 1 32  ? 4.554   2.007   6.895   1.00 0.00 ? 35  ALA A C    3  
ATOM 3530  O O    . ALA A 1 32  ? 5.115   2.916   7.507   1.00 0.00 ? 35  ALA A O    3  
ATOM 3531  C CB   . ALA A 1 32  ? 2.085   2.144   6.536   1.00 0.00 ? 35  ALA A CB   3  
ATOM 3532  H H    . ALA A 1 32  ? 3.343   2.579   9.150   1.00 0.00 ? 35  ALA A H    3  
ATOM 3533  H HA   . ALA A 1 32  ? 3.151   0.425   7.189   1.00 0.00 ? 35  ALA A HA   3  
ATOM 3534  H HB1  . ALA A 1 32  ? 1.127   1.780   6.875   1.00 0.00 ? 35  ALA A HB1  3  
ATOM 3535  H HB2  . ALA A 1 32  ? 2.129   3.216   6.664   1.00 0.00 ? 35  ALA A HB2  3  
ATOM 3536  H HB3  . ALA A 1 32  ? 2.215   1.902   5.491   1.00 0.00 ? 35  ALA A HB3  3  
ATOM 3537  N N    . ARG A 1 33  ? 5.081   1.419   5.834   1.00 0.00 ? 36  ARG A N    3  
ATOM 3538  C CA   . ARG A 1 33  ? 6.378   1.801   5.304   1.00 0.00 ? 36  ARG A CA   3  
ATOM 3539  C C    . ARG A 1 33  ? 6.409   1.590   3.797   1.00 0.00 ? 36  ARG A C    3  
ATOM 3540  O O    . ARG A 1 33  ? 5.633   0.804   3.256   1.00 0.00 ? 36  ARG A O    3  
ATOM 3541  C CB   . ARG A 1 33  ? 7.488   0.977   5.978   1.00 0.00 ? 36  ARG A CB   3  
ATOM 3542  C CG   . ARG A 1 33  ? 7.462   -0.507  5.627   1.00 0.00 ? 36  ARG A CG   3  
ATOM 3543  C CD   . ARG A 1 33  ? 8.497   -0.852  4.566   1.00 0.00 ? 36  ARG A CD   3  
ATOM 3544  N NE   . ARG A 1 33  ? 9.862   -0.845  5.095   1.00 0.00 ? 36  ARG A NE   3  
ATOM 3545  C CZ   . ARG A 1 33  ? 10.891  -1.432  4.486   1.00 0.00 ? 36  ARG A CZ   3  
ATOM 3546  N NH1  . ARG A 1 33  ? 10.732  -1.989  3.296   1.00 0.00 ? 36  ARG A NH1  3  
ATOM 3547  N NH2  . ARG A 1 33  ? 12.087  -1.445  5.051   1.00 0.00 ? 36  ARG A NH2  3  
ATOM 3548  H H    . ARG A 1 33  ? 4.579   0.698   5.387   1.00 0.00 ? 36  ARG A H    3  
ATOM 3549  H HA   . ARG A 1 33  ? 6.535   2.848   5.514   1.00 0.00 ? 36  ARG A HA   3  
ATOM 3550  H HB2  . ARG A 1 33  ? 8.447   1.374   5.676   1.00 0.00 ? 36  ARG A HB2  3  
ATOM 3551  H HB3  . ARG A 1 33  ? 7.390   1.073   7.049   1.00 0.00 ? 36  ARG A HB3  3  
ATOM 3552  H HG2  . ARG A 1 33  ? 7.664   -1.085  6.516   1.00 0.00 ? 36  ARG A HG2  3  
ATOM 3553  H HG3  . ARG A 1 33  ? 6.481   -0.759  5.251   1.00 0.00 ? 36  ARG A HG3  3  
ATOM 3554  H HD2  . ARG A 1 33  ? 8.280   -1.838  4.179   1.00 0.00 ? 36  ARG A HD2  3  
ATOM 3555  H HD3  . ARG A 1 33  ? 8.426   -0.125  3.767   1.00 0.00 ? 36  ARG A HD3  3  
ATOM 3556  H HE   . ARG A 1 33  ? 10.013  -0.401  5.958   1.00 0.00 ? 36  ARG A HE   3  
ATOM 3557  H HH12 . ARG A 1 33  ? 9.907   -2.555  3.101   1.00 0.00 ? 36  ARG A HH12 3  
ATOM 3558  H HH21 . ARG A 1 33  ? 12.233  -1.006  5.948   1.00 0.00 ? 36  ARG A HH21 3  
ATOM 3559  H HH22 . ARG A 1 33  ? 12.856  -1.906  4.589   1.00 0.00 ? 36  ARG A HH22 3  
ATOM 3560  N N    . LEU A 1 34  ? 7.288   2.309   3.125   1.00 0.00 ? 37  LEU A N    3  
ATOM 3561  C CA   . LEU A 1 34  ? 7.524   2.092   1.711   1.00 0.00 ? 37  LEU A CA   3  
ATOM 3562  C C    . LEU A 1 34  ? 8.779   1.257   1.544   1.00 0.00 ? 37  LEU A C    3  
ATOM 3563  O O    . LEU A 1 34  ? 9.791   1.517   2.197   1.00 0.00 ? 37  LEU A O    3  
ATOM 3564  C CB   . LEU A 1 34  ? 7.672   3.429   0.987   1.00 0.00 ? 37  LEU A CB   3  
ATOM 3565  C CG   . LEU A 1 34  ? 6.438   4.332   1.045   1.00 0.00 ? 37  LEU A CG   3  
ATOM 3566  C CD1  . LEU A 1 34  ? 6.744   5.688   0.435   1.00 0.00 ? 37  LEU A CD1  3  
ATOM 3567  C CD2  . LEU A 1 34  ? 5.267   3.687   0.320   1.00 0.00 ? 37  LEU A CD2  3  
ATOM 3568  H H    . LEU A 1 34  ? 7.798   3.004   3.589   1.00 0.00 ? 37  LEU A H    3  
ATOM 3569  H HA   . LEU A 1 34  ? 6.682   1.554   1.304   1.00 0.00 ? 37  LEU A HA   3  
ATOM 3570  H HB2  . LEU A 1 34  ? 8.506   3.960   1.423   1.00 0.00 ? 37  LEU A HB2  3  
ATOM 3571  H HB3  . LEU A 1 34  ? 7.896   3.231   -0.053  1.00 0.00 ? 37  LEU A HB3  3  
ATOM 3572  H HG   . LEU A 1 34  ? 6.156   4.483   2.078   1.00 0.00 ? 37  LEU A HG   3  
ATOM 3573  H HD11 . LEU A 1 34  ? 7.566   6.145   0.966   1.00 0.00 ? 37  LEU A HD11 3  
ATOM 3574  H HD12 . LEU A 1 34  ? 7.011   5.562   -0.603  1.00 0.00 ? 37  LEU A HD12 3  
ATOM 3575  H HD13 . LEU A 1 34  ? 5.872   6.320   0.508   1.00 0.00 ? 37  LEU A HD13 3  
ATOM 3576  H HD21 . LEU A 1 34  ? 4.994   2.769   0.818   1.00 0.00 ? 37  LEU A HD21 3  
ATOM 3577  H HD22 . LEU A 1 34  ? 4.425   4.364   0.324   1.00 0.00 ? 37  LEU A HD22 3  
ATOM 3578  H HD23 . LEU A 1 34  ? 5.551   3.473   -0.700  1.00 0.00 ? 37  LEU A HD23 3  
ATOM 3579  N N    . THR A 1 35  ? 8.687   0.231   0.705   1.00 0.00 ? 38  THR A N    3  
ATOM 3580  C CA   . THR A 1 35  ? 9.810   -0.663  0.443   1.00 0.00 ? 38  THR A CA   3  
ATOM 3581  C C    . THR A 1 35  ? 11.061  0.111   0.054   1.00 0.00 ? 38  THR A C    3  
ATOM 3582  O O    . THR A 1 35  ? 10.981  1.122   -0.653  1.00 0.00 ? 38  THR A O    3  
ATOM 3583  C CB   . THR A 1 35  ? 9.487   -1.636  -0.704  1.00 0.00 ? 38  THR A CB   3  
ATOM 3584  O OG1  . THR A 1 35  ? 9.074   -0.888  -1.852  1.00 0.00 ? 38  THR A OG1  3  
ATOM 3585  C CG2  . THR A 1 35  ? 8.402   -2.624  -0.311  1.00 0.00 ? 38  THR A CG2  3  
ATOM 3586  H H    . THR A 1 35  ? 7.830   0.063   0.254   1.00 0.00 ? 38  THR A H    3  
ATOM 3587  H HA   . THR A 1 35  ? 10.006  -1.238  1.337   1.00 0.00 ? 38  THR A HA   3  
ATOM 3588  H HB   . THR A 1 35  ? 10.387  -2.186  -0.946  1.00 0.00 ? 38  THR A HB   3  
ATOM 3589  H HG1  . THR A 1 35  ? 9.183   0.053   -1.670  1.00 0.00 ? 38  THR A HG1  3  
ATOM 3590  H HG21 . THR A 1 35  ? 7.480   -2.094  -0.129  1.00 0.00 ? 38  THR A HG21 3  
ATOM 3591  H HG22 . THR A 1 35  ? 8.699   -3.148  0.585   1.00 0.00 ? 38  THR A HG22 3  
ATOM 3592  H HG23 . THR A 1 35  ? 8.255   -3.337  -1.110  1.00 0.00 ? 38  THR A HG23 3  
ATOM 3593  N N    . ARG A 1 36  ? 12.212  -0.384  0.489   1.00 0.00 ? 39  ARG A N    3  
ATOM 3594  C CA   . ARG A 1 36  ? 13.499  0.197   0.124   1.00 0.00 ? 39  ARG A CA   3  
ATOM 3595  C C    . ARG A 1 36  ? 13.835  -0.183  -1.318  1.00 0.00 ? 39  ARG A C    3  
ATOM 3596  O O    . ARG A 1 36  ? 14.899  -0.732  -1.606  1.00 0.00 ? 39  ARG A O    3  
ATOM 3597  C CB   . ARG A 1 36  ? 14.583  -0.308  1.082   1.00 0.00 ? 39  ARG A CB   3  
ATOM 3598  C CG   . ARG A 1 36  ? 14.213  -0.147  2.549   1.00 0.00 ? 39  ARG A CG   3  
ATOM 3599  C CD   . ARG A 1 36  ? 14.436  1.272   3.046   1.00 0.00 ? 39  ARG A CD   3  
ATOM 3600  N NE   . ARG A 1 36  ? 15.859  1.573   3.195   1.00 0.00 ? 39  ARG A NE   3  
ATOM 3601  C CZ   . ARG A 1 36  ? 16.524  1.439   4.340   1.00 0.00 ? 39  ARG A CZ   3  
ATOM 3602  N NH1  . ARG A 1 36  ? 15.877  1.088   5.443   1.00 0.00 ? 39  ARG A NH1  3  
ATOM 3603  N NH2  . ARG A 1 36  ? 17.825  1.670   4.396   1.00 0.00 ? 39  ARG A NH2  3  
ATOM 3604  H H    . ARG A 1 36  ? 12.195  -1.168  1.078   1.00 0.00 ? 39  ARG A H    3  
ATOM 3605  H HA   . ARG A 1 36  ? 13.418  1.271   0.201   1.00 0.00 ? 39  ARG A HA   3  
ATOM 3606  H HB2  . ARG A 1 36  ? 14.763  -1.355  0.887   1.00 0.00 ? 39  ARG A HB2  3  
ATOM 3607  H HB3  . ARG A 1 36  ? 15.493  0.244   0.900   1.00 0.00 ? 39  ARG A HB3  3  
ATOM 3608  H HG2  . ARG A 1 36  ? 13.170  -0.398  2.674   1.00 0.00 ? 39  ARG A HG2  3  
ATOM 3609  H HG3  . ARG A 1 36  ? 14.817  -0.822  3.137   1.00 0.00 ? 39  ARG A HG3  3  
ATOM 3610  H HD2  . ARG A 1 36  ? 14.002  1.963   2.338   1.00 0.00 ? 39  ARG A HD2  3  
ATOM 3611  H HD3  . ARG A 1 36  ? 13.951  1.389   4.005   1.00 0.00 ? 39  ARG A HD3  3  
ATOM 3612  H HE   . ARG A 1 36  ? 16.347  1.875   2.391   1.00 0.00 ? 39  ARG A HE   3  
ATOM 3613  H HH12 . ARG A 1 36  ? 15.731  0.108   5.653   1.00 0.00 ? 39  ARG A HH12 3  
ATOM 3614  H HH21 . ARG A 1 36  ? 18.330  1.942   3.571   1.00 0.00 ? 39  ARG A HH21 3  
ATOM 3615  H HH22 . ARG A 1 36  ? 18.317  1.563   5.269   1.00 0.00 ? 39  ARG A HH22 3  
ATOM 3616  N N    . SER A 1 37  ? 12.904  0.121   -2.213  1.00 0.00 ? 40  SER A N    3  
ATOM 3617  C CA   . SER A 1 37  ? 12.984  -0.297  -3.600  1.00 0.00 ? 40  SER A CA   3  
ATOM 3618  C C    . SER A 1 37  ? 13.701  0.750   -4.448  1.00 0.00 ? 40  SER A C    3  
ATOM 3619  O O    . SER A 1 37  ? 14.809  0.516   -4.933  1.00 0.00 ? 40  SER A O    3  
ATOM 3620  C CB   . SER A 1 37  ? 11.568  -0.540  -4.143  1.00 0.00 ? 40  SER A CB   3  
ATOM 3621  O OG   . SER A 1 37  ? 11.593  -1.089  -5.450  1.00 0.00 ? 40  SER A OG   3  
ATOM 3622  H H    . SER A 1 37  ? 12.127  0.647   -1.918  1.00 0.00 ? 40  SER A H    3  
ATOM 3623  H HA   . SER A 1 37  ? 13.539  -1.223  -3.640  1.00 0.00 ? 40  SER A HA   3  
ATOM 3624  H HB2  . SER A 1 37  ? 11.044  -1.224  -3.492  1.00 0.00 ? 40  SER A HB2  3  
ATOM 3625  H HB3  . SER A 1 37  ? 11.034  0.399   -4.174  1.00 0.00 ? 40  SER A HB3  3  
ATOM 3626  H HG   . SER A 1 37  ? 10.700  -1.359  -5.696  1.00 0.00 ? 40  SER A HG   3  
ATOM 3627  N N    . ASN A 1 38  ? 13.078  1.913   -4.601  1.00 0.00 ? 41  ASN A N    3  
ATOM 3628  C CA   . ASN A 1 38  ? 13.603  2.938   -5.490  1.00 0.00 ? 41  ASN A CA   3  
ATOM 3629  C C    . ASN A 1 38  ? 13.808  4.254   -4.751  1.00 0.00 ? 41  ASN A C    3  
ATOM 3630  O O    . ASN A 1 38  ? 14.920  4.767   -4.682  1.00 0.00 ? 41  ASN A O    3  
ATOM 3631  C CB   . ASN A 1 38  ? 12.656  3.142   -6.676  1.00 0.00 ? 41  ASN A CB   3  
ATOM 3632  C CG   . ASN A 1 38  ? 13.179  4.149   -7.685  1.00 0.00 ? 41  ASN A CG   3  
ATOM 3633  O OD1  . ASN A 1 38  ? 12.401  4.871   -8.307  1.00 0.00 ? 41  ASN A OD1  3  
ATOM 3634  N ND2  . ASN A 1 38  ? 14.492  4.189   -7.874  1.00 0.00 ? 41  ASN A ND2  3  
ATOM 3635  H H    . ASN A 1 38  ? 12.254  2.086   -4.101  1.00 0.00 ? 41  ASN A H    3  
ATOM 3636  H HA   . ASN A 1 38  ? 14.556  2.596   -5.860  1.00 0.00 ? 41  ASN A HA   3  
ATOM 3637  H HB2  . ASN A 1 38  ? 12.516  2.198   -7.182  1.00 0.00 ? 41  ASN A HB2  3  
ATOM 3638  H HB3  . ASN A 1 38  ? 11.705  3.491   -6.306  1.00 0.00 ? 41  ASN A HB3  3  
ATOM 3639  H HD21 . ASN A 1 38  ? 15.060  3.564   -7.358  1.00 0.00 ? 41  ASN A HD21 3  
ATOM 3640  H HD22 . ASN A 1 38  ? 14.851  4.842   -8.513  1.00 0.00 ? 41  ASN A HD22 3  
ATOM 3641  N N    . SER A 1 39  ? 12.736  4.790   -4.194  1.00 0.00 ? 42  SER A N    3  
ATOM 3642  C CA   . SER A 1 39  ? 12.799  6.053   -3.483  1.00 0.00 ? 42  SER A CA   3  
ATOM 3643  C C    . SER A 1 39  ? 12.293  5.874   -2.064  1.00 0.00 ? 42  SER A C    3  
ATOM 3644  O O    . SER A 1 39  ? 11.398  5.068   -1.807  1.00 0.00 ? 42  SER A O    3  
ATOM 3645  C CB   . SER A 1 39  ? 11.964  7.110   -4.217  1.00 0.00 ? 42  SER A CB   3  
ATOM 3646  O OG   . SER A 1 39  ? 11.925  8.336   -3.504  1.00 0.00 ? 42  SER A OG   3  
ATOM 3647  H H    . SER A 1 39  ? 11.878  4.319   -4.247  1.00 0.00 ? 42  SER A H    3  
ATOM 3648  H HA   . SER A 1 39  ? 13.831  6.371   -3.455  1.00 0.00 ? 42  SER A HA   3  
ATOM 3649  H HB2  . SER A 1 39  ? 12.389  7.290   -5.192  1.00 0.00 ? 42  SER A HB2  3  
ATOM 3650  H HB3  . SER A 1 39  ? 10.953  6.745   -4.331  1.00 0.00 ? 42  SER A HB3  3  
ATOM 3651  H HG   . SER A 1 39  ? 11.151  8.850   -3.790  1.00 0.00 ? 42  SER A HG   3  
ATOM 3652  N N    . LYS A 1 40  ? 12.889  6.624   -1.148  1.00 0.00 ? 43  LYS A N    3  
ATOM 3653  C CA   . LYS A 1 40  ? 12.485  6.611   0.252   1.00 0.00 ? 43  LYS A CA   3  
ATOM 3654  C C    . LYS A 1 40  ? 11.036  7.066   0.401   1.00 0.00 ? 43  LYS A C    3  
ATOM 3655  O O    . LYS A 1 40  ? 10.378  6.756   1.392   1.00 0.00 ? 43  LYS A O    3  
ATOM 3656  C CB   . LYS A 1 40  ? 13.399  7.514   1.083   1.00 0.00 ? 43  LYS A CB   3  
ATOM 3657  C CG   . LYS A 1 40  ? 13.471  8.949   0.579   1.00 0.00 ? 43  LYS A CG   3  
ATOM 3658  C CD   . LYS A 1 40  ? 14.142  9.863   1.590   1.00 0.00 ? 43  LYS A CD   3  
ATOM 3659  C CE   . LYS A 1 40  ? 13.337  9.945   2.876   1.00 0.00 ? 43  LYS A CE   3  
ATOM 3660  N NZ   . LYS A 1 40  ? 13.965  10.853  3.868   1.00 0.00 ? 43  LYS A NZ   3  
ATOM 3661  H H    . LYS A 1 40  ? 13.634  7.204   -1.424  1.00 0.00 ? 43  LYS A H    3  
ATOM 3662  H HA   . LYS A 1 40  ? 12.569  5.597   0.614   1.00 0.00 ? 43  LYS A HA   3  
ATOM 3663  H HB2  . LYS A 1 40  ? 13.039  7.532   2.101   1.00 0.00 ? 43  LYS A HB2  3  
ATOM 3664  H HB3  . LYS A 1 40  ? 14.397  7.101   1.074   1.00 0.00 ? 43  LYS A HB3  3  
ATOM 3665  H HG2  . LYS A 1 40  ? 14.039  8.970   -0.340  1.00 0.00 ? 43  LYS A HG2  3  
ATOM 3666  H HG3  . LYS A 1 40  ? 12.469  9.305   0.392   1.00 0.00 ? 43  LYS A HG3  3  
ATOM 3667  H HD2  . LYS A 1 40  ? 15.125  9.476   1.816   1.00 0.00 ? 43  LYS A HD2  3  
ATOM 3668  H HD3  . LYS A 1 40  ? 14.229  10.851  1.165   1.00 0.00 ? 43  LYS A HD3  3  
ATOM 3669  H HE2  . LYS A 1 40  ? 12.347  10.311  2.644   1.00 0.00 ? 43  LYS A HE2  3  
ATOM 3670  H HE3  . LYS A 1 40  ? 13.263  8.956   3.302   1.00 0.00 ? 43  LYS A HE3  3  
ATOM 3671  H HZ1  . LYS A 1 40  ? 13.333  10.946  4.693   1.00 0.00 ? 43  LYS A HZ1  3  
ATOM 3672  H HZ3  . LYS A 1 40  ? 14.079  11.801  3.446   1.00 0.00 ? 43  LYS A HZ3  3  
ATOM 3673  N N    . CYS A 1 41  ? 10.553  7.811   -0.583  1.00 0.00 ? 44  CYS A N    3  
ATOM 3674  C CA   . CYS A 1 41  ? 9.167   8.246   -0.596  1.00 0.00 ? 44  CYS A CA   3  
ATOM 3675  C C    . CYS A 1 41  ? 8.445   7.692   -1.826  1.00 0.00 ? 44  CYS A C    3  
ATOM 3676  O O    . CYS A 1 41  ? 7.468   8.272   -2.290  1.00 0.00 ? 44  CYS A O    3  
ATOM 3677  C CB   . CYS A 1 41  ? 9.077   9.778   -0.577  1.00 0.00 ? 44  CYS A CB   3  
ATOM 3678  S SG   . CYS A 1 41  ? 9.882   10.580  0.856   1.00 0.00 ? 44  CYS A SG   3  
ATOM 3679  H H    . CYS A 1 41  ? 11.146  8.071   -1.322  1.00 0.00 ? 44  CYS A H    3  
ATOM 3680  H HA   . CYS A 1 41  ? 8.692   7.855   0.291   1.00 0.00 ? 44  CYS A HA   3  
ATOM 3681  H HB2  . CYS A 1 41  ? 9.544   10.166  -1.469  1.00 0.00 ? 44  CYS A HB2  3  
ATOM 3682  H HB3  . CYS A 1 41  ? 8.035   10.067  -0.570  1.00 0.00 ? 44  CYS A HB3  3  
ATOM 3683  N N    . GLN A 1 42  ? 8.927   6.571   -2.356  1.00 0.00 ? 45  GLN A N    3  
ATOM 3684  C CA   . GLN A 1 42  ? 8.299   5.942   -3.517  1.00 0.00 ? 45  GLN A CA   3  
ATOM 3685  C C    . GLN A 1 42  ? 8.688   4.472   -3.627  1.00 0.00 ? 45  GLN A C    3  
ATOM 3686  O O    . GLN A 1 42  ? 9.828   4.137   -3.960  1.00 0.00 ? 45  GLN A O    3  
ATOM 3687  C CB   . GLN A 1 42  ? 8.672   6.665   -4.814  1.00 0.00 ? 45  GLN A CB   3  
ATOM 3688  C CG   . GLN A 1 42  ? 8.173   5.960   -6.071  1.00 0.00 ? 45  GLN A CG   3  
ATOM 3689  C CD   . GLN A 1 42  ? 8.557   6.682   -7.345  1.00 0.00 ? 45  GLN A CD   3  
ATOM 3690  O OE1  . GLN A 1 42  ? 7.821   7.534   -7.832  1.00 0.00 ? 45  GLN A OE1  3  
ATOM 3691  N NE2  . GLN A 1 42  ? 9.714   6.344   -7.897  1.00 0.00 ? 45  GLN A NE2  3  
ATOM 3692  H H    . GLN A 1 42  ? 9.717   6.146   -1.949  1.00 0.00 ? 45  GLN A H    3  
ATOM 3693  H HA   . GLN A 1 42  ? 7.229   6.007   -3.381  1.00 0.00 ? 45  GLN A HA   3  
ATOM 3694  H HB2  . GLN A 1 42  ? 8.251   7.658   -4.793  1.00 0.00 ? 45  GLN A HB2  3  
ATOM 3695  H HB3  . GLN A 1 42  ? 9.746   6.742   -4.874  1.00 0.00 ? 45  GLN A HB3  3  
ATOM 3696  H HG2  . GLN A 1 42  ? 8.594   4.966   -6.099  1.00 0.00 ? 45  GLN A HG2  3  
ATOM 3697  H HG3  . GLN A 1 42  ? 7.097   5.891   -6.027  1.00 0.00 ? 45  GLN A HG3  3  
ATOM 3698  H HE21 . GLN A 1 42  ? 10.254  5.654   -7.460  1.00 0.00 ? 45  GLN A HE21 3  
ATOM 3699  H HE22 . GLN A 1 42  ? 9.981   6.799   -8.724  1.00 0.00 ? 45  GLN A HE22 3  
ATOM 3700  N N    . GLY A 1 43  ? 7.724   3.610   -3.370  1.00 0.00 ? 46  GLY A N    3  
ATOM 3701  C CA   . GLY A 1 43  ? 7.948   2.184   -3.451  1.00 0.00 ? 46  GLY A CA   3  
ATOM 3702  C C    . GLY A 1 43  ? 6.671   1.420   -3.194  1.00 0.00 ? 46  GLY A C    3  
ATOM 3703  O O    . GLY A 1 43  ? 5.591   2.016   -3.143  1.00 0.00 ? 46  GLY A O    3  
ATOM 3704  H H    . GLY A 1 43  ? 6.832   3.949   -3.129  1.00 0.00 ? 46  GLY A H    3  
ATOM 3705  H HA2  . GLY A 1 43  ? 8.320   1.938   -4.437  1.00 0.00 ? 46  GLY A HA2  3  
ATOM 3706  H HA3  . GLY A 1 43  ? 8.687   1.896   -2.712  1.00 0.00 ? 46  GLY A HA3  3  
ATOM 3707  N N    . GLN A 1 44  ? 6.781   0.111   -3.034  1.00 0.00 ? 47  GLN A N    3  
ATOM 3708  C CA   . GLN A 1 44  ? 5.630   -0.706  -2.695  1.00 0.00 ? 47  GLN A CA   3  
ATOM 3709  C C    . GLN A 1 44  ? 5.233   -0.446  -1.248  1.00 0.00 ? 47  GLN A C    3  
ATOM 3710  O O    . GLN A 1 44  ? 6.095   -0.308  -0.376  1.00 0.00 ? 47  GLN A O    3  
ATOM 3711  C CB   . GLN A 1 44  ? 5.924   -2.199  -2.899  1.00 0.00 ? 47  GLN A CB   3  
ATOM 3712  C CG   . GLN A 1 44  ? 6.408   -2.563  -4.299  1.00 0.00 ? 47  GLN A CG   3  
ATOM 3713  C CD   . GLN A 1 44  ? 7.908   -2.411  -4.465  1.00 0.00 ? 47  GLN A CD   3  
ATOM 3714  O OE1  . GLN A 1 44  ? 8.406   -1.351  -4.848  1.00 0.00 ? 47  GLN A OE1  3  
ATOM 3715  N NE2  . GLN A 1 44  ? 8.639   -3.477  -4.173  1.00 0.00 ? 47  GLN A NE2  3  
ATOM 3716  H H    . GLN A 1 44  ? 7.660   -0.319  -3.144  1.00 0.00 ? 47  GLN A H    3  
ATOM 3717  H HA   . GLN A 1 44  ? 4.814   -0.415  -3.339  1.00 0.00 ? 47  GLN A HA   3  
ATOM 3718  H HB2  . GLN A 1 44  ? 6.683   -2.500  -2.194  1.00 0.00 ? 47  GLN A HB2  3  
ATOM 3719  H HB3  . GLN A 1 44  ? 5.021   -2.761  -2.697  1.00 0.00 ? 47  GLN A HB3  3  
ATOM 3720  H HG2  . GLN A 1 44  ? 6.144   -3.590  -4.499  1.00 0.00 ? 47  GLN A HG2  3  
ATOM 3721  H HG3  . GLN A 1 44  ? 5.916   -1.920  -5.015  1.00 0.00 ? 47  GLN A HG3  3  
ATOM 3722  H HE21 . GLN A 1 44  ? 8.177   -4.285  -3.875  1.00 0.00 ? 47  GLN A HE21 3  
ATOM 3723  H HE22 . GLN A 1 44  ? 9.619   -3.411  -4.261  1.00 0.00 ? 47  GLN A HE22 3  
ATOM 3724  N N    . LEU A 1 45  ? 3.940   -0.354  -1.000  1.00 0.00 ? 48  LEU A N    3  
ATOM 3725  C CA   . LEU A 1 45  ? 3.440   -0.075  0.335   1.00 0.00 ? 48  LEU A CA   3  
ATOM 3726  C C    . LEU A 1 45  ? 3.439   -1.336  1.189   1.00 0.00 ? 48  LEU A C    3  
ATOM 3727  O O    . LEU A 1 45  ? 2.750   -2.310  0.881   1.00 0.00 ? 48  LEU A O    3  
ATOM 3728  C CB   . LEU A 1 45  ? 2.025   0.507   0.259   1.00 0.00 ? 48  LEU A CB   3  
ATOM 3729  C CG   . LEU A 1 45  ? 1.420   0.943   1.598   1.00 0.00 ? 48  LEU A CG   3  
ATOM 3730  C CD1  . LEU A 1 45  ? 2.176   2.129   2.178   1.00 0.00 ? 48  LEU A CD1  3  
ATOM 3731  C CD2  . LEU A 1 45  ? -0.049  1.290   1.423   1.00 0.00 ? 48  LEU A CD2  3  
ATOM 3732  H H    . LEU A 1 45  ? 3.301   -0.470  -1.738  1.00 0.00 ? 48  LEU A H    3  
ATOM 3733  H HA   . LEU A 1 45  ? 4.095   0.653   0.789   1.00 0.00 ? 48  LEU A HA   3  
ATOM 3734  H HB2  . LEU A 1 45  ? 2.050   1.366   -0.400  1.00 0.00 ? 48  LEU A HB2  3  
ATOM 3735  H HB3  . LEU A 1 45  ? 1.377   -0.241  -0.175  1.00 0.00 ? 48  LEU A HB3  3  
ATOM 3736  H HG   . LEU A 1 45  ? 1.491   0.127   2.302   1.00 0.00 ? 48  LEU A HG   3  
ATOM 3737  H HD11 . LEU A 1 45  ? 1.677   2.469   3.072   1.00 0.00 ? 48  LEU A HD11 3  
ATOM 3738  H HD12 . LEU A 1 45  ? 3.185   1.831   2.419   1.00 0.00 ? 48  LEU A HD12 3  
ATOM 3739  H HD13 . LEU A 1 45  ? 2.200   2.928   1.452   1.00 0.00 ? 48  LEU A HD13 3  
ATOM 3740  H HD21 . LEU A 1 45  ? -0.461  1.603   2.373   1.00 0.00 ? 48  LEU A HD21 3  
ATOM 3741  H HD22 . LEU A 1 45  ? -0.145  2.093   0.707   1.00 0.00 ? 48  LEU A HD22 3  
ATOM 3742  H HD23 . LEU A 1 45  ? -0.584  0.422   1.067   1.00 0.00 ? 48  LEU A HD23 3  
ATOM 3743  N N    . GLU A 1 46  ? 4.230   -1.317  2.248   1.00 0.00 ? 49  GLU A N    3  
ATOM 3744  C CA   . GLU A 1 46  ? 4.230   -2.390  3.225   1.00 0.00 ? 49  GLU A CA   3  
ATOM 3745  C C    . GLU A 1 46  ? 3.537   -1.926  4.490   1.00 0.00 ? 49  GLU A C    3  
ATOM 3746  O O    . GLU A 1 46  ? 3.871   -0.881  5.048   1.00 0.00 ? 49  GLU A O    3  
ATOM 3747  C CB   . GLU A 1 46  ? 5.651   -2.855  3.555   1.00 0.00 ? 49  GLU A CB   3  
ATOM 3748  C CG   . GLU A 1 46  ? 6.265   -3.753  2.499   1.00 0.00 ? 49  GLU A CG   3  
ATOM 3749  C CD   . GLU A 1 46  ? 7.644   -4.244  2.890   1.00 0.00 ? 49  GLU A CD   3  
ATOM 3750  O OE1  . GLU A 1 46  ? 8.619   -3.480  2.745   1.00 0.00 ? 49  GLU A OE1  3  
ATOM 3751  O OE2  . GLU A 1 46  ? 7.761   -5.400  3.343   1.00 0.00 ? 49  GLU A OE2  3  
ATOM 3752  H H    . GLU A 1 46  ? 4.822   -0.545  2.388   1.00 0.00 ? 49  GLU A H    3  
ATOM 3753  H HA   . GLU A 1 46  ? 3.675   -3.215  2.809   1.00 0.00 ? 49  GLU A HA   3  
ATOM 3754  H HB2  . GLU A 1 46  ? 6.284   -1.986  3.662   1.00 0.00 ? 49  GLU A HB2  3  
ATOM 3755  H HB3  . GLU A 1 46  ? 5.636   -3.394  4.492   1.00 0.00 ? 49  GLU A HB3  3  
ATOM 3756  H HG2  . GLU A 1 46  ? 5.625   -4.611  2.360   1.00 0.00 ? 49  GLU A HG2  3  
ATOM 3757  H HG3  . GLU A 1 46  ? 6.339   -3.202  1.574   1.00 0.00 ? 49  GLU A HG3  3  
ATOM 3758  N N    . VAL A 1 47  ? 2.566   -2.696  4.929   1.00 0.00 ? 50  VAL A N    3  
ATOM 3759  C CA   . VAL A 1 47  ? 1.824   -2.366  6.128   1.00 0.00 ? 50  VAL A CA   3  
ATOM 3760  C C    . VAL A 1 47  ? 2.099   -3.394  7.212   1.00 0.00 ? 50  VAL A C    3  
ATOM 3761  O O    . VAL A 1 47  ? 2.407   -4.554  6.921   1.00 0.00 ? 50  VAL A O    3  
ATOM 3762  C CB   . VAL A 1 47  ? 0.306   -2.277  5.864   1.00 0.00 ? 50  VAL A CB   3  
ATOM 3763  C CG1  . VAL A 1 47  ? 0.003   -1.183  4.853   1.00 0.00 ? 50  VAL A CG1  3  
ATOM 3764  C CG2  . VAL A 1 47  ? -0.250  -3.615  5.394   1.00 0.00 ? 50  VAL A CG2  3  
ATOM 3765  H H    . VAL A 1 47  ? 2.352   -3.520  4.439   1.00 0.00 ? 50  VAL A H    3  
ATOM 3766  H HA   . VAL A 1 47  ? 2.167   -1.401  6.473   1.00 0.00 ? 50  VAL A HA   3  
ATOM 3767  H HB   . VAL A 1 47  ? -0.182  -2.020  6.793   1.00 0.00 ? 50  VAL A HB   3  
ATOM 3768  H HG11 . VAL A 1 47  ? 0.387   -0.240  5.217   1.00 0.00 ? 50  VAL A HG11 3  
ATOM 3769  H HG12 . VAL A 1 47  ? 0.476   -1.423  3.912   1.00 0.00 ? 50  VAL A HG12 3  
ATOM 3770  H HG13 . VAL A 1 47  ? -1.065  -1.107  4.712   1.00 0.00 ? 50  VAL A HG13 3  
ATOM 3771  H HG21 . VAL A 1 47  ? -0.064  -4.368  6.144   1.00 0.00 ? 50  VAL A HG21 3  
ATOM 3772  H HG22 . VAL A 1 47  ? -1.315  -3.524  5.233   1.00 0.00 ? 50  VAL A HG22 3  
ATOM 3773  H HG23 . VAL A 1 47  ? 0.228   -3.900  4.469   1.00 0.00 ? 50  VAL A HG23 3  
ATOM 3774  N N    . TYR A 1 48  ? 2.016   -2.965  8.457   1.00 0.00 ? 51  TYR A N    3  
ATOM 3775  C CA   . TYR A 1 48  ? 2.267   -3.852  9.575   1.00 0.00 ? 51  TYR A CA   3  
ATOM 3776  C C    . TYR A 1 48  ? 0.983   -4.531  10.017  1.00 0.00 ? 51  TYR A C    3  
ATOM 3777  O O    . TYR A 1 48  ? 0.110   -3.907  10.624  1.00 0.00 ? 51  TYR A O    3  
ATOM 3778  C CB   . TYR A 1 48  ? 2.894   -3.095  10.749  1.00 0.00 ? 51  TYR A CB   3  
ATOM 3779  C CG   . TYR A 1 48  ? 3.173   -3.979  11.950  1.00 0.00 ? 51  TYR A CG   3  
ATOM 3780  C CD1  . TYR A 1 48  ? 4.193   -4.923  11.921  1.00 0.00 ? 51  TYR A CD1  3  
ATOM 3781  C CD2  . TYR A 1 48  ? 2.413   -3.872  13.111  1.00 0.00 ? 51  TYR A CD2  3  
ATOM 3782  C CE1  . TYR A 1 48  ? 4.443   -5.735  13.010  1.00 0.00 ? 51  TYR A CE1  3  
ATOM 3783  C CE2  . TYR A 1 48  ? 2.661   -4.681  14.203  1.00 0.00 ? 51  TYR A CE2  3  
ATOM 3784  C CZ   . TYR A 1 48  ? 3.676   -5.609  14.147  1.00 0.00 ? 51  TYR A CZ   3  
ATOM 3785  O OH   . TYR A 1 48  ? 3.924   -6.419  15.232  1.00 0.00 ? 51  TYR A OH   3  
ATOM 3786  H H    . TYR A 1 48  ? 1.773   -2.026  8.630   1.00 0.00 ? 51  TYR A H    3  
ATOM 3787  H HA   . TYR A 1 48  ? 2.957   -4.611  9.240   1.00 0.00 ? 51  TYR A HA   3  
ATOM 3788  H HB2  . TYR A 1 48  ? 3.831   -2.656  10.431  1.00 0.00 ? 51  TYR A HB2  3  
ATOM 3789  H HB3  . TYR A 1 48  ? 2.221   -2.310  11.061  1.00 0.00 ? 51  TYR A HB3  3  
ATOM 3790  H HD1  . TYR A 1 48  ? 4.794   -5.022  11.029  1.00 0.00 ? 51  TYR A HD1  3  
ATOM 3791  H HD2  . TYR A 1 48  ? 1.616   -3.145  13.153  1.00 0.00 ? 51  TYR A HD2  3  
ATOM 3792  H HE1  . TYR A 1 48  ? 5.240   -6.464  12.968  1.00 0.00 ? 51  TYR A HE1  3  
ATOM 3793  H HE2  . TYR A 1 48  ? 2.060   -4.583  15.095  1.00 0.00 ? 51  TYR A HE2  3  
ATOM 3794  H HH   . TYR A 1 48  ? 4.880   -6.538  15.328  1.00 0.00 ? 51  TYR A HH   3  
ATOM 3795  N N    . LEU A 1 49  ? 0.867   -5.807  9.696   1.00 0.00 ? 52  LEU A N    3  
ATOM 3796  C CA   . LEU A 1 49  ? -0.246  -6.607  10.170  1.00 0.00 ? 52  LEU A CA   3  
ATOM 3797  C C    . LEU A 1 49  ? 0.165   -7.327  11.443  1.00 0.00 ? 52  LEU A C    3  
ATOM 3798  O O    . LEU A 1 49  ? 1.340   -7.280  11.819  1.00 0.00 ? 52  LEU A O    3  
ATOM 3799  C CB   . LEU A 1 49  ? -0.721  -7.607  9.108   1.00 0.00 ? 52  LEU A CB   3  
ATOM 3800  C CG   . LEU A 1 49  ? -2.006  -7.218  8.366   1.00 0.00 ? 52  LEU A CG   3  
ATOM 3801  C CD1  . LEU A 1 49  ? -1.822  -5.932  7.576   1.00 0.00 ? 52  LEU A CD1  3  
ATOM 3802  C CD2  . LEU A 1 49  ? -2.453  -8.347  7.453   1.00 0.00 ? 52  LEU A CD2  3  
ATOM 3803  H H    . LEU A 1 49  ? 1.563   -6.226  9.149   1.00 0.00 ? 52  LEU A H    3  
ATOM 3804  H HA   . LEU A 1 49  ? -1.057  -5.934  10.403  1.00 0.00 ? 52  LEU A HA   3  
ATOM 3805  H HB2  . LEU A 1 49  ? 0.068   -7.729  8.380   1.00 0.00 ? 52  LEU A HB2  3  
ATOM 3806  H HB3  . LEU A 1 49  ? -0.889  -8.557  9.588   1.00 0.00 ? 52  LEU A HB3  3  
ATOM 3807  H HG   . LEU A 1 49  ? -2.787  -7.049  9.089   1.00 0.00 ? 52  LEU A HG   3  
ATOM 3808  H HD11 . LEU A 1 49  ? -2.739  -5.693  7.059   1.00 0.00 ? 52  LEU A HD11 3  
ATOM 3809  H HD12 . LEU A 1 49  ? -1.570  -5.129  8.253   1.00 0.00 ? 52  LEU A HD12 3  
ATOM 3810  H HD13 . LEU A 1 49  ? -1.026  -6.062  6.856   1.00 0.00 ? 52  LEU A HD13 3  
ATOM 3811  H HD21 . LEU A 1 49  ? -3.345  -8.050  6.922   1.00 0.00 ? 52  LEU A HD21 3  
ATOM 3812  H HD22 . LEU A 1 49  ? -1.669  -8.570  6.744   1.00 0.00 ? 52  LEU A HD22 3  
ATOM 3813  H HD23 . LEU A 1 49  ? -2.664  -9.225  8.044   1.00 0.00 ? 52  LEU A HD23 3  
ATOM 3814  N N    . LYS A 1 50  ? -0.774  -7.988  12.100  1.00 0.00 ? 53  LYS A N    3  
ATOM 3815  C CA   . LYS A 1 50  ? -0.495  -8.636  13.379  1.00 0.00 ? 53  LYS A CA   3  
ATOM 3816  C C    . LYS A 1 50  ? 0.688   -9.603  13.268  1.00 0.00 ? 53  LYS A C    3  
ATOM 3817  O O    . LYS A 1 50  ? 1.463   -9.765  14.211  1.00 0.00 ? 53  LYS A O    3  
ATOM 3818  C CB   . LYS A 1 50  ? -1.737  -9.375  13.884  1.00 0.00 ? 53  LYS A CB   3  
ATOM 3819  C CG   . LYS A 1 50  ? -1.669  -9.728  15.359  1.00 0.00 ? 53  LYS A CG   3  
ATOM 3820  C CD   . LYS A 1 50  ? -2.929  -10.438 15.826  1.00 0.00 ? 53  LYS A CD   3  
ATOM 3821  C CE   . LYS A 1 50  ? -2.982  -10.518 17.343  1.00 0.00 ? 53  LYS A CE   3  
ATOM 3822  N NZ   . LYS A 1 50  ? -3.050  -9.167  17.965  1.00 0.00 ? 53  LYS A NZ   3  
ATOM 3823  H H    . LYS A 1 50  ? -1.679  -8.028  11.731  1.00 0.00 ? 53  LYS A H    3  
ATOM 3824  H HA   . LYS A 1 50  ? -0.240  -7.861  14.087  1.00 0.00 ? 53  LYS A HA   3  
ATOM 3825  H HB2  . LYS A 1 50  ? -2.604  -8.752  13.724  1.00 0.00 ? 53  LYS A HB2  3  
ATOM 3826  H HB3  . LYS A 1 50  ? -1.851  -10.290 13.322  1.00 0.00 ? 53  LYS A HB3  3  
ATOM 3827  H HG2  . LYS A 1 50  ? -0.821  -10.376 15.525  1.00 0.00 ? 53  LYS A HG2  3  
ATOM 3828  H HG3  . LYS A 1 50  ? -1.547  -8.820  15.930  1.00 0.00 ? 53  LYS A HG3  3  
ATOM 3829  H HD2  . LYS A 1 50  ? -3.793  -9.892  15.473  1.00 0.00 ? 53  LYS A HD2  3  
ATOM 3830  H HD3  . LYS A 1 50  ? -2.939  -11.438 15.420  1.00 0.00 ? 53  LYS A HD3  3  
ATOM 3831  H HE2  . LYS A 1 50  ? -3.857  -11.083 17.632  1.00 0.00 ? 53  LYS A HE2  3  
ATOM 3832  H HE3  . LYS A 1 50  ? -2.095  -11.023 17.696  1.00 0.00 ? 53  LYS A HE3  3  
ATOM 3833  H HZ1  . LYS A 1 50  ? -2.211  -8.612  17.689  1.00 0.00 ? 53  LYS A HZ1  3  
ATOM 3834  H HZ3  . LYS A 1 50  ? -3.048  -9.259  19.004  1.00 0.00 ? 53  LYS A HZ3  3  
ATOM 3835  N N    . ASP A 1 51  ? 0.840   -10.211 12.099  1.00 0.00 ? 54  ASP A N    3  
ATOM 3836  C CA   . ASP A 1 51  ? 1.897   -11.190 11.880  1.00 0.00 ? 54  ASP A CA   3  
ATOM 3837  C C    . ASP A 1 51  ? 3.008   -10.650 10.982  1.00 0.00 ? 54  ASP A C    3  
ATOM 3838  O O    . ASP A 1 51  ? 3.582   -11.390 10.183  1.00 0.00 ? 54  ASP A O    3  
ATOM 3839  C CB   . ASP A 1 51  ? 1.324   -12.481 11.288  1.00 0.00 ? 54  ASP A CB   3  
ATOM 3840  C CG   . ASP A 1 51  ? 0.680   -13.365 12.338  1.00 0.00 ? 54  ASP A CG   3  
ATOM 3841  O OD1  . ASP A 1 51  ? -0.395  -13.001 12.856  1.00 0.00 ? 54  ASP A OD1  3  
ATOM 3842  O OD2  . ASP A 1 51  ? 1.257   -14.430 12.658  1.00 0.00 ? 54  ASP A OD2  3  
ATOM 3843  H H    . ASP A 1 51  ? 0.229   -9.995  11.369  1.00 0.00 ? 54  ASP A H    3  
ATOM 3844  H HA   . ASP A 1 51  ? 2.322   -11.422 12.844  1.00 0.00 ? 54  ASP A HA   3  
ATOM 3845  H HB2  . ASP A 1 51  ? 0.577   -12.232 10.548  1.00 0.00 ? 54  ASP A HB2  3  
ATOM 3846  H HB3  . ASP A 1 51  ? 2.121   -13.037 10.815  1.00 0.00 ? 54  ASP A HB3  3  
ATOM 3847  N N    . GLY A 1 52  ? 3.299   -9.359  11.091  1.00 0.00 ? 55  GLY A N    3  
ATOM 3848  C CA   . GLY A 1 52  ? 4.483   -8.820  10.440  1.00 0.00 ? 55  GLY A CA   3  
ATOM 3849  C C    . GLY A 1 52  ? 4.186   -7.895  9.272   1.00 0.00 ? 55  GLY A C    3  
ATOM 3850  O O    . GLY A 1 52  ? 3.028   -7.719  8.874   1.00 0.00 ? 55  GLY A O    3  
ATOM 3851  H H    . GLY A 1 52  ? 2.703   -8.765  11.603  1.00 0.00 ? 55  GLY A H    3  
ATOM 3852  H HA2  . GLY A 1 52  ? 5.059   -8.274  11.171  1.00 0.00 ? 55  GLY A HA2  3  
ATOM 3853  H HA3  . GLY A 1 52  ? 5.082   -9.646  10.082  1.00 0.00 ? 55  GLY A HA3  3  
ATOM 3854  N N    . TRP A 1 53  ? 5.249   -7.321  8.716   1.00 0.00 ? 56  TRP A N    3  
ATOM 3855  C CA   . TRP A 1 53  ? 5.144   -6.384  7.603   1.00 0.00 ? 56  TRP A CA   3  
ATOM 3856  C C    . TRP A 1 53  ? 4.854   -7.122  6.306   1.00 0.00 ? 56  TRP A C    3  
ATOM 3857  O O    . TRP A 1 53  ? 5.449   -8.162  6.028   1.00 0.00 ? 56  TRP A O    3  
ATOM 3858  C CB   . TRP A 1 53  ? 6.439   -5.582  7.460   1.00 0.00 ? 56  TRP A CB   3  
ATOM 3859  C CG   . TRP A 1 53  ? 6.719   -4.682  8.624   1.00 0.00 ? 56  TRP A CG   3  
ATOM 3860  C CD1  . TRP A 1 53  ? 7.434   -4.984  9.751   1.00 0.00 ? 56  TRP A CD1  3  
ATOM 3861  C CD2  . TRP A 1 53  ? 6.292   -3.326  8.772   1.00 0.00 ? 56  TRP A CD2  3  
ATOM 3862  N NE1  . TRP A 1 53  ? 7.469   -3.898  10.588  1.00 0.00 ? 56  TRP A NE1  3  
ATOM 3863  C CE2  . TRP A 1 53  ? 6.777   -2.869  10.009  1.00 0.00 ? 56  TRP A CE2  3  
ATOM 3864  C CE3  . TRP A 1 53  ? 5.545   -2.453  7.978   1.00 0.00 ? 56  TRP A CE3  3  
ATOM 3865  C CZ2  . TRP A 1 53  ? 6.538   -1.579  10.470  1.00 0.00 ? 56  TRP A CZ2  3  
ATOM 3866  C CZ3  . TRP A 1 53  ? 5.309   -1.174  8.434   1.00 0.00 ? 56  TRP A CZ3  3  
ATOM 3867  C CH2  . TRP A 1 53  ? 5.805   -0.746  9.671   1.00 0.00 ? 56  TRP A CH2  3  
ATOM 3868  H H    . TRP A 1 53  ? 6.140   -7.546  9.054   1.00 0.00 ? 56  TRP A H    3  
ATOM 3869  H HA   . TRP A 1 53  ? 4.329   -5.707  7.811   1.00 0.00 ? 56  TRP A HA   3  
ATOM 3870  H HB2  . TRP A 1 53  ? 7.267   -6.269  7.364   1.00 0.00 ? 56  TRP A HB2  3  
ATOM 3871  H HB3  . TRP A 1 53  ? 6.382   -4.972  6.571   1.00 0.00 ? 56  TRP A HB3  3  
ATOM 3872  H HD1  . TRP A 1 53  ? 7.894   -5.941  9.946   1.00 0.00 ? 56  TRP A HD1  3  
ATOM 3873  H HE1  . TRP A 1 53  ? 7.917   -3.866  11.462  1.00 0.00 ? 56  TRP A HE1  3  
ATOM 3874  H HE3  . TRP A 1 53  ? 5.154   -2.762  7.020   1.00 0.00 ? 56  TRP A HE3  3  
ATOM 3875  H HZ2  . TRP A 1 53  ? 6.915   -1.233  11.421  1.00 0.00 ? 56  TRP A HZ2  3  
ATOM 3876  H HZ3  . TRP A 1 53  ? 4.733   -0.487  7.834   1.00 0.00 ? 56  TRP A HZ3  3  
ATOM 3877  H HH2  . TRP A 1 53  ? 5.594   0.264   9.988   1.00 0.00 ? 56  TRP A HH2  3  
ATOM 3878  N N    . HIS A 1 54  ? 3.934   -6.588  5.517   1.00 0.00 ? 57  HIS A N    3  
ATOM 3879  C CA   . HIS A 1 54  ? 3.534   -7.231  4.274   1.00 0.00 ? 57  HIS A CA   3  
ATOM 3880  C C    . HIS A 1 54  ? 3.241   -6.201  3.191   1.00 0.00 ? 57  HIS A C    3  
ATOM 3881  O O    . HIS A 1 54  ? 2.687   -5.135  3.467   1.00 0.00 ? 57  HIS A O    3  
ATOM 3882  C CB   . HIS A 1 54  ? 2.297   -8.100  4.507   1.00 0.00 ? 57  HIS A CB   3  
ATOM 3883  C CG   . HIS A 1 54  ? 2.581   -9.403  5.194   1.00 0.00 ? 57  HIS A CG   3  
ATOM 3884  N ND1  . HIS A 1 54  ? 2.559   -9.562  6.567   1.00 0.00 ? 57  HIS A ND1  3  
ATOM 3885  C CD2  . HIS A 1 54  ? 2.876   -10.621 4.682   1.00 0.00 ? 57  HIS A CD2  3  
ATOM 3886  C CE1  . HIS A 1 54  ? 2.825   -10.821 6.864   1.00 0.00 ? 57  HIS A CE1  3  
ATOM 3887  N NE2  . HIS A 1 54  ? 3.020   -11.483 5.740   1.00 0.00 ? 57  HIS A NE2  3  
ATOM 3888  H H    . HIS A 1 54  ? 3.510   -5.737  5.775   1.00 0.00 ? 57  HIS A H    3  
ATOM 3889  H HA   . HIS A 1 54  ? 4.347   -7.860  3.947   1.00 0.00 ? 57  HIS A HA   3  
ATOM 3890  H HB2  . HIS A 1 54  ? 1.596   -7.553  5.120   1.00 0.00 ? 57  HIS A HB2  3  
ATOM 3891  H HB3  . HIS A 1 54  ? 1.841   -8.318  3.554   1.00 0.00 ? 57  HIS A HB3  3  
ATOM 3892  H HD1  . HIS A 1 54  ? 2.391   -8.853  7.225   1.00 0.00 ? 57  HIS A HD1  3  
ATOM 3893  H HD2  . HIS A 1 54  ? 2.983   -10.867 3.636   1.00 0.00 ? 57  HIS A HD2  3  
ATOM 3894  H HE1  . HIS A 1 54  ? 2.881   -11.236 7.861   1.00 0.00 ? 57  HIS A HE1  3  
ATOM 3895  N N    . MET A 1 55  ? 3.624   -6.536  1.965   1.00 0.00 ? 58  MET A N    3  
ATOM 3896  C CA   . MET A 1 55  ? 3.366   -5.689  0.803   1.00 0.00 ? 58  MET A CA   3  
ATOM 3897  C C    . MET A 1 55  ? 1.888   -5.717  0.453   1.00 0.00 ? 58  MET A C    3  
ATOM 3898  O O    . MET A 1 55  ? 1.265   -6.770  0.492   1.00 0.00 ? 58  MET A O    3  
ATOM 3899  C CB   . MET A 1 55  ? 4.169   -6.184  -0.405  1.00 0.00 ? 58  MET A CB   3  
ATOM 3900  C CG   . MET A 1 55  ? 5.676   -6.150  -0.219  1.00 0.00 ? 58  MET A CG   3  
ATOM 3901  S SD   . MET A 1 55  ? 6.554   -6.984  -1.560  1.00 0.00 ? 58  MET A SD   3  
ATOM 3902  C CE   . MET A 1 55  ? 5.820   -6.204  -2.997  1.00 0.00 ? 58  MET A CE   3  
ATOM 3903  H H    . MET A 1 55  ? 4.093   -7.389  1.833   1.00 0.00 ? 58  MET A H    3  
ATOM 3904  H HA   . MET A 1 55  ? 3.660   -4.681  1.042   1.00 0.00 ? 58  MET A HA   3  
ATOM 3905  H HB2  . MET A 1 55  ? 3.879   -7.203  -0.618  1.00 0.00 ? 58  MET A HB2  3  
ATOM 3906  H HB3  . MET A 1 55  ? 3.921   -5.569  -1.257  1.00 0.00 ? 58  MET A HB3  3  
ATOM 3907  H HG2  . MET A 1 55  ? 6.000   -5.120  -0.180  1.00 0.00 ? 58  MET A HG2  3  
ATOM 3908  H HG3  . MET A 1 55  ? 5.921   -6.639  0.712   1.00 0.00 ? 58  MET A HG3  3  
ATOM 3909  H HE1  . MET A 1 55  ? 4.749   -6.354  -2.978  1.00 0.00 ? 58  MET A HE1  3  
ATOM 3910  H HE2  . MET A 1 55  ? 6.035   -5.145  -2.982  1.00 0.00 ? 58  MET A HE2  3  
ATOM 3911  H HE3  . MET A 1 55  ? 6.228   -6.644  -3.894  1.00 0.00 ? 58  MET A HE3  3  
ATOM 3912  N N    . VAL A 1 56  ? 1.328   -4.571  0.108   1.00 0.00 ? 59  VAL A N    3  
ATOM 3913  C CA   . VAL A 1 56  ? -0.069  -4.510  -0.299  1.00 0.00 ? 59  VAL A CA   3  
ATOM 3914  C C    . VAL A 1 56  ? -0.184  -4.616  -1.817  1.00 0.00 ? 59  VAL A C    3  
ATOM 3915  O O    . VAL A 1 56  ? 0.538   -3.941  -2.550  1.00 0.00 ? 59  VAL A O    3  
ATOM 3916  C CB   . VAL A 1 56  ? -0.749  -3.202  0.175   1.00 0.00 ? 59  VAL A CB   3  
ATOM 3917  C CG1  . VAL A 1 56  ? -2.210  -3.157  -0.261  1.00 0.00 ? 59  VAL A CG1  3  
ATOM 3918  C CG2  . VAL A 1 56  ? -0.647  -3.053  1.686   1.00 0.00 ? 59  VAL A CG2  3  
ATOM 3919  H H    . VAL A 1 56  ? 1.864   -3.745  0.129   1.00 0.00 ? 59  VAL A H    3  
ATOM 3920  H HA   . VAL A 1 56  ? -0.584  -5.347  0.151   1.00 0.00 ? 59  VAL A HA   3  
ATOM 3921  H HB   . VAL A 1 56  ? -0.234  -2.368  -0.282  1.00 0.00 ? 59  VAL A HB   3  
ATOM 3922  H HG11 . VAL A 1 56  ? -2.267  -3.201  -1.339  1.00 0.00 ? 59  VAL A HG11 3  
ATOM 3923  H HG12 . VAL A 1 56  ? -2.739  -3.999  0.161   1.00 0.00 ? 59  VAL A HG12 3  
ATOM 3924  H HG13 . VAL A 1 56  ? -2.661  -2.239  0.085   1.00 0.00 ? 59  VAL A HG13 3  
ATOM 3925  H HG21 . VAL A 1 56  ? -1.132  -2.136  1.991   1.00 0.00 ? 59  VAL A HG21 3  
ATOM 3926  H HG22 . VAL A 1 56  ? -1.130  -3.892  2.164   1.00 0.00 ? 59  VAL A HG22 3  
ATOM 3927  H HG23 . VAL A 1 56  ? 0.391   -3.022  1.977   1.00 0.00 ? 59  VAL A HG23 3  
ATOM 3928  N N    . CYS A 1 57  ? -1.066  -5.490  -2.283  1.00 0.00 ? 60  CYS A N    3  
ATOM 3929  C CA   . CYS A 1 57  ? -1.371  -5.581  -3.704  1.00 0.00 ? 60  CYS A CA   3  
ATOM 3930  C C    . CYS A 1 57  ? -2.373  -4.495  -4.097  1.00 0.00 ? 60  CYS A C    3  
ATOM 3931  O O    . CYS A 1 57  ? -3.302  -4.195  -3.347  1.00 0.00 ? 60  CYS A O    3  
ATOM 3932  C CB   . CYS A 1 57  ? -1.932  -6.966  -4.051  1.00 0.00 ? 60  CYS A CB   3  
ATOM 3933  S SG   . CYS A 1 57  ? -0.718  -8.322  -3.945  1.00 0.00 ? 60  CYS A SG   3  
ATOM 3934  H H    . CYS A 1 57  ? -1.514  -6.102  -1.655  1.00 0.00 ? 60  CYS A H    3  
ATOM 3935  H HA   . CYS A 1 57  ? -0.453  -5.423  -4.249  1.00 0.00 ? 60  CYS A HA   3  
ATOM 3936  H HB2  . CYS A 1 57  ? -2.737  -7.200  -3.369  1.00 0.00 ? 60  CYS A HB2  3  
ATOM 3937  H HB3  . CYS A 1 57  ? -2.317  -6.948  -5.059  1.00 0.00 ? 60  CYS A HB3  3  
ATOM 3938  N N    . SER A 1 58  ? -2.186  -3.912  -5.274  1.00 0.00 ? 61  SER A N    3  
ATOM 3939  C CA   . SER A 1 58  ? -3.021  -2.806  -5.729  1.00 0.00 ? 61  SER A CA   3  
ATOM 3940  C C    . SER A 1 58  ? -4.390  -3.281  -6.221  1.00 0.00 ? 61  SER A C    3  
ATOM 3941  O O    . SER A 1 58  ? -5.243  -2.472  -6.574  1.00 0.00 ? 61  SER A O    3  
ATOM 3942  C CB   . SER A 1 58  ? -2.288  -2.031  -6.823  1.00 0.00 ? 61  SER A CB   3  
ATOM 3943  O OG   . SER A 1 58  ? -1.596  -2.914  -7.692  1.00 0.00 ? 61  SER A OG   3  
ATOM 3944  H H    . SER A 1 58  ? -1.460  -4.233  -5.859  1.00 0.00 ? 61  SER A H    3  
ATOM 3945  H HA   . SER A 1 58  ? -3.175  -2.149  -4.888  1.00 0.00 ? 61  SER A HA   3  
ATOM 3946  H HB2  . SER A 1 58  ? -3.003  -1.461  -7.400  1.00 0.00 ? 61  SER A HB2  3  
ATOM 3947  H HB3  . SER A 1 58  ? -1.573  -1.360  -6.368  1.00 0.00 ? 61  SER A HB3  3  
ATOM 3948  H HG   . SER A 1 58  ? -0.645  -2.796  -7.573  1.00 0.00 ? 61  SER A HG   3  
ATOM 3949  N N    . GLN A 1 59  ? -4.595  -4.594  -6.235  1.00 0.00 ? 62  GLN A N    3  
ATOM 3950  C CA   . GLN A 1 59  ? -5.898  -5.155  -6.580  1.00 0.00 ? 62  GLN A CA   3  
ATOM 3951  C C    . GLN A 1 59  ? -6.795  -5.248  -5.349  1.00 0.00 ? 62  GLN A C    3  
ATOM 3952  O O    . GLN A 1 59  ? -7.889  -5.811  -5.406  1.00 0.00 ? 62  GLN A O    3  
ATOM 3953  C CB   . GLN A 1 59  ? -5.748  -6.536  -7.228  1.00 0.00 ? 62  GLN A CB   3  
ATOM 3954  C CG   . GLN A 1 59  ? -5.730  -6.506  -8.750  1.00 0.00 ? 62  GLN A CG   3  
ATOM 3955  C CD   . GLN A 1 59  ? -4.647  -5.612  -9.320  1.00 0.00 ? 62  GLN A CD   3  
ATOM 3956  O OE1  . GLN A 1 59  ? -3.527  -6.057  -9.575  1.00 0.00 ? 62  GLN A OE1  3  
ATOM 3957  N NE2  . GLN A 1 59  ? -4.971  -4.346  -9.525  1.00 0.00 ? 62  GLN A NE2  3  
ATOM 3958  H H    . GLN A 1 59  ? -3.854  -5.194  -6.021  1.00 0.00 ? 62  GLN A H    3  
ATOM 3959  H HA   . GLN A 1 59  ? -6.361  -4.488  -7.291  1.00 0.00 ? 62  GLN A HA   3  
ATOM 3960  H HB2  . GLN A 1 59  ? -4.826  -6.983  -6.889  1.00 0.00 ? 62  GLN A HB2  3  
ATOM 3961  H HB3  . GLN A 1 59  ? -6.573  -7.157  -6.914  1.00 0.00 ? 62  GLN A HB3  3  
ATOM 3962  H HG2  . GLN A 1 59  ? -5.568  -7.511  -9.111  1.00 0.00 ? 62  GLN A HG2  3  
ATOM 3963  H HG3  . GLN A 1 59  ? -6.689  -6.154  -9.101  1.00 0.00 ? 62  GLN A HG3  3  
ATOM 3964  H HE21 . GLN A 1 59  ? -5.887  -4.056  -9.300  1.00 0.00 ? 62  GLN A HE21 3  
ATOM 3965  H HE22 . GLN A 1 59  ? -4.288  -3.745  -9.883  1.00 0.00 ? 62  GLN A HE22 3  
ATOM 3966  N N    . SER A 1 60  ? -6.328  -4.689  -4.240  1.00 0.00 ? 63  SER A N    3  
ATOM 3967  C CA   . SER A 1 60  ? -7.103  -4.668  -3.014  1.00 0.00 ? 63  SER A CA   3  
ATOM 3968  C C    . SER A 1 60  ? -8.295  -3.731  -3.159  1.00 0.00 ? 63  SER A C    3  
ATOM 3969  O O    . SER A 1 60  ? -8.243  -2.768  -3.924  1.00 0.00 ? 63  SER A O    3  
ATOM 3970  C CB   . SER A 1 60  ? -6.225  -4.219  -1.841  1.00 0.00 ? 63  SER A CB   3  
ATOM 3971  O OG   . SER A 1 60  ? -5.143  -5.115  -1.646  1.00 0.00 ? 63  SER A OG   3  
ATOM 3972  H H    . SER A 1 60  ? -5.445  -4.269  -4.250  1.00 0.00 ? 63  SER A H    3  
ATOM 3973  H HA   . SER A 1 60  ? -7.462  -5.674  -2.828  1.00 0.00 ? 63  SER A HA   3  
ATOM 3974  H HB2  . SER A 1 60  ? -5.827  -3.234  -2.046  1.00 0.00 ? 63  SER A HB2  3  
ATOM 3975  H HB3  . SER A 1 60  ? -6.819  -4.186  -0.937  1.00 0.00 ? 63  SER A HB3  3  
ATOM 3976  H HG   . SER A 1 60  ? -4.369  -4.784  -2.126  1.00 0.00 ? 63  SER A HG   3  
ATOM 3977  N N    . TRP A 1 61  ? -9.365  -4.040  -2.434  1.00 0.00 ? 64  TRP A N    3  
ATOM 3978  C CA   . TRP A 1 61  ? -10.585 -3.226  -2.429  1.00 0.00 ? 64  TRP A CA   3  
ATOM 3979  C C    . TRP A 1 61  ? -11.205 -3.137  -3.824  1.00 0.00 ? 64  TRP A C    3  
ATOM 3980  O O    . TRP A 1 61  ? -11.958 -2.210  -4.123  1.00 0.00 ? 64  TRP A O    3  
ATOM 3981  C CB   . TRP A 1 61  ? -10.294 -1.817  -1.894  1.00 0.00 ? 64  TRP A CB   3  
ATOM 3982  C CG   . TRP A 1 61  ? -9.521  -1.811  -0.608  1.00 0.00 ? 64  TRP A CG   3  
ATOM 3983  C CD1  . TRP A 1 61  ? -9.921  -2.315  0.593   1.00 0.00 ? 64  TRP A CD1  3  
ATOM 3984  C CD2  . TRP A 1 61  ? -8.215  -1.262  -0.401  1.00 0.00 ? 64  TRP A CD2  3  
ATOM 3985  N NE1  . TRP A 1 61  ? -8.944  -2.115  1.537   1.00 0.00 ? 64  TRP A NE1  3  
ATOM 3986  C CE2  . TRP A 1 61  ? -7.885  -1.473  0.952   1.00 0.00 ? 64  TRP A CE2  3  
ATOM 3987  C CE3  . TRP A 1 61  ? -7.292  -0.617  -1.226  1.00 0.00 ? 64  TRP A CE3  3  
ATOM 3988  C CZ2  . TRP A 1 61  ? -6.670  -1.059  1.494   1.00 0.00 ? 64  TRP A CZ2  3  
ATOM 3989  C CZ3  . TRP A 1 61  ? -6.089  -0.206  -0.688  1.00 0.00 ? 64  TRP A CZ3  3  
ATOM 3990  C CH2  . TRP A 1 61  ? -5.786  -0.429  0.659   1.00 0.00 ? 64  TRP A CH2  3  
ATOM 3991  H H    . TRP A 1 61  ? -9.331  -4.843  -1.870  1.00 0.00 ? 64  TRP A H    3  
ATOM 3992  H HA   . TRP A 1 61  ? -11.294 -3.710  -1.772  1.00 0.00 ? 64  TRP A HA   3  
ATOM 3993  H HB2  . TRP A 1 61  ? -9.719  -1.275  -2.630  1.00 0.00 ? 64  TRP A HB2  3  
ATOM 3994  H HB3  . TRP A 1 61  ? -11.231 -1.302  -1.724  1.00 0.00 ? 64  TRP A HB3  3  
ATOM 3995  H HD1  . TRP A 1 61  ? -10.873 -2.796  0.764   1.00 0.00 ? 64  TRP A HD1  3  
ATOM 3996  H HE1  . TRP A 1 61  ? -8.999  -2.391  2.484   1.00 0.00 ? 64  TRP A HE1  3  
ATOM 3997  H HE3  . TRP A 1 61  ? -7.508  -0.435  -2.266  1.00 0.00 ? 64  TRP A HE3  3  
ATOM 3998  H HZ2  . TRP A 1 61  ? -6.419  -1.226  2.531   1.00 0.00 ? 64  TRP A HZ2  3  
ATOM 3999  H HZ3  . TRP A 1 61  ? -5.364  0.294   -1.310  1.00 0.00 ? 64  TRP A HZ3  3  
ATOM 4000  H HH2  . TRP A 1 61  ? -4.833  -0.091  1.037   1.00 0.00 ? 64  TRP A HH2  3  
ATOM 4001  N N    . GLY A 1 62  ? -10.880 -4.107  -4.672  1.00 0.00 ? 65  GLY A N    3  
ATOM 4002  C CA   . GLY A 1 62  ? -11.430 -4.139  -6.013  1.00 0.00 ? 65  GLY A CA   3  
ATOM 4003  C C    . GLY A 1 62  ? -10.930 -2.995  -6.875  1.00 0.00 ? 65  GLY A C    3  
ATOM 4004  O O    . GLY A 1 62  ? -11.718 -2.306  -7.527  1.00 0.00 ? 65  GLY A O    3  
ATOM 4005  H H    . GLY A 1 62  ? -10.255 -4.804  -4.385  1.00 0.00 ? 65  GLY A H    3  
ATOM 4006  H HA2  . GLY A 1 62  ? -11.160 -5.076  -6.480  1.00 0.00 ? 65  GLY A HA2  3  
ATOM 4007  H HA3  . GLY A 1 62  ? -12.506 -4.081  -5.949  1.00 0.00 ? 65  GLY A HA3  3  
ATOM 4008  N N    . ARG A 1 63  ? -9.623  -2.771  -6.867  1.00 0.00 ? 66  ARG A N    3  
ATOM 4009  C CA   . ARG A 1 63  ? -9.030  -1.713  -7.672  1.00 0.00 ? 66  ARG A CA   3  
ATOM 4010  C C    . ARG A 1 63  ? -8.340  -2.291  -8.904  1.00 0.00 ? 66  ARG A C    3  
ATOM 4011  O O    . ARG A 1 63  ? -7.567  -3.248  -8.812  1.00 0.00 ? 66  ARG A O    3  
ATOM 4012  C CB   . ARG A 1 63  ? -8.036  -0.895  -6.844  1.00 0.00 ? 66  ARG A CB   3  
ATOM 4013  C CG   . ARG A 1 63  ? -8.658  -0.148  -5.669  1.00 0.00 ? 66  ARG A CG   3  
ATOM 4014  C CD   . ARG A 1 63  ? -9.620  0.946   -6.125  1.00 0.00 ? 66  ARG A CD   3  
ATOM 4015  N NE   . ARG A 1 63  ? -10.868 0.404   -6.668  1.00 0.00 ? 66  ARG A NE   3  
ATOM 4016  C CZ   . ARG A 1 63  ? -11.781 1.138   -7.296  1.00 0.00 ? 66  ARG A CZ   3  
ATOM 4017  N NH1  . ARG A 1 63  ? -11.613 2.447   -7.415  1.00 0.00 ? 66  ARG A NH1  3  
ATOM 4018  N NH2  . ARG A 1 63  ? -12.881 0.572   -7.773  1.00 0.00 ? 66  ARG A NH2  3  
ATOM 4019  H H    . ARG A 1 63  ? -9.043  -3.329  -6.307  1.00 0.00 ? 66  ARG A H    3  
ATOM 4020  H HA   . ARG A 1 63  ? -9.831  -1.065  -7.996  1.00 0.00 ? 66  ARG A HA   3  
ATOM 4021  H HB2  . ARG A 1 63  ? -7.282  -1.560  -6.453  1.00 0.00 ? 66  ARG A HB2  3  
ATOM 4022  H HB3  . ARG A 1 63  ? -7.561  -0.171  -7.489  1.00 0.00 ? 66  ARG A HB3  3  
ATOM 4023  H HG2  . ARG A 1 63  ? -9.198  -0.854  -5.058  1.00 0.00 ? 66  ARG A HG2  3  
ATOM 4024  H HG3  . ARG A 1 63  ? -7.867  0.302   -5.087  1.00 0.00 ? 66  ARG A HG3  3  
ATOM 4025  H HD2  . ARG A 1 63  ? -9.856  1.577   -5.281  1.00 0.00 ? 66  ARG A HD2  3  
ATOM 4026  H HD3  . ARG A 1 63  ? -9.134  1.536   -6.889  1.00 0.00 ? 66  ARG A HD3  3  
ATOM 4027  H HE   . ARG A 1 63  ? -11.026 -0.562  -6.559  1.00 0.00 ? 66  ARG A HE   3  
ATOM 4028  H HH12 . ARG A 1 63  ? -11.296 2.842   -8.285  1.00 0.00 ? 66  ARG A HH12 3  
ATOM 4029  H HH21 . ARG A 1 63  ? -13.031 -0.415  -7.660  1.00 0.00 ? 66  ARG A HH21 3  
ATOM 4030  H HH22 . ARG A 1 63  ? -13.561 1.127   -8.265  1.00 0.00 ? 66  ARG A HH22 3  
ATOM 4031  N N    . SER A 1 64  ? -8.641  -1.707  -10.054 1.00 0.00 ? 67  SER A N    3  
ATOM 4032  C CA   . SER A 1 64  ? -8.052  -2.124  -11.317 1.00 0.00 ? 67  SER A CA   3  
ATOM 4033  C C    . SER A 1 64  ? -6.680  -1.479  -11.512 1.00 0.00 ? 67  SER A C    3  
ATOM 4034  O O    . SER A 1 64  ? -6.257  -0.642  -10.713 1.00 0.00 ? 67  SER A O    3  
ATOM 4035  C CB   . SER A 1 64  ? -8.985  -1.734  -12.462 1.00 0.00 ? 67  SER A CB   3  
ATOM 4036  O OG   . SER A 1 64  ? -10.297 -2.219  -12.232 1.00 0.00 ? 67  SER A OG   3  
ATOM 4037  H H    . SER A 1 64  ? -9.285  -0.975  -10.057 1.00 0.00 ? 67  SER A H    3  
ATOM 4038  H HA   . SER A 1 64  ? -7.940  -3.195  -11.301 1.00 0.00 ? 67  SER A HA   3  
ATOM 4039  H HB2  . SER A 1 64  ? -9.020  -0.660  -12.545 1.00 0.00 ? 67  SER A HB2  3  
ATOM 4040  H HB3  . SER A 1 64  ? -8.615  -2.156  -13.384 1.00 0.00 ? 67  SER A HB3  3  
ATOM 4041  H HG   . SER A 1 64  ? -10.279 -3.193  -12.204 1.00 0.00 ? 67  SER A HG   3  
ATOM 4042  N N    . SER A 1 65  ? -5.998  -1.857  -12.587 1.00 0.00 ? 68  SER A N    3  
ATOM 4043  C CA   . SER A 1 65  ? -4.650  -1.381  -12.857 1.00 0.00 ? 68  SER A CA   3  
ATOM 4044  C C    . SER A 1 65  ? -4.657  0.020   -13.475 1.00 0.00 ? 68  SER A C    3  
ATOM 4045  O O    . SER A 1 65  ? -4.098  0.246   -14.549 1.00 0.00 ? 68  SER A O    3  
ATOM 4046  C CB   . SER A 1 65  ? -3.934  -2.376  -13.772 1.00 0.00 ? 68  SER A CB   3  
ATOM 4047  O OG   . SER A 1 65  ? -4.792  -2.821  -14.813 1.00 0.00 ? 68  SER A OG   3  
ATOM 4048  H H    . SER A 1 65  ? -6.414  -2.475  -13.223 1.00 0.00 ? 68  SER A H    3  
ATOM 4049  H HA   . SER A 1 65  ? -4.123  -1.337  -11.914 1.00 0.00 ? 68  SER A HA   3  
ATOM 4050  H HB2  . SER A 1 65  ? -3.071  -1.900  -14.212 1.00 0.00 ? 68  SER A HB2  3  
ATOM 4051  H HB3  . SER A 1 65  ? -3.618  -3.231  -13.192 1.00 0.00 ? 68  SER A HB3  3  
ATOM 4052  H HG   . SER A 1 65  ? -4.805  -2.161  -15.526 1.00 0.00 ? 68  SER A HG   3  
ATOM 4053  N N    . LYS A 1 66  ? -5.290  0.957   -12.786 1.00 0.00 ? 69  LYS A N    3  
ATOM 4054  C CA   . LYS A 1 66  ? -5.343  2.341   -13.231 1.00 0.00 ? 69  LYS A CA   3  
ATOM 4055  C C    . LYS A 1 66  ? -5.017  3.275   -12.073 1.00 0.00 ? 69  LYS A C    3  
ATOM 4056  O O    . LYS A 1 66  ? -5.299  2.965   -10.916 1.00 0.00 ? 69  LYS A O    3  
ATOM 4057  C CB   . LYS A 1 66  ? -6.721  2.682   -13.811 1.00 0.00 ? 69  LYS A CB   3  
ATOM 4058  C CG   . LYS A 1 66  ? -6.980  2.080   -15.186 1.00 0.00 ? 69  LYS A CG   3  
ATOM 4059  C CD   . LYS A 1 66  ? -8.326  2.519   -15.741 1.00 0.00 ? 69  LYS A CD   3  
ATOM 4060  C CE   . LYS A 1 66  ? -9.481  1.847   -15.015 1.00 0.00 ? 69  LYS A CE   3  
ATOM 4061  N NZ   . LYS A 1 66  ? -9.566  0.393   -15.321 1.00 0.00 ? 69  LYS A NZ   3  
ATOM 4062  H H    . LYS A 1 66  ? -5.726  0.711   -11.938 1.00 0.00 ? 69  LYS A H    3  
ATOM 4063  H HA   . LYS A 1 66  ? -4.595  2.468   -13.998 1.00 0.00 ? 69  LYS A HA   3  
ATOM 4064  H HB2  . LYS A 1 66  ? -7.482  2.317   -13.135 1.00 0.00 ? 69  LYS A HB2  3  
ATOM 4065  H HB3  . LYS A 1 66  ? -6.810  3.756   -13.890 1.00 0.00 ? 69  LYS A HB3  3  
ATOM 4066  H HG2  . LYS A 1 66  ? -6.202  2.399   -15.863 1.00 0.00 ? 69  LYS A HG2  3  
ATOM 4067  H HG3  . LYS A 1 66  ? -6.968  1.001   -15.105 1.00 0.00 ? 69  LYS A HG3  3  
ATOM 4068  H HD2  . LYS A 1 66  ? -8.418  3.589   -15.627 1.00 0.00 ? 69  LYS A HD2  3  
ATOM 4069  H HD3  . LYS A 1 66  ? -8.372  2.263   -16.790 1.00 0.00 ? 69  LYS A HD3  3  
ATOM 4070  H HE2  . LYS A 1 66  ? -9.341  1.974   -13.952 1.00 0.00 ? 69  LYS A HE2  3  
ATOM 4071  H HE3  . LYS A 1 66  ? -10.404 2.325   -15.315 1.00 0.00 ? 69  LYS A HE3  3  
ATOM 4072  H HZ1  . LYS A 1 66  ? -8.667  -0.072  -15.067 1.00 0.00 ? 69  LYS A HZ1  3  
ATOM 4073  H HZ3  . LYS A 1 66  ? -9.710  0.262   -16.347 1.00 0.00 ? 69  LYS A HZ3  3  
ATOM 4074  N N    . GLN A 1 67  ? -4.410  4.407   -12.396 1.00 0.00 ? 70  GLN A N    3  
ATOM 4075  C CA   . GLN A 1 67  ? -4.015  5.390   -11.398 1.00 0.00 ? 70  GLN A CA   3  
ATOM 4076  C C    . GLN A 1 67  ? -5.228  6.249   -11.027 1.00 0.00 ? 70  GLN A C    3  
ATOM 4077  O O    . GLN A 1 67  ? -5.612  7.148   -11.776 1.00 0.00 ? 70  GLN A O    3  
ATOM 4078  C CB   . GLN A 1 67  ? -2.878  6.257   -11.972 1.00 0.00 ? 70  GLN A CB   3  
ATOM 4079  C CG   . GLN A 1 67  ? -1.960  6.910   -10.939 1.00 0.00 ? 70  GLN A CG   3  
ATOM 4080  C CD   . GLN A 1 67  ? -2.648  7.959   -10.087 1.00 0.00 ? 70  GLN A CD   3  
ATOM 4081  O OE1  . GLN A 1 67  ? -2.720  9.128   -10.457 1.00 0.00 ? 70  GLN A OE1  3  
ATOM 4082  N NE2  . GLN A 1 67  ? -3.116  7.558   -8.922  1.00 0.00 ? 70  GLN A NE2  3  
ATOM 4083  H H    . GLN A 1 67  ? -4.221  4.591   -13.346 1.00 0.00 ? 70  GLN A H    3  
ATOM 4084  H HA   . GLN A 1 67  ? -3.663  4.863   -10.524 1.00 0.00 ? 70  GLN A HA   3  
ATOM 4085  H HB2  . GLN A 1 67  ? -2.266  5.638   -12.609 1.00 0.00 ? 70  GLN A HB2  3  
ATOM 4086  H HB3  . GLN A 1 67  ? -3.316  7.041   -12.572 1.00 0.00 ? 70  GLN A HB3  3  
ATOM 4087  H HG2  . GLN A 1 67  ? -1.576  6.144   -10.285 1.00 0.00 ? 70  GLN A HG2  3  
ATOM 4088  H HG3  . GLN A 1 67  ? -1.138  7.378   -11.460 1.00 0.00 ? 70  GLN A HG3  3  
ATOM 4089  H HE21 . GLN A 1 67  ? -2.989  6.616   -8.664  1.00 0.00 ? 70  GLN A HE21 3  
ATOM 4090  H HE22 . GLN A 1 67  ? -3.603  8.210   -8.369  1.00 0.00 ? 70  GLN A HE22 3  
ATOM 4091  N N    . TRP A 1 68  ? -5.845  5.948   -9.886  1.00 0.00 ? 71  TRP A N    3  
ATOM 4092  C CA   . TRP A 1 68  ? -7.030  6.681   -9.445  1.00 0.00 ? 71  TRP A CA   3  
ATOM 4093  C C    . TRP A 1 68  ? -6.645  8.056   -8.899  1.00 0.00 ? 71  TRP A C    3  
ATOM 4094  O O    . TRP A 1 68  ? -5.591  8.222   -8.290  1.00 0.00 ? 71  TRP A O    3  
ATOM 4095  C CB   . TRP A 1 68  ? -7.816  5.876   -8.399  1.00 0.00 ? 71  TRP A CB   3  
ATOM 4096  C CG   . TRP A 1 68  ? -7.005  5.443   -7.214  1.00 0.00 ? 71  TRP A CG   3  
ATOM 4097  C CD1  . TRP A 1 68  ? -6.741  6.173   -6.093  1.00 0.00 ? 71  TRP A CD1  3  
ATOM 4098  C CD2  . TRP A 1 68  ? -6.362  4.174   -7.027  1.00 0.00 ? 71  TRP A CD2  3  
ATOM 4099  N NE1  . TRP A 1 68  ? -5.972  5.442   -5.224  1.00 0.00 ? 71  TRP A NE1  3  
ATOM 4100  C CE2  . TRP A 1 68  ? -5.725  4.212   -5.773  1.00 0.00 ? 71  TRP A CE2  3  
ATOM 4101  C CE3  . TRP A 1 68  ? -6.260  3.013   -7.799  1.00 0.00 ? 71  TRP A CE3  3  
ATOM 4102  C CZ2  . TRP A 1 68  ? -5.002  3.134   -5.273  1.00 0.00 ? 71  TRP A CZ2  3  
ATOM 4103  C CZ3  . TRP A 1 68  ? -5.540  1.943   -7.301  1.00 0.00 ? 71  TRP A CZ3  3  
ATOM 4104  C CH2  . TRP A 1 68  ? -4.919  2.009   -6.049  1.00 0.00 ? 71  TRP A CH2  3  
ATOM 4105  H H    . TRP A 1 68  ? -5.496  5.222   -9.327  1.00 0.00 ? 71  TRP A H    3  
ATOM 4106  H HA   . TRP A 1 68  ? -7.659  6.827   -10.311 1.00 0.00 ? 71  TRP A HA   3  
ATOM 4107  H HB2  . TRP A 1 68  ? -8.630  6.482   -8.033  1.00 0.00 ? 71  TRP A HB2  3  
ATOM 4108  H HB3  . TRP A 1 68  ? -8.221  4.990   -8.868  1.00 0.00 ? 71  TRP A HB3  3  
ATOM 4109  H HD1  . TRP A 1 68  ? -7.089  7.183   -5.928  1.00 0.00 ? 71  TRP A HD1  3  
ATOM 4110  H HE1  . TRP A 1 68  ? -5.652  5.753   -4.350  1.00 0.00 ? 71  TRP A HE1  3  
ATOM 4111  H HE3  . TRP A 1 68  ? -6.733  2.944   -8.767  1.00 0.00 ? 71  TRP A HE3  3  
ATOM 4112  H HZ2  . TRP A 1 68  ? -4.518  3.169   -4.310  1.00 0.00 ? 71  TRP A HZ2  3  
ATOM 4113  H HZ3  . TRP A 1 68  ? -5.451  1.038   -7.882  1.00 0.00 ? 71  TRP A HZ3  3  
ATOM 4114  H HH2  . TRP A 1 68  ? -4.367  1.149   -5.702  1.00 0.00 ? 71  TRP A HH2  3  
ATOM 4115  N N    . GLU A 1 69  ? -7.522  9.031   -9.097  1.00 0.00 ? 72  GLU A N    3  
ATOM 4116  C CA   . GLU A 1 69  ? -7.185  10.432  -8.847  1.00 0.00 ? 72  GLU A CA   3  
ATOM 4117  C C    . GLU A 1 69  ? -7.216  10.794  -7.362  1.00 0.00 ? 72  GLU A C    3  
ATOM 4118  O O    . GLU A 1 69  ? -7.263  11.976  -7.010  1.00 0.00 ? 72  GLU A O    3  
ATOM 4119  C CB   . GLU A 1 69  ? -8.137  11.366  -9.609  1.00 0.00 ? 72  GLU A CB   3  
ATOM 4120  C CG   . GLU A 1 69  ? -8.271  11.066  -11.096 1.00 0.00 ? 72  GLU A CG   3  
ATOM 4121  C CD   . GLU A 1 69  ? -9.279  9.972   -11.383 1.00 0.00 ? 72  GLU A CD   3  
ATOM 4122  O OE1  . GLU A 1 69  ? -10.492 10.267  -11.398 1.00 0.00 ? 72  GLU A OE1  3  
ATOM 4123  O OE2  . GLU A 1 69  ? -8.873  8.810   -11.568 1.00 0.00 ? 72  GLU A OE2  3  
ATOM 4124  H H    . GLU A 1 69  ? -8.420  8.805   -9.425  1.00 0.00 ? 72  GLU A H    3  
ATOM 4125  H HA   . GLU A 1 69  ? -6.182  10.593  -9.215  1.00 0.00 ? 72  GLU A HA   3  
ATOM 4126  H HB2  . GLU A 1 69  ? -9.118  11.293  -9.166  1.00 0.00 ? 72  GLU A HB2  3  
ATOM 4127  H HB3  . GLU A 1 69  ? -7.783  12.380  -9.502  1.00 0.00 ? 72  GLU A HB3  3  
ATOM 4128  H HG2  . GLU A 1 69  ? -8.584  11.965  -11.603 1.00 0.00 ? 72  GLU A HG2  3  
ATOM 4129  H HG3  . GLU A 1 69  ? -7.307  10.757  -11.477 1.00 0.00 ? 72  GLU A HG3  3  
ATOM 4130  N N    . ASP A 1 70  ? -7.175  9.805   -6.481  1.00 0.00 ? 73  ASP A N    3  
ATOM 4131  C CA   . ASP A 1 70  ? -7.180  10.097  -5.053  1.00 0.00 ? 73  ASP A CA   3  
ATOM 4132  C C    . ASP A 1 70  ? -6.042  9.379   -4.329  1.00 0.00 ? 73  ASP A C    3  
ATOM 4133  O O    . ASP A 1 70  ? -6.240  8.319   -3.736  1.00 0.00 ? 73  ASP A O    3  
ATOM 4134  C CB   . ASP A 1 70  ? -8.515  9.726   -4.407  1.00 0.00 ? 73  ASP A CB   3  
ATOM 4135  C CG   . ASP A 1 70  ? -8.739  10.481  -3.106  1.00 0.00 ? 73  ASP A CG   3  
ATOM 4136  O OD1  . ASP A 1 70  ? -7.907  10.354  -2.182  1.00 0.00 ? 73  ASP A OD1  3  
ATOM 4137  O OD2  . ASP A 1 70  ? -9.727  11.243  -3.025  1.00 0.00 ? 73  ASP A OD2  3  
ATOM 4138  H H    . ASP A 1 70  ? -7.127  8.875   -6.791  1.00 0.00 ? 73  ASP A H    3  
ATOM 4139  H HA   . ASP A 1 70  ? -7.032  11.161  -4.944  1.00 0.00 ? 73  ASP A HA   3  
ATOM 4140  H HB2  . ASP A 1 70  ? -9.321  9.960   -5.087  1.00 0.00 ? 73  ASP A HB2  3  
ATOM 4141  H HB3  . ASP A 1 70  ? -8.522  8.667   -4.193  1.00 0.00 ? 73  ASP A HB3  3  
ATOM 4142  N N    . PRO A 1 71  ? -4.822  9.932   -4.392  1.00 0.00 ? 74  PRO A N    3  
ATOM 4143  C CA   . PRO A 1 71  ? -3.704  9.487   -3.573  1.00 0.00 ? 74  PRO A CA   3  
ATOM 4144  C C    . PRO A 1 71  ? -3.725  10.183  -2.218  1.00 0.00 ? 74  PRO A C    3  
ATOM 4145  O O    . PRO A 1 71  ? -2.953  9.861   -1.319  1.00 0.00 ? 74  PRO A O    3  
ATOM 4146  C CB   . PRO A 1 71  ? -2.466  9.915   -4.380  1.00 0.00 ? 74  PRO A CB   3  
ATOM 4147  C CG   . PRO A 1 71  ? -2.984  10.642  -5.584  1.00 0.00 ? 74  PRO A CG   3  
ATOM 4148  C CD   . PRO A 1 71  ? -4.410  11.009  -5.287  1.00 0.00 ? 74  PRO A CD   3  
ATOM 4149  H HA   . PRO A 1 71  ? -3.705  8.415   -3.435  1.00 0.00 ? 74  PRO A HA   3  
ATOM 4150  H HB2  . PRO A 1 71  ? -1.846  10.558  -3.774  1.00 0.00 ? 74  PRO A HB2  3  
ATOM 4151  H HB3  . PRO A 1 71  ? -1.904  9.040   -4.667  1.00 0.00 ? 74  PRO A HB3  3  
ATOM 4152  H HG2  . PRO A 1 71  ? -2.398  11.533  -5.753  1.00 0.00 ? 74  PRO A HG2  3  
ATOM 4153  H HG3  . PRO A 1 71  ? -2.935  9.993   -6.445  1.00 0.00 ? 74  PRO A HG3  3  
ATOM 4154  H HD2  . PRO A 1 71  ? -4.463  11.967  -4.791  1.00 0.00 ? 74  PRO A HD2  3  
ATOM 4155  H HD3  . PRO A 1 71  ? -5.003  11.011  -6.192  1.00 0.00 ? 74  PRO A HD3  3  
ATOM 4156  N N    . SER A 1 72  ? -4.653  11.123  -2.088  1.00 0.00 ? 75  SER A N    3  
ATOM 4157  C CA   . SER A 1 72  ? -4.765  11.976  -0.917  1.00 0.00 ? 75  SER A CA   3  
ATOM 4158  C C    . SER A 1 72  ? -5.173  11.200  0.333   1.00 0.00 ? 75  SER A C    3  
ATOM 4159  O O    . SER A 1 72  ? -4.987  11.669  1.454   1.00 0.00 ? 75  SER A O    3  
ATOM 4160  C CB   . SER A 1 72  ? -5.764  13.087  -1.215  1.00 0.00 ? 75  SER A CB   3  
ATOM 4161  O OG   . SER A 1 72  ? -6.667  12.687  -2.239  1.00 0.00 ? 75  SER A OG   3  
ATOM 4162  H H    . SER A 1 72  ? -5.298  11.247  -2.815  1.00 0.00 ? 75  SER A H    3  
ATOM 4163  H HA   . SER A 1 72  ? -3.798  12.419  -0.744  1.00 0.00 ? 75  SER A HA   3  
ATOM 4164  H HB2  . SER A 1 72  ? -6.324  13.316  -0.321  1.00 0.00 ? 75  SER A HB2  3  
ATOM 4165  H HB3  . SER A 1 72  ? -5.230  13.968  -1.544  1.00 0.00 ? 75  SER A HB3  3  
ATOM 4166  H HG   . SER A 1 72  ? -7.199  11.927  -1.928  1.00 0.00 ? 75  SER A HG   3  
ATOM 4167  N N    . GLN A 1 73  ? -5.721  10.007  0.150   1.00 0.00 ? 76  GLN A N    3  
ATOM 4168  C CA   . GLN A 1 73  ? -6.044  9.149   1.282   1.00 0.00 ? 76  GLN A CA   3  
ATOM 4169  C C    . GLN A 1 73  ? -4.778  8.535   1.876   1.00 0.00 ? 76  GLN A C    3  
ATOM 4170  O O    . GLN A 1 73  ? -4.825  7.872   2.908   1.00 0.00 ? 76  GLN A O    3  
ATOM 4171  C CB   . GLN A 1 73  ? -7.029  8.054   0.866   1.00 0.00 ? 76  GLN A CB   3  
ATOM 4172  C CG   . GLN A 1 73  ? -8.438  8.571   0.623   1.00 0.00 ? 76  GLN A CG   3  
ATOM 4173  C CD   . GLN A 1 73  ? -9.030  9.231   1.854   1.00 0.00 ? 76  GLN A CD   3  
ATOM 4174  O OE1  . GLN A 1 73  ? -8.872  10.433  2.070   1.00 0.00 ? 76  GLN A OE1  3  
ATOM 4175  N NE2  . GLN A 1 73  ? -9.721  8.453   2.672   1.00 0.00 ? 76  GLN A NE2  3  
ATOM 4176  H H    . GLN A 1 73  ? -5.929  9.705   -0.762  1.00 0.00 ? 76  GLN A H    3  
ATOM 4177  H HA   . GLN A 1 73  ? -6.510  9.769   2.034   1.00 0.00 ? 76  GLN A HA   3  
ATOM 4178  H HB2  . GLN A 1 73  ? -6.675  7.594   -0.046  1.00 0.00 ? 76  GLN A HB2  3  
ATOM 4179  H HB3  . GLN A 1 73  ? -7.070  7.307   1.645   1.00 0.00 ? 76  GLN A HB3  3  
ATOM 4180  H HG2  . GLN A 1 73  ? -8.408  9.296   -0.175  1.00 0.00 ? 76  GLN A HG2  3  
ATOM 4181  H HG3  . GLN A 1 73  ? -9.069  7.742   0.336   1.00 0.00 ? 76  GLN A HG3  3  
ATOM 4182  H HE21 . GLN A 1 73  ? -9.814  7.504   2.442   1.00 0.00 ? 76  GLN A HE21 3  
ATOM 4183  H HE22 . GLN A 1 73  ? -10.120 8.856   3.470   1.00 0.00 ? 76  GLN A HE22 3  
ATOM 4184  N N    . ALA A 1 74  ? -3.645  8.777   1.224   1.00 0.00 ? 77  ALA A N    3  
ATOM 4185  C CA   . ALA A 1 74  ? -2.369  8.245   1.678   1.00 0.00 ? 77  ALA A CA   3  
ATOM 4186  C C    . ALA A 1 74  ? -1.446  9.354   2.174   1.00 0.00 ? 77  ALA A C    3  
ATOM 4187  O O    . ALA A 1 74  ? -0.279  9.108   2.489   1.00 0.00 ? 77  ALA A O    3  
ATOM 4188  C CB   . ALA A 1 74  ? -1.706  7.464   0.554   1.00 0.00 ? 77  ALA A CB   3  
ATOM 4189  H H    . ALA A 1 74  ? -3.671  9.325   0.407   1.00 0.00 ? 77  ALA A H    3  
ATOM 4190  H HA   . ALA A 1 74  ? -2.565  7.562   2.492   1.00 0.00 ? 77  ALA A HA   3  
ATOM 4191  H HB1  . ALA A 1 74  ? -1.464  8.138   -0.255  1.00 0.00 ? 77  ALA A HB1  3  
ATOM 4192  H HB2  . ALA A 1 74  ? -0.799  7.002   0.920   1.00 0.00 ? 77  ALA A HB2  3  
ATOM 4193  H HB3  . ALA A 1 74  ? -2.381  6.698   0.199   1.00 0.00 ? 77  ALA A HB3  3  
ATOM 4194  N N    . SER A 1 75  ? -1.977  10.573  2.255   1.00 0.00 ? 78  SER A N    3  
ATOM 4195  C CA   . SER A 1 75  ? -1.198  11.731  2.694   1.00 0.00 ? 78  SER A CA   3  
ATOM 4196  C C    . SER A 1 75  ? -0.580  11.508  4.075   1.00 0.00 ? 78  SER A C    3  
ATOM 4197  O O    . SER A 1 75  ? 0.560   11.909  4.319   1.00 0.00 ? 78  SER A O    3  
ATOM 4198  C CB   . SER A 1 75  ? -2.078  12.983  2.718   1.00 0.00 ? 78  SER A CB   3  
ATOM 4199  O OG   . SER A 1 75  ? -2.643  13.233  1.444   1.00 0.00 ? 78  SER A OG   3  
ATOM 4200  H H    . SER A 1 75  ? -2.914  10.703  1.996   1.00 0.00 ? 78  SER A H    3  
ATOM 4201  H HA   . SER A 1 75  ? -0.402  11.880  1.980   1.00 0.00 ? 78  SER A HA   3  
ATOM 4202  H HB2  . SER A 1 75  ? -2.878  12.846  3.432   1.00 0.00 ? 78  SER A HB2  3  
ATOM 4203  H HB3  . SER A 1 75  ? -1.479  13.834  3.007   1.00 0.00 ? 78  SER A HB3  3  
ATOM 4204  H HG   . SER A 1 75  ? -2.882  14.171  1.383   1.00 0.00 ? 78  SER A HG   3  
ATOM 4205  N N    . LYS A 1 76  ? -1.327  10.856  4.963   1.00 0.00 ? 79  LYS A N    3  
ATOM 4206  C CA   . LYS A 1 76  ? -0.859  10.604  6.323   1.00 0.00 ? 79  LYS A CA   3  
ATOM 4207  C C    . LYS A 1 76  ? 0.350   9.670   6.319   1.00 0.00 ? 79  LYS A C    3  
ATOM 4208  O O    . LYS A 1 76  ? 1.269   9.828   7.125   1.00 0.00 ? 79  LYS A O    3  
ATOM 4209  C CB   . LYS A 1 76  ? -1.985  10.011  7.176   1.00 0.00 ? 79  LYS A CB   3  
ATOM 4210  C CG   . LYS A 1 76  ? -1.611  9.825   8.637   1.00 0.00 ? 79  LYS A CG   3  
ATOM 4211  C CD   . LYS A 1 76  ? -2.767  9.256   9.444   1.00 0.00 ? 79  LYS A CD   3  
ATOM 4212  C CE   . LYS A 1 76  ? -2.408  9.119   10.917  1.00 0.00 ? 79  LYS A CE   3  
ATOM 4213  N NZ   . LYS A 1 76  ? -2.037  10.427  11.521  1.00 0.00 ? 79  LYS A NZ   3  
ATOM 4214  H H    . LYS A 1 76  ? -2.218  10.541  4.701   1.00 0.00 ? 79  LYS A H    3  
ATOM 4215  H HA   . LYS A 1 76  ? -0.561  11.552  6.745   1.00 0.00 ? 79  LYS A HA   3  
ATOM 4216  H HB2  . LYS A 1 76  ? -2.841  10.667  7.130   1.00 0.00 ? 79  LYS A HB2  3  
ATOM 4217  H HB3  . LYS A 1 76  ? -2.258  9.048   6.773   1.00 0.00 ? 79  LYS A HB3  3  
ATOM 4218  H HG2  . LYS A 1 76  ? -0.773  9.147   8.698   1.00 0.00 ? 79  LYS A HG2  3  
ATOM 4219  H HG3  . LYS A 1 76  ? -1.334  10.783  9.050   1.00 0.00 ? 79  LYS A HG3  3  
ATOM 4220  H HD2  . LYS A 1 76  ? -3.617  9.916   9.352   1.00 0.00 ? 79  LYS A HD2  3  
ATOM 4221  H HD3  . LYS A 1 76  ? -3.022  8.283   9.052   1.00 0.00 ? 79  LYS A HD3  3  
ATOM 4222  H HE2  . LYS A 1 76  ? -3.261  8.718   11.447  1.00 0.00 ? 79  LYS A HE2  3  
ATOM 4223  H HE3  . LYS A 1 76  ? -1.575  8.440   11.010  1.00 0.00 ? 79  LYS A HE3  3  
ATOM 4224  H HZ1  . LYS A 1 76  ? -1.820  10.291  12.535  1.00 0.00 ? 79  LYS A HZ1  3  
ATOM 4225  H HZ3  . LYS A 1 76  ? -2.848  11.082  11.453  1.00 0.00 ? 79  LYS A HZ3  3  
ATOM 4226  N N    . VAL A 1 77  ? 0.353   8.714   5.397   1.00 0.00 ? 80  VAL A N    3  
ATOM 4227  C CA   . VAL A 1 77  ? 1.469   7.790   5.267   1.00 0.00 ? 80  VAL A CA   3  
ATOM 4228  C C    . VAL A 1 77  ? 2.722   8.550   4.857   1.00 0.00 ? 80  VAL A C    3  
ATOM 4229  O O    . VAL A 1 77  ? 3.768   8.425   5.493   1.00 0.00 ? 80  VAL A O    3  
ATOM 4230  C CB   . VAL A 1 77  ? 1.174   6.672   4.237   1.00 0.00 ? 80  VAL A CB   3  
ATOM 4231  C CG1  . VAL A 1 77  ? 2.396   5.781   4.038   1.00 0.00 ? 80  VAL A CG1  3  
ATOM 4232  C CG2  . VAL A 1 77  ? -0.027  5.840   4.678   1.00 0.00 ? 80  VAL A CG2  3  
ATOM 4233  H H    . VAL A 1 77  ? -0.404  8.639   4.782   1.00 0.00 ? 80  VAL A H    3  
ATOM 4234  H HA   . VAL A 1 77  ? 1.638   7.332   6.231   1.00 0.00 ? 80  VAL A HA   3  
ATOM 4235  H HB   . VAL A 1 77  ? 0.936   7.136   3.291   1.00 0.00 ? 80  VAL A HB   3  
ATOM 4236  H HG11 . VAL A 1 77  ? 2.172   5.020   3.304   1.00 0.00 ? 80  VAL A HG11 3  
ATOM 4237  H HG12 . VAL A 1 77  ? 3.226   6.380   3.691   1.00 0.00 ? 80  VAL A HG12 3  
ATOM 4238  H HG13 . VAL A 1 77  ? 2.657   5.312   4.974   1.00 0.00 ? 80  VAL A HG13 3  
ATOM 4239  H HG21 . VAL A 1 77  ? 0.197   5.354   5.616   1.00 0.00 ? 80  VAL A HG21 3  
ATOM 4240  H HG22 . VAL A 1 77  ? -0.885  6.482   4.803   1.00 0.00 ? 80  VAL A HG22 3  
ATOM 4241  H HG23 . VAL A 1 77  ? -0.243  5.092   3.929   1.00 0.00 ? 80  VAL A HG23 3  
ATOM 4242  N N    . CYS A 1 78  ? 2.599   9.367   3.814   1.00 0.00 ? 81  CYS A N    3  
ATOM 4243  C CA   . CYS A 1 78  ? 3.711   10.191  3.359   1.00 0.00 ? 81  CYS A CA   3  
ATOM 4244  C C    . CYS A 1 78  ? 4.165   11.133  4.471   1.00 0.00 ? 81  CYS A C    3  
ATOM 4245  O O    . CYS A 1 78  ? 5.358   11.341  4.668   1.00 0.00 ? 81  CYS A O    3  
ATOM 4246  C CB   . CYS A 1 78  ? 3.317   11.001  2.117   1.00 0.00 ? 81  CYS A CB   3  
ATOM 4247  S SG   . CYS A 1 78  ? 2.681   9.998   0.734   1.00 0.00 ? 81  CYS A SG   3  
ATOM 4248  H H    . CYS A 1 78  ? 1.740   9.409   3.335   1.00 0.00 ? 81  CYS A H    3  
ATOM 4249  H HA   . CYS A 1 78  ? 4.529   9.531   3.106   1.00 0.00 ? 81  CYS A HA   3  
ATOM 4250  H HB2  . CYS A 1 78  ? 2.549   11.707  2.388   1.00 0.00 ? 81  CYS A HB2  3  
ATOM 4251  H HB3  . CYS A 1 78  ? 4.180   11.543  1.760   1.00 0.00 ? 81  CYS A HB3  3  
ATOM 4252  N N    . GLN A 1 79  ? 3.203   11.674  5.212   1.00 0.00 ? 82  GLN A N    3  
ATOM 4253  C CA   . GLN A 1 79  ? 3.496   12.623  6.281   1.00 0.00 ? 82  GLN A CA   3  
ATOM 4254  C C    . GLN A 1 79  ? 4.332   11.979  7.382   1.00 0.00 ? 82  GLN A C    3  
ATOM 4255  O O    . GLN A 1 79  ? 5.325   12.554  7.833   1.00 0.00 ? 82  GLN A O    3  
ATOM 4256  C CB   . GLN A 1 79  ? 2.197   13.183  6.871   1.00 0.00 ? 82  GLN A CB   3  
ATOM 4257  C CG   . GLN A 1 79  ? 2.419   14.209  7.969   1.00 0.00 ? 82  GLN A CG   3  
ATOM 4258  C CD   . GLN A 1 79  ? 3.202   15.421  7.494   1.00 0.00 ? 82  GLN A CD   3  
ATOM 4259  O OE1  . GLN A 1 79  ? 3.960   16.022  8.256   1.00 0.00 ? 82  GLN A OE1  3  
ATOM 4260  N NE2  . GLN A 1 79  ? 3.017   15.794  6.238   1.00 0.00 ? 82  GLN A NE2  3  
ATOM 4261  H H    . GLN A 1 79  ? 2.267   11.430  5.035   1.00 0.00 ? 82  GLN A H    3  
ATOM 4262  H HA   . GLN A 1 79  ? 4.061   13.435  5.852   1.00 0.00 ? 82  GLN A HA   3  
ATOM 4263  H HB2  . GLN A 1 79  ? 1.629   13.652  6.081   1.00 0.00 ? 82  GLN A HB2  3  
ATOM 4264  H HB3  . GLN A 1 79  ? 1.620   12.367  7.282   1.00 0.00 ? 82  GLN A HB3  3  
ATOM 4265  H HG2  . GLN A 1 79  ? 1.458   14.542  8.332   1.00 0.00 ? 82  GLN A HG2  3  
ATOM 4266  H HG3  . GLN A 1 79  ? 2.964   13.741  8.775   1.00 0.00 ? 82  GLN A HG3  3  
ATOM 4267  H HE21 . GLN A 1 79  ? 2.390   15.278  5.683   1.00 0.00 ? 82  GLN A HE21 3  
ATOM 4268  H HE22 . GLN A 1 79  ? 3.521   16.570  5.906   1.00 0.00 ? 82  GLN A HE22 3  
ATOM 4269  N N    . ARG A 1 80  ? 3.948   10.781  7.807   1.00 0.00 ? 83  ARG A N    3  
ATOM 4270  C CA   . ARG A 1 80  ? 4.655   10.116  8.894   1.00 0.00 ? 83  ARG A CA   3  
ATOM 4271  C C    . ARG A 1 80  ? 5.982   9.534   8.422   1.00 0.00 ? 83  ARG A C    3  
ATOM 4272  O O    . ARG A 1 80  ? 6.836   9.186   9.234   1.00 0.00 ? 83  ARG A O    3  
ATOM 4273  C CB   . ARG A 1 80  ? 3.797   9.029   9.545   1.00 0.00 ? 83  ARG A CB   3  
ATOM 4274  C CG   . ARG A 1 80  ? 2.558   9.556   10.261  1.00 0.00 ? 83  ARG A CG   3  
ATOM 4275  C CD   . ARG A 1 80  ? 2.836   10.837  11.047  1.00 0.00 ? 83  ARG A CD   3  
ATOM 4276  N NE   . ARG A 1 80  ? 4.109   10.801  11.774  1.00 0.00 ? 83  ARG A NE   3  
ATOM 4277  C CZ   . ARG A 1 80  ? 4.806   11.895  12.082  1.00 0.00 ? 83  ARG A CZ   3  
ATOM 4278  N NH1  . ARG A 1 80  ? 4.297   13.095  11.831  1.00 0.00 ? 83  ARG A NH1  3  
ATOM 4279  N NH2  . ARG A 1 80  ? 5.995   11.796  12.661  1.00 0.00 ? 83  ARG A NH2  3  
ATOM 4280  H H    . ARG A 1 80  ? 3.175   10.341  7.384   1.00 0.00 ? 83  ARG A H    3  
ATOM 4281  H HA   . ARG A 1 80  ? 4.872   10.869  9.637   1.00 0.00 ? 83  ARG A HA   3  
ATOM 4282  H HB2  . ARG A 1 80  ? 3.474   8.340   8.779   1.00 0.00 ? 83  ARG A HB2  3  
ATOM 4283  H HB3  . ARG A 1 80  ? 4.401   8.495   10.262  1.00 0.00 ? 83  ARG A HB3  3  
ATOM 4284  H HG2  . ARG A 1 80  ? 1.794   9.760   9.527   1.00 0.00 ? 83  ARG A HG2  3  
ATOM 4285  H HG3  . ARG A 1 80  ? 2.205   8.797   10.944  1.00 0.00 ? 83  ARG A HG3  3  
ATOM 4286  H HD2  . ARG A 1 80  ? 2.854   11.668  10.360  1.00 0.00 ? 83  ARG A HD2  3  
ATOM 4287  H HD3  . ARG A 1 80  ? 2.035   10.982  11.757  1.00 0.00 ? 83  ARG A HD3  3  
ATOM 4288  H HE   . ARG A 1 80  ? 4.469   9.922   12.018  1.00 0.00 ? 83  ARG A HE   3  
ATOM 4289  H HH12 . ARG A 1 80  ? 4.873   13.821  11.423  1.00 0.00 ? 83  ARG A HH12 3  
ATOM 4290  H HH21 . ARG A 1 80  ? 6.384   10.889  12.877  1.00 0.00 ? 83  ARG A HH21 3  
ATOM 4291  H HH22 . ARG A 1 80  ? 6.525   12.625  12.872  1.00 0.00 ? 83  ARG A HH22 3  
ATOM 4292  N N    . LEU A 1 81  ? 6.148   9.432   7.111   1.00 0.00 ? 84  LEU A N    3  
ATOM 4293  C CA   . LEU A 1 81  ? 7.431   9.048   6.536   1.00 0.00 ? 84  LEU A CA   3  
ATOM 4294  C C    . LEU A 1 81  ? 8.279   10.288  6.277   1.00 0.00 ? 84  LEU A C    3  
ATOM 4295  O O    . LEU A 1 81  ? 9.360   10.209  5.690   1.00 0.00 ? 84  LEU A O    3  
ATOM 4296  C CB   . LEU A 1 81  ? 7.229   8.261   5.240   1.00 0.00 ? 84  LEU A CB   3  
ATOM 4297  C CG   . LEU A 1 81  ? 6.535   6.908   5.405   1.00 0.00 ? 84  LEU A CG   3  
ATOM 4298  C CD1  . LEU A 1 81  ? 6.271   6.280   4.050   1.00 0.00 ? 84  LEU A CD1  3  
ATOM 4299  C CD2  . LEU A 1 81  ? 7.377   5.974   6.263   1.00 0.00 ? 84  LEU A CD2  3  
ATOM 4300  H H    . LEU A 1 81  ? 5.387   9.603   6.512   1.00 0.00 ? 84  LEU A H    3  
ATOM 4301  H HA   . LEU A 1 81  ? 7.940   8.423   7.252   1.00 0.00 ? 84  LEU A HA   3  
ATOM 4302  H HB2  . LEU A 1 81  ? 6.638   8.865   4.567   1.00 0.00 ? 84  LEU A HB2  3  
ATOM 4303  H HB3  . LEU A 1 81  ? 8.196   8.092   4.790   1.00 0.00 ? 84  LEU A HB3  3  
ATOM 4304  H HG   . LEU A 1 81  ? 5.586   7.057   5.900   1.00 0.00 ? 84  LEU A HG   3  
ATOM 4305  H HD11 . LEU A 1 81  ? 5.804   5.317   4.186   1.00 0.00 ? 84  LEU A HD11 3  
ATOM 4306  H HD12 . LEU A 1 81  ? 5.615   6.920   3.479   1.00 0.00 ? 84  LEU A HD12 3  
ATOM 4307  H HD13 . LEU A 1 81  ? 7.205   6.157   3.522   1.00 0.00 ? 84  LEU A HD13 3  
ATOM 4308  H HD21 . LEU A 1 81  ? 6.886   5.015   6.339   1.00 0.00 ? 84  LEU A HD21 3  
ATOM 4309  H HD22 . LEU A 1 81  ? 8.347   5.845   5.808   1.00 0.00 ? 84  LEU A HD22 3  
ATOM 4310  H HD23 . LEU A 1 81  ? 7.495   6.398   7.249   1.00 0.00 ? 84  LEU A HD23 3  
ATOM 4311  N N    . ASN A 1 82  ? 7.765   11.434  6.732   1.00 0.00 ? 85  ASN A N    3  
ATOM 4312  C CA   . ASN A 1 82  ? 8.441   12.723  6.596   1.00 0.00 ? 85  ASN A CA   3  
ATOM 4313  C C    . ASN A 1 82  ? 8.643   13.082  5.127   1.00 0.00 ? 85  ASN A C    3  
ATOM 4314  O O    . ASN A 1 82  ? 9.684   13.615  4.732   1.00 0.00 ? 85  ASN A O    3  
ATOM 4315  C CB   . ASN A 1 82  ? 9.774   12.722  7.350   1.00 0.00 ? 85  ASN A CB   3  
ATOM 4316  C CG   . ASN A 1 82  ? 9.606   12.553  8.851   1.00 0.00 ? 85  ASN A CG   3  
ATOM 4317  O OD1  . ASN A 1 82  ? 8.623   13.011  9.438   1.00 0.00 ? 85  ASN A OD1  3  
ATOM 4318  N ND2  . ASN A 1 82  ? 10.560  11.885  9.481   1.00 0.00 ? 85  ASN A ND2  3  
ATOM 4319  H H    . ASN A 1 82  ? 6.894   11.411  7.183   1.00 0.00 ? 85  ASN A H    3  
ATOM 4320  H HA   . ASN A 1 82  ? 7.798   13.470  7.038   1.00 0.00 ? 85  ASN A HA   3  
ATOM 4321  H HB2  . ASN A 1 82  ? 10.383  11.910  6.984   1.00 0.00 ? 85  ASN A HB2  3  
ATOM 4322  H HB3  . ASN A 1 82  ? 10.282  13.657  7.167   1.00 0.00 ? 85  ASN A HB3  3  
ATOM 4323  H HD21 . ASN A 1 82  ? 11.314  11.540  8.948   1.00 0.00 ? 85  ASN A HD21 3  
ATOM 4324  H HD22 . ASN A 1 82  ? 10.475  11.756  10.448  1.00 0.00 ? 85  ASN A HD22 3  
ATOM 4325  N N    . CYS A 1 83  ? 7.646   12.763  4.323   1.00 0.00 ? 86  CYS A N    3  
ATOM 4326  C CA   . CYS A 1 83  ? 7.623   13.158  2.928   1.00 0.00 ? 86  CYS A CA   3  
ATOM 4327  C C    . CYS A 1 83  ? 6.517   14.193  2.733   1.00 0.00 ? 86  CYS A C    3  
ATOM 4328  O O    . CYS A 1 83  ? 5.757   14.469  3.664   1.00 0.00 ? 86  CYS A O    3  
ATOM 4329  C CB   . CYS A 1 83  ? 7.387   11.941  2.016   1.00 0.00 ? 86  CYS A CB   3  
ATOM 4330  S SG   . CYS A 1 83  ? 8.490   10.518  2.340   1.00 0.00 ? 86  CYS A SG   3  
ATOM 4331  H H    . CYS A 1 83  ? 6.891   12.248  4.681   1.00 0.00 ? 86  CYS A H    3  
ATOM 4332  H HA   . CYS A 1 83  ? 8.577   13.608  2.690   1.00 0.00 ? 86  CYS A HA   3  
ATOM 4333  H HB2  . CYS A 1 83  ? 6.371   11.599  2.153   1.00 0.00 ? 86  CYS A HB2  3  
ATOM 4334  H HB3  . CYS A 1 83  ? 7.524   12.237  0.985   1.00 0.00 ? 86  CYS A HB3  3  
ATOM 4335  N N    . GLY A 1 84  ? 6.419   14.759  1.546   1.00 0.00 ? 87  GLY A N    3  
ATOM 4336  C CA   . GLY A 1 84  ? 5.419   15.776  1.288   1.00 0.00 ? 87  GLY A CA   3  
ATOM 4337  C C    . GLY A 1 84  ? 4.082   15.200  0.859   1.00 0.00 ? 87  GLY A C    3  
ATOM 4338  O O    . GLY A 1 84  ? 3.521   14.325  1.527   1.00 0.00 ? 87  GLY A O    3  
ATOM 4339  H H    . GLY A 1 84  ? 7.040   14.492  0.828   1.00 0.00 ? 87  GLY A H    3  
ATOM 4340  H HA2  . GLY A 1 84  ? 5.274   16.354  2.186   1.00 0.00 ? 87  GLY A HA2  3  
ATOM 4341  H HA3  . GLY A 1 84  ? 5.783   16.430  0.506   1.00 0.00 ? 87  GLY A HA3  3  
ATOM 4342  N N    . ASP A 1 85  ? 3.572   15.701  -0.257  1.00 0.00 ? 88  ASP A N    3  
ATOM 4343  C CA   . ASP A 1 85  ? 2.272   15.291  -0.783  1.00 0.00 ? 88  ASP A CA   3  
ATOM 4344  C C    . ASP A 1 85  ? 2.370   13.969  -1.530  1.00 0.00 ? 88  ASP A C    3  
ATOM 4345  O O    . ASP A 1 85  ? 3.422   13.633  -2.071  1.00 0.00 ? 88  ASP A O    3  
ATOM 4346  C CB   . ASP A 1 85  ? 1.723   16.362  -1.731  1.00 0.00 ? 88  ASP A CB   3  
ATOM 4347  C CG   . ASP A 1 85  ? 1.189   17.579  -1.006  1.00 0.00 ? 88  ASP A CG   3  
ATOM 4348  O OD1  . ASP A 1 85  ? 1.971   18.250  -0.300  1.00 0.00 ? 88  ASP A OD1  3  
ATOM 4349  O OD2  . ASP A 1 85  ? -0.018  17.877  -1.148  1.00 0.00 ? 88  ASP A OD2  3  
ATOM 4350  H H    . ASP A 1 85  ? 4.088   16.375  -0.749  1.00 0.00 ? 88  ASP A H    3  
ATOM 4351  H HA   . ASP A 1 85  ? 1.593   15.178  0.049   1.00 0.00 ? 88  ASP A HA   3  
ATOM 4352  H HB2  . ASP A 1 85  ? 2.510   16.680  -2.393  1.00 0.00 ? 88  ASP A HB2  3  
ATOM 4353  H HB3  . ASP A 1 85  ? 0.921   15.935  -2.316  1.00 0.00 ? 88  ASP A HB3  3  
ATOM 4354  N N    . PRO A 1 86  ? 1.274   13.198  -1.560  1.00 0.00 ? 89  PRO A N    3  
ATOM 4355  C CA   . PRO A 1 86  ? 1.196   11.974  -2.343  1.00 0.00 ? 89  PRO A CA   3  
ATOM 4356  C C    . PRO A 1 86  ? 0.911   12.278  -3.814  1.00 0.00 ? 89  PRO A C    3  
ATOM 4357  O O    . PRO A 1 86  ? -0.221  12.571  -4.199  1.00 0.00 ? 89  PRO A O    3  
ATOM 4358  C CB   . PRO A 1 86  ? 0.042   11.208  -1.696  1.00 0.00 ? 89  PRO A CB   3  
ATOM 4359  C CG   . PRO A 1 86  ? -0.834  12.247  -1.086  1.00 0.00 ? 89  PRO A CG   3  
ATOM 4360  C CD   . PRO A 1 86  ? 0.025   13.463  -0.824  1.00 0.00 ? 89  PRO A CD   3  
ATOM 4361  H HA   . PRO A 1 86  ? 2.106   11.397  -2.265  1.00 0.00 ? 89  PRO A HA   3  
ATOM 4362  H HB2  . PRO A 1 86  ? -0.484  10.648  -2.452  1.00 0.00 ? 89  PRO A HB2  3  
ATOM 4363  H HB3  . PRO A 1 86  ? 0.430   10.534  -0.947  1.00 0.00 ? 89  PRO A HB3  3  
ATOM 4364  H HG2  . PRO A 1 86  ? -1.633  12.494  -1.768  1.00 0.00 ? 89  PRO A HG2  3  
ATOM 4365  H HG3  . PRO A 1 86  ? -1.243  11.872  -0.157  1.00 0.00 ? 89  PRO A HG3  3  
ATOM 4366  H HD2  . PRO A 1 86  ? -0.457  14.348  -1.204  1.00 0.00 ? 89  PRO A HD2  3  
ATOM 4367  H HD3  . PRO A 1 86  ? 0.217   13.566  0.231   1.00 0.00 ? 89  PRO A HD3  3  
ATOM 4368  N N    . LEU A 1 87  ? 1.954   12.203  -4.622  1.00 0.00 ? 90  LEU A N    3  
ATOM 4369  C CA   . LEU A 1 87  ? 1.889   12.578  -6.028  1.00 0.00 ? 90  LEU A CA   3  
ATOM 4370  C C    . LEU A 1 87  ? 1.154   11.522  -6.848  1.00 0.00 ? 90  LEU A C    3  
ATOM 4371  O O    . LEU A 1 87  ? 0.444   11.841  -7.801  1.00 0.00 ? 90  LEU A O    3  
ATOM 4372  C CB   . LEU A 1 87  ? 3.310   12.765  -6.575  1.00 0.00 ? 90  LEU A CB   3  
ATOM 4373  C CG   . LEU A 1 87  ? 3.592   14.112  -7.247  1.00 0.00 ? 90  LEU A CG   3  
ATOM 4374  C CD1  . LEU A 1 87  ? 5.074   14.258  -7.560  1.00 0.00 ? 90  LEU A CD1  3  
ATOM 4375  C CD2  . LEU A 1 87  ? 2.772   14.265  -8.519  1.00 0.00 ? 90  LEU A CD2  3  
ATOM 4376  H H    . LEU A 1 87  ? 2.800   11.864  -4.264  1.00 0.00 ? 90  LEU A H    3  
ATOM 4377  H HA   . LEU A 1 87  ? 1.360   13.514  -6.103  1.00 0.00 ? 90  LEU A HA   3  
ATOM 4378  H HB2  . LEU A 1 87  ? 4.005   12.641  -5.757  1.00 0.00 ? 90  LEU A HB2  3  
ATOM 4379  H HB3  . LEU A 1 87  ? 3.497   11.984  -7.296  1.00 0.00 ? 90  LEU A HB3  3  
ATOM 4380  H HG   . LEU A 1 87  ? 3.312   14.908  -6.571  1.00 0.00 ? 90  LEU A HG   3  
ATOM 4381  H HD11 . LEU A 1 87  ? 5.387   13.448  -8.203  1.00 0.00 ? 90  LEU A HD11 3  
ATOM 4382  H HD12 . LEU A 1 87  ? 5.245   15.200  -8.058  1.00 0.00 ? 90  LEU A HD12 3  
ATOM 4383  H HD13 . LEU A 1 87  ? 5.642   14.229  -6.642  1.00 0.00 ? 90  LEU A HD13 3  
ATOM 4384  H HD21 . LEU A 1 87  ? 1.721   14.205  -8.282  1.00 0.00 ? 90  LEU A HD21 3  
ATOM 4385  H HD22 . LEU A 1 87  ? 2.985   15.222  -8.972  1.00 0.00 ? 90  LEU A HD22 3  
ATOM 4386  H HD23 . LEU A 1 87  ? 3.032   13.476  -9.210  1.00 0.00 ? 90  LEU A HD23 3  
ATOM 4387  N N    . SER A 1 88  ? 1.333   10.261  -6.482  1.00 0.00 ? 91  SER A N    3  
ATOM 4388  C CA   . SER A 1 88  ? 0.737   9.164   -7.230  1.00 0.00 ? 91  SER A CA   3  
ATOM 4389  C C    . SER A 1 88  ? 0.498   7.958   -6.329  1.00 0.00 ? 91  SER A C    3  
ATOM 4390  O O    . SER A 1 88  ? 1.210   7.754   -5.347  1.00 0.00 ? 91  SER A O    3  
ATOM 4391  C CB   . SER A 1 88  ? 1.639   8.775   -8.405  1.00 0.00 ? 91  SER A CB   3  
ATOM 4392  O OG   . SER A 1 88  ? 1.878   9.892   -9.245  1.00 0.00 ? 91  SER A OG   3  
ATOM 4393  H H    . SER A 1 88  ? 1.867   10.066  -5.681  1.00 0.00 ? 91  SER A H    3  
ATOM 4394  H HA   . SER A 1 88  ? -0.211  9.503   -7.616  1.00 0.00 ? 91  SER A HA   3  
ATOM 4395  H HB2  . SER A 1 88  ? 2.584   8.414   -8.028  1.00 0.00 ? 91  SER A HB2  3  
ATOM 4396  H HB3  . SER A 1 88  ? 1.161   7.998   -8.983  1.00 0.00 ? 91  SER A HB3  3  
ATOM 4397  H HG   . SER A 1 88  ? 1.288   10.616  -8.986  1.00 0.00 ? 91  SER A HG   3  
ATOM 4398  N N    . LEU A 1 89  ? -0.510  7.168   -6.678  1.00 0.00 ? 92  LEU A N    3  
ATOM 4399  C CA   . LEU A 1 89  ? -0.876  5.986   -5.908  1.00 0.00 ? 92  LEU A CA   3  
ATOM 4400  C C    . LEU A 1 89  ? -1.596  4.984   -6.807  1.00 0.00 ? 92  LEU A C    3  
ATOM 4401  O O    . LEU A 1 89  ? -2.509  5.352   -7.543  1.00 0.00 ? 92  LEU A O    3  
ATOM 4402  C CB   . LEU A 1 89  ? -1.790  6.384   -4.744  1.00 0.00 ? 92  LEU A CB   3  
ATOM 4403  C CG   . LEU A 1 89  ? -2.284  5.235   -3.858  1.00 0.00 ? 92  LEU A CG   3  
ATOM 4404  C CD1  . LEU A 1 89  ? -1.136  4.629   -3.067  1.00 0.00 ? 92  LEU A CD1  3  
ATOM 4405  C CD2  . LEU A 1 89  ? -3.374  5.716   -2.912  1.00 0.00 ? 92  LEU A CD2  3  
ATOM 4406  H H    . LEU A 1 89  ? -1.027  7.387   -7.483  1.00 0.00 ? 92  LEU A H    3  
ATOM 4407  H HA   . LEU A 1 89  ? 0.030   5.538   -5.522  1.00 0.00 ? 92  LEU A HA   3  
ATOM 4408  H HB2  . LEU A 1 89  ? -1.255  7.086   -4.119  1.00 0.00 ? 92  LEU A HB2  3  
ATOM 4409  H HB3  . LEU A 1 89  ? -2.654  6.884   -5.157  1.00 0.00 ? 92  LEU A HB3  3  
ATOM 4410  H HG   . LEU A 1 89  ? -2.701  4.460   -4.487  1.00 0.00 ? 92  LEU A HG   3  
ATOM 4411  H HD11 . LEU A 1 89  ? -1.518  3.872   -2.398  1.00 0.00 ? 92  LEU A HD11 3  
ATOM 4412  H HD12 . LEU A 1 89  ? -0.423  4.187   -3.744  1.00 0.00 ? 92  LEU A HD12 3  
ATOM 4413  H HD13 . LEU A 1 89  ? -0.653  5.405   -2.492  1.00 0.00 ? 92  LEU A HD13 3  
ATOM 4414  H HD21 . LEU A 1 89  ? -3.686  4.899   -2.276  1.00 0.00 ? 92  LEU A HD21 3  
ATOM 4415  H HD22 . LEU A 1 89  ? -2.990  6.519   -2.301  1.00 0.00 ? 92  LEU A HD22 3  
ATOM 4416  H HD23 . LEU A 1 89  ? -4.221  6.069   -3.483  1.00 0.00 ? 92  LEU A HD23 3  
ATOM 4417  N N    . GLY A 1 90  ? -1.187  3.730   -6.757  1.00 0.00 ? 93  GLY A N    3  
ATOM 4418  C CA   . GLY A 1 90  ? -1.826  2.723   -7.585  1.00 0.00 ? 93  GLY A CA   3  
ATOM 4419  C C    . GLY A 1 90  ? -0.934  1.525   -7.831  1.00 0.00 ? 93  GLY A C    3  
ATOM 4420  O O    . GLY A 1 90  ? -0.038  1.256   -7.035  1.00 0.00 ? 93  GLY A O    3  
ATOM 4421  H H    . GLY A 1 90  ? -0.444  3.483   -6.160  1.00 0.00 ? 93  GLY A H    3  
ATOM 4422  H HA2  . GLY A 1 90  ? -2.733  2.389   -7.097  1.00 0.00 ? 93  GLY A HA2  3  
ATOM 4423  H HA3  . GLY A 1 90  ? -2.080  3.171   -8.536  1.00 0.00 ? 93  GLY A HA3  3  
ATOM 4424  N N    . PRO A 1 91  ? -1.159  0.775   -8.920  1.00 0.00 ? 94  PRO A N    3  
ATOM 4425  C CA   . PRO A 1 91  ? -0.336  -0.388  -9.262  1.00 0.00 ? 94  PRO A CA   3  
ATOM 4426  C C    . PRO A 1 91  ? 1.088   0.012   -9.646  1.00 0.00 ? 94  PRO A C    3  
ATOM 4427  O O    . PRO A 1 91  ? 1.291   0.829   -10.544 1.00 0.00 ? 94  PRO A O    3  
ATOM 4428  C CB   . PRO A 1 91  ? -1.056  -1.016  -10.464 1.00 0.00 ? 94  PRO A CB   3  
ATOM 4429  C CG   . PRO A 1 91  ? -2.407  -0.383  -10.491 1.00 0.00 ? 94  PRO A CG   3  
ATOM 4430  C CD   . PRO A 1 91  ? -2.235  0.985   -9.901  1.00 0.00 ? 94  PRO A CD   3  
ATOM 4431  H HA   . PRO A 1 91  ? -0.302  -1.097  -8.448  1.00 0.00 ? 94  PRO A HA   3  
ATOM 4432  H HB2  . PRO A 1 91  ? -0.504  -0.802  -11.368 1.00 0.00 ? 94  PRO A HB2  3  
ATOM 4433  H HB3  . PRO A 1 91  ? -1.125  -2.085  -10.326 1.00 0.00 ? 94  PRO A HB3  3  
ATOM 4434  H HG2  . PRO A 1 91  ? -2.758  -0.311  -11.512 1.00 0.00 ? 94  PRO A HG2  3  
ATOM 4435  H HG3  . PRO A 1 91  ? -3.097  -0.965  -9.898  1.00 0.00 ? 94  PRO A HG3  3  
ATOM 4436  H HD2  . PRO A 1 91  ? -1.935  1.692   -10.662 1.00 0.00 ? 94  PRO A HD2  3  
ATOM 4437  H HD3  . PRO A 1 91  ? -3.146  1.306   -9.417  1.00 0.00 ? 94  PRO A HD3  3  
ATOM 4438  N N    . PHE A 1 92  ? 2.067   -0.562  -8.962  1.00 0.00 ? 95  PHE A N    3  
ATOM 4439  C CA   . PHE A 1 92  ? 3.461   -0.229  -9.201  1.00 0.00 ? 95  PHE A CA   3  
ATOM 4440  C C    . PHE A 1 92  ? 4.312   -1.492  -9.190  1.00 0.00 ? 95  PHE A C    3  
ATOM 4441  O O    . PHE A 1 92  ? 4.337   -2.212  -8.195  1.00 0.00 ? 95  PHE A O    3  
ATOM 4442  C CB   . PHE A 1 92  ? 3.954   0.739   -8.123  1.00 0.00 ? 95  PHE A CB   3  
ATOM 4443  C CG   . PHE A 1 92  ? 5.298   1.355   -8.407  1.00 0.00 ? 95  PHE A CG   3  
ATOM 4444  C CD1  . PHE A 1 92  ? 5.438   2.310   -9.401  1.00 0.00 ? 95  PHE A CD1  3  
ATOM 4445  C CD2  . PHE A 1 92  ? 6.416   0.987   -7.673  1.00 0.00 ? 95  PHE A CD2  3  
ATOM 4446  C CE1  . PHE A 1 92  ? 6.668   2.884   -9.660  1.00 0.00 ? 95  PHE A CE1  3  
ATOM 4447  C CE2  . PHE A 1 92  ? 7.648   1.558   -7.929  1.00 0.00 ? 95  PHE A CE2  3  
ATOM 4448  C CZ   . PHE A 1 92  ? 7.774   2.508   -8.922  1.00 0.00 ? 95  PHE A CZ   3  
ATOM 4449  H H    . PHE A 1 92  ? 1.849   -1.235  -8.278  1.00 0.00 ? 95  PHE A H    3  
ATOM 4450  H HA   . PHE A 1 92  ? 3.536   0.244   -10.167 1.00 0.00 ? 95  PHE A HA   3  
ATOM 4451  H HB2  . PHE A 1 92  ? 3.238   1.541   -8.015  1.00 0.00 ? 95  PHE A HB2  3  
ATOM 4452  H HB3  . PHE A 1 92  ? 4.027   0.204   -7.188  1.00 0.00 ? 95  PHE A HB3  3  
ATOM 4453  H HD1  . PHE A 1 92  ? 4.575   2.605   -9.981  1.00 0.00 ? 95  PHE A HD1  3  
ATOM 4454  H HD2  . PHE A 1 92  ? 6.321   0.245   -6.893  1.00 0.00 ? 95  PHE A HD2  3  
ATOM 4455  H HE1  . PHE A 1 92  ? 6.765   3.626   -10.438 1.00 0.00 ? 95  PHE A HE1  3  
ATOM 4456  H HE2  . PHE A 1 92  ? 8.512   1.261   -7.353  1.00 0.00 ? 95  PHE A HE2  3  
ATOM 4457  H HZ   . PHE A 1 92  ? 8.735   2.957   -9.123  1.00 0.00 ? 95  PHE A HZ   3  
ATOM 4458  N N    . LEU A 1 93  ? 4.985   -1.750  -10.311 1.00 0.00 ? 96  LEU A N    3  
ATOM 4459  C CA   . LEU A 1 93  ? 5.881   -2.903  -10.462 1.00 0.00 ? 96  LEU A CA   3  
ATOM 4460  C C    . LEU A 1 93  ? 5.116   -4.226  -10.501 1.00 0.00 ? 96  LEU A C    3  
ATOM 4461  O O    . LEU A 1 93  ? 4.410   -4.600  -9.559  1.00 0.00 ? 96  LEU A O    3  
ATOM 4462  C CB   . LEU A 1 93  ? 6.941   -2.943  -9.351  1.00 0.00 ? 96  LEU A CB   3  
ATOM 4463  C CG   . LEU A 1 93  ? 7.924   -1.764  -9.323  1.00 0.00 ? 96  LEU A CG   3  
ATOM 4464  C CD1  . LEU A 1 93  ? 8.932   -1.940  -8.197  1.00 0.00 ? 96  LEU A CD1  3  
ATOM 4465  C CD2  . LEU A 1 93  ? 8.644   -1.618  -10.661 1.00 0.00 ? 96  LEU A CD2  3  
ATOM 4466  H H    . LEU A 1 93  ? 4.875   -1.135  -11.076 1.00 0.00 ? 96  LEU A H    3  
ATOM 4467  H HA   . LEU A 1 93  ? 6.387   -2.790  -11.410 1.00 0.00 ? 96  LEU A HA   3  
ATOM 4468  H HB2  . LEU A 1 93  ? 6.427   -2.977  -8.399  1.00 0.00 ? 96  LEU A HB2  3  
ATOM 4469  H HB3  . LEU A 1 93  ? 7.511   -3.855  -9.461  1.00 0.00 ? 96  LEU A HB3  3  
ATOM 4470  H HG   . LEU A 1 93  ? 7.375   -0.850  -9.135  1.00 0.00 ? 96  LEU A HG   3  
ATOM 4471  H HD11 . LEU A 1 93  ? 9.595   -1.088  -8.171  1.00 0.00 ? 96  LEU A HD11 3  
ATOM 4472  H HD12 . LEU A 1 93  ? 8.410   -2.018  -7.254  1.00 0.00 ? 96  LEU A HD12 3  
ATOM 4473  H HD13 . LEU A 1 93  ? 9.508   -2.837  -8.367  1.00 0.00 ? 96  LEU A HD13 3  
ATOM 4474  H HD21 . LEU A 1 93  ? 9.131   -2.548  -10.915 1.00 0.00 ? 96  LEU A HD21 3  
ATOM 4475  H HD22 . LEU A 1 93  ? 7.931   -1.361  -11.431 1.00 0.00 ? 96  LEU A HD22 3  
ATOM 4476  H HD23 . LEU A 1 93  ? 9.383   -0.835  -10.586 1.00 0.00 ? 96  LEU A HD23 3  
ATOM 4477  N N    . LYS A 1 94  ? 5.273   -4.946  -11.600 1.00 0.00 ? 97  LYS A N    3  
ATOM 4478  C CA   . LYS A 1 94  ? 4.647   -6.250  -11.759 1.00 0.00 ? 97  LYS A CA   3  
ATOM 4479  C C    . LYS A 1 94  ? 5.556   -7.332  -11.191 1.00 0.00 ? 97  LYS A C    3  
ATOM 4480  O O    . LYS A 1 94  ? 5.957   -8.254  -11.894 1.00 0.00 ? 97  LYS A O    3  
ATOM 4481  C CB   . LYS A 1 94  ? 4.363   -6.523  -13.236 1.00 0.00 ? 97  LYS A CB   3  
ATOM 4482  C CG   . LYS A 1 94  ? 3.524   -5.448  -13.907 1.00 0.00 ? 97  LYS A CG   3  
ATOM 4483  C CD   . LYS A 1 94  ? 3.483   -5.639  -15.413 1.00 0.00 ? 97  LYS A CD   3  
ATOM 4484  C CE   . LYS A 1 94  ? 2.704   -4.526  -16.095 1.00 0.00 ? 97  LYS A CE   3  
ATOM 4485  N NZ   . LYS A 1 94  ? 2.832   -4.591  -17.575 1.00 0.00 ? 97  LYS A NZ   3  
ATOM 4486  H H    . LYS A 1 94  ? 5.833   -4.597  -12.323 1.00 0.00 ? 97  LYS A H    3  
ATOM 4487  H HA   . LYS A 1 94  ? 3.719   -6.245  -11.209 1.00 0.00 ? 97  LYS A HA   3  
ATOM 4488  H HB2  . LYS A 1 94  ? 5.301   -6.600  -13.763 1.00 0.00 ? 97  LYS A HB2  3  
ATOM 4489  H HB3  . LYS A 1 94  ? 3.837   -7.461  -13.319 1.00 0.00 ? 97  LYS A HB3  3  
ATOM 4490  H HG2  . LYS A 1 94  ? 2.516   -5.496  -13.520 1.00 0.00 ? 97  LYS A HG2  3  
ATOM 4491  H HG3  . LYS A 1 94  ? 3.950   -4.480  -13.686 1.00 0.00 ? 97  LYS A HG3  3  
ATOM 4492  H HD2  . LYS A 1 94  ? 4.493   -5.645  -15.793 1.00 0.00 ? 97  LYS A HD2  3  
ATOM 4493  H HD3  . LYS A 1 94  ? 3.008   -6.585  -15.631 1.00 0.00 ? 97  LYS A HD3  3  
ATOM 4494  H HE2  . LYS A 1 94  ? 1.663   -4.615  -15.828 1.00 0.00 ? 97  LYS A HE2  3  
ATOM 4495  H HE3  . LYS A 1 94  ? 3.085   -3.574  -15.749 1.00 0.00 ? 97  LYS A HE3  3  
ATOM 4496  H HZ1  . LYS A 1 94  ? 2.437   -5.495  -17.919 1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 4497  H HZ3  . LYS A 1 94  ? 3.845   -4.559  -17.833 1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 4498  N N    . THR A 1 95  ? 5.885   -7.199  -9.916  1.00 0.00 ? 98  THR A N    3  
ATOM 4499  C CA   . THR A 1 95  ? 6.798   -8.121  -9.258  1.00 0.00 ? 98  THR A CA   3  
ATOM 4500  C C    . THR A 1 95  ? 6.158   -9.499  -9.084  1.00 0.00 ? 98  THR A C    3  
ATOM 4501  O O    . THR A 1 95  ? 6.836   -10.524 -9.160  1.00 0.00 ? 98  THR A O    3  
ATOM 4502  C CB   . THR A 1 95  ? 7.223   -7.561  -7.889  1.00 0.00 ? 98  THR A CB   3  
ATOM 4503  O OG1  . THR A 1 95  ? 7.327   -6.134  -7.972  1.00 0.00 ? 98  THR A OG1  3  
ATOM 4504  C CG2  . THR A 1 95  ? 8.561   -8.138  -7.453  1.00 0.00 ? 98  THR A CG2  3  
ATOM 4505  H H    . THR A 1 95  ? 5.519   -6.445  -9.404  1.00 0.00 ? 98  THR A H    3  
ATOM 4506  H HA   . THR A 1 95  ? 7.677   -8.218  -9.876  1.00 0.00 ? 98  THR A HA   3  
ATOM 4507  H HB   . THR A 1 95  ? 6.474   -7.823  -7.157  1.00 0.00 ? 98  THR A HB   3  
ATOM 4508  H HG1  . THR A 1 95  ? 8.005   -5.897  -8.627  1.00 0.00 ? 98  THR A HG1  3  
ATOM 4509  H HG21 . THR A 1 95  ? 8.830   -7.730  -6.490  1.00 0.00 ? 98  THR A HG21 3  
ATOM 4510  H HG22 . THR A 1 95  ? 9.320   -7.882  -8.177  1.00 0.00 ? 98  THR A HG22 3  
ATOM 4511  H HG23 . THR A 1 95  ? 8.482   -9.213  -7.379  1.00 0.00 ? 98  THR A HG23 3  
ATOM 4512  N N    . TYR A 1 96  ? 4.842   -9.497  -8.848  1.00 0.00 ? 99  TYR A N    3  
ATOM 4513  C CA   . TYR A 1 96  ? 4.028   -10.723 -8.730  1.00 0.00 ? 99  TYR A CA   3  
ATOM 4514  C C    . TYR A 1 96  ? 4.321   -11.517 -7.455  1.00 0.00 ? 99  TYR A C    3  
ATOM 4515  O O    . TYR A 1 96  ? 3.557   -12.415 -7.117  1.00 0.00 ? 99  TYR A O    3  
ATOM 4516  C CB   . TYR A 1 96  ? 4.209   -11.644 -9.948  1.00 0.00 ? 99  TYR A CB   3  
ATOM 4517  C CG   . TYR A 1 96  ? 3.756   -11.051 -11.269 1.00 0.00 ? 99  TYR A CG   3  
ATOM 4518  C CD1  . TYR A 1 96  ? 2.478   -10.525 -11.425 1.00 0.00 ? 99  TYR A CD1  3  
ATOM 4519  C CD2  . TYR A 1 96  ? 4.609   -11.028 -12.367 1.00 0.00 ? 99  TYR A CD2  3  
ATOM 4520  C CE1  . TYR A 1 96  ? 2.067   -9.992  -12.631 1.00 0.00 ? 99  TYR A CE1  3  
ATOM 4521  C CE2  . TYR A 1 96  ? 4.202   -10.497 -13.577 1.00 0.00 ? 99  TYR A CE2  3  
ATOM 4522  C CZ   . TYR A 1 96  ? 2.932   -9.982  -13.703 1.00 0.00 ? 99  TYR A CZ   3  
ATOM 4523  O OH   . TYR A 1 96  ? 2.523   -9.456  -14.907 1.00 0.00 ? 99  TYR A OH   3  
