data_2JQA
# 
_entry.id   2JQA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JQA         
RCSB  RCSB100154   
WWPDB D_1000100154 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2007-06-12 
_pdbx_database_PDB_obs_spr.pdb_id           2JQA 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1X7L 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_id          1X9L 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JQA 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-05-30 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Banci, L.'         1 
'Bertini, I.'       2 
'Ciofi Baffoni, S.' 3 
'Katsari, E.'       4 
'Katsaros, N.'      5 
'Kubicek, K.'       6 
# 
_citation.id                        primary 
_citation.title                     
'A copper(I) protein possibly involved in the assembly of CuA center of bacterial cytochrome c oxidase' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            102 
_citation.page_first                3994 
_citation.page_last                 3999 
_citation.year                      2005 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15753304 
_citation.pdbx_database_id_DOI      10.1073/pnas.0406150102 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Banci, L.'         1 
primary 'Bertini, I.'       2 
primary 'Ciofi Baffoni, S.' 3 
primary 'Katsari, E.'       4 
primary 'Katsaros, N.'      5 
primary 'Kubicek, K.'       6 
primary 'Mangani, S.'       7 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Hypothetical protein' 
_entity.formula_weight             15492.146 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'sequence database residues 35-178' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHS
GGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHS
GGMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKNIEGR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   HIS n 
1 4   THR n 
1 5   MET n 
1 6   PRO n 
1 7   ALA n 
1 8   HIS n 
1 9   THR n 
1 10  PRO n 
1 11  PRO n 
1 12  ALA n 
1 13  GLN n 
1 14  THR n 
1 15  ALA n 
1 16  PRO n 
1 17  ALA n 
1 18  ALA n 
1 19  GLN n 
1 20  LYS n 
1 21  ALA n 
1 22  GLY n 
1 23  ALA n 
1 24  GLN n 
1 25  ALA n 
1 26  LEU n 
1 27  PRO n 
1 28  VAL n 
1 29  THR n 
1 30  VAL n 
1 31  GLN n 
1 32  GLY n 
1 33  ALA n 
1 34  THR n 
1 35  VAL n 
1 36  ALA n 
1 37  ALA n 
1 38  VAL n 
1 39  PRO n 
1 40  PRO n 
1 41  SER n 
1 42  ILE n 
1 43  ARG n 
1 44  ASP n 
1 45  THR n 
1 46  ALA n 
1 47  ALA n 
1 48  TYR n 
1 49  MET n 
1 50  THR n 
1 51  LEU n 
1 52  THR n 
1 53  ASN n 
1 54  LYS n 
1 55  SER n 
1 56  ASP n 
1 57  GLN n 
1 58  PRO n 
1 59  ILE n 
1 60  LYS n 
1 61  LEU n 
1 62  VAL n 
1 63  GLY n 
1 64  ALA n 
1 65  ALA n 
1 66  THR n 
1 67  PRO n 
1 68  LEU n 
1 69  ALA n 
1 70  THR n 
1 71  SER n 
1 72  PRO n 
1 73  MET n 
1 74  LEU n 
1 75  MET n 
1 76  THR n 
1 77  THR n 
1 78  THR n 
1 79  HIS n 
1 80  SER n 
1 81  GLY n 
1 82  GLY n 
1 83  MET n 
1 84  ALA n 
1 85  GLY n 
1 86  MET n 
1 87  LYS n 
1 88  MET n 
1 89  VAL n 
1 90  PRO n 
1 91  TRP n 
1 92  LEU n 
1 93  THR n 
1 94  ILE n 
1 95  PRO n 
1 96  ALA n 
1 97  ARG n 
1 98  GLY n 
1 99  THR n 
1 100 LEU n 
1 101 THR n 
1 102 LEU n 
1 103 GLN n 
1 104 ARG n 
1 105 ASP n 
1 106 GLY n 
1 107 ASP n 
1 108 HIS n 
1 109 VAL n 
1 110 MET n 
1 111 LEU n 
1 112 MET n 
1 113 GLY n 
1 114 LEU n 
1 115 LYS n 
1 116 ARG n 
1 117 PRO n 
1 118 LEU n 
1 119 LYS n 
1 120 VAL n 
1 121 GLY n 
1 122 GLU n 
1 123 THR n 
1 124 VAL n 
1 125 ASN n 
1 126 ILE n 
1 127 THR n 
1 128 LEU n 
1 129 LYS n 
1 130 ALA n 
1 131 THR n 
1 132 ASP n 
1 133 GLY n 
1 134 ARG n 
1 135 THR n 
1 136 LEU n 
1 137 ASN n 
1 138 VAL n 
1 139 ALA n 
1 140 ALA n 
1 141 THR n 
1 142 VAL n 
1 143 LYS n 
1 144 LYS n 
1 145 ASN n 
1 146 ILE n 
1 147 GLU n 
1 148 GLY n 
1 149 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Deinococcus 
_entity_src_gen.pdbx_gene_src_gene                 DR1885 
_entity_src_gen.gene_src_species                   'Deinococcus radiodurans' 
_entity_src_gen.gene_src_strain                    R1 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Deinococcus radiodurans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     243230 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3) pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               'pET21a(+)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9RT80_DEIRA 
_struct_ref.pdbx_db_accession          Q9RT80 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GHTMPAHTPPAQTAPAAQKAGAQALPVTVQGATVAAVPPSIRDTAAYMTLTNKSDQPIKLVGAATPLATSPMLMTTTHSG
GMAGMKMVPWLTIPARGTLTLQRDGDHVMLMGLKRPLKVGETVNITLKATDGRTLNVAATVKKN
;
_struct_ref.pdbx_align_begin           35 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JQA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 145 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9RT80 
_struct_ref_seq.db_align_beg                  35 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  178 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       145 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JQA MET A 1   ? UNP Q9RT80 ? ? 'CLONING ARTIFACT' 1   1 
1 2JQA ILE A 146 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT' 146 2 
1 2JQA GLU A 147 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT' 147 3 
1 2JQA GLY A 148 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT' 148 4 
1 2JQA ARG A 149 ? UNP Q9RT80 ? ? 'CLONING ARTIFACT' 149 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 2 '2D 1H-15N HSQC'  
1 2 2 '3D 1H-15N NOESY' 
1 3 2 '3D 1H-13C NOESY' 
1 4 1 '2D 1H-1H NOESY'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      100 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1.5 mM protein, 90% H2O/10% D2O'              1 '90% H2O/10% D2O' 
'1 mM [U-13C; U-15N] protein, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2JQA 
_pdbx_nmr_refine.method             'simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2JQA 
_pdbx_nmr_details.text       'The structure was determined using a combination of NOE and angle constraints.' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JQA 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JQA 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Koll' refinement           AMBER   8 1 
'Guntert, Braun and Wuthrich'                                        'structure solution' DYANA   ? 2 
'Bartels et al.'                                                     'data analysis'      XEASY   ? 3 
'Bruker Biospin'                                                     processing           xwinnmr ? 4 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'apo-DR1885 is a bacterial protein involved in copper homeostasis' 
_exptl.entry_id                   2JQA 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2JQA 
_struct.title                     'Solution structure of apo-DR1885 from Deinococcus radiodurans' 
_struct.pdbx_descriptor           'Hypothetical protein' 
_struct.pdbx_model_details        'apo-DR1885 is a bacterial protein involved in copper homeostasis' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JQA 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'COPPER BINDING PROTEIN, METAL BINDING PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       GLN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        103 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASP 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        107 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         103 
_struct_conf.end_auth_comp_id        ASP 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         107 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 2 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 71  ? MET A 73  ? SER A 71  MET A 73  
A 2 VAL A 109 ? MET A 112 ? VAL A 109 MET A 112 
A 3 ASP A 44  ? THR A 50  ? ASP A 44  THR A 50  
A 4 THR A 101 ? LEU A 102 ? THR A 101 LEU A 102 
B 1 SER A 71  ? MET A 73  ? SER A 71  MET A 73  
B 2 VAL A 109 ? MET A 112 ? VAL A 109 MET A 112 
B 3 ASP A 44  ? THR A 50  ? ASP A 44  THR A 50  
B 4 THR A 34  ? VAL A 35  ? THR A 34  VAL A 35  
B 5 THR A 141 ? VAL A 142 ? THR A 141 VAL A 142 
C 1 LYS A 60  ? LEU A 61  ? LYS A 60  LEU A 61  
C 2 LEU A 92  ? THR A 93  ? LEU A 92  THR A 93  
D 1 GLY A 63  ? ALA A 65  ? GLY A 63  ALA A 65  
D 2 ILE A 126 ? LYS A 129 ? ILE A 126 LYS A 129 
D 3 THR A 135 ? VAL A 138 ? THR A 135 VAL A 138 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 71  ? N SER A 71  O MET A 112 ? O MET A 112 
A 2 3 O VAL A 109 ? O VAL A 109 N ALA A 47  ? N ALA A 47  
A 3 4 N MET A 49  ? N MET A 49  O LEU A 102 ? O LEU A 102 
B 1 2 N SER A 71  ? N SER A 71  O MET A 112 ? O MET A 112 
B 2 3 O VAL A 109 ? O VAL A 109 N ALA A 47  ? N ALA A 47  
B 3 4 O TYR A 48  ? O TYR A 48  N THR A 34  ? N THR A 34  
B 4 5 N VAL A 35  ? N VAL A 35  O THR A 141 ? O THR A 141 
C 1 2 N LEU A 61  ? N LEU A 61  O LEU A 92  ? O LEU A 92  
D 1 2 N ALA A 65  ? N ALA A 65  O THR A 127 ? O THR A 127 
D 2 3 N ILE A 126 ? N ILE A 126 O VAL A 138 ? O VAL A 138 
# 
_atom_sites.entry_id                    2JQA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 13.270  2.854   48.367  1.00 95.99  ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 14.013  2.316   47.207  1.00 95.64  ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 13.026  1.680   46.241  1.00 94.40  ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 12.105  1.014   46.699  1.00 94.90  ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 15.048  1.267   47.633  1.00 96.99  ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 16.224  1.876   48.403  1.00 98.08  ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 17.448  0.664   48.976  1.00 99.72  ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 16.572  -0.084  50.380  1.00 101.37 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 12.657  2.146   48.749  1.00 96.25  ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 12.720  3.650   48.067  1.00 95.61  ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 13.908  3.202   49.066  1.00 96.33  ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 14.522  3.134   46.689  1.00 95.35  ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 14.559  0.514   48.248  1.00 97.38  ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 15.440  0.776   46.744  1.00 96.84  ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 16.728  2.586   47.747  1.00 97.62  ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 15.849  2.421   49.267  1.00 98.34  ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 15.633  -0.524  50.045  1.00 101.42 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 17.195  -0.866  50.816  1.00 102.34 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 16.371  0.677   51.136  1.00 101.41 ? 1   MET A HE3  1  
ATOM 20    N N    . GLY A 1 2   ? 13.222  1.861   44.932  1.00 92.86  ? 2   GLY A N    1  
ATOM 21    C CA   . GLY A 1 2   ? 12.463  1.156   43.885  1.00 91.67  ? 2   GLY A CA   1  
ATOM 22    C C    . GLY A 1 2   ? 13.227  -0.036  43.300  1.00 91.33  ? 2   GLY A C    1  
ATOM 23    O O    . GLY A 1 2   ? 14.288  -0.433  43.792  1.00 92.21  ? 2   GLY A O    1  
ATOM 24    H H    . GLY A 1 2   ? 13.986  2.454   44.634  1.00 92.54  ? 2   GLY A H    1  
ATOM 25    H HA2  . GLY A 1 2   ? 11.514  0.791   44.282  1.00 91.89  ? 2   GLY A HA2  1  
ATOM 26    H HA3  . GLY A 1 2   ? 12.265  1.850   43.065  1.00 90.78  ? 2   GLY A HA3  1  
ATOM 27    N N    . HIS A 1 3   ? 12.691  -0.579  42.207  1.00 90.04  ? 3   HIS A N    1  
ATOM 28    C CA   . HIS A 1 3   ? 13.438  -1.407  41.258  1.00 89.25  ? 3   HIS A CA   1  
ATOM 29    C C    . HIS A 1 3   ? 14.116  -0.517  40.195  1.00 87.38  ? 3   HIS A C    1  
ATOM 30    O O    . HIS A 1 3   ? 13.617  0.567   39.882  1.00 86.60  ? 3   HIS A O    1  
ATOM 31    C CB   . HIS A 1 3   ? 12.485  -2.400  40.564  1.00 89.15  ? 3   HIS A CB   1  
ATOM 32    C CG   . HIS A 1 3   ? 11.675  -3.291  41.480  1.00 90.00  ? 3   HIS A CG   1  
ATOM 33    N ND1  . HIS A 1 3   ? 12.150  -4.233  42.367  1.00 91.08  ? 3   HIS A ND1  1  
ATOM 34    C CD2  . HIS A 1 3   ? 10.308  -3.366  41.515  1.00 89.91  ? 3   HIS A CD2  1  
ATOM 35    C CE1  . HIS A 1 3   ? 11.093  -4.841  42.934  1.00 91.62  ? 3   HIS A CE1  1  
ATOM 36    N NE2  . HIS A 1 3   ? 9.941   -4.349  42.437  1.00 90.94  ? 3   HIS A NE2  1  
ATOM 37    H H    . HIS A 1 3   ? 11.825  -0.184  41.874  1.00 89.39  ? 3   HIS A H    1  
ATOM 38    H HA   . HIS A 1 3   ? 14.213  -1.963  41.790  1.00 90.13  ? 3   HIS A HA   1  
ATOM 39    H HB2  . HIS A 1 3   ? 11.788  -1.835  39.942  1.00 88.53  ? 3   HIS A HB2  1  
ATOM 40    H HB3  . HIS A 1 3   ? 13.062  -3.041  39.898  1.00 89.07  ? 3   HIS A HB3  1  
ATOM 41    H HD1  . HIS A 1 3   ? 13.118  -4.450  42.551  1.00 91.45  ? 3   HIS A HD1  1  
ATOM 42    H HD2  . HIS A 1 3   ? 9.626   -2.782  40.913  1.00 89.20  ? 3   HIS A HD2  1  
ATOM 43    H HE1  . HIS A 1 3   ? 11.162  -5.629  43.677  1.00 92.51  ? 3   HIS A HE1  1  
ATOM 44    N N    . THR A 1 4   ? 15.225  -0.983  39.611  1.00 86.71  ? 4   THR A N    1  
ATOM 45    C CA   . THR A 1 4   ? 15.984  -0.260  38.578  1.00 84.96  ? 4   THR A CA   1  
ATOM 46    C C    . THR A 1 4   ? 15.269  -0.275  37.225  1.00 83.30  ? 4   THR A C    1  
ATOM 47    O O    . THR A 1 4   ? 15.449  -1.188  36.423  1.00 83.60  ? 4   THR A O    1  
ATOM 48    C CB   . THR A 1 4   ? 17.400  -0.839  38.480  1.00 85.62  ? 4   THR A CB   1  
ATOM 49    O OG1  . THR A 1 4   ? 17.946  -0.902  39.780  1.00 85.91  ? 4   THR A OG1  1  
ATOM 50    C CG2  . THR A 1 4   ? 18.320  0.034   37.629  1.00 84.92  ? 4   THR A CG2  1  
ATOM 51    H H    . THR A 1 4   ? 15.636  -1.840  39.950  1.00 87.46  ? 4   THR A H    1  
ATOM 52    H HA   . THR A 1 4   ? 16.074  0.784   38.881  1.00 84.38  ? 4   THR A HA   1  
ATOM 53    H HB   . THR A 1 4   ? 17.358  -1.847  38.057  1.00 86.49  ? 4   THR A HB   1  
ATOM 54    H HG1  . THR A 1 4   ? 18.735  -1.454  39.743  1.00 86.56  ? 4   THR A HG1  1  
ATOM 55    H HG21 . THR A 1 4   ? 18.369  1.042   38.038  1.00 84.62  ? 4   THR A HG21 1  
ATOM 56    H HG22 . THR A 1 4   ? 19.320  -0.400  37.606  1.00 85.29  ? 4   THR A HG22 1  
ATOM 57    H HG23 . THR A 1 4   ? 17.946  0.085   36.603  1.00 84.40  ? 4   THR A HG23 1  
ATOM 58    N N    . MET A 1 5   ? 14.457  0.753   36.983  1.00 81.58  ? 5   MET A N    1  
ATOM 59    C CA   . MET A 1 5   ? 13.789  0.999   35.697  1.00 79.76  ? 5   MET A CA   1  
ATOM 60    C C    . MET A 1 5   ? 14.755  1.523   34.614  1.00 78.21  ? 5   MET A C    1  
ATOM 61    O O    . MET A 1 5   ? 15.720  2.217   34.943  1.00 78.11  ? 5   MET A O    1  
ATOM 62    C CB   . MET A 1 5   ? 12.636  1.999   35.885  1.00 79.07  ? 5   MET A CB   1  
ATOM 63    C CG   . MET A 1 5   ? 11.393  1.341   36.487  1.00 79.05  ? 5   MET A CG   1  
ATOM 64    S SD   . MET A 1 5   ? 10.601  0.125   35.396  1.00 79.14  ? 5   MET A SD   1  
ATOM 65    C CE   . MET A 1 5   ? 9.011   -0.047  36.238  1.00 79.23  ? 5   MET A CE   1  
ATOM 66    H H    . MET A 1 5   ? 14.319  1.418   37.732  1.00 81.54  ? 5   MET A H    1  
ATOM 67    H HA   . MET A 1 5   ? 13.382  0.049   35.353  1.00 80.10  ? 5   MET A HA   1  
ATOM 68    H HB2  . MET A 1 5   ? 12.966  2.819   36.526  1.00 79.44  ? 5   MET A HB2  1  
ATOM 69    H HB3  . MET A 1 5   ? 12.356  2.424   34.920  1.00 78.25  ? 5   MET A HB3  1  
ATOM 70    H HG2  . MET A 1 5   ? 11.656  0.868   37.434  1.00 79.53  ? 5   MET A HG2  1  
ATOM 71    H HG3  . MET A 1 5   ? 10.672  2.132   36.696  1.00 78.52  ? 5   MET A HG3  1  
ATOM 72    H HE1  . MET A 1 5   ? 9.172   -0.345  37.272  1.00 79.96  ? 5   MET A HE1  1  
ATOM 73    H HE2  . MET A 1 5   ? 8.472   0.902   36.213  1.00 78.58  ? 5   MET A HE2  1  
ATOM 74    H HE3  . MET A 1 5   ? 8.414   -0.810  35.738  1.00 79.29  ? 5   MET A HE3  1  
ATOM 75    N N    . PRO A 1 6   ? 14.489  1.247   33.318  1.00 77.01  ? 6   PRO A N    1  
ATOM 76    C CA   . PRO A 1 6   ? 15.226  1.809   32.183  1.00 75.38  ? 6   PRO A CA   1  
ATOM 77    C C    . PRO A 1 6   ? 14.778  3.249   31.878  1.00 73.54  ? 6   PRO A C    1  
ATOM 78    O O    . PRO A 1 6   ? 13.924  3.805   32.567  1.00 73.55  ? 6   PRO A O    1  
ATOM 79    C CB   . PRO A 1 6   ? 14.927  0.850   31.023  1.00 75.06  ? 6   PRO A CB   1  
ATOM 80    C CG   . PRO A 1 6   ? 13.481  0.439   31.299  1.00 75.52  ? 6   PRO A CG   1  
ATOM 81    C CD   . PRO A 1 6   ? 13.432  0.365   32.826  1.00 77.20  ? 6   PRO A CD   1  
ATOM 82    H HA   . PRO A 1 6   ? 16.296  1.804   32.388  1.00 75.86  ? 6   PRO A HA   1  
ATOM 83    H HB2  . PRO A 1 6   ? 15.035  1.315   30.043  1.00 73.57  ? 6   PRO A HB2  1  
ATOM 84    H HB3  . PRO A 1 6   ? 15.575  -0.027  31.095  1.00 76.17  ? 6   PRO A HB3  1  
ATOM 85    H HG2  . PRO A 1 6   ? 12.804  1.220   30.945  1.00 74.23  ? 6   PRO A HG2  1  
ATOM 86    H HG3  . PRO A 1 6   ? 13.239  -0.519  30.839  1.00 76.03  ? 6   PRO A HG3  1  
ATOM 87    H HD2  . PRO A 1 6   ? 12.451  0.686   33.178  1.00 77.09  ? 6   PRO A HD2  1  
ATOM 88    H HD3  . PRO A 1 6   ? 13.634  -0.657  33.150  1.00 78.66  ? 6   PRO A HD3  1  
ATOM 89    N N    . ALA A 1 7   ? 15.351  3.849   30.827  1.00 71.99  ? 7   ALA A N    1  
ATOM 90    C CA   . ALA A 1 7   ? 15.038  5.201   30.365  1.00 70.11  ? 7   ALA A CA   1  
ATOM 91    C C    . ALA A 1 7   ? 14.290  5.224   29.019  1.00 68.26  ? 7   ALA A C    1  
ATOM 92    O O    . ALA A 1 7   ? 14.333  4.290   28.213  1.00 68.31  ? 7   ALA A O    1  
ATOM 93    C CB   . ALA A 1 7   ? 16.342  6.002   30.316  1.00 70.13  ? 7   ALA A CB   1  
ATOM 94    H H    . ALA A 1 7   ? 16.036  3.333   30.298  1.00 72.14  ? 7   ALA A H    1  
ATOM 95    H HA   . ALA A 1 7   ? 14.385  5.681   31.097  1.00 70.08  ? 7   ALA A HA   1  
ATOM 96    H HB1  . ALA A 1 7   ? 17.077  5.489   29.699  1.00 70.37  ? 7   ALA A HB1  1  
ATOM 97    H HB2  . ALA A 1 7   ? 16.167  6.996   29.906  1.00 69.42  ? 7   ALA A HB2  1  
ATOM 98    H HB3  . ALA A 1 7   ? 16.733  6.104   31.325  1.00 70.69  ? 7   ALA A HB3  1  
ATOM 99    N N    . HIS A 1 8   ? 13.595  6.335   28.776  1.00 66.64  ? 8   HIS A N    1  
ATOM 100   C CA   . HIS A 1 8   ? 12.674  6.523   27.647  1.00 64.78  ? 8   HIS A CA   1  
ATOM 101   C C    . HIS A 1 8   ? 12.631  7.988   27.165  1.00 63.07  ? 8   HIS A C    1  
ATOM 102   O O    . HIS A 1 8   ? 13.227  8.257   26.122  1.00 62.79  ? 8   HIS A O    1  
ATOM 103   C CB   . HIS A 1 8   ? 11.294  5.914   27.993  1.00 64.98  ? 8   HIS A CB   1  
ATOM 104   C CG   . HIS A 1 8   ? 10.496  6.551   29.116  1.00 64.66  ? 8   HIS A CG   1  
ATOM 105   N ND1  . HIS A 1 8   ? 9.166   6.903   29.049  1.00 64.08  ? 8   HIS A ND1  1  
ATOM 106   C CD2  . HIS A 1 8   ? 10.911  6.851   30.392  1.00 64.98  ? 8   HIS A CD2  1  
ATOM 107   C CE1  . HIS A 1 8   ? 8.804   7.412   30.242  1.00 64.04  ? 8   HIS A CE1  1  
ATOM 108   N NE2  . HIS A 1 8   ? 9.841   7.422   31.094  1.00 64.56  ? 8   HIS A NE2  1  
ATOM 109   H H    . HIS A 1 8   ? 13.707  7.102   29.422  1.00 66.73  ? 8   HIS A H    1  
ATOM 110   H HA   . HIS A 1 8   ? 13.060  5.960   26.795  1.00 64.55  ? 8   HIS A HA   1  
ATOM 111   H HB2  . HIS A 1 8   ? 10.676  5.933   27.091  1.00 64.81  ? 8   HIS A HB2  1  
ATOM 112   H HB3  . HIS A 1 8   ? 11.433  4.861   28.249  1.00 65.62  ? 8   HIS A HB3  1  
ATOM 113   H HD1  . HIS A 1 8   ? 8.529   6.730   28.267  1.00 63.83  ? 8   HIS A HD1  1  
ATOM 114   H HD2  . HIS A 1 8   ? 11.893  6.661   30.797  1.00 65.53  ? 8   HIS A HD2  1  
ATOM 115   H HE1  . HIS A 1 8   ? 7.805   7.744   30.493  1.00 63.70  ? 8   HIS A HE1  1  
ATOM 116   N N    . THR A 1 9   ? 12.016  8.902   27.945  1.00 62.07  ? 9   THR A N    1  
ATOM 117   C CA   . THR A 1 9   ? 11.921  10.367  27.744  1.00 60.54  ? 9   THR A CA   1  
ATOM 118   C C    . THR A 1 9   ? 10.840  10.706  26.688  1.00 58.66  ? 9   THR A C    1  
ATOM 119   O O    . THR A 1 9   ? 10.576  9.891   25.801  1.00 58.42  ? 9   THR A O    1  
ATOM 120   C CB   . THR A 1 9   ? 13.327  10.975  27.511  1.00 60.61  ? 9   THR A CB   1  
ATOM 121   O OG1  . THR A 1 9   ? 13.939  10.967  28.784  1.00 61.29  ? 9   THR A OG1  1  
ATOM 122   C CG2  . THR A 1 9   ? 13.438  12.410  27.001  1.00 59.43  ? 9   THR A CG2  1  
ATOM 123   H H    . THR A 1 9   ? 11.561  8.541   28.772  1.00 62.47  ? 9   THR A H    1  
ATOM 124   H HA   . THR A 1 9   ? 11.571  10.783  28.685  1.00 60.87  ? 9   THR A HA   1  
ATOM 125   H HB   . THR A 1 9   ? 13.903  10.356  26.826  1.00 61.20  ? 9   THR A HB   1  
ATOM 126   H HG1  . THR A 1 9   ? 14.891  10.768  28.674  1.00 61.69  ? 9   THR A HG1  1  
ATOM 127   H HG21 . THR A 1 9   ? 13.120  13.122  27.758  1.00 59.23  ? 9   THR A HG21 1  
ATOM 128   H HG22 . THR A 1 9   ? 14.480  12.614  26.762  1.00 59.48  ? 9   THR A HG22 1  
ATOM 129   H HG23 . THR A 1 9   ? 12.856  12.535  26.092  1.00 58.80  ? 9   THR A HG23 1  
ATOM 130   N N    . PRO A 1 10  ? 10.143  11.857  26.799  1.00 57.43  ? 10  PRO A N    1  
ATOM 131   C CA   . PRO A 1 10  ? 9.137   12.281  25.822  1.00 55.63  ? 10  PRO A CA   1  
ATOM 132   C C    . PRO A 1 10  ? 9.749   12.608  24.446  1.00 54.12  ? 10  PRO A C    1  
ATOM 133   O O    . PRO A 1 10  ? 10.962  12.799  24.347  1.00 54.27  ? 10  PRO A O    1  
ATOM 134   C CB   . PRO A 1 10  ? 8.438   13.501  26.445  1.00 55.04  ? 10  PRO A CB   1  
ATOM 135   C CG   . PRO A 1 10  ? 9.455   14.037  27.448  1.00 56.03  ? 10  PRO A CG   1  
ATOM 136   C CD   . PRO A 1 10  ? 10.128  12.763  27.942  1.00 57.83  ? 10  PRO A CD   1  
ATOM 137   H HA   . PRO A 1 10  ? 8.407   11.480  25.698  1.00 55.93  ? 10  PRO A HA   1  
ATOM 138   H HB2  . PRO A 1 10  ? 8.180   14.262  25.706  1.00 53.53  ? 10  PRO A HB2  1  
ATOM 139   H HB3  . PRO A 1 10  ? 7.543   13.171  26.976  1.00 55.67  ? 10  PRO A HB3  1  
ATOM 140   H HG2  . PRO A 1 10  ? 10.185  14.666  26.935  1.00 55.21  ? 10  PRO A HG2  1  
ATOM 141   H HG3  . PRO A 1 10  ? 8.973   14.582  28.261  1.00 56.37  ? 10  PRO A HG3  1  
ATOM 142   H HD2  . PRO A 1 10  ? 11.120  12.992  28.318  1.00 58.33  ? 10  PRO A HD2  1  
ATOM 143   H HD3  . PRO A 1 10  ? 9.531   12.323  28.742  1.00 58.92  ? 10  PRO A HD3  1  
ATOM 144   N N    . PRO A 1 11  ? 8.922   12.699  23.380  1.00 52.70  ? 11  PRO A N    1  
ATOM 145   C CA   . PRO A 1 11  ? 9.362   13.098  22.044  1.00 51.13  ? 11  PRO A CA   1  
ATOM 146   C C    . PRO A 1 11  ? 9.777   14.579  21.999  1.00 49.79  ? 11  PRO A C    1  
ATOM 147   O O    . PRO A 1 11  ? 9.664   15.304  22.988  1.00 49.91  ? 11  PRO A O    1  
ATOM 148   C CB   . PRO A 1 11  ? 8.175   12.793  21.122  1.00 50.33  ? 11  PRO A CB   1  
ATOM 149   C CG   . PRO A 1 11  ? 6.971   12.984  22.039  1.00 50.74  ? 11  PRO A CG   1  
ATOM 150   C CD   . PRO A 1 11  ? 7.484   12.456  23.377  1.00 52.58  ? 11  PRO A CD   1  
ATOM 151   H HA   . PRO A 1 11  ? 10.215  12.491  21.741  1.00 51.65  ? 11  PRO A HA   1  
ATOM 152   H HB2  . PRO A 1 11  ? 8.128   13.452  20.255  1.00 48.87  ? 11  PRO A HB2  1  
ATOM 153   H HB3  . PRO A 1 11  ? 8.223   11.751  20.800  1.00 51.14  ? 11  PRO A HB3  1  
ATOM 154   H HG2  . PRO A 1 11  ? 6.740   14.048  22.128  1.00 49.71  ? 11  PRO A HG2  1  
ATOM 155   H HG3  . PRO A 1 11  ? 6.100   12.428  21.691  1.00 50.89  ? 11  PRO A HG3  1  
ATOM 156   H HD2  . PRO A 1 11  ? 6.981   12.977  24.193  1.00 52.69  ? 11  PRO A HD2  1  
ATOM 157   H HD3  . PRO A 1 11  ? 7.303   11.383  23.445  1.00 53.73  ? 11  PRO A HD3  1  
ATOM 158   N N    . ALA A 1 12  ? 10.257  15.040  20.839  1.00 48.59  ? 12  ALA A N    1  
ATOM 159   C CA   . ALA A 1 12  ? 10.833  16.373  20.664  1.00 47.43  ? 12  ALA A CA   1  
ATOM 160   C C    . ALA A 1 12  ? 10.535  16.964  19.271  1.00 45.62  ? 12  ALA A C    1  
ATOM 161   O O    . ALA A 1 12  ? 10.108  16.246  18.366  1.00 45.47  ? 12  ALA A O    1  
ATOM 162   C CB   . ALA A 1 12  ? 12.337  16.267  20.968  1.00 48.38  ? 12  ALA A CB   1  
ATOM 163   H H    . ALA A 1 12  ? 10.276  14.437  20.029  1.00 48.56  ? 12  ALA A H    1  
ATOM 164   H HA   . ALA A 1 12  ? 10.380  17.051  21.389  1.00 47.31  ? 12  ALA A HA   1  
ATOM 165   H HB1  . ALA A 1 12  ? 12.770  17.263  21.046  1.00 48.41  ? 12  ALA A HB1  1  
ATOM 166   H HB2  . ALA A 1 12  ? 12.495  15.754  21.918  1.00 49.44  ? 12  ALA A HB2  1  
ATOM 167   H HB3  . ALA A 1 12  ? 12.841  15.706  20.179  1.00 48.10  ? 12  ALA A HB3  1  
ATOM 168   N N    . GLN A 1 13  ? 10.742  18.281  19.122  1.00 44.33  ? 13  GLN A N    1  
ATOM 169   C CA   . GLN A 1 13  ? 10.381  19.083  17.942  1.00 42.55  ? 13  GLN A CA   1  
ATOM 170   C C    . GLN A 1 13  ? 8.842   19.098  17.789  1.00 41.35  ? 13  GLN A C    1  
ATOM 171   O O    . GLN A 1 13  ? 8.171   19.553  18.714  1.00 41.70  ? 13  GLN A O    1  
ATOM 172   C CB   . GLN A 1 13  ? 11.158  18.659  16.667  1.00 42.12  ? 13  GLN A CB   1  
ATOM 173   C CG   . GLN A 1 13  ? 12.688  18.833  16.733  1.00 42.45  ? 13  GLN A CG   1  
ATOM 174   C CD   . GLN A 1 13  ? 13.411  17.761  17.551  1.00 43.72  ? 13  GLN A CD   1  
ATOM 175   O OE1  . GLN A 1 13  ? 13.598  16.627  17.134  1.00 44.03  ? 13  GLN A OE1  1  
ATOM 176   N NE2  . GLN A 1 13  ? 13.846  18.072  18.752  1.00 44.60  ? 13  GLN A NE2  1  
ATOM 177   H H    . GLN A 1 13  ? 11.101  18.786  19.920  1.00 44.65  ? 13  GLN A H    1  
ATOM 178   H HA   . GLN A 1 13  ? 10.656  20.120  18.149  1.00 42.50  ? 13  GLN A HA   1  
ATOM 179   H HB2  . GLN A 1 13  ? 10.932  17.626  16.400  1.00 42.22  ? 13  GLN A HB2  1  
ATOM 180   H HB3  . GLN A 1 13  ? 10.812  19.290  15.847  1.00 41.50  ? 13  GLN A HB3  1  
ATOM 181   H HG2  . GLN A 1 13  ? 13.084  18.789  15.717  1.00 41.99  ? 13  GLN A HG2  1  
ATOM 182   H HG3  . GLN A 1 13  ? 12.921  19.821  17.131  1.00 42.29  ? 13  GLN A HG3  1  
ATOM 183   H HE21 . GLN A 1 13  ? 13.724  19.002  19.132  1.00 44.47  ? 13  GLN A HE21 1  
ATOM 184   H HE22 . GLN A 1 13  ? 14.324  17.353  19.274  1.00 45.48  ? 13  GLN A HE22 1  
ATOM 185   N N    . THR A 1 14  ? 8.298   18.609  16.657  1.00 40.02  ? 14  THR A N    1  
ATOM 186   C CA   . THR A 1 14  ? 6.883   18.343  16.273  1.00 38.81  ? 14  THR A CA   1  
ATOM 187   C C    . THR A 1 14  ? 6.694   18.649  14.790  1.00 37.17  ? 14  THR A C    1  
ATOM 188   O O    . THR A 1 14  ? 6.572   17.704  14.018  1.00 37.20  ? 14  THR A O    1  
ATOM 189   C CB   . THR A 1 14  ? 5.794   18.966  17.169  1.00 38.95  ? 14  THR A CB   1  
ATOM 190   O OG1  . THR A 1 14  ? 5.861   18.374  18.449  1.00 39.67  ? 14  THR A OG1  1  
ATOM 191   C CG2  . THR A 1 14  ? 4.383   18.717  16.633  1.00 38.59  ? 14  THR A CG2  1  
ATOM 192   H H    . THR A 1 14  ? 8.974   18.277  15.982  1.00 39.91  ? 14  THR A H    1  
ATOM 193   H HA   . THR A 1 14  ? 6.741   17.262  16.346  1.00 39.11  ? 14  THR A HA   1  
ATOM 194   H HB   . THR A 1 14  ? 5.953   20.043  17.257  1.00 38.91  ? 14  THR A HB   1  
ATOM 195   H HG1  . THR A 1 14  ? 6.720   18.696  18.796  1.00 39.96  ? 14  THR A HG1  1  
ATOM 196   H HG21 . THR A 1 14  ? 3.649   19.010  17.384  1.00 38.53  ? 14  THR A HG21 1  
ATOM 197   H HG22 . THR A 1 14  ? 4.206   19.317  15.740  1.00 38.15  ? 14  THR A HG22 1  
ATOM 198   H HG23 . THR A 1 14  ? 4.247   17.666  16.388  1.00 38.93  ? 14  THR A HG23 1  
ATOM 199   N N    . ALA A 1 15  ? 6.680   19.939  14.421  1.00 35.85  ? 15  ALA A N    1  
ATOM 200   C CA   . ALA A 1 15  ? 6.534   20.512  13.062  1.00 34.21  ? 15  ALA A CA   1  
ATOM 201   C C    . ALA A 1 15  ? 5.046   20.770  12.672  1.00 32.72  ? 15  ALA A C    1  
ATOM 202   O O    . ALA A 1 15  ? 4.144   20.195  13.290  1.00 32.75  ? 15  ALA A O    1  
ATOM 203   C CB   . ALA A 1 15  ? 7.287   19.661  12.017  1.00 34.16  ? 15  ALA A CB   1  
ATOM 204   H H    . ALA A 1 15  ? 6.760   20.601  15.178  1.00 36.07  ? 15  ALA A H    1  
ATOM 205   H HA   . ALA A 1 15  ? 7.027   21.483  13.085  1.00 34.24  ? 15  ALA A HA   1  
ATOM 206   H HB1  . ALA A 1 15  ? 6.708   18.768  11.771  1.00 33.93  ? 15  ALA A HB1  1  
ATOM 207   H HB2  . ALA A 1 15  ? 7.448   20.216  11.098  1.00 33.75  ? 15  ALA A HB2  1  
ATOM 208   H HB3  . ALA A 1 15  ? 8.263   19.366  12.408  1.00 34.88  ? 15  ALA A HB3  1  
ATOM 209   N N    . PRO A 1 16  ? 4.759   21.654  11.688  1.00 31.56  ? 16  PRO A N    1  
ATOM 210   C CA   . PRO A 1 16  ? 3.391   21.939  11.242  1.00 30.15  ? 16  PRO A CA   1  
ATOM 211   C C    . PRO A 1 16  ? 2.838   20.850  10.310  1.00 28.95  ? 16  PRO A C    1  
ATOM 212   O O    . PRO A 1 16  ? 3.594   20.064  9.742   1.00 29.13  ? 16  PRO A O    1  
ATOM 213   C CB   . PRO A 1 16  ? 3.470   23.299  10.542  1.00 29.67  ? 16  PRO A CB   1  
ATOM 214   C CG   . PRO A 1 16  ? 4.878   23.301  9.952   1.00 30.23  ? 16  PRO A CG   1  
ATOM 215   C CD   . PRO A 1 16  ? 5.695   22.538  10.997  1.00 31.68  ? 16  PRO A CD   1  
ATOM 216   H HA   . PRO A 1 16  ? 2.730   22.028  12.105  1.00 30.49  ? 16  PRO A HA   1  
ATOM 217   H HB2  . PRO A 1 16  ? 2.713   23.420  9.767   1.00 28.47  ? 16  PRO A HB2  1  
ATOM 218   H HB3  . PRO A 1 16  ? 3.389   24.099  11.279  1.00 30.37  ? 16  PRO A HB3  1  
ATOM 219   H HG2  . PRO A 1 16  ? 4.886   22.749  9.009   1.00 29.42  ? 16  PRO A HG2  1  
ATOM 220   H HG3  . PRO A 1 16  ? 5.259   24.313  9.806   1.00 30.56  ? 16  PRO A HG3  1  
ATOM 221   H HD2  . PRO A 1 16  ? 6.486   21.982  10.495  1.00 31.89  ? 16  PRO A HD2  1  
ATOM 222   H HD3  . PRO A 1 16  ? 6.126   23.241  11.713  1.00 32.68  ? 16  PRO A HD3  1  
ATOM 223   N N    . ALA A 1 17  ? 1.510   20.817  10.150  1.00 27.82  ? 17  ALA A N    1  
ATOM 224   C CA   . ALA A 1 17  ? 0.793   19.819  9.345   1.00 26.67  ? 17  ALA A CA   1  
ATOM 225   C C    . ALA A 1 17  ? 1.150   19.873  7.848   1.00 25.23  ? 17  ALA A C    1  
ATOM 226   O O    . ALA A 1 17  ? 1.372   20.949  7.282   1.00 24.72  ? 17  ALA A O    1  
ATOM 227   C CB   . ALA A 1 17  ? -0.712  19.998  9.582   1.00 26.35  ? 17  ALA A CB   1  
ATOM 228   H H    . ALA A 1 17  ? 0.953   21.509  10.627  1.00 27.82  ? 17  ALA A H    1  
ATOM 229   H HA   . ALA A 1 17  ? 1.086   18.833  9.708   1.00 27.33  ? 17  ALA A HA   1  
ATOM 230   H HB1  . ALA A 1 17  ? -1.266  19.216  9.061   1.00 26.20  ? 17  ALA A HB1  1  
ATOM 231   H HB2  . ALA A 1 17  ? -0.935  19.928  10.647  1.00 27.24  ? 17  ALA A HB2  1  
ATOM 232   H HB3  . ALA A 1 17  ? -1.044  20.968  9.213   1.00 25.57  ? 17  ALA A HB3  1  
ATOM 233   N N    . ALA A 1 18  ? 1.167   18.701  7.193   1.00 24.72  ? 18  ALA A N    1  
ATOM 234   C CA   . ALA A 1 18  ? 1.800   18.482  5.885   1.00 23.68  ? 18  ALA A CA   1  
ATOM 235   C C    . ALA A 1 18  ? 1.384   19.497  4.793   1.00 22.09  ? 18  ALA A C    1  
ATOM 236   O O    . ALA A 1 18  ? 2.258   20.206  4.297   1.00 22.20  ? 18  ALA A O    1  
ATOM 237   C CB   . ALA A 1 18  ? 1.557   17.024  5.471   1.00 24.00  ? 18  ALA A CB   1  
ATOM 238   H H    . ALA A 1 18  ? 0.899   17.873  7.711   1.00 25.33  ? 18  ALA A H    1  
ATOM 239   H HA   . ALA A 1 18  ? 2.875   18.611  6.012   1.00 24.08  ? 18  ALA A HA   1  
ATOM 240   H HB1  . ALA A 1 18  ? 2.009   16.352  6.201   1.00 24.81  ? 18  ALA A HB1  1  
ATOM 241   H HB2  . ALA A 1 18  ? 0.483   16.815  5.414   1.00 23.77  ? 18  ALA A HB2  1  
ATOM 242   H HB3  . ALA A 1 18  ? 2.013   16.841  4.496   1.00 23.87  ? 18  ALA A HB3  1  
ATOM 243   N N    . GLN A 1 19  ? 0.085   19.628  4.497   1.00 20.80  ? 19  GLN A N    1  
ATOM 244   C CA   . GLN A 1 19  ? -0.501  20.742  3.731   1.00 19.33  ? 19  GLN A CA   1  
ATOM 245   C C    . GLN A 1 19  ? -2.035  20.683  3.681   1.00 18.14  ? 19  GLN A C    1  
ATOM 246   O O    . GLN A 1 19  ? -2.641  19.617  3.768   1.00 18.46  ? 19  GLN A O    1  
ATOM 247   C CB   . GLN A 1 19  ? 0.117   20.926  2.326   1.00 19.17  ? 19  GLN A CB   1  
ATOM 248   C CG   . GLN A 1 19  ? 0.958   22.217  2.212   1.00 19.16  ? 19  GLN A CG   1  
ATOM 249   C CD   . GLN A 1 19  ? 0.128   23.499  2.217   1.00 18.76  ? 19  GLN A CD   1  
ATOM 250   O OE1  . GLN A 1 19  ? -0.275  23.995  1.173   1.00 18.19  ? 19  GLN A OE1  1  
ATOM 251   N NE2  . GLN A 1 19  ? -0.158  24.108  3.355   1.00 19.28  ? 19  GLN A NE2  1  
ATOM 252   H H    . GLN A 1 19  ? -0.561  18.979  4.924   1.00 20.94  ? 19  GLN A H    1  
ATOM 253   H HA   . GLN A 1 19  ? -0.275  21.634  4.306   1.00 19.43  ? 19  GLN A HA   1  
ATOM 254   H HB2  . GLN A 1 19  ? 0.748   20.071  2.086   1.00 19.93  ? 19  GLN A HB2  1  
ATOM 255   H HB3  . GLN A 1 19  ? -0.674  20.953  1.570   1.00 18.57  ? 19  GLN A HB3  1  
ATOM 256   H HG2  . GLN A 1 19  ? 1.683   22.264  3.022   1.00 19.61  ? 19  GLN A HG2  1  
ATOM 257   H HG3  . GLN A 1 19  ? 1.518   22.174  1.274   1.00 19.30  ? 19  GLN A HG3  1  
ATOM 258   H HE21 . GLN A 1 19  ? 0.199   23.762  4.246   1.00 19.90  ? 19  GLN A HE21 1  
ATOM 259   H HE22 . GLN A 1 19  ? -0.655  24.985  3.304   1.00 19.23  ? 19  GLN A HE22 1  
ATOM 260   N N    . LYS A 1 20  ? -2.675  21.853  3.565   1.00 17.01  ? 20  LYS A N    1  
ATOM 261   C CA   . LYS A 1 20  ? -4.111  22.039  3.849   1.00 16.10  ? 20  LYS A CA   1  
ATOM 262   C C    . LYS A 1 20  ? -5.032  21.903  2.616   1.00 14.80  ? 20  LYS A C    1  
ATOM 263   O O    . LYS A 1 20  ? -5.954  22.700  2.419   1.00 14.69  ? 20  LYS A O    1  
ATOM 264   C CB   . LYS A 1 20  ? -4.298  23.338  4.658   1.00 16.29  ? 20  LYS A CB   1  
ATOM 265   C CG   . LYS A 1 20  ? -3.487  23.245  5.960   1.00 17.19  ? 20  LYS A CG   1  
ATOM 266   C CD   . LYS A 1 20  ? -3.920  24.246  7.030   1.00 18.04  ? 20  LYS A CD   1  
ATOM 267   C CE   . LYS A 1 20  ? -3.163  23.864  8.307   1.00 19.05  ? 20  LYS A CE   1  
ATOM 268   N NZ   . LYS A 1 20  ? -3.798  24.415  9.521   1.00 19.94  ? 20  LYS A NZ   1  
ATOM 269   H H    . LYS A 1 20  ? -2.122  22.689  3.450   1.00 17.06  ? 20  LYS A H    1  
ATOM 270   H HA   . LYS A 1 20  ? -4.427  21.214  4.494   1.00 16.60  ? 20  LYS A HA   1  
ATOM 271   H HB2  . LYS A 1 20  ? -3.977  24.206  4.074   1.00 16.10  ? 20  LYS A HB2  1  
ATOM 272   H HB3  . LYS A 1 20  ? -5.357  23.441  4.908   1.00 16.28  ? 20  LYS A HB3  1  
ATOM 273   H HG2  . LYS A 1 20  ? -3.602  22.243  6.372   1.00 17.41  ? 20  LYS A HG2  1  
ATOM 274   H HG3  . LYS A 1 20  ? -2.430  23.399  5.748   1.00 17.33  ? 20  LYS A HG3  1  
ATOM 275   H HD2  . LYS A 1 20  ? -3.690  25.269  6.723   1.00 18.05  ? 20  LYS A HD2  1  
ATOM 276   H HD3  . LYS A 1 20  ? -4.991  24.142  7.197   1.00 18.18  ? 20  LYS A HD3  1  
ATOM 277   H HE2  . LYS A 1 20  ? -3.143  22.764  8.387   1.00 19.18  ? 20  LYS A HE2  1  
ATOM 278   H HE3  . LYS A 1 20  ? -2.136  24.224  8.245   1.00 19.25  ? 20  LYS A HE3  1  
ATOM 279   H HZ1  . LYS A 1 20  ? -4.794  24.285  9.482   1.00 19.94  ? 20  LYS A HZ1  1  
ATOM 280   H HZ2  . LYS A 1 20  ? -3.535  23.817  10.298  1.00 20.49  ? 20  LYS A HZ2  1  
ATOM 281   H HZ3  . LYS A 1 20  ? -3.516  25.379  9.718   1.00 20.27  ? 20  LYS A HZ3  1  
ATOM 282   N N    . ALA A 1 21  ? -4.753  20.856  1.832   1.00 14.12  ? 21  ALA A N    1  
ATOM 283   C CA   . ALA A 1 21  ? -5.412  20.322  0.633   1.00 13.15  ? 21  ALA A CA   1  
ATOM 284   C C    . ALA A 1 21  ? -4.434  19.362  -0.082  1.00 13.01  ? 21  ALA A C    1  
ATOM 285   O O    . ALA A 1 21  ? -3.341  19.109  0.419   1.00 13.72  ? 21  ALA A O    1  
ATOM 286   C CB   . ALA A 1 21  ? -5.959  21.442  -0.277  1.00 12.54  ? 21  ALA A CB   1  
ATOM 287   H H    . ALA A 1 21  ? -3.941  20.321  2.132   1.00 14.60  ? 21  ALA A H    1  
ATOM 288   H HA   . ALA A 1 21  ? -6.260  19.715  0.959   1.00 13.44  ? 21  ALA A HA   1  
ATOM 289   H HB1  . ALA A 1 21  ? -6.343  21.029  -1.210  1.00 12.18  ? 21  ALA A HB1  1  
ATOM 290   H HB2  . ALA A 1 21  ? -6.783  21.960  0.215   1.00 12.50  ? 21  ALA A HB2  1  
ATOM 291   H HB3  . ALA A 1 21  ? -5.167  22.156  -0.508  1.00 12.97  ? 21  ALA A HB3  1  
ATOM 292   N N    . GLY A 1 22  ? -4.833  18.821  -1.237  1.00 12.47  ? 22  GLY A N    1  
ATOM 293   C CA   . GLY A 1 22  ? -4.001  17.970  -2.098  1.00 12.69  ? 22  GLY A CA   1  
ATOM 294   C C    . GLY A 1 22  ? -4.200  18.277  -3.584  1.00 11.87  ? 22  GLY A C    1  
ATOM 295   O O    . GLY A 1 22  ? -4.275  19.436  -3.993  1.00 11.72  ? 22  GLY A O    1  
ATOM 296   H H    . GLY A 1 22  ? -5.741  19.088  -1.581  1.00 12.13  ? 22  GLY A H    1  
ATOM 297   H HA2  . GLY A 1 22  ? -2.944  18.087  -1.854  1.00 13.37  ? 22  GLY A HA2  1  
ATOM 298   H HA3  . GLY A 1 22  ? -4.269  16.930  -1.919  1.00 13.22  ? 22  GLY A HA3  1  
ATOM 299   N N    . ALA A 1 23  ? -4.301  17.232  -4.409  1.00 11.73  ? 23  ALA A N    1  
ATOM 300   C CA   . ALA A 1 23  ? -4.722  17.355  -5.806  1.00 11.21  ? 23  ALA A CA   1  
ATOM 301   C C    . ALA A 1 23  ? -6.243  17.592  -5.907  1.00 9.90   ? 23  ALA A C    1  
ATOM 302   O O    . ALA A 1 23  ? -7.028  16.899  -5.254  1.00 9.63   ? 23  ALA A O    1  
ATOM 303   C CB   . ALA A 1 23  ? -4.287  16.091  -6.562  1.00 12.07  ? 23  ALA A CB   1  
ATOM 304   H H    . ALA A 1 23  ? -4.243  16.299  -4.032  1.00 12.18  ? 23  ALA A H    1  
ATOM 305   H HA   . ALA A 1 23  ? -4.215  18.209  -6.262  1.00 11.61  ? 23  ALA A HA   1  
ATOM 306   H HB1  . ALA A 1 23  ? -4.532  16.192  -7.623  1.00 12.19  ? 23  ALA A HB1  1  
ATOM 307   H HB2  . ALA A 1 23  ? -3.206  15.952  -6.468  1.00 13.03  ? 23  ALA A HB2  1  
ATOM 308   H HB3  . ALA A 1 23  ? -4.804  15.217  -6.161  1.00 12.00  ? 23  ALA A HB3  1  
ATOM 309   N N    . GLN A 1 24  ? -6.639  18.574  -6.720  1.00 9.62   ? 24  GLN A N    1  
ATOM 310   C CA   . GLN A 1 24  ? -8.019  18.856  -7.120  1.00 8.92   ? 24  GLN A CA   1  
ATOM 311   C C    . GLN A 1 24  ? -8.427  18.030  -8.354  1.00 9.12   ? 24  GLN A C    1  
ATOM 312   O O    . GLN A 1 24  ? -7.565  17.548  -9.078  1.00 10.13  ? 24  GLN A O    1  
ATOM 313   C CB   . GLN A 1 24  ? -8.187  20.373  -7.380  1.00 9.14   ? 24  GLN A CB   1  
ATOM 314   C CG   . GLN A 1 24  ? -7.624  20.926  -8.713  1.00 10.16  ? 24  GLN A CG   1  
ATOM 315   C CD   . GLN A 1 24  ? -6.100  20.890  -8.866  1.00 11.18  ? 24  GLN A CD   1  
ATOM 316   O OE1  . GLN A 1 24  ? -5.344  20.713  -7.924  1.00 11.37  ? 24  GLN A OE1  1  
ATOM 317   N NE2  . GLN A 1 24  ? -5.576  21.091  -10.050 1.00 12.22  ? 24  GLN A NE2  1  
ATOM 318   H H    . GLN A 1 24  ? -5.916  19.125  -7.173  1.00 10.34  ? 24  GLN A H    1  
ATOM 319   H HA   . GLN A 1 24  ? -8.672  18.569  -6.294  1.00 8.60   ? 24  GLN A HA   1  
ATOM 320   H HB2  . GLN A 1 24  ? -9.254  20.587  -7.371  1.00 8.51   ? 24  GLN A HB2  1  
ATOM 321   H HB3  . GLN A 1 24  ? -7.746  20.929  -6.549  1.00 9.67   ? 24  GLN A HB3  1  
ATOM 322   H HG2  . GLN A 1 24  ? -8.071  20.392  -9.549  1.00 10.34  ? 24  GLN A HG2  1  
ATOM 323   H HG3  . GLN A 1 24  ? -7.936  21.967  -8.806  1.00 10.37  ? 24  GLN A HG3  1  
ATOM 324   H HE21 . GLN A 1 24  ? -6.154  21.322  -10.845 1.00 12.43  ? 24  GLN A HE21 1  
ATOM 325   H HE22 . GLN A 1 24  ? -4.571  21.120  -10.099 1.00 13.01  ? 24  GLN A HE22 1  
ATOM 326   N N    . ALA A 1 25  ? -9.737  17.932  -8.637  1.00 8.52   ? 25  ALA A N    1  
ATOM 327   C CA   . ALA A 1 25  ? -10.283 17.475  -9.930  1.00 9.07   ? 25  ALA A CA   1  
ATOM 328   C C    . ALA A 1 25  ? -9.911  16.024  -10.328 1.00 9.01   ? 25  ALA A C    1  
ATOM 329   O O    . ALA A 1 25  ? -9.912  15.693  -11.513 1.00 9.70   ? 25  ALA A O    1  
ATOM 330   C CB   . ALA A 1 25  ? -9.933  18.506  -11.021 1.00 10.67  ? 25  ALA A CB   1  
ATOM 331   H H    . ALA A 1 25  ? -10.391 18.343  -7.989  1.00 7.96   ? 25  ALA A H    1  
ATOM 332   H HA   . ALA A 1 25  ? -11.368 17.470  -9.839  1.00 8.71   ? 25  ALA A HA   1  
ATOM 333   H HB1  . ALA A 1 25  ? -8.857  18.500  -11.212 1.00 11.69  ? 25  ALA A HB1  1  
ATOM 334   H HB2  . ALA A 1 25  ? -10.453 18.253  -11.946 1.00 11.03  ? 25  ALA A HB2  1  
ATOM 335   H HB3  . ALA A 1 25  ? -10.244 19.504  -10.709 1.00 10.79  ? 25  ALA A HB3  1  
ATOM 336   N N    . LEU A 1 26  ? -9.602  15.148  -9.365  1.00 8.46   ? 26  LEU A N    1  
ATOM 337   C CA   . LEU A 1 26  ? -9.358  13.718  -9.606  1.00 8.40   ? 26  LEU A CA   1  
ATOM 338   C C    . LEU A 1 26  ? -10.599 12.884  -9.206  1.00 7.56   ? 26  LEU A C    1  
ATOM 339   O O    . LEU A 1 26  ? -10.757 12.605  -8.009  1.00 7.05   ? 26  LEU A O    1  
ATOM 340   C CB   . LEU A 1 26  ? -8.082  13.279  -8.839  1.00 8.59   ? 26  LEU A CB   1  
ATOM 341   C CG   . LEU A 1 26  ? -6.767  13.261  -9.649  1.00 9.82   ? 26  LEU A CG   1  
ATOM 342   C CD1  . LEU A 1 26  ? -6.814  12.260  -10.816 1.00 10.16  ? 26  LEU A CD1  1  
ATOM 343   C CD2  . LEU A 1 26  ? -6.359  14.649  -10.155 1.00 10.91  ? 26  LEU A CD2  1  
ATOM 344   H H    . LEU A 1 26  ? -9.551  15.495  -8.419  1.00 8.26   ? 26  LEU A H    1  
ATOM 345   H HA   . LEU A 1 26  ? -9.179  13.559  -10.667 1.00 9.19   ? 26  LEU A HA   1  
ATOM 346   H HB2  . LEU A 1 26  ? -7.944  13.919  -7.966  1.00 8.49   ? 26  LEU A HB2  1  
ATOM 347   H HB3  . LEU A 1 26  ? -8.226  12.272  -8.455  1.00 8.28   ? 26  LEU A HB3  1  
ATOM 348   H HG   . LEU A 1 26  ? -5.984  12.923  -8.969  1.00 10.15  ? 26  LEU A HG   1  
ATOM 349   H HD11 . LEU A 1 26  ? -7.126  11.280  -10.454 1.00 9.93   ? 26  LEU A HD11 1  
ATOM 350   H HD12 . LEU A 1 26  ? -7.501  12.595  -11.593 1.00 10.15  ? 26  LEU A HD12 1  
ATOM 351   H HD13 . LEU A 1 26  ? -5.820  12.167  -11.253 1.00 11.14  ? 26  LEU A HD13 1  
ATOM 352   H HD21 . LEU A 1 26  ? -7.100  15.036  -10.855 1.00 10.64  ? 26  LEU A HD21 1  
ATOM 353   H HD22 . LEU A 1 26  ? -6.266  15.328  -9.310  1.00 11.26  ? 26  LEU A HD22 1  
ATOM 354   H HD23 . LEU A 1 26  ? -5.395  14.587  -10.660 1.00 11.99  ? 26  LEU A HD23 1  
ATOM 355   N N    . PRO A 1 27  ? -11.452 12.428  -10.157 1.00 7.68   ? 27  PRO A N    1  
ATOM 356   C CA   . PRO A 1 27  ? -12.643 11.625  -9.863  1.00 7.21   ? 27  PRO A CA   1  
ATOM 357   C C    . PRO A 1 27  ? -12.269 10.168  -9.518  1.00 6.42   ? 27  PRO A C    1  
ATOM 358   O O    . PRO A 1 27  ? -12.562 9.221   -10.247 1.00 6.64   ? 27  PRO A O    1  
ATOM 359   C CB   . PRO A 1 27  ? -13.555 11.782  -11.086 1.00 8.09   ? 27  PRO A CB   1  
ATOM 360   C CG   . PRO A 1 27  ? -12.577 11.998  -12.235 1.00 8.76   ? 27  PRO A CG   1  
ATOM 361   C CD   . PRO A 1 27  ? -11.428 12.764  -11.579 1.00 8.60   ? 27  PRO A CD   1  
ATOM 362   H HA   . PRO A 1 27  ? -13.162 12.045  -8.999  1.00 7.10   ? 27  PRO A HA   1  
ATOM 363   H HB2  . PRO A 1 27  ? -14.200 10.920  -11.255 1.00 8.08   ? 27  PRO A HB2  1  
ATOM 364   H HB3  . PRO A 1 27  ? -14.163 12.679  -10.964 1.00 8.51   ? 27  PRO A HB3  1  
ATOM 365   H HG2  . PRO A 1 27  ? -12.219 11.040  -12.601 1.00 8.68   ? 27  PRO A HG2  1  
ATOM 366   H HG3  . PRO A 1 27  ? -13.027 12.571  -13.046 1.00 9.57   ? 27  PRO A HG3  1  
ATOM 367   H HD2  . PRO A 1 27  ? -10.482 12.485  -12.040 1.00 8.91   ? 27  PRO A HD2  1  
ATOM 368   H HD3  . PRO A 1 27  ? -11.601 13.834  -11.697 1.00 9.08   ? 27  PRO A HD3  1  
ATOM 369   N N    . VAL A 1 28  ? -11.591 10.008  -8.380  1.00 5.68   ? 28  VAL A N    1  
ATOM 370   C CA   . VAL A 1 28  ? -11.095 8.744   -7.821  1.00 4.94   ? 28  VAL A CA   1  
ATOM 371   C C    . VAL A 1 28  ? -10.941 8.901   -6.306  1.00 4.79   ? 28  VAL A C    1  
ATOM 372   O O    . VAL A 1 28  ? -10.528 9.963   -5.834  1.00 5.32   ? 28  VAL A O    1  
ATOM 373   C CB   . VAL A 1 28  ? -9.783  8.288   -8.500  1.00 5.02   ? 28  VAL A CB   1  
ATOM 374   C CG1  . VAL A 1 28  ? -8.682  9.363   -8.500  1.00 5.59   ? 28  VAL A CG1  1  
ATOM 375   C CG2  . VAL A 1 28  ? -9.237  6.989   -7.886  1.00 5.12   ? 28  VAL A CG2  1  
ATOM 376   H H    . VAL A 1 28  ? -11.344 10.860  -7.866  1.00 5.84   ? 28  VAL A H    1  
ATOM 377   H HA   . VAL A 1 28  ? -11.849 7.976   -8.003  1.00 4.72   ? 28  VAL A HA   1  
ATOM 378   H HB   . VAL A 1 28  ? -10.025 8.072   -9.540  1.00 5.34   ? 28  VAL A HB   1  
ATOM 379   H HG11 . VAL A 1 28  ? -7.775  8.972   -8.962  1.00 6.50   ? 28  VAL A HG11 1  
ATOM 380   H HG12 . VAL A 1 28  ? -9.013  10.223  -9.081  1.00 5.78   ? 28  VAL A HG12 1  
ATOM 381   H HG13 . VAL A 1 28  ? -8.448  9.675   -7.483  1.00 5.63   ? 28  VAL A HG13 1  
ATOM 382   H HG21 . VAL A 1 28  ? -8.911  7.156   -6.860  1.00 5.73   ? 28  VAL A HG21 1  
ATOM 383   H HG22 . VAL A 1 28  ? -10.008 6.218   -7.899  1.00 4.40   ? 28  VAL A HG22 1  
ATOM 384   H HG23 . VAL A 1 28  ? -8.383  6.644   -8.467  1.00 6.10   ? 28  VAL A HG23 1  
ATOM 385   N N    . THR A 1 29  ? -11.369 7.871   -5.564  1.00 4.26   ? 29  THR A N    1  
ATOM 386   C CA   . THR A 1 29  ? -11.645 7.956   -4.125  1.00 4.20   ? 29  THR A CA   1  
ATOM 387   C C    . THR A 1 29  ? -10.651 7.103   -3.344  1.00 3.58   ? 29  THR A C    1  
ATOM 388   O O    . THR A 1 29  ? -10.300 6.005   -3.771  1.00 3.39   ? 29  THR A O    1  
ATOM 389   C CB   . THR A 1 29  ? -13.091 7.506   -3.863  1.00 4.57   ? 29  THR A CB   1  
ATOM 390   O OG1  . THR A 1 29  ? -13.948 8.242   -4.708  1.00 5.44   ? 29  THR A OG1  1  
ATOM 391   C CG2  . THR A 1 29  ? -13.574 7.782   -2.439  1.00 4.94   ? 29  THR A CG2  1  
ATOM 392   H H    . THR A 1 29  ? -11.590 6.997   -6.028  1.00 4.05   ? 29  THR A H    1  
ATOM 393   H HA   . THR A 1 29  ? -11.552 8.994   -3.796  1.00 4.81   ? 29  THR A HA   1  
ATOM 394   H HB   . THR A 1 29  ? -13.186 6.438   -4.077  1.00 4.47   ? 29  THR A HB   1  
ATOM 395   H HG1  . THR A 1 29  ? -13.583 8.219   -5.595  1.00 5.78   ? 29  THR A HG1  1  
ATOM 396   H HG21 . THR A 1 29  ? -13.428 8.829   -2.184  1.00 5.75   ? 29  THR A HG21 1  
ATOM 397   H HG22 . THR A 1 29  ? -14.635 7.545   -2.359  1.00 5.25   ? 29  THR A HG22 1  
ATOM 398   H HG23 . THR A 1 29  ? -13.037 7.155   -1.734  1.00 4.77   ? 29  THR A HG23 1  
ATOM 399   N N    . VAL A 1 30  ? -10.242 7.592   -2.179  1.00 3.70   ? 30  VAL A N    1  
ATOM 400   C CA   . VAL A 1 30  ? -9.360  6.880   -1.238  1.00 3.38   ? 30  VAL A CA   1  
ATOM 401   C C    . VAL A 1 30  ? -10.224 5.964   -0.363  1.00 2.72   ? 30  VAL A C    1  
ATOM 402   O O    . VAL A 1 30  ? -11.352 6.295   -0.012  1.00 3.41   ? 30  VAL A O    1  
ATOM 403   C CB   . VAL A 1 30  ? -8.511  7.861   -0.389  1.00 4.65   ? 30  VAL A CB   1  
ATOM 404   C CG1  . VAL A 1 30  ? -7.639  7.140   0.655   1.00 5.60   ? 30  VAL A CG1  1  
ATOM 405   C CG2  . VAL A 1 30  ? -7.585  8.689   -1.299  1.00 5.64   ? 30  VAL A CG2  1  
ATOM 406   H H    . VAL A 1 30  ? -10.655 8.458   -1.871  1.00 4.27   ? 30  VAL A H    1  
ATOM 407   H HA   . VAL A 1 30  ? -8.669  6.256   -1.815  1.00 3.40   ? 30  VAL A HA   1  
ATOM 408   H HB   . VAL A 1 30  ? -9.185  8.544   0.130   1.00 5.23   ? 30  VAL A HB   1  
ATOM 409   H HG11 . VAL A 1 30  ? -7.030  6.375   0.174   1.00 5.73   ? 30  VAL A HG11 1  
ATOM 410   H HG12 . VAL A 1 30  ? -6.985  7.855   1.155   1.00 6.57   ? 30  VAL A HG12 1  
ATOM 411   H HG13 . VAL A 1 30  ? -8.269  6.680   1.415   1.00 6.02   ? 30  VAL A HG13 1  
ATOM 412   H HG21 . VAL A 1 30  ? -6.986  9.373   -0.698  1.00 6.43   ? 30  VAL A HG21 1  
ATOM 413   H HG22 . VAL A 1 30  ? -6.920  8.030   -1.857  1.00 5.91   ? 30  VAL A HG22 1  
ATOM 414   H HG23 . VAL A 1 30  ? -8.172  9.281   -2.001  1.00 6.10   ? 30  VAL A HG23 1  
ATOM 415   N N    . GLN A 1 31  ? -9.691  4.792   -0.041  1.00 2.27   ? 31  GLN A N    1  
ATOM 416   C CA   . GLN A 1 31  ? -10.349 3.706   0.700   1.00 2.87   ? 31  GLN A CA   1  
ATOM 417   C C    . GLN A 1 31  ? -10.111 3.777   2.214   1.00 3.05   ? 31  GLN A C    1  
ATOM 418   O O    . GLN A 1 31  ? -10.974 3.369   2.989   1.00 4.64   ? 31  GLN A O    1  
ATOM 419   C CB   . GLN A 1 31  ? -9.869  2.331   0.178   1.00 3.40   ? 31  GLN A CB   1  
ATOM 420   C CG   . GLN A 1 31  ? -8.727  2.287   -0.864  1.00 3.39   ? 31  GLN A CG   1  
ATOM 421   C CD   . GLN A 1 31  ? -7.395  2.952   -0.475  1.00 3.18   ? 31  GLN A CD   1  
ATOM 422   O OE1  . GLN A 1 31  ? -7.218  3.485   0.604   1.00 4.25   ? 31  GLN A OE1  1  
ATOM 423   N NE2  . GLN A 1 31  ? -6.400  3.002   -1.326  1.00 2.68   ? 31  GLN A NE2  1  
ATOM 424   H H    . GLN A 1 31  ? -8.722  4.653   -0.280  1.00 2.43   ? 31  GLN A H    1  
ATOM 425   H HA   . GLN A 1 31  ? -11.430 3.780   0.563   1.00 3.60   ? 31  GLN A HA   1  
ATOM 426   H HB2  . GLN A 1 31  ? -9.568  1.712   1.027   1.00 3.72   ? 31  GLN A HB2  1  
ATOM 427   H HB3  . GLN A 1 31  ? -10.732 1.834   -0.269  1.00 3.97   ? 31  GLN A HB3  1  
ATOM 428   H HG2  . GLN A 1 31  ? -8.533  1.236   -1.042  1.00 4.12   ? 31  GLN A HG2  1  
ATOM 429   H HG3  . GLN A 1 31  ? -9.076  2.728   -1.799  1.00 4.27   ? 31  GLN A HG3  1  
ATOM 430   H HE21 . GLN A 1 31  ? -6.459  2.478   -2.195  1.00 2.18   ? 31  GLN A HE21 1  
ATOM 431   H HE22 . GLN A 1 31  ? -5.570  3.485   -1.028  1.00 3.42   ? 31  GLN A HE22 1  
ATOM 432   N N    . GLY A 1 32  ? -8.931  4.263   2.611   1.00 1.94   ? 32  GLY A N    1  
ATOM 433   C CA   . GLY A 1 32  ? -8.575  4.728   3.960   1.00 2.13   ? 32  GLY A CA   1  
ATOM 434   C C    . GLY A 1 32  ? -7.091  4.581   4.307   1.00 1.95   ? 32  GLY A C    1  
ATOM 435   O O    . GLY A 1 32  ? -6.577  5.380   5.082   1.00 2.34   ? 32  GLY A O    1  
ATOM 436   H H    . GLY A 1 32  ? -8.214  4.304   1.887   1.00 1.72   ? 32  GLY A H    1  
ATOM 437   H HA2  . GLY A 1 32  ? -8.818  5.789   4.028   1.00 2.49   ? 32  GLY A HA2  1  
ATOM 438   H HA3  . GLY A 1 32  ? -9.167  4.197   4.705   1.00 2.29   ? 32  GLY A HA3  1  
ATOM 439   N N    . ALA A 1 33  ? -6.434  3.579   3.699   1.00 1.73   ? 33  ALA A N    1  
ATOM 440   C CA   . ALA A 1 33  ? -5.027  3.172   3.851   1.00 1.58   ? 33  ALA A CA   1  
ATOM 441   C C    . ALA A 1 33  ? -4.698  2.677   5.278   1.00 1.38   ? 33  ALA A C    1  
ATOM 442   O O    . ALA A 1 33  ? -4.961  3.369   6.265   1.00 1.90   ? 33  ALA A O    1  
ATOM 443   C CB   . ALA A 1 33  ? -4.103  4.301   3.369   1.00 1.82   ? 33  ALA A CB   1  
ATOM 444   H H    . ALA A 1 33  ? -6.984  3.035   3.052   1.00 1.91   ? 33  ALA A H    1  
ATOM 445   H HA   . ALA A 1 33  ? -4.862  2.324   3.187   1.00 1.57   ? 33  ALA A HA   1  
ATOM 446   H HB1  . ALA A 1 33  ? -4.352  4.572   2.342   1.00 2.72   ? 33  ALA A HB1  1  
ATOM 447   H HB2  . ALA A 1 33  ? -4.223  5.186   3.997   1.00 2.70   ? 33  ALA A HB2  1  
ATOM 448   H HB3  . ALA A 1 33  ? -3.063  3.976   3.411   1.00 1.62   ? 33  ALA A HB3  1  
ATOM 449   N N    . THR A 1 34  ? -4.139  1.463   5.429   1.00 0.96   ? 34  THR A N    1  
ATOM 450   C CA   . THR A 1 34  ? -3.932  0.870   6.767   1.00 0.94   ? 34  THR A CA   1  
ATOM 451   C C    . THR A 1 34  ? -2.713  -0.042  6.863   1.00 0.80   ? 34  THR A C    1  
ATOM 452   O O    . THR A 1 34  ? -2.408  -0.763  5.914   1.00 0.92   ? 34  THR A O    1  
ATOM 453   C CB   . THR A 1 34  ? -5.209  0.158   7.239   1.00 1.26   ? 34  THR A CB   1  
ATOM 454   O OG1  . THR A 1 34  ? -6.267  1.087   7.244   1.00 2.11   ? 34  THR A OG1  1  
ATOM 455   C CG2  . THR A 1 34  ? -5.148  -0.385  8.660   1.00 1.68   ? 34  THR A CG2  1  
ATOM 456   H H    . THR A 1 34  ? -3.979  0.874   4.624   1.00 1.09   ? 34  THR A H    1  
ATOM 457   H HA   . THR A 1 34  ? -3.749  1.694   7.438   1.00 1.02   ? 34  THR A HA   1  
ATOM 458   H HB   . THR A 1 34  ? -5.432  -0.665  6.563   1.00 1.15   ? 34  THR A HB   1  
ATOM 459   H HG1  . THR A 1 34  ? -5.892  1.957   7.043   1.00 2.90   ? 34  THR A HG1  1  
ATOM 460   H HG21 . THR A 1 34  ? -6.130  -0.780  8.916   1.00 2.11   ? 34  THR A HG21 1  
ATOM 461   H HG22 . THR A 1 34  ? -4.420  -1.193  8.731   1.00 2.48   ? 34  THR A HG22 1  
ATOM 462   H HG23 . THR A 1 34  ? -4.892  0.412   9.356   1.00 2.51   ? 34  THR A HG23 1  
ATOM 463   N N    . VAL A 1 35  ? -2.041  -0.006  8.021   1.00 0.74   ? 35  VAL A N    1  
ATOM 464   C CA   . VAL A 1 35  ? -0.920  -0.905  8.397   1.00 0.70   ? 35  VAL A CA   1  
ATOM 465   C C    . VAL A 1 35  ? -1.260  -1.915  9.505   1.00 0.78   ? 35  VAL A C    1  
ATOM 466   O O    . VAL A 1 35  ? -2.066  -1.639  10.387  1.00 0.91   ? 35  VAL A O    1  
ATOM 467   C CB   . VAL A 1 35  ? 0.342   -0.138  8.848   1.00 0.86   ? 35  VAL A CB   1  
ATOM 468   C CG1  . VAL A 1 35  ? 1.119   0.385   7.636   1.00 1.93   ? 35  VAL A CG1  1  
ATOM 469   C CG2  . VAL A 1 35  ? 0.061   1.029   9.795   1.00 1.80   ? 35  VAL A CG2  1  
ATOM 470   H H    . VAL A 1 35  ? -2.355  0.684   8.704   1.00 0.85   ? 35  VAL A H    1  
ATOM 471   H HA   . VAL A 1 35  ? -0.655  -1.482  7.515   1.00 0.73   ? 35  VAL A HA   1  
ATOM 472   H HB   . VAL A 1 35  ? 0.965   -0.845  9.406   1.00 2.26   ? 35  VAL A HB   1  
ATOM 473   H HG11 . VAL A 1 35  ? 1.530   -0.457  7.081   1.00 2.62   ? 35  VAL A HG11 1  
ATOM 474   H HG12 . VAL A 1 35  ? 0.466   0.970   6.988   1.00 3.30   ? 35  VAL A HG12 1  
ATOM 475   H HG13 . VAL A 1 35  ? 1.936   1.023   7.973   1.00 2.40   ? 35  VAL A HG13 1  
ATOM 476   H HG21 . VAL A 1 35  ? -0.530  1.797   9.298   1.00 1.95   ? 35  VAL A HG21 1  
ATOM 477   H HG22 . VAL A 1 35  ? -0.472  0.653   10.659  1.00 3.20   ? 35  VAL A HG22 1  
ATOM 478   H HG23 . VAL A 1 35  ? 1.000   1.467   10.134  1.00 2.57   ? 35  VAL A HG23 1  
ATOM 479   N N    . ALA A 1 36  ? -0.602  -3.079  9.482   1.00 0.79   ? 36  ALA A N    1  
ATOM 480   C CA   . ALA A 1 36  ? -0.772  -4.179  10.436  1.00 0.92   ? 36  ALA A CA   1  
ATOM 481   C C    . ALA A 1 36  ? -0.003  -3.965  11.759  1.00 1.14   ? 36  ALA A C    1  
ATOM 482   O O    . ALA A 1 36  ? 1.173   -4.302  11.867  1.00 1.75   ? 36  ALA A O    1  
ATOM 483   C CB   . ALA A 1 36  ? -0.366  -5.487  9.741   1.00 1.01   ? 36  ALA A CB   1  
ATOM 484   H H    . ALA A 1 36  ? 0.044   -3.228  8.712   1.00 0.75   ? 36  ALA A H    1  
ATOM 485   H HA   . ALA A 1 36  ? -1.826  -4.265  10.687  1.00 0.98   ? 36  ALA A HA   1  
ATOM 486   H HB1  . ALA A 1 36  ? 0.682   -5.446  9.445   1.00 1.79   ? 36  ALA A HB1  1  
ATOM 487   H HB2  . ALA A 1 36  ? -0.504  -6.327  10.421  1.00 2.03   ? 36  ALA A HB2  1  
ATOM 488   H HB3  . ALA A 1 36  ? -0.976  -5.649  8.856   1.00 1.90   ? 36  ALA A HB3  1  
ATOM 489   N N    . ALA A 1 37  ? -0.670  -3.406  12.776  1.00 0.93   ? 37  ALA A N    1  
ATOM 490   C CA   . ALA A 1 37  ? -0.144  -3.279  14.157  1.00 1.03   ? 37  ALA A CA   1  
ATOM 491   C C    . ALA A 1 37  ? 0.656   -4.512  14.643  1.00 1.08   ? 37  ALA A C    1  
ATOM 492   O O    . ALA A 1 37  ? 0.193   -5.634  14.455  1.00 1.14   ? 37  ALA A O    1  
ATOM 493   C CB   . ALA A 1 37  ? -1.289  -3.058  15.162  1.00 1.21   ? 37  ALA A CB   1  
ATOM 494   H H    . ALA A 1 37  ? -1.513  -2.913  12.521  1.00 0.99   ? 37  ALA A H    1  
ATOM 495   H HA   . ALA A 1 37  ? 0.512   -2.408  14.171  1.00 1.08   ? 37  ALA A HA   1  
ATOM 496   H HB1  . ALA A 1 37  ? -1.732  -4.016  15.429  1.00 2.14   ? 37  ALA A HB1  1  
ATOM 497   H HB2  . ALA A 1 37  ? -0.886  -2.607  16.072  1.00 2.20   ? 37  ALA A HB2  1  
ATOM 498   H HB3  . ALA A 1 37  ? -2.070  -2.422  14.762  1.00 1.45   ? 37  ALA A HB3  1  
ATOM 499   N N    . VAL A 1 38  ? 1.796   -4.290  15.303  1.00 1.20   ? 38  VAL A N    1  
ATOM 500   C CA   . VAL A 1 38  ? 2.770   -5.323  15.720  1.00 1.30   ? 38  VAL A CA   1  
ATOM 501   C C    . VAL A 1 38  ? 3.307   -5.009  17.122  1.00 1.46   ? 38  VAL A C    1  
ATOM 502   O O    . VAL A 1 38  ? 3.312   -3.832  17.493  1.00 1.50   ? 38  VAL A O    1  
ATOM 503   C CB   . VAL A 1 38  ? 3.972   -5.451  14.737  1.00 1.33   ? 38  VAL A CB   1  
ATOM 504   C CG1  . VAL A 1 38  ? 3.601   -6.344  13.544  1.00 2.23   ? 38  VAL A CG1  1  
ATOM 505   C CG2  . VAL A 1 38  ? 4.514   -4.092  14.250  1.00 2.06   ? 38  VAL A CG2  1  
ATOM 506   H H    . VAL A 1 38  ? 2.011   -3.336  15.572  1.00 1.27   ? 38  VAL A H    1  
ATOM 507   H HA   . VAL A 1 38  ? 2.252   -6.279  15.767  1.00 1.37   ? 38  VAL A HA   1  
ATOM 508   H HB   . VAL A 1 38  ? 4.784   -5.955  15.263  1.00 2.38   ? 38  VAL A HB   1  
ATOM 509   H HG11 . VAL A 1 38  ? 3.262   -7.317  13.903  1.00 3.35   ? 38  VAL A HG11 1  
ATOM 510   H HG12 . VAL A 1 38  ? 2.809   -5.888  12.957  1.00 2.66   ? 38  VAL A HG12 1  
ATOM 511   H HG13 . VAL A 1 38  ? 4.472   -6.496  12.908  1.00 3.14   ? 38  VAL A HG13 1  
ATOM 512   H HG21 . VAL A 1 38  ? 5.402   -4.249  13.638  1.00 2.68   ? 38  VAL A HG21 1  
ATOM 513   H HG22 . VAL A 1 38  ? 3.767   -3.571  13.650  1.00 2.82   ? 38  VAL A HG22 1  
ATOM 514   H HG23 . VAL A 1 38  ? 4.787   -3.472  15.103  1.00 2.90   ? 38  VAL A HG23 1  
ATOM 515   N N    . PRO A 1 39  ? 3.771   -6.015  17.893  1.00 1.66   ? 39  PRO A N    1  
ATOM 516   C CA   . PRO A 1 39  ? 4.398   -5.805  19.194  1.00 1.89   ? 39  PRO A CA   1  
ATOM 517   C C    . PRO A 1 39  ? 5.777   -5.133  19.041  1.00 1.81   ? 39  PRO A C    1  
ATOM 518   O O    . PRO A 1 39  ? 6.428   -5.315  18.010  1.00 1.72   ? 39  PRO A O    1  
ATOM 519   C CB   . PRO A 1 39  ? 4.506   -7.201  19.822  1.00 2.19   ? 39  PRO A CB   1  
ATOM 520   C CG   . PRO A 1 39  ? 4.623   -8.124  18.610  1.00 2.18   ? 39  PRO A CG   1  
ATOM 521   C CD   . PRO A 1 39  ? 3.724   -7.441  17.583  1.00 1.83   ? 39  PRO A CD   1  