ATOM 4524  H H    . TYR A 1 96  ? 4.393   -8.634  -8.750  1.00 0.00 ? 99  TYR A H    3  
ATOM 4525  H HA   . TYR A 1 96  ? 2.995   -10.413 -8.692  1.00 0.00 ? 99  TYR A HA   3  
ATOM 4526  H HB2  . TYR A 1 96  ? 5.255   -11.891 -10.043 1.00 0.00 ? 99  TYR A HB2  3  
ATOM 4527  H HB3  . TYR A 1 96  ? 3.649   -12.553 -9.783  1.00 0.00 ? 99  TYR A HB3  3  
ATOM 4528  H HD1  . TYR A 1 96  ? 1.801   -10.535 -10.585 1.00 0.00 ? 99  TYR A HD1  3  
ATOM 4529  H HD2  . TYR A 1 96  ? 5.606   -11.432 -12.268 1.00 0.00 ? 99  TYR A HD2  3  
ATOM 4530  H HE1  . TYR A 1 96  ? 1.071   -9.585  -12.729 1.00 0.00 ? 99  TYR A HE1  3  
ATOM 4531  H HE2  . TYR A 1 96  ? 4.880   -10.487 -14.417 1.00 0.00 ? 99  TYR A HE2  3  
ATOM 4532  H HH   . TYR A 1 96  ? 2.724   -10.083 -15.610 1.00 0.00 ? 99  TYR A HH   3  
ATOM 4533  N N    . THR A 1 97  ? 5.411   -11.176 -6.763  1.00 0.00 ? 100 THR A N    3  
ATOM 4534  C CA   . THR A 1 97  ? 5.885   -11.917 -5.589  1.00 0.00 ? 100 THR A CA   3  
ATOM 4535  C C    . THR A 1 97  ? 4.795   -12.135 -4.532  1.00 0.00 ? 100 THR A C    3  
ATOM 4536  O O    . THR A 1 97  ? 4.505   -11.244 -3.735  1.00 0.00 ? 100 THR A O    3  
ATOM 4537  C CB   . THR A 1 97  ? 7.067   -11.173 -4.938  1.00 0.00 ? 100 THR A CB   3  
ATOM 4538  O OG1  . THR A 1 97  ? 8.101   -10.972 -5.908  1.00 0.00 ? 100 THR A OG1  3  
ATOM 4539  C CG2  . THR A 1 97  ? 7.619   -11.949 -3.751  1.00 0.00 ? 100 THR A CG2  3  
ATOM 4540  H H    . THR A 1 97  ? 5.923   -10.401 -7.059  1.00 0.00 ? 100 THR A H    3  
ATOM 4541  H HA   . THR A 1 97  ? 6.241   -12.878 -5.925  1.00 0.00 ? 100 THR A HA   3  
ATOM 4542  H HB   . THR A 1 97  ? 6.717   -10.212 -4.590  1.00 0.00 ? 100 THR A HB   3  
ATOM 4543  H HG1  . THR A 1 97  ? 8.320   -11.820 -6.321  1.00 0.00 ? 100 THR A HG1  3  
ATOM 4544  H HG21 . THR A 1 97  ? 7.987   -12.906 -4.086  1.00 0.00 ? 100 THR A HG21 3  
ATOM 4545  H HG22 . THR A 1 97  ? 6.834   -12.100 -3.022  1.00 0.00 ? 100 THR A HG22 3  
ATOM 4546  H HG23 . THR A 1 97  ? 8.426   -11.391 -3.301  1.00 0.00 ? 100 THR A HG23 3  
ATOM 4547  N N    . PRO A 1 98  ? 4.218   -13.349 -4.481  1.00 0.00 ? 101 PRO A N    3  
ATOM 4548  C CA   . PRO A 1 98  ? 3.131   -13.676 -3.575  1.00 0.00 ? 101 PRO A CA   3  
ATOM 4549  C C    . PRO A 1 98  ? 3.622   -14.291 -2.266  1.00 0.00 ? 101 PRO A C    3  
ATOM 4550  O O    . PRO A 1 98  ? 2.883   -14.991 -1.574  1.00 0.00 ? 101 PRO A O    3  
ATOM 4551  C CB   . PRO A 1 98  ? 2.320   -14.690 -4.383  1.00 0.00 ? 101 PRO A CB   3  
ATOM 4552  C CG   . PRO A 1 98  ? 3.276   -15.297 -5.370  1.00 0.00 ? 101 PRO A CG   3  
ATOM 4553  C CD   . PRO A 1 98  ? 4.563   -14.505 -5.315  1.00 0.00 ? 101 PRO A CD   3  
ATOM 4554  H HA   . PRO A 1 98  ? 2.523   -12.812 -3.359  1.00 0.00 ? 101 PRO A HA   3  
ATOM 4555  H HB2  . PRO A 1 98  ? 1.919   -15.440 -3.717  1.00 0.00 ? 101 PRO A HB2  3  
ATOM 4556  H HB3  . PRO A 1 98  ? 1.508   -14.184 -4.886  1.00 0.00 ? 101 PRO A HB3  3  
ATOM 4557  H HG2  . PRO A 1 98  ? 3.465   -16.325 -5.101  1.00 0.00 ? 101 PRO A HG2  3  
ATOM 4558  H HG3  . PRO A 1 98  ? 2.851   -15.246 -6.361  1.00 0.00 ? 101 PRO A HG3  3  
ATOM 4559  H HD2  . PRO A 1 98  ? 5.348   -15.090 -4.856  1.00 0.00 ? 101 PRO A HD2  3  
ATOM 4560  H HD3  . PRO A 1 98  ? 4.855   -14.191 -6.307  1.00 0.00 ? 101 PRO A HD3  3  
ATOM 4561  N N    . GLN A 1 99  ? 4.879   -14.039 -1.934  1.00 0.00 ? 102 GLN A N    3  
ATOM 4562  C CA   . GLN A 1 99  ? 5.434   -14.502 -0.667  1.00 0.00 ? 102 GLN A CA   3  
ATOM 4563  C C    . GLN A 1 99  ? 5.555   -13.346 0.312   1.00 0.00 ? 102 GLN A C    3  
ATOM 4564  O O    . GLN A 1 99  ? 5.809   -13.550 1.498   1.00 0.00 ? 102 GLN A O    3  
ATOM 4565  C CB   . GLN A 1 99  ? 6.801   -15.180 -0.855  1.00 0.00 ? 102 GLN A CB   3  
ATOM 4566  C CG   . GLN A 1 99  ? 6.722   -16.537 -1.541  1.00 0.00 ? 102 GLN A CG   3  
ATOM 4567  C CD   . GLN A 1 99  ? 6.627   -16.444 -3.050  1.00 0.00 ? 102 GLN A CD   3  
ATOM 4568  O OE1  . GLN A 1 99  ? 5.948   -17.246 -3.687  1.00 0.00 ? 102 GLN A OE1  3  
ATOM 4569  N NE2  . GLN A 1 99  ? 7.344   -15.496 -3.636  1.00 0.00 ? 102 GLN A NE2  3  
ATOM 4570  H H    . GLN A 1 99  ? 5.443   -13.533 -2.554  1.00 0.00 ? 102 GLN A H    3  
ATOM 4571  H HA   . GLN A 1 99  ? 4.742   -15.224 -0.257  1.00 0.00 ? 102 GLN A HA   3  
ATOM 4572  H HB2  . GLN A 1 99  ? 7.433   -14.536 -1.452  1.00 0.00 ? 102 GLN A HB2  3  
ATOM 4573  H HB3  . GLN A 1 99  ? 7.258   -15.317 0.114   1.00 0.00 ? 102 GLN A HB3  3  
ATOM 4574  H HG2  . GLN A 1 99  ? 7.607   -17.101 -1.290  1.00 0.00 ? 102 GLN A HG2  3  
ATOM 4575  H HG3  . GLN A 1 99  ? 5.851   -17.059 -1.174  1.00 0.00 ? 102 GLN A HG3  3  
ATOM 4576  H HE21 . GLN A 1 99  ? 7.895   -14.911 -3.070  1.00 0.00 ? 102 GLN A HE21 3  
ATOM 4577  H HE22 . GLN A 1 99  ? 7.307   -15.428 -4.618  1.00 0.00 ? 102 GLN A HE22 3  
ATOM 4578  N N    . SER A 1 100 ? 5.360   -12.139 -0.190  1.00 0.00 ? 103 SER A N    3  
ATOM 4579  C CA   . SER A 1 100 ? 5.471   -10.949 0.637   1.00 0.00 ? 103 SER A CA   3  
ATOM 4580  C C    . SER A 1 100 ? 4.209   -10.100 0.533   1.00 0.00 ? 103 SER A C    3  
ATOM 4581  O O    . SER A 1 100 ? 3.950   -9.249  1.383   1.00 0.00 ? 103 SER A O    3  
ATOM 4582  C CB   . SER A 1 100 ? 6.690   -10.131 0.200   1.00 0.00 ? 103 SER A CB   3  
ATOM 4583  O OG   . SER A 1 100 ? 7.858   -10.939 0.141   1.00 0.00 ? 103 SER A OG   3  
ATOM 4584  H H    . SER A 1 100 ? 5.144   -12.044 -1.139  1.00 0.00 ? 103 SER A H    3  
ATOM 4585  H HA   . SER A 1 100 ? 5.603   -11.262 1.660   1.00 0.00 ? 103 SER A HA   3  
ATOM 4586  H HB2  . SER A 1 100 ? 6.505   -9.711  -0.779  1.00 0.00 ? 103 SER A HB2  3  
ATOM 4587  H HB3  . SER A 1 100 ? 6.856   -9.332  0.908   1.00 0.00 ? 103 SER A HB3  3  
ATOM 4588  H HG   . SER A 1 100 ? 8.634   -10.373 0.015   1.00 0.00 ? 103 SER A HG   3  
ATOM 4589  N N    . SER A 1 101 ? 3.417   -10.345 -0.501  1.00 0.00 ? 104 SER A N    3  
ATOM 4590  C CA   . SER A 1 101 ? 2.270   -9.503  -0.789  1.00 0.00 ? 104 SER A CA   3  
ATOM 4591  C C    . SER A 1 101 ? 0.986   -10.034 -0.146  1.00 0.00 ? 104 SER A C    3  
ATOM 4592  O O    . SER A 1 101 ? 0.786   -11.246 -0.015  1.00 0.00 ? 104 SER A O    3  
ATOM 4593  C CB   . SER A 1 101 ? 2.087   -9.393  -2.302  1.00 0.00 ? 104 SER A CB   3  
ATOM 4594  O OG   . SER A 1 101 ? 1.877   -10.673 -2.877  1.00 0.00 ? 104 SER A OG   3  
ATOM 4595  H H    . SER A 1 101 ? 3.609   -11.103 -1.087  1.00 0.00 ? 104 SER A H    3  
ATOM 4596  H HA   . SER A 1 101 ? 2.476   -8.521  -0.392  1.00 0.00 ? 104 SER A HA   3  
ATOM 4597  H HB2  . SER A 1 101 ? 1.233   -8.768  -2.517  1.00 0.00 ? 104 SER A HB2  3  
ATOM 4598  H HB3  . SER A 1 101 ? 2.972   -8.957  -2.741  1.00 0.00 ? 104 SER A HB3  3  
ATOM 4599  H HG   . SER A 1 101 ? 1.093   -11.072 -2.489  1.00 0.00 ? 104 SER A HG   3  
ATOM 4600  N N    . ILE A 1 102 ? 0.125   -9.111  0.255   1.00 0.00 ? 105 ILE A N    3  
ATOM 4601  C CA   . ILE A 1 102 ? -1.202  -9.439  0.738   1.00 0.00 ? 105 ILE A CA   3  
ATOM 4602  C C    . ILE A 1 102 ? -2.241  -8.703  -0.095  1.00 0.00 ? 105 ILE A C    3  
ATOM 4603  O O    . ILE A 1 102 ? -2.009  -7.575  -0.540  1.00 0.00 ? 105 ILE A O    3  
ATOM 4604  C CB   . ILE A 1 102 ? -1.405  -9.075  2.231   1.00 0.00 ? 105 ILE A CB   3  
ATOM 4605  C CG1  . ILE A 1 102 ? -1.083  -7.595  2.473   1.00 0.00 ? 105 ILE A CG1  3  
ATOM 4606  C CG2  . ILE A 1 102 ? -0.565  -9.979  3.125   1.00 0.00 ? 105 ILE A CG2  3  
ATOM 4607  C CD1  . ILE A 1 102 ? -1.348  -7.128  3.888   1.00 0.00 ? 105 ILE A CD1  3  
ATOM 4608  H H    . ILE A 1 102 ? 0.397   -8.163  0.218   1.00 0.00 ? 105 ILE A H    3  
ATOM 4609  H HA   . ILE A 1 102 ? -1.346  -10.501 0.620   1.00 0.00 ? 105 ILE A HA   3  
ATOM 4610  H HB   . ILE A 1 102 ? -2.445  -9.248  2.474   1.00 0.00 ? 105 ILE A HB   3  
ATOM 4611  H HG12 . ILE A 1 102 ? -0.041  -7.420  2.261   1.00 0.00 ? 105 ILE A HG12 3  
ATOM 4612  H HG13 . ILE A 1 102 ? -1.684  -6.993  1.808   1.00 0.00 ? 105 ILE A HG13 3  
ATOM 4613  H HG21 . ILE A 1 102 ? -0.953  -10.982 3.092   1.00 0.00 ? 105 ILE A HG21 3  
ATOM 4614  H HG22 . ILE A 1 102 ? 0.458   -9.977  2.781   1.00 0.00 ? 105 ILE A HG22 3  
ATOM 4615  H HG23 . ILE A 1 102 ? -0.603  -9.617  4.141   1.00 0.00 ? 105 ILE A HG23 3  
ATOM 4616  H HD11 . ILE A 1 102 ? -1.074  -6.087  3.978   1.00 0.00 ? 105 ILE A HD11 3  
ATOM 4617  H HD12 . ILE A 1 102 ? -2.396  -7.245  4.116   1.00 0.00 ? 105 ILE A HD12 3  
ATOM 4618  H HD13 . ILE A 1 102 ? -0.763  -7.714  4.578   1.00 0.00 ? 105 ILE A HD13 3  
ATOM 4619  N N    . ILE A 1 103 ? -3.370  -9.342  -0.325  1.00 0.00 ? 106 ILE A N    3  
ATOM 4620  C CA   . ILE A 1 103 ? -4.457  -8.704  -1.035  1.00 0.00 ? 106 ILE A CA   3  
ATOM 4621  C C    . ILE A 1 103 ? -5.622  -8.511  -0.074  1.00 0.00 ? 106 ILE A C    3  
ATOM 4622  O O    . ILE A 1 103 ? -6.065  -9.452  0.593   1.00 0.00 ? 106 ILE A O    3  
ATOM 4623  C CB   . ILE A 1 103 ? -4.885  -9.499  -2.301  1.00 0.00 ? 106 ILE A CB   3  
ATOM 4624  C CG1  . ILE A 1 103 ? -5.854  -8.669  -3.148  1.00 0.00 ? 106 ILE A CG1  3  
ATOM 4625  C CG2  . ILE A 1 103 ? -5.506  -10.842 -1.933  1.00 0.00 ? 106 ILE A CG2  3  
ATOM 4626  C CD1  . ILE A 1 103 ? -6.256  -9.336  -4.447  1.00 0.00 ? 106 ILE A CD1  3  
ATOM 4627  H H    . ILE A 1 103 ? -3.482  -10.262 0.009   1.00 0.00 ? 106 ILE A H    3  
ATOM 4628  H HA   . ILE A 1 103 ? -4.108  -7.729  -1.351  1.00 0.00 ? 106 ILE A HA   3  
ATOM 4629  H HB   . ILE A 1 103 ? -3.997  -9.696  -2.884  1.00 0.00 ? 106 ILE A HB   3  
ATOM 4630  H HG12 . ILE A 1 103 ? -6.754  -8.484  -2.578  1.00 0.00 ? 106 ILE A HG12 3  
ATOM 4631  H HG13 . ILE A 1 103 ? -5.384  -7.726  -3.392  1.00 0.00 ? 106 ILE A HG13 3  
ATOM 4632  H HG21 . ILE A 1 103 ? -4.798  -11.425 -1.365  1.00 0.00 ? 106 ILE A HG21 3  
ATOM 4633  H HG22 . ILE A 1 103 ? -6.392  -10.672 -1.337  1.00 0.00 ? 106 ILE A HG22 3  
ATOM 4634  H HG23 . ILE A 1 103 ? -5.774  -11.375 -2.832  1.00 0.00 ? 106 ILE A HG23 3  
ATOM 4635  H HD11 . ILE A 1 103 ? -5.371  -9.543  -5.034  1.00 0.00 ? 106 ILE A HD11 3  
ATOM 4636  H HD12 . ILE A 1 103 ? -6.770  -10.260 -4.233  1.00 0.00 ? 106 ILE A HD12 3  
ATOM 4637  H HD13 . ILE A 1 103 ? -6.911  -8.681  -5.001  1.00 0.00 ? 106 ILE A HD13 3  
ATOM 4638  N N    . CYS A 1 104 ? -6.083  -7.283  0.048   1.00 0.00 ? 107 CYS A N    3  
ATOM 4639  C CA   . CYS A 1 104 ? -7.094  -6.970  1.038   1.00 0.00 ? 107 CYS A CA   3  
ATOM 4640  C C    . CYS A 1 104 ? -8.423  -6.655  0.373   1.00 0.00 ? 107 CYS A C    3  
ATOM 4641  O O    . CYS A 1 104 ? -8.469  -6.201  -0.772  1.00 0.00 ? 107 CYS A O    3  
ATOM 4642  C CB   . CYS A 1 104 ? -6.640  -5.801  1.917   1.00 0.00 ? 107 CYS A CB   3  
ATOM 4643  S SG   . CYS A 1 104 ? -7.361  -5.822  3.587   1.00 0.00 ? 107 CYS A SG   3  
ATOM 4644  H H    . CYS A 1 104 ? -5.742  -6.573  -0.544  1.00 0.00 ? 107 CYS A H    3  
ATOM 4645  H HA   . CYS A 1 104 ? -7.219  -7.843  1.661   1.00 0.00 ? 107 CYS A HA   3  
ATOM 4646  H HB2  . CYS A 1 104 ? -5.563  -5.828  2.020   1.00 0.00 ? 107 CYS A HB2  3  
ATOM 4647  H HB3  . CYS A 1 104 ? -6.930  -4.873  1.445   1.00 0.00 ? 107 CYS A HB3  3  
ATOM 4648  N N    . TYR A 1 105 ? -9.505  -6.917  1.084   1.00 0.00 ? 108 TYR A N    3  
ATOM 4649  C CA   . TYR A 1 105 ? -10.835 -6.675  0.560   1.00 0.00 ? 108 TYR A CA   3  
ATOM 4650  C C    . TYR A 1 105 ? -11.594 -5.741  1.486   1.00 0.00 ? 108 TYR A C    3  
ATOM 4651  O O    . TYR A 1 105 ? -11.146 -5.463  2.600   1.00 0.00 ? 108 TYR A O    3  
ATOM 4652  C CB   . TYR A 1 105 ? -11.588 -7.998  0.377   1.00 0.00 ? 108 TYR A CB   3  
ATOM 4653  C CG   . TYR A 1 105 ? -10.924 -8.925  -0.615  1.00 0.00 ? 108 TYR A CG   3  
ATOM 4654  C CD1  . TYR A 1 105 ? -10.982 -8.666  -1.981  1.00 0.00 ? 108 TYR A CD1  3  
ATOM 4655  C CD2  . TYR A 1 105 ? -10.224 -10.048 -0.190  1.00 0.00 ? 108 TYR A CD2  3  
ATOM 4656  C CE1  . TYR A 1 105 ? -10.366 -9.499  -2.891  1.00 0.00 ? 108 TYR A CE1  3  
ATOM 4657  C CE2  . TYR A 1 105 ? -9.602  -10.883 -1.095  1.00 0.00 ? 108 TYR A CE2  3  
ATOM 4658  C CZ   . TYR A 1 105 ? -9.676  -10.606 -2.446  1.00 0.00 ? 108 TYR A CZ   3  
ATOM 4659  O OH   . TYR A 1 105 ? -9.056  -11.431 -3.353  1.00 0.00 ? 108 TYR A OH   3  
ATOM 4660  H H    . TYR A 1 105 ? -9.408  -7.274  1.994   1.00 0.00 ? 108 TYR A H    3  
ATOM 4661  H HA   . TYR A 1 105 ? -10.728 -6.199  -0.401  1.00 0.00 ? 108 TYR A HA   3  
ATOM 4662  H HB2  . TYR A 1 105 ? -11.640 -8.509  1.327   1.00 0.00 ? 108 TYR A HB2  3  
ATOM 4663  H HB3  . TYR A 1 105 ? -12.588 -7.793  0.027   1.00 0.00 ? 108 TYR A HB3  3  
ATOM 4664  H HD1  . TYR A 1 105 ? -11.524 -7.798  -2.329  1.00 0.00 ? 108 TYR A HD1  3  
ATOM 4665  H HD2  . TYR A 1 105 ? -10.169 -10.265 0.867   1.00 0.00 ? 108 TYR A HD2  3  
ATOM 4666  H HE1  . TYR A 1 105 ? -10.426 -9.283  -3.950  1.00 0.00 ? 108 TYR A HE1  3  
ATOM 4667  H HE2  . TYR A 1 105 ? -9.063  -11.752 -0.745  1.00 0.00 ? 108 TYR A HE2  3  
ATOM 4668  H HH   . TYR A 1 105 ? -8.567  -10.900 -3.989  1.00 0.00 ? 108 TYR A HH   3  
ATOM 4669  N N    . GLY A 1 106 ? -12.724 -5.241  1.021   1.00 0.00 ? 109 GLY A N    3  
ATOM 4670  C CA   . GLY A 1 106 ? -13.506 -4.324  1.817   1.00 0.00 ? 109 GLY A CA   3  
ATOM 4671  C C    . GLY A 1 106 ? -13.623 -2.967  1.160   1.00 0.00 ? 109 GLY A C    3  
ATOM 4672  O O    . GLY A 1 106 ? -14.026 -2.868  -0.001  1.00 0.00 ? 109 GLY A O    3  
ATOM 4673  H H    . GLY A 1 106 ? -13.030 -5.488  0.118   1.00 0.00 ? 109 GLY A H    3  
ATOM 4674  H HA2  . GLY A 1 106 ? -14.496 -4.733  1.958   1.00 0.00 ? 109 GLY A HA2  3  
ATOM 4675  H HA3  . GLY A 1 106 ? -13.032 -4.206  2.781   1.00 0.00 ? 109 GLY A HA3  3  
ATOM 4676  N N    . GLN A 1 107 ? -13.249 -1.927  1.886   1.00 0.00 ? 110 GLN A N    3  
ATOM 4677  C CA   . GLN A 1 107 ? -13.393 -0.565  1.399   1.00 0.00 ? 110 GLN A CA   3  
ATOM 4678  C C    . GLN A 1 107 ? -12.064 0.173   1.456   1.00 0.00 ? 110 GLN A C    3  
ATOM 4679  O O    . GLN A 1 107 ? -11.232 -0.096  2.325   1.00 0.00 ? 110 GLN A O    3  
ATOM 4680  C CB   . GLN A 1 107 ? -14.456 0.168   2.216   1.00 0.00 ? 110 GLN A CB   3  
ATOM 4681  C CG   . GLN A 1 107 ? -15.845 -0.425  2.044   1.00 0.00 ? 110 GLN A CG   3  
ATOM 4682  C CD   . GLN A 1 107 ? -16.903 0.329   2.815   1.00 0.00 ? 110 GLN A CD   3  
ATOM 4683  O OE1  . GLN A 1 107 ? -17.195 0.013   3.967   1.00 0.00 ? 110 GLN A OE1  3  
ATOM 4684  N NE2  . GLN A 1 107 ? -17.489 1.328   2.184   1.00 0.00 ? 110 GLN A NE2  3  
ATOM 4685  H H    . GLN A 1 107 ? -12.852 -2.077  2.766   1.00 0.00 ? 110 GLN A H    3  
ATOM 4686  H HA   . GLN A 1 107 ? -13.715 -0.617  0.369   1.00 0.00 ? 110 GLN A HA   3  
ATOM 4687  H HB2  . GLN A 1 107 ? -14.190 0.116   3.262   1.00 0.00 ? 110 GLN A HB2  3  
ATOM 4688  H HB3  . GLN A 1 107 ? -14.486 1.202   1.909   1.00 0.00 ? 110 GLN A HB3  3  
ATOM 4689  H HG2  . GLN A 1 107 ? -16.105 -0.404  0.996   1.00 0.00 ? 110 GLN A HG2  3  
ATOM 4690  H HG3  . GLN A 1 107 ? -15.830 -1.448  2.388   1.00 0.00 ? 110 GLN A HG3  3  
ATOM 4691  H HE21 . GLN A 1 107 ? -17.208 1.524   1.266   1.00 0.00 ? 110 GLN A HE21 3  
ATOM 4692  H HE22 . GLN A 1 107 ? -18.188 1.835   2.659   1.00 0.00 ? 110 GLN A HE22 3  
ATOM 4693  N N    . LEU A 1 108 ? -11.888 1.104   0.523   1.00 0.00 ? 111 LEU A N    3  
ATOM 4694  C CA   . LEU A 1 108 ? -10.625 1.815   0.342   1.00 0.00 ? 111 LEU A CA   3  
ATOM 4695  C C    . LEU A 1 108 ? -10.169 2.496   1.629   1.00 0.00 ? 111 LEU A C    3  
ATOM 4696  O O    . LEU A 1 108 ? -10.789 3.454   2.095   1.00 0.00 ? 111 LEU A O    3  
ATOM 4697  C CB   . LEU A 1 108 ? -10.765 2.858   -0.775  1.00 0.00 ? 111 LEU A CB   3  
ATOM 4698  C CG   . LEU A 1 108 ? -9.526  3.732   -1.032  1.00 0.00 ? 111 LEU A CG   3  
ATOM 4699  C CD1  . LEU A 1 108 ? -8.362  2.904   -1.558  1.00 0.00 ? 111 LEU A CD1  3  
ATOM 4700  C CD2  . LEU A 1 108 ? -9.858  4.854   -2.003  1.00 0.00 ? 111 LEU A CD2  3  
ATOM 4701  H H    . LEU A 1 108 ? -12.646 1.333   -0.064  1.00 0.00 ? 111 LEU A H    3  
ATOM 4702  H HA   . LEU A 1 108 ? -9.883  1.089   0.051   1.00 0.00 ? 111 LEU A HA   3  
ATOM 4703  H HB2  . LEU A 1 108 ? -11.012 2.342   -1.692  1.00 0.00 ? 111 LEU A HB2  3  
ATOM 4704  H HB3  . LEU A 1 108 ? -11.588 3.509   -0.521  1.00 0.00 ? 111 LEU A HB3  3  
ATOM 4705  H HG   . LEU A 1 108 ? -9.216  4.182   -0.099  1.00 0.00 ? 111 LEU A HG   3  
ATOM 4706  H HD11 . LEU A 1 108 ? -8.056  2.192   -0.805  1.00 0.00 ? 111 LEU A HD11 3  
ATOM 4707  H HD12 . LEU A 1 108 ? -8.665  2.380   -2.451  1.00 0.00 ? 111 LEU A HD12 3  
ATOM 4708  H HD13 . LEU A 1 108 ? -7.534  3.558   -1.789  1.00 0.00 ? 111 LEU A HD13 3  
ATOM 4709  H HD21 . LEU A 1 108 ? -10.165 4.433   -2.949  1.00 0.00 ? 111 LEU A HD21 3  
ATOM 4710  H HD22 . LEU A 1 108 ? -10.661 5.453   -1.597  1.00 0.00 ? 111 LEU A HD22 3  
ATOM 4711  H HD23 . LEU A 1 108 ? -8.986  5.473   -2.149  1.00 0.00 ? 111 LEU A HD23 3  
ATOM 4712  N N    . GLY A 1 109 ? -9.078  1.994   2.190   1.00 0.00 ? 112 GLY A N    3  
ATOM 4713  C CA   . GLY A 1 109 ? -8.523  2.575   3.394   1.00 0.00 ? 112 GLY A CA   3  
ATOM 4714  C C    . GLY A 1 109 ? -8.656  1.666   4.595   1.00 0.00 ? 112 GLY A C    3  
ATOM 4715  O O    . GLY A 1 109 ? -8.040  1.907   5.634   1.00 0.00 ? 112 GLY A O    3  
ATOM 4716  H H    . GLY A 1 109 ? -8.642  1.218   1.778   1.00 0.00 ? 112 GLY A H    3  
ATOM 4717  H HA2  . GLY A 1 109 ? -7.474  2.780   3.230   1.00 0.00 ? 112 GLY A HA2  3  
ATOM 4718  H HA3  . GLY A 1 109 ? -9.034  3.504   3.602   1.00 0.00 ? 112 GLY A HA3  3  
ATOM 4719  N N    . SER A 1 110 ? -9.456  0.618   4.464   1.00 0.00 ? 113 SER A N    3  
ATOM 4720  C CA   . SER A 1 110 ? -9.673  -0.303  5.563   1.00 0.00 ? 113 SER A CA   3  
ATOM 4721  C C    . SER A 1 110 ? -8.986  -1.641  5.290   1.00 0.00 ? 113 SER A C    3  
ATOM 4722  O O    . SER A 1 110 ? -9.250  -2.293  4.277   1.00 0.00 ? 113 SER A O    3  
ATOM 4723  C CB   . SER A 1 110 ? -11.172 -0.511  5.790   1.00 0.00 ? 113 SER A CB   3  
ATOM 4724  O OG   . SER A 1 110 ? -11.419 -1.049  7.076   1.00 0.00 ? 113 SER A OG   3  
ATOM 4725  H H    . SER A 1 110 ? -9.913  0.459   3.606   1.00 0.00 ? 113 SER A H    3  
ATOM 4726  H HA   . SER A 1 110 ? -9.241  0.136   6.450   1.00 0.00 ? 113 SER A HA   3  
ATOM 4727  H HB2  . SER A 1 110 ? -11.684 0.435   5.701   1.00 0.00 ? 113 SER A HB2  3  
ATOM 4728  H HB3  . SER A 1 110 ? -11.552 -1.197  5.047   1.00 0.00 ? 113 SER A HB3  3  
ATOM 4729  H HG   . SER A 1 110 ? -12.333 -1.373  7.118   1.00 0.00 ? 113 SER A HG   3  
ATOM 4730  N N    . PHE A 1 111 ? -8.109  -2.037  6.200   1.00 0.00 ? 114 PHE A N    3  
ATOM 4731  C CA   . PHE A 1 111 ? -7.353  -3.281  6.074   1.00 0.00 ? 114 PHE A CA   3  
ATOM 4732  C C    . PHE A 1 111 ? -7.906  -4.334  7.032   1.00 0.00 ? 114 PHE A C    3  
ATOM 4733  O O    . PHE A 1 111 ? -7.150  -5.037  7.704   1.00 0.00 ? 114 PHE A O    3  
ATOM 4734  C CB   . PHE A 1 111 ? -5.866  -3.036  6.376   1.00 0.00 ? 114 PHE A CB   3  
ATOM 4735  C CG   . PHE A 1 111 ? -5.145  -2.203  5.349   1.00 0.00 ? 114 PHE A CG   3  
ATOM 4736  C CD1  . PHE A 1 111 ? -5.175  -0.818  5.412   1.00 0.00 ? 114 PHE A CD1  3  
ATOM 4737  C CD2  . PHE A 1 111 ? -4.420  -2.805  4.332   1.00 0.00 ? 114 PHE A CD2  3  
ATOM 4738  C CE1  . PHE A 1 111 ? -4.502  -0.052  4.481   1.00 0.00 ? 114 PHE A CE1  3  
ATOM 4739  C CE2  . PHE A 1 111 ? -3.743  -2.043  3.399   1.00 0.00 ? 114 PHE A CE2  3  
ATOM 4740  C CZ   . PHE A 1 111 ? -3.784  -0.665  3.474   1.00 0.00 ? 114 PHE A CZ   3  
ATOM 4741  H H    . PHE A 1 111 ? -7.971  -1.481  7.000   1.00 0.00 ? 114 PHE A H    3  
ATOM 4742  H HA   . PHE A 1 111 ? -7.458  -3.639  5.059   1.00 0.00 ? 114 PHE A HA   3  
ATOM 4743  H HB2  . PHE A 1 111 ? -5.781  -2.526  7.322   1.00 0.00 ? 114 PHE A HB2  3  
ATOM 4744  H HB3  . PHE A 1 111 ? -5.362  -3.991  6.446   1.00 0.00 ? 114 PHE A HB3  3  
ATOM 4745  H HD1  . PHE A 1 111 ? -5.736  -0.335  6.198   1.00 0.00 ? 114 PHE A HD1  3  
ATOM 4746  H HD2  . PHE A 1 111 ? -4.388  -3.882  4.270   1.00 0.00 ? 114 PHE A HD2  3  
ATOM 4747  H HE1  . PHE A 1 111 ? -4.537  1.027   4.541   1.00 0.00 ? 114 PHE A HE1  3  
ATOM 4748  H HE2  . PHE A 1 111 ? -3.181  -2.523  2.612   1.00 0.00 ? 114 PHE A HE2  3  
ATOM 4749  H HZ   . PHE A 1 111 ? -3.255  -0.068  2.745   1.00 0.00 ? 114 PHE A HZ   3  
ATOM 4750  N N    . SER A 1 112 ? -9.226  -4.425  7.102   1.00 0.00 ? 115 SER A N    3  
ATOM 4751  C CA   . SER A 1 112 ? -9.880  -5.360  8.010   1.00 0.00 ? 115 SER A CA   3  
ATOM 4752  C C    . SER A 1 112 ? -9.644  -6.813  7.601   1.00 0.00 ? 115 SER A C    3  
ATOM 4753  O O    . SER A 1 112 ? -9.186  -7.624  8.409   1.00 0.00 ? 115 SER A O    3  
ATOM 4754  C CB   . SER A 1 112 ? -11.383 -5.074  8.070   1.00 0.00 ? 115 SER A CB   3  
ATOM 4755  O OG   . SER A 1 112 ? -11.642 -3.772  8.572   1.00 0.00 ? 115 SER A OG   3  
ATOM 4756  H H    . SER A 1 112 ? -9.776  -3.844  6.537   1.00 0.00 ? 115 SER A H    3  
ATOM 4757  H HA   . SER A 1 112 ? -9.459  -5.205  8.993   1.00 0.00 ? 115 SER A HA   3  
ATOM 4758  H HB2  . SER A 1 112 ? -11.802 -5.154  7.079   1.00 0.00 ? 115 SER A HB2  3  
ATOM 4759  H HB3  . SER A 1 112 ? -11.856 -5.796  8.719   1.00 0.00 ? 115 SER A HB3  3  
ATOM 4760  H HG   . SER A 1 112 ? -11.844 -3.832  9.521   1.00 0.00 ? 115 SER A HG   3  
ATOM 4761  N N    . ASN A 1 113 ? -9.954  -7.138  6.351   1.00 0.00 ? 116 ASN A N    3  
ATOM 4762  C CA   . ASN A 1 113 ? -9.853  -8.509  5.865   1.00 0.00 ? 116 ASN A CA   3  
ATOM 4763  C C    . ASN A 1 113 ? -8.811  -8.622  4.762   1.00 0.00 ? 116 ASN A C    3  
ATOM 4764  O O    . ASN A 1 113 ? -9.142  -8.619  3.573   1.00 0.00 ? 116 ASN A O    3  
ATOM 4765  C CB   . ASN A 1 113 ? -11.210 -8.996  5.348   1.00 0.00 ? 116 ASN A CB   3  
ATOM 4766  C CG   . ASN A 1 113 ? -12.166 -9.393  6.458   1.00 0.00 ? 116 ASN A CG   3  
ATOM 4767  O OD1  . ASN A 1 113 ? -12.060 -8.927  7.592   1.00 0.00 ? 116 ASN A OD1  3  
ATOM 4768  N ND2  . ASN A 1 113 ? -13.128 -10.239 6.128   1.00 0.00 ? 116 ASN A ND2  3  
ATOM 4769  H H    . ASN A 1 113 ? -10.256 -6.437  5.736   1.00 0.00 ? 116 ASN A H    3  
ATOM 4770  H HA   . ASN A 1 113 ? -9.551  -9.130  6.694   1.00 0.00 ? 116 ASN A HA   3  
ATOM 4771  H HB2  . ASN A 1 113 ? -11.668 -8.208  4.772   1.00 0.00 ? 116 ASN A HB2  3  
ATOM 4772  H HB3  . ASN A 1 113 ? -11.055 -9.855  4.710   1.00 0.00 ? 116 ASN A HB3  3  
ATOM 4773  H HD21 . ASN A 1 113 ? -13.172 -10.555 5.195   1.00 0.00 ? 116 ASN A HD21 3  
ATOM 4774  H HD22 . ASN A 1 113 ? -13.761 -10.520 6.826   1.00 0.00 ? 116 ASN A HD22 3  
ATOM 4775  N N    . CYS A 1 114 ? -7.551  -8.704  5.158   1.00 0.00 ? 117 CYS A N    3  
ATOM 4776  C CA   . CYS A 1 114 ? -6.462  -8.860  4.206   1.00 0.00 ? 117 CYS A CA   3  
ATOM 4777  C C    . CYS A 1 114 ? -5.966  -10.306 4.210   1.00 0.00 ? 117 CYS A C    3  
ATOM 4778  O O    . CYS A 1 114 ? -5.644  -10.860 5.263   1.00 0.00 ? 117 CYS A O    3  
ATOM 4779  C CB   . CYS A 1 114 ? -5.303  -7.915  4.541   1.00 0.00 ? 117 CYS A CB   3  
ATOM 4780  S SG   . CYS A 1 114 ? -5.772  -6.167  4.810   1.00 0.00 ? 117 CYS A SG   3  
ATOM 4781  H H    . CYS A 1 114 ? -7.347  -8.658  6.114   1.00 0.00 ? 117 CYS A H    3  
ATOM 4782  H HA   . CYS A 1 114 ? -6.844  -8.624  3.224   1.00 0.00 ? 117 CYS A HA   3  
ATOM 4783  H HB2  . CYS A 1 114 ? -4.821  -8.262  5.442   1.00 0.00 ? 117 CYS A HB2  3  
ATOM 4784  H HB3  . CYS A 1 114 ? -4.589  -7.939  3.728   1.00 0.00 ? 117 CYS A HB3  3  
ATOM 4785  N N    . SER A 1 115 ? -5.911  -10.915 3.035   1.00 0.00 ? 118 SER A N    3  
ATOM 4786  C CA   . SER A 1 115 ? -5.470  -12.296 2.903   1.00 0.00 ? 118 SER A CA   3  
ATOM 4787  C C    . SER A 1 115 ? -4.128  -12.364 2.183   1.00 0.00 ? 118 SER A C    3  
ATOM 4788  O O    . SER A 1 115 ? -3.830  -11.525 1.329   1.00 0.00 ? 118 SER A O    3  
ATOM 4789  C CB   . SER A 1 115 ? -6.531  -13.104 2.149   1.00 0.00 ? 118 SER A CB   3  
ATOM 4790  O OG   . SER A 1 115 ? -6.953  -12.431 0.970   1.00 0.00 ? 118 SER A OG   3  
ATOM 4791  H H    . SER A 1 115 ? -6.166  -10.418 2.227   1.00 0.00 ? 118 SER A H    3  
ATOM 4792  H HA   . SER A 1 115 ? -5.356  -12.704 3.895   1.00 0.00 ? 118 SER A HA   3  
ATOM 4793  H HB2  . SER A 1 115 ? -6.119  -14.064 1.870   1.00 0.00 ? 118 SER A HB2  3  
ATOM 4794  H HB3  . SER A 1 115 ? -7.388  -13.254 2.789   1.00 0.00 ? 118 SER A HB3  3  
ATOM 4795  H HG   . SER A 1 115 ? -6.291  -11.777 0.717   1.00 0.00 ? 118 SER A HG   3  
ATOM 4796  N N    . HIS A 1 116 ? -3.315  -13.350 2.547   1.00 0.00 ? 119 HIS A N    3  
ATOM 4797  C CA   . HIS A 1 116 ? -2.012  -13.533 1.922   1.00 0.00 ? 119 HIS A CA   3  
ATOM 4798  C C    . HIS A 1 116 ? -2.191  -13.983 0.478   1.00 0.00 ? 119 HIS A C    3  
ATOM 4799  O O    . HIS A 1 116 ? -2.842  -14.994 0.215   1.00 0.00 ? 119 HIS A O    3  
ATOM 4800  C CB   . HIS A 1 116 ? -1.167  -14.550 2.701   1.00 0.00 ? 119 HIS A CB   3  
ATOM 4801  C CG   . HIS A 1 116 ? 0.261   -14.623 2.244   1.00 0.00 ? 119 HIS A CG   3  
ATOM 4802  N ND1  . HIS A 1 116 ? 0.892   -15.803 1.909   1.00 0.00 ? 119 HIS A ND1  3  
ATOM 4803  C CD2  . HIS A 1 116 ? 1.187   -13.648 2.084   1.00 0.00 ? 119 HIS A CD2  3  
ATOM 4804  C CE1  . HIS A 1 116 ? 2.140   -15.550 1.562   1.00 0.00 ? 119 HIS A CE1  3  
ATOM 4805  N NE2  . HIS A 1 116 ? 2.345   -14.251 1.657   1.00 0.00 ? 119 HIS A NE2  3  
ATOM 4806  H H    . HIS A 1 116 ? -3.607  -13.977 3.249   1.00 0.00 ? 119 HIS A H    3  
ATOM 4807  H HA   . HIS A 1 116 ? -1.508  -12.581 1.926   1.00 0.00 ? 119 HIS A HA   3  
ATOM 4808  H HB2  . HIS A 1 116 ? -1.167  -14.284 3.747   1.00 0.00 ? 119 HIS A HB2  3  
ATOM 4809  H HB3  . HIS A 1 116 ? -1.602  -15.532 2.585   1.00 0.00 ? 119 HIS A HB3  3  
ATOM 4810  H HD1  . HIS A 1 116 ? 0.487   -16.702 1.936   1.00 0.00 ? 119 HIS A HD1  3  
ATOM 4811  H HD2  . HIS A 1 116 ? 1.043   -12.592 2.264   1.00 0.00 ? 119 HIS A HD2  3  
ATOM 4812  H HE1  . HIS A 1 116 ? 2.870   -16.282 1.252   1.00 0.00 ? 119 HIS A HE1  3  
ATOM 4813  N N    . SER A 1 117 ? -1.620  -13.223 -0.444  1.00 0.00 ? 120 SER A N    3  
ATOM 4814  C CA   . SER A 1 117 ? -1.790  -13.479 -1.861  1.00 0.00 ? 120 SER A CA   3  
ATOM 4815  C C    . SER A 1 117 ? -1.130  -14.794 -2.255  1.00 0.00 ? 120 SER A C    3  
ATOM 4816  O O    . SER A 1 117 ? 0.066   -14.985 -2.054  1.00 0.00 ? 120 SER A O    3  
ATOM 4817  C CB   . SER A 1 117 ? -1.190  -12.328 -2.664  1.00 0.00 ? 120 SER A CB   3  
ATOM 4818  O OG   . SER A 1 117 ? -1.624  -11.081 -2.151  1.00 0.00 ? 120 SER A OG   3  
ATOM 4819  H H    . SER A 1 117 ? -1.063  -12.468 -0.166  1.00 0.00 ? 120 SER A H    3  
ATOM 4820  H HA   . SER A 1 117 ? -2.848  -13.541 -2.065  1.00 0.00 ? 120 SER A HA   3  
ATOM 4821  H HB2  . SER A 1 117 ? -0.112  -12.373 -2.608  1.00 0.00 ? 120 SER A HB2  3  
ATOM 4822  H HB3  . SER A 1 117 ? -1.503  -12.406 -3.696  1.00 0.00 ? 120 SER A HB3  3  
ATOM 4823  H HG   . SER A 1 117 ? -1.623  -10.426 -2.860  1.00 0.00 ? 120 SER A HG   3  
ATOM 4824  N N    . ARG A 1 118 ? -1.918  -15.702 -2.801  1.00 0.00 ? 121 ARG A N    3  
ATOM 4825  C CA   . ARG A 1 118 ? -1.398  -16.968 -3.278  1.00 0.00 ? 121 ARG A CA   3  
ATOM 4826  C C    . ARG A 1 118 ? -1.626  -17.053 -4.782  1.00 0.00 ? 121 ARG A C    3  
ATOM 4827  O O    . ARG A 1 118 ? -1.923  -18.112 -5.334  1.00 0.00 ? 121 ARG A O    3  
ATOM 4828  C CB   . ARG A 1 118 ? -2.085  -18.122 -2.544  1.00 0.00 ? 121 ARG A CB   3  
ATOM 4829  C CG   . ARG A 1 118 ? -1.318  -19.437 -2.584  1.00 0.00 ? 121 ARG A CG   3  
ATOM 4830  C CD   . ARG A 1 118 ? 0.069   -19.305 -1.967  1.00 0.00 ? 121 ARG A CD   3  
ATOM 4831  N NE   . ARG A 1 118 ? 1.091   -18.991 -2.965  1.00 0.00 ? 121 ARG A NE   3  
ATOM 4832  C CZ   . ARG A 1 118 ? 2.188   -18.283 -2.714  1.00 0.00 ? 121 ARG A CZ   3  
ATOM 4833  N NH1  . ARG A 1 118 ? 2.369   -17.741 -1.517  1.00 0.00 ? 121 ARG A NH1  3  
ATOM 4834  N NH2  . ARG A 1 118 ? 3.096   -18.103 -3.661  1.00 0.00 ? 121 ARG A NH2  3  
ATOM 4835  H H    . ARG A 1 118 ? -2.878  -15.517 -2.887  1.00 0.00 ? 121 ARG A H    3  
ATOM 4836  H HA   . ARG A 1 118 ? -0.338  -16.998 -3.078  1.00 0.00 ? 121 ARG A HA   3  
ATOM 4837  H HB2  . ARG A 1 118 ? -2.215  -17.843 -1.510  1.00 0.00 ? 121 ARG A HB2  3  
ATOM 4838  H HB3  . ARG A 1 118 ? -3.057  -18.285 -2.987  1.00 0.00 ? 121 ARG A HB3  3  
ATOM 4839  H HG2  . ARG A 1 118 ? -1.873  -20.184 -2.039  1.00 0.00 ? 121 ARG A HG2  3  
ATOM 4840  H HG3  . ARG A 1 118 ? -1.213  -19.748 -3.614  1.00 0.00 ? 121 ARG A HG3  3  
ATOM 4841  H HD2  . ARG A 1 118 ? 0.048   -18.516 -1.232  1.00 0.00 ? 121 ARG A HD2  3  
ATOM 4842  H HD3  . ARG A 1 118 ? 0.326   -20.237 -1.485  1.00 0.00 ? 121 ARG A HD3  3  
ATOM 4843  H HE   . ARG A 1 118 ? 0.960   -19.362 -3.869  1.00 0.00 ? 121 ARG A HE   3  
ATOM 4844  H HH12 . ARG A 1 118 ? 2.350   -16.733 -1.414  1.00 0.00 ? 121 ARG A HH12 3  
ATOM 4845  H HH21 . ARG A 1 118 ? 2.956   -18.496 -4.582  1.00 0.00 ? 121 ARG A HH21 3  
ATOM 4846  H HH22 . ARG A 1 118 ? 3.931   -17.581 -3.469  1.00 0.00 ? 121 ARG A HH22 3  
ATOM 4847  N N    . ASN A 1 119 ? -1.490  -15.906 -5.433  1.00 0.00 ? 122 ASN A N    3  
ATOM 4848  C CA   . ASN A 1 119 ? -1.756  -15.781 -6.858  1.00 0.00 ? 122 ASN A CA   3  
ATOM 4849  C C    . ASN A 1 119 ? -0.544  -15.173 -7.547  1.00 0.00 ? 122 ASN A C    3  
ATOM 4850  O O    . ASN A 1 119 ? 0.066   -14.244 -7.021  1.00 0.00 ? 122 ASN A O    3  
ATOM 4851  C CB   . ASN A 1 119 ? -2.987  -14.900 -7.101  1.00 0.00 ? 122 ASN A CB   3  
ATOM 4852  C CG   . ASN A 1 119 ? -4.211  -15.371 -6.338  1.00 0.00 ? 122 ASN A CG   3  
ATOM 4853  O OD1  . ASN A 1 119 ? -4.433  -14.972 -5.195  1.00 0.00 ? 122 ASN A OD1  3  
ATOM 4854  N ND2  . ASN A 1 119 ? -5.007  -16.226 -6.959  1.00 0.00 ? 122 ASN A ND2  3  
ATOM 4855  H H    . ASN A 1 119 ? -1.182  -15.117 -4.941  1.00 0.00 ? 122 ASN A H    3  
ATOM 4856  H HA   . ASN A 1 119 ? -1.938  -16.767 -7.255  1.00 0.00 ? 122 ASN A HA   3  
ATOM 4857  H HB2  . ASN A 1 119 ? -2.764  -13.889 -6.795  1.00 0.00 ? 122 ASN A HB2  3  
ATOM 4858  H HB3  . ASN A 1 119 ? -3.220  -14.905 -8.156  1.00 0.00 ? 122 ASN A HB3  3  
ATOM 4859  H HD21 . ASN A 1 119 ? -4.765  -16.511 -7.870  1.00 0.00 ? 122 ASN A HD21 3  
ATOM 4860  H HD22 . ASN A 1 119 ? -5.812  -16.537 -6.488  1.00 0.00 ? 122 ASN A HD22 3  
ATOM 4861  N N    . ASP A 1 120 ? -0.210  -15.677 -8.726  1.00 0.00 ? 123 ASP A N    3  
ATOM 4862  C CA   . ASP A 1 120 ? 1.000   -15.246 -9.426  1.00 0.00 ? 123 ASP A CA   3  
ATOM 4863  C C    . ASP A 1 120 ? 0.733   -14.023 -10.302 1.00 0.00 ? 123 ASP A C    3  
ATOM 4864  O O    . ASP A 1 120 ? 1.461   -13.766 -11.261 1.00 0.00 ? 123 ASP A O    3  
ATOM 4865  C CB   . ASP A 1 120 ? 1.561   -16.380 -10.291 1.00 0.00 ? 123 ASP A CB   3  
ATOM 4866  C CG   . ASP A 1 120 ? 1.868   -17.635 -9.499  1.00 0.00 ? 123 ASP A CG   3  
ATOM 4867  O OD1  . ASP A 1 120 ? 2.962   -17.723 -8.905  1.00 0.00 ? 123 ASP A OD1  3  
ATOM 4868  O OD2  . ASP A 1 120 ? 1.015   -18.553 -9.481  1.00 0.00 ? 123 ASP A OD2  3  
ATOM 4869  H H    . ASP A 1 120 ? -0.788  -16.354 -9.143  1.00 0.00 ? 123 ASP A H    3  
ATOM 4870  H HA   . ASP A 1 120 ? 1.732   -14.981 -8.677  1.00 0.00 ? 123 ASP A HA   3  
ATOM 4871  H HB2  . ASP A 1 120 ? 0.841   -16.629 -11.056 1.00 0.00 ? 123 ASP A HB2  3  
ATOM 4872  H HB3  . ASP A 1 120 ? 2.475   -16.044 -10.762 1.00 0.00 ? 123 ASP A HB3  3  
ATOM 4873  N N    . MET A 1 121 ? -0.319  -13.279 -9.985  1.00 0.00 ? 124 MET A N    3  
ATOM 4874  C CA   . MET A 1 121 ? -0.642  -12.058 -10.713 1.00 0.00 ? 124 MET A CA   3  
ATOM 4875  C C    . MET A 1 121 ? -0.933  -10.909 -9.759  1.00 0.00 ? 124 MET A C    3  
ATOM 4876  O O    . MET A 1 121 ? -1.699  -10.001 -10.086 1.00 0.00 ? 124 MET A O    3  
ATOM 4877  C CB   . MET A 1 121 ? -1.850  -12.261 -11.631 1.00 0.00 ? 124 MET A CB   3  
ATOM 4878  C CG   . MET A 1 121 ? -1.573  -13.120 -12.851 1.00 0.00 ? 124 MET A CG   3  
ATOM 4879  S SD   . MET A 1 121 ? -2.979  -13.182 -13.979 1.00 0.00 ? 124 MET A SD   3  
ATOM 4880  C CE   . MET A 1 121 ? -3.148  -11.451 -14.409 1.00 0.00 ? 124 MET A CE   3  
ATOM 4881  H H    . MET A 1 121 ? -0.897  -13.565 -9.249  1.00 0.00 ? 124 MET A H    3  
ATOM 4882  H HA   . MET A 1 121 ? 0.214   -11.798 -11.315 1.00 0.00 ? 124 MET A HA   3  
ATOM 4883  H HB2  . MET A 1 121 ? -2.638  -12.731 -11.063 1.00 0.00 ? 124 MET A HB2  3  
ATOM 4884  H HB3  . MET A 1 121 ? -2.194  -11.296 -11.970 1.00 0.00 ? 124 MET A HB3  3  
ATOM 4885  H HG2  . MET A 1 121 ? -0.723  -12.712 -13.377 1.00 0.00 ? 124 MET A HG2  3  
ATOM 4886  H HG3  . MET A 1 121 ? -1.345  -14.124 -12.525 1.00 0.00 ? 124 MET A HG3  3  
ATOM 4887  H HE1  . MET A 1 121 ? -3.275  -10.868 -13.509 1.00 0.00 ? 124 MET A HE1  3  
ATOM 4888  H HE2  . MET A 1 121 ? -2.262  -11.120 -14.929 1.00 0.00 ? 124 MET A HE2  3  
ATOM 4889  H HE3  . MET A 1 121 ? -4.009  -11.320 -15.049 1.00 0.00 ? 124 MET A HE3  3  
ATOM 4890  N N    . CYS A 1 122 ? -0.324  -10.937 -8.587  1.00 0.00 ? 125 CYS A N    3  
ATOM 4891  C CA   . CYS A 1 122 ? -0.555  -9.882  -7.612  1.00 0.00 ? 125 CYS A CA   3  
ATOM 4892  C C    . CYS A 1 122 ? 0.330   -8.682  -7.923  1.00 0.00 ? 125 CYS A C    3  
ATOM 4893  O O    . CYS A 1 122 ? 1.554   -8.745  -7.796  1.00 0.00 ? 125 CYS A O    3  
ATOM 4894  C CB   . CYS A 1 122 ? -0.311  -10.372 -6.181  1.00 0.00 ? 125 CYS A CB   3  
ATOM 4895  S SG   . CYS A 1 122 ? -1.590  -9.823  -4.998  1.00 0.00 ? 125 CYS A SG   3  
ATOM 4896  H H    . CYS A 1 122 ? 0.296   -11.668 -8.379  1.00 0.00 ? 125 CYS A H    3  
ATOM 4897  H HA   . CYS A 1 122 ? -1.587  -9.577  -7.705  1.00 0.00 ? 125 CYS A HA   3  
ATOM 4898  H HB2  . CYS A 1 122 ? -0.296  -11.452 -6.169  1.00 0.00 ? 125 CYS A HB2  3  
ATOM 4899  H HB3  . CYS A 1 122 ? 0.640   -9.996  -5.837  1.00 0.00 ? 125 CYS A HB3  3  
ATOM 4900  N N    . HIS A 1 123 ? -0.295  -7.598  -8.362  1.00 0.00 ? 126 HIS A N    3  
ATOM 4901  C CA   . HIS A 1 123 ? 0.425   -6.371  -8.669  1.00 0.00 ? 126 HIS A CA   3  
ATOM 4902  C C    . HIS A 1 123 ? 0.617   -5.556  -7.400  1.00 0.00 ? 126 HIS A C    3  
ATOM 4903  O O    . HIS A 1 123 ? -0.321  -5.374  -6.627  1.00 0.00 ? 126 HIS A O    3  
ATOM 4904  C CB   . HIS A 1 123 ? -0.330  -5.544  -9.718  1.00 0.00 ? 126 HIS A CB   3  
ATOM 4905  C CG   . HIS A 1 123 ? -0.484  -6.243  -11.036 1.00 0.00 ? 126 HIS A CG   3  
ATOM 4906  N ND1  . HIS A 1 123 ? -1.689  -6.727  -11.496 1.00 0.00 ? 126 HIS A ND1  3  
ATOM 4907  C CD2  . HIS A 1 123 ? 0.429   -6.541  -11.990 1.00 0.00 ? 126 HIS A CD2  3  
ATOM 4908  C CE1  . HIS A 1 123 ? -1.512  -7.295  -12.675 1.00 0.00 ? 126 HIS A CE1  3  
ATOM 4909  N NE2  . HIS A 1 123 ? -0.235  -7.195  -12.996 1.00 0.00 ? 126 HIS A NE2  3  
ATOM 4910  H H    . HIS A 1 123 ? -1.268  -7.624  -8.477  1.00 0.00 ? 126 HIS A H    3  
ATOM 4911  H HA   . HIS A 1 123 ? 1.393   -6.644  -9.063  1.00 0.00 ? 126 HIS A HA   3  
ATOM 4912  H HB2  . HIS A 1 123 ? -1.319  -5.319  -9.344  1.00 0.00 ? 126 HIS A HB2  3  
ATOM 4913  H HB3  . HIS A 1 123 ? 0.202   -4.620  -9.892  1.00 0.00 ? 126 HIS A HB3  3  
ATOM 4914  H HD1  . HIS A 1 123 ? -2.552  -6.662  -11.027 1.00 0.00 ? 126 HIS A HD1  3  
ATOM 4915  H HD2  . HIS A 1 123 ? 1.484   -6.309  -11.963 1.00 0.00 ? 126 HIS A HD2  3  
ATOM 4916  H HE1  . HIS A 1 123 ? -2.283  -7.760  -13.274 1.00 0.00 ? 126 HIS A HE1  3  
ATOM 4917  N N    . SER A 1 124 ? 1.835   -5.082  -7.183  1.00 0.00 ? 127 SER A N    3  
ATOM 4918  C CA   . SER A 1 124 ? 2.166   -4.333  -5.981  1.00 0.00 ? 127 SER A CA   3  
ATOM 4919  C C    . SER A 1 124 ? 1.480   -2.968  -5.983  1.00 0.00 ? 127 SER A C    3  
ATOM 4920  O O    . SER A 1 124 ? 1.177   -2.412  -7.043  1.00 0.00 ? 127 SER A O    3  
ATOM 4921  C CB   . SER A 1 124 ? 3.680   -4.153  -5.894  1.00 0.00 ? 127 SER A CB   3  
ATOM 4922  O OG   . SER A 1 124 ? 4.348   -5.389  -6.099  1.00 0.00 ? 127 SER A OG   3  
ATOM 4923  H H    . SER A 1 124 ? 2.537   -5.238  -7.850  1.00 0.00 ? 127 SER A H    3  
ATOM 4924  H HA   . SER A 1 124 ? 1.825   -4.899  -5.127  1.00 0.00 ? 127 SER A HA   3  
ATOM 4925  H HB2  . SER A 1 124 ? 4.004   -3.453  -6.653  1.00 0.00 ? 127 SER A HB2  3  
ATOM 4926  H HB3  . SER A 1 124 ? 3.942   -3.772  -4.915  1.00 0.00 ? 127 SER A HB3  3  
ATOM 4927  H HG   . SER A 1 124 ? 5.132   -5.242  -6.643  1.00 0.00 ? 127 SER A HG   3  
ATOM 4928  N N    . LEU A 1 125 ? 1.204   -2.451  -4.795  1.00 0.00 ? 128 LEU A N    3  
ATOM 4929  C CA   . LEU A 1 125 ? 0.634   -1.123  -4.653  1.00 0.00 ? 128 LEU A CA   3  
ATOM 4930  C C    . LEU A 1 125 ? 1.751   -0.123  -4.384  1.00 0.00 ? 128 LEU A C    3  
ATOM 4931  O O    . LEU A 1 125 ? 2.483   -0.248  -3.401  1.00 0.00 ? 128 LEU A O    3  
ATOM 4932  C CB   . LEU A 1 125 ? -0.400  -1.105  -3.519  1.00 0.00 ? 128 LEU A CB   3  
ATOM 4933  C CG   . LEU A 1 125 ? -1.283  0.144   -3.438  1.00 0.00 ? 128 LEU A CG   3  
ATOM 4934  C CD1  . LEU A 1 125 ? -2.625  -0.199  -2.810  1.00 0.00 ? 128 LEU A CD1  3  
ATOM 4935  C CD2  . LEU A 1 125 ? -0.596  1.236   -2.634  1.00 0.00 ? 128 LEU A CD2  3  
ATOM 4936  H H    . LEU A 1 125 ? 1.385   -2.981  -3.986  1.00 0.00 ? 128 LEU A H    3  
ATOM 4937  H HA   . LEU A 1 125 ? 0.146   -0.866  -5.582  1.00 0.00 ? 128 LEU A HA   3  
ATOM 4938  H HB2  . LEU A 1 125 ? -1.043  -1.966  -3.633  1.00 0.00 ? 128 LEU A HB2  3  
ATOM 4939  H HB3  . LEU A 1 125 ? 0.130   -1.199  -2.583  1.00 0.00 ? 128 LEU A HB3  3  
ATOM 4940  H HG   . LEU A 1 125 ? -1.463  0.520   -4.435  1.00 0.00 ? 128 LEU A HG   3  
ATOM 4941  H HD11 . LEU A 1 125 ? -3.125  -0.942  -3.414  1.00 0.00 ? 128 LEU A HD11 3  
ATOM 4942  H HD12 . LEU A 1 125 ? -2.467  -0.590  -1.815  1.00 0.00 ? 128 LEU A HD12 3  
ATOM 4943  H HD13 . LEU A 1 125 ? -3.235  0.691   -2.755  1.00 0.00 ? 128 LEU A HD13 3  
ATOM 4944  H HD21 . LEU A 1 125 ? -1.243  2.098   -2.572  1.00 0.00 ? 128 LEU A HD21 3  
ATOM 4945  H HD22 . LEU A 1 125 ? -0.383  0.874   -1.639  1.00 0.00 ? 128 LEU A HD22 3  
ATOM 4946  H HD23 . LEU A 1 125 ? 0.329   1.513   -3.121  1.00 0.00 ? 128 LEU A HD23 3  
ATOM 4947  N N    . GLY A 1 126 ? 1.876   0.856   -5.261  1.00 0.00 ? 129 GLY A N    3  
ATOM 4948  C CA   . GLY A 1 126 ? 2.937   1.829   -5.143  1.00 0.00 ? 129 GLY A CA   3  
ATOM 4949  C C    . GLY A 1 126 ? 2.426   3.187   -4.735  1.00 0.00 ? 129 GLY A C    3  
ATOM 4950  O O    . GLY A 1 126 ? 1.377   3.636   -5.206  1.00 0.00 ? 129 GLY A O    3  
ATOM 4951  H H    . GLY A 1 126 ? 1.226   0.929   -5.998  1.00 0.00 ? 129 GLY A H    3  
ATOM 4952  H HA2  . GLY A 1 126 ? 3.647   1.485   -4.409  1.00 0.00 ? 129 GLY A HA2  3  
ATOM 4953  H HA3  . GLY A 1 126 ? 3.434   1.921   -6.099  1.00 0.00 ? 129 GLY A HA3  3  
ATOM 4954  N N    . LEU A 1 127 ? 3.164   3.834   -3.854  1.00 0.00 ? 130 LEU A N    3  
ATOM 4955  C CA   . LEU A 1 127 ? 2.828   5.171   -3.411  1.00 0.00 ? 130 LEU A CA   3  
ATOM 4956  C C    . LEU A 1 127 ? 3.998   6.110   -3.673  1.00 0.00 ? 130 LEU A C    3  
ATOM 4957  O O    . LEU A 1 127 ? 5.113   5.871   -3.204  1.00 0.00 ? 130 LEU A O    3  
ATOM 4958  C CB   . LEU A 1 127 ? 2.473   5.162   -1.920  1.00 0.00 ? 130 LEU A CB   3  
ATOM 4959  C CG   . LEU A 1 127 ? 2.168   6.530   -1.300  1.00 0.00 ? 130 LEU A CG   3  
ATOM 4960  C CD1  . LEU A 1 127 ? 0.981   7.193   -1.983  1.00 0.00 ? 130 LEU A CD1  3  
ATOM 4961  C CD2  . LEU A 1 127 ? 1.912   6.385   0.194   1.00 0.00 ? 130 LEU A CD2  3  
ATOM 4962  H H    . LEU A 1 127 ? 3.965   3.398   -3.487  1.00 0.00 ? 130 LEU A H    3  
ATOM 4963  H HA   . LEU A 1 127 ? 1.969   5.505   -3.980  1.00 0.00 ? 130 LEU A HA   3  
ATOM 4964  H HB2  . LEU A 1 127 ? 1.605   4.528   -1.784  1.00 0.00 ? 130 LEU A HB2  3  
ATOM 4965  H HB3  . LEU A 1 127 ? 3.303   4.727   -1.382  1.00 0.00 ? 130 LEU A HB3  3  
ATOM 4966  H HG   . LEU A 1 127 ? 3.027   7.173   -1.430  1.00 0.00 ? 130 LEU A HG   3  
ATOM 4967  H HD11 . LEU A 1 127 ? 0.122   6.538   -1.934  1.00 0.00 ? 130 LEU A HD11 3  
ATOM 4968  H HD12 . LEU A 1 127 ? 0.751   8.124   -1.487  1.00 0.00 ? 130 LEU A HD12 3  
ATOM 4969  H HD13 . LEU A 1 127 ? 1.223   7.388   -3.017  1.00 0.00 ? 130 LEU A HD13 3  
ATOM 4970  H HD21 . LEU A 1 127 ? 2.790   5.982   0.673   1.00 0.00 ? 130 LEU A HD21 3  
ATOM 4971  H HD22 . LEU A 1 127 ? 1.684   7.353   0.616   1.00 0.00 ? 130 LEU A HD22 3  
ATOM 4972  H HD23 . LEU A 1 127 ? 1.077   5.718   0.352   1.00 0.00 ? 130 LEU A HD23 3  
ATOM 4973  N N    . THR A 1 128 ? 3.748   7.151   -4.449  1.00 0.00 ? 131 THR A N    3  
ATOM 4974  C CA   . THR A 1 128 ? 4.761   8.148   -4.735  1.00 0.00 ? 131 THR A CA   3  
ATOM 4975  C C    . THR A 1 128 ? 4.502   9.409   -3.925  1.00 0.00 ? 131 THR A C    3  
ATOM 4976  O O    . THR A 1 128 ? 3.586   10.172  -4.226  1.00 0.00 ? 131 THR A O    3  
ATOM 4977  C CB   . THR A 1 128 ? 4.796   8.514   -6.235  1.00 0.00 ? 131 THR A CB   3  
ATOM 4978  O OG1  . THR A 1 128 ? 5.063   7.346   -7.026  1.00 0.00 ? 131 THR A OG1  3  
ATOM 4979  C CG2  . THR A 1 128 ? 5.856   9.571   -6.513  1.00 0.00 ? 131 THR A CG2  3  
ATOM 4980  H H    . THR A 1 128 ? 2.849   7.258   -4.832  1.00 0.00 ? 131 THR A H    3  
ATOM 4981  H HA   . THR A 1 128 ? 5.722   7.740   -4.457  1.00 0.00 ? 131 THR A HA   3  
ATOM 4982  H HB   . THR A 1 128 ? 3.833   8.917   -6.513  1.00 0.00 ? 131 THR A HB   3  
ATOM 4983  H HG1  . THR A 1 128 ? 5.987   7.364   -7.316  1.00 0.00 ? 131 THR A HG1  3  
ATOM 4984  H HG21 . THR A 1 128 ? 5.852   9.819   -7.565  1.00 0.00 ? 131 THR A HG21 3  
ATOM 4985  H HG22 . THR A 1 128 ? 6.828   9.188   -6.238  1.00 0.00 ? 131 THR A HG22 3  
ATOM 4986  H HG23 . THR A 1 128 ? 5.643   10.458  -5.933  1.00 0.00 ? 131 THR A HG23 3  
ATOM 4987  N N    . CYS A 1 129 ? 5.292   9.609   -2.893  1.00 0.00 ? 132 CYS A N    3  
ATOM 4988  C CA   . CYS A 1 129 ? 5.221   10.822  -2.101  1.00 0.00 ? 132 CYS A CA   3  
ATOM 4989  C C    . CYS A 1 129 ? 6.324   11.777  -2.545  1.00 0.00 ? 132 CYS A C    3  
ATOM 4990  O O    . CYS A 1 129 ? 7.447   11.353  -2.816  1.00 0.00 ? 132 CYS A O    3  
ATOM 4991  C CB   . CYS A 1 129 ? 5.370   10.502  -0.608  1.00 0.00 ? 132 CYS A CB   3  
ATOM 4992  S SG   . CYS A 1 129 ? 4.339   9.111   -0.034  1.00 0.00 ? 132 CYS A SG   3  
ATOM 4993  H H    . CYS A 1 129 ? 5.952   8.918   -2.654  1.00 0.00 ? 132 CYS A H    3  
ATOM 4994  H HA   . CYS A 1 129 ? 4.261   11.285  -2.276  1.00 0.00 ? 132 CYS A HA   3  
ATOM 4995  H HB2  . CYS A 1 129 ? 6.400   10.254  -0.397  1.00 0.00 ? 132 CYS A HB2  3  
ATOM 4996  H HB3  . CYS A 1 129 ? 5.090   11.374  -0.030  1.00 0.00 ? 132 CYS A HB3  3  
ATOM 4997  N N    . LEU A 1 130 ? 5.991   13.052  -2.646  1.00 0.00 ? 133 LEU A N    3  
ATOM 4998  C CA   . LEU A 1 130 ? 6.959   14.069  -3.018  1.00 0.00 ? 133 LEU A CA   3  
ATOM 4999  C C    . LEU A 1 130 ? 7.957   14.227  -1.876  1.00 0.00 ? 133 LEU A C    3  
ATOM 5000  O O    . LEU A 1 130 ? 7.561   14.576  -0.771  1.00 0.00 ? 133 LEU A O    3  
ATOM 5001  C CB   . LEU A 1 130 ? 6.226   15.392  -3.294  1.00 0.00 ? 133 LEU A CB   3  
ATOM 5002  C CG   . LEU A 1 130 ? 6.994   16.447  -4.101  1.00 0.00 ? 133 LEU A CG   3  
ATOM 5003  C CD1  . LEU A 1 130 ? 6.028   17.487  -4.647  1.00 0.00 ? 133 LEU A CD1  3  
ATOM 5004  C CD2  . LEU A 1 130 ? 8.055   17.125  -3.248  1.00 0.00 ? 133 LEU A CD2  3  
ATOM 5005  H H    . LEU A 1 130 ? 5.063   13.324  -2.457  1.00 0.00 ? 133 LEU A H    3  
ATOM 5006  H HA   . LEU A 1 130 ? 7.473   13.745  -3.909  1.00 0.00 ? 133 LEU A HA   3  
ATOM 5007  H HB2  . LEU A 1 130 ? 5.315   15.162  -3.825  1.00 0.00 ? 133 LEU A HB2  3  
ATOM 5008  H HB3  . LEU A 1 130 ? 5.962   15.829  -2.342  1.00 0.00 ? 133 LEU A HB3  3  
ATOM 5009  H HG   . LEU A 1 130 ? 7.486   15.971  -4.939  1.00 0.00 ? 133 LEU A HG   3  
ATOM 5010  H HD11 . LEU A 1 130 ? 5.507   17.959  -3.828  1.00 0.00 ? 133 LEU A HD11 3  
ATOM 5011  H HD12 . LEU A 1 130 ? 6.577   18.233  -5.202  1.00 0.00 ? 133 LEU A HD12 3  
ATOM 5012  H HD13 . LEU A 1 130 ? 5.313   17.006  -5.299  1.00 0.00 ? 133 LEU A HD13 3  
ATOM 5013  H HD21 . LEU A 1 130 ? 8.598   17.841  -3.847  1.00 0.00 ? 133 LEU A HD21 3  
ATOM 5014  H HD22 . LEU A 1 130 ? 7.581   17.634  -2.421  1.00 0.00 ? 133 LEU A HD22 3  
ATOM 5015  H HD23 . LEU A 1 130 ? 8.739   16.381  -2.867  1.00 0.00 ? 133 LEU A HD23 3  
ATOM 5016  N N    . GLU A 1 131 ? 9.226   13.924  -2.139  1.00 0.00 ? 134 GLU A N    3  
ATOM 5017  C CA   . GLU A 1 131 ? 10.274  14.001  -1.113  1.00 0.00 ? 134 GLU A CA   3  
ATOM 5018  C C    . GLU A 1 131 ? 10.221  15.332  -0.366  1.00 0.00 ? 134 GLU A C    3  
ATOM 5019  O O    . GLU A 1 131 ? 10.567  16.369  -0.972  1.00 0.00 ? 134 GLU A O    3  
ATOM 5020  C CB   . GLU A 1 131 ? 11.673  13.831  -1.723  1.00 0.00 ? 134 GLU A CB   3  
ATOM 5021  C CG   . GLU A 1 131 ? 11.850  12.596  -2.596  1.00 0.00 ? 134 GLU A CG   3  
ATOM 5022  C CD   . GLU A 1 131 ? 11.291  12.786  -3.991  1.00 0.00 ? 134 GLU A CD   3  
ATOM 5023  O OE1  . GLU A 1 131 ? 11.923  13.500  -4.794  1.00 0.00 ? 134 GLU A OE1  3  
ATOM 5024  O OE2  . GLU A 1 131 ? 10.218  12.230  -4.289  1.00 0.00 ? 134 GLU A OE2  3  
ATOM 5025  O OXT  . GLU A 1 131 ? 9.848   15.332  0.824   1.00 0.00 ? 134 GLU A OXT  3  
ATOM 5026  H H    . GLU A 1 131 ? 9.464   13.618  -3.042  1.00 0.00 ? 134 GLU A H    3  
ATOM 5027  H HA   . GLU A 1 131 ? 10.100  13.203  -0.408  1.00 0.00 ? 134 GLU A HA   3  
ATOM 5028  H HB2  . GLU A 1 131 ? 11.891  14.699  -2.325  1.00 0.00 ? 134 GLU A HB2  3  
ATOM 5029  H HB3  . GLU A 1 131 ? 12.393  13.779  -0.919  1.00 0.00 ? 134 GLU A HB3  3  
ATOM 5030  H HG2  . GLU A 1 131 ? 12.905  12.379  -2.676  1.00 0.00 ? 134 GLU A HG2  3  
ATOM 5031  H HG3  . GLU A 1 131 ? 11.347  11.760  -2.131  1.00 0.00 ? 134 GLU A HG3  3  
ATOM 5032  N N    . ARG A 1 22  ? -10.904 -3.365  12.490  1.00 0.00 ? 25  ARG A N    4  
ATOM 5033  C CA   . ARG A 1 22  ? -10.660 -2.529  11.296  1.00 0.00 ? 25  ARG A CA   4  
ATOM 5034  C C    . ARG A 1 22  ? -9.499  -1.568  11.529  1.00 0.00 ? 25  ARG A C    4  
ATOM 5035  O O    . ARG A 1 22  ? -9.647  -0.560  12.219  1.00 0.00 ? 25  ARG A O    4  
ATOM 5036  C CB   . ARG A 1 22  ? -11.911 -1.726  10.941  1.00 0.00 ? 25  ARG A CB   4  
ATOM 5037  C CG   . ARG A 1 22  ? -11.758 -0.911  9.668   1.00 0.00 ? 25  ARG A CG   4  
ATOM 5038  C CD   . ARG A 1 22  ? -12.928 0.029   9.455   1.00 0.00 ? 25  ARG A CD   4  
ATOM 5039  N NE   . ARG A 1 22  ? -12.968 1.105   10.445  1.00 0.00 ? 25  ARG A NE   4  
ATOM 5040  C CZ   . ARG A 1 22  ? -13.992 1.939   10.577  1.00 0.00 ? 25  ARG A CZ   4  
ATOM 5041  N NH1  . ARG A 1 22  ? -15.091 1.751   9.864   1.00 0.00 ? 25  ARG A NH1  4  
ATOM 5042  N NH2  . ARG A 1 22  ? -13.939 2.935   11.440  1.00 0.00 ? 25  ARG A NH2  4  
ATOM 5043  H HA   . ARG A 1 22  ? -10.412 -3.181  10.470  1.00 0.00 ? 25  ARG A HA   4  
ATOM 5044  H HB2  . ARG A 1 22  ? -12.740 -2.407  10.812  1.00 0.00 ? 25  ARG A HB2  4  
ATOM 5045  H HB3  . ARG A 1 22  ? -12.135 -1.050  11.751  1.00 0.00 ? 25  ARG A HB3  4  
ATOM 5046  H HG2  . ARG A 1 22  ? -10.850 -0.329  9.731   1.00 0.00 ? 25  ARG A HG2  4  
ATOM 5047  H HG3  . ARG A 1 22  ? -11.696 -1.586  8.829   1.00 0.00 ? 25  ARG A HG3  4  
ATOM 5048  H HD2  . ARG A 1 22  ? -12.847 0.464   8.470   1.00 0.00 ? 25  ARG A HD2  4  
ATOM 5049  H HD3  . ARG A 1 22  ? -13.844 -0.539  9.521   1.00 0.00 ? 25  ARG A HD3  4  
ATOM 5050  H HE   . ARG A 1 22  ? -12.182 1.225   11.020  1.00 0.00 ? 25  ARG A HE   4  
ATOM 5051  H HH12 . ARG A 1 22  ? -15.278 2.340   9.057   1.00 0.00 ? 25  ARG A HH12 4  
ATOM 5052  H HH21 . ARG A 1 22  ? -13.116 3.073   12.007  1.00 0.00 ? 25  ARG A HH21 4  
ATOM 5053  H HH22 . ARG A 1 22  ? -14.717 3.573   11.522  1.00 0.00 ? 25  ARG A HH22 4  
ATOM 5054  N N    . LEU A 1 23  ? -8.348  -1.880  10.956  1.00 0.00 ? 26  LEU A N    4  
ATOM 5055  C CA   . LEU A 1 23  ? -7.215  -0.967  10.993  1.00 0.00 ? 26  LEU A CA   4  
ATOM 5056  C C    . LEU A 1 23  ? -7.314  0.004   9.829   1.00 0.00 ? 26  LEU A C    4  
ATOM 5057  O O    . LEU A 1 23  ? -7.731  -0.374  8.736   1.00 0.00 ? 26  LEU A O    4  
ATOM 5058  C CB   . LEU A 1 23  ? -5.880  -1.722  10.930  1.00 0.00 ? 26  LEU A CB   4  
ATOM 5059  C CG   . LEU A 1 23  ? -5.401  -2.335  12.249  1.00 0.00 ? 26  LEU A CG   4  
ATOM 5060  C CD1  . LEU A 1 23  ? -6.291  -3.487  12.676  1.00 0.00 ? 26  LEU A CD1  4  
ATOM 5061  C CD2  . LEU A 1 23  ? -3.958  -2.790  12.122  1.00 0.00 ? 26  LEU A CD2  4  
ATOM 5062  H H    . LEU A 1 23  ? -8.258  -2.737  10.490  1.00 0.00 ? 26  LEU A H    4  
ATOM 5063  H HA   . LEU A 1 23  ? -7.265  -0.412  11.918  1.00 0.00 ? 26  LEU A HA   4  
ATOM 5064  H HB2  . LEU A 1 23  ? -5.977  -2.519  10.207  1.00 0.00 ? 26  LEU A HB2  4  
ATOM 5065  H HB3  . LEU A 1 23  ? -5.121  -1.038  10.582  1.00 0.00 ? 26  LEU A HB3  4  
ATOM 5066  H HG   . LEU A 1 23  ? -5.444  -1.581  13.021  1.00 0.00 ? 26  LEU A HG   4  
ATOM 5067  H HD11 . LEU A 1 23  ? -6.273  -4.257  11.918  1.00 0.00 ? 26  LEU A HD11 4  
ATOM 5068  H HD12 . LEU A 1 23  ? -5.935  -3.892  13.611  1.00 0.00 ? 26  LEU A HD12 4  
ATOM 5069  H HD13 . LEU A 1 23  ? -7.302  -3.128  12.801  1.00 0.00 ? 26  LEU A HD13 4  
ATOM 5070  H HD21 . LEU A 1 23  ? -3.637  -3.235  13.052  1.00 0.00 ? 26  LEU A HD21 4  
ATOM 5071  H HD22 . LEU A 1 23  ? -3.877  -3.517  11.326  1.00 0.00 ? 26  LEU A HD22 4  
ATOM 5072  H HD23 . LEU A 1 23  ? -3.333  -1.938  11.896  1.00 0.00 ? 26  LEU A HD23 4  
ATOM 5073  N N    . SER A 1 24  ? -6.957  1.251   10.057  1.00 0.00 ? 27  SER A N    4  
ATOM 5074  C CA   . SER A 1 24  ? -6.984  2.244   9.002   1.00 0.00 ? 27  SER A CA   4  
ATOM 5075  C C    . SER A 1 24  ? -5.633  2.933   8.929   1.00 0.00 ? 27  SER A C    4  
ATOM 5076  O O    . SER A 1 24  ? -4.957  3.087   9.941   1.00 0.00 ? 27  SER A O    4  
ATOM 5077  C CB   . SER A 1 24  ? -8.090  3.271   9.265   1.00 0.00 ? 27  SER A CB   4  
ATOM 5078  O OG   . SER A 1 24  ? -8.295  4.105   8.135   1.00 0.00 ? 27  SER A OG   4  
ATOM 5079  H H    . SER A 1 24  ? -6.661  1.517   10.962  1.00 0.00 ? 27  SER A H    4  
ATOM 5080  H HA   . SER A 1 24  ? -7.178  1.740   8.069   1.00 0.00 ? 27  SER A HA   4  
ATOM 5081  H HB2  . SER A 1 24  ? -9.013  2.758   9.488   1.00 0.00 ? 27  SER A HB2  4  
ATOM 5082  H HB3  . SER A 1 24  ? -7.811  3.888   10.104  1.00 0.00 ? 27  SER A HB3  4  
ATOM 5083  H HG   . SER A 1 24  ? -8.496  3.557   7.367   1.00 0.00 ? 27  SER A HG   4  
ATOM 5084  N N    . TRP A 1 25  ? -5.235  3.348   7.732   1.00 0.00 ? 28  TRP A N    4  
ATOM 5085  C CA   . TRP A 1 25  ? -3.948  4.007   7.559   1.00 0.00 ? 28  TRP A CA   4  
ATOM 5086  C C    . TRP A 1 25  ? -3.982  5.446   8.078   1.00 0.00 ? 28  TRP A C    4  
ATOM 5087  O O    . TRP A 1 25  ? -3.034  6.205   7.890   1.00 0.00 ? 28  TRP A O    4  
ATOM 5088  C CB   . TRP A 1 25  ? -3.483  3.951   6.094   1.00 0.00 ? 28  TRP A CB   4  
ATOM 5089  C CG   . TRP A 1 25  ? -4.442  4.514   5.077   1.00 0.00 ? 28  TRP A CG   4  
ATOM 5090  C CD1  . TRP A 1 25  ? -5.414  5.456   5.272   1.00 0.00 ? 28  TRP A CD1  4  
ATOM 5091  C CD2  . TRP A 1 25  ? -4.491  4.176   3.684   1.00 0.00 ? 28  TRP A CD2  4  
ATOM 5092  N NE1  . TRP A 1 25  ? -6.067  5.711   4.092   1.00 0.00 ? 28  TRP A NE1  4  
ATOM 5093  C CE2  . TRP A 1 25  ? -5.519  4.940   3.103   1.00 0.00 ? 28  TRP A CE2  4  
ATOM 5094  C CE3  . TRP A 1 25  ? -3.764  3.298   2.869   1.00 0.00 ? 28  TRP A CE3  4  
ATOM 5095  C CZ2  . TRP A 1 25  ? -5.837  4.858   1.749   1.00 0.00 ? 28  TRP A CZ2  4  
ATOM 5096  C CZ3  . TRP A 1 25  ? -4.084  3.215   1.527   1.00 0.00 ? 28  TRP A CZ3  4  
ATOM 5097  C CH2  . TRP A 1 25  ? -5.111  3.992   0.978   1.00 0.00 ? 28  TRP A CH2  4  
ATOM 5098  H H    . TRP A 1 25  ? -5.811  3.201   6.953   1.00 0.00 ? 28  TRP A H    4  
ATOM 5099  H HA   . TRP A 1 25  ? -3.235  3.460   8.160   1.00 0.00 ? 28  TRP A HA   4  
ATOM 5100  H HB2  . TRP A 1 25  ? -2.561  4.502   6.006   1.00 0.00 ? 28  TRP A HB2  4  
ATOM 5101  H HB3  . TRP A 1 25  ? -3.298  2.917   5.835   1.00 0.00 ? 28  TRP A HB3  4  
ATOM 5102  H HD1  . TRP A 1 25  ? -5.632  5.916   6.223   1.00 0.00 ? 28  TRP A HD1  4  
ATOM 5103  H HE1  . TRP A 1 25  ? -6.805  6.349   3.975   1.00 0.00 ? 28  TRP A HE1  4  
ATOM 5104  H HE3  . TRP A 1 25  ? -2.968  2.689   3.274   1.00 0.00 ? 28  TRP A HE3  4  
ATOM 5105  H HZ2  . TRP A 1 25  ? -6.627  5.448   1.311   1.00 0.00 ? 28  TRP A HZ2  4  
ATOM 5106  H HZ3  . TRP A 1 25  ? -3.532  2.544   0.883   1.00 0.00 ? 28  TRP A HZ3  4  
ATOM 5107  H HH2  . TRP A 1 25  ? -5.327  3.896   -0.076  1.00 0.00 ? 28  TRP A HH2  4  
ATOM 5108  N N    . TYR A 1 26  ? -5.083  5.809   8.728   1.00 0.00 ? 29  TYR A N    4  
ATOM 5109  C CA   . TYR A 1 26  ? -5.189  7.094   9.399   1.00 0.00 ? 29  TYR A CA   4  
ATOM 5110  C C    . TYR A 1 26  ? -4.865  6.945   10.883  1.00 0.00 ? 29  TYR A C    4  
ATOM 5111  O O    . TYR A 1 26  ? -4.709  7.938   11.593  1.00 0.00 ? 29  TYR A O    4  
ATOM 5112  C CB   . TYR A 1 26  ? -6.588  7.695   9.228   1.00 0.00 ? 29  TYR A CB   4  
ATOM 5113  C CG   . TYR A 1 26  ? -6.846  8.285   7.857   1.00 0.00 ? 29  TYR A CG   4  
ATOM 5114  C CD1  . TYR A 1 26  ? -6.326  9.526   7.509   1.00 0.00 ? 29  TYR A CD1  4  
ATOM 5115  C CD2  . TYR A 1 26  ? -7.616  7.611   6.918   1.00 0.00 ? 29  TYR A CD2  4  
ATOM 5116  C CE1  . TYR A 1 26  ? -6.563  10.076  6.264   1.00 0.00 ? 29  TYR A CE1  4  
ATOM 5117  C CE2  . TYR A 1 26  ? -7.856  8.155   5.669   1.00 0.00 ? 29  TYR A CE2  4  
ATOM 5118  C CZ   . TYR A 1 26  ? -7.329  9.389   5.348   1.00 0.00 ? 29  TYR A CZ   4  
ATOM 5119  O OH   . TYR A 1 26  ? -7.565  9.936   4.107   1.00 0.00 ? 29  TYR A OH   4  
ATOM 5120  H H    . TYR A 1 26  ? -5.841  5.191   8.758   1.00 0.00 ? 29  TYR A H    4  
ATOM 5121  H HA   . TYR A 1 26  ? -4.465  7.759   8.950   1.00 0.00 ? 29  TYR A HA   4  
ATOM 5122  H HB2  . TYR A 1 26  ? -7.326  6.926   9.399   1.00 0.00 ? 29  TYR A HB2  4  
ATOM 5123  H HB3  . TYR A 1 26  ? -6.725  8.480   9.959   1.00 0.00 ? 29  TYR A HB3  4  
ATOM 5124  H HD1  . TYR A 1 26  ? -5.727  10.065  8.227   1.00 0.00 ? 29  TYR A HD1  4  
ATOM 5125  H HD2  . TYR A 1 26  ? -8.029  6.646   7.171   1.00 0.00 ? 29  TYR A HD2  4  
ATOM 5126  H HE1  . TYR A 1 26  ? -6.148  11.041  6.014   1.00 0.00 ? 29  TYR A HE1  4  
ATOM 5127  H HE2  . TYR A 1 26  ? -8.456  7.616   4.954   1.00 0.00 ? 29  TYR A HE2  4  
ATOM 5128  H HH   . TYR A 1 26  ? -8.473  9.753   3.843   1.00 0.00 ? 29  TYR A HH   4  
ATOM 5129  N N    . ASP A 1 27  ? -4.764  5.701   11.343  1.00 0.00 ? 30  ASP A N    4  
ATOM 5130  C CA   . ASP A 1 27  ? -4.436  5.423   12.738  1.00 0.00 ? 30  ASP A CA   4  
ATOM 5131  C C    . ASP A 1 27  ? -3.028  5.911   13.063  1.00 0.00 ? 30  ASP A C    4  
ATOM 5132  O O    . ASP A 1 27  ? -2.096  5.722   12.281  1.00 0.00 ? 30  ASP A O    4  
ATOM 5133  C CB   . ASP A 1 27  ? -4.556  3.927   13.046  1.00 0.00 ? 30  ASP A CB   4  
ATOM 5134  C CG   . ASP A 1 27  ? -5.988  3.480   13.274  1.00 0.00 ? 30  ASP A CG   4  
ATOM 5135  O OD1  . ASP A 1 27  ? -6.553  3.825   14.331  1.00 0.00 ? 30  ASP A OD1  4  
ATOM 5136  O OD2  . ASP A 1 27  ? -6.555  2.781   12.405  1.00 0.00 ? 30  ASP A OD2  4  
ATOM 5137  H H    . ASP A 1 27  ? -4.903  4.947   10.728  1.00 0.00 ? 30  ASP A H    4  
ATOM 5138  H HA   . ASP A 1 27  ? -5.141  5.964   13.354  1.00 0.00 ? 30  ASP A HA   4  
ATOM 5139  H HB2  . ASP A 1 27  ? -4.154  3.367   12.222  1.00 0.00 ? 30  ASP A HB2  4  
ATOM 5140  H HB3  . ASP A 1 27  ? -3.985  3.706   13.936  1.00 0.00 ? 30  ASP A HB3  4  
ATOM 5141  N N    . PRO A 1 28  ? -2.863  6.552   14.230  1.00 0.00 ? 31  PRO A N    4  
ATOM 5142  C CA   . PRO A 1 28  ? -1.597  7.177   14.630  1.00 0.00 ? 31  PRO A CA   4  
ATOM 5143  C C    . PRO A 1 28  ? -0.486  6.166   14.897  1.00 0.00 ? 31  PRO A C    4  
ATOM 5144  O O    . PRO A 1 28  ? 0.693   6.523   14.925  1.00 0.00 ? 31  PRO A O    4  
ATOM 5145  C CB   . PRO A 1 28  ? -1.956  7.930   15.912  1.00 0.00 ? 31  PRO A CB   4  
ATOM 5146  C CG   . PRO A 1 28  ? -3.153  7.227   16.448  1.00 0.00 ? 31  PRO A CG   4  
ATOM 5147  C CD   . PRO A 1 28  ? -3.908  6.716   15.255  1.00 0.00 ? 31  PRO A CD   4  
ATOM 5148  H HA   . PRO A 1 28  ? -1.258  7.881   13.887  1.00 0.00 ? 31  PRO A HA   4  
ATOM 5149  H HB2  . PRO A 1 28  ? -1.127  7.884   16.605  1.00 0.00 ? 31  PRO A HB2  4  
ATOM 5150  H HB3  . PRO A 1 28  ? -2.178  8.959   15.677  1.00 0.00 ? 31  PRO A HB3  4  
ATOM 5151  H HG2  . PRO A 1 28  ? -2.844  6.405   17.077  1.00 0.00 ? 31  PRO A HG2  4  
ATOM 5152  H HG3  . PRO A 1 28  ? -3.762  7.919   17.009  1.00 0.00 ? 31  PRO A HG3  4  
ATOM 5153  H HD2  . PRO A 1 28  ? -4.373  5.767   15.481  1.00 0.00 ? 31  PRO A HD2  4  
ATOM 5154  H HD3  . PRO A 1 28  ? -4.649  7.435   14.938  1.00 0.00 ? 31  PRO A HD3  4  
ATOM 5155  N N    . ASP A 1 29  ? -0.860  4.914   15.105  1.00 0.00 ? 32  ASP A N    4  
ATOM 5156  C CA   . ASP A 1 29  ? 0.121   3.856   15.311  1.00 0.00 ? 32  ASP A CA   4  
ATOM 5157  C C    . ASP A 1 29  ? 0.104   2.857   14.165  1.00 0.00 ? 32  ASP A C    4  
ATOM 5158  O O    . ASP A 1 29  ? 0.560   1.725   14.308  1.00 0.00 ? 32  ASP A O    4  
ATOM 5159  C CB   . ASP A 1 29  ? -0.113  3.131   16.639  1.00 0.00 ? 32  ASP A CB   4  
ATOM 5160  C CG   . ASP A 1 29  ? 0.507   3.855   17.815  1.00 0.00 ? 32  ASP A CG   4  
ATOM 5161  O OD1  . ASP A 1 29  ? -0.100  4.830   18.311  1.00 0.00 ? 32  ASP A OD1  4  
ATOM 5162  O OD2  . ASP A 1 29  ? 1.607   3.452   18.254  1.00 0.00 ? 32  ASP A OD2  4  
ATOM 5163  H H    . ASP A 1 29  ? -1.819  4.694   15.130  1.00 0.00 ? 32  ASP A H    4  
ATOM 5164  H HA   . ASP A 1 29  ? 1.095   4.320   15.341  1.00 0.00 ? 32  ASP A HA   4  
ATOM 5165  H HB2  . ASP A 1 29  ? -1.174  3.046   16.813  1.00 0.00 ? 32  ASP A HB2  4  
ATOM 5166  H HB3  . ASP A 1 29  ? 0.318   2.143   16.581  1.00 0.00 ? 32  ASP A HB3  4  
ATOM 5167  N N    . PHE A 1 30  ? -0.417  3.276   13.020  1.00 0.00 ? 33  PHE A N    4  
ATOM 5168  C CA   . PHE A 1 30  ? -0.422  2.418   11.849  1.00 0.00 ? 33  PHE A CA   4  
ATOM 5169  C C    . PHE A 1 30  ? 0.951   2.439   11.196  1.00 0.00 ? 33  PHE A C    4  
ATOM 5170  O O    . PHE A 1 30  ? 1.280   3.350   10.437  1.00 0.00 ? 33  PHE A O    4  
ATOM 5171  C CB   . PHE A 1 30  ? -1.490  2.861   10.849  1.00 0.00 ? 33  PHE A CB   4  
ATOM 5172  C CG   . PHE A 1 30  ? -1.804  1.819   9.814   1.00 0.00 ? 33  PHE A CG   4  
ATOM 5173  C CD1  . PHE A 1 30  ? -2.657  0.767   10.113  1.00 0.00 ? 33  PHE A CD1  4  
ATOM 5174  C CD2  . PHE A 1 30  ? -1.247  1.884   8.548   1.00 0.00 ? 33  PHE A CD2  4  
ATOM 5175  C CE1  . PHE A 1 30  ? -2.948  -0.199  9.171   1.00 0.00 ? 33  PHE A CE1  4  
ATOM 5176  C CE2  . PHE A 1 30  ? -1.533  0.919   7.600   1.00 0.00 ? 33  PHE A CE2  4  
ATOM 5177  C CZ   . PHE A 1 30  ? -2.385  -0.122  7.912   1.00 0.00 ? 33  PHE A CZ   4  
ATOM 5178  H H    . PHE A 1 30  ? -0.800  4.178   12.960  1.00 0.00 ? 33  PHE A H    4  
ATOM 5179  H HA   . PHE A 1 30  ? -0.639  1.410   12.178  1.00 0.00 ? 33  PHE A HA   4  
ATOM 5180  H HB2  . PHE A 1 30  ? -2.402  3.092   11.379  1.00 0.00 ? 33  PHE A HB2  4  
ATOM 5181  H HB3  . PHE A 1 30  ? -1.142  3.747   10.336  1.00 0.00 ? 33  PHE A HB3  4  
ATOM 5182  H HD1  . PHE A 1 30  ? -3.098  0.706   11.098  1.00 0.00 ? 33  PHE A HD1  4  
ATOM 5183  H HD2  . PHE A 1 30  ? -0.582  2.698   8.302   1.00 0.00 ? 33  PHE A HD2  4  
ATOM 5184  H HE1  . PHE A 1 30  ? -3.616  -1.012  9.417   1.00 0.00 ? 33  PHE A HE1  4  
ATOM 5185  H HE2  . PHE A 1 30  ? -1.093  0.982   6.615   1.00 0.00 ? 33  PHE A HE2  4  
ATOM 5186  H HZ   . PHE A 1 30  ? -2.610  -0.878  7.174   1.00 0.00 ? 33  PHE A HZ   4  
ATOM 5187  N N    . GLN A 1 31  ? 1.758   1.443   11.518  1.00 0.00 ? 34  GLN A N    4  
ATOM 5188  C CA   . GLN A 1 31  ? 3.119   1.371   11.012  1.00 0.00 ? 34  GLN A CA   4  
ATOM 5189  C C    . GLN A 1 31  ? 3.131   0.917   9.556   1.00 0.00 ? 34  GLN A C    4  
ATOM 5190  O O    . GLN A 1 31  ? 2.636   -0.160  9.222   1.00 0.00 ? 34  GLN A O    4  
ATOM 5191  C CB   . GLN A 1 31  ? 3.953   0.421   11.876  1.00 0.00 ? 34  GLN A CB   4  
ATOM 5192  C CG   . GLN A 1 31  ? 4.098   0.875   13.320  1.00 0.00 ? 34  GLN A CG   4  
ATOM 5193  C CD   . GLN A 1 31  ? 4.856   -0.124  14.170  1.00 0.00 ? 34  GLN A CD   4  
ATOM 5194  O OE1  . GLN A 1 31  ? 4.269   -1.032  14.758  1.00 0.00 ? 34  GLN A OE1  4  
ATOM 5195  N NE2  . GLN A 1 31  ? 6.164   0.043   14.260  1.00 0.00 ? 34  GLN A NE2  4  
ATOM 5196  H H    . GLN A 1 31  ? 1.425   0.735   12.108  1.00 0.00 ? 34  GLN A H    4  
ATOM 5197  H HA   . GLN A 1 31  ? 3.546   2.362   11.070  1.00 0.00 ? 34  GLN A HA   4  
ATOM 5198  H HB2  . GLN A 1 31  ? 3.488   -0.551  11.876  1.00 0.00 ? 34  GLN A HB2  4  
ATOM 5199  H HB3  . GLN A 1 31  ? 4.939   0.335   11.449  1.00 0.00 ? 34  GLN A HB3  4  
ATOM 5200  H HG2  . GLN A 1 31  ? 4.631   1.814   13.336  1.00 0.00 ? 34  GLN A HG2  4  
ATOM 5201  H HG3  . GLN A 1 31  ? 3.116   1.014   13.743  1.00 0.00 ? 34  GLN A HG3  4  
ATOM 5202  H HE21 . GLN A 1 31  ? 6.571   0.801   13.784  1.00 0.00 ? 34  GLN A HE21 4  
ATOM 5203  H HE22 . GLN A 1 31  ? 6.678   -0.599  14.797  1.00 0.00 ? 34  GLN A HE22 4  
ATOM 5204  N N    . ALA A 1 32  ? 3.681   1.757   8.696   1.00 0.00 ? 35  ALA A N    4  
ATOM 5205  C CA   . ALA A 1 32  ? 3.810   1.441   7.282   1.00 0.00 ? 35  ALA A CA   4  
ATOM 5206  C C    . ALA A 1 32  ? 5.157   1.922   6.764   1.00 0.00 ? 35  ALA A C    4  
ATOM 5207  O O    . ALA A 1 32  ? 5.751   2.843   7.327   1.00 0.00 ? 35  ALA A O    4  
ATOM 5208  C CB   . ALA A 1 32  ? 2.676   2.072   6.484   1.00 0.00 ? 35  ALA A CB   4  
ATOM 5209  H H    . ALA A 1 32  ? 4.018   2.624   9.025   1.00 0.00 ? 35  ALA A H    4  
ATOM 5210  H HA   . ALA A 1 32  ? 3.752   0.367   7.171   1.00 0.00 ? 35  ALA A HA   4  
ATOM 5211  H HB1  . ALA A 1 32  ? 2.802   1.840   5.437   1.00 0.00 ? 35  ALA A HB1  4  
ATOM 5212  H HB2  . ALA A 1 32  ? 1.732   1.679   6.829   1.00 0.00 ? 35  ALA A HB2  4  
ATOM 5213  H HB3  . ALA A 1 32  ? 2.694   3.143   6.619   1.00 0.00 ? 35  ALA A HB3  4  
ATOM 5214  N N    . ARG A 1 33  ? 5.643   1.297   5.704   1.00 0.00 ? 36  ARG A N    4  
ATOM 5215  C CA   . ARG A 1 33  ? 6.929   1.659   5.137   1.00 0.00 ? 36  ARG A CA   4  
ATOM 5216  C C    . ARG A 1 33  ? 6.912   1.499   3.624   1.00 0.00 ? 36  ARG A C    4  
ATOM 5217  O O    . ARG A 1 33  ? 6.142   0.706   3.078   1.00 0.00 ? 36  ARG A O    4  
ATOM 5218  C CB   . ARG A 1 33  ? 8.045   0.793   5.730   1.00 0.00 ? 36  ARG A CB   4  
ATOM 5219  C CG   . ARG A 1 33  ? 7.975   -0.665  5.301   1.00 0.00 ? 36  ARG A CG   4  
ATOM 5220  C CD   . ARG A 1 33  ? 9.167   -1.459  5.804   1.00 0.00 ? 36  ARG A CD   4  
ATOM 5221  N NE   . ARG A 1 33  ? 9.171   -2.813  5.253   1.00 0.00 ? 36  ARG A NE   4  
ATOM 5222  C CZ   . ARG A 1 33  ? 10.006  -3.774  5.635   1.00 0.00 ? 36  ARG A CZ   4  
ATOM 5223  N NH1  . ARG A 1 33  ? 10.927  -3.536  6.559   1.00 0.00 ? 36  ARG A NH1  4  
ATOM 5224  N NH2  . ARG A 1 33  ? 9.933   -4.969  5.073   1.00 0.00 ? 36  ARG A NH2  4  
ATOM 5225  H H    . ARG A 1 33  ? 5.121   0.574   5.284   1.00 0.00 ? 36  ARG A H    4  
ATOM 5226  H HA   . ARG A 1 33  ? 7.120   2.694   5.378   1.00 0.00 ? 36  ARG A HA   4  
ATOM 5227  H HB2  . ARG A 1 33  ? 8.999   1.192   5.418   1.00 0.00 ? 36  ARG A HB2  4  
ATOM 5228  H HB3  . ARG A 1 33  ? 7.982   0.834   6.809   1.00 0.00 ? 36  ARG A HB3  4  
ATOM 5229  H HG2  . ARG A 1 33  ? 7.071   -1.104  5.696   1.00 0.00 ? 36  ARG A HG2  4  
ATOM 5230  H HG3  . ARG A 1 33  ? 7.954   -0.708  4.222   1.00 0.00 ? 36  ARG A HG3  4  
ATOM 5231  H HD2  . ARG A 1 33  ? 10.076  -0.951  5.507   1.00 0.00 ? 36  ARG A HD2  4  
ATOM 5232  H HD3  . ARG A 1 33  ? 9.119   -1.518  6.883   1.00 0.00 ? 36  ARG A HD3  4  
ATOM 5233  H HE   . ARG A 1 33  ? 8.513   -3.016  4.548   1.00 0.00 ? 36  ARG A HE   4  
ATOM 5234  H HH12 . ARG A 1 33  ? 10.665  -3.459  7.531   1.00 0.00 ? 36  ARG A HH12 4  
ATOM 5235  H HH21 . ARG A 1 33  ? 9.244   -5.146  4.353   1.00 0.00 ? 36  ARG A HH21 4  
ATOM 5236  H HH22 . ARG A 1 33  ? 10.567  -5.700  5.344   1.00 0.00 ? 36  ARG A HH22 4  
ATOM 5237  N N    . LEU A 1 34  ? 7.755   2.268   2.959   1.00 0.00 ? 37  LEU A N    4  
ATOM 5238  C CA   . LEU A 1 34  ? 7.967   2.126   1.531   1.00 0.00 ? 37  LEU A CA   4  
ATOM 5239  C C    . LEU A 1 34  ? 9.340   1.515   1.299   1.00 0.00 ? 37  LEU A C    4  
ATOM 5240  O O    . LEU A 1 34  ? 10.324  1.920   1.924   1.00 0.00 ? 37  LEU A O    4  
ATOM 5241  C CB   . LEU A 1 34  ? 7.846   3.484   0.837   1.00 0.00 ? 37  LEU A CB   4  
ATOM 5242  C CG   . LEU A 1 34  ? 6.461   4.132   0.937   1.00 0.00 ? 37  LEU A CG   4  
ATOM 5243  C CD1  . LEU A 1 34  ? 6.484   5.540   0.377   1.00 0.00 ? 37  LEU A CD1  4  
ATOM 5244  C CD2  . LEU A 1 34  ? 5.425   3.301   0.202   1.00 0.00 ? 37  LEU A CD2  4  
ATOM 5245  H H    . LEU A 1 34  ? 8.254   2.956   3.443   1.00 0.00 ? 37  LEU A H    4  
ATOM 5246  H HA   . LEU A 1 34  ? 7.213   1.457   1.146   1.00 0.00 ? 37  LEU A HA   4  
ATOM 5247  H HB2  . LEU A 1 34  ? 8.570   4.153   1.278   1.00 0.00 ? 37  LEU A HB2  4  
ATOM 5248  H HB3  . LEU A 1 34  ? 8.084   3.355   -0.208  1.00 0.00 ? 37  LEU A HB3  4  
ATOM 5249  H HG   . LEU A 1 34  ? 6.171   4.188   1.977   1.00 0.00 ? 37  LEU A HG   4  
ATOM 5250  H HD11 . LEU A 1 34  ? 5.495   5.966   0.438   1.00 0.00 ? 37  LEU A HD11 4  
ATOM 5251  H HD12 . LEU A 1 34  ? 7.175   6.144   0.947   1.00 0.00 ? 37  LEU A HD12 4  
ATOM 5252  H HD13 . LEU A 1 34  ? 6.800   5.512   -0.656  1.00 0.00 ? 37  LEU A HD13 4  
ATOM 5253  H HD21 . LEU A 1 34  ? 5.727   3.181   -0.827  1.00 0.00 ? 37  LEU A HD21 4  
ATOM 5254  H HD22 . LEU A 1 34  ? 5.344   2.334   0.670   1.00 0.00 ? 37  LEU A HD22 4  
ATOM 5255  H HD23 . LEU A 1 34  ? 4.468   3.801   0.240   1.00 0.00 ? 37  LEU A HD23 4  
ATOM 5256  N N    . THR A 1 35  ? 9.392   0.527   0.421   1.00 0.00 ? 38  THR A N    4  
ATOM 5257  C CA   . THR A 1 35  ? 10.600  -0.258  0.197   1.00 0.00 ? 38  THR A CA   4  
ATOM 5258  C C    . THR A 1 35  ? 11.741  0.573   -0.390  1.00 0.00 ? 38  THR A C    4  
ATOM 5259  O O    . THR A 1 35  ? 11.535  1.671   -0.908  1.00 0.00 ? 38  THR A O    4  
ATOM 5260  C CB   . THR A 1 35  ? 10.303  -1.438  -0.739  1.00 0.00 ? 38  THR A CB   4  
ATOM 5261  O OG1  . THR A 1 35  ? 9.667   -0.960  -1.932  1.00 0.00 ? 38  THR A OG1  4  
ATOM 5262  C CG2  . THR A 1 35  ? 9.412   -2.458  -0.045  1.00 0.00 ? 38  THR A CG2  4  
ATOM 5263  H H    . THR A 1 35  ? 8.586   0.312   -0.098  1.00 0.00 ? 38  THR A H    4  
ATOM 5264  H HA   . THR A 1 35  ? 10.917  -0.658  1.150   1.00 0.00 ? 38  THR A HA   4  
ATOM 5265  H HB   . THR A 1 35  ? 11.238  -1.916  -1.003  1.00 0.00 ? 38  THR A HB   4  
ATOM 5266  H HG1  . THR A 1 35  ? 10.301  -0.973  -2.663  1.00 0.00 ? 38  THR A HG1  4  
ATOM 5267  H HG21 . THR A 1 35  ? 8.490   -1.985  0.257   1.00 0.00 ? 38  THR A HG21 4  
ATOM 5268  H HG22 . THR A 1 35  ? 9.919   -2.846  0.826   1.00 0.00 ? 38  THR A HG22 4  
ATOM 5269  H HG23 . THR A 1 35  ? 9.193   -3.270  -0.725  1.00 0.00 ? 38  THR A HG23 4  
ATOM 5270  N N    . ARG A 1 36  ? 12.947  0.015   -0.317  1.00 0.00 ? 39  ARG A N    4  
ATOM 5271  C CA   . ARG A 1 36  ? 14.161  0.689   -0.776  1.00 0.00 ? 39  ARG A CA   4  
ATOM 5272  C C    . ARG A 1 36  ? 14.281  0.643   -2.301  1.00 0.00 ? 39  ARG A C    4  
ATOM 5273  O O    . ARG A 1 36  ? 15.338  0.320   -2.848  1.00 0.00 ? 39  ARG A O    4  
ATOM 5274  C CB   . ARG A 1 36  ? 15.394  0.053   -0.112  1.00 0.00 ? 39  ARG A CB   4  
ATOM 5275  C CG   . ARG A 1 36  ? 15.526  -1.450  -0.347  1.00 0.00 ? 39  ARG A CG   4  
ATOM 5276  C CD   . ARG A 1 36  ? 16.606  -2.064  0.526   1.00 0.00 ? 39  ARG A CD   4  
ATOM 5277  N NE   . ARG A 1 36  ? 16.729  -3.504  0.311   1.00 0.00 ? 39  ARG A NE   4  
ATOM 5278  C CZ   . ARG A 1 36  ? 16.780  -4.405  1.291   1.00 0.00 ? 39  ARG A CZ   4  
ATOM 5279  N NH1  . ARG A 1 36  ? 16.689  -4.017  2.558   1.00 0.00 ? 39  ARG A NH1  4  
ATOM 5280  N NH2  . ARG A 1 36  ? 16.926  -5.688  1.006   1.00 0.00 ? 39  ARG A NH2  4  
ATOM 5281  H H    . ARG A 1 36  ? 13.021  -0.885  0.057   1.00 0.00 ? 39  ARG A H    4  
ATOM 5282  H HA   . ARG A 1 36  ? 14.096  1.721   -0.468  1.00 0.00 ? 39  ARG A HA   4  
ATOM 5283  H HB2  . ARG A 1 36  ? 16.282  0.531   -0.500  1.00 0.00 ? 39  ARG A HB2  4  
ATOM 5284  H HB3  . ARG A 1 36  ? 15.344  0.225   0.954   1.00 0.00 ? 39  ARG A HB3  4  
ATOM 5285  H HG2  . ARG A 1 36  ? 14.586  -1.928  -0.123  1.00 0.00 ? 39  ARG A HG2  4  
ATOM 5286  H HG3  . ARG A 1 36  ? 15.777  -1.619  -1.385  1.00 0.00 ? 39  ARG A HG3  4  
ATOM 5287  H HD2  . ARG A 1 36  ? 17.550  -1.594  0.294   1.00 0.00 ? 39  ARG A HD2  4  
ATOM 5288  H HD3  . ARG A 1 36  ? 16.360  -1.884  1.562   1.00 0.00 ? 39  ARG A HD3  4  
ATOM 5289  H HE   . ARG A 1 36  ? 16.788  -3.817  -0.627  1.00 0.00 ? 39  ARG A HE   4  
ATOM 5290  H HH12 . ARG A 1 36  ? 16.294  -4.638  3.248   1.00 0.00 ? 39  ARG A HH12 4  
ATOM 5291  H HH21 . ARG A 1 36  ? 17.000  -5.990  0.046   1.00 0.00 ? 39  ARG A HH21 4  
ATOM 5292  H HH22 . ARG A 1 36  ? 16.966  -6.371  1.742   1.00 0.00 ? 39  ARG A HH22 4  
ATOM 5293  N N    . SER A 1 37  ? 13.192  0.974   -2.974  1.00 0.00 ? 40  SER A N    4  
ATOM 5294  C CA   . SER A 1 37  ? 13.149  0.989   -4.426  1.00 0.00 ? 40  SER A CA   4  
ATOM 5295  C C    . SER A 1 37  ? 13.835  2.242   -4.959  1.00 0.00 ? 40  SER A C    4  
ATOM 5296  O O    . SER A 1 37  ? 14.871  2.169   -5.624  1.00 0.00 ? 40  SER A O    4  
ATOM 5297  C CB   . SER A 1 37  ? 11.693  0.944   -4.889  1.00 0.00 ? 40  SER A CB   4  
ATOM 5298  O OG   . SER A 1 37  ? 10.996  -0.112  -4.250  1.00 0.00 ? 40  SER A OG   4  
ATOM 5299  H H    . SER A 1 37  ? 12.381  1.219   -2.471  1.00 0.00 ? 40  SER A H    4  
ATOM 5300  H HA   . SER A 1 37  ? 13.667  0.116   -4.791  1.00 0.00 ? 40  SER A HA   4  
ATOM 5301  H HB2  . SER A 1 37  ? 11.212  1.878   -4.645  1.00 0.00 ? 40  SER A HB2  4  
ATOM 5302  H HB3  . SER A 1 37  ? 11.656  0.790   -5.955  1.00 0.00 ? 40  SER A HB3  4  
ATOM 5303  H HG   . SER A 1 37  ? 11.582  -0.886  -4.180  1.00 0.00 ? 40  SER A HG   4  
ATOM 5304  N N    . ASN A 1 38  ? 13.255  3.392   -4.651  1.00 0.00 ? 41  ASN A N    4  
ATOM 5305  C CA   . ASN A 1 38  ? 13.835  4.666   -5.048  1.00 0.00 ? 41  ASN A CA   4  
ATOM 5306  C C    . ASN A 1 38  ? 14.197  5.466   -3.812  1.00 0.00 ? 41  ASN A C    4  
ATOM 5307  O O    . ASN A 1 38  ? 15.369  5.721   -3.541  1.00 0.00 ? 41  ASN A O    4  
ATOM 5308  C CB   . ASN A 1 38  ? 12.865  5.465   -5.922  1.00 0.00 ? 41  ASN A CB   4  
ATOM 5309  C CG   . ASN A 1 38  ? 12.588  4.798   -7.254  1.00 0.00 ? 41  ASN A CG   4  
ATOM 5310  O OD1  . ASN A 1 38  ? 13.422  4.061   -7.779  1.00 0.00 ? 41  ASN A OD1  4  
ATOM 5311  N ND2  . ASN A 1 38  ? 11.416  5.055   -7.812  1.00 0.00 ? 41  ASN A ND2  4  
ATOM 5312  H H    . ASN A 1 38  ? 12.419  3.387   -4.137  1.00 0.00 ? 41  ASN A H    4  
ATOM 5313  H HA   . ASN A 1 38  ? 14.732  4.462   -5.610  1.00 0.00 ? 41  ASN A HA   4  
ATOM 5314  H HB2  . ASN A 1 38  ? 11.928  5.573   -5.397  1.00 0.00 ? 41  ASN A HB2  4  
ATOM 5315  H HB3  . ASN A 1 38  ? 13.283  6.443   -6.108  1.00 0.00 ? 41  ASN A HB3  4  
ATOM 5316  H HD21 . ASN A 1 38  ? 10.799  5.649   -7.342  1.00 0.00 ? 41  ASN A HD21 4  
ATOM 5317  H HD22 . ASN A 1 38  ? 11.220  4.647   -8.691  1.00 0.00 ? 41  ASN A HD22 4  
ATOM 5318  N N    . SER A 1 39  ? 13.176  5.826   -3.055  1.00 0.00 ? 42  SER A N    4  
ATOM 5319  C CA   . SER A 1 39  ? 13.341  6.559   -1.816  1.00 0.00 ? 42  SER A CA   4  
ATOM 5320  C C    . SER A 1 39  ? 12.245  6.129   -0.856  1.00 0.00 ? 42  SER A C    4  
ATOM 5321  O O    . SER A 1 39  ? 11.345  5.382   -1.240  1.00 0.00 ? 42  SER A O    4  
ATOM 5322  C CB   . SER A 1 39  ? 13.250  8.062   -2.075  1.00 0.00 ? 42  SER A CB   4  
ATOM 5323  O OG   . SER A 1 39  ? 14.211  8.485   -3.028  1.00 0.00 ? 42  SER A OG   4  
ATOM 5324  H H    . SER A 1 39  ? 12.270  5.586   -3.337  1.00 0.00 ? 42  SER A H    4  
ATOM 5325  H HA   . SER A 1 39  ? 14.305  6.316   -1.396  1.00 0.00 ? 42  SER A HA   4  
ATOM 5326  H HB2  . SER A 1 39  ? 12.266  8.300   -2.451  1.00 0.00 ? 42  SER A HB2  4  
ATOM 5327  H HB3  . SER A 1 39  ? 13.419  8.596   -1.152  1.00 0.00 ? 42  SER A HB3  4  
ATOM 5328  H HG   . SER A 1 39  ? 14.344  9.443   -2.936  1.00 0.00 ? 42  SER A HG   4  
ATOM 5329  N N    . LYS A 1 40  ? 12.294  6.616   0.373   1.00 0.00 ? 43  LYS A N    4  
ATOM 5330  C CA   . LYS A 1 40  ? 11.283  6.260   1.363   1.00 0.00 ? 43  LYS A CA   4  
ATOM 5331  C C    . LYS A 1 40  ? 9.995   7.033   1.107   1.00 0.00 ? 43  LYS A C    4  
ATOM 5332  O O    . LYS A 1 40  ? 9.063   6.986   1.900   1.00 0.00 ? 43  LYS A O    4  
ATOM 5333  C CB   . LYS A 1 40  ? 11.779  6.529   2.788   1.00 0.00 ? 43  LYS A CB   4  
ATOM 5334  C CG   . LYS A 1 40  ? 13.077  5.816   3.138   1.00 0.00 ? 43  LYS A CG   4  
ATOM 5335  C CD   . LYS A 1 40  ? 13.036  4.341   2.769   1.00 0.00 ? 43  LYS A CD   4  
ATOM 5336  C CE   . LYS A 1 40  ? 14.326  3.631   3.149   1.00 0.00 ? 43  LYS A CE   4  
ATOM 5337  N NZ   . LYS A 1 40  ? 15.532  4.390   2.712   1.00 0.00 ? 43  LYS A NZ   4  
ATOM 5338  H H    . LYS A 1 40  ? 13.019  7.230   0.622   1.00 0.00 ? 43  LYS A H    4  
ATOM 5339  H HA   . LYS A 1 40  ? 11.077  5.205   1.258   1.00 0.00 ? 43  LYS A HA   4  
ATOM 5340  H HB2  . LYS A 1 40  ? 11.937  7.592   2.905   1.00 0.00 ? 43  LYS A HB2  4  
ATOM 5341  H HB3  . LYS A 1 40  ? 11.020  6.210   3.485   1.00 0.00 ? 43  LYS A HB3  4  
ATOM 5342  H HG2  . LYS A 1 40  ? 13.889  6.285   2.602   1.00 0.00 ? 43  LYS A HG2  4  
ATOM 5343  H HG3  . LYS A 1 40  ? 13.248  5.906   4.201   1.00 0.00 ? 43  LYS A HG3  4  
ATOM 5344  H HD2  . LYS A 1 40  ? 12.212  3.873   3.287   1.00 0.00 ? 43  LYS A HD2  4  
ATOM 5345  H HD3  . LYS A 1 40  ? 12.889  4.252   1.702   1.00 0.00 ? 43  LYS A HD3  4  
ATOM 5346  H HE2  . LYS A 1 40  ? 14.356  3.516   4.223   1.00 0.00 ? 43  LYS A HE2  4  
ATOM 5347  H HE3  . LYS A 1 40  ? 14.338  2.656   2.683   1.00 0.00 ? 43  LYS A HE3  4  
ATOM 5348  H HZ1  . LYS A 1 40  ? 15.712  5.165   3.390   1.00 0.00 ? 43  LYS A HZ1  4  
ATOM 5349  H HZ3  . LYS A 1 40  ? 15.349  4.822   1.781   1.00 0.00 ? 43  LYS A HZ3  4  
ATOM 5350  N N    . CYS A 1 41  ? 9.958   7.751   -0.006  1.00 0.00 ? 44  CYS A N    4  
ATOM 5351  C CA   . CYS A 1 41  ? 8.776   8.500   -0.386  1.00 0.00 ? 44  CYS A CA   4  
ATOM 5352  C C    . CYS A 1 41  ? 8.080   7.850   -1.581  1.00 0.00 ? 44  CYS A C    4  
ATOM 5353  O O    . CYS A 1 41  ? 6.987   8.254   -1.956  1.00 0.00 ? 44  CYS A O    4  
ATOM 5354  C CB   . CYS A 1 41  ? 9.145   9.949   -0.707  1.00 0.00 ? 44  CYS A CB   4  
ATOM 5355  S SG   . CYS A 1 41  ? 9.967   10.824  0.666   1.00 0.00 ? 44  CYS A SG   4  
ATOM 5356  H H    . CYS A 1 41  ? 10.751  7.786   -0.574  1.00 0.00 ? 44  CYS A H    4  
ATOM 5357  H HA   . CYS A 1 41  ? 8.097   8.491   0.453   1.00 0.00 ? 44  CYS A HA   4  
ATOM 5358  H HB2  . CYS A 1 41  ? 9.812   9.965   -1.556  1.00 0.00 ? 44  CYS A HB2  4  
ATOM 5359  H HB3  . CYS A 1 41  ? 8.245   10.495  -0.954  1.00 0.00 ? 44  CYS A HB3  4  
ATOM 5360  N N    . GLN A 1 42  ? 8.709   6.836   -2.172  1.00 0.00 ? 45  GLN A N    4  
ATOM 5361  C CA   . GLN A 1 42  ? 8.107   6.123   -3.296  1.00 0.00 ? 45  GLN A CA   4  
ATOM 5362  C C    . GLN A 1 42  ? 8.665   4.708   -3.422  1.00 0.00 ? 45  GLN A C    4  
ATOM 5363  O O    . GLN A 1 42  ? 9.869   4.508   -3.620  1.00 0.00 ? 45  GLN A O    4  
ATOM 5364  C CB   . GLN A 1 42  ? 8.279   6.887   -4.622  1.00 0.00 ? 45  GLN A CB   4  
ATOM 5365  C CG   . GLN A 1 42  ? 9.701   7.324   -4.945  1.00 0.00 ? 45  GLN A CG   4  
ATOM 5366  C CD   . GLN A 1 42  ? 10.021  8.723   -4.442  1.00 0.00 ? 45  GLN A CD   4  
ATOM 5367  O OE1  . GLN A 1 42  ? 11.168  9.035   -4.127  1.00 0.00 ? 45  GLN A OE1  4  
ATOM 5368  N NE2  . GLN A 1 42  ? 9.010   9.572   -4.362  1.00 0.00 ? 45  GLN A NE2  4  
ATOM 5369  H H    . GLN A 1 42  ? 9.582   6.544   -1.832  1.00 0.00 ? 45  GLN A H    4  
ATOM 5370  H HA   . GLN A 1 42  ? 7.048   6.046   -3.088  1.00 0.00 ? 45  GLN A HA   4  
ATOM 5371  H HB2  . GLN A 1 42  ? 7.935   6.260   -5.429  1.00 0.00 ? 45  GLN A HB2  4  
ATOM 5372  H HB3  . GLN A 1 42  ? 7.661   7.772   -4.586  1.00 0.00 ? 45  GLN A HB3  4  
ATOM 5373  H HG2  . GLN A 1 42  ? 10.387  6.630   -4.486  1.00 0.00 ? 45  GLN A HG2  4  
ATOM 5374  H HG3  . GLN A 1 42  ? 9.833   7.304   -6.017  1.00 0.00 ? 45  GLN A HG3  4  
ATOM 5375  H HE21 . GLN A 1 42  ? 8.120   9.260   -4.628  1.00 0.00 ? 45  GLN A HE21 4  
ATOM 5376  H HE22 . GLN A 1 42  ? 9.190   10.480  -4.042  1.00 0.00 ? 45  GLN A HE22 4  
ATOM 5377  N N    . GLY A 1 43  ? 7.775   3.732   -3.305  1.00 0.00 ? 46  GLY A N    4  
ATOM 5378  C CA   . GLY A 1 43  ? 8.160   2.336   -3.397  1.00 0.00 ? 46  GLY A CA   4  
ATOM 5379  C C    . GLY A 1 43  ? 6.996   1.421   -3.078  1.00 0.00 ? 46  GLY A C    4  
ATOM 5380  O O    . GLY A 1 43  ? 5.841   1.847   -3.148  1.00 0.00 ? 46  GLY A O    4  
ATOM 5381  H H    . GLY A 1 43  ? 6.831   3.962   -3.149  1.00 0.00 ? 46  GLY A H    4  
ATOM 5382  H HA2  . GLY A 1 43  ? 8.507   2.130   -4.402  1.00 0.00 ? 46  GLY A HA2  4  
ATOM 5383  H HA3  . GLY A 1 43  ? 8.963   2.143   -2.698  1.00 0.00 ? 46  GLY A HA3  4  
ATOM 5384  N N    . GLN A 1 44  ? 7.289   0.172   -2.724  1.00 0.00 ? 47  GLN A N    4  
ATOM 5385  C CA   . GLN A 1 44  ? 6.250   -0.793  -2.388  1.00 0.00 ? 47  GLN A CA   4  
ATOM 5386  C C    . GLN A 1 44  ? 5.678   -0.485  -1.011  1.00 0.00 ? 47  GLN A C    4  
ATOM 5387  O O    . GLN A 1 44  ? 6.426   -0.271  -0.055  1.00 0.00 ? 47  GLN A O    4  
ATOM 5388  C CB   . GLN A 1 44  ? 6.805   -2.222  -2.401  1.00 0.00 ? 47  GLN A CB   4  
ATOM 5389  C CG   . GLN A 1 44  ? 7.361   -2.658  -3.746  1.00 0.00 ? 47  GLN A CG   4  
ATOM 5390  C CD   . GLN A 1 44  ? 8.103   -3.984  -3.680  1.00 0.00 ? 47  GLN A CD   4  
ATOM 5391  O OE1  . GLN A 1 44  ? 8.695   -4.331  -2.662  1.00 0.00 ? 47  GLN A OE1  4  
ATOM 5392  N NE2  . GLN A 1 44  ? 8.074   -4.737  -4.768  1.00 0.00 ? 47  GLN A NE2  4  
ATOM 5393  H H    . GLN A 1 44  ? 8.234   -0.106  -2.672  1.00 0.00 ? 47  GLN A H    4  
ATOM 5394  H HA   . GLN A 1 44  ? 5.464   -0.710  -3.124  1.00 0.00 ? 47  GLN A HA   4  
ATOM 5395  H HB2  . GLN A 1 44  ? 7.597   -2.293  -1.668  1.00 0.00 ? 47  GLN A HB2  4  
ATOM 5396  H HB3  . GLN A 1 44  ? 6.012   -2.903  -2.125  1.00 0.00 ? 47  GLN A HB3  4  
ATOM 5397  H HG2  . GLN A 1 44  ? 6.543   -2.758  -4.442  1.00 0.00 ? 47  GLN A HG2  4  
ATOM 5398  H HG3  . GLN A 1 44  ? 8.043   -1.899  -4.101  1.00 0.00 ? 47  GLN A HG3  4  
ATOM 5399  H HE21 . GLN A 1 44  ? 7.584   -4.408  -5.549  1.00 0.00 ? 47  GLN A HE21 4  
ATOM 5400  H HE22 . GLN A 1 44  ? 8.553   -5.592  -4.751  1.00 0.00 ? 47  GLN A HE22 4  
ATOM 5401  N N    . LEU A 1 45  ? 4.359   -0.448  -0.917  1.00 0.00 ? 48  LEU A N    4  
ATOM 5402  C CA   . LEU A 1 45  ? 3.701   -0.175  0.351   1.00 0.00 ? 48  LEU A CA   4  
ATOM 5403  C C    . LEU A 1 45  ? 3.593   -1.438  1.197   1.00 0.00 ? 48  LEU A C    4  
ATOM 5404  O O    . LEU A 1 45  ? 2.786   -2.327  0.909   1.00 0.00 ? 48  LEU A O    4  
ATOM 5405  C CB   . LEU A 1 45  ? 2.306   0.416   0.120   1.00 0.00 ? 48  LEU A CB   4  
ATOM 5406  C CG   . LEU A 1 45  ? 1.533   0.781   1.393   1.00 0.00 ? 48  LEU A CG   4  
ATOM 5407  C CD1  . LEU A 1 45  ? 2.246   1.879   2.165   1.00 0.00 ? 48  LEU A CD1  4  
ATOM 5408  C CD2  . LEU A 1 45  ? 0.116   1.207   1.048   1.00 0.00 ? 48  LEU A CD2  4  
ATOM 5409  H H    . LEU A 1 45  ? 3.813   -0.597  -1.721  1.00 0.00 ? 48  LEU A H    4  
ATOM 5410  H HA   . LEU A 1 45  ? 4.302   0.545   0.883   1.00 0.00 ? 48  LEU A HA   4  
ATOM 5411  H HB2  . LEU A 1 45  ? 2.410   1.309   -0.483  1.00 0.00 ? 48  LEU A HB2  4  
ATOM 5412  H HB3  . LEU A 1 45  ? 1.721   -0.307  -0.431  1.00 0.00 ? 48  LEU A HB3  4  
ATOM 5413  H HG   . LEU A 1 45  ? 1.474   -0.089  2.031   1.00 0.00 ? 48  LEU A HG   4  
ATOM 5414  H HD11 . LEU A 1 45  ? 3.204   1.519   2.505   1.00 0.00 ? 48  LEU A HD11 4  
ATOM 5415  H HD12 . LEU A 1 45  ? 2.390   2.735   1.522   1.00 0.00 ? 48  LEU A HD12 4  
ATOM 5416  H HD13 . LEU A 1 45  ? 1.646   2.166   3.015   1.00 0.00 ? 48  LEU A HD13 4  
ATOM 5417  H HD21 . LEU A 1 45  ? -0.421  1.438   1.956   1.00 0.00 ? 48  LEU A HD21 4  
ATOM 5418  H HD22 . LEU A 1 45  ? 0.146   2.083   0.416   1.00 0.00 ? 48  LEU A HD22 4  
ATOM 5419  H HD23 . LEU A 1 45  ? -0.386  0.405   0.527   1.00 0.00 ? 48  LEU A HD23 4  
ATOM 5420  N N    . GLU A 1 46  ? 4.417   -1.518  2.231   1.00 0.00 ? 49  GLU A N    4  
ATOM 5421  C CA   . GLU A 1 46  ? 4.305   -2.586  3.209   1.00 0.00 ? 49  GLU A CA   4  
ATOM 5422  C C    . GLU A 1 46  ? 3.734   -2.043  4.504   1.00 0.00 ? 49  GLU A C    4  
ATOM 5423  O O    . GLU A 1 46  ? 4.214   -1.042  5.040   1.00 0.00 ? 49  GLU A O    4  
ATOM 5424  C CB   . GLU A 1 46  ? 5.652   -3.256  3.487   1.00 0.00 ? 49  GLU A CB   4  
ATOM 5425  C CG   . GLU A 1 46  ? 6.088   -4.251  2.426   1.00 0.00 ? 49  GLU A CG   4  
ATOM 5426  C CD   . GLU A 1 46  ? 7.268   -5.084  2.877   1.00 0.00 ? 49  GLU A CD   4  
ATOM 5427  O OE1  . GLU A 1 46  ? 8.395   -4.552  2.919   1.00 0.00 ? 49  GLU A OE1  4  
ATOM 5428  O OE2  . GLU A 1 46  ? 7.073   -6.273  3.204   1.00 0.00 ? 49  GLU A OE2  4  
ATOM 5429  H H    . GLU A 1 46  ? 5.114   -0.832  2.344   1.00 0.00 ? 49  GLU A H    4  
ATOM 5430  H HA   . GLU A 1 46  ? 3.620   -3.322  2.814   1.00 0.00 ? 49  GLU A HA   4  
ATOM 5431  H HB2  . GLU A 1 46  ? 6.411   -2.492  3.561   1.00 0.00 ? 49  GLU A HB2  4  
ATOM 5432  H HB3  . GLU A 1 46  ? 5.589   -3.779  4.430   1.00 0.00 ? 49  GLU A HB3  4  
ATOM 5433  H HG2  . GLU A 1 46  ? 5.264   -4.915  2.211   1.00 0.00 ? 49  GLU A HG2  4  
ATOM 5434  H HG3  . GLU A 1 46  ? 6.363   -3.712  1.530   1.00 0.00 ? 49  GLU A HG3  4  
ATOM 5435  N N    . VAL A 1 47  ? 2.698   -2.694  4.994   1.00 0.00 ? 50  VAL A N    4  
ATOM 5436  C CA   . VAL A 1 47  ? 2.064   -2.287  6.234   1.00 0.00 ? 50  VAL A CA   4  
ATOM 5437  C C    . VAL A 1 47  ? 2.358   -3.298  7.335   1.00 0.00 ? 50  VAL A C    4  
ATOM 5438  O O    . VAL A 1 47  ? 2.491   -4.495  7.071   1.00 0.00 ? 50  VAL A O    4  
ATOM 5439  C CB   . VAL A 1 47  ? 0.537   -2.119  6.067   1.00 0.00 ? 50  VAL A CB   4  
ATOM 5440  C CG1  . VAL A 1 47  ? 0.227   -1.055  5.023   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 5441  C CG2  . VAL A 1 47  ? -0.120  -3.439  5.692   1.00 0.00 ? 50  VAL A CG2  4  
ATOM 5442  H H    . VAL A 1 47  ? 2.356   -3.479  4.512   1.00 0.00 ? 50  VAL A H    4  
ATOM 5443  H HA   . VAL A 1 47  ? 2.482   -1.333  6.519   1.00 0.00 ? 50  VAL A HA   4  
ATOM 5444  H HB   . VAL A 1 47  ? 0.127   -1.793  7.013   1.00 0.00 ? 50  VAL A HB   4  
ATOM 5445  H HG11 . VAL A 1 47  ? 0.664   -1.341  4.077   1.00 0.00 ? 50  VAL A HG11 4  
ATOM 5446  H HG12 . VAL A 1 47  ? -0.843  -0.961  4.911   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 5447  H HG13 . VAL A 1 47  ? 0.641   -0.109  5.339   1.00 0.00 ? 50  VAL A HG13 4  
ATOM 5448  H HG21 . VAL A 1 47  ? 0.126   -4.185  6.433   1.00 0.00 ? 50  VAL A HG21 4  
ATOM 5449  H HG22 . VAL A 1 47  ? -1.192  -3.310  5.653   1.00 0.00 ? 50  VAL A HG22 4  
ATOM 5450  H HG23 . VAL A 1 47  ? 0.240   -3.759  4.726   1.00 0.00 ? 50  VAL A HG23 4  
ATOM 5451  N N    . TYR A 1 48  ? 2.481   -2.810  8.558   1.00 0.00 ? 51  TYR A N    4  
ATOM 5452  C CA   . TYR A 1 48  ? 2.797   -3.659  9.694   1.00 0.00 ? 51  TYR A CA   4  
ATOM 5453  C C    . TYR A 1 48  ? 1.524   -4.064  10.418  1.00 0.00 ? 51  TYR A C    4  
ATOM 5454  O O    . TYR A 1 48  ? 1.047   -3.359  11.305  1.00 0.00 ? 51  TYR A O    4  
ATOM 5455  C CB   . TYR A 1 48  ? 3.739   -2.929  10.655  1.00 0.00 ? 51  TYR A CB   4  
ATOM 5456  C CG   . TYR A 1 48  ? 4.362   -3.813  11.719  1.00 0.00 ? 51  TYR A CG   4  
ATOM 5457  C CD1  . TYR A 1 48  ? 5.474   -4.595  11.432  1.00 0.00 ? 51  TYR A CD1  4  
ATOM 5458  C CD2  . TYR A 1 48  ? 3.852   -3.853  13.015  1.00 0.00 ? 51  TYR A CD2  4  
ATOM 5459  C CE1  . TYR A 1 48  ? 6.060   -5.390  12.398  1.00 0.00 ? 51  TYR A CE1  4  
ATOM 5460  C CE2  . TYR A 1 48  ? 4.438   -4.644  13.988  1.00 0.00 ? 51  TYR A CE2  4  
ATOM 5461  C CZ   . TYR A 1 48  ? 5.540   -5.410  13.674  1.00 0.00 ? 51  TYR A CZ   4  
ATOM 5462  O OH   . TYR A 1 48  ? 6.133   -6.189  14.642  1.00 0.00 ? 51  TYR A OH   4  
ATOM 5463  H H    . TYR A 1 48  ? 2.352   -1.845  8.704   1.00 0.00 ? 51  TYR A H    4  
ATOM 5464  H HA   . TYR A 1 48  ? 3.286   -4.547  9.323   1.00 0.00 ? 51  TYR A HA   4  
ATOM 5465  H HB2  . TYR A 1 48  ? 4.542   -2.477  10.087  1.00 0.00 ? 51  TYR A HB2  4  
ATOM 5466  H HB3  . TYR A 1 48  ? 3.184   -2.149  11.156  1.00 0.00 ? 51  TYR A HB3  4  
ATOM 5467  H HD1  . TYR A 1 48  ? 5.883   -4.582  10.433  1.00 0.00 ? 51  TYR A HD1  4  
ATOM 5468  H HD2  . TYR A 1 48  ? 2.989   -3.255  13.261  1.00 0.00 ? 51  TYR A HD2  4  
ATOM 5469  H HE1  . TYR A 1 48  ? 6.924   -5.991  12.152  1.00 0.00 ? 51  TYR A HE1  4  
ATOM 5470  H HE2  . TYR A 1 48  ? 4.028   -4.662  14.988  1.00 0.00 ? 51  TYR A HE2  4  
ATOM 5471  H HH   . TYR A 1 48  ? 7.088   -6.028  14.638  1.00 0.00 ? 51  TYR A HH   4  
ATOM 5472  N N    . LEU A 1 49  ? 0.965   -5.190  10.015  1.00 0.00 ? 52  LEU A N    4  
ATOM 5473  C CA   . LEU A 1 49  ? -0.199  -5.734  10.692  1.00 0.00 ? 52  LEU A CA   4  
ATOM 5474  C C    . LEU A 1 49  ? 0.265   -6.682  11.791  1.00 0.00 ? 52  LEU A C    4  
ATOM 5475  O O    . LEU A 1 49  ? 1.466   -6.775  12.053  1.00 0.00 ? 52  LEU A O    4  
ATOM 5476  C CB   . LEU A 1 49  ? -1.122  -6.450  9.696   1.00 0.00 ? 52  LEU A CB   4  
ATOM 5477  C CG   . LEU A 1 49  ? -1.636  -5.592  8.533   1.00 0.00 ? 52  LEU A CG   4  
ATOM 5478  C CD1  . LEU A 1 49  ? -2.530  -6.417  7.621   1.00 0.00 ? 52  LEU A CD1  4  
ATOM 5479  C CD2  . LEU A 1 49  ? -2.387  -4.370  9.046   1.00 0.00 ? 52  LEU A CD2  4  
ATOM 5480  H H    . LEU A 1 49  ? 1.351   -5.671  9.252   1.00 0.00 ? 52  LEU A H    4  
ATOM 5481  H HA   . LEU A 1 49  ? -0.732  -4.913  11.145  1.00 0.00 ? 52  LEU A HA   4  
ATOM 5482  H HB2  . LEU A 1 49  ? -0.586  -7.288  9.282   1.00 0.00 ? 52  LEU A HB2  4  
ATOM 5483  H HB3  . LEU A 1 49  ? -1.979  -6.824  10.236  1.00 0.00 ? 52  LEU A HB3  4  
ATOM 5484  H HG   . LEU A 1 49  ? -0.793  -5.248  7.951   1.00 0.00 ? 52  LEU A HG   4  
ATOM 5485  H HD11 . LEU A 1 49  ? -2.927  -5.787  6.838   1.00 0.00 ? 52  LEU A HD11 4  
ATOM 5486  H HD12 . LEU A 1 49  ? -1.956  -7.220  7.182   1.00 0.00 ? 52  LEU A HD12 4  
ATOM 5487  H HD13 . LEU A 1 49  ? -3.344  -6.831  8.196   1.00 0.00 ? 52  LEU A HD13 4  
ATOM 5488  H HD21 . LEU A 1 49  ? -3.172  -4.686  9.717   1.00 0.00 ? 52  LEU A HD21 4  
ATOM 5489  H HD22 . LEU A 1 49  ? -1.704  -3.719  9.569   1.00 0.00 ? 52  LEU A HD22 4  
ATOM 5490  H HD23 . LEU A 1 49  ? -2.819  -3.838  8.211   1.00 0.00 ? 52  LEU A HD23 4  
ATOM 5491  N N    . LYS A 1 50  ? -0.652  -7.393  12.430  1.00 0.00 ? 53  LYS A N    4  
ATOM 5492  C CA   . LYS A 1 50  ? -0.275  -8.286  13.517  1.00 0.00 ? 53  LYS A CA   4  
ATOM 5493  C C    . LYS A 1 50  ? 0.563   -9.447  12.975  1.00 0.00 ? 53  LYS A C    4  
ATOM 5494  O O    . LYS A 1 50  ? 1.400   -10.013 13.682  1.00 0.00 ? 53  LYS A O    4  
ATOM 5495  C CB   . LYS A 1 50  ? -1.520  -8.798  14.247  1.00 0.00 ? 53  LYS A CB   4  
ATOM 5496  C CG   . LYS A 1 50  ? -1.212  -9.463  15.576  1.00 0.00 ? 53  LYS A CG   4  
ATOM 5497  C CD   . LYS A 1 50  ? -2.481  -9.769  16.350  1.00 0.00 ? 53  LYS A CD   4  
ATOM 5498  C CE   . LYS A 1 50  ? -2.176  -10.334 17.729  1.00 0.00 ? 53  LYS A CE   4  
ATOM 5499  N NZ   . LYS A 1 50  ? -1.416  -9.371  18.572  1.00 0.00 ? 53  LYS A NZ   4  
ATOM 5500  H H    . LYS A 1 50  ? -1.593  -7.323  12.166  1.00 0.00 ? 53  LYS A H    4  
ATOM 5501  H HA   . LYS A 1 50  ? 0.329   -7.720  14.209  1.00 0.00 ? 53  LYS A HA   4  
ATOM 5502  H HB2  . LYS A 1 50  ? -2.183  -7.966  14.433  1.00 0.00 ? 53  LYS A HB2  4  
ATOM 5503  H HB3  . LYS A 1 50  ? -2.024  -9.518  13.618  1.00 0.00 ? 53  LYS A HB3  4  
ATOM 5504  H HG2  . LYS A 1 50  ? -0.683  -10.385 15.391  1.00 0.00 ? 53  LYS A HG2  4  
ATOM 5505  H HG3  . LYS A 1 50  ? -0.593  -8.800  16.164  1.00 0.00 ? 53  LYS A HG3  4  
ATOM 5506  H HD2  . LYS A 1 50  ? -3.050  -8.859  16.462  1.00 0.00 ? 53  LYS A HD2  4  
ATOM 5507  H HD3  . LYS A 1 50  ? -3.062  -10.492 15.797  1.00 0.00 ? 53  LYS A HD3  4  
ATOM 5508  H HE2  . LYS A 1 50  ? -3.108  -10.570 18.221  1.00 0.00 ? 53  LYS A HE2  4  
ATOM 5509  H HE3  . LYS A 1 50  ? -1.593  -11.236 17.612  1.00 0.00 ? 53  LYS A HE3  4  
ATOM 5510  H HZ1  . LYS A 1 50  ? -1.233  -9.804  19.506  1.00 0.00 ? 53  LYS A HZ1  4  
ATOM 5511  H HZ3  . LYS A 1 50  ? -1.990  -8.515  18.727  1.00 0.00 ? 53  LYS A HZ3  4  
ATOM 5512  N N    . ASP A 1 51  ? 0.344   -9.771  11.706  1.00 0.00 ? 54  ASP A N    4  
ATOM 5513  C CA   . ASP A 1 51  ? 1.125   -10.800 11.014  1.00 0.00 ? 54  ASP A CA   4  
ATOM 5514  C C    . ASP A 1 51  ? 2.504   -10.285 10.610  1.00 0.00 ? 54  ASP A C    4  
ATOM 5515  O O    . ASP A 1 51  ? 3.332   -11.048 10.116  1.00 0.00 ? 54  ASP A O    4  
ATOM 5516  C CB   . ASP A 1 51  ? 0.394   -11.298 9.761   1.00 0.00 ? 54  ASP A CB   4  
ATOM 5517  C CG   . ASP A 1 51  ? -0.779  -12.201 10.077  1.00 0.00 ? 54  ASP A CG   4  
ATOM 5518  O OD1  . ASP A 1 51  ? -1.842  -11.683 10.472  1.00 0.00 ? 54  ASP A OD1  4  
ATOM 5519  O OD2  . ASP A 1 51  ? -0.640  -13.436 9.937   1.00 0.00 ? 54  ASP A OD2  4  