ATOM 522   H HA   . PRO A 1 39  ? 3.748   -5.182  19.809  1.00 2.02   ? 39  PRO A HA   1  
ATOM 523   H HB2  . PRO A 1 39  ? 5.367   -7.297  20.485  1.00 2.30   ? 39  PRO A HB2  1  
ATOM 524   H HB3  . PRO A 1 39  ? 3.585   -7.427  20.363  1.00 2.37   ? 39  PRO A HB3  1  
ATOM 525   H HG2  . PRO A 1 39  ? 5.654   -8.133  18.250  1.00 2.19   ? 39  PRO A HG2  1  
ATOM 526   H HG3  . PRO A 1 39  ? 4.285   -9.136  18.835  1.00 2.49   ? 39  PRO A HG3  1  
ATOM 527   H HD2  . PRO A 1 39  ? 4.083   -7.655  16.577  1.00 1.74   ? 39  PRO A HD2  1  
ATOM 528   H HD3  . PRO A 1 39  ? 2.702   -7.799  17.703  1.00 1.94   ? 39  PRO A HD3  1  
ATOM 529   N N    . PRO A 1 40  ? 6.268   -4.407  20.068  1.00 1.95   ? 40  PRO A N    1  
ATOM 530   C CA   . PRO A 1 40  ? 7.516   -3.632  20.007  1.00 1.95   ? 40  PRO A CA   1  
ATOM 531   C C    . PRO A 1 40  ? 8.771   -4.477  19.744  1.00 2.09   ? 40  PRO A C    1  
ATOM 532   O O    . PRO A 1 40  ? 9.811   -3.939  19.372  1.00 3.20   ? 40  PRO A O    1  
ATOM 533   C CB   . PRO A 1 40  ? 7.609   -2.901  21.353  1.00 2.22   ? 40  PRO A CB   1  
ATOM 534   C CG   . PRO A 1 40  ? 6.741   -3.731  22.295  1.00 2.45   ? 40  PRO A CG   1  
ATOM 535   C CD   . PRO A 1 40  ? 5.642   -4.247  21.373  1.00 2.25   ? 40  PRO A CD   1  
ATOM 536   H HA   . PRO A 1 40  ? 7.439   -2.894  19.207  1.00 1.79   ? 40  PRO A HA   1  
ATOM 537   H HB2  . PRO A 1 40  ? 8.636   -2.845  21.716  1.00 2.34   ? 40  PRO A HB2  1  
ATOM 538   H HB3  . PRO A 1 40  ? 7.184   -1.901  21.257  1.00 2.21   ? 40  PRO A HB3  1  
ATOM 539   H HG2  . PRO A 1 40  ? 7.320   -4.570  22.684  1.00 2.61   ? 40  PRO A HG2  1  
ATOM 540   H HG3  . PRO A 1 40  ? 6.333   -3.133  23.111  1.00 2.65   ? 40  PRO A HG3  1  
ATOM 541   H HD2  . PRO A 1 40  ? 5.250   -5.190  21.756  1.00 2.42   ? 40  PRO A HD2  1  
ATOM 542   H HD3  . PRO A 1 40  ? 4.842   -3.508  21.302  1.00 2.26   ? 40  PRO A HD3  1  
ATOM 543   N N    . SER A 1 41  ? 8.678   -5.799  19.913  1.00 2.17   ? 41  SER A N    1  
ATOM 544   C CA   . SER A 1 41  ? 9.714   -6.762  19.525  1.00 2.32   ? 41  SER A CA   1  
ATOM 545   C C    . SER A 1 41  ? 10.054  -6.683  18.023  1.00 2.03   ? 41  SER A C    1  
ATOM 546   O O    . SER A 1 41  ? 11.232  -6.664  17.644  1.00 2.17   ? 41  SER A O    1  
ATOM 547   C CB   . SER A 1 41  ? 9.197   -8.165  19.900  1.00 2.85   ? 41  SER A CB   1  
ATOM 548   O OG   . SER A 1 41  ? 10.179  -9.182  19.769  1.00 3.41   ? 41  SER A OG   1  
ATOM 549   H H    . SER A 1 41  ? 7.801   -6.160  20.248  1.00 2.96   ? 41  SER A H    1  
ATOM 550   H HA   . SER A 1 41  ? 10.625  -6.553  20.083  1.00 2.51   ? 41  SER A HA   1  
ATOM 551   H HB2  . SER A 1 41  ? 8.864   -8.146  20.937  1.00 3.15   ? 41  SER A HB2  1  
ATOM 552   H HB3  . SER A 1 41  ? 8.343   -8.413  19.267  1.00 2.78   ? 41  SER A HB3  1  
ATOM 553   H HG   . SER A 1 41  ? 9.737   -10.037 19.910  1.00 3.98   ? 41  SER A HG   1  
ATOM 554   N N    . ILE A 1 42  ? 9.030   -6.599  17.160  1.00 1.91   ? 42  ILE A N    1  
ATOM 555   C CA   . ILE A 1 42  ? 9.155   -6.722  15.702  1.00 1.81   ? 42  ILE A CA   1  
ATOM 556   C C    . ILE A 1 42  ? 8.993   -5.339  15.059  1.00 1.49   ? 42  ILE A C    1  
ATOM 557   O O    . ILE A 1 42  ? 7.881   -4.849  14.886  1.00 2.04   ? 42  ILE A O    1  
ATOM 558   C CB   . ILE A 1 42  ? 8.123   -7.742  15.159  1.00 2.18   ? 42  ILE A CB   1  
ATOM 559   C CG1  . ILE A 1 42  ? 8.132   -9.102  15.896  1.00 2.78   ? 42  ILE A CG1  1  
ATOM 560   C CG2  . ILE A 1 42  ? 8.349   -7.963  13.652  1.00 2.29   ? 42  ILE A CG2  1  
ATOM 561   C CD1  . ILE A 1 42  ? 9.483   -9.829  15.955  1.00 3.30   ? 42  ILE A CD1  1  
ATOM 562   H H    . ILE A 1 42  ? 8.111   -6.355  17.517  1.00 1.97   ? 42  ILE A H    1  
ATOM 563   H HA   . ILE A 1 42  ? 10.150  -7.095  15.453  1.00 1.88   ? 42  ILE A HA   1  
ATOM 564   H HB   . ILE A 1 42  ? 7.120   -7.322  15.283  1.00 2.21   ? 42  ILE A HB   1  
ATOM 565   H HG12 . ILE A 1 42  ? 7.778   -8.955  16.918  1.00 2.75   ? 42  ILE A HG12 1  
ATOM 566   H HG13 . ILE A 1 42  ? 7.415   -9.761  15.406  1.00 3.24   ? 42  ILE A HG13 1  
ATOM 567   H HG21 . ILE A 1 42  ? 7.647   -8.709  13.272  1.00 2.55   ? 42  ILE A HG21 1  
ATOM 568   H HG22 . ILE A 1 42  ? 8.171   -7.033  13.115  1.00 2.42   ? 42  ILE A HG22 1  
ATOM 569   H HG23 . ILE A 1 42  ? 9.370   -8.293  13.456  1.00 2.93   ? 42  ILE A HG23 1  
ATOM 570   H HD11 . ILE A 1 42  ? 9.847   -10.035 14.949  1.00 4.18   ? 42  ILE A HD11 1  
ATOM 571   H HD12 . ILE A 1 42  ? 10.216  -9.228  16.493  1.00 3.82   ? 42  ILE A HD12 1  
ATOM 572   H HD13 . ILE A 1 42  ? 9.357   -10.776 16.482  1.00 3.34   ? 42  ILE A HD13 1  
ATOM 573   N N    . ARG A 1 43  ? 10.116  -4.699  14.728  1.00 1.28   ? 43  ARG A N    1  
ATOM 574   C CA   . ARG A 1 43  ? 10.191  -3.374  14.088  1.00 1.31   ? 43  ARG A CA   1  
ATOM 575   C C    . ARG A 1 43  ? 9.971   -3.485  12.570  1.00 1.25   ? 43  ARG A C    1  
ATOM 576   O O    . ARG A 1 43  ? 10.714  -2.905  11.783  1.00 1.33   ? 43  ARG A O    1  
ATOM 577   C CB   . ARG A 1 43  ? 11.504  -2.683  14.511  1.00 1.79   ? 43  ARG A CB   1  
ATOM 578   C CG   . ARG A 1 43  ? 12.810  -3.427  14.149  1.00 2.21   ? 43  ARG A CG   1  
ATOM 579   C CD   . ARG A 1 43  ? 13.859  -3.347  15.273  1.00 2.65   ? 43  ARG A CD   1  
ATOM 580   N NE   . ARG A 1 43  ? 13.476  -4.189  16.423  1.00 3.53   ? 43  ARG A NE   1  
ATOM 581   C CZ   . ARG A 1 43  ? 13.959  -4.172  17.658  1.00 4.32   ? 43  ARG A CZ   1  
ATOM 582   N NH1  . ARG A 1 43  ? 14.896  -3.340  18.064  1.00 4.37   ? 43  ARG A NH1  1  
ATOM 583   N NH2  . ARG A 1 43  ? 13.472  -5.022  18.529  1.00 5.52   ? 43  ARG A NH2  1  
ATOM 584   H H    . ARG A 1 43  ? 10.979  -5.198  14.862  1.00 1.67   ? 43  ARG A H    1  
ATOM 585   H HA   . ARG A 1 43  ? 9.378   -2.749  14.472  1.00 1.27   ? 43  ARG A HA   1  
ATOM 586   H HB2  . ARG A 1 43  ? 11.539  -1.686  14.069  1.00 2.46   ? 43  ARG A HB2  1  
ATOM 587   H HB3  . ARG A 1 43  ? 11.457  -2.548  15.593  1.00 2.27   ? 43  ARG A HB3  1  
ATOM 588   H HG2  . ARG A 1 43  ? 12.617  -4.478  13.928  1.00 2.63   ? 43  ARG A HG2  1  
ATOM 589   H HG3  . ARG A 1 43  ? 13.226  -2.975  13.248  1.00 3.09   ? 43  ARG A HG3  1  
ATOM 590   H HD2  . ARG A 1 43  ? 14.818  -3.698  14.884  1.00 3.02   ? 43  ARG A HD2  1  
ATOM 591   H HD3  . ARG A 1 43  ? 13.968  -2.309  15.587  1.00 3.02   ? 43  ARG A HD3  1  
ATOM 592   H HE   . ARG A 1 43  ? 12.784  -4.900  16.260  1.00 3.97   ? 43  ARG A HE   1  
ATOM 593   H HH11 . ARG A 1 43  ? 15.362  -2.732  17.411  1.00 3.91   ? 43  ARG A HH11 1  
ATOM 594   H HH12 . ARG A 1 43  ? 15.209  -3.385  19.030  1.00 5.18   ? 43  ARG A HH12 1  
ATOM 595   H HH21 . ARG A 1 43  ? 12.729  -5.656  18.250  1.00 5.88   ? 43  ARG A HH21 1  
ATOM 596   H HH22 . ARG A 1 43  ? 13.859  -5.089  19.459  1.00 6.21   ? 43  ARG A HH22 1  
ATOM 597   N N    . ASP A 1 44  ? 8.954   -4.240  12.156  1.00 1.24   ? 44  ASP A N    1  
ATOM 598   C CA   . ASP A 1 44  ? 8.681   -4.641  10.773  1.00 1.21   ? 44  ASP A CA   1  
ATOM 599   C C    . ASP A 1 44  ? 7.179   -4.953  10.633  1.00 0.96   ? 44  ASP A C    1  
ATOM 600   O O    . ASP A 1 44  ? 6.624   -5.681  11.452  1.00 0.99   ? 44  ASP A O    1  
ATOM 601   C CB   . ASP A 1 44  ? 9.528   -5.879  10.409  1.00 1.52   ? 44  ASP A CB   1  
ATOM 602   C CG   . ASP A 1 44  ? 11.043  -5.666  10.525  1.00 1.91   ? 44  ASP A CG   1  
ATOM 603   O OD1  . ASP A 1 44  ? 11.640  -5.151  9.580   1.00 2.84   ? 44  ASP A OD1  1  
ATOM 604   O OD2  . ASP A 1 44  ? 11.602  -6.050  11.612  1.00 2.51   ? 44  ASP A OD2  1  
ATOM 605   H H    . ASP A 1 44  ? 8.349   -4.629  12.875  1.00 1.31   ? 44  ASP A H    1  
ATOM 606   H HA   . ASP A 1 44  ? 8.946   -3.828  10.096  1.00 1.30   ? 44  ASP A HA   1  
ATOM 607   H HB2  . ASP A 1 44  ? 9.228   -6.721  11.030  1.00 1.56   ? 44  ASP A HB2  1  
ATOM 608   H HB3  . ASP A 1 44  ? 9.299   -6.158  9.380   1.00 1.64   ? 44  ASP A HB3  1  
ATOM 609   N N    . THR A 1 45  ? 6.514   -4.413  9.608   1.00 0.83   ? 45  THR A N    1  
ATOM 610   C CA   . THR A 1 45  ? 5.043   -4.451  9.444   1.00 0.76   ? 45  THR A CA   1  
ATOM 611   C C    . THR A 1 45  ? 4.695   -4.416  7.957   1.00 0.68   ? 45  THR A C    1  
ATOM 612   O O    . THR A 1 45  ? 5.587   -4.485  7.116   1.00 0.71   ? 45  THR A O    1  
ATOM 613   C CB   . THR A 1 45  ? 4.380   -3.362  10.320  1.00 0.88   ? 45  THR A CB   1  
ATOM 614   O OG1  . THR A 1 45  ? 2.975   -3.322  10.176  1.00 2.03   ? 45  THR A OG1  1  
ATOM 615   C CG2  . THR A 1 45  ? 4.848   -1.947  10.001  1.00 1.70   ? 45  THR A CG2  1  
ATOM 616   H H    . THR A 1 45  ? 7.041   -3.868  8.932   1.00 0.89   ? 45  THR A H    1  
ATOM 617   H HA   . THR A 1 45  ? 4.685   -5.412  9.810   1.00 0.88   ? 45  THR A HA   1  
ATOM 618   H HB   . THR A 1 45  ? 4.620   -3.572  11.363  1.00 1.55   ? 45  THR A HB   1  
ATOM 619   H HG1  . THR A 1 45  ? 2.561   -3.850  10.886  1.00 2.77   ? 45  THR A HG1  1  
ATOM 620   H HG21 . THR A 1 45  ? 5.934   -1.896  9.998   1.00 2.41   ? 45  THR A HG21 1  
ATOM 621   H HG22 . THR A 1 45  ? 4.458   -1.643  9.032   1.00 2.71   ? 45  THR A HG22 1  
ATOM 622   H HG23 . THR A 1 45  ? 4.463   -1.262  10.758  1.00 2.10   ? 45  THR A HG23 1  
ATOM 623   N N    . ALA A 1 46  ? 3.417   -4.311  7.602   1.00 0.89   ? 46  ALA A N    1  
ATOM 624   C CA   . ALA A 1 46  ? 2.949   -4.287  6.219   1.00 0.96   ? 46  ALA A CA   1  
ATOM 625   C C    . ALA A 1 46  ? 1.658   -3.475  6.059   1.00 0.79   ? 46  ALA A C    1  
ATOM 626   O O    . ALA A 1 46  ? 0.863   -3.385  6.998   1.00 0.78   ? 46  ALA A O    1  
ATOM 627   C CB   . ALA A 1 46  ? 2.751   -5.729  5.732   1.00 1.21   ? 46  ALA A CB   1  
ATOM 628   H H    . ALA A 1 46  ? 2.739   -4.156  8.339   1.00 1.10   ? 46  ALA A H    1  
ATOM 629   H HA   . ALA A 1 46  ? 3.716   -3.817  5.608   1.00 1.12   ? 46  ALA A HA   1  
ATOM 630   H HB1  . ALA A 1 46  ? 2.490   -5.728  4.673   1.00 1.94   ? 46  ALA A HB1  1  
ATOM 631   H HB2  . ALA A 1 46  ? 3.666   -6.302  5.864   1.00 1.97   ? 46  ALA A HB2  1  
ATOM 632   H HB3  . ALA A 1 46  ? 1.951   -6.208  6.300   1.00 1.38   ? 46  ALA A HB3  1  
ATOM 633   N N    . ALA A 1 47  ? 1.442   -2.923  4.860   1.00 0.88   ? 47  ALA A N    1  
ATOM 634   C CA   . ALA A 1 47  ? 0.193   -2.282  4.461   1.00 0.79   ? 47  ALA A CA   1  
ATOM 635   C C    . ALA A 1 47  ? -0.517  -3.028  3.317   1.00 0.84   ? 47  ALA A C    1  
ATOM 636   O O    . ALA A 1 47  ? 0.095   -3.697  2.473   1.00 1.03   ? 47  ALA A O    1  
ATOM 637   C CB   . ALA A 1 47  ? 0.431   -0.805  4.119   1.00 0.95   ? 47  ALA A CB   1  
ATOM 638   H H    . ALA A 1 47  ? 2.153   -3.047  4.149   1.00 1.09   ? 47  ALA A H    1  
ATOM 639   H HA   . ALA A 1 47  ? -0.477  -2.309  5.319   1.00 0.77   ? 47  ALA A HA   1  
ATOM 640   H HB1  . ALA A 1 47  ? -0.524  -0.278  4.101   1.00 2.12   ? 47  ALA A HB1  1  
ATOM 641   H HB2  . ALA A 1 47  ? 1.069   -0.338  4.865   1.00 1.52   ? 47  ALA A HB2  1  
ATOM 642   H HB3  . ALA A 1 47  ? 0.894   -0.702  3.144   1.00 1.99   ? 47  ALA A HB3  1  
ATOM 643   N N    . TYR A 1 48  ? -1.835  -2.863  3.305   1.00 0.89   ? 48  TYR A N    1  
ATOM 644   C CA   . TYR A 1 48  ? -2.832  -3.616  2.545   1.00 1.04   ? 48  TYR A CA   1  
ATOM 645   C C    . TYR A 1 48  ? -4.076  -2.727  2.354   1.00 1.11   ? 48  TYR A C    1  
ATOM 646   O O    . TYR A 1 48  ? -4.424  -1.998  3.281   1.00 1.42   ? 48  TYR A O    1  
ATOM 647   C CB   . TYR A 1 48  ? -3.172  -4.910  3.312   1.00 1.64   ? 48  TYR A CB   1  
ATOM 648   C CG   . TYR A 1 48  ? -3.633  -4.712  4.753   1.00 1.26   ? 48  TYR A CG   1  
ATOM 649   C CD1  . TYR A 1 48  ? -2.695  -4.517  5.791   1.00 2.34   ? 48  TYR A CD1  1  
ATOM 650   C CD2  . TYR A 1 48  ? -5.009  -4.702  5.057   1.00 2.61   ? 48  TYR A CD2  1  
ATOM 651   C CE1  . TYR A 1 48  ? -3.128  -4.264  7.105   1.00 3.37   ? 48  TYR A CE1  1  
ATOM 652   C CE2  . TYR A 1 48  ? -5.448  -4.456  6.373   1.00 3.85   ? 48  TYR A CE2  1  
ATOM 653   C CZ   . TYR A 1 48  ? -4.508  -4.225  7.402   1.00 3.95   ? 48  TYR A CZ   1  
ATOM 654   O OH   . TYR A 1 48  ? -4.938  -3.991  8.674   1.00 5.45   ? 48  TYR A OH   1  
ATOM 655   H H    . TYR A 1 48  ? -2.222  -2.243  4.011   1.00 0.92   ? 48  TYR A H    1  
ATOM 656   H HA   . TYR A 1 48  ? -2.429  -3.880  1.567   1.00 1.06   ? 48  TYR A HA   1  
ATOM 657   H HB2  . TYR A 1 48  ? -3.959  -5.428  2.768   1.00 2.76   ? 48  TYR A HB2  1  
ATOM 658   H HB3  . TYR A 1 48  ? -2.295  -5.555  3.314   1.00 2.88   ? 48  TYR A HB3  1  
ATOM 659   H HD1  . TYR A 1 48  ? -1.636  -4.528  5.576   1.00 3.29   ? 48  TYR A HD1  1  
ATOM 660   H HD2  . TYR A 1 48  ? -5.738  -4.853  4.273   1.00 3.42   ? 48  TYR A HD2  1  
ATOM 661   H HE1  . TYR A 1 48  ? -2.401  -4.085  7.878   1.00 4.44   ? 48  TYR A HE1  1  
ATOM 662   H HE2  . TYR A 1 48  ? -6.505  -4.420  6.592   1.00 5.23   ? 48  TYR A HE2  1  
ATOM 663   H HH   . TYR A 1 48  ? -4.223  -3.793  9.291   1.00 5.75   ? 48  TYR A HH   1  
ATOM 664   N N    . MET A 1 49  ? -4.709  -2.730  1.166   1.00 1.10   ? 49  MET A N    1  
ATOM 665   C CA   . MET A 1 49  ? -5.837  -1.831  0.815   1.00 1.51   ? 49  MET A CA   1  
ATOM 666   C C    . MET A 1 49  ? -6.435  -2.099  -0.588  1.00 1.22   ? 49  MET A C    1  
ATOM 667   O O    . MET A 1 49  ? -6.252  -3.181  -1.143  1.00 1.41   ? 49  MET A O    1  
ATOM 668   C CB   . MET A 1 49  ? -5.481  -0.332  1.025   1.00 2.10   ? 49  MET A CB   1  
ATOM 669   C CG   . MET A 1 49  ? -6.637  0.418   1.711   1.00 3.77   ? 49  MET A CG   1  
ATOM 670   S SD   . MET A 1 49  ? -6.869  0.021   3.462   1.00 5.97   ? 49  MET A SD   1  
ATOM 671   C CE   . MET A 1 49  ? -8.539  0.659   3.750   1.00 7.52   ? 49  MET A CE   1  
ATOM 672   H H    . MET A 1 49  ? -4.482  -3.466  0.500   1.00 1.06   ? 49  MET A H    1  
ATOM 673   H HA   . MET A 1 49  ? -6.630  -2.076  1.523   1.00 2.07   ? 49  MET A HA   1  
ATOM 674   H HB2  . MET A 1 49  ? -4.589  -0.205  1.636   1.00 2.64   ? 49  MET A HB2  1  
ATOM 675   H HB3  . MET A 1 49  ? -5.252  0.139   0.067   1.00 1.94   ? 49  MET A HB3  1  
ATOM 676   H HG2  . MET A 1 49  ? -6.427  1.483   1.650   1.00 3.98   ? 49  MET A HG2  1  
ATOM 677   H HG3  . MET A 1 49  ? -7.570  0.218   1.188   1.00 4.43   ? 49  MET A HG3  1  
ATOM 678   H HE1  . MET A 1 49  ? -9.256  0.127   3.125   1.00 8.29   ? 49  MET A HE1  1  
ATOM 679   H HE2  . MET A 1 49  ? -8.805  0.498   4.796   1.00 8.50   ? 49  MET A HE2  1  
ATOM 680   H HE3  . MET A 1 49  ? -8.586  1.725   3.541   1.00 7.30   ? 49  MET A HE3  1  
ATOM 681   N N    . THR A 1 50  ? -7.170  -1.123  -1.160  1.00 1.11   ? 50  THR A N    1  
ATOM 682   C CA   . THR A 1 50  ? -7.948  -1.255  -2.421  1.00 1.12   ? 50  THR A CA   1  
ATOM 683   C C    . THR A 1 50  ? -7.813  0.028   -3.265  1.00 1.48   ? 50  THR A C    1  
ATOM 684   O O    . THR A 1 50  ? -6.960  0.859   -2.957  1.00 2.55   ? 50  THR A O    1  
ATOM 685   C CB   . THR A 1 50  ? -9.421  -1.602  -2.099  1.00 1.57   ? 50  THR A CB   1  
ATOM 686   O OG1  . THR A 1 50  ? -9.465  -2.429  -0.961  1.00 2.02   ? 50  THR A OG1  1  
ATOM 687   C CG2  . THR A 1 50  ? -10.152 -2.389  -3.188  1.00 2.05   ? 50  THR A CG2  1  
ATOM 688   H H    . THR A 1 50  ? -7.245  -0.241  -0.659  1.00 1.25   ? 50  THR A H    1  
ATOM 689   H HA   . THR A 1 50  ? -7.527  -2.063  -3.019  1.00 1.07   ? 50  THR A HA   1  
ATOM 690   H HB   . THR A 1 50  ? -9.975  -0.688  -1.879  1.00 2.46   ? 50  THR A HB   1  
ATOM 691   H HG1  . THR A 1 50  ? -8.866  -3.166  -1.137  1.00 2.22   ? 50  THR A HG1  1  
ATOM 692   H HG21 . THR A 1 50  ? -9.582  -3.277  -3.465  1.00 2.36   ? 50  THR A HG21 1  
ATOM 693   H HG22 . THR A 1 50  ? -11.133 -2.698  -2.823  1.00 2.48   ? 50  THR A HG22 1  
ATOM 694   H HG23 . THR A 1 50  ? -10.309 -1.776  -4.072  1.00 3.33   ? 50  THR A HG23 1  
ATOM 695   N N    . LEU A 1 51  ? -8.649  0.249   -4.282  1.00 1.33   ? 51  LEU A N    1  
ATOM 696   C CA   . LEU A 1 51  ? -8.734  1.511   -5.027  1.00 1.60   ? 51  LEU A CA   1  
ATOM 697   C C    . LEU A 1 51  ? -10.057 1.616   -5.792  1.00 1.78   ? 51  LEU A C    1  
ATOM 698   O O    . LEU A 1 51  ? -10.168 1.154   -6.928  1.00 2.43   ? 51  LEU A O    1  
ATOM 699   C CB   . LEU A 1 51  ? -7.503  1.653   -5.949  1.00 1.97   ? 51  LEU A CB   1  
ATOM 700   C CG   . LEU A 1 51  ? -7.218  3.064   -6.494  1.00 2.88   ? 51  LEU A CG   1  
ATOM 701   C CD1  . LEU A 1 51  ? -8.248  3.570   -7.512  1.00 3.62   ? 51  LEU A CD1  1  
ATOM 702   C CD2  . LEU A 1 51  ? -7.029  4.112   -5.385  1.00 3.65   ? 51  LEU A CD2  1  
ATOM 703   H H    . LEU A 1 51  ? -9.164  -0.549  -4.638  1.00 1.61   ? 51  LEU A H    1  
ATOM 704   H HA   . LEU A 1 51  ? -8.713  2.320   -4.297  1.00 1.86   ? 51  LEU A HA   1  
ATOM 705   H HB2  . LEU A 1 51  ? -6.609  1.345   -5.409  1.00 2.14   ? 51  LEU A HB2  1  
ATOM 706   H HB3  . LEU A 1 51  ? -7.607  0.968   -6.789  1.00 2.01   ? 51  LEU A HB3  1  
ATOM 707   H HG   . LEU A 1 51  ? -6.274  2.975   -7.022  1.00 3.76   ? 51  LEU A HG   1  
ATOM 708   H HD11 . LEU A 1 51  ? -9.165  3.880   -7.012  1.00 4.05   ? 51  LEU A HD11 1  
ATOM 709   H HD12 . LEU A 1 51  ? -7.833  4.420   -8.051  1.00 4.34   ? 51  LEU A HD12 1  
ATOM 710   H HD13 . LEU A 1 51  ? -8.475  2.782   -8.228  1.00 4.25   ? 51  LEU A HD13 1  
ATOM 711   H HD21 . LEU A 1 51  ? -7.978  4.330   -4.893  1.00 3.69   ? 51  LEU A HD21 1  
ATOM 712   H HD22 . LEU A 1 51  ? -6.315  3.747   -4.646  1.00 4.44   ? 51  LEU A HD22 1  
ATOM 713   H HD23 . LEU A 1 51  ? -6.643  5.037   -5.818  1.00 4.51   ? 51  LEU A HD23 1  
ATOM 714   N N    . THR A 1 52  ? -11.051 2.264   -5.172  1.00 1.80   ? 52  THR A N    1  
ATOM 715   C CA   . THR A 1 52  ? -12.390 2.472   -5.738  1.00 2.26   ? 52  THR A CA   1  
ATOM 716   C C    . THR A 1 52  ? -12.378 3.684   -6.660  1.00 2.52   ? 52  THR A C    1  
ATOM 717   O O    . THR A 1 52  ? -12.583 4.828   -6.253  1.00 2.79   ? 52  THR A O    1  
ATOM 718   C CB   . THR A 1 52  ? -13.434 2.595   -4.625  1.00 2.92   ? 52  THR A CB   1  
ATOM 719   O OG1  . THR A 1 52  ? -13.420 1.389   -3.899  1.00 3.24   ? 52  THR A OG1  1  
ATOM 720   C CG2  . THR A 1 52  ? -14.855 2.788   -5.157  1.00 2.94   ? 52  THR A CG2  1  
ATOM 721   H H    . THR A 1 52  ? -10.893 2.633   -4.248  1.00 1.88   ? 52  THR A H    1  
ATOM 722   H HA   . THR A 1 52  ? -12.658 1.607   -6.348  1.00 2.26   ? 52  THR A HA   1  
ATOM 723   H HB   . THR A 1 52  ? -13.175 3.428   -3.966  1.00 3.93   ? 52  THR A HB   1  
ATOM 724   H HG1  . THR A 1 52  ? -13.848 0.717   -4.443  1.00 2.85   ? 52  THR A HG1  1  
ATOM 725   H HG21 . THR A 1 52  ? -15.563 2.736   -4.330  1.00 3.33   ? 52  THR A HG21 1  
ATOM 726   H HG22 . THR A 1 52  ? -14.950 3.766   -5.627  1.00 3.76   ? 52  THR A HG22 1  
ATOM 727   H HG23 . THR A 1 52  ? -15.099 2.017   -5.888  1.00 2.96   ? 52  THR A HG23 1  
ATOM 728   N N    . ASN A 1 53  ? -12.170 3.415   -7.945  1.00 2.65   ? 53  ASN A N    1  
ATOM 729   C CA   . ASN A 1 53  ? -12.447 4.387   -9.004  1.00 2.95   ? 53  ASN A CA   1  
ATOM 730   C C    . ASN A 1 53  ? -13.962 4.650   -9.091  1.00 3.45   ? 53  ASN A C    1  
ATOM 731   O O    . ASN A 1 53  ? -14.722 3.805   -9.560  1.00 3.57   ? 53  ASN A O    1  
ATOM 732   C CB   . ASN A 1 53  ? -11.836 3.897   -10.332 1.00 2.60   ? 53  ASN A CB   1  
ATOM 733   C CG   . ASN A 1 53  ? -12.298 2.515   -10.790 1.00 1.64   ? 53  ASN A CG   1  
ATOM 734   O OD1  . ASN A 1 53  ? -11.910 1.486   -10.233 1.00 2.70   ? 53  ASN A OD1  1  
ATOM 735   N ND2  . ASN A 1 53  ? -13.093 2.455   -11.847 1.00 2.05   ? 53  ASN A ND2  1  
ATOM 736   H H    . ASN A 1 53  ? -11.950 2.466   -8.226  1.00 2.65   ? 53  ASN A H    1  
ATOM 737   H HA   . ASN A 1 53  ? -11.957 5.324   -8.749  1.00 3.25   ? 53  ASN A HA   1  
ATOM 738   H HB2  . ASN A 1 53  ? -12.065 4.630   -11.111 1.00 3.40   ? 53  ASN A HB2  1  
ATOM 739   H HB3  . ASN A 1 53  ? -10.753 3.863   -10.226 1.00 3.50   ? 53  ASN A HB3  1  
ATOM 740   H HD21 . ASN A 1 53  ? -13.431 3.312   -12.279 1.00 2.64   ? 53  ASN A HD21 1  
ATOM 741   H HD22 . ASN A 1 53  ? -13.444 1.560   -12.139 1.00 2.96   ? 53  ASN A HD22 1  
ATOM 742   N N    . LYS A 1 54  ? -14.429 5.801   -8.596  1.00 3.92   ? 54  LYS A N    1  
ATOM 743   C CA   . LYS A 1 54  ? -15.865 6.103   -8.451  1.00 4.44   ? 54  LYS A CA   1  
ATOM 744   C C    . LYS A 1 54  ? -16.483 6.627   -9.775  1.00 4.04   ? 54  LYS A C    1  
ATOM 745   O O    . LYS A 1 54  ? -17.276 7.565   -9.788  1.00 4.57   ? 54  LYS A O    1  
ATOM 746   C CB   . LYS A 1 54  ? -16.033 7.019   -7.214  1.00 5.48   ? 54  LYS A CB   1  
ATOM 747   C CG   . LYS A 1 54  ? -17.404 6.891   -6.524  1.00 6.01   ? 54  LYS A CG   1  
ATOM 748   C CD   . LYS A 1 54  ? -17.479 7.730   -5.232  1.00 7.20   ? 54  LYS A CD   1  
ATOM 749   C CE   . LYS A 1 54  ? -18.757 7.413   -4.434  1.00 7.74   ? 54  LYS A CE   1  
ATOM 750   N NZ   . LYS A 1 54  ? -18.859 8.203   -3.175  1.00 8.96   ? 54  LYS A NZ   1  
ATOM 751   H H    . LYS A 1 54  ? -13.760 6.466   -8.233  1.00 4.02   ? 54  LYS A H    1  
ATOM 752   H HA   . LYS A 1 54  ? -16.374 5.163   -8.239  1.00 4.47   ? 54  LYS A HA   1  
ATOM 753   H HB2  . LYS A 1 54  ? -15.283 6.729   -6.476  1.00 5.58   ? 54  LYS A HB2  1  
ATOM 754   H HB3  . LYS A 1 54  ? -15.853 8.059   -7.495  1.00 6.03   ? 54  LYS A HB3  1  
ATOM 755   H HG2  . LYS A 1 54  ? -18.194 7.210   -7.204  1.00 6.10   ? 54  LYS A HG2  1  
ATOM 756   H HG3  . LYS A 1 54  ? -17.569 5.843   -6.267  1.00 5.76   ? 54  LYS A HG3  1  
ATOM 757   H HD2  . LYS A 1 54  ? -16.614 7.510   -4.604  1.00 7.30   ? 54  LYS A HD2  1  
ATOM 758   H HD3  . LYS A 1 54  ? -17.461 8.790   -5.492  1.00 7.88   ? 54  LYS A HD3  1  
ATOM 759   H HE2  . LYS A 1 54  ? -19.629 7.616   -5.065  1.00 7.93   ? 54  LYS A HE2  1  
ATOM 760   H HE3  . LYS A 1 54  ? -18.759 6.347   -4.193  1.00 7.36   ? 54  LYS A HE3  1  
ATOM 761   H HZ1  . LYS A 1 54  ? -19.659 7.925   -2.622  1.00 8.93   ? 54  LYS A HZ1  1  
ATOM 762   H HZ2  . LYS A 1 54  ? -18.048 8.091   -2.566  1.00 9.41   ? 54  LYS A HZ2  1  
ATOM 763   H HZ3  . LYS A 1 54  ? -18.961 9.199   -3.361  1.00 9.75   ? 54  LYS A HZ3  1  
ATOM 764   N N    . SER A 1 55  ? -16.071 6.042   -10.904 1.00 3.22   ? 55  SER A N    1  
ATOM 765   C CA   . SER A 1 55  ? -16.309 6.437   -12.305 1.00 2.93   ? 55  SER A CA   1  
ATOM 766   C C    . SER A 1 55  ? -15.424 5.603   -13.258 1.00 2.34   ? 55  SER A C    1  
ATOM 767   O O    . SER A 1 55  ? -14.398 5.034   -12.868 1.00 2.90   ? 55  SER A O    1  
ATOM 768   C CB   . SER A 1 55  ? -16.096 7.948   -12.552 1.00 3.42   ? 55  SER A CB   1  
ATOM 769   O OG   . SER A 1 55  ? -17.253 8.699   -12.209 1.00 3.74   ? 55  SER A OG   1  
ATOM 770   H H    . SER A 1 55  ? -15.472 5.228   -10.799 1.00 2.90   ? 55  SER A H    1  
ATOM 771   H HA   . SER A 1 55  ? -17.345 6.206   -12.566 1.00 3.00   ? 55  SER A HA   1  
ATOM 772   H HB2  . SER A 1 55  ? -15.239 8.300   -11.978 1.00 3.89   ? 55  SER A HB2  1  
ATOM 773   H HB3  . SER A 1 55  ? -15.890 8.118   -13.609 1.00 3.44   ? 55  SER A HB3  1  
ATOM 774   H HG   . SER A 1 55  ? -17.462 8.503   -11.272 1.00 3.92   ? 55  SER A HG   1  
ATOM 775   N N    . ASP A 1 56  ? -15.852 5.547   -14.517 1.00 1.70   ? 56  ASP A N    1  
ATOM 776   C CA   . ASP A 1 56  ? -15.438 4.656   -15.611 1.00 1.44   ? 56  ASP A CA   1  
ATOM 777   C C    . ASP A 1 56  ? -14.112 5.077   -16.295 1.00 1.82   ? 56  ASP A C    1  
ATOM 778   O O    . ASP A 1 56  ? -13.964 4.939   -17.512 1.00 2.63   ? 56  ASP A O    1  
ATOM 779   C CB   . ASP A 1 56  ? -16.591 4.642   -16.649 1.00 1.82   ? 56  ASP A CB   1  
ATOM 780   C CG   . ASP A 1 56  ? -18.003 4.419   -16.074 1.00 3.14   ? 56  ASP A CG   1  
ATOM 781   O OD1  . ASP A 1 56  ? -18.444 5.287   -15.277 1.00 4.15   ? 56  ASP A OD1  1  
ATOM 782   O OD2  . ASP A 1 56  ? -18.641 3.433   -16.523 1.00 4.09   ? 56  ASP A OD2  1  
ATOM 783   H H    . ASP A 1 56  ? -16.759 5.978   -14.696 1.00 1.93   ? 56  ASP A H    1  
ATOM 784   H HA   . ASP A 1 56  ? -15.313 3.645   -15.216 1.00 1.45   ? 56  ASP A HA   1  
ATOM 785   H HB2  . ASP A 1 56  ? -16.595 5.603   -17.175 1.00 2.20   ? 56  ASP A HB2  1  
ATOM 786   H HB3  . ASP A 1 56  ? -16.378 3.864   -17.390 1.00 2.30   ? 56  ASP A HB3  1  
ATOM 787   N N    . GLN A 1 57  ? -13.178 5.656   -15.540 1.00 1.87   ? 57  GLN A N    1  
ATOM 788   C CA   . GLN A 1 57  ? -12.042 6.395   -16.086 1.00 2.61   ? 57  GLN A CA   1  
ATOM 789   C C    . GLN A 1 57  ? -10.717 5.816   -15.556 1.00 2.47   ? 57  GLN A C    1  
ATOM 790   O O    . GLN A 1 57  ? -10.639 5.535   -14.353 1.00 2.43   ? 57  GLN A O    1  
ATOM 791   C CB   . GLN A 1 57  ? -12.249 7.893   -15.837 1.00 3.48   ? 57  GLN A CB   1  
ATOM 792   C CG   . GLN A 1 57  ? -12.252 8.327   -14.367 1.00 3.13   ? 57  GLN A CG   1  
ATOM 793   C CD   . GLN A 1 57  ? -10.869 8.647   -13.794 1.00 4.30   ? 57  GLN A CD   1  
ATOM 794   O OE1  . GLN A 1 57  ? -9.878  8.789   -14.491 1.00 5.36   ? 57  GLN A OE1  1  
ATOM 795   N NE2  . GLN A 1 57  ? -10.748 8.816   -12.499 1.00 4.79   ? 57  GLN A NE2  1  
ATOM 796   H H    . GLN A 1 57  ? -13.316 5.635   -14.537 1.00 1.78   ? 57  GLN A H    1  
ATOM 797   H HA   . GLN A 1 57  ? -12.068 6.301   -17.162 1.00 2.96   ? 57  GLN A HA   1  
ATOM 798   H HB2  . GLN A 1 57  ? -11.499 8.453   -16.396 1.00 4.89   ? 57  GLN A HB2  1  
ATOM 799   H HB3  . GLN A 1 57  ? -13.219 8.161   -16.265 1.00 3.92   ? 57  GLN A HB3  1  
ATOM 800   H HG2  . GLN A 1 57  ? -12.845 9.232   -14.316 1.00 3.28   ? 57  GLN A HG2  1  
ATOM 801   H HG3  . GLN A 1 57  ? -12.740 7.578   -13.746 1.00 3.04   ? 57  GLN A HG3  1  
ATOM 802   H HE21 . GLN A 1 57  ? -11.546 8.764   -11.872 1.00 4.40   ? 57  GLN A HE21 1  
ATOM 803   H HE22 . GLN A 1 57  ? -9.830  9.055   -12.181 1.00 5.91   ? 57  GLN A HE22 1  
ATOM 804   N N    . PRO A 1 58  ? -9.698  5.620   -16.423 1.00 2.51   ? 58  PRO A N    1  
ATOM 805   C CA   . PRO A 1 58  ? -8.496  4.880   -16.070 1.00 2.54   ? 58  PRO A CA   1  
ATOM 806   C C    . PRO A 1 58  ? -7.416  5.774   -15.446 1.00 2.61   ? 58  PRO A C    1  
ATOM 807   O O    . PRO A 1 58  ? -6.724  6.533   -16.125 1.00 3.27   ? 58  PRO A O    1  
ATOM 808   C CB   . PRO A 1 58  ? -8.020  4.228   -17.373 1.00 2.71   ? 58  PRO A CB   1  
ATOM 809   C CG   . PRO A 1 58  ? -8.453  5.219   -18.447 1.00 2.83   ? 58  PRO A CG   1  
ATOM 810   C CD   . PRO A 1 58  ? -9.742  5.809   -17.871 1.00 2.66   ? 58  PRO A CD   1  
ATOM 811   H HA   . PRO A 1 58  ? -8.748  4.092   -15.358 1.00 2.51   ? 58  PRO A HA   1  
ATOM 812   H HB2  . PRO A 1 58  ? -6.942  4.056   -17.390 1.00 2.86   ? 58  PRO A HB2  1  
ATOM 813   H HB3  . PRO A 1 58  ? -8.553  3.288   -17.528 1.00 2.71   ? 58  PRO A HB3  1  
ATOM 814   H HG2  . PRO A 1 58  ? -7.705  6.003   -18.559 1.00 2.98   ? 58  PRO A HG2  1  
ATOM 815   H HG3  . PRO A 1 58  ? -8.634  4.714   -19.398 1.00 2.94   ? 58  PRO A HG3  1  
ATOM 816   H HD2  . PRO A 1 58  ? -9.821  6.867   -18.120 1.00 2.78   ? 58  PRO A HD2  1  
ATOM 817   H HD3  . PRO A 1 58  ? -10.590 5.260   -18.285 1.00 2.63   ? 58  PRO A HD3  1  
ATOM 818   N N    . ILE A 1 59  ? -7.253  5.641   -14.129 1.00 2.11   ? 59  ILE A N    1  
ATOM 819   C CA   . ILE A 1 59  ? -6.246  6.366   -13.345 1.00 2.13   ? 59  ILE A CA   1  
ATOM 820   C C    . ILE A 1 59  ? -4.867  5.711   -13.489 1.00 2.26   ? 59  ILE A C    1  
ATOM 821   O O    . ILE A 1 59  ? -4.765  4.492   -13.346 1.00 2.56   ? 59  ILE A O    1  
ATOM 822   C CB   . ILE A 1 59  ? -6.643  6.431   -11.850 1.00 2.28   ? 59  ILE A CB   1  
ATOM 823   C CG1  . ILE A 1 59  ? -8.098  6.913   -11.660 1.00 2.66   ? 59  ILE A CG1  1  
ATOM 824   C CG2  . ILE A 1 59  ? -5.698  7.365   -11.068 1.00 2.51   ? 59  ILE A CG2  1  
ATOM 825   C CD1  . ILE A 1 59  ? -9.075  5.759   -11.412 1.00 4.02   ? 59  ILE A CD1  1  
ATOM 826   H H    . ILE A 1 59  ? -7.909  5.048   -13.644 1.00 1.88   ? 59  ILE A H    1  
ATOM 827   H HA   . ILE A 1 59  ? -6.192  7.383   -13.735 1.00 2.20   ? 59  ILE A HA   1  
ATOM 828   H HB   . ILE A 1 59  ? -6.541  5.433   -11.420 1.00 2.55   ? 59  ILE A HB   1  
ATOM 829   H HG12 . ILE A 1 59  ? -8.155  7.581   -10.805 1.00 2.53   ? 59  ILE A HG12 1  
ATOM 830   H HG13 . ILE A 1 59  ? -8.410  7.480   -12.536 1.00 3.56   ? 59  ILE A HG13 1  
ATOM 831   H HG21 . ILE A 1 59  ? -5.996  7.398   -10.019 1.00 2.59   ? 59  ILE A HG21 1  
ATOM 832   H HG22 . ILE A 1 59  ? -4.674  6.994   -11.106 1.00 3.23   ? 59  ILE A HG22 1  
ATOM 833   H HG23 . ILE A 1 59  ? -5.735  8.373   -11.484 1.00 3.07   ? 59  ILE A HG23 1  
ATOM 834   H HD11 . ILE A 1 59  ? -8.803  5.238   -10.494 1.00 4.62   ? 59  ILE A HD11 1  
ATOM 835   H HD12 . ILE A 1 59  ? -10.081 6.162   -11.310 1.00 4.41   ? 59  ILE A HD12 1  
ATOM 836   H HD13 . ILE A 1 59  ? -9.064  5.052   -12.238 1.00 5.13   ? 59  ILE A HD13 1  
ATOM 837   N N    . LYS A 1 60  ? -3.823  6.530   -13.683 1.00 2.24   ? 60  LYS A N    1  
ATOM 838   C CA   . LYS A 1 60  ? -2.410  6.138   -13.594 1.00 2.35   ? 60  LYS A CA   1  
ATOM 839   C C    . LYS A 1 60  ? -1.761  6.699   -12.313 1.00 1.81   ? 60  LYS A C    1  
ATOM 840   O O    . LYS A 1 60  ? -1.954  7.870   -11.994 1.00 1.61   ? 60  LYS A O    1  
ATOM 841   C CB   . LYS A 1 60  ? -1.665  6.573   -14.879 1.00 3.01   ? 60  LYS A CB   1  
ATOM 842   C CG   . LYS A 1 60  ? -1.451  8.096   -15.020 1.00 3.71   ? 60  LYS A CG   1  
ATOM 843   C CD   . LYS A 1 60  ? -0.840  8.484   -16.374 1.00 4.76   ? 60  LYS A CD   1  
ATOM 844   C CE   . LYS A 1 60  ? -0.678  10.009  -16.464 1.00 5.67   ? 60  LYS A CE   1  
ATOM 845   N NZ   . LYS A 1 60  ? -0.254  10.431  -17.820 1.00 6.52   ? 60  LYS A NZ   1  
ATOM 846   H H    . LYS A 1 60  ? -4.013  7.513   -13.794 1.00 2.26   ? 60  LYS A H    1  
ATOM 847   H HA   . LYS A 1 60  ? -2.358  5.050   -13.531 1.00 2.65   ? 60  LYS A HA   1  
ATOM 848   H HB2  . LYS A 1 60  ? -0.694  6.079   -14.898 1.00 3.11   ? 60  LYS A HB2  1  
ATOM 849   H HB3  . LYS A 1 60  ? -2.233  6.212   -15.739 1.00 3.36   ? 60  LYS A HB3  1  
ATOM 850   H HG2  . LYS A 1 60  ? -2.410  8.605   -14.911 1.00 3.81   ? 60  LYS A HG2  1  
ATOM 851   H HG3  . LYS A 1 60  ? -0.781  8.443   -14.234 1.00 3.87   ? 60  LYS A HG3  1  
ATOM 852   H HD2  . LYS A 1 60  ? 0.134   8.005   -16.490 1.00 5.19   ? 60  LYS A HD2  1  
ATOM 853   H HD3  . LYS A 1 60  ? -1.502  8.137   -17.169 1.00 4.99   ? 60  LYS A HD3  1  
ATOM 854   H HE2  . LYS A 1 60  ? -1.639  10.479  -16.229 1.00 5.62   ? 60  LYS A HE2  1  
ATOM 855   H HE3  . LYS A 1 60  ? 0.054   10.344  -15.723 1.00 6.26   ? 60  LYS A HE3  1  
ATOM 856   H HZ1  . LYS A 1 60  ? -0.260  11.444  -17.909 1.00 7.06   ? 60  LYS A HZ1  1  
ATOM 857   H HZ2  . LYS A 1 60  ? 0.677   10.094  -18.050 1.00 7.17   ? 60  LYS A HZ2  1  
ATOM 858   H HZ3  . LYS A 1 60  ? -0.893  10.068  -18.523 1.00 6.42   ? 60  LYS A HZ3  1  
ATOM 859   N N    . LEU A 1 61  ? -0.949  5.898   -11.618 1.00 1.94   ? 61  LEU A N    1  
ATOM 860   C CA   . LEU A 1 61  ? -0.262  6.159   -10.332 1.00 1.61   ? 61  LEU A CA   1  
ATOM 861   C C    . LEU A 1 61  ? 0.627   4.922   -10.033 1.00 1.40   ? 61  LEU A C    1  
ATOM 862   O O    . LEU A 1 61  ? 0.473   3.898   -10.701 1.00 1.94   ? 61  LEU A O    1  
ATOM 863   C CB   . LEU A 1 61  ? -1.314  6.414   -9.208  1.00 1.83   ? 61  LEU A CB   1  
ATOM 864   C CG   . LEU A 1 61  ? -1.332  7.730   -8.397  1.00 2.08   ? 61  LEU A CG   1  
ATOM 865   C CD1  . LEU A 1 61  ? -1.475  9.012   -9.224  1.00 3.24   ? 61  LEU A CD1  1  
ATOM 866   C CD2  . LEU A 1 61  ? -2.489  7.679   -7.388  1.00 2.64   ? 61  LEU A CD2  1  
ATOM 867   H H    . LEU A 1 61  ? -0.918  4.928   -11.921 1.00 2.40   ? 61  LEU A H    1  
ATOM 868   H HA   . LEU A 1 61  ? 0.379   7.027   -10.447 1.00 1.67   ? 61  LEU A HA   1  
ATOM 869   H HB2  . LEU A 1 61  ? -2.305  6.316   -9.645  1.00 2.31   ? 61  LEU A HB2  1  
ATOM 870   H HB3  . LEU A 1 61  ? -1.219  5.620   -8.469  1.00 1.94   ? 61  LEU A HB3  1  
ATOM 871   H HG   . LEU A 1 61  ? -0.420  7.789   -7.820  1.00 2.22   ? 61  LEU A HG   1  
ATOM 872   H HD11 . LEU A 1 61  ? -1.350  9.884   -8.576  1.00 3.45   ? 61  LEU A HD11 1  
ATOM 873   H HD12 . LEU A 1 61  ? -0.737  9.050   -10.022 1.00 4.27   ? 61  LEU A HD12 1  
ATOM 874   H HD13 . LEU A 1 61  ? -2.469  9.037   -9.666  1.00 3.84   ? 61  LEU A HD13 1  
ATOM 875   H HD21 . LEU A 1 61  ? -3.427  7.564   -7.927  1.00 3.53   ? 61  LEU A HD21 1  
ATOM 876   H HD22 . LEU A 1 61  ? -2.356  6.837   -6.703  1.00 2.96   ? 61  LEU A HD22 1  
ATOM 877   H HD23 . LEU A 1 61  ? -2.527  8.607   -6.817  1.00 3.02   ? 61  LEU A HD23 1  
ATOM 878   N N    . VAL A 1 62  ? 1.525   4.973   -9.040  1.00 0.99   ? 62  VAL A N    1  
ATOM 879   C CA   . VAL A 1 62  ? 2.390   3.813   -8.690  1.00 1.04   ? 62  VAL A CA   1  
ATOM 880   C C    . VAL A 1 62  ? 1.810   2.948   -7.561  1.00 1.31   ? 62  VAL A C    1  
ATOM 881   O O    . VAL A 1 62  ? 2.140   1.774   -7.441  1.00 1.95   ? 62  VAL A O    1  
ATOM 882   C CB   . VAL A 1 62  ? 3.850   4.204   -8.336  1.00 1.49   ? 62  VAL A CB   1  
ATOM 883   C CG1  . VAL A 1 62  ? 4.425   5.199   -9.357  1.00 1.99   ? 62  VAL A CG1  1  
ATOM 884   C CG2  . VAL A 1 62  ? 4.013   4.758   -6.909  1.00 2.86   ? 62  VAL A CG2  1  
ATOM 885   H H    . VAL A 1 62  ? 1.677   5.865   -8.568  1.00 1.08   ? 62  VAL A H    1  
ATOM 886   H HA   . VAL A 1 62  ? 2.460   3.178   -9.573  1.00 1.15   ? 62  VAL A HA   1  
ATOM 887   H HB   . VAL A 1 62  ? 4.455   3.299   -8.394  1.00 2.45   ? 62  VAL A HB   1  
ATOM 888   H HG11 . VAL A 1 62  ? 4.282   4.820   -10.368 1.00 2.67   ? 62  VAL A HG11 1  
ATOM 889   H HG12 . VAL A 1 62  ? 3.936   6.167   -9.262  1.00 3.00   ? 62  VAL A HG12 1  
ATOM 890   H HG13 . VAL A 1 62  ? 5.493   5.330   -9.182  1.00 2.62   ? 62  VAL A HG13 1  
ATOM 891   H HG21 . VAL A 1 62  ? 3.857   3.965   -6.178  1.00 4.04   ? 62  VAL A HG21 1  
ATOM 892   H HG22 . VAL A 1 62  ? 5.024   5.136   -6.770  1.00 3.26   ? 62  VAL A HG22 1  
ATOM 893   H HG23 . VAL A 1 62  ? 3.299   5.554   -6.717  1.00 3.55   ? 62  VAL A HG23 1  
ATOM 894   N N    . GLY A 1 63  ? 0.967   3.541   -6.709  1.00 1.40   ? 63  GLY A N    1  
ATOM 895   C CA   . GLY A 1 63  ? 0.600   3.007   -5.394  1.00 1.66   ? 63  GLY A CA   1  
ATOM 896   C C    . GLY A 1 63  ? 1.187   3.848   -4.260  1.00 1.18   ? 63  GLY A C    1  
ATOM 897   O O    . GLY A 1 63  ? 1.513   5.018   -4.460  1.00 1.04   ? 63  GLY A O    1  
ATOM 898   H H    . GLY A 1 63  ? 0.756   4.512   -6.880  1.00 1.58   ? 63  GLY A H    1  
ATOM 899   H HA2  . GLY A 1 63  ? -0.482  3.037   -5.285  1.00 2.07   ? 63  GLY A HA2  1  
ATOM 900   H HA3  . GLY A 1 63  ? 0.934   1.976   -5.286  1.00 2.10   ? 63  GLY A HA3  1  
ATOM 901   N N    . ALA A 1 64  ? 1.256   3.260   -3.063  1.00 1.31   ? 64  ALA A N    1  
ATOM 902   C CA   . ALA A 1 64  ? 1.548   3.936   -1.795  1.00 1.23   ? 64  ALA A CA   1  
ATOM 903   C C    . ALA A 1 64  ? 2.818   3.402   -1.106  1.00 1.24   ? 64  ALA A C    1  
ATOM 904   O O    . ALA A 1 64  ? 3.091   2.204   -1.143  1.00 1.46   ? 64  ALA A O    1  
ATOM 905   C CB   . ALA A 1 64  ? 0.322   3.760   -0.891  1.00 1.64   ? 64  ALA A CB   1  
ATOM 906   H H    . ALA A 1 64  ? 1.053   2.272   -3.004  1.00 1.67   ? 64  ALA A H    1  
ATOM 907   H HA   . ALA A 1 64  ? 1.698   4.999   -1.967  1.00 1.11   ? 64  ALA A HA   1  
ATOM 908   H HB1  . ALA A 1 64  ? -0.545  4.252   -1.333  1.00 2.55   ? 64  ALA A HB1  1  
ATOM 909   H HB2  . ALA A 1 64  ? 0.111   2.699   -0.755  1.00 2.07   ? 64  ALA A HB2  1  
ATOM 910   H HB3  . ALA A 1 64  ? 0.523   4.194   0.086   1.00 2.06   ? 64  ALA A HB3  1  
ATOM 911   N N    . ALA A 1 65  ? 3.563   4.301   -0.449  1.00 1.14   ? 65  ALA A N    1  
ATOM 912   C CA   . ALA A 1 65  ? 4.771   4.039   0.348   1.00 1.20   ? 65  ALA A CA   1  
ATOM 913   C C    . ALA A 1 65  ? 4.795   4.886   1.651   1.00 1.18   ? 65  ALA A C    1  
ATOM 914   O O    . ALA A 1 65  ? 3.789   5.504   2.011   1.00 1.23   ? 65  ALA A O    1  
ATOM 915   C CB   . ALA A 1 65  ? 5.984   4.335   -0.554  1.00 1.24   ? 65  ALA A CB   1  
ATOM 916   H H    . ALA A 1 65  ? 3.304   5.283   -0.520  1.00 1.09   ? 65  ALA A H    1  
ATOM 917   H HA   . ALA A 1 65  ? 4.794   2.983   0.633   1.00 1.34   ? 65  ALA A HA   1  
ATOM 918   H HB1  . ALA A 1 65  ? 6.020   5.400   -0.798  1.00 1.85   ? 65  ALA A HB1  1  
ATOM 919   H HB2  . ALA A 1 65  ? 6.912   4.048   -0.060  1.00 1.86   ? 65  ALA A HB2  1  
ATOM 920   H HB3  . ALA A 1 65  ? 5.900   3.772   -1.486  1.00 2.20   ? 65  ALA A HB3  1  
ATOM 921   N N    . THR A 1 66  ? 5.935   4.947   2.363   1.00 1.18   ? 66  THR A N    1  
ATOM 922   C CA   . THR A 1 66  ? 6.056   5.673   3.642   1.00 1.28   ? 66  THR A CA   1  
ATOM 923   C C    . THR A 1 66  ? 7.511   6.022   3.998   1.00 1.40   ? 66  THR A C    1  
ATOM 924   O O    . THR A 1 66  ? 8.400   5.247   3.644   1.00 1.41   ? 66  THR A O    1  
ATOM 925   C CB   . THR A 1 66  ? 5.419   4.836   4.761   1.00 1.19   ? 66  THR A CB   1  
ATOM 926   O OG1  . THR A 1 66  ? 5.375   5.620   5.925   1.00 1.62   ? 66  THR A OG1  1  
ATOM 927   C CG2  . THR A 1 66  ? 6.183   3.543   5.076   1.00 1.12   ? 66  THR A CG2  1  
ATOM 928   H H    . THR A 1 66  ? 6.750   4.447   2.032   1.00 1.19   ? 66  THR A H    1  
ATOM 929   H HA   . THR A 1 66  ? 5.488   6.598   3.551   1.00 1.45   ? 66  THR A HA   1  
ATOM 930   H HB   . THR A 1 66  ? 4.399   4.572   4.483   1.00 1.24   ? 66  THR A HB   1  
ATOM 931   H HG1  . THR A 1 66  ? 4.511   6.067   5.977   1.00 2.26   ? 66  THR A HG1  1  
ATOM 932   H HG21 . THR A 1 66  ? 5.709   3.050   5.919   1.00 1.88   ? 66  THR A HG21 1  
ATOM 933   H HG22 . THR A 1 66  ? 6.172   2.870   4.217   1.00 1.53   ? 66  THR A HG22 1  
ATOM 934   H HG23 . THR A 1 66  ? 7.218   3.738   5.346   1.00 1.87   ? 66  THR A HG23 1  
ATOM 935   N N    . PRO A 1 67  ? 7.754   7.115   4.757   1.00 1.65   ? 67  PRO A N    1  
ATOM 936   C CA   . PRO A 1 67  ? 9.010   7.368   5.467   1.00 1.77   ? 67  PRO A CA   1  
ATOM 937   C C    . PRO A 1 67  ? 9.070   6.738   6.879   1.00 1.68   ? 67  PRO A C    1  
ATOM 938   O O    . PRO A 1 67  ? 10.096  6.861   7.556   1.00 1.75   ? 67  PRO A O    1  
ATOM 939   C CB   . PRO A 1 67  ? 9.090   8.896   5.547   1.00 2.12   ? 67  PRO A CB   1  
ATOM 940   C CG   . PRO A 1 67  ? 7.628   9.304   5.724   1.00 2.17   ? 67  PRO A CG   1  
ATOM 941   C CD   . PRO A 1 67  ? 6.881   8.282   4.867   1.00 1.89   ? 67  PRO A CD   1  
ATOM 942   H HA   . PRO A 1 67  ? 9.854   6.990   4.887   1.00 1.77   ? 67  PRO A HA   1  
ATOM 943   H HB2  . PRO A 1 67  ? 9.711   9.245   6.373   1.00 2.25   ? 67  PRO A HB2  1  
ATOM 944   H HB3  . PRO A 1 67  ? 9.465   9.291   4.602   1.00 2.24   ? 67  PRO A HB3  1  
ATOM 945   H HG2  . PRO A 1 67  ? 7.337   9.190   6.769   1.00 2.20   ? 67  PRO A HG2  1  
ATOM 946   H HG3  . PRO A 1 67  ? 7.446   10.326  5.387   1.00 2.41   ? 67  PRO A HG3  1  
ATOM 947   H HD2  . PRO A 1 67  ? 5.925   8.039   5.330   1.00 1.88   ? 67  PRO A HD2  1  
ATOM 948   H HD3  . PRO A 1 67  ? 6.716   8.698   3.873   1.00 1.96   ? 67  PRO A HD3  1  
ATOM 949   N N    . LEU A 1 68  ? 8.004   6.076   7.362   1.00 1.57   ? 68  LEU A N    1  
ATOM 950   C CA   . LEU A 1 68  ? 7.991   5.455   8.699   1.00 1.53   ? 68  LEU A CA   1  
ATOM 951   C C    . LEU A 1 68  ? 8.855   4.188   8.753   1.00 1.32   ? 68  LEU A C    1  
ATOM 952   O O    . LEU A 1 68  ? 9.323   3.818   9.830   1.00 1.40   ? 68  LEU A O    1  
ATOM 953   C CB   . LEU A 1 68  ? 6.540   5.148   9.148   1.00 1.66   ? 68  LEU A CB   1  
ATOM 954   C CG   . LEU A 1 68  ? 5.762   6.293   9.835   1.00 2.01   ? 68  LEU A CG   1  
ATOM 955   C CD1  . LEU A 1 68  ? 6.361   6.644   11.207  1.00 2.67   ? 68  LEU A CD1  1  
ATOM 956   C CD2  . LEU A 1 68  ? 5.651   7.566   8.985   1.00 2.38   ? 68  LEU A CD2  1  
ATOM 957   H H    . LEU A 1 68  ? 7.168   5.986   6.791   1.00 1.57   ? 68  LEU A H    1  
ATOM 958   H HA   . LEU A 1 68  ? 8.440   6.148   9.407   1.00 1.68   ? 68  LEU A HA   1  
ATOM 959   H HB2  . LEU A 1 68  ? 5.967   4.788   8.296   1.00 1.63   ? 68  LEU A HB2  1  
ATOM 960   H HB3  . LEU A 1 68  ? 6.570   4.320   9.861   1.00 1.67   ? 68  LEU A HB3  1  
ATOM 961   H HG   . LEU A 1 68  ? 4.748   5.930   10.010  1.00 2.97   ? 68  LEU A HG   1  
ATOM 962   H HD11 . LEU A 1 68  ? 6.441   5.745   11.818  1.00 3.48   ? 68  LEU A HD11 1  
ATOM 963   H HD12 . LEU A 1 68  ? 7.348   7.092   11.096  1.00 3.04   ? 68  LEU A HD12 1  
ATOM 964   H HD13 . LEU A 1 68  ? 5.710   7.353   11.721  1.00 3.33   ? 68  LEU A HD13 1  
ATOM 965   H HD21 . LEU A 1 68  ? 6.634   8.010   8.833   1.00 2.49   ? 68  LEU A HD21 1  
ATOM 966   H HD22 . LEU A 1 68  ? 5.205   7.330   8.019   1.00 3.32   ? 68  LEU A HD22 1  
ATOM 967   H HD23 . LEU A 1 68  ? 5.015   8.291   9.492   1.00 3.18   ? 68  LEU A HD23 1  
ATOM 968   N N    . ALA A 1 69  ? 9.088   3.532   7.616   1.00 1.24   ? 69  ALA A N    1  
ATOM 969   C CA   . ALA A 1 69  ? 9.899   2.324   7.495   1.00 1.22   ? 69  ALA A CA   1  
ATOM 970   C C    . ALA A 1 69  ? 11.091  2.590   6.573   1.00 1.42   ? 69  ALA A C    1  
ATOM 971   O O    . ALA A 1 69  ? 10.896  3.041   5.445   1.00 1.82   ? 69  ALA A O    1  
ATOM 972   C CB   . ALA A 1 69  ? 9.007   1.217   6.940   1.00 1.42   ? 69  ALA A CB   1  
ATOM 973   H H    . ALA A 1 69  ? 8.742   3.935   6.759   1.00 1.33   ? 69  ALA A H    1  
ATOM 974   H HA   . ALA A 1 69  ? 10.272  2.015   8.471   1.00 1.15   ? 69  ALA A HA   1  
ATOM 975   H HB1  . ALA A 1 69  ? 9.579   0.293   6.882   1.00 1.65   ? 69  ALA A HB1  1  
ATOM 976   H HB2  . ALA A 1 69  ? 8.162   1.078   7.611   1.00 2.41   ? 69  ALA A HB2  1  
ATOM 977   H HB3  . ALA A 1 69  ? 8.653   1.483   5.943   1.00 1.86   ? 69  ALA A HB3  1  
ATOM 978   N N    . THR A 1 70  ? 12.315  2.350   7.060   1.00 1.45   ? 70  THR A N    1  
ATOM 979   C CA   . THR A 1 70  ? 13.562  2.743   6.380   1.00 1.77   ? 70  THR A CA   1  
ATOM 980   C C    . THR A 1 70  ? 13.790  1.982   5.075   1.00 1.58   ? 70  THR A C    1  
ATOM 981   O O    . THR A 1 70  ? 14.366  2.552   4.155   1.00 1.86   ? 70  THR A O    1  
ATOM 982   C CB   . THR A 1 70  ? 14.740  2.611   7.352   1.00 2.10   ? 70  THR A CB   1  
ATOM 983   O OG1  . THR A 1 70  ? 14.449  3.370   8.506   1.00 2.51   ? 70  THR A OG1  1  
ATOM 984   C CG2  . THR A 1 70  ? 16.054  3.143   6.782   1.00 2.84   ? 70  THR A CG2  1  
ATOM 985   H H    . THR A 1 70  ? 12.391  1.976   8.001   1.00 1.48   ? 70  THR A H    1  
ATOM 986   H HA   . THR A 1 70  ? 13.477  3.788   6.079   1.00 2.07   ? 70  THR A HA   1  
ATOM 987   H HB   . THR A 1 70  ? 14.863  1.561   7.630   1.00 2.00   ? 70  THR A HB   1  
ATOM 988   H HG1  . THR A 1 70  ? 14.462  4.297   8.243   1.00 3.57   ? 70  THR A HG1  1  
ATOM 989   H HG21 . THR A 1 70  ? 16.823  3.127   7.554   1.00 2.78   ? 70  THR A HG21 1  
ATOM 990   H HG22 . THR A 1 70  ? 16.383  2.513   5.957   1.00 3.16   ? 70  THR A HG22 1  
ATOM 991   H HG23 . THR A 1 70  ? 15.923  4.162   6.418   1.00 4.09   ? 70  THR A HG23 1  
ATOM 992   N N    . SER A 1 71  ? 13.290  0.752   4.950   1.00 1.21   ? 71  SER A N    1  
ATOM 993   C CA   . SER A 1 71  ? 13.179  0.062   3.656   1.00 1.08   ? 71  SER A CA   1  
ATOM 994   C C    . SER A 1 71  ? 11.705  -0.280  3.353   1.00 0.96   ? 71  SER A C    1  
ATOM 995   O O    . SER A 1 71  ? 11.197  -1.289  3.855   1.00 0.90   ? 71  SER A O    1  
ATOM 996   C CB   . SER A 1 71  ? 14.031  -1.219  3.634   1.00 1.11   ? 71  SER A CB   1  
ATOM 997   O OG   . SER A 1 71  ? 15.420  -0.932  3.576   1.00 1.76   ? 71  SER A OG   1  
ATOM 998   H H    . SER A 1 71  ? 12.840  0.307   5.745   1.00 1.13   ? 71  SER A H    1  
ATOM 999   H HA   . SER A 1 71  ? 13.562  0.695   2.857   1.00 1.14   ? 71  SER A HA   1  
ATOM 1000  H HB2  . SER A 1 71  ? 13.815  -1.811  4.527   1.00 1.39   ? 71  SER A HB2  1  
ATOM 1001  H HB3  . SER A 1 71  ? 13.763  -1.809  2.756   1.00 1.57   ? 71  SER A HB3  1  
ATOM 1002  H HG   . SER A 1 71  ? 15.618  -0.480  2.725   1.00 2.44   ? 71  SER A HG   1  
ATOM 1003  N N    . PRO A 1 72  ? 11.003  0.517   2.519   1.00 0.98   ? 72  PRO A N    1  
ATOM 1004  C CA   . PRO A 1 72  ? 9.680   0.167   2.017   1.00 0.92   ? 72  PRO A CA   1  
ATOM 1005  C C    . PRO A 1 72  ? 9.824   -0.926  0.949   1.00 0.88   ? 72  PRO A C    1  
ATOM 1006  O O    . PRO A 1 72  ? 10.018  -0.667  -0.237  1.00 1.35   ? 72  PRO A O    1  
ATOM 1007  C CB   . PRO A 1 72  ? 9.075   1.481   1.511   1.00 1.02   ? 72  PRO A CB   1  
ATOM 1008  C CG   . PRO A 1 72  ? 10.298  2.287   1.072   1.00 1.13   ? 72  PRO A CG   1  
ATOM 1009  C CD   . PRO A 1 72  ? 11.393  1.839   2.042   1.00 1.11   ? 72  PRO A CD   1  
ATOM 1010  H HA   . PRO A 1 72  ? 9.059   -0.214  2.829   1.00 0.88   ? 72  PRO A HA   1  
ATOM 1011  H HB2  . PRO A 1 72  ? 8.370   1.330   0.694   1.00 1.02   ? 72  PRO A HB2  1  
ATOM 1012  H HB3  . PRO A 1 72  ? 8.588   1.994   2.341   1.00 1.04   ? 72  PRO A HB3  1  
ATOM 1013  H HG2  . PRO A 1 72  ? 10.576  2.009   0.054   1.00 1.15   ? 72  PRO A HG2  1  
ATOM 1014  H HG3  . PRO A 1 72  ? 10.117  3.361   1.139   1.00 1.23   ? 72  PRO A HG3  1  
ATOM 1015  H HD2  . PRO A 1 72  ? 12.350  1.819   1.523   1.00 1.17   ? 72  PRO A HD2  1  
ATOM 1016  H HD3  . PRO A 1 72  ? 11.438  2.524   2.889   1.00 1.18   ? 72  PRO A HD3  1  
ATOM 1017  N N    . MET A 1 73  ? 9.741   -2.177  1.396   1.00 0.80   ? 73  MET A N    1  
ATOM 1018  C CA   . MET A 1 73  ? 9.851   -3.397  0.599   1.00 0.81   ? 73  MET A CA   1  
ATOM 1019  C C    . MET A 1 73  ? 8.487   -3.757  -0.011  1.00 0.79   ? 73  MET A C    1  
ATOM 1020  O O    . MET A 1 73  ? 7.755   -4.640  0.437   1.00 1.26   ? 73  MET A O    1  
ATOM 1021  C CB   . MET A 1 73  ? 10.479  -4.475  1.491   1.00 0.97   ? 73  MET A CB   1  
ATOM 1022  C CG   . MET A 1 73  ? 10.754  -5.805  0.769   1.00 1.03   ? 73  MET A CG   1  
ATOM 1023  S SD   . MET A 1 73  ? 11.663  -5.721  -0.806  1.00 2.08   ? 73  MET A SD   1  
ATOM 1024  C CE   . MET A 1 73  ? 13.281  -5.175  -0.212  1.00 2.74   ? 73  MET A CE   1  
ATOM 1025  H H    . MET A 1 73  ? 9.550   -2.306  2.388   1.00 1.08   ? 73  MET A H    1  
ATOM 1026  H HA   . MET A 1 73  ? 10.540  -3.207  -0.224  1.00 0.85   ? 73  MET A HA   1  
ATOM 1027  H HB2  . MET A 1 73  ? 11.403  -4.061  1.892   1.00 1.37   ? 73  MET A HB2  1  
ATOM 1028  H HB3  . MET A 1 73  ? 9.832   -4.664  2.344   1.00 1.29   ? 73  MET A HB3  1  
ATOM 1029  H HG2  . MET A 1 73  ? 11.297  -6.457  1.454   1.00 2.01   ? 73  MET A HG2  1  
ATOM 1030  H HG3  . MET A 1 73  ? 9.791   -6.283  0.570   1.00 1.85   ? 73  MET A HG3  1  
ATOM 1031  H HE1  . MET A 1 73  ? 13.189  -4.189  0.240   1.00 3.50   ? 73  MET A HE1  1  
ATOM 1032  H HE2  . MET A 1 73  ? 13.662  -5.879  0.526   1.00 3.17   ? 73  MET A HE2  1  
ATOM 1033  H HE3  . MET A 1 73  ? 13.976  -5.116  -1.053  1.00 3.41   ? 73  MET A HE3  1  
ATOM 1034  N N    . LEU A 1 74  ? 8.114   -2.975  -1.022  1.00 1.03   ? 74  LEU A N    1  
ATOM 1035  C CA   . LEU A 1 74  ? 6.764   -2.909  -1.587  1.00 1.15   ? 74  LEU A CA   1  
ATOM 1036  C C    . LEU A 1 74  ? 6.452   -4.137  -2.466  1.00 1.21   ? 74  LEU A C    1  
ATOM 1037  O O    . LEU A 1 74  ? 7.205   -4.417  -3.401  1.00 1.23   ? 74  LEU A O    1  
ATOM 1038  C CB   . LEU A 1 74  ? 6.681   -1.609  -2.416  1.00 1.20   ? 74  LEU A CB   1  
ATOM 1039  C CG   . LEU A 1 74  ? 6.983   -0.286  -1.668  1.00 2.07   ? 74  LEU A CG   1  
ATOM 1040  C CD1  . LEU A 1 74  ? 7.997   0.558   -2.455  1.00 1.96   ? 74  LEU A CD1  1  
ATOM 1041  C CD2  . LEU A 1 74  ? 5.718   0.550   -1.467  1.00 3.58   ? 74  LEU A CD2  1  
ATOM 1042  H H    . LEU A 1 74  ? 8.773   -2.253  -1.289  1.00 1.54   ? 74  LEU A H    1  
ATOM 1043  H HA   . LEU A 1 74  ? 6.044   -2.880  -0.771  1.00 1.29   ? 74  LEU A HA   1  
ATOM 1044  H HB2  . LEU A 1 74  ? 7.394   -1.708  -3.237  1.00 1.74   ? 74  LEU A HB2  1  
ATOM 1045  H HB3  . LEU A 1 74  ? 5.694   -1.544  -2.859  1.00 1.47   ? 74  LEU A HB3  1  
ATOM 1046  H HG   . LEU A 1 74  ? 7.396   -0.499  -0.683  1.00 3.05   ? 74  LEU A HG   1  
ATOM 1047  H HD11 . LEU A 1 74  ? 7.587   0.828   -3.429  1.00 2.50   ? 74  LEU A HD11 1  
ATOM 1048  H HD12 . LEU A 1 74  ? 8.235   1.467   -1.902  1.00 2.64   ? 74  LEU A HD12 1  
ATOM 1049  H HD13 . LEU A 1 74  ? 8.918   -0.008  -2.603  1.00 2.22   ? 74  LEU A HD13 1  
ATOM 1050  H HD21 . LEU A 1 74  ? 5.963   1.449   -0.905  1.00 4.51   ? 74  LEU A HD21 1  
ATOM 1051  H HD22 . LEU A 1 74  ? 5.290   0.832   -2.430  1.00 3.86   ? 74  LEU A HD22 1  
ATOM 1052  H HD23 . LEU A 1 74  ? 4.983   -0.013  -0.900  1.00 4.61   ? 74  LEU A HD23 1  
ATOM 1053  N N    . MET A 1 75  ? 5.336   -4.844  -2.237  1.00 1.38   ? 75  MET A N    1  
ATOM 1054  C CA   . MET A 1 75  ? 4.933   -6.078  -2.942  1.00 1.60   ? 75  MET A CA   1  
ATOM 1055  C C    . MET A 1 75  ? 3.391   -6.233  -3.047  1.00 1.83   ? 75  MET A C    1  
ATOM 1056  O O    . MET A 1 75  ? 2.655   -5.431  -2.471  1.00 2.25   ? 75  MET A O    1  
ATOM 1057  C CB   . MET A 1 75  ? 5.577   -7.293  -2.239  1.00 1.71   ? 75  MET A CB   1  
ATOM 1058  C CG   . MET A 1 75  ? 7.094   -7.370  -2.442  1.00 2.07   ? 75  MET A CG   1  
ATOM 1059  S SD   . MET A 1 75  ? 7.841   -8.871  -1.759  1.00 2.13   ? 75  MET A SD   1  
ATOM 1060  C CE   . MET A 1 75  ? 9.509   -8.678  -2.428  1.00 3.49   ? 75  MET A CE   1  
ATOM 1061  H H    . MET A 1 75  ? 4.729   -4.566  -1.483  1.00 1.46   ? 75  MET A H    1  
ATOM 1062  H HA   . MET A 1 75  ? 5.311   -6.037  -3.962  1.00 1.70   ? 75  MET A HA   1  
ATOM 1063  H HB2  . MET A 1 75  ? 5.373   -7.263  -1.172  1.00 2.64   ? 75  MET A HB2  1  
ATOM 1064  H HB3  . MET A 1 75  ? 5.143   -8.213  -2.625  1.00 2.19   ? 75  MET A HB3  1  
ATOM 1065  H HG2  . MET A 1 75  ? 7.322   -7.319  -3.508  1.00 2.77   ? 75  MET A HG2  1  
ATOM 1066  H HG3  . MET A 1 75  ? 7.562   -6.516  -1.949  1.00 3.20   ? 75  MET A HG3  1  
ATOM 1067  H HE1  . MET A 1 75  ? 9.467   -8.654  -3.521  1.00 4.11   ? 75  MET A HE1  1  
ATOM 1068  H HE2  . MET A 1 75  ? 9.941   -7.753  -2.061  1.00 4.31   ? 75  MET A HE2  1  
ATOM 1069  H HE3  . MET A 1 75  ? 10.127  -9.520  -2.110  1.00 4.02   ? 75  MET A HE3  1  
ATOM 1070  N N    . THR A 1 76  ? 2.946   -7.238  -3.826  1.00 1.93   ? 76  THR A N    1  
ATOM 1071  C CA   . THR A 1 76  ? 1.566   -7.627  -4.214  1.00 2.02   ? 76  THR A CA   1  
ATOM 1072  C C    . THR A 1 76  ? 1.626   -8.646  -5.358  1.00 2.02   ? 76  THR A C    1  
ATOM 1073  O O    . THR A 1 76  ? 2.536   -8.573  -6.186  1.00 2.16   ? 76  THR A O    1  
ATOM 1074  C CB   . THR A 1 76  ? 0.645   -6.438  -4.559  1.00 2.37   ? 76  THR A CB   1  
ATOM 1075  O OG1  . THR A 1 76  ? -0.663  -6.898  -4.800  1.00 3.20   ? 76  THR A OG1  1  
ATOM 1076  C CG2  . THR A 1 76  ? 1.082   -5.649  -5.790  1.00 2.37   ? 76  THR A CG2  1  
ATOM 1077  H H    . THR A 1 76  ? 3.661   -7.827  -4.225  1.00 2.14   ? 76  THR A H    1  
ATOM 1078  H HA   . THR A 1 76  ? 1.099   -8.124  -3.368  1.00 1.96   ? 76  THR A HA   1  
ATOM 1079  H HB   . THR A 1 76  ? 0.601   -5.762  -3.705  1.00 2.59   ? 76  THR A HB   1  
ATOM 1080  H HG1  . THR A 1 76  ? -0.715  -7.304  -5.671  1.00 2.89   ? 76  THR A HG1  1  
ATOM 1081  H HG21 . THR A 1 76  ? 2.099   -5.286  -5.639  1.00 2.90   ? 76  THR A HG21 1  
ATOM 1082  H HG22 . THR A 1 76  ? 1.056   -6.277  -6.676  1.00 2.45   ? 76  THR A HG22 1  
ATOM 1083  H HG23 . THR A 1 76  ? 0.413   -4.804  -5.934  1.00 3.16   ? 76  THR A HG23 1  
ATOM 1084  N N    . THR A 1 77  ? 0.665   -9.569  -5.455  1.00 1.98   ? 77  THR A N    1  
ATOM 1085  C CA   . THR A 1 77  ? 0.394   -10.352 -6.657  1.00 2.10   ? 77  THR A CA   1  
ATOM 1086  C C    . THR A 1 77  ? -1.046  -10.131 -7.117  1.00 2.49   ? 77  THR A C    1  
ATOM 1087  O O    . THR A 1 77  ? -1.818  -9.519  -6.385  1.00 3.40   ? 77  THR A O    1  
ATOM 1088  C CB   . THR A 1 77  ? 0.673   -11.830 -6.388  1.00 2.05   ? 77  THR A CB   1  
ATOM 1089  O OG1  . THR A 1 77  ? -0.231  -12.413 -5.483  1.00 3.23   ? 77  THR A OG1  1  
ATOM 1090  C CG2  . THR A 1 77  ? 2.107   -12.105 -5.929  1.00 2.63   ? 77  THR A CG2  1  
ATOM 1091  H H    . THR A 1 77  ? -0.004  -9.704  -4.710  1.00 2.02   ? 77  THR A H    1  
ATOM 1092  H HA   . THR A 1 77  ? 1.049   -10.019 -7.462  1.00 2.43   ? 77  THR A HA   1  
ATOM 1093  H HB   . THR A 1 77  ? 0.525   -12.321 -7.331  1.00 2.16   ? 77  THR A HB   1  
ATOM 1094  H HG1  . THR A 1 77  ? -0.314  -11.841 -4.696  1.00 3.44   ? 77  THR A HG1  1  
ATOM 1095  H HG21 . THR A 1 77  ? 2.272   -11.687 -4.935  1.00 3.63   ? 77  THR A HG21 1  
ATOM 1096  H HG22 . THR A 1 77  ? 2.277   -13.180 -5.896  1.00 2.96   ? 77  THR A HG22 1  
ATOM 1097  H HG23 . THR A 1 77  ? 2.808   -11.652 -6.632  1.00 3.17   ? 77  THR A HG23 1  
ATOM 1098  N N    . THR A 1 78  ? -1.389  -10.625 -8.319  1.00 2.32   ? 78  THR A N    1  
ATOM 1099  C CA   . THR A 1 78  ? -2.733  -10.762 -8.924  1.00 2.56   ? 78  THR A CA   1  
ATOM 1100  C C    . THR A 1 78  ? -2.617  -11.016 -10.425 1.00 2.18   ? 78  THR A C    1  
ATOM 1101  O O    . THR A 1 78  ? -1.687  -10.540 -11.071 1.00 3.21   ? 78  THR A O    1  
ATOM 1102  C CB   . THR A 1 78  ? -3.716  -9.615  -8.597  1.00 4.37   ? 78  THR A CB   1  
ATOM 1103  O OG1  . THR A 1 78  ? -4.957  -9.861  -9.214  1.00 5.11   ? 78  THR A OG1  1  
ATOM 1104  C CG2  . THR A 1 78  ? -3.272  -8.222  -9.045  1.00 5.76   ? 78  THR A CG2  1  
ATOM 1105  H H    . THR A 1 78  ? -0.635  -11.008 -8.870  1.00 2.40   ? 78  THR A H    1  
ATOM 1106  H HA   . THR A 1 78  ? -3.178  -11.655 -8.485  1.00 2.72   ? 78  THR A HA   1  
ATOM 1107  H HB   . THR A 1 78  ? -3.897  -9.595  -7.522  1.00 4.70   ? 78  THR A HB   1  
ATOM 1108  H HG1  . THR A 1 78  ? -5.600  -9.321  -8.744  1.00 5.80   ? 78  THR A HG1  1  
ATOM 1109  H HG21 . THR A 1 78  ? -4.093  -7.516  -8.930  1.00 6.93   ? 78  THR A HG21 1  
ATOM 1110  H HG22 . THR A 1 78  ? -2.450  -7.886  -8.417  1.00 5.97   ? 78  THR A HG22 1  
ATOM 1111  H HG23 . THR A 1 78  ? -2.958  -8.242  -10.090 1.00 5.87   ? 78  THR A HG23 1  
ATOM 1112  N N    . HIS A 1 79  ? -3.575  -11.765 -10.971 1.00 2.04   ? 79  HIS A N    1  
ATOM 1113  C CA   . HIS A 1 79  ? -3.839  -11.861 -12.411 1.00 3.09   ? 79  HIS A CA   1  
ATOM 1114  C C    . HIS A 1 79  ? -4.913  -10.855 -12.897 1.00 3.50   ? 79  HIS A C    1  
ATOM 1115  O O    . HIS A 1 79  ? -4.934  -10.489 -14.069 1.00 5.12   ? 79  HIS A O    1  
ATOM 1116  C CB   . HIS A 1 79  ? -4.240  -13.306 -12.766 1.00 4.28   ? 79  HIS A CB   1  
ATOM 1117  C CG   . HIS A 1 79  ? -3.086  -14.229 -13.089 1.00 5.11   ? 79  HIS A CG   1  
ATOM 1118  N ND1  . HIS A 1 79  ? -3.105  -15.214 -14.048 1.00 6.63   ? 79  HIS A ND1  1  
ATOM 1119  C CD2  . HIS A 1 79  ? -1.842  -14.268 -12.511 1.00 5.47   ? 79  HIS A CD2  1  
ATOM 1120  C CE1  . HIS A 1 79  ? -1.913  -15.829 -14.046 1.00 7.54   ? 79  HIS A CE1  1  
ATOM 1121  N NE2  . HIS A 1 79  ? -1.094  -15.280 -13.133 1.00 7.06   ? 79  HIS A NE2  1  
ATOM 1122  H H    . HIS A 1 79  ? -4.255  -12.170 -10.344 1.00 2.11   ? 79  HIS A H    1  
ATOM 1123  H HA   . HIS A 1 79  ? -2.936  -11.616 -12.957 1.00 3.38   ? 79  HIS A HA   1  
ATOM 1124  H HB2  . HIS A 1 79  ? -4.840  -13.739 -11.962 1.00 4.48   ? 79  HIS A HB2  1  
ATOM 1125  H HB3  . HIS A 1 79  ? -4.882  -13.274 -13.651 1.00 5.32   ? 79  HIS A HB3  1  
ATOM 1126  H HD1  . HIS A 1 79  ? -3.888  -15.441 -14.659 1.00 7.38   ? 79  HIS A HD1  1  
ATOM 1127  H HD2  . HIS A 1 79  ? -1.500  -13.630 -11.708 1.00 5.23   ? 79  HIS A HD2  1  
ATOM 1128  H HE1  . HIS A 1 79  ? -1.650  -16.662 -14.684 1.00 8.87   ? 79  HIS A HE1  1  
ATOM 1129  N N    . SER A 1 80  ? -5.799  -10.402 -11.999 1.00 2.57   ? 80  SER A N    1  
ATOM 1130  C CA   . SER A 1 80  ? -6.940  -9.506  -12.283 1.00 3.07   ? 80  SER A CA   1  
ATOM 1131  C C    . SER A 1 80  ? -7.809  -9.999  -13.470 1.00 3.32   ? 80  SER A C    1  
ATOM 1132  O O    . SER A 1 80  ? -7.866  -11.199 -13.740 1.00 4.08   ? 80  SER A O    1  
ATOM 1133  C CB   . SER A 1 80  ? -6.399  -8.069  -12.461 1.00 3.64   ? 80  SER A CB   1  
ATOM 1134  O OG   . SER A 1 80  ? -7.412  -7.066  -12.513 1.00 5.07   ? 80  SER A OG   1  
ATOM 1135  H H    . SER A 1 80  ? -5.656  -10.671 -11.037 1.00 2.16   ? 80  SER A H    1  
ATOM 1136  H HA   . SER A 1 80  ? -7.601  -9.502  -11.415 1.00 3.62   ? 80  SER A HA   1  
ATOM 1137  H HB2  . SER A 1 80  ? -5.713  -7.840  -11.641 1.00 3.44   ? 80  SER A HB2  1  
ATOM 1138  H HB3  . SER A 1 80  ? -5.827  -8.044  -13.390 1.00 4.08   ? 80  SER A HB3  1  
ATOM 1139  H HG   . SER A 1 80  ? -7.568  -6.729  -11.624 1.00 5.31   ? 80  SER A HG   1  
ATOM 1140  N N    . GLY A 1 81  ? -8.448  -9.087  -14.217 1.00 3.33   ? 81  GLY A N    1  
ATOM 1141  C CA   . GLY A 1 81  ? -9.156  -9.356  -15.479 1.00 4.00   ? 81  GLY A CA   1  