ATOM 5520  H H    . ASP A 1 51  ? -0.382  -9.316  11.224  1.00 0.00 ? 54  ASP A H    4  
ATOM 5521  H HA   . ASP A 1 51  ? 1.250   -11.628 11.694  1.00 0.00 ? 54  ASP A HA   4  
ATOM 5522  H HB2  . ASP A 1 51  ? 0.027   -10.449 9.205   1.00 0.00 ? 54  ASP A HB2  4  
ATOM 5523  H HB3  . ASP A 1 51  ? 1.091   -11.850 9.144   1.00 0.00 ? 54  ASP A HB3  4  
ATOM 5524  N N    . GLY A 1 52  ? 2.747   -8.996  10.805  1.00 0.00 ? 55  GLY A N    4  
ATOM 5525  C CA   . GLY A 1 52  ? 4.023   -8.414  10.427  1.00 0.00 ? 55  GLY A CA   4  
ATOM 5526  C C    . GLY A 1 52  ? 3.929   -7.617  9.142   1.00 0.00 ? 55  GLY A C    4  
ATOM 5527  O O    . GLY A 1 52  ? 2.825   -7.380  8.638   1.00 0.00 ? 55  GLY A O    4  
ATOM 5528  H H    . GLY A 1 52  ? 2.055   -8.429  11.210  1.00 0.00 ? 55  GLY A H    4  
ATOM 5529  H HA2  . GLY A 1 52  ? 4.362   -7.762  11.220  1.00 0.00 ? 55  GLY A HA2  4  
ATOM 5530  H HA3  . GLY A 1 52  ? 4.742   -9.208  10.295  1.00 0.00 ? 55  GLY A HA3  4  
ATOM 5531  N N    . TRP A 1 53  ? 5.078   -7.215  8.605   1.00 0.00 ? 56  TRP A N    4  
ATOM 5532  C CA   . TRP A 1 53  ? 5.119   -6.423  7.378   1.00 0.00 ? 56  TRP A CA   4  
ATOM 5533  C C    . TRP A 1 53  ? 4.567   -7.218  6.202   1.00 0.00 ? 56  TRP A C    4  
ATOM 5534  O O    . TRP A 1 53  ? 4.921   -8.382  6.004   1.00 0.00 ? 56  TRP A O    4  
ATOM 5535  C CB   . TRP A 1 53  ? 6.550   -5.974  7.058   1.00 0.00 ? 56  TRP A CB   4  
ATOM 5536  C CG   . TRP A 1 53  ? 7.129   -5.006  8.050   1.00 0.00 ? 56  TRP A CG   4  
ATOM 5537  C CD1  . TRP A 1 53  ? 8.097   -5.262  8.980   1.00 0.00 ? 56  TRP A CD1  4  
ATOM 5538  C CD2  . TRP A 1 53  ? 6.780   -3.623  8.207   1.00 0.00 ? 56  TRP A CD2  4  
ATOM 5539  N NE1  . TRP A 1 53  ? 8.370   -4.125  9.702   1.00 0.00 ? 56  TRP A NE1  4  
ATOM 5540  C CE2  . TRP A 1 53  ? 7.573   -3.106  9.249   1.00 0.00 ? 56  TRP A CE2  4  
ATOM 5541  C CE3  . TRP A 1 53  ? 5.876   -2.772  7.568   1.00 0.00 ? 56  TRP A CE3  4  
ATOM 5542  C CZ2  . TRP A 1 53  ? 7.485   -1.779  9.664   1.00 0.00 ? 56  TRP A CZ2  4  
ATOM 5543  C CZ3  . TRP A 1 53  ? 5.789   -1.459  7.983   1.00 0.00 ? 56  TRP A CZ3  4  
ATOM 5544  C CH2  . TRP A 1 53  ? 6.589   -0.972  9.020   1.00 0.00 ? 56  TRP A CH2  4  
ATOM 5545  H H    . TRP A 1 53  ? 5.921   -7.466  9.037   1.00 0.00 ? 56  TRP A H    4  
ATOM 5546  H HA   . TRP A 1 53  ? 4.502   -5.550  7.529   1.00 0.00 ? 56  TRP A HA   4  
ATOM 5547  H HB2  . TRP A 1 53  ? 7.190   -6.843  7.031   1.00 0.00 ? 56  TRP A HB2  4  
ATOM 5548  H HB3  . TRP A 1 53  ? 6.561   -5.501  6.086   1.00 0.00 ? 56  TRP A HB3  4  
ATOM 5549  H HD1  . TRP A 1 53  ? 8.573   -6.222  9.116   1.00 0.00 ? 56  TRP A HD1  4  
ATOM 5550  H HE1  . TRP A 1 53  ? 9.032   -4.058  10.435  1.00 0.00 ? 56  TRP A HE1  4  
ATOM 5551  H HE3  . TRP A 1 53  ? 5.248   -3.125  6.765   1.00 0.00 ? 56  TRP A HE3  4  
ATOM 5552  H HZ2  . TRP A 1 53  ? 8.095   -1.388  10.464  1.00 0.00 ? 56  TRP A HZ2  4  
ATOM 5553  H HZ3  . TRP A 1 53  ? 5.096   -0.790  7.501   1.00 0.00 ? 56  TRP A HZ3  4  
ATOM 5554  H HH2  . TRP A 1 53  ? 6.485   0.063   9.309   1.00 0.00 ? 56  TRP A HH2  4  
ATOM 5555  N N    . HIS A 1 54  ? 3.685   -6.597  5.435   1.00 0.00 ? 57  HIS A N    4  
ATOM 5556  C CA   . HIS A 1 54  ? 3.107   -7.243  4.266   1.00 0.00 ? 57  HIS A CA   4  
ATOM 5557  C C    . HIS A 1 54  ? 2.905   -6.251  3.133   1.00 0.00 ? 57  HIS A C    4  
ATOM 5558  O O    . HIS A 1 54  ? 2.466   -5.120  3.353   1.00 0.00 ? 57  HIS A O    4  
ATOM 5559  C CB   . HIS A 1 54  ? 1.779   -7.917  4.617   1.00 0.00 ? 57  HIS A CB   4  
ATOM 5560  C CG   . HIS A 1 54  ? 1.941   -9.253  5.274   1.00 0.00 ? 57  HIS A CG   4  
ATOM 5561  N ND1  . HIS A 1 54  ? 2.066   -9.415  6.639   1.00 0.00 ? 57  HIS A ND1  4  
ATOM 5562  C CD2  . HIS A 1 54  ? 1.998   -10.496 4.743   1.00 0.00 ? 57  HIS A CD2  4  
ATOM 5563  C CE1  . HIS A 1 54  ? 2.193   -10.699 6.917   1.00 0.00 ? 57  HIS A CE1  4  
ATOM 5564  N NE2  . HIS A 1 54  ? 2.153   -11.377 5.785   1.00 0.00 ? 57  HIS A NE2  4  
ATOM 5565  H H    . HIS A 1 54  ? 3.416   -5.675  5.659   1.00 0.00 ? 57  HIS A H    4  
ATOM 5566  H HA   . HIS A 1 54  ? 3.804   -8.002  3.937   1.00 0.00 ? 57  HIS A HA   4  
ATOM 5567  H HB2  . HIS A 1 54  ? 1.228   -7.281  5.295   1.00 0.00 ? 57  HIS A HB2  4  
ATOM 5568  H HB3  . HIS A 1 54  ? 1.202   -8.056  3.713   1.00 0.00 ? 57  HIS A HB3  4  
ATOM 5569  H HD1  . HIS A 1 54  ? 2.081   -8.692  7.303   1.00 0.00 ? 57  HIS A HD1  4  
ATOM 5570  H HD2  . HIS A 1 54  ? 1.931   -10.748 3.693   1.00 0.00 ? 57  HIS A HD2  4  
ATOM 5571  H HE1  . HIS A 1 54  ? 2.302   -11.123 7.901   1.00 0.00 ? 57  HIS A HE1  4  
ATOM 5572  N N    . MET A 1 55  ? 3.233   -6.690  1.927   1.00 0.00 ? 58  MET A N    4  
ATOM 5573  C CA   . MET A 1 55  ? 3.104   -5.867  0.734   1.00 0.00 ? 58  MET A CA   4  
ATOM 5574  C C    . MET A 1 55  ? 1.648   -5.777  0.315   1.00 0.00 ? 58  MET A C    4  
ATOM 5575  O O    . MET A 1 55  ? 0.997   -6.798  0.114   1.00 0.00 ? 58  MET A O    4  
ATOM 5576  C CB   . MET A 1 55  ? 3.918   -6.473  -0.412  1.00 0.00 ? 58  MET A CB   4  
ATOM 5577  C CG   . MET A 1 55  ? 5.394   -6.659  -0.098  1.00 0.00 ? 58  MET A CG   4  
ATOM 5578  S SD   . MET A 1 55  ? 6.250   -7.641  -1.348  1.00 0.00 ? 58  MET A SD   4  
ATOM 5579  C CE   . MET A 1 55  ? 5.872   -6.710  -2.830  1.00 0.00 ? 58  MET A CE   4  
ATOM 5580  H H    . MET A 1 55  ? 3.568   -7.610  1.833   1.00 0.00 ? 58  MET A H    4  
ATOM 5581  H HA   . MET A 1 55  ? 3.476   -4.879  0.957   1.00 0.00 ? 58  MET A HA   4  
ATOM 5582  H HB2  . MET A 1 55  ? 3.501   -7.437  -0.659  1.00 0.00 ? 58  MET A HB2  4  
ATOM 5583  H HB3  . MET A 1 55  ? 3.836   -5.827  -1.275  1.00 0.00 ? 58  MET A HB3  4  
ATOM 5584  H HG2  . MET A 1 55  ? 5.863   -5.689  -0.041  1.00 0.00 ? 58  MET A HG2  4  
ATOM 5585  H HG3  . MET A 1 55  ? 5.484   -7.158  0.855   1.00 0.00 ? 58  MET A HG3  4  
ATOM 5586  H HE1  . MET A 1 55  ? 4.800   -6.677  -2.969  1.00 0.00 ? 58  MET A HE1  4  
ATOM 5587  H HE2  . MET A 1 55  ? 6.254   -5.705  -2.733  1.00 0.00 ? 58  MET A HE2  4  
ATOM 5588  H HE3  . MET A 1 55  ? 6.331   -7.189  -3.682  1.00 0.00 ? 58  MET A HE3  4  
ATOM 5589  N N    . VAL A 1 56  ? 1.136   -4.566  0.183   1.00 0.00 ? 59  VAL A N    4  
ATOM 5590  C CA   . VAL A 1 56  ? -0.234  -4.383  -0.264  1.00 0.00 ? 59  VAL A CA   4  
ATOM 5591  C C    . VAL A 1 56  ? -0.303  -4.545  -1.777  1.00 0.00 ? 59  VAL A C    4  
ATOM 5592  O O    . VAL A 1 56  ? 0.457   -3.914  -2.515  1.00 0.00 ? 59  VAL A O    4  
ATOM 5593  C CB   . VAL A 1 56  ? -0.796  -3.001  0.139   1.00 0.00 ? 59  VAL A CB   4  
ATOM 5594  C CG1  . VAL A 1 56  ? -2.242  -2.847  -0.319  1.00 0.00 ? 59  VAL A CG1  4  
ATOM 5595  C CG2  . VAL A 1 56  ? -0.692  -2.791  1.642   1.00 0.00 ? 59  VAL A CG2  4  
ATOM 5596  H H    . VAL A 1 56  ? 1.692   -3.778  0.381   1.00 0.00 ? 59  VAL A H    4  
ATOM 5597  H HA   . VAL A 1 56  ? -0.839  -5.150  0.197   1.00 0.00 ? 59  VAL A HA   4  
ATOM 5598  H HB   . VAL A 1 56  ? -0.207  -2.239  -0.350  1.00 0.00 ? 59  VAL A HB   4  
ATOM 5599  H HG11 . VAL A 1 56  ? -2.604  -1.867  -0.042  1.00 0.00 ? 59  VAL A HG11 4  
ATOM 5600  H HG12 . VAL A 1 56  ? -2.294  -2.959  -1.392  1.00 0.00 ? 59  VAL A HG12 4  
ATOM 5601  H HG13 . VAL A 1 56  ? -2.853  -3.603  0.153   1.00 0.00 ? 59  VAL A HG13 4  
ATOM 5602  H HG21 . VAL A 1 56  ? -1.138  -1.843  1.904   1.00 0.00 ? 59  VAL A HG21 4  
ATOM 5603  H HG22 . VAL A 1 56  ? -1.211  -3.589  2.155   1.00 0.00 ? 59  VAL A HG22 4  
ATOM 5604  H HG23 . VAL A 1 56  ? 0.346   -2.792  1.935   1.00 0.00 ? 59  VAL A HG23 4  
ATOM 5605  N N    . CYS A 1 57  ? -1.189  -5.413  -2.236  1.00 0.00 ? 60  CYS A N    4  
ATOM 5606  C CA   . CYS A 1 57  ? -1.346  -5.651  -3.660  1.00 0.00 ? 60  CYS A CA   4  
ATOM 5607  C C    . CYS A 1 57  ? -2.301  -4.615  -4.248  1.00 0.00 ? 60  CYS A C    4  
ATOM 5608  O O    . CYS A 1 57  ? -3.348  -4.337  -3.665  1.00 0.00 ? 60  CYS A O    4  
ATOM 5609  C CB   . CYS A 1 57  ? -1.861  -7.073  -3.904  1.00 0.00 ? 60  CYS A CB   4  
ATOM 5610  S SG   . CYS A 1 57  ? -1.416  -7.758  -5.530  1.00 0.00 ? 60  CYS A SG   4  
ATOM 5611  H H    . CYS A 1 57  ? -1.750  -5.913  -1.600  1.00 0.00 ? 60  CYS A H    4  
ATOM 5612  H HA   . CYS A 1 57  ? -0.378  -5.537  -4.124  1.00 0.00 ? 60  CYS A HA   4  
ATOM 5613  H HB2  . CYS A 1 57  ? -1.451  -7.731  -3.149  1.00 0.00 ? 60  CYS A HB2  4  
ATOM 5614  H HB3  . CYS A 1 57  ? -2.941  -7.073  -3.831  1.00 0.00 ? 60  CYS A HB3  4  
ATOM 5615  N N    . SER A 1 58  ? -1.924  -4.042  -5.389  1.00 0.00 ? 61  SER A N    4  
ATOM 5616  C CA   . SER A 1 58  ? -2.621  -2.893  -5.971  1.00 0.00 ? 61  SER A CA   4  
ATOM 5617  C C    . SER A 1 58  ? -4.140  -3.076  -6.042  1.00 0.00 ? 61  SER A C    4  
ATOM 5618  O O    . SER A 1 58  ? -4.889  -2.246  -5.522  1.00 0.00 ? 61  SER A O    4  
ATOM 5619  C CB   . SER A 1 58  ? -2.067  -2.608  -7.366  1.00 0.00 ? 61  SER A CB   4  
ATOM 5620  O OG   . SER A 1 58  ? -0.656  -2.470  -7.333  1.00 0.00 ? 61  SER A OG   4  
ATOM 5621  H H    . SER A 1 58  ? -1.134  -4.402  -5.858  1.00 0.00 ? 61  SER A H    4  
ATOM 5622  H HA   . SER A 1 58  ? -2.414  -2.042  -5.347  1.00 0.00 ? 61  SER A HA   4  
ATOM 5623  H HB2  . SER A 1 58  ? -2.320  -3.425  -8.026  1.00 0.00 ? 61  SER A HB2  4  
ATOM 5624  H HB3  . SER A 1 58  ? -2.497  -1.691  -7.742  1.00 0.00 ? 61  SER A HB3  4  
ATOM 5625  H HG   . SER A 1 58  ? -0.383  -2.174  -6.460  1.00 0.00 ? 61  SER A HG   4  
ATOM 5626  N N    . GLN A 1 59  ? -4.591  -4.158  -6.671  1.00 0.00 ? 62  GLN A N    4  
ATOM 5627  C CA   . GLN A 1 59  ? -6.019  -4.366  -6.892  1.00 0.00 ? 62  GLN A CA   4  
ATOM 5628  C C    . GLN A 1 59  ? -6.709  -4.933  -5.644  1.00 0.00 ? 62  GLN A C    4  
ATOM 5629  O O    . GLN A 1 59  ? -7.342  -5.990  -5.677  1.00 0.00 ? 62  GLN A O    4  
ATOM 5630  C CB   . GLN A 1 59  ? -6.269  -5.251  -8.132  1.00 0.00 ? 62  GLN A CB   4  
ATOM 5631  C CG   . GLN A 1 59  ? -5.736  -6.678  -8.054  1.00 0.00 ? 62  GLN A CG   4  
ATOM 5632  C CD   . GLN A 1 59  ? -4.222  -6.780  -8.104  1.00 0.00 ? 62  GLN A CD   4  
ATOM 5633  O OE1  . GLN A 1 59  ? -3.535  -5.945  -8.700  1.00 0.00 ? 62  GLN A OE1  4  
ATOM 5634  N NE2  . GLN A 1 59  ? -3.695  -7.823  -7.488  1.00 0.00 ? 62  GLN A NE2  4  
ATOM 5635  H H    . GLN A 1 59  ? -3.953  -4.828  -6.991  1.00 0.00 ? 62  GLN A H    4  
ATOM 5636  H HA   . GLN A 1 59  ? -6.446  -3.393  -7.086  1.00 0.00 ? 62  GLN A HA   4  
ATOM 5637  H HB2  . GLN A 1 59  ? -7.333  -5.307  -8.298  1.00 0.00 ? 62  GLN A HB2  4  
ATOM 5638  H HB3  . GLN A 1 59  ? -5.815  -4.772  -8.988  1.00 0.00 ? 62  GLN A HB3  4  
ATOM 5639  H HG2  . GLN A 1 59  ? -6.072  -7.117  -7.126  1.00 0.00 ? 62  GLN A HG2  4  
ATOM 5640  H HG3  . GLN A 1 59  ? -6.145  -7.240  -8.879  1.00 0.00 ? 62  GLN A HG3  4  
ATOM 5641  H HE21 . GLN A 1 59  ? -4.303  -8.453  -7.047  1.00 0.00 ? 62  GLN A HE21 4  
ATOM 5642  H HE22 . GLN A 1 59  ? -2.723  -7.923  -7.490  1.00 0.00 ? 62  GLN A HE22 4  
ATOM 5643  N N    . SER A 1 60  ? -6.576  -4.210  -4.541  1.00 0.00 ? 63  SER A N    4  
ATOM 5644  C CA   . SER A 1 60  ? -7.263  -4.552  -3.307  1.00 0.00 ? 63  SER A CA   4  
ATOM 5645  C C    . SER A 1 60  ? -8.475  -3.645  -3.112  1.00 0.00 ? 63  SER A C    4  
ATOM 5646  O O    . SER A 1 60  ? -8.537  -2.556  -3.693  1.00 0.00 ? 63  SER A O    4  
ATOM 5647  C CB   . SER A 1 60  ? -6.321  -4.413  -2.107  1.00 0.00 ? 63  SER A CB   4  
ATOM 5648  O OG   . SER A 1 60  ? -5.288  -5.384  -2.149  1.00 0.00 ? 63  SER A OG   4  
ATOM 5649  H H    . SER A 1 60  ? -6.001  -3.413  -4.563  1.00 0.00 ? 63  SER A H    4  
ATOM 5650  H HA   . SER A 1 60  ? -7.595  -5.579  -3.384  1.00 0.00 ? 63  SER A HA   4  
ATOM 5651  H HB2  . SER A 1 60  ? -5.871  -3.430  -2.118  1.00 0.00 ? 63  SER A HB2  4  
ATOM 5652  H HB3  . SER A 1 60  ? -6.883  -4.539  -1.192  1.00 0.00 ? 63  SER A HB3  4  
ATOM 5653  H HG   . SER A 1 60  ? -4.586  -5.077  -2.742  1.00 0.00 ? 63  SER A HG   4  
ATOM 5654  N N    . TRP A 1 61  ? -9.418  -4.100  -2.287  1.00 0.00 ? 64  TRP A N    4  
ATOM 5655  C CA   . TRP A 1 61  ? -10.636 -3.354  -1.960  1.00 0.00 ? 64  TRP A CA   4  
ATOM 5656  C C    . TRP A 1 61  ? -11.482 -3.080  -3.204  1.00 0.00 ? 64  TRP A C    4  
ATOM 5657  O O    . TRP A 1 61  ? -12.409 -3.829  -3.519  1.00 0.00 ? 64  TRP A O    4  
ATOM 5658  C CB   . TRP A 1 61  ? -10.298 -2.034  -1.250  1.00 0.00 ? 64  TRP A CB   4  
ATOM 5659  C CG   . TRP A 1 61  ? -9.494  -2.214  0.002   1.00 0.00 ? 64  TRP A CG   4  
ATOM 5660  C CD1  . TRP A 1 61  ? -9.915  -2.773  1.172   1.00 0.00 ? 64  TRP A CD1  4  
ATOM 5661  C CD2  . TRP A 1 61  ? -8.132  -1.824  0.211   1.00 0.00 ? 64  TRP A CD2  4  
ATOM 5662  N NE1  . TRP A 1 61  ? -8.902  -2.750  2.099   1.00 0.00 ? 64  TRP A NE1  4  
ATOM 5663  C CE2  . TRP A 1 61  ? -7.795  -2.177  1.532   1.00 0.00 ? 64  TRP A CE2  4  
ATOM 5664  C CE3  . TRP A 1 61  ? -7.165  -1.213  -0.590  1.00 0.00 ? 64  TRP A CE3  4  
ATOM 5665  C CZ2  . TRP A 1 61  ? -6.530  -1.937  2.065   1.00 0.00 ? 64  TRP A CZ2  4  
ATOM 5666  C CZ3  . TRP A 1 61  ? -5.912  -0.977  -0.059  1.00 0.00 ? 64  TRP A CZ3  4  
ATOM 5667  C CH2  . TRP A 1 61  ? -5.604  -1.340  1.256   1.00 0.00 ? 64  TRP A CH2  4  
ATOM 5668  H H    . TRP A 1 61  ? -9.286  -4.979  -1.867  1.00 0.00 ? 64  TRP A H    4  
ATOM 5669  H HA   . TRP A 1 61  ? -11.216 -3.968  -1.287  1.00 0.00 ? 64  TRP A HA   4  
ATOM 5670  H HB2  . TRP A 1 61  ? -9.726  -1.410  -1.923  1.00 0.00 ? 64  TRP A HB2  4  
ATOM 5671  H HB3  . TRP A 1 61  ? -11.216 -1.528  -0.987  1.00 0.00 ? 64  TRP A HB3  4  
ATOM 5672  H HD1  . TRP A 1 61  ? -10.907 -3.162  1.335   1.00 0.00 ? 64  TRP A HD1  4  
ATOM 5673  H HE1  . TRP A 1 61  ? -8.966  -3.092  3.024   1.00 0.00 ? 64  TRP A HE1  4  
ATOM 5674  H HE3  . TRP A 1 61  ? -7.384  -0.925  -1.607  1.00 0.00 ? 64  TRP A HE3  4  
ATOM 5675  H HZ2  . TRP A 1 61  ? -6.274  -2.211  3.078   1.00 0.00 ? 64  TRP A HZ2  4  
ATOM 5676  H HZ3  . TRP A 1 61  ? -5.151  -0.508  -0.664  1.00 0.00 ? 64  TRP A HZ3  4  
ATOM 5677  H HH2  . TRP A 1 61  ? -4.611  -1.137  1.628   1.00 0.00 ? 64  TRP A HH2  4  
ATOM 5678  N N    . GLY A 1 62  ? -11.154 -2.009  -3.907  1.00 0.00 ? 65  GLY A N    4  
ATOM 5679  C CA   . GLY A 1 62  ? -11.877 -1.655  -5.108  1.00 0.00 ? 65  GLY A CA   4  
ATOM 5680  C C    . GLY A 1 62  ? -11.014 -0.898  -6.097  1.00 0.00 ? 65  GLY A C    4  
ATOM 5681  O O    . GLY A 1 62  ? -11.513 -0.050  -6.842  1.00 0.00 ? 65  GLY A O    4  
ATOM 5682  H H    . GLY A 1 62  ? -10.407 -1.454  -3.603  1.00 0.00 ? 65  GLY A H    4  
ATOM 5683  H HA2  . GLY A 1 62  ? -12.240 -2.557  -5.578  1.00 0.00 ? 65  GLY A HA2  4  
ATOM 5684  H HA3  . GLY A 1 62  ? -12.720 -1.036  -4.838  1.00 0.00 ? 65  GLY A HA3  4  
ATOM 5685  N N    . ARG A 1 63  ? -9.718  -1.192  -6.107  1.00 0.00 ? 66  ARG A N    4  
ATOM 5686  C CA   . ARG A 1 63  ? -8.800  -0.528  -7.019  1.00 0.00 ? 66  ARG A CA   4  
ATOM 5687  C C    . ARG A 1 63  ? -8.526  -1.396  -8.235  1.00 0.00 ? 66  ARG A C    4  
ATOM 5688  O O    . ARG A 1 63  ? -8.309  -2.601  -8.120  1.00 0.00 ? 66  ARG A O    4  
ATOM 5689  C CB   . ARG A 1 63  ? -7.493  -0.157  -6.313  1.00 0.00 ? 66  ARG A CB   4  
ATOM 5690  C CG   . ARG A 1 63  ? -7.571  1.173   -5.576  1.00 0.00 ? 66  ARG A CG   4  
ATOM 5691  C CD   . ARG A 1 63  ? -7.786  2.327   -6.549  1.00 0.00 ? 66  ARG A CD   4  
ATOM 5692  N NE   . ARG A 1 63  ? -8.061  3.592   -5.867  1.00 0.00 ? 66  ARG A NE   4  
ATOM 5693  C CZ   . ARG A 1 63  ? -9.237  4.214   -5.931  1.00 0.00 ? 66  ARG A CZ   4  
ATOM 5694  N NH1  . ARG A 1 63  ? -10.241 3.648   -6.582  1.00 0.00 ? 66  ARG A NH1  4  
ATOM 5695  N NH2  . ARG A 1 63  ? -9.416  5.394   -5.355  1.00 0.00 ? 66  ARG A NH2  4  
ATOM 5696  H H    . ARG A 1 63  ? -9.375  -1.888  -5.505  1.00 0.00 ? 66  ARG A H    4  
ATOM 5697  H HA   . ARG A 1 63  ? -9.281  0.377   -7.353  1.00 0.00 ? 66  ARG A HA   4  
ATOM 5698  H HB2  . ARG A 1 63  ? -7.252  -0.929  -5.595  1.00 0.00 ? 66  ARG A HB2  4  
ATOM 5699  H HB3  . ARG A 1 63  ? -6.701  -0.095  -7.046  1.00 0.00 ? 66  ARG A HB3  4  
ATOM 5700  H HG2  . ARG A 1 63  ? -8.396  1.140   -4.879  1.00 0.00 ? 66  ARG A HG2  4  
ATOM 5701  H HG3  . ARG A 1 63  ? -6.648  1.333   -5.037  1.00 0.00 ? 66  ARG A HG3  4  
ATOM 5702  H HD2  . ARG A 1 63  ? -6.899  2.442   -7.152  1.00 0.00 ? 66  ARG A HD2  4  
ATOM 5703  H HD3  . ARG A 1 63  ? -8.622  2.091   -7.190  1.00 0.00 ? 66  ARG A HD3  4  
ATOM 5704  H HE   . ARG A 1 63  ? -7.326  4.004   -5.364  1.00 0.00 ? 66  ARG A HE   4  
ATOM 5705  H HH12 . ARG A 1 63  ? -10.949 3.138   -6.068  1.00 0.00 ? 66  ARG A HH12 4  
ATOM 5706  H HH21 . ARG A 1 63  ? -8.668  5.839   -4.864  1.00 0.00 ? 66  ARG A HH21 4  
ATOM 5707  H HH22 . ARG A 1 63  ? -10.321 5.845   -5.401  1.00 0.00 ? 66  ARG A HH22 4  
ATOM 5708  N N    . SER A 1 64  ? -8.568  -0.773  -9.397  1.00 0.00 ? 67  SER A N    4  
ATOM 5709  C CA   . SER A 1 64  ? -8.355  -1.465  -10.650 1.00 0.00 ? 67  SER A CA   4  
ATOM 5710  C C    . SER A 1 64  ? -7.054  -0.996  -11.303 1.00 0.00 ? 67  SER A C    4  
ATOM 5711  O O    . SER A 1 64  ? -6.327  -0.176  -10.741 1.00 0.00 ? 67  SER A O    4  
ATOM 5712  C CB   . SER A 1 64  ? -9.556  -1.232  -11.566 1.00 0.00 ? 67  SER A CB   4  
ATOM 5713  O OG   . SER A 1 64  ? -9.954  0.128   -11.551 1.00 0.00 ? 67  SER A OG   4  
ATOM 5714  H H    . SER A 1 64  ? -8.750  0.192   -9.413  1.00 0.00 ? 67  SER A H    4  
ATOM 5715  H HA   . SER A 1 64  ? -8.275  -2.519  -10.436 1.00 0.00 ? 67  SER A HA   4  
ATOM 5716  H HB2  . SER A 1 64  ? -9.293  -1.506  -12.576 1.00 0.00 ? 67  SER A HB2  4  
ATOM 5717  H HB3  . SER A 1 64  ? -10.384 -1.840  -11.232 1.00 0.00 ? 67  SER A HB3  4  
ATOM 5718  H HG   . SER A 1 64  ? -10.244 0.370   -10.663 1.00 0.00 ? 67  SER A HG   4  
ATOM 5719  N N    . SER A 1 65  ? -6.772  -1.515  -12.490 1.00 0.00 ? 68  SER A N    4  
ATOM 5720  C CA   . SER A 1 65  ? -5.487  -1.303  -13.145 1.00 0.00 ? 68  SER A CA   4  
ATOM 5721  C C    . SER A 1 65  ? -5.414  0.029   -13.898 1.00 0.00 ? 68  SER A C    4  
ATOM 5722  O O    . SER A 1 65  ? -5.186  0.057   -15.111 1.00 0.00 ? 68  SER A O    4  
ATOM 5723  C CB   . SER A 1 65  ? -5.222  -2.469  -14.095 1.00 0.00 ? 68  SER A CB   4  
ATOM 5724  O OG   . SER A 1 65  ? -6.411  -2.841  -14.778 1.00 0.00 ? 68  SER A OG   4  
ATOM 5725  H H    . SER A 1 65  ? -7.447  -2.058  -12.948 1.00 0.00 ? 68  SER A H    4  
ATOM 5726  H HA   . SER A 1 65  ? -4.727  -1.307  -12.379 1.00 0.00 ? 68  SER A HA   4  
ATOM 5727  H HB2  . SER A 1 65  ? -4.480  -2.178  -14.822 1.00 0.00 ? 68  SER A HB2  4  
ATOM 5728  H HB3  . SER A 1 65  ? -4.865  -3.318  -13.531 1.00 0.00 ? 68  SER A HB3  4  
ATOM 5729  H HG   . SER A 1 65  ? -6.208  -3.544  -15.414 1.00 0.00 ? 68  SER A HG   4  
ATOM 5730  N N    . LYS A 1 66  ? -5.607  1.124   -13.173 1.00 0.00 ? 69  LYS A N    4  
ATOM 5731  C CA   . LYS A 1 66  ? -5.419  2.465   -13.717 1.00 0.00 ? 69  LYS A CA   4  
ATOM 5732  C C    . LYS A 1 66  ? -5.353  3.469   -12.570 1.00 0.00 ? 69  LYS A C    4  
ATOM 5733  O O    . LYS A 1 66  ? -5.922  3.236   -11.503 1.00 0.00 ? 69  LYS A O    4  
ATOM 5734  C CB   . LYS A 1 66  ? -6.543  2.848   -14.704 1.00 0.00 ? 69  LYS A CB   4  
ATOM 5735  C CG   . LYS A 1 66  ? -7.870  3.239   -14.057 1.00 0.00 ? 69  LYS A CG   4  
ATOM 5736  C CD   . LYS A 1 66  ? -8.588  2.045   -13.456 1.00 0.00 ? 69  LYS A CD   4  
ATOM 5737  C CE   . LYS A 1 66  ? -9.042  1.058   -14.521 1.00 0.00 ? 69  LYS A CE   4  
ATOM 5738  N NZ   . LYS A 1 66  ? -10.091 1.632   -15.406 1.00 0.00 ? 69  LYS A NZ   4  
ATOM 5739  H H    . LYS A 1 66  ? -5.882  1.031   -12.231 1.00 0.00 ? 69  LYS A H    4  
ATOM 5740  H HA   . LYS A 1 66  ? -4.472  2.476   -14.238 1.00 0.00 ? 69  LYS A HA   4  
ATOM 5741  H HB2  . LYS A 1 66  ? -6.206  3.681   -15.302 1.00 0.00 ? 69  LYS A HB2  4  
ATOM 5742  H HB3  . LYS A 1 66  ? -6.724  2.007   -15.357 1.00 0.00 ? 69  LYS A HB3  4  
ATOM 5743  H HG2  . LYS A 1 66  ? -7.678  3.957   -13.275 1.00 0.00 ? 69  LYS A HG2  4  
ATOM 5744  H HG3  . LYS A 1 66  ? -8.504  3.688   -14.809 1.00 0.00 ? 69  LYS A HG3  4  
ATOM 5745  H HD2  . LYS A 1 66  ? -7.917  1.540   -12.777 1.00 0.00 ? 69  LYS A HD2  4  
ATOM 5746  H HD3  . LYS A 1 66  ? -9.453  2.397   -12.913 1.00 0.00 ? 69  LYS A HD3  4  
ATOM 5747  H HE2  . LYS A 1 66  ? -8.190  0.780   -15.124 1.00 0.00 ? 69  LYS A HE2  4  
ATOM 5748  H HE3  . LYS A 1 66  ? -9.437  0.178   -14.032 1.00 0.00 ? 69  LYS A HE3  4  
ATOM 5749  H HZ1  . LYS A 1 66  ? -10.388 0.907   -16.097 1.00 0.00 ? 69  LYS A HZ1  4  
ATOM 5750  H HZ3  . LYS A 1 66  ? -9.696  2.436   -15.940 1.00 0.00 ? 69  LYS A HZ3  4  
ATOM 5751  N N    . GLN A 1 67  ? -4.637  4.565   -12.781 1.00 0.00 ? 70  GLN A N    4  
ATOM 5752  C CA   . GLN A 1 67  ? -4.509  5.594   -11.761 1.00 0.00 ? 70  GLN A CA   4  
ATOM 5753  C C    . GLN A 1 67  ? -5.823  6.349   -11.609 1.00 0.00 ? 70  GLN A C    4  
ATOM 5754  O O    . GLN A 1 67  ? -6.370  6.864   -12.590 1.00 0.00 ? 70  GLN A O    4  
ATOM 5755  C CB   . GLN A 1 67  ? -3.386  6.574   -12.115 1.00 0.00 ? 70  GLN A CB   4  
ATOM 5756  C CG   . GLN A 1 67  ? -3.222  7.698   -11.100 1.00 0.00 ? 70  GLN A CG   4  
ATOM 5757  C CD   . GLN A 1 67  ? -2.204  8.737   -11.526 1.00 0.00 ? 70  GLN A CD   4  
ATOM 5758  O OE1  . GLN A 1 67  ? -1.023  8.641   -11.200 1.00 0.00 ? 70  GLN A OE1  4  
ATOM 5759  N NE2  . GLN A 1 67  ? -2.658  9.737   -12.263 1.00 0.00 ? 70  GLN A NE2  4  
ATOM 5760  H H    . GLN A 1 67  ? -4.187  4.686   -13.646 1.00 0.00 ? 70  GLN A H    4  
ATOM 5761  H HA   . GLN A 1 67  ? -4.272  5.107   -10.826 1.00 0.00 ? 70  GLN A HA   4  
ATOM 5762  H HB2  . GLN A 1 67  ? -2.454  6.031   -12.173 1.00 0.00 ? 70  GLN A HB2  4  
ATOM 5763  H HB3  . GLN A 1 67  ? -3.597  7.015   -13.078 1.00 0.00 ? 70  GLN A HB3  4  
ATOM 5764  H HG2  . GLN A 1 67  ? -4.174  8.188   -10.968 1.00 0.00 ? 70  GLN A HG2  4  
ATOM 5765  H HG3  . GLN A 1 67  ? -2.906  7.272   -10.159 1.00 0.00 ? 70  GLN A HG3  4  
ATOM 5766  H HE21 . GLN A 1 67  ? -3.615  9.748   -12.494 1.00 0.00 ? 70  GLN A HE21 4  
ATOM 5767  H HE22 . GLN A 1 67  ? -2.023  10.427  -12.549 1.00 0.00 ? 70  GLN A HE22 4  
ATOM 5768  N N    . TRP A 1 68  ? -6.323  6.411   -10.383 1.00 0.00 ? 71  TRP A N    4  
ATOM 5769  C CA   . TRP A 1 68  ? -7.574  7.099   -10.100 1.00 0.00 ? 71  TRP A CA   4  
ATOM 5770  C C    . TRP A 1 68  ? -7.303  8.586   -9.882  1.00 0.00 ? 71  TRP A C    4  
ATOM 5771  O O    . TRP A 1 68  ? -6.172  8.967   -9.572  1.00 0.00 ? 71  TRP A O    4  
ATOM 5772  C CB   . TRP A 1 68  ? -8.249  6.484   -8.865  1.00 0.00 ? 71  TRP A CB   4  
ATOM 5773  C CG   . TRP A 1 68  ? -9.714  6.788   -8.757  1.00 0.00 ? 71  TRP A CG   4  
ATOM 5774  C CD1  . TRP A 1 68  ? -10.290 7.848   -8.122  1.00 0.00 ? 71  TRP A CD1  4  
ATOM 5775  C CD2  . TRP A 1 68  ? -10.789 6.013   -9.298  1.00 0.00 ? 71  TRP A CD2  4  
ATOM 5776  N NE1  . TRP A 1 68  ? -11.656 7.784   -8.243  1.00 0.00 ? 71  TRP A NE1  4  
ATOM 5777  C CE2  . TRP A 1 68  ? -11.987 6.664   -8.956  1.00 0.00 ? 71  TRP A CE2  4  
ATOM 5778  C CE3  . TRP A 1 68  ? -10.853 4.830   -10.040 1.00 0.00 ? 71  TRP A CE3  4  
ATOM 5779  C CZ2  . TRP A 1 68  ? -13.235 6.172   -9.333  1.00 0.00 ? 71  TRP A CZ2  4  
ATOM 5780  C CZ3  . TRP A 1 68  ? -12.093 4.344   -10.410 1.00 0.00 ? 71  TRP A CZ3  4  
ATOM 5781  C CH2  . TRP A 1 68  ? -13.268 5.014   -10.057 1.00 0.00 ? 71  TRP A CH2  4  
ATOM 5782  H H    . TRP A 1 68  ? -5.835  5.989   -9.648  1.00 0.00 ? 71  TRP A H    4  
ATOM 5783  H HA   . TRP A 1 68  ? -8.222  6.980   -10.955 1.00 0.00 ? 71  TRP A HA   4  
ATOM 5784  H HB2  . TRP A 1 68  ? -8.135  5.410   -8.896  1.00 0.00 ? 71  TRP A HB2  4  
ATOM 5785  H HB3  . TRP A 1 68  ? -7.764  6.864   -7.977  1.00 0.00 ? 71  TRP A HB3  4  
ATOM 5786  H HD1  . TRP A 1 68  ? -9.738  8.622   -7.611  1.00 0.00 ? 71  TRP A HD1  4  
ATOM 5787  H HE1  . TRP A 1 68  ? -12.299 8.440   -7.873  1.00 0.00 ? 71  TRP A HE1  4  
ATOM 5788  H HE3  . TRP A 1 68  ? -9.957  4.300   -10.322 1.00 0.00 ? 71  TRP A HE3  4  
ATOM 5789  H HZ2  . TRP A 1 68  ? -14.153 6.676   -9.069  1.00 0.00 ? 71  TRP A HZ2  4  
ATOM 5790  H HZ3  . TRP A 1 68  ? -12.163 3.432   -10.982 1.00 0.00 ? 71  TRP A HZ3  4  
ATOM 5791  H HH2  . TRP A 1 68  ? -14.212 4.595   -10.369 1.00 0.00 ? 71  TRP A HH2  4  
ATOM 5792  N N    . GLU A 1 69  ? -8.322  9.422   -10.048 1.00 0.00 ? 72  GLU A N    4  
ATOM 5793  C CA   . GLU A 1 69  ? -8.153  10.868  -9.899  1.00 0.00 ? 72  GLU A CA   4  
ATOM 5794  C C    . GLU A 1 69  ? -7.673  11.260  -8.500  1.00 0.00 ? 72  GLU A C    4  
ATOM 5795  O O    . GLU A 1 69  ? -6.856  12.173  -8.357  1.00 0.00 ? 72  GLU A O    4  
ATOM 5796  C CB   . GLU A 1 69  ? -9.452  11.608  -10.222 1.00 0.00 ? 72  GLU A CB   4  
ATOM 5797  C CG   . GLU A 1 69  ? -9.779  11.660  -11.702 1.00 0.00 ? 72  GLU A CG   4  
ATOM 5798  C CD   . GLU A 1 69  ? -10.940 12.584  -11.994 1.00 0.00 ? 72  GLU A CD   4  
ATOM 5799  O OE1  . GLU A 1 69  ? -10.726 13.813  -12.036 1.00 0.00 ? 72  GLU A OE1  4  
ATOM 5800  O OE2  . GLU A 1 69  ? -12.075 12.092  -12.167 1.00 0.00 ? 72  GLU A OE2  4  
ATOM 5801  H H    . GLU A 1 69  ? -9.207  9.062   -10.290 1.00 0.00 ? 72  GLU A H    4  
ATOM 5802  H HA   . GLU A 1 69  ? -7.400  11.176  -10.609 1.00 0.00 ? 72  GLU A HA   4  
ATOM 5803  H HB2  . GLU A 1 69  ? -10.269 11.117  -9.714  1.00 0.00 ? 72  GLU A HB2  4  
ATOM 5804  H HB3  . GLU A 1 69  ? -9.372  12.622  -9.858  1.00 0.00 ? 72  GLU A HB3  4  
ATOM 5805  H HG2  . GLU A 1 69  ? -8.911  12.015  -12.237 1.00 0.00 ? 72  GLU A HG2  4  
ATOM 5806  H HG3  . GLU A 1 69  ? -10.031 10.666  -12.041 1.00 0.00 ? 72  GLU A HG3  4  
ATOM 5807  N N    . ASP A 1 70  ? -8.163  10.575  -7.471  1.00 0.00 ? 73  ASP A N    4  
ATOM 5808  C CA   . ASP A 1 70  ? -7.840  10.950  -6.096  1.00 0.00 ? 73  ASP A CA   4  
ATOM 5809  C C    . ASP A 1 70  ? -7.004  9.877   -5.400  1.00 0.00 ? 73  ASP A C    4  
ATOM 5810  O O    . ASP A 1 70  ? -7.533  8.865   -4.933  1.00 0.00 ? 73  ASP A O    4  
ATOM 5811  C CB   . ASP A 1 70  ? -9.116  11.210  -5.290  1.00 0.00 ? 73  ASP A CB   4  
ATOM 5812  C CG   . ASP A 1 70  ? -8.822  11.795  -3.922  1.00 0.00 ? 73  ASP A CG   4  
ATOM 5813  O OD1  . ASP A 1 70  ? -8.543  11.023  -2.986  1.00 0.00 ? 73  ASP A OD1  4  
ATOM 5814  O OD2  . ASP A 1 70  ? -8.868  13.034  -3.778  1.00 0.00 ? 73  ASP A OD2  4  
ATOM 5815  H H    . ASP A 1 70  ? -8.741  9.804   -7.636  1.00 0.00 ? 73  ASP A H    4  
ATOM 5816  H HA   . ASP A 1 70  ? -7.264  11.863  -6.133  1.00 0.00 ? 73  ASP A HA   4  
ATOM 5817  H HB2  . ASP A 1 70  ? -9.745  11.904  -5.832  1.00 0.00 ? 73  ASP A HB2  4  
ATOM 5818  H HB3  . ASP A 1 70  ? -9.645  10.278  -5.158  1.00 0.00 ? 73  ASP A HB3  4  
ATOM 5819  N N    . PRO A 1 71  ? -5.675  10.064  -5.361  1.00 0.00 ? 74  PRO A N    4  
ATOM 5820  C CA   . PRO A 1 71  ? -4.764  9.225   -4.603  1.00 0.00 ? 74  PRO A CA   4  
ATOM 5821  C C    . PRO A 1 71  ? -4.344  9.876   -3.281  1.00 0.00 ? 74  PRO A C    4  
ATOM 5822  O O    . PRO A 1 71  ? -3.463  9.379   -2.578  1.00 0.00 ? 74  PRO A O    4  
ATOM 5823  C CB   . PRO A 1 71  ? -3.568  9.127   -5.551  1.00 0.00 ? 74  PRO A CB   4  
ATOM 5824  C CG   . PRO A 1 71  ? -3.621  10.360  -6.407  1.00 0.00 ? 74  PRO A CG   4  
ATOM 5825  C CD   . PRO A 1 71  ? -4.921  11.073  -6.107  1.00 0.00 ? 74  PRO A CD   4  
ATOM 5826  H HA   . PRO A 1 71  ? -5.170  8.243   -4.420  1.00 0.00 ? 74  PRO A HA   4  
ATOM 5827  H HB2  . PRO A 1 71  ? -2.658  9.089   -4.974  1.00 0.00 ? 74  PRO A HB2  4  
ATOM 5828  H HB3  . PRO A 1 71  ? -3.656  8.234   -6.148  1.00 0.00 ? 74  PRO A HB3  4  
ATOM 5829  H HG2  . PRO A 1 71  ? -2.786  11.001  -6.168  1.00 0.00 ? 74  PRO A HG2  4  
ATOM 5830  H HG3  . PRO A 1 71  ? -3.586  10.078  -7.448  1.00 0.00 ? 74  PRO A HG3  4  
ATOM 5831  H HD2  . PRO A 1 71  ? -4.742  11.949  -5.500  1.00 0.00 ? 74  PRO A HD2  4  
ATOM 5832  H HD3  . PRO A 1 71  ? -5.428  11.339  -7.023  1.00 0.00 ? 74  PRO A HD3  4  
ATOM 5833  N N    . SER A 1 72  ? -4.999  10.982  -2.945  1.00 0.00 ? 75  SER A N    4  
ATOM 5834  C CA   . SER A 1 72  ? -4.617  11.792  -1.794  1.00 0.00 ? 75  SER A CA   4  
ATOM 5835  C C    . SER A 1 72  ? -5.067  11.160  -0.478  1.00 0.00 ? 75  SER A C    4  
ATOM 5836  O O    . SER A 1 72  ? -4.753  11.664  0.598   1.00 0.00 ? 75  SER A O    4  
ATOM 5837  C CB   . SER A 1 72  ? -5.213  13.192  -1.937  1.00 0.00 ? 75  SER A CB   4  
ATOM 5838  O OG   . SER A 1 72  ? -5.009  13.694  -3.249  1.00 0.00 ? 75  SER A OG   4  
ATOM 5839  H H    . SER A 1 72  ? -5.760  11.267  -3.491  1.00 0.00 ? 75  SER A H    4  
ATOM 5840  H HA   . SER A 1 72  ? -3.541  11.872  -1.790  1.00 0.00 ? 75  SER A HA   4  
ATOM 5841  H HB2  . SER A 1 72  ? -6.273  13.154  -1.738  1.00 0.00 ? 75  SER A HB2  4  
ATOM 5842  H HB3  . SER A 1 72  ? -4.737  13.857  -1.233  1.00 0.00 ? 75  SER A HB3  4  
ATOM 5843  H HG   . SER A 1 72  ? -4.058  13.767  -3.425  1.00 0.00 ? 75  SER A HG   4  
ATOM 5844  N N    . GLN A 1 73  ? -5.786  10.047  -0.564  1.00 0.00 ? 76  GLN A N    4  
ATOM 5845  C CA   . GLN A 1 73  ? -6.263  9.350   0.626   1.00 0.00 ? 76  GLN A CA   4  
ATOM 5846  C C    . GLN A 1 73  ? -5.100  8.715   1.387   1.00 0.00 ? 76  GLN A C    4  
ATOM 5847  O O    . GLN A 1 73  ? -5.230  8.351   2.554   1.00 0.00 ? 76  GLN A O    4  
ATOM 5848  C CB   . GLN A 1 73  ? -7.275  8.271   0.238   1.00 0.00 ? 76  GLN A CB   4  
ATOM 5849  C CG   . GLN A 1 73  ? -8.427  8.799   -0.598  1.00 0.00 ? 76  GLN A CG   4  
ATOM 5850  C CD   . GLN A 1 73  ? -9.265  9.839   0.126   1.00 0.00 ? 76  GLN A CD   4  
ATOM 5851  O OE1  . GLN A 1 73  ? -9.426  9.794   1.347   1.00 0.00 ? 76  GLN A OE1  4  
ATOM 5852  N NE2  . GLN A 1 73  ? -9.777  10.800  -0.621  1.00 0.00 ? 76  GLN A NE2  4  
ATOM 5853  H H    . GLN A 1 73  ? -6.010  9.691   -1.449  1.00 0.00 ? 76  GLN A H    4  
ATOM 5854  H HA   . GLN A 1 73  ? -6.747  10.074  1.264   1.00 0.00 ? 76  GLN A HA   4  
ATOM 5855  H HB2  . GLN A 1 73  ? -6.767  7.503   -0.330  1.00 0.00 ? 76  GLN A HB2  4  
ATOM 5856  H HB3  . GLN A 1 73  ? -7.680  7.833   1.137   1.00 0.00 ? 76  GLN A HB3  4  
ATOM 5857  H HG2  . GLN A 1 73  ? -8.025  9.248   -1.494  1.00 0.00 ? 76  GLN A HG2  4  
ATOM 5858  H HG3  . GLN A 1 73  ? -9.065  7.971   -0.871  1.00 0.00 ? 76  GLN A HG3  4  
ATOM 5859  H HE21 . GLN A 1 73  ? -9.582  10.787  -1.594  1.00 0.00 ? 76  GLN A HE21 4  
ATOM 5860  H HE22 . GLN A 1 73  ? -10.325 11.487  -0.190  1.00 0.00 ? 76  GLN A HE22 4  
ATOM 5861  N N    . ALA A 1 74  ? -3.962  8.598   0.719   1.00 0.00 ? 77  ALA A N    4  
ATOM 5862  C CA   . ALA A 1 74  ? -2.784  7.983   1.314   1.00 0.00 ? 77  ALA A CA   4  
ATOM 5863  C C    . ALA A 1 74  ? -1.837  9.042   1.870   1.00 0.00 ? 77  ALA A C    4  
ATOM 5864  O O    . ALA A 1 74  ? -0.673  8.762   2.159   1.00 0.00 ? 77  ALA A O    4  
ATOM 5865  C CB   . ALA A 1 74  ? -2.074  7.119   0.285   1.00 0.00 ? 77  ALA A CB   4  
ATOM 5866  H H    . ALA A 1 74  ? -3.910  8.939   -0.200  1.00 0.00 ? 77  ALA A H    4  
ATOM 5867  H HA   . ALA A 1 74  ? -3.114  7.347   2.121   1.00 0.00 ? 77  ALA A HA   4  
ATOM 5868  H HB1  . ALA A 1 74  ? -2.761  6.378   -0.099  1.00 0.00 ? 77  ALA A HB1  4  
ATOM 5869  H HB2  . ALA A 1 74  ? -1.724  7.742   -0.527  1.00 0.00 ? 77  ALA A HB2  4  
ATOM 5870  H HB3  . ALA A 1 74  ? -1.231  6.625   0.747   1.00 0.00 ? 77  ALA A HB3  4  
ATOM 5871  N N    . SER A 1 75  ? -2.352  10.254  2.027   1.00 0.00 ? 78  SER A N    4  
ATOM 5872  C CA   . SER A 1 75  ? -1.565  11.370  2.539   1.00 0.00 ? 78  SER A CA   4  
ATOM 5873  C C    . SER A 1 75  ? -1.000  11.069  3.928   1.00 0.00 ? 78  SER A C    4  
ATOM 5874  O O    . SER A 1 75  ? 0.158   11.381  4.223   1.00 0.00 ? 78  SER A O    4  
ATOM 5875  C CB   . SER A 1 75  ? -2.433  12.627  2.575   1.00 0.00 ? 78  SER A CB   4  
ATOM 5876  O OG   . SER A 1 75  ? -3.738  12.323  3.038   1.00 0.00 ? 78  SER A OG   4  
ATOM 5877  H H    . SER A 1 75  ? -3.293  10.406  1.794   1.00 0.00 ? 78  SER A H    4  
ATOM 5878  H HA   . SER A 1 75  ? -0.743  11.534  1.858   1.00 0.00 ? 78  SER A HA   4  
ATOM 5879  H HB2  . SER A 1 75  ? -1.988  13.353  3.240   1.00 0.00 ? 78  SER A HB2  4  
ATOM 5880  H HB3  . SER A 1 75  ? -2.504  13.043  1.581   1.00 0.00 ? 78  SER A HB3  4  
ATOM 5881  H HG   . SER A 1 75  ? -4.356  12.355  2.295   1.00 0.00 ? 78  SER A HG   4  
ATOM 5882  N N    . LYS A 1 76  ? -1.814  10.439  4.773   1.00 0.00 ? 79  LYS A N    4  
ATOM 5883  C CA   . LYS A 1 76  ? -1.384  10.091  6.121   1.00 0.00 ? 79  LYS A CA   4  
ATOM 5884  C C    . LYS A 1 76  ? -0.195  9.130   6.079   1.00 0.00 ? 79  LYS A C    4  
ATOM 5885  O O    . LYS A 1 76  ? 0.681   9.187   6.941   1.00 0.00 ? 79  LYS A O    4  
ATOM 5886  C CB   . LYS A 1 76  ? -2.540  9.482   6.923   1.00 0.00 ? 79  LYS A CB   4  
ATOM 5887  C CG   . LYS A 1 76  ? -2.217  9.276   8.397   1.00 0.00 ? 79  LYS A CG   4  
ATOM 5888  C CD   . LYS A 1 76  ? -1.907  10.596  9.092   1.00 0.00 ? 79  LYS A CD   4  
ATOM 5889  C CE   . LYS A 1 76  ? -1.440  10.385  10.527  1.00 0.00 ? 79  LYS A CE   4  
ATOM 5890  N NZ   . LYS A 1 76  ? -2.489  9.765   11.384  1.00 0.00 ? 79  LYS A NZ   4  
ATOM 5891  H H    . LYS A 1 76  ? -2.727  10.225  4.488   1.00 0.00 ? 79  LYS A H    4  
ATOM 5892  H HA   . LYS A 1 76  ? -1.065  11.000  6.606   1.00 0.00 ? 79  LYS A HA   4  
ATOM 5893  H HB2  . LYS A 1 76  ? -3.397  10.137  6.854   1.00 0.00 ? 79  LYS A HB2  4  
ATOM 5894  H HB3  . LYS A 1 76  ? -2.795  8.525   6.496   1.00 0.00 ? 79  LYS A HB3  4  
ATOM 5895  H HG2  . LYS A 1 76  ? -3.067  8.817   8.878   1.00 0.00 ? 79  LYS A HG2  4  
ATOM 5896  H HG3  . LYS A 1 76  ? -1.360  8.625   8.477   1.00 0.00 ? 79  LYS A HG3  4  
ATOM 5897  H HD2  . LYS A 1 76  ? -1.129  11.105  8.542   1.00 0.00 ? 79  LYS A HD2  4  
ATOM 5898  H HD3  . LYS A 1 76  ? -2.800  11.205  9.099   1.00 0.00 ? 79  LYS A HD3  4  
ATOM 5899  H HE2  . LYS A 1 76  ? -0.572  9.745   10.520  1.00 0.00 ? 79  LYS A HE2  4  
ATOM 5900  H HE3  . LYS A 1 76  ? -1.172  11.344  10.945  1.00 0.00 ? 79  LYS A HE3  4  
ATOM 5901  H HZ1  . LYS A 1 76  ? -2.843  8.896   10.936  1.00 0.00 ? 79  LYS A HZ1  4  
ATOM 5902  H HZ3  . LYS A 1 76  ? -3.291  10.427  11.498  1.00 0.00 ? 79  LYS A HZ3  4  
ATOM 5903  N N    . VAL A 1 77  ? -0.148  8.273   5.061   1.00 0.00 ? 80  VAL A N    4  
ATOM 5904  C CA   . VAL A 1 77  ? 0.967   7.343   4.901   1.00 0.00 ? 80  VAL A CA   4  
ATOM 5905  C C    . VAL A 1 77  ? 2.247   8.108   4.585   1.00 0.00 ? 80  VAL A C    4  
ATOM 5906  O O    . VAL A 1 77  ? 3.293   7.864   5.187   1.00 0.00 ? 80  VAL A O    4  
ATOM 5907  C CB   . VAL A 1 77  ? 0.705   6.300   3.792   1.00 0.00 ? 80  VAL A CB   4  
ATOM 5908  C CG1  . VAL A 1 77  ? 1.928   5.410   3.595   1.00 0.00 ? 80  VAL A CG1  4  
ATOM 5909  C CG2  . VAL A 1 77  ? -0.517  5.455   4.122   1.00 0.00 ? 80  VAL A CG2  4  
ATOM 5910  H H    . VAL A 1 77  ? -0.867  8.279   4.397   1.00 0.00 ? 80  VAL A H    4  
ATOM 5911  H HA   . VAL A 1 77  ? 1.097   6.820   5.838   1.00 0.00 ? 80  VAL A HA   4  
ATOM 5912  H HB   . VAL A 1 77  ? 0.517   6.828   2.865   1.00 0.00 ? 80  VAL A HB   4  
ATOM 5913  H HG11 . VAL A 1 77  ? 2.774   6.019   3.311   1.00 0.00 ? 80  VAL A HG11 4  
ATOM 5914  H HG12 . VAL A 1 77  ? 2.150   4.894   4.518   1.00 0.00 ? 80  VAL A HG12 4  
ATOM 5915  H HG13 . VAL A 1 77  ? 1.727   4.687   2.817   1.00 0.00 ? 80  VAL A HG13 4  
ATOM 5916  H HG21 . VAL A 1 77  ? -0.737  4.798   3.292   1.00 0.00 ? 80  VAL A HG21 4  
ATOM 5917  H HG22 . VAL A 1 77  ? -0.318  4.864   5.004   1.00 0.00 ? 80  VAL A HG22 4  
ATOM 5918  H HG23 . VAL A 1 77  ? -1.363  6.100   4.303   1.00 0.00 ? 80  VAL A HG23 4  
ATOM 5919  N N    . CYS A 1 78  ? 2.152   9.050   3.655   1.00 0.00 ? 81  CYS A N    4  
ATOM 5920  C CA   . CYS A 1 78  ? 3.287   9.902   3.317   1.00 0.00 ? 81  CYS A CA   4  
ATOM 5921  C C    . CYS A 1 78  ? 3.781   10.641  4.559   1.00 0.00 ? 81  CYS A C    4  
ATOM 5922  O O    . CYS A 1 78  ? 4.984   10.803  4.761   1.00 0.00 ? 81  CYS A O    4  
ATOM 5923  C CB   . CYS A 1 78  ? 2.895   10.909  2.234   1.00 0.00 ? 81  CYS A CB   4  
ATOM 5924  S SG   . CYS A 1 78  ? 2.308   10.153  0.681   1.00 0.00 ? 81  CYS A SG   4  
ATOM 5925  H H    . CYS A 1 78  ? 1.300   9.172   3.176   1.00 0.00 ? 81  CYS A H    4  
ATOM 5926  H HA   . CYS A 1 78  ? 4.081   9.268   2.946   1.00 0.00 ? 81  CYS A HA   4  
ATOM 5927  H HB2  . CYS A 1 78  ? 2.100   11.538  2.612   1.00 0.00 ? 81  CYS A HB2  4  
ATOM 5928  H HB3  . CYS A 1 78  ? 3.750   11.525  2.000   1.00 0.00 ? 81  CYS A HB3  4  
ATOM 5929  N N    . GLN A 1 79  ? 2.842   11.066  5.399   1.00 0.00 ? 82  GLN A N    4  
ATOM 5930  C CA   . GLN A 1 79  ? 3.173   11.755  6.640   1.00 0.00 ? 82  GLN A CA   4  
ATOM 5931  C C    . GLN A 1 79  ? 3.854   10.806  7.627   1.00 0.00 ? 82  GLN A C    4  
ATOM 5932  O O    . GLN A 1 79  ? 4.765   11.202  8.352   1.00 0.00 ? 82  GLN A O    4  
ATOM 5933  C CB   . GLN A 1 79  ? 1.911   12.356  7.266   1.00 0.00 ? 82  GLN A CB   4  
ATOM 5934  C CG   . GLN A 1 79  ? 2.154   13.017  8.616   1.00 0.00 ? 82  GLN A CG   4  
ATOM 5935  C CD   . GLN A 1 79  ? 0.892   13.588  9.231   1.00 0.00 ? 82  GLN A CD   4  
ATOM 5936  O OE1  . GLN A 1 79  ? 0.748   13.613  10.454  1.00 0.00 ? 82  GLN A OE1  4  
ATOM 5937  N NE2  . GLN A 1 79  ? -0.019  14.065  8.397   1.00 0.00 ? 82  GLN A NE2  4  
ATOM 5938  H H    . GLN A 1 79  ? 1.897   10.922  5.170   1.00 0.00 ? 82  GLN A H    4  
ATOM 5939  H HA   . GLN A 1 79  ? 3.860   12.553  6.399   1.00 0.00 ? 82  GLN A HA   4  
ATOM 5940  H HB2  . GLN A 1 79  ? 1.507   13.098  6.594   1.00 0.00 ? 82  GLN A HB2  4  
ATOM 5941  H HB3  . GLN A 1 79  ? 1.182   11.570  7.402   1.00 0.00 ? 82  GLN A HB3  4  
ATOM 5942  H HG2  . GLN A 1 79  ? 2.564   12.282  9.292   1.00 0.00 ? 82  GLN A HG2  4  
ATOM 5943  H HG3  . GLN A 1 79  ? 2.866   13.818  8.485   1.00 0.00 ? 82  GLN A HG3  4  
ATOM 5944  H HE21 . GLN A 1 79  ? 0.164   14.027  7.433   1.00 0.00 ? 82  GLN A HE21 4  
ATOM 5945  H HE22 . GLN A 1 79  ? -0.839  14.452  8.777   1.00 0.00 ? 82  GLN A HE22 4  
ATOM 5946  N N    . ARG A 1 80  ? 3.415   9.550   7.640   1.00 0.00 ? 83  ARG A N    4  
ATOM 5947  C CA   . ARG A 1 80  ? 4.000   8.537   8.521   1.00 0.00 ? 83  ARG A CA   4  
ATOM 5948  C C    . ARG A 1 80  ? 5.477   8.330   8.199   1.00 0.00 ? 83  ARG A C    4  
ATOM 5949  O O    . ARG A 1 80  ? 6.273   7.995   9.077   1.00 0.00 ? 83  ARG A O    4  
ATOM 5950  C CB   . ARG A 1 80  ? 3.256   7.201   8.395   1.00 0.00 ? 83  ARG A CB   4  
ATOM 5951  C CG   . ARG A 1 80  ? 1.837   7.213   8.950   1.00 0.00 ? 83  ARG A CG   4  
ATOM 5952  C CD   . ARG A 1 80  ? 1.819   7.201   10.472  1.00 0.00 ? 83  ARG A CD   4  
ATOM 5953  N NE   . ARG A 1 80  ? 2.420   5.983   11.016  1.00 0.00 ? 83  ARG A NE   4  
ATOM 5954  C CZ   . ARG A 1 80  ? 2.876   5.869   12.259  1.00 0.00 ? 83  ARG A CZ   4  
ATOM 5955  N NH1  . ARG A 1 80  ? 2.801   6.898   13.092  1.00 0.00 ? 83  ARG A NH1  4  
ATOM 5956  N NH2  . ARG A 1 80  ? 3.409   4.729   12.669  1.00 0.00 ? 83  ARG A NH2  4  
ATOM 5957  H H    . ARG A 1 80  ? 2.677   9.297   7.042   1.00 0.00 ? 83  ARG A H    4  
ATOM 5958  H HA   . ARG A 1 80  ? 3.915   8.895   9.534   1.00 0.00 ? 83  ARG A HA   4  
ATOM 5959  H HB2  . ARG A 1 80  ? 3.205   6.930   7.351   1.00 0.00 ? 83  ARG A HB2  4  
ATOM 5960  H HB3  . ARG A 1 80  ? 3.816   6.445   8.923   1.00 0.00 ? 83  ARG A HB3  4  
ATOM 5961  H HG2  . ARG A 1 80  ? 1.335   8.104   8.604   1.00 0.00 ? 83  ARG A HG2  4  
ATOM 5962  H HG3  . ARG A 1 80  ? 1.314   6.341   8.586   1.00 0.00 ? 83  ARG A HG3  4  
ATOM 5963  H HD2  . ARG A 1 80  ? 2.368   8.057   10.835  1.00 0.00 ? 83  ARG A HD2  4  
ATOM 5964  H HD3  . ARG A 1 80  ? 0.794   7.263   10.808  1.00 0.00 ? 83  ARG A HD3  4  
ATOM 5965  H HE   . ARG A 1 80  ? 2.482   5.204   10.416  1.00 0.00 ? 83  ARG A HE   4  
ATOM 5966  H HH12 . ARG A 1 80  ? 2.056   6.943   13.772  1.00 0.00 ? 83  ARG A HH12 4  
ATOM 5967  H HH21 . ARG A 1 80  ? 3.467   3.948   12.047  1.00 0.00 ? 83  ARG A HH21 4  
ATOM 5968  H HH22 . ARG A 1 80  ? 3.767   4.643   13.610  1.00 0.00 ? 83  ARG A HH22 4  
ATOM 5969  N N    . LEU A 1 81  ? 5.843   8.532   6.941   1.00 0.00 ? 84  LEU A N    4  
ATOM 5970  C CA   . LEU A 1 81  ? 7.233   8.385   6.524   1.00 0.00 ? 84  LEU A CA   4  
ATOM 5971  C C    . LEU A 1 81  ? 7.913   9.744   6.369   1.00 0.00 ? 84  LEU A C    4  
ATOM 5972  O O    . LEU A 1 81  ? 9.035   9.835   5.869   1.00 0.00 ? 84  LEU A O    4  
ATOM 5973  C CB   . LEU A 1 81  ? 7.335   7.588   5.219   1.00 0.00 ? 84  LEU A CB   4  
ATOM 5974  C CG   . LEU A 1 81  ? 7.131   6.073   5.356   1.00 0.00 ? 84  LEU A CG   4  
ATOM 5975  C CD1  . LEU A 1 81  ? 5.669   5.731   5.589   1.00 0.00 ? 84  LEU A CD1  4  
ATOM 5976  C CD2  . LEU A 1 81  ? 7.654   5.354   4.128   1.00 0.00 ? 84  LEU A CD2  4  
ATOM 5977  H H    . LEU A 1 81  ? 5.163   8.774   6.274   1.00 0.00 ? 84  LEU A H    4  
ATOM 5978  H HA   . LEU A 1 81  ? 7.742   7.836   7.301   1.00 0.00 ? 84  LEU A HA   4  
ATOM 5979  H HB2  . LEU A 1 81  ? 6.592   7.968   4.533   1.00 0.00 ? 84  LEU A HB2  4  
ATOM 5980  H HB3  . LEU A 1 81  ? 8.313   7.760   4.795   1.00 0.00 ? 84  LEU A HB3  4  
ATOM 5981  H HG   . LEU A 1 81  ? 7.693   5.721   6.210   1.00 0.00 ? 84  LEU A HG   4  
ATOM 5982  H HD11 . LEU A 1 81  ? 5.555   4.658   5.641   1.00 0.00 ? 84  LEU A HD11 4  
ATOM 5983  H HD12 . LEU A 1 81  ? 5.338   6.174   6.517   1.00 0.00 ? 84  LEU A HD12 4  
ATOM 5984  H HD13 . LEU A 1 81  ? 5.075   6.116   4.773   1.00 0.00 ? 84  LEU A HD13 4  
ATOM 5985  H HD21 . LEU A 1 81  ? 7.144   5.724   3.251   1.00 0.00 ? 84  LEU A HD21 4  
ATOM 5986  H HD22 . LEU A 1 81  ? 8.713   5.536   4.030   1.00 0.00 ? 84  LEU A HD22 4  
ATOM 5987  H HD23 . LEU A 1 81  ? 7.476   4.294   4.228   1.00 0.00 ? 84  LEU A HD23 4  
ATOM 5988  N N    . ASN A 1 82  ? 7.218   10.791  6.818   1.00 0.00 ? 85  ASN A N    4  
ATOM 5989  C CA   . ASN A 1 82  ? 7.735   12.162  6.793   1.00 0.00 ? 85  ASN A CA   4  
ATOM 5990  C C    . ASN A 1 82  ? 8.119   12.604  5.381   1.00 0.00 ? 85  ASN A C    4  
ATOM 5991  O O    . ASN A 1 82  ? 9.178   13.196  5.167   1.00 0.00 ? 85  ASN A O    4  
ATOM 5992  C CB   . ASN A 1 82  ? 8.926   12.315  7.747   1.00 0.00 ? 85  ASN A CB   4  
ATOM 5993  C CG   . ASN A 1 82  ? 8.501   12.392  9.201   1.00 0.00 ? 85  ASN A CG   4  
ATOM 5994  O OD1  . ASN A 1 82  ? 7.437   12.921  9.524   1.00 0.00 ? 85  ASN A OD1  4  
ATOM 5995  N ND2  . ASN A 1 82  ? 9.323   11.855  10.087  1.00 0.00 ? 85  ASN A ND2  4  
ATOM 5996  H H    . ASN A 1 82  ? 6.323   10.635  7.188   1.00 0.00 ? 85  ASN A H    4  
ATOM 5997  H HA   . ASN A 1 82  ? 6.941   12.806  7.138   1.00 0.00 ? 85  ASN A HA   4  
ATOM 5998  H HB2  . ASN A 1 82  ? 9.581   11.465  7.629   1.00 0.00 ? 85  ASN A HB2  4  
ATOM 5999  H HB3  . ASN A 1 82  ? 9.465   13.217  7.499   1.00 0.00 ? 85  ASN A HB3  4  
ATOM 6000  H HD21 . ASN A 1 82  ? 10.153  11.435  9.755   1.00 0.00 ? 85  ASN A HD21 4  
ATOM 6001  H HD22 . ASN A 1 82  ? 9.073   11.890  11.033  1.00 0.00 ? 85  ASN A HD22 4  
ATOM 6002  N N    . CYS A 1 83  ? 7.248   12.320  4.428   1.00 0.00 ? 86  CYS A N    4  
ATOM 6003  C CA   . CYS A 1 83  ? 7.438   12.761  3.054   1.00 0.00 ? 86  CYS A CA   4  
ATOM 6004  C C    . CYS A 1 83  ? 6.378   13.795  2.686   1.00 0.00 ? 86  CYS A C    4  
ATOM 6005  O O    . CYS A 1 83  ? 5.553   14.162  3.524   1.00 0.00 ? 86  CYS A O    4  
ATOM 6006  C CB   . CYS A 1 83  ? 7.389   11.567  2.093   1.00 0.00 ? 86  CYS A CB   4  
ATOM 6007  S SG   . CYS A 1 83  ? 8.793   10.417  2.274   1.00 0.00 ? 86  CYS A SG   4  
ATOM 6008  H H    . CYS A 1 83  ? 6.445   11.800  4.652   1.00 0.00 ? 86  CYS A H    4  
ATOM 6009  H HA   . CYS A 1 83  ? 8.411   13.226  2.988   1.00 0.00 ? 86  CYS A HA   4  
ATOM 6010  H HB2  . CYS A 1 83  ? 6.484   11.004  2.274   1.00 0.00 ? 86  CYS A HB2  4  
ATOM 6011  H HB3  . CYS A 1 83  ? 7.386   11.927  1.073   1.00 0.00 ? 86  CYS A HB3  4  
ATOM 6012  N N    . GLY A 1 84  ? 6.406   14.267  1.446   1.00 0.00 ? 87  GLY A N    4  
ATOM 6013  C CA   . GLY A 1 84  ? 5.457   15.273  1.014   1.00 0.00 ? 87  GLY A CA   4  
ATOM 6014  C C    . GLY A 1 84  ? 4.131   14.678  0.589   1.00 0.00 ? 87  GLY A C    4  
ATOM 6015  O O    . GLY A 1 84  ? 3.844   13.515  0.876   1.00 0.00 ? 87  GLY A O    4  
ATOM 6016  H H    . GLY A 1 84  ? 7.079   13.931  0.814   1.00 0.00 ? 87  GLY A H    4  
ATOM 6017  H HA2  . GLY A 1 84  ? 5.285   15.962  1.826   1.00 0.00 ? 87  GLY A HA2  4  
ATOM 6018  H HA3  . GLY A 1 84  ? 5.880   15.815  0.180   1.00 0.00 ? 87  GLY A HA3  4  
ATOM 6019  N N    . ASP A 1 85  ? 3.329   15.478  -0.104  1.00 0.00 ? 88  ASP A N    4  
ATOM 6020  C CA   . ASP A 1 85  ? 1.999   15.057  -0.547  1.00 0.00 ? 88  ASP A CA   4  
ATOM 6021  C C    . ASP A 1 85  ? 2.087   13.886  -1.526  1.00 0.00 ? 88  ASP A C    4  
ATOM 6022  O O    . ASP A 1 85  ? 3.069   13.750  -2.262  1.00 0.00 ? 88  ASP A O    4  
ATOM 6023  C CB   . ASP A 1 85  ? 1.258   16.224  -1.210  1.00 0.00 ? 88  ASP A CB   4  
ATOM 6024  C CG   . ASP A 1 85  ? 0.921   17.346  -0.245  1.00 0.00 ? 88  ASP A CG   4  
ATOM 6025  O OD1  . ASP A 1 85  ? -0.158  17.295  0.386   1.00 0.00 ? 88  ASP A OD1  4  
ATOM 6026  O OD2  . ASP A 1 85  ? 1.724   18.294  -0.125  1.00 0.00 ? 88  ASP A OD2  4  
ATOM 6027  H H    . ASP A 1 85  ? 3.641   16.380  -0.330  1.00 0.00 ? 88  ASP A H    4  
ATOM 6028  H HA   . ASP A 1 85  ? 1.445   14.741  0.324   1.00 0.00 ? 88  ASP A HA   4  
ATOM 6029  H HB2  . ASP A 1 85  ? 1.871   16.627  -1.997  1.00 0.00 ? 88  ASP A HB2  4  
ATOM 6030  H HB3  . ASP A 1 85  ? 0.338   15.856  -1.637  1.00 0.00 ? 88  ASP A HB3  4  
ATOM 6031  N N    . PRO A 1 86  ? 1.062   13.019  -1.538  1.00 0.00 ? 89  PRO A N    4  
ATOM 6032  C CA   . PRO A 1 86  ? 1.024   11.855  -2.418  1.00 0.00 ? 89  PRO A CA   4  
ATOM 6033  C C    . PRO A 1 86  ? 0.627   12.217  -3.845  1.00 0.00 ? 89  PRO A C    4  
ATOM 6034  O O    . PRO A 1 86  ? -0.453  12.759  -4.087  1.00 0.00 ? 89  PRO A O    4  
ATOM 6035  C CB   . PRO A 1 86  ? -0.034  10.960  -1.776  1.00 0.00 ? 89  PRO A CB   4  
ATOM 6036  C CG   . PRO A 1 86  ? -0.947  11.886  -1.051  1.00 0.00 ? 89  PRO A CG   4  
ATOM 6037  C CD   . PRO A 1 86  ? -0.136  13.104  -0.683  1.00 0.00 ? 89  PRO A CD   4  
ATOM 6038  H HA   . PRO A 1 86  ? 1.972   11.341  -2.429  1.00 0.00 ? 89  PRO A HA   4  
ATOM 6039  H HB2  . PRO A 1 86  ? -0.559  10.412  -2.544  1.00 0.00 ? 89  PRO A HB2  4  
ATOM 6040  H HB3  . PRO A 1 86  ? 0.444   10.270  -1.096  1.00 0.00 ? 89  PRO A HB3  4  
ATOM 6041  H HG2  . PRO A 1 86  ? -1.770  12.161  -1.694  1.00 0.00 ? 89  PRO A HG2  4  
ATOM 6042  H HG3  . PRO A 1 86  ? -1.320  11.401  -0.159  1.00 0.00 ? 89  PRO A HG3  4  
ATOM 6043  H HD2  . PRO A 1 86  ? -0.693  14.001  -0.895  1.00 0.00 ? 89  PRO A HD2  4  
ATOM 6044  H HD3  . PRO A 1 86  ? 0.137   13.073  0.359   1.00 0.00 ? 89  PRO A HD3  4  
ATOM 6045  N N    . LEU A 1 87  ? 1.510   11.919  -4.783  1.00 0.00 ? 90  LEU A N    4  
ATOM 6046  C CA   . LEU A 1 87  ? 1.275   12.213  -6.188  1.00 0.00 ? 90  LEU A CA   4  
ATOM 6047  C C    . LEU A 1 87  ? 0.416   11.131  -6.828  1.00 0.00 ? 90  LEU A C    4  
ATOM 6048  O O    . LEU A 1 87  ? -0.610  11.421  -7.440  1.00 0.00 ? 90  LEU A O    4  
ATOM 6049  C CB   . LEU A 1 87  ? 2.607   12.321  -6.938  1.00 0.00 ? 90  LEU A CB   4  
ATOM 6050  C CG   . LEU A 1 87  ? 3.538   13.442  -6.473  1.00 0.00 ? 90  LEU A CG   4  
ATOM 6051  C CD1  . LEU A 1 87  ? 4.883   13.343  -7.181  1.00 0.00 ? 90  LEU A CD1  4  
ATOM 6052  C CD2  . LEU A 1 87  ? 2.909   14.804  -6.728  1.00 0.00 ? 90  LEU A CD2  4  
ATOM 6053  H H    . LEU A 1 87  ? 2.351   11.479  -4.524  1.00 0.00 ? 90  LEU A H    4  
ATOM 6054  H HA   . LEU A 1 87  ? 0.755   13.156  -6.249  1.00 0.00 ? 90  LEU A HA   4  
ATOM 6055  H HB2  . LEU A 1 87  ? 3.130   11.386  -6.827  1.00 0.00 ? 90  LEU A HB2  4  
ATOM 6056  H HB3  . LEU A 1 87  ? 2.396   12.468  -7.984  1.00 0.00 ? 90  LEU A HB3  4  
ATOM 6057  H HG   . LEU A 1 87  ? 3.712   13.344  -5.412  1.00 0.00 ? 90  LEU A HG   4  
ATOM 6058  H HD11 . LEU A 1 87  ? 5.348   12.398  -6.943  1.00 0.00 ? 90  LEU A HD11 4  
ATOM 6059  H HD12 . LEU A 1 87  ? 4.734   13.413  -8.248  1.00 0.00 ? 90  LEU A HD12 4  
ATOM 6060  H HD13 . LEU A 1 87  ? 5.521   14.151  -6.853  1.00 0.00 ? 90  LEU A HD13 4  
ATOM 6061  H HD21 . LEU A 1 87  ? 1.997   14.893  -6.155  1.00 0.00 ? 90  LEU A HD21 4  
ATOM 6062  H HD22 . LEU A 1 87  ? 3.598   15.579  -6.430  1.00 0.00 ? 90  LEU A HD22 4  
ATOM 6063  H HD23 . LEU A 1 87  ? 2.685   14.905  -7.780  1.00 0.00 ? 90  LEU A HD23 4  
ATOM 6064  N N    . SER A 1 88  ? 0.836   9.885   -6.675  1.00 0.00 ? 91  SER A N    4  
ATOM 6065  C CA   . SER A 1 88  ? 0.134   8.769   -7.281  1.00 0.00 ? 91  SER A CA   4  
ATOM 6066  C C    . SER A 1 88  ? 0.078   7.576   -6.335  1.00 0.00 ? 91  SER A C    4  
ATOM 6067  O O    . SER A 1 88  ? 0.919   7.431   -5.446  1.00 0.00 ? 91  SER A O    4  
ATOM 6068  C CB   . SER A 1 88  ? 0.804   8.378   -8.601  1.00 0.00 ? 91  SER A CB   4  
ATOM 6069  O OG   . SER A 1 88  ? 2.212   8.286   -8.459  1.00 0.00 ? 91  SER A OG   4  
ATOM 6070  H H    . SER A 1 88  ? 1.631   9.711   -6.133  1.00 0.00 ? 91  SER A H    4  
ATOM 6071  H HA   . SER A 1 88  ? -0.874  9.093   -7.486  1.00 0.00 ? 91  SER A HA   4  
ATOM 6072  H HB2  . SER A 1 88  ? 0.428   7.419   -8.923  1.00 0.00 ? 91  SER A HB2  4  
ATOM 6073  H HB3  . SER A 1 88  ? 0.579   9.123   -9.350  1.00 0.00 ? 91  SER A HB3  4  
ATOM 6074  H HG   . SER A 1 88  ? 2.625   9.068   -8.861  1.00 0.00 ? 91  SER A HG   4  
ATOM 6075  N N    . LEU A 1 89  ? -0.928  6.737   -6.534  1.00 0.00 ? 92  LEU A N    4  
ATOM 6076  C CA   . LEU A 1 89  ? -1.126  5.542   -5.727  1.00 0.00 ? 92  LEU A CA   4  
ATOM 6077  C C    . LEU A 1 89  ? -1.673  4.432   -6.615  1.00 0.00 ? 92  LEU A C    4  
ATOM 6078  O O    . LEU A 1 89  ? -2.880  4.353   -6.847  1.00 0.00 ? 92  LEU A O    4  
ATOM 6079  C CB   . LEU A 1 89  ? -2.107  5.825   -4.581  1.00 0.00 ? 92  LEU A CB   4  
ATOM 6080  C CG   . LEU A 1 89  ? -2.456  4.621   -3.694  1.00 0.00 ? 92  LEU A CG   4  
ATOM 6081  C CD1  . LEU A 1 89  ? -1.253  4.176   -2.873  1.00 0.00 ? 92  LEU A CD1  4  
ATOM 6082  C CD2  . LEU A 1 89  ? -3.632  4.950   -2.783  1.00 0.00 ? 92  LEU A CD2  4  
ATOM 6083  H H    . LEU A 1 89  ? -1.557  6.920   -7.262  1.00 0.00 ? 92  LEU A H    4  
ATOM 6084  H HA   . LEU A 1 89  ? -0.170  5.242   -5.322  1.00 0.00 ? 92  LEU A HA   4  
ATOM 6085  H HB2  . LEU A 1 89  ? -1.686  6.601   -3.954  1.00 0.00 ? 92  LEU A HB2  4  
ATOM 6086  H HB3  . LEU A 1 89  ? -3.024  6.197   -5.013  1.00 0.00 ? 92  LEU A HB3  4  
ATOM 6087  H HG   . LEU A 1 89  ? -2.744  3.794   -4.329  1.00 0.00 ? 92  LEU A HG   4  
ATOM 6088  H HD11 . LEU A 1 89  ? -1.545  3.373   -2.211  1.00 0.00 ? 92  LEU A HD11 4  
ATOM 6089  H HD12 . LEU A 1 89  ? -0.471  3.831   -3.531  1.00 0.00 ? 92  LEU A HD12 4  
ATOM 6090  H HD13 . LEU A 1 89  ? -0.890  5.008   -2.289  1.00 0.00 ? 92  LEU A HD13 4  
ATOM 6091  H HD21 . LEU A 1 89  ? -3.376  5.787   -2.152  1.00 0.00 ? 92  LEU A HD21 4  
ATOM 6092  H HD22 . LEU A 1 89  ? -4.495  5.201   -3.383  1.00 0.00 ? 92  LEU A HD22 4  
ATOM 6093  H HD23 . LEU A 1 89  ? -3.861  4.092   -2.167  1.00 0.00 ? 92  LEU A HD23 4  
ATOM 6094  N N    . GLY A 1 90  ? -0.789  3.594   -7.131  1.00 0.00 ? 93  GLY A N    4  
ATOM 6095  C CA   . GLY A 1 90  ? -1.217  2.560   -8.051  1.00 0.00 ? 93  GLY A CA   4  
ATOM 6096  C C    . GLY A 1 90  ? -0.207  1.439   -8.185  1.00 0.00 ? 93  GLY A C    4  
ATOM 6097  O O    . GLY A 1 90  ? 0.628   1.246   -7.302  1.00 0.00 ? 93  GLY A O    4  
ATOM 6098  H H    . GLY A 1 90  ? 0.159   3.669   -6.876  1.00 0.00 ? 93  GLY A H    4  
ATOM 6099  H HA2  . GLY A 1 90  ? -2.153  2.145   -7.697  1.00 0.00 ? 93  GLY A HA2  4  
ATOM 6100  H HA3  . GLY A 1 90  ? -1.377  3.005   -9.026  1.00 0.00 ? 93  GLY A HA3  4  
ATOM 6101  N N    . PRO A 1 91  ? -0.262  0.674   -9.285  1.00 0.00 ? 94  PRO A N    4  
ATOM 6102  C CA   . PRO A 1 91  ? 0.662   -0.430  -9.542  1.00 0.00 ? 94  PRO A CA   4  
ATOM 6103  C C    . PRO A 1 91  ? 2.036   0.071   -9.981  1.00 0.00 ? 94  PRO A C    4  
ATOM 6104  O O    . PRO A 1 91  ? 2.357   0.069   -11.170 1.00 0.00 ? 94  PRO A O    4  
ATOM 6105  C CB   . PRO A 1 91  ? -0.009  -1.214  -10.684 1.00 0.00 ? 94  PRO A CB   4  
ATOM 6106  C CG   . PRO A 1 91  ? -1.354  -0.589  -10.879 1.00 0.00 ? 94  PRO A CG   4  
ATOM 6107  C CD   . PRO A 1 91  ? -1.235  0.817   -10.373 1.00 0.00 ? 94  PRO A CD   4  
ATOM 6108  H HA   . PRO A 1 91  ? 0.769   -1.068  -8.674  1.00 0.00 ? 94  PRO A HA   4  
ATOM 6109  H HB2  . PRO A 1 91  ? 0.592   -1.131  -11.578 1.00 0.00 ? 94  PRO A HB2  4  
ATOM 6110  H HB3  . PRO A 1 91  ? -0.100  -2.251  -10.406 1.00 0.00 ? 94  PRO A HB3  4  
ATOM 6111  H HG2  . PRO A 1 91  ? -1.612  -0.590  -11.927 1.00 0.00 ? 94  PRO A HG2  4  
ATOM 6112  H HG3  . PRO A 1 91  ? -2.095  -1.132  -10.310 1.00 0.00 ? 94  PRO A HG3  4  
ATOM 6113  H HD2  . PRO A 1 91  ? -0.860  1.470   -11.148 1.00 0.00 ? 94  PRO A HD2  4  
ATOM 6114  H HD3  . PRO A 1 91  ? -2.186  1.169   -10.002 1.00 0.00 ? 94  PRO A HD3  4  
ATOM 6115  N N    . PHE A 1 92  ? 2.843   0.499   -9.020  1.00 0.00 ? 95  PHE A N    4  
ATOM 6116  C CA   . PHE A 1 92  ? 4.144   1.079   -9.329  1.00 0.00 ? 95  PHE A CA   4  
ATOM 6117  C C    . PHE A 1 92  ? 5.154   -0.008  -9.673  1.00 0.00 ? 95  PHE A C    4  
ATOM 6118  O O    . PHE A 1 92  ? 5.838   0.069   -10.697 1.00 0.00 ? 95  PHE A O    4  
ATOM 6119  C CB   . PHE A 1 92  ? 4.660   1.914   -8.155  1.00 0.00 ? 95  PHE A CB   4  
ATOM 6120  C CG   . PHE A 1 92  ? 5.723   2.907   -8.539  1.00 0.00 ? 95  PHE A CG   4  
ATOM 6121  C CD1  . PHE A 1 92  ? 5.373   4.150   -9.044  1.00 0.00 ? 95  PHE A CD1  4  
ATOM 6122  C CD2  . PHE A 1 92  ? 7.070   2.603   -8.397  1.00 0.00 ? 95  PHE A CD2  4  
ATOM 6123  C CE1  . PHE A 1 92  ? 6.344   5.068   -9.400  1.00 0.00 ? 95  PHE A CE1  4  
ATOM 6124  C CE2  . PHE A 1 92  ? 8.042   3.516   -8.751  1.00 0.00 ? 95  PHE A CE2  4  
ATOM 6125  C CZ   . PHE A 1 92  ? 7.680   4.750   -9.252  1.00 0.00 ? 95  PHE A CZ   4  
ATOM 6126  H H    . PHE A 1 92  ? 2.554   0.428   -8.086  1.00 0.00 ? 95  PHE A H    4  
ATOM 6127  H HA   . PHE A 1 92  ? 4.022   1.721   -10.187 1.00 0.00 ? 95  PHE A HA   4  
ATOM 6128  H HB2  . PHE A 1 92  ? 3.838   2.460   -7.713  1.00 0.00 ? 95  PHE A HB2  4  
ATOM 6129  H HB3  . PHE A 1 92  ? 5.083   1.249   -7.414  1.00 0.00 ? 95  PHE A HB3  4  
ATOM 6130  H HD1  . PHE A 1 92  ? 4.329   4.401   -9.160  1.00 0.00 ? 95  PHE A HD1  4  
ATOM 6131  H HD2  . PHE A 1 92  ? 7.356   1.638   -8.005  1.00 0.00 ? 95  PHE A HD2  4  
ATOM 6132  H HE1  . PHE A 1 92  ? 6.058   6.035   -9.792  1.00 0.00 ? 95  PHE A HE1  4  
ATOM 6133  H HE2  . PHE A 1 92  ? 9.086   3.265   -8.634  1.00 0.00 ? 95  PHE A HE2  4  
ATOM 6134  H HZ   . PHE A 1 92  ? 8.441   5.465   -9.530  1.00 0.00 ? 95  PHE A HZ   4  
ATOM 6135  N N    . LEU A 1 93  ? 5.245   -1.026  -8.827  1.00 0.00 ? 96  LEU A N    4  
ATOM 6136  C CA   . LEU A 1 93  ? 6.217   -2.089  -9.041  1.00 0.00 ? 96  LEU A CA   4  
ATOM 6137  C C    . LEU A 1 93  ? 5.535   -3.361  -9.520  1.00 0.00 ? 96  LEU A C    4  
ATOM 6138  O O    . LEU A 1 93  ? 4.420   -3.685  -9.104  1.00 0.00 ? 96  LEU A O    4  
ATOM 6139  C CB   . LEU A 1 93  ? 7.037   -2.380  -7.776  1.00 0.00 ? 96  LEU A CB   4  
ATOM 6140  C CG   . LEU A 1 93  ? 7.960   -1.244  -7.316  1.00 0.00 ? 96  LEU A CG   4  
ATOM 6141  C CD1  . LEU A 1 93  ? 7.207   -0.247  -6.447  1.00 0.00 ? 96  LEU A CD1  4  
ATOM 6142  C CD2  . LEU A 1 93  ? 9.171   -1.800  -6.580  1.00 0.00 ? 96  LEU A CD2  4  
ATOM 6143  H H    . LEU A 1 93  ? 4.633   -1.074  -8.061  1.00 0.00 ? 96  LEU A H    4  
ATOM 6144  H HA   . LEU A 1 93  ? 6.892   -1.754  -9.817  1.00 0.00 ? 96  LEU A HA   4  
ATOM 6145  H HB2  . LEU A 1 93  ? 6.351   -2.609  -6.974  1.00 0.00 ? 96  LEU A HB2  4  
ATOM 6146  H HB3  . LEU A 1 93  ? 7.645   -3.252  -7.964  1.00 0.00 ? 96  LEU A HB3  4  
ATOM 6147  H HG   . LEU A 1 93  ? 8.319   -0.715  -8.188  1.00 0.00 ? 96  LEU A HG   4  
ATOM 6148  H HD11 . LEU A 1 93  ? 6.836   -0.745  -5.564  1.00 0.00 ? 96  LEU A HD11 4  
ATOM 6149  H HD12 . LEU A 1 93  ? 7.873   0.552   -6.157  1.00 0.00 ? 96  LEU A HD12 4  
ATOM 6150  H HD13 . LEU A 1 93  ? 6.378   0.163   -7.005  1.00 0.00 ? 96  LEU A HD13 4  
ATOM 6151  H HD21 . LEU A 1 93  ? 9.761   -2.401  -7.257  1.00 0.00 ? 96  LEU A HD21 4  
ATOM 6152  H HD22 . LEU A 1 93  ? 9.773   -0.984  -6.209  1.00 0.00 ? 96  LEU A HD22 4  
ATOM 6153  H HD23 . LEU A 1 93  ? 8.841   -2.408  -5.751  1.00 0.00 ? 96  LEU A HD23 4  
ATOM 6154  N N    . LYS A 1 94  ? 6.218   -4.077  -10.395 1.00 0.00 ? 97  LYS A N    4  
ATOM 6155  C CA   . LYS A 1 94  ? 5.693   -5.304  -10.962 1.00 0.00 ? 97  LYS A CA   4  
ATOM 6156  C C    . LYS A 1 94  ? 6.596   -6.474  -10.592 1.00 0.00 ? 97  LYS A C    4  
ATOM 6157  O O    . LYS A 1 94  ? 7.270   -7.049  -11.446 1.00 0.00 ? 97  LYS A O    4  
ATOM 6158  C CB   . LYS A 1 94  ? 5.579   -5.179  -12.486 1.00 0.00 ? 97  LYS A CB   4  
ATOM 6159  C CG   . LYS A 1 94  ? 4.699   -4.023  -12.943 1.00 0.00 ? 97  LYS A CG   4  
ATOM 6160  C CD   . LYS A 1 94  ? 4.594   -3.957  -14.459 1.00 0.00 ? 97  LYS A CD   4  
ATOM 6161  C CE   . LYS A 1 94  ? 3.758   -2.766  -14.903 1.00 0.00 ? 97  LYS A CE   4  
ATOM 6162  N NZ   . LYS A 1 94  ? 2.394   -2.803  -14.314 1.00 0.00 ? 97  LYS A NZ   4  
ATOM 6163  H H    . LYS A 1 94  ? 7.116   -3.771  -10.667 1.00 0.00 ? 97  LYS A H    4  
ATOM 6164  H HA   . LYS A 1 94  ? 4.712   -5.475  -10.544 1.00 0.00 ? 97  LYS A HA   4  
ATOM 6165  H HB2  . LYS A 1 94  ? 6.567   -5.035  -12.896 1.00 0.00 ? 97  LYS A HB2  4  
ATOM 6166  H HB3  . LYS A 1 94  ? 5.165   -6.095  -12.881 1.00 0.00 ? 97  LYS A HB3  4  
ATOM 6167  H HG2  . LYS A 1 94  ? 3.710   -4.152  -12.530 1.00 0.00 ? 97  LYS A HG2  4  
ATOM 6168  H HG3  . LYS A 1 94  ? 5.121   -3.096  -12.579 1.00 0.00 ? 97  LYS A HG3  4  
ATOM 6169  H HD2  . LYS A 1 94  ? 5.585   -3.866  -14.880 1.00 0.00 ? 97  LYS A HD2  4  
ATOM 6170  H HD3  . LYS A 1 94  ? 4.130   -4.863  -14.818 1.00 0.00 ? 97  LYS A HD3  4  
ATOM 6171  H HE2  . LYS A 1 94  ? 4.251   -1.858  -14.591 1.00 0.00 ? 97  LYS A HE2  4  
ATOM 6172  H HE3  . LYS A 1 94  ? 3.677   -2.779  -15.980 1.00 0.00 ? 97  LYS A HE3  4  
ATOM 6173  H HZ1  . LYS A 1 94  ? 1.848   -3.585  -14.743 1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 6174  H HZ3  . LYS A 1 94  ? 1.897   -1.907  -14.522 1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 6175  N N    . THR A 1 95  ? 6.629   -6.801  -9.309  1.00 0.00 ? 98  THR A N    4  
ATOM 6176  C CA   . THR A 1 95  ? 7.467   -7.887  -8.824  1.00 0.00 ? 98  THR A CA   4  
ATOM 6177  C C    . THR A 1 95  ? 6.696   -9.209  -8.807  1.00 0.00 ? 98  THR A C    4  
ATOM 6178  O O    . THR A 1 95  ? 7.275   -10.283 -8.954  1.00 0.00 ? 98  THR A O    4  
ATOM 6179  C CB   . THR A 1 95  ? 7.999   -7.571  -7.416  1.00 0.00 ? 98  THR A CB   4  
ATOM 6180  O OG1  . THR A 1 95  ? 8.388   -6.191  -7.354  1.00 0.00 ? 98  THR A OG1  4  
ATOM 6181  C CG2  . THR A 1 95  ? 9.193   -8.448  -7.067  1.00 0.00 ? 98  THR A CG2  4  
ATOM 6182  H H    . THR A 1 95  ? 6.094   -6.286  -8.669  1.00 0.00 ? 98  THR A H    4  
ATOM 6183  H HA   . THR A 1 95  ? 8.308   -7.983  -9.494  1.00 0.00 ? 98  THR A HA   4  
ATOM 6184  H HB   . THR A 1 95  ? 7.213   -7.751  -6.699  1.00 0.00 ? 98  THR A HB   4  
ATOM 6185  H HG1  . THR A 1 95  ? 8.850   -5.947  -8.172  1.00 0.00 ? 98  THR A HG1  4  
ATOM 6186  H HG21 . THR A 1 95  ? 9.989   -8.275  -7.778  1.00 0.00 ? 98  THR A HG21 4  
ATOM 6187  H HG22 . THR A 1 95  ? 8.899   -9.487  -7.101  1.00 0.00 ? 98  THR A HG22 4  
ATOM 6188  H HG23 . THR A 1 95  ? 9.540   -8.204  -6.075  1.00 0.00 ? 98  THR A HG23 4  
ATOM 6189  N N    . TYR A 1 96  ? 5.376   -9.099  -8.628  1.00 0.00 ? 99  TYR A N    4  
ATOM 6190  C CA   . TYR A 1 96  ? 4.448   -10.237 -8.725  1.00 0.00 ? 99  TYR A CA   4  
ATOM 6191  C C    . TYR A 1 96  ? 4.722   -11.334 -7.696  1.00 0.00 ? 99  TYR A C    4  
ATOM 6192  O O    . TYR A 1 96  ? 4.283   -12.465 -7.882  1.00 0.00 ? 99  TYR A O    4  
ATOM 6193  C CB   . TYR A 1 96  ? 4.489   -10.847 -10.129 1.00 0.00 ? 99  TYR A CB   4  
ATOM 6194  C CG   . TYR A 1 96  ? 4.095   -9.894  -11.234 1.00 0.00 ? 99  TYR A CG   4  
ATOM 6195  C CD1  . TYR A 1 96  ? 2.762   -9.580  -11.471 1.00 0.00 ? 99  TYR A CD1  4  
ATOM 6196  C CD2  . TYR A 1 96  ? 5.058   -9.312  -12.047 1.00 0.00 ? 99  TYR A CD2  4  
ATOM 6197  C CE1  . TYR A 1 96  ? 2.403   -8.712  -12.483 1.00 0.00 ? 99  TYR A CE1  4  
ATOM 6198  C CE2  . TYR A 1 96  ? 4.705   -8.444  -13.058 1.00 0.00 ? 99  TYR A CE2  4  
ATOM 6199  C CZ   . TYR A 1 96  ? 3.378   -8.148  -13.274 1.00 0.00 ? 99  TYR A CZ   4  
ATOM 6200  O OH   . TYR A 1 96  ? 3.033   -7.281  -14.284 1.00 0.00 ? 99  TYR A OH   4  
ATOM 6201  H H    . TYR A 1 96  ? 5.008   -8.214  -8.436  1.00 0.00 ? 99  TYR A H    4  
ATOM 6202  H HA   . TYR A 1 96  ? 3.453   -9.856  -8.551  1.00 0.00 ? 99  TYR A HA   4  
ATOM 6203  H HB2  . TYR A 1 96  ? 5.494   -11.186 -10.331 1.00 0.00 ? 99  TYR A HB2  4  
ATOM 6204  H HB3  . TYR A 1 96  ? 3.818   -11.694 -10.166 1.00 0.00 ? 99  TYR A HB3  4  
ATOM 6205  H HD1  . TYR A 1 96  ? 2.000   -10.025 -10.848 1.00 0.00 ? 99  TYR A HD1  4  
ATOM 6206  H HD2  . TYR A 1 96  ? 6.099   -9.544  -11.877 1.00 0.00 ? 99  TYR A HD2  4  
ATOM 6207  H HE1  . TYR A 1 96  ? 1.361   -8.481  -12.651 1.00 0.00 ? 99  TYR A HE1  4  
ATOM 6208  H HE2  . TYR A 1 96  ? 5.471   -8.002  -13.678 1.00 0.00 ? 99  TYR A HE2  4  
ATOM 6209  H HH   . TYR A 1 96  ? 3.650   -7.400  -15.027 1.00 0.00 ? 99  TYR A HH   4  
ATOM 6210  N N    . THR A 1 97  ? 5.428   -11.004 -6.620  1.00 0.00 ? 100 THR A N    4  
ATOM 6211  C CA   . THR A 1 97  ? 5.738   -11.983 -5.582  1.00 0.00 ? 100 THR A CA   4  
ATOM 6212  C C    . THR A 1 97  ? 4.495   -12.329 -4.758  1.00 0.00 ? 100 THR A C    4  
ATOM 6213  O O    . THR A 1 97  ? 4.028   -11.516 -3.958  1.00 0.00 ? 100 THR A O    4  
ATOM 6214  C CB   . THR A 1 97  ? 6.835   -11.456 -4.636  1.00 0.00 ? 100 THR A CB   4  
ATOM 6215  O OG1  . THR A 1 97  ? 7.943   -10.967 -5.402  1.00 0.00 ? 100 THR A OG1  4  
ATOM 6216  C CG2  . THR A 1 97  ? 7.312   -12.553 -3.693  1.00 0.00 ? 100 THR A CG2  4  
ATOM 6217  H H    . THR A 1 97  ? 5.758   -10.091 -6.525  1.00 0.00 ? 100 THR A H    4  
ATOM 6218  H HA   . THR A 1 97  ? 6.104   -12.877 -6.064  1.00 0.00 ? 100 THR A HA   4  
ATOM 6219  H HB   . THR A 1 97  ? 6.427   -10.647 -4.047  1.00 0.00 ? 100 THR A HB   4  
ATOM 6220  H HG1  . THR A 1 97  ? 8.178   -11.621 -6.085  1.00 0.00 ? 100 THR A HG1  4  
ATOM 6221  H HG21 . THR A 1 97  ? 7.716   -13.372 -4.268  1.00 0.00 ? 100 THR A HG21 4  
ATOM 6222  H HG22 . THR A 1 97  ? 6.480   -12.904 -3.100  1.00 0.00 ? 100 THR A HG22 4  
ATOM 6223  H HG23 . THR A 1 97  ? 8.079   -12.159 -3.040  1.00 0.00 ? 100 THR A HG23 4  
ATOM 6224  N N    . PRO A 1 98  ? 3.952   -13.547 -4.929  1.00 0.00 ? 101 PRO A N    4  
ATOM 6225  C CA   . PRO A 1 98  ? 2.753   -13.989 -4.235  1.00 0.00 ? 101 PRO A CA   4  
ATOM 6226  C C    . PRO A 1 98  ? 3.081   -14.716 -2.933  1.00 0.00 ? 101 PRO A C    4  
ATOM 6227  O O    . PRO A 1 98  ? 2.724   -15.883 -2.746  1.00 0.00 ? 101 PRO A O    4  
ATOM 6228  C CB   . PRO A 1 98  ? 2.129   -14.941 -5.252  1.00 0.00 ? 101 PRO A CB   4  
ATOM 6229  C CG   . PRO A 1 98  ? 3.284   -15.528 -6.003  1.00 0.00 ? 101 PRO A CG   4  
ATOM 6230  C CD   . PRO A 1 98  ? 4.468   -14.605 -5.811  1.00 0.00 ? 101 PRO A CD   4  
ATOM 6231  H HA   . PRO A 1 98  ? 2.079   -13.169 -4.037  1.00 0.00 ? 101 PRO A HA   4  
ATOM 6232  H HB2  . PRO A 1 98  ? 1.567   -15.706 -4.735  1.00 0.00 ? 101 PRO A HB2  4  
ATOM 6233  H HB3  . PRO A 1 98  ? 1.475   -14.390 -5.910  1.00 0.00 ? 101 PRO A HB3  4  
ATOM 6234  H HG2  . PRO A 1 98  ? 3.512   -16.507 -5.611  1.00 0.00 ? 101 PRO A HG2  4  
ATOM 6235  H HG3  . PRO A 1 98  ? 3.035   -15.598 -7.053  1.00 0.00 ? 101 PRO A HG3  4  
ATOM 6236  H HD2  . PRO A 1 98  ? 5.284   -15.134 -5.342  1.00 0.00 ? 101 PRO A HD2  4  
ATOM 6237  H HD3  . PRO A 1 98  ? 4.782   -14.195 -6.760  1.00 0.00 ? 101 PRO A HD3  4  
ATOM 6238  N N    . GLN A 1 99  ? 3.777   -14.026 -2.043  1.00 0.00 ? 102 GLN A N    4  
ATOM 6239  C CA   . GLN A 1 99  ? 4.190   -14.610 -0.773  1.00 0.00 ? 102 GLN A CA   4  
ATOM 6240  C C    . GLN A 1 99  ? 4.158   -13.555 0.323   1.00 0.00 ? 102 GLN A C    4  
ATOM 6241  O O    . GLN A 1 99  ? 3.523   -13.733 1.359   1.00 0.00 ? 102 GLN A O    4  
ATOM 6242  C CB   . GLN A 1 99  ? 5.600   -15.197 -0.903  1.00 0.00 ? 102 GLN A CB   4  
ATOM 6243  C CG   . GLN A 1 99  ? 6.055   -16.004 0.303   1.00 0.00 ? 102 GLN A CG   4  
ATOM 6244  C CD   . GLN A 1 99  ? 5.191   -17.226 0.549   1.00 0.00 ? 102 GLN A CD   4  
ATOM 6245  O OE1  . GLN A 1 99  ? 4.217   -17.174 1.302   1.00 0.00 ? 102 GLN A OE1  4  
ATOM 6246  N NE2  . GLN A 1 99  ? 5.532   -18.330 -0.096  1.00 0.00 ? 102 GLN A NE2  4  
ATOM 6247  H H    . GLN A 1 99  ? 4.017   -13.098 -2.246  1.00 0.00 ? 102 GLN A H    4  
ATOM 6248  H HA   . GLN A 1 99  ? 3.496   -15.398 -0.525  1.00 0.00 ? 102 GLN A HA   4  
ATOM 6249  H HB2  . GLN A 1 99  ? 5.626   -15.844 -1.768  1.00 0.00 ? 102 GLN A HB2  4  
ATOM 6250  H HB3  . GLN A 1 99  ? 6.299   -14.387 -1.051  1.00 0.00 ? 102 GLN A HB3  4  
ATOM 6251  H HG2  . GLN A 1 99  ? 7.071   -16.327 0.141   1.00 0.00 ? 102 GLN A HG2  4  
ATOM 6252  H HG3  . GLN A 1 99  ? 6.015   -15.372 1.179   1.00 0.00 ? 102 GLN A HG3  4  
ATOM 6253  H HE21 . GLN A 1 99  ? 6.320   -18.300 -0.692  1.00 0.00 ? 102 GLN A HE21 4  
ATOM 6254  H HE22 . GLN A 1 99  ? 4.984   -19.132 0.037   1.00 0.00 ? 102 GLN A HE22 4  
ATOM 6255  N N    . SER A 1 100 ? 4.839   -12.450 0.079   1.00 0.00 ? 103 SER A N    4  
ATOM 6256  C CA   . SER A 1 100 ? 4.905   -11.363 1.039   1.00 0.00 ? 103 SER A CA   4  
ATOM 6257  C C    . SER A 1 100 ? 3.787   -10.351 0.808   1.00 0.00 ? 103 SER A C    4  
ATOM 6258  O O    . SER A 1 100 ? 3.661   -9.368  1.540   1.00 0.00 ? 103 SER A O    4  
ATOM 6259  C CB   . SER A 1 100 ? 6.270   -10.690 0.931   1.00 0.00 ? 103 SER A CB   4  
ATOM 6260  O OG   . SER A 1 100 ? 6.639   -10.516 -0.430  1.00 0.00 ? 103 SER A OG   4  
ATOM 6261  H H    . SER A 1 100 ? 5.329   -12.365 -0.764  1.00 0.00 ? 103 SER A H    4  
ATOM 6262  H HA   . SER A 1 100 ? 4.798   -11.783 2.027   1.00 0.00 ? 103 SER A HA   4  
ATOM 6263  H HB2  . SER A 1 100 ? 6.232   -9.724  1.410   1.00 0.00 ? 103 SER A HB2  4  
ATOM 6264  H HB3  . SER A 1 100 ? 7.012   -11.305 1.417   1.00 0.00 ? 103 SER A HB3  4  
ATOM 6265  H HG   . SER A 1 100 ? 6.749   -9.574  -0.616  1.00 0.00 ? 103 SER A HG   4  
ATOM 6266  N N    . SER A 1 101 ? 2.969   -10.607 -0.201  1.00 0.00 ? 104 SER A N    4  
ATOM 6267  C CA   . SER A 1 101 ? 1.915   -9.685  -0.588  1.00 0.00 ? 104 SER A CA   4  
ATOM 6268  C C    . SER A 1 101 ? 0.552   -10.138 -0.062  1.00 0.00 ? 104 SER A C    4  
ATOM 6269  O O    . SER A 1 101 ? 0.309   -11.333 0.131   1.00 0.00 ? 104 SER A O    4  
ATOM 6270  C CB   . SER A 1 101 ? 1.883   -9.566  -2.112  1.00 0.00 ? 104 SER A CB   4  
ATOM 6271  O OG   . SER A 1 101 ? 1.804   -10.846 -2.717  1.00 0.00 ? 104 SER A OG   4  
ATOM 6272  H H    . SER A 1 101 ? 3.067   -11.445 -0.693  1.00 0.00 ? 104 SER A H    4  
ATOM 6273  H HA   . SER A 1 101 ? 2.152   -8.719  -0.168  1.00 0.00 ? 104 SER A HA   4  
ATOM 6274  H HB2  . SER A 1 101 ? 1.022   -8.986  -2.411  1.00 0.00 ? 104 SER A HB2  4  
ATOM 6275  H HB3  . SER A 1 101 ? 2.783   -9.075  -2.452  1.00 0.00 ? 104 SER A HB3  4  
ATOM 6276  H HG   . SER A 1 101 ? 2.553   -10.965 -3.317  1.00 0.00 ? 104 SER A HG   4  
ATOM 6277  N N    . ILE A 1 102 ? -0.329  -9.171  0.176   1.00 0.00 ? 105 ILE A N    4  
ATOM 6278  C CA   . ILE A 1 102 ? -1.679  -9.451  0.643   1.00 0.00 ? 105 ILE A CA   4  
ATOM 6279  C C    . ILE A 1 102 ? -2.709  -8.656  -0.152  1.00 0.00 ? 105 ILE A C    4  
ATOM 6280  O O    . ILE A 1 102 ? -2.415  -7.577  -0.673  1.00 0.00 ? 105 ILE A O    4  
ATOM 6281  C CB   . ILE A 1 102 ? -1.864  -9.118  2.145   1.00 0.00 ? 105 ILE A CB   4  
ATOM 6282  C CG1  . ILE A 1 102 ? -1.437  -7.671  2.429   1.00 0.00 ? 105 ILE A CG1  4  
ATOM 6283  C CG2  . ILE A 1 102 ? -1.094  -10.101 3.019   1.00 0.00 ? 105 ILE A CG2  4  
ATOM 6284  C CD1  . ILE A 1 102 ? -1.750  -7.196  3.832   1.00 0.00 ? 105 ILE A CD1  4  
ATOM 6285  H H    . ILE A 1 102 ? -0.060  -8.235  0.026   1.00 0.00 ? 105 ILE A H    4  
ATOM 6286  H HA   . ILE A 1 102 ? -1.867  -10.505 0.505   1.00 0.00 ? 105 ILE A HA   4  
ATOM 6287  H HB   . ILE A 1 102 ? -2.915  -9.222  2.381   1.00 0.00 ? 105 ILE A HB   4  
ATOM 6288  H HG12 . ILE A 1 102 ? -0.373  -7.583  2.283   1.00 0.00 ? 105 ILE A HG12 4  
ATOM 6289  H HG13 . ILE A 1 102 ? -1.945  -7.016  1.738   1.00 0.00 ? 105 ILE A HG13 4  
ATOM 6290  H HG21 . ILE A 1 102 ? -1.169  -9.801  4.053   1.00 0.00 ? 105 ILE A HG21 4  
ATOM 6291  H HG22 . ILE A 1 102 ? -1.510  -11.089 2.901   1.00 0.00 ? 105 ILE A HG22 4  
ATOM 6292  H HG23 . ILE A 1 102 ? -0.055  -10.112 2.722   1.00 0.00 ? 105 ILE A HG23 4  
ATOM 6293  H HD11 . ILE A 1 102 ? -2.817  -7.224  3.991   1.00 0.00 ? 105 ILE A HD11 4  
ATOM 6294  H HD12 . ILE A 1 102 ? -1.263  -7.839  4.549   1.00 0.00 ? 105 ILE A HD12 4  
ATOM 6295  H HD13 . ILE A 1 102 ? -1.396  -6.184  3.957   1.00 0.00 ? 105 ILE A HD13 4  
ATOM 6296  N N    . ILE A 1 103 ? -3.908  -9.201  -0.241  1.00 0.00 ? 106 ILE A N    4  
ATOM 6297  C CA   . ILE A 1 103 ? -5.040  -8.500  -0.822  1.00 0.00 ? 106 ILE A CA   4  
ATOM 6298  C C    . ILE A 1 103 ? -6.098  -8.319  0.252   1.00 0.00 ? 106 ILE A C    4  
ATOM 6299  O O    . ILE A 1 103 ? -6.511  -9.282  0.893   1.00 0.00 ? 106 ILE A O    4  
ATOM 6300  C CB   . ILE A 1 103 ? -5.631  -9.253  -2.043  1.00 0.00 ? 106 ILE A CB   4  
ATOM 6301  C CG1  . ILE A 1 103 ? -4.828  -8.917  -3.300  1.00 0.00 ? 106 ILE A CG1  4  
ATOM 6302  C CG2  . ILE A 1 103 ? -7.107  -8.924  -2.240  1.00 0.00 ? 106 ILE A CG2  4  
ATOM 6303  C CD1  . ILE A 1 103 ? -5.314  -9.621  -4.551  1.00 0.00 ? 106 ILE A CD1  4  
ATOM 6304  H H    . ILE A 1 103 ? -4.047  -10.107 0.123   1.00 0.00 ? 106 ILE A H    4  
ATOM 6305  H HA   . ILE A 1 103 ? -4.699  -7.527  -1.148  1.00 0.00 ? 106 ILE A HA   4  
ATOM 6306  H HB   . ILE A 1 103 ? -5.549  -10.312 -1.852  1.00 0.00 ? 106 ILE A HB   4  
ATOM 6307  H HG12 . ILE A 1 103 ? -4.887  -7.853  -3.481  1.00 0.00 ? 106 ILE A HG12 4  
ATOM 6308  H HG13 . ILE A 1 103 ? -3.795  -9.196  -3.141  1.00 0.00 ? 106 ILE A HG13 4  
ATOM 6309  H HG21 . ILE A 1 103 ? -7.657  -9.182  -1.345  1.00 0.00 ? 106 ILE A HG21 4  
ATOM 6310  H HG22 . ILE A 1 103 ? -7.218  -7.870  -2.440  1.00 0.00 ? 106 ILE A HG22 4  
ATOM 6311  H HG23 . ILE A 1 103 ? -7.493  -9.492  -3.074  1.00 0.00 ? 106 ILE A HG23 4  
ATOM 6312  H HD11 . ILE A 1 103 ? -5.293  -10.690 -4.397  1.00 0.00 ? 106 ILE A HD11 4  
ATOM 6313  H HD12 . ILE A 1 103 ? -6.324  -9.308  -4.770  1.00 0.00 ? 106 ILE A HD12 4  
ATOM 6314  H HD13 . ILE A 1 103 ? -4.671  -9.364  -5.381  1.00 0.00 ? 106 ILE A HD13 4  
ATOM 6315  N N    . CYS A 1 104 ? -6.518  -7.092  0.473   1.00 0.00 ? 107 CYS A N    4  
ATOM 6316  C CA   . CYS A 1 104 ? -7.442  -6.819  1.555   1.00 0.00 ? 107 CYS A CA   4  
ATOM 6317  C C    . CYS A 1 104 ? -8.815  -6.446  1.018   1.00 0.00 ? 107 CYS A C    4  
ATOM 6318  O O    . CYS A 1 104 ? -8.933  -5.837  -0.049  1.00 0.00 ? 107 CYS A O    4  
ATOM 6319  C CB   . CYS A 1 104 ? -6.895  -5.716  2.459   1.00 0.00 ? 107 CYS A CB   4  
ATOM 6320  S SG   . CYS A 1 104 ? -7.543  -5.780  4.161   1.00 0.00 ? 107 CYS A SG   4  
ATOM 6321  H H    . CYS A 1 104 ? -6.216  -6.362  -0.108  1.00 0.00 ? 107 CYS A H    4  
ATOM 6322  H HA   . CYS A 1 104 ? -7.540  -7.722  2.132   1.00 0.00 ? 107 CYS A HA   4  
ATOM 6323  H HB2  . CYS A 1 104 ? -5.818  -5.799  2.512   1.00 0.00 ? 107 CYS A HB2  4  
ATOM 6324  H HB3  . CYS A 1 104 ? -7.159  -4.754  2.043   1.00 0.00 ? 107 CYS A HB3  4  
ATOM 6325  N N    . TYR A 1 105 ? -9.845  -6.833  1.757   1.00 0.00 ? 108 TYR A N    4  
ATOM 6326  C CA   . TYR A 1 105 ? -11.219 -6.567  1.370   1.00 0.00 ? 108 TYR A CA   4  
ATOM 6327  C C    . TYR A 1 105 ? -11.825 -5.517  2.291   1.00 0.00 ? 108 TYR A C    4  
ATOM 6328  O O    . TYR A 1 105 ? -11.309 -5.264  3.382   1.00 0.00 ? 108 TYR A O    4  
ATOM 6329  C CB   . TYR A 1 105 ? -12.057 -7.848  1.439   1.00 0.00 ? 108 TYR A CB   4  
ATOM 6330  C CG   . TYR A 1 105 ? -11.503 -8.999  0.625   1.00 0.00 ? 108 TYR A CG   4  
ATOM 6331  C CD1  . TYR A 1 105 ? -11.628 -9.021  -0.760  1.00 0.00 ? 108 TYR A CD1  4  
ATOM 6332  C CD2  . TYR A 1 105 ? -10.864 -10.067 1.243   1.00 0.00 ? 108 TYR A CD2  4  
ATOM 6333  C CE1  . TYR A 1 105 ? -11.129 -10.075 -1.504  1.00 0.00 ? 108 TYR A CE1  4  
ATOM 6334  C CE2  . TYR A 1 105 ? -10.362 -11.122 0.506   1.00 0.00 ? 108 TYR A CE2  4  
ATOM 6335  C CZ   . TYR A 1 105 ? -10.498 -11.123 -0.866  1.00 0.00 ? 108 TYR A CZ   4  
ATOM 6336  O OH   . TYR A 1 105 ? -10.002 -12.176 -1.602  1.00 0.00 ? 108 TYR A OH   4  
ATOM 6337  H H    . TYR A 1 105 ? -9.673  -7.306  2.603   1.00 0.00 ? 108 TYR A H    4  
ATOM 6338  H HA   . TYR A 1 105 ? -11.218 -6.196  0.359   1.00 0.00 ? 108 TYR A HA   4  
ATOM 6339  H HB2  . TYR A 1 105 ? -12.119 -8.170  2.466   1.00 0.00 ? 108 TYR A HB2  4  
ATOM 6340  H HB3  . TYR A 1 105 ? -13.053 -7.636  1.075   1.00 0.00 ? 108 TYR A HB3  4  
ATOM 6341  H HD1  . TYR A 1 105 ? -12.121 -8.200  -1.257  1.00 0.00 ? 108 TYR A HD1  4  
ATOM 6342  H HD2  . TYR A 1 105 ? -10.760 -10.068 2.318   1.00 0.00 ? 108 TYR A HD2  4  
ATOM 6343  H HE1  . TYR A 1 105 ? -11.236 -10.074 -2.580  1.00 0.00 ? 108 TYR A HE1  4  
ATOM 6344  H HE2  . TYR A 1 105 ? -9.868  -11.941 1.006   1.00 0.00 ? 108 TYR A HE2  4  
ATOM 6345  H HH   . TYR A 1 105 ? -9.600  -11.839 -2.417  1.00 0.00 ? 108 TYR A HH   4  
ATOM 6346  N N    . GLY A 1 106 ? -12.921 -4.913  1.857   1.00 0.00 ? 109 GLY A N    4  
ATOM 6347  C CA   . GLY A 1 106 ? -13.577 -3.907  2.661   1.00 0.00 ? 109 GLY A CA   4  
ATOM 6348  C C    . GLY A 1 106 ? -13.716 -2.594  1.928   1.00 0.00 ? 109 GLY A C    4  
ATOM 6349  O O    . GLY A 1 106 ? -14.535 -2.464  1.017   1.00 0.00 ? 109 GLY A O    4  
ATOM 6350  H H    . GLY A 1 106 ? -13.288 -5.149  0.970   1.00 0.00 ? 109 GLY A H    4  
ATOM 6351  H HA2  . GLY A 1 106 ? -14.562 -4.261  2.935   1.00 0.00 ? 109 GLY A HA2  4  
ATOM 6352  H HA3  . GLY A 1 106 ? -13.001 -3.747  3.560   1.00 0.00 ? 109 GLY A HA3  4  
ATOM 6353  N N    . GLN A 1 107 ? -12.911 -1.622  2.317   1.00 0.00 ? 110 GLN A N    4  
ATOM 6354  C CA   . GLN A 1 107 ? -12.936 -0.306  1.699   1.00 0.00 ? 110 GLN A CA   4  
ATOM 6355  C C    . GLN A 1 107 ? -11.520 0.248   1.649   1.00 0.00 ? 110 GLN A C    4  
ATOM 6356  O O    . GLN A 1 107 ? -10.682 -0.133  2.463   1.00 0.00 ? 110 GLN A O    4  
ATOM 6357  C CB   . GLN A 1 107 ? -13.844 0.631   2.500   1.00 0.00 ? 110 GLN A CB   4  
ATOM 6358  C CG   . GLN A 1 107 ? -14.185 1.927   1.778   1.00 0.00 ? 110 GLN A CG   4  
ATOM 6359  C CD   . GLN A 1 107 ? -14.996 2.875   2.640   1.00 0.00 ? 110 GLN A CD   4  
ATOM 6360  O OE1  . GLN A 1 107 ? -15.724 2.447   3.536   1.00 0.00 ? 110 GLN A OE1  4  
ATOM 6361  N NE2  . GLN A 1 107 ? -14.887 4.164   2.367   1.00 0.00 ? 110 GLN A NE2  4  
ATOM 6362  H H    . GLN A 1 107 ? -12.270 -1.795  3.038   1.00 0.00 ? 110 GLN A H    4  
ATOM 6363  H HA   . GLN A 1 107 ? -13.317 -0.410  0.694   1.00 0.00 ? 110 GLN A HA   4  
ATOM 6364  H HB2  . GLN A 1 107 ? -14.767 0.116   2.720   1.00 0.00 ? 110 GLN A HB2  4  
ATOM 6365  H HB3  . GLN A 1 107 ? -13.352 0.883   3.429   1.00 0.00 ? 110 GLN A HB3  4  
ATOM 6366  H HG2  . GLN A 1 107 ? -13.266 2.421   1.495   1.00 0.00 ? 110 GLN A HG2  4  
ATOM 6367  H HG3  . GLN A 1 107 ? -14.756 1.692   0.891   1.00 0.00 ? 110 GLN A HG3  4  
ATOM 6368  H HE21 . GLN A 1 107 ? -14.299 4.434   1.629   1.00 0.00 ? 110 GLN A HE21 4  
ATOM 6369  H HE22 . GLN A 1 107 ? -15.397 4.802   2.915   1.00 0.00 ? 110 GLN A HE22 4  
ATOM 6370  N N    . LEU A 1 108 ? -11.253 1.124   0.687   1.00 0.00 ? 111 LEU A N    4  
ATOM 6371  C CA   . LEU A 1 108 ? -9.929  1.716   0.528   1.00 0.00 ? 111 LEU A CA   4  
ATOM 6372  C C    . LEU A 1 108 ? -9.490  2.412   1.817   1.00 0.00 ? 111 LEU A C    4  
ATOM 6373  O O    . LEU A 1 108 ? -10.022 3.460   2.180   1.00 0.00 ? 111 LEU A O    4  
ATOM 6374  C CB   . LEU A 1 108 ? -9.936  2.715   -0.637  1.00 0.00 ? 111 LEU A CB   4  
ATOM 6375  C CG   . LEU A 1 108 ? -8.604  3.419   -0.925  1.00 0.00 ? 111 LEU A CG   4  
ATOM 6376  C CD1  . LEU A 1 108 ? -7.553  2.429   -1.406  1.00 0.00 ? 111 LEU A CD1  4  
ATOM 6377  C CD2  . LEU A 1 108 ? -8.800  4.526   -1.951  1.00 0.00 ? 111 LEU A CD2  4  
ATOM 6378  H H    . LEU A 1 108 ? -11.966 1.382   0.068   1.00 0.00 ? 111 LEU A H    4  
ATOM 6379  H HA   . LEU A 1 108 ? -9.236  0.918   0.307   1.00 0.00 ? 111 LEU A HA   4  
ATOM 6380  H HB2  . LEU A 1 108 ? -10.241 2.188   -1.529  1.00 0.00 ? 111 LEU A HB2  4  
ATOM 6381  H HB3  . LEU A 1 108 ? -10.675 3.470   -0.422  1.00 0.00 ? 111 LEU A HB3  4  
ATOM 6382  H HG   . LEU A 1 108 ? -8.241  3.871   -0.013  1.00 0.00 ? 111 LEU A HG   4  
ATOM 6383  H HD11 . LEU A 1 108 ? -7.929  1.891   -2.264  1.00 0.00 ? 111 LEU A HD11 4  
ATOM 6384  H HD12 . LEU A 1 108 ? -6.657  2.965   -1.682  1.00 0.00 ? 111 LEU A HD12 4  
ATOM 6385  H HD13 . LEU A 1 108 ? -7.323  1.731   -0.615  1.00 0.00 ? 111 LEU A HD13 4  
ATOM 6386  H HD21 . LEU A 1 108 ? -9.178  4.103   -2.871  1.00 0.00 ? 111 LEU A HD21 4  
ATOM 6387  H HD22 . LEU A 1 108 ? -9.505  5.250   -1.572  1.00 0.00 ? 111 LEU A HD22 4  
ATOM 6388  H HD23 . LEU A 1 108 ? -7.854  5.010   -2.142  1.00 0.00 ? 111 LEU A HD23 4  
ATOM 6389  N N    . GLY A 1 109 ? -8.526  1.811   2.504   1.00 0.00 ? 112 GLY A N    4  
ATOM 6390  C CA   . GLY A 1 109 ? -8.057  2.353   3.765   1.00 0.00 ? 112 GLY A CA   4  
ATOM 6391  C C    . GLY A 1 109 ? -8.489  1.509   4.950   1.00 0.00 ? 112 GLY A C    4  
ATOM 6392  O O    . GLY A 1 109 ? -8.144  1.809   6.095   1.00 0.00 ? 112 GLY A O    4  
ATOM 6393  H H    . GLY A 1 109 ? -8.129  0.990   2.150   1.00 0.00 ? 112 GLY A H    4  
ATOM 6394  H HA2  . GLY A 1 109 ? -6.976  2.401   3.744   1.00 0.00 ? 112 GLY A HA2  4  
ATOM 6395  H HA3  . GLY A 1 109 ? -8.451  3.351   3.883   1.00 0.00 ? 112 GLY A HA3  4  
ATOM 6396  N N    . SER A 1 110 ? -9.249  0.459   4.673   1.00 0.00 ? 113 SER A N    4  
ATOM 6397  C CA   . SER A 1 110 ? -9.716  -0.455  5.703   1.00 0.00 ? 113 SER A CA   4  
ATOM 6398  C C    . SER A 1 110 ? -8.926  -1.763  5.653   1.00 0.00 ? 113 SER A C    4  
ATOM 6399  O O    . SER A 1 110 ? -9.239  -2.669  4.879   1.00 0.00 ? 113 SER A O    4  
ATOM 6400  C CB   . SER A 1 110 ? -11.215 -0.729  5.522   1.00 0.00 ? 113 SER A CB   4  
ATOM 6401  O OG   . SER A 1 110 ? -11.721 -1.571  6.545   1.00 0.00 ? 113 SER A OG   4  
ATOM 6402  H H    . SER A 1 110 ? -9.517  0.295   3.740   1.00 0.00 ? 113 SER A H    4  
ATOM 6403  H HA   . SER A 1 110 ? -9.556  0.014   6.661   1.00 0.00 ? 113 SER A HA   4  
ATOM 6404  H HB2  . SER A 1 110 ? -11.752 0.207   5.548   1.00 0.00 ? 113 SER A HB2  4  
ATOM 6405  H HB3  . SER A 1 110 ? -11.375 -1.208  4.569   1.00 0.00 ? 113 SER A HB3  4  
ATOM 6406  H HG   . SER A 1 110 ? -12.496 -2.048  6.211   1.00 0.00 ? 113 SER A HG   4  
ATOM 6407  N N    . PHE A 1 111 ? -7.901  -1.849  6.485   1.00 0.00 ? 114 PHE A N    4  
ATOM 6408  C CA   . PHE A 1 111 ? -7.080  -3.047  6.583   1.00 0.00 ? 114 PHE A CA   4  
ATOM 6409  C C    . PHE A 1 111 ? -7.662  -3.974  7.642   1.00 0.00 ? 114 PHE A C    4  
ATOM 6410  O O    . PHE A 1 111 ? -7.035  -4.250  8.666   1.00 0.00 ? 114 PHE A O    4  
ATOM 6411  C CB   . PHE A 1 111 ? -5.633  -2.683  6.936   1.00 0.00 ? 114 PHE A CB   4  
ATOM 6412  C CG   . PHE A 1 111 ? -4.902  -1.942  5.849   1.00 0.00 ? 114 PHE A CG   4  
ATOM 6413  C CD1  . PHE A 1 111 ? -4.987  -0.561  5.751   1.00 0.00 ? 114 PHE A CD1  4  
ATOM 6414  C CD2  . PHE A 1 111 ? -4.124  -2.627  4.930   1.00 0.00 ? 114 PHE A CD2  4  
ATOM 6415  C CE1  . PHE A 1 111 ? -4.309  0.119   4.756   1.00 0.00 ? 114 PHE A CE1  4  
ATOM 6416  C CE2  . PHE A 1 111 ? -3.444  -1.952  3.934   1.00 0.00 ? 114 PHE A CE2  4  
ATOM 6417  C CZ   . PHE A 1 111 ? -3.539  -0.578  3.847   1.00 0.00 ? 114 PHE A CZ   4  
ATOM 6418  H H    . PHE A 1 111 ? -7.702  -1.089  7.073   1.00 0.00 ? 114 PHE A H    4  
ATOM 6419  H HA   . PHE A 1 111 ? -7.100  -3.549  5.626   1.00 0.00 ? 114 PHE A HA   4  
ATOM 6420  H HB2  . PHE A 1 111 ? -5.634  -2.057  7.815   1.00 0.00 ? 114 PHE A HB2  4  
ATOM 6421  H HB3  . PHE A 1 111 ? -5.085  -3.590  7.152   1.00 0.00 ? 114 PHE A HB3  4  
ATOM 6422  H HD1  . PHE A 1 111 ? -5.588  -0.013  6.461   1.00 0.00 ? 114 PHE A HD1  4  
ATOM 6423  H HD2  . PHE A 1 111 ? -4.050  -3.702  4.996   1.00 0.00 ? 114 PHE A HD2  4  
ATOM 6424  H HE1  . PHE A 1 111 ? -4.385  1.194   4.689   1.00 0.00 ? 114 PHE A HE1  4  
ATOM 6425  H HE2  . PHE A 1 111 ? -2.843  -2.499  3.223   1.00 0.00 ? 114 PHE A HE2  4  
ATOM 6426  H HZ   . PHE A 1 111 ? -3.011  -0.049  3.069   1.00 0.00 ? 114 PHE A HZ   4  
ATOM 6427  N N    . SER A 1 112 ? -8.880  -4.424  7.402   1.00 0.00 ? 115 SER A N    4  
ATOM 6428  C CA   . SER A 1 112 ? -9.582  -5.261  8.357   1.00 0.00 ? 115 SER A CA   4  
ATOM 6429  C C    . SER A 1 112 ? -9.474  -6.735  7.966   1.00 0.00 ? 115 SER A C    4  
ATOM 6430  O O    . SER A 1 112 ? -8.866  -7.536  8.681   1.00 0.00 ? 115 SER A O    4  
ATOM 6431  C CB   . SER A 1 112 ? -11.049 -4.825  8.448   1.00 0.00 ? 115 SER A CB   4  
ATOM 6432  O OG   . SER A 1 112 ? -11.663 -5.320  9.626   1.00 0.00 ? 115 SER A OG   4  
ATOM 6433  H H    . SER A 1 112 ? -9.320  -4.181  6.559   1.00 0.00 ? 115 SER A H    4  
ATOM 6434  H HA   . SER A 1 112 ? -9.114  -5.124  9.322   1.00 0.00 ? 115 SER A HA   4  
ATOM 6435  H HB2  . SER A 1 112 ? -11.101 -3.747  8.458   1.00 0.00 ? 115 SER A HB2  4  
ATOM 6436  H HB3  . SER A 1 112 ? -11.587 -5.203  7.591   1.00 0.00 ? 115 SER A HB3  4  
ATOM 6437  H HG   . SER A 1 112 ? -12.322 -5.993  9.385   1.00 0.00 ? 115 SER A HG   4  
ATOM 6438  N N    . ASN A 1 113 ? -10.047 -7.088  6.822   1.00 0.00 ? 116 ASN A N    4  
ATOM 6439  C CA   . ASN A 1 113 ? -10.019 -8.467  6.355   1.00 0.00 ? 116 ASN A CA   4  
ATOM 6440  C C    . ASN A 1 113 ? -9.085  -8.598  5.163   1.00 0.00 ? 116 ASN A C    4  
ATOM 6441  O O    . ASN A 1 113 ? -9.498  -8.446  4.012   1.00 0.00 ? 116 ASN A O    4  
ATOM 6442  C CB   . ASN A 1 113 ? -11.428 -8.947  5.981   1.00 0.00 ? 116 ASN A CB   4  
ATOM 6443  C CG   . ASN A 1 113 ? -11.450 -10.396 5.516   1.00 0.00 ? 116 ASN A CG   4  
ATOM 6444  O OD1  . ASN A 1 113 ? -10.640 -11.216 5.948   1.00 0.00 ? 116 ASN A OD1  4  
ATOM 6445  N ND2  . ASN A 1 113 ? -12.381 -10.720 4.633   1.00 0.00 ? 116 ASN A ND2  4  
ATOM 6446  H H    . ASN A 1 113 ? -10.481 -6.406  6.270   1.00 0.00 ? 116 ASN A H    4  
ATOM 6447  H HA   . ASN A 1 113 ? -9.641  -9.082  7.158   1.00 0.00 ? 116 ASN A HA   4  
ATOM 6448  H HB2  . ASN A 1 113 ? -12.074 -8.856  6.843   1.00 0.00 ? 116 ASN A HB2  4  
ATOM 6449  H HB3  . ASN A 1 113 ? -11.811 -8.328  5.183   1.00 0.00 ? 116 ASN A HB3  4  
ATOM 6450  H HD21 . ASN A 1 113 ? -12.999 -10.016 4.328   1.00 0.00 ? 116 ASN A HD21 4  
ATOM 6451  H HD22 . ASN A 1 113 ? -12.421 -11.649 4.321   1.00 0.00 ? 116 ASN A HD22 4  
ATOM 6452  N N    . CYS A 1 114 ? -7.820  -8.851  5.442   1.00 0.00 ? 117 CYS A N    4  
ATOM 6453  C CA   . CYS A 1 114 ? -6.833  -8.997  4.388   1.00 0.00 ? 117 CYS A CA   4  
ATOM 6454  C C    . CYS A 1 114 ? -6.423  -10.460 4.265   1.00 0.00 ? 117 CYS A C    4  
ATOM 6455  O O    . CYS A 1 114 ? -6.240  -11.144 5.273   1.00 0.00 ? 117 CYS A O    4  
ATOM 6456  C CB   . CYS A 1 114 ? -5.604  -8.127  4.676   1.00 0.00 ? 117 CYS A CB   4  
ATOM 6457  S SG   . CYS A 1 114 ? -5.974  -6.437  5.278   1.00 0.00 ? 117 CYS A SG   4  
ATOM 6458  H H    . CYS A 1 114 ? -7.544  -8.946  6.376   1.00 0.00 ? 117 CYS A H    4  
ATOM 6459  H HA   . CYS A 1 114 ? -7.286  -8.682  3.464   1.00 0.00 ? 117 CYS A HA   4  
ATOM 6460  H HB2  . CYS A 1 114 ? -5.001  -8.615  5.427   1.00 0.00 ? 117 CYS A HB2  4  
ATOM 6461  H HB3  . CYS A 1 114 ? -5.024  -8.030  3.767   1.00 0.00 ? 117 CYS A HB3  4  
ATOM 6462  N N    . SER A 1 115 ? -6.288  -10.941 3.041   1.00 0.00 ? 118 SER A N    4  
ATOM 6463  C CA   . SER A 1 115 ? -5.951  -12.333 2.802   1.00 0.00 ? 118 SER A CA   4  
ATOM 6464  C C    . SER A 1 115 ? -4.613  -12.456 2.075   1.00 0.00 ? 118 SER A C    4  
ATOM 6465  O O    . SER A 1 115 ? -4.145  -11.509 1.434   1.00 0.00 ? 118 SER A O    4  
ATOM 6466  C CB   . SER A 1 115 ? -7.064  -12.999 1.988   1.00 0.00 ? 118 SER A CB   4  
ATOM 6467  O OG   . SER A 1 115 ? -7.354  -12.255 0.818   1.00 0.00 ? 118 SER A OG   4  
ATOM 6468  H H    . SER A 1 115 ? -6.413  -10.345 2.267   1.00 0.00 ? 118 SER A H    4  
ATOM 6469  H HA   . SER A 1 115 ? -5.875  -12.824 3.760   1.00 0.00 ? 118 SER A HA   4  
ATOM 6470  H HB2  . SER A 1 115 ? -6.751  -13.993 1.700   1.00 0.00 ? 118 SER A HB2  4  
ATOM 6471  H HB3  . SER A 1 115 ? -7.959  -13.063 2.590   1.00 0.00 ? 118 SER A HB3  4  
ATOM 6472  H HG   . SER A 1 115 ? -8.178  -12.570 0.436   1.00 0.00 ? 118 SER A HG   4  
ATOM 6473  N N    . HIS A 1 116 ? -4.001  -13.625 2.203   1.00 0.00 ? 119 HIS A N    4  
ATOM 6474  C CA   . HIS A 1 116 ? -2.735  -13.922 1.547   1.00 0.00 ? 119 HIS A CA   4  
ATOM 6475  C C    . HIS A 1 116 ? -2.925  -13.952 0.033   1.00 0.00 ? 119 HIS A C    4  
ATOM 6476  O O    . HIS A 1 116 ? -3.797  -14.657 -0.475  1.00 0.00 ? 119 HIS A O    4  
ATOM 6477  C CB   . HIS A 1 116 ? -2.205  -15.269 2.054   1.00 0.00 ? 119 HIS A CB   4  
ATOM 6478  C CG   . HIS A 1 116 ? -0.841  -15.633 1.553   1.00 0.00 ? 119 HIS A CG   4  
ATOM 6479  N ND1  . HIS A 1 116 ? 0.312   -15.361 2.255   1.00 0.00 ? 119 HIS A ND1  4  
ATOM 6480  C CD2  . HIS A 1 116 ? -0.452  -16.269 0.424   1.00 0.00 ? 119 HIS A CD2  4  
ATOM 6481  C CE1  . HIS A 1 116 ? 1.351   -15.815 1.582   1.00 0.00 ? 119 HIS A CE1  4  
ATOM 6482  N NE2  . HIS A 1 116 ? 0.914   -16.371 0.467   1.00 0.00 ? 119 HIS A NE2  4  
ATOM 6483  H H    . HIS A 1 116 ? -4.420  -14.319 2.763   1.00 0.00 ? 119 HIS A H    4  
ATOM 6484  H HA   . HIS A 1 116 ? -2.032  -13.144 1.798   1.00 0.00 ? 119 HIS A HA   4  
ATOM 6485  H HB2  . HIS A 1 116 ? -2.161  -15.243 3.131   1.00 0.00 ? 119 HIS A HB2  4  
ATOM 6486  H HB3  . HIS A 1 116 ? -2.888  -16.049 1.749   1.00 0.00 ? 119 HIS A HB3  4  
ATOM 6487  H HD1  . HIS A 1 116 ? 0.363   -14.899 3.128   1.00 0.00 ? 119 HIS A HD1  4  
ATOM 6488  H HD2  . HIS A 1 116 ? -1.099  -16.631 -0.362  1.00 0.00 ? 119 HIS A HD2  4  
ATOM 6489  H HE1  . HIS A 1 116 ? 2.384   -15.742 1.888   1.00 0.00 ? 119 HIS A HE1  4  
ATOM 6490  N N    . SER A 1 117 ? -2.109  -13.191 -0.682  1.00 0.00 ? 120 SER A N    4  
ATOM 6491  C CA   . SER A 1 117 ? -2.245  -13.081 -2.126  1.00 0.00 ? 120 SER A CA   4  
ATOM 6492  C C    . SER A 1 117 ? -1.839  -14.389 -2.806  1.00 0.00 ? 120 SER A C    4  
ATOM 6493  O O    . SER A 1 117 ? -0.668  -14.775 -2.799  1.00 0.00 ? 120 SER A O    4  
ATOM 6494  C CB   . SER A 1 117 ? -1.405  -11.912 -2.649  1.00 0.00 ? 120 SER A CB   4  
ATOM 6495  O OG   . SER A 1 117 ? -1.654  -11.673 -4.023  1.00 0.00 ? 120 SER A OG   4  
ATOM 6496  H H    . SER A 1 117 ? -1.391  -12.697 -0.230  1.00 0.00 ? 120 SER A H    4  
ATOM 6497  H HA   . SER A 1 117 ? -3.286  -12.886 -2.341  1.00 0.00 ? 120 SER A HA   4  
ATOM 6498  H HB2  . SER A 1 117 ? -1.653  -11.020 -2.094  1.00 0.00 ? 120 SER A HB2  4  
ATOM 6499  H HB3  . SER A 1 117 ? -0.356  -12.137 -2.519  1.00 0.00 ? 120 SER A HB3  4  
ATOM 6500  H HG   . SER A 1 117 ? -0.958  -11.106 -4.378  1.00 0.00 ? 120 SER A HG   4  
ATOM 6501  N N    . ARG A 1 118 ? -2.824  -15.077 -3.372  1.00 0.00 ? 121 ARG A N    4  
ATOM 6502  C CA   . ARG A 1 118 ? -2.593  -16.352 -4.042  1.00 0.00 ? 121 ARG A CA   4  
ATOM 6503  C C    . ARG A 1 118 ? -2.383  -16.166 -5.539  1.00 0.00 ? 121 ARG A C    4  
ATOM 6504  O O    . ARG A 1 118 ? -2.254  -17.139 -6.280  1.00 0.00 ? 121 ARG A O    4  
ATOM 6505  C CB   . ARG A 1 118 ? -3.780  -17.289 -3.820  1.00 0.00 ? 121 ARG A CB   4  
ATOM 6506  C CG   . ARG A 1 118 ? -5.095  -16.717 -4.318  1.00 0.00 ? 121 ARG A CG   4  
ATOM 6507  C CD   . ARG A 1 118 ? -6.197  -17.760 -4.313  1.00 0.00 ? 121 ARG A CD   4  
ATOM 6508  N NE   . ARG A 1 118 ? -6.434  -18.320 -2.985  1.00 0.00 ? 121 ARG A NE   4  
ATOM 6509  C CZ   . ARG A 1 118 ? -7.312  -19.285 -2.747  1.00 0.00 ? 121 ARG A CZ   4  
ATOM 6510  N NH1  . ARG A 1 118 ? -8.010  -19.798 -3.748  1.00 0.00 ? 121 ARG A NH1  4  
ATOM 6511  N NH2  . ARG A 1 118 ? -7.483  -19.751 -1.522  1.00 0.00 ? 121 ARG A NH2  4  
ATOM 6512  H H    . ARG A 1 118 ? -3.737  -14.727 -3.319  1.00 0.00 ? 121 ARG A H    4  
ATOM 6513  H HA   . ARG A 1 118 ? -1.709  -16.798 -3.616  1.00 0.00 ? 121 ARG A HA   4  
ATOM 6514  H HB2  . ARG A 1 118 ? -3.595  -18.218 -4.339  1.00 0.00 ? 121 ARG A HB2  4  
ATOM 6515  H HB3  . ARG A 1 118 ? -3.876  -17.489 -2.764  1.00 0.00 ? 121 ARG A HB3  4  
ATOM 6516  H HG2  . ARG A 1 118 ? -5.384  -15.897 -3.680  1.00 0.00 ? 121 ARG A HG2  4  
ATOM 6517  H HG3  . ARG A 1 118 ? -4.958  -16.358 -5.327  1.00 0.00 ? 121 ARG A HG3  4  
ATOM 6518  H HD2  . ARG A 1 118 ? -7.108  -17.301 -4.664  1.00 0.00 ? 121 ARG A HD2  4  
ATOM 6519  H HD3  . ARG A 1 118 ? -5.917  -18.561 -4.984  1.00 0.00 ? 121 ARG A HD3  4  
ATOM 6520  H HE   . ARG A 1 118 ? -5.904  -17.956 -2.229  1.00 0.00 ? 121 ARG A HE   4  
ATOM 6521  H HH12 . ARG A 1 118 ? -9.021  -19.686 -3.780  1.00 0.00 ? 121 ARG A HH12 4  
ATOM 6522  H HH21 . ARG A 1 118 ? -6.953  -19.375 -0.761  1.00 0.00 ? 121 ARG A HH21 4  
ATOM 6523  H HH22 . ARG A 1 118 ? -8.144  -20.492 -1.354  1.00 0.00 ? 121 ARG A HH22 4  
ATOM 6524  N N    . ASN A 1 119 ? -2.355  -14.921 -5.987  1.00 0.00 ? 122 ASN A N    4  
ATOM 6525  C CA   . ASN A 1 119 ? -2.233  -14.642 -7.409  1.00 0.00 ? 122 ASN A CA   4  
ATOM 6526  C C    . ASN A 1 119 ? -0.841  -14.125 -7.729  1.00 0.00 ? 122 ASN A C    4  
ATOM 6527  O O    . ASN A 1 119 ? -0.306  -13.266 -7.028  1.00 0.00 ? 122 ASN A O    4  
ATOM 6528  C CB   . ASN A 1 119 ? -3.306  -13.645 -7.876  1.00 0.00 ? 122 ASN A CB   4  
ATOM 6529  C CG   . ASN A 1 119 ? -3.190  -12.283 -7.219  1.00 0.00 ? 122 ASN A CG   4  
ATOM 6530  O OD1  . ASN A 1 119 ? -2.529  -11.385 -7.735  1.00 0.00 ? 122 ASN A OD1  4  
ATOM 6531  N ND2  . ASN A 1 119 ? -3.847  -12.118 -6.083  1.00 0.00 ? 122 ASN A ND2  4  
ATOM 6532  H H    . ASN A 1 119 ? -2.389  -14.177 -5.351  1.00 0.00 ? 122 ASN A H    4  
ATOM 6533  H HA   . ASN A 1 119 ? -2.377  -15.577 -7.933  1.00 0.00 ? 122 ASN A HA   4  
ATOM 6534  H HB2  . ASN A 1 119 ? -3.220  -13.511 -8.942  1.00 0.00 ? 122 ASN A HB2  4  
ATOM 6535  H HB3  . ASN A 1 119 ? -4.281  -14.051 -7.648  1.00 0.00 ? 122 ASN A HB3  4  
ATOM 6536  H HD21 . ASN A 1 119 ? -4.369  -12.870 -5.737  1.00 0.00 ? 122 ASN A HD21 4  
ATOM 6537  H HD22 . ASN A 1 119 ? -3.775  -11.253 -5.628  1.00 0.00 ? 122 ASN A HD22 4  
ATOM 6538  N N    . ASP A 1 120 ? -0.251  -14.666 -8.781  1.00 0.00 ? 123 ASP A N    4  
ATOM 6539  C CA   . ASP A 1 120 ? 1.095   -14.276 -9.186  1.00 0.00 ? 123 ASP A CA   4  
ATOM 6540  C C    . ASP A 1 120 ? 1.044   -13.143 -10.205 1.00 0.00 ? 123 ASP A C    4  
ATOM 6541  O O    . ASP A 1 120 ? 2.045   -12.818 -10.841 1.00 0.00 ? 123 ASP A O    4  
ATOM 6542  C CB   . ASP A 1 120 ? 1.866   -15.473 -9.747  1.00 0.00 ? 123 ASP A CB   4  
ATOM 6543  C CG   . ASP A 1 120 ? 1.218   -16.065 -10.977 1.00 0.00 ? 123 ASP A CG   4  
ATOM 6544  O OD1  . ASP A 1 120 ? 0.243   -16.837 -10.829 1.00 0.00 ? 123 ASP A OD1  4  
ATOM 6545  O OD2  . ASP A 1 120 ? 1.692   -15.782 -12.094 1.00 0.00 ? 123 ASP A OD2  4  
ATOM 6546  H H    . ASP A 1 120 ? -0.729  -15.353 -9.301  1.00 0.00 ? 123 ASP A H    4  
ATOM 6547  H HA   . ASP A 1 120 ? 1.604   -13.917 -8.304  1.00 0.00 ? 123 ASP A HA   4  
ATOM 6548  H HB2  . ASP A 1 120 ? 2.864   -15.156 -10.012 1.00 0.00 ? 123 ASP A HB2  4  
ATOM 6549  H HB3  . ASP A 1 120 ? 1.927   -16.241 -8.990  1.00 0.00 ? 123 ASP A HB3  4  
ATOM 6550  N N    . MET A 1 121 ? -0.133  -12.549 -10.354 1.00 0.00 ? 124 MET A N    4  
ATOM 6551  C CA   . MET A 1 121 ? -0.287  -11.332 -11.139 1.00 0.00 ? 124 MET A CA   4  
ATOM 6552  C C    . MET A 1 121 ? -0.388  -10.152 -10.184 1.00 0.00 ? 124 MET A C    4  
ATOM 6553  O O    . MET A 1 121 ? -0.868  -9.074  -10.541 1.00 0.00 ? 124 MET A O    4  
ATOM 6554  C CB   . MET A 1 121 ? -1.535  -11.379 -12.034 1.00 0.00 ? 124 MET A CB   4  
ATOM 6555  C CG   . MET A 1 121 ? -1.624  -12.598 -12.939 1.00 0.00 ? 124 MET A CG   4  
ATOM 6556  S SD   . MET A 1 121 ? -2.306  -14.042 -12.098 1.00 0.00 ? 124 MET A SD   4  
ATOM 6557  C CE   . MET A 1 121 ? -3.966  -13.472 -11.739 1.00 0.00 ? 124 MET A CE   4  
ATOM 6558  H H    . MET A 1 121 ? -0.921  -12.940 -9.925  1.00 0.00 ? 124 MET A H    4  
ATOM 6559  H HA   . MET A 1 121 ? 0.595   -11.215 -11.753 1.00 0.00 ? 124 MET A HA   4  
ATOM 6560  H HB2  . MET A 1 121 ? -2.410  -11.367 -11.403 1.00 0.00 ? 124 MET A HB2  4  
ATOM 6561  H HB3  . MET A 1 121 ? -1.546  -10.495 -12.656 1.00 0.00 ? 124 MET A HB3  4  
ATOM 6562  H HG2  . MET A 1 121 ? -2.254  -12.361 -13.781 1.00 0.00 ? 124 MET A HG2  4  
ATOM 6563  H HG3  . MET A 1 121 ? -0.633  -12.843 -13.293 1.00 0.00 ? 124 MET A HG3  4  
ATOM 6564  H HE1  . MET A 1 121 ? -4.480  -13.251 -12.664 1.00 0.00 ? 124 MET A HE1  4  
ATOM 6565  H HE2  . MET A 1 121 ? -4.502  -14.243 -11.205 1.00 0.00 ? 124 MET A HE2  4  
ATOM 6566  H HE3  . MET A 1 121 ? -3.918  -12.581 -11.131 1.00 0.00 ? 124 MET A HE3  4  
ATOM 6567  N N    . CYS A 1 122 ? 0.061   -10.383 -8.959  1.00 0.00 ? 125 CYS A N    4  
ATOM 6568  C CA   . CYS A 1 122 ? -0.019  -9.388  -7.902  1.00 0.00 ? 125 CYS A CA   4  
ATOM 6569  C C    . CYS A 1 122 ? 0.865   -8.189  -8.212  1.00 0.00 ? 125 CYS A C    4  
ATOM 6570  O O    . CYS A 1 122 ? 2.090   -8.299  -8.293  1.00 0.00 ? 125 CYS A O    4  
ATOM 6571  C CB   . CYS A 1 122 ? 0.379   -10.003 -6.559  1.00 0.00 ? 125 CYS A CB   4  
ATOM 6572  S SG   . CYS A 1 122 ? 0.247   -8.859  -5.143  1.00 0.00 ? 125 CYS A SG   4  
ATOM 6573  H H    . CYS A 1 122 ? 0.459   -11.257 -8.759  1.00 0.00 ? 125 CYS A H    4  
ATOM 6574  H HA   . CYS A 1 122 ? -1.043  -9.053  -7.843  1.00 0.00 ? 125 CYS A HA   4  
ATOM 6575  H HB2  . CYS A 1 122 ? -0.259  -10.850 -6.353  1.00 0.00 ? 125 CYS A HB2  4  
ATOM 6576  H HB3  . CYS A 1 122 ? 1.404   -10.337 -6.615  1.00 0.00 ? 125 CYS A HB3  4  
ATOM 6577  N N    . HIS A 1 123 ? 0.229   -7.049  -8.405  1.00 0.00 ? 126 HIS A N    4  
ATOM 6578  C CA   . HIS A 1 123 ? 0.944   -5.813  -8.646  1.00 0.00 ? 126 HIS A CA   4  
ATOM 6579  C C    . HIS A 1 123 ? 1.279   -5.162  -7.311  1.00 0.00 ? 126 HIS A C    4  
ATOM 6580  O O    . HIS A 1 123 ? 0.436   -5.103  -6.416  1.00 0.00 ? 126 HIS A O    4  
ATOM 6581  C CB   . HIS A 1 123 ? 0.100   -4.858  -9.498  1.00 0.00 ? 126 HIS A CB   4  
ATOM 6582  C CG   . HIS A 1 123 ? -0.377  -5.447  -10.791 1.00 0.00 ? 126 HIS A CG   4  
ATOM 6583  N ND1  . HIS A 1 123 ? -1.692  -5.810  -11.012 1.00 0.00 ? 126 HIS A ND1  4  
ATOM 6584  C CD2  . HIS A 1 123 ? 0.286   -5.731  -11.938 1.00 0.00 ? 126 HIS A CD2  4  
ATOM 6585  C CE1  . HIS A 1 123 ? -1.815  -6.292  -12.234 1.00 0.00 ? 126 HIS A CE1  4  
ATOM 6586  N NE2  . HIS A 1 123 ? -0.631  -6.256  -12.820 1.00 0.00 ? 126 HIS A NE2  4  
ATOM 6587  H H    . HIS A 1 123 ? -0.749  -7.036  -8.374  1.00 0.00 ? 126 HIS A H    4  
ATOM 6588  H HA   . HIS A 1 123 ? 1.859   -6.049  -9.168  1.00 0.00 ? 126 HIS A HA   4  
ATOM 6589  H HB2  . HIS A 1 123 ? -0.769  -4.557  -8.933  1.00 0.00 ? 126 HIS A HB2  4  
ATOM 6590  H HB3  . HIS A 1 123 ? 0.692   -3.987  -9.729  1.00 0.00 ? 126 HIS A HB3  4  
ATOM 6591  H HD1  . HIS A 1 123 ? -2.429  -5.720  -10.367 1.00 0.00 ? 126 HIS A HD1  4  
ATOM 6592  H HD2  . HIS A 1 123 ? 1.340   -5.572  -12.126 1.00 0.00 ? 126 HIS A HD2  4  
ATOM 6593  H HE1  . HIS A 1 123 ? -2.727  -6.657  -12.679 1.00 0.00 ? 126 HIS A HE1  4  
ATOM 6594  N N    . SER A 1 124 ? 2.504   -4.688  -7.170  1.00 0.00 ? 127 SER A N    4  
ATOM 6595  C CA   . SER A 1 124 ? 2.933   -4.076  -5.927  1.00 0.00 ? 127 SER A CA   4  
ATOM 6596  C C    . SER A 1 124 ? 2.415   -2.644  -5.843  1.00 0.00 ? 127 SER A C    4  
ATOM 6597  O O    . SER A 1 124 ? 2.748   -1.806  -6.688  1.00 0.00 ? 127 SER A O    4  
ATOM 6598  C CB   . SER A 1 124 ? 4.459   -4.094  -5.840  1.00 0.00 ? 127 SER A CB   4  
ATOM 6599  O OG   . SER A 1 124 ? 4.965   -5.390  -6.123  1.00 0.00 ? 127 SER A OG   4  
ATOM 6600  H H    . SER A 1 124 ? 3.133   -4.735  -7.922  1.00 0.00 ? 127 SER A H    4  
ATOM 6601  H HA   . SER A 1 124 ? 2.524   -4.650  -5.107  1.00 0.00 ? 127 SER A HA   4  
ATOM 6602  H HB2  . SER A 1 124 ? 4.868   -3.396  -6.558  1.00 0.00 ? 127 SER A HB2  4  
ATOM 6603  H HB3  . SER A 1 124 ? 4.765   -3.808  -4.843  1.00 0.00 ? 127 SER A HB3  4  
ATOM 6604  H HG   . SER A 1 124 ? 4.402   -6.050  -5.707  1.00 0.00 ? 127 SER A HG   4  
ATOM 6605  N N    . LEU A 1 125 ? 1.589   -2.372  -4.838  1.00 0.00 ? 128 LEU A N    4  
ATOM 6606  C CA   . LEU A 1 125 ? 1.033   -1.042  -4.658  1.00 0.00 ? 128 LEU A CA   4  
ATOM 6607  C C    . LEU A 1 125 ? 2.147   -0.054  -4.356  1.00 0.00 ? 128 LEU A C    4  
ATOM 6608  O O    . LEU A 1 125 ? 2.887   -0.213  -3.382  1.00 0.00 ? 128 LEU A O    4  
ATOM 6609  C CB   . LEU A 1 125 ? -0.003  -1.018  -3.530  1.00 0.00 ? 128 LEU A CB   4  
ATOM 6610  C CG   . LEU A 1 125 ? -0.791  0.289   -3.397  1.00 0.00 ? 128 LEU A CG   4  
ATOM 6611  C CD1  . LEU A 1 125 ? -1.648  0.533   -4.630  1.00 0.00 ? 128 LEU A CD1  4  
ATOM 6612  C CD2  . LEU A 1 125 ? -1.655  0.264   -2.147  1.00 0.00 ? 128 LEU A CD2  4  
ATOM 6613  H H    . LEU A 1 125 ? 1.356   -3.082  -4.196  1.00 0.00 ? 128 LEU A H    4  
ATOM 6614  H HA   . LEU A 1 125 ? 0.555   -0.758  -5.583  1.00 0.00 ? 128 LEU A HA   4  
ATOM 6615  H HB2  . LEU A 1 125 ? -0.706  -1.823  -3.691  1.00 0.00 ? 128 LEU A HB2  4  
ATOM 6616  H HB3  . LEU A 1 125 ? 0.513   -1.193  -2.600  1.00 0.00 ? 128 LEU A HB3  4  
ATOM 6617  H HG   . LEU A 1 125 ? -0.095  1.110   -3.307  1.00 0.00 ? 128 LEU A HG   4  
ATOM 6618  H HD11 . LEU A 1 125 ? -1.014  0.764   -5.473  1.00 0.00 ? 128 LEU A HD11 4  
ATOM 6619  H HD12 . LEU A 1 125 ? -2.229  -0.351  -4.845  1.00 0.00 ? 128 LEU A HD12 4  
ATOM 6620  H HD13 . LEU A 1 125 ? -2.313  1.363   -4.444  1.00 0.00 ? 128 LEU A HD13 4  
ATOM 6621  H HD21 . LEU A 1 125 ? -1.027  0.165   -1.274  1.00 0.00 ? 128 LEU A HD21 4  
ATOM 6622  H HD22 . LEU A 1 125 ? -2.219  1.184   -2.080  1.00 0.00 ? 128 LEU A HD22 4  
ATOM 6623  H HD23 . LEU A 1 125 ? -2.336  -0.573  -2.195  1.00 0.00 ? 128 LEU A HD23 4  
ATOM 6624  N N    . GLY A 1 126 ? 2.272   0.945   -5.205  1.00 0.00 ? 129 GLY A N    4  
ATOM 6625  C CA   . GLY A 1 126 ? 3.304   1.934   -5.039  1.00 0.00 ? 129 GLY A CA   4  
ATOM 6626  C C    . GLY A 1 126 ? 2.725   3.292   -4.747  1.00 0.00 ? 129 GLY A C    4  
ATOM 6627  O O    . GLY A 1 126 ? 1.890   3.795   -5.504  1.00 0.00 ? 129 GLY A O    4  
ATOM 6628  H H    . GLY A 1 126 ? 1.638   1.024   -5.953  1.00 0.00 ? 129 GLY A H    4  
ATOM 6629  H HA2  . GLY A 1 126 ? 3.945   1.638   -4.223  1.00 0.00 ? 129 GLY A HA2  4  
ATOM 6630  H HA3  . GLY A 1 126 ? 3.890   1.991   -5.943  1.00 0.00 ? 129 GLY A HA3  4  
ATOM 6631  N N    . LEU A 1 127 ? 3.148   3.875   -3.645  1.00 0.00 ? 130 LEU A N    4  
ATOM 6632  C CA   . LEU A 1 127 ? 2.713   5.205   -3.280  1.00 0.00 ? 130 LEU A CA   4  
ATOM 6633  C C    . LEU A 1 127 ? 3.822   6.200   -3.581  1.00 0.00 ? 130 LEU A C    4  
ATOM 6634  O O    . LEU A 1 127 ? 4.920   6.108   -3.029  1.00 0.00 ? 130 LEU A O    4  
ATOM 6635  C CB   . LEU A 1 127 ? 2.332   5.258   -1.798  1.00 0.00 ? 130 LEU A CB   4  
ATOM 6636  C CG   . LEU A 1 127 ? 1.865   6.624   -1.290  1.00 0.00 ? 130 LEU A CG   4  
ATOM 6637  C CD1  . LEU A 1 127 ? 0.654   7.107   -2.072  1.00 0.00 ? 130 LEU A CD1  4  
ATOM 6638  C CD2  . LEU A 1 127 ? 1.544   6.552   0.193   1.00 0.00 ? 130 LEU A CD2  4  
ATOM 6639  H H    . LEU A 1 127 ? 3.779   3.402   -3.062  1.00 0.00 ? 130 LEU A H    4  
ATOM 6640  H HA   . LEU A 1 127 ? 1.846   5.448   -3.880  1.00 0.00 ? 130 LEU A HA   4  
ATOM 6641  H HB2  . LEU A 1 127 ? 1.536   4.543   -1.630  1.00 0.00 ? 130 LEU A HB2  4  
ATOM 6642  H HB3  . LEU A 1 127 ? 3.192   4.956   -1.217  1.00 0.00 ? 130 LEU A HB3  4  
ATOM 6643  H HG   . LEU A 1 127 ? 2.662   7.342   -1.429  1.00 0.00 ? 130 LEU A HG   4  
ATOM 6644  H HD11 . LEU A 1 127 ? -0.106  6.339   -2.075  1.00 0.00 ? 130 LEU A HD11 4  
ATOM 6645  H HD12 . LEU A 1 127 ? 0.260   7.999   -1.610  1.00 0.00 ? 130 LEU A HD12 4  
ATOM 6646  H HD13 . LEU A 1 127 ? 0.944   7.329   -3.088  1.00 0.00 ? 130 LEU A HD13 4  
ATOM 6647  H HD21 . LEU A 1 127 ? 1.245   7.527   0.544   1.00 0.00 ? 130 LEU A HD21 4  
ATOM 6648  H HD22 . LEU A 1 127 ? 0.737   5.849   0.352   1.00 0.00 ? 130 LEU A HD22 4  
ATOM 6649  H HD23 . LEU A 1 127 ? 2.418   6.227   0.737   1.00 0.00 ? 130 LEU A HD23 4  
ATOM 6650  N N    . THR A 1 128 ? 3.544   7.126   -4.480  1.00 0.00 ? 131 THR A N    4  
ATOM 6651  C CA   . THR A 1 128 ? 4.527   8.112   -4.877  1.00 0.00 ? 131 THR A CA   4  
ATOM 6652  C C    . THR A 1 128 ? 4.310   9.426   -4.134  1.00 0.00 ? 131 THR A C    4  
ATOM 6653  O O    . THR A 1 128 ? 3.605   10.311  -4.613  1.00 0.00 ? 131 THR A O    4  
ATOM 6654  C CB   . THR A 1 128 ? 4.476   8.368   -6.396  1.00 0.00 ? 131 THR A CB   4  
ATOM 6655  O OG1  . THR A 1 128 ? 4.463   7.120   -7.100  1.00 0.00 ? 131 THR A OG1  4  
ATOM 6656  C CG2  . THR A 1 128 ? 5.669   9.197   -6.855  1.00 0.00 ? 131 THR A CG2  4  
ATOM 6657  H H    . THR A 1 128 ? 2.650   7.146   -4.891  1.00 0.00 ? 131 THR A H    4  
ATOM 6658  H HA   . THR A 1 128 ? 5.506   7.724   -4.630  1.00 0.00 ? 131 THR A HA   4  
ATOM 6659  H HB   . THR A 1 128 ? 3.571   8.910   -6.625  1.00 0.00 ? 131 THR A HB   4  
ATOM 6660  H HG1  . THR A 1 128 ? 3.689   7.086   -7.675  1.00 0.00 ? 131 THR A HG1  4  
ATOM 6661  H HG21 . THR A 1 128 ? 5.703   10.120  -6.294  1.00 0.00 ? 131 THR A HG21 4  
ATOM 6662  H HG22 . THR A 1 128 ? 5.572   9.419   -7.907  1.00 0.00 ? 131 THR A HG22 4  
ATOM 6663  H HG23 . THR A 1 128 ? 6.580   8.641   -6.688  1.00 0.00 ? 131 THR A HG23 4  
ATOM 6664  N N    . CYS A 1 129 ? 4.893   9.537   -2.956  1.00 0.00 ? 132 CYS A N    4  
ATOM 6665  C CA   . CYS A 1 129 ? 4.858   10.781  -2.200  1.00 0.00 ? 132 CYS A CA   4  
ATOM 6666  C C    . CYS A 1 129 ? 5.998   11.676  -2.665  1.00 0.00 ? 132 CYS A C    4  
ATOM 6667  O O    . CYS A 1 129 ? 7.051   11.183  -3.072  1.00 0.00 ? 132 CYS A O    4  
ATOM 6668  C CB   . CYS A 1 129 ? 5.003   10.508  -0.696  1.00 0.00 ? 132 CYS A CB   4  
ATOM 6669  S SG   . CYS A 1 129 ? 3.929   9.179   -0.061  1.00 0.00 ? 132 CYS A SG   4  
ATOM 6670  H H    . CYS A 1 129 ? 5.372   8.762   -2.582  1.00 0.00 ? 132 CYS A H    4  
ATOM 6671  H HA   . CYS A 1 129 ? 3.917   11.272  -2.391  1.00 0.00 ? 132 CYS A HA   4  
ATOM 6672  H HB2  . CYS A 1 129 ? 6.026   10.232  -0.483  1.00 0.00 ? 132 CYS A HB2  4  
ATOM 6673  H HB3  . CYS A 1 129 ? 4.762   11.410  -0.153  1.00 0.00 ? 132 CYS A HB3  4  
ATOM 6674  N N    . LEU A 1 130 ? 5.786   12.986  -2.631  1.00 0.00 ? 133 LEU A N    4  
ATOM 6675  C CA   . LEU A 1 130 ? 6.842   13.928  -2.971  1.00 0.00 ? 133 LEU A CA   4  
ATOM 6676  C C    . LEU A 1 130 ? 8.038   13.733  -2.046  1.00 0.00 ? 133 LEU A C    4  
ATOM 6677  O O    . LEU A 1 130 ? 7.893   13.692  -0.821  1.00 0.00 ? 133 LEU A O    4  
ATOM 6678  C CB   . LEU A 1 130 ? 6.333   15.370  -2.888  1.00 0.00 ? 133 LEU A CB   4  
ATOM 6679  C CG   . LEU A 1 130 ? 5.482   15.837  -4.075  1.00 0.00 ? 133 LEU A CG   4  
ATOM 6680  C CD1  . LEU A 1 130 ? 4.810   17.161  -3.754  1.00 0.00 ? 133 LEU A CD1  4  
ATOM 6681  C CD2  . LEU A 1 130 ? 6.344   15.977  -5.324  1.00 0.00 ? 133 LEU A CD2  4  
ATOM 6682  H H    . LEU A 1 130 ? 4.899   13.327  -2.373  1.00 0.00 ? 133 LEU A H    4  
ATOM 6683  H HA   . LEU A 1 130 ? 7.151   13.721  -3.984  1.00 0.00 ? 133 LEU A HA   4  
ATOM 6684  H HB2  . LEU A 1 130 ? 5.741   15.468  -1.991  1.00 0.00 ? 133 LEU A HB2  4  
ATOM 6685  H HB3  . LEU A 1 130 ? 7.187   16.026  -2.810  1.00 0.00 ? 133 LEU A HB3  4  
ATOM 6686  H HG   . LEU A 1 130 ? 4.712   15.104  -4.275  1.00 0.00 ? 133 LEU A HG   4  
ATOM 6687  H HD11 . LEU A 1 130 ? 4.178   17.454  -4.578  1.00 0.00 ? 133 LEU A HD11 4  
ATOM 6688  H HD12 . LEU A 1 130 ? 4.213   17.055  -2.862  1.00 0.00 ? 133 LEU A HD12 4  
ATOM 6689  H HD13 . LEU A 1 130 ? 5.565   17.917  -3.594  1.00 0.00 ? 133 LEU A HD13 4  
ATOM 6690  H HD21 . LEU A 1 130 ? 7.165   16.649  -5.123  1.00 0.00 ? 133 LEU A HD21 4  
ATOM 6691  H HD22 . LEU A 1 130 ? 6.732   15.010  -5.608  1.00 0.00 ? 133 LEU A HD22 4  
ATOM 6692  H HD23 . LEU A 1 130 ? 5.745   16.373  -6.132  1.00 0.00 ? 133 LEU A HD23 4  
ATOM 6693  N N    . GLU A 1 131 ? 9.211   13.585  -2.639  1.00 0.00 ? 134 GLU A N    4  
ATOM 6694  C CA   . GLU A 1 131 ? 10.431  13.374  -1.880  1.00 0.00 ? 134 GLU A CA   4  
ATOM 6695  C C    . GLU A 1 131 ? 10.960  14.709  -1.378  1.00 0.00 ? 134 GLU A C    4  
ATOM 6696  O O    . GLU A 1 131 ? 11.413  15.519  -2.213  1.00 0.00 ? 134 GLU A O    4  
ATOM 6697  C CB   . GLU A 1 131 ? 11.486  12.671  -2.739  1.00 0.00 ? 134 GLU A CB   4  
ATOM 6698  C CG   . GLU A 1 131 ? 12.815  12.463  -2.030  1.00 0.00 ? 134 GLU A CG   4  
ATOM 6699  C CD   . GLU A 1 131 ? 13.891  11.939  -2.956  1.00 0.00 ? 134 GLU A CD   4  
ATOM 6700  O OE1  . GLU A 1 131 ? 13.996  12.444  -4.093  1.00 0.00 ? 134 GLU A OE1  4  
ATOM 6701  O OE2  . GLU A 1 131 ? 14.651  11.036  -2.547  1.00 0.00 ? 134 GLU A OE2  4  
ATOM 6702  O OXT  . GLU A 1 131 ? 10.914  14.945  -0.155  1.00 0.00 ? 134 GLU A OXT  4  
ATOM 6703  H H    . GLU A 1 131 ? 9.261   13.642  -3.615  1.00 0.00 ? 134 GLU A H    4  
ATOM 6704  H HA   . GLU A 1 131 ? 10.191  12.751  -1.031  1.00 0.00 ? 134 GLU A HA   4  
ATOM 6705  H HB2  . GLU A 1 131 ? 11.107  11.704  -3.035  1.00 0.00 ? 134 GLU A HB2  4  
ATOM 6706  H HB3  . GLU A 1 131 ? 11.667  13.263  -3.624  1.00 0.00 ? 134 GLU A HB3  4  
ATOM 6707  H HG2  . GLU A 1 131 ? 13.142  13.408  -1.624  1.00 0.00 ? 134 GLU A HG2  4  
ATOM 6708  H HG3  . GLU A 1 131 ? 12.675  11.755  -1.226  1.00 0.00 ? 134 GLU A HG3  4  
ATOM 6709  N N    . ARG A 1 22  ? -7.305  -0.759  15.807  1.00 0.00 ? 25  ARG A N    5  
ATOM 6710  C CA   . ARG A 1 22  ? -8.043  -0.772  14.524  1.00 0.00 ? 25  ARG A CA   5  
ATOM 6711  C C    . ARG A 1 22  ? -7.062  -0.599  13.370  1.00 0.00 ? 25  ARG A C    5  
ATOM 6712  O O    . ARG A 1 22  ? -6.271  0.345   13.359  1.00 0.00 ? 25  ARG A O    5  
ATOM 6713  C CB   . ARG A 1 22  ? -9.074  0.359   14.507  1.00 0.00 ? 25  ARG A CB   5  
ATOM 6714  C CG   . ARG A 1 22  ? -10.032 0.318   13.327  1.00 0.00 ? 25  ARG A CG   5  
ATOM 6715  C CD   . ARG A 1 22  ? -11.349 -0.348  13.690  1.00 0.00 ? 25  ARG A CD   5  
ATOM 6716  N NE   . ARG A 1 22  ? -11.180 -1.728  14.144  1.00 0.00 ? 25  ARG A NE   5  
ATOM 6717  C CZ   . ARG A 1 22  ? -11.815 -2.764  13.604  1.00 0.00 ? 25  ARG A CZ   5  
ATOM 6718  N NH1  . ARG A 1 22  ? -12.630 -2.581  12.573  1.00 0.00 ? 25  ARG A NH1  5  
ATOM 6719  N NH2  . ARG A 1 22  ? -11.639 -3.979  14.097  1.00 0.00 ? 25  ARG A NH2  5  
ATOM 6720  H HA   . ARG A 1 22  ? -8.546  -1.723  14.424  1.00 0.00 ? 25  ARG A HA   5  
ATOM 6721  H HB2  . ARG A 1 22  ? -9.659  0.306   15.413  1.00 0.00 ? 25  ARG A HB2  5  
ATOM 6722  H HB3  . ARG A 1 22  ? -8.550  1.304   14.485  1.00 0.00 ? 25  ARG A HB3  5  
ATOM 6723  H HG2  . ARG A 1 22  ? -10.232 1.329   13.004  1.00 0.00 ? 25  ARG A HG2  5  
ATOM 6724  H HG3  . ARG A 1 22  ? -9.570  -0.233  12.521  1.00 0.00 ? 25  ARG A HG3  5  
ATOM 6725  H HD2  . ARG A 1 22  ? -11.814 0.221   14.481  1.00 0.00 ? 25  ARG A HD2  5  
ATOM 6726  H HD3  . ARG A 1 22  ? -11.991 -0.341  12.821  1.00 0.00 ? 25  ARG A HD3  5  
ATOM 6727  H HE   . ARG A 1 22  ? -10.574 -1.890  14.903  1.00 0.00 ? 25  ARG A HE   5  
ATOM 6728  H HH12 . ARG A 1 22  ? -13.309 -3.293  12.332  1.00 0.00 ? 25  ARG A HH12 5  
ATOM 6729  H HH21 . ARG A 1 22  ? -11.023 -4.122  14.874  1.00 0.00 ? 25  ARG A HH21 5  
ATOM 6730  H HH22 . ARG A 1 22  ? -12.121 -4.765  13.693  1.00 0.00 ? 25  ARG A HH22 5  
ATOM 6731  N N    . LEU A 1 23  ? -7.091  -1.521  12.416  1.00 0.00 ? 26  LEU A N    5  
ATOM 6732  C CA   . LEU A 1 23  ? -6.170  -1.472  11.286  1.00 0.00 ? 26  LEU A CA   5  
ATOM 6733  C C    . LEU A 1 23  ? -6.730  -0.620  10.151  1.00 0.00 ? 26  LEU A C    5  
ATOM 6734  O O    . LEU A 1 23  ? -7.451  -1.110  9.276   1.00 0.00 ? 26  LEU A O    5  
ATOM 6735  C CB   . LEU A 1 23  ? -5.851  -2.879  10.771  1.00 0.00 ? 26  LEU A CB   5  
ATOM 6736  C CG   . LEU A 1 23  ? -5.177  -3.819  11.773  1.00 0.00 ? 26  LEU A CG   5  
ATOM 6737  C CD1  . LEU A 1 23  ? -4.844  -5.147  11.109  1.00 0.00 ? 26  LEU A CD1  5  
ATOM 6738  C CD2  . LEU A 1 23  ? -3.918  -3.188  12.349  1.00 0.00 ? 26  LEU A CD2  5  
ATOM 6739  H H    . LEU A 1 23  ? -7.745  -2.255  12.475  1.00 0.00 ? 26  LEU A H    5  
ATOM 6740  H HA   . LEU A 1 23  ? -5.258  -1.015  11.634  1.00 0.00 ? 26  LEU A HA   5  
ATOM 6741  H HB2  . LEU A 1 23  ? -6.774  -3.336  10.446  1.00 0.00 ? 26  LEU A HB2  5  
ATOM 6742  H HB3  . LEU A 1 23  ? -5.201  -2.781  9.915   1.00 0.00 ? 26  LEU A HB3  5  
ATOM 6743  H HG   . LEU A 1 23  ? -5.856  -4.016  12.589  1.00 0.00 ? 26  LEU A HG   5  
ATOM 6744  H HD11 . LEU A 1 23  ? -4.201  -4.971  10.258  1.00 0.00 ? 26  LEU A HD11 5  
ATOM 6745  H HD12 . LEU A 1 23  ? -4.340  -5.787  11.818  1.00 0.00 ? 26  LEU A HD12 5  
ATOM 6746  H HD13 . LEU A 1 23  ? -5.756  -5.622  10.779  1.00 0.00 ? 26  LEU A HD13 5  
ATOM 6747  H HD21 . LEU A 1 23  ? -4.188  -2.353  12.978  1.00 0.00 ? 26  LEU A HD21 5  
ATOM 6748  H HD22 . LEU A 1 23  ? -3.385  -3.921  12.934  1.00 0.00 ? 26  LEU A HD22 5  
ATOM 6749  H HD23 . LEU A 1 23  ? -3.286  -2.844  11.543  1.00 0.00 ? 26  LEU A HD23 5  
ATOM 6750  N N    . SER A 1 24  ? -6.402  0.655   10.190  1.00 0.00 ? 27  SER A N    5  
ATOM 6751  C CA   . SER A 1 24  ? -6.769  1.592   9.143   1.00 0.00 ? 27  SER A CA   5  
ATOM 6752  C C    . SER A 1 24  ? -5.758  2.727   9.137   1.00 0.00 ? 27  SER A C    5  
ATOM 6753  O O    . SER A 1 24  ? -5.196  3.058   10.183  1.00 0.00 ? 27  SER A O    5  
ATOM 6754  C CB   . SER A 1 24  ? -8.182  2.139   9.382   1.00 0.00 ? 27  SER A CB   5  
ATOM 6755  O OG   . SER A 1 24  ? -8.582  3.017   8.342   1.00 0.00 ? 27  SER A OG   5  
ATOM 6756  H H    . SER A 1 24  ? -5.893  0.988   10.960  1.00 0.00 ? 27  SER A H    5  
ATOM 6757  H HA   . SER A 1 24  ? -6.735  1.077   8.196   1.00 0.00 ? 27  SER A HA   5  
ATOM 6758  H HB2  . SER A 1 24  ? -8.879  1.318   9.430   1.00 0.00 ? 27  SER A HB2  5  
ATOM 6759  H HB3  . SER A 1 24  ? -8.199  2.680   10.316  1.00 0.00 ? 27  SER A HB3  5  
ATOM 6760  H HG   . SER A 1 24  ? -9.539  3.151   8.386   1.00 0.00 ? 27  SER A HG   5  
ATOM 6761  N N    . TRP A 1 25  ? -5.521  3.336   7.978   1.00 0.00 ? 28  TRP A N    5  
ATOM 6762  C CA   . TRP A 1 25  ? -4.535  4.412   7.888   1.00 0.00 ? 28  TRP A CA   5  
ATOM 6763  C C    . TRP A 1 25  ? -5.117  5.742   8.378   1.00 0.00 ? 28  TRP A C    5  
ATOM 6764  O O    . TRP A 1 25  ? -4.736  6.820   7.916   1.00 0.00 ? 28  TRP A O    5  
ATOM 6765  C CB   . TRP A 1 25  ? -3.949  4.544   6.466   1.00 0.00 ? 28  TRP A CB   5  
ATOM 6766  C CG   . TRP A 1 25  ? -4.951  4.641   5.348   1.00 0.00 ? 28  TRP A CG   5  
ATOM 6767  C CD1  . TRP A 1 25  ? -6.196  5.201   5.386   1.00 0.00 ? 28  TRP A CD1  5  
ATOM 6768  C CD2  . TRP A 1 25  ? -4.762  4.183   4.003   1.00 0.00 ? 28  TRP A CD2  5  
ATOM 6769  N NE1  . TRP A 1 25  ? -6.796  5.107   4.152   1.00 0.00 ? 28  TRP A NE1  5  
ATOM 6770  C CE2  . TRP A 1 25  ? -5.936  4.484   3.288   1.00 0.00 ? 28  TRP A CE2  5  
ATOM 6771  C CE3  . TRP A 1 25  ? -3.715  3.541   3.336   1.00 0.00 ? 28  TRP A CE3  5  
ATOM 6772  C CZ2  . TRP A 1 25  ? -6.089  4.168   1.941   1.00 0.00 ? 28  TRP A CZ2  5  
ATOM 6773  C CZ3  . TRP A 1 25  ? -3.869  3.228   1.999   1.00 0.00 ? 28  TRP A CZ3  5  
ATOM 6774  C CH2  . TRP A 1 25  ? -5.049  3.542   1.314   1.00 0.00 ? 28  TRP A CH2  5  
ATOM 6775  H H    . TRP A 1 25  ? -6.029  3.071   7.180   1.00 0.00 ? 28  TRP A H    5  
ATOM 6776  H HA   . TRP A 1 25  ? -3.728  4.143   8.558   1.00 0.00 ? 28  TRP A HA   5  
ATOM 6777  H HB2  . TRP A 1 25  ? -3.337  5.431   6.426   1.00 0.00 ? 28  TRP A HB2  5  
ATOM 6778  H HB3  . TRP A 1 25  ? -3.324  3.680   6.272   1.00 0.00 ? 28  TRP A HB3  5  
ATOM 6779  H HD1  . TRP A 1 25  ? -6.635  5.645   6.265   1.00 0.00 ? 28  TRP A HD1  5  
ATOM 6780  H HE1  . TRP A 1 25  ? -7.693  5.432   3.928   1.00 0.00 ? 28  TRP A HE1  5  
ATOM 6781  H HE3  . TRP A 1 25  ? -2.798  3.292   3.848   1.00 0.00 ? 28  TRP A HE3  5  
ATOM 6782  H HZ2  . TRP A 1 25  ? -6.994  4.403   1.398   1.00 0.00 ? 28  TRP A HZ2  5  
ATOM 6783  H HZ3  . TRP A 1 25  ? -3.070  2.735   1.467   1.00 0.00 ? 28  TRP A HZ3  5  
ATOM 6784  H HH2  . TRP A 1 25  ? -5.126  3.279   0.269   1.00 0.00 ? 28  TRP A HH2  5  
ATOM 6785  N N    . TYR A 1 26  ? -6.056  5.641   9.309   1.00 0.00 ? 29  TYR A N    5  
ATOM 6786  C CA   . TYR A 1 26  ? -6.598  6.793   10.010  1.00 0.00 ? 29  TYR A CA   5  
ATOM 6787  C C    . TYR A 1 26  ? -6.411  6.621   11.516  1.00 0.00 ? 29  TYR A C    5  
ATOM 6788  O O    . TYR A 1 26  ? -6.857  7.456   12.306  1.00 0.00 ? 29  TYR A O    5  
ATOM 6789  C CB   . TYR A 1 26  ? -8.086  6.974   9.695   1.00 0.00 ? 29  TYR A CB   5  
ATOM 6790  C CG   . TYR A 1 26  ? -8.362  7.653   8.373   1.00 0.00 ? 29  TYR A CG   5  
ATOM 6791  C CD1  . TYR A 1 26  ? -8.406  6.928   7.190   1.00 0.00 ? 29  TYR A CD1  5  
ATOM 6792  C CD2  . TYR A 1 26  ? -8.584  9.023   8.312   1.00 0.00 ? 29  TYR A CD2  5  
ATOM 6793  C CE1  . TYR A 1 26  ? -8.658  7.551   5.983   1.00 0.00 ? 29  TYR A CE1  5  
ATOM 6794  C CE2  . TYR A 1 26  ? -8.838  9.650   7.109   1.00 0.00 ? 29  TYR A CE2  5  
ATOM 6795  C CZ   . TYR A 1 26  ? -8.872  8.911   5.948   1.00 0.00 ? 29  TYR A CZ   5  
ATOM 6796  O OH   . TYR A 1 26  ? -9.122  9.533   4.747   1.00 0.00 ? 29  TYR A OH   5  
ATOM 6797  H H    . TYR A 1 26  ? -6.405  4.751   9.530   1.00 0.00 ? 29  TYR A H    5  
ATOM 6798  H HA   . TYR A 1 26  ? -6.056  7.669   9.684   1.00 0.00 ? 29  TYR A HA   5  
ATOM 6799  H HB2  . TYR A 1 26  ? -8.559  6.003   9.671   1.00 0.00 ? 29  TYR A HB2  5  
ATOM 6800  H HB3  . TYR A 1 26  ? -8.540  7.568   10.475  1.00 0.00 ? 29  TYR A HB3  5  
ATOM 6801  H HD1  . TYR A 1 26  ? -8.237  5.863   7.219   1.00 0.00 ? 29  TYR A HD1  5  
ATOM 6802  H HD2  . TYR A 1 26  ? -8.556  9.601   9.222   1.00 0.00 ? 29  TYR A HD2  5  
ATOM 6803  H HE1  . TYR A 1 26  ? -8.688  6.970   5.072   1.00 0.00 ? 29  TYR A HE1  5  
ATOM 6804  H HE2  . TYR A 1 26  ? -9.005  10.716  7.081   1.00 0.00 ? 29  TYR A HE2  5  
ATOM 6805  H HH   . TYR A 1 26  ? -9.505  8.895   4.131   1.00 0.00 ? 29  TYR A HH   5  
ATOM 6806  N N    . ASP A 1 27  ? -5.751  5.533   11.902  1.00 0.00 ? 30  ASP A N    5  
ATOM 6807  C CA   . ASP A 1 27  ? -5.575  5.194   13.311  1.00 0.00 ? 30  ASP A CA   5  
ATOM 6808  C C    . ASP A 1 27  ? -4.134  5.407   13.757  1.00 0.00 ? 30  ASP A C    5  
ATOM 6809  O O    . ASP A 1 27  ? -3.195  5.218   12.983  1.00 0.00 ? 30  ASP A O    5  
ATOM 6810  C CB   . ASP A 1 27  ? -5.983  3.742   13.568  1.00 0.00 ? 30  ASP A CB   5  
ATOM 6811  C CG   . ASP A 1 27  ? -7.486  3.552   13.572  1.00 0.00 ? 30  ASP A CG   5  
ATOM 6812  O OD1  . ASP A 1 27  ? -8.072  3.358   12.491  1.00 0.00 ? 30  ASP A OD1  5  
ATOM 6813  O OD2  . ASP A 1 27  ? -8.090  3.604   14.667  1.00 0.00 ? 30  ASP A OD2  5  
ATOM 6814  H H    . ASP A 1 27  ? -5.366  4.940   11.223  1.00 0.00 ? 30  ASP A H    5  
ATOM 6815  H HA   . ASP A 1 27  ? -6.216  5.843   13.886  1.00 0.00 ? 30  ASP A HA   5  
ATOM 6816  H HB2  . ASP A 1 27  ? -5.559  3.117   12.801  1.00 0.00 ? 30  ASP A HB2  5  
ATOM 6817  H HB3  . ASP A 1 27  ? -5.598  3.433   14.528  1.00 0.00 ? 30  ASP A HB3  5  
ATOM 6818  N N    . PRO A 1 28  ? -3.951  5.783   15.035  1.00 0.00 ? 31  PRO A N    5  
ATOM 6819  C CA   . PRO A 1 28  ? -2.639  6.116   15.601  1.00 0.00 ? 31  PRO A CA   5  
ATOM 6820  C C    . PRO A 1 28  ? -1.754  4.892   15.827  1.00 0.00 ? 31  PRO A C    5  
ATOM 6821  O O    . PRO A 1 28  ? -0.575  5.024   16.160  1.00 0.00 ? 31  PRO A O    5  
ATOM 6822  C CB   . PRO A 1 28  ? -2.973  6.770   16.951  1.00 0.00 ? 31  PRO A CB   5  
ATOM 6823  C CG   . PRO A 1 28  ? -4.450  6.968   16.956  1.00 0.00 ? 31  PRO A CG   5  
ATOM 6824  C CD   . PRO A 1 28  ? -5.013  5.928   16.038  1.00 0.00 ? 31  PRO A CD   5  
ATOM 6825  H HA   . PRO A 1 28  ? -2.115  6.825   14.979  1.00 0.00 ? 31  PRO A HA   5  
ATOM 6826  H HB2  . PRO A 1 28  ? -2.665  6.113   17.750  1.00 0.00 ? 31  PRO A HB2  5  
ATOM 6827  H HB3  . PRO A 1 28  ? -2.450  7.711   17.035  1.00 0.00 ? 31  PRO A HB3  5  
ATOM 6828  H HG2  . PRO A 1 28  ? -4.835  6.834   17.955  1.00 0.00 ? 31  PRO A HG2  5  
ATOM 6829  H HG3  . PRO A 1 28  ? -4.688  7.958   16.592  1.00 0.00 ? 31  PRO A HG3  5  
ATOM 6830  H HD2  . PRO A 1 28  ? -5.176  5.000   16.567  1.00 0.00 ? 31  PRO A HD2  5  
ATOM 6831  H HD3  . PRO A 1 28  ? -5.928  6.274   15.585  1.00 0.00 ? 31  PRO A HD3  5  
ATOM 6832  N N    . ASP A 1 29  ? -2.326  3.708   15.668  1.00 0.00 ? 32  ASP A N    5  
ATOM 6833  C CA   . ASP A 1 29  ? -1.582  2.468   15.869  1.00 0.00 ? 32  ASP A CA   5  
ATOM 6834  C C    . ASP A 1 29  ? -1.312  1.774   14.543  1.00 0.00 ? 32  ASP A C    5  
ATOM 6835  O O    . ASP A 1 29  ? -1.042  0.575   14.506  1.00 0.00 ? 32  ASP A O    5  
ATOM 6836  C CB   . ASP A 1 29  ? -2.336  1.517   16.802  1.00 0.00 ? 32  ASP A CB   5  
ATOM 6837  C CG   . ASP A 1 29  ? -2.443  2.041   18.219  1.00 0.00 ? 32  ASP A CG   5  
ATOM 6838  O OD1  . ASP A 1 29  ? -1.392  2.224   18.874  1.00 0.00 ? 32  ASP A OD1  5  
ATOM 6839  O OD2  . ASP A 1 29  ? -3.580  2.262   18.690  1.00 0.00 ? 32  ASP A OD2  5  
ATOM 6840  H H    . ASP A 1 29  ? -3.271  3.666   15.409  1.00 0.00 ? 32  ASP A H    5  
ATOM 6841  H HA   . ASP A 1 29  ? -0.636  2.724   16.324  1.00 0.00 ? 32  ASP A HA   5  
ATOM 6842  H HB2  . ASP A 1 29  ? -3.334  1.368   16.420  1.00 0.00 ? 32  ASP A HB2  5  
ATOM 6843  H HB3  . ASP A 1 29  ? -1.819  0.568   16.827  1.00 0.00 ? 32  ASP A HB3  5  
ATOM 6844  N N    . PHE A 1 30  ? -1.397  2.526   13.458  1.00 0.00 ? 33  PHE A N    5  
ATOM 6845  C CA   . PHE A 1 30  ? -1.124  1.979   12.140  1.00 0.00 ? 33  PHE A CA   5  
ATOM 6846  C C    . PHE A 1 30  ? 0.319   2.267   11.731  1.00 0.00 ? 33  PHE A C    5  
ATOM 6847  O O    . PHE A 1 30  ? 0.726   3.425   11.626  1.00 0.00 ? 33  PHE A O    5  
ATOM 6848  C CB   . PHE A 1 30  ? -2.096  2.569   11.114  1.00 0.00 ? 33  PHE A CB   5  
ATOM 6849  C CG   . PHE A 1 30  ? -1.911  2.038   9.720   1.00 0.00 ? 33  PHE A CG   5  
ATOM 6850  C CD1  . PHE A 1 30  ? -2.314  0.751   9.392   1.00 0.00 ? 33  PHE A CD1  5  
ATOM 6851  C CD2  . PHE A 1 30  ? -1.341  2.829   8.736   1.00 0.00 ? 33  PHE A CD2  5  
ATOM 6852  C CE1  . PHE A 1 30  ? -2.153  0.268   8.108   1.00 0.00 ? 33  PHE A CE1  5  
ATOM 6853  C CE2  . PHE A 1 30  ? -1.175  2.349   7.451   1.00 0.00 ? 33  PHE A CE2  5  
ATOM 6854  C CZ   . PHE A 1 30  ? -1.582  1.068   7.136   1.00 0.00 ? 33  PHE A CZ   5  
ATOM 6855  H H    . PHE A 1 30  ? -1.645  3.470   13.543  1.00 0.00 ? 33  PHE A H    5  
ATOM 6856  H HA   . PHE A 1 30  ? -1.267  0.911   12.188  1.00 0.00 ? 33  PHE A HA   5  
ATOM 6857  H HB2  . PHE A 1 30  ? -3.110  2.348   11.421  1.00 0.00 ? 33  PHE A HB2  5  
ATOM 6858  H HB3  . PHE A 1 30  ? -1.963  3.643   11.081  1.00 0.00 ? 33  PHE A HB3  5  
ATOM 6859  H HD1  . PHE A 1 30  ? -2.758  0.123   10.150  1.00 0.00 ? 33  PHE A HD1  5  
ATOM 6860  H HD2  . PHE A 1 30  ? -1.021  3.831   8.978   1.00 0.00 ? 33  PHE A HD2  5  
ATOM 6861  H HE1  . PHE A 1 30  ? -2.472  -0.735  7.863   1.00 0.00 ? 33  PHE A HE1  5  
ATOM 6862  H HE2  . PHE A 1 30  ? -0.730  2.976   6.694   1.00 0.00 ? 33  PHE A HE2  5  
ATOM 6863  H HZ   . PHE A 1 30  ? -1.456  0.693   6.131   1.00 0.00 ? 33  PHE A HZ   5  
ATOM 6864  N N    . GLN A 1 31  ? 1.094   1.209   11.526  1.00 0.00 ? 34  GLN A N    5  
ATOM 6865  C CA   . GLN A 1 31  ? 2.475   1.348   11.085  1.00 0.00 ? 34  GLN A CA   5  
ATOM 6866  C C    . GLN A 1 31  ? 2.626   0.885   9.641   1.00 0.00 ? 34  GLN A C    5  
ATOM 6867  O O    . GLN A 1 31  ? 2.109   -0.167  9.259   1.00 0.00 ? 34  GLN A O    5  
ATOM 6868  C CB   . GLN A 1 31  ? 3.430   0.556   11.987  1.00 0.00 ? 34  GLN A CB   5  
ATOM 6869  C CG   . GLN A 1 31  ? 3.574   1.129   13.389  1.00 0.00 ? 34  GLN A CG   5  
ATOM 6870  C CD   . GLN A 1 31  ? 2.435   0.742   14.314  1.00 0.00 ? 34  GLN A CD   5  
ATOM 6871  O OE1  . GLN A 1 31  ? 1.867   -0.341  14.201  1.00 0.00 ? 34  GLN A OE1  5  
ATOM 6872  N NE2  . GLN A 1 31  ? 2.095   1.630   15.234  1.00 0.00 ? 34  GLN A NE2  5  
ATOM 6873  H H    . GLN A 1 31  ? 0.728   0.311   11.676  1.00 0.00 ? 34  GLN A H    5  
ATOM 6874  H HA   . GLN A 1 31  ? 2.733   2.396   11.137  1.00 0.00 ? 34  GLN A HA   5  
ATOM 6875  H HB2  . GLN A 1 31  ? 3.062   -0.455  12.077  1.00 0.00 ? 34  GLN A HB2  5  
ATOM 6876  H HB3  . GLN A 1 31  ? 4.406   0.532   11.527  1.00 0.00 ? 34  GLN A HB3  5  
ATOM 6877  H HG2  . GLN A 1 31  ? 4.498   0.768   13.814  1.00 0.00 ? 34  GLN A HG2  5  
ATOM 6878  H HG3  . GLN A 1 31  ? 3.611   2.205   13.320  1.00 0.00 ? 34  GLN A HG3  5  
ATOM 6879  H HE21 . GLN A 1 31  ? 2.588   2.482   15.266  1.00 0.00 ? 34  GLN A HE21 5  
ATOM 6880  H HE22 . GLN A 1 31  ? 1.370   1.400   15.855  1.00 0.00 ? 34  GLN A HE22 5  
ATOM 6881  N N    . ALA A 1 32  ? 3.334   1.672   8.844   1.00 0.00 ? 35  ALA A N    5  
ATOM 6882  C CA   . ALA A 1 32  ? 3.552   1.344   7.444   1.00 0.00 ? 35  ALA A CA   5  
ATOM 6883  C C    . ALA A 1 32  ? 4.889   1.892   6.966   1.00 0.00 ? 35  ALA A C    5  
ATOM 6884  O O    . ALA A 1 32  ? 5.481   2.756   7.613   1.00 0.00 ? 35  ALA A O    5  
ATOM 6885  C CB   . ALA A 1 32  ? 2.418   1.892   6.589   1.00 0.00 ? 35  ALA A CB   5  
ATOM 6886  H H    . ALA A 1 32  ? 3.725   2.496   9.204   1.00 0.00 ? 35  ALA A H    5  
ATOM 6887  H HA   . ALA A 1 32  ? 3.562   0.268   7.351   1.00 0.00 ? 35  ALA A HA   5  
ATOM 6888  H HB1  . ALA A 1 32  ? 2.404   2.969   6.658   1.00 0.00 ? 35  ALA A HB1  5  
ATOM 6889  H HB2  . ALA A 1 32  ? 2.567   1.599   5.560   1.00 0.00 ? 35  ALA A HB2  5  
ATOM 6890  H HB3  . ALA A 1 32  ? 1.477   1.497   6.942   1.00 0.00 ? 35  ALA A HB3  5  
ATOM 6891  N N    . ARG A 1 33  ? 5.362   1.373   5.843   1.00 0.00 ? 36  ARG A N    5  
ATOM 6892  C CA   . ARG A 1 33  ? 6.610   1.819   5.248   1.00 0.00 ? 36  ARG A CA   5  
ATOM 6893  C C    . ARG A 1 33  ? 6.570   1.598   3.743   1.00 0.00 ? 36  ARG A C    5  
ATOM 6894  O O    . ARG A 1 33  ? 5.691   0.906   3.229   1.00 0.00 ? 36  ARG A O    5  
ATOM 6895  C CB   . ARG A 1 33  ? 7.796   1.049   5.834   1.00 0.00 ? 36  ARG A CB   5  
ATOM 6896  C CG   . ARG A 1 33  ? 7.755   -0.442  5.533   1.00 0.00 ? 36  ARG A CG   5  
ATOM 6897  C CD   . ARG A 1 33  ? 9.111   -1.100  5.739   1.00 0.00 ? 36  ARG A CD   5  
ATOM 6898  N NE   . ARG A 1 33  ? 10.106  -0.596  4.795   1.00 0.00 ? 36  ARG A NE   5  
ATOM 6899  C CZ   . ARG A 1 33  ? 11.418  -0.702  4.973   1.00 0.00 ? 36  ARG A CZ   5  
ATOM 6900  N NH1  . ARG A 1 33  ? 11.902  -1.227  6.088   1.00 0.00 ? 36  ARG A NH1  5  
ATOM 6901  N NH2  . ARG A 1 33  ? 12.254  -0.259  4.048   1.00 0.00 ? 36  ARG A NH2  5  
ATOM 6902  H H    . ARG A 1 33  ? 4.854   0.659   5.392   1.00 0.00 ? 36  ARG A H    5  
ATOM 6903  H HA   . ARG A 1 33  ? 6.728   2.873   5.452   1.00 0.00 ? 36  ARG A HA   5  
ATOM 6904  H HB2  . ARG A 1 33  ? 8.711   1.453   5.424   1.00 0.00 ? 36  ARG A HB2  5  
ATOM 6905  H HB3  . ARG A 1 33  ? 7.802   1.180   6.908   1.00 0.00 ? 36  ARG A HB3  5  
ATOM 6906  H HG2  . ARG A 1 33  ? 7.036   -0.914  6.186   1.00 0.00 ? 36  ARG A HG2  5  
ATOM 6907  H HG3  . ARG A 1 33  ? 7.455   -0.578  4.506   1.00 0.00 ? 36  ARG A HG3  5  
ATOM 6908  H HD2  . ARG A 1 33  ? 9.448   -0.903  6.747   1.00 0.00 ? 36  ARG A HD2  5  
ATOM 6909  H HD3  . ARG A 1 33  ? 9.002   -2.167  5.595   1.00 0.00 ? 36  ARG A HD3  5  
ATOM 6910  H HE   . ARG A 1 33  ? 9.772   -0.170  3.975   1.00 0.00 ? 36  ARG A HE   5  
ATOM 6911  H HH12 . ARG A 1 33  ? 11.581  -2.127  6.409   1.00 0.00 ? 36  ARG A HH12 5  
ATOM 6912  H HH21 . ARG A 1 33  ? 11.903  0.169   3.213   1.00 0.00 ? 36  ARG A HH21 5  
ATOM 6913  H HH22 . ARG A 1 33  ? 13.244  -0.355  4.180   1.00 0.00 ? 36  ARG A HH22 5  
ATOM 6914  N N    . LEU A 1 34  ? 7.515   2.197   3.043   1.00 0.00 ? 37  LEU A N    5  
ATOM 6915  C CA   . LEU A 1 34  ? 7.686   1.951   1.624   1.00 0.00 ? 37  LEU A CA   5  
ATOM 6916  C C    . LEU A 1 34  ? 8.936   1.110   1.411   1.00 0.00 ? 37  LEU A C    5  
ATOM 6917  O O    . LEU A 1 34  ? 9.893   1.200   2.187   1.00 0.00 ? 37  LEU A O    5  
ATOM 6918  C CB   . LEU A 1 34  ? 7.792   3.271   0.861   1.00 0.00 ? 37  LEU A CB   5  
ATOM 6919  C CG   . LEU A 1 34  ? 6.541   4.152   0.917   1.00 0.00 ? 37  LEU A CG   5  
ATOM 6920  C CD1  . LEU A 1 34  ? 6.774   5.460   0.187   1.00 0.00 ? 37  LEU A CD1  5  
ATOM 6921  C CD2  . LEU A 1 34  ? 5.347   3.429   0.316   1.00 0.00 ? 37  LEU A CD2  5  
ATOM 6922  H H    . LEU A 1 34  ? 8.114   2.828   3.489   1.00 0.00 ? 37  LEU A H    5  
ATOM 6923  H HA   . LEU A 1 34  ? 6.825   1.401   1.271   1.00 0.00 ? 37  LEU A HA   5  
ATOM 6924  H HB2  . LEU A 1 34  ? 8.622   3.831   1.269   1.00 0.00 ? 37  LEU A HB2  5  
ATOM 6925  H HB3  . LEU A 1 34  ? 8.003   3.050   -0.174  1.00 0.00 ? 37  LEU A HB3  5  
ATOM 6926  H HG   . LEU A 1 34  ? 6.315   4.378   1.950   1.00 0.00 ? 37  LEU A HG   5  
ATOM 6927  H HD11 . LEU A 1 34  ? 5.866   6.043   0.195   1.00 0.00 ? 37  LEU A HD11 5  
ATOM 6928  H HD12 . LEU A 1 34  ? 7.562   6.012   0.680   1.00 0.00 ? 37  LEU A HD12 5  
ATOM 6929  H HD13 . LEU A 1 34  ? 7.062   5.254   -0.831  1.00 0.00 ? 37  LEU A HD13 5  
ATOM 6930  H HD21 . LEU A 1 34  ? 5.103   2.568   0.918   1.00 0.00 ? 37  LEU A HD21 5  
ATOM 6931  H HD22 . LEU A 1 34  ? 4.500   4.100   0.288   1.00 0.00 ? 37  LEU A HD22 5  
ATOM 6932  H HD23 . LEU A 1 34  ? 5.586   3.114   -0.689  1.00 0.00 ? 37  LEU A HD23 5  
ATOM 6933  N N    . THR A 1 35  ? 8.910   0.271   0.389   1.00 0.00 ? 38  THR A N    5  
ATOM 6934  C CA   . THR A 1 35  ? 10.037  -0.595  0.086   1.00 0.00 ? 38  THR A CA   5  
ATOM 6935  C C    . THR A 1 35  ? 11.155  0.190   -0.598  1.00 0.00 ? 38  THR A C    5  
ATOM 6936  O O    . THR A 1 35  ? 10.938  1.288   -1.115  1.00 0.00 ? 38  THR A O    5  
ATOM 6937  C CB   . THR A 1 35  ? 9.604   -1.781  -0.794  1.00 0.00 ? 38  THR A CB   5  
ATOM 6938  O OG1  . THR A 1 35  ? 8.981   -1.305  -1.994  1.00 0.00 ? 38  THR A OG1  5  
ATOM 6939  C CG2  . THR A 1 35  ? 8.639   -2.685  -0.037  1.00 0.00 ? 38  THR A CG2  5  
ATOM 6940  H H    . THR A 1 35  ? 8.105   0.225   -0.174  1.00 0.00 ? 38  THR A H    5  
ATOM 6941  H HA   . THR A 1 35  ? 10.411  -0.987  1.023   1.00 0.00 ? 38  THR A HA   5  
ATOM 6942  H HB   . THR A 1 35  ? 10.481  -2.354  -1.056  1.00 0.00 ? 38  THR A HB   5  
ATOM 6943  H HG1  . THR A 1 35  ? 8.800   -2.054  -2.576  1.00 0.00 ? 38  THR A HG1  5  
ATOM 6944  H HG21 . THR A 1 35  ? 7.750   -2.126  0.222   1.00 0.00 ? 38  THR A HG21 5  
ATOM 6945  H HG22 . THR A 1 35  ? 9.113   -3.042  0.866   1.00 0.00 ? 38  THR A HG22 5  
ATOM 6946  H HG23 . THR A 1 35  ? 8.367   -3.523  -0.659  1.00 0.00 ? 38  THR A HG23 5  
ATOM 6947  N N    . ARG A 1 36  ? 12.348  -0.389  -0.611  1.00 0.00 ? 39  ARG A N    5  
ATOM 6948  C CA   . ARG A 1 36  ? 13.544  0.316   -1.051  1.00 0.00 ? 39  ARG A CA   5  
ATOM 6949  C C    . ARG A 1 36  ? 13.703  0.259   -2.571  1.00 0.00 ? 39  ARG A C    5  
ATOM 6950  O O    . ARG A 1 36  ? 14.486  -0.529  -3.108  1.00 0.00 ? 39  ARG A O    5  
ATOM 6951  C CB   . ARG A 1 36  ? 14.779  -0.257  -0.340  1.00 0.00 ? 39  ARG A CB   5  
ATOM 6952  C CG   . ARG A 1 36  ? 14.879  -1.774  -0.404  1.00 0.00 ? 39  ARG A CG   5  
ATOM 6953  C CD   . ARG A 1 36  ? 16.007  -2.297  0.468   1.00 0.00 ? 39  ARG A CD   5  
ATOM 6954  N NE   . ARG A 1 36  ? 17.314  -1.804  0.037   1.00 0.00 ? 39  ARG A NE   5  
ATOM 6955  C CZ   . ARG A 1 36  ? 18.452  -2.469  0.212   1.00 0.00 ? 39  ARG A CZ   5  
ATOM 6956  N NH1  . ARG A 1 36  ? 18.442  -3.665  0.786   1.00 0.00 ? 39  ARG A NH1  5  
ATOM 6957  N NH2  . ARG A 1 36  ? 19.600  -1.946  -0.185  1.00 0.00 ? 39  ARG A NH2  5  
ATOM 6958  H H    . ARG A 1 36  ? 12.423  -1.326  -0.340  1.00 0.00 ? 39  ARG A H    5  
ATOM 6959  H HA   . ARG A 1 36  ? 13.432  1.350   -0.761  1.00 0.00 ? 39  ARG A HA   5  
ATOM 6960  H HB2  . ARG A 1 36  ? 15.666  0.159   -0.794  1.00 0.00 ? 39  ARG A HB2  5  
ATOM 6961  H HB3  . ARG A 1 36  ? 14.749  0.035   0.700   1.00 0.00 ? 39  ARG A HB3  5  
ATOM 6962  H HG2  . ARG A 1 36  ? 13.947  -2.200  -0.065  1.00 0.00 ? 39  ARG A HG2  5  
ATOM 6963  H HG3  . ARG A 1 36  ? 15.062  -2.068  -1.427  1.00 0.00 ? 39  ARG A HG3  5  
ATOM 6964  H HD2  . ARG A 1 36  ? 15.834  -1.979  1.485   1.00 0.00 ? 39  ARG A HD2  5  
ATOM 6965  H HD3  . ARG A 1 36  ? 16.008  -3.377  0.426   1.00 0.00 ? 39  ARG A HD3  5  
ATOM 6966  H HE   . ARG A 1 36  ? 17.344  -0.914  -0.400  1.00 0.00 ? 39  ARG A HE   5  
ATOM 6967  H HH12 . ARG A 1 36  ? 18.103  -4.465  0.275   1.00 0.00 ? 39  ARG A HH12 5  
ATOM 6968  H HH21 . ARG A 1 36  ? 19.620  -1.041  -0.621  1.00 0.00 ? 39  ARG A HH21 5  
ATOM 6969  H HH22 . ARG A 1 36  ? 20.457  -2.451  -0.050  1.00 0.00 ? 39  ARG A HH22 5  
ATOM 6970  N N    . SER A 1 37  ? 12.939  1.094   -3.261  1.00 0.00 ? 40  SER A N    5  
ATOM 6971  C CA   . SER A 1 37  ? 13.052  1.213   -4.707  1.00 0.00 ? 40  SER A CA   5  
ATOM 6972  C C    . SER A 1 37  ? 14.192  2.163   -5.069  1.00 0.00 ? 40  SER A C    5  
ATOM 6973  O O    . SER A 1 37  ? 15.082  1.812   -5.844  1.00 0.00 ? 40  SER A O    5  
ATOM 6974  C CB   . SER A 1 37  ? 11.733  1.709   -5.311  1.00 0.00 ? 40  SER A CB   5  
ATOM 6975  O OG   . SER A 1 37  ? 11.799  1.745   -6.729  1.00 0.00 ? 40  SER A OG   5  
ATOM 6976  H H    . SER A 1 37  ? 12.269  1.631   -2.782  1.00 0.00 ? 40  SER A H    5  
ATOM 6977  H HA   . SER A 1 37  ? 13.276  0.234   -5.104  1.00 0.00 ? 40  SER A HA   5  
ATOM 6978  H HB2  . SER A 1 37  ? 10.933  1.046   -5.018  1.00 0.00 ? 40  SER A HB2  5  
ATOM 6979  H HB3  . SER A 1 37  ? 11.526  2.704   -4.948  1.00 0.00 ? 40  SER A HB3  5  
ATOM 6980  H HG   . SER A 1 37  ? 11.221  1.066   -7.092  1.00 0.00 ? 40  SER A HG   5  
ATOM 6981  N N    . ASN A 1 38  ? 14.160  3.367   -4.503  1.00 0.00 ? 41  ASN A N    5  
ATOM 6982  C CA   . ASN A 1 38  ? 15.206  4.359   -4.741  1.00 0.00 ? 41  ASN A CA   5  
ATOM 6983  C C    . ASN A 1 38  ? 15.237  5.373   -3.607  1.00 0.00 ? 41  ASN A C    5  
ATOM 6984  O O    . ASN A 1 38  ? 16.246  5.532   -2.925  1.00 0.00 ? 41  ASN A O    5  
ATOM 6985  C CB   . ASN A 1 38  ? 14.982  5.080   -6.075  1.00 0.00 ? 41  ASN A CB   5  
ATOM 6986  C CG   . ASN A 1 38  ? 16.065  6.106   -6.374  1.00 0.00 ? 41  ASN A CG   5  
ATOM 6987  O OD1  . ASN A 1 38  ? 15.952  7.273   -5.998  1.00 0.00 ? 41  ASN A OD1  5  
ATOM 6988  N ND2  . ASN A 1 38  ? 17.113  5.683   -7.065  1.00 0.00 ? 41  ASN A ND2  5  
ATOM 6989  H H    . ASN A 1 38  ? 13.417  3.591   -3.905  1.00 0.00 ? 41  ASN A H    5  
ATOM 6990  H HA   . ASN A 1 38  ? 16.153  3.843   -4.773  1.00 0.00 ? 41  ASN A HA   5  
ATOM 6991  H HB2  . ASN A 1 38  ? 14.971  4.352   -6.873  1.00 0.00 ? 41  ASN A HB2  5  
ATOM 6992  H HB3  . ASN A 1 38  ? 14.029  5.587   -6.045  1.00 0.00 ? 41  ASN A HB3  5  
ATOM 6993  H HD21 . ASN A 1 38  ? 17.136  4.739   -7.349  1.00 0.00 ? 41  ASN A HD21 5  
ATOM 6994  H HD22 . ASN A 1 38  ? 17.826  6.330   -7.273  1.00 0.00 ? 41  ASN A HD22 5  
ATOM 6995  N N    . SER A 1 39  ? 14.119  6.050   -3.411  1.00 0.00 ? 42  SER A N    5  
ATOM 6996  C CA   . SER A 1 39  ? 13.985  7.022   -2.344  1.00 0.00 ? 42  SER A CA   5  
ATOM 6997  C C    . SER A 1 39  ? 12.773  6.644   -1.498  1.00 0.00 ? 42  SER A C    5  
ATOM 6998  O O    . SER A 1 39  ? 11.820  6.059   -2.012  1.00 0.00 ? 42  SER A O    5  
ATOM 6999  C CB   . SER A 1 39  ? 13.830  8.425   -2.943  1.00 0.00 ? 42  SER A CB   5  
ATOM 7000  O OG   . SER A 1 39  ? 14.242  9.425   -2.028  1.00 0.00 ? 42  SER A OG   5  
ATOM 7001  H H    . SER A 1 39  ? 13.353  5.889   -4.001  1.00 0.00 ? 42  SER A H    5  
ATOM 7002  H HA   . SER A 1 39  ? 14.873  6.984   -1.733  1.00 0.00 ? 42  SER A HA   5  
ATOM 7003  H HB2  . SER A 1 39  ? 14.435  8.501   -3.833  1.00 0.00 ? 42  SER A HB2  5  
ATOM 7004  H HB3  . SER A 1 39  ? 12.794  8.592   -3.197  1.00 0.00 ? 42  SER A HB3  5  
ATOM 7005  H HG   . SER A 1 39  ? 13.899  10.290  -2.319  1.00 0.00 ? 42  SER A HG   5  
ATOM 7006  N N    . LYS A 1 40  ? 12.807  6.971   -0.210  1.00 0.00 ? 43  LYS A N    5  
ATOM 7007  C CA   . LYS A 1 40  ? 11.799  6.473   0.730   1.00 0.00 ? 43  LYS A CA   5  
ATOM 7008  C C    . LYS A 1 40  ? 10.439  7.135   0.523   1.00 0.00 ? 43  LYS A C    5  
ATOM 7009  O O    . LYS A 1 40  ? 9.468   6.766   1.173   1.00 0.00 ? 43  LYS A O    5  
ATOM 7010  C CB   . LYS A 1 40  ? 12.241  6.661   2.187   1.00 0.00 ? 43  LYS A CB   5  
ATOM 7011  C CG   . LYS A 1 40  ? 12.344  8.114   2.624   1.00 0.00 ? 43  LYS A CG   5  
ATOM 7012  C CD   . LYS A 1 40  ? 13.777  8.618   2.574   1.00 0.00 ? 43  LYS A CD   5  
ATOM 7013  C CE   . LYS A 1 40  ? 14.652  7.906   3.593   1.00 0.00 ? 43  LYS A CE   5  
ATOM 7014  N NZ   . LYS A 1 40  ? 14.126  8.067   4.978   1.00 0.00 ? 43  LYS A NZ   5  
ATOM 7015  H H    . LYS A 1 40  ? 13.517  7.565   0.115   1.00 0.00 ? 43  LYS A H    5  
ATOM 7016  H HA   . LYS A 1 40  ? 11.689  5.415   0.543   1.00 0.00 ? 43  LYS A HA   5  
ATOM 7017  H HB2  . LYS A 1 40  ? 11.531  6.166   2.831   1.00 0.00 ? 43  LYS A HB2  5  
ATOM 7018  H HB3  . LYS A 1 40  ? 13.210  6.201   2.319   1.00 0.00 ? 43  LYS A HB3  5  
ATOM 7019  H HG2  . LYS A 1 40  ? 11.737  8.719   1.968   1.00 0.00 ? 43  LYS A HG2  5  
ATOM 7020  H HG3  . LYS A 1 40  ? 11.976  8.199   3.636   1.00 0.00 ? 43  LYS A HG3  5  
ATOM 7021  H HD2  . LYS A 1 40  ? 14.177  8.441   1.587   1.00 0.00 ? 43  LYS A HD2  5  
ATOM 7022  H HD3  . LYS A 1 40  ? 13.784  9.678   2.783   1.00 0.00 ? 43  LYS A HD3  5  
ATOM 7023  H HE2  . LYS A 1 40  ? 14.686  6.855   3.350   1.00 0.00 ? 43  LYS A HE2  5  
ATOM 7024  H HE3  . LYS A 1 40  ? 15.648  8.321   3.545   1.00 0.00 ? 43  LYS A HE3  5  
ATOM 7025  H HZ1  . LYS A 1 40  ? 13.246  7.515   5.082   1.00 0.00 ? 43  LYS A HZ1  5  
ATOM 7026  H HZ3  . LYS A 1 40  ? 13.893  9.070   5.143   1.00 0.00 ? 43  LYS A HZ3  5  
ATOM 7027  N N    . CYS A 1 41  ? 10.372  8.120   -0.361  1.00 0.00 ? 44  CYS A N    5  
ATOM 7028  C CA   . CYS A 1 41  ? 9.103   8.759   -0.678  1.00 0.00 ? 44  CYS A CA   5  
ATOM 7029  C C    . CYS A 1 41  ? 8.413   8.072   -1.852  1.00 0.00 ? 44  CYS A C    5  
ATOM 7030  O O    . CYS A 1 41  ? 7.294   8.422   -2.205  1.00 0.00 ? 44  CYS A O    5  
ATOM 7031  C CB   . CYS A 1 41  ? 9.297   10.246  -0.986  1.00 0.00 ? 44  CYS A CB   5  
ATOM 7032  S SG   . CYS A 1 41  ? 9.845   11.246  0.441   1.00 0.00 ? 44  CYS A SG   5  
ATOM 7033  H H    . CYS A 1 41  ? 11.194  8.434   -0.794  1.00 0.00 ? 44  CYS A H    5  
ATOM 7034  H HA   . CYS A 1 41  ? 8.468   8.667   0.192   1.00 0.00 ? 44  CYS A HA   5  
ATOM 7035  H HB2  . CYS A 1 41  ? 10.043  10.350  -1.760  1.00 0.00 ? 44  CYS A HB2  5  
ATOM 7036  H HB3  . CYS A 1 41  ? 8.362   10.657  -1.338  1.00 0.00 ? 44  CYS A HB3  5  
ATOM 7037  N N    . GLN A 1 42  ? 9.070   7.088   -2.457  1.00 0.00 ? 45  GLN A N    5  
ATOM 7038  C CA   . GLN A 1 42  ? 8.476   6.379   -3.582  1.00 0.00 ? 45  GLN A CA   5  
ATOM 7039  C C    . GLN A 1 42  ? 8.883   4.914   -3.585  1.00 0.00 ? 45  GLN A C    5  
ATOM 7040  O O    . GLN A 1 42  ? 10.056  4.576   -3.755  1.00 0.00 ? 45  GLN A O    5  
ATOM 7041  C CB   . GLN A 1 42  ? 8.864   7.030   -4.913  1.00 0.00 ? 45  GLN A CB   5  
ATOM 7042  C CG   . GLN A 1 42  ? 8.285   6.318   -6.129  1.00 0.00 ? 45  GLN A CG   5  
ATOM 7043  C CD   . GLN A 1 42  ? 8.609   7.016   -7.434  1.00 0.00 ? 45  GLN A CD   5  
ATOM 7044  O OE1  . GLN A 1 42  ? 9.659   7.641   -7.579  1.00 0.00 ? 45  GLN A OE1  5  
ATOM 7045  N NE2  . GLN A 1 42  ? 7.696   6.932   -8.390  1.00 0.00 ? 45  GLN A NE2  5  
ATOM 7046  H H    . GLN A 1 42  ? 9.959   6.822   -2.132  1.00 0.00 ? 45  GLN A H    5  
ATOM 7047  H HA   . GLN A 1 42  ? 7.403   6.437   -3.468  1.00 0.00 ? 45  GLN A HA   5  
ATOM 7048  H HB2  . GLN A 1 42  ? 8.512   8.050   -4.917  1.00 0.00 ? 45  GLN A HB2  5  
ATOM 7049  H HB3  . GLN A 1 42  ? 9.938   7.028   -5.000  1.00 0.00 ? 45  GLN A HB3  5  
ATOM 7050  H HG2  . GLN A 1 42  ? 8.691   5.317   -6.166  1.00 0.00 ? 45  GLN A HG2  5  
ATOM 7051  H HG3  . GLN A 1 42  ? 7.214   6.261   -6.024  1.00 0.00 ? 45  GLN A HG3  5  
ATOM 7052  H HE21 . GLN A 1 42  ? 6.872   6.433   -8.201  1.00 0.00 ? 45  GLN A HE21 5  
ATOM 7053  H HE22 . GLN A 1 42  ? 7.878   7.372   -9.246  1.00 0.00 ? 45  GLN A HE22 5  
ATOM 7054  N N    . GLY A 1 43  ? 7.902   4.052   -3.404  1.00 0.00 ? 46  GLY A N    5  
ATOM 7055  C CA   . GLY A 1 43  ? 8.148   2.630   -3.419  1.00 0.00 ? 46  GLY A CA   5  
ATOM 7056  C C    . GLY A 1 43  ? 6.868   1.850   -3.231  1.00 0.00 ? 46  GLY A C    5  
ATOM 7057  O O    . GLY A 1 43  ? 5.777   2.396   -3.394  1.00 0.00 ? 46  GLY A O    5  
ATOM 7058  H H    . GLY A 1 43  ? 6.989   4.388   -3.257  1.00 0.00 ? 46  GLY A H    5  
ATOM 7059  H HA2  . GLY A 1 43  ? 8.590   2.362   -4.370  1.00 0.00 ? 46  GLY A HA2  5  
ATOM 7060  H HA3  . GLY A 1 43  ? 8.837   2.380   -2.625  1.00 0.00 ? 46  GLY A HA3  5  
ATOM 7061  N N    . GLN A 1 44  ? 6.991   0.582   -2.884  1.00 0.00 ? 47  GLN A N    5  
ATOM 7062  C CA   . GLN A 1 44  ? 5.828   -0.272  -2.703  1.00 0.00 ? 47  GLN A CA   5  
ATOM 7063  C C    . GLN A 1 44  ? 5.378   -0.235  -1.251  1.00 0.00 ? 47  GLN A C    5  
ATOM 7064  O O    . GLN A 1 44  ? 6.204   -0.232  -0.337  1.00 0.00 ? 47  GLN A O    5  
ATOM 7065  C CB   . GLN A 1 44  ? 6.159   -1.696  -3.143  1.00 0.00 ? 47  GLN A CB   5  
ATOM 7066  C CG   . GLN A 1 44  ? 6.596   -1.775  -4.598  1.00 0.00 ? 47  GLN A CG   5  
ATOM 7067  C CD   . GLN A 1 44  ? 7.424   -3.005  -4.896  1.00 0.00 ? 47  GLN A CD   5  
ATOM 7068  O OE1  . GLN A 1 44  ? 8.126   -3.521  -4.026  1.00 0.00 ? 47  GLN A OE1  5  
ATOM 7069  N NE2  . GLN A 1 44  ? 7.362   -3.475  -6.129  1.00 0.00 ? 47  GLN A NE2  5  
ATOM 7070  H H    . GLN A 1 44  ? 7.887   0.208   -2.729  1.00 0.00 ? 47  GLN A H    5  
ATOM 7071  H HA   . GLN A 1 44  ? 5.033   0.112   -3.323  1.00 0.00 ? 47  GLN A HA   5  
ATOM 7072  H HB2  . GLN A 1 44  ? 6.957   -2.079  -2.522  1.00 0.00 ? 47  GLN A HB2  5  
ATOM 7073  H HB3  . GLN A 1 44  ? 5.283   -2.317  -3.015  1.00 0.00 ? 47  GLN A HB3  5  
ATOM 7074  H HG2  . GLN A 1 44  ? 5.717   -1.793  -5.224  1.00 0.00 ? 47  GLN A HG2  5  
ATOM 7075  H HG3  . GLN A 1 44  ? 7.185   -0.900  -4.832  1.00 0.00 ? 47  GLN A HG3  5  
ATOM 7076  H HE21 . GLN A 1 44  ? 6.790   -3.008  -6.780  1.00 0.00 ? 47  GLN A HE21 5  
ATOM 7077  H HE22 . GLN A 1 44  ? 7.904   -4.267  -6.355  1.00 0.00 ? 47  GLN A HE22 5  
ATOM 7078  N N    . LEU A 1 45  ? 4.072   -0.187  -1.047  1.00 0.00 ? 48  LEU A N    5  
ATOM 7079  C CA   . LEU A 1 45  ? 3.515   -0.045  0.290   1.00 0.00 ? 48  LEU A CA   5  
ATOM 7080  C C    . LEU A 1 45  ? 3.595   -1.356  1.063   1.00 0.00 ? 48  LEU A C    5  
ATOM 7081  O O    . LEU A 1 45  ? 3.076   -2.384  0.625   1.00 0.00 ? 48  LEU A O    5  
ATOM 7082  C CB   . LEU A 1 45  ? 2.058   0.426   0.214   1.00 0.00 ? 48  LEU A CB   5  
ATOM 7083  C CG   . LEU A 1 45  ? 1.401   0.776   1.557   1.00 0.00 ? 48  LEU A CG   5  
ATOM 7084  C CD1  . LEU A 1 45  ? 2.101   1.956   2.217   1.00 0.00 ? 48  LEU A CD1  5  
ATOM 7085  C CD2  . LEU A 1 45  ? -0.075  1.078   1.359   1.00 0.00 ? 48  LEU A CD2  5  
ATOM 7086  H H    . LEU A 1 45  ? 3.464   -0.247  -1.819  1.00 0.00 ? 48  LEU A H    5  
ATOM 7087  H HA   . LEU A 1 45  ? 4.097   0.697   0.810   1.00 0.00 ? 48  LEU A HA   5  
ATOM 7088  H HB2  . LEU A 1 45  ? 2.017   1.303   -0.421  1.00 0.00 ? 48  LEU A HB2  5  
ATOM 7089  H HB3  . LEU A 1 45  ? 1.476   -0.358  -0.246  1.00 0.00 ? 48  LEU A HB3  5  
ATOM 7090  H HG   . LEU A 1 45  ? 1.482   -0.074  2.223   1.00 0.00 ? 48  LEU A HG   5  
ATOM 7091  H HD11 . LEU A 1 45  ? 3.104   1.673   2.493   1.00 0.00 ? 48  LEU A HD11 5  
ATOM 7092  H HD12 . LEU A 1 45  ? 2.135   2.787   1.529   1.00 0.00 ? 48  LEU A HD12 5  
ATOM 7093  H HD13 . LEU A 1 45  ? 1.554   2.247   3.104   1.00 0.00 ? 48  LEU A HD13 5  
ATOM 7094  H HD21 . LEU A 1 45  ? -0.568  0.210   0.949   1.00 0.00 ? 48  LEU A HD21 5  
ATOM 7095  H HD22 . LEU A 1 45  ? -0.522  1.329   2.310   1.00 0.00 ? 48  LEU A HD22 5  
ATOM 7096  H HD23 . LEU A 1 45  ? -0.184  1.911   0.680   1.00 0.00 ? 48  LEU A HD23 5  
ATOM 7097  N N    . GLU A 1 46  ? 4.255   -1.305  2.207   1.00 0.00 ? 49  GLU A N    5  
ATOM 7098  C CA   . GLU A 1 46  ? 4.342   -2.444  3.103   1.00 0.00 ? 49  GLU A CA   5  
ATOM 7099  C C    . GLU A 1 46  ? 3.812   -2.029  4.468   1.00 0.00 ? 49  GLU A C    5  
ATOM 7100  O O    . GLU A 1 46  ? 4.245   -1.024  5.032   1.00 0.00 ? 49  GLU A O    5  
ATOM 7101  C CB   . GLU A 1 46  ? 5.791   -2.932  3.202   1.00 0.00 ? 49  GLU A CB   5  
ATOM 7102  C CG   . GLU A 1 46  ? 5.945   -4.286  3.875   1.00 0.00 ? 49  GLU A CG   5  
ATOM 7103  C CD   . GLU A 1 46  ? 7.382   -4.764  3.885   1.00 0.00 ? 49  GLU A CD   5  
ATOM 7104  O OE1  . GLU A 1 46  ? 8.193   -4.211  4.655   1.00 0.00 ? 49  GLU A OE1  5  
ATOM 7105  O OE2  . GLU A 1 46  ? 7.708   -5.699  3.121   1.00 0.00 ? 49  GLU A OE2  5  
ATOM 7106  H H    . GLU A 1 46  ? 4.696   -0.464  2.466   1.00 0.00 ? 49  GLU A H    5  
ATOM 7107  H HA   . GLU A 1 46  ? 3.721   -3.231  2.708   1.00 0.00 ? 49  GLU A HA   5  
ATOM 7108  H HB2  . GLU A 1 46  ? 6.203   -3.001  2.208   1.00 0.00 ? 49  GLU A HB2  5  
ATOM 7109  H HB3  . GLU A 1 46  ? 6.359   -2.212  3.769   1.00 0.00 ? 49  GLU A HB3  5  
ATOM 7110  H HG2  . GLU A 1 46  ? 5.597   -4.210  4.893   1.00 0.00 ? 49  GLU A HG2  5  
ATOM 7111  H HG3  . GLU A 1 46  ? 5.348   -5.011  3.343   1.00 0.00 ? 49  GLU A HG3  5  
ATOM 7112  N N    . VAL A 1 47  ? 2.858   -2.784  4.985   1.00 0.00 ? 50  VAL A N    5  
ATOM 7113  C CA   . VAL A 1 47  ? 2.160   -2.389  6.201   1.00 0.00 ? 50  VAL A CA   5  
ATOM 7114  C C    . VAL A 1 47  ? 2.322   -3.421  7.308   1.00 0.00 ? 50  VAL A C    5  
ATOM 7115  O O    . VAL A 1 47  ? 2.583   -4.600  7.049   1.00 0.00 ? 50  VAL A O    5  
ATOM 7116  C CB   . VAL A 1 47  ? 0.654   -2.152  5.944   1.00 0.00 ? 50  VAL A CB   5  
ATOM 7117  C CG1  . VAL A 1 47  ? 0.450   -1.054  4.910   1.00 0.00 ? 50  VAL A CG1  5  
ATOM 7118  C CG2  . VAL A 1 47  ? -0.035  -3.437  5.508   1.00 0.00 ? 50  VAL A CG2  5  
ATOM 7119  H H    . VAL A 1 47  ? 2.627   -3.634  4.550   1.00 0.00 ? 50  VAL A H    5  
ATOM 7120  H HA   . VAL A 1 47  ? 2.592   -1.458  6.536   1.00 0.00 ? 50  VAL A HA   5  
ATOM 7121  H HB   . VAL A 1 47  ? 0.201   -1.826  6.870   1.00 0.00 ? 50  VAL A HB   5  
ATOM 7122  H HG11 . VAL A 1 47  ? 0.861   -0.127  5.280   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 7123  H HG12 . VAL A 1 47  ? 0.950   -1.330  3.993   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 7124  H HG13 . VAL A 1 47  ? -0.606  -0.930  4.719   1.00 0.00 ? 50  VAL A HG13 5  
ATOM 7125  H HG21 . VAL A 1 47  ? 0.115   -4.198  6.260   1.00 0.00 ? 50  VAL A HG21 5  
ATOM 7126  H HG22 . VAL A 1 47  ? -1.091  -3.256  5.384   1.00 0.00 ? 50  VAL A HG22 5  
ATOM 7127  H HG23 . VAL A 1 47  ? 0.386   -3.770  4.572   1.00 0.00 ? 50  VAL A HG23 5  
ATOM 7128  N N    . TYR A 1 48  ? 2.184   -2.954  8.539   1.00 0.00 ? 51  TYR A N    5  
ATOM 7129  C CA   . TYR A 1 48  ? 2.212   -3.821  9.705   1.00 0.00 ? 51  TYR A CA   5  
ATOM 7130  C C    . TYR A 1 48  ? 0.821   -4.389  9.958   1.00 0.00 ? 51  TYR A C    5  
ATOM 7131  O O    . TYR A 1 48  ? -0.095  -3.667  10.354  1.00 0.00 ? 51  TYR A O    5  
ATOM 7132  C CB   . TYR A 1 48  ? 2.710   -3.040  10.934  1.00 0.00 ? 51  TYR A CB   5  
ATOM 7133  C CG   . TYR A 1 48  ? 2.601   -3.798  12.246  1.00 0.00 ? 51  TYR A CG   5  
ATOM 7134  C CD1  . TYR A 1 48  ? 3.565   -4.728  12.625  1.00 0.00 ? 51  TYR A CD1  5  
ATOM 7135  C CD2  . TYR A 1 48  ? 1.532   -3.575  13.111  1.00 0.00 ? 51  TYR A CD2  5  
ATOM 7136  C CE1  . TYR A 1 48  ? 3.465   -5.411  13.824  1.00 0.00 ? 51  TYR A CE1  5  
ATOM 7137  C CE2  . TYR A 1 48  ? 1.427   -4.256  14.309  1.00 0.00 ? 51  TYR A CE2  5  
ATOM 7138  C CZ   . TYR A 1 48  ? 2.395   -5.171  14.662  1.00 0.00 ? 51  TYR A CZ   5  
ATOM 7139  O OH   . TYR A 1 48  ? 2.292   -5.850  15.860  1.00 0.00 ? 51  TYR A OH   5  
ATOM 7140  H H    . TYR A 1 48  ? 2.053   -1.988  8.671   1.00 0.00 ? 51  TYR A H    5  
ATOM 7141  H HA   . TYR A 1 48  ? 2.892   -4.634  9.501   1.00 0.00 ? 51  TYR A HA   5  
ATOM 7142  H HB2  . TYR A 1 48  ? 3.751   -2.781  10.788  1.00 0.00 ? 51  TYR A HB2  5  
ATOM 7143  H HB3  . TYR A 1 48  ? 2.133   -2.131  11.028  1.00 0.00 ? 51  TYR A HB3  5  
ATOM 7144  H HD1  . TYR A 1 48  ? 4.402   -4.917  11.969  1.00 0.00 ? 51  TYR A HD1  5  
ATOM 7145  H HD2  . TYR A 1 48  ? 0.774   -2.860  12.832  1.00 0.00 ? 51  TYR A HD2  5  
ATOM 7146  H HE1  . TYR A 1 48  ? 4.224   -6.128  14.100  1.00 0.00 ? 51  TYR A HE1  5  
ATOM 7147  H HE2  . TYR A 1 48  ? 0.590   -4.068  14.964  1.00 0.00 ? 51  TYR A HE2  5  
ATOM 7148  H HH   . TYR A 1 48  ? 3.075   -5.660  16.402  1.00 0.00 ? 51  TYR A HH   5  
ATOM 7149  N N    . LEU A 1 49  ? 0.661   -5.677  9.700   1.00 0.00 ? 52  LEU A N    5  
ATOM 7150  C CA   . LEU A 1 49  ? -0.607  -6.348  9.932   1.00 0.00 ? 52  LEU A CA   5  
ATOM 7151  C C    . LEU A 1 49  ? -0.684  -6.847  11.367  1.00 0.00 ? 52  LEU A C    5  
ATOM 7152  O O    . LEU A 1 49  ? 0.149   -6.497  12.200  1.00 0.00 ? 52  LEU A O    5  
ATOM 7153  C CB   . LEU A 1 49  ? -0.791  -7.529  8.972   1.00 0.00 ? 52  LEU A CB   5  
ATOM 7154  C CG   . LEU A 1 49  ? -0.897  -7.181  7.489   1.00 0.00 ? 52  LEU A CG   5  
ATOM 7155  C CD1  . LEU A 1 49  ? -1.019  -8.453  6.670   1.00 0.00 ? 52  LEU A CD1  5  
ATOM 7156  C CD2  . LEU A 1 49  ? -2.090  -6.271  7.231   1.00 0.00 ? 52  LEU A CD2  5  
ATOM 7157  H H    . LEU A 1 49  ? 1.421   -6.194  9.353   1.00 0.00 ? 52  LEU A H    5  
ATOM 7158  H HA   . LEU A 1 49  ? -1.397  -5.632  9.769   1.00 0.00 ? 52  LEU A HA   5  
ATOM 7159  H HB2  . LEU A 1 49  ? 0.044   -8.199  9.098   1.00 0.00 ? 52  LEU A HB2  5  
ATOM 7160  H HB3  . LEU A 1 49  ? -1.690  -8.054  9.252   1.00 0.00 ? 52  LEU A HB3  5  
ATOM 7161  H HG   . LEU A 1 49  ? -0.001  -6.664  7.178   1.00 0.00 ? 52  LEU A HG   5  
ATOM 7162  H HD11 . LEU A 1 49  ? -1.923  -8.973  6.948   1.00 0.00 ? 52  LEU A HD11 5  
ATOM 7163  H HD12 . LEU A 1 49  ? -1.056  -8.204  5.620   1.00 0.00 ? 52  LEU A HD12 5  
ATOM 7164  H HD13 . LEU A 1 49  ? -0.164  -9.087  6.859   1.00 0.00 ? 52  LEU A HD13 5  
ATOM 7165  H HD21 . LEU A 1 49  ? -2.171  -6.073  6.172   1.00 0.00 ? 52  LEU A HD21 5  
ATOM 7166  H HD22 . LEU A 1 49  ? -2.993  -6.755  7.574   1.00 0.00 ? 52  LEU A HD22 5  
ATOM 7167  H HD23 . LEU A 1 49  ? -1.958  -5.339  7.761   1.00 0.00 ? 52  LEU A HD23 5  
ATOM 7168  N N    . LYS A 1 50  ? -1.666  -7.686  11.645  1.00 0.00 ? 53  LYS A N    5  
ATOM 7169  C CA   . LYS A 1 50  ? -1.855  -8.222  12.981  1.00 0.00 ? 53  LYS A CA   5  
ATOM 7170  C C    . LYS A 1 50  ? -0.706  -9.163  13.351  1.00 0.00 ? 53  LYS A C    5  
ATOM 7171  O O    . LYS A 1 50  ? -0.455  -9.426  14.528  1.00 0.00 ? 53  LYS A O    5  
ATOM 7172  C CB   . LYS A 1 50  ? -3.193  -8.957  13.049  1.00 0.00 ? 53  LYS A CB   5  
ATOM 7173  C CG   . LYS A 1 50  ? -3.726  -9.143  14.459  1.00 0.00 ? 53  LYS A CG   5  
ATOM 7174  C CD   . LYS A 1 50  ? -3.993  -7.808  15.142  1.00 0.00 ? 53  LYS A CD   5  
ATOM 7175  C CE   . LYS A 1 50  ? -5.002  -6.963  14.375  1.00 0.00 ? 53  LYS A CE   5  
ATOM 7176  N NZ   . LYS A 1 50  ? -6.312  -7.650  14.215  1.00 0.00 ? 53  LYS A NZ   5  
ATOM 7177  H H    . LYS A 1 50  ? -2.284  -7.951  10.935  1.00 0.00 ? 53  LYS A H    5  
ATOM 7178  H HA   . LYS A 1 50  ? -1.869  -7.396  13.674  1.00 0.00 ? 53  LYS A HA   5  
ATOM 7179  H HB2  . LYS A 1 50  ? -3.926  -8.398  12.486  1.00 0.00 ? 53  LYS A HB2  5  
ATOM 7180  H HB3  . LYS A 1 50  ? -3.076  -9.932  12.599  1.00 0.00 ? 53  LYS A HB3  5  
ATOM 7181  H HG2  . LYS A 1 50  ? -4.647  -9.703  14.413  1.00 0.00 ? 53  LYS A HG2  5  
ATOM 7182  H HG3  . LYS A 1 50  ? -2.998  -9.694  15.036  1.00 0.00 ? 53  LYS A HG3  5  
ATOM 7183  H HD2  . LYS A 1 50  ? -4.382  -7.994  16.132  1.00 0.00 ? 53  LYS A HD2  5  
ATOM 7184  H HD3  . LYS A 1 50  ? -3.063  -7.261  15.217  1.00 0.00 ? 53  LYS A HD3  5  
ATOM 7185  H HE2  . LYS A 1 50  ? -5.157  -6.039  14.910  1.00 0.00 ? 53  LYS A HE2  5  
ATOM 7186  H HE3  . LYS A 1 50  ? -4.597  -6.746  13.397  1.00 0.00 ? 53  LYS A HE3  5  
ATOM 7187  H HZ1  . LYS A 1 50  ? -6.205  -8.462  13.561  1.00 0.00 ? 53  LYS A HZ1  5  
ATOM 7188  H HZ3  . LYS A 1 50  ? -6.627  -8.019  15.140  1.00 0.00 ? 53  LYS A HZ3  5  
ATOM 7189  N N    . ASP A 1 51  ? -0.018  -9.669  12.337  1.00 0.00 ? 54  ASP A N    5  
ATOM 7190  C CA   . ASP A 1 51  ? 1.114   -10.561 12.548  1.00 0.00 ? 54  ASP A CA   5  
ATOM 7191  C C    . ASP A 1 51  ? 2.445   -9.846  12.298  1.00 0.00 ? 54  ASP A C    5  
ATOM 7192  O O    . ASP A 1 51  ? 3.345   -9.890  13.139  1.00 0.00 ? 54  ASP A O    5  
ATOM 7193  C CB   . ASP A 1 51  ? 0.995   -11.801 11.648  1.00 0.00 ? 54  ASP A CB   5  
ATOM 7194  C CG   . ASP A 1 51  ? 1.036   -11.472 10.165  1.00 0.00 ? 54  ASP A CG   5  
ATOM 7195  O OD1  . ASP A 1 51  ? 0.183   -10.683 9.700   1.00 0.00 ? 54  ASP A OD1  5  
ATOM 7196  O OD2  . ASP A 1 51  ? 1.913   -12.007 9.458   1.00 0.00 ? 54  ASP A OD2  5  
ATOM 7197  H H    . ASP A 1 51  ? -0.285  -9.448  11.421  1.00 0.00 ? 54  ASP A H    5  
ATOM 7198  H HA   . ASP A 1 51  ? 1.087   -10.878 13.578  1.00 0.00 ? 54  ASP A HA   5  
ATOM 7199  H HB2  . ASP A 1 51  ? 1.812   -12.472 11.867  1.00 0.00 ? 54  ASP A HB2  5  
ATOM 7200  H HB3  . ASP A 1 51  ? 0.060   -12.300 11.861  1.00 0.00 ? 54  ASP A HB3  5  
ATOM 7201  N N    . GLY A 1 52  ? 2.572   -9.183  11.153  1.00 0.00 ? 55  GLY A N    5  
ATOM 7202  C CA   . GLY A 1 52  ? 3.821   -8.527  10.821  1.00 0.00 ? 55  GLY A CA   5  
ATOM 7203  C C    . GLY A 1 52  ? 3.754   -7.758  9.517   1.00 0.00 ? 55  GLY A C    5  
ATOM 7204  O O    . GLY A 1 52  ? 2.669   -7.405  9.054   1.00 0.00 ? 55  GLY A O    5  
ATOM 7205  H H    . GLY A 1 52  ? 1.818   -9.140  10.528  1.00 0.00 ? 55  GLY A H    5  
ATOM 7206  H HA2  . GLY A 1 52  ? 4.076   -7.842  11.615  1.00 0.00 ? 55  GLY A HA2  5  
ATOM 7207  H HA3  . GLY A 1 52  ? 4.597   -9.275  10.746  1.00 0.00 ? 55  GLY A HA3  5  
ATOM 7208  N N    . TRP A 1 53  ? 4.912   -7.523  8.912   1.00 0.00 ? 56  TRP A N    5  
ATOM 7209  C CA   . TRP A 1 53  ? 5.008   -6.671  7.731   1.00 0.00 ? 56  TRP A CA   5  
ATOM 7210  C C    . TRP A 1 53  ? 4.639   -7.426  6.459   1.00 0.00 ? 56  TRP A C    5  
ATOM 7211  O O    . TRP A 1 53  ? 5.208   -8.474  6.152   1.00 0.00 ? 56  TRP A O    5  
ATOM 7212  C CB   . TRP A 1 53  ? 6.418   -6.088  7.602   1.00 0.00 ? 56  TRP A CB   5  
ATOM 7213  C CG   . TRP A 1 53  ? 6.743   -5.079  8.662   1.00 0.00 ? 56  TRP A CG   5  
ATOM 7214  C CD1  . TRP A 1 53  ? 7.439   -5.292  9.819   1.00 0.00 ? 56  TRP A CD1  5  
ATOM 7215  C CD2  . TRP A 1 53  ? 6.379   -3.695  8.664   1.00 0.00 ? 56  TRP A CD2  5  
ATOM 7216  N NE1  . TRP A 1 53  ? 7.524   -4.124  10.538  1.00 0.00 ? 56  TRP A NE1  5  
ATOM 7217  C CE2  . TRP A 1 53  ? 6.883   -3.130  9.851   1.00 0.00 ? 56  TRP A CE2  5  
ATOM 7218  C CE3  . TRP A 1 53  ? 5.677   -2.877  7.778   1.00 0.00 ? 56  TRP A CE3  5  
ATOM 7219  C CZ2  . TRP A 1 53  ? 6.703   -1.787  10.173  1.00 0.00 ? 56  TRP A CZ2  5  
ATOM 7220  C CZ3  . TRP A 1 53  ? 5.500   -1.546  8.098   1.00 0.00 ? 56  TRP A CZ3  5  
ATOM 7221  C CH2  . TRP A 1 53  ? 6.011   -1.012  9.284   1.00 0.00 ? 56  TRP A CH2  5  
ATOM 7222  H H    . TRP A 1 53  ? 5.723   -7.955  9.256   1.00 0.00 ? 56  TRP A H    5  
ATOM 7223  H HA   . TRP A 1 53  ? 4.309   -5.858  7.862   1.00 0.00 ? 56  TRP A HA   5  
ATOM 7224  H HB2  . TRP A 1 53  ? 7.139   -6.889  7.670   1.00 0.00 ? 56  TRP A HB2  5  
ATOM 7225  H HB3  . TRP A 1 53  ? 6.514   -5.605  6.641   1.00 0.00 ? 56  TRP A HB3  5  
ATOM 7226  H HD1  . TRP A 1 53  ? 7.854   -6.244  10.115  1.00 0.00 ? 56  TRP A HD1  5  
ATOM 7227  H HE1  . TRP A 1 53  ? 7.977   -4.018  11.411  1.00 0.00 ? 56  TRP A HE1  5  
ATOM 7228  H HE3  . TRP A 1 53  ? 5.274   -3.267  6.855   1.00 0.00 ? 56  TRP A HE3  5  
ATOM 7229  H HZ2  . TRP A 1 53  ? 7.093   -1.359  11.084  1.00 0.00 ? 56  TRP A HZ2  5  
ATOM 7230  H HZ3  . TRP A 1 53  ? 4.960   -0.900  7.425   1.00 0.00 ? 56  TRP A HZ3  5  
ATOM 7231  H HH2  . TRP A 1 53  ? 5.849   0.034   9.489   1.00 0.00 ? 56  TRP A HH2  5  
ATOM 7232  N N    . HIS A 1 54  ? 3.684   -6.882  5.720   1.00 0.00 ? 57  HIS A N    5  
ATOM 7233  C CA   . HIS A 1 54  ? 3.259   -7.470  4.460   1.00 0.00 ? 57  HIS A CA   5  
ATOM 7234  C C    . HIS A 1 54  ? 3.028   -6.389  3.413   1.00 0.00 ? 57  HIS A C    5  
ATOM 7235  O O    . HIS A 1 54  ? 2.583   -5.286  3.733   1.00 0.00 ? 57  HIS A O    5  
ATOM 7236  C CB   . HIS A 1 54  ? 1.984   -8.295  4.651   1.00 0.00 ? 57  HIS A CB   5  
ATOM 7237  C CG   . HIS A 1 54  ? 2.241   -9.703  5.106   1.00 0.00 ? 57  HIS A CG   5  
ATOM 7238  N ND1  . HIS A 1 54  ? 2.052   -10.130 6.405   1.00 0.00 ? 57  HIS A ND1  5  
ATOM 7239  C CD2  . HIS A 1 54  ? 2.667   -10.788 4.416   1.00 0.00 ? 57  HIS A CD2  5  
ATOM 7240  C CE1  . HIS A 1 54  ? 2.352   -11.413 6.492   1.00 0.00 ? 57  HIS A CE1  5  
ATOM 7241  N NE2  . HIS A 1 54  ? 2.726   -11.835 5.299   1.00 0.00 ? 57  HIS A NE2  5  
ATOM 7242  H H    . HIS A 1 54  ? 3.250   -6.051  6.032   1.00 0.00 ? 57  HIS A H    5  
ATOM 7243  H HA   . HIS A 1 54  ? 4.051   -8.121  4.119   1.00 0.00 ? 57  HIS A HA   5  
ATOM 7244  H HB2  . HIS A 1 54  ? 1.365   -7.814  5.393   1.00 0.00 ? 57  HIS A HB2  5  
ATOM 7245  H HB3  . HIS A 1 54  ? 1.446   -8.336  3.713   1.00 0.00 ? 57  HIS A HB3  5  
ATOM 7246  H HD1  . HIS A 1 54  ? 1.747   -9.576  7.155   1.00 0.00 ? 57  HIS A HD1  5  
ATOM 7247  H HD2  . HIS A 1 54  ? 2.915   -10.823 3.364   1.00 0.00 ? 57  HIS A HD2  5  
ATOM 7248  H HE1  . HIS A 1 54  ? 2.301   -12.014 7.387   1.00 0.00 ? 57  HIS A HE1  5  
ATOM 7249  N N    . MET A 1 55  ? 3.333   -6.717  2.166   1.00 0.00 ? 58  MET A N    5  
ATOM 7250  C CA   . MET A 1 55  ? 3.191   -5.777  1.059   1.00 0.00 ? 58  MET A CA   5  
ATOM 7251  C C    . MET A 1 55  ? 1.733   -5.671  0.642   1.00 0.00 ? 58  MET A C    5  
ATOM 7252  O O    . MET A 1 55  ? 1.027   -6.675  0.582   1.00 0.00 ? 58  MET A O    5  
ATOM 7253  C CB   . MET A 1 55  ? 4.023   -6.231  -0.142  1.00 0.00 ? 58  MET A CB   5  
ATOM 7254  C CG   . MET A 1 55  ? 5.518   -6.299  0.119   1.00 0.00 ? 58  MET A CG   5  
ATOM 7255  S SD   . MET A 1 55  ? 6.430   -6.938  -1.302  1.00 0.00 ? 58  MET A SD   5  
ATOM 7256  C CE   . MET A 1 55  ? 5.911   -5.790  -2.576  1.00 0.00 ? 58  MET A CE   5  
ATOM 7257  H H    . MET A 1 55  ? 3.648   -7.626  1.978   1.00 0.00 ? 58  MET A H    5  
ATOM 7258  H HA   . MET A 1 55  ? 3.539   -4.814  1.392   1.00 0.00 ? 58  MET A HA   5  
ATOM 7259  H HB2  . MET A 1 55  ? 3.690   -7.213  -0.441  1.00 0.00 ? 58  MET A HB2  5  
ATOM 7260  H HB3  . MET A 1 55  ? 3.854   -5.544  -0.960  1.00 0.00 ? 58  MET A HB3  5  
ATOM 7261  H HG2  . MET A 1 55  ? 5.879   -5.307  0.345   1.00 0.00 ? 58  MET A HG2  5  
ATOM 7262  H HG3  . MET A 1 55  ? 5.693   -6.946  0.966   1.00 0.00 ? 58  MET A HG3  5  
ATOM 7263  H HE1  . MET A 1 55  ? 4.841   -5.867  -2.717  1.00 0.00 ? 58  MET A HE1  5  
ATOM 7264  H HE2  . MET A 1 55  ? 6.162   -4.783  -2.280  1.00 0.00 ? 58  MET A HE2  5  
ATOM 7265  H HE3  . MET A 1 55  ? 6.412   -6.029  -3.504  1.00 0.00 ? 58  MET A HE3  5  
ATOM 7266  N N    . VAL A 1 56  ? 1.285   -4.463  0.342   1.00 0.00 ? 59  VAL A N    5  
ATOM 7267  C CA   . VAL A 1 56  ? -0.092  -4.253  -0.078  1.00 0.00 ? 59  VAL A CA   5  
ATOM 7268  C C    . VAL A 1 56  ? -0.213  -4.409  -1.590  1.00 0.00 ? 59  VAL A C    5  
ATOM 7269  O O    . VAL A 1 56  ? 0.574   -3.843  -2.352  1.00 0.00 ? 59  VAL A O    5  
ATOM 7270  C CB   . VAL A 1 56  ? -0.620  -2.860  0.342   1.00 0.00 ? 59  VAL A CB   5  
ATOM 7271  C CG1  . VAL A 1 56  ? -2.066  -2.669  -0.097  1.00 0.00 ? 59  VAL A CG1  5  
ATOM 7272  C CG2  . VAL A 1 56  ? -0.499  -2.670  1.847   1.00 0.00 ? 59  VAL A CG2  5  
ATOM 7273  H H    . VAL A 1 56  ? 1.897   -3.694  0.392   1.00 0.00 ? 59  VAL A H    5  
ATOM 7274  H HA   . VAL A 1 56  ? -0.702  -5.006  0.400   1.00 0.00 ? 59  VAL A HA   5  
ATOM 7275  H HB   . VAL A 1 56  ? -0.017  -2.106  -0.145  1.00 0.00 ? 59  VAL A HB   5  
ATOM 7276  H HG11 . VAL A 1 56  ? -2.137  -2.790  -1.169  1.00 0.00 ? 59  VAL A HG11 5  
ATOM 7277  H HG12 . VAL A 1 56  ? -2.691  -3.403  0.391   1.00 0.00 ? 59  VAL A HG12 5  
ATOM 7278  H HG13 . VAL A 1 56  ? -2.395  -1.679  0.175   1.00 0.00 ? 59  VAL A HG13 5  
ATOM 7279  H HG21 . VAL A 1 56  ? -0.911  -1.709  2.122   1.00 0.00 ? 59  VAL A HG21 5  
ATOM 7280  H HG22 . VAL A 1 56  ? -1.045  -3.452  2.354   1.00 0.00 ? 59  VAL A HG22 5  
ATOM 7281  H HG23 . VAL A 1 56  ? 0.539   -2.711  2.135   1.00 0.00 ? 59  VAL A HG23 5  
ATOM 7282  N N    . CYS A 1 57  ? -1.184  -5.199  -2.013  1.00 0.00 ? 60  CYS A N    5  
ATOM 7283  C CA   . CYS A 1 57  ? -1.450  -5.403  -3.427  1.00 0.00 ? 60  CYS A CA   5  
ATOM 7284  C C    . CYS A 1 57  ? -2.452  -4.355  -3.897  1.00 0.00 ? 60  CYS A C    5  
ATOM 7285  O O    . CYS A 1 57  ? -3.427  -4.077  -3.199  1.00 0.00 ? 60  CYS A O    5  
ATOM 7286  C CB   . CYS A 1 57  ? -2.008  -6.816  -3.643  1.00 0.00 ? 60  CYS A CB   5  
ATOM 7287  S SG   . CYS A 1 57  ? -1.887  -7.441  -5.347  1.00 0.00 ? 60  CYS A SG   5  
ATOM 7288  H H    . CYS A 1 57  ? -1.747  -5.661  -1.350  1.00 0.00 ? 60  CYS A H    5  
ATOM 7289  H HA   . CYS A 1 57  ? -0.524  -5.289  -3.972  1.00 0.00 ? 60  CYS A HA   5  
ATOM 7290  H HB2  . CYS A 1 57  ? -1.473  -7.506  -3.007  1.00 0.00 ? 60  CYS A HB2  5  
ATOM 7291  H HB3  . CYS A 1 57  ? -3.054  -6.821  -3.369  1.00 0.00 ? 60  CYS A HB3  5  
ATOM 7292  N N    . SER A 1 58  ? -2.219  -3.767  -5.065  1.00 0.00 ? 61  SER A N    5  
ATOM 7293  C CA   . SER A 1 58  ? -3.078  -2.694  -5.563  1.00 0.00 ? 61  SER A CA   5  
ATOM 7294  C C    . SER A 1 58  ? -4.442  -3.217  -6.019  1.00 0.00 ? 61  SER A C    5  
ATOM 7295  O O    . SER A 1 58  ? -5.310  -2.441  -6.410  1.00 0.00 ? 61  SER A O    5  
ATOM 7296  C CB   . SER A 1 58  ? -2.377  -1.944  -6.696  1.00 0.00 ? 61  SER A CB   5  
ATOM 7297  O OG   . SER A 1 58  ? -1.738  -2.841  -7.588  1.00 0.00 ? 61  SER A OG   5  
ATOM 7298  H H    . SER A 1 58  ? -1.449  -4.055  -5.608  1.00 0.00 ? 61  SER A H    5  
ATOM 7299  H HA   . SER A 1 58  ? -3.238  -2.005  -4.746  1.00 0.00 ? 61  SER A HA   5  
ATOM 7300  H HB2  . SER A 1 58  ? -3.104  -1.366  -7.246  1.00 0.00 ? 61  SER A HB2  5  
ATOM 7301  H HB3  . SER A 1 58  ? -1.632  -1.282  -6.275  1.00 0.00 ? 61  SER A HB3  5  
ATOM 7302  H HG   . SER A 1 58  ? -0.791  -2.665  -7.589  1.00 0.00 ? 61  SER A HG   5  
ATOM 7303  N N    . GLN A 1 59  ? -4.630  -4.530  -5.951  1.00 0.00 ? 62  GLN A N    5  
ATOM 7304  C CA   . GLN A 1 59  ? -5.922  -5.143  -6.248  1.00 0.00 ? 62  GLN A CA   5  
ATOM 7305  C C    . GLN A 1 59  ? -6.710  -5.313  -4.943  1.00 0.00 ? 62  GLN A C    5  
ATOM 7306  O O    . GLN A 1 59  ? -7.385  -6.315  -4.710  1.00 0.00 ? 62  GLN A O    5  
ATOM 7307  C CB   . GLN A 1 59  ? -5.713  -6.486  -6.979  1.00 0.00 ? 62  GLN A CB   5  
ATOM 7308  C CG   . GLN A 1 59  ? -6.995  -7.216  -7.375  1.00 0.00 ? 62  GLN A CG   5  
ATOM 7309  C CD   . GLN A 1 59  ? -8.013  -6.319  -8.055  1.00 0.00 ? 62  GLN A CD   5  
ATOM 7310  O OE1  . GLN A 1 59  ? -8.859  -5.716  -7.396  1.00 0.00 ? 62  GLN A OE1  5  
ATOM 7311  N NE2  . GLN A 1 59  ? -7.957  -6.242  -9.375  1.00 0.00 ? 62  GLN A NE2  5  
ATOM 7312  H H    . GLN A 1 59  ? -3.883  -5.101  -5.684  1.00 0.00 ? 62  GLN A H    5  
ATOM 7313  H HA   . GLN A 1 59  ? -6.465  -4.469  -6.896  1.00 0.00 ? 62  GLN A HA   5  
ATOM 7314  H HB2  . GLN A 1 59  ? -5.145  -6.303  -7.879  1.00 0.00 ? 62  GLN A HB2  5  
ATOM 7315  H HB3  . GLN A 1 59  ? -5.141  -7.141  -6.337  1.00 0.00 ? 62  GLN A HB3  5  
ATOM 7316  H HG2  . GLN A 1 59  ? -6.741  -8.016  -8.052  1.00 0.00 ? 62  GLN A HG2  5  
ATOM 7317  H HG3  . GLN A 1 59  ? -7.445  -7.633  -6.486  1.00 0.00 ? 62  GLN A HG3  5  
ATOM 7318  H HE21 . GLN A 1 59  ? -7.274  -6.764  -9.843  1.00 0.00 ? 62  GLN A HE21 5  
ATOM 7319  H HE22 . GLN A 1 59  ? -8.607  -5.659  -9.831  1.00 0.00 ? 62  GLN A HE22 5  
ATOM 7320  N N    . SER A 1 60  ? -6.607  -4.316  -4.080  1.00 0.00 ? 63  SER A N    5  
ATOM 7321  C CA   . SER A 1 60  ? -7.316  -4.329  -2.815  1.00 0.00 ? 63  SER A CA   5  
ATOM 7322  C C    . SER A 1 60  ? -8.470  -3.337  -2.845  1.00 0.00 ? 63  SER A C    5  
ATOM 7323  O O    . SER A 1 60  ? -8.404  -2.324  -3.541  1.00 0.00 ? 63  SER A O    5  
ATOM 7324  C CB   . SER A 1 60  ? -6.363  -3.981  -1.668  1.00 0.00 ? 63  SER A CB   5  
ATOM 7325  O OG   . SER A 1 60  ? -5.336  -4.950  -1.548  1.00 0.00 ? 63  SER A OG   5  
ATOM 7326  H H    . SER A 1 60  ? -6.050  -3.545  -4.306  1.00 0.00 ? 63  SER A H    5  
ATOM 7327  H HA   . SER A 1 60  ? -7.705  -5.327  -2.665  1.00 0.00 ? 63  SER A HA   5  
ATOM 7328  H HB2  . SER A 1 60  ? -5.908  -3.020  -1.861  1.00 0.00 ? 63  SER A HB2  5  
ATOM 7329  H HB3  . SER A 1 60  ? -6.914  -3.936  -0.737  1.00 0.00 ? 63  SER A HB3  5  
ATOM 7330  H HG   . SER A 1 60  ? -4.594  -4.694  -2.114  1.00 0.00 ? 63  SER A HG   5  
ATOM 7331  N N    . TRP A 1 61  ? -9.521  -3.646  -2.090  1.00 0.00 ? 64  TRP A N    5  
ATOM 7332  C CA   . TRP A 1 61  ? -10.676 -2.760  -1.937  1.00 0.00 ? 64  TRP A CA   5  
ATOM 7333  C C    . TRP A 1 61  ? -11.377 -2.508  -3.273  1.00 0.00 ? 64  TRP A C    5  
ATOM 7334  O O    . TRP A 1 61  ? -12.024 -1.475  -3.462  1.00 0.00 ? 64  TRP A O    5  
ATOM 7335  C CB   . TRP A 1 61  ? -10.245 -1.427  -1.312  1.00 0.00 ? 64  TRP A CB   5  
ATOM 7336  C CG   . TRP A 1 61  ? -9.471  -1.589  -0.036  1.00 0.00 ? 64  TRP A CG   5  
ATOM 7337  C CD1  . TRP A 1 61  ? -9.930  -2.096  1.145   1.00 0.00 ? 64  TRP A CD1  5  
ATOM 7338  C CD2  . TRP A 1 61  ? -8.100  -1.238  0.187   1.00 0.00 ? 64  TRP A CD2  5  
ATOM 7339  N NE1  . TRP A 1 61  ? -8.932  -2.080  2.085   1.00 0.00 ? 64  TRP A NE1  5  
ATOM 7340  C CE2  . TRP A 1 61  ? -7.799  -1.559  1.522   1.00 0.00 ? 64  TRP A CE2  5  
ATOM 7341  C CE3  . TRP A 1 61  ? -7.098  -0.684  -0.615  1.00 0.00 ? 64  TRP A CE3  5  
ATOM 7342  C CZ2  . TRP A 1 61  ? -6.539  -1.346  2.073   1.00 0.00 ? 64  TRP A CZ2  5  
ATOM 7343  C CZ3  . TRP A 1 61  ? -5.847  -0.472  -0.065  1.00 0.00 ? 64  TRP A CZ3  5  
ATOM 7344  C CH2  . TRP A 1 61  ? -5.579  -0.802  1.265   1.00 0.00 ? 64  TRP A CH2  5  
ATOM 7345  H H    . TRP A 1 61  ? -9.514  -4.502  -1.606  1.00 0.00 ? 64  TRP A H    5  
ATOM 7346  H HA   . TRP A 1 61  ? -11.373 -3.245  -1.272  1.00 0.00 ? 64  TRP A HA   5  
ATOM 7347  H HB2  . TRP A 1 61  ? -9.617  -0.898  -2.015  1.00 0.00 ? 64  TRP A HB2  5  
ATOM 7348  H HB3  . TRP A 1 61  ? -11.124 -0.832  -1.100  1.00 0.00 ? 64  TRP A HB3  5  
ATOM 7349  H HD1  . TRP A 1 61  ? -10.937 -2.452  1.305   1.00 0.00 ? 64  TRP A HD1  5  
ATOM 7350  H HE1  . TRP A 1 61  ? -9.019  -2.396  3.019   1.00 0.00 ? 64  TRP A HE1  5  
ATOM 7351  H HE3  . TRP A 1 61  ? -7.287  -0.422  -1.646  1.00 0.00 ? 64  TRP A HE3  5  
ATOM 7352  H HZ2  . TRP A 1 61  ? -6.312  -1.594  3.099   1.00 0.00 ? 64  TRP A HZ2  5  
ATOM 7353  H HZ3  . TRP A 1 61  ? -5.060  -0.044  -0.667  1.00 0.00 ? 64  TRP A HZ3  5  
ATOM 7354  H HH2  . TRP A 1 61  ? -4.588  -0.618  1.652   1.00 0.00 ? 64  TRP A HH2  5  
ATOM 7355  N N    . GLY A 1 62  ? -11.251 -3.457  -4.191  1.00 0.00 ? 65  GLY A N    5  
ATOM 7356  C CA   . GLY A 1 62  ? -11.884 -3.321  -5.487  1.00 0.00 ? 65  GLY A CA   5  
ATOM 7357  C C    . GLY A 1 62  ? -11.231 -2.251  -6.338  1.00 0.00 ? 65  GLY A C    5  
ATOM 7358  O O    . GLY A 1 62  ? -11.845 -1.222  -6.635  1.00 0.00 ? 65  GLY A O    5  
ATOM 7359  H H    . GLY A 1 62  ? -10.718 -4.252  -3.989  1.00 0.00 ? 65  GLY A H    5  
ATOM 7360  H HA2  . GLY A 1 62  ? -11.828 -4.267  -6.007  1.00 0.00 ? 65  GLY A HA2  5  
ATOM 7361  H HA3  . GLY A 1 62  ? -12.922 -3.065  -5.342  1.00 0.00 ? 65  GLY A HA3  5  
ATOM 7362  N N    . ARG A 1 63  ? -9.984  -2.481  -6.727  1.00 0.00 ? 66  ARG A N    5  
ATOM 7363  C CA   . ARG A 1 63  ? -9.250  -1.519  -7.534  1.00 0.00 ? 66  ARG A CA   5  
ATOM 7364  C C    . ARG A 1 63  ? -8.618  -2.194  -8.742  1.00 0.00 ? 66  ARG A C    5  
ATOM 7365  O O    . ARG A 1 63  ? -7.948  -3.216  -8.620  1.00 0.00 ? 66  ARG A O    5  
ATOM 7366  C CB   . ARG A 1 63  ? -8.165  -0.832  -6.703  1.00 0.00 ? 66  ARG A CB   5  
ATOM 7367  C CG   . ARG A 1 63  ? -8.702  0.069   -5.604  1.00 0.00 ? 66  ARG A CG   5  
ATOM 7368  C CD   . ARG A 1 63  ? -9.556  1.195   -6.165  1.00 0.00 ? 66  ARG A CD   5  
ATOM 7369  N NE   . ARG A 1 63  ? -10.020 2.097   -5.116  1.00 0.00 ? 66  ARG A NE   5  
ATOM 7370  C CZ   . ARG A 1 63  ? -11.303 2.311   -4.839  1.00 0.00 ? 66  ARG A CZ   5  
ATOM 7371  N NH1  . ARG A 1 63  ? -12.247 1.693   -5.535  1.00 0.00 ? 66  ARG A NH1  5  
ATOM 7372  N NH2  . ARG A 1 63  ? -11.650 3.147   -3.875  1.00 0.00 ? 66  ARG A NH2  5  
ATOM 7373  H H    . ARG A 1 63  ? -9.547  -3.321  -6.473  1.00 0.00 ? 66  ARG A H    5  
ATOM 7374  H HA   . ARG A 1 63  ? -9.951  -0.777  -7.879  1.00 0.00 ? 66  ARG A HA   5  
ATOM 7375  H HB2  . ARG A 1 63  ? -7.548  -1.589  -6.246  1.00 0.00 ? 66  ARG A HB2  5  
ATOM 7376  H HB3  . ARG A 1 63  ? -7.553  -0.233  -7.362  1.00 0.00 ? 66  ARG A HB3  5  
ATOM 7377  H HG2  . ARG A 1 63  ? -9.303  -0.523  -4.929  1.00 0.00 ? 66  ARG A HG2  5  
ATOM 7378  H HG3  . ARG A 1 63  ? -7.870  0.497   -5.063  1.00 0.00 ? 66  ARG A HG3  5  
ATOM 7379  H HD2  . ARG A 1 63  ? -8.969  1.758   -6.877  1.00 0.00 ? 66  ARG A HD2  5  
ATOM 7380  H HD3  . ARG A 1 63  ? -10.414 0.771   -6.665  1.00 0.00 ? 66  ARG A HD3  5  
ATOM 7381  H HE   . ARG A 1 63  ? -9.338  2.571   -4.598  1.00 0.00 ? 66  ARG A HE   5  
ATOM 7382  H HH12 . ARG A 1 63  ? -12.174 0.704   -5.728  1.00 0.00 ? 66  ARG A HH12 5  
ATOM 7383  H HH21 . ARG A 1 63  ? -10.950 3.632   -3.351  1.00 0.00 ? 66  ARG A HH21 5  
ATOM 7384  H HH22 . ARG A 1 63  ? -12.627 3.296   -3.662  1.00 0.00 ? 66  ARG A HH22 5  
ATOM 7385  N N    . SER A 1 64  ? -8.850  -1.609  -9.905  1.00 0.00 ? 67  SER A N    5  
ATOM 7386  C CA   . SER A 1 64  ? -8.293  -2.103  -11.152 1.00 0.00 ? 67  SER A CA   5  
ATOM 7387  C C    . SER A 1 64  ? -6.787  -1.856  -11.205 1.00 0.00 ? 67  SER A C    5  
ATOM 7388  O O    . SER A 1 64  ? -6.262  -1.023  -10.466 1.00 0.00 ? 67  SER A O    5  
ATOM 7389  C CB   . SER A 1 64  ? -8.982  -1.391  -12.315 1.00 0.00 ? 67  SER A CB   5  
ATOM 7390  O OG   . SER A 1 64  ? -8.917  0.017   -12.148 1.00 0.00 ? 67  SER A OG   5  
ATOM 7391  H H    . SER A 1 64  ? -9.420  -0.815  -9.927  1.00 0.00 ? 67  SER A H    5  
ATOM 7392  H HA   . SER A 1 64  ? -8.485  -3.161  -11.218 1.00 0.00 ? 67  SER A HA   5  
ATOM 7393  H HB2  . SER A 1 64  ? -8.492  -1.655  -13.240 1.00 0.00 ? 67  SER A HB2  5  
ATOM 7394  H HB3  . SER A 1 64  ? -10.018 -1.689  -12.355 1.00 0.00 ? 67  SER A HB3  5  
ATOM 7395  H HG   . SER A 1 64  ? -8.183  0.235   -11.561 1.00 0.00 ? 67  SER A HG   5  
ATOM 7396  N N    . SER A 1 65  ? -6.099  -2.563  -12.094 1.00 0.00 ? 68  SER A N    5  
ATOM 7397  C CA   . SER A 1 65  ? -4.659  -2.401  -12.263 1.00 0.00 ? 68  SER A CA   5  
ATOM 7398  C C    . SER A 1 65  ? -4.342  -1.141  -13.069 1.00 0.00 ? 68  SER A C    5  
ATOM 7399  O O    . SER A 1 65  ? -3.564  -1.168  -14.027 1.00 0.00 ? 68  SER A O    5  
ATOM 7400  C CB   . SER A 1 65  ? -4.076  -3.643  -12.936 1.00 0.00 ? 68  SER A CB   5  
ATOM 7401  O OG   . SER A 1 65  ? -4.946  -4.133  -13.944 1.00 0.00 ? 68  SER A OG   5  
ATOM 7402  H H    . SER A 1 65  ? -6.574  -3.214  -12.659 1.00 0.00 ? 68  SER A H    5  
ATOM 7403  H HA   . SER A 1 65  ? -4.224  -2.298  -11.281 1.00 0.00 ? 68  SER A HA   5  
ATOM 7404  H HB2  . SER A 1 65  ? -3.126  -3.393  -13.388 1.00 0.00 ? 68  SER A HB2  5  
ATOM 7405  H HB3  . SER A 1 65  ? -3.930  -4.415  -12.196 1.00 0.00 ? 68  SER A HB3  5  
ATOM 7406  H HG   . SER A 1 65  ? -5.345  -4.967  -13.643 1.00 0.00 ? 68  SER A HG   5  
ATOM 7407  N N    . LYS A 1 66  ? -4.951  -0.041  -12.654 1.00 0.00 ? 69  LYS A N    5  
ATOM 7408  C CA   . LYS A 1 66  ? -4.799  1.249   -13.299 1.00 0.00 ? 69  LYS A CA   5  
ATOM 7409  C C    . LYS A 1 66  ? -4.893  2.333   -12.235 1.00 0.00 ? 69  LYS A C    5  
ATOM 7410  O O    . LYS A 1 66  ? -5.619  2.168   -11.258 1.00 0.00 ? 69  LYS A O    5  
ATOM 7411  C CB   . LYS A 1 66  ? -5.901  1.455   -14.350 1.00 0.00 ? 69  LYS A CB   5  
ATOM 7412  C CG   . LYS A 1 66  ? -5.836  0.477   -15.518 1.00 0.00 ? 69  LYS A CG   5  
ATOM 7413  C CD   . LYS A 1 66  ? -7.021  0.641   -16.458 1.00 0.00 ? 69  LYS A CD   5  
ATOM 7414  C CE   . LYS A 1 66  ? -8.338  0.329   -15.765 1.00 0.00 ? 69  LYS A CE   5  
ATOM 7415  N NZ   . LYS A 1 66  ? -9.491  0.402   -16.702 1.00 0.00 ? 69  LYS A NZ   5  
ATOM 7416  H H    . LYS A 1 66  ? -5.521  -0.096  -11.855 1.00 0.00 ? 69  LYS A H    5  
ATOM 7417  H HA   . LYS A 1 66  ? -3.829  1.286   -13.771 1.00 0.00 ? 69  LYS A HA   5  
ATOM 7418  H HB2  . LYS A 1 66  ? -6.863  1.343   -13.873 1.00 0.00 ? 69  LYS A HB2  5  
ATOM 7419  H HB3  . LYS A 1 66  ? -5.822  2.457   -14.745 1.00 0.00 ? 69  LYS A HB3  5  
ATOM 7420  H HG2  . LYS A 1 66  ? -4.928  0.654   -16.072 1.00 0.00 ? 69  LYS A HG2  5  
ATOM 7421  H HG3  . LYS A 1 66  ? -5.831  -0.532  -15.130 1.00 0.00 ? 69  LYS A HG3  5  
ATOM 7422  H HD2  . LYS A 1 66  ? -7.047  1.660   -16.813 1.00 0.00 ? 69  LYS A HD2  5  
ATOM 7423  H HD3  . LYS A 1 66  ? -6.898  -0.030  -17.295 1.00 0.00 ? 69  LYS A HD3  5  
ATOM 7424  H HE2  . LYS A 1 66  ? -8.287  -0.668  -15.353 1.00 0.00 ? 69  LYS A HE2  5  
ATOM 7425  H HE3  . LYS A 1 66  ? -8.488  1.041   -14.967 1.00 0.00 ? 69  LYS A HE3  5  
ATOM 7426  H HZ1  . LYS A 1 66  ? -9.559  1.367   -17.097 1.00 0.00 ? 69  LYS A HZ1  5  
ATOM 7427  H HZ3  . LYS A 1 66  ? -10.373 0.202   -16.177 1.00 0.00 ? 69  LYS A HZ3  5  
ATOM 7428  N N    . GLN A 1 67  ? -4.149  3.418   -12.414 1.00 0.00 ? 70  GLN A N    5  
ATOM 7429  C CA   . GLN A 1 67  ? -4.138  4.515   -11.448 1.00 0.00 ? 70  GLN A CA   5  
ATOM 7430  C C    . GLN A 1 67  ? -5.542  5.091   -11.262 1.00 0.00 ? 70  GLN A C    5  
ATOM 7431  O O    . GLN A 1 67  ? -6.162  5.561   -12.221 1.00 0.00 ? 70  GLN A O    5  
ATOM 7432  C CB   . GLN A 1 67  ? -3.174  5.613   -11.911 1.00 0.00 ? 70  GLN A CB   5  
ATOM 7433  C CG   . GLN A 1 67  ? -3.119  6.820   -10.985 1.00 0.00 ? 70  GLN A CG   5  
ATOM 7434  C CD   . GLN A 1 67  ? -2.115  7.857   -11.448 1.00 0.00 ? 70  GLN A CD   5  
ATOM 7435  O OE1  . GLN A 1 67  ? -0.953  7.844   -11.042 1.00 0.00 ? 70  GLN A OE1  5  
ATOM 7436  N NE2  . GLN A 1 67  ? -2.553  8.760   -12.310 1.00 0.00 ? 70  GLN A NE2  5  
ATOM 7437  H H    . GLN A 1 67  ? -3.589  3.485   -13.218 1.00 0.00 ? 70  GLN A H    5  
ATOM 7438  H HA   . GLN A 1 67  ? -3.792  4.119   -10.505 1.00 0.00 ? 70  GLN A HA   5  
ATOM 7439  H HB2  . GLN A 1 67  ? -2.181  5.196   -11.984 1.00 0.00 ? 70  GLN A HB2  5  
ATOM 7440  H HB3  . GLN A 1 67  ? -3.482  5.953   -12.889 1.00 0.00 ? 70  GLN A HB3  5  
ATOM 7441  H HG2  . GLN A 1 67  ? -4.096  7.276   -10.953 1.00 0.00 ? 70  GLN A HG2  5  
ATOM 7442  H HG3  . GLN A 1 67  ? -2.843  6.488   -9.996  1.00 0.00 ? 70  GLN A HG3  5  
ATOM 7443  H HE21 . GLN A 1 67  ? -3.487  8.710   -12.599 1.00 0.00 ? 70  GLN A HE21 5  
ATOM 7444  H HE22 . GLN A 1 67  ? -1.917  9.435   -12.636 1.00 0.00 ? 70  GLN A HE22 5  
ATOM 7445  N N    . TRP A 1 68  ? -6.039  5.042   -10.028 1.00 0.00 ? 71  TRP A N    5  
ATOM 7446  C CA   . TRP A 1 68  ? -7.377  5.530   -9.713  1.00 0.00 ? 71  TRP A CA   5  
ATOM 7447  C C    . TRP A 1 68  ? -7.352  6.991   -9.267  1.00 0.00 ? 71  TRP A C    5  
ATOM 7448  O O    . TRP A 1 68  ? -6.304  7.638   -9.260  1.00 0.00 ? 71  TRP A O    5  
ATOM 7449  C CB   . TRP A 1 68  ? -8.040  4.642   -8.651  1.00 0.00 ? 71  TRP A CB   5  
ATOM 7450  C CG   . TRP A 1 68  ? -7.135  4.240   -7.529  1.00 0.00 ? 71  TRP A CG   5  
ATOM 7451  C CD1  . TRP A 1 68  ? -6.872  4.944   -6.390  1.00 0.00 ? 71  TRP A CD1  5  
ATOM 7452  C CD2  . TRP A 1 68  ? -6.382  3.026   -7.435  1.00 0.00 ? 71  TRP A CD2  5  
ATOM 7453  N NE1  . TRP A 1 68  ? -5.999  4.241   -5.596  1.00 0.00 ? 71  TRP A NE1  5  
ATOM 7454  C CE2  . TRP A 1 68  ? -5.684  3.061   -6.217  1.00 0.00 ? 71  TRP A CE2  5  
ATOM 7455  C CE3  . TRP A 1 68  ? -6.230  1.912   -8.266  1.00 0.00 ? 71  TRP A CE3  5  
ATOM 7456  C CZ2  . TRP A 1 68  ? -4.849  2.025   -5.810  1.00 0.00 ? 71  TRP A CZ2  5  
ATOM 7457  C CZ3  . TRP A 1 68  ? -5.399  0.886   -7.860  1.00 0.00 ? 71  TRP A CZ3  5  
ATOM 7458  C CH2  . TRP A 1 68  ? -4.721  0.950   -6.641  1.00 0.00 ? 71  TRP A CH2  5  
ATOM 7459  H H    . TRP A 1 68  ? -5.489  4.670   -9.308  1.00 0.00 ? 71  TRP A H    5  
ATOM 7460  H HA   . TRP A 1 68  ? -7.960  5.470   -10.620 1.00 0.00 ? 71  TRP A HA   5  
ATOM 7461  H HB2  . TRP A 1 68  ? -8.876  5.175   -8.222  1.00 0.00 ? 71  TRP A HB2  5  
ATOM 7462  H HB3  . TRP A 1 68  ? -8.403  3.740   -9.124  1.00 0.00 ? 71  TRP A HB3  5  
ATOM 7463  H HD1  . TRP A 1 68  ? -7.293  5.911   -6.162  1.00 0.00 ? 71  TRP A HD1  5  
ATOM 7464  H HE1  . TRP A 1 68  ? -5.655  4.539   -4.729  1.00 0.00 ? 71  TRP A HE1  5  
ATOM 7465  H HE3  . TRP A 1 68  ? -6.747  1.846   -9.210  1.00 0.00 ? 71  TRP A HE3  5  
ATOM 7466  H HZ2  . TRP A 1 68  ? -4.317  2.056   -4.872  1.00 0.00 ? 71  TRP A HZ2  5  
ATOM 7467  H HZ3  . TRP A 1 68  ? -5.270  0.018   -8.486  1.00 0.00 ? 71  TRP A HZ3  5  
ATOM 7468  H HH2  . TRP A 1 68  ? -4.083  0.127   -6.364  1.00 0.00 ? 71  TRP A HH2  5  
ATOM 7469  N N    . GLU A 1 69  ? -8.526  7.486   -8.887  1.00 0.00 ? 72  GLU A N    5  
ATOM 7470  C CA   . GLU A 1 69  ? -8.792  8.922   -8.825  1.00 0.00 ? 72  GLU A CA   5  
ATOM 7471  C C    . GLU A 1 69  ? -8.307  9.584   -7.535  1.00 0.00 ? 72  GLU A C    5  
ATOM 7472  O O    . GLU A 1 69  ? -7.977  10.771  -7.543  1.00 0.00 ? 72  GLU A O    5  
ATOM 7473  C CB   . GLU A 1 69  ? -10.294 9.167   -8.984  1.00 0.00 ? 72  GLU A CB   5  
ATOM 7474  C CG   . GLU A 1 69  ? -10.870 8.642   -10.292 1.00 0.00 ? 72  GLU A CG   5  
ATOM 7475  C CD   . GLU A 1 69  ? -12.382 8.699   -10.321 1.00 0.00 ? 72  GLU A CD   5  
ATOM 7476  O OE1  . GLU A 1 69  ? -13.027 7.850   -9.668  1.00 0.00 ? 72  GLU A OE1  5  
ATOM 7477  O OE2  . GLU A 1 69  ? -12.934 9.587   -11.005 1.00 0.00 ? 72  GLU A OE2  5  
ATOM 7478  H H    . GLU A 1 69  ? -9.240  6.862   -8.625  1.00 0.00 ? 72  GLU A H    5  
ATOM 7479  H HA   . GLU A 1 69  ? -8.283  9.380   -9.657  1.00 0.00 ? 72  GLU A HA   5  
ATOM 7480  H HB2  . GLU A 1 69  ? -10.814 8.685   -8.171  1.00 0.00 ? 72  GLU A HB2  5  
ATOM 7481  H HB3  . GLU A 1 69  ? -10.478 10.229  -8.937  1.00 0.00 ? 72  GLU A HB3  5  
ATOM 7482  H HG2  . GLU A 1 69  ? -10.487 9.239   -11.105 1.00 0.00 ? 72  GLU A HG2  5  
ATOM 7483  H HG3  . GLU A 1 69  ? -10.560 7.616   -10.423 1.00 0.00 ? 72  GLU A HG3  5  
ATOM 7484  N N    . ASP A 1 70  ? -8.277  8.846   -6.434  1.00 0.00 ? 73  ASP A N    5  
ATOM 7485  C CA   . ASP A 1 70  ? -7.930  9.444   -5.148  1.00 0.00 ? 73  ASP A CA   5  
ATOM 7486  C C    . ASP A 1 70  ? -6.783  8.702   -4.474  1.00 0.00 ? 73  ASP A C    5  
ATOM 7487  O O    . ASP A 1 70  ? -6.990  7.689   -3.803  1.00 0.00 ? 73  ASP A O    5  
ATOM 7488  C CB   . ASP A 1 70  ? -9.147  9.480   -4.220  1.00 0.00 ? 73  ASP A CB   5  
ATOM 7489  C CG   . ASP A 1 70  ? -8.839  10.137  -2.888  1.00 0.00 ? 73  ASP A CG   5  
ATOM 7490  O OD1  . ASP A 1 70  ? -7.973  11.038  -2.843  1.00 0.00 ? 73  ASP A OD1  5  
ATOM 7491  O OD2  . ASP A 1 70  ? -9.476  9.767   -1.880  1.00 0.00 ? 73  ASP A OD2  5  
ATOM 7492  H H    . ASP A 1 70  ? -8.480  7.889   -6.484  1.00 0.00 ? 73  ASP A H    5  
ATOM 7493  H HA   . ASP A 1 70  ? -7.615  10.460  -5.338  1.00 0.00 ? 73  ASP A HA   5  
ATOM 7494  H HB2  . ASP A 1 70  ? -9.943  10.033  -4.699  1.00 0.00 ? 73  ASP A HB2  5  
ATOM 7495  H HB3  . ASP A 1 70  ? -9.478  8.467   -4.034  1.00 0.00 ? 73  ASP A HB3  5  
ATOM 7496  N N    . PRO A 1 71  ? -5.549  9.190   -4.662  1.00 0.00 ? 74  PRO A N    5  
ATOM 7497  C CA   . PRO A 1 71  ? -4.373  8.634   -4.018  1.00 0.00 ? 74  PRO A CA   5  
ATOM 7498  C C    . PRO A 1 71  ? -4.013  9.358   -2.717  1.00 0.00 ? 74  PRO A C    5  
ATOM 7499  O O    . PRO A 1 71  ? -3.102  8.949   -1.994  1.00 0.00 ? 74  PRO A O    5  
ATOM 7500  C CB   . PRO A 1 71  ? -3.298  8.863   -5.074  1.00 0.00 ? 74  PRO A CB   5  
ATOM 7501  C CG   . PRO A 1 71  ? -3.699  10.125  -5.770  1.00 0.00 ? 74  PRO A CG   5  
ATOM 7502  C CD   . PRO A 1 71  ? -5.187  10.301  -5.560  1.00 0.00 ? 74  PRO A CD   5  
ATOM 7503  H HA   . PRO A 1 71  ? -4.482  7.580   -3.829  1.00 0.00 ? 74  PRO A HA   5  
ATOM 7504  H HB2  . PRO A 1 71  ? -2.336  8.966   -4.594  1.00 0.00 ? 74  PRO A HB2  5  
ATOM 7505  H HB3  . PRO A 1 71  ? -3.276  8.028   -5.757  1.00 0.00 ? 74  PRO A HB3  5  
ATOM 7506  H HG2  . PRO A 1 71  ? -3.166  10.960  -5.342  1.00 0.00 ? 74  PRO A HG2  5  
ATOM 7507  H HG3  . PRO A 1 71  ? -3.481  10.044  -6.824  1.00 0.00 ? 74  PRO A HG3  5  
ATOM 7508  H HD2  . PRO A 1 71  ? -5.388  11.254  -5.091  1.00 0.00 ? 74  PRO A HD2  5  
ATOM 7509  H HD3  . PRO A 1 71  ? -5.712  10.223  -6.501  1.00 0.00 ? 74  PRO A HD3  5  