ATOM 1142  C C    . GLY A 1 81  ? -8.209  -9.487  -16.679 1.00 4.02   ? 81  GLY A C    1  
ATOM 1143  O O    . GLY A 1 81  ? -8.532  -9.038  -17.778 1.00 4.83   ? 81  GLY A O    1  
ATOM 1144  H H    . GLY A 1 81  ? -8.399  -8.121  -13.911 1.00 3.36   ? 81  GLY A H    1  
ATOM 1145  H HA2  . GLY A 1 81  ? -9.709  -10.290 -15.388 1.00 4.39   ? 81  GLY A HA2  1  
ATOM 1146  H HA3  . GLY A 1 81  ? -9.854  -8.542  -15.684 1.00 4.50   ? 81  GLY A HA3  1  
ATOM 1147  N N    . GLY A 1 82  ? -6.996  -10.012 -16.453 1.00 3.68   ? 82  GLY A N    1  
ATOM 1148  C CA   . GLY A 1 82  ? -5.888  -10.040 -17.409 1.00 4.03   ? 82  GLY A CA   1  
ATOM 1149  C C    . GLY A 1 82  ? -4.827  -8.984  -17.102 1.00 3.21   ? 82  GLY A C    1  
ATOM 1150  O O    . GLY A 1 82  ? -3.772  -8.990  -17.736 1.00 3.64   ? 82  GLY A O    1  
ATOM 1151  H H    . GLY A 1 82  ? -6.783  -10.309 -15.507 1.00 3.56   ? 82  GLY A H    1  
ATOM 1152  H HA2  . GLY A 1 82  ? -5.400  -11.012 -17.346 1.00 4.54   ? 82  GLY A HA2  1  
ATOM 1153  H HA3  . GLY A 1 82  ? -6.258  -9.873  -18.421 1.00 4.81   ? 82  GLY A HA3  1  
ATOM 1154  N N    . MET A 1 83  ? -5.081  -8.098  -16.126 1.00 2.55   ? 83  MET A N    1  
ATOM 1155  C CA   . MET A 1 83  ? -4.126  -7.102  -15.624 1.00 2.38   ? 83  MET A CA   1  
ATOM 1156  C C    . MET A 1 83  ? -3.189  -7.732  -14.580 1.00 2.24   ? 83  MET A C    1  
ATOM 1157  O O    . MET A 1 83  ? -3.233  -7.444  -13.380 1.00 2.51   ? 83  MET A O    1  
ATOM 1158  C CB   . MET A 1 83  ? -4.854  -5.823  -15.159 1.00 2.76   ? 83  MET A CB   1  
ATOM 1159  C CG   . MET A 1 83  ? -3.901  -4.696  -14.718 1.00 3.26   ? 83  MET A CG   1  
ATOM 1160  S SD   . MET A 1 83  ? -2.588  -4.250  -15.888 1.00 3.80   ? 83  MET A SD   1  
ATOM 1161  C CE   . MET A 1 83  ? -3.562  -3.432  -17.174 1.00 5.31   ? 83  MET A CE   1  
ATOM 1162  H H    . MET A 1 83  ? -5.944  -8.214  -15.622 1.00 2.71   ? 83  MET A H    1  
ATOM 1163  H HA   . MET A 1 83  ? -3.508  -6.830  -16.472 1.00 2.66   ? 83  MET A HA   1  
ATOM 1164  H HB2  . MET A 1 83  ? -5.469  -5.456  -15.981 1.00 3.05   ? 83  MET A HB2  1  
ATOM 1165  H HB3  . MET A 1 83  ? -5.517  -6.054  -14.328 1.00 3.07   ? 83  MET A HB3  1  
ATOM 1166  H HG2  . MET A 1 83  ? -4.487  -3.802  -14.501 1.00 4.12   ? 83  MET A HG2  1  
ATOM 1167  H HG3  . MET A 1 83  ? -3.421  -4.995  -13.783 1.00 3.52   ? 83  MET A HG3  1  
ATOM 1168  H HE1  . MET A 1 83  ? -4.023  -2.531  -16.766 1.00 5.98   ? 83  MET A HE1  1  
ATOM 1169  H HE2  . MET A 1 83  ? -2.903  -3.145  -17.996 1.00 5.71   ? 83  MET A HE2  1  
ATOM 1170  H HE3  . MET A 1 83  ? -4.328  -4.108  -17.553 1.00 6.03   ? 83  MET A HE3  1  
ATOM 1171  N N    . ALA A 1 84  ? -2.381  -8.669  -15.069 1.00 2.21   ? 84  ALA A N    1  
ATOM 1172  C CA   . ALA A 1 84  ? -1.501  -9.516  -14.282 1.00 2.11   ? 84  ALA A CA   1  
ATOM 1173  C C    . ALA A 1 84  ? -0.101  -8.913  -14.141 1.00 2.36   ? 84  ALA A C    1  
ATOM 1174  O O    . ALA A 1 84  ? 0.470   -8.418  -15.120 1.00 2.72   ? 84  ALA A O    1  
ATOM 1175  C CB   . ALA A 1 84  ? -1.442  -10.888 -14.960 1.00 2.34   ? 84  ALA A CB   1  
ATOM 1176  H H    . ALA A 1 84  ? -2.446  -8.855  -16.058 1.00 2.49   ? 84  ALA A H    1  
ATOM 1177  H HA   . ALA A 1 84  ? -1.931  -9.619  -13.290 1.00 1.99   ? 84  ALA A HA   1  
ATOM 1178  H HB1  . ALA A 1 84  ? -2.441  -11.313 -15.050 1.00 2.56   ? 84  ALA A HB1  1  
ATOM 1179  H HB2  . ALA A 1 84  ? -1.041  -10.772 -15.961 1.00 3.17   ? 84  ALA A HB2  1  
ATOM 1180  H HB3  . ALA A 1 84  ? -0.807  -11.566 -14.388 1.00 2.73   ? 84  ALA A HB3  1  
ATOM 1181  N N    . GLY A 1 85  ? 0.477   -9.031  -12.940 1.00 2.39   ? 85  GLY A N    1  
ATOM 1182  C CA   . GLY A 1 85  ? 1.850   -8.626  -12.625 1.00 2.81   ? 85  GLY A CA   1  
ATOM 1183  C C    . GLY A 1 85  ? 2.566   -9.639  -11.728 1.00 2.09   ? 85  GLY A C    1  
ATOM 1184  O O    . GLY A 1 85  ? 2.143   -10.788 -11.601 1.00 2.08   ? 85  GLY A O    1  
ATOM 1185  H H    . GLY A 1 85  ? -0.028  -9.517  -12.207 1.00 2.19   ? 85  GLY A H    1  
ATOM 1186  H HA2  . GLY A 1 85  ? 2.433   -8.471  -13.533 1.00 3.63   ? 85  GLY A HA2  1  
ATOM 1187  H HA3  . GLY A 1 85  ? 1.816   -7.675  -12.092 1.00 3.26   ? 85  GLY A HA3  1  
ATOM 1188  N N    . MET A 1 86  ? 3.646   -9.191  -11.089 1.00 2.43   ? 86  MET A N    1  
ATOM 1189  C CA   . MET A 1 86  ? 4.512   -9.965  -10.183 1.00 2.01   ? 86  MET A CA   1  
ATOM 1190  C C    . MET A 1 86  ? 5.238   -9.026  -9.213  1.00 2.05   ? 86  MET A C    1  
ATOM 1191  O O    . MET A 1 86  ? 5.429   -7.851  -9.517  1.00 3.07   ? 86  MET A O    1  
ATOM 1192  C CB   . MET A 1 86  ? 5.467   -10.876 -10.979 1.00 2.80   ? 86  MET A CB   1  
ATOM 1193  C CG   . MET A 1 86  ? 6.377   -10.142 -11.974 1.00 4.05   ? 86  MET A CG   1  
ATOM 1194  S SD   . MET A 1 86  ? 7.314   -11.280 -13.028 1.00 4.80   ? 86  MET A SD   1  
ATOM 1195  C CE   . MET A 1 86  ? 8.244   -10.077 -14.009 1.00 6.69   ? 86  MET A CE   1  
ATOM 1196  H H    . MET A 1 86  ? 3.883   -8.216  -11.212 1.00 3.39   ? 86  MET A H    1  
ATOM 1197  H HA   . MET A 1 86  ? 3.874   -10.610 -9.579  1.00 1.71   ? 86  MET A HA   1  
ATOM 1198  H HB2  . MET A 1 86  ? 6.092   -11.434 -10.281 1.00 3.23   ? 86  MET A HB2  1  
ATOM 1199  H HB3  . MET A 1 86  ? 4.868   -11.598 -11.536 1.00 3.09   ? 86  MET A HB3  1  
ATOM 1200  H HG2  . MET A 1 86  ? 5.768   -9.513  -12.621 1.00 4.65   ? 86  MET A HG2  1  
ATOM 1201  H HG3  . MET A 1 86  ? 7.074   -9.502  -11.428 1.00 4.70   ? 86  MET A HG3  1  
ATOM 1202  H HE1  . MET A 1 86  ? 8.903   -9.501  -13.358 1.00 7.20   ? 86  MET A HE1  1  
ATOM 1203  H HE2  . MET A 1 86  ? 8.853   -10.602 -14.747 1.00 7.10   ? 86  MET A HE2  1  
ATOM 1204  H HE3  . MET A 1 86  ? 7.562   -9.401  -14.523 1.00 7.54   ? 86  MET A HE3  1  
ATOM 1205  N N    . LYS A 1 87  ? 5.576   -9.497  -8.008  1.00 1.59   ? 87  LYS A N    1  
ATOM 1206  C CA   . LYS A 1 87  ? 5.851   -8.577  -6.899  1.00 2.20   ? 87  LYS A CA   1  
ATOM 1207  C C    . LYS A 1 87  ? 7.197   -7.816  -7.003  1.00 1.45   ? 87  LYS A C    1  
ATOM 1208  O O    . LYS A 1 87  ? 8.235   -8.453  -7.139  1.00 1.73   ? 87  LYS A O    1  
ATOM 1209  C CB   . LYS A 1 87  ? 5.652   -9.287  -5.537  1.00 3.83   ? 87  LYS A CB   1  
ATOM 1210  C CG   . LYS A 1 87  ? 6.758   -10.225 -5.001  1.00 4.41   ? 87  LYS A CG   1  
ATOM 1211  C CD   . LYS A 1 87  ? 6.725   -11.680 -5.491  1.00 5.43   ? 87  LYS A CD   1  
ATOM 1212  C CE   . LYS A 1 87  ? 5.621   -12.465 -4.759  1.00 6.93   ? 87  LYS A CE   1  
ATOM 1213  N NZ   . LYS A 1 87  ? 5.716   -13.924 -5.011  1.00 8.12   ? 87  LYS A NZ   1  
ATOM 1214  H H    . LYS A 1 87  ? 5.450   -10.475 -7.807  1.00 1.60   ? 87  LYS A H    1  
ATOM 1215  H HA   . LYS A 1 87  ? 5.074   -7.813  -6.953  1.00 2.95   ? 87  LYS A HA   1  
ATOM 1216  H HB2  . LYS A 1 87  ? 5.553   -8.490  -4.805  1.00 4.81   ? 87  LYS A HB2  1  
ATOM 1217  H HB3  . LYS A 1 87  ? 4.706   -9.829  -5.540  1.00 4.52   ? 87  LYS A HB3  1  
ATOM 1218  H HG2  . LYS A 1 87  ? 7.743   -9.810  -5.195  1.00 4.26   ? 87  LYS A HG2  1  
ATOM 1219  H HG3  . LYS A 1 87  ? 6.665   -10.258 -3.917  1.00 5.27   ? 87  LYS A HG3  1  
ATOM 1220  H HD2  . LYS A 1 87  ? 6.579   -11.716 -6.571  1.00 5.32   ? 87  LYS A HD2  1  
ATOM 1221  H HD3  . LYS A 1 87  ? 7.691   -12.134 -5.261  1.00 5.99   ? 87  LYS A HD3  1  
ATOM 1222  H HE2  . LYS A 1 87  ? 5.713   -12.272 -3.685  1.00 7.60   ? 87  LYS A HE2  1  
ATOM 1223  H HE3  . LYS A 1 87  ? 4.645   -12.084 -5.069  1.00 6.99   ? 87  LYS A HE3  1  
ATOM 1224  H HZ1  . LYS A 1 87  ? 4.977   -14.425 -4.535  1.00 8.92   ? 87  LYS A HZ1  1  
ATOM 1225  H HZ2  . LYS A 1 87  ? 5.637   -14.113 -6.010  1.00 8.12   ? 87  LYS A HZ2  1  
ATOM 1226  H HZ3  . LYS A 1 87  ? 6.606   -14.287 -4.701  1.00 8.60   ? 87  LYS A HZ3  1  
ATOM 1227  N N    . MET A 1 88  ? 7.155   -6.484  -6.834  1.00 1.92   ? 88  MET A N    1  
ATOM 1228  C CA   . MET A 1 88  ? 8.227   -5.526  -6.525  1.00 2.13   ? 88  MET A CA   1  
ATOM 1229  C C    . MET A 1 88  ? 7.726   -4.129  -6.917  1.00 1.97   ? 88  MET A C    1  
ATOM 1230  O O    . MET A 1 88  ? 7.740   -3.778  -8.089  1.00 2.45   ? 88  MET A O    1  
ATOM 1231  C CB   . MET A 1 88  ? 9.577   -5.878  -7.171  1.00 2.86   ? 88  MET A CB   1  
ATOM 1232  C CG   . MET A 1 88  ? 10.546  -4.727  -6.922  1.00 3.82   ? 88  MET A CG   1  
ATOM 1233  S SD   . MET A 1 88  ? 12.299  -5.129  -7.120  1.00 4.93   ? 88  MET A SD   1  
ATOM 1234  C CE   . MET A 1 88  ? 12.331  -5.613  -8.860  1.00 4.46   ? 88  MET A CE   1  
ATOM 1235  H H    . MET A 1 88  ? 6.281   -6.031  -7.033  1.00 2.71   ? 88  MET A H    1  
ATOM 1236  H HA   . MET A 1 88  ? 8.386   -5.534  -5.447  1.00 2.46   ? 88  MET A HA   1  
ATOM 1237  H HB2  . MET A 1 88  ? 9.986   -6.774  -6.707  1.00 3.84   ? 88  MET A HB2  1  
ATOM 1238  H HB3  . MET A 1 88  ? 9.455   -6.039  -8.244  1.00 2.85   ? 88  MET A HB3  1  
ATOM 1239  H HG2  . MET A 1 88  ? 10.276  -3.917  -7.603  1.00 3.73   ? 88  MET A HG2  1  
ATOM 1240  H HG3  . MET A 1 88  ? 10.379  -4.376  -5.907  1.00 4.86   ? 88  MET A HG3  1  
ATOM 1241  H HE1  . MET A 1 88  ? 13.355  -5.825  -9.162  1.00 4.68   ? 88  MET A HE1  1  
ATOM 1242  H HE2  . MET A 1 88  ? 11.718  -6.502  -9.010  1.00 4.77   ? 88  MET A HE2  1  
ATOM 1243  H HE3  . MET A 1 88  ? 11.939  -4.800  -9.476  1.00 4.60   ? 88  MET A HE3  1  
ATOM 1244  N N    . VAL A 1 89  ? 7.221   -3.374  -5.938  1.00 2.16   ? 89  VAL A N    1  
ATOM 1245  C CA   . VAL A 1 89  ? 6.329   -2.210  -6.099  1.00 1.87   ? 89  VAL A CA   1  
ATOM 1246  C C    . VAL A 1 89  ? 4.936   -2.689  -6.573  1.00 1.50   ? 89  VAL A C    1  
ATOM 1247  O O    . VAL A 1 89  ? 4.858   -3.572  -7.429  1.00 1.71   ? 89  VAL A O    1  
ATOM 1248  C CB   . VAL A 1 89  ? 6.894   -1.087  -7.020  1.00 2.06   ? 89  VAL A CB   1  
ATOM 1249  C CG1  . VAL A 1 89  ? 6.120   0.233   -6.835  1.00 3.14   ? 89  VAL A CG1  1  
ATOM 1250  C CG2  . VAL A 1 89  ? 8.368   -0.769  -6.690  1.00 3.29   ? 89  VAL A CG2  1  
ATOM 1251  H H    . VAL A 1 89  ? 7.310   -3.732  -4.992  1.00 2.90   ? 89  VAL A H    1  
ATOM 1252  H HA   . VAL A 1 89  ? 6.231   -1.785  -5.104  1.00 1.98   ? 89  VAL A HA   1  
ATOM 1253  H HB   . VAL A 1 89  ? 6.820   -1.378  -8.066  1.00 1.85   ? 89  VAL A HB   1  
ATOM 1254  H HG11 . VAL A 1 89  ? 6.207   0.580   -5.804  1.00 4.23   ? 89  VAL A HG11 1  
ATOM 1255  H HG12 . VAL A 1 89  ? 6.524   0.998   -7.500  1.00 3.45   ? 89  VAL A HG12 1  
ATOM 1256  H HG13 . VAL A 1 89  ? 5.069   0.100   -7.075  1.00 3.62   ? 89  VAL A HG13 1  
ATOM 1257  H HG21 . VAL A 1 89  ? 8.469   -0.511  -5.635  1.00 4.50   ? 89  VAL A HG21 1  
ATOM 1258  H HG22 . VAL A 1 89  ? 9.007   -1.624  -6.908  1.00 3.47   ? 89  VAL A HG22 1  
ATOM 1259  H HG23 . VAL A 1 89  ? 8.714   0.068   -7.297  1.00 3.77   ? 89  VAL A HG23 1  
ATOM 1260  N N    . PRO A 1 90  ? 3.823   -2.172  -6.016  1.00 1.27   ? 90  PRO A N    1  
ATOM 1261  C CA   . PRO A 1 90  ? 2.496   -2.392  -6.574  1.00 1.17   ? 90  PRO A CA   1  
ATOM 1262  C C    . PRO A 1 90  ? 2.324   -1.607  -7.877  1.00 1.27   ? 90  PRO A C    1  
ATOM 1263  O O    . PRO A 1 90  ? 3.269   -1.085  -8.462  1.00 2.43   ? 90  PRO A O    1  
ATOM 1264  C CB   . PRO A 1 90  ? 1.518   -1.978  -5.461  1.00 1.47   ? 90  PRO A CB   1  
ATOM 1265  C CG   . PRO A 1 90  ? 2.286   -0.880  -4.731  1.00 1.61   ? 90  PRO A CG   1  
ATOM 1266  C CD   . PRO A 1 90  ? 3.724   -1.384  -4.796  1.00 1.50   ? 90  PRO A CD   1  
ATOM 1267  H HA   . PRO A 1 90  ? 2.353   -3.444  -6.809  1.00 1.30   ? 90  PRO A HA   1  
ATOM 1268  H HB2  . PRO A 1 90  ? 0.559   -1.618  -5.832  1.00 1.66   ? 90  PRO A HB2  1  
ATOM 1269  H HB3  . PRO A 1 90  ? 1.354   -2.826  -4.795  1.00 1.68   ? 90  PRO A HB3  1  
ATOM 1270  H HG2  . PRO A 1 90  ? 2.203   0.055   -5.283  1.00 1.64   ? 90  PRO A HG2  1  
ATOM 1271  H HG3  . PRO A 1 90  ? 1.941   -0.758  -3.704  1.00 2.06   ? 90  PRO A HG3  1  
ATOM 1272  H HD2  . PRO A 1 90  ? 4.412   -0.541  -4.790  1.00 1.64   ? 90  PRO A HD2  1  
ATOM 1273  H HD3  . PRO A 1 90  ? 3.908   -2.039  -3.946  1.00 1.84   ? 90  PRO A HD3  1  
ATOM 1274  N N    . TRP A 1 91  ? 1.083   -1.529  -8.341  1.00 1.24   ? 91  TRP A N    1  
ATOM 1275  C CA   . TRP A 1 91  ? 0.693   -0.801  -9.534  1.00 1.31   ? 91  TRP A CA   1  
ATOM 1276  C C    . TRP A 1 91  ? -0.652  -0.131  -9.276  1.00 1.79   ? 91  TRP A C    1  
ATOM 1277  O O    . TRP A 1 91  ? -1.473  -0.621  -8.501  1.00 2.47   ? 91  TRP A O    1  
ATOM 1278  C CB   . TRP A 1 91  ? 0.675   -1.756  -10.740 1.00 1.84   ? 91  TRP A CB   1  
ATOM 1279  C CG   . TRP A 1 91  ? 0.091   -3.120  -10.508 1.00 2.15   ? 91  TRP A CG   1  
ATOM 1280  C CD1  . TRP A 1 91  ? -1.217  -3.450  -10.581 1.00 2.18   ? 91  TRP A CD1  1  
ATOM 1281  C CD2  . TRP A 1 91  ? 0.784   -4.345  -10.103 1.00 2.77   ? 91  TRP A CD2  1  
ATOM 1282  N NE1  . TRP A 1 91  ? -1.375  -4.793  -10.294 1.00 2.59   ? 91  TRP A NE1  1  
ATOM 1283  C CE2  . TRP A 1 91  ? -0.176  -5.392  -9.985  1.00 2.97   ? 91  TRP A CE2  1  
ATOM 1284  C CE3  . TRP A 1 91  ? 2.121   -4.673  -9.788  1.00 3.39   ? 91  TRP A CE3  1  
ATOM 1285  C CZ2  . TRP A 1 91  ? 0.164   -6.694  -9.598  1.00 3.62   ? 91  TRP A CZ2  1  
ATOM 1286  C CZ3  . TRP A 1 91  ? 2.479   -5.979  -9.400  1.00 4.12   ? 91  TRP A CZ3  1  
ATOM 1287  C CH2  . TRP A 1 91  ? 1.507   -6.991  -9.310  1.00 4.20   ? 91  TRP A CH2  1  
ATOM 1288  H H    . TRP A 1 91  ? 0.336   -1.974  -7.827  1.00 2.06   ? 91  TRP A H    1  
ATOM 1289  H HA   . TRP A 1 91  ? 1.416   -0.015  -9.731  1.00 1.46   ? 91  TRP A HA   1  
ATOM 1290  H HB2  . TRP A 1 91  ? 0.158   -1.282  -11.576 1.00 2.24   ? 91  TRP A HB2  1  
ATOM 1291  H HB3  . TRP A 1 91  ? 1.712   -1.901  -11.053 1.00 2.10   ? 91  TRP A HB3  1  
ATOM 1292  H HD1  . TRP A 1 91  ? -2.021  -2.763  -10.805 1.00 2.19   ? 91  TRP A HD1  1  
ATOM 1293  H HE1  . TRP A 1 91  ? -2.266  -5.264  -10.296 1.00 2.78   ? 91  TRP A HE1  1  
ATOM 1294  H HE3  . TRP A 1 91  ? 2.879   -3.900  -9.827  1.00 3.38   ? 91  TRP A HE3  1  
ATOM 1295  H HZ2  . TRP A 1 91  ? -0.605  -7.444  -9.503  1.00 3.77   ? 91  TRP A HZ2  1  
ATOM 1296  H HZ3  . TRP A 1 91  ? 3.508   -6.194  -9.148  1.00 4.68   ? 91  TRP A HZ3  1  
ATOM 1297  H HH2  . TRP A 1 91  ? 1.792   -7.987  -8.997  1.00 4.78   ? 91  TRP A HH2  1  
ATOM 1298  N N    . LEU A 1 92  ? -0.883  1.010   -9.924  1.00 1.88   ? 92  LEU A N    1  
ATOM 1299  C CA   . LEU A 1 92  ? -2.143  1.745   -9.872  1.00 2.55   ? 92  LEU A CA   1  
ATOM 1300  C C    . LEU A 1 92  ? -2.422  2.334   -11.264 1.00 2.27   ? 92  LEU A C    1  
ATOM 1301  O O    . LEU A 1 92  ? -2.529  3.541   -11.455 1.00 2.95   ? 92  LEU A O    1  
ATOM 1302  C CB   . LEU A 1 92  ? -2.076  2.724   -8.680  1.00 3.70   ? 92  LEU A CB   1  
ATOM 1303  C CG   . LEU A 1 92  ? -3.435  3.057   -8.033  1.00 4.68   ? 92  LEU A CG   1  
ATOM 1304  C CD1  . LEU A 1 92  ? -3.228  3.357   -6.539  1.00 6.02   ? 92  LEU A CD1  1  
ATOM 1305  C CD2  . LEU A 1 92  ? -4.153  4.260   -8.666  1.00 5.80   ? 92  LEU A CD2  1  
ATOM 1306  H H    . LEU A 1 92  ? -0.121  1.449   -10.421 1.00 1.73   ? 92  LEU A H    1  
ATOM 1307  H HA   . LEU A 1 92  ? -2.943  1.031   -9.682  1.00 3.23   ? 92  LEU A HA   1  
ATOM 1308  H HB2  . LEU A 1 92  ? -1.455  2.262   -7.910  1.00 4.20   ? 92  LEU A HB2  1  
ATOM 1309  H HB3  . LEU A 1 92  ? -1.572  3.627   -8.991  1.00 3.93   ? 92  LEU A HB3  1  
ATOM 1310  H HG   . LEU A 1 92  ? -4.069  2.176   -8.117  1.00 4.24   ? 92  LEU A HG   1  
ATOM 1311  H HD11 . LEU A 1 92  ? -4.175  3.627   -6.074  1.00 6.79   ? 92  LEU A HD11 1  
ATOM 1312  H HD12 . LEU A 1 92  ? -2.837  2.473   -6.036  1.00 6.32   ? 92  LEU A HD12 1  
ATOM 1313  H HD13 . LEU A 1 92  ? -2.524  4.182   -6.416  1.00 6.62   ? 92  LEU A HD13 1  
ATOM 1314  H HD21 . LEU A 1 92  ? -3.646  5.178   -8.390  1.00 6.26   ? 92  LEU A HD21 1  
ATOM 1315  H HD22 . LEU A 1 92  ? -4.186  4.173   -9.747  1.00 6.08   ? 92  LEU A HD22 1  
ATOM 1316  H HD23 . LEU A 1 92  ? -5.172  4.332   -8.301  1.00 6.59   ? 92  LEU A HD23 1  
ATOM 1317  N N    . THR A 1 93  ? -2.504  1.422   -12.241 1.00 2.33   ? 93  THR A N    1  
ATOM 1318  C CA   . THR A 1 93  ? -3.178  1.626   -13.522 1.00 2.86   ? 93  THR A CA   1  
ATOM 1319  C C    . THR A 1 93  ? -4.507  0.887   -13.421 1.00 2.41   ? 93  THR A C    1  
ATOM 1320  O O    . THR A 1 93  ? -4.529  -0.311  -13.139 1.00 2.60   ? 93  THR A O    1  
ATOM 1321  C CB   . THR A 1 93  ? -2.318  1.189   -14.715 1.00 4.10   ? 93  THR A CB   1  
ATOM 1322  O OG1  . THR A 1 93  ? -3.094  1.372   -15.874 1.00 5.26   ? 93  THR A OG1  1  
ATOM 1323  C CG2  . THR A 1 93  ? -1.827  -0.262  -14.703 1.00 5.22   ? 93  THR A CG2  1  
ATOM 1324  H H    . THR A 1 93  ? -2.380  0.458   -11.971 1.00 2.65   ? 93  THR A H    1  
ATOM 1325  H HA   . THR A 1 93  ? -3.376  2.685   -13.662 1.00 3.12   ? 93  THR A HA   1  
ATOM 1326  H HB   . THR A 1 93  ? -1.447  1.846   -14.764 1.00 4.32   ? 93  THR A HB   1  
ATOM 1327  H HG1  . THR A 1 93  ? -2.526  1.269   -16.643 1.00 5.83   ? 93  THR A HG1  1  
ATOM 1328  H HG21 . THR A 1 93  ? -1.271  -0.469  -13.788 1.00 5.71   ? 93  THR A HG21 1  
ATOM 1329  H HG22 . THR A 1 93  ? -2.669  -0.949  -14.775 1.00 5.53   ? 93  THR A HG22 1  
ATOM 1330  H HG23 . THR A 1 93  ? -1.170  -0.429  -15.555 1.00 6.13   ? 93  THR A HG23 1  
ATOM 1331  N N    . ILE A 1 94  ? -5.622  1.602   -13.543 1.00 2.19   ? 94  ILE A N    1  
ATOM 1332  C CA   . ILE A 1 94  ? -6.965  1.027   -13.390 1.00 1.89   ? 94  ILE A CA   1  
ATOM 1333  C C    . ILE A 1 94  ? -7.571  0.823   -14.788 1.00 1.93   ? 94  ILE A C    1  
ATOM 1334  O O    . ILE A 1 94  ? -7.934  1.817   -15.414 1.00 2.21   ? 94  ILE A O    1  
ATOM 1335  C CB   . ILE A 1 94  ? -7.845  1.936   -12.492 1.00 2.28   ? 94  ILE A CB   1  
ATOM 1336  C CG1  . ILE A 1 94  ? -7.551  1.798   -10.980 1.00 2.77   ? 94  ILE A CG1  1  
ATOM 1337  C CG2  . ILE A 1 94  ? -9.351  1.639   -12.643 1.00 3.47   ? 94  ILE A CG2  1  
ATOM 1338  C CD1  . ILE A 1 94  ? -6.123  2.110   -10.535 1.00 4.23   ? 94  ILE A CD1  1  
ATOM 1339  H H    . ILE A 1 94  ? -5.526  2.599   -13.719 1.00 2.53   ? 94  ILE A H    1  
ATOM 1340  H HA   . ILE A 1 94  ? -6.900  0.059   -12.891 1.00 2.00   ? 94  ILE A HA   1  
ATOM 1341  H HB   . ILE A 1 94  ? -7.682  2.975   -12.787 1.00 3.07   ? 94  ILE A HB   1  
ATOM 1342  H HG12 . ILE A 1 94  ? -8.205  2.493   -10.452 1.00 3.37   ? 94  ILE A HG12 1  
ATOM 1343  H HG13 . ILE A 1 94  ? -7.800  0.790   -10.648 1.00 3.28   ? 94  ILE A HG13 1  
ATOM 1344  H HG21 . ILE A 1 94  ? -9.908  2.239   -11.929 1.00 3.84   ? 94  ILE A HG21 1  
ATOM 1345  H HG22 . ILE A 1 94  ? -9.710  1.922   -13.630 1.00 4.44   ? 94  ILE A HG22 1  
ATOM 1346  H HG23 . ILE A 1 94  ? -9.553  0.584   -12.463 1.00 3.99   ? 94  ILE A HG23 1  
ATOM 1347  H HD11 . ILE A 1 94  ? -6.100  2.173   -9.448  1.00 4.86   ? 94  ILE A HD11 1  
ATOM 1348  H HD12 . ILE A 1 94  ? -5.444  1.318   -10.845 1.00 4.84   ? 94  ILE A HD12 1  
ATOM 1349  H HD13 . ILE A 1 94  ? -5.804  3.060   -10.960 1.00 5.05   ? 94  ILE A HD13 1  
ATOM 1350  N N    . PRO A 1 95  ? -7.769  -0.424  -15.264 1.00 2.11   ? 95  PRO A N    1  
ATOM 1351  C CA   . PRO A 1 95  ? -8.578  -0.706  -16.453 1.00 2.49   ? 95  PRO A CA   1  
ATOM 1352  C C    . PRO A 1 95  ? -10.083 -0.423  -16.236 1.00 2.14   ? 95  PRO A C    1  
ATOM 1353  O O    . PRO A 1 95  ? -10.894 -1.343  -16.170 1.00 2.65   ? 95  PRO A O    1  
ATOM 1354  C CB   . PRO A 1 95  ? -8.255  -2.152  -16.868 1.00 3.17   ? 95  PRO A CB   1  
ATOM 1355  C CG   . PRO A 1 95  ? -7.353  -2.739  -15.784 1.00 3.07   ? 95  PRO A CG   1  
ATOM 1356  C CD   . PRO A 1 95  ? -6.989  -1.584  -14.856 1.00 2.48   ? 95  PRO A CD   1  
ATOM 1357  H HA   . PRO A 1 95  ? -8.239  -0.051  -17.257 1.00 2.87   ? 95  PRO A HA   1  
ATOM 1358  H HB2  . PRO A 1 95  ? -9.151  -2.764  -16.952 1.00 3.33   ? 95  PRO A HB2  1  
ATOM 1359  H HB3  . PRO A 1 95  ? -7.727  -2.146  -17.823 1.00 3.89   ? 95  PRO A HB3  1  
ATOM 1360  H HG2  . PRO A 1 95  ? -7.890  -3.510  -15.232 1.00 3.12   ? 95  PRO A HG2  1  
ATOM 1361  H HG3  . PRO A 1 95  ? -6.454  -3.166  -16.228 1.00 3.67   ? 95  PRO A HG3  1  
ATOM 1362  H HD2  . PRO A 1 95  ? -7.197  -1.857  -13.822 1.00 2.41   ? 95  PRO A HD2  1  
ATOM 1363  H HD3  . PRO A 1 95  ? -5.928  -1.358  -14.969 1.00 2.72   ? 95  PRO A HD3  1  
ATOM 1364  N N    . ALA A 1 96  ? -10.431 0.863   -16.069 1.00 1.86   ? 96  ALA A N    1  
ATOM 1365  C CA   . ALA A 1 96  ? -11.772 1.481   -16.029 1.00 1.92   ? 96  ALA A CA   1  
ATOM 1366  C C    . ALA A 1 96  ? -12.890 0.699   -15.323 1.00 1.99   ? 96  ALA A C    1  
ATOM 1367  O O    . ALA A 1 96  ? -14.057 0.787   -15.694 1.00 3.08   ? 96  ALA A O    1  
ATOM 1368  C CB   . ALA A 1 96  ? -12.130 1.930   -17.456 1.00 2.34   ? 96  ALA A CB   1  
ATOM 1369  H H    . ALA A 1 96  ? -9.652  1.517   -16.077 1.00 2.24   ? 96  ALA A H    1  
ATOM 1370  H HA   . ALA A 1 96  ? -11.690 2.354   -15.386 1.00 2.05   ? 96  ALA A HA   1  
ATOM 1371  H HB1  . ALA A 1 96  ? -11.356 2.588   -17.850 1.00 2.74   ? 96  ALA A HB1  1  
ATOM 1372  H HB2  . ALA A 1 96  ? -12.228 1.056   -18.101 1.00 3.21   ? 96  ALA A HB2  1  
ATOM 1373  H HB3  . ALA A 1 96  ? -13.079 2.468   -17.445 1.00 2.72   ? 96  ALA A HB3  1  
ATOM 1374  N N    . ARG A 1 97  ? -12.486 -0.065  -14.304 1.00 1.73   ? 97  ARG A N    1  
ATOM 1375  C CA   . ARG A 1 97  ? -13.185 -1.175  -13.640 1.00 1.87   ? 97  ARG A CA   1  
ATOM 1376  C C    . ARG A 1 97  ? -12.192 -2.126  -12.944 1.00 1.89   ? 97  ARG A C    1  
ATOM 1377  O O    . ARG A 1 97  ? -12.568 -2.831  -12.006 1.00 2.60   ? 97  ARG A O    1  
ATOM 1378  C CB   . ARG A 1 97  ? -14.141 -1.912  -14.618 1.00 1.98   ? 97  ARG A CB   1  
ATOM 1379  C CG   . ARG A 1 97  ? -14.620 -3.337  -14.274 1.00 2.38   ? 97  ARG A CG   1  
ATOM 1380  C CD   . ARG A 1 97  ? -13.586 -4.419  -14.641 1.00 3.38   ? 97  ARG A CD   1  
ATOM 1381  N NE   . ARG A 1 97  ? -14.166 -5.768  -14.699 1.00 3.98   ? 97  ARG A NE   1  
ATOM 1382  C CZ   . ARG A 1 97  ? -14.814 -6.310  -15.725 1.00 4.08   ? 97  ARG A CZ   1  
ATOM 1383  N NH1  . ARG A 1 97  ? -15.155 -5.625  -16.800 1.00 3.88   ? 97  ARG A NH1  1  
ATOM 1384  N NH2  . ARG A 1 97  ? -15.112 -7.585  -15.671 1.00 5.11   ? 97  ARG A NH2  1  
ATOM 1385  H H    . ARG A 1 97  ? -11.511 0.043   -14.082 1.00 2.18   ? 97  ARG A H    1  
ATOM 1386  H HA   . ARG A 1 97  ? -13.789 -0.700  -12.872 1.00 2.07   ? 97  ARG A HA   1  
ATOM 1387  H HB2  . ARG A 1 97  ? -15.040 -1.303  -14.708 1.00 2.55   ? 97  ARG A HB2  1  
ATOM 1388  H HB3  . ARG A 1 97  ? -13.681 -1.953  -15.608 1.00 2.28   ? 97  ARG A HB3  1  
ATOM 1389  H HG2  . ARG A 1 97  ? -14.886 -3.406  -13.219 1.00 2.99   ? 97  ARG A HG2  1  
ATOM 1390  H HG3  . ARG A 1 97  ? -15.524 -3.523  -14.855 1.00 2.67   ? 97  ARG A HG3  1  
ATOM 1391  H HD2  . ARG A 1 97  ? -13.136 -4.180  -15.607 1.00 3.73   ? 97  ARG A HD2  1  
ATOM 1392  H HD3  . ARG A 1 97  ? -12.790 -4.433  -13.899 1.00 4.18   ? 97  ARG A HD3  1  
ATOM 1393  H HE   . ARG A 1 97  ? -13.948 -6.403  -13.931 1.00 4.84   ? 97  ARG A HE   1  
ATOM 1394  H HH11 . ARG A 1 97  ? -14.949 -4.643  -16.854 1.00 3.67   ? 97  ARG A HH11 1  
ATOM 1395  H HH12 . ARG A 1 97  ? -15.599 -6.097  -17.568 1.00 4.46   ? 97  ARG A HH12 1  
ATOM 1396  H HH21 . ARG A 1 97  ? -14.823 -8.109  -14.846 1.00 5.84   ? 97  ARG A HH21 1  
ATOM 1397  H HH22 . ARG A 1 97  ? -15.476 -8.083  -16.475 1.00 5.47   ? 97  ARG A HH22 1  
ATOM 1398  N N    . GLY A 1 98  ? -10.909 -2.131  -13.339 1.00 1.53   ? 98  GLY A N    1  
ATOM 1399  C CA   . GLY A 1 98  ? -9.844  -2.931  -12.718 1.00 1.67   ? 98  GLY A CA   1  
ATOM 1400  C C    . GLY A 1 98  ? -9.389  -2.291  -11.409 1.00 2.02   ? 98  GLY A C    1  
ATOM 1401  O O    . GLY A 1 98  ? -8.271  -1.793  -11.304 1.00 3.50   ? 98  GLY A O    1  
ATOM 1402  H H    . GLY A 1 98  ? -10.657 -1.537  -14.115 1.00 1.61   ? 98  GLY A H    1  
ATOM 1403  H HA2  . GLY A 1 98  ? -10.226 -3.926  -12.487 1.00 1.76   ? 98  GLY A HA2  1  
ATOM 1404  H HA3  . GLY A 1 98  ? -8.993  -3.028  -13.384 1.00 1.66   ? 98  GLY A HA3  1  
ATOM 1405  N N    . THR A 1 99  ? -10.324 -2.262  -10.460 1.00 1.82   ? 99  THR A N    1  
ATOM 1406  C CA   . THR A 1 99  ? -10.266 -1.707  -9.106  1.00 2.18   ? 99  THR A CA   1  
ATOM 1407  C C    . THR A 1 99  ? -9.122  -2.370  -8.344  1.00 1.94   ? 99  THR A C    1  
ATOM 1408  O O    . THR A 1 99  ? -9.184  -3.541  -7.969  1.00 2.39   ? 99  THR A O    1  
ATOM 1409  C CB   . THR A 1 99  ? -11.651 -1.938  -8.481  1.00 3.00   ? 99  THR A CB   1  
ATOM 1410  O OG1  . THR A 1 99  ? -12.565 -1.171  -9.247  1.00 3.88   ? 99  THR A OG1  1  
ATOM 1411  C CG2  . THR A 1 99  ? -11.820 -1.543  -7.013  1.00 3.82   ? 99  THR A CG2  1  
ATOM 1412  H H    . THR A 1 99  ? -11.219 -2.649  -10.743 1.00 2.56   ? 99  THR A H    1  
ATOM 1413  H HA   . THR A 1 99  ? -10.080 -0.632  -9.136  1.00 2.28   ? 99  THR A HA   1  
ATOM 1414  H HB   . THR A 1 99  ? -11.900 -3.000  -8.567  1.00 2.93   ? 99  THR A HB   1  
ATOM 1415  H HG1  . THR A 1 99  ? -12.174 -0.300  -9.428  1.00 4.67   ? 99  THR A HG1  1  
ATOM 1416  H HG21 . THR A 1 99  ? -10.953 -1.851  -6.430  1.00 3.72   ? 99  THR A HG21 1  
ATOM 1417  H HG22 . THR A 1 99  ? -11.973 -0.472  -6.924  1.00 4.75   ? 99  THR A HG22 1  
ATOM 1418  H HG23 . THR A 1 99  ? -12.702 -2.048  -6.614  1.00 4.27   ? 99  THR A HG23 1  
ATOM 1419  N N    . LEU A 1 100 ? -8.032  -1.621  -8.202  1.00 1.56   ? 100 LEU A N    1  
ATOM 1420  C CA   . LEU A 1 100 ? -6.806  -2.091  -7.557  1.00 1.47   ? 100 LEU A CA   1  
ATOM 1421  C C    . LEU A 1 100 ? -6.996  -2.504  -6.088  1.00 1.45   ? 100 LEU A C    1  
ATOM 1422  O O    . LEU A 1 100 ? -7.990  -2.156  -5.458  1.00 1.65   ? 100 LEU A O    1  
ATOM 1423  C CB   . LEU A 1 100 ? -5.689  -1.053  -7.757  1.00 1.65   ? 100 LEU A CB   1  
ATOM 1424  C CG   . LEU A 1 100 ? -4.551  -1.548  -8.660  1.00 2.50   ? 100 LEU A CG   1  
ATOM 1425  C CD1  . LEU A 1 100 ? -3.803  -2.732  -8.023  1.00 3.57   ? 100 LEU A CD1  1  
ATOM 1426  C CD2  . LEU A 1 100 ? -5.027  -1.883  -10.082 1.00 3.98   ? 100 LEU A CD2  1  
ATOM 1427  H H    . LEU A 1 100 ? -8.020  -0.757  -8.723  1.00 1.54   ? 100 LEU A H    1  
ATOM 1428  H HA   . LEU A 1 100 ? -6.539  -3.015  -8.070  1.00 1.61   ? 100 LEU A HA   1  
ATOM 1429  H HB2  . LEU A 1 100 ? -6.099  -0.145  -8.199  1.00 2.08   ? 100 LEU A HB2  1  
ATOM 1430  H HB3  . LEU A 1 100 ? -5.272  -0.770  -6.789  1.00 2.29   ? 100 LEU A HB3  1  
ATOM 1431  H HG   . LEU A 1 100 ? -3.868  -0.713  -8.744  1.00 2.87   ? 100 LEU A HG   1  
ATOM 1432  H HD11 . LEU A 1 100 ? -3.498  -2.477  -7.008  1.00 3.92   ? 100 LEU A HD11 1  
ATOM 1433  H HD12 . LEU A 1 100 ? -4.424  -3.627  -8.002  1.00 4.33   ? 100 LEU A HD12 1  
ATOM 1434  H HD13 . LEU A 1 100 ? -2.908  -2.949  -8.597  1.00 4.32   ? 100 LEU A HD13 1  
ATOM 1435  H HD21 . LEU A 1 100 ? -4.166  -2.053  -10.727 1.00 4.90   ? 100 LEU A HD21 1  
ATOM 1436  H HD22 . LEU A 1 100 ? -5.649  -2.777  -10.088 1.00 4.73   ? 100 LEU A HD22 1  
ATOM 1437  H HD23 . LEU A 1 100 ? -5.599  -1.049  -10.487 1.00 4.37   ? 100 LEU A HD23 1  
ATOM 1438  N N    . THR A 1 101 ? -6.045  -3.294  -5.566  1.00 1.48   ? 101 THR A N    1  
ATOM 1439  C CA   . THR A 1 101 ? -6.287  -4.388  -4.606  1.00 1.42   ? 101 THR A CA   1  
ATOM 1440  C C    . THR A 1 101 ? -4.936  -4.959  -4.148  1.00 1.20   ? 101 THR A C    1  
ATOM 1441  O O    . THR A 1 101 ? -4.130  -5.262  -5.024  1.00 1.67   ? 101 THR A O    1  
ATOM 1442  C CB   . THR A 1 101 ? -7.106  -5.464  -5.352  1.00 2.17   ? 101 THR A CB   1  
ATOM 1443  O OG1  . THR A 1 101 ? -8.445  -5.034  -5.503  1.00 3.04   ? 101 THR A OG1  1  
ATOM 1444  C CG2  . THR A 1 101 ? -7.222  -6.792  -4.608  1.00 2.69   ? 101 THR A CG2  1  
ATOM 1445  H H    . THR A 1 101 ? -5.195  -3.404  -6.099  1.00 1.71   ? 101 THR A H    1  
ATOM 1446  H HA   . THR A 1 101 ? -6.855  -4.049  -3.740  1.00 1.77   ? 101 THR A HA   1  
ATOM 1447  H HB   . THR A 1 101 ? -6.634  -5.647  -6.331  1.00 2.41   ? 101 THR A HB   1  
ATOM 1448  H HG1  . THR A 1 101 ? -8.541  -4.436  -6.260  1.00 3.33   ? 101 THR A HG1  1  
ATOM 1449  H HG21 . THR A 1 101 ? -7.895  -7.458  -5.149  1.00 3.58   ? 101 THR A HG21 1  
ATOM 1450  H HG22 . THR A 1 101 ? -6.244  -7.269  -4.547  1.00 2.93   ? 101 THR A HG22 1  
ATOM 1451  H HG23 . THR A 1 101 ? -7.616  -6.620  -3.605  1.00 3.25   ? 101 THR A HG23 1  