ATOM 7510  N N    . SER A 1 72  ? -4.751  10.421  -2.415  1.00 0.00 ? 75  SER A N    5  
ATOM 7511  C CA   . SER A 1 72  ? -4.437  11.286  -1.283  1.00 0.00 ? 75  SER A CA   5  
ATOM 7512  C C    . SER A 1 72  ? -4.750  10.626  0.061   1.00 0.00 ? 75  SER A C    5  
ATOM 7513  O O    . SER A 1 72  ? -4.446  11.182  1.119   1.00 0.00 ? 75  SER A O    5  
ATOM 7514  C CB   . SER A 1 72  ? -5.202  12.599  -1.411  1.00 0.00 ? 75  SER A CB   5  
ATOM 7515  O OG   . SER A 1 72  ? -4.965  13.198  -2.672  1.00 0.00 ? 75  SER A OG   5  
ATOM 7516  H H    . SER A 1 72  ? -5.525  10.640  -2.977  1.00 0.00 ? 75  SER A H    5  
ATOM 7517  H HA   . SER A 1 72  ? -3.379  11.499  -1.320  1.00 0.00 ? 75  SER A HA   5  
ATOM 7518  H HB2  . SER A 1 72  ? -6.260  12.410  -1.306  1.00 0.00 ? 75  SER A HB2  5  
ATOM 7519  H HB3  . SER A 1 72  ? -4.878  13.279  -0.636  1.00 0.00 ? 75  SER A HB3  5  
ATOM 7520  H HG   . SER A 1 72  ? -5.257  14.122  -2.645  1.00 0.00 ? 75  SER A HG   5  
ATOM 7521  N N    . GLN A 1 73  ? -5.334  9.434   0.019   1.00 0.00 ? 76  GLN A N    5  
ATOM 7522  C CA   . GLN A 1 73  ? -5.649  8.687   1.234   1.00 0.00 ? 76  GLN A CA   5  
ATOM 7523  C C    . GLN A 1 73  ? -4.375  8.333   2.001   1.00 0.00 ? 76  GLN A C    5  
ATOM 7524  O O    . GLN A 1 73  ? -4.409  8.048   3.199   1.00 0.00 ? 76  GLN A O    5  
ATOM 7525  C CB   . GLN A 1 73  ? -6.406  7.405   0.879   1.00 0.00 ? 76  GLN A CB   5  
ATOM 7526  C CG   . GLN A 1 73  ? -7.756  7.646   0.225   1.00 0.00 ? 76  GLN A CG   5  
ATOM 7527  C CD   . GLN A 1 73  ? -8.778  8.244   1.173   1.00 0.00 ? 76  GLN A CD   5  
ATOM 7528  O OE1  . GLN A 1 73  ? -8.760  7.987   2.378   1.00 0.00 ? 76  GLN A OE1  5  
ATOM 7529  N NE2  . GLN A 1 73  ? -9.679  9.041   0.630   1.00 0.00 ? 76  GLN A NE2  5  
ATOM 7530  H H    . GLN A 1 73  ? -5.559  9.046   -0.850  1.00 0.00 ? 76  GLN A H    5  
ATOM 7531  H HA   . GLN A 1 73  ? -6.275  9.309   1.857   1.00 0.00 ? 76  GLN A HA   5  
ATOM 7532  H HB2  . GLN A 1 73  ? -5.802  6.822   0.198   1.00 0.00 ? 76  GLN A HB2  5  
ATOM 7533  H HB3  . GLN A 1 73  ? -6.565  6.836   1.782   1.00 0.00 ? 76  GLN A HB3  5  
ATOM 7534  H HG2  . GLN A 1 73  ? -7.622  8.322   -0.605  1.00 0.00 ? 76  GLN A HG2  5  
ATOM 7535  H HG3  . GLN A 1 73  ? -8.136  6.704   -0.140  1.00 0.00 ? 76  GLN A HG3  5  
ATOM 7536  H HE21 . GLN A 1 73  ? -9.635  9.199   -0.350  1.00 0.00 ? 76  GLN A HE21 5  
ATOM 7537  H HE22 . GLN A 1 73  ? -10.356 9.451   1.215   1.00 0.00 ? 76  GLN A HE22 5  
ATOM 7538  N N    . ALA A 1 74  ? -3.246  8.380   1.305   1.00 0.00 ? 77  ALA A N    5  
ATOM 7539  C CA   . ALA A 1 74  ? -1.977  7.971   1.885   1.00 0.00 ? 77  ALA A CA   5  
ATOM 7540  C C    . ALA A 1 74  ? -1.156  9.164   2.362   1.00 0.00 ? 77  ALA A C    5  
ATOM 7541  O O    . ALA A 1 74  ? 0.025   9.018   2.675   1.00 0.00 ? 77  ALA A O    5  
ATOM 7542  C CB   . ALA A 1 74  ? -1.181  7.160   0.876   1.00 0.00 ? 77  ALA A CB   5  
ATOM 7543  H H    . ALA A 1 74  ? -3.269  8.702   0.378   1.00 0.00 ? 77  ALA A H    5  
ATOM 7544  H HA   . ALA A 1 74  ? -2.193  7.336   2.730   1.00 0.00 ? 77  ALA A HA   5  
ATOM 7545  H HB1  . ALA A 1 74  ? -0.947  7.779   0.023   1.00 0.00 ? 77  ALA A HB1  5  
ATOM 7546  H HB2  . ALA A 1 74  ? -0.264  6.815   1.332   1.00 0.00 ? 77  ALA A HB2  5  
ATOM 7547  H HB3  . ALA A 1 74  ? -1.765  6.310   0.554   1.00 0.00 ? 77  ALA A HB3  5  
ATOM 7548  N N    . SER A 1 75  ? -1.780  10.338  2.424   1.00 0.00 ? 78  SER A N    5  
ATOM 7549  C CA   . SER A 1 75  ? -1.092  11.552  2.872   1.00 0.00 ? 78  SER A CA   5  
ATOM 7550  C C    . SER A 1 75  ? -0.443  11.352  4.242   1.00 0.00 ? 78  SER A C    5  
ATOM 7551  O O    . SER A 1 75  ? 0.721   11.699  4.443   1.00 0.00 ? 78  SER A O    5  
ATOM 7552  C CB   . SER A 1 75  ? -2.063  12.731  2.924   1.00 0.00 ? 78  SER A CB   5  
ATOM 7553  O OG   . SER A 1 75  ? -2.569  13.030  1.635   1.00 0.00 ? 78  SER A OG   5  
ATOM 7554  H H    . SER A 1 75  ? -2.723  10.393  2.150   1.00 0.00 ? 78  SER A H    5  
ATOM 7555  H HA   . SER A 1 75  ? -0.317  11.772  2.153   1.00 0.00 ? 78  SER A HA   5  
ATOM 7556  H HB2  . SER A 1 75  ? -2.890  12.487  3.575   1.00 0.00 ? 78  SER A HB2  5  
ATOM 7557  H HB3  . SER A 1 75  ? -1.548  13.600  3.306   1.00 0.00 ? 78  SER A HB3  5  
ATOM 7558  H HG   . SER A 1 75  ? -3.397  12.549  1.495   1.00 0.00 ? 78  SER A HG   5  
ATOM 7559  N N    . LYS A 1 76  ? -1.194  10.770  5.172   1.00 0.00 ? 79  LYS A N    5  
ATOM 7560  C CA   . LYS A 1 76  ? -0.686  10.505  6.513   1.00 0.00 ? 79  LYS A CA   5  
ATOM 7561  C C    . LYS A 1 76  ? 0.478   9.519   6.481   1.00 0.00 ? 79  LYS A C    5  
ATOM 7562  O O    . LYS A 1 76  ? 1.416   9.641   7.263   1.00 0.00 ? 79  LYS A O    5  
ATOM 7563  C CB   . LYS A 1 76  ? -1.807  9.979   7.415   1.00 0.00 ? 79  LYS A CB   5  
ATOM 7564  C CG   . LYS A 1 76  ? -2.789  11.057  7.852   1.00 0.00 ? 79  LYS A CG   5  
ATOM 7565  C CD   . LYS A 1 76  ? -4.031  10.468  8.505   1.00 0.00 ? 79  LYS A CD   5  
ATOM 7566  C CE   . LYS A 1 76  ? -5.124  10.174  7.486   1.00 0.00 ? 79  LYS A CE   5  
ATOM 7567  N NZ   . LYS A 1 76  ? -4.700  9.177   6.463   1.00 0.00 ? 79  LYS A NZ   5  
ATOM 7568  H H    . LYS A 1 76  ? -2.115  10.524  4.954   1.00 0.00 ? 79  LYS A H    5  
ATOM 7569  H HA   . LYS A 1 76  ? -0.326  11.439  6.915   1.00 0.00 ? 79  LYS A HA   5  
ATOM 7570  H HB2  . LYS A 1 76  ? -2.355  9.217   6.884   1.00 0.00 ? 79  LYS A HB2  5  
ATOM 7571  H HB3  . LYS A 1 76  ? -1.367  9.545   8.301   1.00 0.00 ? 79  LYS A HB3  5  
ATOM 7572  H HG2  . LYS A 1 76  ? -2.302  11.707  8.563   1.00 0.00 ? 79  LYS A HG2  5  
ATOM 7573  H HG3  . LYS A 1 76  ? -3.086  11.629  6.985   1.00 0.00 ? 79  LYS A HG3  5  
ATOM 7574  H HD2  . LYS A 1 76  ? -3.762  9.548   9.000   1.00 0.00 ? 79  LYS A HD2  5  
ATOM 7575  H HD3  . LYS A 1 76  ? -4.409  11.173  9.232   1.00 0.00 ? 79  LYS A HD3  5  
ATOM 7576  H HE2  . LYS A 1 76  ? -5.987  9.789   8.007   1.00 0.00 ? 79  LYS A HE2  5  
ATOM 7577  H HE3  . LYS A 1 76  ? -5.389  11.097  6.989   1.00 0.00 ? 79  LYS A HE3  5  
ATOM 7578  H HZ1  . LYS A 1 76  ? -5.381  9.189   5.669   1.00 0.00 ? 79  LYS A HZ1  5  
ATOM 7579  H HZ3  . LYS A 1 76  ? -4.714  8.223   6.886   1.00 0.00 ? 79  LYS A HZ3  5  
ATOM 7580  N N    . VAL A 1 77  ? 0.428   8.556   5.566   1.00 0.00 ? 80  VAL A N    5  
ATOM 7581  C CA   . VAL A 1 77  ? 1.516   7.596   5.415   1.00 0.00 ? 80  VAL A CA   5  
ATOM 7582  C C    . VAL A 1 77  ? 2.771   8.308   4.923   1.00 0.00 ? 80  VAL A C    5  
ATOM 7583  O O    . VAL A 1 77  ? 3.847   8.154   5.499   1.00 0.00 ? 80  VAL A O    5  
ATOM 7584  C CB   . VAL A 1 77  ? 1.150   6.453   4.437   1.00 0.00 ? 80  VAL A CB   5  
ATOM 7585  C CG1  . VAL A 1 77  ? 2.349   5.543   4.195   1.00 0.00 ? 80  VAL A CG1  5  
ATOM 7586  C CG2  . VAL A 1 77  ? -0.028  5.645   4.967   1.00 0.00 ? 80  VAL A CG2  5  
ATOM 7587  H H    . VAL A 1 77  ? -0.346  8.499   4.970   1.00 0.00 ? 80  VAL A H    5  
ATOM 7588  H HA   . VAL A 1 77  ? 1.719   7.166   6.386   1.00 0.00 ? 80  VAL A HA   5  
ATOM 7589  H HB   . VAL A 1 77  ? 0.863   6.891   3.492   1.00 0.00 ? 80  VAL A HB   5  
ATOM 7590  H HG11 . VAL A 1 77  ? 2.072   4.756   3.510   1.00 0.00 ? 80  VAL A HG11 5  
ATOM 7591  H HG12 . VAL A 1 77  ? 3.157   6.122   3.769   1.00 0.00 ? 80  VAL A HG12 5  
ATOM 7592  H HG13 . VAL A 1 77  ? 2.671   5.111   5.130   1.00 0.00 ? 80  VAL A HG13 5  
ATOM 7593  H HG21 . VAL A 1 77  ? 0.238   5.191   5.910   1.00 0.00 ? 80  VAL A HG21 5  
ATOM 7594  H HG22 . VAL A 1 77  ? -0.877  6.296   5.111   1.00 0.00 ? 80  VAL A HG22 5  
ATOM 7595  H HG23 . VAL A 1 77  ? -0.283  4.873   4.256   1.00 0.00 ? 80  VAL A HG23 5  
ATOM 7596  N N    . CYS A 1 78  ? 2.612   9.105   3.872   1.00 0.00 ? 81  CYS A N    5  
ATOM 7597  C CA   . CYS A 1 78  ? 3.708   9.905   3.345   1.00 0.00 ? 81  CYS A CA   5  
ATOM 7598  C C    . CYS A 1 78  ? 4.297   10.790  4.442   1.00 0.00 ? 81  CYS A C    5  
ATOM 7599  O O    . CYS A 1 78  ? 5.515   10.902  4.579   1.00 0.00 ? 81  CYS A O    5  
ATOM 7600  C CB   . CYS A 1 78  ? 3.216   10.778  2.185   1.00 0.00 ? 81  CYS A CB   5  
ATOM 7601  S SG   . CYS A 1 78  ? 2.523   9.851   0.773   1.00 0.00 ? 81  CYS A SG   5  
ATOM 7602  H H    . CYS A 1 78  ? 1.731   9.149   3.430   1.00 0.00 ? 81  CYS A H    5  
ATOM 7603  H HA   . CYS A 1 78  ? 4.474   9.230   2.986   1.00 0.00 ? 81  CYS A HA   5  
ATOM 7604  H HB2  . CYS A 1 78  ? 2.441   11.436  2.551   1.00 0.00 ? 81  CYS A HB2  5  
ATOM 7605  H HB3  . CYS A 1 78  ? 4.035   11.374  1.820   1.00 0.00 ? 81  CYS A HB3  5  
ATOM 7606  N N    . GLN A 1 79  ? 3.418   11.392  5.237   1.00 0.00 ? 82  GLN A N    5  
ATOM 7607  C CA   . GLN A 1 79  ? 3.830   12.280  6.319   1.00 0.00 ? 82  GLN A CA   5  
ATOM 7608  C C    . GLN A 1 79  ? 4.694   11.543  7.341   1.00 0.00 ? 82  GLN A C    5  
ATOM 7609  O O    . GLN A 1 79  ? 5.684   12.083  7.831   1.00 0.00 ? 82  GLN A O    5  
ATOM 7610  C CB   . GLN A 1 79  ? 2.597   12.873  7.005   1.00 0.00 ? 82  GLN A CB   5  
ATOM 7611  C CG   . GLN A 1 79  ? 2.926   13.941  8.036   1.00 0.00 ? 82  GLN A CG   5  
ATOM 7612  C CD   . GLN A 1 79  ? 3.612   15.151  7.424   1.00 0.00 ? 82  GLN A CD   5  
ATOM 7613  O OE1  . GLN A 1 79  ? 4.439   15.798  8.064   1.00 0.00 ? 82  GLN A OE1  5  
ATOM 7614  N NE2  . GLN A 1 79  ? 3.256   15.480  6.193   1.00 0.00 ? 82  GLN A NE2  5  
ATOM 7615  H H    . GLN A 1 79  ? 2.459   11.246  5.084   1.00 0.00 ? 82  GLN A H    5  
ATOM 7616  H HA   . GLN A 1 79  ? 4.409   13.081  5.888   1.00 0.00 ? 82  GLN A HA   5  
ATOM 7617  H HB2  . GLN A 1 79  ? 1.958   13.313  6.254   1.00 0.00 ? 82  GLN A HB2  5  
ATOM 7618  H HB3  . GLN A 1 79  ? 2.059   12.078  7.501   1.00 0.00 ? 82  GLN A HB3  5  
ATOM 7619  H HG2  . GLN A 1 79  ? 2.008   14.266  8.504   1.00 0.00 ? 82  GLN A HG2  5  
ATOM 7620  H HG3  . GLN A 1 79  ? 3.578   13.514  8.783   1.00 0.00 ? 82  GLN A HG3  5  
ATOM 7621  H HE21 . GLN A 1 79  ? 2.568   14.937  5.748   1.00 0.00 ? 82  GLN A HE21 5  
ATOM 7622  H HE22 . GLN A 1 79  ? 3.696   16.251  5.769   1.00 0.00 ? 82  GLN A HE22 5  
ATOM 7623  N N    . ARG A 1 80  ? 4.332   10.298  7.636   1.00 0.00 ? 83  ARG A N    5  
ATOM 7624  C CA   . ARG A 1 80  ? 5.057   9.502   8.627   1.00 0.00 ? 83  ARG A CA   5  
ATOM 7625  C C    . ARG A 1 80  ? 6.458   9.149   8.136   1.00 0.00 ? 83  ARG A C    5  
ATOM 7626  O O    . ARG A 1 80  ? 7.328   8.797   8.927   1.00 0.00 ? 83  ARG A O    5  
ATOM 7627  C CB   . ARG A 1 80  ? 4.294   8.217   8.965   1.00 0.00 ? 83  ARG A CB   5  
ATOM 7628  C CG   . ARG A 1 80  ? 2.942   8.440   9.630   1.00 0.00 ? 83  ARG A CG   5  
ATOM 7629  C CD   . ARG A 1 80  ? 3.063   9.211   10.939  1.00 0.00 ? 83  ARG A CD   5  
ATOM 7630  N NE   . ARG A 1 80  ? 3.930   8.536   11.903  1.00 0.00 ? 83  ARG A NE   5  
ATOM 7631  C CZ   . ARG A 1 80  ? 3.915   8.789   13.208  1.00 0.00 ? 83  ARG A CZ   5  
ATOM 7632  N NH1  . ARG A 1 80  ? 3.081   9.696   13.692  1.00 0.00 ? 83  ARG A NH1  5  
ATOM 7633  N NH2  . ARG A 1 80  ? 4.727   8.145   14.032  1.00 0.00 ? 83  ARG A NH2  5  
ATOM 7634  H H    . ARG A 1 80  ? 3.558   9.904   7.176   1.00 0.00 ? 83  ARG A H    5  
ATOM 7635  H HA   . ARG A 1 80  ? 5.151   10.098  9.519   1.00 0.00 ? 83  ARG A HA   5  
ATOM 7636  H HB2  . ARG A 1 80  ? 4.130   7.663   8.054   1.00 0.00 ? 83  ARG A HB2  5  
ATOM 7637  H HB3  . ARG A 1 80  ? 4.900   7.621   9.631   1.00 0.00 ? 83  ARG A HB3  5  
ATOM 7638  H HG2  . ARG A 1 80  ? 2.310   8.997   8.958   1.00 0.00 ? 83  ARG A HG2  5  
ATOM 7639  H HG3  . ARG A 1 80  ? 2.492   7.477   9.834   1.00 0.00 ? 83  ARG A HG3  5  
ATOM 7640  H HD2  . ARG A 1 80  ? 3.463   10.191  10.731  1.00 0.00 ? 83  ARG A HD2  5  
ATOM 7641  H HD3  . ARG A 1 80  ? 2.078   9.314   11.370  1.00 0.00 ? 83  ARG A HD3  5  
ATOM 7642  H HE   . ARG A 1 80  ? 4.565   7.864   11.555  1.00 0.00 ? 83  ARG A HE   5  
ATOM 7643  H HH12 . ARG A 1 80  ? 2.367   9.428   14.358  1.00 0.00 ? 83  ARG A HH12 5  
ATOM 7644  H HH21 . ARG A 1 80  ? 5.369   7.455   13.678  1.00 0.00 ? 83  ARG A HH21 5  
ATOM 7645  H HH22 . ARG A 1 80  ? 4.714   8.351   15.012  1.00 0.00 ? 83  ARG A HH22 5  
ATOM 7646  N N    . LEU A 1 81  ? 6.669   9.231   6.832   1.00 0.00 ? 84  LEU A N    5  
ATOM 7647  C CA   . LEU A 1 81  ? 7.987   8.983   6.262   1.00 0.00 ? 84  LEU A CA   5  
ATOM 7648  C C    . LEU A 1 81  ? 8.710   10.294  5.970   1.00 0.00 ? 84  LEU A C    5  
ATOM 7649  O O    . LEU A 1 81  ? 9.769   10.300  5.340   1.00 0.00 ? 84  LEU A O    5  
ATOM 7650  C CB   . LEU A 1 81  ? 7.884   8.147   4.982   1.00 0.00 ? 84  LEU A CB   5  
ATOM 7651  C CG   . LEU A 1 81  ? 7.765   6.631   5.186   1.00 0.00 ? 84  LEU A CG   5  
ATOM 7652  C CD1  . LEU A 1 81  ? 6.449   6.257   5.851   1.00 0.00 ? 84  LEU A CD1  5  
ATOM 7653  C CD2  . LEU A 1 81  ? 7.911   5.908   3.859   1.00 0.00 ? 84  LEU A CD2  5  
ATOM 7654  H H    . LEU A 1 81  ? 5.920   9.453   6.235   1.00 0.00 ? 84  LEU A H    5  
ATOM 7655  H HA   . LEU A 1 81  ? 8.558   8.429   6.992   1.00 0.00 ? 84  LEU A HA   5  
ATOM 7656  H HB2  . LEU A 1 81  ? 7.017   8.484   4.432   1.00 0.00 ? 84  LEU A HB2  5  
ATOM 7657  H HB3  . LEU A 1 81  ? 8.762   8.339   4.385   1.00 0.00 ? 84  LEU A HB3  5  
ATOM 7658  H HG   . LEU A 1 81  ? 8.566   6.301   5.833   1.00 0.00 ? 84  LEU A HG   5  
ATOM 7659  H HD11 . LEU A 1 81  ? 6.371   6.757   6.805   1.00 0.00 ? 84  LEU A HD11 5  
ATOM 7660  H HD12 . LEU A 1 81  ? 5.628   6.558   5.218   1.00 0.00 ? 84  LEU A HD12 5  
ATOM 7661  H HD13 . LEU A 1 81  ? 6.412   5.188   6.001   1.00 0.00 ? 84  LEU A HD13 5  
ATOM 7662  H HD21 . LEU A 1 81  ? 8.882   6.122   3.437   1.00 0.00 ? 84  LEU A HD21 5  
ATOM 7663  H HD22 . LEU A 1 81  ? 7.812   4.845   4.015   1.00 0.00 ? 84  LEU A HD22 5  
ATOM 7664  H HD23 . LEU A 1 81  ? 7.142   6.246   3.179   1.00 0.00 ? 84  LEU A HD23 5  
ATOM 7665  N N    . ASN A 1 82  ? 8.135   11.398  6.453   1.00 0.00 ? 85  ASN A N    5  
ATOM 7666  C CA   . ASN A 1 82  ? 8.666   12.742  6.213   1.00 0.00 ? 85  ASN A CA   5  
ATOM 7667  C C    . ASN A 1 82  ? 8.636   13.083  4.730   1.00 0.00 ? 85  ASN A C    5  
ATOM 7668  O O    . ASN A 1 82  ? 9.572   13.678  4.189   1.00 0.00 ? 85  ASN A O    5  
ATOM 7669  C CB   . ASN A 1 82  ? 10.085  12.896  6.773   1.00 0.00 ? 85  ASN A CB   5  
ATOM 7670  C CG   . ASN A 1 82  ? 10.107  12.970  8.287   1.00 0.00 ? 85  ASN A CG   5  
ATOM 7671  O OD1  . ASN A 1 82  ? 10.240  11.955  8.973   1.00 0.00 ? 85  ASN A OD1  5  
ATOM 7672  N ND2  . ASN A 1 82  ? 9.980   14.177  8.819   1.00 0.00 ? 85  ASN A ND2  5  
ATOM 7673  H H    . ASN A 1 82  ? 7.322   11.306  6.999   1.00 0.00 ? 85  ASN A H    5  
ATOM 7674  H HA   . ASN A 1 82  ? 8.018   13.435  6.729   1.00 0.00 ? 85  ASN A HA   5  
ATOM 7675  H HB2  . ASN A 1 82  ? 10.680  12.050  6.465   1.00 0.00 ? 85  ASN A HB2  5  
ATOM 7676  H HB3  . ASN A 1 82  ? 10.525  13.800  6.379   1.00 0.00 ? 85  ASN A HB3  5  
ATOM 7677  H HD21 . ASN A 1 82  ? 9.882   14.946  8.214   1.00 0.00 ? 85  ASN A HD21 5  
ATOM 7678  H HD22 . ASN A 1 82  ? 9.977   14.254  9.799   1.00 0.00 ? 85  ASN A HD22 5  
ATOM 7679  N N    . CYS A 1 83  ? 7.550   12.703  4.082   1.00 0.00 ? 86  CYS A N    5  
ATOM 7680  C CA   . CYS A 1 83  ? 7.336   13.011  2.681   1.00 0.00 ? 86  CYS A CA   5  
ATOM 7681  C C    . CYS A 1 83  ? 6.083   13.869  2.533   1.00 0.00 ? 86  CYS A C    5  
ATOM 7682  O O    . CYS A 1 83  ? 5.310   14.019  3.483   1.00 0.00 ? 86  CYS A O    5  
ATOM 7683  C CB   . CYS A 1 83  ? 7.206   11.716  1.874   1.00 0.00 ? 86  CYS A CB   5  
ATOM 7684  S SG   . CYS A 1 83  ? 8.663   10.625  1.970   1.00 0.00 ? 86  CYS A SG   5  
ATOM 7685  H H    . CYS A 1 83  ? 6.860   12.197  4.561   1.00 0.00 ? 86  CYS A H    5  
ATOM 7686  H HA   . CYS A 1 83  ? 8.190   13.570  2.327   1.00 0.00 ? 86  CYS A HA   5  
ATOM 7687  H HB2  . CYS A 1 83  ? 6.359   11.159  2.244   1.00 0.00 ? 86  CYS A HB2  5  
ATOM 7688  H HB3  . CYS A 1 83  ? 7.047   11.961  0.833   1.00 0.00 ? 86  CYS A HB3  5  
ATOM 7689  N N    . GLY A 1 84  ? 5.891   14.434  1.355   1.00 0.00 ? 87  GLY A N    5  
ATOM 7690  C CA   . GLY A 1 84  ? 4.775   15.327  1.129   1.00 0.00 ? 87  GLY A CA   5  
ATOM 7691  C C    . GLY A 1 84  ? 3.596   14.643  0.469   1.00 0.00 ? 87  GLY A C    5  
ATOM 7692  O O    . GLY A 1 84  ? 3.409   13.434  0.614   1.00 0.00 ? 87  GLY A O    5  
ATOM 7693  H H    . GLY A 1 84  ? 6.521   14.247  0.623   1.00 0.00 ? 87  GLY A H    5  
ATOM 7694  H HA2  . GLY A 1 84  ? 4.456   15.727  2.079   1.00 0.00 ? 87  GLY A HA2  5  
ATOM 7695  H HA3  . GLY A 1 84  ? 5.103   16.142  0.501   1.00 0.00 ? 87  GLY A HA3  5  
ATOM 7696  N N    . ASP A 1 85  ? 2.817   15.426  -0.272  1.00 0.00 ? 88  ASP A N    5  
ATOM 7697  C CA   . ASP A 1 85  ? 1.573   14.958  -0.888  1.00 0.00 ? 88  ASP A CA   5  
ATOM 7698  C C    . ASP A 1 85  ? 1.785   13.741  -1.785  1.00 0.00 ? 88  ASP A C    5  
ATOM 7699  O O    . ASP A 1 85  ? 2.827   13.602  -2.430  1.00 0.00 ? 88  ASP A O    5  
ATOM 7700  C CB   . ASP A 1 85  ? 0.930   16.079  -1.709  1.00 0.00 ? 88  ASP A CB   5  
ATOM 7701  C CG   . ASP A 1 85  ? 0.270   17.131  -0.842  1.00 0.00 ? 88  ASP A CG   5  
ATOM 7702  O OD1  . ASP A 1 85  ? 0.943   18.109  -0.458  1.00 0.00 ? 88  ASP A OD1  5  
ATOM 7703  O OD2  . ASP A 1 85  ? -0.929  16.981  -0.537  1.00 0.00 ? 88  ASP A OD2  5  
ATOM 7704  H H    . ASP A 1 85  ? 3.085   16.358  -0.406  1.00 0.00 ? 88  ASP A H    5  
ATOM 7705  H HA   . ASP A 1 85  ? 0.898   14.686  -0.093  1.00 0.00 ? 88  ASP A HA   5  
ATOM 7706  H HB2  . ASP A 1 85  ? 1.689   16.557  -2.310  1.00 0.00 ? 88  ASP A HB2  5  
ATOM 7707  H HB3  . ASP A 1 85  ? 0.182   15.653  -2.359  1.00 0.00 ? 88  ASP A HB3  5  
ATOM 7708  N N    . PRO A 1 86  ? 0.786   12.844  -1.830  1.00 0.00 ? 89  PRO A N    5  
ATOM 7709  C CA   . PRO A 1 86  ? 0.810   11.665  -2.686  1.00 0.00 ? 89  PRO A CA   5  
ATOM 7710  C C    . PRO A 1 86  ? 0.533   12.020  -4.142  1.00 0.00 ? 89  PRO A C    5  
ATOM 7711  O O    . PRO A 1 86  ? -0.560  12.469  -4.490  1.00 0.00 ? 89  PRO A O    5  
ATOM 7712  C CB   . PRO A 1 86  ? -0.314  10.772  -2.141  1.00 0.00 ? 89  PRO A CB   5  
ATOM 7713  C CG   . PRO A 1 86  ? -0.850  11.468  -0.931  1.00 0.00 ? 89  PRO A CG   5  
ATOM 7714  C CD   . PRO A 1 86  ? -0.451  12.910  -1.051  1.00 0.00 ? 89  PRO A CD   5  
ATOM 7715  H HA   . PRO A 1 86  ? 1.753   11.143  -2.616  1.00 0.00 ? 89  PRO A HA   5  
ATOM 7716  H HB2  . PRO A 1 86  ? -1.076  10.658  -2.895  1.00 0.00 ? 89  PRO A HB2  5  
ATOM 7717  H HB3  . PRO A 1 86  ? 0.089   9.806   -1.887  1.00 0.00 ? 89  PRO A HB3  5  
ATOM 7718  H HG2  . PRO A 1 86  ? -1.926  11.379  -0.906  1.00 0.00 ? 89  PRO A HG2  5  
ATOM 7719  H HG3  . PRO A 1 86  ? -0.418  11.033  -0.042  1.00 0.00 ? 89  PRO A HG3  5  
ATOM 7720  H HD2  . PRO A 1 86  ? -1.208  13.474  -1.575  1.00 0.00 ? 89  PRO A HD2  5  
ATOM 7721  H HD3  . PRO A 1 86  ? -0.271  13.334  -0.076  1.00 0.00 ? 89  PRO A HD3  5  
ATOM 7722  N N    . LEU A 1 87  ? 1.529   11.824  -4.983  1.00 0.00 ? 90  LEU A N    5  
ATOM 7723  C CA   . LEU A 1 87  ? 1.415   12.129  -6.398  1.00 0.00 ? 90  LEU A CA   5  
ATOM 7724  C C    . LEU A 1 87  ? 0.724   10.992  -7.139  1.00 0.00 ? 90  LEU A C    5  
ATOM 7725  O O    . LEU A 1 87  ? -0.058  11.223  -8.060  1.00 0.00 ? 90  LEU A O    5  
ATOM 7726  C CB   . LEU A 1 87  ? 2.803   12.377  -6.993  1.00 0.00 ? 90  LEU A CB   5  
ATOM 7727  C CG   . LEU A 1 87  ? 3.593   13.529  -6.359  1.00 0.00 ? 90  LEU A CG   5  
ATOM 7728  C CD1  . LEU A 1 87  ? 4.979   13.633  -6.975  1.00 0.00 ? 90  LEU A CD1  5  
ATOM 7729  C CD2  . LEU A 1 87  ? 2.848   14.848  -6.519  1.00 0.00 ? 90  LEU A CD2  5  
ATOM 7730  H H    . LEU A 1 87  ? 2.375   11.458  -4.640  1.00 0.00 ? 90  LEU A H    5  
ATOM 7731  H HA   . LEU A 1 87  ? 0.821   13.023  -6.498  1.00 0.00 ? 90  LEU A HA   5  
ATOM 7732  H HB2  . LEU A 1 87  ? 3.379   11.470  -6.884  1.00 0.00 ? 90  LEU A HB2  5  
ATOM 7733  H HB3  . LEU A 1 87  ? 2.688   12.581  -8.044  1.00 0.00 ? 90  LEU A HB3  5  
ATOM 7734  H HG   . LEU A 1 87  ? 3.711   13.336  -5.303  1.00 0.00 ? 90  LEU A HG   5  
ATOM 7735  H HD11 . LEU A 1 87  ? 5.524   12.717  -6.796  1.00 0.00 ? 90  LEU A HD11 5  
ATOM 7736  H HD12 . LEU A 1 87  ? 4.889   13.799  -8.039  1.00 0.00 ? 90  LEU A HD12 5  
ATOM 7737  H HD13 . LEU A 1 87  ? 5.508   14.460  -6.526  1.00 0.00 ? 90  LEU A HD13 5  
ATOM 7738  H HD21 . LEU A 1 87  ? 1.908   14.800  -5.991  1.00 0.00 ? 90  LEU A HD21 5  
ATOM 7739  H HD22 . LEU A 1 87  ? 3.447   15.650  -6.112  1.00 0.00 ? 90  LEU A HD22 5  
ATOM 7740  H HD23 . LEU A 1 87  ? 2.664   15.034  -7.567  1.00 0.00 ? 90  LEU A HD23 5  
ATOM 7741  N N    . SER A 1 88  ? 1.023   9.767   -6.733  1.00 0.00 ? 91  SER A N    5  
ATOM 7742  C CA   . SER A 1 88  ? 0.441   8.585   -7.352  1.00 0.00 ? 91  SER A CA   5  
ATOM 7743  C C    . SER A 1 88  ? 0.347   7.441   -6.356  1.00 0.00 ? 91  SER A C    5  
ATOM 7744  O O    . SER A 1 88  ? 1.185   7.316   -5.459  1.00 0.00 ? 91  SER A O    5  
ATOM 7745  C CB   . SER A 1 88  ? 1.270   8.137   -8.559  1.00 0.00 ? 91  SER A CB   5  
ATOM 7746  O OG   . SER A 1 88  ? 1.134   9.036   -9.645  1.00 0.00 ? 91  SER A OG   5  
ATOM 7747  H H    . SER A 1 88  ? 1.648   9.652   -5.987  1.00 0.00 ? 91  SER A H    5  
ATOM 7748  H HA   . SER A 1 88  ? -0.554  8.842   -7.686  1.00 0.00 ? 91  SER A HA   5  
ATOM 7749  H HB2  . SER A 1 88  ? 2.310   8.090   -8.276  1.00 0.00 ? 91  SER A HB2  5  
ATOM 7750  H HB3  . SER A 1 88  ? 0.940   7.159   -8.875  1.00 0.00 ? 91  SER A HB3  5  
ATOM 7751  H HG   . SER A 1 88  ? 0.372   8.767   -10.180 1.00 0.00 ? 91  SER A HG   5  
ATOM 7752  N N    . LEU A 1 89  ? -0.677  6.622   -6.522  1.00 0.00 ? 92  LEU A N    5  
ATOM 7753  C CA   . LEU A 1 89  ? -0.869  5.432   -5.709  1.00 0.00 ? 92  LEU A CA   5  
ATOM 7754  C C    . LEU A 1 89  ? -1.621  4.401   -6.538  1.00 0.00 ? 92  LEU A C    5  
ATOM 7755  O O    . LEU A 1 89  ? -2.790  4.596   -6.868  1.00 0.00 ? 92  LEU A O    5  
ATOM 7756  C CB   . LEU A 1 89  ? -1.639  5.777   -4.420  1.00 0.00 ? 92  LEU A CB   5  
ATOM 7757  C CG   . LEU A 1 89  ? -1.704  4.675   -3.347  1.00 0.00 ? 92  LEU A CG   5  
ATOM 7758  C CD1  . LEU A 1 89  ? -1.994  5.280   -1.982  1.00 0.00 ? 92  LEU A CD1  5  
ATOM 7759  C CD2  . LEU A 1 89  ? -2.774  3.642   -3.675  1.00 0.00 ? 92  LEU A CD2  5  
ATOM 7760  H H    . LEU A 1 89  ? -1.330  6.819   -7.227  1.00 0.00 ? 92  LEU A H    5  
ATOM 7761  H HA   . LEU A 1 89  ? 0.107   5.040   -5.451  1.00 0.00 ? 92  LEU A HA   5  
ATOM 7762  H HB2  . LEU A 1 89  ? -1.177  6.649   -3.980  1.00 0.00 ? 92  LEU A HB2  5  
ATOM 7763  H HB3  . LEU A 1 89  ? -2.650  6.033   -4.698  1.00 0.00 ? 92  LEU A HB3  5  
ATOM 7764  H HG   . LEU A 1 89  ? -0.749  4.170   -3.296  1.00 0.00 ? 92  LEU A HG   5  
ATOM 7765  H HD11 . LEU A 1 89  ? -2.063  4.492   -1.246  1.00 0.00 ? 92  LEU A HD11 5  
ATOM 7766  H HD12 . LEU A 1 89  ? -1.198  5.958   -1.712  1.00 0.00 ? 92  LEU A HD12 5  
ATOM 7767  H HD13 . LEU A 1 89  ? -2.929  5.819   -2.018  1.00 0.00 ? 92  LEU A HD13 5  
ATOM 7768  H HD21 . LEU A 1 89  ? -2.754  2.853   -2.937  1.00 0.00 ? 92  LEU A HD21 5  
ATOM 7769  H HD22 . LEU A 1 89  ? -3.745  4.116   -3.668  1.00 0.00 ? 92  LEU A HD22 5  
ATOM 7770  H HD23 . LEU A 1 89  ? -2.584  3.224   -4.653  1.00 0.00 ? 92  LEU A HD23 5  
ATOM 7771  N N    . GLY A 1 90  ? -0.941  3.329   -6.901  1.00 0.00 ? 93  GLY A N    5  
ATOM 7772  C CA   . GLY A 1 90  ? -1.553  2.310   -7.734  1.00 0.00 ? 93  GLY A CA   5  
ATOM 7773  C C    . GLY A 1 90  ? -0.578  1.204   -8.078  1.00 0.00 ? 93  GLY A C    5  
ATOM 7774  O O    . GLY A 1 90  ? 0.309   0.907   -7.288  1.00 0.00 ? 93  GLY A O    5  
ATOM 7775  H H    . GLY A 1 90  ? -0.008  3.225   -6.603  1.00 0.00 ? 93  GLY A H    5  
ATOM 7776  H HA2  . GLY A 1 90  ? -2.398  1.884   -7.207  1.00 0.00 ? 93  GLY A HA2  5  
ATOM 7777  H HA3  . GLY A 1 90  ? -1.900  2.770   -8.647  1.00 0.00 ? 93  GLY A HA3  5  
ATOM 7778  N N    . PRO A 1 91  ? -0.710  0.570   -9.252  1.00 0.00 ? 94  PRO A N    5  
ATOM 7779  C CA   . PRO A 1 91  ? 0.210   -0.489  -9.673  1.00 0.00 ? 94  PRO A CA   5  
ATOM 7780  C C    . PRO A 1 91  ? 1.562   0.072   -10.114 1.00 0.00 ? 94  PRO A C    5  
ATOM 7781  O O    . PRO A 1 91  ? 1.638   0.866   -11.053 1.00 0.00 ? 94  PRO A O    5  
ATOM 7782  C CB   . PRO A 1 91  ? -0.517  -1.136  -10.854 1.00 0.00 ? 94  PRO A CB   5  
ATOM 7783  C CG   . PRO A 1 91  ? -1.376  -0.055  -11.416 1.00 0.00 ? 94  PRO A CG   5  
ATOM 7784  C CD   . PRO A 1 91  ? -1.760  0.831   -10.258 1.00 0.00 ? 94  PRO A CD   5  
ATOM 7785  H HA   . PRO A 1 91  ? 0.357   -1.218  -8.889  1.00 0.00 ? 94  PRO A HA   5  
ATOM 7786  H HB2  . PRO A 1 91  ? 0.206   -1.482  -11.579 1.00 0.00 ? 94  PRO A HB2  5  
ATOM 7787  H HB3  . PRO A 1 91  ? -1.110  -1.968  -10.504 1.00 0.00 ? 94  PRO A HB3  5  
ATOM 7788  H HG2  . PRO A 1 91  ? -0.819  0.509   -12.150 1.00 0.00 ? 94  PRO A HG2  5  
ATOM 7789  H HG3  . PRO A 1 91  ? -2.259  -0.487  -11.866 1.00 0.00 ? 94  PRO A HG3  5  
ATOM 7790  H HD2  . PRO A 1 91  ? -1.754  1.867   -10.561 1.00 0.00 ? 94  PRO A HD2  5  
ATOM 7791  H HD3  . PRO A 1 91  ? -2.734  0.554   -9.878  1.00 0.00 ? 94  PRO A HD3  5  
ATOM 7792  N N    . PHE A 1 92  ? 2.626   -0.325  -9.429  1.00 0.00 ? 95  PHE A N    5  
ATOM 7793  C CA   . PHE A 1 92  ? 3.954   0.187   -9.738  1.00 0.00 ? 95  PHE A CA   5  
ATOM 7794  C C    . PHE A 1 92  ? 5.010   -0.889  -9.527  1.00 0.00 ? 95  PHE A C    5  
ATOM 7795  O O    . PHE A 1 92  ? 5.164   -1.395  -8.414  1.00 0.00 ? 95  PHE A O    5  
ATOM 7796  C CB   . PHE A 1 92  ? 4.269   1.385   -8.845  1.00 0.00 ? 95  PHE A CB   5  
ATOM 7797  C CG   . PHE A 1 92  ? 5.460   2.186   -9.292  1.00 0.00 ? 95  PHE A CG   5  
ATOM 7798  C CD1  . PHE A 1 92  ? 5.341   3.118   -10.312 1.00 0.00 ? 95  PHE A CD1  5  
ATOM 7799  C CD2  . PHE A 1 92  ? 6.696   2.013   -8.688  1.00 0.00 ? 95  PHE A CD2  5  
ATOM 7800  C CE1  . PHE A 1 92  ? 6.431   3.862   -10.721 1.00 0.00 ? 95  PHE A CE1  5  
ATOM 7801  C CE2  . PHE A 1 92  ? 7.789   2.752   -9.094  1.00 0.00 ? 95  PHE A CE2  5  
ATOM 7802  C CZ   . PHE A 1 92  ? 7.656   3.678   -10.112 1.00 0.00 ? 95  PHE A CZ   5  
ATOM 7803  H H    . PHE A 1 92  ? 2.519   -0.972  -8.696  1.00 0.00 ? 95  PHE A H    5  
ATOM 7804  H HA   . PHE A 1 92  ? 3.963   0.502   -10.769 1.00 0.00 ? 95  PHE A HA   5  
ATOM 7805  H HB2  . PHE A 1 92  ? 3.414   2.042   -8.814  1.00 0.00 ? 95  PHE A HB2  5  
ATOM 7806  H HB3  . PHE A 1 92  ? 4.472   1.022   -7.849  1.00 0.00 ? 95  PHE A HB3  5  
ATOM 7807  H HD1  . PHE A 1 92  ? 4.381   3.262   -10.789 1.00 0.00 ? 95  PHE A HD1  5  
ATOM 7808  H HD2  . PHE A 1 92  ? 6.803   1.291   -7.892  1.00 0.00 ? 95  PHE A HD2  5  
ATOM 7809  H HE1  . PHE A 1 92  ? 6.326   4.584   -11.515 1.00 0.00 ? 95  PHE A HE1  5  
ATOM 7810  H HE2  . PHE A 1 92  ? 8.747   2.606   -8.617  1.00 0.00 ? 95  PHE A HE2  5  
ATOM 7811  H HZ   . PHE A 1 92  ? 8.511   4.256   -10.430 1.00 0.00 ? 95  PHE A HZ   5  
ATOM 7812  N N    . LEU A 1 93  ? 5.721   -1.225  -10.604 1.00 0.00 ? 96  LEU A N    5  
ATOM 7813  C CA   . LEU A 1 93  ? 6.840   -2.169  -10.557 1.00 0.00 ? 96  LEU A CA   5  
ATOM 7814  C C    . LEU A 1 93  ? 6.388   -3.525  -10.011 1.00 0.00 ? 96  LEU A C    5  
ATOM 7815  O O    . LEU A 1 93  ? 6.425   -3.768  -8.805  1.00 0.00 ? 96  LEU A O    5  
ATOM 7816  C CB   . LEU A 1 93  ? 7.979   -1.591  -9.698  1.00 0.00 ? 96  LEU A CB   5  
ATOM 7817  C CG   . LEU A 1 93  ? 9.403   -2.032  -10.080 1.00 0.00 ? 96  LEU A CG   5  
ATOM 7818  C CD1  . LEU A 1 93  ? 10.429  -1.265  -9.258  1.00 0.00 ? 96  LEU A CD1  5  
ATOM 7819  C CD2  . LEU A 1 93  ? 9.595   -3.533  -9.891  1.00 0.00 ? 96  LEU A CD2  5  
ATOM 7820  H H    . LEU A 1 93  ? 5.486   -0.818  -11.469 1.00 0.00 ? 96  LEU A H    5  
ATOM 7821  H HA   . LEU A 1 93  ? 7.201   -2.307  -11.567 1.00 0.00 ? 96  LEU A HA   5  
ATOM 7822  H HB2  . LEU A 1 93  ? 7.932   -0.513  -9.762  1.00 0.00 ? 96  LEU A HB2  5  
ATOM 7823  H HB3  . LEU A 1 93  ? 7.801   -1.877  -8.671  1.00 0.00 ? 96  LEU A HB3  5  
ATOM 7824  H HG   . LEU A 1 93  ? 9.572   -1.798  -11.122 1.00 0.00 ? 96  LEU A HG   5  
ATOM 7825  H HD11 . LEU A 1 93  ? 10.255  -1.444  -8.207  1.00 0.00 ? 96  LEU A HD11 5  
ATOM 7826  H HD12 . LEU A 1 93  ? 11.422  -1.597  -9.522  1.00 0.00 ? 96  LEU A HD12 5  
ATOM 7827  H HD13 . LEU A 1 93  ? 10.337  -0.208  -9.464  1.00 0.00 ? 96  LEU A HD13 5  
ATOM 7828  H HD21 . LEU A 1 93  ? 9.456   -3.789  -8.852  1.00 0.00 ? 96  LEU A HD21 5  
ATOM 7829  H HD22 . LEU A 1 93  ? 8.873   -4.068  -10.493 1.00 0.00 ? 96  LEU A HD22 5  
ATOM 7830  H HD23 . LEU A 1 93  ? 10.593  -3.811  -10.198 1.00 0.00 ? 96  LEU A HD23 5  
ATOM 7831  N N    . LYS A 1 94  ? 5.976   -4.415  -10.903 1.00 0.00 ? 97  LYS A N    5  
ATOM 7832  C CA   . LYS A 1 94  ? 5.522   -5.733  -10.484 1.00 0.00 ? 97  LYS A CA   5  
ATOM 7833  C C    . LYS A 1 94  ? 6.722   -6.621  -10.189 1.00 0.00 ? 97  LYS A C    5  
ATOM 7834  O O    . LYS A 1 94  ? 7.223   -7.320  -11.065 1.00 0.00 ? 97  LYS A O    5  
ATOM 7835  C CB   . LYS A 1 94  ? 4.624   -6.388  -11.540 1.00 0.00 ? 97  LYS A CB   5  
ATOM 7836  C CG   . LYS A 1 94  ? 3.359   -5.594  -11.847 1.00 0.00 ? 97  LYS A CG   5  
ATOM 7837  C CD   . LYS A 1 94  ? 2.299   -6.432  -12.557 1.00 0.00 ? 97  LYS A CD   5  
ATOM 7838  C CE   . LYS A 1 94  ? 2.676   -6.794  -13.990 1.00 0.00 ? 97  LYS A CE   5  
ATOM 7839  N NZ   . LYS A 1 94  ? 3.705   -7.868  -14.061 1.00 0.00 ? 97  LYS A NZ   5  
ATOM 7840  H H    . LYS A 1 94  ? 6.004   -4.188  -11.862 1.00 0.00 ? 97  LYS A H    5  
ATOM 7841  H HA   . LYS A 1 94  ? 4.956   -5.605  -9.572  1.00 0.00 ? 97  LYS A HA   5  
ATOM 7842  H HB2  . LYS A 1 94  ? 5.185   -6.503  -12.456 1.00 0.00 ? 97  LYS A HB2  5  
ATOM 7843  H HB3  . LYS A 1 94  ? 4.331   -7.366  -11.187 1.00 0.00 ? 97  LYS A HB3  5  
ATOM 7844  H HG2  . LYS A 1 94  ? 2.945   -5.228  -10.921 1.00 0.00 ? 97  LYS A HG2  5  
ATOM 7845  H HG3  . LYS A 1 94  ? 3.619   -4.759  -12.480 1.00 0.00 ? 97  LYS A HG3  5  
ATOM 7846  H HD2  . LYS A 1 94  ? 2.153   -7.347  -12.001 1.00 0.00 ? 97  LYS A HD2  5  
ATOM 7847  H HD3  . LYS A 1 94  ? 1.373   -5.874  -12.571 1.00 0.00 ? 97  LYS A HD3  5  
ATOM 7848  H HE2  . LYS A 1 94  ? 1.789   -7.127  -14.506 1.00 0.00 ? 97  LYS A HE2  5  
ATOM 7849  H HE3  . LYS A 1 94  ? 3.059   -5.909  -14.477 1.00 0.00 ? 97  LYS A HE3  5  
ATOM 7850  H HZ1  . LYS A 1 94  ? 4.657   -7.443  -13.984 1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 7851  H HZ3  . LYS A 1 94  ? 3.638   -8.352  -14.983 1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 7852  N N    . THR A 1 95  ? 7.187   -6.569  -8.948  1.00 0.00 ? 98  THR A N    5  
ATOM 7853  C CA   . THR A 1 95  ? 8.339   -7.350  -8.514  1.00 0.00 ? 98  THR A CA   5  
ATOM 7854  C C    . THR A 1 95  ? 7.992   -8.837  -8.427  1.00 0.00 ? 98  THR A C    5  
ATOM 7855  O O    . THR A 1 95  ? 8.876   -9.693  -8.344  1.00 0.00 ? 98  THR A O    5  
ATOM 7856  C CB   . THR A 1 95  ? 8.830   -6.852  -7.140  1.00 0.00 ? 98  THR A CB   5  
ATOM 7857  O OG1  . THR A 1 95  ? 8.943   -5.427  -7.163  1.00 0.00 ? 98  THR A OG1  5  
ATOM 7858  C CG2  . THR A 1 95  ? 10.178  -7.453  -6.774  1.00 0.00 ? 98  THR A CG2  5  
ATOM 7859  H H    . THR A 1 95  ? 6.752   -5.967  -8.305  1.00 0.00 ? 98  THR A H    5  
ATOM 7860  H HA   . THR A 1 95  ? 9.132   -7.212  -9.232  1.00 0.00 ? 98  THR A HA   5  
ATOM 7861  H HB   . THR A 1 95  ? 8.106   -7.139  -6.390  1.00 0.00 ? 98  THR A HB   5  
ATOM 7862  H HG1  . THR A 1 95  ? 9.714   -5.176  -7.684  1.00 0.00 ? 98  THR A HG1  5  
ATOM 7863  H HG21 . THR A 1 95  ? 10.923  -7.125  -7.484  1.00 0.00 ? 98  THR A HG21 5  
ATOM 7864  H HG22 . THR A 1 95  ? 10.108  -8.531  -6.796  1.00 0.00 ? 98  THR A HG22 5  
ATOM 7865  H HG23 . THR A 1 95  ? 10.459  -7.131  -5.783  1.00 0.00 ? 98  THR A HG23 5  
ATOM 7866  N N    . TYR A 1 96  ? 6.692   -9.120  -8.468  1.00 0.00 ? 99  TYR A N    5  
ATOM 7867  C CA   . TYR A 1 96  ? 6.176   -10.478 -8.337  1.00 0.00 ? 99  TYR A CA   5  
ATOM 7868  C C    . TYR A 1 96  ? 6.603   -11.076 -6.999  1.00 0.00 ? 99  TYR A C    5  
ATOM 7869  O O    . TYR A 1 96  ? 7.486   -11.931 -6.929  1.00 0.00 ? 99  TYR A O    5  
ATOM 7870  C CB   . TYR A 1 96  ? 6.638   -11.361 -9.507  1.00 0.00 ? 99  TYR A CB   5  
ATOM 7871  C CG   . TYR A 1 96  ? 6.051   -12.758 -9.487  1.00 0.00 ? 99  TYR A CG   5  
ATOM 7872  C CD1  . TYR A 1 96  ? 4.700   -12.967 -9.731  1.00 0.00 ? 99  TYR A CD1  5  
ATOM 7873  C CD2  . TYR A 1 96  ? 6.849   -13.865 -9.220  1.00 0.00 ? 99  TYR A CD2  5  
ATOM 7874  C CE1  . TYR A 1 96  ? 4.160   -14.239 -9.705  1.00 0.00 ? 99  TYR A CE1  5  
ATOM 7875  C CE2  . TYR A 1 96  ? 6.315   -15.138 -9.196  1.00 0.00 ? 99  TYR A CE2  5  
ATOM 7876  C CZ   . TYR A 1 96  ? 4.973   -15.320 -9.438  1.00 0.00 ? 99  TYR A CZ   5  
ATOM 7877  O OH   . TYR A 1 96  ? 4.440   -16.587 -9.408  1.00 0.00 ? 99  TYR A OH   5  
ATOM 7878  H H    . TYR A 1 96  ? 6.061   -8.385  -8.593  1.00 0.00 ? 99  TYR A H    5  
ATOM 7879  H HA   . TYR A 1 96  ? 5.097   -10.419 -8.352  1.00 0.00 ? 99  TYR A HA   5  
ATOM 7880  H HB2  . TYR A 1 96  ? 6.348   -10.895 -10.438 1.00 0.00 ? 99  TYR A HB2  5  
ATOM 7881  H HB3  . TYR A 1 96  ? 7.713   -11.451 -9.476  1.00 0.00 ? 99  TYR A HB3  5  
ATOM 7882  H HD1  . TYR A 1 96  ? 4.065   -12.120 -9.940  1.00 0.00 ? 99  TYR A HD1  5  
ATOM 7883  H HD2  . TYR A 1 96  ? 7.901   -13.721 -9.028  1.00 0.00 ? 99  TYR A HD2  5  
ATOM 7884  H HE1  . TYR A 1 96  ? 3.107   -14.383 -9.898  1.00 0.00 ? 99  TYR A HE1  5  
ATOM 7885  H HE2  . TYR A 1 96  ? 6.953   -15.984 -8.986  1.00 0.00 ? 99  TYR A HE2  5  
ATOM 7886  H HH   . TYR A 1 96  ? 3.761   -16.666 -10.095 1.00 0.00 ? 99  TYR A HH   5  
ATOM 7887  N N    . THR A 1 97  ? 5.974   -10.609 -5.933  1.00 0.00 ? 100 THR A N    5  
ATOM 7888  C CA   . THR A 1 97  ? 6.253   -11.114 -4.602  1.00 0.00 ? 100 THR A CA   5  
ATOM 7889  C C    . THR A 1 97  ? 4.975   -11.612 -3.921  1.00 0.00 ? 100 THR A C    5  
ATOM 7890  O O    . THR A 1 97  ? 4.562   -11.073 -2.892  1.00 0.00 ? 100 THR A O    5  
ATOM 7891  C CB   . THR A 1 97  ? 6.912   -10.027 -3.731  1.00 0.00 ? 100 THR A CB   5  
ATOM 7892  O OG1  . THR A 1 97  ? 6.255   -8.769  -3.945  1.00 0.00 ? 100 THR A OG1  5  
ATOM 7893  C CG2  . THR A 1 97  ? 8.395   -9.891  -4.048  1.00 0.00 ? 100 THR A CG2  5  
ATOM 7894  H H    . THR A 1 97  ? 5.310   -9.901  -6.040  1.00 0.00 ? 100 THR A H    5  
ATOM 7895  H HA   . THR A 1 97  ? 6.944   -11.937 -4.697  1.00 0.00 ? 100 THR A HA   5  
ATOM 7896  H HB   . THR A 1 97  ? 6.805   -10.306 -2.694  1.00 0.00 ? 100 THR A HB   5  
ATOM 7897  H HG1  . THR A 1 97  ? 6.158   -8.317  -3.099  1.00 0.00 ? 100 THR A HG1  5  
ATOM 7898  H HG21 . THR A 1 97  ? 8.517   -9.642  -5.092  1.00 0.00 ? 100 THR A HG21 5  
ATOM 7899  H HG22 . THR A 1 97  ? 8.895   -10.824 -3.840  1.00 0.00 ? 100 THR A HG22 5  
ATOM 7900  H HG23 . THR A 1 97  ? 8.822   -9.109  -3.437  1.00 0.00 ? 100 THR A HG23 5  
ATOM 7901  N N    . PRO A 1 98  ? 4.349   -12.677 -4.464  1.00 0.00 ? 101 PRO A N    5  
ATOM 7902  C CA   . PRO A 1 98  ? 3.079   -13.201 -3.953  1.00 0.00 ? 101 PRO A CA   5  
ATOM 7903  C C    . PRO A 1 98  ? 3.266   -13.958 -2.646  1.00 0.00 ? 101 PRO A C    5  
ATOM 7904  O O    . PRO A 1 98  ? 2.323   -14.515 -2.090  1.00 0.00 ? 101 PRO A O    5  
ATOM 7905  C CB   . PRO A 1 98  ? 2.598   -14.152 -5.062  1.00 0.00 ? 101 PRO A CB   5  
ATOM 7906  C CG   . PRO A 1 98  ? 3.541   -13.955 -6.204  1.00 0.00 ? 101 PRO A CG   5  
ATOM 7907  C CD   . PRO A 1 98  ? 4.823   -13.473 -5.598  1.00 0.00 ? 101 PRO A CD   5  
ATOM 7908  H HA   . PRO A 1 98  ? 2.357   -12.413 -3.809  1.00 0.00 ? 101 PRO A HA   5  
ATOM 7909  H HB2  . PRO A 1 98  ? 2.627   -15.169 -4.701  1.00 0.00 ? 101 PRO A HB2  5  
ATOM 7910  H HB3  . PRO A 1 98  ? 1.585   -13.896 -5.341  1.00 0.00 ? 101 PRO A HB3  5  
ATOM 7911  H HG2  . PRO A 1 98  ? 3.696   -14.892 -6.718  1.00 0.00 ? 101 PRO A HG2  5  
ATOM 7912  H HG3  . PRO A 1 98  ? 3.145   -13.214 -6.883  1.00 0.00 ? 101 PRO A HG3  5  
ATOM 7913  H HD2  . PRO A 1 98  ? 5.423   -14.307 -5.267  1.00 0.00 ? 101 PRO A HD2  5  
ATOM 7914  H HD3  . PRO A 1 98  ? 5.371   -12.862 -6.300  1.00 0.00 ? 101 PRO A HD3  5  
ATOM 7915  N N    . GLN A 1 99  ? 4.502   -13.969 -2.172  1.00 0.00 ? 102 GLN A N    5  
ATOM 7916  C CA   . GLN A 1 99  ? 4.844   -14.597 -0.907  1.00 0.00 ? 102 GLN A CA   5  
ATOM 7917  C C    . GLN A 1 99  ? 5.047   -13.523 0.156   1.00 0.00 ? 102 GLN A C    5  
ATOM 7918  O O    . GLN A 1 99  ? 5.585   -13.781 1.233   1.00 0.00 ? 102 GLN A O    5  
ATOM 7919  C CB   . GLN A 1 99  ? 6.115   -15.438 -1.057  1.00 0.00 ? 102 GLN A CB   5  
ATOM 7920  C CG   . GLN A 1 99  ? 6.011   -16.518 -2.125  1.00 0.00 ? 102 GLN A CG   5  
ATOM 7921  C CD   . GLN A 1 99  ? 7.323   -17.237 -2.350  1.00 0.00 ? 102 GLN A CD   5  
ATOM 7922  O OE1  . GLN A 1 99  ? 7.607   -18.250 -1.715  1.00 0.00 ? 102 GLN A OE1  5  
ATOM 7923  N NE2  . GLN A 1 99  ? 8.136   -16.711 -3.253  1.00 0.00 ? 102 GLN A NE2  5  
ATOM 7924  H H    . GLN A 1 99  ? 5.208   -13.531 -2.690  1.00 0.00 ? 102 GLN A H    5  
ATOM 7925  H HA   . GLN A 1 99  ? 4.023   -15.235 -0.615  1.00 0.00 ? 102 GLN A HA   5  
ATOM 7926  H HB2  . GLN A 1 99  ? 6.937   -14.787 -1.313  1.00 0.00 ? 102 GLN A HB2  5  
ATOM 7927  H HB3  . GLN A 1 99  ? 6.329   -15.918 -0.112  1.00 0.00 ? 102 GLN A HB3  5  
ATOM 7928  H HG2  . GLN A 1 99  ? 5.273   -17.241 -1.815  1.00 0.00 ? 102 GLN A HG2  5  
ATOM 7929  H HG3  . GLN A 1 99  ? 5.704   -16.063 -3.054  1.00 0.00 ? 102 GLN A HG3  5  
ATOM 7930  H HE21 . GLN A 1 99  ? 7.848   -15.899 -3.721  1.00 0.00 ? 102 GLN A HE21 5  
ATOM 7931  H HE22 . GLN A 1 99  ? 9.001   -17.147 -3.408  1.00 0.00 ? 102 GLN A HE22 5  
ATOM 7932  N N    . SER A 1 100 ? 4.636   -12.303 -0.171  1.00 0.00 ? 103 SER A N    5  
ATOM 7933  C CA   . SER A 1 100 ? 4.739   -11.184 0.755   1.00 0.00 ? 103 SER A CA   5  
ATOM 7934  C C    . SER A 1 100 ? 3.581   -10.202 0.572   1.00 0.00 ? 103 SER A C    5  
ATOM 7935  O O    . SER A 1 100 ? 3.257   -9.444  1.488   1.00 0.00 ? 103 SER A O    5  
ATOM 7936  C CB   . SER A 1 100 ? 6.073   -10.458 0.560   1.00 0.00 ? 103 SER A CB   5  
ATOM 7937  O OG   . SER A 1 100 ? 7.169   -11.333 0.776   1.00 0.00 ? 103 SER A OG   5  
ATOM 7938  H H    . SER A 1 100 ? 4.265   -12.152 -1.064  1.00 0.00 ? 103 SER A H    5  
ATOM 7939  H HA   . SER A 1 100 ? 4.702   -11.581 1.759   1.00 0.00 ? 103 SER A HA   5  
ATOM 7940  H HB2  . SER A 1 100 ? 6.129   -10.074 -0.447  1.00 0.00 ? 103 SER A HB2  5  
ATOM 7941  H HB3  . SER A 1 100 ? 6.138   -9.638  1.261   1.00 0.00 ? 103 SER A HB3  5  
ATOM 7942  H HG   . SER A 1 100 ? 6.846   -12.154 1.173   1.00 0.00 ? 103 SER A HG   5  
ATOM 7943  N N    . SER A 1 101 ? 2.960   -10.211 -0.603  1.00 0.00 ? 104 SER A N    5  
ATOM 7944  C CA   . SER A 1 101 ? 1.881   -9.280  -0.897  1.00 0.00 ? 104 SER A CA   5  
ATOM 7945  C C    . SER A 1 101 ? 0.524   -9.825  -0.438  1.00 0.00 ? 104 SER A C    5  
ATOM 7946  O O    . SER A 1 101 ? 0.304   -11.038 -0.403  1.00 0.00 ? 104 SER A O    5  
ATOM 7947  C CB   . SER A 1 101 ? 1.859   -8.972  -2.397  1.00 0.00 ? 104 SER A CB   5  
ATOM 7948  O OG   . SER A 1 101 ? 1.766   -10.161 -3.164  1.00 0.00 ? 104 SER A OG   5  
ATOM 7949  H H    . SER A 1 101 ? 3.233   -10.852 -1.291  1.00 0.00 ? 104 SER A H    5  
ATOM 7950  H HA   . SER A 1 101 ? 2.085   -8.366  -0.357  1.00 0.00 ? 104 SER A HA   5  
ATOM 7951  H HB2  . SER A 1 101 ? 1.010   -8.345  -2.622  1.00 0.00 ? 104 SER A HB2  5  
ATOM 7952  H HB3  . SER A 1 101 ? 2.768   -8.453  -2.670  1.00 0.00 ? 104 SER A HB3  5  
ATOM 7953  H HG   . SER A 1 101 ? 0.998   -10.108 -3.742  1.00 0.00 ? 104 SER A HG   5  
ATOM 7954  N N    . ILE A 1 102 ? -0.373  -8.917  -0.070  1.00 0.00 ? 105 ILE A N    5  
ATOM 7955  C CA   . ILE A 1 102 ? -1.709  -9.283  0.379   1.00 0.00 ? 105 ILE A CA   5  
ATOM 7956  C C    . ILE A 1 102 ? -2.772  -8.469  -0.356  1.00 0.00 ? 105 ILE A C    5  
ATOM 7957  O O    . ILE A 1 102 ? -2.551  -7.306  -0.698  1.00 0.00 ? 105 ILE A O    5  
ATOM 7958  C CB   . ILE A 1 102 ? -1.885  -9.050  1.897   1.00 0.00 ? 105 ILE A CB   5  
ATOM 7959  C CG1  . ILE A 1 102 ? -1.540  -7.596  2.243   1.00 0.00 ? 105 ILE A CG1  5  
ATOM 7960  C CG2  . ILE A 1 102 ? -1.030  -10.025 2.701   1.00 0.00 ? 105 ILE A CG2  5  
ATOM 7961  C CD1  . ILE A 1 102 ? -1.897  -7.191  3.653   1.00 0.00 ? 105 ILE A CD1  5  
ATOM 7962  H H    . ILE A 1 102 ? -0.125  -7.965  -0.098  1.00 0.00 ? 105 ILE A H    5  
ATOM 7963  H HA   . ILE A 1 102 ? -1.858  -10.331 0.174   1.00 0.00 ? 105 ILE A HA   5  
ATOM 7964  H HB   . ILE A 1 102 ? -2.917  -9.233  2.143   1.00 0.00 ? 105 ILE A HB   5  
ATOM 7965  H HG12 . ILE A 1 102 ? -0.480  -7.445  2.119   1.00 0.00 ? 105 ILE A HG12 5  
ATOM 7966  H HG13 . ILE A 1 102 ? -2.072  -6.943  1.568   1.00 0.00 ? 105 ILE A HG13 5  
ATOM 7967  H HG21 . ILE A 1 102 ? -1.353  -11.036 2.506   1.00 0.00 ? 105 ILE A HG21 5  
ATOM 7968  H HG22 . ILE A 1 102 ? 0.007   -9.918  2.415   1.00 0.00 ? 105 ILE A HG22 5  
ATOM 7969  H HG23 . ILE A 1 102 ? -1.134  -9.813  3.755   1.00 0.00 ? 105 ILE A HG23 5  
ATOM 7970  H HD11 . ILE A 1 102 ? -1.621  -6.159  3.811   1.00 0.00 ? 105 ILE A HD11 5  
ATOM 7971  H HD12 . ILE A 1 102 ? -2.959  -7.305  3.801   1.00 0.00 ? 105 ILE A HD12 5  
ATOM 7972  H HD13 . ILE A 1 102 ? -1.366  -7.817  4.354   1.00 0.00 ? 105 ILE A HD13 5  
ATOM 7973  N N    . ILE A 1 103 ? -3.917  -9.086  -0.598  1.00 0.00 ? 106 ILE A N    5  
ATOM 7974  C CA   . ILE A 1 103 ? -5.058  -8.392  -1.177  1.00 0.00 ? 106 ILE A CA   5  
ATOM 7975  C C    . ILE A 1 103 ? -6.112  -8.158  -0.104  1.00 0.00 ? 106 ILE A C    5  
ATOM 7976  O O    . ILE A 1 103 ? -6.651  -9.104  0.471   1.00 0.00 ? 106 ILE A O    5  
ATOM 7977  C CB   . ILE A 1 103 ? -5.673  -9.171  -2.368  1.00 0.00 ? 106 ILE A CB   5  
ATOM 7978  C CG1  . ILE A 1 103 ? -4.814  -8.986  -3.620  1.00 0.00 ? 106 ILE A CG1  5  
ATOM 7979  C CG2  . ILE A 1 103 ? -7.107  -8.727  -2.636  1.00 0.00 ? 106 ILE A CG2  5  
ATOM 7980  C CD1  . ILE A 1 103 ? -5.337  -9.723  -4.834  1.00 0.00 ? 106 ILE A CD1  5  
ATOM 7981  H H    . ILE A 1 103 ? -4.003  -10.040 -0.369  1.00 0.00 ? 106 ILE A H    5  
ATOM 7982  H HA   . ILE A 1 103 ? -4.714  -7.433  -1.539  1.00 0.00 ? 106 ILE A HA   5  
ATOM 7983  H HB   . ILE A 1 103 ? -5.690  -10.219 -2.112  1.00 0.00 ? 106 ILE A HB   5  
ATOM 7984  H HG12 . ILE A 1 103 ? -4.774  -7.934  -3.865  1.00 0.00 ? 106 ILE A HG12 5  
ATOM 7985  H HG13 . ILE A 1 103 ? -3.814  -9.342  -3.415  1.00 0.00 ? 106 ILE A HG13 5  
ATOM 7986  H HG21 . ILE A 1 103 ? -7.681  -8.796  -1.723  1.00 0.00 ? 106 ILE A HG21 5  
ATOM 7987  H HG22 . ILE A 1 103 ? -7.109  -7.706  -2.985  1.00 0.00 ? 106 ILE A HG22 5  
ATOM 7988  H HG23 . ILE A 1 103 ? -7.549  -9.364  -3.389  1.00 0.00 ? 106 ILE A HG23 5  
ATOM 7989  H HD11 . ILE A 1 103 ? -4.644  -9.605  -5.655  1.00 0.00 ? 106 ILE A HD11 5  
ATOM 7990  H HD12 . ILE A 1 103 ? -5.445  -10.771 -4.601  1.00 0.00 ? 106 ILE A HD12 5  
ATOM 7991  H HD13 . ILE A 1 103 ? -6.298  -9.316  -5.113  1.00 0.00 ? 106 ILE A HD13 5  
ATOM 7992  N N    . CYS A 1 104 ? -6.385  -6.898  0.175   1.00 0.00 ? 107 CYS A N    5  
ATOM 7993  C CA   . CYS A 1 104 ? -7.339  -6.539  1.211   1.00 0.00 ? 107 CYS A CA   5  
ATOM 7994  C C    . CYS A 1 104 ? -8.713  -6.267  0.616   1.00 0.00 ? 107 CYS A C    5  
ATOM 7995  O O    . CYS A 1 104 ? -8.839  -5.890  -0.552  1.00 0.00 ? 107 CYS A O    5  
ATOM 7996  C CB   . CYS A 1 104 ? -6.840  -5.323  1.995   1.00 0.00 ? 107 CYS A CB   5  
ATOM 7997  S SG   . CYS A 1 104 ? -5.275  -5.620  2.883   1.00 0.00 ? 107 CYS A SG   5  
ATOM 7998  H H    . CYS A 1 104 ? -5.936  -6.186  -0.336  1.00 0.00 ? 107 CYS A H    5  
ATOM 7999  H HA   . CYS A 1 104 ? -7.415  -7.378  1.885   1.00 0.00 ? 107 CYS A HA   5  
ATOM 8000  H HB2  . CYS A 1 104 ? -6.682  -4.500  1.312   1.00 0.00 ? 107 CYS A HB2  5  
ATOM 8001  H HB3  . CYS A 1 104 ? -7.585  -5.039  2.726   1.00 0.00 ? 107 CYS A HB3  5  
ATOM 8002  N N    . TYR A 1 105 ? -9.743  -6.480  1.418   1.00 0.00 ? 108 TYR A N    5  
ATOM 8003  C CA   . TYR A 1 105 ? -11.112 -6.282  0.980   1.00 0.00 ? 108 TYR A CA   5  
ATOM 8004  C C    . TYR A 1 105 ? -11.781 -5.218  1.839   1.00 0.00 ? 108 TYR A C    5  
ATOM 8005  O O    . TYR A 1 105 ? -11.313 -4.921  2.940   1.00 0.00 ? 108 TYR A O    5  
ATOM 8006  C CB   . TYR A 1 105 ? -11.891 -7.599  1.066   1.00 0.00 ? 108 TYR A CB   5  
ATOM 8007  C CG   . TYR A 1 105 ? -11.253 -8.735  0.294   1.00 0.00 ? 108 TYR A CG   5  
ATOM 8008  C CD1  . TYR A 1 105 ? -11.344 -8.795  -1.092  1.00 0.00 ? 108 TYR A CD1  5  
ATOM 8009  C CD2  . TYR A 1 105 ? -10.556 -9.742  0.949   1.00 0.00 ? 108 TYR A CD2  5  
ATOM 8010  C CE1  . TYR A 1 105 ? -10.759 -9.827  -1.801  1.00 0.00 ? 108 TYR A CE1  5  
ATOM 8011  C CE2  . TYR A 1 105 ? -9.967  -10.775 0.247   1.00 0.00 ? 108 TYR A CE2  5  
ATOM 8012  C CZ   . TYR A 1 105 ? -10.072 -10.813 -1.127  1.00 0.00 ? 108 TYR A CZ   5  
ATOM 8013  O OH   . TYR A 1 105 ? -9.486  -11.842 -1.829  1.00 0.00 ? 108 TYR A OH   5  
ATOM 8014  H H    . TYR A 1 105 ? -9.578  -6.775  2.342   1.00 0.00 ? 108 TYR A H    5  
ATOM 8015  H HA   . TYR A 1 105 ? -11.091 -5.948  -0.044  1.00 0.00 ? 108 TYR A HA   5  
ATOM 8016  H HB2  . TYR A 1 105 ? -11.964 -7.900  2.100   1.00 0.00 ? 108 TYR A HB2  5  
ATOM 8017  H HB3  . TYR A 1 105 ? -12.884 -7.446  0.670   1.00 0.00 ? 108 TYR A HB3  5  
ATOM 8018  H HD1  . TYR A 1 105 ? -11.883 -8.021  -1.618  1.00 0.00 ? 108 TYR A HD1  5  
ATOM 8019  H HD2  . TYR A 1 105 ? -10.473 -9.712  2.026   1.00 0.00 ? 108 TYR A HD2  5  
ATOM 8020  H HE1  . TYR A 1 105 ? -10.840 -9.857  -2.877  1.00 0.00 ? 108 TYR A HE1  5  
ATOM 8021  H HE2  . TYR A 1 105 ? -9.430  -11.550 0.775   1.00 0.00 ? 108 TYR A HE2  5  
ATOM 8022  H HH   . TYR A 1 105 ? -9.095  -11.495 -2.639  1.00 0.00 ? 108 TYR A HH   5  
ATOM 8023  N N    . GLY A 1 106 ? -12.871 -4.655  1.341   1.00 0.00 ? 109 GLY A N    5  
ATOM 8024  C CA   . GLY A 1 106 ? -13.574 -3.626  2.078   1.00 0.00 ? 109 GLY A CA   5  
ATOM 8025  C C    . GLY A 1 106 ? -13.431 -2.261  1.439   1.00 0.00 ? 109 GLY A C    5  
ATOM 8026  O O    . GLY A 1 106 ? -13.153 -2.154  0.243   1.00 0.00 ? 109 GLY A O    5  
ATOM 8027  H H    . GLY A 1 106 ? -13.206 -4.942  0.460   1.00 0.00 ? 109 GLY A H    5  
ATOM 8028  H HA2  . GLY A 1 106 ? -14.622 -3.883  2.122   1.00 0.00 ? 109 GLY A HA2  5  
ATOM 8029  H HA3  . GLY A 1 106 ? -13.181 -3.584  3.084   1.00 0.00 ? 109 GLY A HA3  5  
ATOM 8030  N N    . GLN A 1 107 ? -13.636 -1.222  2.232   1.00 0.00 ? 110 GLN A N    5  
ATOM 8031  C CA   . GLN A 1 107 ? -13.516 0.149   1.759   1.00 0.00 ? 110 GLN A CA   5  
ATOM 8032  C C    . GLN A 1 107 ? -12.054 0.591   1.764   1.00 0.00 ? 110 GLN A C    5  
ATOM 8033  O O    . GLN A 1 107 ? -11.283 0.205   2.645   1.00 0.00 ? 110 GLN A O    5  
ATOM 8034  C CB   . GLN A 1 107 ? -14.355 1.075   2.643   1.00 0.00 ? 110 GLN A CB   5  
ATOM 8035  C CG   . GLN A 1 107 ? -14.426 2.512   2.146   1.00 0.00 ? 110 GLN A CG   5  
ATOM 8036  C CD   . GLN A 1 107 ? -14.952 2.609   0.727   1.00 0.00 ? 110 GLN A CD   5  
ATOM 8037  O OE1  . GLN A 1 107 ? -14.183 2.599   -0.236  1.00 0.00 ? 110 GLN A OE1  5  
ATOM 8038  N NE2  . GLN A 1 107 ? -16.263 2.693   0.586   1.00 0.00 ? 110 GLN A NE2  5  
ATOM 8039  H H    . GLN A 1 107 ? -13.886 -1.380  3.172   1.00 0.00 ? 110 GLN A H    5  
ATOM 8040  H HA   . GLN A 1 107 ? -13.893 0.189   0.747   1.00 0.00 ? 110 GLN A HA   5  
ATOM 8041  H HB2  . GLN A 1 107 ? -15.361 0.686   2.691   1.00 0.00 ? 110 GLN A HB2  5  
ATOM 8042  H HB3  . GLN A 1 107 ? -13.933 1.079   3.639   1.00 0.00 ? 110 GLN A HB3  5  
ATOM 8043  H HG2  . GLN A 1 107 ? -15.080 3.074   2.795   1.00 0.00 ? 110 GLN A HG2  5  
ATOM 8044  H HG3  . GLN A 1 107 ? -13.434 2.939   2.177   1.00 0.00 ? 110 GLN A HG3  5  
ATOM 8045  H HE21 . GLN A 1 107 ? -16.821 2.689   1.400   1.00 0.00 ? 110 GLN A HE21 5  
ATOM 8046  H HE22 . GLN A 1 107 ? -16.631 2.743   -0.325  1.00 0.00 ? 110 GLN A HE22 5  
ATOM 8047  N N    . LEU A 1 108 ? -11.696 1.401   0.768   1.00 0.00 ? 111 LEU A N    5  
ATOM 8048  C CA   . LEU A 1 108 ? -10.333 1.904   0.592   1.00 0.00 ? 111 LEU A CA   5  
ATOM 8049  C C    . LEU A 1 108 ? -9.796  2.531   1.877   1.00 0.00 ? 111 LEU A C    5  
ATOM 8050  O O    . LEU A 1 108 ? -10.123 3.671   2.212   1.00 0.00 ? 111 LEU A O    5  
ATOM 8051  C CB   . LEU A 1 108 ? -10.312 2.932   -0.549  1.00 0.00 ? 111 LEU A CB   5  
ATOM 8052  C CG   . LEU A 1 108 ? -8.952  3.583   -0.845  1.00 0.00 ? 111 LEU A CG   5  
ATOM 8053  C CD1  . LEU A 1 108 ? -7.947  2.557   -1.347  1.00 0.00 ? 111 LEU A CD1  5  
ATOM 8054  C CD2  . LEU A 1 108 ? -9.111  4.706   -1.860  1.00 0.00 ? 111 LEU A CD2  5  
ATOM 8055  H H    . LEU A 1 108 ? -12.384 1.676   0.122   1.00 0.00 ? 111 LEU A H    5  
ATOM 8056  H HA   . LEU A 1 108 ? -9.704  1.070   0.327   1.00 0.00 ? 111 LEU A HA   5  
ATOM 8057  H HB2  . LEU A 1 108 ? -10.657 2.444   -1.449  1.00 0.00 ? 111 LEU A HB2  5  
ATOM 8058  H HB3  . LEU A 1 108 ? -11.010 3.716   -0.300  1.00 0.00 ? 111 LEU A HB3  5  
ATOM 8059  H HG   . LEU A 1 108 ? -8.562  4.011   0.067   1.00 0.00 ? 111 LEU A HG   5  
ATOM 8060  H HD11 . LEU A 1 108 ? -8.348  2.050   -2.213  1.00 0.00 ? 111 LEU A HD11 5  
ATOM 8061  H HD12 . LEU A 1 108 ? -7.030  3.058   -1.617  1.00 0.00 ? 111 LEU A HD12 5  
ATOM 8062  H HD13 . LEU A 1 108 ? -7.745  1.837   -0.568  1.00 0.00 ? 111 LEU A HD13 5  
ATOM 8063  H HD21 . LEU A 1 108 ? -9.504  4.305   -2.784  1.00 0.00 ? 111 LEU A HD21 5  
ATOM 8064  H HD22 . LEU A 1 108 ? -9.791  5.450   -1.473  1.00 0.00 ? 111 LEU A HD22 5  
ATOM 8065  H HD23 . LEU A 1 108 ? -8.148  5.160   -2.048  1.00 0.00 ? 111 LEU A HD23 5  
ATOM 8066  N N    . GLY A 1 109 ? -8.971  1.773   2.588   1.00 0.00 ? 112 GLY A N    5  
ATOM 8067  C CA   . GLY A 1 109 ? -8.400  2.250   3.828   1.00 0.00 ? 112 GLY A CA   5  
ATOM 8068  C C    . GLY A 1 109 ? -8.511  1.232   4.942   1.00 0.00 ? 112 GLY A C    5  
ATOM 8069  O O    . GLY A 1 109 ? -7.703  1.225   5.870   1.00 0.00 ? 112 GLY A O    5  
ATOM 8070  H H    . GLY A 1 109 ? -8.756  0.871   2.268   1.00 0.00 ? 112 GLY A H    5  
ATOM 8071  H HA2  . GLY A 1 109 ? -7.356  2.480   3.666   1.00 0.00 ? 112 GLY A HA2  5  
ATOM 8072  H HA3  . GLY A 1 109 ? -8.916  3.153   4.127   1.00 0.00 ? 112 GLY A HA3  5  
ATOM 8073  N N    . SER A 1 110 ? -9.505  0.359   4.845   1.00 0.00 ? 113 SER A N    5  
ATOM 8074  C CA   . SER A 1 110 ? -9.743  -0.638  5.875   1.00 0.00 ? 113 SER A CA   5  
ATOM 8075  C C    . SER A 1 110 ? -8.868  -1.870  5.656   1.00 0.00 ? 113 SER A C    5  
ATOM 8076  O O    . SER A 1 110 ? -9.086  -2.650  4.729   1.00 0.00 ? 113 SER A O    5  
ATOM 8077  C CB   . SER A 1 110 ? -11.220 -1.037  5.892   1.00 0.00 ? 113 SER A CB   5  
ATOM 8078  O OG   . SER A 1 110 ? -11.486 -1.976  6.922   1.00 0.00 ? 113 SER A OG   5  
ATOM 8079  H H    . SER A 1 110 ? -10.096 0.384   4.058   1.00 0.00 ? 113 SER A H    5  
ATOM 8080  H HA   . SER A 1 110 ? -9.491  -0.196  6.826   1.00 0.00 ? 113 SER A HA   5  
ATOM 8081  H HB2  . SER A 1 110 ? -11.827 -0.158  6.056   1.00 0.00 ? 113 SER A HB2  5  
ATOM 8082  H HB3  . SER A 1 110 ? -11.481 -1.481  4.942   1.00 0.00 ? 113 SER A HB3  5  
ATOM 8083  H HG   . SER A 1 110 ? -12.311 -1.732  7.379   1.00 0.00 ? 113 SER A HG   5  
ATOM 8084  N N    . PHE A 1 111 ? -7.880  -2.047  6.518   1.00 0.00 ? 114 PHE A N    5  
ATOM 8085  C CA   . PHE A 1 111 ? -7.014  -3.218  6.465   1.00 0.00 ? 114 PHE A CA   5  
ATOM 8086  C C    . PHE A 1 111 ? -7.560  -4.292  7.398   1.00 0.00 ? 114 PHE A C    5  
ATOM 8087  O O    . PHE A 1 111 ? -6.819  -4.946  8.130   1.00 0.00 ? 114 PHE A O    5  
ATOM 8088  C CB   . PHE A 1 111 ? -5.581  -2.845  6.861   1.00 0.00 ? 114 PHE A CB   5  
ATOM 8089  C CG   . PHE A 1 111 ? -4.880  -1.960  5.866   1.00 0.00 ? 114 PHE A CG   5  
ATOM 8090  C CD1  . PHE A 1 111 ? -4.962  -0.578  5.964   1.00 0.00 ? 114 PHE A CD1  5  
ATOM 8091  C CD2  . PHE A 1 111 ? -4.135  -2.509  4.835   1.00 0.00 ? 114 PHE A CD2  5  
ATOM 8092  C CE1  . PHE A 1 111 ? -4.314  0.236   5.056   1.00 0.00 ? 114 PHE A CE1  5  
ATOM 8093  C CE2  . PHE A 1 111 ? -3.484  -1.699  3.924   1.00 0.00 ? 114 PHE A CE2  5  
ATOM 8094  C CZ   . PHE A 1 111 ? -3.573  -0.326  4.034   1.00 0.00 ? 114 PHE A CZ   5  
ATOM 8095  H H    . PHE A 1 111 ? -7.737  -1.376  7.222   1.00 0.00 ? 114 PHE A H    5  
ATOM 8096  H HA   . PHE A 1 111 ? -7.018  -3.596  5.451   1.00 0.00 ? 114 PHE A HA   5  
ATOM 8097  H HB2  . PHE A 1 111 ? -5.607  -2.321  7.803   1.00 0.00 ? 114 PHE A HB2  5  
ATOM 8098  H HB3  . PHE A 1 111 ? -5.000  -3.750  6.975   1.00 0.00 ? 114 PHE A HB3  5  
ATOM 8099  H HD1  . PHE A 1 111 ? -5.542  -0.136  6.761   1.00 0.00 ? 114 PHE A HD1  5  
ATOM 8100  H HD2  . PHE A 1 111 ? -4.064  -3.584  4.746   1.00 0.00 ? 114 PHE A HD2  5  
ATOM 8101  H HE1  . PHE A 1 111 ? -4.386  1.311   5.144   1.00 0.00 ? 114 PHE A HE1  5  
ATOM 8102  H HE2  . PHE A 1 111 ? -2.906  -2.139  3.125   1.00 0.00 ? 114 PHE A HE2  5  
ATOM 8103  H HZ   . PHE A 1 111 ? -3.064  0.308   3.322   1.00 0.00 ? 114 PHE A HZ   5  
ATOM 8104  N N    . SER A 1 112 ? -8.876  -4.446  7.376   1.00 0.00 ? 115 SER A N    5  
ATOM 8105  C CA   . SER A 1 112 ? -9.562  -5.367  8.266   1.00 0.00 ? 115 SER A CA   5  
ATOM 8106  C C    . SER A 1 112 ? -9.475  -6.805  7.766   1.00 0.00 ? 115 SER A C    5  
ATOM 8107  O O    . SER A 1 112 ? -9.144  -7.717  8.526   1.00 0.00 ? 115 SER A O    5  
ATOM 8108  C CB   . SER A 1 112 ? -11.023 -4.944  8.411   1.00 0.00 ? 115 SER A CB   5  
ATOM 8109  O OG   . SER A 1 112 ? -11.579 -4.624  7.144   1.00 0.00 ? 115 SER A OG   5  
ATOM 8110  H H    . SER A 1 112 ? -9.403  -3.921  6.737   1.00 0.00 ? 115 SER A H    5  
ATOM 8111  H HA   . SER A 1 112 ? -9.085  -5.306  9.234   1.00 0.00 ? 115 SER A HA   5  
ATOM 8112  H HB2  . SER A 1 112 ? -11.590 -5.752  8.848   1.00 0.00 ? 115 SER A HB2  5  
ATOM 8113  H HB3  . SER A 1 112 ? -11.086 -4.074  9.047   1.00 0.00 ? 115 SER A HB3  5  
ATOM 8114  H HG   . SER A 1 112 ? -11.580 -3.657  7.030   1.00 0.00 ? 115 SER A HG   5  
ATOM 8115  N N    . ASN A 1 113 ? -9.771  -7.009  6.491   1.00 0.00 ? 116 ASN A N    5  
ATOM 8116  C CA   . ASN A 1 113 ? -9.752  -8.344  5.916   1.00 0.00 ? 116 ASN A CA   5  
ATOM 8117  C C    . ASN A 1 113 ? -8.820  -8.389  4.717   1.00 0.00 ? 116 ASN A C    5  
ATOM 8118  O O    . ASN A 1 113 ? -9.091  -7.772  3.690   1.00 0.00 ? 116 ASN A O    5  
ATOM 8119  C CB   . ASN A 1 113 ? -11.160 -8.774  5.495   1.00 0.00 ? 116 ASN A CB   5  
ATOM 8120  C CG   . ASN A 1 113 ? -11.216 -10.234 5.090   1.00 0.00 ? 116 ASN A CG   5  
ATOM 8121  O OD1  . ASN A 1 113 ? -10.453 -11.059 5.593   1.00 0.00 ? 116 ASN A OD1  5  
ATOM 8122  N ND2  . ASN A 1 113 ? -12.124 -10.564 4.187   1.00 0.00 ? 116 ASN A ND2  5  
ATOM 8123  H H    . ASN A 1 113 ? -10.002 -6.245  5.922   1.00 0.00 ? 116 ASN A H    5  
ATOM 8124  H HA   . ASN A 1 113 ? -9.386  -9.025  6.669   1.00 0.00 ? 116 ASN A HA   5  
ATOM 8125  H HB2  . ASN A 1 113 ? -11.840 -8.621  6.321   1.00 0.00 ? 116 ASN A HB2  5  
ATOM 8126  H HB3  . ASN A 1 113 ? -11.479 -8.174  4.654   1.00 0.00 ? 116 ASN A HB3  5  
ATOM 8127  H HD21 . ASN A 1 113 ? -12.699 -9.858  3.829   1.00 0.00 ? 116 ASN A HD21 5  
ATOM 8128  H HD22 . ASN A 1 113 ? -12.192 -11.511 3.920   1.00 0.00 ? 116 ASN A HD22 5  
ATOM 8129  N N    . CYS A 1 114 ? -7.722  -9.110  4.856   1.00 0.00 ? 117 CYS A N    5  
ATOM 8130  C CA   . CYS A 1 114 ? -6.745  -9.222  3.784   1.00 0.00 ? 117 CYS A CA   5  
ATOM 8131  C C    . CYS A 1 114 ? -6.384  -10.684 3.546   1.00 0.00 ? 117 CYS A C    5  
ATOM 8132  O O    . CYS A 1 114 ? -6.303  -11.474 4.490   1.00 0.00 ? 117 CYS A O    5  
ATOM 8133  C CB   . CYS A 1 114 ? -5.495  -8.405  4.121   1.00 0.00 ? 117 CYS A CB   5  
ATOM 8134  S SG   . CYS A 1 114 ? -5.838  -6.659  4.537   1.00 0.00 ? 117 CYS A SG   5  
ATOM 8135  H H    . CYS A 1 114 ? -7.565  -9.590  5.700   1.00 0.00 ? 117 CYS A H    5  
ATOM 8136  H HA   . CYS A 1 114 ? -7.195  -8.827  2.889   1.00 0.00 ? 117 CYS A HA   5  
ATOM 8137  H HB2  . CYS A 1 114 ? -4.998  -8.853  4.968   1.00 0.00 ? 117 CYS A HB2  5  
ATOM 8138  H HB3  . CYS A 1 114 ? -4.829  -8.414  3.270   1.00 0.00 ? 117 CYS A HB3  5  
ATOM 8139  N N    . SER A 1 115 ? -6.180  -11.038 2.285   1.00 0.00 ? 118 SER A N    5  
ATOM 8140  C CA   . SER A 1 115 ? -5.899  -12.411 1.903   1.00 0.00 ? 118 SER A CA   5  
ATOM 8141  C C    . SER A 1 115 ? -4.565  -12.501 1.162   1.00 0.00 ? 118 SER A C    5  
ATOM 8142  O O    . SER A 1 115 ? -4.254  -11.659 0.317   1.00 0.00 ? 118 SER A O    5  
ATOM 8143  C CB   . SER A 1 115 ? -7.038  -12.938 1.022   1.00 0.00 ? 118 SER A CB   5  
ATOM 8144  O OG   . SER A 1 115 ? -6.821  -14.284 0.640   1.00 0.00 ? 118 SER A OG   5  
ATOM 8145  H H    . SER A 1 115 ? -6.221  -10.349 1.583   1.00 0.00 ? 118 SER A H    5  
ATOM 8146  H HA   . SER A 1 115 ? -5.843  -13.006 2.801   1.00 0.00 ? 118 SER A HA   5  
ATOM 8147  H HB2  . SER A 1 115 ? -7.965  -12.882 1.569   1.00 0.00 ? 118 SER A HB2  5  
ATOM 8148  H HB3  . SER A 1 115 ? -7.109  -12.332 0.131   1.00 0.00 ? 118 SER A HB3  5  
ATOM 8149  H HG   . SER A 1 115 ? -7.036  -14.865 1.387   1.00 0.00 ? 118 SER A HG   5  
ATOM 8150  N N    . HIS A 1 116 ? -3.775  -13.510 1.497   1.00 0.00 ? 119 HIS A N    5  
ATOM 8151  C CA   . HIS A 1 116 ? -2.489  -13.735 0.846   1.00 0.00 ? 119 HIS A CA   5  
ATOM 8152  C C    . HIS A 1 116 ? -2.701  -14.380 -0.524  1.00 0.00 ? 119 HIS A C    5  
ATOM 8153  O O    . HIS A 1 116 ? -3.258  -15.473 -0.621  1.00 0.00 ? 119 HIS A O    5  
ATOM 8154  C CB   . HIS A 1 116 ? -1.619  -14.635 1.725   1.00 0.00 ? 119 HIS A CB   5  
ATOM 8155  C CG   . HIS A 1 116 ? -0.159  -14.601 1.389   1.00 0.00 ? 119 HIS A CG   5  
ATOM 8156  N ND1  . HIS A 1 116 ? 0.534   -15.695 0.915   1.00 0.00 ? 119 HIS A ND1  5  
ATOM 8157  C CD2  . HIS A 1 116 ? 0.753   -13.605 1.505   1.00 0.00 ? 119 HIS A CD2  5  
ATOM 8158  C CE1  . HIS A 1 116 ? 1.803   -15.377 0.759   1.00 0.00 ? 119 HIS A CE1  5  
ATOM 8159  N NE2  . HIS A 1 116 ? 1.964   -14.114 1.109   1.00 0.00 ? 119 HIS A NE2  5  
ATOM 8160  H H    . HIS A 1 116 ? -4.064  -14.124 2.211   1.00 0.00 ? 119 HIS A H    5  
ATOM 8161  H HA   . HIS A 1 116 ? -2.002  -12.781 0.718   1.00 0.00 ? 119 HIS A HA   5  
ATOM 8162  H HB2  . HIS A 1 116 ? -1.728  -14.332 2.756   1.00 0.00 ? 119 HIS A HB2  5  
ATOM 8163  H HB3  . HIS A 1 116 ? -1.959  -15.656 1.621   1.00 0.00 ? 119 HIS A HB3  5  
ATOM 8164  H HD1  . HIS A 1 116 ? 0.147   -16.581 0.713   1.00 0.00 ? 119 HIS A HD1  5  
ATOM 8165  H HD2  . HIS A 1 116 ? 0.562   -12.599 1.849   1.00 0.00 ? 119 HIS A HD2  5  
ATOM 8166  H HE1  . HIS A 1 116 ? 2.581   -16.039 0.406   1.00 0.00 ? 119 HIS A HE1  5  
ATOM 8167  N N    . SER A 1 117 ? -2.264  -13.702 -1.578  1.00 0.00 ? 120 SER A N    5  
ATOM 8168  C CA   . SER A 1 117 ? -2.507  -14.164 -2.940  1.00 0.00 ? 120 SER A CA   5  
ATOM 8169  C C    . SER A 1 117 ? -1.221  -14.680 -3.594  1.00 0.00 ? 120 SER A C    5  
ATOM 8170  O O    . SER A 1 117 ? -0.275  -13.923 -3.802  1.00 0.00 ? 120 SER A O    5  
ATOM 8171  C CB   . SER A 1 117 ? -3.091  -13.018 -3.767  1.00 0.00 ? 120 SER A CB   5  
ATOM 8172  O OG   . SER A 1 117 ? -4.212  -12.441 -3.115  1.00 0.00 ? 120 SER A OG   5  
ATOM 8173  H H    . SER A 1 117 ? -1.756  -12.875 -1.440  1.00 0.00 ? 120 SER A H    5  
ATOM 8174  H HA   . SER A 1 117 ? -3.226  -14.967 -2.894  1.00 0.00 ? 120 SER A HA   5  
ATOM 8175  H HB2  . SER A 1 117 ? -2.340  -12.255 -3.903  1.00 0.00 ? 120 SER A HB2  5  
ATOM 8176  H HB3  . SER A 1 117 ? -3.403  -13.393 -4.730  1.00 0.00 ? 120 SER A HB3  5  
ATOM 8177  H HG   . SER A 1 117 ? -4.466  -12.989 -2.367  1.00 0.00 ? 120 SER A HG   5  
ATOM 8178  N N    . ARG A 1 118 ? -1.203  -15.966 -3.929  1.00 0.00 ? 121 ARG A N    5  
ATOM 8179  C CA   . ARG A 1 118 ? -0.045  -16.597 -4.551  1.00 0.00 ? 121 ARG A CA   5  
ATOM 8180  C C    . ARG A 1 118 ? -0.264  -16.797 -6.047  1.00 0.00 ? 121 ARG A C    5  
ATOM 8181  O O    . ARG A 1 118 ? -0.367  -17.928 -6.524  1.00 0.00 ? 121 ARG A O    5  
ATOM 8182  C CB   . ARG A 1 118 ? 0.239   -17.944 -3.884  1.00 0.00 ? 121 ARG A CB   5  
ATOM 8183  C CG   . ARG A 1 118 ? 1.306   -17.881 -2.804  1.00 0.00 ? 121 ARG A CG   5  
ATOM 8184  C CD   . ARG A 1 118 ? 2.674   -17.583 -3.397  1.00 0.00 ? 121 ARG A CD   5  
ATOM 8185  N NE   . ARG A 1 118 ? 3.117   -18.641 -4.308  1.00 0.00 ? 121 ARG A NE   5  
ATOM 8186  C CZ   . ARG A 1 118 ? 3.873   -18.425 -5.382  1.00 0.00 ? 121 ARG A CZ   5  
ATOM 8187  N NH1  . ARG A 1 118 ? 4.229   -17.191 -5.704  1.00 0.00 ? 121 ARG A NH1  5  
ATOM 8188  N NH2  . ARG A 1 118 ? 4.277   -19.435 -6.136  1.00 0.00 ? 121 ARG A NH2  5  
ATOM 8189  H H    . ARG A 1 118 ? -2.005  -16.515 -3.764  1.00 0.00 ? 121 ARG A H    5  
ATOM 8190  H HA   . ARG A 1 118 ? 0.805   -15.950 -4.406  1.00 0.00 ? 121 ARG A HA   5  
ATOM 8191  H HB2  . ARG A 1 118 ? -0.674  -18.305 -3.436  1.00 0.00 ? 121 ARG A HB2  5  
ATOM 8192  H HB3  . ARG A 1 118 ? 0.560   -18.646 -4.639  1.00 0.00 ? 121 ARG A HB3  5  
ATOM 8193  H HG2  . ARG A 1 118 ? 1.049   -17.102 -2.101  1.00 0.00 ? 121 ARG A HG2  5  
ATOM 8194  H HG3  . ARG A 1 118 ? 1.343   -18.832 -2.292  1.00 0.00 ? 121 ARG A HG3  5  
ATOM 8195  H HD2  . ARG A 1 118 ? 2.624   -16.651 -3.939  1.00 0.00 ? 121 ARG A HD2  5  
ATOM 8196  H HD3  . ARG A 1 118 ? 3.389   -17.493 -2.591  1.00 0.00 ? 121 ARG A HD3  5  
ATOM 8197  H HE   . ARG A 1 118 ? 2.841   -19.563 -4.098  1.00 0.00 ? 121 ARG A HE   5  
ATOM 8198  H HH12 . ARG A 1 118 ? 4.036   -16.839 -6.624  1.00 0.00 ? 121 ARG A HH12 5  
ATOM 8199  H HH21 . ARG A 1 118 ? 4.020   -20.377 -5.903  1.00 0.00 ? 121 ARG A HH21 5  
ATOM 8200  H HH22 . ARG A 1 118 ? 4.836   -19.260 -6.957  1.00 0.00 ? 121 ARG A HH22 5  
ATOM 8201  N N    . ASN A 1 119 ? -0.344  -15.694 -6.779  1.00 0.00 ? 122 ASN A N    5  
ATOM 8202  C CA   . ASN A 1 119 ? -0.505  -15.743 -8.228  1.00 0.00 ? 122 ASN A CA   5  
ATOM 8203  C C    . ASN A 1 119 ? -0.157  -14.383 -8.830  1.00 0.00 ? 122 ASN A C    5  
ATOM 8204  O O    . ASN A 1 119 ? -0.216  -13.362 -8.142  1.00 0.00 ? 122 ASN A O    5  
ATOM 8205  C CB   . ASN A 1 119 ? -1.939  -16.147 -8.596  1.00 0.00 ? 122 ASN A CB   5  
ATOM 8206  C CG   . ASN A 1 119 ? -2.108  -16.413 -10.082 1.00 0.00 ? 122 ASN A CG   5  
ATOM 8207  O OD1  . ASN A 1 119 ? -1.164  -16.799 -10.769 1.00 0.00 ? 122 ASN A OD1  5  
ATOM 8208  N ND2  . ASN A 1 119 ? -3.317  -16.225 -10.585 1.00 0.00 ? 122 ASN A ND2  5  
ATOM 8209  H H    . ASN A 1 119 ? -0.290  -14.821 -6.335  1.00 0.00 ? 122 ASN A H    5  
ATOM 8210  H HA   . ASN A 1 119 ? 0.182   -16.482 -8.613  1.00 0.00 ? 122 ASN A HA   5  
ATOM 8211  H HB2  . ASN A 1 119 ? -2.202  -17.047 -8.059  1.00 0.00 ? 122 ASN A HB2  5  
ATOM 8212  H HB3  . ASN A 1 119 ? -2.614  -15.355 -8.313  1.00 0.00 ? 122 ASN A HB3  5  
ATOM 8213  H HD21 . ASN A 1 119 ? -4.033  -15.932 -9.983  1.00 0.00 ? 122 ASN A HD21 5  
ATOM 8214  H HD22 . ASN A 1 119 ? -3.446  -16.381 -11.547 1.00 0.00 ? 122 ASN A HD22 5  
ATOM 8215  N N    . ASP A 1 120 ? 0.188   -14.369 -10.116 1.00 0.00 ? 123 ASP A N    5  
ATOM 8216  C CA   . ASP A 1 120 ? 0.663   -13.154 -10.786 1.00 0.00 ? 123 ASP A CA   5  
ATOM 8217  C C    . ASP A 1 120 ? -0.489  -12.229 -11.177 1.00 0.00 ? 123 ASP A C    5  
ATOM 8218  O O    . ASP A 1 120 ? -0.356  -11.389 -12.068 1.00 0.00 ? 123 ASP A O    5  
ATOM 8219  C CB   . ASP A 1 120 ? 1.499   -13.504 -12.024 1.00 0.00 ? 123 ASP A CB   5  
ATOM 8220  C CG   . ASP A 1 120 ? 0.715   -14.267 -13.074 1.00 0.00 ? 123 ASP A CG   5  
ATOM 8221  O OD1  . ASP A 1 120 ? 0.586   -15.503 -12.938 1.00 0.00 ? 123 ASP A OD1  5  
ATOM 8222  O OD2  . ASP A 1 120 ? 0.243   -13.645 -14.047 1.00 0.00 ? 123 ASP A OD2  5  
ATOM 8223  H H    . ASP A 1 120 ? 0.118   -15.202 -10.636 1.00 0.00 ? 123 ASP A H    5  
ATOM 8224  H HA   . ASP A 1 120 ? 1.294   -12.628 -10.083 1.00 0.00 ? 123 ASP A HA   5  
ATOM 8225  H HB2  . ASP A 1 120 ? 1.864   -12.591 -12.473 1.00 0.00 ? 123 ASP A HB2  5  
ATOM 8226  H HB3  . ASP A 1 120 ? 2.342   -14.109 -11.722 1.00 0.00 ? 123 ASP A HB3  5  
ATOM 8227  N N    . MET A 1 121 ? -1.620  -12.380 -10.501 1.00 0.00 ? 124 MET A N    5  
ATOM 8228  C CA   . MET A 1 121 ? -2.742  -11.467 -10.679 1.00 0.00 ? 124 MET A CA   5  
ATOM 8229  C C    . MET A 1 121 ? -2.644  -10.341 -9.663  1.00 0.00 ? 124 MET A C    5  
ATOM 8230  O O    . MET A 1 121 ? -3.437  -9.397  -9.668  1.00 0.00 ? 124 MET A O    5  
ATOM 8231  C CB   . MET A 1 121 ? -4.080  -12.198 -10.536 1.00 0.00 ? 124 MET A CB   5  
ATOM 8232  C CG   . MET A 1 121 ? -4.337  -13.215 -11.634 1.00 0.00 ? 124 MET A CG   5  
ATOM 8233  S SD   . MET A 1 121 ? -5.885  -14.108 -11.402 1.00 0.00 ? 124 MET A SD   5  
ATOM 8234  C CE   . MET A 1 121 ? -5.870  -15.175 -12.840 1.00 0.00 ? 124 MET A CE   5  
ATOM 8235  H H    . MET A 1 121 ? -1.696  -13.117 -9.863  1.00 0.00 ? 124 MET A H    5  
ATOM 8236  H HA   . MET A 1 121 ? -2.670  -11.046 -11.669 1.00 0.00 ? 124 MET A HA   5  
ATOM 8237  H HB2  . MET A 1 121 ? -4.098  -12.713 -9.588  1.00 0.00 ? 124 MET A HB2  5  
ATOM 8238  H HB3  . MET A 1 121 ? -4.877  -11.470 -10.555 1.00 0.00 ? 124 MET A HB3  5  
ATOM 8239  H HG2  . MET A 1 121 ? -4.375  -12.702 -12.583 1.00 0.00 ? 124 MET A HG2  5  
ATOM 8240  H HG3  . MET A 1 121 ? -3.526  -13.927 -11.645 1.00 0.00 ? 124 MET A HG3  5  
ATOM 8241  H HE1  . MET A 1 121 ? -5.875  -14.572 -13.736 1.00 0.00 ? 124 MET A HE1  5  
ATOM 8242  H HE2  . MET A 1 121 ? -4.981  -15.789 -12.824 1.00 0.00 ? 124 MET A HE2  5  
ATOM 8243  H HE3  . MET A 1 121 ? -6.745  -15.807 -12.827 1.00 0.00 ? 124 MET A HE3  5  
ATOM 8244  N N    . CYS A 1 122 ? -1.654  -10.452 -8.792  1.00 0.00 ? 125 CYS A N    5  
ATOM 8245  C CA   . CYS A 1 122 ? -1.389  -9.429  -7.798  1.00 0.00 ? 125 CYS A CA   5  
ATOM 8246  C C    . CYS A 1 122 ? -0.436  -8.387  -8.373  1.00 0.00 ? 125 CYS A C    5  
ATOM 8247  O O    . CYS A 1 122 ? 0.545   -8.721  -9.036  1.00 0.00 ? 125 CYS A O    5  
ATOM 8248  C CB   . CYS A 1 122 ? -0.799  -10.044 -6.526  1.00 0.00 ? 125 CYS A CB   5  
ATOM 8249  S SG   . CYS A 1 122 ? -0.408  -8.831  -5.221  1.00 0.00 ? 125 CYS A SG   5  
ATOM 8250  H H    . CYS A 1 122 ? -1.074  -11.241 -8.832  1.00 0.00 ? 125 CYS A H    5  
ATOM 8251  H HA   . CYS A 1 122 ? -2.325  -8.947  -7.557  1.00 0.00 ? 125 CYS A HA   5  
ATOM 8252  H HB2  . CYS A 1 122 ? -1.504  -10.751 -6.113  1.00 0.00 ? 125 CYS A HB2  5  
ATOM 8253  H HB3  . CYS A 1 122 ? 0.116   -10.562 -6.774  1.00 0.00 ? 125 CYS A HB3  5  
ATOM 8254  N N    . HIS A 1 123 ? -0.742  -7.127  -8.126  1.00 0.00 ? 126 HIS A N    5  
ATOM 8255  C CA   . HIS A 1 123 ? 0.063   -6.028  -8.624  1.00 0.00 ? 126 HIS A CA   5  
ATOM 8256  C C    . HIS A 1 123 ? 0.618   -5.249  -7.440  1.00 0.00 ? 126 HIS A C    5  
ATOM 8257  O O    . HIS A 1 123 ? -0.122  -4.929  -6.509  1.00 0.00 ? 126 HIS A O    5  
ATOM 8258  C CB   . HIS A 1 123 ? -0.783  -5.110  -9.517  1.00 0.00 ? 126 HIS A CB   5  
ATOM 8259  C CG   . HIS A 1 123 ? -1.477  -5.821  -10.642 1.00 0.00 ? 126 HIS A CG   5  
ATOM 8260  N ND1  . HIS A 1 123 ? -2.772  -6.291  -10.551 1.00 0.00 ? 126 HIS A ND1  5  
ATOM 8261  C CD2  . HIS A 1 123 ? -1.053  -6.139  -11.887 1.00 0.00 ? 126 HIS A CD2  5  
ATOM 8262  C CE1  . HIS A 1 123 ? -3.112  -6.868  -11.688 1.00 0.00 ? 126 HIS A CE1  5  
ATOM 8263  N NE2  . HIS A 1 123 ? -2.087  -6.789  -12.516 1.00 0.00 ? 126 HIS A NE2  5  
ATOM 8264  H H    . HIS A 1 123 ? -1.521  -6.930  -7.564  1.00 0.00 ? 126 HIS A H    5  
ATOM 8265  H HA   . HIS A 1 123 ? 0.882   -6.438  -9.198  1.00 0.00 ? 126 HIS A HA   5  
ATOM 8266  H HB2  . HIS A 1 123 ? -1.541  -4.633  -8.913  1.00 0.00 ? 126 HIS A HB2  5  
ATOM 8267  H HB3  . HIS A 1 123 ? -0.146  -4.351  -9.948  1.00 0.00 ? 126 HIS A HB3  5  
ATOM 8268  H HD1  . HIS A 1 123 ? -3.357  -6.213  -9.770  1.00 0.00 ? 126 HIS A HD1  5  
ATOM 8269  H HD2  . HIS A 1 123 ? -0.083  -5.917  -12.309 1.00 0.00 ? 126 HIS A HD2  5  
ATOM 8270  H HE1  . HIS A 1 123 ? -4.069  -7.318  -11.907 1.00 0.00 ? 126 HIS A HE1  5  
ATOM 8271  N N    . SER A 1 124 ? 1.912   -4.974  -7.458  1.00 0.00 ? 127 SER A N    5  
ATOM 8272  C CA   . SER A 1 124 ? 2.548   -4.239  -6.376  1.00 0.00 ? 127 SER A CA   5  
ATOM 8273  C C    . SER A 1 124 ? 1.990   -2.818  -6.289  1.00 0.00 ? 127 SER A C    5  
ATOM 8274  O O    . SER A 1 124 ? 1.912   -2.109  -7.297  1.00 0.00 ? 127 SER A O    5  
ATOM 8275  C CB   . SER A 1 124 ? 4.062   -4.198  -6.593  1.00 0.00 ? 127 SER A CB   5  
ATOM 8276  O OG   . SER A 1 124 ? 4.573   -5.501  -6.842  1.00 0.00 ? 127 SER A OG   5  
ATOM 8277  H H    . SER A 1 124 ? 2.459   -5.277  -8.211  1.00 0.00 ? 127 SER A H    5  
ATOM 8278  H HA   . SER A 1 124 ? 2.336   -4.758  -5.453  1.00 0.00 ? 127 SER A HA   5  
ATOM 8279  H HB2  . SER A 1 124 ? 4.288   -3.564  -7.440  1.00 0.00 ? 127 SER A HB2  5  
ATOM 8280  H HB3  . SER A 1 124 ? 4.540   -3.800  -5.707  1.00 0.00 ? 127 SER A HB3  5  
ATOM 8281  H HG   . SER A 1 124 ? 5.055   -5.806  -6.066  1.00 0.00 ? 127 SER A HG   5  
ATOM 8282  N N    . LEU A 1 125 ? 1.583   -2.418  -5.090  1.00 0.00 ? 128 LEU A N    5  
ATOM 8283  C CA   . LEU A 1 125 ? 1.045   -1.082  -4.881  1.00 0.00 ? 128 LEU A CA   5  
ATOM 8284  C C    . LEU A 1 125 ? 2.185   -0.093  -4.675  1.00 0.00 ? 128 LEU A C    5  
ATOM 8285  O O    . LEU A 1 125 ? 2.913   -0.160  -3.682  1.00 0.00 ? 128 LEU A O    5  
ATOM 8286  C CB   . LEU A 1 125 ? 0.083   -1.066  -3.684  1.00 0.00 ? 128 LEU A CB   5  
ATOM 8287  C CG   . LEU A 1 125 ? -0.803  0.183   -3.553  1.00 0.00 ? 128 LEU A CG   5  
ATOM 8288  C CD1  . LEU A 1 125 ? -2.037  -0.138  -2.727  1.00 0.00 ? 128 LEU A CD1  5  
ATOM 8289  C CD2  . LEU A 1 125 ? -0.037  1.335   -2.915  1.00 0.00 ? 128 LEU A CD2  5  
ATOM 8290  H H    . LEU A 1 125 ? 1.652   -3.031  -4.327  1.00 0.00 ? 128 LEU A H    5  
ATOM 8291  H HA   . LEU A 1 125 ? 0.501   -0.805  -5.771  1.00 0.00 ? 128 LEU A HA   5  
ATOM 8292  H HB2  . LEU A 1 125 ? -0.563  -1.931  -3.759  1.00 0.00 ? 128 LEU A HB2  5  
ATOM 8293  H HB3  . LEU A 1 125 ? 0.671   -1.156  -2.782  1.00 0.00 ? 128 LEU A HB3  5  
ATOM 8294  H HG   . LEU A 1 125 ? -1.127  0.495   -4.537  1.00 0.00 ? 128 LEU A HG   5  
ATOM 8295  H HD11 . LEU A 1 125 ? -2.600  -0.922  -3.213  1.00 0.00 ? 128 LEU A HD11 5  
ATOM 8296  H HD12 . LEU A 1 125 ? -1.736  -0.465  -1.744  1.00 0.00 ? 128 LEU A HD12 5  
ATOM 8297  H HD13 . LEU A 1 125 ? -2.652  0.746   -2.639  1.00 0.00 ? 128 LEU A HD13 5  
ATOM 8298  H HD21 . LEU A 1 125 ? -0.678  2.202   -2.850  1.00 0.00 ? 128 LEU A HD21 5  
ATOM 8299  H HD22 . LEU A 1 125 ? 0.284   1.050   -1.924  1.00 0.00 ? 128 LEU A HD22 5  
ATOM 8300  H HD23 . LEU A 1 125 ? 0.826   1.570   -3.520  1.00 0.00 ? 128 LEU A HD23 5  
ATOM 8301  N N    . GLY A 1 126 ? 2.337   0.808   -5.629  1.00 0.00 ? 129 GLY A N    5  
ATOM 8302  C CA   . GLY A 1 126 ? 3.364   1.815   -5.553  1.00 0.00 ? 129 GLY A CA   5  
ATOM 8303  C C    . GLY A 1 126 ? 2.824   3.127   -5.046  1.00 0.00 ? 129 GLY A C    5  
ATOM 8304  O O    . GLY A 1 126 ? 1.851   3.656   -5.588  1.00 0.00 ? 129 GLY A O    5  
ATOM 8305  H H    . GLY A 1 126 ? 1.723   0.797   -6.396  1.00 0.00 ? 129 GLY A H    5  
ATOM 8306  H HA2  . GLY A 1 126 ? 4.145   1.474   -4.894  1.00 0.00 ? 129 GLY A HA2  5  
ATOM 8307  H HA3  . GLY A 1 126 ? 3.778   1.972   -6.535  1.00 0.00 ? 129 GLY A HA3  5  
ATOM 8308  N N    . LEU A 1 127 ? 3.445   3.646   -4.007  1.00 0.00 ? 130 LEU A N    5  
ATOM 8309  C CA   . LEU A 1 127 ? 3.069   4.930   -3.461  1.00 0.00 ? 130 LEU A CA   5  
ATOM 8310  C C    . LEU A 1 127 ? 4.143   5.957   -3.788  1.00 0.00 ? 130 LEU A C    5  
ATOM 8311  O O    . LEU A 1 127 ? 5.303   5.803   -3.399  1.00 0.00 ? 130 LEU A O    5  
ATOM 8312  C CB   . LEU A 1 127 ? 2.867   4.828   -1.948  1.00 0.00 ? 130 LEU A CB   5  
ATOM 8313  C CG   . LEU A 1 127 ? 2.485   6.134   -1.245  1.00 0.00 ? 130 LEU A CG   5  
ATOM 8314  C CD1  . LEU A 1 127 ? 1.214   6.721   -1.843  1.00 0.00 ? 130 LEU A CD1  5  
ATOM 8315  C CD2  . LEU A 1 127 ? 2.315   5.899   0.250   1.00 0.00 ? 130 LEU A CD2  5  
ATOM 8316  H H    . LEU A 1 127 ? 4.191   3.150   -3.596  1.00 0.00 ? 130 LEU A H    5  
ATOM 8317  H HA   . LEU A 1 127 ? 2.137   5.229   -3.925  1.00 0.00 ? 130 LEU A HA   5  
ATOM 8318  H HB2  . LEU A 1 127 ? 2.091   4.098   -1.758  1.00 0.00 ? 130 LEU A HB2  5  
ATOM 8319  H HB3  . LEU A 1 127 ? 3.790   4.469   -1.511  1.00 0.00 ? 130 LEU A HB3  5  
ATOM 8320  H HG   . LEU A 1 127 ? 3.281   6.855   -1.384  1.00 0.00 ? 130 LEU A HG   5  
ATOM 8321  H HD11 . LEU A 1 127 ? 1.397   7.014   -2.865  1.00 0.00 ? 130 LEU A HD11 5  
ATOM 8322  H HD12 . LEU A 1 127 ? 0.427   5.982   -1.815  1.00 0.00 ? 130 LEU A HD12 5  
ATOM 8323  H HD13 . LEU A 1 127 ? 0.914   7.586   -1.269  1.00 0.00 ? 130 LEU A HD13 5  
ATOM 8324  H HD21 . LEU A 1 127 ? 3.241   5.526   0.665   1.00 0.00 ? 130 LEU A HD21 5  
ATOM 8325  H HD22 . LEU A 1 127 ? 2.056   6.830   0.735   1.00 0.00 ? 130 LEU A HD22 5  
ATOM 8326  H HD23 . LEU A 1 127 ? 1.530   5.176   0.415   1.00 0.00 ? 130 LEU A HD23 5  
ATOM 8327  N N    . THR A 1 128 ? 3.766   6.983   -4.529  1.00 0.00 ? 131 THR A N    5  
ATOM 8328  C CA   . THR A 1 128 ? 4.689   8.037   -4.897  1.00 0.00 ? 131 THR A CA   5  
ATOM 8329  C C    . THR A 1 128 ? 4.362   9.315   -4.137  1.00 0.00 ? 131 THR A C    5  
ATOM 8330  O O    . THR A 1 128 ? 3.479   10.074  -4.527  1.00 0.00 ? 131 THR A O    5  
ATOM 8331  C CB   . THR A 1 128 ? 4.642   8.305   -6.413  1.00 0.00 ? 131 THR A CB   5  
ATOM 8332  O OG1  . THR A 1 128 ? 4.829   7.072   -7.119  1.00 0.00 ? 131 THR A OG1  5  
ATOM 8333  C CG2  . THR A 1 128 ? 5.713   9.305   -6.832  1.00 0.00 ? 131 THR A CG2  5  
ATOM 8334  H H    . THR A 1 128 ? 2.831   7.039   -4.834  1.00 0.00 ? 131 THR A H    5  
ATOM 8335  H HA   . THR A 1 128 ? 5.687   7.718   -4.635  1.00 0.00 ? 131 THR A HA   5  
ATOM 8336  H HB   . THR A 1 128 ? 3.673   8.711   -6.665  1.00 0.00 ? 131 THR A HB   5  
ATOM 8337  H HG1  . THR A 1 128 ? 4.590   6.340   -6.543  1.00 0.00 ? 131 THR A HG1  5  
ATOM 8338  H HG21 . THR A 1 128 ? 5.613   9.519   -7.887  1.00 0.00 ? 131 THR A HG21 5  
ATOM 8339  H HG22 . THR A 1 128 ? 6.692   8.890   -6.641  1.00 0.00 ? 131 THR A HG22 5  
ATOM 8340  H HG23 . THR A 1 128 ? 5.594   10.217  -6.268  1.00 0.00 ? 131 THR A HG23 5  
ATOM 8341  N N    . CYS A 1 129 ? 5.061   9.527   -3.039  1.00 0.00 ? 132 CYS A N    5  
ATOM 8342  C CA   . CYS A 1 129 ? 4.892   10.727  -2.243  1.00 0.00 ? 132 CYS A CA   5  
ATOM 8343  C C    . CYS A 1 129 ? 5.891   11.783  -2.695  1.00 0.00 ? 132 CYS A C    5  
ATOM 8344  O O    . CYS A 1 129 ? 6.958   11.457  -3.222  1.00 0.00 ? 132 CYS A O    5  
ATOM 8345  C CB   . CYS A 1 129 ? 5.106   10.416  -0.759  1.00 0.00 ? 132 CYS A CB   5  
ATOM 8346  S SG   . CYS A 1 129 ? 4.134   9.006   -0.134  1.00 0.00 ? 132 CYS A SG   5  
ATOM 8347  H H    . CYS A 1 129 ? 5.726   8.856   -2.755  1.00 0.00 ? 132 CYS A H    5  
ATOM 8348  H HA   . CYS A 1 129 ? 3.889   11.099  -2.394  1.00 0.00 ? 132 CYS A HA   5  
ATOM 8349  H HB2  . CYS A 1 129 ? 6.150   10.191  -0.593  1.00 0.00 ? 132 CYS A HB2  5  
ATOM 8350  H HB3  . CYS A 1 129 ? 4.836   11.285  -0.177  1.00 0.00 ? 132 CYS A HB3  5  
ATOM 8351  N N    . LEU A 1 130 ? 5.532   13.044  -2.510  1.00 0.00 ? 133 LEU A N    5  
ATOM 8352  C CA   . LEU A 1 130 ? 6.413   14.148  -2.850  1.00 0.00 ? 133 LEU A CA   5  
ATOM 8353  C C    . LEU A 1 130 ? 7.604   14.167  -1.896  1.00 0.00 ? 133 LEU A C    5  
ATOM 8354  O O    . LEU A 1 130 ? 7.450   13.901  -0.706  1.00 0.00 ? 133 LEU A O    5  
ATOM 8355  C CB   . LEU A 1 130 ? 5.645   15.467  -2.753  1.00 0.00 ? 133 LEU A CB   5  
ATOM 8356  C CG   . LEU A 1 130 ? 6.291   16.658  -3.457  1.00 0.00 ? 133 LEU A CG   5  
ATOM 8357  C CD1  . LEU A 1 130 ? 6.026   16.602  -4.951  1.00 0.00 ? 133 LEU A CD1  5  
ATOM 8358  C CD2  . LEU A 1 130 ? 5.774   17.958  -2.866  1.00 0.00 ? 133 LEU A CD2  5  
ATOM 8359  H H    . LEU A 1 130 ? 4.641   13.240  -2.141  1.00 0.00 ? 133 LEU A H    5  
ATOM 8360  H HA   . LEU A 1 130 ? 6.763   14.007  -3.861  1.00 0.00 ? 133 LEU A HA   5  
ATOM 8361  H HB2  . LEU A 1 130 ? 4.662   15.318  -3.174  1.00 0.00 ? 133 LEU A HB2  5  
ATOM 8362  H HB3  . LEU A 1 130 ? 5.532   15.717  -1.709  1.00 0.00 ? 133 LEU A HB3  5  
ATOM 8363  H HG   . LEU A 1 130 ? 7.360   16.622  -3.306  1.00 0.00 ? 133 LEU A HG   5  
ATOM 8364  H HD11 . LEU A 1 130 ? 4.959   16.564  -5.125  1.00 0.00 ? 133 LEU A HD11 5  
ATOM 8365  H HD12 . LEU A 1 130 ? 6.437   17.482  -5.423  1.00 0.00 ? 133 LEU A HD12 5  
ATOM 8366  H HD13 . LEU A 1 130 ? 6.490   15.721  -5.368  1.00 0.00 ? 133 LEU A HD13 5  
ATOM 8367  H HD21 . LEU A 1 130 ? 6.236   18.792  -3.372  1.00 0.00 ? 133 LEU A HD21 5  
ATOM 8368  H HD22 . LEU A 1 130 ? 4.703   18.008  -2.990  1.00 0.00 ? 133 LEU A HD22 5  
ATOM 8369  H HD23 . LEU A 1 130 ? 6.018   17.995  -1.815  1.00 0.00 ? 133 LEU A HD23 5  
ATOM 8370  N N    . GLU A 1 131 ? 8.787   14.452  -2.417  1.00 0.00 ? 134 GLU A N    5  
ATOM 8371  C CA   . GLU A 1 131 ? 9.972   14.562  -1.577  1.00 0.00 ? 134 GLU A CA   5  
ATOM 8372  C C    . GLU A 1 131 ? 10.100  15.983  -1.055  1.00 0.00 ? 134 GLU A C    5  
ATOM 8373  O O    . GLU A 1 131 ? 10.447  16.876  -1.856  1.00 0.00 ? 134 GLU A O    5  
ATOM 8374  C CB   . GLU A 1 131 ? 11.242  14.178  -2.344  1.00 0.00 ? 134 GLU A CB   5  
ATOM 8375  C CG   . GLU A 1 131 ? 11.288  12.728  -2.793  1.00 0.00 ? 134 GLU A CG   5  
ATOM 8376  C CD   . GLU A 1 131 ? 12.596  12.388  -3.471  1.00 0.00 ? 134 GLU A CD   5  
ATOM 8377  O OE1  . GLU A 1 131 ? 12.719  12.637  -4.690  1.00 0.00 ? 134 GLU A OE1  5  
ATOM 8378  O OE2  . GLU A 1 131 ? 13.512  11.884  -2.790  1.00 0.00 ? 134 GLU A OE2  5  
ATOM 8379  O OXT  . GLU A 1 131 ? 9.852   16.205  0.149   1.00 0.00 ? 134 GLU A OXT  5  
ATOM 8380  H H    . GLU A 1 131 ? 8.864   14.606  -3.381  1.00 0.00 ? 134 GLU A H    5  
ATOM 8381  H HA   . GLU A 1 131 ? 9.850   13.894  -0.738  1.00 0.00 ? 134 GLU A HA   5  
ATOM 8382  H HB2  . GLU A 1 131 ? 11.321  14.803  -3.220  1.00 0.00 ? 134 GLU A HB2  5  
ATOM 8383  H HB3  . GLU A 1 131 ? 12.098  14.361  -1.709  1.00 0.00 ? 134 GLU A HB3  5  
ATOM 8384  H HG2  . GLU A 1 131 ? 11.170  12.088  -1.932  1.00 0.00 ? 134 GLU A HG2  5  
ATOM 8385  H HG3  . GLU A 1 131 ? 10.482  12.550  -3.489  1.00 0.00 ? 134 GLU A HG3  5  
ATOM 8386  N N    . ARG A 1 22  ? -9.277  -1.374  15.059  1.00 0.00 ? 25  ARG A N    6  
ATOM 8387  C CA   . ARG A 1 22  ? -9.200  -1.762  13.632  1.00 0.00 ? 25  ARG A CA   6  
ATOM 8388  C C    . ARG A 1 22  ? -7.771  -1.603  13.128  1.00 0.00 ? 25  ARG A C    6  
ATOM 8389  O O    . ARG A 1 22  ? -6.857  -1.345  13.910  1.00 0.00 ? 25  ARG A O    6  
ATOM 8390  C CB   . ARG A 1 22  ? -10.128 -0.884  12.787  1.00 0.00 ? 25  ARG A CB   6  
ATOM 8391  C CG   . ARG A 1 22  ? -11.562 -0.832  13.288  1.00 0.00 ? 25  ARG A CG   6  
ATOM 8392  C CD   . ARG A 1 22  ? -12.441 -0.005  12.363  1.00 0.00 ? 25  ARG A CD   6  
ATOM 8393  N NE   . ARG A 1 22  ? -11.847 1.301   12.072  1.00 0.00 ? 25  ARG A NE   6  
ATOM 8394  C CZ   . ARG A 1 22  ? -12.174 2.046   11.020  1.00 0.00 ? 25  ARG A CZ   6  
ATOM 8395  N NH1  . ARG A 1 22  ? -13.126 1.646   10.192  1.00 0.00 ? 25  ARG A NH1  6  
ATOM 8396  N NH2  . ARG A 1 22  ? -11.545 3.187   10.789  1.00 0.00 ? 25  ARG A NH2  6  
ATOM 8397  H HA   . ARG A 1 22  ? -9.498  -2.797  13.538  1.00 0.00 ? 25  ARG A HA   6  
ATOM 8398  H HB2  . ARG A 1 22  ? -9.739  0.123   12.779  1.00 0.00 ? 25  ARG A HB2  6  
ATOM 8399  H HB3  . ARG A 1 22  ? -10.138 -1.265  11.776  1.00 0.00 ? 25  ARG A HB3  6  
ATOM 8400  H HG2  . ARG A 1 22  ? -11.954 -1.837  13.336  1.00 0.00 ? 25  ARG A HG2  6  
ATOM 8401  H HG3  . ARG A 1 22  ? -11.572 -0.389  14.272  1.00 0.00 ? 25  ARG A HG3  6  
ATOM 8402  H HD2  . ARG A 1 22  ? -12.578 -0.543  11.437  1.00 0.00 ? 25  ARG A HD2  6  
ATOM 8403  H HD3  . ARG A 1 22  ? -13.399 0.144   12.838  1.00 0.00 ? 25  ARG A HD3  6  
ATOM 8404  H HE   . ARG A 1 22  ? -11.154 1.628   12.688  1.00 0.00 ? 25  ARG A HE   6  
ATOM 8405  H HH12 . ARG A 1 22  ? -14.095 1.756   10.446  1.00 0.00 ? 25  ARG A HH12 6  
ATOM 8406  H HH21 . ARG A 1 22  ? -10.814 3.494   11.413  1.00 0.00 ? 25  ARG A HH21 6  
ATOM 8407  H HH22 . ARG A 1 22  ? -11.793 3.750   9.991   1.00 0.00 ? 25  ARG A HH22 6  
ATOM 8408  N N    . LEU A 1 23  ? -7.586  -1.765  11.824  1.00 0.00 ? 26  LEU A N    6  
ATOM 8409  C CA   . LEU A 1 23  ? -6.285  -1.580  11.197  1.00 0.00 ? 26  LEU A CA   6  
ATOM 8410  C C    . LEU A 1 23  ? -6.412  -0.666  9.986   1.00 0.00 ? 26  LEU A C    6  
ATOM 8411  O O    . LEU A 1 23  ? -6.318  -1.116  8.852   1.00 0.00 ? 26  LEU A O    6  
ATOM 8412  C CB   . LEU A 1 23  ? -5.693  -2.926  10.761  1.00 0.00 ? 26  LEU A CB   6  
ATOM 8413  C CG   . LEU A 1 23  ? -5.352  -3.902  11.890  1.00 0.00 ? 26  LEU A CG   6  
ATOM 8414  C CD1  . LEU A 1 23  ? -4.930  -5.241  11.312  1.00 0.00 ? 26  LEU A CD1  6  
ATOM 8415  C CD2  . LEU A 1 23  ? -4.249  -3.342  12.775  1.00 0.00 ? 26  LEU A CD2  6  
ATOM 8416  H H    . LEU A 1 23  ? -8.353  -2.021  11.260  1.00 0.00 ? 26  LEU A H    6  
ATOM 8417  H HA   . LEU A 1 23  ? -5.629  -1.117  11.916  1.00 0.00 ? 26  LEU A HA   6  
ATOM 8418  H HB2  . LEU A 1 23  ? -6.404  -3.407  10.104  1.00 0.00 ? 26  LEU A HB2  6  
ATOM 8419  H HB3  . LEU A 1 23  ? -4.791  -2.732  10.199  1.00 0.00 ? 26  LEU A HB3  6  
ATOM 8420  H HG   . LEU A 1 23  ? -6.229  -4.061  12.500  1.00 0.00 ? 26  LEU A HG   6  
ATOM 8421  H HD11 . LEU A 1 23  ? -5.745  -5.661  10.743  1.00 0.00 ? 26  LEU A HD11 6  
ATOM 8422  H HD12 . LEU A 1 23  ? -4.076  -5.099  10.666  1.00 0.00 ? 26  LEU A HD12 6  
ATOM 8423  H HD13 . LEU A 1 23  ? -4.665  -5.912  12.115  1.00 0.00 ? 26  LEU A HD13 6  
ATOM 8424  H HD21 . LEU A 1 23  ? -3.380  -3.121  12.173  1.00 0.00 ? 26  LEU A HD21 6  
ATOM 8425  H HD22 . LEU A 1 23  ? -4.595  -2.439  13.255  1.00 0.00 ? 26  LEU A HD22 6  
ATOM 8426  H HD23 . LEU A 1 23  ? -3.989  -4.071  13.528  1.00 0.00 ? 26  LEU A HD23 6  
ATOM 8427  N N    . SER A 1 24  ? -6.638  0.612   10.223  1.00 0.00 ? 27  SER A N    6  
ATOM 8428  C CA   . SER A 1 24  ? -6.784  1.566   9.135   1.00 0.00 ? 27  SER A CA   6  
ATOM 8429  C C    . SER A 1 24  ? -5.617  2.539   9.148   1.00 0.00 ? 27  SER A C    6  
ATOM 8430  O O    . SER A 1 24  ? -5.055  2.816   10.204  1.00 0.00 ? 27  SER A O    6  
ATOM 8431  C CB   . SER A 1 24  ? -8.109  2.313   9.277   1.00 0.00 ? 27  SER A CB   6  
ATOM 8432  O OG   . SER A 1 24  ? -9.191  1.403   9.360   1.00 0.00 ? 27  SER A OG   6  
ATOM 8433  H H    . SER A 1 24  ? -6.686  0.933   11.153  1.00 0.00 ? 27  SER A H    6  
ATOM 8434  H HA   . SER A 1 24  ? -6.779  1.019   8.204   1.00 0.00 ? 27  SER A HA   6  
ATOM 8435  H HB2  . SER A 1 24  ? -8.086  2.911   10.175  1.00 0.00 ? 27  SER A HB2  6  
ATOM 8436  H HB3  . SER A 1 24  ? -8.254  2.954   8.421   1.00 0.00 ? 27  SER A HB3  6  
ATOM 8437  H HG   . SER A 1 24  ? -9.130  0.910   10.182  1.00 0.00 ? 27  SER A HG   6  
ATOM 8438  N N    . TRP A 1 25  ? -5.250  3.067   7.984   1.00 0.00 ? 28  TRP A N    6  
ATOM 8439  C CA   . TRP A 1 25  ? -4.082  3.938   7.902   1.00 0.00 ? 28  TRP A CA   6  
ATOM 8440  C C    . TRP A 1 25  ? -4.366  5.328   8.466   1.00 0.00 ? 28  TRP A C    6  
ATOM 8441  O O    . TRP A 1 25  ? -3.571  6.249   8.297   1.00 0.00 ? 28  TRP A O    6  
ATOM 8442  C CB   . TRP A 1 25  ? -3.521  4.020   6.468   1.00 0.00 ? 28  TRP A CB   6  
ATOM 8443  C CG   . TRP A 1 25  ? -4.431  4.632   5.428   1.00 0.00 ? 28  TRP A CG   6  
ATOM 8444  C CD1  . TRP A 1 25  ? -5.366  5.614   5.607   1.00 0.00 ? 28  TRP A CD1  6  
ATOM 8445  C CD2  . TRP A 1 25  ? -4.449  4.319   4.028   1.00 0.00 ? 28  TRP A CD2  6  
ATOM 8446  N NE1  . TRP A 1 25  ? -5.973  5.914   4.412   1.00 0.00 ? 28  TRP A NE1  6  
ATOM 8447  C CE2  . TRP A 1 25  ? -5.425  5.136   3.427   1.00 0.00 ? 28  TRP A CE2  6  
ATOM 8448  C CE3  . TRP A 1 25  ? -3.735  3.425   3.224   1.00 0.00 ? 28  TRP A CE3  6  
ATOM 8449  C CZ2  . TRP A 1 25  ? -5.706  5.081   2.063   1.00 0.00 ? 28  TRP A CZ2  6  
ATOM 8450  C CZ3  . TRP A 1 25  ? -4.014  3.372   1.872   1.00 0.00 ? 28  TRP A CZ3  6  
ATOM 8451  C CH2  . TRP A 1 25  ? -4.992  4.199   1.302   1.00 0.00 ? 28  TRP A CH2  6  
ATOM 8452  H H    . TRP A 1 25  ? -5.764  2.861   7.168   1.00 0.00 ? 28  TRP A H    6  
ATOM 8453  H HA   . TRP A 1 25  ? -3.325  3.488   8.529   1.00 0.00 ? 28  TRP A HA   6  
ATOM 8454  H HB2  . TRP A 1 25  ? -2.616  4.608   6.489   1.00 0.00 ? 28  TRP A HB2  6  
ATOM 8455  H HB3  . TRP A 1 25  ? -3.276  3.018   6.141   1.00 0.00 ? 28  TRP A HB3  6  
ATOM 8456  H HD1  . TRP A 1 25  ? -5.593  6.071   6.559   1.00 0.00 ? 28  TRP A HD1  6  
ATOM 8457  H HE1  . TRP A 1 25  ? -6.681  6.584   4.284   1.00 0.00 ? 28  TRP A HE1  6  
ATOM 8458  H HE3  . TRP A 1 25  ? -2.976  2.780   3.645   1.00 0.00 ? 28  TRP A HE3  6  
ATOM 8459  H HZ2  . TRP A 1 25  ? -6.457  5.711   1.609   1.00 0.00 ? 28  TRP A HZ2  6  
ATOM 8460  H HZ3  . TRP A 1 25  ? -3.470  2.687   1.237   1.00 0.00 ? 28  TRP A HZ3  6  
ATOM 8461  H HH2  . TRP A 1 25  ? -5.176  4.124   0.241   1.00 0.00 ? 28  TRP A HH2  6  
ATOM 8462  N N    . TYR A 1 26  ? -5.507  5.473   9.128   1.00 0.00 ? 29  TYR A N    6  
ATOM 8463  C CA   . TYR A 1 26  ? -5.832  6.699   9.835   1.00 0.00 ? 29  TYR A CA   6  
ATOM 8464  C C    . TYR A 1 26  ? -5.427  6.578   11.298  1.00 0.00 ? 29  TYR A C    6  
ATOM 8465  O O    . TYR A 1 26  ? -5.301  7.578   12.008  1.00 0.00 ? 29  TYR A O    6  
ATOM 8466  C CB   . TYR A 1 26  ? -7.326  7.013   9.724   1.00 0.00 ? 29  TYR A CB   6  
ATOM 8467  C CG   . TYR A 1 26  ? -7.751  7.393   8.328   1.00 0.00 ? 29  TYR A CG   6  
ATOM 8468  C CD1  . TYR A 1 26  ? -7.416  8.632   7.803   1.00 0.00 ? 29  TYR A CD1  6  
ATOM 8469  C CD2  . TYR A 1 26  ? -8.474  6.515   7.531   1.00 0.00 ? 29  TYR A CD2  6  
ATOM 8470  C CE1  . TYR A 1 26  ? -7.790  8.989   6.528   1.00 0.00 ? 29  TYR A CE1  6  
ATOM 8471  C CE2  . TYR A 1 26  ? -8.851  6.866   6.250   1.00 0.00 ? 29  TYR A CE2  6  
ATOM 8472  C CZ   . TYR A 1 26  ? -8.506  8.104   5.756   1.00 0.00 ? 29  TYR A CZ   6  
ATOM 8473  O OH   . TYR A 1 26  ? -8.874  8.460   4.484   1.00 0.00 ? 29  TYR A OH   6  
ATOM 8474  H H    . TYR A 1 26  ? -6.143  4.729   9.146   1.00 0.00 ? 29  TYR A H    6  
ATOM 8475  H HA   . TYR A 1 26  ? -5.266  7.501   9.384   1.00 0.00 ? 29  TYR A HA   6  
ATOM 8476  H HB2  . TYR A 1 26  ? -7.894  6.146   10.020  1.00 0.00 ? 29  TYR A HB2  6  
ATOM 8477  H HB3  . TYR A 1 26  ? -7.566  7.837   10.381  1.00 0.00 ? 29  TYR A HB3  6  
ATOM 8478  H HD1  . TYR A 1 26  ? -6.856  9.324   8.410   1.00 0.00 ? 29  TYR A HD1  6  
ATOM 8479  H HD2  . TYR A 1 26  ? -8.743  5.547   7.922   1.00 0.00 ? 29  TYR A HD2  6  
ATOM 8480  H HE1  . TYR A 1 26  ? -7.521  9.960   6.138   1.00 0.00 ? 29  TYR A HE1  6  
ATOM 8481  H HE2  . TYR A 1 26  ? -9.415  6.173   5.642   1.00 0.00 ? 29  TYR A HE2  6  
ATOM 8482  H HH   . TYR A 1 26  ? -9.827  8.325   4.375   1.00 0.00 ? 29  TYR A HH   6  
ATOM 8483  N N    . ASP A 1 27  ? -5.228  5.343   11.745  1.00 0.00 ? 30  ASP A N    6  
ATOM 8484  C CA   . ASP A 1 27  ? -4.763  5.089   13.097  1.00 0.00 ? 30  ASP A CA   6  
ATOM 8485  C C    . ASP A 1 27  ? -3.319  5.546   13.223  1.00 0.00 ? 30  ASP A C    6  
ATOM 8486  O O    . ASP A 1 27  ? -2.482  5.240   12.373  1.00 0.00 ? 30  ASP A O    6  
ATOM 8487  C CB   . ASP A 1 27  ? -4.876  3.600   13.444  1.00 0.00 ? 30  ASP A CB   6  
ATOM 8488  C CG   . ASP A 1 27  ? -6.310  3.116   13.547  1.00 0.00 ? 30  ASP A CG   6  
ATOM 8489  O OD1  . ASP A 1 27  ? -6.937  2.847   12.500  1.00 0.00 ? 30  ASP A OD1  6  
ATOM 8490  O OD2  . ASP A 1 27  ? -6.813  2.989   14.684  1.00 0.00 ? 30  ASP A OD2  6  
ATOM 8491  H H    . ASP A 1 27  ? -5.379  4.582   11.145  1.00 0.00 ? 30  ASP A H    6  
ATOM 8492  H HA   . ASP A 1 27  ? -5.375  5.662   13.778  1.00 0.00 ? 30  ASP A HA   6  
ATOM 8493  H HB2  . ASP A 1 27  ? -4.379  3.027   12.683  1.00 0.00 ? 30  ASP A HB2  6  
ATOM 8494  H HB3  . ASP A 1 27  ? -4.390  3.424   14.391  1.00 0.00 ? 30  ASP A HB3  6  
ATOM 8495  N N    . PRO A 1 28  ? -3.012  6.304   14.279  1.00 0.00 ? 31  PRO A N    6  
ATOM 8496  C CA   . PRO A 1 28  ? -1.684  6.886   14.473  1.00 0.00 ? 31  PRO A CA   6  
ATOM 8497  C C    . PRO A 1 28  ? -0.628  5.836   14.791  1.00 0.00 ? 31  PRO A C    6  
ATOM 8498  O O    . PRO A 1 28  ? 0.567   6.077   14.632  1.00 0.00 ? 31  PRO A O    6  
ATOM 8499  C CB   . PRO A 1 28  ? -1.880  7.834   15.657  1.00 0.00 ? 31  PRO A CB   6  
ATOM 8500  C CG   . PRO A 1 28  ? -3.049  7.290   16.396  1.00 0.00 ? 31  PRO A CG   6  
ATOM 8501  C CD   . PRO A 1 28  ? -3.936  6.651   15.368  1.00 0.00 ? 31  PRO A CD   6  
ATOM 8502  H HA   . PRO A 1 28  ? -1.374  7.451   13.609  1.00 0.00 ? 31  PRO A HA   6  
ATOM 8503  H HB2  . PRO A 1 28  ? -0.992  7.834   16.269  1.00 0.00 ? 31  PRO A HB2  6  
ATOM 8504  H HB3  . PRO A 1 28  ? -2.073  8.833   15.295  1.00 0.00 ? 31  PRO A HB3  6  
ATOM 8505  H HG2  . PRO A 1 28  ? -2.719  6.554   17.114  1.00 0.00 ? 31  PRO A HG2  6  
ATOM 8506  H HG3  . PRO A 1 28  ? -3.573  8.092   16.894  1.00 0.00 ? 31  PRO A HG3  6  
ATOM 8507  H HD2  . PRO A 1 28  ? -4.402  5.764   15.769  1.00 0.00 ? 31  PRO A HD2  6  
ATOM 8508  H HD3  . PRO A 1 28  ? -4.682  7.352   15.027  1.00 0.00 ? 31  PRO A HD3  6  
ATOM 8509  N N    . ASP A 1 29  ? -1.072  4.668   15.230  1.00 0.00 ? 32  ASP A N    6  
ATOM 8510  C CA   . ASP A 1 29  ? -0.159  3.589   15.577  1.00 0.00 ? 32  ASP A CA   6  
ATOM 8511  C C    . ASP A 1 29  ? 0.005   2.622   14.411  1.00 0.00 ? 32  ASP A C    6  
ATOM 8512  O O    . ASP A 1 29  ? 0.759   1.652   14.501  1.00 0.00 ? 32  ASP A O    6  
ATOM 8513  C CB   . ASP A 1 29  ? -0.663  2.836   16.809  1.00 0.00 ? 32  ASP A CB   6  
ATOM 8514  C CG   . ASP A 1 29  ? -1.916  2.028   16.532  1.00 0.00 ? 32  ASP A CG   6  
ATOM 8515  O OD1  . ASP A 1 29  ? -2.973  2.636   16.250  1.00 0.00 ? 32  ASP A OD1  6  
ATOM 8516  O OD2  . ASP A 1 29  ? -1.850  0.785   16.604  1.00 0.00 ? 32  ASP A OD2  6  
ATOM 8517  H H    . ASP A 1 29  ? -2.039  4.526   15.323  1.00 0.00 ? 32  ASP A H    6  
ATOM 8518  H HA   . ASP A 1 29  ? 0.802   4.029   15.802  1.00 0.00 ? 32  ASP A HA   6  
ATOM 8519  H HB2  . ASP A 1 29  ? 0.108   2.162   17.148  1.00 0.00 ? 32  ASP A HB2  6  
ATOM 8520  H HB3  . ASP A 1 29  ? -0.882  3.547   17.591  1.00 0.00 ? 32  ASP A HB3  6  
ATOM 8521  N N    . PHE A 1 30  ? -0.696  2.894   13.313  1.00 0.00 ? 33  PHE A N    6  
ATOM 8522  C CA   . PHE A 1 30  ? -0.623  2.041   12.139  1.00 0.00 ? 33  PHE A CA   6  
ATOM 8523  C C    . PHE A 1 30  ? 0.680   2.303   11.398  1.00 0.00 ? 33  PHE A C    6  
ATOM 8524  O O    . PHE A 1 30  ? 0.844   3.340   10.751  1.00 0.00 ? 33  PHE A O    6  
ATOM 8525  C CB   . PHE A 1 30  ? -1.815  2.288   11.212  1.00 0.00 ? 33  PHE A CB   6  
ATOM 8526  C CG   . PHE A 1 30  ? -1.946  1.270   10.116  1.00 0.00 ? 33  PHE A CG   6  
ATOM 8527  C CD1  . PHE A 1 30  ? -2.572  0.059   10.359  1.00 0.00 ? 33  PHE A CD1  6  
ATOM 8528  C CD2  . PHE A 1 30  ? -1.447  1.521   8.847   1.00 0.00 ? 33  PHE A CD2  6  
ATOM 8529  C CE1  . PHE A 1 30  ? -2.702  -0.882  9.358   1.00 0.00 ? 33  PHE A CE1  6  
ATOM 8530  C CE2  . PHE A 1 30  ? -1.575  0.584   7.841   1.00 0.00 ? 33  PHE A CE2  6  
ATOM 8531  C CZ   . PHE A 1 30  ? -2.202  -0.620  8.098   1.00 0.00 ? 33  PHE A CZ   6  
ATOM 8532  H H    . PHE A 1 30  ? -1.260  3.694   13.290  1.00 0.00 ? 33  PHE A H    6  
ATOM 8533  H HA   . PHE A 1 30  ? -0.637  1.013   12.471  1.00 0.00 ? 33  PHE A HA   6  
ATOM 8534  H HB2  . PHE A 1 30  ? -2.724  2.266   11.793  1.00 0.00 ? 33  PHE A HB2  6  
ATOM 8535  H HB3  . PHE A 1 30  ? -1.707  3.261   10.753  1.00 0.00 ? 33  PHE A HB3  6  
ATOM 8536  H HD1  . PHE A 1 30  ? -2.963  -0.148  11.344  1.00 0.00 ? 33  PHE A HD1  6  
ATOM 8537  H HD2  . PHE A 1 30  ? -0.954  2.461   8.645   1.00 0.00 ? 33  PHE A HD2  6  
ATOM 8538  H HE1  . PHE A 1 30  ? -3.195  -1.824  9.560   1.00 0.00 ? 33  PHE A HE1  6  
ATOM 8539  H HE2  . PHE A 1 30  ? -1.184  0.790   6.856   1.00 0.00 ? 33  PHE A HE2  6  
ATOM 8540  H HZ   . PHE A 1 30  ? -2.306  -1.354  7.313   1.00 0.00 ? 33  PHE A HZ   6  
ATOM 8541  N N    . GLN A 1 31  ? 1.604   1.368   11.504  1.00 0.00 ? 34  GLN A N    6  
ATOM 8542  C CA   . GLN A 1 31  ? 2.915   1.524   10.901  1.00 0.00 ? 34  GLN A CA   6  
ATOM 8543  C C    . GLN A 1 31  ? 2.898   1.053   9.452   1.00 0.00 ? 34  GLN A C    6  
ATOM 8544  O O    . GLN A 1 31  ? 2.342   0.003   9.137   1.00 0.00 ? 34  GLN A O    6  
ATOM 8545  C CB   . GLN A 1 31  ? 3.963   0.751   11.705  1.00 0.00 ? 34  GLN A CB   6  
ATOM 8546  C CG   . GLN A 1 31  ? 4.116   1.248   13.133  1.00 0.00 ? 34  GLN A CG   6  
ATOM 8547  C CD   . GLN A 1 31  ? 5.125   0.450   13.936  1.00 0.00 ? 34  GLN A CD   6  
ATOM 8548  O OE1  . GLN A 1 31  ? 6.104   -0.066  13.397  1.00 0.00 ? 34  GLN A OE1  6  
ATOM 8549  N NE2  . GLN A 1 31  ? 4.886   0.340   15.233  1.00 0.00 ? 34  GLN A NE2  6  
ATOM 8550  H H    . GLN A 1 31  ? 1.396   0.544   11.993  1.00 0.00 ? 34  GLN A H    6  
ATOM 8551  H HA   . GLN A 1 31  ? 3.162   2.575   10.921  1.00 0.00 ? 34  GLN A HA   6  
ATOM 8552  H HB2  . GLN A 1 31  ? 3.678   -0.286  11.741  1.00 0.00 ? 34  GLN A HB2  6  
ATOM 8553  H HB3  . GLN A 1 31  ? 4.918   0.836   11.211  1.00 0.00 ? 34  GLN A HB3  6  
ATOM 8554  H HG2  . GLN A 1 31  ? 4.435   2.278   13.109  1.00 0.00 ? 34  GLN A HG2  6  
ATOM 8555  H HG3  . GLN A 1 31  ? 3.158   1.184   13.624  1.00 0.00 ? 34  GLN A HG3  6  
ATOM 8556  H HE21 . GLN A 1 31  ? 4.081   0.771   15.593  1.00 0.00 ? 34  GLN A HE21 6  
ATOM 8557  H HE22 . GLN A 1 31  ? 5.521   -0.168  15.782  1.00 0.00 ? 34  GLN A HE22 6  
ATOM 8558  N N    . ALA A 1 32  ? 3.493   1.847   8.576   1.00 0.00 ? 35  ALA A N    6  
ATOM 8559  C CA   . ALA A 1 32  ? 3.572   1.516   7.161   1.00 0.00 ? 35  ALA A CA   6  
ATOM 8560  C C    . ALA A 1 32  ? 4.820   2.136   6.560   1.00 0.00 ? 35  ALA A C    6  
ATOM 8561  O O    . ALA A 1 32  ? 5.231   3.219   6.973   1.00 0.00 ? 35  ALA A O    6  
ATOM 8562  C CB   . ALA A 1 32  ? 2.329   2.001   6.423   1.00 0.00 ? 35  ALA A CB   6  
ATOM 8563  H H    . ALA A 1 32  ? 3.899   2.682   8.890   1.00 0.00 ? 35  ALA A H    6  
ATOM 8564  H HA   . ALA A 1 32  ? 3.632   0.441   7.071   1.00 0.00 ? 35  ALA A HA   6  
ATOM 8565  H HB1  . ALA A 1 32  ? 2.407   1.744   5.376   1.00 0.00 ? 35  ALA A HB1  6  
ATOM 8566  H HB2  . ALA A 1 32  ? 1.453   1.532   6.843   1.00 0.00 ? 35  ALA A HB2  6  
ATOM 8567  H HB3  . ALA A 1 32  ? 2.244   3.074   6.523   1.00 0.00 ? 35  ALA A HB3  6  
ATOM 8568  N N    . ARG A 1 33  ? 5.420   1.460   5.596   1.00 0.00 ? 36  ARG A N    6  
ATOM 8569  C CA   . ARG A 1 33  ? 6.645   1.944   4.989   1.00 0.00 ? 36  ARG A CA   6  
ATOM 8570  C C    . ARG A 1 33  ? 6.650   1.689   3.494   1.00 0.00 ? 36  ARG A C    6  
ATOM 8571  O O    . ARG A 1 33  ? 5.927   0.829   2.990   1.00 0.00 ? 36  ARG A O    6  
ATOM 8572  C CB   . ARG A 1 33  ? 7.868   1.270   5.617   1.00 0.00 ? 36  ARG A CB   6  
ATOM 8573  C CG   . ARG A 1 33  ? 7.920   -0.233  5.387   1.00 0.00 ? 36  ARG A CG   6  
ATOM 8574  C CD   . ARG A 1 33  ? 9.269   -0.813  5.771   1.00 0.00 ? 36  ARG A CD   6  
ATOM 8575  N NE   . ARG A 1 33  ? 9.703   -0.379  7.097   1.00 0.00 ? 36  ARG A NE   6  
ATOM 8576  C CZ   . ARG A 1 33  ? 10.869  -0.707  7.630   1.00 0.00 ? 36  ARG A CZ   6  
ATOM 8577  N NH1  . ARG A 1 33  ? 11.706  -1.488  6.965   1.00 0.00 ? 36  ARG A NH1  6  
ATOM 8578  N NH2  . ARG A 1 33  ? 11.208  -0.248  8.821   1.00 0.00 ? 36  ARG A NH2  6  
ATOM 8579  H H    . ARG A 1 33  ? 5.023   0.618   5.270   1.00 0.00 ? 36  ARG A H    6  
ATOM 8580  H HA   . ARG A 1 33  ? 6.702   3.006   5.162   1.00 0.00 ? 36  ARG A HA   6  
ATOM 8581  H HB2  . ARG A 1 33  ? 8.760   1.708   5.196   1.00 0.00 ? 36  ARG A HB2  6  
ATOM 8582  H HB3  . ARG A 1 33  ? 7.858   1.449   6.684   1.00 0.00 ? 36  ARG A HB3  6  
ATOM 8583  H HG2  . ARG A 1 33  ? 7.155   -0.706  5.983   1.00 0.00 ? 36  ARG A HG2  6  
ATOM 8584  H HG3  . ARG A 1 33  ? 7.736   -0.430  4.342   1.00 0.00 ? 36  ARG A HG3  6  
ATOM 8585  H HD2  . ARG A 1 33  ? 9.195   -1.892  5.766   1.00 0.00 ? 36  ARG A HD2  6  
ATOM 8586  H HD3  . ARG A 1 33  ? 10.004  -0.498  5.040   1.00 0.00 ? 36  ARG A HD3  6  
ATOM 8587  H HE   . ARG A 1 33  ? 9.093   0.200   7.609   1.00 0.00 ? 36  ARG A HE   6  
ATOM 8588  H HH12 . ARG A 1 33  ? 11.551  -2.490  6.942   1.00 0.00 ? 36  ARG A HH12 6  
ATOM 8589  H HH21 . ARG A 1 33  ? 10.575  0.353   9.326   1.00 0.00 ? 36  ARG A HH21 6  
ATOM 8590  H HH22 . ARG A 1 33  ? 12.095  -0.486  9.221   1.00 0.00 ? 36  ARG A HH22 6  
ATOM 8591  N N    . LEU A 1 34  ? 7.465   2.451   2.796   1.00 0.00 ? 37  LEU A N    6  
ATOM 8592  C CA   . LEU A 1 34  ? 7.700   2.234   1.387   1.00 0.00 ? 37  LEU A CA   6  
ATOM 8593  C C    . LEU A 1 34  ? 9.041   1.542   1.221   1.00 0.00 ? 37  LEU A C    6  
ATOM 8594  O O    . LEU A 1 34  ? 10.019  1.916   1.876   1.00 0.00 ? 37  LEU A O    6  
ATOM 8595  C CB   . LEU A 1 34  ? 7.683   3.568   0.642   1.00 0.00 ? 37  LEU A CB   6  
ATOM 8596  C CG   . LEU A 1 34  ? 6.389   4.367   0.800   1.00 0.00 ? 37  LEU A CG   6  
ATOM 8597  C CD1  . LEU A 1 34  ? 6.503   5.717   0.115   1.00 0.00 ? 37  LEU A CD1  6  
ATOM 8598  C CD2  . LEU A 1 34  ? 5.217   3.588   0.231   1.00 0.00 ? 37  LEU A CD2  6  
ATOM 8599  H H    . LEU A 1 34  ? 7.931   3.184   3.243   1.00 0.00 ? 37  LEU A H    6  
ATOM 8600  H HA   . LEU A 1 34  ? 6.920   1.595   1.002   1.00 0.00 ? 37  LEU A HA   6  
ATOM 8601  H HB2  . LEU A 1 34  ? 8.505   4.169   1.003   1.00 0.00 ? 37  LEU A HB2  6  
ATOM 8602  H HB3  . LEU A 1 34  ? 7.832   3.374   -0.409  1.00 0.00 ? 37  LEU A HB3  6  
ATOM 8603  H HG   . LEU A 1 34  ? 6.203   4.535   1.854   1.00 0.00 ? 37  LEU A HG   6  
ATOM 8604  H HD11 . LEU A 1 34  ? 7.295   6.292   0.574   1.00 0.00 ? 37  LEU A HD11 6  
ATOM 8605  H HD12 . LEU A 1 34  ? 6.725   5.570   -0.931  1.00 0.00 ? 37  LEU A HD12 6  
ATOM 8606  H HD13 . LEU A 1 34  ? 5.570   6.250   0.210   1.00 0.00 ? 37  LEU A HD13 6  
ATOM 8607  H HD21 . LEU A 1 34  ? 4.315   4.172   0.323   1.00 0.00 ? 37  LEU A HD21 6  
ATOM 8608  H HD22 . LEU A 1 34  ? 5.403   3.373   -0.811  1.00 0.00 ? 37  LEU A HD22 6  
ATOM 8609  H HD23 . LEU A 1 34  ? 5.103   2.661   0.774   1.00 0.00 ? 37  LEU A HD23 6  
ATOM 8610  N N    . THR A 1 35  ? 9.067   0.511   0.387   1.00 0.00 ? 38  THR A N    6  
ATOM 8611  C CA   . THR A 1 35  ? 10.280  -0.262  0.149   1.00 0.00 ? 38  THR A CA   6  
ATOM 8612  C C    . THR A 1 35  ? 11.461  0.637   -0.189  1.00 0.00 ? 38  THR A C    6  
ATOM 8613  O O    . THR A 1 35  ? 11.311  1.634   -0.901  1.00 0.00 ? 38  THR A O    6  
ATOM 8614  C CB   . THR A 1 35  ? 10.092  -1.247  -1.017  1.00 0.00 ? 38  THR A CB   6  
ATOM 8615  O OG1  . THR A 1 35  ? 9.685   -0.524  -2.184  1.00 0.00 ? 38  THR A OG1  6  
ATOM 8616  C CG2  . THR A 1 35  ? 9.068   -2.320  -0.687  1.00 0.00 ? 38  THR A CG2  6  
ATOM 8617  H H    . THR A 1 35  ? 8.236   0.250   -0.072  1.00 0.00 ? 38  THR A H    6  
ATOM 8618  H HA   . THR A 1 35  ? 10.504  -0.826  1.041   1.00 0.00 ? 38  THR A HA   6  
ATOM 8619  H HB   . THR A 1 35  ? 11.042  -1.724  -1.215  1.00 0.00 ? 38  THR A HB   6  
ATOM 8620  H HG1  . THR A 1 35  ? 9.927   0.402   -2.075  1.00 0.00 ? 38  THR A HG1  6  
ATOM 8621  H HG21 . THR A 1 35  ? 8.985   -3.007  -1.518  1.00 0.00 ? 38  THR A HG21 6  
ATOM 8622  H HG22 . THR A 1 35  ? 8.110   -1.860  -0.505  1.00 0.00 ? 38  THR A HG22 6  
ATOM 8623  H HG23 . THR A 1 35  ? 9.383   -2.859  0.194   1.00 0.00 ? 38  THR A HG23 6  
ATOM 8624  N N    . ARG A 1 36  ? 12.629  0.262   0.314   1.00 0.00 ? 39  ARG A N    6  
ATOM 8625  C CA   . ARG A 1 36  ? 13.875  0.967   0.031   1.00 0.00 ? 39  ARG A CA   6  
ATOM 8626  C C    . ARG A 1 36  ? 14.298  0.764   -1.426  1.00 0.00 ? 39  ARG A C    6  
ATOM 8627  O O    . ARG A 1 36  ? 15.343  0.179   -1.716  1.00 0.00 ? 39  ARG A O    6  
ATOM 8628  C CB   . ARG A 1 36  ? 14.964  0.483   0.995   1.00 0.00 ? 39  ARG A CB   6  
ATOM 8629  C CG   . ARG A 1 36  ? 14.996  -1.033  1.136   1.00 0.00 ? 39  ARG A CG   6  
ATOM 8630  C CD   . ARG A 1 36  ? 15.752  -1.490  2.377   1.00 0.00 ? 39  ARG A CD   6  
ATOM 8631  N NE   . ARG A 1 36  ? 15.262  -0.882  3.626   1.00 0.00 ? 39  ARG A NE   6  
ATOM 8632  C CZ   . ARG A 1 36  ? 13.997  -0.934  4.067   1.00 0.00 ? 39  ARG A CZ   6  
ATOM 8633  N NH1  . ARG A 1 36  ? 13.021  -1.394  3.293   1.00 0.00 ? 39  ARG A NH1  6  
ATOM 8634  N NH2  . ARG A 1 36  ? 13.702  -0.466  5.269   1.00 0.00 ? 39  ARG A NH2  6  
ATOM 8635  H H    . ARG A 1 36  ? 12.653  -0.519  0.906   1.00 0.00 ? 39  ARG A H    6  
ATOM 8636  H HA   . ARG A 1 36  ? 13.703  2.020   0.197   1.00 0.00 ? 39  ARG A HA   6  
ATOM 8637  H HB2  . ARG A 1 36  ? 15.925  0.814   0.631   1.00 0.00 ? 39  ARG A HB2  6  
ATOM 8638  H HB3  . ARG A 1 36  ? 14.790  0.912   1.971   1.00 0.00 ? 39  ARG A HB3  6  
ATOM 8639  H HG2  . ARG A 1 36  ? 13.983  -1.397  1.197   1.00 0.00 ? 39  ARG A HG2  6  
ATOM 8640  H HG3  . ARG A 1 36  ? 15.475  -1.452  0.263   1.00 0.00 ? 39  ARG A HG3  6  
ATOM 8641  H HD2  . ARG A 1 36  ? 15.658  -2.563  2.460   1.00 0.00 ? 39  ARG A HD2  6  
ATOM 8642  H HD3  . ARG A 1 36  ? 16.794  -1.237  2.256   1.00 0.00 ? 39  ARG A HD3  6  
ATOM 8643  H HE   . ARG A 1 36  ? 15.939  -0.445  4.195   1.00 0.00 ? 39  ARG A HE   6  
ATOM 8644  H HH12 . ARG A 1 36  ? 12.634  -2.321  3.438   1.00 0.00 ? 39  ARG A HH12 6  
ATOM 8645  H HH21 . ARG A 1 36  ? 14.423  -0.061  5.846   1.00 0.00 ? 39  ARG A HH21 6  
ATOM 8646  H HH22 . ARG A 1 36  ? 12.760  -0.530  5.622   1.00 0.00 ? 39  ARG A HH22 6  
ATOM 8647  N N    . SER A 1 37  ? 13.466  1.250   -2.335  1.00 0.00 ? 40  SER A N    6  
ATOM 8648  C CA   . SER A 1 37  ? 13.721  1.132   -3.759  1.00 0.00 ? 40  SER A CA   6  
ATOM 8649  C C    . SER A 1 37  ? 14.582  2.299   -4.235  1.00 0.00 ? 40  SER A C    6  
ATOM 8650  O O    . SER A 1 37  ? 15.793  2.157   -4.398  1.00 0.00 ? 40  SER A O    6  
ATOM 8651  C CB   . SER A 1 37  ? 12.396  1.084   -4.533  1.00 0.00 ? 40  SER A CB   6  
ATOM 8652  O OG   . SER A 1 37  ? 12.613  0.809   -5.906  1.00 0.00 ? 40  SER A OG   6  
ATOM 8653  H H    . SER A 1 37  ? 12.648  1.704   -2.027  1.00 0.00 ? 40  SER A H    6  
ATOM 8654  H HA   . SER A 1 37  ? 14.259  0.210   -3.924  1.00 0.00 ? 40  SER A HA   6  
ATOM 8655  H HB2  . SER A 1 37  ? 11.764  0.311   -4.121  1.00 0.00 ? 40  SER A HB2  6  
ATOM 8656  H HB3  . SER A 1 37  ? 11.894  2.038   -4.446  1.00 0.00 ? 40  SER A HB3  6  
ATOM 8657  H HG   . SER A 1 37  ? 12.339  -0.094  -6.096  1.00 0.00 ? 40  SER A HG   6  
ATOM 8658  N N    . ASN A 1 38  ? 13.958  3.454   -4.430  1.00 0.00 ? 41  ASN A N    6  
ATOM 8659  C CA   . ASN A 1 38  ? 14.686  4.641   -4.859  1.00 0.00 ? 41  ASN A CA   6  
ATOM 8660  C C    . ASN A 1 38  ? 14.923  5.573   -3.675  1.00 0.00 ? 41  ASN A C    6  
ATOM 8661  O O    . ASN A 1 38  ? 16.055  5.980   -3.405  1.00 0.00 ? 41  ASN A O    6  
ATOM 8662  C CB   . ASN A 1 38  ? 13.929  5.381   -5.966  1.00 0.00 ? 41  ASN A CB   6  
ATOM 8663  C CG   . ASN A 1 38  ? 14.710  6.568   -6.501  1.00 0.00 ? 41  ASN A CG   6  
ATOM 8664  O OD1  . ASN A 1 38  ? 15.941  6.567   -6.502  1.00 0.00 ? 41  ASN A OD1  6  
ATOM 8665  N ND2  . ASN A 1 38  ? 14.004  7.582   -6.971  1.00 0.00 ? 41  ASN A ND2  6  
ATOM 8666  H H    . ASN A 1 38  ? 12.991  3.508   -4.285  1.00 0.00 ? 41  ASN A H    6  
ATOM 8667  H HA   . ASN A 1 38  ? 15.641  4.320   -5.243  1.00 0.00 ? 41  ASN A HA   6  
ATOM 8668  H HB2  . ASN A 1 38  ? 13.738  4.701   -6.785  1.00 0.00 ? 41  ASN A HB2  6  
ATOM 8669  H HB3  . ASN A 1 38  ? 12.991  5.738   -5.574  1.00 0.00 ? 41  ASN A HB3  6  
ATOM 8670  H HD21 . ASN A 1 38  ? 13.026  7.517   -6.956  1.00 0.00 ? 41  ASN A HD21 6  
ATOM 8671  H HD22 . ASN A 1 38  ? 14.490  8.363   -7.321  1.00 0.00 ? 41  ASN A HD22 6  
ATOM 8672  N N    . SER A 1 39  ? 13.853  5.892   -2.966  1.00 0.00 ? 42  SER A N    6  
ATOM 8673  C CA   . SER A 1 39  ? 13.937  6.756   -1.805  1.00 0.00 ? 42  SER A CA   6  
ATOM 8674  C C    . SER A 1 39  ? 12.831  6.401   -0.822  1.00 0.00 ? 42  SER A C    6  
ATOM 8675  O O    . SER A 1 39  ? 11.947  5.604   -1.142  1.00 0.00 ? 42  SER A O    6  
ATOM 8676  C CB   . SER A 1 39  ? 13.836  8.225   -2.231  1.00 0.00 ? 42  SER A CB   6  
ATOM 8677  O OG   . SER A 1 39  ? 14.057  9.102   -1.139  1.00 0.00 ? 42  SER A OG   6  
ATOM 8678  H H    . SER A 1 39  ? 12.982  5.533   -3.226  1.00 0.00 ? 42  SER A H    6  
ATOM 8679  H HA   . SER A 1 39  ? 14.893  6.589   -1.333  1.00 0.00 ? 42  SER A HA   6  
ATOM 8680  H HB2  . SER A 1 39  ? 14.577  8.427   -2.988  1.00 0.00 ? 42  SER A HB2  6  
ATOM 8681  H HB3  . SER A 1 39  ? 12.852  8.414   -2.635  1.00 0.00 ? 42  SER A HB3  6  
ATOM 8682  H HG   . SER A 1 39  ? 14.519  9.895   -1.456  1.00 0.00 ? 42  SER A HG   6  
ATOM 8683  N N    . LYS A 1 40  ? 12.880  6.995   0.358   1.00 0.00 ? 43  LYS A N    6  
ATOM 8684  C CA   . LYS A 1 40  ? 11.892  6.736   1.400   1.00 0.00 ? 43  LYS A CA   6  
ATOM 8685  C C    . LYS A 1 40  ? 10.500  7.213   0.983   1.00 0.00 ? 43  LYS A C    6  
ATOM 8686  O O    . LYS A 1 40  ? 9.489   6.707   1.468   1.00 0.00 ? 43  LYS A O    6  
ATOM 8687  C CB   . LYS A 1 40  ? 12.326  7.432   2.700   1.00 0.00 ? 43  LYS A CB   6  
ATOM 8688  C CG   . LYS A 1 40  ? 11.276  7.419   3.804   1.00 0.00 ? 43  LYS A CG   6  
ATOM 8689  C CD   . LYS A 1 40  ? 11.787  8.084   5.076   1.00 0.00 ? 43  LYS A CD   6  
ATOM 8690  C CE   . LYS A 1 40  ? 12.278  9.508   4.826   1.00 0.00 ? 43  LYS A CE   6  
ATOM 8691  N NZ   . LYS A 1 40  ? 11.201  10.397  4.312   1.00 0.00 ? 43  LYS A NZ   6  
ATOM 8692  H H    . LYS A 1 40  ? 13.609  7.630   0.538   1.00 0.00 ? 43  LYS A H    6  
ATOM 8693  H HA   . LYS A 1 40  ? 11.860  5.671   1.565   1.00 0.00 ? 43  LYS A HA   6  
ATOM 8694  H HB2  . LYS A 1 40  ? 13.210  6.940   3.075   1.00 0.00 ? 43  LYS A HB2  6  
ATOM 8695  H HB3  . LYS A 1 40  ? 12.569  8.462   2.477   1.00 0.00 ? 43  LYS A HB3  6  
ATOM 8696  H HG2  . LYS A 1 40  ? 10.401  7.952   3.461   1.00 0.00 ? 43  LYS A HG2  6  
ATOM 8697  H HG3  . LYS A 1 40  ? 11.012  6.395   4.026   1.00 0.00 ? 43  LYS A HG3  6  
ATOM 8698  H HD2  . LYS A 1 40  ? 10.985  8.117   5.797   1.00 0.00 ? 43  LYS A HD2  6  
ATOM 8699  H HD3  . LYS A 1 40  ? 12.603  7.497   5.470   1.00 0.00 ? 43  LYS A HD3  6  
ATOM 8700  H HE2  . LYS A 1 40  ? 12.649  9.912   5.756   1.00 0.00 ? 43  LYS A HE2  6  
ATOM 8701  H HE3  . LYS A 1 40  ? 13.081  9.476   4.106   1.00 0.00 ? 43  LYS A HE3  6  
ATOM 8702  H HZ1  . LYS A 1 40  ? 10.387  10.369  4.965   1.00 0.00 ? 43  LYS A HZ1  6  
ATOM 8703  H HZ3  . LYS A 1 40  ? 10.880  10.059  3.382   1.00 0.00 ? 43  LYS A HZ3  6  
ATOM 8704  N N    . CYS A 1 41  ? 10.448  8.165   0.066   1.00 0.00 ? 44  CYS A N    6  
ATOM 8705  C CA   . CYS A 1 41  ? 9.187   8.799   -0.277  1.00 0.00 ? 44  CYS A CA   6  
ATOM 8706  C C    . CYS A 1 41  ? 8.493   8.136   -1.465  1.00 0.00 ? 44  CYS A C    6  
ATOM 8707  O O    . CYS A 1 41  ? 7.401   8.547   -1.840  1.00 0.00 ? 44  CYS A O    6  
ATOM 8708  C CB   . CYS A 1 41  ? 9.406   10.286  -0.549  1.00 0.00 ? 44  CYS A CB   6  
ATOM 8709  S SG   . CYS A 1 41  ? 10.008  11.210  0.904   1.00 0.00 ? 44  CYS A SG   6  
ATOM 8710  H H    . CYS A 1 41  ? 11.271  8.445   -0.386  1.00 0.00 ? 44  CYS A H    6  
ATOM 8711  H HA   . CYS A 1 41  ? 8.539   8.707   0.583   1.00 0.00 ? 44  CYS A HA   6  
ATOM 8712  H HB2  . CYS A 1 41  ? 10.137  10.398  -1.336  1.00 0.00 ? 44  CYS A HB2  6  
ATOM 8713  H HB3  . CYS A 1 41  ? 8.472   10.730  -0.862  1.00 0.00 ? 44  CYS A HB3  6  
ATOM 8714  N N    . GLN A 1 42  ? 9.098   7.114   -2.057  1.00 0.00 ? 45  GLN A N    6  
ATOM 8715  C CA   . GLN A 1 42  ? 8.442   6.407   -3.155  1.00 0.00 ? 45  GLN A CA   6  
ATOM 8716  C C    . GLN A 1 42  ? 8.949   4.976   -3.288  1.00 0.00 ? 45  GLN A C    6  
ATOM 8717  O O    . GLN A 1 42  ? 10.158  4.724   -3.321  1.00 0.00 ? 45  GLN A O    6  
ATOM 8718  C CB   . GLN A 1 42  ? 8.595   7.154   -4.490  1.00 0.00 ? 45  GLN A CB   6  
ATOM 8719  C CG   . GLN A 1 42  ? 10.023  7.506   -4.863  1.00 0.00 ? 45  GLN A CG   6  
ATOM 8720  C CD   . GLN A 1 42  ? 10.443  8.884   -4.380  1.00 0.00 ? 45  GLN A CD   6  
ATOM 8721  O OE1  . GLN A 1 42  ? 11.612  9.118   -4.092  1.00 0.00 ? 45  GLN A OE1  6  
ATOM 8722  N NE2  . GLN A 1 42  ? 9.492   9.805   -4.289  1.00 0.00 ? 45  GLN A NE2  6  
ATOM 8723  H H    . GLN A 1 42  ? 9.983   6.820   -1.746  1.00 0.00 ? 45  GLN A H    6  
ATOM 8724  H HA   . GLN A 1 42  ? 7.390   6.363   -2.915  1.00 0.00 ? 45  GLN A HA   6  
ATOM 8725  H HB2  . GLN A 1 42  ? 8.187   6.539   -5.277  1.00 0.00 ? 45  GLN A HB2  6  
ATOM 8726  H HB3  . GLN A 1 42  ? 8.029   8.072   -4.436  1.00 0.00 ? 45  GLN A HB3  6  
ATOM 8727  H HG2  . GLN A 1 42  ? 10.683  6.773   -4.423  1.00 0.00 ? 45  GLN A HG2  6  
ATOM 8728  H HG3  . GLN A 1 42  ? 10.116  7.472   -5.939  1.00 0.00 ? 45  GLN A HG3  6  
ATOM 8729  H HE21 . GLN A 1 42  ? 8.578   9.552   -4.526  1.00 0.00 ? 45  GLN A HE21 6  
ATOM 8730  H HE22 . GLN A 1 42  ? 9.746   10.713  -4.000  1.00 0.00 ? 45  GLN A HE22 6  
ATOM 8731  N N    . GLY A 1 43  ? 8.006   4.047   -3.363  1.00 0.00 ? 46  GLY A N    6  
ATOM 8732  C CA   . GLY A 1 43  ? 8.334   2.641   -3.495  1.00 0.00 ? 46  GLY A CA   6  
ATOM 8733  C C    . GLY A 1 43  ? 7.102   1.768   -3.350  1.00 0.00 ? 46  GLY A C    6  
ATOM 8734  O O    . GLY A 1 43  ? 5.975   2.251   -3.489  1.00 0.00 ? 46  GLY A O    6  
ATOM 8735  H H    . GLY A 1 43  ? 7.061   4.321   -3.325  1.00 0.00 ? 46  GLY A H    6  
ATOM 8736  H HA2  . GLY A 1 43  ? 8.779   2.472   -4.469  1.00 0.00 ? 46  GLY A HA2  6  
ATOM 8737  H HA3  . GLY A 1 43  ? 9.049   2.374   -2.730  1.00 0.00 ? 46  GLY A HA3  6  
ATOM 8738  N N    . GLN A 1 44  ? 7.311   0.489   -3.066  1.00 0.00 ? 47  GLN A N    6  
ATOM 8739  C CA   . GLN A 1 44  ? 6.210   -0.444  -2.878  1.00 0.00 ? 47  GLN A CA   6  
ATOM 8740  C C    . GLN A 1 44  ? 5.693   -0.322  -1.442  1.00 0.00 ? 47  GLN A C    6  
ATOM 8741  O O    . GLN A 1 44  ? 6.476   -0.079  -0.521  1.00 0.00 ? 47  GLN A O    6  
ATOM 8742  C CB   . GLN A 1 44  ? 6.688   -1.870  -3.194  1.00 0.00 ? 47  GLN A CB   6  
ATOM 8743  C CG   . GLN A 1 44  ? 5.573   -2.887  -3.390  1.00 0.00 ? 47  GLN A CG   6  
ATOM 8744  C CD   . GLN A 1 44  ? 5.002   -3.412  -2.089  1.00 0.00 ? 47  GLN A CD   6  
ATOM 8745  O OE1  . GLN A 1 44  ? 5.710   -3.535  -1.094  1.00 0.00 ? 47  GLN A OE1  6  
ATOM 8746  N NE2  . GLN A 1 44  ? 3.715   -3.711  -2.085  1.00 0.00 ? 47  GLN A NE2  6  
ATOM 8747  H H    . GLN A 1 44  ? 8.234   0.163   -2.965  1.00 0.00 ? 47  GLN A H    6  
ATOM 8748  H HA   . GLN A 1 44  ? 5.421   -0.174  -3.561  1.00 0.00 ? 47  GLN A HA   6  
ATOM 8749  H HB2  . GLN A 1 44  ? 7.278   -1.845  -4.099  1.00 0.00 ? 47  GLN A HB2  6  
ATOM 8750  H HB3  . GLN A 1 44  ? 7.314   -2.210  -2.380  1.00 0.00 ? 47  GLN A HB3  6  
ATOM 8751  H HG2  . GLN A 1 44  ? 4.775   -2.422  -3.948  1.00 0.00 ? 47  GLN A HG2  6  
ATOM 8752  H HG3  . GLN A 1 44  ? 5.966   -3.720  -3.953  1.00 0.00 ? 47  GLN A HG3  6  
ATOM 8753  H HE21 . GLN A 1 44  ? 3.204   -3.579  -2.908  1.00 0.00 ? 47  GLN A HE21 6  
ATOM 8754  H HE22 . GLN A 1 44  ? 3.325   -4.044  -1.252  1.00 0.00 ? 47  GLN A HE22 6  
ATOM 8755  N N    . LEU A 1 45  ? 4.386   -0.470  -1.256  1.00 0.00 ? 48  LEU A N    6  
ATOM 8756  C CA   . LEU A 1 45  ? 3.775   -0.230  0.048   1.00 0.00 ? 48  LEU A CA   6  
ATOM 8757  C C    . LEU A 1 45  ? 3.765   -1.488  0.915   1.00 0.00 ? 48  LEU A C    6  
ATOM 8758  O O    . LEU A 1 45  ? 3.073   -2.465  0.610   1.00 0.00 ? 48  LEU A O    6  
ATOM 8759  C CB   . LEU A 1 45  ? 2.345   0.290   -0.115  1.00 0.00 ? 48  LEU A CB   6  
ATOM 8760  C CG   . LEU A 1 45  ? 1.625   0.650   1.194   1.00 0.00 ? 48  LEU A CG   6  
ATOM 8761  C CD1  . LEU A 1 45  ? 2.319   1.810   1.897   1.00 0.00 ? 48  LEU A CD1  6  
ATOM 8762  C CD2  . LEU A 1 45  ? 0.169   0.990   0.927   1.00 0.00 ? 48  LEU A CD2  6  
ATOM 8763  H H    . LEU A 1 45  ? 3.821   -0.756  -2.009  1.00 0.00 ? 48  LEU A H    6  
ATOM 8764  H HA   . LEU A 1 45  ? 4.362   0.523   0.547   1.00 0.00 ? 48  LEU A HA   6  
ATOM 8765  H HB2  . LEU A 1 45  ? 2.372   1.171   -0.745  1.00 0.00 ? 48  LEU A HB2  6  
ATOM 8766  H HB3  . LEU A 1 45  ? 1.765   -0.472  -0.616  1.00 0.00 ? 48  LEU A HB3  6  
ATOM 8767  H HG   . LEU A 1 45  ? 1.654   -0.203  1.858   1.00 0.00 ? 48  LEU A HG   6  
ATOM 8768  H HD11 . LEU A 1 45  ? 1.750   2.095   2.768   1.00 0.00 ? 48  LEU A HD11 6  
ATOM 8769  H HD12 . LEU A 1 45  ? 3.311   1.509   2.197   1.00 0.00 ? 48  LEU A HD12 6  
ATOM 8770  H HD13 . LEU A 1 45  ? 2.388   2.650   1.221   1.00 0.00 ? 48  LEU A HD13 6  
ATOM 8771  H HD21 . LEU A 1 45  ? 0.113   1.822   0.241   1.00 0.00 ? 48  LEU A HD21 6  
ATOM 8772  H HD22 . LEU A 1 45  ? -0.328  0.134   0.495   1.00 0.00 ? 48  LEU A HD22 6  
ATOM 8773  H HD23 . LEU A 1 45  ? -0.315  1.257   1.855   1.00 0.00 ? 48  LEU A HD23 6  
ATOM 8774  N N    . GLU A 1 46  ? 4.533   -1.446  1.993   1.00 0.00 ? 49  GLU A N    6  
ATOM 8775  C CA   . GLU A 1 46  ? 4.509   -2.495  3.001   1.00 0.00 ? 49  GLU A CA   6  
ATOM 8776  C C    . GLU A 1 46  ? 3.847   -1.966  4.263   1.00 0.00 ? 49  GLU A C    6  
ATOM 8777  O O    . GLU A 1 46  ? 4.227   -0.914  4.777   1.00 0.00 ? 49  GLU A O    6  
ATOM 8778  C CB   . GLU A 1 46  ? 5.922   -2.978  3.334   1.00 0.00 ? 49  GLU A CB   6  
ATOM 8779  C CG   . GLU A 1 46  ? 6.640   -3.636  2.174   1.00 0.00 ? 49  GLU A CG   6  
ATOM 8780  C CD   . GLU A 1 46  ? 8.064   -4.021  2.522   1.00 0.00 ? 49  GLU A CD   6  
ATOM 8781  O OE1  . GLU A 1 46  ? 8.950   -3.140  2.505   1.00 0.00 ? 49  GLU A OE1  6  
ATOM 8782  O OE2  . GLU A 1 46  ? 8.304   -5.211  2.821   1.00 0.00 ? 49  GLU A OE2  6  
ATOM 8783  H H    . GLU A 1 46  ? 5.132   -0.679  2.122   1.00 0.00 ? 49  GLU A H    6  
ATOM 8784  H HA   . GLU A 1 46  ? 3.928   -3.319  2.616   1.00 0.00 ? 49  GLU A HA   6  
ATOM 8785  H HB2  . GLU A 1 46  ? 6.511   -2.134  3.656   1.00 0.00 ? 49  GLU A HB2  6  
ATOM 8786  H HB3  . GLU A 1 46  ? 5.863   -3.694  4.142   1.00 0.00 ? 49  GLU A HB3  6  
ATOM 8787  H HG2  . GLU A 1 46  ? 6.098   -4.530  1.897   1.00 0.00 ? 49  GLU A HG2  6  
ATOM 8788  H HG3  . GLU A 1 46  ? 6.655   -2.951  1.340   1.00 0.00 ? 49  GLU A HG3  6  
ATOM 8789  N N    . VAL A 1 47  ? 2.856   -2.682  4.755   1.00 0.00 ? 50  VAL A N    6  
ATOM 8790  C CA   . VAL A 1 47  ? 2.144   -2.262  5.950   1.00 0.00 ? 50  VAL A CA   6  
ATOM 8791  C C    . VAL A 1 47  ? 2.437   -3.197  7.112   1.00 0.00 ? 50  VAL A C    6  
ATOM 8792  O O    . VAL A 1 47  ? 2.699   -4.385  6.915   1.00 0.00 ? 50  VAL A O    6  
ATOM 8793  C CB   . VAL A 1 47  ? 0.619   -2.182  5.718   1.00 0.00 ? 50  VAL A CB   6  
ATOM 8794  C CG1  . VAL A 1 47  ? 0.290   -1.116  4.683   1.00 0.00 ? 50  VAL A CG1  6  
ATOM 8795  C CG2  . VAL A 1 47  ? 0.062   -3.531  5.291   1.00 0.00 ? 50  VAL A CG2  6  
ATOM 8796  H H    . VAL A 1 47  ? 2.604   -3.521  4.311   1.00 0.00 ? 50  VAL A H    6  
ATOM 8797  H HA   . VAL A 1 47  ? 2.495   -1.275  6.210   1.00 0.00 ? 50  VAL A HA   6  
ATOM 8798  H HB   . VAL A 1 47  ? 0.149   -1.903  6.650   1.00 0.00 ? 50  VAL A HB   6  
ATOM 8799  H HG11 . VAL A 1 47  ? 0.658   -0.157  5.022   1.00 0.00 ? 50  VAL A HG11 6  
ATOM 8800  H HG12 . VAL A 1 47  ? 0.761   -1.369  3.744   1.00 0.00 ? 50  VAL A HG12 6  
ATOM 8801  H HG13 . VAL A 1 47  ? -0.780  -1.063  4.547   1.00 0.00 ? 50  VAL A HG13 6  
ATOM 8802  H HG21 . VAL A 1 47  ? 0.347   -4.282  6.013   1.00 0.00 ? 50  VAL A HG21 6  
ATOM 8803  H HG22 . VAL A 1 47  ? -1.015  -3.474  5.233   1.00 0.00 ? 50  VAL A HG22 6  
ATOM 8804  H HG23 . VAL A 1 47  ? 0.462   -3.795  4.324   1.00 0.00 ? 50  VAL A HG23 6  
ATOM 8805  N N    . TYR A 1 48  ? 2.414   -2.650  8.315   1.00 0.00 ? 51  TYR A N    6  
ATOM 8806  C CA   . TYR A 1 48  ? 2.704   -3.413  9.515   1.00 0.00 ? 51  TYR A CA   6  
ATOM 8807  C C    . TYR A 1 48  ? 1.406   -3.828  10.192  1.00 0.00 ? 51  TYR A C    6  
ATOM 8808  O O    . TYR A 1 48  ? 0.754   -3.027  10.861  1.00 0.00 ? 51  TYR A O    6  
ATOM 8809  C CB   . TYR A 1 48  ? 3.564   -2.576  10.467  1.00 0.00 ? 51  TYR A CB   6  
ATOM 8810  C CG   . TYR A 1 48  ? 4.007   -3.302  11.721  1.00 0.00 ? 51  TYR A CG   6  
ATOM 8811  C CD1  . TYR A 1 48  ? 5.128   -4.126  11.716  1.00 0.00 ? 51  TYR A CD1  6  
ATOM 8812  C CD2  . TYR A 1 48  ? 3.309   -3.155  12.911  1.00 0.00 ? 51  TYR A CD2  6  
ATOM 8813  C CE1  . TYR A 1 48  ? 5.535   -4.781  12.863  1.00 0.00 ? 51  TYR A CE1  6  
ATOM 8814  C CE2  . TYR A 1 48  ? 3.711   -3.805  14.058  1.00 0.00 ? 51  TYR A CE2  6  
ATOM 8815  C CZ   . TYR A 1 48  ? 4.823   -4.618  14.031  1.00 0.00 ? 51  TYR A CZ   6  
ATOM 8816  O OH   . TYR A 1 48  ? 5.221   -5.269  15.179  1.00 0.00 ? 51  TYR A OH   6  
ATOM 8817  H H    . TYR A 1 48  ? 2.186   -1.696  8.404   1.00 0.00 ? 51  TYR A H    6  
ATOM 8818  H HA   . TYR A 1 48  ? 3.248   -4.298  9.227   1.00 0.00 ? 51  TYR A HA   6  
ATOM 8819  H HB2  . TYR A 1 48  ? 4.453   -2.248  9.944   1.00 0.00 ? 51  TYR A HB2  6  
ATOM 8820  H HB3  . TYR A 1 48  ? 2.998   -1.707  10.771  1.00 0.00 ? 51  TYR A HB3  6  
ATOM 8821  H HD1  . TYR A 1 48  ? 5.685   -4.251  10.799  1.00 0.00 ? 51  TYR A HD1  6  
ATOM 8822  H HD2  . TYR A 1 48  ? 2.438   -2.519  12.932  1.00 0.00 ? 51  TYR A HD2  6  
ATOM 8823  H HE1  . TYR A 1 48  ? 6.408   -5.417  12.841  1.00 0.00 ? 51  TYR A HE1  6  
ATOM 8824  H HE2  . TYR A 1 48  ? 3.153   -3.678  14.972  1.00 0.00 ? 51  TYR A HE2  6  
ATOM 8825  H HH   . TYR A 1 48  ? 4.436   -5.597  15.642  1.00 0.00 ? 51  TYR A HH   6  
ATOM 8826  N N    . LEU A 1 49  ? 1.030   -5.077  9.990   1.00 0.00 ? 52  LEU A N    6  
ATOM 8827  C CA   . LEU A 1 49  ? -0.169  -5.623  10.597  1.00 0.00 ? 52  LEU A CA   6  
ATOM 8828  C C    . LEU A 1 49  ? 0.214   -6.450  11.822  1.00 0.00 ? 52  LEU A C    6  
ATOM 8829  O O    . LEU A 1 49  ? 1.300   -6.267  12.375  1.00 0.00 ? 52  LEU A O    6  
ATOM 8830  C CB   . LEU A 1 49  ? -0.947  -6.464  9.576   1.00 0.00 ? 52  LEU A CB   6  
ATOM 8831  C CG   . LEU A 1 49  ? -1.369  -5.724  8.302   1.00 0.00 ? 52  LEU A CG   6  
ATOM 8832  C CD1  . LEU A 1 49  ? -2.130  -6.652  7.367   1.00 0.00 ? 52  LEU A CD1  6  
ATOM 8833  C CD2  . LEU A 1 49  ? -2.211  -4.502  8.639   1.00 0.00 ? 52  LEU A CD2  6  
ATOM 8834  H H    . LEU A 1 49  ? 1.591   -5.659  9.427   1.00 0.00 ? 52  LEU A H    6  
ATOM 8835  H HA   . LEU A 1 49  ? -0.785  -4.797  10.917  1.00 0.00 ? 52  LEU A HA   6  
ATOM 8836  H HB2  . LEU A 1 49  ? -0.333  -7.302  9.290   1.00 0.00 ? 52  LEU A HB2  6  
ATOM 8837  H HB3  . LEU A 1 49  ? -1.840  -6.838  10.055  1.00 0.00 ? 52  LEU A HB3  6  
ATOM 8838  H HG   . LEU A 1 49  ? -0.484  -5.387  7.786   1.00 0.00 ? 52  LEU A HG   6  
ATOM 8839  H HD11 . LEU A 1 49  ? -1.471  -7.436  7.023   1.00 0.00 ? 52  LEU A HD11 6  
ATOM 8840  H HD12 . LEU A 1 49  ? -2.964  -7.091  7.895   1.00 0.00 ? 52  LEU A HD12 6  
ATOM 8841  H HD13 . LEU A 1 49  ? -2.497  -6.091  6.521   1.00 0.00 ? 52  LEU A HD13 6  
ATOM 8842  H HD21 . LEU A 1 49  ? -2.583  -4.056  7.728   1.00 0.00 ? 52  LEU A HD21 6  
ATOM 8843  H HD22 . LEU A 1 49  ? -3.045  -4.798  9.258   1.00 0.00 ? 52  LEU A HD22 6  
ATOM 8844  H HD23 . LEU A 1 49  ? -1.607  -3.784  9.170   1.00 0.00 ? 52  LEU A HD23 6  
ATOM 8845  N N    . LYS A 1 50  ? -0.655  -7.357  12.247  1.00 0.00 ? 53  LYS A N    6  
ATOM 8846  C CA   . LYS A 1 50  ? -0.407  -8.127  13.462  1.00 0.00 ? 53  LYS A CA   6  
ATOM 8847  C C    . LYS A 1 50  ? 0.738   -9.118  13.265  1.00 0.00 ? 53  LYS A C    6  
ATOM 8848  O O    . LYS A 1 50  ? 1.487   -9.413  14.200  1.00 0.00 ? 53  LYS A O    6  
ATOM 8849  C CB   . LYS A 1 50  ? -1.679  -8.857  13.907  1.00 0.00 ? 53  LYS A CB   6  
ATOM 8850  C CG   . LYS A 1 50  ? -2.839  -7.922  14.214  1.00 0.00 ? 53  LYS A CG   6  
ATOM 8851  C CD   . LYS A 1 50  ? -4.048  -8.684  14.729  1.00 0.00 ? 53  LYS A CD   6  
ATOM 8852  C CE   . LYS A 1 50  ? -5.216  -7.754  15.013  1.00 0.00 ? 53  LYS A CE   6  
ATOM 8853  N NZ   . LYS A 1 50  ? -4.874  -6.723  16.027  1.00 0.00 ? 53  LYS A NZ   6  
ATOM 8854  H H    . LYS A 1 50  ? -1.468  -7.527  11.730  1.00 0.00 ? 53  LYS A H    6  
ATOM 8855  H HA   . LYS A 1 50  ? -0.122  -7.429  14.234  1.00 0.00 ? 53  LYS A HA   6  
ATOM 8856  H HB2  . LYS A 1 50  ? -1.985  -9.536  13.125  1.00 0.00 ? 53  LYS A HB2  6  
ATOM 8857  H HB3  . LYS A 1 50  ? -1.459  -9.428  14.799  1.00 0.00 ? 53  LYS A HB3  6  
ATOM 8858  H HG2  . LYS A 1 50  ? -2.529  -7.215  14.967  1.00 0.00 ? 53  LYS A HG2  6  
ATOM 8859  H HG3  . LYS A 1 50  ? -3.116  -7.395  13.313  1.00 0.00 ? 53  LYS A HG3  6  
ATOM 8860  H HD2  . LYS A 1 50  ? -4.350  -9.406  13.986  1.00 0.00 ? 53  LYS A HD2  6  
ATOM 8861  H HD3  . LYS A 1 50  ? -3.778  -9.195  15.641  1.00 0.00 ? 53  LYS A HD3  6  
ATOM 8862  H HE2  . LYS A 1 50  ? -5.497  -7.262  14.094  1.00 0.00 ? 53  LYS A HE2  6  
ATOM 8863  H HE3  . LYS A 1 50  ? -6.047  -8.340  15.374  1.00 0.00 ? 53  LYS A HE3  6  
ATOM 8864  H HZ1  . LYS A 1 50  ? -4.634  -7.188  16.931  1.00 0.00 ? 53  LYS A HZ1  6  
ATOM 8865  H HZ3  . LYS A 1 50  ? -5.705  -6.112  16.190  1.00 0.00 ? 53  LYS A HZ3  6  
ATOM 8866  N N    . ASP A 1 51  ? 0.875   -9.630  12.048  1.00 0.00 ? 54  ASP A N    6  
ATOM 8867  C CA   . ASP A 1 51  ? 1.951   -10.573 11.737  1.00 0.00 ? 54  ASP A CA   6  
ATOM 8868  C C    . ASP A 1 51  ? 3.246   -9.830  11.412  1.00 0.00 ? 54  ASP A C    6  
ATOM 8869  O O    . ASP A 1 51  ? 4.330   -10.416 11.425  1.00 0.00 ? 54  ASP A O    6  
ATOM 8870  C CB   . ASP A 1 51  ? 1.571   -11.489 10.562  1.00 0.00 ? 54  ASP A CB   6  
ATOM 8871  C CG   . ASP A 1 51  ? 1.716   -10.815 9.208   1.00 0.00 ? 54  ASP A CG   6  
ATOM 8872  O OD1  . ASP A 1 51  ? 0.794   -10.080 8.794   1.00 0.00 ? 54  ASP A OD1  6  
ATOM 8873  O OD2  . ASP A 1 51  ? 2.752   -11.031 8.542   1.00 0.00 ? 54  ASP A OD2  6  
ATOM 8874  H H    . ASP A 1 51  ? 0.230   -9.382  11.347  1.00 0.00 ? 54  ASP A H    6  
ATOM 8875  H HA   . ASP A 1 51  ? 2.117   -11.182 12.614  1.00 0.00 ? 54  ASP A HA   6  
ATOM 8876  H HB2  . ASP A 1 51  ? 2.211   -12.360 10.573  1.00 0.00 ? 54  ASP A HB2  6  
ATOM 8877  H HB3  . ASP A 1 51  ? 0.544   -11.806 10.679  1.00 0.00 ? 54  ASP A HB3  6  
ATOM 8878  N N    . GLY A 1 52  ? 3.132   -8.539  11.134  1.00 0.00 ? 55  GLY A N    6  
ATOM 8879  C CA   . GLY A 1 52  ? 4.296   -7.753  10.791  1.00 0.00 ? 55  GLY A CA   6  
ATOM 8880  C C    . GLY A 1 52  ? 4.151   -7.070  9.451   1.00 0.00 ? 55  GLY A C    6  
ATOM 8881  O O    . GLY A 1 52  ? 3.062   -6.618  9.097   1.00 0.00 ? 55  GLY A O    6  
ATOM 8882  H H    . GLY A 1 52  ? 2.250   -8.117  11.160  1.00 0.00 ? 55  GLY A H    6  
ATOM 8883  H HA2  . GLY A 1 52  ? 4.448   -7.003  11.552  1.00 0.00 ? 55  GLY A HA2  6  
ATOM 8884  H HA3  . GLY A 1 52  ? 5.160   -8.400  10.762  1.00 0.00 ? 55  GLY A HA3  6  
ATOM 8885  N N    . TRP A 1 53  ? 5.235   -7.017  8.693   1.00 0.00 ? 56  TRP A N    6  
ATOM 8886  C CA   . TRP A 1 53  ? 5.242   -6.303  7.425   1.00 0.00 ? 56  TRP A CA   6  
ATOM 8887  C C    . TRP A 1 53  ? 4.662   -7.159  6.310   1.00 0.00 ? 56  TRP A C    6  
ATOM 8888  O O    . TRP A 1 53  ? 5.060   -8.308  6.116   1.00 0.00 ? 56  TRP A O    6  
ATOM 8889  C CB   . TRP A 1 53  ? 6.659   -5.852  7.065   1.00 0.00 ? 56  TRP A CB   6  
ATOM 8890  C CG   . TRP A 1 53  ? 7.227   -4.859  8.035   1.00 0.00 ? 56  TRP A CG   6  
ATOM 8891  C CD1  . TRP A 1 53  ? 8.199   -5.084  8.966   1.00 0.00 ? 56  TRP A CD1  6  
ATOM 8892  C CD2  . TRP A 1 53  ? 6.841   -3.484  8.182   1.00 0.00 ? 56  TRP A CD2  6  
ATOM 8893  N NE1  . TRP A 1 53  ? 8.449   -3.935  9.674   1.00 0.00 ? 56  TRP A NE1  6  
ATOM 8894  C CE2  . TRP A 1 53  ? 7.629   -2.940  9.214   1.00 0.00 ? 56  TRP A CE2  6  
ATOM 8895  C CE3  . TRP A 1 53  ? 5.910   -2.660  7.542   1.00 0.00 ? 56  TRP A CE3  6  
ATOM 8896  C CZ2  . TRP A 1 53  ? 7.512   -1.611  9.616   1.00 0.00 ? 56  TRP A CZ2  6  
ATOM 8897  C CZ3  . TRP A 1 53  ? 5.796   -1.344  7.944   1.00 0.00 ? 56  TRP A CZ3  6  
ATOM 8898  C CH2  . TRP A 1 53  ? 6.592   -0.830  8.971   1.00 0.00 ? 56  TRP A CH2  6  
ATOM 8899  H H    . TRP A 1 53  ? 6.045   -7.490  8.981   1.00 0.00 ? 56  TRP A H    6  
ATOM 8900  H HA   . TRP A 1 53  ? 4.621   -5.428  7.543   1.00 0.00 ? 56  TRP A HA   6  
ATOM 8901  H HB2  . TRP A 1 53  ? 7.310   -6.716  7.049   1.00 0.00 ? 56  TRP A HB2  6  
ATOM 8902  H HB3  . TRP A 1 53  ? 6.651   -5.398  6.085   1.00 0.00 ? 56  TRP A HB3  6  
ATOM 8903  H HD1  . TRP A 1 53  ? 8.696   -6.033  9.111   1.00 0.00 ? 56  TRP A HD1  6  
ATOM 8904  H HE1  . TRP A 1 53  ? 9.117   -3.842  10.400  1.00 0.00 ? 56  TRP A HE1  6  
ATOM 8905  H HE3  . TRP A 1 53  ? 5.286   -3.036  6.746   1.00 0.00 ? 56  TRP A HE3  6  
ATOM 8906  H HZ2  . TRP A 1 53  ? 8.119   -1.197  10.407  1.00 0.00 ? 56  TRP A HZ2  6  
ATOM 8907  H HZ3  . TRP A 1 53  ? 5.082   -0.696  7.464   1.00 0.00 ? 56  TRP A HZ3  6  
ATOM 8908  H HH2  . TRP A 1 53  ? 6.466   0.204   9.253   1.00 0.00 ? 56  TRP A HH2  6  
ATOM 8909  N N    . HIS A 1 54  ? 3.709   -6.592  5.589   1.00 0.00 ? 57  HIS A N    6  
ATOM 8910  C CA   . HIS A 1 54  ? 3.082   -7.277  4.474   1.00 0.00 ? 57  HIS A CA   6  
ATOM 8911  C C    . HIS A 1 54  ? 2.929   -6.333  3.288   1.00 0.00 ? 57  HIS A C    6  
ATOM 8912  O O    . HIS A 1 54  ? 2.488   -5.192  3.443   1.00 0.00 ? 57  HIS A O    6  
ATOM 8913  C CB   . HIS A 1 54  ? 1.715   -7.834  4.883   1.00 0.00 ? 57  HIS A CB   6  
ATOM 8914  C CG   . HIS A 1 54  ? 1.654   -9.332  4.895   1.00 0.00 ? 57  HIS A CG   6  
ATOM 8915  N ND1  . HIS A 1 54  ? 1.528   -10.083 6.047   1.00 0.00 ? 57  HIS A ND1  6  
ATOM 8916  C CD2  . HIS A 1 54  ? 1.687   -10.221 3.876   1.00 0.00 ? 57  HIS A CD2  6  
ATOM 8917  C CE1  . HIS A 1 54  ? 1.486   -11.364 5.731   1.00 0.00 ? 57  HIS A CE1  6  
ATOM 8918  N NE2  . HIS A 1 54  ? 1.577   -11.474 4.421   1.00 0.00 ? 57  HIS A NE2  6  
ATOM 8919  H H    . HIS A 1 54  ? 3.414   -5.678  5.818   1.00 0.00 ? 57  HIS A H    6  
ATOM 8920  H HA   . HIS A 1 54  ? 3.725   -8.096  4.187   1.00 0.00 ? 57  HIS A HA   6  
ATOM 8921  H HB2  . HIS A 1 54  ? 1.468   -7.487  5.874   1.00 0.00 ? 57  HIS A HB2  6  
ATOM 8922  H HB3  . HIS A 1 54  ? 0.969   -7.477  4.186   1.00 0.00 ? 57  HIS A HB3  6  
ATOM 8923  H HD1  . HIS A 1 54  ? 1.481   -9.731  6.969   1.00 0.00 ? 57  HIS A HD1  6  
ATOM 8924  H HD2  . HIS A 1 54  ? 1.776   -9.984  2.824   1.00 0.00 ? 57  HIS A HD2  6  
ATOM 8925  H HE1  . HIS A 1 54  ? 1.389   -12.182 6.429   1.00 0.00 ? 57  HIS A HE1  6  
ATOM 8926  N N    . MET A 1 55  ? 3.303   -6.814  2.111   1.00 0.00 ? 58  MET A N    6  
ATOM 8927  C CA   . MET A 1 55  ? 3.202   -6.033  0.886   1.00 0.00 ? 58  MET A CA   6  
ATOM 8928  C C    . MET A 1 55  ? 1.747   -5.928  0.443   1.00 0.00 ? 58  MET A C    6  
ATOM 8929  O O    . MET A 1 55  ? 1.007   -6.908  0.497   1.00 0.00 ? 58  MET A O    6  
ATOM 8930  C CB   . MET A 1 55  ? 4.023   -6.685  -0.228  1.00 0.00 ? 58  MET A CB   6  
ATOM 8931  C CG   . MET A 1 55  ? 5.520   -6.706  0.030   1.00 0.00 ? 58  MET A CG   6  
ATOM 8932  S SD   . MET A 1 55  ? 6.412   -7.722  -1.165  1.00 0.00 ? 58  MET A SD   6  
ATOM 8933  C CE   . MET A 1 55  ? 5.741   -7.097  -2.707  1.00 0.00 ? 58  MET A CE   6  
ATOM 8934  H H    . MET A 1 55  ? 3.651   -7.734  2.059   1.00 0.00 ? 58  MET A H    6  
ATOM 8935  H HA   . MET A 1 55  ? 3.588   -5.045  1.083   1.00 0.00 ? 58  MET A HA   6  
ATOM 8936  H HB2  . MET A 1 55  ? 3.689   -7.704  -0.351  1.00 0.00 ? 58  MET A HB2  6  
ATOM 8937  H HB3  . MET A 1 55  ? 3.847   -6.149  -1.148  1.00 0.00 ? 58  MET A HB3  6  
ATOM 8938  H HG2  . MET A 1 55  ? 5.896   -5.695  -0.026  1.00 0.00 ? 58  MET A HG2  6  
ATOM 8939  H HG3  . MET A 1 55  ? 5.694   -7.099  1.020   1.00 0.00 ? 58  MET A HG3  6  
ATOM 8940  H HE1  . MET A 1 55  ? 5.921   -6.033  -2.772  1.00 0.00 ? 58  MET A HE1  6  
ATOM 8941  H HE2  . MET A 1 55  ? 6.220   -7.595  -3.535  1.00 0.00 ? 58  MET A HE2  6  
ATOM 8942  H HE3  . MET A 1 55  ? 4.676   -7.287  -2.738  1.00 0.00 ? 58  MET A HE3  6  
ATOM 8943  N N    . VAL A 1 56  ? 1.334   -4.747  0.016   1.00 0.00 ? 59  VAL A N    6  
ATOM 8944  C CA   . VAL A 1 56  ? -0.023  -4.564  -0.481  1.00 0.00 ? 59  VAL A CA   6  
ATOM 8945  C C    . VAL A 1 56  ? -0.051  -4.666  -2.007  1.00 0.00 ? 59  VAL A C    6  
ATOM 8946  O O    . VAL A 1 56  ? 0.842   -4.159  -2.692  1.00 0.00 ? 59  VAL A O    6  
ATOM 8947  C CB   . VAL A 1 56  ? -0.618  -3.207  -0.034  1.00 0.00 ? 59  VAL A CB   6  
ATOM 8948  C CG1  . VAL A 1 56  ? -2.077  -3.081  -0.454  1.00 0.00 ? 59  VAL A CG1  6  
ATOM 8949  C CG2  . VAL A 1 56  ? -0.489  -3.035  1.472   1.00 0.00 ? 59  VAL A CG2  6  
ATOM 8950  H H    . VAL A 1 56  ? 1.947   -3.977  0.043   1.00 0.00 ? 59  VAL A H    6  
ATOM 8951  H HA   . VAL A 1 56  ? -0.634  -5.354  -0.072  1.00 0.00 ? 59  VAL A HA   6  
ATOM 8952  H HB   . VAL A 1 56  ? -0.059  -2.417  -0.513  1.00 0.00 ? 59  VAL A HB   6  
ATOM 8953  H HG11 . VAL A 1 56  ? -2.650  -3.881  -0.009  1.00 0.00 ? 59  VAL A HG11 6  
ATOM 8954  H HG12 . VAL A 1 56  ? -2.466  -2.131  -0.120  1.00 0.00 ? 59  VAL A HG12 6  
ATOM 8955  H HG13 . VAL A 1 56  ? -2.149  -3.141  -1.530  1.00 0.00 ? 59  VAL A HG13 6  
ATOM 8956  H HG21 . VAL A 1 56  ? 0.553   -3.029  1.748   1.00 0.00 ? 59  VAL A HG21 6  
ATOM 8957  H HG22 . VAL A 1 56  ? -0.945  -2.103  1.768   1.00 0.00 ? 59  VAL A HG22 6  
ATOM 8958  H HG23 . VAL A 1 56  ? -0.989  -3.853  1.971   1.00 0.00 ? 59  VAL A HG23 6  
ATOM 8959  N N    . CYS A 1 57  ? -1.061  -5.345  -2.534  1.00 0.00 ? 60  CYS A N    6  
ATOM 8960  C CA   . CYS A 1 57  ? -1.221  -5.490  -3.974  1.00 0.00 ? 60  CYS A CA   6  
ATOM 8961  C C    . CYS A 1 57  ? -2.252  -4.503  -4.520  1.00 0.00 ? 60  CYS A C    6  
ATOM 8962  O O    . CYS A 1 57  ? -3.177  -4.101  -3.819  1.00 0.00 ? 60  CYS A O    6  
ATOM 8963  C CB   . CYS A 1 57  ? -1.633  -6.920  -4.324  1.00 0.00 ? 60  CYS A CB   6  
ATOM 8964  S SG   . CYS A 1 57  ? -0.260  -8.116  -4.325  1.00 0.00 ? 60  CYS A SG   6  
ATOM 8965  H H    . CYS A 1 57  ? -1.719  -5.764  -1.937  1.00 0.00 ? 60  CYS A H    6  
ATOM 8966  H HA   . CYS A 1 57  ? -0.266  -5.282  -4.433  1.00 0.00 ? 60  CYS A HA   6  
ATOM 8967  H HB2  . CYS A 1 57  ? -2.362  -7.262  -3.601  1.00 0.00 ? 60  CYS A HB2  6  
ATOM 8968  H HB3  . CYS A 1 57  ? -2.080  -6.929  -5.308  1.00 0.00 ? 60  CYS A HB3  6  
ATOM 8969  N N    . SER A 1 58  ? -2.073  -4.130  -5.784  1.00 0.00 ? 61  SER A N    6  
ATOM 8970  C CA   . SER A 1 58  ? -2.939  -3.166  -6.457  1.00 0.00 ? 61  SER A CA   6  
ATOM 8971  C C    . SER A 1 58  ? -4.301  -3.768  -6.794  1.00 0.00 ? 61  SER A C    6  
ATOM 8972  O O    . SER A 1 58  ? -5.191  -3.068  -7.259  1.00 0.00 ? 61  SER A O    6  
ATOM 8973  C CB   . SER A 1 58  ? -2.265  -2.680  -7.737  1.00 0.00 ? 61  SER A CB   6  
ATOM 8974  O OG   . SER A 1 58  ? -0.916  -2.332  -7.493  1.00 0.00 ? 61  SER A OG   6  
ATOM 8975  H H    . SER A 1 58  ? -1.311  -4.505  -6.284  1.00 0.00 ? 61  SER A H    6  
ATOM 8976  H HA   . SER A 1 58  ? -3.080  -2.326  -5.796  1.00 0.00 ? 61  SER A HA   6  
ATOM 8977  H HB2  . SER A 1 58  ? -2.294  -3.464  -8.481  1.00 0.00 ? 61  SER A HB2  6  
ATOM 8978  H HB3  . SER A 1 58  ? -2.787  -1.810  -8.110  1.00 0.00 ? 61  SER A HB3  6  
ATOM 8979  H HG   . SER A 1 58  ? -0.859  -1.392  -7.295  1.00 0.00 ? 61  SER A HG   6  
ATOM 8980  N N    . GLN A 1 59  ? -4.458  -5.065  -6.561  1.00 0.00 ? 62  GLN A N    6  
ATOM 8981  C CA   . GLN A 1 59  ? -5.732  -5.738  -6.790  1.00 0.00 ? 62  GLN A CA   6  
ATOM 8982  C C    . GLN A 1 59  ? -6.599  -5.627  -5.530  1.00 0.00 ? 62  GLN A C    6  
ATOM 8983  O O    . GLN A 1 59  ? -7.517  -6.417  -5.300  1.00 0.00 ? 62  GLN A O    6  
ATOM 8984  C CB   . GLN A 1 59  ? -5.487  -7.207  -7.158  1.00 0.00 ? 62  GLN A CB   6  
ATOM 8985  C CG   . GLN A 1 59  ? -6.710  -7.929  -7.706  1.00 0.00 ? 62  GLN A CG   6  
ATOM 8986  C CD   . GLN A 1 59  ? -7.145  -7.420  -9.066  1.00 0.00 ? 62  GLN A CD   6  
ATOM 8987  O OE1  . GLN A 1 59  ? -6.328  -6.985  -9.880  1.00 0.00 ? 62  GLN A OE1  6  
ATOM 8988  N NE2  . GLN A 1 59  ? -8.437  -7.470  -9.319  1.00 0.00 ? 62  GLN A NE2  6  
ATOM 8989  H H    . GLN A 1 59  ? -3.700  -5.583  -6.223  1.00 0.00 ? 62  GLN A H    6  
ATOM 8990  H HA   . GLN A 1 59  ? -6.234  -5.242  -7.609  1.00 0.00 ? 62  GLN A HA   6  
ATOM 8991  H HB2  . GLN A 1 59  ? -4.710  -7.252  -7.906  1.00 0.00 ? 62  GLN A HB2  6  
ATOM 8992  H HB3  . GLN A 1 59  ? -5.154  -7.733  -6.275  1.00 0.00 ? 62  GLN A HB3  6  
ATOM 8993  H HG2  . GLN A 1 59  ? -6.479  -8.978  -7.795  1.00 0.00 ? 62  GLN A HG2  6  
ATOM 8994  H HG3  . GLN A 1 59  ? -7.529  -7.801  -7.013  1.00 0.00 ? 62  GLN A HG3  6  
ATOM 8995  H HE21 . GLN A 1 59  ? -9.034  -7.823  -8.622  1.00 0.00 ? 62  GLN A HE21 6  
ATOM 8996  H HE22 . GLN A 1 59  ? -8.753  -7.167  -10.197 1.00 0.00 ? 62  GLN A HE22 6  
ATOM 8997  N N    . SER A 1 60  ? -6.291  -4.625  -4.722  1.00 0.00 ? 63  SER A N    6  
ATOM 8998  C CA   . SER A 1 60  ? -6.960  -4.415  -3.455  1.00 0.00 ? 63  SER A CA   6  
ATOM 8999  C C    . SER A 1 60  ? -7.974  -3.279  -3.588  1.00 0.00 ? 63  SER A C    6  
ATOM 9000  O O    . SER A 1 60  ? -7.799  -2.385  -4.413  1.00 0.00 ? 63  SER A O    6  
ATOM 9001  C CB   . SER A 1 60  ? -5.919  -4.075  -2.381  1.00 0.00 ? 63  SER A CB   6  
ATOM 9002  O OG   . SER A 1 60  ? -6.477  -4.109  -1.082  1.00 0.00 ? 63  SER A OG   6  
ATOM 9003  H H    . SER A 1 60  ? -5.596  -3.994  -4.996  1.00 0.00 ? 63  SER A H    6  
ATOM 9004  H HA   . SER A 1 60  ? -7.475  -5.328  -3.187  1.00 0.00 ? 63  SER A HA   6  
ATOM 9005  H HB2  . SER A 1 60  ? -5.109  -4.789  -2.426  1.00 0.00 ? 63  SER A HB2  6  
ATOM 9006  H HB3  . SER A 1 60  ? -5.532  -3.081  -2.562  1.00 0.00 ? 63  SER A HB3  6  
ATOM 9007  H HG   . SER A 1 60  ? -6.973  -3.298  -0.926  1.00 0.00 ? 63  SER A HG   6  
ATOM 9008  N N    . TRP A 1 61  ? -9.027  -3.337  -2.778  1.00 0.00 ? 64  TRP A N    6  
ATOM 9009  C CA   . TRP A 1 61  ? -10.067 -2.301  -2.737  1.00 0.00 ? 64  TRP A CA   6  
ATOM 9010  C C    . TRP A 1 61  ? -10.686 -2.053  -4.115  1.00 0.00 ? 64  TRP A C    6  
ATOM 9011  O O    . TRP A 1 61  ? -11.092 -0.934  -4.431  1.00 0.00 ? 64  TRP A O    6  
ATOM 9012  C CB   . TRP A 1 61  ? -9.512  -0.986  -2.172  1.00 0.00 ? 64  TRP A CB   6  
ATOM 9013  C CG   . TRP A 1 61  ? -8.882  -1.125  -0.816  1.00 0.00 ? 64  TRP A CG   6  
ATOM 9014  C CD1  . TRP A 1 61  ? -9.506  -1.426  0.361   1.00 0.00 ? 64  TRP A CD1  6  
ATOM 9015  C CD2  . TRP A 1 61  ? -7.499  -0.952  -0.502  1.00 0.00 ? 64  TRP A CD2  6  
ATOM 9016  N NE1  . TRP A 1 61  ? -8.590  -1.460  1.386   1.00 0.00 ? 64  TRP A NE1  6  
ATOM 9017  C CE2  . TRP A 1 61  ? -7.350  -1.171  0.879   1.00 0.00 ? 64  TRP A CE2  6  
ATOM 9018  C CE3  . TRP A 1 61  ? -6.369  -0.637  -1.260  1.00 0.00 ? 64  TRP A CE3  6  
ATOM 9019  C CZ2  . TRP A 1 61  ? -6.118  -1.082  1.515   1.00 0.00 ? 64  TRP A CZ2  6  
ATOM 9020  C CZ3  . TRP A 1 61  ? -5.147  -0.548  -0.628  1.00 0.00 ? 64  TRP A CZ3  6  
ATOM 9021  C CH2  . TRP A 1 61  ? -5.030  -0.772  0.747   1.00 0.00 ? 64  TRP A CH2  6  
ATOM 9022  H H    . TRP A 1 61  ? -9.110  -4.111  -2.174  1.00 0.00 ? 64  TRP A H    6  
ATOM 9023  H HA   . TRP A 1 61  ? -10.845 -2.655  -2.079  1.00 0.00 ? 64  TRP A HA   6  
ATOM 9024  H HB2  . TRP A 1 61  ? -8.762  -0.601  -2.847  1.00 0.00 ? 64  TRP A HB2  6  
ATOM 9025  H HB3  . TRP A 1 61  ? -10.318 -0.268  -2.092  1.00 0.00 ? 64  TRP A HB3  6  
ATOM 9026  H HD1  . TRP A 1 61  ? -10.565 -1.611  0.459   1.00 0.00 ? 64  TRP A HD1  6  
ATOM 9027  H HE1  . TRP A 1 61  ? -8.792  -1.660  2.330   1.00 0.00 ? 64  TRP A HE1  6  
ATOM 9028  H HE3  . TRP A 1 61  ? -6.439  -0.461  -2.322  1.00 0.00 ? 64  TRP A HE3  6  
ATOM 9029  H HZ2  . TRP A 1 61  ? -6.008  -1.252  2.576   1.00 0.00 ? 64  TRP A HZ2  6  
ATOM 9030  H HZ3  . TRP A 1 61  ? -4.263  -0.306  -1.197  1.00 0.00 ? 64  TRP A HZ3  6  
ATOM 9031  H HH2  . TRP A 1 61  ? -4.053  -0.693  1.201   1.00 0.00 ? 64  TRP A HH2  6  
ATOM 9032  N N    . GLY A 1 62  ? -10.763 -3.104  -4.921  1.00 0.00 ? 65  GLY A N    6  
ATOM 9033  C CA   . GLY A 1 62  ? -11.363 -2.989  -6.237  1.00 0.00 ? 65  GLY A CA   6  
ATOM 9034  C C    . GLY A 1 62  ? -10.540 -2.152  -7.197  1.00 0.00 ? 65  GLY A C    6  
ATOM 9035  O O    . GLY A 1 62  ? -11.092 -1.495  -8.079  1.00 0.00 ? 65  GLY A O    6  
ATOM 9036  H H    . GLY A 1 62  ? -10.416 -3.967  -4.618  1.00 0.00 ? 65  GLY A H    6  
ATOM 9037  H HA2  . GLY A 1 62  ? -11.481 -3.979  -6.653  1.00 0.00 ? 65  GLY A HA2  6  
ATOM 9038  H HA3  . GLY A 1 62  ? -12.337 -2.538  -6.133  1.00 0.00 ? 65  GLY A HA3  6  
ATOM 9039  N N    . ARG A 1 63  ? -9.226  -2.158  -7.025  1.00 0.00 ? 66  ARG A N    6  
ATOM 9040  C CA   . ARG A 1 63  ? -8.342  -1.449  -7.934  1.00 0.00 ? 66  ARG A CA   6  
ATOM 9041  C C    . ARG A 1 63  ? -7.775  -2.415  -8.968  1.00 0.00 ? 66  ARG A C    6  
ATOM 9042  O O    . ARG A 1 63  ? -7.869  -3.634  -8.807  1.00 0.00 ? 66  ARG A O    6  
ATOM 9043  C CB   . ARG A 1 63  ? -7.211  -0.761  -7.161  1.00 0.00 ? 66  ARG A CB   6  
ATOM 9044  C CG   . ARG A 1 63  ? -7.682  0.326   -6.205  1.00 0.00 ? 66  ARG A CG   6  
ATOM 9045  C CD   . ARG A 1 63  ? -8.188  1.558   -6.946  1.00 0.00 ? 66  ARG A CD   6  
ATOM 9046  N NE   . ARG A 1 63  ? -8.677  2.585   -6.029  1.00 0.00 ? 66  ARG A NE   6  
ATOM 9047  C CZ   . ARG A 1 63  ? -8.349  3.871   -6.105  1.00 0.00 ? 66  ARG A CZ   6  
ATOM 9048  N NH1  . ARG A 1 63  ? -7.572  4.312   -7.085  1.00 0.00 ? 66  ARG A NH1  6  
ATOM 9049  N NH2  . ARG A 1 63  ? -8.822  4.728   -5.216  1.00 0.00 ? 66  ARG A NH2  6  
ATOM 9050  H H    . ARG A 1 63  ? -8.839  -2.652  -6.271  1.00 0.00 ? 66  ARG A H    6  
ATOM 9051  H HA   . ARG A 1 63  ? -8.928  -0.701  -8.446  1.00 0.00 ? 66  ARG A HA   6  
ATOM 9052  H HB2  . ARG A 1 63  ? -6.684  -1.509  -6.586  1.00 0.00 ? 66  ARG A HB2  6  
ATOM 9053  H HB3  . ARG A 1 63  ? -6.525  -0.317  -7.868  1.00 0.00 ? 66  ARG A HB3  6  
ATOM 9054  H HG2  . ARG A 1 63  ? -8.482  -0.069  -5.596  1.00 0.00 ? 66  ARG A HG2  6  
ATOM 9055  H HG3  . ARG A 1 63  ? -6.854  0.611   -5.570  1.00 0.00 ? 66  ARG A HG3  6  
ATOM 9056  H HD2  . ARG A 1 63  ? -7.379  1.971   -7.532  1.00 0.00 ? 66  ARG A HD2  6  
ATOM 9057  H HD3  . ARG A 1 63  ? -8.992  1.267   -7.604  1.00 0.00 ? 66  ARG A HD3  6  
ATOM 9058  H HE   . ARG A 1 63  ? -9.288  2.290   -5.308  1.00 0.00 ? 66  ARG A HE   6  
ATOM 9059  H HH12 . ARG A 1 63  ? -6.688  3.867   -7.273  1.00 0.00 ? 66  ARG A HH12 6  
ATOM 9060  H HH21 . ARG A 1 63  ? -9.430  4.412   -4.486  1.00 0.00 ? 66  ARG A HH21 6  
ATOM 9061  H HH22 . ARG A 1 63  ? -8.562  5.691   -5.265  1.00 0.00 ? 66  ARG A HH22 6  
ATOM 9062  N N    . SER A 1 64  ? -7.209  -1.873  -10.035 1.00 0.00 ? 67  SER A N    6  
ATOM 9063  C CA   . SER A 1 64  ? -6.673  -2.685  -11.113 1.00 0.00 ? 67  SER A CA   6  
ATOM 9064  C C    . SER A 1 64  ? -5.459  -2.007  -11.746 1.00 0.00 ? 67  SER A C    6  
ATOM 9065  O O    . SER A 1 64  ? -4.886  -1.090  -11.155 1.00 0.00 ? 67  SER A O    6  
ATOM 9066  C CB   . SER A 1 64  ? -7.757  -2.917  -12.161 1.00 0.00 ? 67  SER A CB   6  
ATOM 9067  O OG   . SER A 1 64  ? -8.891  -3.548  -11.589 1.00 0.00 ? 67  SER A OG   6  
ATOM 9068  H H    . SER A 1 64  ? -7.152  -0.901  -10.101 1.00 0.00 ? 67  SER A H    6  
ATOM 9069  H HA   . SER A 1 64  ? -6.374  -3.633  -10.699 1.00 0.00 ? 67  SER A HA   6  
ATOM 9070  H HB2  . SER A 1 64  ? -8.059  -1.968  -12.576 1.00 0.00 ? 67  SER A HB2  6  
ATOM 9071  H HB3  . SER A 1 64  ? -7.366  -3.547  -12.946 1.00 0.00 ? 67  SER A HB3  6  
ATOM 9072  H HG   . SER A 1 64  ? -8.740  -3.675  -10.641 1.00 0.00 ? 67  SER A HG   6  
ATOM 9073  N N    . SER A 1 65  ? -5.074  -2.449  -12.943 1.00 0.00 ? 68  SER A N    6  
ATOM 9074  C CA   . SER A 1 65  ? -3.916  -1.891  -13.635 1.00 0.00 ? 68  SER A CA   6  
ATOM 9075  C C    . SER A 1 65  ? -4.102  -0.401  -13.924 1.00 0.00 ? 68  SER A C    6  
ATOM 9076  O O    . SER A 1 65  ? -3.147  0.375   -13.884 1.00 0.00 ? 68  SER A O    6  
ATOM 9077  C CB   . SER A 1 65  ? -3.670  -2.648  -14.943 1.00 0.00 ? 68  SER A CB   6  
ATOM 9078  O OG   . SER A 1 65  ? -3.619  -4.048  -14.720 1.00 0.00 ? 68  SER A OG   6  
ATOM 9079  H H    . SER A 1 65  ? -5.582  -3.174  -13.373 1.00 0.00 ? 68  SER A H    6  
ATOM 9080  H HA   . SER A 1 65  ? -3.056  -2.014  -12.995 1.00 0.00 ? 68  SER A HA   6  
ATOM 9081  H HB2  . SER A 1 65  ? -4.471  -2.435  -15.635 1.00 0.00 ? 68  SER A HB2  6  
ATOM 9082  H HB3  . SER A 1 65  ? -2.730  -2.329  -15.371 1.00 0.00 ? 68  SER A HB3  6  
ATOM 9083  H HG   . SER A 1 65  ? -4.522  -4.395  -14.653 1.00 0.00 ? 68  SER A HG   6  
ATOM 9084  N N    . LYS A 1 66  ? -5.336  0.002   -14.200 1.00 0.00 ? 69  LYS A N    6  
ATOM 9085  C CA   . LYS A 1 66  ? -5.626  1.389   -14.525 1.00 0.00 ? 69  LYS A CA   6  
ATOM 9086  C C    . LYS A 1 66  ? -6.677  1.964   -13.578 1.00 0.00 ? 69  LYS A C    6  
ATOM 9087  O O    . LYS A 1 66  ? -7.876  1.920   -13.857 1.00 0.00 ? 69  LYS A O    6  
ATOM 9088  C CB   . LYS A 1 66  ? -6.083  1.519   -15.986 1.00 0.00 ? 69  LYS A CB   6  
ATOM 9089  C CG   . LYS A 1 66  ? -6.473  2.939   -16.389 1.00 0.00 ? 69  LYS A CG   6  
ATOM 9090  C CD   . LYS A 1 66  ? -5.345  3.929   -16.143 1.00 0.00 ? 69  LYS A CD   6  
ATOM 9091  C CE   . LYS A 1 66  ? -5.796  5.359   -16.396 1.00 0.00 ? 69  LYS A CE   6  
ATOM 9092  N NZ   . LYS A 1 66  ? -4.737  6.347   -16.064 1.00 0.00 ? 69  LYS A NZ   6  
ATOM 9093  H H    . LYS A 1 66  ? -6.067  -0.647  -14.175 1.00 0.00 ? 69  LYS A H    6  
ATOM 9094  H HA   . LYS A 1 66  ? -4.711  1.949   -14.396 1.00 0.00 ? 69  LYS A HA   6  
ATOM 9095  H HB2  . LYS A 1 66  ? -5.282  1.192   -16.632 1.00 0.00 ? 69  LYS A HB2  6  
ATOM 9096  H HB3  . LYS A 1 66  ? -6.938  0.880   -16.138 1.00 0.00 ? 69  LYS A HB3  6  
ATOM 9097  H HG2  . LYS A 1 66  ? -6.722  2.946   -17.440 1.00 0.00 ? 69  LYS A HG2  6  
ATOM 9098  H HG3  . LYS A 1 66  ? -7.334  3.238   -15.812 1.00 0.00 ? 69  LYS A HG3  6  
ATOM 9099  H HD2  . LYS A 1 66  ? -5.019  3.843   -15.118 1.00 0.00 ? 69  LYS A HD2  6  
ATOM 9100  H HD3  . LYS A 1 66  ? -4.523  3.696   -16.805 1.00 0.00 ? 69  LYS A HD3  6  
ATOM 9101  H HE2  . LYS A 1 66  ? -6.056  5.463   -17.440 1.00 0.00 ? 69  LYS A HE2  6  
ATOM 9102  H HE3  . LYS A 1 66  ? -6.666  5.560   -15.790 1.00 0.00 ? 69  LYS A HE3  6  
ATOM 9103  H HZ1  . LYS A 1 66  ? -5.161  7.301   -16.019 1.00 0.00 ? 69  LYS A HZ1  6  
ATOM 9104  H HZ3  . LYS A 1 66  ? -4.018  6.353   -16.824 1.00 0.00 ? 69  LYS A HZ3  6  
ATOM 9105  N N    . GLN A 1 67  ? -6.211  2.471   -12.447 1.00 0.00 ? 70  GLN A N    6  
ATOM 9106  C CA   . GLN A 1 67  ? -7.052  3.198   -11.507 1.00 0.00 ? 70  GLN A CA   6  
ATOM 9107  C C    . GLN A 1 67  ? -6.208  4.178   -10.697 1.00 0.00 ? 70  GLN A C    6  
ATOM 9108  O O    . GLN A 1 67  ? -5.769  3.879   -9.586  1.00 0.00 ? 70  GLN A O    6  
ATOM 9109  C CB   . GLN A 1 67  ? -7.822  2.244   -10.582 1.00 0.00 ? 70  GLN A CB   6  
ATOM 9110  C CG   . GLN A 1 67  ? -9.189  1.847   -11.124 1.00 0.00 ? 70  GLN A CG   6  
ATOM 9111  C CD   . GLN A 1 67  ? -9.899  0.827   -10.260 1.00 0.00 ? 70  GLN A CD   6  
ATOM 9112  O OE1  . GLN A 1 67  ? -9.763  -0.376  -10.467 1.00 0.00 ? 70  GLN A OE1  6  
ATOM 9113  N NE2  . GLN A 1 67  ? -10.669 1.300   -9.292  1.00 0.00 ? 70  GLN A NE2  6  
ATOM 9114  H H    . GLN A 1 67  ? -5.263  2.352   -12.236 1.00 0.00 ? 70  GLN A H    6  
ATOM 9115  H HA   . GLN A 1 67  ? -7.761  3.764   -12.088 1.00 0.00 ? 70  GLN A HA   6  
ATOM 9116  H HB2  . GLN A 1 67  ? -7.238  1.347   -10.440 1.00 0.00 ? 70  GLN A HB2  6  
ATOM 9117  H HB3  . GLN A 1 67  ? -7.965  2.725   -9.625  1.00 0.00 ? 70  GLN A HB3  6  
ATOM 9118  H HG2  . GLN A 1 67  ? -9.808  2.729   -11.186 1.00 0.00 ? 70  GLN A HG2  6  
ATOM 9119  H HG3  . GLN A 1 67  ? -9.062  1.430   -12.114 1.00 0.00 ? 70  GLN A HG3  6  
ATOM 9120  H HE21 . GLN A 1 67  ? -10.741 2.272   -9.188  1.00 0.00 ? 70  GLN A HE21 6  
ATOM 9121  H HE22 . GLN A 1 67  ? -11.135 0.656   -8.715  1.00 0.00 ? 70  GLN A HE22 6  
ATOM 9122  N N    . TRP A 1 68  ? -5.982  5.351   -11.277 1.00 0.00 ? 71  TRP A N    6  
ATOM 9123  C CA   . TRP A 1 68  ? -5.178  6.390   -10.651 1.00 0.00 ? 71  TRP A CA   6  
ATOM 9124  C C    . TRP A 1 68  ? -6.034  7.635   -10.435 1.00 0.00 ? 71  TRP A C    6  
ATOM 9125  O O    . TRP A 1 68  ? -5.844  8.650   -11.106 1.00 0.00 ? 71  TRP A O    6  
ATOM 9126  C CB   . TRP A 1 68  ? -3.979  6.755   -11.536 1.00 0.00 ? 71  TRP A CB   6  
ATOM 9127  C CG   . TRP A 1 68  ? -3.053  5.617   -11.850 1.00 0.00 ? 71  TRP A CG   6  
ATOM 9128  C CD1  . TRP A 1 68  ? -3.165  4.725   -12.879 1.00 0.00 ? 71  TRP A CD1  6  
ATOM 9129  C CD2  . TRP A 1 68  ? -1.856  5.270   -11.148 1.00 0.00 ? 71  TRP A CD2  6  
ATOM 9130  N NE1  . TRP A 1 68  ? -2.111  3.844   -12.858 1.00 0.00 ? 71  TRP A NE1  6  
ATOM 9131  C CE2  . TRP A 1 68  ? -1.294  4.158   -11.805 1.00 0.00 ? 71  TRP A CE2  6  
ATOM 9132  C CE3  . TRP A 1 68  ? -1.201  5.792   -10.028 1.00 0.00 ? 71  TRP A CE3  6  
ATOM 9133  C CZ2  . TRP A 1 68  ? -0.112  3.561   -11.376 1.00 0.00 ? 71  TRP A CZ2  6  
ATOM 9134  C CZ3  . TRP A 1 68  ? -0.029  5.196   -9.606  1.00 0.00 ? 71  TRP A CZ3  6  
ATOM 9135  C CH2  . TRP A 1 68  ? 0.506   4.093   -10.279 1.00 0.00 ? 71  TRP A CH2  6  
ATOM 9136  H H    . TRP A 1 68  ? -6.388  5.532   -12.158 1.00 0.00 ? 71  TRP A H    6  
ATOM 9137  H HA   . TRP A 1 68  ? -4.824  6.025   -9.697  1.00 0.00 ? 71  TRP A HA   6  
ATOM 9138  H HB2  . TRP A 1 68  ? -4.345  7.145   -12.473 1.00 0.00 ? 71  TRP A HB2  6  
ATOM 9139  H HB3  . TRP A 1 68  ? -3.402  7.523   -11.040 1.00 0.00 ? 71  TRP A HB3  6  
ATOM 9140  H HD1  . TRP A 1 68  ? -3.971  4.723   -13.598 1.00 0.00 ? 71  TRP A HD1  6  
ATOM 9141  H HE1  . TRP A 1 68  ? -1.963  3.109   -13.497 1.00 0.00 ? 71  TRP A HE1  6  
ATOM 9142  H HE3  . TRP A 1 68  ? -1.601  6.643   -9.495  1.00 0.00 ? 71  TRP A HE3  6  
ATOM 9143  H HZ2  . TRP A 1 68  ? 0.314   2.709   -11.885 1.00 0.00 ? 71  TRP A HZ2  6  
ATOM 9144  H HZ3  . TRP A 1 68  ? 0.491   5.584   -8.743  1.00 0.00 ? 71  TRP A HZ3  6  
ATOM 9145  H HH2  . TRP A 1 68  ? 1.424   3.661   -9.913  1.00 0.00 ? 71  TRP A HH2  6  
ATOM 9146  N N    . GLU A 1 69  ? -6.984  7.556   -9.517  1.00 0.00 ? 72  GLU A N    6  
ATOM 9147  C CA   . GLU A 1 69  ? -7.914  8.660   -9.313  1.00 0.00 ? 72  GLU A CA   6  
ATOM 9148  C C    . GLU A 1 69  ? -7.609  9.441   -8.033  1.00 0.00 ? 72  GLU A C    6  
ATOM 9149  O O    . GLU A 1 69  ? -7.012  10.516  -8.089  1.00 0.00 ? 72  GLU A O    6  
ATOM 9150  C CB   . GLU A 1 69  ? -9.370  8.164   -9.338  1.00 0.00 ? 72  GLU A CB   6  
ATOM 9151  C CG   . GLU A 1 69  ? -9.636  6.937   -8.476  1.00 0.00 ? 72  GLU A CG   6  
ATOM 9152  C CD   . GLU A 1 69  ? -11.062 6.449   -8.591  1.00 0.00 ? 72  GLU A CD   6  
ATOM 9153  O OE1  . GLU A 1 69  ? -11.392 5.813   -9.613  1.00 0.00 ? 72  GLU A OE1  6  
ATOM 9154  O OE2  . GLU A 1 69  ? -11.862 6.701   -7.665  1.00 0.00 ? 72  GLU A OE2  6  
ATOM 9155  H H    . GLU A 1 69  ? -7.054  6.750   -8.964  1.00 0.00 ? 72  GLU A H    6  
ATOM 9156  H HA   . GLU A 1 69  ? -7.778  9.337   -10.145 1.00 0.00 ? 72  GLU A HA   6  
ATOM 9157  H HB2  . GLU A 1 69  ? -10.012 8.962   -8.992  1.00 0.00 ? 72  GLU A HB2  6  
ATOM 9158  H HB3  . GLU A 1 69  ? -9.638  7.924   -10.357 1.00 0.00 ? 72  GLU A HB3  6  
ATOM 9159  H HG2  . GLU A 1 69  ? -8.977  6.143   -8.787  1.00 0.00 ? 72  GLU A HG2  6  
ATOM 9160  H HG3  . GLU A 1 69  ? -9.439  7.188   -7.445  1.00 0.00 ? 72  GLU A HG3  6  
ATOM 9161  N N    . ASP A 1 70  ? -7.990  8.900   -6.882  1.00 0.00 ? 73  ASP A N    6  
ATOM 9162  C CA   . ASP A 1 70  ? -7.834  9.620   -5.623  1.00 0.00 ? 73  ASP A CA   6  
ATOM 9163  C C    . ASP A 1 70  ? -6.896  8.873   -4.679  1.00 0.00 ? 73  ASP A C    6  
ATOM 9164  O O    . ASP A 1 70  ? -7.302  7.911   -4.022  1.00 0.00 ? 73  ASP A O    6  
ATOM 9165  C CB   . ASP A 1 70  ? -9.193  9.823   -4.946  1.00 0.00 ? 73  ASP A CB   6  
ATOM 9166  C CG   . ASP A 1 70  ? -9.112  10.817  -3.803  1.00 0.00 ? 73  ASP A CG   6  
ATOM 9167  O OD1  . ASP A 1 70  ? -8.729  10.420  -2.688  1.00 0.00 ? 73  ASP A OD1  6  
ATOM 9168  O OD2  . ASP A 1 70  ? -9.428  12.004  -4.026  1.00 0.00 ? 73  ASP A OD2  6  
ATOM 9169  H H    . ASP A 1 70  ? -8.377  8.001   -6.877  1.00 0.00 ? 73  ASP A H    6  
ATOM 9170  H HA   . ASP A 1 70  ? -7.408  10.587  -5.845  1.00 0.00 ? 73  ASP A HA   6  
ATOM 9171  H HB2  . ASP A 1 70  ? -9.905  10.190  -5.673  1.00 0.00 ? 73  ASP A HB2  6  
ATOM 9172  H HB3  . ASP A 1 70  ? -9.538  8.878   -4.552  1.00 0.00 ? 73  ASP A HB3  6  
ATOM 9173  N N    . PRO A 1 71  ? -5.618  9.282   -4.633  1.00 0.00 ? 74  PRO A N    6  
ATOM 9174  C CA   . PRO A 1 71  ? -4.623  8.702   -3.745  1.00 0.00 ? 74  PRO A CA   6  
ATOM 9175  C C    . PRO A 1 71  ? -4.406  9.529   -2.475  1.00 0.00 ? 74  PRO A C    6  
ATOM 9176  O O    . PRO A 1 71  ? -3.646  9.137   -1.587  1.00 0.00 ? 74  PRO A O    6  
ATOM 9177  C CB   . PRO A 1 71  ? -3.373  8.741   -4.620  1.00 0.00 ? 74  PRO A CB   6  
ATOM 9178  C CG   . PRO A 1 71  ? -3.541  9.951   -5.489  1.00 0.00 ? 74  PRO A CG   6  
ATOM 9179  C CD   . PRO A 1 71  ? -5.011  10.316  -5.484  1.00 0.00 ? 74  PRO A CD   6  
ATOM 9180  H HA   . PRO A 1 71  ? -4.856  7.683   -3.485  1.00 0.00 ? 74  PRO A HA   6  
ATOM 9181  H HB2  . PRO A 1 71  ? -2.496  8.825   -3.994  1.00 0.00 ? 74  PRO A HB2  6  
ATOM 9182  H HB3  . PRO A 1 71  ? -3.314  7.841   -5.210  1.00 0.00 ? 74  PRO A HB3  6  
ATOM 9183  H HG2  . PRO A 1 71  ? -2.956  10.765  -5.091  1.00 0.00 ? 74  PRO A HG2  6  
ATOM 9184  H HG3  . PRO A 1 71  ? -3.219  9.721   -6.492  1.00 0.00 ? 74  PRO A HG3  6  
ATOM 9185  H HD2  . PRO A 1 71  ? -5.154  11.298  -5.058  1.00 0.00 ? 74  PRO A HD2  6  
ATOM 9186  H HD3  . PRO A 1 71  ? -5.412  10.275  -6.487  1.00 0.00 ? 74  PRO A HD3  6  
ATOM 9187  N N    . SER A 1 72  ? -5.096  10.660  -2.392  1.00 0.00 ? 75  SER A N    6  
ATOM 9188  C CA   . SER A 1 72  ? -4.870  11.638  -1.333  1.00 0.00 ? 75  SER A CA   6  
ATOM 9189  C C    . SER A 1 72  ? -5.267  11.103  0.044   1.00 0.00 ? 75  SER A C    6  
ATOM 9190  O O    . SER A 1 72  ? -4.842  11.638  1.071   1.00 0.00 ? 75  SER A O    6  
ATOM 9191  C CB   . SER A 1 72  ? -5.642  12.917  -1.650  1.00 0.00 ? 75  SER A CB   6  
ATOM 9192  O OG   . SER A 1 72  ? -5.364  13.357  -2.972  1.00 0.00 ? 75  SER A OG   6  
ATOM 9193  H H    . SER A 1 72  ? -5.777  10.847  -3.071  1.00 0.00 ? 75  SER A H    6  
ATOM 9194  H HA   . SER A 1 72  ? -3.817  11.866  -1.319  1.00 0.00 ? 75  SER A HA   6  
ATOM 9195  H HB2  . SER A 1 72  ? -6.701  12.732  -1.558  1.00 0.00 ? 75  SER A HB2  6  
ATOM 9196  H HB3  . SER A 1 72  ? -5.348  13.692  -0.958  1.00 0.00 ? 75  SER A HB3  6  
ATOM 9197  H HG   . SER A 1 72  ? -4.410  13.526  -3.060  1.00 0.00 ? 75  SER A HG   6  
ATOM 9198  N N    . GLN A 1 73  ? -6.065  10.042  0.064   1.00 0.00 ? 76  GLN A N    6  
ATOM 9199  C CA   . GLN A 1 73  ? -6.504  9.431   1.315   1.00 0.00 ? 76  GLN A CA   6  
ATOM 9200  C C    . GLN A 1 73  ? -5.313  8.884   2.097   1.00 0.00 ? 76  GLN A C    6  
ATOM 9201  O O    . GLN A 1 73  ? -5.358  8.769   3.321   1.00 0.00 ? 76  GLN A O    6  
ATOM 9202  C CB   . GLN A 1 73  ? -7.492  8.298   1.028   1.00 0.00 ? 76  GLN A CB   6  
ATOM 9203  C CG   . GLN A 1 73  ? -8.609  8.692   0.079   1.00 0.00 ? 76  GLN A CG   6  
ATOM 9204  C CD   . GLN A 1 73  ? -9.460  9.830   0.607   1.00 0.00 ? 76  GLN A CD   6  
ATOM 9205  O OE1  . GLN A 1 73  ? -9.675  9.965   1.810   1.00 0.00 ? 76  GLN A OE1  6  
ATOM 9206  N NE2  . GLN A 1 73  ? -9.920  10.674  -0.295  1.00 0.00 ? 76  GLN A NE2  6  
ATOM 9207  H H    . GLN A 1 73  ? -6.374  9.663   -0.784  1.00 0.00 ? 76  GLN A H    6  
ATOM 9208  H HA   . GLN A 1 73  ? -6.995  10.190  1.904   1.00 0.00 ? 76  GLN A HA   6  
ATOM 9209  H HB2  . GLN A 1 73  ? -6.954  7.469   0.589   1.00 0.00 ? 76  GLN A HB2  6  
ATOM 9210  H HB3  . GLN A 1 73  ? -7.934  7.977   1.959   1.00 0.00 ? 76  GLN A HB3  6  
ATOM 9211  H HG2  . GLN A 1 73  ? -8.176  8.997   -0.861  1.00 0.00 ? 76  GLN A HG2  6  
ATOM 9212  H HG3  . GLN A 1 73  ? -9.245  7.833   -0.082  1.00 0.00 ? 76  GLN A HG3  6  
ATOM 9213  H HE21 . GLN A 1 73  ? -9.679  10.521  -1.244  1.00 0.00 ? 76  GLN A HE21 6  
ATOM 9214  H HE22 . GLN A 1 73  ? -10.488 11.416  0.008   1.00 0.00 ? 76  GLN A HE22 6  
ATOM 9215  N N    . ALA A 1 74  ? -4.237  8.578   1.382   1.00 0.00 ? 77  ALA A N    6  
ATOM 9216  C CA   . ALA A 1 74  ? -3.065  7.963   1.987   1.00 0.00 ? 77  ALA A CA   6  
ATOM 9217  C C    . ALA A 1 74  ? -2.057  9.012   2.449   1.00 0.00 ? 77  ALA A C    6  
ATOM 9218  O O    . ALA A 1 74  ? -0.882  8.710   2.659   1.00 0.00 ? 77  ALA A O    6  
ATOM 9219  C CB   . ALA A 1 74  ? -2.417  7.000   1.005   1.00 0.00 ? 77  ALA A CB   6  
ATOM 9220  H H    . ALA A 1 74  ? -4.231  8.779   0.421   1.00 0.00 ? 77  ALA A H    6  
ATOM 9221  H HA   . ALA A 1 74  ? -3.396  7.398   2.845   1.00 0.00 ? 77  ALA A HA   6  
ATOM 9222  H HB1  . ALA A 1 74  ? -3.137  6.252   0.707   1.00 0.00 ? 77  ALA A HB1  6  
ATOM 9223  H HB2  . ALA A 1 74  ? -2.081  7.545   0.134   1.00 0.00 ? 77  ALA A HB2  6  
ATOM 9224  H HB3  . ALA A 1 74  ? -1.571  6.519   1.477   1.00 0.00 ? 77  ALA A HB3  6  
ATOM 9225  N N    . SER A 1 75  ? -2.531  10.241  2.614   1.00 0.00 ? 78  SER A N    6  
ATOM 9226  C CA   . SER A 1 75  ? -1.690  11.344  3.068   1.00 0.00 ? 78  SER A CA   6  
ATOM 9227  C C    . SER A 1 75  ? -1.044  11.034  4.417   1.00 0.00 ? 78  SER A C    6  
ATOM 9228  O O    . SER A 1 75  ? 0.103   11.406  4.665   1.00 0.00 ? 78  SER A O    6  
ATOM 9229  C CB   . SER A 1 75  ? -2.524  12.623  3.150   1.00 0.00 ? 78  SER A CB   6  
ATOM 9230  O OG   . SER A 1 75  ? -3.801  12.354  3.708   1.00 0.00 ? 78  SER A OG   6  
ATOM 9231  H H    . SER A 1 75  ? -3.478  10.415  2.424   1.00 0.00 ? 78  SER A H    6  
ATOM 9232  H HA   . SER A 1 75  ? -0.911  11.484  2.334   1.00 0.00 ? 78  SER A HA   6  
ATOM 9233  H HB2  . SER A 1 75  ? -2.016  13.344  3.775   1.00 0.00 ? 78  SER A HB2  6  
ATOM 9234  H HB3  . SER A 1 75  ? -2.656  13.032  2.160   1.00 0.00 ? 78  SER A HB3  6  
ATOM 9235  H HG   . SER A 1 75  ? -4.464  12.351  3.006   1.00 0.00 ? 78  SER A HG   6  
ATOM 9236  N N    . LYS A 1 76  ? -1.781  10.330  5.271   1.00 0.00 ? 79  LYS A N    6  
ATOM 9237  C CA   . LYS A 1 76  ? -1.290  9.959   6.595   1.00 0.00 ? 79  LYS A CA   6  
ATOM 9238  C C    . LYS A 1 76  ? -0.038  9.091   6.495   1.00 0.00 ? 79  LYS A C    6  
ATOM 9239  O O    . LYS A 1 76  ? 0.859   9.178   7.336   1.00 0.00 ? 79  LYS A O    6  
ATOM 9240  C CB   . LYS A 1 76  ? -2.377  9.215   7.369   1.00 0.00 ? 79  LYS A CB   6  
ATOM 9241  C CG   . LYS A 1 76  ? -3.675  9.991   7.502   1.00 0.00 ? 79  LYS A CG   6  
ATOM 9242  C CD   . LYS A 1 76  ? -3.463  11.331  8.189   1.00 0.00 ? 79  LYS A CD   6  
ATOM 9243  C CE   . LYS A 1 76  ? -4.776  12.062  8.406   1.00 0.00 ? 79  LYS A CE   6  
ATOM 9244  N NZ   . LYS A 1 76  ? -4.573  13.366  9.093   1.00 0.00 ? 79  LYS A NZ   6  
ATOM 9245  H H    . LYS A 1 76  ? -2.685  10.060  5.006   1.00 0.00 ? 79  LYS A H    6  
ATOM 9246  H HA   . LYS A 1 76  ? -1.044  10.867  7.122   1.00 0.00 ? 79  LYS A HA   6  
ATOM 9247  H HB2  . LYS A 1 76  ? -2.590  8.288   6.860   1.00 0.00 ? 79  LYS A HB2  6  
ATOM 9248  H HB3  . LYS A 1 76  ? -2.011  8.995   8.362   1.00 0.00 ? 79  LYS A HB3  6  
ATOM 9249  H HG2  . LYS A 1 76  ? -4.076  10.163  6.516   1.00 0.00 ? 79  LYS A HG2  6  
ATOM 9250  H HG3  . LYS A 1 76  ? -4.372  9.404   8.080   1.00 0.00 ? 79  LYS A HG3  6  
ATOM 9251  H HD2  . LYS A 1 76  ? -2.995  11.164  9.147   1.00 0.00 ? 79  LYS A HD2  6  
ATOM 9252  H HD3  . LYS A 1 76  ? -2.818  11.942  7.574   1.00 0.00 ? 79  LYS A HD3  6  
ATOM 9253  H HE2  . LYS A 1 76  ? -5.241  12.238  7.447   1.00 0.00 ? 79  LYS A HE2  6  
ATOM 9254  H HE3  . LYS A 1 76  ? -5.424  11.444  9.011   1.00 0.00 ? 79  LYS A HE3  6  
ATOM 9255  H HZ1  . LYS A 1 76  ? -3.981  13.221  9.943   1.00 0.00 ? 79  LYS A HZ1  6  
ATOM 9256  H HZ3  . LYS A 1 76  ? -5.497  13.740  9.405   1.00 0.00 ? 79  LYS A HZ3  6  
ATOM 9257  N N    . VAL A 1 77  ? 0.026   8.266   5.453   1.00 0.00 ? 80  VAL A N    6  
ATOM 9258  C CA   . VAL A 1 77  ? 1.164   7.383   5.246   1.00 0.00 ? 80  VAL A CA   6  
ATOM 9259  C C    . VAL A 1 77  ? 2.420   8.200   4.972   1.00 0.00 ? 80  VAL A C    6  
ATOM 9260  O O    . VAL A 1 77  ? 3.425   8.056   5.672   1.00 0.00 ? 80  VAL A O    6  
ATOM 9261  C CB   . VAL A 1 77  ? 0.923   6.394   4.080   1.00 0.00 ? 80  VAL A CB   6  
ATOM 9262  C CG1  . VAL A 1 77  ? 2.167   5.557   3.810   1.00 0.00 ? 80  VAL A CG1  6  
ATOM 9263  C CG2  . VAL A 1 77  ? -0.266  5.489   4.383   1.00 0.00 ? 80  VAL A CG2  6  
ATOM 9264  H H    . VAL A 1 77  ? -0.702  8.270   4.796   1.00 0.00 ? 80  VAL A H    6  
ATOM 9265  H HA   . VAL A 1 77  ? 1.312   6.814   6.154   1.00 0.00 ? 80  VAL A HA   6  
ATOM 9266  H HB   . VAL A 1 77  ? 0.697   6.964   3.190   1.00 0.00 ? 80  VAL A HB   6  
ATOM 9267  H HG11 . VAL A 1 77  ? 2.431   5.004   4.699   1.00 0.00 ? 80  VAL A HG11 6  
ATOM 9268  H HG12 . VAL A 1 77  ? 1.971   4.866   3.002   1.00 0.00 ? 80  VAL A HG12 6  
ATOM 9269  H HG13 . VAL A 1 77  ? 2.985   6.207   3.536   1.00 0.00 ? 80  VAL A HG13 6  
ATOM 9270  H HG21 . VAL A 1 77  ? -0.044  4.881   5.248   1.00 0.00 ? 80  VAL A HG21 6  
ATOM 9271  H HG22 . VAL A 1 77  ? -1.138  6.091   4.579   1.00 0.00 ? 80  VAL A HG22 6  
ATOM 9272  H HG23 . VAL A 1 77  ? -0.454  4.847   3.533   1.00 0.00 ? 80  VAL A HG23 6  
ATOM 9273  N N    . CYS A 1 78  ? 2.340   9.078   3.976   1.00 0.00 ? 81  CYS A N    6  
ATOM 9274  C CA   . CYS A 1 78  ? 3.471   9.920   3.608   1.00 0.00 ? 81  CYS A CA   6  
ATOM 9275  C C    . CYS A 1 78  ? 3.856   10.834  4.767   1.00 0.00 ? 81  CYS A C    6  
ATOM 9276  O O    . CYS A 1 78  ? 5.036   11.043  5.035   1.00 0.00 ? 81  CYS A O    6  
ATOM 9277  C CB   . CYS A 1 78  ? 3.146   10.757  2.367   1.00 0.00 ? 81  CYS A CB   6  
ATOM 9278  S SG   . CYS A 1 78  ? 2.547   9.790   0.942   1.00 0.00 ? 81  CYS A SG   6  
ATOM 9279  H H    . CYS A 1 78  ? 1.500   9.157   3.472   1.00 0.00 ? 81  CYS A H    6  
ATOM 9280  H HA   . CYS A 1 78  ? 4.305   9.273   3.387   1.00 0.00 ? 81  CYS A HA   6  
ATOM 9281  H HB2  . CYS A 1 78  ? 2.384   11.478  2.615   1.00 0.00 ? 81  CYS A HB2  6  
ATOM 9282  H HB3  . CYS A 1 78  ? 4.036   11.284  2.053   1.00 0.00 ? 81  CYS A HB3  6  
ATOM 9283  N N    . GLN A 1 79  ? 2.849   11.351  5.468   1.00 0.00 ? 82  GLN A N    6  
ATOM 9284  C CA   . GLN A 1 79  ? 3.070   12.253  6.593   1.00 0.00 ? 82  GLN A CA   6  
ATOM 9285  C C    . GLN A 1 79  ? 3.920   11.589  7.675   1.00 0.00 ? 82  GLN A C    6  
ATOM 9286  O O    . GLN A 1 79  ? 4.904   12.166  8.139   1.00 0.00 ? 82  GLN A O    6  
ATOM 9287  C CB   . GLN A 1 79  ? 1.727   12.712  7.174   1.00 0.00 ? 82  GLN A CB   6  
ATOM 9288  C CG   . GLN A 1 79  ? 1.853   13.642  8.373   1.00 0.00 ? 82  GLN A CG   6  
ATOM 9289  C CD   . GLN A 1 79  ? 0.517   14.193  8.824   1.00 0.00 ? 82  GLN A CD   6  
ATOM 9290  O OE1  . GLN A 1 79  ? -0.167  13.607  9.666   1.00 0.00 ? 82  GLN A OE1  6  
ATOM 9291  N NE2  . GLN A 1 79  ? 0.136   15.329  8.267   1.00 0.00 ? 82  GLN A NE2  6  
ATOM 9292  H H    . GLN A 1 79  ? 1.925   11.125  5.214   1.00 0.00 ? 82  GLN A H    6  
ATOM 9293  H HA   . GLN A 1 79  ? 3.602   13.113  6.220   1.00 0.00 ? 82  GLN A HA   6  
ATOM 9294  H HB2  . GLN A 1 79  ? 1.173   13.231  6.405   1.00 0.00 ? 82  GLN A HB2  6  
ATOM 9295  H HB3  . GLN A 1 79  ? 1.165   11.842  7.481   1.00 0.00 ? 82  GLN A HB3  6  
ATOM 9296  H HG2  . GLN A 1 79  ? 2.296   13.097  9.192   1.00 0.00 ? 82  GLN A HG2  6  
ATOM 9297  H HG3  . GLN A 1 79  ? 2.492   14.471  8.105   1.00 0.00 ? 82  GLN A HG3  6  
ATOM 9298  H HE21 . GLN A 1 79  ? 0.735   15.745  7.603   1.00 0.00 ? 82  GLN A HE21 6  
ATOM 9299  H HE22 . GLN A 1 79  ? -0.728  15.711  8.531   1.00 0.00 ? 82  GLN A HE22 6  
ATOM 9300  N N    . ARG A 1 80  ? 3.560   10.371  8.062   1.00 0.00 ? 83  ARG A N    6  
ATOM 9301  C CA   . ARG A 1 80  ? 4.301   9.660   9.102   1.00 0.00 ? 83  ARG A CA   6  
ATOM 9302  C C    . ARG A 1 80  ? 5.667   9.199   8.598   1.00 0.00 ? 83  ARG A C    6  
ATOM 9303  O O    . ARG A 1 80  ? 6.575   8.944   9.389   1.00 0.00 ? 83  ARG A O    6  
ATOM 9304  C CB   . ARG A 1 80  ? 3.497   8.476   9.629   1.00 0.00 ? 83  ARG A CB   6  
ATOM 9305  C CG   . ARG A 1 80  ? 2.328   8.887   10.507  1.00 0.00 ? 83  ARG A CG   6  
ATOM 9306  C CD   . ARG A 1 80  ? 1.543   7.683   10.993  1.00 0.00 ? 83  ARG A CD   6  
ATOM 9307  N NE   . ARG A 1 80  ? 0.936   6.950   9.887   1.00 0.00 ? 83  ARG A NE   6  
ATOM 9308  C CZ   . ARG A 1 80  ? -0.373  6.798   9.736   1.00 0.00 ? 83  ARG A CZ   6  
ATOM 9309  N NH1  . ARG A 1 80  ? -1.210  7.291   10.640  1.00 0.00 ? 83  ARG A NH1  6  
ATOM 9310  N NH2  . ARG A 1 80  ? -0.852  6.150   8.688   1.00 0.00 ? 83  ARG A NH2  6  
ATOM 9311  H H    . ARG A 1 80  ? 2.777   9.943   7.645   1.00 0.00 ? 83  ARG A H    6  
ATOM 9312  H HA   . ARG A 1 80  ? 4.458   10.353  9.913   1.00 0.00 ? 83  ARG A HA   6  
ATOM 9313  H HB2  . ARG A 1 80  ? 3.110   7.913   8.790   1.00 0.00 ? 83  ARG A HB2  6  
ATOM 9314  H HB3  . ARG A 1 80  ? 4.151   7.840   10.208  1.00 0.00 ? 83  ARG A HB3  6  
ATOM 9315  H HG2  . ARG A 1 80  ? 2.705   9.426   11.363  1.00 0.00 ? 83  ARG A HG2  6  
ATOM 9316  H HG3  . ARG A 1 80  ? 1.671   9.528   9.937   1.00 0.00 ? 83  ARG A HG3  6  
ATOM 9317  H HD2  . ARG A 1 80  ? 2.213   7.024   11.525  1.00 0.00 ? 83  ARG A HD2  6  
ATOM 9318  H HD3  . ARG A 1 80  ? 0.765   8.021   11.661  1.00 0.00 ? 83  ARG A HD3  6  
ATOM 9319  H HE   . ARG A 1 80  ? 1.543   6.560   9.214   1.00 0.00 ? 83  ARG A HE   6  
ATOM 9320  H HH12 . ARG A 1 80  ? -1.659  6.673   11.300  1.00 0.00 ? 83  ARG A HH12 6  
ATOM 9321  H HH21 . ARG A 1 80  ? -0.229  5.769   8.005   1.00 0.00 ? 83  ARG A HH21 6  
ATOM 9322  H HH22 . ARG A 1 80  ? -1.847  6.057   8.567   1.00 0.00 ? 83  ARG A HH22 6  
ATOM 9323  N N    . LEU A 1 81  ? 5.814   9.104   7.284   1.00 0.00 ? 84  LEU A N    6  
ATOM 9324  C CA   . LEU A 1 81  ? 7.096   8.751   6.688   1.00 0.00 ? 84  LEU A CA   6  
ATOM 9325  C C    . LEU A 1 81  ? 7.932   9.996   6.405   1.00 0.00 ? 84  LEU A C    6  
ATOM 9326  O O    . LEU A 1 81  ? 9.010   9.912   5.818   1.00 0.00 ? 84  LEU A O    6  
ATOM 9327  C CB   . LEU A 1 81  ? 6.892   7.958   5.398   1.00 0.00 ? 84  LEU A CB   6  
ATOM 9328  C CG   . LEU A 1 81  ? 6.297   6.561   5.581   1.00 0.00 ? 84  LEU A CG   6  
ATOM 9329  C CD1  . LEU A 1 81  ? 6.003   5.921   4.234   1.00 0.00 ? 84  LEU A CD1  6  
ATOM 9330  C CD2  . LEU A 1 81  ? 7.252   5.687   6.378   1.00 0.00 ? 84  LEU A CD2  6  
ATOM 9331  H H    . LEU A 1 81  ? 5.042   9.264   6.699   1.00 0.00 ? 84  LEU A H    6  
ATOM 9332  H HA   . LEU A 1 81  ? 7.626   8.134   7.395   1.00 0.00 ? 84  LEU A HA   6  
ATOM 9333  H HB2  . LEU A 1 81  ? 6.238   8.526   4.753   1.00 0.00 ? 84  LEU A HB2  6  
ATOM 9334  H HB3  . LEU A 1 81  ? 7.851   7.855   4.910   1.00 0.00 ? 84  LEU A HB3  6  
ATOM 9335  H HG   . LEU A 1 81  ? 5.369   6.637   6.132   1.00 0.00 ? 84  LEU A HG   6  
ATOM 9336  H HD11 . LEU A 1 81  ? 5.308   6.537   3.684   1.00 0.00 ? 84  LEU A HD11 6  
ATOM 9337  H HD12 . LEU A 1 81  ? 6.921   5.827   3.673   1.00 0.00 ? 84  LEU A HD12 6  
ATOM 9338  H HD13 . LEU A 1 81  ? 5.572   4.942   4.386   1.00 0.00 ? 84  LEU A HD13 6  
ATOM 9339  H HD21 . LEU A 1 81  ? 6.820   4.706   6.504   1.00 0.00 ? 84  LEU A HD21 6  
ATOM 9340  H HD22 . LEU A 1 81  ? 8.186   5.604   5.844   1.00 0.00 ? 84  LEU A HD22 6  
ATOM 9341  H HD23 . LEU A 1 81  ? 7.427   6.131   7.345   1.00 0.00 ? 84  LEU A HD23 6  
ATOM 9342  N N    . ASN A 1 82  ? 7.414   11.149  6.831   1.00 0.00 ? 85  ASN A N    6  
ATOM 9343  C CA   . ASN A 1 82  ? 8.087   12.433  6.651   1.00 0.00 ? 85  ASN A CA   6  
ATOM 9344  C C    . ASN A 1 82  ? 8.281   12.740  5.166   1.00 0.00 ? 85  ASN A C    6  
ATOM 9345  O O    . ASN A 1 82  ? 9.372   13.097  4.717   1.00 0.00 ? 85  ASN A O    6  
ATOM 9346  C CB   . ASN A 1 82  ? 9.427   12.457  7.395   1.00 0.00 ? 85  ASN A CB   6  
ATOM 9347  C CG   . ASN A 1 82  ? 10.048  13.843  7.449   1.00 0.00 ? 85  ASN A CG   6  
ATOM 9348  O OD1  . ASN A 1 82  ? 11.271  13.983  7.470   1.00 0.00 ? 85  ASN A OD1  6  
ATOM 9349  N ND2  . ASN A 1 82  ? 9.216   14.875  7.471   1.00 0.00 ? 85  ASN A ND2  6  
ATOM 9350  H H    . ASN A 1 82  ? 6.540   11.135  7.277   1.00 0.00 ? 85  ASN A H    6  
ATOM 9351  H HA   . ASN A 1 82  ? 7.448   13.194  7.072   1.00 0.00 ? 85  ASN A HA   6  
ATOM 9352  H HB2  . ASN A 1 82  ? 9.274   12.114  8.408   1.00 0.00 ? 85  ASN A HB2  6  
ATOM 9353  H HB3  . ASN A 1 82  ? 10.113  11.792  6.896   1.00 0.00 ? 85  ASN A HB3  6  
ATOM 9354  H HD21 . ASN A 1 82  ? 8.249   14.698  7.451   1.00 0.00 ? 85  ASN A HD21 6  
ATOM 9355  H HD22 . ASN A 1 82  ? 9.597   15.781  7.500   1.00 0.00 ? 85  ASN A HD22 6  
ATOM 9356  N N    . CYS A 1 83  ? 7.212   12.582  4.406   1.00 0.00 ? 86  CYS A N    6  
ATOM 9357  C CA   . CYS A 1 83  ? 7.218   12.901  2.991   1.00 0.00 ? 86  CYS A CA   6  
ATOM 9358  C C    . CYS A 1 83  ? 5.978   13.708  2.646   1.00 0.00 ? 86  CYS A C    6  
ATOM 9359  O O    . CYS A 1 83  ? 5.020   13.742  3.419   1.00 0.00 ? 86  CYS A O    6  
ATOM 9360  C CB   . CYS A 1 83  ? 7.266   11.621  2.150   1.00 0.00 ? 86  CYS A CB   6  
ATOM 9361  S SG   . CYS A 1 83  ? 8.768   10.618  2.400   1.00 0.00 ? 86  CYS A SG   6  
ATOM 9362  H H    . CYS A 1 83  ? 6.384   12.239  4.811   1.00 0.00 ? 86  CYS A H    6  
ATOM 9363  H HA   . CYS A 1 83  ? 8.096   13.496  2.786   1.00 0.00 ? 86  CYS A HA   6  
ATOM 9364  H HB2  . CYS A 1 83  ? 6.414   11.004  2.400   1.00 0.00 ? 86  CYS A HB2  6  
ATOM 9365  H HB3  . CYS A 1 83  ? 7.218   11.885  1.103   1.00 0.00 ? 86  CYS A HB3  6  
ATOM 9366  N N    . GLY A 1 84  ? 5.998   14.359  1.494   1.00 0.00 ? 87  GLY A N    6  
ATOM 9367  C CA   . GLY A 1 84  ? 4.871   15.156  1.073   1.00 0.00 ? 87  GLY A CA   6  
ATOM 9368  C C    . GLY A 1 84  ? 3.705   14.306  0.617   1.00 0.00 ? 87  GLY A C    6  
ATOM 9369  O O    . GLY A 1 84  ? 3.811   13.083  0.550   1.00 0.00 ? 87  GLY A O    6  
ATOM 9370  H H    . GLY A 1 84  ? 6.792   14.289  0.916   1.00 0.00 ? 87  GLY A H    6  
ATOM 9371  H HA2  . GLY A 1 84  ? 4.551   15.769  1.904   1.00 0.00 ? 87  GLY A HA2  6  
ATOM 9372  H HA3  . GLY A 1 84  ? 5.175   15.800  0.263   1.00 0.00 ? 87  GLY A HA3  6  
ATOM 9373  N N    . ASP A 1 85  ? 2.614   14.966  0.272   1.00 0.00 ? 88  ASP A N    6  
ATOM 9374  C CA   . ASP A 1 85  ? 1.350   14.304  -0.038  1.00 0.00 ? 88  ASP A CA   6  
ATOM 9375  C C    . ASP A 1 85  ? 1.472   13.314  -1.196  1.00 0.00 ? 88  ASP A C    6  
ATOM 9376  O O    . ASP A 1 85  ? 2.248   13.514  -2.134  1.00 0.00 ? 88  ASP A O    6  
ATOM 9377  C CB   . ASP A 1 85  ? 0.267   15.351  -0.333  1.00 0.00 ? 88  ASP A CB   6  
ATOM 9378  C CG   . ASP A 1 85  ? 0.783   16.547  -1.105  1.00 0.00 ? 88  ASP A CG   6  
ATOM 9379  O OD1  . ASP A 1 85  ? 1.584   17.324  -0.539  1.00 0.00 ? 88  ASP A OD1  6  
ATOM 9380  O OD2  . ASP A 1 85  ? 0.368   16.738  -2.265  1.00 0.00 ? 88  ASP A OD2  6  
ATOM 9381  H H    . ASP A 1 85  ? 2.657   15.946  0.209   1.00 0.00 ? 88  ASP A H    6  
ATOM 9382  H HA   . ASP A 1 85  ? 1.057   13.752  0.843   1.00 0.00 ? 88  ASP A HA   6  
ATOM 9383  H HB2  . ASP A 1 85  ? -0.514  14.892  -0.917  1.00 0.00 ? 88  ASP A HB2  6  
ATOM 9384  H HB3  . ASP A 1 85  ? -0.148  15.698  0.601   1.00 0.00 ? 88  ASP A HB3  6  
ATOM 9385  N N    . PRO A 1 86  ? 0.686   12.223  -1.121  1.00 0.00 ? 89  PRO A N    6  
ATOM 9386  C CA   . PRO A 1 86  ? 0.734   11.115  -2.082  1.00 0.00 ? 89  PRO A CA   6  
ATOM 9387  C C    . PRO A 1 86  ? 0.333   11.532  -3.493  1.00 0.00 ? 89  PRO A C    6  
ATOM 9388  O O    . PRO A 1 86  ? -0.849  11.703  -3.793  1.00 0.00 ? 89  PRO A O    6  
ATOM 9389  C CB   . PRO A 1 86  ? -0.273  10.103  -1.520  1.00 0.00 ? 89  PRO A CB   6  
ATOM 9390  C CG   . PRO A 1 86  ? -1.166  10.892  -0.630  1.00 0.00 ? 89  PRO A CG   6  
ATOM 9391  C CD   . PRO A 1 86  ? -0.317  11.990  -0.069  1.00 0.00 ? 89  PRO A CD   6  
ATOM 9392  H HA   . PRO A 1 86  ? 1.714   10.665  -2.109  1.00 0.00 ? 89  PRO A HA   6  
ATOM 9393  H HB2  . PRO A 1 86  ? -0.825  9.653   -2.331  1.00 0.00 ? 89  PRO A HB2  6  
ATOM 9394  H HB3  . PRO A 1 86  ? 0.252   9.339   -0.969  1.00 0.00 ? 89  PRO A HB3  6  
ATOM 9395  H HG2  . PRO A 1 86  ? -1.985  11.304  -1.201  1.00 0.00 ? 89  PRO A HG2  6  
ATOM 9396  H HG3  . PRO A 1 86  ? -1.540  10.264  0.165   1.00 0.00 ? 89  PRO A HG3  6  
ATOM 9397  H HD2  . PRO A 1 86  ? -0.911  12.873  0.101   1.00 0.00 ? 89  PRO A HD2  6  
ATOM 9398  H HD3  . PRO A 1 86  ? 0.154   11.673  0.846   1.00 0.00 ? 89  PRO A HD3  6  
ATOM 9399  N N    . LEU A 1 87  ? 1.329   11.679  -4.353  1.00 0.00 ? 90  LEU A N    6  
ATOM 9400  C CA   . LEU A 1 87  ? 1.115   12.062  -5.739  1.00 0.00 ? 90  LEU A CA   6  
ATOM 9401  C C    . LEU A 1 87  ? 0.404   10.955  -6.505  1.00 0.00 ? 90  LEU A C    6  
ATOM 9402  O O    . LEU A 1 87  ? -0.482  11.215  -7.317  1.00 0.00 ? 90  LEU A O    6  
ATOM 9403  C CB   . LEU A 1 87  ? 2.456   12.362  -6.410  1.00 0.00 ? 90  LEU A CB   6  
ATOM 9404  C CG   . LEU A 1 87  ? 3.179   13.615  -5.912  1.00 0.00 ? 90  LEU A CG   6  
ATOM 9405  C CD1  . LEU A 1 87  ? 4.596   13.666  -6.463  1.00 0.00 ? 90  LEU A CD1  6  
ATOM 9406  C CD2  . LEU A 1 87  ? 2.413   14.867  -6.313  1.00 0.00 ? 90  LEU A CD2  6  
ATOM 9407  H H    . LEU A 1 87  ? 2.248   11.512  -4.044  1.00 0.00 ? 90  LEU A H    6  
ATOM 9408  H HA   . LEU A 1 87  ? 0.505   12.949  -5.753  1.00 0.00 ? 90  LEU A HA   6  
ATOM 9409  H HB2  . LEU A 1 87  ? 3.104   11.515  -6.251  1.00 0.00 ? 90  LEU A HB2  6  
ATOM 9410  H HB3  . LEU A 1 87  ? 2.288   12.464  -7.470  1.00 0.00 ? 90  LEU A HB3  6  
ATOM 9411  H HG   . LEU A 1 87  ? 3.239   13.586  -4.834  1.00 0.00 ? 90  LEU A HG   6  
ATOM 9412  H HD11 . LEU A 1 87  ? 4.561   13.742  -7.539  1.00 0.00 ? 90  LEU A HD11 6  
ATOM 9413  H HD12 . LEU A 1 87  ? 5.110   14.526  -6.058  1.00 0.00 ? 90  LEU A HD12 6  
ATOM 9414  H HD13 . LEU A 1 87  ? 5.125   12.766  -6.182  1.00 0.00 ? 90  LEU A HD13 6  
ATOM 9415  H HD21 . LEU A 1 87  ? 2.951   15.741  -5.976  1.00 0.00 ? 90  LEU A HD21 6  
ATOM 9416  H HD22 . LEU A 1 87  ? 2.311   14.899  -7.388  1.00 0.00 ? 90  LEU A HD22 6  
ATOM 9417  H HD23 . LEU A 1 87  ? 1.432   14.853  -5.859  1.00 0.00 ? 90  LEU A HD23 6  
ATOM 9418  N N    . SER A 1 88  ? 0.801   9.721   -6.248  1.00 0.00 ? 91  SER A N    6  
ATOM 9419  C CA   . SER A 1 88  ? 0.243   8.584   -6.959  1.00 0.00 ? 91  SER A CA   6  
ATOM 9420  C C    . SER A 1 88  ? 0.165   7.359   -6.060  1.00 0.00 ? 91  SER A C    6  
ATOM 9421  O O    . SER A 1 88  ? 0.974   7.200   -5.145  1.00 0.00 ? 91  SER A O    6  
ATOM 9422  C CB   . SER A 1 88  ? 1.086   8.273   -8.195  1.00 0.00 ? 91  SER A CB   6  
ATOM 9423  O OG   . SER A 1 88  ? 1.211   9.416   -9.023  1.00 0.00 ? 91  SER A OG   6  
ATOM 9424  H H    . SER A 1 88  ? 1.478   9.569   -5.555  1.00 0.00 ? 91  SER A H    6  
ATOM 9425  H HA   . SER A 1 88  ? -0.754  8.847   -7.274  1.00 0.00 ? 91  SER A HA   6  
ATOM 9426  H HB2  . SER A 1 88  ? 2.071   7.956   -7.886  1.00 0.00 ? 91  SER A HB2  6  
ATOM 9427  H HB3  . SER A 1 88  ? 0.616   7.483   -8.762  1.00 0.00 ? 91  SER A HB3  6  
ATOM 9428  H HG   . SER A 1 88  ? 0.550   10.072  -8.768  1.00 0.00 ? 91  SER A HG   6  
ATOM 9429  N N    . LEU A 1 89  ? -0.819  6.512   -6.328  1.00 0.00 ? 92  LEU A N    6  
ATOM 9430  C CA   . LEU A 1 89  ? -1.008  5.271   -5.593  1.00 0.00 ? 92  LEU A CA   6  
ATOM 9431  C C    . LEU A 1 89  ? -1.667  4.251   -6.517  1.00 0.00 ? 92  LEU A C    6  
ATOM 9432  O O    . LEU A 1 89  ? -2.794  4.449   -6.967  1.00 0.00 ? 92  LEU A O    6  
ATOM 9433  C CB   . LEU A 1 89  ? -1.863  5.512   -4.338  1.00 0.00 ? 92  LEU A CB   6  
ATOM 9434  C CG   . LEU A 1 89  ? -1.971  4.330   -3.368  1.00 0.00 ? 92  LEU A CG   6  
ATOM 9435  C CD1  . LEU A 1 89  ? -2.202  4.842   -1.959  1.00 0.00 ? 92  LEU A CD1  6  
ATOM 9436  C CD2  . LEU A 1 89  ? -3.105  3.393   -3.763  1.00 0.00 ? 92  LEU A CD2  6  
ATOM 9437  H H    . LEU A 1 89  ? -1.440  6.723   -7.057  1.00 0.00 ? 92  LEU A H    6  
ATOM 9438  H HA   . LEU A 1 89  ? -0.034  4.905   -5.293  1.00 0.00 ? 92  LEU A HA   6  
ATOM 9439  H HB2  . LEU A 1 89  ? -1.443  6.351   -3.800  1.00 0.00 ? 92  LEU A HB2  6  
ATOM 9440  H HB3  . LEU A 1 89  ? -2.860  5.777   -4.657  1.00 0.00 ? 92  LEU A HB3  6  
ATOM 9441  H HG   . LEU A 1 89  ? -1.046  3.771   -3.380  1.00 0.00 ? 92  LEU A HG   6  
ATOM 9442  H HD11 . LEU A 1 89  ? -1.383  5.487   -1.675  1.00 0.00 ? 92  LEU A HD11 6  
ATOM 9443  H HD12 . LEU A 1 89  ? -3.126  5.398   -1.925  1.00 0.00 ? 92  LEU A HD12 6  
ATOM 9444  H HD13 . LEU A 1 89  ? -2.258  4.007   -1.277  1.00 0.00 ? 92  LEU A HD13 6  
ATOM 9445  H HD21 . LEU A 1 89  ? -4.043  3.929   -3.731  1.00 0.00 ? 92  LEU A HD21 6  
ATOM 9446  H HD22 . LEU A 1 89  ? -2.937  3.022   -4.764  1.00 0.00 ? 92  LEU A HD22 6  
ATOM 9447  H HD23 . LEU A 1 89  ? -3.143  2.565   -3.071  1.00 0.00 ? 92  LEU A HD23 6  
ATOM 9448  N N    . GLY A 1 90  ? -0.953  3.180   -6.819  1.00 0.00 ? 93  GLY A N    6  
ATOM 9449  C CA   . GLY A 1 90  ? -1.469  2.181   -7.736  1.00 0.00 ? 93  GLY A CA   6  
ATOM 9450  C C    . GLY A 1 90  ? -0.430  1.127   -8.055  1.00 0.00 ? 93  GLY A C    6  
ATOM 9451  O O    . GLY A 1 90  ? 0.473   0.901   -7.252  1.00 0.00 ? 93  GLY A O    6  
ATOM 9452  H H    . GLY A 1 90  ? -0.063  3.065   -6.416  1.00 0.00 ? 93  GLY A H    6  
ATOM 9453  H HA2  . GLY A 1 90  ? -2.331  1.701   -7.288  1.00 0.00 ? 93  GLY A HA2  6  
ATOM 9454  H HA3  . GLY A 1 90  ? -1.772  2.670   -8.653  1.00 0.00 ? 93  GLY A HA3  6  
ATOM 9455  N N    . PRO A 1 91  ? -0.527  0.457   -9.214  1.00 0.00 ? 94  PRO A N    6  
ATOM 9456  C CA   . PRO A 1 91  ? 0.449   -0.563  -9.620  1.00 0.00 ? 94  PRO A CA   6  
ATOM 9457  C C    . PRO A 1 91  ? 1.783   0.048   -10.059 1.00 0.00 ? 94  PRO A C    6  
ATOM 9458  O O    . PRO A 1 91  ? 2.116   0.072   -11.245 1.00 0.00 ? 94  PRO A O    6  
ATOM 9459  C CB   . PRO A 1 91  ? -0.244  -1.265  -10.791 1.00 0.00 ? 94  PRO A CB   6  
ATOM 9460  C CG   . PRO A 1 91  ? -1.154  -0.237  -11.367 1.00 0.00 ? 94  PRO A CG   6  
ATOM 9461  C CD   . PRO A 1 91  ? -1.603  0.623   -10.214 1.00 0.00 ? 94  PRO A CD   6  
ATOM 9462  H HA   . PRO A 1 91  ? 0.629   -1.273  -8.826  1.00 0.00 ? 94  PRO A HA   6  
ATOM 9463  H HB2  . PRO A 1 91  ? 0.496   -1.589  -11.512 1.00 0.00 ? 94  PRO A HB2  6  
ATOM 9464  H HB3  . PRO A 1 91  ? -0.796  -2.116  -10.426 1.00 0.00 ? 94  PRO A HB3  6  
ATOM 9465  H HG2  . PRO A 1 91  ? -0.621  0.359   -12.094 1.00 0.00 ? 94  PRO A HG2  6  
ATOM 9466  H HG3  . PRO A 1 91  ? -2.003  -0.719  -11.830 1.00 0.00 ? 94  PRO A HG3  6  
ATOM 9467  H HD2  . PRO A 1 91  ? -1.685  1.655   -10.528 1.00 0.00 ? 94  PRO A HD2  6  
ATOM 9468  H HD3  . PRO A 1 91  ? -2.548  0.271   -9.826  1.00 0.00 ? 94  PRO A HD3  6  
ATOM 9469  N N    . PHE A 1 92  ? 2.542   0.530   -9.086  1.00 0.00 ? 95  PHE A N    6  
ATOM 9470  C CA   . PHE A 1 92  ? 3.812   1.199   -9.351  1.00 0.00 ? 95  PHE A CA   6  
ATOM 9471  C C    . PHE A 1 92  ? 4.864   0.199   -9.809  1.00 0.00 ? 95  PHE A C    6  
ATOM 9472  O O    . PHE A 1 92  ? 5.592   0.444   -10.771 1.00 0.00 ? 95  PHE A O    6  
ATOM 9473  C CB   . PHE A 1 92  ? 4.298   1.917   -8.090  1.00 0.00 ? 95  PHE A CB   6  
ATOM 9474  C CG   . PHE A 1 92  ? 5.420   2.894   -8.323  1.00 0.00 ? 95  PHE A CG   6  
ATOM 9475  C CD1  . PHE A 1 92  ? 5.167   4.147   -8.856  1.00 0.00 ? 95  PHE A CD1  6  
ATOM 9476  C CD2  . PHE A 1 92  ? 6.727   2.561   -8.001  1.00 0.00 ? 95  PHE A CD2  6  
ATOM 9477  C CE1  . PHE A 1 92  ? 6.194   5.050   -9.064  1.00 0.00 ? 95  PHE A CE1  6  
ATOM 9478  C CE2  . PHE A 1 92  ? 7.758   3.457   -8.207  1.00 0.00 ? 95  PHE A CE2  6  
ATOM 9479  C CZ   . PHE A 1 92  ? 7.490   4.703   -8.740  1.00 0.00 ? 95  PHE A CZ   6  
ATOM 9480  H H    . PHE A 1 92  ? 2.233   0.440   -8.160  1.00 0.00 ? 95  PHE A H    6  
ATOM 9481  H HA   . PHE A 1 92  ? 3.653   1.926   -10.133 1.00 0.00 ? 95  PHE A HA   6  
ATOM 9482  H HB2  . PHE A 1 92  ? 3.475   2.456   -7.647  1.00 0.00 ? 95  PHE A HB2  6  
ATOM 9483  H HB3  . PHE A 1 92  ? 4.651   1.173   -7.389  1.00 0.00 ? 95  PHE A HB3  6  
ATOM 9484  H HD1  . PHE A 1 92  ? 4.154   4.419   -9.111  1.00 0.00 ? 95  PHE A HD1  6  
ATOM 9485  H HD2  . PHE A 1 92  ? 6.940   1.587   -7.584  1.00 0.00 ? 95  PHE A HD2  6  
ATOM 9486  H HE1  . PHE A 1 92  ? 5.983   6.024   -9.479  1.00 0.00 ? 95  PHE A HE1  6  
ATOM 9487  H HE2  . PHE A 1 92  ? 8.771   3.184   -7.953  1.00 0.00 ? 95  PHE A HE2  6  
ATOM 9488  H HZ   . PHE A 1 92  ? 8.294   5.407   -8.903  1.00 0.00 ? 95  PHE A HZ   6  
ATOM 9489  N N    . LEU A 1 93  ? 4.930   -0.929  -9.113  1.00 0.00 ? 96  LEU A N    6  
ATOM 9490  C CA   . LEU A 1 93  ? 5.911   -1.965  -9.407  1.00 0.00 ? 96  LEU A CA   6  
ATOM 9491  C C    . LEU A 1 93  ? 5.228   -3.322  -9.471  1.00 0.00 ? 96  LEU A C    6  
ATOM 9492  O O    . LEU A 1 93  ? 4.016   -3.420  -9.271  1.00 0.00 ? 96  LEU A O    6  
ATOM 9493  C CB   . LEU A 1 93  ? 7.001   -1.998  -8.328  1.00 0.00 ? 96  LEU A CB   6  
ATOM 9494  C CG   . LEU A 1 93  ? 7.878   -0.746  -8.239  1.00 0.00 ? 96  LEU A CG   6  
ATOM 9495  C CD1  . LEU A 1 93  ? 8.818   -0.835  -7.045  1.00 0.00 ? 96  LEU A CD1  6  
ATOM 9496  C CD2  . LEU A 1 93  ? 8.675   -0.562  -9.522  1.00 0.00 ? 96  LEU A CD2  6  
ATOM 9497  H H    . LEU A 1 93  ? 4.282   -1.079  -8.391  1.00 0.00 ? 96  LEU A H    6  
ATOM 9498  H HA   . LEU A 1 93  ? 6.362   -1.745  -10.362 1.00 0.00 ? 96  LEU A HA   6  
ATOM 9499  H HB2  . LEU A 1 93  ? 6.524   -2.147  -7.370  1.00 0.00 ? 96  LEU A HB2  6  
ATOM 9500  H HB3  . LEU A 1 93  ? 7.642   -2.844  -8.525  1.00 0.00 ? 96  LEU A HB3  6  