ATOM 1452  N N    . LEU A 1 102 ? -4.692  -5.110  -2.833  1.00 1.29   ? 102 LEU A N    1  
ATOM 1453  C CA   . LEU A 1 102 ? -3.502  -5.759  -2.231  1.00 1.71   ? 102 LEU A CA   1  
ATOM 1454  C C    . LEU A 1 102 ? -3.724  -6.160  -0.754  1.00 1.41   ? 102 LEU A C    1  
ATOM 1455  O O    . LEU A 1 102 ? -4.304  -5.403  0.024   1.00 1.42   ? 102 LEU A O    1  
ATOM 1456  C CB   . LEU A 1 102 ? -2.197  -4.955  -2.441  1.00 2.40   ? 102 LEU A CB   1  
ATOM 1457  C CG   . LEU A 1 102 ? -2.045  -3.614  -1.693  1.00 2.85   ? 102 LEU A CG   1  
ATOM 1458  C CD1  . LEU A 1 102 ? -0.562  -3.220  -1.670  1.00 3.87   ? 102 LEU A CD1  1  
ATOM 1459  C CD2  . LEU A 1 102 ? -2.849  -2.471  -2.330  1.00 3.45   ? 102 LEU A CD2  1  
ATOM 1460  H H    . LEU A 1 102 ? -5.412  -4.809  -2.183  1.00 1.54   ? 102 LEU A H    1  
ATOM 1461  H HA   . LEU A 1 102 ? -3.354  -6.691  -2.778  1.00 2.36   ? 102 LEU A HA   1  
ATOM 1462  H HB2  . LEU A 1 102 ? -1.386  -5.616  -2.128  1.00 3.57   ? 102 LEU A HB2  1  
ATOM 1463  H HB3  . LEU A 1 102 ? -2.050  -4.782  -3.508  1.00 3.26   ? 102 LEU A HB3  1  
ATOM 1464  H HG   . LEU A 1 102 ? -2.369  -3.739  -0.663  1.00 3.66   ? 102 LEU A HG   1  
ATOM 1465  H HD11 . LEU A 1 102 ? 0.022   -3.999  -1.179  1.00 4.72   ? 102 LEU A HD11 1  
ATOM 1466  H HD12 . LEU A 1 102 ? -0.193  -3.086  -2.686  1.00 4.14   ? 102 LEU A HD12 1  
ATOM 1467  H HD13 . LEU A 1 102 ? -0.436  -2.292  -1.115  1.00 4.56   ? 102 LEU A HD13 1  
ATOM 1468  H HD21 . LEU A 1 102 ? -2.567  -2.354  -3.377  1.00 3.67   ? 102 LEU A HD21 1  
ATOM 1469  H HD22 . LEU A 1 102 ? -3.915  -2.674  -2.268  1.00 4.35   ? 102 LEU A HD22 1  
ATOM 1470  H HD23 . LEU A 1 102 ? -2.650  -1.542  -1.798  1.00 4.01   ? 102 LEU A HD23 1  
ATOM 1471  N N    . GLN A 1 103 ? -3.229  -7.339  -0.342  1.00 1.43   ? 103 GLN A N    1  
ATOM 1472  C CA   . GLN A 1 103 ? -3.623  -8.038  0.903   1.00 1.44   ? 103 GLN A CA   1  
ATOM 1473  C C    . GLN A 1 103 ? -2.563  -9.052  1.336   1.00 1.67   ? 103 GLN A C    1  
ATOM 1474  O O    . GLN A 1 103 ? -2.016  -9.720  0.475   1.00 1.90   ? 103 GLN A O    1  
ATOM 1475  C CB   . GLN A 1 103 ? -4.969  -8.798  0.757   1.00 1.66   ? 103 GLN A CB   1  
ATOM 1476  C CG   . GLN A 1 103 ? -5.211  -9.578  -0.554  1.00 3.10   ? 103 GLN A CG   1  
ATOM 1477  C CD   . GLN A 1 103 ? -5.462  -8.686  -1.770  1.00 3.43   ? 103 GLN A CD   1  
ATOM 1478  O OE1  . GLN A 1 103 ? -6.236  -7.746  -1.736  1.00 3.44   ? 103 GLN A OE1  1  
ATOM 1479  N NE2  . GLN A 1 103 ? -4.762  -8.903  -2.865  1.00 4.69   ? 103 GLN A NE2  1  
ATOM 1480  H H    . GLN A 1 103 ? -2.613  -7.853  -0.970  1.00 1.64   ? 103 GLN A H    1  
ATOM 1481  H HA   . GLN A 1 103 ? -3.728  -7.309  1.704   1.00 1.37   ? 103 GLN A HA   1  
ATOM 1482  H HB2  . GLN A 1 103 ? -5.021  -9.539  1.566   1.00 2.77   ? 103 GLN A HB2  1  
ATOM 1483  H HB3  . GLN A 1 103 ? -5.788  -8.089  0.897   1.00 1.60   ? 103 GLN A HB3  1  
ATOM 1484  H HG2  . GLN A 1 103 ? -4.365  -10.234 -0.745  1.00 4.54   ? 103 GLN A HG2  1  
ATOM 1485  H HG3  . GLN A 1 103 ? -6.089  -10.213 -0.425  1.00 3.78   ? 103 GLN A HG3  1  
ATOM 1486  H HE21 . GLN A 1 103 ? -4.161  -9.702  -2.940  1.00 5.11   ? 103 GLN A HE21 1  
ATOM 1487  H HE22 . GLN A 1 103 ? -4.890  -8.262  -3.634  1.00 5.51   ? 103 GLN A HE22 1  
ATOM 1488  N N    . ARG A 1 104 ? -2.345  -9.278  2.647   1.00 1.83   ? 104 ARG A N    1  
ATOM 1489  C CA   . ARG A 1 104 ? -1.385  -10.304 3.128   1.00 2.24   ? 104 ARG A CA   1  
ATOM 1490  C C    . ARG A 1 104 ? -1.631  -11.679 2.481   1.00 2.56   ? 104 ARG A C    1  
ATOM 1491  O O    . ARG A 1 104 ? -0.695  -12.360 2.073   1.00 2.66   ? 104 ARG A O    1  
ATOM 1492  C CB   . ARG A 1 104 ? -1.395  -10.384 4.675   1.00 2.43   ? 104 ARG A CB   1  
ATOM 1493  C CG   . ARG A 1 104 ? -0.247  -11.235 5.277   1.00 3.34   ? 104 ARG A CG   1  
ATOM 1494  C CD   . ARG A 1 104 ? 0.177   -10.738 6.679   1.00 4.41   ? 104 ARG A CD   1  
ATOM 1495  N NE   . ARG A 1 104 ? 1.095   -11.647 7.413   1.00 5.53   ? 104 ARG A NE   1  
ATOM 1496  C CZ   . ARG A 1 104 ? 2.341   -11.992 7.092   1.00 6.24   ? 104 ARG A CZ   1  
ATOM 1497  N NH1  . ARG A 1 104 ? 2.971   -11.474 6.058   1.00 6.57   ? 104 ARG A NH1  1  
ATOM 1498  N NH2  . ARG A 1 104 ? 2.998   -12.837 7.863   1.00 7.41   ? 104 ARG A NH2  1  
ATOM 1499  H H    . ARG A 1 104 ? -2.853  -8.738  3.333   1.00 1.80   ? 104 ARG A H    1  
ATOM 1500  H HA   . ARG A 1 104 ? -0.391  -9.995  2.808   1.00 2.26   ? 104 ARG A HA   1  
ATOM 1501  H HB2  . ARG A 1 104 ? -1.320  -9.371  5.067   1.00 2.87   ? 104 ARG A HB2  1  
ATOM 1502  H HB3  . ARG A 1 104 ? -2.350  -10.789 5.014   1.00 2.62   ? 104 ARG A HB3  1  
ATOM 1503  H HG2  . ARG A 1 104 ? -0.577  -12.272 5.338   1.00 3.94   ? 104 ARG A HG2  1  
ATOM 1504  H HG3  . ARG A 1 104 ? 0.616   -11.196 4.615   1.00 3.84   ? 104 ARG A HG3  1  
ATOM 1505  H HD2  . ARG A 1 104 ? 0.643   -9.758  6.583   1.00 4.74   ? 104 ARG A HD2  1  
ATOM 1506  H HD3  . ARG A 1 104 ? -0.723  -10.617 7.282   1.00 4.79   ? 104 ARG A HD3  1  
ATOM 1507  H HE   . ARG A 1 104 ? 0.731   -12.097 8.235   1.00 6.30   ? 104 ARG A HE   1  
ATOM 1508  H HH11 . ARG A 1 104 ? 2.545   -10.719 5.528   1.00 6.27   ? 104 ARG A HH11 1  
ATOM 1509  H HH12 . ARG A 1 104 ? 3.919   -11.751 5.864   1.00 7.61   ? 104 ARG A HH12 1  
ATOM 1510  H HH21 . ARG A 1 104 ? 2.723   -13.021 8.833   1.00 8.09   ? 104 ARG A HH21 1  
ATOM 1511  H HH22 . ARG A 1 104 ? 3.879   -13.252 7.566   1.00 8.05   ? 104 ARG A HH22 1  
ATOM 1512  N N    . ASP A 1 105 ? -2.906  -12.035 2.286   1.00 2.93   ? 105 ASP A N    1  
ATOM 1513  C CA   . ASP A 1 105 ? -3.333  -13.287 1.649   1.00 3.46   ? 105 ASP A CA   1  
ATOM 1514  C C    . ASP A 1 105 ? -2.917  -13.440 0.162   1.00 3.16   ? 105 ASP A C    1  
ATOM 1515  O O    . ASP A 1 105 ? -2.868  -14.562 -0.340  1.00 3.43   ? 105 ASP A O    1  
ATOM 1516  C CB   . ASP A 1 105 ? -4.858  -13.442 1.826   1.00 4.09   ? 105 ASP A CB   1  
ATOM 1517  C CG   . ASP A 1 105 ? -5.297  -14.915 1.755   1.00 4.55   ? 105 ASP A CG   1  
ATOM 1518  O OD1  . ASP A 1 105 ? -4.745  -15.723 2.547   1.00 5.83   ? 105 ASP A OD1  1  
ATOM 1519  O OD2  . ASP A 1 105 ? -6.207  -15.233 0.953   1.00 4.37   ? 105 ASP A OD2  1  
ATOM 1520  H H    . ASP A 1 105 ? -3.629  -11.429 2.639   1.00 3.11   ? 105 ASP A H    1  
ATOM 1521  H HA   . ASP A 1 105 ? -2.858  -14.084 2.210   1.00 3.92   ? 105 ASP A HA   1  
ATOM 1522  H HB2  . ASP A 1 105 ? -5.149  -13.053 2.807   1.00 5.13   ? 105 ASP A HB2  1  
ATOM 1523  H HB3  . ASP A 1 105 ? -5.373  -12.847 1.063   1.00 3.87   ? 105 ASP A HB3  1  
ATOM 1524  N N    . GLY A 1 106 ? -2.560  -12.337 -0.512  1.00 2.80   ? 106 GLY A N    1  
ATOM 1525  C CA   . GLY A 1 106 ? -2.074  -12.272 -1.901  1.00 2.65   ? 106 GLY A CA   1  
ATOM 1526  C C    . GLY A 1 106 ? -0.829  -11.400 -2.101  1.00 2.56   ? 106 GLY A C    1  
ATOM 1527  O O    . GLY A 1 106 ? -0.567  -10.999 -3.233  1.00 2.51   ? 106 GLY A O    1  
ATOM 1528  H H    . GLY A 1 106 ? -2.576  -11.467 0.009   1.00 2.76   ? 106 GLY A H    1  
ATOM 1529  H HA2  . GLY A 1 106 ? -1.848  -13.274 -2.264  1.00 2.79   ? 106 GLY A HA2  1  
ATOM 1530  H HA3  . GLY A 1 106 ? -2.865  -11.849 -2.517  1.00 2.76   ? 106 GLY A HA3  1  
ATOM 1531  N N    . ASP A 1 107 ? -0.097  -11.103 -1.029  1.00 3.16   ? 107 ASP A N    1  
ATOM 1532  C CA   . ASP A 1 107 ? 1.121   -10.291 -0.945  1.00 3.59   ? 107 ASP A CA   1  
ATOM 1533  C C    . ASP A 1 107 ? 0.814   -8.775  -0.859  1.00 2.51   ? 107 ASP A C    1  
ATOM 1534  O O    . ASP A 1 107 ? -0.246  -8.286  -1.253  1.00 2.23   ? 107 ASP A O    1  
ATOM 1535  C CB   . ASP A 1 107 ? 2.158   -10.678 -2.023  1.00 4.82   ? 107 ASP A CB   1  
ATOM 1536  C CG   . ASP A 1 107 ? 3.610   -10.381 -1.632  1.00 6.14   ? 107 ASP A CG   1  
ATOM 1537  O OD1  . ASP A 1 107 ? 3.864   -9.835  -0.532  1.00 7.20   ? 107 ASP A OD1  1  
ATOM 1538  O OD2  . ASP A 1 107 ? 4.506   -10.719 -2.437  1.00 6.77   ? 107 ASP A OD2  1  
ATOM 1539  H H    . ASP A 1 107 ? -0.487  -11.389 -0.142  1.00 3.69   ? 107 ASP A H    1  
ATOM 1540  H HA   . ASP A 1 107 ? 1.574   -10.549 0.014   1.00 4.33   ? 107 ASP A HA   1  
ATOM 1541  H HB2  . ASP A 1 107 ? 2.086   -11.752 -2.205  1.00 5.65   ? 107 ASP A HB2  1  
ATOM 1542  H HB3  . ASP A 1 107 ? 1.926   -10.172 -2.958  1.00 4.55   ? 107 ASP A HB3  1  
ATOM 1543  N N    . HIS A 1 108 ? 1.737   -8.005  -0.285  1.00 2.19   ? 108 HIS A N    1  
ATOM 1544  C CA   . HIS A 1 108 ? 1.448   -6.721  0.375   1.00 1.60   ? 108 HIS A CA   1  
ATOM 1545  C C    . HIS A 1 108 ? 2.716   -5.865  0.561   1.00 1.47   ? 108 HIS A C    1  
ATOM 1546  O O    . HIS A 1 108 ? 3.816   -6.414  0.509   1.00 1.94   ? 108 HIS A O    1  
ATOM 1547  C CB   . HIS A 1 108 ? 0.804   -7.026  1.742   1.00 1.70   ? 108 HIS A CB   1  
ATOM 1548  C CG   . HIS A 1 108 ? 1.653   -7.799  2.738   1.00 2.13   ? 108 HIS A CG   1  
ATOM 1549  N ND1  . HIS A 1 108 ? 2.975   -8.167  2.627   1.00 2.39   ? 108 HIS A ND1  1  
ATOM 1550  C CD2  . HIS A 1 108 ? 1.230   -8.246  3.957   1.00 3.09   ? 108 HIS A CD2  1  
ATOM 1551  C CE1  . HIS A 1 108 ? 3.321   -8.845  3.734   1.00 2.86   ? 108 HIS A CE1  1  
ATOM 1552  N NE2  . HIS A 1 108 ? 2.271   -8.942  4.577   1.00 3.33   ? 108 HIS A NE2  1  
ATOM 1553  H H    . HIS A 1 108 ? 2.656   -8.418  -0.117  1.00 2.67   ? 108 HIS A H    1  
ATOM 1554  H HA   . HIS A 1 108 ? 0.742   -6.154  -0.240  1.00 1.58   ? 108 HIS A HA   1  
ATOM 1555  H HB2  . HIS A 1 108 ? 0.511   -6.097  2.222   1.00 1.65   ? 108 HIS A HB2  1  
ATOM 1556  H HB3  . HIS A 1 108 ? -0.106  -7.600  1.569   1.00 1.82   ? 108 HIS A HB3  1  
ATOM 1557  H HD1  . HIS A 1 108 ? 3.597   -7.908  1.866   1.00 2.77   ? 108 HIS A HD1  1  
ATOM 1558  H HD2  . HIS A 1 108 ? 0.254   -8.076  4.378   1.00 3.89   ? 108 HIS A HD2  1  
ATOM 1559  H HE1  . HIS A 1 108 ? 4.315   -9.235  3.923   1.00 3.30   ? 108 HIS A HE1  1  
ATOM 1560  N N    . VAL A 1 109 ? 2.608   -4.553  0.804   1.00 1.00   ? 109 VAL A N    1  
ATOM 1561  C CA   . VAL A 1 109 ? 3.798   -3.685  0.873   1.00 0.80   ? 109 VAL A CA   1  
ATOM 1562  C C    . VAL A 1 109 ? 4.414   -3.763  2.268   1.00 0.77   ? 109 VAL A C    1  
ATOM 1563  O O    . VAL A 1 109 ? 3.753   -3.408  3.240   1.00 1.04   ? 109 VAL A O    1  
ATOM 1564  C CB   . VAL A 1 109 ? 3.540   -2.235  0.390   1.00 0.93   ? 109 VAL A CB   1  
ATOM 1565  C CG1  . VAL A 1 109 ? 3.104   -2.217  -1.087  1.00 2.45   ? 109 VAL A CG1  1  
ATOM 1566  C CG2  . VAL A 1 109 ? 2.510   -1.434  1.193   1.00 2.17   ? 109 VAL A CG2  1  
ATOM 1567  H H    . VAL A 1 109 ? 1.707   -4.172  1.080   1.00 0.97   ? 109 VAL A H    1  
ATOM 1568  H HA   . VAL A 1 109 ? 4.541   -4.095  0.195   1.00 0.83   ? 109 VAL A HA   1  
ATOM 1569  H HB   . VAL A 1 109 ? 4.490   -1.710  0.463   1.00 1.44   ? 109 VAL A HB   1  
ATOM 1570  H HG11 . VAL A 1 109 ? 3.849   -2.711  -1.702  1.00 3.57   ? 109 VAL A HG11 1  
ATOM 1571  H HG12 . VAL A 1 109 ? 2.154   -2.733  -1.207  1.00 3.23   ? 109 VAL A HG12 1  
ATOM 1572  H HG13 . VAL A 1 109 ? 2.993   -1.191  -1.435  1.00 2.97   ? 109 VAL A HG13 1  
ATOM 1573  H HG21 . VAL A 1 109 ? 2.854   -1.311  2.217   1.00 2.34   ? 109 VAL A HG21 1  
ATOM 1574  H HG22 . VAL A 1 109 ? 2.392   -0.440  0.761   1.00 3.03   ? 109 VAL A HG22 1  
ATOM 1575  H HG23 . VAL A 1 109 ? 1.547   -1.940  1.178   1.00 3.57   ? 109 VAL A HG23 1  
ATOM 1576  N N    . MET A 1 110 ? 5.638   -4.275  2.381   1.00 0.80   ? 110 MET A N    1  
ATOM 1577  C CA   . MET A 1 110 ? 6.291   -4.571  3.656   1.00 0.82   ? 110 MET A CA   1  
ATOM 1578  C C    . MET A 1 110 ? 7.127   -3.373  4.133   1.00 0.70   ? 110 MET A C    1  
ATOM 1579  O O    . MET A 1 110 ? 8.051   -2.899  3.481   1.00 0.79   ? 110 MET A O    1  
ATOM 1580  C CB   . MET A 1 110 ? 7.125   -5.855  3.513   1.00 1.01   ? 110 MET A CB   1  
ATOM 1581  C CG   . MET A 1 110 ? 7.499   -6.467  4.868   1.00 1.80   ? 110 MET A CG   1  
ATOM 1582  S SD   . MET A 1 110 ? 6.191   -7.484  5.587   1.00 1.96   ? 110 MET A SD   1  
ATOM 1583  C CE   . MET A 1 110 ? 6.858   -7.682  7.256   1.00 2.63   ? 110 MET A CE   1  
ATOM 1584  H H    . MET A 1 110 ? 6.123   -4.565  1.534   1.00 0.99   ? 110 MET A H    1  
ATOM 1585  H HA   . MET A 1 110 ? 5.505   -4.763  4.394   1.00 0.89   ? 110 MET A HA   1  
ATOM 1586  H HB2  . MET A 1 110 ? 6.560   -6.597  2.944   1.00 1.26   ? 110 MET A HB2  1  
ATOM 1587  H HB3  . MET A 1 110 ? 8.031   -5.634  2.955   1.00 1.87   ? 110 MET A HB3  1  
ATOM 1588  H HG2  . MET A 1 110 ? 8.378   -7.101  4.732   1.00 2.90   ? 110 MET A HG2  1  
ATOM 1589  H HG3  . MET A 1 110 ? 7.767   -5.677  5.569   1.00 3.07   ? 110 MET A HG3  1  
ATOM 1590  H HE1  . MET A 1 110 ? 6.956   -6.701  7.730   1.00 3.57   ? 110 MET A HE1  1  
ATOM 1591  H HE2  . MET A 1 110 ? 6.178   -8.287  7.849   1.00 3.11   ? 110 MET A HE2  1  
ATOM 1592  H HE3  . MET A 1 110 ? 7.835   -8.167  7.211   1.00 2.75   ? 110 MET A HE3  1  
ATOM 1593  N N    . LEU A 1 111 ? 6.783   -2.870  5.309   1.00 0.68   ? 111 LEU A N    1  
ATOM 1594  C CA   . LEU A 1 111 ? 7.379   -1.741  6.004   1.00 0.70   ? 111 LEU A CA   1  
ATOM 1595  C C    . LEU A 1 111 ? 8.484   -2.260  6.928   1.00 0.72   ? 111 LEU A C    1  
ATOM 1596  O O    . LEU A 1 111 ? 8.314   -2.369  8.145   1.00 0.84   ? 111 LEU A O    1  
ATOM 1597  C CB   . LEU A 1 111 ? 6.253   -1.019  6.764   1.00 0.83   ? 111 LEU A CB   1  
ATOM 1598  C CG   . LEU A 1 111 ? 5.478   0.023   5.942   1.00 1.05   ? 111 LEU A CG   1  
ATOM 1599  C CD1  . LEU A 1 111 ? 4.644   -0.571  4.797   1.00 2.37   ? 111 LEU A CD1  1  
ATOM 1600  C CD2  . LEU A 1 111 ? 4.548   0.769   6.905   1.00 2.00   ? 111 LEU A CD2  1  
ATOM 1601  H H    . LEU A 1 111 ? 6.085   -3.384  5.831   1.00 0.73   ? 111 LEU A H    1  
ATOM 1602  H HA   . LEU A 1 111 ? 7.844   -1.058  5.289   1.00 0.76   ? 111 LEU A HA   1  
ATOM 1603  H HB2  . LEU A 1 111 ? 5.556   -1.760  7.147   1.00 1.17   ? 111 LEU A HB2  1  
ATOM 1604  H HB3  . LEU A 1 111 ? 6.678   -0.511  7.627   1.00 1.05   ? 111 LEU A HB3  1  
ATOM 1605  H HG   . LEU A 1 111 ? 6.188   0.733   5.520   1.00 1.98   ? 111 LEU A HG   1  
ATOM 1606  H HD11 . LEU A 1 111 ? 3.970   -1.335  5.184   1.00 2.88   ? 111 LEU A HD11 1  
ATOM 1607  H HD12 . LEU A 1 111 ? 4.057   0.214   4.318   1.00 3.20   ? 111 LEU A HD12 1  
ATOM 1608  H HD13 . LEU A 1 111 ? 5.298   -1.009  4.043   1.00 3.35   ? 111 LEU A HD13 1  
ATOM 1609  H HD21 . LEU A 1 111 ? 5.136   1.304   7.654   1.00 2.88   ? 111 LEU A HD21 1  
ATOM 1610  H HD22 . LEU A 1 111 ? 3.933   1.487   6.360   1.00 2.70   ? 111 LEU A HD22 1  
ATOM 1611  H HD23 . LEU A 1 111 ? 3.903   0.052   7.411   1.00 2.82   ? 111 LEU A HD23 1  
ATOM 1612  N N    . MET A 1 112 ? 9.620   -2.604  6.319   1.00 0.72   ? 112 MET A N    1  
ATOM 1613  C CA   . MET A 1 112 ? 10.793  -3.108  7.035   1.00 0.87   ? 112 MET A CA   1  
ATOM 1614  C C    . MET A 1 112 ? 11.643  -1.971  7.596   1.00 1.05   ? 112 MET A C    1  
ATOM 1615  O O    . MET A 1 112 ? 11.831  -0.924  6.965   1.00 1.17   ? 112 MET A O    1  
ATOM 1616  C CB   . MET A 1 112 ? 11.640  -4.015  6.133   1.00 0.95   ? 112 MET A CB   1  
ATOM 1617  C CG   . MET A 1 112 ? 10.870  -5.286  5.756   1.00 2.11   ? 112 MET A CG   1  
ATOM 1618  S SD   . MET A 1 112 ? 11.853  -6.575  4.948   1.00 2.47   ? 112 MET A SD   1  
ATOM 1619  C CE   . MET A 1 112 ? 12.957  -6.990  6.326   1.00 2.22   ? 112 MET A CE   1  
ATOM 1620  H H    . MET A 1 112 ? 9.698   -2.467  5.317   1.00 0.72   ? 112 MET A H    1  
ATOM 1621  H HA   . MET A 1 112 ? 10.458  -3.711  7.880   1.00 0.94   ? 112 MET A HA   1  
ATOM 1622  H HB2  . MET A 1 112 ? 11.941  -3.484  5.227   1.00 2.10   ? 112 MET A HB2  1  
ATOM 1623  H HB3  . MET A 1 112 ? 12.539  -4.294  6.683   1.00 1.77   ? 112 MET A HB3  1  
ATOM 1624  H HG2  . MET A 1 112 ? 10.436  -5.714  6.662   1.00 2.95   ? 112 MET A HG2  1  
ATOM 1625  H HG3  . MET A 1 112 ? 10.056  -5.007  5.086   1.00 3.28   ? 112 MET A HG3  1  
ATOM 1626  H HE1  . MET A 1 112 ? 13.700  -6.207  6.457   1.00 2.57   ? 112 MET A HE1  1  
ATOM 1627  H HE2  . MET A 1 112 ? 12.379  -7.091  7.248   1.00 3.06   ? 112 MET A HE2  1  
ATOM 1628  H HE3  . MET A 1 112 ? 13.461  -7.935  6.118   1.00 2.48   ? 112 MET A HE3  1  
ATOM 1629  N N    . GLY A 1 113 ? 12.165  -2.182  8.805   1.00 1.17   ? 113 GLY A N    1  
ATOM 1630  C CA   . GLY A 1 113 ? 12.972  -1.183  9.504   1.00 1.41   ? 113 GLY A CA   1  
ATOM 1631  C C    . GLY A 1 113 ? 12.114  -0.030  10.020  1.00 1.43   ? 113 GLY A C    1  
ATOM 1632  O O    . GLY A 1 113 ? 12.395  1.133   9.727   1.00 1.90   ? 113 GLY A O    1  
ATOM 1633  H H    . GLY A 1 113 ? 11.981  -3.079  9.255   1.00 1.17   ? 113 GLY A H    1  
ATOM 1634  H HA2  . GLY A 1 113 ? 13.463  -1.653  10.357  1.00 1.56   ? 113 GLY A HA2  1  
ATOM 1635  H HA3  . GLY A 1 113 ? 13.718  -0.775  8.822   1.00 1.54   ? 113 GLY A HA3  1  
ATOM 1636  N N    . LEU A 1 114 ? 11.079  -0.338  10.802  1.00 1.17   ? 114 LEU A N    1  
ATOM 1637  C CA   . LEU A 1 114 ? 10.263  0.601   11.566  1.00 1.23   ? 114 LEU A CA   1  
ATOM 1638  C C    . LEU A 1 114 ? 11.045  1.181   12.766  1.00 1.35   ? 114 LEU A C    1  
ATOM 1639  O O    . LEU A 1 114 ? 12.226  0.898   12.970  1.00 2.20   ? 114 LEU A O    1  
ATOM 1640  C CB   . LEU A 1 114 ? 8.969   -0.142  11.980  1.00 1.45   ? 114 LEU A CB   1  
ATOM 1641  C CG   . LEU A 1 114 ? 7.716   0.748   12.017  1.00 1.96   ? 114 LEU A CG   1  
ATOM 1642  C CD1  . LEU A 1 114 ? 7.212   1.067   10.602  1.00 2.56   ? 114 LEU A CD1  1  
ATOM 1643  C CD2  . LEU A 1 114 ? 6.608   0.070   12.835  1.00 2.78   ? 114 LEU A CD2  1  
ATOM 1644  H H    . LEU A 1 114 ? 10.901  -1.317  10.984  1.00 1.18   ? 114 LEU A H    1  
ATOM 1645  H HA   . LEU A 1 114 ? 10.012  1.433   10.911  1.00 1.61   ? 114 LEU A HA   1  
ATOM 1646  H HB2  . LEU A 1 114 ? 8.770   -0.958  11.280  1.00 1.80   ? 114 LEU A HB2  1  
ATOM 1647  H HB3  . LEU A 1 114 ? 9.129   -0.596  12.959  1.00 1.76   ? 114 LEU A HB3  1  
ATOM 1648  H HG   . LEU A 1 114 ? 7.983   1.680   12.506  1.00 2.16   ? 114 LEU A HG   1  
ATOM 1649  H HD11 . LEU A 1 114 ? 6.948   0.150   10.078  1.00 3.02   ? 114 LEU A HD11 1  
ATOM 1650  H HD12 . LEU A 1 114 ? 6.335   1.712   10.659  1.00 3.32   ? 114 LEU A HD12 1  
ATOM 1651  H HD13 . LEU A 1 114 ? 7.981   1.580   10.032  1.00 3.14   ? 114 LEU A HD13 1  
ATOM 1652  H HD21 . LEU A 1 114 ? 6.370   -0.905  12.411  1.00 3.32   ? 114 LEU A HD21 1  
ATOM 1653  H HD22 . LEU A 1 114 ? 6.938   -0.063  13.866  1.00 3.16   ? 114 LEU A HD22 1  
ATOM 1654  H HD23 . LEU A 1 114 ? 5.714   0.692   12.835  1.00 3.61   ? 114 LEU A HD23 1  
ATOM 1655  N N    . LYS A 1 115 ? 10.400  2.039   13.559  1.00 1.21   ? 115 LYS A N    1  
ATOM 1656  C CA   . LYS A 1 115 ? 11.065  2.887   14.573  1.00 1.56   ? 115 LYS A CA   1  
ATOM 1657  C C    . LYS A 1 115 ? 10.126  3.510   15.627  1.00 1.78   ? 115 LYS A C    1  
ATOM 1658  O O    . LYS A 1 115 ? 10.488  3.567   16.800  1.00 2.37   ? 115 LYS A O    1  
ATOM 1659  C CB   . LYS A 1 115 ? 11.902  3.973   13.861  1.00 1.79   ? 115 LYS A CB   1  
ATOM 1660  C CG   . LYS A 1 115 ? 11.116  4.719   12.772  1.00 2.27   ? 115 LYS A CG   1  
ATOM 1661  C CD   . LYS A 1 115 ? 11.999  5.632   11.926  1.00 2.66   ? 115 LYS A CD   1  
ATOM 1662  C CE   . LYS A 1 115 ? 11.104  6.096   10.773  1.00 3.46   ? 115 LYS A CE   1  
ATOM 1663  N NZ   . LYS A 1 115 ? 11.636  7.286   10.068  1.00 4.36   ? 115 LYS A NZ   1  
ATOM 1664  H H    . LYS A 1 115 ? 9.459   2.258   13.287  1.00 1.49   ? 115 LYS A H    1  
ATOM 1665  H HA   . LYS A 1 115 ? 11.763  2.262   15.138  1.00 1.89   ? 115 LYS A HA   1  
ATOM 1666  H HB2  . LYS A 1 115 ? 12.274  4.688   14.598  1.00 2.45   ? 115 LYS A HB2  1  
ATOM 1667  H HB3  . LYS A 1 115 ? 12.768  3.494   13.403  1.00 2.05   ? 115 LYS A HB3  1  
ATOM 1668  H HG2  . LYS A 1 115 ? 10.666  4.007   12.085  1.00 2.36   ? 115 LYS A HG2  1  
ATOM 1669  H HG3  . LYS A 1 115 ? 10.324  5.313   13.232  1.00 3.00   ? 115 LYS A HG3  1  
ATOM 1670  H HD2  . LYS A 1 115 ? 12.341  6.468   12.533  1.00 3.24   ? 115 LYS A HD2  1  
ATOM 1671  H HD3  . LYS A 1 115 ? 12.869  5.088   11.545  1.00 2.74   ? 115 LYS A HD3  1  
ATOM 1672  H HE2  . LYS A 1 115 ? 11.013  5.260   10.081  1.00 3.54   ? 115 LYS A HE2  1  
ATOM 1673  H HE3  . LYS A 1 115 ? 10.109  6.306   11.188  1.00 3.88   ? 115 LYS A HE3  1  
ATOM 1674  H HZ1  . LYS A 1 115 ? 11.538  8.077   10.692  1.00 5.20   ? 115 LYS A HZ1  1  
ATOM 1675  H HZ2  . LYS A 1 115 ? 12.623  7.196   9.852   1.00 4.15   ? 115 LYS A HZ2  1  
ATOM 1676  H HZ3  . LYS A 1 115 ? 11.096  7.493   9.233   1.00 5.05   ? 115 LYS A HZ3  1  
ATOM 1677  N N    . ARG A 1 116 ? 8.906   3.919   15.252  1.00 1.58   ? 116 ARG A N    1  
ATOM 1678  C CA   . ARG A 1 116 ? 7.864   4.330   16.217  1.00 1.83   ? 116 ARG A CA   1  
ATOM 1679  C C    . ARG A 1 116 ? 7.195   3.094   16.843  1.00 1.61   ? 116 ARG A C    1  
ATOM 1680  O O    . ARG A 1 116 ? 6.838   2.187   16.086  1.00 1.56   ? 116 ARG A O    1  
ATOM 1681  C CB   . ARG A 1 116 ? 6.767   5.178   15.545  1.00 2.25   ? 116 ARG A CB   1  
ATOM 1682  C CG   . ARG A 1 116 ? 7.168   6.638   15.298  1.00 3.22   ? 116 ARG A CG   1  
ATOM 1683  C CD   . ARG A 1 116 ? 7.206   7.503   16.576  1.00 3.12   ? 116 ARG A CD   1  
ATOM 1684  N NE   . ARG A 1 116 ? 8.557   8.021   16.876  1.00 3.62   ? 116 ARG A NE   1  
ATOM 1685  C CZ   . ARG A 1 116 ? 9.309   8.776   16.088  1.00 4.80   ? 116 ARG A CZ   1  
ATOM 1686  N NH1  . ARG A 1 116 ? 8.906   9.219   14.918  1.00 5.65   ? 116 ARG A NH1  1  
ATOM 1687  N NH2  . ARG A 1 116 ? 10.529  9.032   16.476  1.00 5.80   ? 116 ARG A NH2  1  
ATOM 1688  H H    . ARG A 1 116 ? 8.656   3.851   14.277  1.00 1.49   ? 116 ARG A H    1  
ATOM 1689  H HA   . ARG A 1 116 ? 8.333   4.925   16.999  1.00 2.53   ? 116 ARG A HA   1  
ATOM 1690  H HB2  . ARG A 1 116 ? 6.501   4.715   14.591  1.00 2.79   ? 116 ARG A HB2  1  
ATOM 1691  H HB3  . ARG A 1 116 ? 5.874   5.176   16.174  1.00 2.78   ? 116 ARG A HB3  1  
ATOM 1692  H HG2  . ARG A 1 116 ? 8.128   6.651   14.780  1.00 4.07   ? 116 ARG A HG2  1  
ATOM 1693  H HG3  . ARG A 1 116 ? 6.428   7.074   14.626  1.00 4.35   ? 116 ARG A HG3  1  
ATOM 1694  H HD2  . ARG A 1 116 ? 6.520   8.345   16.454  1.00 3.78   ? 116 ARG A HD2  1  
ATOM 1695  H HD3  . ARG A 1 116 ? 6.849   6.921   17.430  1.00 3.21   ? 116 ARG A HD3  1  
ATOM 1696  H HE   . ARG A 1 116 ? 8.959   7.791   17.779  1.00 3.86   ? 116 ARG A HE   1  
ATOM 1697  H HH11 . ARG A 1 116 ? 7.964   9.078   14.624  1.00 5.39   ? 116 ARG A HH11 1  
ATOM 1698  H HH12 . ARG A 1 116 ? 9.582   9.610   14.261  1.00 6.97   ? 116 ARG A HH12 1  
ATOM 1699  H HH21 . ARG A 1 116 ? 10.827  8.704   17.395  1.00 5.71   ? 116 ARG A HH21 1  
ATOM 1700  H HH22 . ARG A 1 116 ? 11.144  9.575   15.896  1.00 6.95   ? 116 ARG A HH22 1  
ATOM 1701  N N    . PRO A 1 117 ? 6.945   3.062   18.168  1.00 2.25   ? 117 PRO A N    1  
ATOM 1702  C CA   . PRO A 1 117 ? 6.034   2.105   18.786  1.00 2.62   ? 117 PRO A CA   1  
ATOM 1703  C C    . PRO A 1 117 ? 4.591   2.589   18.577  1.00 2.27   ? 117 PRO A C    1  
ATOM 1704  O O    . PRO A 1 117 ? 4.173   3.594   19.152  1.00 2.50   ? 117 PRO A O    1  
ATOM 1705  C CB   . PRO A 1 117 ? 6.443   2.065   20.263  1.00 3.57   ? 117 PRO A CB   1  
ATOM 1706  C CG   . PRO A 1 117 ? 6.974   3.476   20.534  1.00 3.70   ? 117 PRO A CG   1  
ATOM 1707  C CD   . PRO A 1 117 ? 7.535   3.931   19.183  1.00 3.05   ? 117 PRO A CD   1  
ATOM 1708  H HA   . PRO A 1 117 ? 6.158   1.113   18.348  1.00 2.75   ? 117 PRO A HA   1  
ATOM 1709  H HB2  . PRO A 1 117 ? 5.603   1.808   20.912  1.00 3.89   ? 117 PRO A HB2  1  
ATOM 1710  H HB3  . PRO A 1 117 ? 7.251   1.341   20.389  1.00 3.95   ? 117 PRO A HB3  1  
ATOM 1711  H HG2  . PRO A 1 117 ? 6.152   4.126   20.834  1.00 3.70   ? 117 PRO A HG2  1  
ATOM 1712  H HG3  . PRO A 1 117 ? 7.742   3.466   21.307  1.00 4.37   ? 117 PRO A HG3  1  
ATOM 1713  H HD2  . PRO A 1 117 ? 7.269   4.973   19.011  1.00 3.09   ? 117 PRO A HD2  1  
ATOM 1714  H HD3  . PRO A 1 117 ? 8.619   3.812   19.185  1.00 3.40   ? 117 PRO A HD3  1  
ATOM 1715  N N    . LEU A 1 118 ? 3.825   1.884   17.740  1.00 1.95   ? 118 LEU A N    1  
ATOM 1716  C CA   . LEU A 1 118 ? 2.465   2.287   17.364  1.00 1.71   ? 118 LEU A CA   1  
ATOM 1717  C C    . LEU A 1 118 ? 1.401   1.661   18.279  1.00 2.11   ? 118 LEU A C    1  
ATOM 1718  O O    . LEU A 1 118 ? 1.623   0.620   18.903  1.00 2.80   ? 118 LEU A O    1  
ATOM 1719  C CB   . LEU A 1 118 ? 2.207   1.944   15.880  1.00 1.69   ? 118 LEU A CB   1  
ATOM 1720  C CG   . LEU A 1 118 ? 3.214   2.537   14.870  1.00 1.59   ? 118 LEU A CG   1  
ATOM 1721  C CD1  . LEU A 1 118 ? 2.911   2.012   13.460  1.00 2.05   ? 118 LEU A CD1  1  
ATOM 1722  C CD2  . LEU A 1 118 ? 3.193   4.073   14.867  1.00 2.08   ? 118 LEU A CD2  1  
ATOM 1723  H H    . LEU A 1 118 ? 4.198   1.051   17.308  1.00 2.07   ? 118 LEU A H    1  
ATOM 1724  H HA   . LEU A 1 118 ? 2.376   3.366   17.483  1.00 1.55   ? 118 LEU A HA   1  
ATOM 1725  H HB2  . LEU A 1 118 ? 2.184   0.860   15.765  1.00 2.27   ? 118 LEU A HB2  1  
ATOM 1726  H HB3  . LEU A 1 118 ? 1.215   2.312   15.626  1.00 1.78   ? 118 LEU A HB3  1  
ATOM 1727  H HG   . LEU A 1 118 ? 4.220   2.207   15.130  1.00 1.76   ? 118 LEU A HG   1  
ATOM 1728  H HD11 . LEU A 1 118 ? 2.959   0.922   13.452  1.00 3.02   ? 118 LEU A HD11 1  
ATOM 1729  H HD12 . LEU A 1 118 ? 1.917   2.328   13.148  1.00 2.57   ? 118 LEU A HD12 1  
ATOM 1730  H HD13 . LEU A 1 118 ? 3.644   2.400   12.753  1.00 2.48   ? 118 LEU A HD13 1  
ATOM 1731  H HD21 . LEU A 1 118 ? 3.880   4.453   14.111  1.00 2.34   ? 118 LEU A HD21 1  
ATOM 1732  H HD22 . LEU A 1 118 ? 2.187   4.433   14.648  1.00 2.55   ? 118 LEU A HD22 1  
ATOM 1733  H HD23 . LEU A 1 118 ? 3.502   4.455   15.840  1.00 3.07   ? 118 LEU A HD23 1  
ATOM 1734  N N    . LYS A 1 119 ? 0.209   2.264   18.322  1.00 1.74   ? 119 LYS A N    1  
ATOM 1735  C CA   . LYS A 1 119 ? -0.989  1.648   18.904  1.00 1.75   ? 119 LYS A CA   1  
ATOM 1736  C C    . LYS A 1 119 ? -1.867  1.025   17.815  1.00 1.58   ? 119 LYS A C    1  
ATOM 1737  O O    . LYS A 1 119 ? -1.930  1.539   16.698  1.00 1.48   ? 119 LYS A O    1  
ATOM 1738  C CB   . LYS A 1 119 ? -1.762  2.593   19.863  1.00 1.74   ? 119 LYS A CB   1  
ATOM 1739  C CG   . LYS A 1 119 ? -2.725  3.629   19.248  1.00 2.41   ? 119 LYS A CG   1  
ATOM 1740  C CD   . LYS A 1 119 ? -3.907  3.936   20.185  1.00 3.26   ? 119 LYS A CD   1  
ATOM 1741  C CE   . LYS A 1 119 ? -4.862  4.962   19.555  1.00 4.87   ? 119 LYS A CE   1  
ATOM 1742  N NZ   . LYS A 1 119 ? -6.207  4.942   20.183  1.00 6.16   ? 119 LYS A NZ   1  
ATOM 1743  H H    . LYS A 1 119 ? 0.112   3.111   17.781  1.00 1.38   ? 119 LYS A H    1  
ATOM 1744  H HA   . LYS A 1 119 ? -0.646  0.824   19.523  1.00 2.28   ? 119 LYS A HA   1  
ATOM 1745  H HB2  . LYS A 1 119 ? -2.346  1.952   20.520  1.00 2.21   ? 119 LYS A HB2  1  
ATOM 1746  H HB3  . LYS A 1 119 ? -1.045  3.113   20.500  1.00 2.55   ? 119 LYS A HB3  1  
ATOM 1747  H HG2  . LYS A 1 119 ? -2.174  4.546   19.038  1.00 3.20   ? 119 LYS A HG2  1  
ATOM 1748  H HG3  . LYS A 1 119 ? -3.141  3.246   18.318  1.00 3.00   ? 119 LYS A HG3  1  
ATOM 1749  H HD2  . LYS A 1 119 ? -4.452  3.007   20.369  1.00 3.74   ? 119 LYS A HD2  1  
ATOM 1750  H HD3  . LYS A 1 119 ? -3.534  4.319   21.137  1.00 3.20   ? 119 LYS A HD3  1  
ATOM 1751  H HE2  . LYS A 1 119 ? -4.425  5.961   19.644  1.00 5.17   ? 119 LYS A HE2  1  
ATOM 1752  H HE3  . LYS A 1 119 ? -4.974  4.738   18.490  1.00 5.35   ? 119 LYS A HE3  1  
ATOM 1753  H HZ1  . LYS A 1 119 ? -6.658  4.037   20.054  1.00 6.44   ? 119 LYS A HZ1  1  
ATOM 1754  H HZ2  . LYS A 1 119 ? -6.196  5.177   21.170  1.00 6.42   ? 119 LYS A HZ2  1  
ATOM 1755  H HZ3  . LYS A 1 119 ? -6.824  5.596   19.711  1.00 7.11   ? 119 LYS A HZ3  1  
ATOM 1756  N N    . VAL A 1 120 ? -2.599  -0.033  18.169  1.00 1.94   ? 120 VAL A N    1  
ATOM 1757  C CA   . VAL A 1 120 ? -3.535  -0.811  17.335  1.00 2.27   ? 120 VAL A CA   1  
ATOM 1758  C C    . VAL A 1 120 ? -4.282  -0.016  16.252  1.00 2.28   ? 120 VAL A C    1  
ATOM 1759  O O    . VAL A 1 120 ? -4.359  -0.505  15.135  1.00 3.07   ? 120 VAL A O    1  
ATOM 1760  C CB   . VAL A 1 120 ? -4.530  -1.588  18.235  1.00 2.33   ? 120 VAL A CB   1  
ATOM 1761  C CG1  . VAL A 1 120 ? -5.337  -0.699  19.200  1.00 2.38   ? 120 VAL A CG1  1  