ATOM 9501  H HG   . LEU A 1 93  ? 7.249   0.123   -8.108  1.00 0.00 ? 96  LEU A HG   6  
ATOM 9502  H HD11 . LEU A 1 93  ? 9.477   -1.682  -7.167  1.00 0.00 ? 96  LEU A HD11 6  
ATOM 9503  H HD12 . LEU A 1 93  ? 9.404   0.070   -6.980  1.00 0.00 ? 96  LEU A HD12 6  
ATOM 9504  H HD13 . LEU A 1 93  ? 8.241   -0.953  -6.139  1.00 0.00 ? 96  LEU A HD13 6  
ATOM 9505  H HD21 . LEU A 1 93  ? 7.995   -0.462  -10.355 1.00 0.00 ? 96  LEU A HD21 6  
ATOM 9506  H HD22 . LEU A 1 93  ? 9.283   0.326   -9.444  1.00 0.00 ? 96  LEU A HD22 6  
ATOM 9507  H HD23 . LEU A 1 93  ? 9.311   -1.421  -9.677  1.00 0.00 ? 96  LEU A HD23 6  
ATOM 9508  N N    . LYS A 1 94  ? 5.993   -4.359  -9.764  1.00 0.00 ? 97  LYS A N    6  
ATOM 9509  C CA   . LYS A 1 94  ? 5.474   -5.715  -9.711  1.00 0.00 ? 97  LYS A CA   6  
ATOM 9510  C C    . LYS A 1 94  ? 6.549   -6.663  -9.204  1.00 0.00 ? 97  LYS A C    6  
ATOM 9511  O O    . LYS A 1 94  ? 7.314   -7.239  -9.982  1.00 0.00 ? 97  LYS A O    6  
ATOM 9512  C CB   . LYS A 1 94  ? 4.967   -6.180  -11.077 1.00 0.00 ? 97  LYS A CB   6  
ATOM 9513  C CG   . LYS A 1 94  ? 4.156   -7.469  -11.005 1.00 0.00 ? 97  LYS A CG   6  
ATOM 9514  C CD   . LYS A 1 94  ? 3.958   -8.093  -12.376 1.00 0.00 ? 97  LYS A CD   6  
ATOM 9515  C CE   . LYS A 1 94  ? 5.277   -8.559  -12.969 1.00 0.00 ? 97  LYS A CE   6  
ATOM 9516  N NZ   . LYS A 1 94  ? 5.085   -9.338  -14.220 1.00 0.00 ? 97  LYS A NZ   6  
ATOM 9517  H H    . LYS A 1 94  ? 6.931   -4.211  -10.029 1.00 0.00 ? 97  LYS A H    6  
ATOM 9518  H HA   . LYS A 1 94  ? 4.652   -5.724  -9.010  1.00 0.00 ? 97  LYS A HA   6  
ATOM 9519  H HB2  . LYS A 1 94  ? 4.340   -5.408  -11.501 1.00 0.00 ? 97  LYS A HB2  6  
ATOM 9520  H HB3  . LYS A 1 94  ? 5.813   -6.347  -11.727 1.00 0.00 ? 97  LYS A HB3  6  
ATOM 9521  H HG2  . LYS A 1 94  ? 4.675   -8.176  -10.374 1.00 0.00 ? 97  LYS A HG2  6  
ATOM 9522  H HG3  . LYS A 1 94  ? 3.188   -7.248  -10.577 1.00 0.00 ? 97  LYS A HG3  6  
ATOM 9523  H HD2  . LYS A 1 94  ? 3.296   -8.941  -12.283 1.00 0.00 ? 97  LYS A HD2  6  
ATOM 9524  H HD3  . LYS A 1 94  ? 3.515   -7.359  -13.034 1.00 0.00 ? 97  LYS A HD3  6  
ATOM 9525  H HE2  . LYS A 1 94  ? 5.883   -7.692  -13.186 1.00 0.00 ? 97  LYS A HE2  6  
ATOM 9526  H HE3  . LYS A 1 94  ? 5.783   -9.178  -12.244 1.00 0.00 ? 97  LYS A HE3  6  
ATOM 9527  H HZ1  . LYS A 1 94  ? 6.015   -9.653  -14.573 1.00 0.00 ? 97  LYS A HZ1  6  
ATOM 9528  H HZ3  . LYS A 1 94  ? 4.647   -8.733  -14.947 1.00 0.00 ? 97  LYS A HZ3  6  
ATOM 9529  N N    . THR A 1 95  ? 6.613   -6.801  -7.894  1.00 0.00 ? 98  THR A N    6  
ATOM 9530  C CA   . THR A 1 95  ? 7.542   -7.716  -7.269  1.00 0.00 ? 98  THR A CA   6  
ATOM 9531  C C    . THR A 1 95  ? 6.909   -9.101  -7.197  1.00 0.00 ? 98  THR A C    6  
ATOM 9532  O O    . THR A 1 95  ? 5.928   -9.307  -6.481  1.00 0.00 ? 98  THR A O    6  
ATOM 9533  C CB   . THR A 1 95  ? 7.922   -7.229  -5.858  1.00 0.00 ? 98  THR A CB   6  
ATOM 9534  O OG1  . THR A 1 95  ? 8.312   -5.849  -5.918  1.00 0.00 ? 98  THR A OG1  6  
ATOM 9535  C CG2  . THR A 1 95  ? 9.063   -8.055  -5.275  1.00 0.00 ? 98  THR A CG2  6  
ATOM 9536  H H    . THR A 1 95  ? 5.997   -6.284  -7.326  1.00 0.00 ? 98  THR A H    6  
ATOM 9537  H HA   . THR A 1 95  ? 8.434   -7.761  -7.876  1.00 0.00 ? 98  THR A HA   6  
ATOM 9538  H HB   . THR A 1 95  ? 7.060   -7.326  -5.217  1.00 0.00 ? 98  THR A HB   6  
ATOM 9539  H HG1  . THR A 1 95  ? 8.532   -5.618  -6.826  1.00 0.00 ? 98  THR A HG1  6  
ATOM 9540  H HG21 . THR A 1 95  ? 8.770   -9.094  -5.228  1.00 0.00 ? 98  THR A HG21 6  
ATOM 9541  H HG22 . THR A 1 95  ? 9.290   -7.700  -4.280  1.00 0.00 ? 98  THR A HG22 6  
ATOM 9542  H HG23 . THR A 1 95  ? 9.939   -7.955  -5.898  1.00 0.00 ? 98  THR A HG23 6  
ATOM 9543  N N    . TYR A 1 96  ? 7.459   -10.031 -7.962  1.00 0.00 ? 99  TYR A N    6  
ATOM 9544  C CA   . TYR A 1 96  ? 6.896   -11.369 -8.090  1.00 0.00 ? 99  TYR A CA   6  
ATOM 9545  C C    . TYR A 1 96  ? 7.165   -12.193 -6.829  1.00 0.00 ? 99  TYR A C    6  
ATOM 9546  O O    . TYR A 1 96  ? 7.960   -13.134 -6.839  1.00 0.00 ? 99  TYR A O    6  
ATOM 9547  C CB   . TYR A 1 96  ? 7.492   -12.060 -9.321  1.00 0.00 ? 99  TYR A CB   6  
ATOM 9548  C CG   . TYR A 1 96  ? 6.593   -13.100 -9.955  1.00 0.00 ? 99  TYR A CG   6  
ATOM 9549  C CD1  . TYR A 1 96  ? 5.683   -12.742 -10.946 1.00 0.00 ? 99  TYR A CD1  6  
ATOM 9550  C CD2  . TYR A 1 96  ? 6.663   -14.437 -9.584  1.00 0.00 ? 99  TYR A CD2  6  
ATOM 9551  C CE1  . TYR A 1 96  ? 4.868   -13.686 -11.543 1.00 0.00 ? 99  TYR A CE1  6  
ATOM 9552  C CE2  . TYR A 1 96  ? 5.856   -15.384 -10.181 1.00 0.00 ? 99  TYR A CE2  6  
ATOM 9553  C CZ   . TYR A 1 96  ? 4.960   -15.005 -11.157 1.00 0.00 ? 99  TYR A CZ   6  
ATOM 9554  O OH   . TYR A 1 96  ? 4.160   -15.952 -11.757 1.00 0.00 ? 99  TYR A OH   6  
ATOM 9555  H H    . TYR A 1 96  ? 8.278   -9.811  -8.458  1.00 0.00 ? 99  TYR A H    6  
ATOM 9556  H HA   . TYR A 1 96  ? 5.830   -11.272 -8.225  1.00 0.00 ? 99  TYR A HA   6  
ATOM 9557  H HB2  . TYR A 1 96  ? 7.709   -11.314 -10.071 1.00 0.00 ? 99  TYR A HB2  6  
ATOM 9558  H HB3  . TYR A 1 96  ? 8.411   -12.547 -9.033  1.00 0.00 ? 99  TYR A HB3  6  
ATOM 9559  H HD1  . TYR A 1 96  ? 5.613   -11.707 -11.248 1.00 0.00 ? 99  TYR A HD1  6  
ATOM 9560  H HD2  . TYR A 1 96  ? 7.361   -14.735 -8.817  1.00 0.00 ? 99  TYR A HD2  6  
ATOM 9561  H HE1  . TYR A 1 96  ? 4.164   -13.388 -12.307 1.00 0.00 ? 99  TYR A HE1  6  
ATOM 9562  H HE2  . TYR A 1 96  ? 5.925   -16.421 -9.879  1.00 0.00 ? 99  TYR A HE2  6  
ATOM 9563  H HH   . TYR A 1 96  ? 3.752   -16.511 -11.070 1.00 0.00 ? 99  TYR A HH   6  
ATOM 9564  N N    . THR A 1 97  ? 6.506   -11.819 -5.744  1.00 0.00 ? 100 THR A N    6  
ATOM 9565  C CA   . THR A 1 97  ? 6.626   -12.526 -4.479  1.00 0.00 ? 100 THR A CA   6  
ATOM 9566  C C    . THR A 1 97  ? 5.235   -12.827 -3.912  1.00 0.00 ? 100 THR A C    6  
ATOM 9567  O O    . THR A 1 97  ? 4.770   -12.164 -2.978  1.00 0.00 ? 100 THR A O    6  
ATOM 9568  C CB   . THR A 1 97  ? 7.442   -11.697 -3.463  1.00 0.00 ? 100 THR A CB   6  
ATOM 9569  O OG1  . THR A 1 97  ? 8.668   -11.260 -4.061  1.00 0.00 ? 100 THR A OG1  6  
ATOM 9570  C CG2  . THR A 1 97  ? 7.760   -12.512 -2.220  1.00 0.00 ? 100 THR A CG2  6  
ATOM 9571  H H    . THR A 1 97  ? 5.929   -11.027 -5.793  1.00 0.00 ? 100 THR A H    6  
ATOM 9572  H HA   . THR A 1 97  ? 7.146   -13.454 -4.660  1.00 0.00 ? 100 THR A HA   6  
ATOM 9573  H HB   . THR A 1 97  ? 6.861   -10.833 -3.172  1.00 0.00 ? 100 THR A HB   6  
ATOM 9574  H HG1  . THR A 1 97  ? 9.207   -12.035 -4.292  1.00 0.00 ? 100 THR A HG1  6  
ATOM 9575  H HG21 . THR A 1 97  ? 8.332   -13.384 -2.500  1.00 0.00 ? 100 THR A HG21 6  
ATOM 9576  H HG22 . THR A 1 97  ? 6.841   -12.823 -1.747  1.00 0.00 ? 100 THR A HG22 6  
ATOM 9577  H HG23 . THR A 1 97  ? 8.337   -11.911 -1.531  1.00 0.00 ? 100 THR A HG23 6  
ATOM 9578  N N    . PRO A 1 98  ? 4.546   -13.836 -4.476  1.00 0.00 ? 101 PRO A N    6  
ATOM 9579  C CA   . PRO A 1 98  ? 3.183   -14.198 -4.084  1.00 0.00 ? 101 PRO A CA   6  
ATOM 9580  C C    . PRO A 1 98  ? 3.139   -14.986 -2.776  1.00 0.00 ? 101 PRO A C    6  
ATOM 9581  O O    . PRO A 1 98  ? 2.677   -16.126 -2.738  1.00 0.00 ? 101 PRO A O    6  
ATOM 9582  C CB   . PRO A 1 98  ? 2.684   -15.068 -5.255  1.00 0.00 ? 101 PRO A CB   6  
ATOM 9583  C CG   . PRO A 1 98  ? 3.770   -15.037 -6.283  1.00 0.00 ? 101 PRO A CG   6  
ATOM 9584  C CD   . PRO A 1 98  ? 5.033   -14.712 -5.544  1.00 0.00 ? 101 PRO A CD   6  
ATOM 9585  H HA   . PRO A 1 98  ? 2.557   -13.323 -3.993  1.00 0.00 ? 101 PRO A HA   6  
ATOM 9586  H HB2  . PRO A 1 98  ? 2.508   -16.074 -4.905  1.00 0.00 ? 101 PRO A HB2  6  
ATOM 9587  H HB3  . PRO A 1 98  ? 1.765   -14.655 -5.644  1.00 0.00 ? 101 PRO A HB3  6  
ATOM 9588  H HG2  . PRO A 1 98  ? 3.854   -16.002 -6.760  1.00 0.00 ? 101 PRO A HG2  6  
ATOM 9589  H HG3  . PRO A 1 98  ? 3.559   -14.274 -7.018  1.00 0.00 ? 101 PRO A HG3  6  
ATOM 9590  H HD2  . PRO A 1 98  ? 5.477   -15.608 -5.138  1.00 0.00 ? 101 PRO A HD2  6  
ATOM 9591  H HD3  . PRO A 1 98  ? 5.731   -14.193 -6.185  1.00 0.00 ? 101 PRO A HD3  6  
ATOM 9592  N N    . GLN A 1 99  ? 3.622   -14.370 -1.709  1.00 0.00 ? 102 GLN A N    6  
ATOM 9593  C CA   . GLN A 1 99  ? 3.641   -15.007 -0.398  1.00 0.00 ? 102 GLN A CA   6  
ATOM 9594  C C    . GLN A 1 99  ? 3.593   -13.961 0.708   1.00 0.00 ? 102 GLN A C    6  
ATOM 9595  O O    . GLN A 1 99  ? 2.981   -14.173 1.751   1.00 0.00 ? 102 GLN A O    6  
ATOM 9596  C CB   . GLN A 1 99  ? 4.887   -15.889 -0.234  1.00 0.00 ? 102 GLN A CB   6  
ATOM 9597  C CG   . GLN A 1 99  ? 6.196   -15.157 -0.496  1.00 0.00 ? 102 GLN A CG   6  
ATOM 9598  C CD   . GLN A 1 99  ? 7.425   -15.992 -0.186  1.00 0.00 ? 102 GLN A CD   6  
ATOM 9599  O OE1  . GLN A 1 99  ? 8.463   -15.846 -0.831  1.00 0.00 ? 102 GLN A OE1  6  
ATOM 9600  N NE2  . GLN A 1 99  ? 7.330   -16.848 0.819   1.00 0.00 ? 102 GLN A NE2  6  
ATOM 9601  H H    . GLN A 1 99  ? 3.963   -13.454 -1.804  1.00 0.00 ? 102 GLN A H    6  
ATOM 9602  H HA   . GLN A 1 99  ? 2.760   -15.629 -0.324  1.00 0.00 ? 102 GLN A HA   6  
ATOM 9603  H HB2  . GLN A 1 99  ? 4.911   -16.273 0.775   1.00 0.00 ? 102 GLN A HB2  6  
ATOM 9604  H HB3  . GLN A 1 99  ? 4.818   -16.717 -0.923  1.00 0.00 ? 102 GLN A HB3  6  
ATOM 9605  H HG2  . GLN A 1 99  ? 6.233   -14.876 -1.537  1.00 0.00 ? 102 GLN A HG2  6  
ATOM 9606  H HG3  . GLN A 1 99  ? 6.221   -14.267 0.117   1.00 0.00 ? 102 GLN A HG3  6  
ATOM 9607  H HE21 . GLN A 1 99  ? 6.484   -16.899 1.308   1.00 0.00 ? 102 GLN A HE21 6  
ATOM 9608  H HE22 . GLN A 1 99  ? 8.114   -17.399 1.033   1.00 0.00 ? 102 GLN A HE22 6  
ATOM 9609  N N    . SER A 1 100 ? 4.236   -12.827 0.470   1.00 0.00 ? 103 SER A N    6  
ATOM 9610  C CA   . SER A 1 100 ? 4.284   -11.760 1.457   1.00 0.00 ? 103 SER A CA   6  
ATOM 9611  C C    . SER A 1 100 ? 3.434   -10.574 1.016   1.00 0.00 ? 103 SER A C    6  
ATOM 9612  O O    . SER A 1 100 ? 3.654   -9.444  1.452   1.00 0.00 ? 103 SER A O    6  
ATOM 9613  C CB   . SER A 1 100 ? 5.732   -11.326 1.688   1.00 0.00 ? 103 SER A CB   6  
ATOM 9614  O OG   . SER A 1 100 ? 6.506   -12.410 2.178   1.00 0.00 ? 103 SER A OG   6  
ATOM 9615  H H    . SER A 1 100 ? 4.702   -12.707 -0.379  1.00 0.00 ? 103 SER A H    6  
ATOM 9616  H HA   . SER A 1 100 ? 3.884   -12.150 2.380   1.00 0.00 ? 103 SER A HA   6  
ATOM 9617  H HB2  . SER A 1 100 ? 6.160   -10.985 0.757   1.00 0.00 ? 103 SER A HB2  6  
ATOM 9618  H HB3  . SER A 1 100 ? 5.757   -10.527 2.412   1.00 0.00 ? 103 SER A HB3  6  
ATOM 9619  H HG   . SER A 1 100 ? 6.143   -12.694 3.035   1.00 0.00 ? 103 SER A HG   6  
ATOM 9620  N N    . SER A 1 101 ? 2.453   -10.843 0.169   1.00 0.00 ? 104 SER A N    6  
ATOM 9621  C CA   . SER A 1 101 ? 1.566   -9.806  -0.324  1.00 0.00 ? 104 SER A CA   6  
ATOM 9622  C C    . SER A 1 101 ? 0.123   -10.099 0.092   1.00 0.00 ? 104 SER A C    6  
ATOM 9623  O O    . SER A 1 101 ? -0.248  -11.258 0.305   1.00 0.00 ? 104 SER A O    6  
ATOM 9624  C CB   . SER A 1 101 ? 1.684   -9.702  -1.846  1.00 0.00 ? 104 SER A CB   6  
ATOM 9625  O OG   . SER A 1 101 ? 3.032   -9.480  -2.232  1.00 0.00 ? 104 SER A OG   6  
ATOM 9626  H H    . SER A 1 101 ? 2.315   -11.766 -0.125  1.00 0.00 ? 104 SER A H    6  
ATOM 9627  H HA   . SER A 1 101 ? 1.876   -8.870  0.117   1.00 0.00 ? 104 SER A HA   6  
ATOM 9628  H HB2  . SER A 1 101 ? 1.341   -10.620 -2.296  1.00 0.00 ? 104 SER A HB2  6  
ATOM 9629  H HB3  . SER A 1 101 ? 1.081   -8.880  -2.199  1.00 0.00 ? 104 SER A HB3  6  
ATOM 9630  H HG   . SER A 1 101 ? 3.347   -10.228 -2.746  1.00 0.00 ? 104 SER A HG   6  
ATOM 9631  N N    . ILE A 1 102 ? -0.681  -9.050  0.229   1.00 0.00 ? 105 ILE A N    6  
ATOM 9632  C CA   . ILE A 1 102 ? -2.067  -9.195  0.664   1.00 0.00 ? 105 ILE A CA   6  
ATOM 9633  C C    . ILE A 1 102 ? -3.032  -8.455  -0.260  1.00 0.00 ? 105 ILE A C    6  
ATOM 9634  O O    . ILE A 1 102 ? -2.654  -7.511  -0.960  1.00 0.00 ? 105 ILE A O    6  
ATOM 9635  C CB   . ILE A 1 102 ? -2.284  -8.670  2.108   1.00 0.00 ? 105 ILE A CB   6  
ATOM 9636  C CG1  . ILE A 1 102 ? -1.797  -7.219  2.232   1.00 0.00 ? 105 ILE A CG1  6  
ATOM 9637  C CG2  . ILE A 1 102 ? -1.592  -9.565  3.128   1.00 0.00 ? 105 ILE A CG2  6  
ATOM 9638  C CD1  . ILE A 1 102 ? -2.126  -6.568  3.561   1.00 0.00 ? 105 ILE A CD1  6  
ATOM 9639  H H    . ILE A 1 102 ? -0.332  -8.153  0.034   1.00 0.00 ? 105 ILE A H    6  
ATOM 9640  H HA   . ILE A 1 102 ? -2.309  -10.248 0.648   1.00 0.00 ? 105 ILE A HA   6  
ATOM 9641  H HB   . ILE A 1 102 ? -3.342  -8.699  2.314   1.00 0.00 ? 105 ILE A HB   6  
ATOM 9642  H HG12 . ILE A 1 102 ? -0.725  -7.195  2.110   1.00 0.00 ? 105 ILE A HG12 6  
ATOM 9643  H HG13 . ILE A 1 102 ? -2.254  -6.630  1.452   1.00 0.00 ? 105 ILE A HG13 6  
ATOM 9644  H HG21 . ILE A 1 102 ? -0.539  -9.628  2.901   1.00 0.00 ? 105 ILE A HG21 6  
ATOM 9645  H HG22 . ILE A 1 102 ? -1.722  -9.152  4.118   1.00 0.00 ? 105 ILE A HG22 6  
ATOM 9646  H HG23 . ILE A 1 102 ? -2.025  -10.553 3.095   1.00 0.00 ? 105 ILE A HG23 6  
ATOM 9647  H HD11 . ILE A 1 102 ? -1.664  -7.126  4.361   1.00 0.00 ? 105 ILE A HD11 6  
ATOM 9648  H HD12 . ILE A 1 102 ? -1.752  -5.555  3.569   1.00 0.00 ? 105 ILE A HD12 6  
ATOM 9649  H HD13 . ILE A 1 102 ? -3.197  -6.557  3.702   1.00 0.00 ? 105 ILE A HD13 6  
ATOM 9650  N N    . ILE A 1 103 ? -4.277  -8.901  -0.245  1.00 0.00 ? 106 ILE A N    6  
ATOM 9651  C CA   . ILE A 1 103 ? -5.360  -8.236  -0.951  1.00 0.00 ? 106 ILE A CA   6  
ATOM 9652  C C    . ILE A 1 103 ? -6.468  -7.909  0.041   1.00 0.00 ? 106 ILE A C    6  
ATOM 9653  O O    . ILE A 1 103 ? -6.934  -8.783  0.772   1.00 0.00 ? 106 ILE A O    6  
ATOM 9654  C CB   . ILE A 1 103 ? -5.910  -9.109  -2.107  1.00 0.00 ? 106 ILE A CB   6  
ATOM 9655  C CG1  . ILE A 1 103 ? -5.037  -8.944  -3.353  1.00 0.00 ? 106 ILE A CG1  6  
ATOM 9656  C CG2  . ILE A 1 103 ? -7.361  -8.765  -2.426  1.00 0.00 ? 106 ILE A CG2  6  
ATOM 9657  C CD1  . ILE A 1 103 ? -5.393  -9.895  -4.478  1.00 0.00 ? 106 ILE A CD1  6  
ATOM 9658  H H    . ILE A 1 103 ? -4.482  -9.708  0.279   1.00 0.00 ? 106 ILE A H    6  
ATOM 9659  H HA   . ILE A 1 103 ? -4.974  -7.315  -1.366  1.00 0.00 ? 106 ILE A HA   6  
ATOM 9660  H HB   . ILE A 1 103 ? -5.873  -10.139 -1.794  1.00 0.00 ? 106 ILE A HB   6  
ATOM 9661  H HG12 . ILE A 1 103 ? -5.153  -7.935  -3.727  1.00 0.00 ? 106 ILE A HG12 6  
ATOM 9662  H HG13 . ILE A 1 103 ? -4.006  -9.109  -3.085  1.00 0.00 ? 106 ILE A HG13 6  
ATOM 9663  H HG21 . ILE A 1 103 ? -7.953  -8.838  -1.526  1.00 0.00 ? 106 ILE A HG21 6  
ATOM 9664  H HG22 . ILE A 1 103 ? -7.415  -7.759  -2.811  1.00 0.00 ? 106 ILE A HG22 6  
ATOM 9665  H HG23 . ILE A 1 103 ? -7.741  -9.455  -3.164  1.00 0.00 ? 106 ILE A HG23 6  
ATOM 9666  H HD11 . ILE A 1 103 ? -6.396  -9.685  -4.821  1.00 0.00 ? 106 ILE A HD11 6  
ATOM 9667  H HD12 . ILE A 1 103 ? -4.700  -9.762  -5.295  1.00 0.00 ? 106 ILE A HD12 6  
ATOM 9668  H HD13 . ILE A 1 103 ? -5.341  -10.913 -4.122  1.00 0.00 ? 106 ILE A HD13 6  
ATOM 9669  N N    . CYS A 1 104 ? -6.867  -6.654  0.093   1.00 0.00 ? 107 CYS A N    6  
ATOM 9670  C CA   . CYS A 1 104 ? -7.866  -6.228  1.053   1.00 0.00 ? 107 CYS A CA   6  
ATOM 9671  C C    . CYS A 1 104 ? -9.104  -5.714  0.331   1.00 0.00 ? 107 CYS A C    6  
ATOM 9672  O O    . CYS A 1 104 ? -9.026  -5.274  -0.817  1.00 0.00 ? 107 CYS A O    6  
ATOM 9673  C CB   . CYS A 1 104 ? -7.292  -5.142  1.964   1.00 0.00 ? 107 CYS A CB   6  
ATOM 9674  S SG   . CYS A 1 104 ? -7.894  -5.226  3.676   1.00 0.00 ? 107 CYS A SG   6  
ATOM 9675  H H    . CYS A 1 104 ? -6.492  -5.995  -0.534  1.00 0.00 ? 107 CYS A H    6  
ATOM 9676  H HA   . CYS A 1 104 ? -8.137  -7.084  1.650   1.00 0.00 ? 107 CYS A HA   6  
ATOM 9677  H HB2  . CYS A 1 104 ? -6.215  -5.232  1.990   1.00 0.00 ? 107 CYS A HB2  6  
ATOM 9678  H HB3  . CYS A 1 104 ? -7.561  -4.172  1.567   1.00 0.00 ? 107 CYS A HB3  6  
ATOM 9679  N N    . TYR A 1 105 ? -10.247 -5.781  0.992   1.00 0.00 ? 108 TYR A N    6  
ATOM 9680  C CA   . TYR A 1 105 ? -11.492 -5.324  0.402   1.00 0.00 ? 108 TYR A CA   6  
ATOM 9681  C C    . TYR A 1 105 ? -12.383 -4.670  1.448   1.00 0.00 ? 108 TYR A C    6  
ATOM 9682  O O    . TYR A 1 105 ? -12.308 -4.995  2.633   1.00 0.00 ? 108 TYR A O    6  
ATOM 9683  C CB   . TYR A 1 105 ? -12.223 -6.474  -0.309  1.00 0.00 ? 108 TYR A CB   6  
ATOM 9684  C CG   . TYR A 1 105 ? -12.066 -7.830  0.346   1.00 0.00 ? 108 TYR A CG   6  
ATOM 9685  C CD1  . TYR A 1 105 ? -12.878 -8.215  1.402   1.00 0.00 ? 108 TYR A CD1  6  
ATOM 9686  C CD2  . TYR A 1 105 ? -11.110 -8.731  -0.107  1.00 0.00 ? 108 TYR A CD2  6  
ATOM 9687  C CE1  . TYR A 1 105 ? -12.740 -9.458  1.990   1.00 0.00 ? 108 TYR A CE1  6  
ATOM 9688  C CE2  . TYR A 1 105 ? -10.968 -9.976  0.474   1.00 0.00 ? 108 TYR A CE2  6  
ATOM 9689  C CZ   . TYR A 1 105 ? -11.786 -10.333 1.521   1.00 0.00 ? 108 TYR A CZ   6  
ATOM 9690  O OH   . TYR A 1 105 ? -11.651 -11.574 2.100   1.00 0.00 ? 108 TYR A OH   6  
ATOM 9691  H H    . TYR A 1 105 ? -10.254 -6.133  1.909   1.00 0.00 ? 108 TYR A H    6  
ATOM 9692  H HA   . TYR A 1 105 ? -11.236 -4.577  -0.331  1.00 0.00 ? 108 TYR A HA   6  
ATOM 9693  H HB2  . TYR A 1 105 ? -13.280 -6.247  -0.339  1.00 0.00 ? 108 TYR A HB2  6  
ATOM 9694  H HB3  . TYR A 1 105 ? -11.852 -6.549  -1.321  1.00 0.00 ? 108 TYR A HB3  6  
ATOM 9695  H HD1  . TYR A 1 105 ? -13.627 -7.529  1.767   1.00 0.00 ? 108 TYR A HD1  6  
ATOM 9696  H HD2  . TYR A 1 105 ? -10.467 -8.447  -0.927  1.00 0.00 ? 108 TYR A HD2  6  
ATOM 9697  H HE1  . TYR A 1 105 ? -13.380 -9.738  2.813   1.00 0.00 ? 108 TYR A HE1  6  
ATOM 9698  H HE2  . TYR A 1 105 ? -10.220 -10.661 0.107   1.00 0.00 ? 108 TYR A HE2  6  
ATOM 9699  H HH   . TYR A 1 105 ? -10.709 -11.791 2.182   1.00 0.00 ? 108 TYR A HH   6  
ATOM 9700  N N    . GLY A 1 106 ? -13.217 -3.746  0.995   1.00 0.00 ? 109 GLY A N    6  
ATOM 9701  C CA   . GLY A 1 106 ? -14.030 -2.959  1.896   1.00 0.00 ? 109 GLY A CA   6  
ATOM 9702  C C    . GLY A 1 106 ? -13.936 -1.488  1.561   1.00 0.00 ? 109 GLY A C    6  
ATOM 9703  O O    . GLY A 1 106 ? -14.378 -1.064  0.491   1.00 0.00 ? 109 GLY A O    6  
ATOM 9704  H H    . GLY A 1 106 ? -13.288 -3.596  0.030   1.00 0.00 ? 109 GLY A H    6  
ATOM 9705  H HA2  . GLY A 1 106 ? -15.059 -3.276  1.814   1.00 0.00 ? 109 GLY A HA2  6  
ATOM 9706  H HA3  . GLY A 1 106 ? -13.689 -3.114  2.908   1.00 0.00 ? 109 GLY A HA3  6  
ATOM 9707  N N    . GLN A 1 107 ? -13.352 -0.713  2.459   1.00 0.00 ? 110 GLN A N    6  
ATOM 9708  C CA   . GLN A 1 107 ? -13.137 0.706   2.219   1.00 0.00 ? 110 GLN A CA   6  
ATOM 9709  C C    . GLN A 1 107 ? -11.651 0.993   2.058   1.00 0.00 ? 110 GLN A C    6  
ATOM 9710  O O    . GLN A 1 107 ? -10.828 0.528   2.854   1.00 0.00 ? 110 GLN A O    6  
ATOM 9711  C CB   . GLN A 1 107 ? -13.702 1.555   3.364   1.00 0.00 ? 110 GLN A CB   6  
ATOM 9712  C CG   . GLN A 1 107 ? -15.226 1.587   3.434   1.00 0.00 ? 110 GLN A CG   6  
ATOM 9713  C CD   . GLN A 1 107 ? -15.837 0.274   3.887   1.00 0.00 ? 110 GLN A CD   6  
ATOM 9714  O OE1  . GLN A 1 107 ? -15.237 -0.469  4.663   1.00 0.00 ? 110 GLN A OE1  6  
ATOM 9715  N NE2  . GLN A 1 107 ? -17.032 -0.024  3.402   1.00 0.00 ? 110 GLN A NE2  6  
ATOM 9716  H H    . GLN A 1 107 ? -13.063 -1.101  3.309   1.00 0.00 ? 110 GLN A H    6  
ATOM 9717  H HA   . GLN A 1 107 ? -13.645 0.966   1.303   1.00 0.00 ? 110 GLN A HA   6  
ATOM 9718  H HB2  . GLN A 1 107 ? -13.330 1.163   4.301   1.00 0.00 ? 110 GLN A HB2  6  
ATOM 9719  H HB3  . GLN A 1 107 ? -13.348 2.568   3.246   1.00 0.00 ? 110 GLN A HB3  6  
ATOM 9720  H HG2  . GLN A 1 107 ? -15.521 2.357   4.129   1.00 0.00 ? 110 GLN A HG2  6  
ATOM 9721  H HG3  . GLN A 1 107 ? -15.612 1.826   2.453   1.00 0.00 ? 110 GLN A HG3  6  
ATOM 9722  H HE21 . GLN A 1 107 ? -17.454 0.614   2.780   1.00 0.00 ? 110 GLN A HE21 6  
ATOM 9723  H HE22 . GLN A 1 107 ? -17.449 -0.866  3.679   1.00 0.00 ? 110 GLN A HE22 6  
ATOM 9724  N N    . LEU A 1 108 ? -11.320 1.736   1.006   1.00 0.00 ? 111 LEU A N    6  
ATOM 9725  C CA   . LEU A 1 108 ? -9.952  2.169   0.744   1.00 0.00 ? 111 LEU A CA   6  
ATOM 9726  C C    . LEU A 1 108 ? -9.349  2.848   1.972   1.00 0.00 ? 111 LEU A C    6  
ATOM 9727  O O    . LEU A 1 108 ? -9.764  3.940   2.358   1.00 0.00 ? 111 LEU A O    6  
ATOM 9728  C CB   . LEU A 1 108 ? -9.932  3.134   -0.450  1.00 0.00 ? 111 LEU A CB   6  
ATOM 9729  C CG   . LEU A 1 108 ? -8.583  3.797   -0.760  1.00 0.00 ? 111 LEU A CG   6  
ATOM 9730  C CD1  . LEU A 1 108 ? -7.558  2.774   -1.227  1.00 0.00 ? 111 LEU A CD1  6  
ATOM 9731  C CD2  . LEU A 1 108 ? -8.759  4.891   -1.802  1.00 0.00 ? 111 LEU A CD2  6  
ATOM 9732  H H    . LEU A 1 108 ? -12.026 1.992   0.365   1.00 0.00 ? 111 LEU A H    6  
ATOM 9733  H HA   . LEU A 1 108 ? -9.369  1.293   0.505   1.00 0.00 ? 111 LEU A HA   6  
ATOM 9734  H HB2  . LEU A 1 108 ? -10.253 2.592   -1.327  1.00 0.00 ? 111 LEU A HB2  6  
ATOM 9735  H HB3  . LEU A 1 108 ? -10.652 3.917   -0.257  1.00 0.00 ? 111 LEU A HB3  6  
ATOM 9736  H HG   . LEU A 1 108 ? -8.203  4.256   0.141   1.00 0.00 ? 111 LEU A HG   6  
ATOM 9737  H HD11 . LEU A 1 108 ? -6.627  3.275   -1.450  1.00 0.00 ? 111 LEU A HD11 6  
ATOM 9738  H HD12 . LEU A 1 108 ? -7.392  2.046   -0.446  1.00 0.00 ? 111 LEU A HD12 6  
ATOM 9739  H HD13 . LEU A 1 108 ? -7.920  2.276   -2.114  1.00 0.00 ? 111 LEU A HD13 6  
ATOM 9740  H HD21 . LEU A 1 108 ? -9.407  5.660   -1.409  1.00 0.00 ? 111 LEU A HD21 6  
ATOM 9741  H HD22 . LEU A 1 108 ? -7.797  5.319   -2.040  1.00 0.00 ? 111 LEU A HD22 6  
ATOM 9742  H HD23 . LEU A 1 108 ? -9.197  4.472   -2.698  1.00 0.00 ? 111 LEU A HD23 6  
ATOM 9743  N N    . GLY A 1 109 ? -8.380  2.187   2.588   1.00 0.00 ? 112 GLY A N    6  
ATOM 9744  C CA   . GLY A 1 109 ? -7.739  2.747   3.759   1.00 0.00 ? 112 GLY A CA   6  
ATOM 9745  C C    . GLY A 1 109 ? -7.811  1.824   4.951   1.00 0.00 ? 112 GLY A C    6  
ATOM 9746  O O    . GLY A 1 109 ? -7.030  1.960   5.896   1.00 0.00 ? 112 GLY A O    6  
ATOM 9747  H H    . GLY A 1 109 ? -8.101  1.313   2.247   1.00 0.00 ? 112 GLY A H    6  
ATOM 9748  H HA2  . GLY A 1 109 ? -6.699  2.941   3.530   1.00 0.00 ? 112 GLY A HA2  6  
ATOM 9749  H HA3  . GLY A 1 109 ? -8.224  3.679   4.009   1.00 0.00 ? 112 GLY A HA3  6  
ATOM 9750  N N    . SER A 1 110 ? -8.741  0.879   4.913   1.00 0.00 ? 113 SER A N    6  
ATOM 9751  C CA   . SER A 1 110 ? -8.904  -0.058  6.008   1.00 0.00 ? 113 SER A CA   6  
ATOM 9752  C C    . SER A 1 110 ? -8.256  -1.397  5.662   1.00 0.00 ? 113 SER A C    6  
ATOM 9753  O O    . SER A 1 110 ? -8.582  -2.016  4.648   1.00 0.00 ? 113 SER A O    6  
ATOM 9754  C CB   . SER A 1 110 ? -10.388 -0.249  6.339   1.00 0.00 ? 113 SER A CB   6  
ATOM 9755  O OG   . SER A 1 110 ? -10.559 -0.817  7.628   1.00 0.00 ? 113 SER A OG   6  
ATOM 9756  H H    . SER A 1 110 ? -9.333  0.812   4.129   1.00 0.00 ? 113 SER A H    6  
ATOM 9757  H HA   . SER A 1 110 ? -8.405  0.357   6.870   1.00 0.00 ? 113 SER A HA   6  
ATOM 9758  H HB2  . SER A 1 110 ? -10.887 0.708   6.314   1.00 0.00 ? 113 SER A HB2  6  
ATOM 9759  H HB3  . SER A 1 110 ? -10.837 -0.906  5.608   1.00 0.00 ? 113 SER A HB3  6  
ATOM 9760  H HG   . SER A 1 110 ? -10.968 -0.160  8.206   1.00 0.00 ? 113 SER A HG   6  
ATOM 9761  N N    . PHE A 1 111 ? -7.325  -1.817  6.509   1.00 0.00 ? 114 PHE A N    6  
ATOM 9762  C CA   . PHE A 1 111 ? -6.649  -3.101  6.371   1.00 0.00 ? 114 PHE A CA   6  
ATOM 9763  C C    . PHE A 1 111 ? -7.166  -4.057  7.439   1.00 0.00 ? 114 PHE A C    6  
ATOM 9764  O O    . PHE A 1 111 ? -6.483  -4.997  7.846   1.00 0.00 ? 114 PHE A O    6  
ATOM 9765  C CB   . PHE A 1 111 ? -5.132  -2.935  6.537   1.00 0.00 ? 114 PHE A CB   6  
ATOM 9766  C CG   . PHE A 1 111 ? -4.470  -2.087  5.484   1.00 0.00 ? 114 PHE A CG   6  
ATOM 9767  C CD1  . PHE A 1 111 ? -4.443  -0.703  5.598   1.00 0.00 ? 114 PHE A CD1  6  
ATOM 9768  C CD2  . PHE A 1 111 ? -3.859  -2.676  4.388   1.00 0.00 ? 114 PHE A CD2  6  
ATOM 9769  C CE1  . PHE A 1 111 ? -3.821  0.073   4.641   1.00 0.00 ? 114 PHE A CE1  6  
ATOM 9770  C CE2  . PHE A 1 111 ? -3.234  -1.901  3.428   1.00 0.00 ? 114 PHE A CE2  6  
ATOM 9771  C CZ   . PHE A 1 111 ? -3.216  -0.526  3.554   1.00 0.00 ? 114 PHE A CZ   6  
ATOM 9772  H H    . PHE A 1 111 ? -7.084  -1.241  7.270   1.00 0.00 ? 114 PHE A H    6  
ATOM 9773  H HA   . PHE A 1 111 ? -6.868  -3.503  5.391   1.00 0.00 ? 114 PHE A HA   6  
ATOM 9774  H HB2  . PHE A 1 111 ? -4.935  -2.476  7.494   1.00 0.00 ? 114 PHE A HB2  6  
ATOM 9775  H HB3  . PHE A 1 111 ? -4.671  -3.912  6.518   1.00 0.00 ? 114 PHE A HB3  6  
ATOM 9776  H HD1  . PHE A 1 111 ? -4.913  -0.231  6.445   1.00 0.00 ? 114 PHE A HD1  6  
ATOM 9777  H HD2  . PHE A 1 111 ? -3.875  -3.750  4.286   1.00 0.00 ? 114 PHE A HD2  6  
ATOM 9778  H HE1  . PHE A 1 111 ? -3.807  1.149   4.742   1.00 0.00 ? 114 PHE A HE1  6  
ATOM 9779  H HE2  . PHE A 1 111 ? -2.760  -2.373  2.578   1.00 0.00 ? 114 PHE A HE2  6  
ATOM 9780  H HZ   . PHE A 1 111 ? -2.727  0.080   2.805   1.00 0.00 ? 114 PHE A HZ   6  
ATOM 9781  N N    . SER A 1 112 ? -8.379  -3.796  7.898   1.00 0.00 ? 115 SER A N    6  
ATOM 9782  C CA   . SER A 1 112 ? -8.956  -4.537  9.009   1.00 0.00 ? 115 SER A CA   6  
ATOM 9783  C C    . SER A 1 112 ? -9.469  -5.907  8.565   1.00 0.00 ? 115 SER A C    6  
ATOM 9784  O O    . SER A 1 112 ? -9.744  -6.774  9.395   1.00 0.00 ? 115 SER A O    6  
ATOM 9785  C CB   . SER A 1 112 ? -10.093 -3.722  9.628   1.00 0.00 ? 115 SER A CB   6  
ATOM 9786  O OG   . SER A 1 112 ? -9.685  -2.382  9.869   1.00 0.00 ? 115 SER A OG   6  
ATOM 9787  H H    . SER A 1 112 ? -8.896  -3.077  7.483   1.00 0.00 ? 115 SER A H    6  
ATOM 9788  H HA   . SER A 1 112 ? -8.183  -4.678  9.750   1.00 0.00 ? 115 SER A HA   6  
ATOM 9789  H HB2  . SER A 1 112 ? -10.940 -3.716  8.956   1.00 0.00 ? 115 SER A HB2  6  
ATOM 9790  H HB3  . SER A 1 112 ? -10.383 -4.169  10.567  1.00 0.00 ? 115 SER A HB3  6  
ATOM 9791  H HG   . SER A 1 112 ? -9.924  -1.833  9.106   1.00 0.00 ? 115 SER A HG   6  
ATOM 9792  N N    . ASN A 1 113 ? -9.585  -6.101  7.257   1.00 0.00 ? 116 ASN A N    6  
ATOM 9793  C CA   . ASN A 1 113 ? -10.141 -7.332  6.710   1.00 0.00 ? 116 ASN A CA   6  
ATOM 9794  C C    . ASN A 1 113 ? -9.473  -7.661  5.377   1.00 0.00 ? 116 ASN A C    6  
ATOM 9795  O O    . ASN A 1 113 ? -10.050 -7.462  4.307   1.00 0.00 ? 116 ASN A O    6  
ATOM 9796  C CB   . ASN A 1 113 ? -11.659 -7.185  6.536   1.00 0.00 ? 116 ASN A CB   6  
ATOM 9797  C CG   . ASN A 1 113 ? -12.353 -8.507  6.274   1.00 0.00 ? 116 ASN A CG   6  
ATOM 9798  O OD1  . ASN A 1 113 ? -12.531 -8.916  5.129   1.00 0.00 ? 116 ASN A OD1  6  
ATOM 9799  N ND2  . ASN A 1 113 ? -12.765 -9.181  7.338   1.00 0.00 ? 116 ASN A ND2  6  
ATOM 9800  H H    . ASN A 1 113 ? -9.279  -5.402  6.641   1.00 0.00 ? 116 ASN A H    6  
ATOM 9801  H HA   . ASN A 1 113 ? -9.940  -8.129  7.409   1.00 0.00 ? 116 ASN A HA   6  
ATOM 9802  H HB2  . ASN A 1 113 ? -12.075 -6.755  7.435   1.00 0.00 ? 116 ASN A HB2  6  
ATOM 9803  H HB3  . ASN A 1 113 ? -11.855 -6.525  5.703   1.00 0.00 ? 116 ASN A HB3  6  
ATOM 9804  H HD21 . ASN A 1 113 ? -12.601 -8.794  8.229   1.00 0.00 ? 116 ASN A HD21 6  
ATOM 9805  H HD22 . ASN A 1 113 ? -13.220 -10.045 7.194   1.00 0.00 ? 116 ASN A HD22 6  
ATOM 9806  N N    . CYS A 1 114 ? -8.239  -8.147  5.448   1.00 0.00 ? 117 CYS A N    6  
ATOM 9807  C CA   . CYS A 1 114 ? -7.469  -8.446  4.249   1.00 0.00 ? 117 CYS A CA   6  
ATOM 9808  C C    . CYS A 1 114 ? -7.189  -9.945  4.151   1.00 0.00 ? 117 CYS A C    6  
ATOM 9809  O O    . CYS A 1 114 ? -7.153  -10.646 5.163   1.00 0.00 ? 117 CYS A O    6  
ATOM 9810  C CB   . CYS A 1 114 ? -6.142  -7.678  4.267   1.00 0.00 ? 117 CYS A CB   6  
ATOM 9811  S SG   . CYS A 1 114 ? -6.284  -5.911  4.709   1.00 0.00 ? 117 CYS A SG   6  
ATOM 9812  H H    . CYS A 1 114 ? -7.836  -8.305  6.327   1.00 0.00 ? 117 CYS A H    6  
ATOM 9813  H HA   . CYS A 1 114 ? -8.050  -8.138  3.394   1.00 0.00 ? 117 CYS A HA   6  
ATOM 9814  H HB2  . CYS A 1 114 ? -5.484  -8.140  4.986   1.00 0.00 ? 117 CYS A HB2  6  
ATOM 9815  H HB3  . CYS A 1 114 ? -5.686  -7.733  3.286   1.00 0.00 ? 117 CYS A HB3  6  
ATOM 9816  N N    . SER A 1 115 ? -6.984  -10.429 2.932   1.00 0.00 ? 118 SER A N    6  
ATOM 9817  C CA   . SER A 1 115 ? -6.680  -11.834 2.703   1.00 0.00 ? 118 SER A CA   6  
ATOM 9818  C C    . SER A 1 115 ? -5.238  -11.999 2.225   1.00 0.00 ? 118 SER A C    6  
ATOM 9819  O O    . SER A 1 115 ? -4.627  -11.051 1.727   1.00 0.00 ? 118 SER A O    6  
ATOM 9820  C CB   . SER A 1 115 ? -7.647  -12.418 1.674   1.00 0.00 ? 118 SER A CB   6  
ATOM 9821  O OG   . SER A 1 115 ? -8.988  -12.323 2.129   1.00 0.00 ? 118 SER A OG   6  
ATOM 9822  H H    . SER A 1 115 ? -7.037  -9.823  2.158   1.00 0.00 ? 118 SER A H    6  
ATOM 9823  H HA   . SER A 1 115 ? -6.800  -12.359 3.639   1.00 0.00 ? 118 SER A HA   6  
ATOM 9824  H HB2  . SER A 1 115 ? -7.555  -11.878 0.743   1.00 0.00 ? 118 SER A HB2  6  
ATOM 9825  H HB3  . SER A 1 115 ? -7.407  -13.459 1.511   1.00 0.00 ? 118 SER A HB3  6  
ATOM 9826  H HG   . SER A 1 115 ? -9.038  -12.657 3.040   1.00 0.00 ? 118 SER A HG   6  
ATOM 9827  N N    . HIS A 1 116 ? -4.702  -13.203 2.381   1.00 0.00 ? 119 HIS A N    6  
ATOM 9828  C CA   . HIS A 1 116 ? -3.326  -13.492 1.995   1.00 0.00 ? 119 HIS A CA   6  
ATOM 9829  C C    . HIS A 1 116 ? -3.264  -13.835 0.519   1.00 0.00 ? 119 HIS A C    6  
ATOM 9830  O O    . HIS A 1 116 ? -4.108  -14.577 0.015   1.00 0.00 ? 119 HIS A O    6  
ATOM 9831  C CB   . HIS A 1 116 ? -2.761  -14.645 2.832   1.00 0.00 ? 119 HIS A CB   6  
ATOM 9832  C CG   . HIS A 1 116 ? -2.563  -14.300 4.277   1.00 0.00 ? 119 HIS A CG   6  
ATOM 9833  N ND1  . HIS A 1 116 ? -1.320  -14.132 4.850   1.00 0.00 ? 119 HIS A ND1  6  
ATOM 9834  C CD2  . HIS A 1 116 ? -3.461  -14.087 5.267   1.00 0.00 ? 119 HIS A CD2  6  
ATOM 9835  C CE1  . HIS A 1 116 ? -1.460  -13.831 6.126   1.00 0.00 ? 119 HIS A CE1  6  
ATOM 9836  N NE2  . HIS A 1 116 ? -2.751  -13.795 6.407   1.00 0.00 ? 119 HIS A NE2  6  
ATOM 9837  H H    . HIS A 1 116 ? -5.260  -13.931 2.741   1.00 0.00 ? 119 HIS A H    6  
ATOM 9838  H HA   . HIS A 1 116 ? -2.740  -12.606 2.173   1.00 0.00 ? 119 HIS A HA   6  
ATOM 9839  H HB2  . HIS A 1 116 ? -3.444  -15.481 2.783   1.00 0.00 ? 119 HIS A HB2  6  
ATOM 9840  H HB3  . HIS A 1 116 ? -1.805  -14.945 2.425   1.00 0.00 ? 119 HIS A HB3  6  
ATOM 9841  H HD1  . HIS A 1 116 ? -0.451  -14.235 4.383   1.00 0.00 ? 119 HIS A HD1  6  
ATOM 9842  H HD2  . HIS A 1 116 ? -4.536  -14.142 5.178   1.00 0.00 ? 119 HIS A HD2  6  
ATOM 9843  H HE1  . HIS A 1 116 ? -0.656  -13.639 6.822   1.00 0.00 ? 119 HIS A HE1  6  
ATOM 9844  N N    . SER A 1 117 ? -2.278  -13.298 -0.179  1.00 0.00 ? 120 SER A N    6  
ATOM 9845  C CA   . SER A 1 117 ? -2.209  -13.472 -1.612  1.00 0.00 ? 120 SER A CA   6  
ATOM 9846  C C    . SER A 1 117 ? -1.080  -14.409 -2.014  1.00 0.00 ? 120 SER A C    6  
ATOM 9847  O O    . SER A 1 117 ? 0.097   -14.152 -1.753  1.00 0.00 ? 120 SER A O    6  
ATOM 9848  C CB   . SER A 1 117 ? -2.041  -12.125 -2.309  1.00 0.00 ? 120 SER A CB   6  
ATOM 9849  O OG   . SER A 1 117 ? -2.129  -12.272 -3.715  1.00 0.00 ? 120 SER A OG   6  
ATOM 9850  H H    . SER A 1 117 ? -1.581  -12.780 0.278   1.00 0.00 ? 120 SER A H    6  
ATOM 9851  H HA   . SER A 1 117 ? -3.145  -13.906 -1.928  1.00 0.00 ? 120 SER A HA   6  
ATOM 9852  H HB2  . SER A 1 117 ? -2.816  -11.451 -1.978  1.00 0.00 ? 120 SER A HB2  6  
ATOM 9853  H HB3  . SER A 1 117 ? -1.074  -11.712 -2.062  1.00 0.00 ? 120 SER A HB3  6  
ATOM 9854  H HG   . SER A 1 117 ? -2.036  -11.407 -4.131  1.00 0.00 ? 120 SER A HG   6  
ATOM 9855  N N    . ARG A 1 118 ? -1.464  -15.504 -2.642  1.00 0.00 ? 121 ARG A N    6  
ATOM 9856  C CA   . ARG A 1 118 ? -0.527  -16.419 -3.266  1.00 0.00 ? 121 ARG A CA   6  
ATOM 9857  C C    . ARG A 1 118 ? -0.795  -16.451 -4.765  1.00 0.00 ? 121 ARG A C    6  
ATOM 9858  O O    . ARG A 1 118 ? -0.619  -17.469 -5.437  1.00 0.00 ? 121 ARG A O    6  
ATOM 9859  C CB   . ARG A 1 118 ? -0.636  -17.819 -2.647  1.00 0.00 ? 121 ARG A CB   6  
ATOM 9860  C CG   . ARG A 1 118 ? -2.017  -18.160 -2.100  1.00 0.00 ? 121 ARG A CG   6  
ATOM 9861  C CD   . ARG A 1 118 ? -3.064  -18.279 -3.195  1.00 0.00 ? 121 ARG A CD   6  
ATOM 9862  N NE   . ARG A 1 118 ? -2.736  -19.327 -4.154  1.00 0.00 ? 121 ARG A NE   6  
ATOM 9863  C CZ   . ARG A 1 118 ? -3.377  -20.484 -4.221  1.00 0.00 ? 121 ARG A CZ   6  
ATOM 9864  N NH1  . ARG A 1 118 ? -4.342  -20.765 -3.357  1.00 0.00 ? 121 ARG A NH1  6  
ATOM 9865  N NH2  . ARG A 1 118 ? -3.048  -21.371 -5.139  1.00 0.00 ? 121 ARG A NH2  6  
ATOM 9866  H H    . ARG A 1 118 ? -2.421  -15.706 -2.691  1.00 0.00 ? 121 ARG A H    6  
ATOM 9867  H HA   . ARG A 1 118 ? 0.467   -16.035 -3.100  1.00 0.00 ? 121 ARG A HA   6  
ATOM 9868  H HB2  . ARG A 1 118 ? -0.386  -18.548 -3.402  1.00 0.00 ? 121 ARG A HB2  6  
ATOM 9869  H HB3  . ARG A 1 118 ? 0.075   -17.896 -1.838  1.00 0.00 ? 121 ARG A HB3  6  
ATOM 9870  H HG2  . ARG A 1 118 ? -1.960  -19.100 -1.575  1.00 0.00 ? 121 ARG A HG2  6  
ATOM 9871  H HG3  . ARG A 1 118 ? -2.318  -17.384 -1.413  1.00 0.00 ? 121 ARG A HG3  6  
ATOM 9872  H HD2  . ARG A 1 118 ? -4.017  -18.507 -2.741  1.00 0.00 ? 121 ARG A HD2  6  
ATOM 9873  H HD3  . ARG A 1 118 ? -3.130  -17.335 -3.715  1.00 0.00 ? 121 ARG A HD3  6  
ATOM 9874  H HE   . ARG A 1 118 ? -2.008  -19.147 -4.792  1.00 0.00 ? 121 ARG A HE   6  
ATOM 9875  H HH12 . ARG A 1 118 ? -4.145  -20.786 -2.364  1.00 0.00 ? 121 ARG A HH12 6  
ATOM 9876  H HH21 . ARG A 1 118 ? -2.312  -21.172 -5.791  1.00 0.00 ? 121 ARG A HH21 6  
ATOM 9877  H HH22 . ARG A 1 118 ? -3.545  -22.249 -5.195  1.00 0.00 ? 121 ARG A HH22 6  
ATOM 9878  N N    . ASN A 1 119 ? -1.232  -15.306 -5.265  1.00 0.00 ? 122 ASN A N    6  
ATOM 9879  C CA   . ASN A 1 119 ? -1.632  -15.163 -6.655  1.00 0.00 ? 122 ASN A CA   6  
ATOM 9880  C C    . ASN A 1 119 ? -0.477  -14.585 -7.466  1.00 0.00 ? 122 ASN A C    6  
ATOM 9881  O O    . ASN A 1 119 ? 0.138   -13.595 -7.067  1.00 0.00 ? 122 ASN A O    6  
ATOM 9882  C CB   . ASN A 1 119 ? -2.861  -14.247 -6.740  1.00 0.00 ? 122 ASN A CB   6  
ATOM 9883  C CG   . ASN A 1 119 ? -3.551  -14.273 -8.092  1.00 0.00 ? 122 ASN A CG   6  
ATOM 9884  O OD1  . ASN A 1 119 ? -2.925  -14.484 -9.131  1.00 0.00 ? 122 ASN A OD1  6  
ATOM 9885  N ND2  . ASN A 1 119 ? -4.857  -14.052 -8.087  1.00 0.00 ? 122 ASN A ND2  6  
ATOM 9886  H H    . ASN A 1 119 ? -1.272  -14.519 -4.679  1.00 0.00 ? 122 ASN A H    6  
ATOM 9887  H HA   . ASN A 1 119 ? -1.887  -16.139 -7.037  1.00 0.00 ? 122 ASN A HA   6  
ATOM 9888  H HB2  . ASN A 1 119 ? -3.578  -14.555 -5.994  1.00 0.00 ? 122 ASN A HB2  6  
ATOM 9889  H HB3  . ASN A 1 119 ? -2.554  -13.232 -6.535  1.00 0.00 ? 122 ASN A HB3  6  
ATOM 9890  H HD21 . ASN A 1 119 ? -5.294  -13.887 -7.221  1.00 0.00 ? 122 ASN A HD21 6  
ATOM 9891  H HD22 . ASN A 1 119 ? -5.333  -14.062 -8.943  1.00 0.00 ? 122 ASN A HD22 6  
ATOM 9892  N N    . ASP A 1 120 ? -0.185  -15.217 -8.596  1.00 0.00 ? 123 ASP A N    6  
ATOM 9893  C CA   . ASP A 1 120 ? 0.916   -14.801 -9.463  1.00 0.00 ? 123 ASP A CA   6  
ATOM 9894  C C    . ASP A 1 120 ? 0.630   -13.453 -10.107 1.00 0.00 ? 123 ASP A C    6  
ATOM 9895  O O    . ASP A 1 120 ? 1.546   -12.737 -10.505 1.00 0.00 ? 123 ASP A O    6  
ATOM 9896  C CB   . ASP A 1 120 ? 1.160   -15.835 -10.565 1.00 0.00 ? 123 ASP A CB   6  
ATOM 9897  C CG   . ASP A 1 120 ? 1.604   -17.182 -10.035 1.00 0.00 ? 123 ASP A CG   6  
ATOM 9898  O OD1  . ASP A 1 120 ? 0.733   -18.005 -9.683  1.00 0.00 ? 123 ASP A OD1  6  
ATOM 9899  O OD2  . ASP A 1 120 ? 2.826   -17.433 -9.984  1.00 0.00 ? 123 ASP A OD2  6  
ATOM 9900  H H    . ASP A 1 120 ? -0.727  -15.999 -8.856  1.00 0.00 ? 123 ASP A H    6  
ATOM 9901  H HA   . ASP A 1 120 ? 1.804   -14.717 -8.854  1.00 0.00 ? 123 ASP A HA   6  
ATOM 9902  H HB2  . ASP A 1 120 ? 0.246   -15.975 -11.123 1.00 0.00 ? 123 ASP A HB2  6  
ATOM 9903  H HB3  . ASP A 1 120 ? 1.925   -15.462 -11.230 1.00 0.00 ? 123 ASP A HB3  6  
ATOM 9904  N N    . MET A 1 121 ? -0.645  -13.110 -10.203 1.00 0.00 ? 124 MET A N    6  
ATOM 9905  C CA   . MET A 1 121 ? -1.057  -11.875 -10.853 1.00 0.00 ? 124 MET A CA   6  
ATOM 9906  C C    . MET A 1 121 ? -1.233  -10.760 -9.826  1.00 0.00 ? 124 MET A C    6  
ATOM 9907  O O    . MET A 1 121 ? -2.033  -9.842  -10.015 1.00 0.00 ? 124 MET A O    6  
ATOM 9908  C CB   . MET A 1 121 ? -2.363  -12.090 -11.622 1.00 0.00 ? 124 MET A CB   6  
ATOM 9909  C CG   . MET A 1 121 ? -2.285  -13.175 -12.686 1.00 0.00 ? 124 MET A CG   6  
ATOM 9910  S SD   . MET A 1 121 ? -3.841  -13.394 -13.568 1.00 0.00 ? 124 MET A SD   6  
ATOM 9911  C CE   . MET A 1 121 ? -3.440  -14.791 -14.611 1.00 0.00 ? 124 MET A CE   6  
ATOM 9912  H H    . MET A 1 121 ? -1.330  -13.699 -9.816  1.00 0.00 ? 124 MET A H    6  
ATOM 9913  H HA   . MET A 1 121 ? -0.282  -11.590 -11.546 1.00 0.00 ? 124 MET A HA   6  
ATOM 9914  H HB2  . MET A 1 121 ? -3.136  -12.364 -10.921 1.00 0.00 ? 124 MET A HB2  6  
ATOM 9915  H HB3  . MET A 1 121 ? -2.641  -11.164 -12.104 1.00 0.00 ? 124 MET A HB3  6  
ATOM 9916  H HG2  . MET A 1 121 ? -1.519  -12.910 -13.398 1.00 0.00 ? 124 MET A HG2  6  
ATOM 9917  H HG3  . MET A 1 121 ? -2.024  -14.109 -12.210 1.00 0.00 ? 124 MET A HG3  6  
ATOM 9918  H HE1  . MET A 1 121 ? -4.305  -15.061 -15.200 1.00 0.00 ? 124 MET A HE1  6  
ATOM 9919  H HE2  . MET A 1 121 ? -2.626  -14.527 -15.269 1.00 0.00 ? 124 MET A HE2  6  
ATOM 9920  H HE3  . MET A 1 121 ? -3.150  -15.629 -13.994 1.00 0.00 ? 124 MET A HE3  6  
ATOM 9921  N N    . CYS A 1 122 ? -0.480  -10.837 -8.741  1.00 0.00 ? 125 CYS A N    6  
ATOM 9922  C CA   . CYS A 1 122 ? -0.575  -9.840  -7.689  1.00 0.00 ? 125 CYS A CA   6  
ATOM 9923  C C    . CYS A 1 122 ? 0.274   -8.623  -8.038  1.00 0.00 ? 125 CYS A C    6  
ATOM 9924  O O    . CYS A 1 122 ? 1.461   -8.563  -7.716  1.00 0.00 ? 125 CYS A O    6  
ATOM 9925  C CB   . CYS A 1 122 ? -0.143  -10.417 -6.336  1.00 0.00 ? 125 CYS A CB   6  
ATOM 9926  S SG   . CYS A 1 122 ? -1.152  -9.832  -4.932  1.00 0.00 ? 125 CYS A SG   6  
ATOM 9927  H H    . CYS A 1 122 ? 0.160   -11.576 -8.653  1.00 0.00 ? 125 CYS A H    6  
ATOM 9928  H HA   . CYS A 1 122 ? -1.608  -9.531  -7.623  1.00 0.00 ? 125 CYS A HA   6  
ATOM 9929  H HB2  . CYS A 1 122 ? -0.216  -11.494 -6.366  1.00 0.00 ? 125 CYS A HB2  6  
ATOM 9930  H HB3  . CYS A 1 122 ? 0.882   -10.136 -6.145  1.00 0.00 ? 125 CYS A HB3  6  
ATOM 9931  N N    . HIS A 1 123 ? -0.341  -7.670  -8.731  1.00 0.00 ? 126 HIS A N    6  
ATOM 9932  C CA   . HIS A 1 123 ? 0.314   -6.408  -9.060  1.00 0.00 ? 126 HIS A CA   6  
ATOM 9933  C C    . HIS A 1 123 ? 0.683   -5.691  -7.764  1.00 0.00 ? 126 HIS A C    6  
ATOM 9934  O O    . HIS A 1 123 ? -0.161  -5.546  -6.886  1.00 0.00 ? 126 HIS A O    6  
ATOM 9935  C CB   . HIS A 1 123 ? -0.611  -5.516  -9.905  1.00 0.00 ? 126 HIS A CB   6  
ATOM 9936  C CG   . HIS A 1 123 ? -1.111  -6.161  -11.171 1.00 0.00 ? 126 HIS A CG   6  
ATOM 9937  N ND1  . HIS A 1 123 ? -0.502  -5.992  -12.396 1.00 0.00 ? 126 HIS A ND1  6  
ATOM 9938  C CD2  . HIS A 1 123 ? -2.175  -6.973  -11.398 1.00 0.00 ? 126 HIS A CD2  6  
ATOM 9939  C CE1  . HIS A 1 123 ? -1.165  -6.666  -13.318 1.00 0.00 ? 126 HIS A CE1  6  
ATOM 9940  N NE2  . HIS A 1 123 ? -2.184  -7.270  -12.739 1.00 0.00 ? 126 HIS A NE2  6  
ATOM 9941  H H    . HIS A 1 123 ? -1.260  -7.823  -9.027  1.00 0.00 ? 126 HIS A H    6  
ATOM 9942  H HA   . HIS A 1 123 ? 1.214   -6.627  -9.617  1.00 0.00 ? 126 HIS A HA   6  
ATOM 9943  H HB2  . HIS A 1 123 ? -1.471  -5.242  -9.314  1.00 0.00 ? 126 HIS A HB2  6  
ATOM 9944  H HB3  . HIS A 1 123 ? -0.074  -4.620  -10.183 1.00 0.00 ? 126 HIS A HB3  6  
ATOM 9945  H HD1  . HIS A 1 123 ? 0.310   -5.453  -12.565 1.00 0.00 ? 126 HIS A HD1  6  
ATOM 9946  H HD2  . HIS A 1 123 ? -2.886  -7.319  -10.659 1.00 0.00 ? 126 HIS A HD2  6  
ATOM 9947  H HE1  . HIS A 1 123 ? -0.915  -6.713  -14.368 1.00 0.00 ? 126 HIS A HE1  6  
ATOM 9948  N N    . SER A 1 124 ? 1.929   -5.263  -7.634  1.00 0.00 ? 127 SER A N    6  
ATOM 9949  C CA   . SER A 1 124 ? 2.393   -4.667  -6.387  1.00 0.00 ? 127 SER A CA   6  
ATOM 9950  C C    . SER A 1 124 ? 1.971   -3.204  -6.283  1.00 0.00 ? 127 SER A C    6  
ATOM 9951  O O    . SER A 1 124 ? 2.178   -2.414  -7.211  1.00 0.00 ? 127 SER A O    6  
ATOM 9952  C CB   . SER A 1 124 ? 3.914   -4.792  -6.280  1.00 0.00 ? 127 SER A CB   6  
ATOM 9953  O OG   . SER A 1 124 ? 4.329   -6.121  -6.541  1.00 0.00 ? 127 SER A OG   6  
ATOM 9954  H H    . SER A 1 124 ? 2.548   -5.339  -8.390  1.00 0.00 ? 127 SER A H    6  
ATOM 9955  H HA   . SER A 1 124 ? 1.939   -5.214  -5.573  1.00 0.00 ? 127 SER A HA   6  
ATOM 9956  H HB2  . SER A 1 124 ? 4.380   -4.132  -6.998  1.00 0.00 ? 127 SER A HB2  6  
ATOM 9957  H HB3  . SER A 1 124 ? 4.227   -4.519  -5.282  1.00 0.00 ? 127 SER A HB3  6  
ATOM 9958  H HG   . SER A 1 124 ? 3.608   -6.730  -6.336  1.00 0.00 ? 127 SER A HG   6  
ATOM 9959  N N    . LEU A 1 125 ? 1.374   -2.847  -5.152  1.00 0.00 ? 128 LEU A N    6  
ATOM 9960  C CA   . LEU A 1 125 ? 0.904   -1.489  -4.937  1.00 0.00 ? 128 LEU A CA   6  
ATOM 9961  C C    . LEU A 1 125 ? 2.063   -0.583  -4.544  1.00 0.00 ? 128 LEU A C    6  
ATOM 9962  O O    . LEU A 1 125 ? 2.870   -0.929  -3.681  1.00 0.00 ? 128 LEU A O    6  
ATOM 9963  C CB   . LEU A 1 125 ? -0.172  -1.453  -3.849  1.00 0.00 ? 128 LEU A CB   6  
ATOM 9964  C CG   . LEU A 1 125 ? -0.924  -0.129  -3.718  1.00 0.00 ? 128 LEU A CG   6  
ATOM 9965  C CD1  . LEU A 1 125 ? -1.901  0.050   -4.869  1.00 0.00 ? 128 LEU A CD1  6  
ATOM 9966  C CD2  . LEU A 1 125 ? -1.652  -0.053  -2.388  1.00 0.00 ? 128 LEU A CD2  6  
ATOM 9967  H H    . LEU A 1 125 ? 1.252   -3.513  -4.441  1.00 0.00 ? 128 LEU A H    6  
ATOM 9968  H HA   . LEU A 1 125 ? 0.483   -1.135  -5.864  1.00 0.00 ? 128 LEU A HA   6  
ATOM 9969  H HB2  . LEU A 1 125 ? -0.891  -2.233  -4.055  1.00 0.00 ? 128 LEU A HB2  6  
ATOM 9970  H HB3  . LEU A 1 125 ? 0.301   -1.663  -2.905  1.00 0.00 ? 128 LEU A HB3  6  
ATOM 9971  H HG   . LEU A 1 125 ? -0.214  0.683   -3.756  1.00 0.00 ? 128 LEU A HG   6  
ATOM 9972  H HD11 . LEU A 1 125 ? -2.503  0.928   -4.694  1.00 0.00 ? 128 LEU A HD11 6  
ATOM 9973  H HD12 . LEU A 1 125 ? -1.354  0.165   -5.793  1.00 0.00 ? 128 LEU A HD12 6  
ATOM 9974  H HD13 . LEU A 1 125 ? -2.541  -0.818  -4.934  1.00 0.00 ? 128 LEU A HD13 6  
ATOM 9975  H HD21 . LEU A 1 125 ? -2.161  0.896   -2.309  1.00 0.00 ? 128 LEU A HD21 6  
ATOM 9976  H HD22 . LEU A 1 125 ? -2.375  -0.854  -2.327  1.00 0.00 ? 128 LEU A HD22 6  
ATOM 9977  H HD23 . LEU A 1 125 ? -0.941  -0.149  -1.581  1.00 0.00 ? 128 LEU A HD23 6  
ATOM 9978  N N    . GLY A 1 126 ? 2.140   0.566   -5.187  1.00 0.00 ? 129 GLY A N    6  
ATOM 9979  C CA   . GLY A 1 126 ? 3.176   1.522   -4.881  1.00 0.00 ? 129 GLY A CA   6  
ATOM 9980  C C    . GLY A 1 126 ? 2.616   2.900   -4.653  1.00 0.00 ? 129 GLY A C    6  
ATOM 9981  O O    . GLY A 1 126 ? 1.558   3.244   -5.194  1.00 0.00 ? 129 GLY A O    6  
ATOM 9982  H H    . GLY A 1 126 ? 1.473   0.775   -5.878  1.00 0.00 ? 129 GLY A H    6  
ATOM 9983  H HA2  . GLY A 1 126 ? 3.693   1.207   -3.991  1.00 0.00 ? 129 GLY A HA2  6  
ATOM 9984  H HA3  . GLY A 1 126 ? 3.875   1.563   -5.701  1.00 0.00 ? 129 GLY A HA3  6  
ATOM 9985  N N    . LEU A 1 127 ? 3.320   3.690   -3.864  1.00 0.00 ? 130 LEU A N    6  
ATOM 9986  C CA   . LEU A 1 127 ? 2.872   5.024   -3.531  1.00 0.00 ? 130 LEU A CA   6  
ATOM 9987  C C    . LEU A 1 127 ? 4.012   6.013   -3.762  1.00 0.00 ? 130 LEU A C    6  
ATOM 9988  O O    . LEU A 1 127 ? 5.161   5.750   -3.395  1.00 0.00 ? 130 LEU A O    6  
ATOM 9989  C CB   . LEU A 1 127 ? 2.397   5.057   -2.072  1.00 0.00 ? 130 LEU A CB   6  
ATOM 9990  C CG   . LEU A 1 127 ? 1.344   6.119   -1.738  1.00 0.00 ? 130 LEU A CG   6  
ATOM 9991  C CD1  . LEU A 1 127 ? 0.783   5.882   -0.351  1.00 0.00 ? 130 LEU A CD1  6  
ATOM 9992  C CD2  . LEU A 1 127 ? 1.929   7.517   -1.821  1.00 0.00 ? 130 LEU A CD2  6  
ATOM 9993  H H    . LEU A 1 127 ? 4.175   3.370   -3.499  1.00 0.00 ? 130 LEU A H    6  
ATOM 9994  H HA   . LEU A 1 127 ? 2.044   5.273   -4.180  1.00 0.00 ? 130 LEU A HA   6  
ATOM 9995  H HB2  . LEU A 1 127 ? 1.985   4.088   -1.831  1.00 0.00 ? 130 LEU A HB2  6  
ATOM 9996  H HB3  . LEU A 1 127 ? 3.259   5.230   -1.441  1.00 0.00 ? 130 LEU A HB3  6  
ATOM 9997  H HG   . LEU A 1 127 ? 0.530   6.048   -2.445  1.00 0.00 ? 130 LEU A HG   6  
ATOM 9998  H HD11 . LEU A 1 127 ? 0.310   4.912   -0.316  1.00 0.00 ? 130 LEU A HD11 6  
ATOM 9999  H HD12 . LEU A 1 127 ? 1.583   5.924   0.372   1.00 0.00 ? 130 LEU A HD12 6  
ATOM 10000 H HD13 . LEU A 1 127 ? 0.053   6.646   -0.125  1.00 0.00 ? 130 LEU A HD13 6  
ATOM 10001 H HD21 . LEU A 1 127 ? 2.316   7.686   -2.814  1.00 0.00 ? 130 LEU A HD21 6  
ATOM 10002 H HD22 . LEU A 1 127 ? 1.159   8.244   -1.603  1.00 0.00 ? 130 LEU A HD22 6  
ATOM 10003 H HD23 . LEU A 1 127 ? 2.728   7.612   -1.103  1.00 0.00 ? 130 LEU A HD23 6  
ATOM 10004 N N    . THR A 1 128 ? 3.691   7.129   -4.389  1.00 0.00 ? 131 THR A N    6  
ATOM 10005 C CA   . THR A 1 128 ? 4.676   8.157   -4.681  1.00 0.00 ? 131 THR A CA   6  
ATOM 10006 C C    . THR A 1 128 ? 4.399   9.421   -3.870  1.00 0.00 ? 131 THR A C    6  
ATOM 10007 O O    . THR A 1 128 ? 3.539   10.220  -4.232  1.00 0.00 ? 131 THR A O    6  
ATOM 10008 C CB   . THR A 1 128 ? 4.668   8.510   -6.184  1.00 0.00 ? 131 THR A CB   6  
ATOM 10009 O OG1  . THR A 1 128 ? 4.778   7.316   -6.967  1.00 0.00 ? 131 THR A OG1  6  
ATOM 10010 C CG2  . THR A 1 128 ? 5.812   9.453   -6.535  1.00 0.00 ? 131 THR A CG2  6  
ATOM 10011 H H    . THR A 1 128 ? 2.760   7.266   -4.667  1.00 0.00 ? 131 THR A H    6  
ATOM 10012 H HA   . THR A 1 128 ? 5.653   7.774   -4.423  1.00 0.00 ? 131 THR A HA   6  
ATOM 10013 H HB   . THR A 1 128 ? 3.733   9.001   -6.419  1.00 0.00 ? 131 THR A HB   6  
ATOM 10014 H HG1  . THR A 1 128 ? 4.917   7.552   -7.890  1.00 0.00 ? 131 THR A HG1  6  
ATOM 10015 H HG21 . THR A 1 128 ? 5.717   10.364  -5.962  1.00 0.00 ? 131 THR A HG21 6  
ATOM 10016 H HG22 . THR A 1 128 ? 5.776   9.685   -7.589  1.00 0.00 ? 131 THR A HG22 6  
ATOM 10017 H HG23 . THR A 1 128 ? 6.754   8.979   -6.304  1.00 0.00 ? 131 THR A HG23 6  
ATOM 10018 N N    . CYS A 1 129 ? 5.111   9.591   -2.770  1.00 0.00 ? 132 CYS A N    6  
ATOM 10019 C CA   . CYS A 1 129 ? 5.006   10.806  -1.972  1.00 0.00 ? 132 CYS A CA   6  
ATOM 10020 C C    . CYS A 1 129 ? 6.097   11.784  -2.411  1.00 0.00 ? 132 CYS A C    6  
ATOM 10021 O O    . CYS A 1 129 ? 7.134   11.366  -2.932  1.00 0.00 ? 132 CYS A O    6  
ATOM 10022 C CB   . CYS A 1 129 ? 5.170   10.485  -0.477  1.00 0.00 ? 132 CYS A CB   6  
ATOM 10023 S SG   . CYS A 1 129 ? 4.233   9.028   0.101   1.00 0.00 ? 132 CYS A SG   6  
ATOM 10024 H H    . CYS A 1 129 ? 5.739   8.886   -2.487  1.00 0.00 ? 132 CYS A H    6  
ATOM 10025 H HA   . CYS A 1 129 ? 4.035   11.246  -2.146  1.00 0.00 ? 132 CYS A HA   6  
ATOM 10026 H HB2  . CYS A 1 129 ? 6.214   10.300  -0.270  1.00 0.00 ? 132 CYS A HB2  6  
ATOM 10027 H HB3  . CYS A 1 129 ? 4.841   11.337  0.103   1.00 0.00 ? 132 CYS A HB3  6  
ATOM 10028 N N    . LEU A 1 130 ? 5.862   13.076  -2.221  1.00 0.00 ? 133 LEU A N    6  
ATOM 10029 C CA   . LEU A 1 130 ? 6.860   14.086  -2.566  1.00 0.00 ? 133 LEU A CA   6  
ATOM 10030 C C    . LEU A 1 130 ? 8.040   14.019  -1.600  1.00 0.00 ? 133 LEU A C    6  
ATOM 10031 O O    . LEU A 1 130 ? 7.843   13.930  -0.389  1.00 0.00 ? 133 LEU A O    6  
ATOM 10032 C CB   . LEU A 1 130 ? 6.249   15.491  -2.532  1.00 0.00 ? 133 LEU A CB   6  
ATOM 10033 C CG   . LEU A 1 130 ? 5.233   15.792  -3.633  1.00 0.00 ? 133 LEU A CG   6  
ATOM 10034 C CD1  . LEU A 1 130 ? 3.891   16.188  -3.034  1.00 0.00 ? 133 LEU A CD1  6  
ATOM 10035 C CD2  . LEU A 1 130 ? 5.756   16.892  -4.548  1.00 0.00 ? 133 LEU A CD2  6  
ATOM 10036 H H    . LEU A 1 130 ? 5.004   13.357  -1.837  1.00 0.00 ? 133 LEU A H    6  
ATOM 10037 H HA   . LEU A 1 130 ? 7.210   13.878  -3.565  1.00 0.00 ? 133 LEU A HA   6  
ATOM 10038 H HB2  . LEU A 1 130 ? 5.762   15.623  -1.581  1.00 0.00 ? 133 LEU A HB2  6  
ATOM 10039 H HB3  . LEU A 1 130 ? 7.052   16.208  -2.610  1.00 0.00 ? 133 LEU A HB3  6  
ATOM 10040 H HG   . LEU A 1 130 ? 5.084   14.904  -4.229  1.00 0.00 ? 133 LEU A HG   6  
ATOM 10041 H HD11 . LEU A 1 130 ? 4.017   17.054  -2.403  1.00 0.00 ? 133 LEU A HD11 6  
ATOM 10042 H HD12 . LEU A 1 130 ? 3.198   16.420  -3.830  1.00 0.00 ? 133 LEU A HD12 6  
ATOM 10043 H HD13 . LEU A 1 130 ? 3.501   15.368  -2.447  1.00 0.00 ? 133 LEU A HD13 6  
ATOM 10044 H HD21 . LEU A 1 130 ? 5.028   17.093  -5.321  1.00 0.00 ? 133 LEU A HD21 6  
ATOM 10045 H HD22 . LEU A 1 130 ? 5.925   17.789  -3.971  1.00 0.00 ? 133 LEU A HD22 6  
ATOM 10046 H HD23 . LEU A 1 130 ? 6.683   16.572  -4.999  1.00 0.00 ? 133 LEU A HD23 6  
ATOM 10047 N N    . GLU A 1 131 ? 9.257   14.041  -2.132  1.00 0.00 ? 134 GLU A N    6  
ATOM 10048 C CA   . GLU A 1 131 ? 10.453  14.027  -1.293  1.00 0.00 ? 134 GLU A CA   6  
ATOM 10049 C C    . GLU A 1 131 ? 10.552  15.331  -0.513  1.00 0.00 ? 134 GLU A C    6  
ATOM 10050 O O    . GLU A 1 131 ? 10.915  16.362  -1.122  1.00 0.00 ? 134 GLU A O    6  
ATOM 10051 C CB   . GLU A 1 131 ? 11.737  13.835  -2.114  1.00 0.00 ? 134 GLU A CB   6  
ATOM 10052 C CG   . GLU A 1 131 ? 11.705  12.676  -3.098  1.00 0.00 ? 134 GLU A CG   6  
ATOM 10053 C CD   . GLU A 1 131 ? 10.997  13.033  -4.387  1.00 0.00 ? 134 GLU A CD   6  
ATOM 10054 O OE1  . GLU A 1 131 ? 11.591  13.762  -5.212  1.00 0.00 ? 134 GLU A OE1  6  
ATOM 10055 O OE2  . GLU A 1 131 ? 9.846   12.600  -4.578  1.00 0.00 ? 134 GLU A OE2  6  
ATOM 10056 O OXT  . GLU A 1 131 ? 10.264  15.326  0.701   1.00 0.00 ? 134 GLU A OXT  6  
ATOM 10057 H H    . GLU A 1 131 ? 9.353   14.056  -3.109  1.00 0.00 ? 134 GLU A H    6  
ATOM 10058 H HA   . GLU A 1 131 ? 10.356  13.209  -0.591  1.00 0.00 ? 134 GLU A HA   6  
ATOM 10059 H HB2  . GLU A 1 131 ? 11.926  14.739  -2.672  1.00 0.00 ? 134 GLU A HB2  6  
ATOM 10060 H HB3  . GLU A 1 131 ? 12.561  13.672  -1.433  1.00 0.00 ? 134 GLU A HB3  6  
ATOM 10061 H HG2  . GLU A 1 131 ? 12.721  12.391  -3.332  1.00 0.00 ? 134 GLU A HG2  6  
ATOM 10062 H HG3  . GLU A 1 131 ? 11.195  11.842  -2.640  1.00 0.00 ? 134 GLU A HG3  6  
ATOM 10063 N N    . ARG A 1 22  ? -8.897  -2.614  14.884  1.00 0.00 ? 25  ARG A N    7  
ATOM 10064 C CA   . ARG A 1 22  ? -9.103  -2.103  13.512  1.00 0.00 ? 25  ARG A CA   7  
ATOM 10065 C C    . ARG A 1 22  ? -7.808  -1.516  12.973  1.00 0.00 ? 25  ARG A C    7  
ATOM 10066 O O    . ARG A 1 22  ? -7.102  -0.805  13.681  1.00 0.00 ? 25  ARG A O    7  
ATOM 10067 C CB   . ARG A 1 22  ? -10.189 -1.021  13.500  1.00 0.00 ? 25  ARG A CB   7  
ATOM 10068 C CG   . ARG A 1 22  ? -10.498 -0.481  12.111  1.00 0.00 ? 25  ARG A CG   7  
ATOM 10069 C CD   . ARG A 1 22  ? -11.344 0.781   12.178  1.00 0.00 ? 25  ARG A CD   7  
ATOM 10070 N NE   . ARG A 1 22  ? -10.592 1.929   12.693  1.00 0.00 ? 25  ARG A NE   7  
ATOM 10071 C CZ   . ARG A 1 22  ? -11.057 2.756   13.627  1.00 0.00 ? 25  ARG A CZ   7  
ATOM 10072 N NH1  . ARG A 1 22  ? -12.230 2.523   14.203  1.00 0.00 ? 25  ARG A NH1  7  
ATOM 10073 N NH2  . ARG A 1 22  ? -10.345 3.807   14.001  1.00 0.00 ? 25  ARG A NH2  7  
ATOM 10074 H HA   . ARG A 1 22  ? -9.409  -2.925  12.881  1.00 0.00 ? 25  ARG A HA   7  
ATOM 10075 H HB2  . ARG A 1 22  ? -11.097 -1.436  13.910  1.00 0.00 ? 25  ARG A HB2  7  
ATOM 10076 H HB3  . ARG A 1 22  ? -9.868  -0.196  14.119  1.00 0.00 ? 25  ARG A HB3  7  
ATOM 10077 H HG2  . ARG A 1 22  ? -9.571  -0.255  11.606  1.00 0.00 ? 25  ARG A HG2  7  
ATOM 10078 H HG3  . ARG A 1 22  ? -11.038 -1.234  11.557  1.00 0.00 ? 25  ARG A HG3  7  
ATOM 10079 H HD2  . ARG A 1 22  ? -11.699 1.013   11.185  1.00 0.00 ? 25  ARG A HD2  7  
ATOM 10080 H HD3  . ARG A 1 22  ? -12.186 0.596   12.826  1.00 0.00 ? 25  ARG A HD3  7  
ATOM 10081 H HE   . ARG A 1 22  ? -9.704  2.107   12.302  1.00 0.00 ? 25  ARG A HE   7  
ATOM 10082 H HH12 . ARG A 1 22  ? -13.052 2.354   13.630  1.00 0.00 ? 25  ARG A HH12 7  
ATOM 10083 H HH21 . ARG A 1 22  ? -9.448  3.994   13.573  1.00 0.00 ? 25  ARG A HH21 7  
ATOM 10084 H HH22 . ARG A 1 22  ? -10.692 4.426   14.714  1.00 0.00 ? 25  ARG A HH22 7  
ATOM 10085 N N    . LEU A 1 23  ? -7.495  -1.822  11.726  1.00 0.00 ? 26  LEU A N    7  
ATOM 10086 C CA   . LEU A 1 23  ? -6.357  -1.215  11.057  1.00 0.00 ? 26  LEU A CA   7  
ATOM 10087 C C    . LEU A 1 23  ? -6.843  -0.457  9.833   1.00 0.00 ? 26  LEU A C    7  
ATOM 10088 O O    . LEU A 1 23  ? -7.640  -0.975  9.063   1.00 0.00 ? 26  LEU A O    7  
ATOM 10089 C CB   . LEU A 1 23  ? -5.330  -2.274  10.645  1.00 0.00 ? 26  LEU A CB   7  
ATOM 10090 C CG   . LEU A 1 23  ? -4.673  -3.037  11.798  1.00 0.00 ? 26  LEU A CG   7  
ATOM 10091 C CD1  . LEU A 1 23  ? -3.710  -4.081  11.260  1.00 0.00 ? 26  LEU A CD1  7  
ATOM 10092 C CD2  . LEU A 1 23  ? -3.948  -2.084  12.737  1.00 0.00 ? 26  LEU A CD2  7  
ATOM 10093 H H    . LEU A 1 23  ? -8.042  -2.471  11.240  1.00 0.00 ? 26  LEU A H    7  
ATOM 10094 H HA   . LEU A 1 23  ? -5.898  -0.520  11.741  1.00 0.00 ? 26  LEU A HA   7  
ATOM 10095 H HB2  . LEU A 1 23  ? -5.823  -2.990  10.003  1.00 0.00 ? 26  LEU A HB2  7  
ATOM 10096 H HB3  . LEU A 1 23  ? -4.552  -1.786  10.076  1.00 0.00 ? 26  LEU A HB3  7  
ATOM 10097 H HG   . LEU A 1 23  ? -5.439  -3.549  12.365  1.00 0.00 ? 26  LEU A HG   7  
ATOM 10098 H HD11 . LEU A 1 23  ? -3.251  -4.608  12.084  1.00 0.00 ? 26  LEU A HD11 7  
ATOM 10099 H HD12 . LEU A 1 23  ? -4.250  -4.781  10.640  1.00 0.00 ? 26  LEU A HD12 7  
ATOM 10100 H HD13 . LEU A 1 23  ? -2.947  -3.594  10.672  1.00 0.00 ? 26  LEU A HD13 7  
ATOM 10101 H HD21 . LEU A 1 23  ? -4.665  -1.443  13.226  1.00 0.00 ? 26  LEU A HD21 7  
ATOM 10102 H HD22 . LEU A 1 23  ? -3.410  -2.653  13.480  1.00 0.00 ? 26  LEU A HD22 7  
ATOM 10103 H HD23 . LEU A 1 23  ? -3.250  -1.483  12.172  1.00 0.00 ? 26  LEU A HD23 7  
ATOM 10104 N N    . SER A 1 24  ? -6.409  0.783   9.690   1.00 0.00 ? 27  SER A N    7  
ATOM 10105 C CA   . SER A 1 24  ? -6.762  1.607   8.538   1.00 0.00 ? 27  SER A CA   7  
ATOM 10106 C C    . SER A 1 24  ? -5.751  2.739   8.411   1.00 0.00 ? 27  SER A C    7  
ATOM 10107 O O    . SER A 1 24  ? -5.252  3.229   9.421   1.00 0.00 ? 27  SER A O    7  
ATOM 10108 C CB   . SER A 1 24  ? -8.175  2.183   8.702   1.00 0.00 ? 27  SER A CB   7  
ATOM 10109 O OG   . SER A 1 24  ? -9.146  1.150   8.819   1.00 0.00 ? 27  SER A OG   7  
ATOM 10110 H H    . SER A 1 24  ? -5.840  1.175   10.389  1.00 0.00 ? 27  SER A H    7  
ATOM 10111 H HA   . SER A 1 24  ? -6.722  0.992   7.652   1.00 0.00 ? 27  SER A HA   7  
ATOM 10112 H HB2  . SER A 1 24  ? -8.207  2.792   9.592   1.00 0.00 ? 27  SER A HB2  7  
ATOM 10113 H HB3  . SER A 1 24  ? -8.413  2.790   7.844   1.00 0.00 ? 27  SER A HB3  7  
ATOM 10114 H HG   . SER A 1 24  ? -8.703  0.328   9.066   1.00 0.00 ? 27  SER A HG   7  
ATOM 10115 N N    . TRP A 1 25  ? -5.448  3.167   7.186   1.00 0.00 ? 28  TRP A N    7  
ATOM 10116 C CA   . TRP A 1 25  ? -4.448  4.217   6.999   1.00 0.00 ? 28  TRP A CA   7  
ATOM 10117 C C    . TRP A 1 25  ? -5.031  5.597   7.304   1.00 0.00 ? 28  TRP A C    7  
ATOM 10118 O O    . TRP A 1 25  ? -4.430  6.625   6.997   1.00 0.00 ? 28  TRP A O    7  
ATOM 10119 C CB   . TRP A 1 25  ? -3.807  4.167   5.595   1.00 0.00 ? 28  TRP A CB   7  
ATOM 10120 C CG   . TRP A 1 25  ? -4.735  4.372   4.425   1.00 0.00 ? 28  TRP A CG   7  
ATOM 10121 C CD1  . TRP A 1 25  ? -5.874  5.125   4.379   1.00 0.00 ? 28  TRP A CD1  7  
ATOM 10122 C CD2  . TRP A 1 25  ? -4.558  3.840   3.103   1.00 0.00 ? 28  TRP A CD2  7  
ATOM 10123 N NE1  . TRP A 1 25  ? -6.423  5.077   3.120   1.00 0.00 ? 28  TRP A NE1  7  
ATOM 10124 C CE2  . TRP A 1 25  ? -5.635  4.297   2.320   1.00 0.00 ? 28  TRP A CE2  7  
ATOM 10125 C CE3  . TRP A 1 25  ? -3.596  3.015   2.507   1.00 0.00 ? 28  TRP A CE3  7  
ATOM 10126 C CZ2  . TRP A 1 25  ? -5.776  3.961   0.975   1.00 0.00 ? 28  TRP A CZ2  7  
ATOM 10127 C CZ3  . TRP A 1 25  ? -3.738  2.681   1.171   1.00 0.00 ? 28  TRP A CZ3  7  
ATOM 10128 C CH2  . TRP A 1 25  ? -4.820  3.154   0.419   1.00 0.00 ? 28  TRP A CH2  7  
ATOM 10129 H H    . TRP A 1 25  ? -5.901  2.778   6.405   1.00 0.00 ? 28  TRP A H    7  
ATOM 10130 H HA   . TRP A 1 25  ? -3.670  4.030   7.726   1.00 0.00 ? 28  TRP A HA   7  
ATOM 10131 H HB2  . TRP A 1 25  ? -3.050  4.933   5.539   1.00 0.00 ? 28  TRP A HB2  7  
ATOM 10132 H HB3  . TRP A 1 25  ? -3.332  3.201   5.473   1.00 0.00 ? 28  TRP A HB3  7  
ATOM 10133 H HD1  . TRP A 1 25  ? -6.280  5.665   5.222   1.00 0.00 ? 28  TRP A HD1  7  
ATOM 10134 H HE1  . TRP A 1 25  ? -7.247  5.535   2.840   1.00 0.00 ? 28  TRP A HE1  7  
ATOM 10135 H HE3  . TRP A 1 25  ? -2.754  2.641   3.071   1.00 0.00 ? 28  TRP A HE3  7  
ATOM 10136 H HZ2  . TRP A 1 25  ? -6.604  4.316   0.380   1.00 0.00 ? 28  TRP A HZ2  7  
ATOM 10137 H HZ3  . TRP A 1 25  ? -3.003  2.046   0.692   1.00 0.00 ? 28  TRP A HZ3  7  
ATOM 10138 H HH2  . TRP A 1 25  ? -4.891  2.869   -0.619  1.00 0.00 ? 28  TRP A HH2  7  
ATOM 10139 N N    . TYR A 1 26  ? -6.214  5.599   7.911   1.00 0.00 ? 29  TYR A N    7  
ATOM 10140 C CA   . TYR A 1 26  ? -6.827  6.819   8.406   1.00 0.00 ? 29  TYR A CA   7  
ATOM 10141 C C    . TYR A 1 26  ? -6.598  6.928   9.908   1.00 0.00 ? 29  TYR A C    7  
ATOM 10142 O O    . TYR A 1 26  ? -6.976  7.919   10.538  1.00 0.00 ? 29  TYR A O    7  
ATOM 10143 C CB   . TYR A 1 26  ? -8.331  6.835   8.113   1.00 0.00 ? 29  TYR A CB   7  
ATOM 10144 C CG   . TYR A 1 26  ? -8.670  6.636   6.653   1.00 0.00 ? 29  TYR A CG   7  
ATOM 10145 C CD1  . TYR A 1 26  ? -8.496  7.662   5.732   1.00 0.00 ? 29  TYR A CD1  7  
ATOM 10146 C CD2  . TYR A 1 26  ? -9.155  5.419   6.196   1.00 0.00 ? 29  TYR A CD2  7  
ATOM 10147 C CE1  . TYR A 1 26  ? -8.797  7.477   4.397   1.00 0.00 ? 29  TYR A CE1  7  
ATOM 10148 C CE2  . TYR A 1 26  ? -9.453  5.225   4.865   1.00 0.00 ? 29  TYR A CE2  7  
ATOM 10149 C CZ   . TYR A 1 26  ? -9.273  6.257   3.967   1.00 0.00 ? 29  TYR A CZ   7  
ATOM 10150 O OH   . TYR A 1 26  ? -9.559  6.060   2.635   1.00 0.00 ? 29  TYR A OH   7  
ATOM 10151 H H    . TYR A 1 26  ? -6.687  4.753   8.028   1.00 0.00 ? 29  TYR A H    7  
ATOM 10152 H HA   . TYR A 1 26  ? -6.356  7.656   7.912   1.00 0.00 ? 29  TYR A HA   7  
ATOM 10153 H HB2  . TYR A 1 26  ? -8.805  6.044   8.675   1.00 0.00 ? 29  TYR A HB2  7  
ATOM 10154 H HB3  . TYR A 1 26  ? -8.740  7.785   8.424   1.00 0.00 ? 29  TYR A HB3  7  
ATOM 10155 H HD1  . TYR A 1 26  ? -8.122  8.616   6.072   1.00 0.00 ? 29  TYR A HD1  7  
ATOM 10156 H HD2  . TYR A 1 26  ? -9.296  4.614   6.899   1.00 0.00 ? 29  TYR A HD2  7  
ATOM 10157 H HE1  . TYR A 1 26  ? -8.657  8.287   3.696   1.00 0.00 ? 29  TYR A HE1  7  
ATOM 10158 H HE2  . TYR A 1 26  ? -9.828  4.271   4.529   1.00 0.00 ? 29  TYR A HE2  7  
ATOM 10159 H HH   . TYR A 1 26  ? -10.366 5.537   2.555   1.00 0.00 ? 29  TYR A HH   7  
ATOM 10160 N N    . ASP A 1 27  ? -5.977  5.894   10.473  1.00 0.00 ? 30  ASP A N    7  
ATOM 10161 C CA   . ASP A 1 27  ? -5.671  5.860   11.897  1.00 0.00 ? 30  ASP A CA   7  
ATOM 10162 C C    . ASP A 1 27  ? -4.231  6.301   12.126  1.00 0.00 ? 30  ASP A C    7  
ATOM 10163 O O    . ASP A 1 27  ? -3.308  5.774   11.508  1.00 0.00 ? 30  ASP A O    7  
ATOM 10164 C CB   . ASP A 1 27  ? -5.873  4.452   12.474  1.00 0.00 ? 30  ASP A CB   7  
ATOM 10165 C CG   . ASP A 1 27  ? -7.305  3.957   12.371  1.00 0.00 ? 30  ASP A CG   7  
ATOM 10166 O OD1  . ASP A 1 27  ? -8.233  4.743   12.652  1.00 0.00 ? 30  ASP A OD1  7  
ATOM 10167 O OD2  . ASP A 1 27  ? -7.514  2.773   12.022  1.00 0.00 ? 30  ASP A OD2  7  
ATOM 10168 H H    . ASP A 1 27  ? -5.706  5.135   9.915   1.00 0.00 ? 30  ASP A H    7  
ATOM 10169 H HA   . ASP A 1 27  ? -6.336  6.546   12.399  1.00 0.00 ? 30  ASP A HA   7  
ATOM 10170 H HB2  . ASP A 1 27  ? -5.235  3.764   11.947  1.00 0.00 ? 30  ASP A HB2  7  
ATOM 10171 H HB3  . ASP A 1 27  ? -5.592  4.461   13.516  1.00 0.00 ? 30  ASP A HB3  7  
ATOM 10172 N N    . PRO A 1 28  ? -4.029  7.286   13.010  1.00 0.00 ? 31  PRO A N    7  
ATOM 10173 C CA   . PRO A 1 28  ? -2.704  7.845   13.309  1.00 0.00 ? 31  PRO A CA   7  
ATOM 10174 C C    . PRO A 1 28  ? -1.707  6.818   13.849  1.00 0.00 ? 31  PRO A C    7  
ATOM 10175 O O    . PRO A 1 28  ? -0.498  7.031   13.773  1.00 0.00 ? 31  PRO A O    7  
ATOM 10176 C CB   . PRO A 1 28  ? -2.990  8.905   14.376  1.00 0.00 ? 31  PRO A CB   7  
ATOM 10177 C CG   . PRO A 1 28  ? -4.430  9.234   14.212  1.00 0.00 ? 31  PRO A CG   7  
ATOM 10178 C CD   . PRO A 1 28  ? -5.091  7.964   13.770  1.00 0.00 ? 31  PRO A CD   7  
ATOM 10179 H HA   . PRO A 1 28  ? -2.279  8.324   12.440  1.00 0.00 ? 31  PRO A HA   7  
ATOM 10180 H HB2  . PRO A 1 28  ? -2.788  8.495   15.354  1.00 0.00 ? 31  PRO A HB2  7  
ATOM 10181 H HB3  . PRO A 1 28  ? -2.366  9.770   14.207  1.00 0.00 ? 31  PRO A HB3  7  
ATOM 10182 H HG2  . PRO A 1 28  ? -4.843  9.564   15.153  1.00 0.00 ? 31  PRO A HG2  7  
ATOM 10183 H HG3  . PRO A 1 28  ? -4.549  10.000  13.459  1.00 0.00 ? 31  PRO A HG3  7  
ATOM 10184 H HD2  . PRO A 1 28  ? -5.390  7.374   14.624  1.00 0.00 ? 31  PRO A HD2  7  
ATOM 10185 H HD3  . PRO A 1 28  ? -5.939  8.179   13.141  1.00 0.00 ? 31  PRO A HD3  7  
ATOM 10186 N N    . ASP A 1 29  ? -2.202  5.716   14.408  1.00 0.00 ? 32  ASP A N    7  
ATOM 10187 C CA   . ASP A 1 29  ? -1.316  4.686   14.960  1.00 0.00 ? 32  ASP A CA   7  
ATOM 10188 C C    . ASP A 1 29  ? -0.941  3.647   13.905  1.00 0.00 ? 32  ASP A C    7  
ATOM 10189 O O    . ASP A 1 29  ? -0.182  2.716   14.182  1.00 0.00 ? 32  ASP A O    7  
ATOM 10190 C CB   . ASP A 1 29  ? -1.941  3.996   16.186  1.00 0.00 ? 32  ASP A CB   7  
ATOM 10191 C CG   . ASP A 1 29  ? -3.072  3.035   15.849  1.00 0.00 ? 32  ASP A CG   7  
ATOM 10192 O OD1  . ASP A 1 29  ? -4.241  3.477   15.797  1.00 0.00 ? 32  ASP A OD1  7  
ATOM 10193 O OD2  . ASP A 1 29  ? -2.801  1.826   15.671  1.00 0.00 ? 32  ASP A OD2  7  
ATOM 10194 H H    . ASP A 1 29  ? -3.177  5.600   14.464  1.00 0.00 ? 32  ASP A H    7  
ATOM 10195 H HA   . ASP A 1 29  ? -0.409  5.183   15.273  1.00 0.00 ? 32  ASP A HA   7  
ATOM 10196 H HB2  . ASP A 1 29  ? -1.172  3.439   16.702  1.00 0.00 ? 32  ASP A HB2  7  
ATOM 10197 H HB3  . ASP A 1 29  ? -2.329  4.754   16.851  1.00 0.00 ? 32  ASP A HB3  7  
ATOM 10198 N N    . PHE A 1 30  ? -1.451  3.819   12.694  1.00 0.00 ? 33  PHE A N    7  
ATOM 10199 C CA   . PHE A 1 30  ? -1.160  2.894   11.608  1.00 0.00 ? 33  PHE A CA   7  
ATOM 10200 C C    . PHE A 1 30  ? 0.284   3.066   11.135  1.00 0.00 ? 33  PHE A C    7  
ATOM 10201 O O    . PHE A 1 30  ? 0.738   4.185   10.894  1.00 0.00 ? 33  PHE A O    7  
ATOM 10202 C CB   . PHE A 1 30  ? -2.133  3.128   10.450  1.00 0.00 ? 33  PHE A CB   7  
ATOM 10203 C CG   . PHE A 1 30  ? -2.069  2.084   9.372   1.00 0.00 ? 33  PHE A CG   7  
ATOM 10204 C CD1  . PHE A 1 30  ? -2.628  0.832   9.573   1.00 0.00 ? 33  PHE A CD1  7  
ATOM 10205 C CD2  . PHE A 1 30  ? -1.465  2.359   8.154   1.00 0.00 ? 33  PHE A CD2  7  
ATOM 10206 C CE1  . PHE A 1 30  ? -2.582  -0.127  8.581   1.00 0.00 ? 33  PHE A CE1  7  
ATOM 10207 C CE2  . PHE A 1 30  ? -1.421  1.404   7.158   1.00 0.00 ? 33  PHE A CE2  7  
ATOM 10208 C CZ   . PHE A 1 30  ? -1.980  0.159   7.372   1.00 0.00 ? 33  PHE A CZ   7  
ATOM 10209 H H    . PHE A 1 30  ? -2.031  4.591   12.521  1.00 0.00 ? 33  PHE A H    7  
ATOM 10210 H HA   . PHE A 1 30  ? -1.288  1.889   11.983  1.00 0.00 ? 33  PHE A HA   7  
ATOM 10211 H HB2  . PHE A 1 30  ? -3.145  3.143   10.833  1.00 0.00 ? 33  PHE A HB2  7  
ATOM 10212 H HB3  . PHE A 1 30  ? -1.912  4.084   9.998   1.00 0.00 ? 33  PHE A HB3  7  
ATOM 10213 H HD1  . PHE A 1 30  ? -3.100  0.606   10.518  1.00 0.00 ? 33  PHE A HD1  7  
ATOM 10214 H HD2  . PHE A 1 30  ? -1.024  3.329   7.988   1.00 0.00 ? 33  PHE A HD2  7  
ATOM 10215 H HE1  . PHE A 1 30  ? -3.020  -1.100  8.752   1.00 0.00 ? 33  PHE A HE1  7  
ATOM 10216 H HE2  . PHE A 1 30  ? -0.951  1.630   6.213   1.00 0.00 ? 33  PHE A HE2  7  
ATOM 10217 H HZ   . PHE A 1 30  ? -1.951  -0.589  6.593   1.00 0.00 ? 33  PHE A HZ   7  
ATOM 10218 N N    . GLN A 1 31  ? 1.001   1.957   11.008  1.00 0.00 ? 34  GLN A N    7  
ATOM 10219 C CA   . GLN A 1 31  ? 2.401   1.994   10.604  1.00 0.00 ? 34  GLN A CA   7  
ATOM 10220 C C    . GLN A 1 31  ? 2.588   1.383   9.220   1.00 0.00 ? 34  GLN A C    7  
ATOM 10221 O O    . GLN A 1 31  ? 2.078   0.298   8.933   1.00 0.00 ? 34  GLN A O    7  
ATOM 10222 C CB   . GLN A 1 31  ? 3.270   1.256   11.629  1.00 0.00 ? 34  GLN A CB   7  
ATOM 10223 C CG   . GLN A 1 31  ? 3.423   2.002   12.945  1.00 0.00 ? 34  GLN A CG   7  
ATOM 10224 C CD   . GLN A 1 31  ? 4.238   1.241   13.975  1.00 0.00 ? 34  GLN A CD   7  
ATOM 10225 O OE1  . GLN A 1 31  ? 4.935   1.839   14.795  1.00 0.00 ? 34  GLN A OE1  7  
ATOM 10226 N NE2  . GLN A 1 31  ? 4.152   -0.080  13.951  1.00 0.00 ? 34  GLN A NE2  7  
ATOM 10227 H H    . GLN A 1 31  ? 0.575   1.091   11.178  1.00 0.00 ? 34  GLN A H    7  
ATOM 10228 H HA   . GLN A 1 31  ? 2.706   3.030   10.570  1.00 0.00 ? 34  GLN A HA   7  
ATOM 10229 H HB2  . GLN A 1 31  ? 2.826   0.294   11.835  1.00 0.00 ? 34  GLN A HB2  7  
ATOM 10230 H HB3  . GLN A 1 31  ? 4.252   1.104   11.209  1.00 0.00 ? 34  GLN A HB3  7  
ATOM 10231 H HG2  . GLN A 1 31  ? 3.910   2.946   12.753  1.00 0.00 ? 34  GLN A HG2  7  
ATOM 10232 H HG3  . GLN A 1 31  ? 2.439   2.185   13.351  1.00 0.00 ? 34  GLN A HG3  7  
ATOM 10233 H HE21 . GLN A 1 31  ? 3.572   -0.496  13.280  1.00 0.00 ? 34  GLN A HE21 7  
ATOM 10234 H HE22 . GLN A 1 31  ? 4.662   -0.588  14.616  1.00 0.00 ? 34  GLN A HE22 7  
ATOM 10235 N N    . ALA A 1 32  ? 3.323   2.086   8.366   1.00 0.00 ? 35  ALA A N    7  
ATOM 10236 C CA   . ALA A 1 32  ? 3.585   1.624   7.012   1.00 0.00 ? 35  ALA A CA   7  
ATOM 10237 C C    . ALA A 1 32  ? 4.958   2.095   6.548   1.00 0.00 ? 35  ALA A C    7  
ATOM 10238 O O    . ALA A 1 32  ? 5.549   2.991   7.153   1.00 0.00 ? 35  ALA A O    7  
ATOM 10239 C CB   . ALA A 1 32  ? 2.505   2.128   6.065   1.00 0.00 ? 35  ALA A CB   7  
ATOM 10240 H H    . ALA A 1 32  ? 3.709   2.941   8.655   1.00 0.00 ? 35  ALA A H    7  
ATOM 10241 H HA   . ALA A 1 32  ? 3.563   0.544   7.014   1.00 0.00 ? 35  ALA A HA   7  
ATOM 10242 H HB1  . ALA A 1 32  ? 2.728   1.803   5.058   1.00 0.00 ? 35  ALA A HB1  7  
ATOM 10243 H HB2  . ALA A 1 32  ? 1.549   1.732   6.367   1.00 0.00 ? 35  ALA A HB2  7  
ATOM 10244 H HB3  . ALA A 1 32  ? 2.475   3.207   6.097   1.00 0.00 ? 35  ALA A HB3  7  
ATOM 10245 N N    . ARG A 1 33  ? 5.464   1.482   5.486   1.00 0.00 ? 36  ARG A N    7  
ATOM 10246 C CA   . ARG A 1 33  ? 6.753   1.850   4.922   1.00 0.00 ? 36  ARG A CA   7  
ATOM 10247 C C    . ARG A 1 33  ? 6.712   1.720   3.406   1.00 0.00 ? 36  ARG A C    7  
ATOM 10248 O O    . ARG A 1 33  ? 5.826   1.066   2.850   1.00 0.00 ? 36  ARG A O    7  
ATOM 10249 C CB   . ARG A 1 33  ? 7.867   0.950   5.469   1.00 0.00 ? 36  ARG A CB   7  
ATOM 10250 C CG   . ARG A 1 33  ? 7.790   -0.477  4.947   1.00 0.00 ? 36  ARG A CG   7  
ATOM 10251 C CD   . ARG A 1 33  ? 9.031   -1.287  5.290   1.00 0.00 ? 36  ARG A CD   7  
ATOM 10252 N NE   . ARG A 1 33  ? 9.172   -1.512  6.727   1.00 0.00 ? 36  ARG A NE   7  
ATOM 10253 C CZ   . ARG A 1 33  ? 10.184  -2.182  7.270   1.00 0.00 ? 36  ARG A CZ   7  
ATOM 10254 N NH1  . ARG A 1 33  ? 11.140  -2.675  6.495   1.00 0.00 ? 36  ARG A NH1  7  
ATOM 10255 N NH2  . ARG A 1 33  ? 10.249  -2.361  8.579   1.00 0.00 ? 36  ARG A NH2  7  
ATOM 10256 H H    . ARG A 1 33  ? 4.952   0.757   5.060   1.00 0.00 ? 36  ARG A H    7  
ATOM 10257 H HA   . ARG A 1 33  ? 6.960   2.875   5.185   1.00 0.00 ? 36  ARG A HA   7  
ATOM 10258 H HB2  . ARG A 1 33  ? 8.824   1.367   5.187   1.00 0.00 ? 36  ARG A HB2  7  
ATOM 10259 H HB3  . ARG A 1 33  ? 7.799   0.921   6.549   1.00 0.00 ? 36  ARG A HB3  7  
ATOM 10260 H HG2  . ARG A 1 33  ? 6.931   -0.960  5.388   1.00 0.00 ? 36  ARG A HG2  7  
ATOM 10261 H HG3  . ARG A 1 33  ? 7.674   -0.445  3.873   1.00 0.00 ? 36  ARG A HG3  7  
ATOM 10262 H HD2  . ARG A 1 33  ? 8.965   -2.244  4.793   1.00 0.00 ? 36  ARG A HD2  7  
ATOM 10263 H HD3  . ARG A 1 33  ? 9.904   -0.756  4.931   1.00 0.00 ? 36  ARG A HD3  7  
ATOM 10264 H HE   . ARG A 1 33  ? 8.472   -1.151  7.310   1.00 0.00 ? 36  ARG A HE   7  
ATOM 10265 H HH12 . ARG A 1 33  ? 10.898  -3.229  5.689   1.00 0.00 ? 36  ARG A HH12 7  
ATOM 10266 H HH21 . ARG A 1 33  ? 9.533   -2.003  9.176   1.00 0.00 ? 36  ARG A HH21 7  
ATOM 10267 H HH22 . ARG A 1 33  ? 11.027  -2.867  8.981   1.00 0.00 ? 36  ARG A HH22 7  
ATOM 10268 N N    . LEU A 1 34  ? 7.670   2.347   2.749   1.00 0.00 ? 37  LEU A N    7  
ATOM 10269 C CA   . LEU A 1 34  ? 7.846   2.201   1.315   1.00 0.00 ? 37  LEU A CA   7  
ATOM 10270 C C    . LEU A 1 34  ? 9.221   1.608   1.050   1.00 0.00 ? 37  LEU A C    7  
ATOM 10271 O O    . LEU A 1 34  ? 10.202  2.006   1.681   1.00 0.00 ? 37  LEU A O    7  
ATOM 10272 C CB   . LEU A 1 34  ? 7.705   3.557   0.616   1.00 0.00 ? 37  LEU A CB   7  
ATOM 10273 C CG   . LEU A 1 34  ? 6.325   4.208   0.734   1.00 0.00 ? 37  LEU A CG   7  
ATOM 10274 C CD1  . LEU A 1 34  ? 6.360   5.628   0.197   1.00 0.00 ? 37  LEU A CD1  7  
ATOM 10275 C CD2  . LEU A 1 34  ? 5.287   3.392   -0.013  1.00 0.00 ? 37  LEU A CD2  7  
ATOM 10276 H H    . LEU A 1 34  ? 8.287   2.923   3.242   1.00 0.00 ? 37  LEU A H    7  
ATOM 10277 H HA   . LEU A 1 34  ? 7.091   1.524   0.945   1.00 0.00 ? 37  LEU A HA   7  
ATOM 10278 H HB2  . LEU A 1 34  ? 8.435   4.233   1.037   1.00 0.00 ? 37  LEU A HB2  7  
ATOM 10279 H HB3  . LEU A 1 34  ? 7.924   3.423   -0.434  1.00 0.00 ? 37  LEU A HB3  7  
ATOM 10280 H HG   . LEU A 1 34  ? 6.039   4.250   1.778   1.00 0.00 ? 37  LEU A HG   7  
ATOM 10281 H HD11 . LEU A 1 34  ? 6.689   5.615   -0.831  1.00 0.00 ? 37  LEU A HD11 7  
ATOM 10282 H HD12 . LEU A 1 34  ? 5.372   6.060   0.254   1.00 0.00 ? 37  LEU A HD12 7  
ATOM 10283 H HD13 . LEU A 1 34  ? 7.045   6.218   0.786   1.00 0.00 ? 37  LEU A HD13 7  
ATOM 10284 H HD21 . LEU A 1 34  ? 5.554   3.339   -1.058  1.00 0.00 ? 37  LEU A HD21 7  
ATOM 10285 H HD22 . LEU A 1 34  ? 5.250   2.396   0.400   1.00 0.00 ? 37  LEU A HD22 7  
ATOM 10286 H HD23 . LEU A 1 34  ? 4.318   3.859   0.090   1.00 0.00 ? 37  LEU A HD23 7  
ATOM 10287 N N    . THR A 1 35  ? 9.279   0.638   0.145   1.00 0.00 ? 38  THR A N    7  
ATOM 10288 C CA   . THR A 1 35  ? 10.533  -0.028  -0.194  1.00 0.00 ? 38  THR A CA   7  
ATOM 10289 C C    . THR A 1 35  ? 11.582  0.980   -0.651  1.00 0.00 ? 38  THR A C    7  
ATOM 10290 O O    . THR A 1 35  ? 11.249  1.975   -1.298  1.00 0.00 ? 38  THR A O    7  
ATOM 10291 C CB   . THR A 1 35  ? 10.331  -1.062  -1.312  1.00 0.00 ? 38  THR A CB   7  
ATOM 10292 O OG1  . THR A 1 35  ? 9.707   -0.428  -2.436  1.00 0.00 ? 38  THR A OG1  7  
ATOM 10293 C CG2  . THR A 1 35  ? 9.484   -2.230  -0.833  1.00 0.00 ? 38  THR A CG2  7  
ATOM 10294 H H    . THR A 1 35  ? 8.450   0.355   -0.300  1.00 0.00 ? 38  THR A H    7  
ATOM 10295 H HA   . THR A 1 35  ? 10.893  -0.539  0.687   1.00 0.00 ? 38  THR A HA   7  
ATOM 10296 H HB   . THR A 1 35  ? 11.299  -1.434  -1.612  1.00 0.00 ? 38  THR A HB   7  
ATOM 10297 H HG1  . THR A 1 35  ? 9.980   0.498   -2.464  1.00 0.00 ? 38  THR A HG1  7  
ATOM 10298 H HG21 . THR A 1 35  ? 8.518   -1.869  -0.512  1.00 0.00 ? 38  THR A HG21 7  
ATOM 10299 H HG22 . THR A 1 35  ? 9.978   -2.718  -0.005  1.00 0.00 ? 38  THR A HG22 7  
ATOM 10300 H HG23 . THR A 1 35  ? 9.354   -2.936  -1.641  1.00 0.00 ? 38  THR A HG23 7  
ATOM 10301 N N    . ARG A 1 36  ? 12.842  0.701   -0.334  1.00 0.00 ? 39  ARG A N    7  
ATOM 10302 C CA   . ARG A 1 36  ? 13.943  1.604   -0.660  1.00 0.00 ? 39  ARG A CA   7  
ATOM 10303 C C    . ARG A 1 36  ? 14.228  1.592   -2.161  1.00 0.00 ? 39  ARG A C    7  
ATOM 10304 O O    . ARG A 1 36  ? 15.174  0.949   -2.626  1.00 0.00 ? 39  ARG A O    7  
ATOM 10305 C CB   . ARG A 1 36  ? 15.204  1.208   0.115   1.00 0.00 ? 39  ARG A CB   7  
ATOM 10306 C CG   . ARG A 1 36  ? 15.023  1.208   1.626   1.00 0.00 ? 39  ARG A CG   7  
ATOM 10307 C CD   . ARG A 1 36  ? 16.244  0.644   2.331   1.00 0.00 ? 39  ARG A CD   7  
ATOM 10308 N NE   . ARG A 1 36  ? 16.000  0.421   3.757   1.00 0.00 ? 39  ARG A NE   7  
ATOM 10309 C CZ   . ARG A 1 36  ? 15.619  -0.748  4.267   1.00 0.00 ? 39  ARG A CZ   7  
ATOM 10310 N NH1  . ARG A 1 36  ? 15.433  -1.791  3.471   1.00 0.00 ? 39  ARG A NH1  7  
ATOM 10311 N NH2  . ARG A 1 36  ? 15.424  -0.882  5.569   1.00 0.00 ? 39  ARG A NH2  7  
ATOM 10312 H H    . ARG A 1 36  ? 13.038  -0.141  0.129   1.00 0.00 ? 39  ARG A H    7  
ATOM 10313 H HA   . ARG A 1 36  ? 13.649  2.602   -0.370  1.00 0.00 ? 39  ARG A HA   7  
ATOM 10314 H HB2  . ARG A 1 36  ? 15.506  0.217   -0.192  1.00 0.00 ? 39  ARG A HB2  7  
ATOM 10315 H HB3  . ARG A 1 36  ? 15.993  1.904   -0.130  1.00 0.00 ? 39  ARG A HB3  7  
ATOM 10316 H HG2  . ARG A 1 36  ? 14.865  2.223   1.960   1.00 0.00 ? 39  ARG A HG2  7  
ATOM 10317 H HG3  . ARG A 1 36  ? 14.162  0.607   1.881   1.00 0.00 ? 39  ARG A HG3  7  
ATOM 10318 H HD2  . ARG A 1 36  ? 16.511  -0.294  1.868   1.00 0.00 ? 39  ARG A HD2  7  
ATOM 10319 H HD3  . ARG A 1 36  ? 17.058  1.344   2.221   1.00 0.00 ? 39  ARG A HD3  7  
ATOM 10320 H HE   . ARG A 1 36  ? 16.133  1.185   4.366   1.00 0.00 ? 39  ARG A HE   7  
ATOM 10321 H HH12 . ARG A 1 36  ? 14.660  -1.798  2.819   1.00 0.00 ? 39  ARG A HH12 7  
ATOM 10322 H HH21 . ARG A 1 36  ? 15.567  -0.102  6.184   1.00 0.00 ? 39  ARG A HH21 7  
ATOM 10323 H HH22 . ARG A 1 36  ? 15.126  -1.770  5.945   1.00 0.00 ? 39  ARG A HH22 7  
ATOM 10324 N N    . SER A 1 37  ? 13.398  2.297   -2.911  1.00 0.00 ? 40  SER A N    7  
ATOM 10325 C CA   . SER A 1 37  ? 13.540  2.377   -4.356  1.00 0.00 ? 40  SER A CA   7  
ATOM 10326 C C    . SER A 1 37  ? 14.312  3.647   -4.731  1.00 0.00 ? 40  SER A C    7  
ATOM 10327 O O    . SER A 1 37  ? 15.135  4.129   -3.950  1.00 0.00 ? 40  SER A O    7  
ATOM 10328 C CB   . SER A 1 37  ? 12.147  2.354   -5.008  1.00 0.00 ? 40  SER A CB   7  
ATOM 10329 O OG   . SER A 1 37  ? 12.229  2.236   -6.421  1.00 0.00 ? 40  SER A OG   7  
ATOM 10330 H H    . SER A 1 37  ? 12.658  2.778   -2.474  1.00 0.00 ? 40  SER A H    7  
ATOM 10331 H HA   . SER A 1 37  ? 14.101  1.514   -4.685  1.00 0.00 ? 40  SER A HA   7  
ATOM 10332 H HB2  . SER A 1 37  ? 11.591  1.510   -4.626  1.00 0.00 ? 40  SER A HB2  7  
ATOM 10333 H HB3  . SER A 1 37  ? 11.622  3.267   -4.764  1.00 0.00 ? 40  SER A HB3  7  
ATOM 10334 H HG   . SER A 1 37  ? 12.699  1.417   -6.649  1.00 0.00 ? 40  SER A HG   7  
ATOM 10335 N N    . ASN A 1 38  ? 14.062  4.168   -5.929  1.00 0.00 ? 41  ASN A N    7  
ATOM 10336 C CA   . ASN A 1 38  ? 14.757  5.357   -6.419  1.00 0.00 ? 41  ASN A CA   7  
ATOM 10337 C C    . ASN A 1 38  ? 14.591  6.533   -5.459  1.00 0.00 ? 41  ASN A C    7  
ATOM 10338 O O    . ASN A 1 38  ? 15.574  7.071   -4.947  1.00 0.00 ? 41  ASN A O    7  
ATOM 10339 C CB   . ASN A 1 38  ? 14.248  5.738   -7.813  1.00 0.00 ? 41  ASN A CB   7  
ATOM 10340 C CG   . ASN A 1 38  ? 14.976  6.942   -8.386  1.00 0.00 ? 41  ASN A CG   7  
ATOM 10341 O OD1  . ASN A 1 38  ? 16.043  6.808   -8.980  1.00 0.00 ? 41  ASN A OD1  7  
ATOM 10342 N ND2  . ASN A 1 38  ? 14.397  8.121   -8.234  1.00 0.00 ? 41  ASN A ND2  7  
ATOM 10343 H H    . ASN A 1 38  ? 13.391  3.735   -6.503  1.00 0.00 ? 41  ASN A H    7  
ATOM 10344 H HA   . ASN A 1 38  ? 15.806  5.116   -6.487  1.00 0.00 ? 41  ASN A HA   7  
ATOM 10345 H HB2  . ASN A 1 38  ? 14.391  4.903   -8.481  1.00 0.00 ? 41  ASN A HB2  7  
ATOM 10346 H HB3  . ASN A 1 38  ? 13.196  5.970   -7.753  1.00 0.00 ? 41  ASN A HB3  7  
ATOM 10347 H HD21 . ASN A 1 38  ? 13.534  8.162   -7.769  1.00 0.00 ? 41  ASN A HD21 7  
ATOM 10348 H HD22 . ASN A 1 38  ? 14.861  8.916   -8.588  1.00 0.00 ? 41  ASN A HD22 7  
ATOM 10349 N N    . SER A 1 39  ? 13.353  6.923   -5.212  1.00 0.00 ? 42  SER A N    7  
ATOM 10350 C CA   . SER A 1 39  ? 13.069  7.984   -4.266  1.00 0.00 ? 42  SER A CA   7  
ATOM 10351 C C    . SER A 1 39  ? 12.899  7.397   -2.874  1.00 0.00 ? 42  SER A C    7  
ATOM 10352 O O    . SER A 1 39  ? 12.348  6.306   -2.712  1.00 0.00 ? 42  SER A O    7  
ATOM 10353 C CB   . SER A 1 39  ? 11.813  8.732   -4.696  1.00 0.00 ? 42  SER A CB   7  
ATOM 10354 O OG   . SER A 1 39  ? 11.923  9.160   -6.044  1.00 0.00 ? 42  SER A OG   7  
ATOM 10355 H H    . SER A 1 39  ? 12.609  6.484   -5.670  1.00 0.00 ? 42  SER A H    7  
ATOM 10356 H HA   . SER A 1 39  ? 13.908  8.667   -4.264  1.00 0.00 ? 42  SER A HA   7  
ATOM 10357 H HB2  . SER A 1 39  ? 10.956  8.080   -4.605  1.00 0.00 ? 42  SER A HB2  7  
ATOM 10358 H HB3  . SER A 1 39  ? 11.676  9.598   -4.067  1.00 0.00 ? 42  SER A HB3  7  
ATOM 10359 H HG   . SER A 1 39  ? 12.663  9.788   -6.119  1.00 0.00 ? 42  SER A HG   7  
ATOM 10360 N N    . LYS A 1 40  ? 13.377  8.128   -1.873  1.00 0.00 ? 43  LYS A N    7  
ATOM 10361 C CA   . LYS A 1 40  ? 13.437  7.621   -0.506  1.00 0.00 ? 43  LYS A CA   7  
ATOM 10362 C C    . LYS A 1 40  ? 12.042  7.495   0.100   1.00 0.00 ? 43  LYS A C    7  
ATOM 10363 O O    . LYS A 1 40  ? 11.860  6.839   1.122   1.00 0.00 ? 43  LYS A O    7  
ATOM 10364 C CB   . LYS A 1 40  ? 14.318  8.525   0.366   1.00 0.00 ? 43  LYS A CB   7  
ATOM 10365 C CG   . LYS A 1 40  ? 13.674  9.855   0.734   1.00 0.00 ? 43  LYS A CG   7  
ATOM 10366 C CD   . LYS A 1 40  ? 14.654  10.779  1.438   1.00 0.00 ? 43  LYS A CD   7  
ATOM 10367 C CE   . LYS A 1 40  ? 15.601  11.439  0.450   1.00 0.00 ? 43  LYS A CE   7  
ATOM 10368 N NZ   . LYS A 1 40  ? 14.900  12.412  -0.436  1.00 0.00 ? 43  LYS A NZ   7  
ATOM 10369 H H    . LYS A 1 40  ? 13.692  9.036   -2.059  1.00 0.00 ? 43  LYS A H    7  
ATOM 10370 H HA   . LYS A 1 40  ? 13.881  6.638   -0.545  1.00 0.00 ? 43  LYS A HA   7  
ATOM 10371 H HB2  . LYS A 1 40  ? 14.552  8.001   1.281   1.00 0.00 ? 43  LYS A HB2  7  
ATOM 10372 H HB3  . LYS A 1 40  ? 15.238  8.728   -0.163  1.00 0.00 ? 43  LYS A HB3  7  
ATOM 10373 H HG2  . LYS A 1 40  ? 13.325  10.340  -0.164  1.00 0.00 ? 43  LYS A HG2  7  
ATOM 10374 H HG3  . LYS A 1 40  ? 12.837  9.668   1.391   1.00 0.00 ? 43  LYS A HG3  7  
ATOM 10375 H HD2  . LYS A 1 40  ? 14.100  11.545  1.959   1.00 0.00 ? 43  LYS A HD2  7  
ATOM 10376 H HD3  . LYS A 1 40  ? 15.232  10.203  2.148   1.00 0.00 ? 43  LYS A HD3  7  
ATOM 10377 H HE2  . LYS A 1 40  ? 16.369  11.958  1.004   1.00 0.00 ? 43  LYS A HE2  7  
ATOM 10378 H HE3  . LYS A 1 40  ? 16.055  10.672  -0.159  1.00 0.00 ? 43  LYS A HE3  7  
ATOM 10379 H HZ1  . LYS A 1 40  ? 14.433  13.144  0.151   1.00 0.00 ? 43  LYS A HZ1  7  
ATOM 10380 H HZ3  . LYS A 1 40  ? 14.159  11.928  -0.985  1.00 0.00 ? 43  LYS A HZ3  7  
ATOM 10381 N N    . CYS A 1 41  ? 11.068  8.139   -0.526  1.00 0.00 ? 44  CYS A N    7  
ATOM 10382 C CA   . CYS A 1 41  ? 9.688   8.023   -0.098  1.00 0.00 ? 44  CYS A CA   7  
ATOM 10383 C C    . CYS A 1 41  ? 8.823   7.603   -1.280  1.00 0.00 ? 44  CYS A C    7  
ATOM 10384 O O    . CYS A 1 41  ? 7.742   8.149   -1.520  1.00 0.00 ? 44  CYS A O    7  
ATOM 10385 C CB   . CYS A 1 41  ? 9.203   9.348   0.484   1.00 0.00 ? 44  CYS A CB   7  
ATOM 10386 S SG   . CYS A 1 41  ? 7.838   9.189   1.677   1.00 0.00 ? 44  CYS A SG   7  
ATOM 10387 H H    . CYS A 1 41  ? 11.285  8.721   -1.286  1.00 0.00 ? 44  CYS A H    7  
ATOM 10388 H HA   . CYS A 1 41  ? 9.637   7.260   0.665   1.00 0.00 ? 44  CYS A HA   7  
ATOM 10389 H HB2  . CYS A 1 41  ? 10.024  9.832   0.991   1.00 0.00 ? 44  CYS A HB2  7  
ATOM 10390 H HB3  . CYS A 1 41  ? 8.861   9.981   -0.323  1.00 0.00 ? 44  CYS A HB3  7  
ATOM 10391 N N    . GLN A 1 42  ? 9.330   6.640   -2.035  1.00 0.00 ? 45  GLN A N    7  
ATOM 10392 C CA   . GLN A 1 42  ? 8.626   6.104   -3.187  1.00 0.00 ? 45  GLN A CA   7  
ATOM 10393 C C    . GLN A 1 42  ? 8.969   4.635   -3.359  1.00 0.00 ? 45  GLN A C    7  
ATOM 10394 O O    . GLN A 1 42  ? 10.140  4.255   -3.338  1.00 0.00 ? 45  GLN A O    7  
ATOM 10395 C CB   . GLN A 1 42  ? 8.995   6.905   -4.447  1.00 0.00 ? 45  GLN A CB   7  
ATOM 10396 C CG   . GLN A 1 42  ? 8.507   6.307   -5.764  1.00 0.00 ? 45  GLN A CG   7  
ATOM 10397 C CD   . GLN A 1 42  ? 9.607   5.591   -6.530  1.00 0.00 ? 45  GLN A CD   7  
ATOM 10398 O OE1  . GLN A 1 42  ? 10.335  6.203   -7.311  1.00 0.00 ? 45  GLN A OE1  7  
ATOM 10399 N NE2  . GLN A 1 42  ? 9.725   4.290   -6.327  1.00 0.00 ? 45  GLN A NE2  7  
ATOM 10400 H H    . GLN A 1 42  ? 10.216  6.275   -1.809  1.00 0.00 ? 45  GLN A H    7  
ATOM 10401 H HA   . GLN A 1 42  ? 7.565   6.199   -3.003  1.00 0.00 ? 45  GLN A HA   7  
ATOM 10402 H HB2  . GLN A 1 42  ? 8.578   7.894   -4.356  1.00 0.00 ? 45  GLN A HB2  7  
ATOM 10403 H HB3  . GLN A 1 42  ? 10.068  6.987   -4.495  1.00 0.00 ? 45  GLN A HB3  7  
ATOM 10404 H HG2  . GLN A 1 42  ? 7.720   5.598   -5.554  1.00 0.00 ? 45  GLN A HG2  7  
ATOM 10405 H HG3  . GLN A 1 42  ? 8.117   7.102   -6.384  1.00 0.00 ? 45  GLN A HG3  7  
ATOM 10406 H HE21 . GLN A 1 42  ? 9.108   3.861   -5.703  1.00 0.00 ? 45  GLN A HE21 7  
ATOM 10407 H HE22 . GLN A 1 42  ? 10.431  3.808   -6.809  1.00 0.00 ? 45  GLN A HE22 7  
ATOM 10408 N N    . GLY A 1 43  ? 7.953   3.807   -3.523  1.00 0.00 ? 46  GLY A N    7  
ATOM 10409 C CA   . GLY A 1 43  ? 8.189   2.395   -3.714  1.00 0.00 ? 46  GLY A CA   7  
ATOM 10410 C C    . GLY A 1 43  ? 6.960   1.562   -3.442  1.00 0.00 ? 46  GLY A C    7  
ATOM 10411 O O    . GLY A 1 43  ? 5.835   2.062   -3.515  1.00 0.00 ? 46  GLY A O    7  
ATOM 10412 H H    . GLY A 1 43  ? 7.032   4.155   -3.500  1.00 0.00 ? 46  GLY A H    7  
ATOM 10413 H HA2  . GLY A 1 43  ? 8.506   2.229   -4.735  1.00 0.00 ? 46  GLY A HA2  7  
ATOM 10414 H HA3  . GLY A 1 43  ? 8.981   2.082   -3.044  1.00 0.00 ? 46  GLY A HA3  7  
ATOM 10415 N N    . GLN A 1 44  ? 7.175   0.292   -3.132  1.00 0.00 ? 47  GLN A N    7  
ATOM 10416 C CA   . GLN A 1 44  ? 6.090   -0.622  -2.825  1.00 0.00 ? 47  GLN A CA   7  
ATOM 10417 C C    . GLN A 1 44  ? 5.533   -0.306  -1.445  1.00 0.00 ? 47  GLN A C    7  
ATOM 10418 O O    . GLN A 1 44  ? 6.289   0.028   -0.531  1.00 0.00 ? 47  GLN A O    7  
ATOM 10419 C CB   . GLN A 1 44  ? 6.598   -2.061  -2.854  1.00 0.00 ? 47  GLN A CB   7  
ATOM 10420 C CG   . GLN A 1 44  ? 7.345   -2.429  -4.128  1.00 0.00 ? 47  GLN A CG   7  
ATOM 10421 C CD   . GLN A 1 44  ? 8.012   -3.789  -4.037  1.00 0.00 ? 47  GLN A CD   7  
ATOM 10422 O OE1  . GLN A 1 44  ? 9.052   -4.028  -4.645  1.00 0.00 ? 47  GLN A OE1  7  
ATOM 10423 N NE2  . GLN A 1 44  ? 7.418   -4.693  -3.278  1.00 0.00 ? 47  GLN A NE2  7  
ATOM 10424 H H    . GLN A 1 44  ? 8.101   -0.042  -3.092  1.00 0.00 ? 47  GLN A H    7  
ATOM 10425 H HA   . GLN A 1 44  ? 5.315   -0.496  -3.565  1.00 0.00 ? 47  GLN A HA   7  
ATOM 10426 H HB2  . GLN A 1 44  ? 7.268   -2.206  -2.016  1.00 0.00 ? 47  GLN A HB2  7  
ATOM 10427 H HB3  . GLN A 1 44  ? 5.758   -2.731  -2.749  1.00 0.00 ? 47  GLN A HB3  7  
ATOM 10428 H HG2  . GLN A 1 44  ? 6.647   -2.445  -4.950  1.00 0.00 ? 47  GLN A HG2  7  
ATOM 10429 H HG3  . GLN A 1 44  ? 8.104   -1.683  -4.315  1.00 0.00 ? 47  GLN A HG3  7  
ATOM 10430 H HE21 . GLN A 1 44  ? 6.586   -4.442  -2.825  1.00 0.00 ? 47  GLN A HE21 7  
ATOM 10431 H HE22 . GLN A 1 44  ? 7.843   -5.572  -3.186  1.00 0.00 ? 47  GLN A HE22 7  
ATOM 10432 N N    . LEU A 1 45  ? 4.222   -0.407  -1.296  1.00 0.00 ? 48  LEU A N    7  
ATOM 10433 C CA   . LEU A 1 45  ? 3.581   -0.125  -0.025  1.00 0.00 ? 48  LEU A CA   7  
ATOM 10434 C C    . LEU A 1 45  ? 3.587   -1.363  0.863   1.00 0.00 ? 48  LEU A C    7  
ATOM 10435 O O    . LEU A 1 45  ? 2.890   -2.344  0.589   1.00 0.00 ? 48  LEU A O    7  
ATOM 10436 C CB   . LEU A 1 45  ? 2.144   0.364   -0.247  1.00 0.00 ? 48  LEU A CB   7  
ATOM 10437 C CG   . LEU A 1 45  ? 1.383   0.754   1.024   1.00 0.00 ? 48  LEU A CG   7  
ATOM 10438 C CD1  . LEU A 1 45  ? 2.060   1.921   1.726   1.00 0.00 ? 48  LEU A CD1  7  
ATOM 10439 C CD2  . LEU A 1 45  ? -0.059  1.099   0.692   1.00 0.00 ? 48  LEU A CD2  7  
ATOM 10440 H H    . LEU A 1 45  ? 3.669   -0.679  -2.063  1.00 0.00 ? 48  LEU A H    7  
ATOM 10441 H HA   . LEU A 1 45  ? 4.144   0.653   0.464   1.00 0.00 ? 48  LEU A HA   7  
ATOM 10442 H HB2  . LEU A 1 45  ? 2.179   1.226   -0.899  1.00 0.00 ? 48  LEU A HB2  7  
ATOM 10443 H HB3  . LEU A 1 45  ? 1.591   -0.421  -0.742  1.00 0.00 ? 48  LEU A HB3  7  
ATOM 10444 H HG   . LEU A 1 45  ? 1.377   -0.085  1.705   1.00 0.00 ? 48  LEU A HG   7  
ATOM 10445 H HD11 . LEU A 1 45  ? 1.476   2.212   2.587   1.00 0.00 ? 48  LEU A HD11 7  
ATOM 10446 H HD12 . LEU A 1 45  ? 3.048   1.627   2.045   1.00 0.00 ? 48  LEU A HD12 7  
ATOM 10447 H HD13 . LEU A 1 45  ? 2.135   2.758   1.046   1.00 0.00 ? 48  LEU A HD13 7  
ATOM 10448 H HD21 . LEU A 1 45  ? -0.532  0.248   0.227   1.00 0.00 ? 48  LEU A HD21 7  
ATOM 10449 H HD22 . LEU A 1 45  ? -0.586  1.353   1.600   1.00 0.00 ? 48  LEU A HD22 7  
ATOM 10450 H HD23 . LEU A 1 45  ? -0.079  1.939   0.016   1.00 0.00 ? 48  LEU A HD23 7  
ATOM 10451 N N    . GLU A 1 46  ? 4.396   -1.318  1.909   1.00 0.00 ? 49  GLU A N    7  
ATOM 10452 C CA   . GLU A 1 46  ? 4.433   -2.384  2.896   1.00 0.00 ? 49  GLU A CA   7  
ATOM 10453 C C    . GLU A 1 46  ? 3.848   -1.876  4.203   1.00 0.00 ? 49  GLU A C    7  
ATOM 10454 O O    . GLU A 1 46  ? 4.333   -0.899  4.772   1.00 0.00 ? 49  GLU A O    7  
ATOM 10455 C CB   . GLU A 1 46  ? 5.867   -2.876  3.112   1.00 0.00 ? 49  GLU A CB   7  
ATOM 10456 C CG   . GLU A 1 46  ? 6.526   -3.429  1.857   1.00 0.00 ? 49  GLU A CG   7  
ATOM 10457 C CD   . GLU A 1 46  ? 8.001   -3.721  2.054   1.00 0.00 ? 49  GLU A CD   7  
ATOM 10458 O OE1  . GLU A 1 46  ? 8.753   -2.796  2.421   1.00 0.00 ? 49  GLU A OE1  7  
ATOM 10459 O OE2  . GLU A 1 46  ? 8.415   -4.883  1.846   1.00 0.00 ? 49  GLU A OE2  7  
ATOM 10460 H H    . GLU A 1 46  ? 4.984   -0.539  2.026   1.00 0.00 ? 49  GLU A H    7  
ATOM 10461 H HA   . GLU A 1 46  ? 3.824   -3.198  2.532   1.00 0.00 ? 49  GLU A HA   7  
ATOM 10462 H HB2  . GLU A 1 46  ? 6.463   -2.052  3.470   1.00 0.00 ? 49  GLU A HB2  7  
ATOM 10463 H HB3  . GLU A 1 46  ? 5.858   -3.654  3.862   1.00 0.00 ? 49  GLU A HB3  7  
ATOM 10464 H HG2  . GLU A 1 46  ? 6.031   -4.347  1.579   1.00 0.00 ? 49  GLU A HG2  7  
ATOM 10465 H HG3  . GLU A 1 46  ? 6.419   -2.707  1.062   1.00 0.00 ? 49  GLU A HG3  7  
ATOM 10466 N N    . VAL A 1 47  ? 2.800   -2.528  4.673   1.00 0.00 ? 50  VAL A N    7  
ATOM 10467 C CA   . VAL A 1 47  ? 2.093   -2.069  5.858   1.00 0.00 ? 50  VAL A CA   7  
ATOM 10468 C C    . VAL A 1 47  ? 2.276   -3.040  7.013   1.00 0.00 ? 50  VAL A C    7  
ATOM 10469 O O    . VAL A 1 47  ? 2.554   -4.225  6.808   1.00 0.00 ? 50  VAL A O    7  
ATOM 10470 C CB   . VAL A 1 47  ? 0.581   -1.881  5.588   1.00 0.00 ? 50  VAL A CB   7  
ATOM 10471 C CG1  . VAL A 1 47  ? 0.357   -0.901  4.444   1.00 0.00 ? 50  VAL A CG1  7  
ATOM 10472 C CG2  . VAL A 1 47  ? -0.092  -3.215  5.292   1.00 0.00 ? 50  VAL A CG2  7  
ATOM 10473 H H    . VAL A 1 47  ? 2.506   -3.350  4.221   1.00 0.00 ? 50  VAL A H    7  
ATOM 10474 H HA   . VAL A 1 47  ? 2.507   -1.115  6.140   1.00 0.00 ? 50  VAL A HA   7  
ATOM 10475 H HB   . VAL A 1 47  ? 0.130   -1.467  6.479   1.00 0.00 ? 50  VAL A HB   7  
ATOM 10476 H HG11 . VAL A 1 47  ? -0.702  -0.806  4.253   1.00 0.00 ? 50  VAL A HG11 7  
ATOM 10477 H HG12 . VAL A 1 47  ? 0.763   0.064   4.710   1.00 0.00 ? 50  VAL A HG12 7  
ATOM 10478 H HG13 . VAL A 1 47  ? 0.850   -1.269  3.556   1.00 0.00 ? 50  VAL A HG13 7  
ATOM 10479 H HG21 . VAL A 1 47  ? 0.324   -3.637  4.391   1.00 0.00 ? 50  VAL A HG21 7  
ATOM 10480 H HG22 . VAL A 1 47  ? 0.073   -3.894  6.118   1.00 0.00 ? 50  VAL A HG22 7  
ATOM 10481 H HG23 . VAL A 1 47  ? -1.152  -3.061  5.161   1.00 0.00 ? 50  VAL A HG23 7  
ATOM 10482 N N    . TYR A 1 48  ? 2.143   -2.530  8.228   1.00 0.00 ? 51  TYR A N    7  
ATOM 10483 C CA   . TYR A 1 48  ? 2.221   -3.364  9.413   1.00 0.00 ? 51  TYR A CA   7  
ATOM 10484 C C    . TYR A 1 48  ? 0.857   -3.980  9.691   1.00 0.00 ? 51  TYR A C    7  
ATOM 10485 O O    . TYR A 1 48  ? -0.019  -3.344  10.276  1.00 0.00 ? 51  TYR A O    7  
ATOM 10486 C CB   . TYR A 1 48  ? 2.704   -2.555  10.625  1.00 0.00 ? 51  TYR A CB   7  
ATOM 10487 C CG   . TYR A 1 48  ? 2.874   -3.390  11.883  1.00 0.00 ? 51  TYR A CG   7  
ATOM 10488 C CD1  . TYR A 1 48  ? 4.031   -4.129  12.102  1.00 0.00 ? 51  TYR A CD1  7  
ATOM 10489 C CD2  . TYR A 1 48  ? 1.869   -3.447  12.847  1.00 0.00 ? 51  TYR A CD2  7  
ATOM 10490 C CE1  . TYR A 1 48  ? 4.182   -4.897  13.242  1.00 0.00 ? 51  TYR A CE1  7  
ATOM 10491 C CE2  . TYR A 1 48  ? 2.015   -4.215  13.985  1.00 0.00 ? 51  TYR A CE2  7  
ATOM 10492 C CZ   . TYR A 1 48  ? 3.172   -4.938  14.178  1.00 0.00 ? 51  TYR A CZ   7  
ATOM 10493 O OH   . TYR A 1 48  ? 3.318   -5.703  15.310  1.00 0.00 ? 51  TYR A OH   7  
ATOM 10494 H H    . TYR A 1 48  ? 1.977   -1.566  8.330   1.00 0.00 ? 51  TYR A H    7  
ATOM 10495 H HA   . TYR A 1 48  ? 2.926   -4.157  9.212   1.00 0.00 ? 51  TYR A HA   7  