ATOM 1762  C CG2  . VAL A 1 120 ? -5.500  -2.453  17.414  1.00 2.65   ? 120 VAL A CG2  1  
ATOM 1763  H H    . VAL A 1 120 ? -2.461  -0.369  19.121  1.00 2.17   ? 120 VAL A H    1  
ATOM 1764  H HA   . VAL A 1 120 ? -2.928  -1.554  16.821  1.00 2.79   ? 120 VAL A HA   1  
ATOM 1765  H HB   . VAL A 1 120 ? -3.931  -2.268  18.845  1.00 3.11   ? 120 VAL A HB   1  
ATOM 1766  H HG11 . VAL A 1 120 ? -5.926  -1.329  19.867  1.00 3.06   ? 120 VAL A HG11 1  
ATOM 1767  H HG12 . VAL A 1 120 ? -4.673  -0.086  19.810  1.00 3.39   ? 120 VAL A HG12 1  
ATOM 1768  H HG13 . VAL A 1 120 ? -6.014  -0.049  18.649  1.00 2.25   ? 120 VAL A HG13 1  
ATOM 1769  H HG21 . VAL A 1 120 ? -6.202  -1.830  16.858  1.00 2.68   ? 120 VAL A HG21 1  
ATOM 1770  H HG22 . VAL A 1 120 ? -4.938  -3.067  16.714  1.00 3.39   ? 120 VAL A HG22 1  
ATOM 1771  H HG23 . VAL A 1 120 ? -6.068  -3.099  18.084  1.00 3.39   ? 120 VAL A HG23 1  
ATOM 1772  N N    . GLY A 1 121 ? -4.796  1.175   16.579  1.00 1.84   ? 121 GLY A N    1  
ATOM 1773  C CA   . GLY A 1 121 ? -5.580  2.101   15.757  1.00 2.08   ? 121 GLY A CA   1  
ATOM 1774  C C    . GLY A 1 121 ? -4.999  3.517   15.695  1.00 1.84   ? 121 GLY A C    1  
ATOM 1775  O O    . GLY A 1 121 ? -5.747  4.484   15.765  1.00 1.98   ? 121 GLY A O    1  
ATOM 1776  H H    . GLY A 1 121 ? -4.668  1.453   17.524  1.00 1.67   ? 121 GLY A H    1  
ATOM 1777  H HA2  . GLY A 1 121 ? -5.680  1.724   14.747  1.00 2.54   ? 121 GLY A HA2  1  
ATOM 1778  H HA3  . GLY A 1 121 ? -6.578  2.193   16.190  1.00 2.22   ? 121 GLY A HA3  1  
ATOM 1779  N N    . GLU A 1 122 ? -3.674  3.675   15.626  1.00 1.63   ? 122 GLU A N    1  
ATOM 1780  C CA   . GLU A 1 122 ? -3.019  4.992   15.521  1.00 1.41   ? 122 GLU A CA   1  
ATOM 1781  C C    . GLU A 1 122 ? -3.176  5.608   14.116  1.00 1.26   ? 122 GLU A C    1  
ATOM 1782  O O    . GLU A 1 122 ? -3.419  4.889   13.149  1.00 1.25   ? 122 GLU A O    1  
ATOM 1783  C CB   . GLU A 1 122 ? -1.543  4.847   15.927  1.00 1.30   ? 122 GLU A CB   1  
ATOM 1784  C CG   . GLU A 1 122 ? -0.818  6.185   16.108  1.00 1.18   ? 122 GLU A CG   1  
ATOM 1785  C CD   . GLU A 1 122 ? 0.531   6.068   16.814  1.00 1.45   ? 122 GLU A CD   1  
ATOM 1786  O OE1  . GLU A 1 122 ? 0.766   5.039   17.498  1.00 2.19   ? 122 GLU A OE1  1  
ATOM 1787  O OE2  . GLU A 1 122 ? 1.322   7.023   16.703  1.00 2.21   ? 122 GLU A OE2  1  
ATOM 1788  H H    . GLU A 1 122 ? -3.083  2.850   15.646  1.00 1.68   ? 122 GLU A H    1  
ATOM 1789  H HA   . GLU A 1 122 ? -3.500  5.665   16.234  1.00 1.70   ? 122 GLU A HA   1  
ATOM 1790  H HB2  . GLU A 1 122 ? -1.515  4.301   16.865  1.00 1.63   ? 122 GLU A HB2  1  
ATOM 1791  H HB3  . GLU A 1 122 ? -1.010  4.258   15.187  1.00 1.30   ? 122 GLU A HB3  1  
ATOM 1792  H HG2  . GLU A 1 122 ? -0.642  6.623   15.126  1.00 1.23   ? 122 GLU A HG2  1  
ATOM 1793  H HG3  . GLU A 1 122 ? -1.449  6.867   16.679  1.00 1.46   ? 122 GLU A HG3  1  
ATOM 1794  N N    . THR A 1 123 ? -3.013  6.931   13.979  1.00 1.40   ? 123 THR A N    1  
ATOM 1795  C CA   . THR A 1 123 ? -2.920  7.638   12.689  1.00 1.56   ? 123 THR A CA   1  
ATOM 1796  C C    . THR A 1 123 ? -1.452  7.816   12.294  1.00 1.28   ? 123 THR A C    1  
ATOM 1797  O O    . THR A 1 123 ? -0.641  8.206   13.125  1.00 1.36   ? 123 THR A O    1  
ATOM 1798  C CB   . THR A 1 123 ? -3.705  8.955   12.746  1.00 2.16   ? 123 THR A CB   1  
ATOM 1799  O OG1  . THR A 1 123 ? -3.650  9.555   11.480  1.00 2.70   ? 123 THR A OG1  1  
ATOM 1800  C CG2  . THR A 1 123 ? -3.220  9.975   13.782  1.00 3.30   ? 123 THR A CG2  1  
ATOM 1801  H H    . THR A 1 123 ? -2.755  7.462   14.796  1.00 1.47   ? 123 THR A H    1  
ATOM 1802  H HA   . THR A 1 123 ? -3.402  7.025   11.928  1.00 1.70   ? 123 THR A HA   1  
ATOM 1803  H HB   . THR A 1 123 ? -4.750  8.721   12.965  1.00 3.20   ? 123 THR A HB   1  
ATOM 1804  H HG1  . THR A 1 123 ? -2.754  9.877   11.345  1.00 3.18   ? 123 THR A HG1  1  
ATOM 1805  H HG21 . THR A 1 123 ? -2.181  10.255  13.596  1.00 3.76   ? 123 THR A HG21 1  
ATOM 1806  H HG22 . THR A 1 123 ? -3.842  10.870  13.722  1.00 3.67   ? 123 THR A HG22 1  
ATOM 1807  H HG23 . THR A 1 123 ? -3.308  9.560   14.786  1.00 4.56   ? 123 THR A HG23 1  
ATOM 1808  N N    . VAL A 1 124 ? -1.115  7.518   11.039  1.00 1.09   ? 124 VAL A N    1  
ATOM 1809  C CA   . VAL A 1 124 ? 0.251   7.411   10.504  1.00 0.97   ? 124 VAL A CA   1  
ATOM 1810  C C    . VAL A 1 124 ? 0.321   7.970   9.076   1.00 0.92   ? 124 VAL A C    1  
ATOM 1811  O O    . VAL A 1 124 ? -0.700  8.129   8.417   1.00 1.06   ? 124 VAL A O    1  
ATOM 1812  C CB   . VAL A 1 124 ? 0.735   5.945   10.526  1.00 1.21   ? 124 VAL A CB   1  
ATOM 1813  C CG1  . VAL A 1 124 ? 1.066   5.471   11.949  1.00 3.02   ? 124 VAL A CG1  1  
ATOM 1814  C CG2  . VAL A 1 124 ? -0.233  4.956   9.858   1.00 2.42   ? 124 VAL A CG2  1  
ATOM 1815  H H    . VAL A 1 124 ? -1.859  7.221   10.407  1.00 1.13   ? 124 VAL A H    1  
ATOM 1816  H HA   . VAL A 1 124 ? 0.924   8.012   11.120  1.00 1.02   ? 124 VAL A HA   1  
ATOM 1817  H HB   . VAL A 1 124 ? 1.654   5.930   9.956   1.00 1.86   ? 124 VAL A HB   1  
ATOM 1818  H HG11 . VAL A 1 124 ? 1.515   4.479   11.909  1.00 3.42   ? 124 VAL A HG11 1  
ATOM 1819  H HG12 . VAL A 1 124 ? 1.776   6.156   12.413  1.00 4.09   ? 124 VAL A HG12 1  
ATOM 1820  H HG13 . VAL A 1 124 ? 0.162   5.424   12.556  1.00 4.02   ? 124 VAL A HG13 1  
ATOM 1821  H HG21 . VAL A 1 124 ? -1.160  4.878   10.427  1.00 3.57   ? 124 VAL A HG21 1  
ATOM 1822  H HG22 . VAL A 1 124 ? -0.457  5.274   8.842   1.00 3.12   ? 124 VAL A HG22 1  
ATOM 1823  H HG23 . VAL A 1 124 ? 0.234   3.973   9.813   1.00 3.01   ? 124 VAL A HG23 1  
ATOM 1824  N N    . ASN A 1 125 ? 1.526   8.301   8.589   1.00 0.94   ? 125 ASN A N    1  
ATOM 1825  C CA   . ASN A 1 125 ? 1.715   8.957   7.283   1.00 1.10   ? 125 ASN A CA   1  
ATOM 1826  C C    . ASN A 1 125 ? 2.004   7.958   6.134   1.00 1.17   ? 125 ASN A C    1  
ATOM 1827  O O    . ASN A 1 125 ? 2.946   7.152   6.198   1.00 1.20   ? 125 ASN A O    1  
ATOM 1828  C CB   . ASN A 1 125 ? 2.817   10.027  7.376   1.00 1.26   ? 125 ASN A CB   1  
ATOM 1829  C CG   . ASN A 1 125 ? 2.272   11.384  7.829   1.00 1.84   ? 125 ASN A CG   1  
ATOM 1830  O OD1  . ASN A 1 125 ? 2.362   12.374  7.106   1.00 3.14   ? 125 ASN A OD1  1  
ATOM 1831  N ND2  . ASN A 1 125 ? 1.660   11.478  9.007   1.00 1.66   ? 125 ASN A ND2  1  
ATOM 1832  H H    . ASN A 1 125 ? 2.349   8.078   9.134   1.00 0.96   ? 125 ASN A H    1  
ATOM 1833  H HA   . ASN A 1 125 ? 0.797   9.478   7.017   1.00 1.19   ? 125 ASN A HA   1  
ATOM 1834  H HB2  . ASN A 1 125 ? 3.605   9.707   8.051   1.00 1.23   ? 125 ASN A HB2  1  
ATOM 1835  H HB3  . ASN A 1 125 ? 3.259   10.168  6.391   1.00 1.46   ? 125 ASN A HB3  1  
ATOM 1836  H HD21 . ASN A 1 125 ? 1.550   10.655  9.577   1.00 2.01   ? 125 ASN A HD21 1  
ATOM 1837  H HD22 . ASN A 1 125 ? 1.272   12.364  9.270   1.00 2.05   ? 125 ASN A HD22 1  
ATOM 1838  N N    . ILE A 1 126 ? 1.212   8.067   5.059   1.00 1.30   ? 126 ILE A N    1  
ATOM 1839  C CA   . ILE A 1 126 ? 1.427   7.421   3.759   1.00 1.23   ? 126 ILE A CA   1  
ATOM 1840  C C    . ILE A 1 126 ? 1.748   8.486   2.702   1.00 1.15   ? 126 ILE A C    1  
ATOM 1841  O O    . ILE A 1 126 ? 1.159   9.573   2.678   1.00 1.27   ? 126 ILE A O    1  
ATOM 1842  C CB   . ILE A 1 126 ? 0.191   6.565   3.385   1.00 1.28   ? 126 ILE A CB   1  
ATOM 1843  C CG1  . ILE A 1 126 ? 0.163   5.225   4.159   1.00 1.77   ? 126 ILE A CG1  1  
ATOM 1844  C CG2  . ILE A 1 126 ? 0.049   6.318   1.872   1.00 1.62   ? 126 ILE A CG2  1  
ATOM 1845  C CD1  . ILE A 1 126 ? 1.259   4.209   3.805   1.00 2.07   ? 126 ILE A CD1  1  
ATOM 1846  H H    . ILE A 1 126 ? 0.469   8.762   5.092   1.00 1.42   ? 126 ILE A H    1  
ATOM 1847  H HA   . ILE A 1 126 ? 2.300   6.774   3.813   1.00 1.28   ? 126 ILE A HA   1  
ATOM 1848  H HB   . ILE A 1 126 ? -0.695  7.127   3.681   1.00 1.88   ? 126 ILE A HB   1  
ATOM 1849  H HG12 . ILE A 1 126 ? 0.238   5.438   5.227   1.00 2.73   ? 126 ILE A HG12 1  
ATOM 1850  H HG13 . ILE A 1 126 ? -0.797  4.744   3.960   1.00 2.23   ? 126 ILE A HG13 1  
ATOM 1851  H HG21 . ILE A 1 126 ? -0.768  5.619   1.690   1.00 2.37   ? 126 ILE A HG21 1  
ATOM 1852  H HG22 . ILE A 1 126 ? -0.187  7.248   1.353   1.00 2.19   ? 126 ILE A HG22 1  
ATOM 1853  H HG23 . ILE A 1 126 ? 0.974   5.909   1.472   1.00 2.29   ? 126 ILE A HG23 1  
ATOM 1854  H HD11 . ILE A 1 126 ? 2.241   4.602   4.055   1.00 2.60   ? 126 ILE A HD11 1  
ATOM 1855  H HD12 . ILE A 1 126 ? 1.099   3.305   4.388   1.00 3.11   ? 126 ILE A HD12 1  
ATOM 1856  H HD13 . ILE A 1 126 ? 1.227   3.945   2.749   1.00 2.34   ? 126 ILE A HD13 1  
ATOM 1857  N N    . THR A 1 127 ? 2.650   8.131   1.789   1.00 1.06   ? 127 THR A N    1  
ATOM 1858  C CA   . THR A 1 127 ? 3.096   8.950   0.666   1.00 1.05   ? 127 THR A CA   1  
ATOM 1859  C C    . THR A 1 127 ? 2.884   8.111   -0.597  1.00 0.84   ? 127 THR A C    1  
ATOM 1860  O O    . THR A 1 127 ? 3.563   7.103   -0.770  1.00 0.93   ? 127 THR A O    1  
ATOM 1861  C CB   . THR A 1 127 ? 4.566   9.327   0.874   1.00 1.22   ? 127 THR A CB   1  
ATOM 1862  O OG1  . THR A 1 127 ? 4.742   9.882   2.157   1.00 1.84   ? 127 THR A OG1  1  
ATOM 1863  C CG2  . THR A 1 127 ? 5.009   10.359  -0.153  1.00 1.48   ? 127 THR A CG2  1  
ATOM 1864  H H    . THR A 1 127 ? 3.043   7.201   1.848   1.00 1.05   ? 127 THR A H    1  
ATOM 1865  H HA   . THR A 1 127 ? 2.524   9.877   0.596   1.00 1.17   ? 127 THR A HA   1  
ATOM 1866  H HB   . THR A 1 127 ? 5.189   8.437   0.785   1.00 1.33   ? 127 THR A HB   1  
ATOM 1867  H HG1  . THR A 1 127 ? 5.239   10.700  2.060   1.00 2.37   ? 127 THR A HG1  1  
ATOM 1868  H HG21 . THR A 1 127 ? 6.048   10.641  0.023   1.00 1.87   ? 127 THR A HG21 1  
ATOM 1869  H HG22 . THR A 1 127 ? 4.926   9.922   -1.149  1.00 1.97   ? 127 THR A HG22 1  
ATOM 1870  H HG23 . THR A 1 127 ? 4.373   11.241  -0.088  1.00 2.42   ? 127 THR A HG23 1  
ATOM 1871  N N    . LEU A 1 128 ? 1.899   8.472   -1.432  1.00 0.88   ? 128 LEU A N    1  
ATOM 1872  C CA   . LEU A 1 128 ? 1.688   7.893   -2.763  1.00 0.81   ? 128 LEU A CA   1  
ATOM 1873  C C    . LEU A 1 128 ? 2.355   8.742   -3.841  1.00 0.95   ? 128 LEU A C    1  
ATOM 1874  O O    . LEU A 1 128 ? 2.800   9.842   -3.547  1.00 1.65   ? 128 LEU A O    1  
ATOM 1875  C CB   . LEU A 1 128 ? 0.207   7.575   -3.043  1.00 1.15   ? 128 LEU A CB   1  
ATOM 1876  C CG   . LEU A 1 128 ? -0.801  8.742   -3.154  1.00 1.87   ? 128 LEU A CG   1  
ATOM 1877  C CD1  . LEU A 1 128 ? -0.703  9.431   -4.528  1.00 3.62   ? 128 LEU A CD1  1  
ATOM 1878  C CD2  . LEU A 1 128 ? -2.221  8.172   -3.011  1.00 2.35   ? 128 LEU A CD2  1  
ATOM 1879  H H    . LEU A 1 128 ? 1.396   9.331   -1.218  1.00 1.08   ? 128 LEU A H    1  
ATOM 1880  H HA   . LEU A 1 128 ? 2.225   6.949   -2.796  1.00 0.80   ? 128 LEU A HA   1  
ATOM 1881  H HB2  . LEU A 1 128 ? 0.144   6.990   -3.958  1.00 2.32   ? 128 LEU A HB2  1  
ATOM 1882  H HB3  . LEU A 1 128 ? -0.125  6.910   -2.255  1.00 1.90   ? 128 LEU A HB3  1  
ATOM 1883  H HG   . LEU A 1 128 ? -0.622  9.460   -2.347  1.00 2.61   ? 128 LEU A HG   1  
ATOM 1884  H HD11 . LEU A 1 128 ? 0.226   9.987   -4.613  1.00 4.69   ? 128 LEU A HD11 1  
ATOM 1885  H HD12 . LEU A 1 128 ? -0.748  8.698   -5.334  1.00 4.29   ? 128 LEU A HD12 1  
ATOM 1886  H HD13 . LEU A 1 128 ? -1.523  10.137  -4.644  1.00 4.29   ? 128 LEU A HD13 1  
ATOM 1887  H HD21 . LEU A 1 128 ? -2.949  8.976   -3.095  1.00 3.28   ? 128 LEU A HD21 1  
ATOM 1888  H HD22 . LEU A 1 128 ? -2.425  7.425   -3.783  1.00 3.10   ? 128 LEU A HD22 1  
ATOM 1889  H HD23 . LEU A 1 128 ? -2.338  7.715   -2.030  1.00 2.50   ? 128 LEU A HD23 1  
ATOM 1890  N N    . LYS A 1 129 ? 2.477   8.223   -5.063  1.00 1.10   ? 129 LYS A N    1  
ATOM 1891  C CA   . LYS A 1 129 ? 3.187   8.901   -6.167  1.00 1.19   ? 129 LYS A CA   1  
ATOM 1892  C C    . LYS A 1 129 ? 2.533   8.571   -7.510  1.00 1.10   ? 129 LYS A C    1  
ATOM 1893  O O    . LYS A 1 129 ? 2.052   7.450   -7.717  1.00 1.22   ? 129 LYS A O    1  
ATOM 1894  C CB   . LYS A 1 129 ? 4.686   8.498   -6.233  1.00 1.58   ? 129 LYS A CB   1  
ATOM 1895  C CG   . LYS A 1 129 ? 5.506   8.818   -4.956  1.00 2.63   ? 129 LYS A CG   1  
ATOM 1896  C CD   . LYS A 1 129 ? 6.896   8.176   -4.990  1.00 3.44   ? 129 LYS A CD   1  
ATOM 1897  C CE   . LYS A 1 129 ? 7.838   8.642   -6.101  1.00 2.91   ? 129 LYS A CE   1  
ATOM 1898  N NZ   . LYS A 1 129 ? 8.288   10.035  -5.879  1.00 3.20   ? 129 LYS A NZ   1  
ATOM 1899  H H    . LYS A 1 129 ? 2.125   7.269   -5.198  1.00 1.61   ? 129 LYS A H    1  
ATOM 1900  H HA   . LYS A 1 129 ? 3.115   9.984   -6.014  1.00 1.26   ? 129 LYS A HA   1  
ATOM 1901  H HB2  . LYS A 1 129 ? 4.650   7.403   -6.280  1.00 2.54   ? 129 LYS A HB2  1  
ATOM 1902  H HB3  . LYS A 1 129 ? 5.161   8.986   -7.124  1.00 1.42   ? 129 LYS A HB3  1  
ATOM 1903  H HG2  . LYS A 1 129 ? 5.646   9.885   -4.895  1.00 2.81   ? 129 LYS A HG2  1  
ATOM 1904  H HG3  . LYS A 1 129 ? 5.026   8.492   -4.020  1.00 3.55   ? 129 LYS A HG3  1  
ATOM 1905  H HD2  . LYS A 1 129 ? 7.385   8.299   -4.029  1.00 4.43   ? 129 LYS A HD2  1  
ATOM 1906  H HD3  . LYS A 1 129 ? 6.762   7.112   -5.080  1.00 4.52   ? 129 LYS A HD3  1  
ATOM 1907  H HE2  . LYS A 1 129 ? 8.704   7.966   -6.135  1.00 3.64   ? 129 LYS A HE2  1  
ATOM 1908  H HE3  . LYS A 1 129 ? 7.312   8.553   -7.052  1.00 2.97   ? 129 LYS A HE3  1  
ATOM 1909  H HZ1  . LYS A 1 129 ? 8.941   10.311  -6.593  1.00 3.31   ? 129 LYS A HZ1  1  
ATOM 1910  H HZ2  . LYS A 1 129 ? 7.524   10.699  -5.844  1.00 3.89   ? 129 LYS A HZ2  1  
ATOM 1911  H HZ3  . LYS A 1 129 ? 8.796   10.120  -4.998  1.00 3.81   ? 129 LYS A HZ3  1  
ATOM 1912  N N    . ALA A 1 130 ? 2.561   9.523   -8.443  1.00 1.35   ? 130 ALA A N    1  
ATOM 1913  C CA   . ALA A 1 130 ? 2.206   9.298   -9.836  1.00 1.46   ? 130 ALA A CA   1  
ATOM 1914  C C    . ALA A 1 130 ? 3.314   8.562   -10.610 1.00 1.82   ? 130 ALA A C    1  
ATOM 1915  O O    . ALA A 1 130 ? 4.477   8.673   -10.236 1.00 2.34   ? 130 ALA A O    1  
ATOM 1916  C CB   . ALA A 1 130 ? 1.826   10.637  -10.466 1.00 1.97   ? 130 ALA A CB   1  
ATOM 1917  H H    . ALA A 1 130 ? 2.915   10.431  -8.181  1.00 1.68   ? 130 ALA A H    1  
ATOM 1918  H HA   . ALA A 1 130 ? 1.335   8.671   -9.848  1.00 1.26   ? 130 ALA A HA   1  
ATOM 1919  H HB1  . ALA A 1 130 ? 1.127   11.176  -9.821  1.00 1.96   ? 130 ALA A HB1  1  
ATOM 1920  H HB2  . ALA A 1 130 ? 2.736   11.216  -10.608 1.00 2.88   ? 130 ALA A HB2  1  
ATOM 1921  H HB3  . ALA A 1 130 ? 1.350   10.468  -11.434 1.00 2.60   ? 130 ALA A HB3  1  
ATOM 1922  N N    . THR A 1 131 ? 2.958   7.840   -11.688 1.00 1.81   ? 131 THR A N    1  
ATOM 1923  C CA   . THR A 1 131 ? 3.924   7.293   -12.674 1.00 2.21   ? 131 THR A CA   1  
ATOM 1924  C C    . THR A 1 131 ? 4.495   8.371   -13.601 1.00 2.51   ? 131 THR A C    1  
ATOM 1925  O O    . THR A 1 131 ? 5.598   8.214   -14.112 1.00 3.05   ? 131 THR A O    1  
ATOM 1926  C CB   . THR A 1 131 ? 3.294   6.152   -13.486 1.00 2.39   ? 131 THR A CB   1  
ATOM 1927  O OG1  . THR A 1 131 ? 4.236   5.658   -14.401 1.00 2.92   ? 131 THR A OG1  1  
ATOM 1928  C CG2  . THR A 1 131 ? 2.066   6.558   -14.301 1.00 2.54   ? 131 THR A CG2  1  
ATOM 1929  H H    . THR A 1 131 ? 1.981   7.807   -11.941 1.00 1.56   ? 131 THR A H    1  
ATOM 1930  H HA   . THR A 1 131 ? 4.782   6.884   -12.136 1.00 2.35   ? 131 THR A HA   1  
ATOM 1931  H HB   . THR A 1 131 ? 3.014   5.349   -12.804 1.00 2.75   ? 131 THR A HB   1  
ATOM 1932  H HG1  . THR A 1 131 ? 4.864   6.370   -14.603 1.00 2.89   ? 131 THR A HG1  1  
ATOM 1933  H HG21 . THR A 1 131 ? 1.682   5.674   -14.813 1.00 3.47   ? 131 THR A HG21 1  
ATOM 1934  H HG22 . THR A 1 131 ? 1.290   6.957   -13.652 1.00 2.72   ? 131 THR A HG22 1  
ATOM 1935  H HG23 . THR A 1 131 ? 2.340   7.302   -15.052 1.00 2.86   ? 131 THR A HG23 1  
ATOM 1936  N N    . ASP A 1 132 ? 3.723   9.439   -13.789 1.00 2.36   ? 132 ASP A N    1  
ATOM 1937  C CA   . ASP A 1 132 ? 4.018   10.709  -14.435 1.00 2.67   ? 132 ASP A CA   1  
ATOM 1938  C C    . ASP A 1 132 ? 3.090   11.710  -13.723 1.00 2.81   ? 132 ASP A C    1  
ATOM 1939  O O    . ASP A 1 132 ? 1.875   11.494  -13.691 1.00 3.63   ? 132 ASP A O    1  
ATOM 1940  C CB   . ASP A 1 132 ? 3.676   10.662  -15.935 1.00 3.05   ? 132 ASP A CB   1  
ATOM 1941  C CG   . ASP A 1 132 ? 4.511   9.662   -16.739 1.00 4.04   ? 132 ASP A CG   1  
ATOM 1942  O OD1  . ASP A 1 132 ? 5.742   9.895   -16.866 1.00 4.71   ? 132 ASP A OD1  1  
ATOM 1943  O OD2  . ASP A 1 132 ? 3.881   8.736   -17.310 1.00 4.91   ? 132 ASP A OD2  1  
ATOM 1944  H H    . ASP A 1 132 ? 2.838   9.450   -13.319 1.00 2.08   ? 132 ASP A H    1  
ATOM 1945  H HA   . ASP A 1 132 ? 5.067   10.978  -14.295 1.00 2.77   ? 132 ASP A HA   1  
ATOM 1946  H HB2  . ASP A 1 132 ? 2.615   10.423  -16.057 1.00 2.88   ? 132 ASP A HB2  1  
ATOM 1947  H HB3  . ASP A 1 132 ? 3.833   11.658  -16.353 1.00 3.39   ? 132 ASP A HB3  1  
ATOM 1948  N N    . GLY A 1 133 ? 3.652   12.735  -13.077 1.00 2.75   ? 133 GLY A N    1  
ATOM 1949  C CA   . GLY A 1 133 ? 2.918   13.674  -12.216 1.00 3.03   ? 133 GLY A CA   1  
ATOM 1950  C C    . GLY A 1 133 ? 3.750   14.152  -11.023 1.00 3.01   ? 133 GLY A C    1  
ATOM 1951  O O    . GLY A 1 133 ? 4.669   14.953  -11.197 1.00 3.84   ? 133 GLY A O    1  
ATOM 1952  H H    . GLY A 1 133 ? 4.656   12.822  -13.129 1.00 3.03   ? 133 GLY A H    1  
ATOM 1953  H HA2  . GLY A 1 133 ? 2.657   14.555  -12.804 1.00 3.68   ? 133 GLY A HA2  1  
ATOM 1954  H HA3  . GLY A 1 133 ? 1.981   13.234  -11.870 1.00 3.09   ? 133 GLY A HA3  1  
ATOM 1955  N N    . ARG A 1 134 ? 3.419   13.705  -9.800  1.00 2.64   ? 134 ARG A N    1  
ATOM 1956  C CA   . ARG A 1 134 ? 4.041   14.140  -8.548  1.00 3.00   ? 134 ARG A CA   1  
ATOM 1957  C C    . ARG A 1 134 ? 3.748   13.170  -7.385  1.00 3.16   ? 134 ARG A C    1  
ATOM 1958  O O    . ARG A 1 134 ? 3.011   12.189  -7.541  1.00 4.08   ? 134 ARG A O    1  
ATOM 1959  C CB   . ARG A 1 134 ? 3.656   15.615  -8.252  1.00 3.43   ? 134 ARG A CB   1  
ATOM 1960  C CG   . ARG A 1 134 ? 4.889   16.522  -8.062  1.00 4.75   ? 134 ARG A CG   1  
ATOM 1961  C CD   . ARG A 1 134 ? 4.574   17.983  -8.428  1.00 5.54   ? 134 ARG A CD   1  
ATOM 1962  N NE   . ARG A 1 134 ? 5.734   18.877  -8.245  1.00 6.82   ? 134 ARG A NE   1  
ATOM 1963  C CZ   . ARG A 1 134 ? 6.864   18.887  -8.949  1.00 8.03   ? 134 ARG A CZ   1  
ATOM 1964  N NH1  . ARG A 1 134 ? 7.101   18.040  -9.927  1.00 8.48   ? 134 ARG A NH1  1  
ATOM 1965  N NH2  . ARG A 1 134 ? 7.815   19.743  -8.650  1.00 9.23   ? 134 ARG A NH2  1  
ATOM 1966  H H    . ARG A 1 134 ? 2.684   13.028  -9.697  1.00 2.57   ? 134 ARG A H    1  
ATOM 1967  H HA   . ARG A 1 134 ? 5.116   14.090  -8.698  1.00 3.37   ? 134 ARG A HA   1  
ATOM 1968  H HB2  . ARG A 1 134 ? 3.064   16.005  -9.081  1.00 3.42   ? 134 ARG A HB2  1  
ATOM 1969  H HB3  . ARG A 1 134 ? 3.020   15.673  -7.368  1.00 3.60   ? 134 ARG A HB3  1  
ATOM 1970  H HG2  . ARG A 1 134 ? 5.223   16.462  -7.023  1.00 5.25   ? 134 ARG A HG2  1  
ATOM 1971  H HG3  . ARG A 1 134 ? 5.687   16.170  -8.716  1.00 5.48   ? 134 ARG A HG3  1  
ATOM 1972  H HD2  . ARG A 1 134 ? 4.245   18.035  -9.467  1.00 5.79   ? 134 ARG A HD2  1  
ATOM 1973  H HD3  . ARG A 1 134 ? 3.753   18.340  -7.803  1.00 5.59   ? 134 ARG A HD3  1  
ATOM 1974  H HE   . ARG A 1 134 ? 5.632   19.587  -7.532  1.00 7.12   ? 134 ARG A HE   1  
ATOM 1975  H HH11 . ARG A 1 134 ? 6.413   17.353  -10.180 1.00 7.84   ? 134 ARG A HH11 1  
ATOM 1976  H HH12 . ARG A 1 134 ? 7.979   18.077  -10.438 1.00 9.69   ? 134 ARG A HH12 1  
ATOM 1977  H HH21 . ARG A 1 134 ? 7.707   20.377  -7.865  1.00 9.30   ? 134 ARG A HH21 1  
ATOM 1978  H HH22 . ARG A 1 134 ? 8.727   19.663  -9.074  1.00 10.27  ? 134 ARG A HH22 1  
ATOM 1979  N N    . THR A 1 135 ? 4.389   13.448  -6.248  1.00 3.13   ? 135 THR A N    1  
ATOM 1980  C CA   . THR A 1 135 ? 4.248   12.793  -4.933  1.00 3.26   ? 135 THR A CA   1  
ATOM 1981  C C    . THR A 1 135 ? 3.067   13.382  -4.162  1.00 1.80   ? 135 THR A C    1  
ATOM 1982  O O    . THR A 1 135 ? 2.682   14.526  -4.417  1.00 2.45   ? 135 THR A O    1  
ATOM 1983  C CB   . THR A 1 135 ? 5.534   12.974  -4.128  1.00 4.98   ? 135 THR A CB   1  
ATOM 1984  O OG1  . THR A 1 135 ? 6.631   12.534  -4.903  1.00 6.36   ? 135 THR A OG1  1  
ATOM 1985  C CG2  . THR A 1 135 ? 5.584   12.208  -2.810  1.00 5.75   ? 135 THR A CG2  1  
ATOM 1986  H H    . THR A 1 135 ? 4.994   14.249  -6.282  1.00 3.58   ? 135 THR A H    1  
ATOM 1987  H HA   . THR A 1 135 ? 4.076   11.735  -5.067  1.00 3.99   ? 135 THR A HA   1  
ATOM 1988  H HB   . THR A 1 135 ? 5.603   14.031  -3.894  1.00 5.17   ? 135 THR A HB   1  
ATOM 1989  H HG1  . THR A 1 135 ? 7.417   12.602  -4.336  1.00 7.38   ? 135 THR A HG1  1  
ATOM 1990  H HG21 . THR A 1 135 ? 5.312   11.172  -2.989  1.00 5.89   ? 135 THR A HG21 1  
ATOM 1991  H HG22 . THR A 1 135 ? 6.589   12.246  -2.391  1.00 6.66   ? 135 THR A HG22 1  
ATOM 1992  H HG23 . THR A 1 135 ? 4.899   12.642  -2.079  1.00 5.76   ? 135 THR A HG23 1  
ATOM 1993  N N    . LEU A 1 136 ? 2.510   12.609  -3.216  1.00 1.29   ? 136 LEU A N    1  
ATOM 1994  C CA   . LEU A 1 136 ? 1.377   13.010  -2.406  1.00 1.87   ? 136 LEU A CA   1  
ATOM 1995  C C    . LEU A 1 136 ? 1.374   12.436  -0.988  1.00 1.48   ? 136 LEU A C    1  
ATOM 1996  O O    . LEU A 1 136 ? 1.361   11.223  -0.808  1.00 1.23   ? 136 LEU A O    1  
ATOM 1997  C CB   . LEU A 1 136 ? 0.108   12.635  -3.180  1.00 3.81   ? 136 LEU A CB   1  
ATOM 1998  C CG   . LEU A 1 136 ? -1.116  13.440  -2.699  1.00 4.76   ? 136 LEU A CG   1  
ATOM 1999  C CD1  . LEU A 1 136 ? -1.102  14.865  -3.269  1.00 5.65   ? 136 LEU A CD1  1  
ATOM 2000  C CD2  . LEU A 1 136 ? -2.418  12.751  -3.145  1.00 5.81   ? 136 LEU A CD2  1  
ATOM 2001  H H    . LEU A 1 136 ? 2.817   11.645  -3.099  1.00 2.14   ? 136 LEU A H    1  
ATOM 2002  H HA   . LEU A 1 136 ? 1.423   14.077  -2.269  1.00 2.75   ? 136 LEU A HA   1  
ATOM 2003  H HB2  . LEU A 1 136 ? 0.286   12.689  -4.263  1.00 4.64   ? 136 LEU A HB2  1  
ATOM 2004  H HB3  . LEU A 1 136 ? -0.084  11.592  -2.982  1.00 4.36   ? 136 LEU A HB3  1  
ATOM 2005  H HG   . LEU A 1 136 ? -1.090  13.496  -1.598  1.00 4.53   ? 136 LEU A HG   1  
ATOM 2006  H HD11 . LEU A 1 136 ? -0.231  15.395  -2.898  1.00 5.25   ? 136 LEU A HD11 1  
ATOM 2007  H HD12 . LEU A 1 136 ? -1.087  14.869  -4.361  1.00 6.22   ? 136 LEU A HD12 1  
ATOM 2008  H HD13 . LEU A 1 136 ? -1.979  15.409  -2.924  1.00 6.77   ? 136 LEU A HD13 1  
ATOM 2009  H HD21 . LEU A 1 136 ? -2.492  12.696  -4.233  1.00 5.97   ? 136 LEU A HD21 1  
ATOM 2010  H HD22 . LEU A 1 136 ? -2.457  11.742  -2.744  1.00 6.29   ? 136 LEU A HD22 1  
ATOM 2011  H HD23 . LEU A 1 136 ? -3.277  13.297  -2.760  1.00 6.48   ? 136 LEU A HD23 1  
ATOM 2012  N N    . ASN A 1 137 ? 1.312   13.320  0.014   1.00 1.75   ? 137 ASN A N    1  
ATOM 2013  C CA   . ASN A 1 137 ? 1.061   13.036  1.419   1.00 1.78   ? 137 ASN A CA   1  
ATOM 2014  C C    . ASN A 1 137 ? -0.425  12.715  1.604   1.00 1.90   ? 137 ASN A C    1  
ATOM 2015  O O    . ASN A 1 137 ? -1.296  13.512  1.271   1.00 2.38   ? 137 ASN A O    1  
ATOM 2016  C CB   . ASN A 1 137 ? 1.481   14.256  2.270   1.00 2.11   ? 137 ASN A CB   1  
ATOM 2017  C CG   . ASN A 1 137 ? 0.823   15.581  1.857   1.00 3.08   ? 137 ASN A CG   1  
ATOM 2018  O OD1  . ASN A 1 137 ? 1.205   16.187  0.869   1.00 4.22   ? 137 ASN A OD1  1  
ATOM 2019  N ND2  . ASN A 1 137 ? -0.170  16.057  2.582   1.00 3.69   ? 137 ASN A ND2  1  
ATOM 2020  H H    . ASN A 1 137 ? 1.170   14.288  -0.209  1.00 2.26   ? 137 ASN A H    1  
ATOM 2021  H HA   . ASN A 1 137 ? 1.653   12.177  1.731   1.00 1.63   ? 137 ASN A HA   1  
ATOM 2022  H HB2  . ASN A 1 137 ? 1.247   14.056  3.317   1.00 3.18   ? 137 ASN A HB2  1  
ATOM 2023  H HB3  . ASN A 1 137 ? 2.561   14.381  2.191   1.00 1.69   ? 137 ASN A HB3  1  
ATOM 2024  H HD21 . ASN A 1 137 ? -0.542  15.537  3.358   1.00 3.89   ? 137 ASN A HD21 1  
ATOM 2025  H HD22 . ASN A 1 137 ? -0.622  16.906  2.263   1.00 4.59   ? 137 ASN A HD22 1  
ATOM 2026  N N    . VAL A 1 138 ? -0.704  11.548  2.156   1.00 1.60   ? 138 VAL A N    1  
ATOM 2027  C CA   . VAL A 1 138 ? -2.059  11.048  2.447   1.00 1.73   ? 138 VAL A CA   1  
ATOM 2028  C C    . VAL A 1 138 ? -2.087  10.427  3.848   1.00 1.52   ? 138 VAL A C    1  
ATOM 2029  O O    . VAL A 1 138 ? -1.083  9.909   4.341   1.00 1.40   ? 138 VAL A O    1  
ATOM 2030  C CB   . VAL A 1 138 ? -2.538  10.045  1.363   1.00 1.99   ? 138 VAL A CB   1  
ATOM 2031  C CG1  . VAL A 1 138 ? -4.012  9.638   1.546   1.00 2.18   ? 138 VAL A CG1  1  
ATOM 2032  C CG2  . VAL A 1 138 ? -2.411  10.628  -0.059  1.00 2.23   ? 138 VAL A CG2  1  
ATOM 2033  H H    . VAL A 1 138 ? 0.094   10.936  2.317   1.00 1.37   ? 138 VAL A H    1  
ATOM 2034  H HA   . VAL A 1 138 ? -2.747  11.896  2.445   1.00 2.03   ? 138 VAL A HA   1  
ATOM 2035  H HB   . VAL A 1 138 ? -1.919  9.145   1.409   1.00 2.19   ? 138 VAL A HB   1  
ATOM 2036  H HG11 . VAL A 1 138 ? -4.332  8.997   0.722   1.00 2.98   ? 138 VAL A HG11 1  
ATOM 2037  H HG12 . VAL A 1 138 ? -4.142  9.075   2.467   1.00 2.35   ? 138 VAL A HG12 1  
ATOM 2038  H HG13 . VAL A 1 138 ? -4.647  10.525  1.573   1.00 2.77   ? 138 VAL A HG13 1  
ATOM 2039  H HG21 . VAL A 1 138 ? -2.824  9.933   -0.788  1.00 3.23   ? 138 VAL A HG21 1  
ATOM 2040  H HG22 . VAL A 1 138 ? -2.950  11.573  -0.129  1.00 2.43   ? 138 VAL A HG22 1  
ATOM 2041  H HG23 . VAL A 1 138 ? -1.363  10.792  -0.313  1.00 2.55   ? 138 VAL A HG23 1  
ATOM 2042  N N    . ALA A 1 139 ? -3.243  10.509  4.509   1.00 1.69   ? 139 ALA A N    1  
ATOM 2043  C CA   . ALA A 1 139 ? -3.497  9.862   5.795   1.00 1.65   ? 139 ALA A CA   1  
ATOM 2044  C C    . ALA A 1 139 ? -3.435  8.321   5.703   1.00 1.43   ? 139 ALA A C    1  
ATOM 2045  O O    . ALA A 1 139 ? -3.374  7.749   4.616   1.00 1.87   ? 139 ALA A O    1  
ATOM 2046  C CB   . ALA A 1 139 ? -4.860  10.349  6.308   1.00 2.36   ? 139 ALA A CB   1  
ATOM 2047  H H    . ALA A 1 139 ? -4.031  10.916  4.029   1.00 1.98   ? 139 ALA A H    1  
ATOM 2048  H HA   . ALA A 1 139 ? -2.724  10.178  6.497   1.00 1.50   ? 139 ALA A HA   1  
ATOM 2049  H HB1  . ALA A 1 139 ? -5.038  9.970   7.314   1.00 3.02   ? 139 ALA A HB1  1  
ATOM 2050  H HB2  . ALA A 1 139 ? -4.881  11.439  6.337   1.00 2.22   ? 139 ALA A HB2  1  
ATOM 2051  H HB3  . ALA A 1 139 ? -5.652  9.988   5.648   1.00 3.44   ? 139 ALA A HB3  1  
ATOM 2052  N N    . ALA A 1 140 ? -3.497  7.666   6.864   1.00 1.57   ? 140 ALA A N    1  
ATOM 2053  C CA   . ALA A 1 140 ? -3.563  6.217   7.060   1.00 1.44   ? 140 ALA A CA   1  
ATOM 2054  C C    . ALA A 1 140 ? -3.695  5.900   8.548   1.00 1.29   ? 140 ALA A C    1  
ATOM 2055  O O    . ALA A 1 140 ? -3.204  6.655   9.399   1.00 1.23   ? 140 ALA A O    1  
ATOM 2056  C CB   . ALA A 1 140 ? -2.323  5.528   6.470   1.00 1.34   ? 140 ALA A CB   1  
ATOM 2057  H H    . ALA A 1 140 ? -3.532  8.212   7.712   1.00 2.14   ? 140 ALA A H    1  
ATOM 2058  H HA   . ALA A 1 140 ? -4.460  5.824   6.573   1.00 1.66   ? 140 ALA A HA   1  
ATOM 2059  H HB1  . ALA A 1 140 ? -1.421  6.000   6.856   1.00 1.92   ? 140 ALA A HB1  1  
ATOM 2060  H HB2  . ALA A 1 140 ? -2.320  4.467   6.731   1.00 2.52   ? 140 ALA A HB2  1  
ATOM 2061  H HB3  . ALA A 1 140 ? -2.341  5.618   5.387   1.00 1.67   ? 140 ALA A HB3  1  
ATOM 2062  N N    . THR A 1 141 ? -4.326  4.762   8.833   1.00 1.32   ? 141 THR A N    1  
ATOM 2063  C CA   . THR A 1 141 ? -4.496  4.243   10.188  1.00 1.27   ? 141 THR A CA   1  
ATOM 2064  C C    . THR A 1 141 ? -3.601  3.020   10.385  1.00 1.05   ? 141 THR A C    1  
ATOM 2065  O O    . THR A 1 141 ? -3.136  2.388   9.439   1.00 1.03   ? 141 THR A O    1  
ATOM 2066  C CB   . THR A 1 141 ? -5.967  3.899   10.478  1.00 1.69   ? 141 THR A CB   1  
ATOM 2067  O OG1  . THR A 1 141 ? -6.856  4.724   9.756   1.00 1.98   ? 141 THR A OG1  1  
ATOM 2068  C CG2  . THR A 1 141 ? -6.297  4.093   11.963  1.00 1.77   ? 141 THR A CG2  1  
ATOM 2069  H H    . THR A 1 141 ? -4.716  4.231   8.063   1.00 1.44   ? 141 THR A H    1  
ATOM 2070  H HA   . THR A 1 141 ? -4.185  5.010   10.891  1.00 1.21   ? 141 THR A HA   1  
ATOM 2071  H HB   . THR A 1 141 ? -6.144  2.871   10.167  1.00 1.90   ? 141 THR A HB   1  