ATOM 10496 H HB2  . TYR A 1 48  ? 3.659   -2.101  10.393  1.00 0.00 ? 51  TYR A HB2  7  
ATOM 10497 H HB3  . TYR A 1 48  ? 1.986   -1.776  10.837  1.00 0.00 ? 51  TYR A HB3  7  
ATOM 10498 H HD1  . TYR A 1 48  ? 4.824   -4.096  11.369  1.00 0.00 ? 51  TYR A HD1  7  
ATOM 10499 H HD2  . TYR A 1 48  ? 0.962   -2.879  12.696  1.00 0.00 ? 51  TYR A HD2  7  
ATOM 10500 H HE1  . TYR A 1 48  ? 5.089   -5.462  13.396  1.00 0.00 ? 51  TYR A HE1  7  
ATOM 10501 H HE2  . TYR A 1 48  ? 1.224   -4.247  14.720  1.00 0.00 ? 51  TYR A HE2  7  
ATOM 10502 H HH   . TYR A 1 48  ? 2.615   -6.363  15.341  1.00 0.00 ? 51  TYR A HH   7  
ATOM 10503 N N    . LEU A 1 49  ? 0.681   -5.214  9.250   1.00 0.00 ? 52  LEU A N    7  
ATOM 10504 C CA   . LEU A 1 49  ? -0.579  -5.909  9.429   1.00 0.00 ? 52  LEU A CA   7  
ATOM 10505 C C    . LEU A 1 49  ? -0.465  -6.867  10.612  1.00 0.00 ? 52  LEU A C    7  
ATOM 10506 O O    . LEU A 1 49  ? 0.533   -6.839  11.335  1.00 0.00 ? 52  LEU A O    7  
ATOM 10507 C CB   . LEU A 1 49  ? -0.948  -6.667  8.146   1.00 0.00 ? 52  LEU A CB   7  
ATOM 10508 C CG   . LEU A 1 49  ? -2.417  -7.078  8.016   1.00 0.00 ? 52  LEU A CG   7  
ATOM 10509 C CD1  . LEU A 1 49  ? -3.301  -5.854  7.837   1.00 0.00 ? 52  LEU A CD1  7  
ATOM 10510 C CD2  . LEU A 1 49  ? -2.599  -8.043  6.853   1.00 0.00 ? 52  LEU A CD2  7  
ATOM 10511 H H    . LEU A 1 49  ? 1.424   -5.673  8.800   1.00 0.00 ? 52  LEU A H    7  
ATOM 10512 H HA   . LEU A 1 49  ? -1.342  -5.175  9.642   1.00 0.00 ? 52  LEU A HA   7  
ATOM 10513 H HB2  . LEU A 1 49  ? -0.702  -6.038  7.305   1.00 0.00 ? 52  LEU A HB2  7  
ATOM 10514 H HB3  . LEU A 1 49  ? -0.342  -7.558  8.095   1.00 0.00 ? 52  LEU A HB3  7  
ATOM 10515 H HG   . LEU A 1 49  ? -2.724  -7.581  8.920   1.00 0.00 ? 52  LEU A HG   7  
ATOM 10516 H HD11 . LEU A 1 49  ? -3.264  -5.245  8.729   1.00 0.00 ? 52  LEU A HD11 7  
ATOM 10517 H HD12 . LEU A 1 49  ? -2.950  -5.278  6.993   1.00 0.00 ? 52  LEU A HD12 7  
ATOM 10518 H HD13 . LEU A 1 49  ? -4.320  -6.167  7.658   1.00 0.00 ? 52  LEU A HD13 7  
ATOM 10519 H HD21 . LEU A 1 49  ? -3.644  -8.293  6.752   1.00 0.00 ? 52  LEU A HD21 7  
ATOM 10520 H HD22 . LEU A 1 49  ? -2.250  -7.579  5.943   1.00 0.00 ? 52  LEU A HD22 7  
ATOM 10521 H HD23 . LEU A 1 49  ? -2.030  -8.943  7.039   1.00 0.00 ? 52  LEU A HD23 7  
ATOM 10522 N N    . LYS A 1 50  ? -1.472  -7.708  10.806  1.00 0.00 ? 53  LYS A N    7  
ATOM 10523 C CA   . LYS A 1 50  ? -1.482  -8.664  11.908  1.00 0.00 ? 53  LYS A CA   7  
ATOM 10524 C C    . LYS A 1 50  ? -0.225  -9.537  11.888  1.00 0.00 ? 53  LYS A C    7  
ATOM 10525 O O    . LYS A 1 50  ? 0.423   -9.734  12.918  1.00 0.00 ? 53  LYS A O    7  
ATOM 10526 C CB   . LYS A 1 50  ? -2.758  -9.521  11.846  1.00 0.00 ? 53  LYS A CB   7  
ATOM 10527 C CG   . LYS A 1 50  ? -2.795  -10.677 12.835  1.00 0.00 ? 53  LYS A CG   7  
ATOM 10528 C CD   . LYS A 1 50  ? -2.305  -11.970 12.199  1.00 0.00 ? 53  LYS A CD   7  
ATOM 10529 C CE   . LYS A 1 50  ? -2.178  -13.092 13.214  1.00 0.00 ? 53  LYS A CE   7  
ATOM 10530 N NZ   . LYS A 1 50  ? -1.717  -14.355 12.578  1.00 0.00 ? 53  LYS A NZ   7  
ATOM 10531 H H    . LYS A 1 50  ? -2.233  -7.686  10.191  1.00 0.00 ? 53  LYS A H    7  
ATOM 10532 H HA   . LYS A 1 50  ? -1.490  -8.099  12.828  1.00 0.00 ? 53  LYS A HA   7  
ATOM 10533 H HB2  . LYS A 1 50  ? -3.610  -8.886  12.044  1.00 0.00 ? 53  LYS A HB2  7  
ATOM 10534 H HB3  . LYS A 1 50  ? -2.853  -9.927  10.850  1.00 0.00 ? 53  LYS A HB3  7  
ATOM 10535 H HG2  . LYS A 1 50  ? -2.161  -10.439 13.676  1.00 0.00 ? 53  LYS A HG2  7  
ATOM 10536 H HG3  . LYS A 1 50  ? -3.810  -10.814 13.174  1.00 0.00 ? 53  LYS A HG3  7  
ATOM 10537 H HD2  . LYS A 1 50  ? -3.005  -12.272 11.436  1.00 0.00 ? 53  LYS A HD2  7  
ATOM 10538 H HD3  . LYS A 1 50  ? -1.337  -11.793 11.750  1.00 0.00 ? 53  LYS A HD3  7  
ATOM 10539 H HE2  . LYS A 1 50  ? -1.466  -12.798 13.971  1.00 0.00 ? 53  LYS A HE2  7  
ATOM 10540 H HE3  . LYS A 1 50  ? -3.143  -13.260 13.673  1.00 0.00 ? 53  LYS A HE3  7  
ATOM 10541 H HZ1  . LYS A 1 50  ? -1.485  -15.053 13.317  1.00 0.00 ? 53  LYS A HZ1  7  
ATOM 10542 H HZ3  . LYS A 1 50  ? -0.852  -14.169 12.021  1.00 0.00 ? 53  LYS A HZ3  7  
ATOM 10543 N N    . ASP A 1 51  ? 0.129   -10.038 10.712  1.00 0.00 ? 54  ASP A N    7  
ATOM 10544 C CA   . ASP A 1 51  ? 1.315   -10.883 10.571  1.00 0.00 ? 54  ASP A CA   7  
ATOM 10545 C C    . ASP A 1 51  ? 2.560   -10.059 10.268  1.00 0.00 ? 54  ASP A C    7  
ATOM 10546 O O    . ASP A 1 51  ? 3.516   -10.561 9.681   1.00 0.00 ? 54  ASP A O    7  
ATOM 10547 C CB   . ASP A 1 51  ? 1.117   -11.936 9.477   1.00 0.00 ? 54  ASP A CB   7  
ATOM 10548 C CG   . ASP A 1 51  ? 0.151   -13.028 9.881   1.00 0.00 ? 54  ASP A CG   7  
ATOM 10549 O OD1  . ASP A 1 51  ? 0.534   -13.884 10.710  1.00 0.00 ? 54  ASP A OD1  7  
ATOM 10550 O OD2  . ASP A 1 51  ? -0.986  -13.042 9.368   1.00 0.00 ? 54  ASP A OD2  7  
ATOM 10551 H H    . ASP A 1 51  ? -0.425  -9.847  9.924   1.00 0.00 ? 54  ASP A H    7  
ATOM 10552 H HA   . ASP A 1 51  ? 1.462   -11.390 11.512  1.00 0.00 ? 54  ASP A HA   7  
ATOM 10553 H HB2  . ASP A 1 51  ? 0.736   -11.455 8.590   1.00 0.00 ? 54  ASP A HB2  7  
ATOM 10554 H HB3  . ASP A 1 51  ? 2.071   -12.391 9.252   1.00 0.00 ? 54  ASP A HB3  7  
ATOM 10555 N N    . GLY A 1 52  ? 2.545   -8.793  10.656  1.00 0.00 ? 55  GLY A N    7  
ATOM 10556 C CA   . GLY A 1 52  ? 3.710   -7.954  10.477  1.00 0.00 ? 55  GLY A CA   7  
ATOM 10557 C C    . GLY A 1 52  ? 3.727   -7.263  9.128   1.00 0.00 ? 55  GLY A C    7  
ATOM 10558 O O    . GLY A 1 52  ? 2.700   -7.198  8.444   1.00 0.00 ? 55  GLY A O    7  
ATOM 10559 H H    . GLY A 1 52  ? 1.731   -8.421  11.064  1.00 0.00 ? 55  GLY A H    7  
ATOM 10560 H HA2  . GLY A 1 52  ? 3.725   -7.203  11.254  1.00 0.00 ? 55  GLY A HA2  7  
ATOM 10561 H HA3  . GLY A 1 52  ? 4.595   -8.565  10.567  1.00 0.00 ? 55  GLY A HA3  7  
ATOM 10562 N N    . TRP A 1 53  ? 4.897   -6.764  8.744   1.00 0.00 ? 56  TRP A N    7  
ATOM 10563 C CA   . TRP A 1 53  ? 5.056   -6.011  7.502   1.00 0.00 ? 56  TRP A CA   7  
ATOM 10564 C C    . TRP A 1 53  ? 4.718   -6.866  6.291   1.00 0.00 ? 56  TRP A C    7  
ATOM 10565 O O    . TRP A 1 53  ? 5.304   -7.930  6.084   1.00 0.00 ? 56  TRP A O    7  
ATOM 10566 C CB   . TRP A 1 53  ? 6.485   -5.474  7.390   1.00 0.00 ? 56  TRP A CB   7  
ATOM 10567 C CG   . TRP A 1 53  ? 6.838   -4.524  8.492   1.00 0.00 ? 56  TRP A CG   7  
ATOM 10568 C CD1  . TRP A 1 53  ? 7.577   -4.800  9.606   1.00 0.00 ? 56  TRP A CD1  7  
ATOM 10569 C CD2  . TRP A 1 53  ? 6.448   -3.149  8.597   1.00 0.00 ? 56  TRP A CD2  7  
ATOM 10570 N NE1  . TRP A 1 53  ? 7.673   -3.681  10.396  1.00 0.00 ? 56  TRP A NE1  7  
ATOM 10571 C CE2  . TRP A 1 53  ? 6.989   -2.653  9.798   1.00 0.00 ? 56  TRP A CE2  7  
ATOM 10572 C CE3  . TRP A 1 53  ? 5.697   -2.289  7.790   1.00 0.00 ? 56  TRP A CE3  7  
ATOM 10573 C CZ2  . TRP A 1 53  ? 6.798   -1.334  10.211  1.00 0.00 ? 56  TRP A CZ2  7  
ATOM 10574 C CZ3  . TRP A 1 53  ? 5.513   -0.985  8.201   1.00 0.00 ? 56  TRP A CZ3  7  
ATOM 10575 C CH2  . TRP A 1 53  ? 6.060   -0.518  9.400   1.00 0.00 ? 56  TRP A CH2  7  
ATOM 10576 H H    . TRP A 1 53  ? 5.682   -6.912  9.311   1.00 0.00 ? 56  TRP A H    7  
ATOM 10577 H HA   . TRP A 1 53  ? 4.373   -5.178  7.535   1.00 0.00 ? 56  TRP A HA   7  
ATOM 10578 H HB2  . TRP A 1 53  ? 7.178   -6.302  7.427   1.00 0.00 ? 56  TRP A HB2  7  
ATOM 10579 H HB3  . TRP A 1 53  ? 6.599   -4.956  6.449   1.00 0.00 ? 56  TRP A HB3  7  
ATOM 10580 H HD1  . TRP A 1 53  ? 8.018   -5.763  9.821   1.00 0.00 ? 56  TRP A HD1  7  
ATOM 10581 H HE1  . TRP A 1 53  ? 8.158   -3.632  11.254  1.00 0.00 ? 56  TRP A HE1  7  
ATOM 10582 H HE3  . TRP A 1 53  ? 5.266   -2.626  6.859   1.00 0.00 ? 56  TRP A HE3  7  
ATOM 10583 H HZ2  . TRP A 1 53  ? 7.214   -0.957  11.132  1.00 0.00 ? 56  TRP A HZ2  7  
ATOM 10584 H HZ3  . TRP A 1 53  ? 4.934   -0.305  7.591   1.00 0.00 ? 56  TRP A HZ3  7  
ATOM 10585 H HH2  . TRP A 1 53  ? 5.887   0.511   9.681   1.00 0.00 ? 56  TRP A HH2  7  
ATOM 10586 N N    . HIS A 1 54  ? 3.763   -6.397  5.501   1.00 0.00 ? 57  HIS A N    7  
ATOM 10587 C CA   . HIS A 1 54  ? 3.330   -7.107  4.308   1.00 0.00 ? 57  HIS A CA   7  
ATOM 10588 C C    . HIS A 1 54  ? 3.066   -6.138  3.166   1.00 0.00 ? 57  HIS A C    7  
ATOM 10589 O O    . HIS A 1 54  ? 2.666   -4.995  3.385   1.00 0.00 ? 57  HIS A O    7  
ATOM 10590 C CB   . HIS A 1 54  ? 2.076   -7.935  4.595   1.00 0.00 ? 57  HIS A CB   7  
ATOM 10591 C CG   . HIS A 1 54  ? 2.369   -9.296  5.144   1.00 0.00 ? 57  HIS A CG   7  
ATOM 10592 N ND1  . HIS A 1 54  ? 2.567   -9.543  6.486   1.00 0.00 ? 57  HIS A ND1  7  
ATOM 10593 C CD2  . HIS A 1 54  ? 2.503   -10.489 4.519   1.00 0.00 ? 57  HIS A CD2  7  
ATOM 10594 C CE1  . HIS A 1 54  ? 2.811   -10.828 6.661   1.00 0.00 ? 57  HIS A CE1  7  
ATOM 10595 N NE2  . HIS A 1 54  ? 2.776   -11.424 5.484   1.00 0.00 ? 57  HIS A NE2  7  
ATOM 10596 H H    . HIS A 1 54  ? 3.334   -5.538  5.729   1.00 0.00 ? 57  HIS A H    7  
ATOM 10597 H HA   . HIS A 1 54  ? 4.127   -7.774  4.016   1.00 0.00 ? 57  HIS A HA   7  
ATOM 10598 H HB2  . HIS A 1 54  ? 1.463   -7.413  5.315   1.00 0.00 ? 57  HIS A HB2  7  
ATOM 10599 H HB3  . HIS A 1 54  ? 1.522   -8.059  3.677   1.00 0.00 ? 57  HIS A HB3  7  
ATOM 10600 H HD1  . HIS A 1 54  ? 2.540   -8.873  7.204   1.00 0.00 ? 57  HIS A HD1  7  
ATOM 10601 H HD2  . HIS A 1 54  ? 2.405   -10.671 3.458   1.00 0.00 ? 57  HIS A HD2  7  
ATOM 10602 H HE1  . HIS A 1 54  ? 3.006   -11.310 7.606   1.00 0.00 ? 57  HIS A HE1  7  
ATOM 10603 N N    . MET A 1 55  ? 3.293   -6.616  1.955   1.00 0.00 ? 58  MET A N    7  
ATOM 10604 C CA   . MET A 1 55  ? 3.166   -5.807  0.752   1.00 0.00 ? 58  MET A CA   7  
ATOM 10605 C C    . MET A 1 55  ? 1.715   -5.754  0.287   1.00 0.00 ? 58  MET A C    7  
ATOM 10606 O O    . MET A 1 55  ? 1.050   -6.782  0.215   1.00 0.00 ? 58  MET A O    7  
ATOM 10607 C CB   . MET A 1 55  ? 4.030   -6.416  -0.352  1.00 0.00 ? 58  MET A CB   7  
ATOM 10608 C CG   . MET A 1 55  ? 5.495   -6.563  0.026   1.00 0.00 ? 58  MET A CG   7  
ATOM 10609 S SD   . MET A 1 55  ? 6.334   -7.812  -0.968  1.00 0.00 ? 58  MET A SD   7  
ATOM 10610 C CE   . MET A 1 55  ? 5.822   -7.322  -2.610  1.00 0.00 ? 58  MET A CE   7  
ATOM 10611 H H    . MET A 1 55  ? 3.552   -7.560  1.862   1.00 0.00 ? 58  MET A H    7  
ATOM 10612 H HA   . MET A 1 55  ? 3.513   -4.810  0.970   1.00 0.00 ? 58  MET A HA   7  
ATOM 10613 H HB2  . MET A 1 55  ? 3.642   -7.393  -0.596  1.00 0.00 ? 58  MET A HB2  7  
ATOM 10614 H HB3  . MET A 1 55  ? 3.968   -5.789  -1.231  1.00 0.00 ? 58  MET A HB3  7  
ATOM 10615 H HG2  . MET A 1 55  ? 5.990   -5.615  -0.118  1.00 0.00 ? 58  MET A HG2  7  
ATOM 10616 H HG3  . MET A 1 55  ? 5.558   -6.848  1.066   1.00 0.00 ? 58  MET A HG3  7  
ATOM 10617 H HE1  . MET A 1 55  ? 4.745   -7.366  -2.681  1.00 0.00 ? 58  MET A HE1  7  
ATOM 10618 H HE2  . MET A 1 55  ? 6.155   -6.312  -2.805  1.00 0.00 ? 58  MET A HE2  7  
ATOM 10619 H HE3  . MET A 1 55  ? 6.257   -7.991  -3.338  1.00 0.00 ? 58  MET A HE3  7  
ATOM 10620 N N    . VAL A 1 56  ? 1.230   -4.568  -0.039  1.00 0.00 ? 59  VAL A N    7  
ATOM 10621 C CA   . VAL A 1 56  ? -0.136  -4.421  -0.528  1.00 0.00 ? 59  VAL A CA   7  
ATOM 10622 C C    . VAL A 1 56  ? -0.198  -4.701  -2.027  1.00 0.00 ? 59  VAL A C    7  
ATOM 10623 O O    . VAL A 1 56  ? 0.597   -4.165  -2.803  1.00 0.00 ? 59  VAL A O    7  
ATOM 10624 C CB   . VAL A 1 56  ? -0.701  -3.012  -0.234  1.00 0.00 ? 59  VAL A CB   7  
ATOM 10625 C CG1  . VAL A 1 56  ? -2.133  -2.884  -0.739  1.00 0.00 ? 59  VAL A CG1  7  
ATOM 10626 C CG2  . VAL A 1 56  ? -0.641  -2.709  1.255   1.00 0.00 ? 59  VAL A CG2  7  
ATOM 10627 H H    . VAL A 1 56  ? 1.803   -3.769  0.044   1.00 0.00 ? 59  VAL A H    7  
ATOM 10628 H HA   . VAL A 1 56  ? -0.749  -5.146  -0.013  1.00 0.00 ? 59  VAL A HA   7  
ATOM 10629 H HB   . VAL A 1 56  ? -0.093  -2.287  -0.754  1.00 0.00 ? 59  VAL A HB   7  
ATOM 10630 H HG11 . VAL A 1 56  ? -2.155  -3.058  -1.804  1.00 0.00 ? 59  VAL A HG11 7  
ATOM 10631 H HG12 . VAL A 1 56  ? -2.755  -3.613  -0.242  1.00 0.00 ? 59  VAL A HG12 7  
ATOM 10632 H HG13 . VAL A 1 56  ? -2.502  -1.891  -0.528  1.00 0.00 ? 59  VAL A HG13 7  
ATOM 10633 H HG21 . VAL A 1 56  ? 0.386   -2.723  1.586   1.00 0.00 ? 59  VAL A HG21 7  
ATOM 10634 H HG22 . VAL A 1 56  ? -1.066  -1.734  1.441   1.00 0.00 ? 59  VAL A HG22 7  
ATOM 10635 H HG23 . VAL A 1 56  ? -1.205  -3.455  1.797   1.00 0.00 ? 59  VAL A HG23 7  
ATOM 10636 N N    . CYS A 1 57  ? -1.129  -5.557  -2.429  1.00 0.00 ? 60  CYS A N    7  
ATOM 10637 C CA   . CYS A 1 57  ? -1.295  -5.900  -3.832  1.00 0.00 ? 60  CYS A CA   7  
ATOM 10638 C C    . CYS A 1 57  ? -2.390  -5.029  -4.448  1.00 0.00 ? 60  CYS A C    7  
ATOM 10639 O O    . CYS A 1 57  ? -3.265  -4.527  -3.740  1.00 0.00 ? 60  CYS A O    7  
ATOM 10640 C CB   . CYS A 1 57  ? -1.643  -7.385  -3.975  1.00 0.00 ? 60  CYS A CB   7  
ATOM 10641 S SG   . CYS A 1 57  ? -1.358  -8.063  -5.643  1.00 0.00 ? 60  CYS A SG   7  
ATOM 10642 H H    . CYS A 1 57  ? -1.727  -5.964  -1.763  1.00 0.00 ? 60  CYS A H    7  
ATOM 10643 H HA   . CYS A 1 57  ? -0.363  -5.701  -4.340  1.00 0.00 ? 60  CYS A HA   7  
ATOM 10644 H HB2  . CYS A 1 57  ? -1.041  -7.957  -3.284  1.00 0.00 ? 60  CYS A HB2  7  
ATOM 10645 H HB3  . CYS A 1 57  ? -2.689  -7.527  -3.738  1.00 0.00 ? 60  CYS A HB3  7  
ATOM 10646 N N    . SER A 1 58  ? -2.341  -4.857  -5.764  1.00 0.00 ? 61  SER A N    7  
ATOM 10647 C CA   . SER A 1 58  ? -3.240  -3.939  -6.460  1.00 0.00 ? 61  SER A CA   7  
ATOM 10648 C C    . SER A 1 58  ? -4.618  -4.552  -6.734  1.00 0.00 ? 61  SER A C    7  
ATOM 10649 O O    . SER A 1 58  ? -5.424  -3.975  -7.462  1.00 0.00 ? 61  SER A O    7  
ATOM 10650 C CB   . SER A 1 58  ? -2.591  -3.483  -7.768  1.00 0.00 ? 61  SER A CB   7  
ATOM 10651 O OG   . SER A 1 58  ? -1.968  -4.571  -8.429  1.00 0.00 ? 61  SER A OG   7  
ATOM 10652 H H    . SER A 1 58  ? -1.678  -5.359  -6.286  1.00 0.00 ? 61  SER A H    7  
ATOM 10653 H HA   . SER A 1 58  ? -3.373  -3.075  -5.825  1.00 0.00 ? 61  SER A HA   7  
ATOM 10654 H HB2  . SER A 1 58  ? -3.350  -3.069  -8.418  1.00 0.00 ? 61  SER A HB2  7  
ATOM 10655 H HB3  . SER A 1 58  ? -1.844  -2.730  -7.557  1.00 0.00 ? 61  SER A HB3  7  
ATOM 10656 H HG   . SER A 1 58  ? -1.107  -4.737  -8.022  1.00 0.00 ? 61  SER A HG   7  
ATOM 10657 N N    . GLN A 1 59  ? -4.890  -5.711  -6.151  1.00 0.00 ? 62  GLN A N    7  
ATOM 10658 C CA   . GLN A 1 59  ? -6.208  -6.327  -6.258  1.00 0.00 ? 62  GLN A CA   7  
ATOM 10659 C C    . GLN A 1 59  ? -6.906  -6.232  -4.901  1.00 0.00 ? 62  GLN A C    7  
ATOM 10660 O O    . GLN A 1 59  ? -7.511  -7.187  -4.412  1.00 0.00 ? 62  GLN A O    7  
ATOM 10661 C CB   . GLN A 1 59  ? -6.085  -7.787  -6.730  1.00 0.00 ? 62  GLN A CB   7  
ATOM 10662 C CG   . GLN A 1 59  ? -7.420  -8.470  -7.016  1.00 0.00 ? 62  GLN A CG   7  
ATOM 10663 C CD   . GLN A 1 59  ? -8.210  -7.806  -8.131  1.00 0.00 ? 62  GLN A CD   7  
ATOM 10664 O OE1  . GLN A 1 59  ? -9.442  -7.808  -8.116  1.00 0.00 ? 62  GLN A OE1  7  
ATOM 10665 N NE2  . GLN A 1 59  ? -7.517  -7.252  -9.114  1.00 0.00 ? 62  GLN A NE2  7  
ATOM 10666 H H    . GLN A 1 59  ? -4.195  -6.158  -5.626  1.00 0.00 ? 62  GLN A H    7  
ATOM 10667 H HA   . GLN A 1 59  ? -6.780  -5.764  -6.983  1.00 0.00 ? 62  GLN A HA   7  
ATOM 10668 H HB2  . GLN A 1 59  ? -5.497  -7.811  -7.637  1.00 0.00 ? 62  GLN A HB2  7  
ATOM 10669 H HB3  . GLN A 1 59  ? -5.573  -8.357  -5.968  1.00 0.00 ? 62  GLN A HB3  7  
ATOM 10670 H HG2  . GLN A 1 59  ? -7.230  -9.493  -7.297  1.00 0.00 ? 62  GLN A HG2  7  
ATOM 10671 H HG3  . GLN A 1 59  ? -8.017  -8.453  -6.115  1.00 0.00 ? 62  GLN A HG3  7  
ATOM 10672 H HE21 . GLN A 1 59  ? -6.539  -7.294  -9.076  1.00 0.00 ? 62  GLN A HE21 7  
ATOM 10673 H HE22 . GLN A 1 59  ? -8.014  -6.827  -9.843  1.00 0.00 ? 62  GLN A HE22 7  
ATOM 10674 N N    . SER A 1 60  ? -6.806  -5.064  -4.291  1.00 0.00 ? 63  SER A N    7  
ATOM 10675 C CA   . SER A 1 60  ? -7.348  -4.856  -2.965  1.00 0.00 ? 63  SER A CA   7  
ATOM 10676 C C    . SER A 1 60  ? -8.517  -3.874  -3.012  1.00 0.00 ? 63  SER A C    7  
ATOM 10677 O O    . SER A 1 60  ? -8.544  -2.971  -3.853  1.00 0.00 ? 63  SER A O    7  
ATOM 10678 C CB   . SER A 1 60  ? -6.247  -4.333  -2.034  1.00 0.00 ? 63  SER A CB   7  
ATOM 10679 O OG   . SER A 1 60  ? -6.636  -4.416  -0.675  1.00 0.00 ? 63  SER A OG   7  
ATOM 10680 H H    . SER A 1 60  ? -6.361  -4.319  -4.750  1.00 0.00 ? 63  SER A H    7  
ATOM 10681 H HA   . SER A 1 60  ? -7.701  -5.811  -2.598  1.00 0.00 ? 63  SER A HA   7  
ATOM 10682 H HB2  . SER A 1 60  ? -5.349  -4.920  -2.174  1.00 0.00 ? 63  SER A HB2  7  
ATOM 10683 H HB3  . SER A 1 60  ? -6.041  -3.298  -2.270  1.00 0.00 ? 63  SER A HB3  7  
ATOM 10684 H HG   . SER A 1 60  ? -7.235  -3.689  -0.470  1.00 0.00 ? 63  SER A HG   7  
ATOM 10685 N N    . TRP A 1 61  ? -9.484  -4.078  -2.116  1.00 0.00 ? 64  TRP A N    7  
ATOM 10686 C CA   . TRP A 1 61  ? -10.655 -3.200  -1.977  1.00 0.00 ? 64  TRP A CA   7  
ATOM 10687 C C    . TRP A 1 61  ? -11.463 -3.110  -3.269  1.00 0.00 ? 64  TRP A C    7  
ATOM 10688 O O    . TRP A 1 61  ? -12.222 -2.156  -3.463  1.00 0.00 ? 64  TRP A O    7  
ATOM 10689 C CB   . TRP A 1 61  ? -10.232 -1.791  -1.545  1.00 0.00 ? 64  TRP A CB   7  
ATOM 10690 C CG   . TRP A 1 61  ? -9.407  -1.770  -0.296  1.00 0.00 ? 64  TRP A CG   7  
ATOM 10691 C CD1  . TRP A 1 61  ? -9.802  -2.136  0.958   1.00 0.00 ? 64  TRP A CD1  7  
ATOM 10692 C CD2  . TRP A 1 61  ? -8.042  -1.352  -0.184  1.00 0.00 ? 64  TRP A CD2  7  
ATOM 10693 N NE1  . TRP A 1 61  ? -8.763  -1.978  1.841   1.00 0.00 ? 64  TRP A NE1  7  
ATOM 10694 C CE2  . TRP A 1 61  ? -7.674  -1.498  1.165   1.00 0.00 ? 64  TRP A CE2  7  
ATOM 10695 C CE3  . TRP A 1 61  ? -7.095  -0.875  -1.095  1.00 0.00 ? 64  TRP A CE3  7  
ATOM 10696 C CZ2  . TRP A 1 61  ? -6.401  -1.182  1.624   1.00 0.00 ? 64  TRP A CZ2  7  
ATOM 10697 C CZ3  . TRP A 1 61  ? -5.832  -0.559  -0.636  1.00 0.00 ? 64  TRP A CZ3  7  
ATOM 10698 C CH2  . TRP A 1 61  ? -5.495  -0.715  0.712   1.00 0.00 ? 64  TRP A CH2  7  
ATOM 10699 H H    . TRP A 1 61  ? -9.405  -4.855  -1.515  1.00 0.00 ? 64  TRP A H    7  
ATOM 10700 H HA   . TRP A 1 61  ? -11.285 -3.622  -1.210  1.00 0.00 ? 64  TRP A HA   7  
ATOM 10701 H HB2  . TRP A 1 61  ? -9.646  -1.344  -2.336  1.00 0.00 ? 64  TRP A HB2  7  
ATOM 10702 H HB3  . TRP A 1 61  ? -11.117 -1.192  -1.375  1.00 0.00 ? 64  TRP A HB3  7  
ATOM 10703 H HD1  . TRP A 1 61  ? -10.788 -2.497  1.205   1.00 0.00 ? 64  TRP A HD1  7  
ATOM 10704 H HE1  . TRP A 1 61  ? -8.795  -2.178  2.809   1.00 0.00 ? 64  TRP A HE1  7  
ATOM 10705 H HE3  . TRP A 1 61  ? -7.340  -0.746  -2.139  1.00 0.00 ? 64  TRP A HE3  7  
ATOM 10706 H HZ2  . TRP A 1 61  ? -6.122  -1.296  2.661   1.00 0.00 ? 64  TRP A HZ2  7  
ATOM 10707 H HZ3  . TRP A 1 61  ? -5.086  -0.186  -1.322  1.00 0.00 ? 64  TRP A HZ3  7  
ATOM 10708 H HH2  . TRP A 1 61  ? -4.496  -0.456  1.028   1.00 0.00 ? 64  TRP A HH2  7  
ATOM 10709 N N    . GLY A 1 62  ? -11.310 -4.101  -4.140  1.00 0.00 ? 65  GLY A N    7  
ATOM 10710 C CA   . GLY A 1 62  ? -11.993 -4.074  -5.421  1.00 0.00 ? 65  GLY A CA   7  
ATOM 10711 C C    . GLY A 1 62  ? -11.600 -2.868  -6.255  1.00 0.00 ? 65  GLY A C    7  
ATOM 10712 O O    . GLY A 1 62  ? -12.395 -2.367  -7.049  1.00 0.00 ? 65  GLY A O    7  
ATOM 10713 H H    . GLY A 1 62  ? -10.736 -4.862  -3.906  1.00 0.00 ? 65  GLY A H    7  
ATOM 10714 H HA2  . GLY A 1 62  ? -11.751 -4.973  -5.969  1.00 0.00 ? 65  GLY A HA2  7  
ATOM 10715 H HA3  . GLY A 1 62  ? -13.058 -4.046  -5.248  1.00 0.00 ? 65  GLY A HA3  7  
ATOM 10716 N N    . ARG A 1 63  ? -10.378 -2.388  -6.063  1.00 0.00 ? 66  ARG A N    7  
ATOM 10717 C CA   . ARG A 1 63  ? -9.881  -1.237  -6.802  1.00 0.00 ? 66  ARG A CA   7  
ATOM 10718 C C    . ARG A 1 63  ? -8.697  -1.648  -7.667  1.00 0.00 ? 66  ARG A C    7  
ATOM 10719 O O    . ARG A 1 63  ? -7.541  -1.459  -7.286  1.00 0.00 ? 66  ARG A O    7  
ATOM 10720 C CB   . ARG A 1 63  ? -9.464  -0.119  -5.839  1.00 0.00 ? 66  ARG A CB   7  
ATOM 10721 C CG   . ARG A 1 63  ? -10.580 0.364   -4.922  1.00 0.00 ? 66  ARG A CG   7  
ATOM 10722 C CD   . ARG A 1 63  ? -11.638 1.161   -5.677  1.00 0.00 ? 66  ARG A CD   7  
ATOM 10723 N NE   . ARG A 1 63  ? -12.674 1.676   -4.779  1.00 0.00 ? 66  ARG A NE   7  
ATOM 10724 C CZ   . ARG A 1 63  ? -12.971 2.968   -4.649  1.00 0.00 ? 66  ARG A CZ   7  
ATOM 10725 N NH1  . ARG A 1 63  ? -12.315 3.877   -5.355  1.00 0.00 ? 66  ARG A NH1  7  
ATOM 10726 N NH2  . ARG A 1 63  ? -13.927 3.353   -3.819  1.00 0.00 ? 66  ARG A NH2  7  
ATOM 10727 H H    . ARG A 1 63  ? -9.792  -2.819  -5.401  1.00 0.00 ? 66  ARG A H    7  
ATOM 10728 H HA   . ARG A 1 63  ? -10.675 -0.881  -7.439  1.00 0.00 ? 66  ARG A HA   7  
ATOM 10729 H HB2  . ARG A 1 63  ? -8.653  -0.479  -5.223  1.00 0.00 ? 66  ARG A HB2  7  
ATOM 10730 H HB3  . ARG A 1 63  ? -9.115  0.723   -6.419  1.00 0.00 ? 66  ARG A HB3  7  
ATOM 10731 H HG2  . ARG A 1 63  ? -11.051 -0.496  -4.469  1.00 0.00 ? 66  ARG A HG2  7  
ATOM 10732 H HG3  . ARG A 1 63  ? -10.152 0.988   -4.150  1.00 0.00 ? 66  ARG A HG3  7  
ATOM 10733 H HD2  . ARG A 1 63  ? -11.160 1.992   -6.177  1.00 0.00 ? 66  ARG A HD2  7  
ATOM 10734 H HD3  . ARG A 1 63  ? -12.100 0.519   -6.411  1.00 0.00 ? 66  ARG A HD3  7  
ATOM 10735 H HE   . ARG A 1 63  ? -13.179 1.018   -4.252  1.00 0.00 ? 66  ARG A HE   7  
ATOM 10736 H HH12 . ARG A 1 63  ? -11.566 4.403   -4.937  1.00 0.00 ? 66  ARG A HH12 7  
ATOM 10737 H HH21 . ARG A 1 63  ? -14.443 2.669   -3.287  1.00 0.00 ? 66  ARG A HH21 7  
ATOM 10738 H HH22 . ARG A 1 63  ? -14.144 4.333   -3.708  1.00 0.00 ? 66  ARG A HH22 7  
ATOM 10739 N N    . SER A 1 64  ? -8.990  -2.208  -8.826  1.00 0.00 ? 67  SER A N    7  
ATOM 10740 C CA   . SER A 1 64  ? -7.955  -2.718  -9.712  1.00 0.00 ? 67  SER A CA   7  
ATOM 10741 C C    . SER A 1 64  ? -7.631  -1.729  -10.831 1.00 0.00 ? 67  SER A C    7  
ATOM 10742 O O    . SER A 1 64  ? -7.498  -2.110  -11.997 1.00 0.00 ? 67  SER A O    7  
ATOM 10743 C CB   . SER A 1 64  ? -8.394  -4.065  -10.288 1.00 0.00 ? 67  SER A CB   7  
ATOM 10744 O OG   . SER A 1 64  ? -9.750  -4.022  -10.711 1.00 0.00 ? 67  SER A OG   7  
ATOM 10745 H H    . SER A 1 64  ? -9.930  -2.284  -9.099  1.00 0.00 ? 67  SER A H    7  
ATOM 10746 H HA   . SER A 1 64  ? -7.067  -2.869  -9.121  1.00 0.00 ? 67  SER A HA   7  
ATOM 10747 H HB2  . SER A 1 64  ? -7.774  -4.309  -11.136 1.00 0.00 ? 67  SER A HB2  7  
ATOM 10748 H HB3  . SER A 1 64  ? -8.289  -4.829  -9.532  1.00 0.00 ? 67  SER A HB3  7  
ATOM 10749 H HG   . SER A 1 64  ? -10.301 -4.496  -10.064 1.00 0.00 ? 67  SER A HG   7  
ATOM 10750 N N    . SER A 1 65  ? -7.501  -0.462  -10.477 1.00 0.00 ? 68  SER A N    7  
ATOM 10751 C CA   . SER A 1 65  ? -7.155  0.564   -11.442 1.00 0.00 ? 68  SER A CA   7  
ATOM 10752 C C    . SER A 1 65  ? -5.681  0.939   -11.284 1.00 0.00 ? 68  SER A C    7  
ATOM 10753 O O    . SER A 1 65  ? -5.079  0.696   -10.234 1.00 0.00 ? 68  SER A O    7  
ATOM 10754 C CB   . SER A 1 65  ? -8.048  1.790   -11.255 1.00 0.00 ? 68  SER A CB   7  
ATOM 10755 O OG   . SER A 1 65  ? -7.918  2.685   -12.343 1.00 0.00 ? 68  SER A OG   7  
ATOM 10756 H H    . SER A 1 65  ? -7.631  -0.209  -9.538  1.00 0.00 ? 68  SER A H    7  
ATOM 10757 H HA   . SER A 1 65  ? -7.311  0.157   -12.431 1.00 0.00 ? 68  SER A HA   7  
ATOM 10758 H HB2  . SER A 1 65  ? -9.079  1.475   -11.187 1.00 0.00 ? 68  SER A HB2  7  
ATOM 10759 H HB3  . SER A 1 65  ? -7.768  2.302   -10.346 1.00 0.00 ? 68  SER A HB3  7  
ATOM 10760 H HG   . SER A 1 65  ? -7.678  2.187   -13.142 1.00 0.00 ? 68  SER A HG   7  
ATOM 10761 N N    . LYS A 1 66  ? -5.104  1.523   -12.326 1.00 0.00 ? 69  LYS A N    7  
ATOM 10762 C CA   . LYS A 1 66  ? -3.671  1.779   -12.357 1.00 0.00 ? 69  LYS A CA   7  
ATOM 10763 C C    . LYS A 1 66  ? -3.332  3.185   -11.872 1.00 0.00 ? 69  LYS A C    7  
ATOM 10764 O O    . LYS A 1 66  ? -2.173  3.475   -11.570 1.00 0.00 ? 69  LYS A O    7  
ATOM 10765 C CB   . LYS A 1 66  ? -3.125  1.562   -13.771 1.00 0.00 ? 69  LYS A CB   7  
ATOM 10766 C CG   . LYS A 1 66  ? -3.361  0.156   -14.304 1.00 0.00 ? 69  LYS A CG   7  
ATOM 10767 C CD   . LYS A 1 66  ? -2.726  -0.042  -15.670 1.00 0.00 ? 69  LYS A CD   7  
ATOM 10768 C CE   . LYS A 1 66  ? -3.053  -1.415  -16.238 1.00 0.00 ? 69  LYS A CE   7  
ATOM 10769 N NZ   . LYS A 1 66  ? -2.636  -2.519  -15.328 1.00 0.00 ? 69  LYS A NZ   7  
ATOM 10770 H H    . LYS A 1 66  ? -5.659  1.793   -13.094 1.00 0.00 ? 69  LYS A H    7  
ATOM 10771 H HA   . LYS A 1 66  ? -3.202  1.070   -11.694 1.00 0.00 ? 69  LYS A HA   7  
ATOM 10772 H HB2  . LYS A 1 66  ? -3.602  2.262   -14.442 1.00 0.00 ? 69  LYS A HB2  7  
ATOM 10773 H HB3  . LYS A 1 66  ? -2.061  1.750   -13.767 1.00 0.00 ? 69  LYS A HB3  7  
ATOM 10774 H HG2  . LYS A 1 66  ? -2.934  -0.559  -13.616 1.00 0.00 ? 69  LYS A HG2  7  
ATOM 10775 H HG3  . LYS A 1 66  ? -4.425  -0.014  -14.385 1.00 0.00 ? 69  LYS A HG3  7  
ATOM 10776 H HD2  . LYS A 1 66  ? -3.102  0.715   -16.342 1.00 0.00 ? 69  LYS A HD2  7  
ATOM 10777 H HD3  . LYS A 1 66  ? -1.655  0.057   -15.576 1.00 0.00 ? 69  LYS A HD3  7  
ATOM 10778 H HE2  . LYS A 1 66  ? -4.119  -1.478  -16.397 1.00 0.00 ? 69  LYS A HE2  7  
ATOM 10779 H HE3  . LYS A 1 66  ? -2.544  -1.527  -17.185 1.00 0.00 ? 69  LYS A HE3  7  
ATOM 10780 H HZ1  . LYS A 1 66  ? -1.602  -2.478  -15.174 1.00 0.00 ? 69  LYS A HZ1  7  
ATOM 10781 H HZ3  . LYS A 1 66  ? -2.864  -3.435  -15.769 1.00 0.00 ? 69  LYS A HZ3  7  
ATOM 10782 N N    . GLN A 1 67  ? -4.335  4.048   -11.792 1.00 0.00 ? 70  GLN A N    7  
ATOM 10783 C CA   . GLN A 1 67  ? -4.126  5.414   -11.329 1.00 0.00 ? 70  GLN A CA   7  
ATOM 10784 C C    . GLN A 1 67  ? -5.466  6.090   -11.054 1.00 0.00 ? 70  GLN A C    7  
ATOM 10785 O O    . GLN A 1 67  ? -6.439  5.857   -11.770 1.00 0.00 ? 70  GLN A O    7  
ATOM 10786 C CB   . GLN A 1 67  ? -3.337  6.207   -12.376 1.00 0.00 ? 70  GLN A CB   7  
ATOM 10787 C CG   . GLN A 1 67  ? -2.826  7.551   -11.881 1.00 0.00 ? 70  GLN A CG   7  
ATOM 10788 C CD   . GLN A 1 67  ? -1.833  7.427   -10.734 1.00 0.00 ? 70  GLN A CD   7  
ATOM 10789 O OE1  . GLN A 1 67  ? -1.719  8.324   -9.899  1.00 0.00 ? 70  GLN A OE1  7  
ATOM 10790 N NE2  . GLN A 1 67  ? -1.116  6.312   -10.677 1.00 0.00 ? 70  GLN A NE2  7  
ATOM 10791 H H    . GLN A 1 67  ? -5.235  3.765   -12.056 1.00 0.00 ? 70  GLN A H    7  
ATOM 10792 H HA   . GLN A 1 67  ? -3.558  5.372   -10.412 1.00 0.00 ? 70  GLN A HA   7  
ATOM 10793 H HB2  . GLN A 1 67  ? -2.488  5.619   -12.689 1.00 0.00 ? 70  GLN A HB2  7  
ATOM 10794 H HB3  . GLN A 1 67  ? -3.974  6.382   -13.229 1.00 0.00 ? 70  GLN A HB3  7  
ATOM 10795 H HG2  . GLN A 1 67  ? -2.343  8.061   -12.701 1.00 0.00 ? 70  GLN A HG2  7  
ATOM 10796 H HG3  . GLN A 1 67  ? -3.669  8.135   -11.543 1.00 0.00 ? 70  GLN A HG3  7  
ATOM 10797 H HE21 . GLN A 1 67  ? -1.262  5.626   -11.366 1.00 0.00 ? 70  GLN A HE21 7  
ATOM 10798 H HE22 . GLN A 1 67  ? -0.468  6.216   -9.945  1.00 0.00 ? 70  GLN A HE22 7  
ATOM 10799 N N    . TRP A 1 68  ? -5.512  6.915   -10.013 1.00 0.00 ? 71  TRP A N    7  
ATOM 10800 C CA   . TRP A 1 68  ? -6.731  7.628   -9.651  1.00 0.00 ? 71  TRP A CA   7  
ATOM 10801 C C    . TRP A 1 68  ? -6.464  9.124   -9.563  1.00 0.00 ? 71  TRP A C    7  
ATOM 10802 O O    . TRP A 1 68  ? -5.328  9.549   -9.359  1.00 0.00 ? 71  TRP A O    7  
ATOM 10803 C CB   . TRP A 1 68  ? -7.270  7.135   -8.304  1.00 0.00 ? 71  TRP A CB   7  
ATOM 10804 C CG   . TRP A 1 68  ? -7.719  5.709   -8.317  1.00 0.00 ? 71  TRP A CG   7  
ATOM 10805 C CD1  . TRP A 1 68  ? -6.967  4.611   -8.022  1.00 0.00 ? 71  TRP A CD1  7  
ATOM 10806 C CD2  . TRP A 1 68  ? -9.027  5.225   -8.640  1.00 0.00 ? 71  TRP A CD2  7  
ATOM 10807 N NE1  . TRP A 1 68  ? -7.728  3.475   -8.138  1.00 0.00 ? 71  TRP A NE1  7  
ATOM 10808 C CE2  . TRP A 1 68  ? -8.996  3.826   -8.517  1.00 0.00 ? 71  TRP A CE2  7  
ATOM 10809 C CE3  . TRP A 1 68  ? -10.220 5.842   -9.020  1.00 0.00 ? 71  TRP A CE3  7  
ATOM 10810 C CZ2  . TRP A 1 68  ? -10.113 3.032   -8.760  1.00 0.00 ? 71  TRP A CZ2  7  
ATOM 10811 C CZ3  . TRP A 1 68  ? -11.329 5.054   -9.261  1.00 0.00 ? 71  TRP A CZ3  7  
ATOM 10812 C CH2  . TRP A 1 68  ? -11.268 3.662   -9.130  1.00 0.00 ? 71  TRP A CH2  7  
ATOM 10813 H H    . TRP A 1 68  ? -4.703  7.056   -9.478  1.00 0.00 ? 71  TRP A H    7  
ATOM 10814 H HA   . TRP A 1 68  ? -7.467  7.442   -10.419 1.00 0.00 ? 71  TRP A HA   7  
ATOM 10815 H HB2  . TRP A 1 68  ? -6.500  7.232   -7.556  1.00 0.00 ? 71  TRP A HB2  7  
ATOM 10816 H HB3  . TRP A 1 68  ? -8.116  7.747   -8.022  1.00 0.00 ? 71  TRP A HB3  7  
ATOM 10817 H HD1  . TRP A 1 68  ? -5.925  4.645   -7.740  1.00 0.00 ? 71  TRP A HD1  7  
ATOM 10818 H HE1  . TRP A 1 68  ? -7.409  2.553   -7.974  1.00 0.00 ? 71  TRP A HE1  7  
ATOM 10819 H HE3  . TRP A 1 68  ? -10.285 6.915   -9.126  1.00 0.00 ? 71  TRP A HE3  7  
ATOM 10820 H HZ2  . TRP A 1 68  ? -10.083 1.956   -8.661  1.00 0.00 ? 71  TRP A HZ2  7  
ATOM 10821 H HZ3  . TRP A 1 68  ? -12.262 5.511   -9.557  1.00 0.00 ? 71  TRP A HZ3  7  
ATOM 10822 H HH2  . TRP A 1 68  ? -12.158 3.087   -9.328  1.00 0.00 ? 71  TRP A HH2  7  
ATOM 10823 N N    . GLU A 1 69  ? -7.523  9.916   -9.697  1.00 0.00 ? 72  GLU A N    7  
ATOM 10824 C CA   . GLU A 1 69  ? -7.416  11.367  -9.580  1.00 0.00 ? 72  GLU A CA   7  
ATOM 10825 C C    . GLU A 1 69  ? -7.599  11.769  -8.114  1.00 0.00 ? 72  GLU A C    7  
ATOM 10826 O O    . GLU A 1 69  ? -8.201  12.794  -7.798  1.00 0.00 ? 72  GLU A O    7  
ATOM 10827 C CB   . GLU A 1 69  ? -8.466  12.043  -10.477 1.00 0.00 ? 72  GLU A CB   7  
ATOM 10828 C CG   . GLU A 1 69  ? -8.006  13.347  -11.124 1.00 0.00 ? 72  GLU A CG   7  
ATOM 10829 C CD   . GLU A 1 69  ? -7.960  14.520  -10.164 1.00 0.00 ? 72  GLU A CD   7  
ATOM 10830 O OE1  . GLU A 1 69  ? -9.014  15.163  -9.955  1.00 0.00 ? 72  GLU A OE1  7  
ATOM 10831 O OE2  . GLU A 1 69  ? -6.872  14.816  -9.631  1.00 0.00 ? 72  GLU A OE2  7  
ATOM 10832 H H    . GLU A 1 69  ? -8.400  9.514   -9.882  1.00 0.00 ? 72  GLU A H    7  
ATOM 10833 H HA   . GLU A 1 69  ? -6.426  11.658  -9.901  1.00 0.00 ? 72  GLU A HA   7  
ATOM 10834 H HB2  . GLU A 1 69  ? -8.738  11.357  -11.265 1.00 0.00 ? 72  GLU A HB2  7  
ATOM 10835 H HB3  . GLU A 1 69  ? -9.343  12.254  -9.882  1.00 0.00 ? 72  GLU A HB3  7  
ATOM 10836 H HG2  . GLU A 1 69  ? -7.017  13.200  -11.530 1.00 0.00 ? 72  GLU A HG2  7  
ATOM 10837 H HG3  . GLU A 1 69  ? -8.687  13.589  -11.927 1.00 0.00 ? 72  GLU A HG3  7  
ATOM 10838 N N    . ASP A 1 70  ? -7.098  10.919  -7.227  1.00 0.00 ? 73  ASP A N    7  
ATOM 10839 C CA   . ASP A 1 70  ? -7.108  11.178  -5.792  1.00 0.00 ? 73  ASP A CA   7  
ATOM 10840 C C    . ASP A 1 70  ? -6.218  10.158  -5.090  1.00 0.00 ? 73  ASP A C    7  
ATOM 10841 O O    . ASP A 1 70  ? -6.700  9.175   -4.529  1.00 0.00 ? 73  ASP A O    7  
ATOM 10842 C CB   . ASP A 1 70  ? -8.523  11.100  -5.214  1.00 0.00 ? 73  ASP A CB   7  
ATOM 10843 C CG   . ASP A 1 70  ? -8.612  11.693  -3.816  1.00 0.00 ? 73  ASP A CG   7  
ATOM 10844 O OD1  . ASP A 1 70  ? -7.917  11.206  -2.902  1.00 0.00 ? 73  ASP A OD1  7  
ATOM 10845 O OD2  . ASP A 1 70  ? -9.378  12.658  -3.627  1.00 0.00 ? 73  ASP A OD2  7  
ATOM 10846 H H    . ASP A 1 70  ? -6.696  10.086  -7.549  1.00 0.00 ? 73  ASP A H    7  
ATOM 10847 H HA   . ASP A 1 70  ? -6.710  12.169  -5.627  1.00 0.00 ? 73  ASP A HA   7  
ATOM 10848 H HB2  . ASP A 1 70  ? -9.198  11.642  -5.859  1.00 0.00 ? 73  ASP A HB2  7  
ATOM 10849 H HB3  . ASP A 1 70  ? -8.829  10.064  -5.168  1.00 0.00 ? 73  ASP A HB3  7  
ATOM 10850 N N    . PRO A 1 71  ? -4.896  10.347  -5.154  1.00 0.00 ? 74  PRO A N    7  
ATOM 10851 C CA   . PRO A 1 71  ? -3.941  9.463   -4.500  1.00 0.00 ? 74  PRO A CA   7  
ATOM 10852 C C    . PRO A 1 71  ? -3.725  9.848   -3.042  1.00 0.00 ? 74  PRO A C    7  
ATOM 10853 O O    . PRO A 1 71  ? -3.010  9.173   -2.304  1.00 0.00 ? 74  PRO A O    7  
ATOM 10854 C CB   . PRO A 1 71  ? -2.646  9.669   -5.305  1.00 0.00 ? 74  PRO A CB   7  
ATOM 10855 C CG   . PRO A 1 71  ? -2.965  10.695  -6.351  1.00 0.00 ? 74  PRO A CG   7  
ATOM 10856 C CD   . PRO A 1 71  ? -4.207  11.404  -5.893  1.00 0.00 ? 74  PRO A CD   7  
ATOM 10857 H HA   . PRO A 1 71  ? -4.251  8.432   -4.560  1.00 0.00 ? 74  PRO A HA   7  
ATOM 10858 H HB2  . PRO A 1 71  ? -1.866  10.015  -4.645  1.00 0.00 ? 74  PRO A HB2  7  
ATOM 10859 H HB3  . PRO A 1 71  ? -2.350  8.732   -5.753  1.00 0.00 ? 74  PRO A HB3  7  
ATOM 10860 H HG2  . PRO A 1 71  ? -2.146  11.391  -6.438  1.00 0.00 ? 74  PRO A HG2  7  
ATOM 10861 H HG3  . PRO A 1 71  ? -3.143  10.204  -7.297  1.00 0.00 ? 74  PRO A HG3  7  
ATOM 10862 H HD2  . PRO A 1 71  ? -3.958  12.236  -5.247  1.00 0.00 ? 74  PRO A HD2  7  
ATOM 10863 H HD3  . PRO A 1 71  ? -4.795  11.733  -6.739  1.00 0.00 ? 74  PRO A HD3  7  
ATOM 10864 N N    . SER A 1 72  ? -4.373  10.927  -2.629  1.00 0.00 ? 75  SER A N    7  
ATOM 10865 C CA   . SER A 1 72  ? -4.165  11.484  -1.307  1.00 0.00 ? 75  SER A CA   7  
ATOM 10866 C C    . SER A 1 72  ? -5.075  10.837  -0.264  1.00 0.00 ? 75  SER A C    7  
ATOM 10867 O O    . SER A 1 72  ? -5.250  11.369  0.829   1.00 0.00 ? 75  SER A O    7  
ATOM 10868 C CB   . SER A 1 72  ? -4.388  12.993  -1.342  1.00 0.00 ? 75  SER A CB   7  
ATOM 10869 O OG   . SER A 1 72  ? -3.607  13.593  -2.364  1.00 0.00 ? 75  SER A OG   7  
ATOM 10870 H H    . SER A 1 72  ? -5.012  11.358  -3.234  1.00 0.00 ? 75  SER A H    7  
ATOM 10871 H HA   . SER A 1 72  ? -3.139  11.295  -1.032  1.00 0.00 ? 75  SER A HA   7  
ATOM 10872 H HB2  . SER A 1 72  ? -5.430  13.197  -1.533  1.00 0.00 ? 75  SER A HB2  7  
ATOM 10873 H HB3  . SER A 1 72  ? -4.102  13.418  -0.391  1.00 0.00 ? 75  SER A HB3  7  
ATOM 10874 H HG   . SER A 1 72  ? -2.793  13.091  -2.487  1.00 0.00 ? 75  SER A HG   7  
ATOM 10875 N N    . GLN A 1 73  ? -5.650  9.685   -0.591  1.00 0.00 ? 76  GLN A N    7  
ATOM 10876 C CA   . GLN A 1 73  ? -6.420  8.927   0.389   1.00 0.00 ? 76  GLN A CA   7  
ATOM 10877 C C    . GLN A 1 73  ? -5.491  8.327   1.439   1.00 0.00 ? 76  GLN A C    7  
ATOM 10878 O O    . GLN A 1 73  ? -5.921  7.961   2.529   1.00 0.00 ? 76  GLN A O    7  
ATOM 10879 C CB   . GLN A 1 73  ? -7.234  7.819   -0.290  1.00 0.00 ? 76  GLN A CB   7  
ATOM 10880 C CG   . GLN A 1 73  ? -8.458  8.329   -1.038  1.00 0.00 ? 76  GLN A CG   7  
ATOM 10881 C CD   . GLN A 1 73  ? -9.458  9.026   -0.129  1.00 0.00 ? 76  GLN A CD   7  
ATOM 10882 O OE1  . GLN A 1 73  ? -10.171 9.939   -0.548  1.00 0.00 ? 76  GLN A OE1  7  
ATOM 10883 N NE2  . GLN A 1 73  ? -9.535  8.597   1.121   1.00 0.00 ? 76  GLN A NE2  7  
ATOM 10884 H H    . GLN A 1 73  ? -5.571  9.348   -1.508  1.00 0.00 ? 76  GLN A H    7  
ATOM 10885 H HA   . GLN A 1 73  ? -7.099  9.611   0.877   1.00 0.00 ? 76  GLN A HA   7  
ATOM 10886 H HB2  . GLN A 1 73  ? -6.598  7.299   -0.995  1.00 0.00 ? 76  GLN A HB2  7  
ATOM 10887 H HB3  . GLN A 1 73  ? -7.566  7.120   0.465   1.00 0.00 ? 76  GLN A HB3  7  
ATOM 10888 H HG2  . GLN A 1 73  ? -8.135  9.030   -1.792  1.00 0.00 ? 76  GLN A HG2  7  
ATOM 10889 H HG3  . GLN A 1 73  ? -8.947  7.491   -1.514  1.00 0.00 ? 76  GLN A HG3  7  
ATOM 10890 H HE21 . GLN A 1 73  ? -8.956  7.853   1.397   1.00 0.00 ? 76  GLN A HE21 7  
ATOM 10891 H HE22 . GLN A 1 73  ? -10.161 9.049   1.727   1.00 0.00 ? 76  GLN A HE22 7  
ATOM 10892 N N    . ALA A 1 74  ? -4.208  8.261   1.106   1.00 0.00 ? 77  ALA A N    7  
ATOM 10893 C CA   . ALA A 1 74  ? -3.214  7.659   1.980   1.00 0.00 ? 77  ALA A CA   7  
ATOM 10894 C C    . ALA A 1 74  ? -2.202  8.695   2.463   1.00 0.00 ? 77  ALA A C    7  
ATOM 10895 O O    . ALA A 1 74  ? -1.016  8.398   2.610   1.00 0.00 ? 77  ALA A O    7  
ATOM 10896 C CB   . ALA A 1 74  ? -2.508  6.531   1.245   1.00 0.00 ? 77  ALA A CB   7  
ATOM 10897 H H    . ALA A 1 74  ? -3.924  8.629   0.244   1.00 0.00 ? 77  ALA A H    7  
ATOM 10898 H HA   . ALA A 1 74  ? -3.727  7.239   2.833   1.00 0.00 ? 77  ALA A HA   7  
ATOM 10899 H HB1  . ALA A 1 74  ? -3.238  5.819   0.888   1.00 0.00 ? 77  ALA A HB1  7  
ATOM 10900 H HB2  . ALA A 1 74  ? -1.960  6.938   0.407   1.00 0.00 ? 77  ALA A HB2  7  
ATOM 10901 H HB3  . ALA A 1 74  ? -1.821  6.036   1.916   1.00 0.00 ? 77  ALA A HB3  7  
ATOM 10902 N N    . SER A 1 75  ? -2.675  9.911   2.711   1.00 0.00 ? 78  SER A N    7  
ATOM 10903 C CA   . SER A 1 75  ? -1.805  10.995  3.160   1.00 0.00 ? 78  SER A CA   7  
ATOM 10904 C C    . SER A 1 75  ? -1.057  10.631  4.443   1.00 0.00 ? 78  SER A C    7  
ATOM 10905 O O    . SER A 1 75  ? 0.112   10.982  4.603   1.00 0.00 ? 78  SER A O    7  
ATOM 10906 C CB   . SER A 1 75  ? -2.615  12.274  3.373   1.00 0.00 ? 78  SER A CB   7  
ATOM 10907 O OG   . SER A 1 75  ? -3.276  12.658  2.178   1.00 0.00 ? 78  SER A OG   7  
ATOM 10908 H H    . SER A 1 75  ? -3.630  10.090  2.573   1.00 0.00 ? 78  SER A H    7  
ATOM 10909 H HA   . SER A 1 75  ? -1.079  11.173  2.379   1.00 0.00 ? 78  SER A HA   7  
ATOM 10910 H HB2  . SER A 1 75  ? -3.355  12.107  4.141   1.00 0.00 ? 78  SER A HB2  7  
ATOM 10911 H HB3  . SER A 1 75  ? -1.953  13.070  3.678   1.00 0.00 ? 78  SER A HB3  7  
ATOM 10912 H HG   . SER A 1 75  ? -4.233  12.646  2.327   1.00 0.00 ? 78  SER A HG   7  
ATOM 10913 N N    . LYS A 1 76  ? -1.725  9.911   5.345   1.00 0.00 ? 79  LYS A N    7  
ATOM 10914 C CA   . LYS A 1 76  ? -1.122  9.545   6.624   1.00 0.00 ? 79  LYS A CA   7  
ATOM 10915 C C    . LYS A 1 76  ? 0.040   8.573   6.442   1.00 0.00 ? 79  LYS A C    7  
ATOM 10916 O O    . LYS A 1 76  ? 0.915   8.480   7.302   1.00 0.00 ? 79  LYS A O    7  
ATOM 10917 C CB   . LYS A 1 76  ? -2.167  8.959   7.575   1.00 0.00 ? 79  LYS A CB   7  
ATOM 10918 C CG   . LYS A 1 76  ? -3.235  9.957   7.991   1.00 0.00 ? 79  LYS A CG   7  
ATOM 10919 C CD   . LYS A 1 76  ? -4.099  9.413   9.115   1.00 0.00 ? 79  LYS A CD   7  
ATOM 10920 C CE   . LYS A 1 76  ? -5.093  10.455  9.605   1.00 0.00 ? 79  LYS A CE   7  
ATOM 10921 N NZ   . LYS A 1 76  ? -4.419  11.714  10.024  1.00 0.00 ? 79  LYS A NZ   7  
ATOM 10922 H H    . LYS A 1 76  ? -2.640  9.624   5.148   1.00 0.00 ? 79  LYS A H    7  
ATOM 10923 H HA   . LYS A 1 76  ? -0.732  10.450  7.062   1.00 0.00 ? 79  LYS A HA   7  
ATOM 10924 H HB2  . LYS A 1 76  ? -2.654  8.126   7.090   1.00 0.00 ? 79  LYS A HB2  7  
ATOM 10925 H HB3  . LYS A 1 76  ? -1.671  8.606   8.467   1.00 0.00 ? 79  LYS A HB3  7  
ATOM 10926 H HG2  . LYS A 1 76  ? -2.755  10.865  8.325   1.00 0.00 ? 79  LYS A HG2  7  
ATOM 10927 H HG3  . LYS A 1 76  ? -3.861  10.170  7.138   1.00 0.00 ? 79  LYS A HG3  7  
ATOM 10928 H HD2  . LYS A 1 76  ? -4.642  8.553   8.754   1.00 0.00 ? 79  LYS A HD2  7  
ATOM 10929 H HD3  . LYS A 1 76  ? -3.461  9.122   9.936   1.00 0.00 ? 79  LYS A HD3  7  
ATOM 10930 H HE2  . LYS A 1 76  ? -5.786  10.677  8.808   1.00 0.00 ? 79  LYS A HE2  7  
ATOM 10931 H HE3  . LYS A 1 76  ? -5.635  10.048  10.448  1.00 0.00 ? 79  LYS A HE3  7  
ATOM 10932 H HZ1  . LYS A 1 76  ? -3.677  11.495  10.724  1.00 0.00 ? 79  LYS A HZ1  7  
ATOM 10933 H HZ3  . LYS A 1 76  ? -5.117  12.348  10.480  1.00 0.00 ? 79  LYS A HZ3  7  
ATOM 10934 N N    . VAL A 1 77  ? 0.059   7.862   5.321   1.00 0.00 ? 80  VAL A N    7  
ATOM 10935 C CA   . VAL A 1 77  ? 1.187   6.999   4.998   1.00 0.00 ? 80  VAL A CA   7  
ATOM 10936 C C    . VAL A 1 77  ? 2.432   7.852   4.805   1.00 0.00 ? 80  VAL A C    7  
ATOM 10937 O O    . VAL A 1 77  ? 3.463   7.624   5.437   1.00 0.00 ? 80  VAL A O    7  
ATOM 10938 C CB   . VAL A 1 77  ? 0.932   6.160   3.723   1.00 0.00 ? 80  VAL A CB   7  
ATOM 10939 C CG1  . VAL A 1 77  ? 2.186   5.398   3.310   1.00 0.00 ? 80  VAL A CG1  7  
ATOM 10940 C CG2  . VAL A 1 77  ? -0.228  5.198   3.940   1.00 0.00 ? 80  VAL A CG2  7  
ATOM 10941 H H    . VAL A 1 77  ? -0.691  7.930   4.694   1.00 0.00 ? 80  VAL A H    7  
ATOM 10942 H HA   . VAL A 1 77  ? 1.344   6.328   5.830   1.00 0.00 ? 80  VAL A HA   7  
ATOM 10943 H HB   . VAL A 1 77  ? 0.666   6.834   2.921   1.00 0.00 ? 80  VAL A HB   7  
ATOM 10944 H HG11 . VAL A 1 77  ? 2.987   6.098   3.119   1.00 0.00 ? 80  VAL A HG11 7  
ATOM 10945 H HG12 . VAL A 1 77  ? 2.477   4.727   4.103   1.00 0.00 ? 80  VAL A HG12 7  
ATOM 10946 H HG13 . VAL A 1 77  ? 1.984   4.830   2.414   1.00 0.00 ? 80  VAL A HG13 7  
ATOM 10947 H HG21 . VAL A 1 77  ? -0.355  4.583   3.061   1.00 0.00 ? 80  VAL A HG21 7  
ATOM 10948 H HG22 . VAL A 1 77  ? -0.021  4.570   4.793   1.00 0.00 ? 80  VAL A HG22 7  
ATOM 10949 H HG23 . VAL A 1 77  ? -1.132  5.760   4.118   1.00 0.00 ? 80  VAL A HG23 7  
ATOM 10950 N N    . CYS A 1 78  ? 2.309   8.863   3.958   1.00 0.00 ? 81  CYS A N    7  
ATOM 10951 C CA   . CYS A 1 78  ? 3.406   9.782   3.703   1.00 0.00 ? 81  CYS A CA   7  
ATOM 10952 C C    . CYS A 1 78  ? 3.806   10.516  4.981   1.00 0.00 ? 81  CYS A C    7  
ATOM 10953 O O    . CYS A 1 78  ? 4.985   10.777  5.216   1.00 0.00 ? 81  CYS A O    7  
ATOM 10954 C CB   . CYS A 1 78  ? 3.002   10.785  2.624   1.00 0.00 ? 81  CYS A CB   7  
ATOM 10955 S SG   . CYS A 1 78  ? 2.495   10.019  1.050   1.00 0.00 ? 81  CYS A SG   7  
ATOM 10956 H H    . CYS A 1 78  ? 1.460   8.989   3.482   1.00 0.00 ? 81  CYS A H    7  
ATOM 10957 H HA   . CYS A 1 78  ? 4.250   9.206   3.352   1.00 0.00 ? 81  CYS A HA   7  
ATOM 10958 H HB2  . CYS A 1 78  ? 2.172   11.374  2.984   1.00 0.00 ? 81  CYS A HB2  7  
ATOM 10959 H HB3  . CYS A 1 78  ? 3.836   11.438  2.420   1.00 0.00 ? 81  CYS A HB3  7  
ATOM 10960 N N    . GLN A 1 79  ? 2.818   10.831  5.815   1.00 0.00 ? 82  GLN A N    7  
ATOM 10961 C CA   . GLN A 1 79  ? 3.071   11.500  7.087   1.00 0.00 ? 82  GLN A CA   7  
ATOM 10962 C C    . GLN A 1 79  ? 3.895   10.614  8.017   1.00 0.00 ? 82  GLN A C    7  
ATOM 10963 O O    . GLN A 1 79  ? 4.808   11.087  8.690   1.00 0.00 ? 82  GLN A O    7  
ATOM 10964 C CB   . GLN A 1 79  ? 1.757   11.889  7.767   1.00 0.00 ? 82  GLN A CB   7  
ATOM 10965 C CG   . GLN A 1 79  ? 0.947   12.913  6.988   1.00 0.00 ? 82  GLN A CG   7  
ATOM 10966 C CD   . GLN A 1 79  ? 1.727   14.184  6.723   1.00 0.00 ? 82  GLN A CD   7  
ATOM 10967 O OE1  . GLN A 1 79  ? 2.597   14.569  7.507   1.00 0.00 ? 82  GLN A OE1  7  
ATOM 10968 N NE2  . GLN A 1 79  ? 1.426   14.842  5.616   1.00 0.00 ? 82  GLN A NE2  7  
ATOM 10969 H H    . GLN A 1 79  ? 1.895   10.613  5.564   1.00 0.00 ? 82  GLN A H    7  
ATOM 10970 H HA   . GLN A 1 79  ? 3.635   12.398  6.878   1.00 0.00 ? 82  GLN A HA   7  
ATOM 10971 H HB2  . GLN A 1 79  ? 1.154   11.003  7.890   1.00 0.00 ? 82  GLN A HB2  7  
ATOM 10972 H HB3  . GLN A 1 79  ? 1.978   12.302  8.740   1.00 0.00 ? 82  GLN A HB3  7  
ATOM 10973 H HG2  . GLN A 1 79  ? 0.655   12.482  6.041   1.00 0.00 ? 82  GLN A HG2  7  
ATOM 10974 H HG3  . GLN A 1 79  ? 0.065   13.163  7.557   1.00 0.00 ? 82  GLN A HG3  7  
ATOM 10975 H HE21 . GLN A 1 79  ? 0.724   14.480  5.040   1.00 0.00 ? 82  GLN A HE21 7  
ATOM 10976 H HE22 . GLN A 1 79  ? 1.923   15.671  5.417   1.00 0.00 ? 82  GLN A HE22 7  
ATOM 10977 N N    . ARG A 1 80  ? 3.580   9.325   8.034   1.00 0.00 ? 83  ARG A N    7  
ATOM 10978 C CA   . ARG A 1 80  ? 4.310   8.370   8.859   1.00 0.00 ? 83  ARG A CA   7  
ATOM 10979 C C    . ARG A 1 80  ? 5.770   8.262   8.428   1.00 0.00 ? 83  ARG A C    7  
ATOM 10980 O O    . ARG A 1 80  ? 6.643   7.975   9.246   1.00 0.00 ? 83  ARG A O    7  
ATOM 10981 C CB   . ARG A 1 80  ? 3.639   6.993   8.822   1.00 0.00 ? 83  ARG A CB   7  
ATOM 10982 C CG   . ARG A 1 80  ? 2.633   6.777   9.942   1.00 0.00 ? 83  ARG A CG   7  
ATOM 10983 C CD   . ARG A 1 80  ? 3.336   6.654   11.285  1.00 0.00 ? 83  ARG A CD   7  
ATOM 10984 N NE   . ARG A 1 80  ? 2.403   6.539   12.403  1.00 0.00 ? 83  ARG A NE   7  
ATOM 10985 C CZ   . ARG A 1 80  ? 2.762   6.128   13.614  1.00 0.00 ? 83  ARG A CZ   7  
ATOM 10986 N NH1  . ARG A 1 80  ? 4.000   5.710   13.836  1.00 0.00 ? 83  ARG A NH1  7  
ATOM 10987 N NH2  . ARG A 1 80  ? 1.885   6.108   14.603  1.00 0.00 ? 83  ARG A NH2  7  
ATOM 10988 H H    . ARG A 1 80  ? 2.827   9.007   7.483   1.00 0.00 ? 83  ARG A H    7  
ATOM 10989 H HA   . ARG A 1 80  ? 4.285   8.739   9.870   1.00 0.00 ? 83  ARG A HA   7  
ATOM 10990 H HB2  . ARG A 1 80  ? 3.124   6.881   7.879   1.00 0.00 ? 83  ARG A HB2  7  
ATOM 10991 H HB3  . ARG A 1 80  ? 4.400   6.231   8.898   1.00 0.00 ? 83  ARG A HB3  7  
ATOM 10992 H HG2  . ARG A 1 80  ? 1.957   7.620   9.973   1.00 0.00 ? 83  ARG A HG2  7  
ATOM 10993 H HG3  . ARG A 1 80  ? 2.078   5.871   9.749   1.00 0.00 ? 83  ARG A HG3  7  
ATOM 10994 H HD2  . ARG A 1 80  ? 3.964   5.775   11.266  1.00 0.00 ? 83  ARG A HD2  7  
ATOM 10995 H HD3  . ARG A 1 80  ? 3.954   7.527   11.436  1.00 0.00 ? 83  ARG A HD3  7  
ATOM 10996 H HE   . ARG A 1 80  ? 1.470   6.805   12.246  1.00 0.00 ? 83  ARG A HE   7  
ATOM 10997 H HH12 . ARG A 1 80  ? 4.753   6.024   13.247  1.00 0.00 ? 83  ARG A HH12 7  
ATOM 10998 H HH21 . ARG A 1 80  ? 0.939   6.410   14.444  1.00 0.00 ? 83  ARG A HH21 7  
ATOM 10999 H HH22 . ARG A 1 80  ? 2.167   5.807   15.514  1.00 0.00 ? 83  ARG A HH22 7  
ATOM 11000 N N    . LEU A 1 81  ? 6.033   8.503   7.152   1.00 0.00 ? 84  LEU A N    7  
ATOM 11001 C CA   . LEU A 1 81  ? 7.401   8.500   6.648   1.00 0.00 ? 84  LEU A CA   7  
ATOM 11002 C C    . LEU A 1 81  ? 8.014   9.899   6.719   1.00 0.00 ? 84  LEU A C    7  
ATOM 11003 O O    . LEU A 1 81  ? 9.180   10.094  6.374   1.00 0.00 ? 84  LEU A O    7  
ATOM 11004 C CB   . LEU A 1 81  ? 7.462   7.973   5.212   1.00 0.00 ? 84  LEU A CB   7  
ATOM 11005 C CG   . LEU A 1 81  ? 7.416   6.447   5.061   1.00 0.00 ? 84  LEU A CG   7  
ATOM 11006 C CD1  . LEU A 1 81  ? 6.050   5.891   5.433   1.00 0.00 ? 84  LEU A CD1  7  
ATOM 11007 C CD2  . LEU A 1 81  ? 7.780   6.043   3.644   1.00 0.00 ? 84  LEU A CD2  7  
ATOM 11008 H H    . LEU A 1 81  ? 5.291   8.675   6.532   1.00 0.00 ? 84  LEU A H    7  
ATOM 11009 H HA   . LEU A 1 81  ? 7.977   7.842   7.281   1.00 0.00 ? 84  LEU A HA   7  
ATOM 11010 H HB2  . LEU A 1 81  ? 6.630   8.392   4.665   1.00 0.00 ? 84  LEU A HB2  7  
ATOM 11011 H HB3  . LEU A 1 81  ? 8.377   8.326   4.761   1.00 0.00 ? 84  LEU A HB3  7  
ATOM 11012 H HG   . LEU A 1 81  ? 8.144   6.011   5.727   1.00 0.00 ? 84  LEU A HG   7  
ATOM 11013 H HD11 . LEU A 1 81  ? 5.849   6.090   6.475   1.00 0.00 ? 84  LEU A HD11 7  
ATOM 11014 H HD12 . LEU A 1 81  ? 5.291   6.360   4.823   1.00 0.00 ? 84  LEU A HD12 7  
ATOM 11015 H HD13 . LEU A 1 81  ? 6.037   4.826   5.262   1.00 0.00 ? 84  LEU A HD13 7  
ATOM 11016 H HD21 . LEU A 1 81  ? 7.074   6.479   2.954   1.00 0.00 ? 84  LEU A HD21 7  
ATOM 11017 H HD22 . LEU A 1 81  ? 8.776   6.396   3.414   1.00 0.00 ? 84  LEU A HD22 7  
ATOM 11018 H HD23 . LEU A 1 81  ? 7.750   4.967   3.559   1.00 0.00 ? 84  LEU A HD23 7  
ATOM 11019 N N    . ASN A 1 82  ? 7.211   10.860  7.186   1.00 0.00 ? 85  ASN A N    7  
ATOM 11020 C CA   . ASN A 1 82  ? 7.631   12.260  7.326   1.00 0.00 ? 85  ASN A CA   7  
ATOM 11021 C C    . ASN A 1 82  ? 7.909   12.894  5.968   1.00 0.00 ? 85  ASN A C    7  
ATOM 11022 O O    . ASN A 1 82  ? 8.863   13.651  5.804   1.00 0.00 ? 85  ASN A O    7  
ATOM 11023 C CB   . ASN A 1 82  ? 8.858   12.393  8.243   1.00 0.00 ? 85  ASN A CB   7  
ATOM 11024 C CG   . ASN A 1 82  ? 8.515   12.260  9.718   1.00 0.00 ? 85  ASN A CG   7  
ATOM 11025 O OD1  . ASN A 1 82  ? 9.162   12.867  10.574  1.00 0.00 ? 85  ASN A OD1  7  
ATOM 11026 N ND2  . ASN A 1 82  ? 7.495   11.474  10.028  1.00 0.00 ? 85  ASN A ND2  7  
ATOM 11027 H H    . ASN A 1 82  ? 6.296   10.620  7.444   1.00 0.00 ? 85  ASN A H    7  
ATOM 11028 H HA   . ASN A 1 82  ? 6.809   12.792  7.779   1.00 0.00 ? 85  ASN A HA   7  
ATOM 11029 H HB2  . ASN A 1 82  ? 9.568   11.622  7.989   1.00 0.00 ? 85  ASN A HB2  7  
ATOM 11030 H HB3  . ASN A 1 82  ? 9.312   13.360  8.083   1.00 0.00 ? 85  ASN A HB3  7  
ATOM 11031 H HD21 . ASN A 1 82  ? 7.018   11.027  9.299   1.00 0.00 ? 85  ASN A HD21 7  
ATOM 11032 H HD22 . ASN A 1 82  ? 7.252   11.374  10.979  1.00 0.00 ? 85  ASN A HD22 7  
ATOM 11033 N N    . CYS A 1 83  ? 7.054   12.591  5.004   1.00 0.00 ? 86  CYS A N    7  
ATOM 11034 C CA   . CYS A 1 83  ? 7.183   13.129  3.659   1.00 0.00 ? 86  CYS A CA   7  
ATOM 11035 C C    . CYS A 1 83  ? 6.044   14.105  3.380   1.00 0.00 ? 86  CYS A C    7  
ATOM 11036 O O    . CYS A 1 83  ? 5.224   14.368  4.263   1.00 0.00 ? 86  CYS A O    7  
ATOM 11037 C CB   . CYS A 1 83  ? 7.162   11.987  2.640   1.00 0.00 ? 86  CYS A CB   7  
ATOM 11038 S SG   . CYS A 1 83  ? 8.266   10.603  3.066   1.00 0.00 ? 86  CYS A SG   7  
ATOM 11039 H H    . CYS A 1 83  ? 6.307   11.985  5.202   1.00 0.00 ? 86  CYS A H    7  
ATOM 11040 H HA   . CYS A 1 83  ? 8.124   13.654  3.594   1.00 0.00 ? 86  CYS A HA   7  
ATOM 11041 H HB2  . CYS A 1 83  ? 6.158   11.594  2.570   1.00 0.00 ? 86  CYS A HB2  7  
ATOM 11042 H HB3  . CYS A 1 83  ? 7.464   12.364  1.674   1.00 0.00 ? 86  CYS A HB3  7  
ATOM 11043 N N    . GLY A 1 84  ? 6.001   14.652  2.173   1.00 0.00 ? 87  GLY A N    7  
ATOM 11044 C CA   . GLY A 1 84  ? 4.907   15.529  1.795   1.00 0.00 ? 87  GLY A CA   7  
ATOM 11045 C C    . GLY A 1 84  ? 3.655   14.757  1.404   1.00 0.00 ? 87  GLY A C    7  
ATOM 11046 O O    . GLY A 1 84  ? 3.463   13.622  1.839   1.00 0.00 ? 87  GLY A O    7  
ATOM 11047 H H    . GLY A 1 84  ? 6.725   14.471  1.534   1.00 0.00 ? 87  GLY A H    7  
ATOM 11048 H HA2  . GLY A 1 84  ? 4.675   16.173  2.629   1.00 0.00 ? 87  GLY A HA2  7  
ATOM 11049 H HA3  . GLY A 1 84  ? 5.218   16.139  0.960   1.00 0.00 ? 87  GLY A HA3  7  
ATOM 11050 N N    . ASP A 1 85  ? 2.805   15.366  0.586   1.00 0.00 ? 88  ASP A N    7  
ATOM 11051 C CA   . ASP A 1 85  ? 1.553   14.737  0.168   1.00 0.00 ? 88  ASP A CA   7  
ATOM 11052 C C    . ASP A 1 85  ? 1.810   13.622  -0.846  1.00 0.00 ? 88  ASP A C    7  
ATOM 11053 O O    . ASP A 1 85  ? 2.860   13.588  -1.497  1.00 0.00 ? 88  ASP A O    7  
ATOM 11054 C CB   . ASP A 1 85  ? 0.581   15.778  -0.418  1.00 0.00 ? 88  ASP A CB   7  
ATOM 11055 C CG   . ASP A 1 85  ? 0.992   16.312  -1.778  1.00 0.00 ? 88  ASP A CG   7  
ATOM 11056 O OD1  . ASP A 1 85  ? 1.724   17.325  -1.829  1.00 0.00 ? 88  ASP A OD1  7  
ATOM 11057 O OD2  . ASP A 1 85  ? 0.550   15.751  -2.803  1.00 0.00 ? 88  ASP A OD2  7  
ATOM 11058 H H    . ASP A 1 85  ? 3.019   16.268  0.261   1.00 0.00 ? 88  ASP A H    7  
ATOM 11059 H HA   . ASP A 1 85  ? 1.105   14.300  1.047   1.00 0.00 ? 88  ASP A HA   7  
ATOM 11060 H HB2  . ASP A 1 85  ? -0.393  15.329  -0.521  1.00 0.00 ? 88  ASP A HB2  7  
ATOM 11061 H HB3  . ASP A 1 85  ? 0.511   16.609  0.267   1.00 0.00 ? 88  ASP A HB3  7  
ATOM 11062 N N    . PRO A 1 86  ? 0.864   12.671  -0.961  1.00 0.00 ? 89  PRO A N    7  
ATOM 11063 C CA   . PRO A 1 86  ? 0.970   11.559  -1.900  1.00 0.00 ? 89  PRO A CA   7  
ATOM 11064 C C    . PRO A 1 86  ? 0.727   12.000  -3.342  1.00 0.00 ? 89  PRO A C    7  
ATOM 11065 O O    . PRO A 1 86  ? -0.382  12.397  -3.706  1.00 0.00 ? 89  PRO A O    7  
ATOM 11066 C CB   . PRO A 1 86  ? -0.123  10.574  -1.456  1.00 0.00 ? 89  PRO A CB   7  
ATOM 11067 C CG   . PRO A 1 86  ? -0.725  11.142  -0.212  1.00 0.00 ? 89  PRO A CG   7  
ATOM 11068 C CD   . PRO A 1 86  ? -0.379  12.603  -0.185  1.00 0.00 ? 89  PRO A CD   7  
ATOM 11069 H HA   . PRO A 1 86  ? 1.935   11.081  -1.832  1.00 0.00 ? 89  PRO A HA   7  
ATOM 11070 H HB2  . PRO A 1 86  ? -0.859  10.483  -2.236  1.00 0.00 ? 89  PRO A HB2  7  
ATOM 11071 H HB3  . PRO A 1 86  ? 0.321   9.608   -1.267  1.00 0.00 ? 89  PRO A HB3  7  
ATOM 11072 H HG2  . PRO A 1 86  ? -1.797  11.013  -0.235  1.00 0.00 ? 89  PRO A HG2  7  
ATOM 11073 H HG3  . PRO A 1 86  ? -0.310  10.646  0.653   1.00 0.00 ? 89  PRO A HG3  7  
ATOM 11074 H HD2  . PRO A 1 86  ? -1.157  13.186  -0.653  1.00 0.00 ? 89  PRO A HD2  7  
ATOM 11075 H HD3  . PRO A 1 86  ? -0.219  12.933  0.829   1.00 0.00 ? 89  PRO A HD3  7  
ATOM 11076 N N    . LEU A 1 87  ? 1.773   11.913  -4.150  1.00 0.00 ? 90  LEU A N    7  
ATOM 11077 C CA   . LEU A 1 87  ? 1.727   12.329  -5.547  1.00 0.00 ? 90  LEU A CA   7  
ATOM 11078 C C    . LEU A 1 87  ? 1.003   11.303  -6.405  1.00 0.00 ? 90  LEU A C    7  
ATOM 11079 O O    . LEU A 1 87  ? 0.202   11.651  -7.273  1.00 0.00 ? 90  LEU A O    7  
ATOM 11080 C CB   . LEU A 1 87  ? 3.150   12.507  -6.088  1.00 0.00 ? 90  LEU A CB   7  
ATOM 11081 C CG   . LEU A 1 87  ? 4.004   13.566  -5.390  1.00 0.00 ? 90  LEU A CG   7  
ATOM 11082 C CD1  . LEU A 1 87  ? 5.444   13.485  -5.876  1.00 0.00 ? 90  LEU A CD1  7  
ATOM 11083 C CD2  . LEU A 1 87  ? 3.440   14.957  -5.636  1.00 0.00 ? 90  LEU A CD2  7  
ATOM 11084 H H    . LEU A 1 87  ? 2.612   11.546  -3.797  1.00 0.00 ? 90  LEU A H    7  
ATOM 11085 H HA   . LEU A 1 87  ? 1.205   13.270  -5.602  1.00 0.00 ? 90  LEU A HA   7  
ATOM 11086 H HB2  . LEU A 1 87  ? 3.658   11.561  -6.004  1.00 0.00 ? 90  LEU A HB2  7  
ATOM 11087 H HB3  . LEU A 1 87  ? 3.082   12.762  -7.134  1.00 0.00 ? 90  LEU A HB3  7  
ATOM 11088 H HG   . LEU A 1 87  ? 3.998   13.382  -4.325  1.00 0.00 ? 90  LEU A HG   7  
ATOM 11089 H HD11 . LEU A 1 87  ? 5.850   12.512  -5.644  1.00 0.00 ? 90  LEU A HD11 7  
ATOM 11090 H HD12 . LEU A 1 87  ? 5.475   13.643  -6.945  1.00 0.00 ? 90  LEU A HD12 7  
ATOM 11091 H HD13 . LEU A 1 87  ? 6.032   14.246  -5.384  1.00 0.00 ? 90  LEU A HD13 7  
ATOM 11092 H HD21 . LEU A 1 87  ? 3.418   15.154  -6.698  1.00 0.00 ? 90  LEU A HD21 7  
ATOM 11093 H HD22 . LEU A 1 87  ? 2.438   15.015  -5.238  1.00 0.00 ? 90  LEU A HD22 7  
ATOM 11094 H HD23 . LEU A 1 87  ? 4.065   15.691  -5.147  1.00 0.00 ? 90  LEU A HD23 7  
ATOM 11095 N N    . SER A 1 88  ? 1.288   10.035  -6.162  1.00 0.00 ? 91  SER A N    7  
ATOM 11096 C CA   . SER A 1 88  ? 0.757   8.970   -6.996  1.00 0.00 ? 91  SER A CA   7  
ATOM 11097 C C    . SER A 1 88  ? 0.525   7.711   -6.174  1.00 0.00 ? 91  SER A C    7  
ATOM 11098 O O    . SER A 1 88  ? 1.205   7.479   -5.171  1.00 0.00 ? 91  SER A O    7  
ATOM 11099 C CB   . SER A 1 88  ? 1.721   8.675   -8.151  1.00 0.00 ? 91  SER A CB   7  
ATOM 11100 O OG   . SER A 1 88  ? 1.180   7.718   -9.046  1.00 0.00 ? 91  SER A OG   7  
ATOM 11101 H H    . SER A 1 88  ? 1.857   9.809   -5.397  1.00 0.00 ? 91  SER A H    7  
ATOM 11102 H HA   . SER A 1 88  ? -0.184  9.304   -7.402  1.00 0.00 ? 91  SER A HA   7  
ATOM 11103 H HB2  . SER A 1 88  ? 1.913   9.586   -8.697  1.00 0.00 ? 91  SER A HB2  7  
ATOM 11104 H HB3  . SER A 1 88  ? 2.648   8.293   -7.753  1.00 0.00 ? 91  SER A HB3  7  
ATOM 11105 H HG   . SER A 1 88  ? 1.115   8.108   -9.930  1.00 0.00 ? 91  SER A HG   7  
ATOM 11106 N N    . LEU A 1 89  ? -0.441  6.910   -6.607  1.00 0.00 ? 92  LEU A N    7  
ATOM 11107 C CA   . LEU A 1 89  ? -0.767  5.652   -5.951  1.00 0.00 ? 92  LEU A CA   7  
ATOM 11108 C C    . LEU A 1 89  ? -1.360  4.694   -6.980  1.00 0.00 ? 92  LEU A C    7  
ATOM 11109 O O    . LEU A 1 89  ? -2.305  5.046   -7.687  1.00 0.00 ? 92  LEU A O    7  
ATOM 11110 C CB   . LEU A 1 89  ? -1.754  5.900   -4.799  1.00 0.00 ? 92  LEU A CB   7  
ATOM 11111 C CG   . LEU A 1 89  ? -1.993  4.719   -3.846  1.00 0.00 ? 92  LEU A CG   7  
ATOM 11112 C CD1  . LEU A 1 89  ? -2.450  5.231   -2.490  1.00 0.00 ? 92  LEU A CD1  7  
ATOM 11113 C CD2  . LEU A 1 89  ? -3.034  3.756   -4.409  1.00 0.00 ? 92  LEU A CD2  7  
ATOM 11114 H H    . LEU A 1 89  ? -0.949  7.169   -7.406  1.00 0.00 ? 92  LEU A H    7  
ATOM 11115 H HA   . LEU A 1 89  ? 0.148   5.232   -5.555  1.00 0.00 ? 92  LEU A HA   7  
ATOM 11116 H HB2  . LEU A 1 89  ? -1.386  6.733   -4.217  1.00 0.00 ? 92  LEU A HB2  7  
ATOM 11117 H HB3  . LEU A 1 89  ? -2.704  6.179   -5.230  1.00 0.00 ? 92  LEU A HB3  7  
ATOM 11118 H HG   . LEU A 1 89  ? -1.066  4.176   -3.709  1.00 0.00 ? 92  LEU A HG   7  
ATOM 11119 H HD11 . LEU A 1 89  ? -2.647  4.395   -1.837  1.00 0.00 ? 92  LEU A HD11 7  
ATOM 11120 H HD12 . LEU A 1 89  ? -1.674  5.849   -2.060  1.00 0.00 ? 92  LEU A HD12 7  
ATOM 11121 H HD13 . LEU A 1 89  ? -3.350  5.815   -2.608  1.00 0.00 ? 92  LEU A HD13 7  
ATOM 11122 H HD21 . LEU A 1 89  ? -3.968  4.278   -4.552  1.00 0.00 ? 92  LEU A HD21 7  
ATOM 11123 H HD22 . LEU A 1 89  ? -2.692  3.367   -5.357  1.00 0.00 ? 92  LEU A HD22 7  
ATOM 11124 H HD23 . LEU A 1 89  ? -3.181  2.938   -3.717  1.00 0.00 ? 92  LEU A HD23 7  
ATOM 11125 N N    . GLY A 1 90  ? -0.788  3.502   -7.085  1.00 0.00 ? 93  GLY A N    7  
ATOM 11126 C CA   . GLY A 1 90  ? -1.292  2.515   -8.026  1.00 0.00 ? 93  GLY A CA   7  
ATOM 11127 C C    . GLY A 1 90  ? -0.328  1.357   -8.215  1.00 0.00 ? 93  GLY A C    7  
ATOM 11128 O O    . GLY A 1 90  ? 0.690   1.291   -7.532  1.00 0.00 ? 93  GLY A O    7  
ATOM 11129 H H    . GLY A 1 90  ? -0.007  3.291   -6.525  1.00 0.00 ? 93  GLY A H    7  
ATOM 11130 H HA2  . GLY A 1 90  ? -2.235  2.131   -7.659  1.00 0.00 ? 93  GLY A HA2  7  
ATOM 11131 H HA3  . GLY A 1 90  ? -1.454  2.994   -8.982  1.00 0.00 ? 93  GLY A HA3  7  
ATOM 11132 N N    . PRO A 1 91  ? -0.629  0.413   -9.125  1.00 0.00 ? 94  PRO A N    7  
ATOM 11133 C CA   . PRO A 1 91  ? 0.260   -0.719  -9.425  1.00 0.00 ? 94  PRO A CA   7  
ATOM 11134 C C    . PRO A 1 91  ? 1.604   -0.250  -9.979  1.00 0.00 ? 94  PRO A C    7  
ATOM 11135 O O    . PRO A 1 91  ? 1.708   0.117   -11.151 1.00 0.00 ? 94  PRO A O    7  
ATOM 11136 C CB   . PRO A 1 91  ? -0.505  -1.519  -10.491 1.00 0.00 ? 94  PRO A CB   7  
ATOM 11137 C CG   . PRO A 1 91  ? -1.917  -1.057  -10.390 1.00 0.00 ? 94  PRO A CG   7  
ATOM 11138 C CD   . PRO A 1 91  ? -1.855  0.374   -9.934  1.00 0.00 ? 94  PRO A CD   7  
ATOM 11139 H HA   . PRO A 1 91  ? 0.423   -1.336  -8.553  1.00 0.00 ? 94  PRO A HA   7  
ATOM 11140 H HB2  . PRO A 1 91  ? -0.091  -1.309  -11.467 1.00 0.00 ? 94  PRO A HB2  7  
ATOM 11141 H HB3  . PRO A 1 91  ? -0.423  -2.574  -10.281 1.00 0.00 ? 94  PRO A HB3  7  
ATOM 11142 H HG2  . PRO A 1 91  ? -2.395  -1.121  -11.359 1.00 0.00 ? 94  PRO A HG2  7  
ATOM 11143 H HG3  . PRO A 1 91  ? -2.451  -1.659  -9.669  1.00 0.00 ? 94  PRO A HG3  7  
ATOM 11144 H HD2  . PRO A 1 91  ? -1.778  1.041   -10.783 1.00 0.00 ? 94  PRO A HD2  7  
ATOM 11145 H HD3  . PRO A 1 91  ? -2.720  0.617   -9.339  1.00 0.00 ? 94  PRO A HD3  7  
ATOM 11146 N N    . PHE A 1 92  ? 2.631   -0.280  -9.140  1.00 0.00 ? 95  PHE A N    7  
ATOM 11147 C CA   . PHE A 1 92  ? 3.910   0.318   -9.493  1.00 0.00 ? 95  PHE A CA   7  
ATOM 11148 C C    . PHE A 1 92  ? 4.910   -0.724  -9.980  1.00 0.00 ? 95  PHE A C    7  
ATOM 11149 O O    . PHE A 1 92  ? 5.258   -0.759  -11.161 1.00 0.00 ? 95  PHE A O    7  
ATOM 11150 C CB   . PHE A 1 92  ? 4.488   1.072   -8.289  1.00 0.00 ? 95  PHE A CB   7  
ATOM 11151 C CG   . PHE A 1 92  ? 5.692   1.910   -8.614  1.00 0.00 ? 95  PHE A CG   7  
ATOM 11152 C CD1  . PHE A 1 92  ? 5.548   3.150   -9.217  1.00 0.00 ? 95  PHE A CD1  7  
ATOM 11153 C CD2  . PHE A 1 92  ? 6.970   1.462   -8.313  1.00 0.00 ? 95  PHE A CD2  7  
ATOM 11154 C CE1  . PHE A 1 92  ? 6.652   3.925   -9.514  1.00 0.00 ? 95  PHE A CE1  7  
ATOM 11155 C CE2  . PHE A 1 92  ? 8.077   2.233   -8.609  1.00 0.00 ? 95  PHE A CE2  7  
ATOM 11156 C CZ   . PHE A 1 92  ? 7.918   3.465   -9.211  1.00 0.00 ? 95  PHE A CZ   7  
ATOM 11157 H H    . PHE A 1 92  ? 2.528   -0.719  -8.268  1.00 0.00 ? 95  PHE A H    7  
ATOM 11158 H HA   . PHE A 1 92  ? 3.734   1.023   -10.289 1.00 0.00 ? 95  PHE A HA   7  
ATOM 11159 H HB2  . PHE A 1 92  ? 3.729   1.725   -7.883  1.00 0.00 ? 95  PHE A HB2  7  
ATOM 11160 H HB3  . PHE A 1 92  ? 4.777   0.354   -7.535  1.00 0.00 ? 95  PHE A HB3  7  
ATOM 11161 H HD1  . PHE A 1 92  ? 4.558   3.510   -9.456  1.00 0.00 ? 95  PHE A HD1  7  
ATOM 11162 H HD2  . PHE A 1 92  ? 7.097   0.499   -7.842  1.00 0.00 ? 95  PHE A HD2  7  
ATOM 11163 H HE1  . PHE A 1 92  ? 6.526   4.889   -9.984  1.00 0.00 ? 95  PHE A HE1  7  
ATOM 11164 H HE2  . PHE A 1 92  ? 9.067   1.870   -8.371  1.00 0.00 ? 95  PHE A HE2  7  
ATOM 11165 H HZ   . PHE A 1 92  ? 8.781   4.069   -9.443  1.00 0.00 ? 95  PHE A HZ   7  
ATOM 11166 N N    . LEU A 1 93  ? 5.355   -1.583  -9.075  1.00 0.00 ? 96  LEU A N    7  
ATOM 11167 C CA   . LEU A 1 93  ? 6.464   -2.479  -9.371  1.00 0.00 ? 96  LEU A CA   7  
ATOM 11168 C C    . LEU A 1 93  ? 6.014   -3.936  -9.397  1.00 0.00 ? 96  LEU A C    7  
ATOM 11169 O O    . LEU A 1 93  ? 5.045   -4.317  -8.732  1.00 0.00 ? 96  LEU A O    7  
ATOM 11170 C CB   . LEU A 1 93  ? 7.579   -2.288  -8.336  1.00 0.00 ? 96  LEU A CB   7  
ATOM 11171 C CG   . LEU A 1 93  ? 8.903   -2.985  -8.667  1.00 0.00 ? 96  LEU A CG   7  
ATOM 11172 C CD1  . LEU A 1 93  ? 9.457   -2.482  -9.995  1.00 0.00 ? 96  LEU A CD1  7  
ATOM 11173 C CD2  . LEU A 1 93  ? 9.911   -2.764  -7.550  1.00 0.00 ? 96  LEU A CD2  7  
ATOM 11174 H H    . LEU A 1 93  ? 4.918   -1.630  -8.198  1.00 0.00 ? 96  LEU A H    7  
ATOM 11175 H HA   . LEU A 1 93  ? 6.850   -2.220  -10.344 1.00 0.00 ? 96  LEU A HA   7  
ATOM 11176 H HB2  . LEU A 1 93  ? 7.769   -1.229  -8.235  1.00 0.00 ? 96  LEU A HB2  7  
ATOM 11177 H HB3  . LEU A 1 93  ? 7.229   -2.664  -7.386  1.00 0.00 ? 96  LEU A HB3  7  
ATOM 11178 H HG   . LEU A 1 93  ? 8.730   -4.047  -8.758  1.00 0.00 ? 96  LEU A HG   7  
ATOM 11179 H HD11 . LEU A 1 93  ? 9.656   -1.423  -9.924  1.00 0.00 ? 96  LEU A HD11 7  
ATOM 11180 H HD12 . LEU A 1 93  ? 10.373  -3.007  -10.225 1.00 0.00 ? 96  LEU A HD12 7  
ATOM 11181 H HD13 . LEU A 1 93  ? 8.735   -2.661  -10.777 1.00 0.00 ? 96  LEU A HD13 7  
ATOM 11182 H HD21 . LEU A 1 93  ? 10.840  -3.255  -7.800  1.00 0.00 ? 96  LEU A HD21 7  
ATOM 11183 H HD22 . LEU A 1 93  ? 10.087  -1.705  -7.430  1.00 0.00 ? 96  LEU A HD22 7  
ATOM 11184 H HD23 . LEU A 1 93  ? 9.523   -3.171  -6.629  1.00 0.00 ? 96  LEU A HD23 7  
ATOM 11185 N N    . LYS A 1 94  ? 6.717   -4.739  -10.184 1.00 0.00 ? 97  LYS A N    7  
ATOM 11186 C CA   . LYS A 1 94  ? 6.444   -6.163  -10.277 1.00 0.00 ? 97  LYS A CA   7  
ATOM 11187 C C    . LYS A 1 94  ? 7.449   -6.930  -9.430  1.00 0.00 ? 97  LYS A C    7  
ATOM 11188 O O    . LYS A 1 94  ? 8.639   -6.606  -9.420  1.00 0.00 ? 97  LYS A O    7  
ATOM 11189 C CB   . LYS A 1 94  ? 6.531   -6.667  -11.731 1.00 0.00 ? 97  LYS A CB   7  
ATOM 11190 C CG   . LYS A 1 94  ? 5.647   -5.936  -12.735 1.00 0.00 ? 97  LYS A CG   7  
ATOM 11191 C CD   . LYS A 1 94  ? 6.246   -4.604  -13.157 1.00 0.00 ? 97  LYS A CD   7  
ATOM 11192 C CE   . LYS A 1 94  ? 5.488   -3.990  -14.322 1.00 0.00 ? 97  LYS A CE   7  
ATOM 11193 N NZ   . LYS A 1 94  ? 5.554   -4.844  -15.539 1.00 0.00 ? 97  LYS A NZ   7  
ATOM 11194 H H    . LYS A 1 94  ? 7.451   -4.362  -10.710 1.00 0.00 ? 97  LYS A H    7  
ATOM 11195 H HA   . LYS A 1 94  ? 5.450   -6.342  -9.894  1.00 0.00 ? 97  LYS A HA   7  
ATOM 11196 H HB2  . LYS A 1 94  ? 7.553   -6.574  -12.064 1.00 0.00 ? 97  LYS A HB2  7  
ATOM 11197 H HB3  . LYS A 1 94  ? 6.258   -7.714  -11.747 1.00 0.00 ? 97  LYS A HB3  7  
ATOM 11198 H HG2  . LYS A 1 94  ? 5.527   -6.555  -13.612 1.00 0.00 ? 97  LYS A HG2  7  
ATOM 11199 H HG3  . LYS A 1 94  ? 4.679   -5.759  -12.286 1.00 0.00 ? 97  LYS A HG3  7  
ATOM 11200 H HD2  . LYS A 1 94  ? 6.208   -3.924  -12.318 1.00 0.00 ? 97  LYS A HD2  7  
ATOM 11201 H HD3  . LYS A 1 94  ? 7.274   -4.761  -13.448 1.00 0.00 ? 97  LYS A HD3  7  
ATOM 11202 H HE2  . LYS A 1 94  ? 4.455   -3.866  -14.038 1.00 0.00 ? 97  LYS A HE2  7  
ATOM 11203 H HE3  . LYS A 1 94  ? 5.919   -3.025  -14.545 1.00 0.00 ? 97  LYS A HE3  7  
ATOM 11204 H HZ1  . LYS A 1 94  ? 5.212   -4.300  -16.362 1.00 0.00 ? 97  LYS A HZ1  7  
ATOM 11205 H HZ3  . LYS A 1 94  ? 4.924   -5.669  -15.420 1.00 0.00 ? 97  LYS A HZ3  7  
ATOM 11206 N N    . THR A 1 95  ? 6.969   -7.934  -8.719  1.00 0.00 ? 98  THR A N    7  
ATOM 11207 C CA   . THR A 1 95  ? 7.832   -8.806  -7.945  1.00 0.00 ? 98  THR A CA   7  
ATOM 11208 C C    . THR A 1 95  ? 7.274   -10.223 -7.992  1.00 0.00 ? 98  THR A C    7  
ATOM 11209 O O    . THR A 1 95  ? 6.064   -10.413 -8.147  1.00 0.00 ? 98  THR A O    7  
ATOM 11210 C CB   . THR A 1 95  ? 7.970   -8.326  -6.480  1.00 0.00 ? 98  THR A CB   7  
ATOM 11211 O OG1  . THR A 1 95  ? 8.953   -9.112  -5.788  1.00 0.00 ? 98  THR A OG1  7  
ATOM 11212 C CG2  . THR A 1 95  ? 6.638   -8.412  -5.748  1.00 0.00 ? 98  THR A CG2  7  
ATOM 11213 H H    . THR A 1 95  ? 6.005   -8.105  -8.720  1.00 0.00 ? 98  THR A H    7  
ATOM 11214 H HA   . THR A 1 95  ? 8.811   -8.798  -8.402  1.00 0.00 ? 98  THR A HA   7  
ATOM 11215 H HB   . THR A 1 95  ? 8.291   -7.295  -6.489  1.00 0.00 ? 98  THR A HB   7  
ATOM 11216 H HG1  . THR A 1 95  ? 9.511   -8.531  -5.251  1.00 0.00 ? 98  THR A HG1  7  
ATOM 11217 H HG21 . THR A 1 95  ? 6.246   -9.415  -5.830  1.00 0.00 ? 98  THR A HG21 7  
ATOM 11218 H HG22 . THR A 1 95  ? 5.939   -7.717  -6.188  1.00 0.00 ? 98  THR A HG22 7  
ATOM 11219 H HG23 . THR A 1 95  ? 6.784   -8.168  -4.706  1.00 0.00 ? 98  THR A HG23 7  
ATOM 11220 N N    . TYR A 1 96  ? 8.145   -11.212 -7.879  1.00 0.00 ? 99  TYR A N    7  
ATOM 11221 C CA   . TYR A 1 96  ? 7.739   -12.598 -8.044  1.00 0.00 ? 99  TYR A CA   7  
ATOM 11222 C C    . TYR A 1 96  ? 7.770   -13.335 -6.713  1.00 0.00 ? 99  TYR A C    7  
ATOM 11223 O O    . TYR A 1 96  ? 8.480   -14.327 -6.543  1.00 0.00 ? 99  TYR A O    7  
ATOM 11224 C CB   . TYR A 1 96  ? 8.634   -13.288 -9.080  1.00 0.00 ? 99  TYR A CB   7  
ATOM 11225 C CG   . TYR A 1 96  ? 8.643   -12.576 -10.419 1.00 0.00 ? 99  TYR A CG   7  
ATOM 11226 C CD1  . TYR A 1 96  ? 7.552   -12.651 -11.275 1.00 0.00 ? 99  TYR A CD1  7  
ATOM 11227 C CD2  . TYR A 1 96  ? 9.740   -11.820 -10.824 1.00 0.00 ? 99  TYR A CD2  7  
ATOM 11228 C CE1  . TYR A 1 96  ? 7.551   -11.999 -12.492 1.00 0.00 ? 99  TYR A CE1  7  
ATOM 11229 C CE2  . TYR A 1 96  ? 9.746   -11.166 -12.041 1.00 0.00 ? 99  TYR A CE2  7  
ATOM 11230 C CZ   . TYR A 1 96  ? 8.649   -11.257 -12.870 1.00 0.00 ? 99  TYR A CZ   7  
ATOM 11231 O OH   . TYR A 1 96  ? 8.653   -10.610 -14.085 1.00 0.00 ? 99  TYR A OH   7  
ATOM 11232 H H    . TYR A 1 96  ? 9.084   -11.004 -7.670  1.00 0.00 ? 99  TYR A H    7  
ATOM 11233 H HA   . TYR A 1 96  ? 6.722   -12.597 -8.410  1.00 0.00 ? 99  TYR A HA   7  
ATOM 11234 H HB2  . TYR A 1 96  ? 9.647   -13.321 -8.710  1.00 0.00 ? 99  TYR A HB2  7  
ATOM 11235 H HB3  . TYR A 1 96  ? 8.280   -14.295 -9.241  1.00 0.00 ? 99  TYR A HB3  7  
ATOM 11236 H HD1  . TYR A 1 96  ? 6.691   -13.234 -10.979 1.00 0.00 ? 99  TYR A HD1  7  
ATOM 11237 H HD2  . TYR A 1 96  ? 10.601  -11.751 -10.174 1.00 0.00 ? 99  TYR A HD2  7  
ATOM 11238 H HE1  . TYR A 1 96  ? 6.692   -12.071 -13.143 1.00 0.00 ? 99  TYR A HE1  7  
ATOM 11239 H HE2  . TYR A 1 96  ? 10.608  -10.584 -12.337 1.00 0.00 ? 99  TYR A HE2  7  
ATOM 11240 H HH   . TYR A 1 96  ? 9.471   -10.831 -14.563 1.00 0.00 ? 99  TYR A HH   7  
ATOM 11241 N N    . THR A 1 97  ? 7.008   -12.825 -5.762  1.00 0.00 ? 100 THR A N    7  
ATOM 11242 C CA   . THR A 1 97  ? 6.850   -13.473 -4.472  1.00 0.00 ? 100 THR A CA   7  
ATOM 11243 C C    . THR A 1 97  ? 5.414   -13.287 -3.972  1.00 0.00 ? 100 THR A C    7  
ATOM 11244 O O    . THR A 1 97  ? 5.134   -12.420 -3.142  1.00 0.00 ? 100 THR A O    7  
ATOM 11245 C CB   . THR A 1 97  ? 7.852   -12.918 -3.435  1.00 0.00 ? 100 THR A CB   7  
ATOM 11246 O OG1  . THR A 1 97  ? 9.182   -12.980 -3.970  1.00 0.00 ? 100 THR A OG1  7  
ATOM 11247 C CG2  . THR A 1 97  ? 7.791   -13.711 -2.136  1.00 0.00 ? 100 THR A CG2  7  
ATOM 11248 H H    . THR A 1 97  ? 6.538   -11.982 -5.929  1.00 0.00 ? 100 THR A H    7  
ATOM 11249 H HA   . THR A 1 97  ? 7.041   -14.528 -4.604  1.00 0.00 ? 100 THR A HA   7  
ATOM 11250 H HB   . THR A 1 97  ? 7.599   -11.889 -3.228  1.00 0.00 ? 100 THR A HB   7  
ATOM 11251 H HG1  . THR A 1 97  ? 9.157   -13.415 -4.834  1.00 0.00 ? 100 THR A HG1  7  
ATOM 11252 H HG21 . THR A 1 97  ? 8.035   -14.744 -2.332  1.00 0.00 ? 100 THR A HG21 7  
ATOM 11253 H HG22 . THR A 1 97  ? 6.794   -13.648 -1.724  1.00 0.00 ? 100 THR A HG22 7  
ATOM 11254 H HG23 . THR A 1 97  ? 8.500   -13.302 -1.430  1.00 0.00 ? 100 THR A HG23 7  
ATOM 11255 N N    . PRO A 1 98  ? 4.478   -14.101 -4.490  1.00 0.00 ? 101 PRO A N    7  
ATOM 11256 C CA   . PRO A 1 98  ? 3.056   -14.007 -4.157  1.00 0.00 ? 101 PRO A CA   7  
ATOM 11257 C C    . PRO A 1 98  ? 2.737   -14.630 -2.801  1.00 0.00 ? 101 PRO A C    7  
ATOM 11258 O O    . PRO A 1 98  ? 1.920   -15.546 -2.698  1.00 0.00 ? 101 PRO A O    7  
ATOM 11259 C CB   . PRO A 1 98  ? 2.356   -14.789 -5.286  1.00 0.00 ? 101 PRO A CB   7  
ATOM 11260 C CG   . PRO A 1 98  ? 3.440   -15.226 -6.223  1.00 0.00 ? 101 PRO A CG   7  
ATOM 11261 C CD   . PRO A 1 98  ? 4.722   -15.185 -5.443  1.00 0.00 ? 101 PRO A CD   7  
ATOM 11262 H HA   . PRO A 1 98  ? 2.718   -12.981 -4.162  1.00 0.00 ? 101 PRO A HA   7  
ATOM 11263 H HB2  . PRO A 1 98  ? 1.840   -15.638 -4.865  1.00 0.00 ? 101 PRO A HB2  7  
ATOM 11264 H HB3  . PRO A 1 98  ? 1.646   -14.145 -5.782  1.00 0.00 ? 101 PRO A HB3  7  
ATOM 11265 H HG2  . PRO A 1 98  ? 3.245   -16.232 -6.565  1.00 0.00 ? 101 PRO A HG2  7  
ATOM 11266 H HG3  . PRO A 1 98  ? 3.492   -14.549 -7.064  1.00 0.00 ? 101 PRO A HG3  7  
ATOM 11267 H HD2  . PRO A 1 98  ? 4.884   -16.122 -4.930  1.00 0.00 ? 101 PRO A HD2  7  
ATOM 11268 H HD3  . PRO A 1 98  ? 5.555   -14.952 -6.089  1.00 0.00 ? 101 PRO A HD3  7  
ATOM 11269 N N    . GLN A 1 99  ? 3.390   -14.133 -1.765  1.00 0.00 ? 102 GLN A N    7  
ATOM 11270 C CA   . GLN A 1 99  ? 3.164   -14.625 -0.417  1.00 0.00 ? 102 GLN A CA   7  
ATOM 11271 C C    . GLN A 1 99  ? 3.265   -13.484 0.584   1.00 0.00 ? 102 GLN A C    7  
ATOM 11272 O O    . GLN A 1 99  ? 2.472   -13.390 1.518   1.00 0.00 ? 102 GLN A O    7  
ATOM 11273 C CB   . GLN A 1 99  ? 4.170   -15.724 -0.064  1.00 0.00 ? 102 GLN A CB   7  
ATOM 11274 C CG   . GLN A 1 99  ? 3.853   -16.435 1.244   1.00 0.00 ? 102 GLN A CG   7  
ATOM 11275 C CD   . GLN A 1 99  ? 2.728   -17.456 1.128   1.00 0.00 ? 102 GLN A CD   7  
ATOM 11276 O OE1  . GLN A 1 99  ? 2.684   -18.423 1.889   1.00 0.00 ? 102 GLN A OE1  7  
ATOM 11277 N NE2  . GLN A 1 99  ? 1.826   -17.270 0.174   1.00 0.00 ? 102 GLN A NE2  7  
ATOM 11278 H H    . GLN A 1 99  ? 4.036   -13.409 -1.913  1.00 0.00 ? 102 GLN A H    7  
ATOM 11279 H HA   . GLN A 1 99  ? 2.166   -15.035 -0.378  1.00 0.00 ? 102 GLN A HA   7  
ATOM 11280 H HB2  . GLN A 1 99  ? 4.178   -16.458 -0.856  1.00 0.00 ? 102 GLN A HB2  7  
ATOM 11281 H HB3  . GLN A 1 99  ? 5.151   -15.283 0.020   1.00 0.00 ? 102 GLN A HB3  7  
ATOM 11282 H HG2  . GLN A 1 99  ? 4.741   -16.946 1.582   1.00 0.00 ? 102 GLN A HG2  7  
ATOM 11283 H HG3  . GLN A 1 99  ? 3.568   -15.693 1.976   1.00 0.00 ? 102 GLN A HG3  7  
ATOM 11284 H HE21 . GLN A 1 99  ? 1.920   -16.490 -0.413  1.00 0.00 ? 102 GLN A HE21 7  
ATOM 11285 H HE22 . GLN A 1 99  ? 1.102   -17.932 0.086   1.00 0.00 ? 102 GLN A HE22 7  
ATOM 11286 N N    . SER A 1 100 ? 4.241   -12.613 0.374   1.00 0.00 ? 103 SER A N    7  
ATOM 11287 C CA   . SER A 1 100 ? 4.423   -11.451 1.224   1.00 0.00 ? 103 SER A CA   7  
ATOM 11288 C C    . SER A 1 100 ? 3.418   -10.362 0.864   1.00 0.00 ? 103 SER A C    7  
ATOM 11289 O O    . SER A 1 100 ? 3.265   -9.373  1.582   1.00 0.00 ? 103 SER A O    7  
ATOM 11290 C CB   . SER A 1 100 ? 5.854   -10.938 1.078   1.00 0.00 ? 103 SER A CB   7  
ATOM 11291 O OG   . SER A 1 100 ? 6.239   -10.911 -0.287  1.00 0.00 ? 103 SER A OG   7  
ATOM 11292 H H    . SER A 1 100 ? 4.865   -12.756 -0.370  1.00 0.00 ? 103 SER A H    7  
ATOM 11293 H HA   . SER A 1 100 ? 4.259   -11.758 2.246   1.00 0.00 ? 103 SER A HA   7  
ATOM 11294 H HB2  . SER A 1 100 ? 5.919   -9.939  1.481   1.00 0.00 ? 103 SER A HB2  7  
ATOM 11295 H HB3  . SER A 1 100 ? 6.526   -11.589 1.618   1.00 0.00 ? 103 SER A HB3  7  
ATOM 11296 H HG   . SER A 1 100 ? 6.297   -9.996  -0.584  1.00 0.00 ? 103 SER A HG   7  
ATOM 11297 N N    . SER A 1 101 ? 2.738   -10.557 -0.255  1.00 0.00 ? 104 SER A N    7  
ATOM 11298 C CA   . SER A 1 101 ? 1.723   -9.628  -0.712  1.00 0.00 ? 104 SER A CA   7  
ATOM 11299 C C    . SER A 1 101 ? 0.348   -10.003 -0.152  1.00 0.00 ? 104 SER A C    7  
ATOM 11300 O O    . SER A 1 101 ? 0.018   -11.187 -0.014  1.00 0.00 ? 104 SER A O    7  
ATOM 11301 C CB   . SER A 1 101 ? 1.706   -9.616  -2.240  1.00 0.00 ? 104 SER A CB   7  
ATOM 11302 O OG   . SER A 1 101 ? 1.712   -10.938 -2.758  1.00 0.00 ? 104 SER A OG   7  
ATOM 11303 H H    . SER A 1 101 ? 2.926   -11.351 -0.796  1.00 0.00 ? 104 SER A H    7  
ATOM 11304 H HA   . SER A 1 101 ? 1.989   -8.645  -0.353  1.00 0.00 ? 104 SER A HA   7  
ATOM 11305 H HB2  . SER A 1 101 ? 0.819   -9.109  -2.586  1.00 0.00 ? 104 SER A HB2  7  
ATOM 11306 H HB3  . SER A 1 101 ? 2.581   -9.098  -2.602  1.00 0.00 ? 104 SER A HB3  7  
ATOM 11307 H HG   . SER A 1 101 ? 1.177   -10.967 -3.557  1.00 0.00 ? 104 SER A HG   7  
ATOM 11308 N N    . ILE A 1 102 ? -0.448  -8.993  0.176   1.00 0.00 ? 105 ILE A N    7  
ATOM 11309 C CA   . ILE A 1 102 ? -1.761  -9.210  0.763   1.00 0.00 ? 105 ILE A CA   7  
ATOM 11310 C C    . ILE A 1 102 ? -2.865  -8.541  -0.047  1.00 0.00 ? 105 ILE A C    7  
ATOM 11311 O O    . ILE A 1 102 ? -2.632  -7.568  -0.771  1.00 0.00 ? 105 ILE A O    7  
ATOM 11312 C CB   . ILE A 1 102 ? -1.839  -8.694  2.218   1.00 0.00 ? 105 ILE A CB   7  
ATOM 11313 C CG1  . ILE A 1 102 ? -1.375  -7.232  2.297   1.00 0.00 ? 105 ILE A CG1  7  
ATOM 11314 C CG2  . ILE A 1 102 ? -1.031  -9.588  3.152   1.00 0.00 ? 105 ILE A CG2  7  
ATOM 11315 C CD1  . ILE A 1 102 ? -1.562  -6.598  3.659   1.00 0.00 ? 105 ILE A CD1  7  
ATOM 11316 H H    . ILE A 1 102 ? -0.141  -8.072  0.018   1.00 0.00 ? 105 ILE A H    7  
ATOM 11317 H HA   . ILE A 1 102 ? -1.941  -10.273 0.777   1.00 0.00 ? 105 ILE A HA   7  
ATOM 11318 H HB   . ILE A 1 102 ? -2.871  -8.746  2.528   1.00 0.00 ? 105 ILE A HB   7  
ATOM 11319 H HG12 . ILE A 1 102 ? -0.328  -7.178  2.050   1.00 0.00 ? 105 ILE A HG12 7  
ATOM 11320 H HG13 . ILE A 1 102 ? -1.936  -6.647  1.583   1.00 0.00 ? 105 ILE A HG13 7  
ATOM 11321 H HG21 . ILE A 1 102 ? -1.006  -9.152  4.139   1.00 0.00 ? 105 ILE A HG21 7  
ATOM 11322 H HG22 . ILE A 1 102 ? -1.492  -10.564 3.204   1.00 0.00 ? 105 ILE A HG22 7  
ATOM 11323 H HG23 . ILE A 1 102 ? -0.023  -9.689  2.778   1.00 0.00 ? 105 ILE A HG23 7  
ATOM 11324 H HD11 . ILE A 1 102 ? -1.242  -5.567  3.622   1.00 0.00 ? 105 ILE A HD11 7  
ATOM 11325 H HD12 . ILE A 1 102 ? -2.605  -6.641  3.933   1.00 0.00 ? 105 ILE A HD12 7  
ATOM 11326 H HD13 . ILE A 1 102 ? -0.976  -7.131  4.391   1.00 0.00 ? 105 ILE A HD13 7  
ATOM 11327 N N    . ILE A 1 103 ? -4.060  -9.091  0.083   1.00 0.00 ? 106 ILE A N    7  
ATOM 11328 C CA   . ILE A 1 103 ? -5.267  -8.515  -0.484  1.00 0.00 ? 106 ILE A CA   7  
ATOM 11329 C C    . ILE A 1 103 ? -6.231  -8.189  0.648   1.00 0.00 ? 106 ILE A C    7  
ATOM 11330 O O    . ILE A 1 103 ? -6.468  -9.022  1.527   1.00 0.00 ? 106 ILE A O    7  
ATOM 11331 C CB   . ILE A 1 103 ? -5.940  -9.477  -1.500  1.00 0.00 ? 106 ILE A CB   7  
ATOM 11332 C CG1  . ILE A 1 103 ? -5.356  -9.271  -2.897  1.00 0.00 ? 106 ILE A CG1  7  
ATOM 11333 C CG2  . ILE A 1 103 ? -7.454  -9.300  -1.523  1.00 0.00 ? 106 ILE A CG2  7  
ATOM 11334 C CD1  . ILE A 1 103 ? -5.818  -10.303 -3.908  1.00 0.00 ? 106 ILE A CD1  7  
ATOM 11335 H H    . ILE A 1 103 ? -4.139  -9.923  0.605   1.00 0.00 ? 106 ILE A H    7  
ATOM 11336 H HA   . ILE A 1 103 ? -4.997  -7.600  -0.996  1.00 0.00 ? 106 ILE A HA   7  
ATOM 11337 H HB   . ILE A 1 103 ? -5.732  -10.487 -1.186  1.00 0.00 ? 106 ILE A HB   7  
ATOM 11338 H HG12 . ILE A 1 103 ? -5.656  -8.298  -3.261  1.00 0.00 ? 106 ILE A HG12 7  
ATOM 11339 H HG13 . ILE A 1 103 ? -4.279  -9.315  -2.840  1.00 0.00 ? 106 ILE A HG13 7  
ATOM 11340 H HG21 . ILE A 1 103 ? -7.853  -9.503  -0.539  1.00 0.00 ? 106 ILE A HG21 7  
ATOM 11341 H HG22 . ILE A 1 103 ? -7.694  -8.287  -1.807  1.00 0.00 ? 106 ILE A HG22 7  
ATOM 11342 H HG23 . ILE A 1 103 ? -7.886  -9.986  -2.235  1.00 0.00 ? 106 ILE A HG23 7  
ATOM 11343 H HD11 . ILE A 1 103 ? -5.342  -10.114 -4.858  1.00 0.00 ? 106 ILE A HD11 7  
ATOM 11344 H HD12 . ILE A 1 103 ? -5.550  -11.291 -3.560  1.00 0.00 ? 106 ILE A HD12 7  
ATOM 11345 H HD13 . ILE A 1 103 ? -6.890  -10.241 -4.022  1.00 0.00 ? 106 ILE A HD13 7  
ATOM 11346 N N    . CYS A 1 104 ? -6.763  -6.980  0.649   1.00 0.00 ? 107 CYS A N    7  
ATOM 11347 C CA   . CYS A 1 104 ? -7.681  -6.578  1.693   1.00 0.00 ? 107 CYS A CA   7  
ATOM 11348 C C    . CYS A 1 104 ? -9.034  -6.234  1.090   1.00 0.00 ? 107 CYS A C    7  
ATOM 11349 O O    . CYS A 1 104 ? -9.125  -5.851  -0.077  1.00 0.00 ? 107 CYS A O    7  
ATOM 11350 C CB   . CYS A 1 104 ? -7.117  -5.385  2.467   1.00 0.00 ? 107 CYS A CB   7  
ATOM 11351 S SG   . CYS A 1 104 ? -7.562  -5.384  4.232   1.00 0.00 ? 107 CYS A SG   7  
ATOM 11352 H H    . CYS A 1 104 ? -6.538  -6.345  -0.068  1.00 0.00 ? 107 CYS A H    7  
ATOM 11353 H HA   . CYS A 1 104 ? -7.803  -7.411  2.369   1.00 0.00 ? 107 CYS A HA   7  
ATOM 11354 H HB2  . CYS A 1 104 ? -6.038  -5.395  2.399   1.00 0.00 ? 107 CYS A HB2  7  
ATOM 11355 H HB3  . CYS A 1 104 ? -7.494  -4.470  2.032   1.00 0.00 ? 107 CYS A HB3  7  
ATOM 11356 N N    . TYR A 1 105 ? -10.083 -6.384  1.879   1.00 0.00 ? 108 TYR A N    7  
ATOM 11357 C CA   . TYR A 1 105 ? -11.431 -6.143  1.404   1.00 0.00 ? 108 TYR A CA   7  
ATOM 11358 C C    . TYR A 1 105 ? -12.226 -5.374  2.447   1.00 0.00 ? 108 TYR A C    7  
ATOM 11359 O O    . TYR A 1 105 ? -11.785 -5.224  3.586   1.00 0.00 ? 108 TYR A O    7  
ATOM 11360 C CB   . TYR A 1 105 ? -12.122 -7.470  1.056   1.00 0.00 ? 108 TYR A CB   7  
ATOM 11361 C CG   . TYR A 1 105 ? -12.019 -8.522  2.140   1.00 0.00 ? 108 TYR A CG   7  
ATOM 11362 C CD1  . TYR A 1 105 ? -12.941 -8.573  3.180   1.00 0.00 ? 108 TYR A CD1  7  
ATOM 11363 C CD2  . TYR A 1 105 ? -11.000 -9.468  2.122   1.00 0.00 ? 108 TYR A CD2  7  
ATOM 11364 C CE1  . TYR A 1 105 ? -12.849 -9.531  4.168   1.00 0.00 ? 108 TYR A CE1  7  
ATOM 11365 C CE2  . TYR A 1 105 ? -10.904 -10.431 3.104   1.00 0.00 ? 108 TYR A CE2  7  
ATOM 11366 C CZ   . TYR A 1 105 ? -11.830 -10.457 4.125   1.00 0.00 ? 108 TYR A CZ   7  
ATOM 11367 O OH   . TYR A 1 105 ? -11.740 -11.416 5.104   1.00 0.00 ? 108 TYR A OH   7  
ATOM 11368 H H    . TYR A 1 105 ? -9.949  -6.653  2.812   1.00 0.00 ? 108 TYR A H    7  
ATOM 11369 H HA   . TYR A 1 105 ? -11.361 -5.541  0.511   1.00 0.00 ? 108 TYR A HA   7  
ATOM 11370 H HB2  . TYR A 1 105 ? -13.170 -7.287  0.874   1.00 0.00 ? 108 TYR A HB2  7  
ATOM 11371 H HB3  . TYR A 1 105 ? -11.673 -7.873  0.159   1.00 0.00 ? 108 TYR A HB3  7  
ATOM 11372 H HD1  . TYR A 1 105 ? -13.739 -7.846  3.211   1.00 0.00 ? 108 TYR A HD1  7  
ATOM 11373 H HD2  . TYR A 1 105 ? -10.277 -9.444  1.321   1.00 0.00 ? 108 TYR A HD2  7  
ATOM 11374 H HE1  . TYR A 1 105 ? -13.574 -9.554  4.967   1.00 0.00 ? 108 TYR A HE1  7  
ATOM 11375 H HE2  . TYR A 1 105 ? -10.105 -11.156 3.072   1.00 0.00 ? 108 TYR A HE2  7  
ATOM 11376 H HH   . TYR A 1 105 ? -12.631 -11.754 5.303   1.00 0.00 ? 108 TYR A HH   7  
ATOM 11377 N N    . GLY A 1 106 ? -13.390 -4.884  2.052   1.00 0.00 ? 109 GLY A N    7  
ATOM 11378 C CA   . GLY A 1 106 ? -14.207 -4.103  2.952   1.00 0.00 ? 109 GLY A CA   7  
ATOM 11379 C C    . GLY A 1 106 ? -14.394 -2.692  2.446   1.00 0.00 ? 109 GLY A C    7  
ATOM 11380 O O    . GLY A 1 106 ? -15.171 -2.455  1.521   1.00 0.00 ? 109 GLY A O    7  
ATOM 11381 H H    . GLY A 1 106 ? -13.696 -5.048  1.136   1.00 0.00 ? 109 GLY A H    7  
ATOM 11382 H HA2  . GLY A 1 106 ? -15.175 -4.573  3.048   1.00 0.00 ? 109 GLY A HA2  7  
ATOM 11383 H HA3  . GLY A 1 106 ? -13.733 -4.069  3.920   1.00 0.00 ? 109 GLY A HA3  7  
ATOM 11384 N N    . GLN A 1 107 ? -13.659 -1.757  3.030   1.00 0.00 ? 110 GLN A N    7  
ATOM 11385 C CA   . GLN A 1 107 ? -13.746 -0.360  2.640   1.00 0.00 ? 110 GLN A CA   7  
ATOM 11386 C C    . GLN A 1 107 ? -12.364 0.159   2.261   1.00 0.00 ? 110 GLN A C    7  
ATOM 11387 O O    . GLN A 1 107 ? -11.377 -0.147  2.935   1.00 0.00 ? 110 GLN A O    7  
ATOM 11388 C CB   . GLN A 1 107 ? -14.323 0.481   3.784   1.00 0.00 ? 110 GLN A CB   7  
ATOM 11389 C CG   . GLN A 1 107 ? -15.670 -0.006  4.316   1.00 0.00 ? 110 GLN A CG   7  
ATOM 11390 C CD   . GLN A 1 107 ? -16.840 0.201   3.360   1.00 0.00 ? 110 GLN A CD   7  
ATOM 11391 O OE1  . GLN A 1 107 ? -17.971 0.415   3.797   1.00 0.00 ? 110 GLN A OE1  7  
ATOM 11392 N NE2  . GLN A 1 107 ? -16.598 0.121   2.062   1.00 0.00 ? 110 GLN A NE2  7  
ATOM 11393 H H    . GLN A 1 107 ? -13.032 -2.015  3.737   1.00 0.00 ? 110 GLN A H    7  
ATOM 11394 H HA   . GLN A 1 107 ? -14.400 -0.290  1.783   1.00 0.00 ? 110 GLN A HA   7  
ATOM 11395 H HB2  . GLN A 1 107 ? -13.620 0.475   4.602   1.00 0.00 ? 110 GLN A HB2  7  
ATOM 11396 H HB3  . GLN A 1 107 ? -14.445 1.497   3.437   1.00 0.00 ? 110 GLN A HB3  7  
ATOM 11397 H HG2  . GLN A 1 107 ? -15.594 -1.061  4.527   1.00 0.00 ? 110 GLN A HG2  7  
ATOM 11398 H HG3  . GLN A 1 107 ? -15.884 0.523   5.235   1.00 0.00 ? 110 GLN A HG3  7  
ATOM 11399 H HE21 . GLN A 1 107 ? -15.684 -0.064  1.768   1.00 0.00 ? 110 GLN A HE21 7  
ATOM 11400 H HE22 . GLN A 1 107 ? -17.357 0.234   1.439   1.00 0.00 ? 110 GLN A HE22 7  
ATOM 11401 N N    . LEU A 1 108 ? -12.306 0.922   1.170   1.00 0.00 ? 111 LEU A N    7  
ATOM 11402 C CA   . LEU A 1 108 ? -11.058 1.502   0.678   1.00 0.00 ? 111 LEU A CA   7  
ATOM 11403 C C    . LEU A 1 108 ? -10.326 2.267   1.774   1.00 0.00 ? 111 LEU A C    7  
ATOM 11404 O O    . LEU A 1 108 ? -10.826 3.268   2.295   1.00 0.00 ? 111 LEU A O    7  
ATOM 11405 C CB   . LEU A 1 108 ? -11.339 2.429   -0.510  1.00 0.00 ? 111 LEU A CB   7  
ATOM 11406 C CG   . LEU A 1 108 ? -10.127 3.200   -1.044  1.00 0.00 ? 111 LEU A CG   7  
ATOM 11407 C CD1  . LEU A 1 108 ? -9.057  2.247   -1.551  1.00 0.00 ? 111 LEU A CD1  7  
ATOM 11408 C CD2  . LEU A 1 108 ? -10.546 4.155   -2.148  1.00 0.00 ? 111 LEU A CD2  7  
ATOM 11409 H H    . LEU A 1 108 ? -13.135 1.090   0.665   1.00 0.00 ? 111 LEU A H    7  
ATOM 11410 H HA   . LEU A 1 108 ? -10.427 0.692   0.346   1.00 0.00 ? 111 LEU A HA   7  
ATOM 11411 H HB2  . LEU A 1 108 ? -11.743 1.833   -1.317  1.00 0.00 ? 111 LEU A HB2  7  
ATOM 11412 H HB3  . LEU A 1 108 ? -12.088 3.145   -0.207  1.00 0.00 ? 111 LEU A HB3  7  
ATOM 11413 H HG   . LEU A 1 108 ? -9.699  3.784   -0.240  1.00 0.00 ? 111 LEU A HG   7  
ATOM 11414 H HD11 . LEU A 1 108 ? -8.754  1.588   -0.751  1.00 0.00 ? 111 LEU A HD11 7  
ATOM 11415 H HD12 . LEU A 1 108 ? -9.454  1.664   -2.368  1.00 0.00 ? 111 LEU A HD12 7  
ATOM 11416 H HD13 . LEU A 1 108 ? -8.206  2.815   -1.894  1.00 0.00 ? 111 LEU A HD13 7  
ATOM 11417 H HD21 . LEU A 1 108 ? -9.676  4.670   -2.528  1.00 0.00 ? 111 LEU A HD21 7  
ATOM 11418 H HD22 . LEU A 1 108 ? -11.011 3.597   -2.948  1.00 0.00 ? 111 LEU A HD22 7  
ATOM 11419 H HD23 . LEU A 1 108 ? -11.250 4.874   -1.756  1.00 0.00 ? 111 LEU A HD23 7  
ATOM 11420 N N    . GLY A 1 109 ? -9.142  1.780   2.123   1.00 0.00 ? 112 GLY A N    7  
ATOM 11421 C CA   . GLY A 1 109 ? -8.333  2.434   3.128   1.00 0.00 ? 112 GLY A CA   7  
ATOM 11422 C C    . GLY A 1 109 ? -8.278  1.657   4.423   1.00 0.00 ? 112 GLY A C    7  
ATOM 11423 O O    . GLY A 1 109 ? -7.449  1.938   5.294   1.00 0.00 ? 112 GLY A O    7  
ATOM 11424 H H    . GLY A 1 109 ? -8.815  0.965   1.690   1.00 0.00 ? 112 GLY A H    7  
ATOM 11425 H HA2  . GLY A 1 109 ? -7.328  2.550   2.749   1.00 0.00 ? 112 GLY A HA2  7  
ATOM 11426 H HA3  . GLY A 1 109 ? -8.748  3.412   3.326   1.00 0.00 ? 112 GLY A HA3  7  
ATOM 11427 N N    . SER A 1 110 ? -9.161  0.681   4.560   1.00 0.00 ? 113 SER A N    7  
ATOM 11428 C CA   . SER A 1 110 ? -9.226  -0.108  5.772   1.00 0.00 ? 113 SER A CA   7  
ATOM 11429 C C    . SER A 1 110 ? -8.492  -1.435  5.594   1.00 0.00 ? 113 SER A C    7  
ATOM 11430 O O    . SER A 1 110 ? -8.685  -2.143  4.605   1.00 0.00 ? 113 SER A O    7  
ATOM 11431 C CB   . SER A 1 110 ? -10.685 -0.350  6.167   1.00 0.00 ? 113 SER A CB   7  
ATOM 11432 O OG   . SER A 1 110 ? -10.792 -0.788  7.512   1.00 0.00 ? 113 SER A OG   7  
ATOM 11433 H H    . SER A 1 110 ? -9.790  0.490   3.827   1.00 0.00 ? 113 SER A H    7  
ATOM 11434 H HA   . SER A 1 110 ? -8.740  0.453   6.555   1.00 0.00 ? 113 SER A HA   7  
ATOM 11435 H HB2  . SER A 1 110 ? -11.240 0.568   6.059   1.00 0.00 ? 113 SER A HB2  7  
ATOM 11436 H HB3  . SER A 1 110 ? -11.109 -1.106  5.521   1.00 0.00 ? 113 SER A HB3  7  
ATOM 11437 H HG   . SER A 1 110 ? -10.508 -0.074  8.101   1.00 0.00 ? 113 SER A HG   7  
ATOM 11438 N N    . PHE A 1 111 ? -7.654  -1.752  6.566   1.00 0.00 ? 114 PHE A N    7  
ATOM 11439 C CA   . PHE A 1 111 ? -6.894  -2.992  6.580   1.00 0.00 ? 114 PHE A CA   7  
ATOM 11440 C C    . PHE A 1 111 ? -7.366  -3.851  7.747   1.00 0.00 ? 114 PHE A C    7  
ATOM 11441 O O    . PHE A 1 111 ? -6.563  -4.476  8.438   1.00 0.00 ? 114 PHE A O    7  
ATOM 11442 C CB   . PHE A 1 111 ? -5.392  -2.710  6.731   1.00 0.00 ? 114 PHE A CB   7  
ATOM 11443 C CG   . PHE A 1 111 ? -4.774  -1.966  5.580   1.00 0.00 ? 114 PHE A CG   7  
ATOM 11444 C CD1  . PHE A 1 111 ? -4.793  -0.581  5.543   1.00 0.00 ? 114 PHE A CD1  7  
ATOM 11445 C CD2  . PHE A 1 111 ? -4.160  -2.652  4.544   1.00 0.00 ? 114 PHE A CD2  7  
ATOM 11446 C CE1  . PHE A 1 111 ? -4.216  0.105   4.494   1.00 0.00 ? 114 PHE A CE1  7  
ATOM 11447 C CE2  . PHE A 1 111 ? -3.579  -1.969  3.494   1.00 0.00 ? 114 PHE A CE2  7  
ATOM 11448 C CZ   . PHE A 1 111 ? -3.607  -0.589  3.469   1.00 0.00 ? 114 PHE A CZ   7  
ATOM 11449 H H    . PHE A 1 111 ? -7.561  -1.140  7.324   1.00 0.00 ? 114 PHE A H    7  
ATOM 11450 H HA   . PHE A 1 111 ? -7.074  -3.514  5.653   1.00 0.00 ? 114 PHE A HA   7  
ATOM 11451 H HB2  . PHE A 1 111 ? -5.235  -2.121  7.623   1.00 0.00 ? 114 PHE A HB2  7  
ATOM 11452 H HB3  . PHE A 1 111 ? -4.869  -3.648  6.838   1.00 0.00 ? 114 PHE A HB3  7  
ATOM 11453 H HD1  . PHE A 1 111 ? -5.267  -0.036  6.344   1.00 0.00 ? 114 PHE A HD1  7  
ATOM 11454 H HD2  . PHE A 1 111 ? -4.139  -3.731  4.560   1.00 0.00 ? 114 PHE A HD2  7  
ATOM 11455 H HE1  . PHE A 1 111 ? -4.238  1.185   4.476   1.00 0.00 ? 114 PHE A HE1  7  
ATOM 11456 H HE2  . PHE A 1 111 ? -3.104  -2.515  2.691   1.00 0.00 ? 114 PHE A HE2  7  
ATOM 11457 H HZ   . PHE A 1 111 ? -3.154  -0.054  2.648   1.00 0.00 ? 114 PHE A HZ   7  
ATOM 11458 N N    . SER A 1 112 ? -8.674  -3.846  7.973   1.00 0.00 ? 115 SER A N    7  
ATOM 11459 C CA   . SER A 1 112 ? -9.269  -4.519  9.124   1.00 0.00 ? 115 SER A CA   7  
ATOM 11460 C C    . SER A 1 112 ? -8.974  -6.019  9.100   1.00 0.00 ? 115 SER A C    7  
ATOM 11461 O O    . SER A 1 112 ? -8.623  -6.607  10.125  1.00 0.00 ? 115 SER A O    7  
ATOM 11462 C CB   . SER A 1 112 ? -10.783 -4.276  9.149   1.00 0.00 ? 115 SER A CB   7  
ATOM 11463 O OG   . SER A 1 112 ? -11.364 -4.727  10.361  1.00 0.00 ? 115 SER A OG   7  
ATOM 11464 H H    . SER A 1 112 ? -9.258  -3.373  7.345   1.00 0.00 ? 115 SER A H    7  
ATOM 11465 H HA   . SER A 1 112 ? -8.832  -4.094  10.015  1.00 0.00 ? 115 SER A HA   7  
ATOM 11466 H HB2  . SER A 1 112 ? -10.978 -3.218  9.050   1.00 0.00 ? 115 SER A HB2  7  
ATOM 11467 H HB3  . SER A 1 112 ? -11.243 -4.803  8.327   1.00 0.00 ? 115 SER A HB3  7  
ATOM 11468 H HG   . SER A 1 112 ? -12.271 -5.022  10.190  1.00 0.00 ? 115 SER A HG   7  
ATOM 11469 N N    . ASN A 1 113 ? -9.113  -6.632  7.932   1.00 0.00 ? 116 ASN A N    7  
ATOM 11470 C CA   . ASN A 1 113 ? -8.832  -8.053  7.784   1.00 0.00 ? 116 ASN A CA   7  
ATOM 11471 C C    . ASN A 1 113 ? -8.359  -8.351  6.369   1.00 0.00 ? 116 ASN A C    7  
ATOM 11472 O O    . ASN A 1 113 ? -9.166  -8.554  5.459   1.00 0.00 ? 116 ASN A O    7  
ATOM 11473 C CB   . ASN A 1 113 ? -10.067 -8.896  8.111   1.00 0.00 ? 116 ASN A CB   7  
ATOM 11474 C CG   . ASN A 1 113 ? -9.744  -10.376 8.212   1.00 0.00 ? 116 ASN A CG   7  
ATOM 11475 O OD1  . ASN A 1 113 ? -9.424  -10.881 9.287   1.00 0.00 ? 116 ASN A OD1  7  
ATOM 11476 N ND2  . ASN A 1 113 ? -9.835  -11.086 7.102   1.00 0.00 ? 116 ASN A ND2  7  
ATOM 11477 H H    . ASN A 1 113 ? -9.404  -6.118  7.151   1.00 0.00 ? 116 ASN A H    7  
ATOM 11478 H HA   . ASN A 1 113 ? -8.040  -8.306  8.473   1.00 0.00 ? 116 ASN A HA   7  
ATOM 11479 H HB2  . ASN A 1 113 ? -10.479 -8.569  9.055   1.00 0.00 ? 116 ASN A HB2  7  
ATOM 11480 H HB3  . ASN A 1 113 ? -10.805 -8.759  7.333   1.00 0.00 ? 116 ASN A HB3  7  
ATOM 11481 H HD21 . ASN A 1 113 ? -10.113 -10.627 6.277   1.00 0.00 ? 116 ASN A HD21 7  
ATOM 11482 H HD22 . ASN A 1 113 ? -9.605  -12.041 7.140   1.00 0.00 ? 116 ASN A HD22 7  
ATOM 11483 N N    . CYS A 1 114 ? -7.051  -8.364  6.184   1.00 0.00 ? 117 CYS A N    7  
ATOM 11484 C CA   . CYS A 1 114 ? -6.474  -8.644  4.882   1.00 0.00 ? 117 CYS A CA   7  
ATOM 11485 C C    . CYS A 1 114 ? -5.823  -10.024 4.898   1.00 0.00 ? 117 CYS A C    7  
ATOM 11486 O O    . CYS A 1 114 ? -5.329  -10.470 5.935   1.00 0.00 ? 117 CYS A O    7  
ATOM 11487 C CB   . CYS A 1 114 ? -5.437  -7.575  4.526   1.00 0.00 ? 117 CYS A CB   7  
ATOM 11488 S SG   . CYS A 1 114 ? -5.832  -5.909  5.161   1.00 0.00 ? 117 CYS A SG   7  
ATOM 11489 H H    . CYS A 1 114 ? -6.457  -8.179  6.943   1.00 0.00 ? 117 CYS A H    7  
ATOM 11490 H HA   . CYS A 1 114 ? -7.269  -8.634  4.152   1.00 0.00 ? 117 CYS A HA   7  
ATOM 11491 H HB2  . CYS A 1 114 ? -4.480  -7.864  4.934   1.00 0.00 ? 11