ATOM 2072  H HG1  . THR A 1 141 ? -7.757  4.457   10.002  1.00 2.95   ? 141 THR A HG1  1  
ATOM 2073  H HG21 . THR A 1 141 ? -5.649  3.499   12.594  1.00 2.60   ? 141 THR A HG21 1  
ATOM 2074  H HG22 . THR A 1 141 ? -6.180  5.141   12.238  1.00 2.00   ? 141 THR A HG22 1  
ATOM 2075  H HG23 . THR A 1 141 ? -7.323  3.783   12.161  1.00 2.01   ? 141 THR A HG23 1  
ATOM 2076  N N    . VAL A 1 142 ? -3.417  2.620   11.629  1.00 1.09   ? 142 VAL A N    1  
ATOM 2077  C CA   . VAL A 1 142 ? -3.040  1.259   11.994  1.00 1.06   ? 142 VAL A CA   1  
ATOM 2078  C C    . VAL A 1 142 ? -4.324  0.441   12.227  1.00 1.17   ? 142 VAL A C    1  
ATOM 2079  O O    . VAL A 1 142 ? -5.361  0.978   12.606  1.00 1.30   ? 142 VAL A O    1  
ATOM 2080  C CB   . VAL A 1 142 ? -2.115  1.272   13.236  1.00 1.16   ? 142 VAL A CB   1  
ATOM 2081  C CG1  . VAL A 1 142 ? -1.420  -0.078  13.447  1.00 1.56   ? 142 VAL A CG1  1  
ATOM 2082  C CG2  . VAL A 1 142 ? -1.001  2.332   13.168  1.00 1.42   ? 142 VAL A CG2  1  
ATOM 2083  H H    . VAL A 1 142 ? -3.686  3.266   12.373  1.00 1.20   ? 142 VAL A H    1  
ATOM 2084  H HA   . VAL A 1 142 ? -2.517  0.804   11.153  1.00 1.05   ? 142 VAL A HA   1  
ATOM 2085  H HB   . VAL A 1 142 ? -2.730  1.491   14.109  1.00 1.55   ? 142 VAL A HB   1  
ATOM 2086  H HG11 . VAL A 1 142 ? -2.149  -0.874  13.387  1.00 2.20   ? 142 VAL A HG11 1  
ATOM 2087  H HG12 . VAL A 1 142 ? -0.662  -0.251  12.685  1.00 2.37   ? 142 VAL A HG12 1  
ATOM 2088  H HG13 . VAL A 1 142 ? -0.945  -0.100  14.429  1.00 2.51   ? 142 VAL A HG13 1  
ATOM 2089  H HG21 . VAL A 1 142 ? -1.416  3.333   13.115  1.00 2.20   ? 142 VAL A HG21 1  
ATOM 2090  H HG22 . VAL A 1 142 ? -0.389  2.269   14.062  1.00 2.56   ? 142 VAL A HG22 1  
ATOM 2091  H HG23 . VAL A 1 142 ? -0.370  2.177   12.298  1.00 1.88   ? 142 VAL A HG23 1  
ATOM 2092  N N    . LYS A 1 143 ? -4.274  -0.869  11.992  1.00 1.33   ? 143 LYS A N    1  
ATOM 2093  C CA   . LYS A 1 143 ? -5.237  -1.852  12.502  1.00 1.63   ? 143 LYS A CA   1  
ATOM 2094  C C    . LYS A 1 143 ? -4.511  -3.201  12.645  1.00 1.93   ? 143 LYS A C    1  
ATOM 2095  O O    . LYS A 1 143 ? -3.914  -3.672  11.676  1.00 2.53   ? 143 LYS A O    1  
ATOM 2096  C CB   . LYS A 1 143 ? -6.423  -1.943  11.514  1.00 1.96   ? 143 LYS A CB   1  
ATOM 2097  C CG   . LYS A 1 143 ? -7.638  -2.768  11.981  1.00 2.50   ? 143 LYS A CG   1  
ATOM 2098  C CD   . LYS A 1 143 ? -8.700  -2.783  10.860  1.00 2.99   ? 143 LYS A CD   1  
ATOM 2099  C CE   . LYS A 1 143 ? -10.084 -3.293  11.294  1.00 3.47   ? 143 LYS A CE   1  
ATOM 2100  N NZ   . LYS A 1 143 ? -10.137 -4.762  11.480  1.00 5.30   ? 143 LYS A NZ   1  
ATOM 2101  H H    . LYS A 1 143 ? -3.444  -1.233  11.536  1.00 1.38   ? 143 LYS A H    1  
ATOM 2102  H HA   . LYS A 1 143 ? -5.598  -1.511  13.481  1.00 1.56   ? 143 LYS A HA   1  
ATOM 2103  H HB2  . LYS A 1 143 ? -6.772  -0.929  11.305  1.00 1.87   ? 143 LYS A HB2  1  
ATOM 2104  H HB3  . LYS A 1 143 ? -6.057  -2.375  10.581  1.00 2.34   ? 143 LYS A HB3  1  
ATOM 2105  H HG2  . LYS A 1 143 ? -7.333  -3.790  12.210  1.00 3.00   ? 143 LYS A HG2  1  
ATOM 2106  H HG3  . LYS A 1 143 ? -8.057  -2.309  12.877  1.00 2.47   ? 143 LYS A HG3  1  
ATOM 2107  H HD2  . LYS A 1 143 ? -8.835  -1.759  10.507  1.00 2.91   ? 143 LYS A HD2  1  
ATOM 2108  H HD3  . LYS A 1 143 ? -8.333  -3.376  10.019  1.00 3.48   ? 143 LYS A HD3  1  
ATOM 2109  H HE2  . LYS A 1 143 ? -10.366 -2.791  12.224  1.00 3.21   ? 143 LYS A HE2  1  
ATOM 2110  H HE3  . LYS A 1 143 ? -10.812 -3.012  10.526  1.00 3.78   ? 143 LYS A HE3  1  
ATOM 2111  H HZ1  . LYS A 1 143 ? -9.470  -5.071  12.184  1.00 6.12   ? 143 LYS A HZ1  1  
ATOM 2112  H HZ2  . LYS A 1 143 ? -11.031 -5.034  11.863  1.00 5.58   ? 143 LYS A HZ2  1  
ATOM 2113  H HZ3  . LYS A 1 143 ? -10.012 -5.271  10.607  1.00 6.15   ? 143 LYS A HZ3  1  
ATOM 2114  N N    . LYS A 1 144 ? -4.508  -3.825  13.833  1.00 2.00   ? 144 LYS A N    1  
ATOM 2115  C CA   . LYS A 1 144 ? -4.007  -5.205  14.014  1.00 2.30   ? 144 LYS A CA   1  
ATOM 2116  C C    . LYS A 1 144 ? -4.517  -6.185  12.932  1.00 2.16   ? 144 LYS A C    1  
ATOM 2117  O O    . LYS A 1 144 ? -5.676  -6.119  12.534  1.00 2.56   ? 144 LYS A O    1  
ATOM 2118  C CB   . LYS A 1 144 ? -4.342  -5.703  15.437  1.00 2.97   ? 144 LYS A CB   1  
ATOM 2119  C CG   . LYS A 1 144 ? -5.851  -5.780  15.749  1.00 3.38   ? 144 LYS A CG   1  
ATOM 2120  C CD   . LYS A 1 144 ? -6.106  -6.122  17.227  1.00 4.59   ? 144 LYS A CD   1  
ATOM 2121  C CE   . LYS A 1 144 ? -7.598  -6.169  17.613  1.00 5.38   ? 144 LYS A CE   1  
ATOM 2122  N NZ   . LYS A 1 144 ? -8.343  -4.926  17.291  1.00 6.03   ? 144 LYS A NZ   1  
ATOM 2123  H H    . LYS A 1 144 ? -4.836  -3.314  14.645  1.00 2.19   ? 144 LYS A H    1  
ATOM 2124  H HA   . LYS A 1 144 ? -2.919  -5.182  13.917  1.00 2.85   ? 144 LYS A HA   1  
ATOM 2125  H HB2  . LYS A 1 144 ? -3.908  -6.694  15.569  1.00 3.61   ? 144 LYS A HB2  1  
ATOM 2126  H HB3  . LYS A 1 144 ? -3.861  -5.041  16.157  1.00 3.42   ? 144 LYS A HB3  1  
ATOM 2127  H HG2  . LYS A 1 144 ? -6.316  -4.822  15.522  1.00 3.59   ? 144 LYS A HG2  1  
ATOM 2128  H HG3  . LYS A 1 144 ? -6.316  -6.547  15.128  1.00 3.55   ? 144 LYS A HG3  1  
ATOM 2129  H HD2  . LYS A 1 144 ? -5.674  -7.103  17.440  1.00 4.93   ? 144 LYS A HD2  1  
ATOM 2130  H HD3  . LYS A 1 144 ? -5.595  -5.399  17.864  1.00 5.51   ? 144 LYS A HD3  1  
ATOM 2131  H HE2  . LYS A 1 144 ? -8.072  -7.014  17.102  1.00 5.80   ? 144 LYS A HE2  1  
ATOM 2132  H HE3  . LYS A 1 144 ? -7.667  -6.355  18.687  1.00 5.92   ? 144 LYS A HE3  1  
ATOM 2133  H HZ1  . LYS A 1 144 ? -8.532  -4.901  16.290  1.00 6.04   ? 144 LYS A HZ1  1  
ATOM 2134  H HZ2  . LYS A 1 144 ? -9.264  -4.921  17.725  1.00 6.65   ? 144 LYS A HZ2  1  
ATOM 2135  H HZ3  . LYS A 1 144 ? -7.848  -4.097  17.585  1.00 6.63   ? 144 LYS A HZ3  1  
ATOM 2136  N N    . ASN A 1 145 ? -3.670  -7.118  12.477  1.00 2.50   ? 145 ASN A N    1  
ATOM 2137  C CA   . ASN A 1 145 ? -4.057  -8.135  11.483  1.00 2.97   ? 145 ASN A CA   1  
ATOM 2138  C C    . ASN A 1 145 ? -2.967  -9.218  11.362  1.00 3.31   ? 145 ASN A C    1  
ATOM 2139  O O    . ASN A 1 145 ? -1.848  -8.905  10.961  1.00 4.58   ? 145 ASN A O    1  
ATOM 2140  C CB   . ASN A 1 145 ? -4.348  -7.461  10.111  1.00 3.83   ? 145 ASN A CB   1  
ATOM 2141  C CG   . ASN A 1 145 ? -5.715  -7.805  9.512   1.00 4.38   ? 145 ASN A CG   1  
ATOM 2142  O OD1  . ASN A 1 145 ? -6.304  -8.841  9.797   1.00 4.43   ? 145 ASN A OD1  1  
ATOM 2143  N ND2  . ASN A 1 145 ? -6.247  -6.962  8.640   1.00 5.52   ? 145 ASN A ND2  1  
ATOM 2144  H H    . ASN A 1 145 ? -2.715  -7.129  12.811  1.00 2.93   ? 145 ASN A H    1  
ATOM 2145  H HA   . ASN A 1 145 ? -4.967  -8.611  11.848  1.00 3.31   ? 145 ASN A HA   1  
ATOM 2146  H HB2  . ASN A 1 145 ? -4.292  -6.377  10.208  1.00 4.14   ? 145 ASN A HB2  1  
ATOM 2147  H HB3  . ASN A 1 145 ? -3.591  -7.743  9.382   1.00 4.54   ? 145 ASN A HB3  1  
ATOM 2148  H HD21 . ASN A 1 145 ? -5.793  -6.084  8.427   1.00 5.93   ? 145 ASN A HD21 1  
ATOM 2149  H HD22 . ASN A 1 145 ? -7.123  -7.210  8.211   1.00 6.27   ? 145 ASN A HD22 1  
ATOM 2150  N N    . ILE A 1 146 ? -3.254  -10.479 11.726  1.00 3.01   ? 146 ILE A N    1  
ATOM 2151  C CA   . ILE A 1 146 ? -2.383  -11.677 11.628  1.00 3.54   ? 146 ILE A CA   1  
ATOM 2152  C C    . ILE A 1 146 ? -1.213  -11.602 12.619  1.00 3.81   ? 146 ILE A C    1  
ATOM 2153  O O    . ILE A 1 146 ? -1.220  -12.297 13.624  1.00 4.50   ? 146 ILE A O    1  
ATOM 2154  C CB   . ILE A 1 146 ? -1.924  -11.983 10.169  1.00 3.90   ? 146 ILE A CB   1  
ATOM 2155  C CG1  . ILE A 1 146 ? -3.074  -12.372 9.204   1.00 4.31   ? 146 ILE A CG1  1  
ATOM 2156  C CG2  . ILE A 1 146 ? -0.932  -13.164 10.151  1.00 5.31   ? 146 ILE A CG2  1  
ATOM 2157  C CD1  . ILE A 1 146 ? -4.012  -11.233 8.786   1.00 4.31   ? 146 ILE A CD1  1  
ATOM 2158  H H    . ILE A 1 146 ? -4.175  -10.640 12.095  1.00 3.14   ? 146 ILE A H    1  
ATOM 2159  H HA   . ILE A 1 146 ? -2.951  -12.545 11.963  1.00 4.05   ? 146 ILE A HA   1  
ATOM 2160  H HB   . ILE A 1 146 ? -1.406  -11.118 9.754   1.00 3.80   ? 146 ILE A HB   1  
ATOM 2161  H HG12 . ILE A 1 146 ? -2.640  -12.758 8.280   1.00 5.15   ? 146 ILE A HG12 1  
ATOM 2162  H HG13 . ILE A 1 146 ? -3.668  -13.172 9.647   1.00 4.97   ? 146 ILE A HG13 1  
ATOM 2163  H HG21 . ILE A 1 146 ? -0.660  -13.420 9.127   1.00 5.89   ? 146 ILE A HG21 1  
ATOM 2164  H HG22 . ILE A 1 146 ? -0.016  -12.905 10.679  1.00 5.96   ? 146 ILE A HG22 1  
ATOM 2165  H HG23 . ILE A 1 146 ? -1.384  -14.038 10.624  1.00 5.80   ? 146 ILE A HG23 1  
ATOM 2166  H HD11 . ILE A 1 146 ? -4.625  -11.564 7.945   1.00 5.24   ? 146 ILE A HD11 1  
ATOM 2167  H HD12 . ILE A 1 146 ? -4.682  -10.976 9.606   1.00 4.65   ? 146 ILE A HD12 1  
ATOM 2168  H HD13 . ILE A 1 146 ? -3.435  -10.359 8.483   1.00 4.21   ? 146 ILE A HD13 1  
ATOM 2169  N N    . GLU A 1 147 ? -0.223  -10.760 12.345  1.00 3.80   ? 147 GLU A N    1  
ATOM 2170  C CA   . GLU A 1 147 ? 1.127   -10.846 12.931  1.00 4.72   ? 147 GLU A CA   1  
ATOM 2171  C C    . GLU A 1 147 ? 1.264   -10.061 14.264  1.00 4.61   ? 147 GLU A C    1  
ATOM 2172  O O    . GLU A 1 147 ? 2.361   -9.918  14.805  1.00 6.18   ? 147 GLU A O    1  
ATOM 2173  C CB   . GLU A 1 147 ? 2.140   -10.381 11.860  1.00 5.80   ? 147 GLU A CB   1  
ATOM 2174  C CG   . GLU A 1 147 ? 3.527   -11.048 11.919  1.00 7.15   ? 147 GLU A CG   1  
ATOM 2175  C CD   . GLU A 1 147 ? 3.524   -12.550 11.591  1.00 7.84   ? 147 GLU A CD   1  
ATOM 2176  O OE1  . GLU A 1 147 ? 2.779   -12.980 10.670  1.00 7.93   ? 147 GLU A OE1  1  
ATOM 2177  O OE2  . GLU A 1 147 ? 4.280   -13.289 12.268  1.00 8.78   ? 147 GLU A OE2  1  
ATOM 2178  H H    . GLU A 1 147 ? -0.393  -10.095 11.601  1.00 3.51   ? 147 GLU A H    1  
ATOM 2179  H HA   . GLU A 1 147 ? 1.327   -11.893 13.153  1.00 5.29   ? 147 GLU A HA   1  
ATOM 2180  H HB2  . GLU A 1 147 ? 1.728   -10.573 10.866  1.00 6.04   ? 147 GLU A HB2  1  
ATOM 2181  H HB3  . GLU A 1 147 ? 2.264   -9.297  11.943  1.00 5.90   ? 147 GLU A HB3  1  
ATOM 2182  H HG2  . GLU A 1 147 ? 4.172   -10.547 11.192  1.00 7.94   ? 147 GLU A HG2  1  
ATOM 2183  H HG3  . GLU A 1 147 ? 3.960   -10.888 12.906  1.00 7.50   ? 147 GLU A HG3  1  
ATOM 2184  N N    . GLY A 1 148 ? 0.150   -9.523  14.781  1.00 3.35   ? 148 GLY A N    1  
ATOM 2185  C CA   . GLY A 1 148 ? 0.103   -8.577  15.898  1.00 4.04   ? 148 GLY A CA   1  
ATOM 2186  C C    . GLY A 1 148 ? -0.652  -9.106  17.116  1.00 3.97   ? 148 GLY A C    1  
ATOM 2187  O O    . GLY A 1 148 ? -1.882  -9.228  17.077  1.00 4.65   ? 148 GLY A O    1  
ATOM 2188  H H    . GLY A 1 148 ? -0.723  -9.787  14.360  1.00 2.60   ? 148 GLY A H    1  
ATOM 2189  H HA2  . GLY A 1 148 ? 1.110   -8.288  16.192  1.00 4.88   ? 148 GLY A HA2  1  
ATOM 2190  H HA3  . GLY A 1 148 ? -0.429  -7.686  15.584  1.00 4.67   ? 148 GLY A HA3  1  
ATOM 2191  N N    . ARG A 1 149 ? 0.088   -9.366  18.200  1.00 3.97   ? 149 ARG A N    1  
ATOM 2192  C CA   . ARG A 1 149 ? -0.406  -9.764  19.529  1.00 4.69   ? 149 ARG A CA   1  
ATOM 2193  C C    . ARG A 1 149 ? 0.661   -9.465  20.587  1.00 5.53   ? 149 ARG A C    1  
ATOM 2194  O O    . ARG A 1 149 ? 1.857   -9.645  20.269  1.00 6.17   ? 149 ARG A O    1  
ATOM 2195  C CB   . ARG A 1 149 ? -0.831  -11.257 19.496  1.00 5.20   ? 149 ARG A CB   1  
ATOM 2196  C CG   . ARG A 1 149 ? -2.087  -11.569 20.330  1.00 6.46   ? 149 ARG A CG   1  
ATOM 2197  C CD   . ARG A 1 149 ? -1.834  -11.679 21.839  1.00 7.11   ? 149 ARG A CD   1  
ATOM 2198  N NE   . ARG A 1 149 ? -3.093  -11.543 22.591  1.00 8.55   ? 149 ARG A NE   1  
ATOM 2199  C CZ   . ARG A 1 149 ? -3.191  -11.096 23.828  1.00 9.44   ? 149 ARG A CZ   1  
ATOM 2200  N NH1  . ARG A 1 149 ? -2.180  -11.012 24.646  1.00 9.35   ? 149 ARG A NH1  1  
ATOM 2201  N NH2  . ARG A 1 149 ? -4.338  -10.680 24.273  1.00 10.83  ? 149 ARG A NH2  1  
ATOM 2202  O OXT  . ARG A 1 149 ? 0.291   -9.051  21.715  1.00 6.26   ? 149 ARG A OXT  1  
ATOM 2203  H H    . ARG A 1 149 ? 1.095   -9.297  18.116  1.00 4.02   ? 149 ARG A H    1  
ATOM 2204  H HA   . ARG A 1 149 ? -1.272  -9.146  19.774  1.00 5.21   ? 149 ARG A HA   1  
ATOM 2205  H HB2  . ARG A 1 149 ? -1.070  -11.536 18.466  1.00 4.99   ? 149 ARG A HB2  1  
ATOM 2206  H HB3  . ARG A 1 149 ? -0.005  -11.895 19.815  1.00 5.71   ? 149 ARG A HB3  1  
ATOM 2207  H HG2  . ARG A 1 149 ? -2.829  -10.793 20.137  1.00 7.09   ? 149 ARG A HG2  1  
ATOM 2208  H HG3  . ARG A 1 149 ? -2.509  -12.515 19.987  1.00 6.99   ? 149 ARG A HG3  1  
ATOM 2209  H HD2  . ARG A 1 149 ? -1.359  -12.638 22.056  1.00 7.26   ? 149 ARG A HD2  1  
ATOM 2210  H HD3  . ARG A 1 149 ? -1.160  -10.882 22.143  1.00 7.04   ? 149 ARG A HD3  1  
ATOM 2211  H HE   . ARG A 1 149 ? -3.951  -11.683 22.071  1.00 9.14   ? 149 ARG A HE   1  
ATOM 2212  H HH11 . ARG A 1 149 ? -1.281  -11.426 24.403  1.00 8.70   ? 149 ARG A HH11 1  
ATOM 2213  H HH12 . ARG A 1 149 ? -2.308  -10.651 25.569  1.00 10.25  ? 149 ARG A HH12 1  
ATOM 2214  H HH21 . ARG A 1 149 ? -5.149  -10.724 23.683  1.00 11.33  ? 149 ARG A HH21 1  
ATOM 2215  H HH22 . ARG A 1 149 ? -4.433  -10.303 25.203  1.00 11.59  ? 149 ARG A HH22 1  
ATOM 2216  N N    . MET A 1 1   ? 21.914  39.124  5.216   1.00 66.88  ? 1   MET A N    2  
ATOM 2217  C CA   . MET A 1 1   ? 20.649  39.841  4.947   1.00 66.12  ? 1   MET A CA   2  
ATOM 2218  C C    . MET A 1 1   ? 19.873  39.155  3.825   1.00 64.92  ? 1   MET A C    2  
ATOM 2219  O O    . MET A 1 1   ? 19.783  39.686  2.722   1.00 64.62  ? 1   MET A O    2  
ATOM 2220  C CB   . MET A 1 1   ? 20.881  41.337  4.666   1.00 66.28  ? 1   MET A CB   2  
ATOM 2221  C CG   . MET A 1 1   ? 21.415  42.093  5.891   1.00 67.21  ? 1   MET A CG   2  
ATOM 2222  S SD   . MET A 1 1   ? 21.477  43.890  5.659   1.00 67.49  ? 1   MET A SD   2  
ATOM 2223  C CE   . MET A 1 1   ? 22.102  44.414  7.277   1.00 68.58  ? 1   MET A CE   2  
ATOM 2224  H H1   . MET A 1 1   ? 22.499  39.095  4.390   1.00 66.77  ? 1   MET A H1   2  
ATOM 2225  H H2   . MET A 1 1   ? 21.711  38.173  5.505   1.00 67.38  ? 1   MET A H2   2  
ATOM 2226  H H3   . MET A 1 1   ? 22.420  39.564  5.969   1.00 67.11  ? 1   MET A H3   2  
ATOM 2227  H HA   . MET A 1 1   ? 20.028  39.772  5.841   1.00 66.41  ? 1   MET A HA   2  
ATOM 2228  H HB2  . MET A 1 1   ? 21.579  41.462  3.836   1.00 66.24  ? 1   MET A HB2  2  
ATOM 2229  H HB3  . MET A 1 1   ? 19.928  41.793  4.388   1.00 65.82  ? 1   MET A HB3  2  
ATOM 2230  H HG2  . MET A 1 1   ? 20.767  41.883  6.745   1.00 67.21  ? 1   MET A HG2  2  
ATOM 2231  H HG3  . MET A 1 1   ? 22.422  41.739  6.122   1.00 67.81  ? 1   MET A HG3  2  
ATOM 2232  H HE1  . MET A 1 1   ? 21.434  44.064  8.065   1.00 68.68  ? 1   MET A HE1  2  
ATOM 2233  H HE2  . MET A 1 1   ? 23.101  44.007  7.438   1.00 69.22  ? 1   MET A HE2  2  
ATOM 2234  H HE3  . MET A 1 1   ? 22.149  45.501  7.306   1.00 68.58  ? 1   MET A HE3  2  
ATOM 2235  N N    . GLY A 1 2   ? 19.305  37.978  4.108   1.00 64.30  ? 2   GLY A N    2  
ATOM 2236  C CA   . GLY A 1 2   ? 18.507  37.175  3.173   1.00 63.19  ? 2   GLY A CA   2  
ATOM 2237  C C    . GLY A 1 2   ? 19.244  35.948  2.634   1.00 62.84  ? 2   GLY A C    2  
ATOM 2238  O O    . GLY A 1 2   ? 20.470  35.885  2.573   1.00 63.48  ? 2   GLY A O    2  
ATOM 2239  H H    . GLY A 1 2   ? 19.432  37.600  5.043   1.00 64.64  ? 2   GLY A H    2  
ATOM 2240  H HA2  . GLY A 1 2   ? 17.623  36.819  3.700   1.00 63.18  ? 2   GLY A HA2  2  
ATOM 2241  H HA3  . GLY A 1 2   ? 18.190  37.774  2.319   1.00 62.64  ? 2   GLY A HA3  2  
ATOM 2242  N N    . HIS A 1 3   ? 18.472  34.940  2.240   1.00 61.86  ? 3   HIS A N    2  
ATOM 2243  C CA   . HIS A 1 3   ? 18.931  33.725  1.545   1.00 61.35  ? 3   HIS A CA   2  
ATOM 2244  C C    . HIS A 1 3   ? 18.078  33.511  0.268   1.00 59.95  ? 3   HIS A C    2  
ATOM 2245  O O    . HIS A 1 3   ? 16.985  34.085  0.173   1.00 59.48  ? 3   HIS A O    2  
ATOM 2246  C CB   . HIS A 1 3   ? 18.790  32.507  2.489   1.00 61.78  ? 3   HIS A CB   2  
ATOM 2247  C CG   . HIS A 1 3   ? 19.496  32.583  3.835   1.00 62.08  ? 3   HIS A CG   2  
ATOM 2248  N ND1  . HIS A 1 3   ? 20.479  33.468  4.225   1.00 62.17  ? 3   HIS A ND1  2  
ATOM 2249  C CD2  . HIS A 1 3   ? 19.253  31.778  4.922   1.00 62.41  ? 3   HIS A CD2  2  
ATOM 2250  C CE1  . HIS A 1 3   ? 20.795  33.218  5.509   1.00 62.54  ? 3   HIS A CE1  2  
ATOM 2251  N NE2  . HIS A 1 3   ? 20.076  32.186  5.983   1.00 62.71  ? 3   HIS A NE2  2  
ATOM 2252  H H    . HIS A 1 3   ? 17.469  35.061  2.276   1.00 61.39  ? 3   HIS A H    2  
ATOM 2253  H HA   . HIS A 1 3   ? 19.974  33.829  1.244   1.00 61.73  ? 3   HIS A HA   2  
ATOM 2254  H HB2  . HIS A 1 3   ? 17.726  32.345  2.683   1.00 61.68  ? 3   HIS A HB2  2  
ATOM 2255  H HB3  . HIS A 1 3   ? 19.158  31.617  1.973   1.00 62.07  ? 3   HIS A HB3  2  
ATOM 2256  H HD1  . HIS A 1 3   ? 20.853  34.228  3.670   1.00 62.02  ? 3   HIS A HD1  2  
ATOM 2257  H HD2  . HIS A 1 3   ? 18.533  30.973  4.962   1.00 62.49  ? 3   HIS A HD2  2  
ATOM 2258  H HE1  . HIS A 1 3   ? 21.516  33.783  6.089   1.00 62.73  ? 3   HIS A HE1  2  
ATOM 2259  N N    . THR A 1 4   ? 18.562  32.697  -0.688  1.00 59.36  ? 4   THR A N    2  
ATOM 2260  C CA   . THR A 1 4   ? 17.744  32.104  -1.769  1.00 58.12  ? 4   THR A CA   2  
ATOM 2261  C C    . THR A 1 4   ? 17.078  30.805  -1.273  1.00 57.39  ? 4   THR A C    2  
ATOM 2262  O O    . THR A 1 4   ? 17.198  30.458  -0.098  1.00 57.75  ? 4   THR A O    2  
ATOM 2263  C CB   . THR A 1 4   ? 18.585  31.933  -3.049  1.00 58.38  ? 4   THR A CB   2  
ATOM 2264  O OG1  . THR A 1 4   ? 17.759  31.518  -4.107  1.00 57.72  ? 4   THR A OG1  2  
ATOM 2265  C CG2  . THR A 1 4   ? 19.710  30.907  -2.911  1.00 59.06  ? 4   THR A CG2  2  
ATOM 2266  H H    . THR A 1 4   ? 19.458  32.266  -0.521  1.00 59.85  ? 4   THR A H    2  
ATOM 2267  H HA   . THR A 1 4   ? 16.925  32.784  -2.013  1.00 57.55  ? 4   THR A HA   2  
ATOM 2268  H HB   . THR A 1 4   ? 19.015  32.903  -3.311  1.00 58.67  ? 4   THR A HB   2  
ATOM 2269  H HG1  . THR A 1 4   ? 17.877  32.120  -4.878  1.00 57.77  ? 4   THR A HG1  2  
ATOM 2270  H HG21 . THR A 1 4   ? 19.305  29.925  -2.691  1.00 59.26  ? 4   THR A HG21 2  
ATOM 2271  H HG22 . THR A 1 4   ? 20.263  30.856  -3.850  1.00 59.17  ? 4   THR A HG22 2  
ATOM 2272  H HG23 . THR A 1 4   ? 20.399  31.204  -2.121  1.00 59.34  ? 4   THR A HG23 2  
ATOM 2273  N N    . MET A 1 5   ? 16.399  30.067  -2.153  1.00 56.45  ? 5   MET A N    2  
ATOM 2274  C CA   . MET A 1 5   ? 15.741  28.789  -1.867  1.00 55.68  ? 5   MET A CA   2  
ATOM 2275  C C    . MET A 1 5   ? 16.057  27.800  -3.009  1.00 55.01  ? 5   MET A C    2  
ATOM 2276  O O    . MET A 1 5   ? 15.946  28.191  -4.173  1.00 54.72  ? 5   MET A O    2  
ATOM 2277  C CB   . MET A 1 5   ? 14.231  29.044  -1.693  1.00 55.18  ? 5   MET A CB   2  
ATOM 2278  C CG   . MET A 1 5   ? 13.468  27.899  -1.007  1.00 54.95  ? 5   MET A CG   2  
ATOM 2279  S SD   . MET A 1 5   ? 13.063  26.453  -2.018  1.00 55.42  ? 5   MET A SD   2  
ATOM 2280  C CE   . MET A 1 5   ? 11.687  27.146  -2.971  1.00 54.58  ? 5   MET A CE   2  
ATOM 2281  H H    . MET A 1 5   ? 16.438  30.373  -3.124  1.00 56.31  ? 5   MET A H    2  
ATOM 2282  H HA   . MET A 1 5   ? 16.131  28.403  -0.927  1.00 56.05  ? 5   MET A HA   2  
ATOM 2283  H HB2  . MET A 1 5   ? 14.113  29.927  -1.065  1.00 55.29  ? 5   MET A HB2  2  
ATOM 2284  H HB3  . MET A 1 5   ? 13.780  29.272  -2.659  1.00 54.95  ? 5   MET A HB3  2  
ATOM 2285  H HG2  . MET A 1 5   ? 14.041  27.571  -0.136  1.00 55.07  ? 5   MET A HG2  2  
ATOM 2286  H HG3  . MET A 1 5   ? 12.534  28.306  -0.623  1.00 54.42  ? 5   MET A HG3  2  
ATOM 2287  H HE1  . MET A 1 5   ? 11.338  26.416  -3.703  1.00 54.70  ? 5   MET A HE1  2  
ATOM 2288  H HE2  . MET A 1 5   ? 10.865  27.403  -2.301  1.00 54.24  ? 5   MET A HE2  2  
ATOM 2289  H HE3  . MET A 1 5   ? 12.010  28.042  -3.500  1.00 54.40  ? 5   MET A HE3  2  
ATOM 2290  N N    . PRO A 1 6   ? 16.478  26.549  -2.719  1.00 54.85  ? 6   PRO A N    2  
ATOM 2291  C CA   . PRO A 1 6   ? 17.064  25.655  -3.723  1.00 54.31  ? 6   PRO A CA   2  
ATOM 2292  C C    . PRO A 1 6   ? 16.054  25.071  -4.722  1.00 53.32  ? 6   PRO A C    2  
ATOM 2293  O O    . PRO A 1 6   ? 16.430  24.873  -5.875  1.00 53.65  ? 6   PRO A O    2  
ATOM 2294  C CB   . PRO A 1 6   ? 17.771  24.549  -2.929  1.00 54.71  ? 6   PRO A CB   2  
ATOM 2295  C CG   . PRO A 1 6   ? 17.001  24.502  -1.610  1.00 54.98  ? 6   PRO A CG   2  
ATOM 2296  C CD   . PRO A 1 6   ? 16.638  25.970  -1.390  1.00 55.34  ? 6   PRO A CD   2  
ATOM 2297  H HA   . PRO A 1 6   ? 17.814  26.208  -4.293  1.00 54.50  ? 6   PRO A HA   2  
ATOM 2298  H HB2  . PRO A 1 6   ? 17.748  23.588  -3.448  1.00 54.19  ? 6   PRO A HB2  2  
ATOM 2299  H HB3  . PRO A 1 6   ? 18.803  24.848  -2.734  1.00 55.42  ? 6   PRO A HB3  2  
ATOM 2300  H HG2  . PRO A 1 6   ? 16.092  23.909  -1.734  1.00 54.33  ? 6   PRO A HG2  2  
ATOM 2301  H HG3  . PRO A 1 6   ? 17.612  24.105  -0.798  1.00 55.62  ? 6   PRO A HG3  2  
ATOM 2302  H HD2  . PRO A 1 6   ? 15.725  26.043  -0.800  1.00 55.19  ? 6   PRO A HD2  2  
ATOM 2303  H HD3  . PRO A 1 6   ? 17.456  26.469  -0.871  1.00 56.19  ? 6   PRO A HD3  2  
ATOM 2304  N N    . ALA A 1 7   ? 14.803  24.822  -4.300  1.00 52.13  ? 7   ALA A N    2  
ATOM 2305  C CA   . ALA A 1 7   ? 13.645  24.458  -5.142  1.00 50.97  ? 7   ALA A CA   2  
ATOM 2306  C C    . ALA A 1 7   ? 13.715  23.061  -5.817  1.00 50.45  ? 7   ALA A C    2  
ATOM 2307  O O    . ALA A 1 7   ? 14.720  22.359  -5.743  1.00 50.96  ? 7   ALA A O    2  
ATOM 2308  C CB   . ALA A 1 7   ? 13.367  25.599  -6.139  1.00 50.61  ? 7   ALA A CB   2  
ATOM 2309  H H    . ALA A 1 7   ? 14.614  24.991  -3.321  1.00 52.00  ? 7   ALA A H    2  
ATOM 2310  H HA   . ALA A 1 7   ? 12.786  24.415  -4.474  1.00 50.79  ? 7   ALA A HA   2  
ATOM 2311  H HB1  . ALA A 1 7   ? 13.333  26.551  -5.610  1.00 50.38  ? 7   ALA A HB1  2  
ATOM 2312  H HB2  . ALA A 1 7   ? 14.155  25.643  -6.892  1.00 50.87  ? 7   ALA A HB2  2  
ATOM 2313  H HB3  . ALA A 1 7   ? 12.412  25.444  -6.641  1.00 50.39  ? 7   ALA A HB3  2  
ATOM 2314  N N    . HIS A 1 8   ? 12.619  22.641  -6.448  1.00 49.50  ? 8   HIS A N    2  
ATOM 2315  C CA   . HIS A 1 8   ? 12.422  21.338  -7.098  1.00 48.93  ? 8   HIS A CA   2  
ATOM 2316  C C    . HIS A 1 8   ? 11.072  21.335  -7.836  1.00 47.78  ? 8   HIS A C    2  
ATOM 2317  O O    . HIS A 1 8   ? 10.266  22.249  -7.664  1.00 47.40  ? 8   HIS A O    2  
ATOM 2318  C CB   . HIS A 1 8   ? 12.557  20.156  -6.101  1.00 49.53  ? 8   HIS A CB   2  
ATOM 2319  C CG   . HIS A 1 8   ? 11.622  20.209  -4.907  1.00 48.96  ? 8   HIS A CG   2  
ATOM 2320  N ND1  . HIS A 1 8   ? 10.432  19.532  -4.754  1.00 48.78  ? 8   HIS A ND1  2  
ATOM 2321  C CD2  . HIS A 1 8   ? 11.852  20.881  -3.735  1.00 48.66  ? 8   HIS A CD2  2  
ATOM 2322  C CE1  . HIS A 1 8   ? 9.951   19.815  -3.532  1.00 48.37  ? 8   HIS A CE1  2  
ATOM 2323  N NE2  . HIS A 1 8   ? 10.783  20.643  -2.865  1.00 48.26  ? 8   HIS A NE2  2  
ATOM 2324  H H    . HIS A 1 8   ? 11.826  23.266  -6.505  1.00 49.17  ? 8   HIS A H    2  
ATOM 2325  H HA   . HIS A 1 8   ? 13.198  21.216  -7.860  1.00 49.01  ? 8   HIS A HA   2  
ATOM 2326  H HB2  . HIS A 1 8   ? 12.378  19.224  -6.626  1.00 50.24  ? 8   HIS A HB2  2  
ATOM 2327  H HB3  . HIS A 1 8   ? 13.577  20.116  -5.728  1.00 49.84  ? 8   HIS A HB3  2  
ATOM 2328  H HD1  . HIS A 1 8   ? 10.009  18.894  -5.414  1.00 49.03  ? 8   HIS A HD1  2  
ATOM 2329  H HD2  . HIS A 1 8   ? 12.726  21.475  -3.513  1.00 48.78  ? 8   HIS A HD2  2  
ATOM 2330  H HE1  . HIS A 1 8   ? 9.024   19.415  -3.134  1.00 48.22  ? 8   HIS A HE1  2  
ATOM 2331  N N    . THR A 1 9   ? 10.843  20.309  -8.662  1.00 47.32  ? 9   THR A N    2  
ATOM 2332  C CA   . THR A 1 9   ? 9.671   20.099  -9.528  1.00 46.33  ? 9   THR A CA   2  
ATOM 2333  C C    . THR A 1 9   ? 9.867   18.762  -10.253 1.00 46.10  ? 9   THR A C    2  
ATOM 2334  O O    . THR A 1 9   ? 11.022  18.426  -10.532 1.00 46.55  ? 9   THR A O    2  
ATOM 2335  C CB   . THR A 1 9   ? 9.458   21.276  -10.504 1.00 45.86  ? 9   THR A CB   2  
ATOM 2336  O OG1  . THR A 1 9   ? 8.402   20.981  -11.388 1.00 45.51  ? 9   THR A OG1  2  
ATOM 2337  C CG2  . THR A 1 9   ? 10.676  21.626  -11.364 1.00 45.76  ? 9   THR A CG2  2  
ATOM 2338  H H    . THR A 1 9   ? 11.575  19.619  -8.785  1.00 47.75  ? 9   THR A H    2  
ATOM 2339  H HA   . THR A 1 9   ? 8.792   20.035  -8.888  1.00 46.24  ? 9   THR A HA   2  
ATOM 2340  H HB   . THR A 1 9   ? 9.180   22.165  -9.929  1.00 45.97  ? 9   THR A HB   2  
ATOM 2341  H HG1  . THR A 1 9   ? 8.711   20.324  -12.027 1.00 45.91  ? 9   THR A HG1  2  
ATOM 2342  H HG21 . THR A 1 9   ? 10.414  22.444  -12.042 1.00 45.42  ? 9   THR A HG21 2  
ATOM 2343  H HG22 . THR A 1 9   ? 11.501  21.956  -10.735 1.00 45.65  ? 9   THR A HG22 2  
ATOM 2344  H HG23 . THR A 1 9   ? 10.988  20.764  -11.953 1.00 46.22  ? 9   THR A HG23 2  
ATOM 2345  N N    . PRO A 1 10  ? 8.802   17.998  -10.561 1.00 45.52  ? 10  PRO A N    2  
ATOM 2346  C CA   . PRO A 1 10  ? 8.922   16.840  -11.432 1.00 45.31  ? 10  PRO A CA   2  
ATOM 2347  C C    . PRO A 1 10  ? 9.251   17.275  -12.874 1.00 44.50  ? 10  PRO A C    2  
ATOM 2348  O O    . PRO A 1 10  ? 8.913   18.397  -13.271 1.00 43.79  ? 10  PRO A O    2  
ATOM 2349  C CB   . PRO A 1 10  ? 7.580   16.110  -11.331 1.00 45.03  ? 10  PRO A CB   2  
ATOM 2350  C CG   . PRO A 1 10  ? 6.595   17.230  -11.003 1.00 44.55  ? 10  PRO A CG   2  
ATOM 2351  C CD   . PRO A 1 10  ? 7.420   18.174  -10.128 1.00 45.17  ? 10  PRO A CD   2  
ATOM 2352  H HA   . PRO A 1 10  ? 9.713   16.198  -11.048 1.00 46.06  ? 10  PRO A HA   2  
ATOM 2353  H HB2  . PRO A 1 10  ? 7.319   15.597  -12.255 1.00 44.53  ? 10  PRO A HB2  2  
ATOM 2354  H HB3  . PRO A 1 10  ? 7.617   15.403  -10.502 1.00 45.80  ? 10  PRO A HB3  2  
ATOM 2355  H HG2  . PRO A 1 10  ? 6.305   17.744  -11.921 1.00 43.76  ? 10  PRO A HG2  2  
ATOM 2356  H HG3  . PRO A 1 10  ? 5.719   16.857  -10.476 1.00 44.70  ? 10  PRO A HG3  2  
ATOM 2357  H HD2  . PRO A 1 10  ? 7.071   19.198  -10.255 1.00 44.74  ? 10  PRO A HD2  2  
ATOM 2358  H HD3  . PRO A 1 10  ? 7.334   17.878  -9.081  1.00 45.91  ? 10  PRO A HD3  2  
ATOM 2359  N N    . PRO A 1 11  ? 9.888   16.393  -13.669 1.00 44.69  ? 11  PRO A N    2  
ATOM 2360  C CA   . PRO A 1 11  ? 10.159  16.622  -15.084 1.00 44.06  ? 11  PRO A CA   2  
ATOM 2361  C C    . PRO A 1 11  ? 8.876   16.483  -15.913 1.00 43.08  ? 11  PRO A C    2  
ATOM 2362  O O    . PRO A 1 11  ? 7.949   15.770  -15.525 1.00 43.13  ? 11  PRO A O    2  
ATOM 2363  C CB   . PRO A 1 11  ? 11.204  15.568  -15.469 1.00 44.94  ? 11  PRO A CB   2  
ATOM 2364  C CG   . PRO A 1 11  ? 10.854  14.393  -14.556 1.00 45.68  ? 11  PRO A CG   2  
ATOM 2365  C CD   . PRO A 1 11  ? 10.393  15.083  -13.272 1.00 45.71  ? 11  PRO A CD   2  
ATOM 2366  H HA   . PRO A 1 11  ? 10.577  17.620  -15.226 1.00 43.83  ? 11  PRO A HA   2  
ATOM 2367  H HB2  . PRO A 1 11  ? 11.149  15.293  -16.524 1.00 44.61  ? 11  PRO A HB2  2  
ATOM 2368  H HB3  . PRO A 1 11  ? 12.202  15.936  -15.223 1.00 45.49  ? 11  PRO A HB3  2  
ATOM 2369  H HG2  . PRO A 1 11  ? 10.029  13.822  -14.987 1.00 45.30  ? 11  PRO A HG2  2  
ATOM 2370  H HG3  . PRO A 1 11  ? 11.715  13.746  -14.382 1.00 46.61  ? 11  PRO A HG3  2  
ATOM 2371  H HD2  . PRO A 1 11  ? 9.615   14.488  -12.792 1.00 45.79  ? 11  PRO A HD2  2  
ATOM 2372  H HD3  . PRO A 1 11  ? 11.242  15.210  -12.600 1.00 46.49  ? 11  PRO A HD3  2  
ATOM 2373  N N    . ALA A 1 12  ? 8.844   17.135  -17.083 1.00 42.29  ? 12  ALA A N    2  
ATOM 2374  C CA   . ALA A 1 12  ? 7.689   17.142  -17.989 1.00 41.37  ? 12  ALA A CA   2  
ATOM 2375  C C    . ALA A 1 12  ? 8.026   17.637  -19.412 1.00 40.77  ? 12  ALA A C    2  
ATOM 2376  O O    . ALA A 1 12  ? 8.174   16.830  -20.328 1.00 41.40  ? 12  ALA A O    2  
ATOM 2377  C CB   . ALA A 1 12  ? 6.540   17.943  -17.341 1.00 40.57  ? 12  ALA A CB   2  
ATOM 2378  H H    . ALA A 1 12  ? 9.672   17.642  -17.359 1.00 42.39  ? 12  ALA A H    2  
ATOM 2379  H HA   . ALA A 1 12  ? 7.347   16.112  -18.102 1.00 41.87  ? 12  ALA A HA   2  
ATOM 2380  H HB1  . ALA A 1 12  ? 6.860   18.955  -17.092 1.00 40.31  ? 12  ALA A HB1  2  
ATOM 2381  H HB2  . ALA A 1 12  ? 5.688   17.986  -18.019 1.00 40.82  ? 12  ALA A HB2  2  
ATOM 2382  H HB3  . ALA A 1 12  ? 6.213   17.452  -16.424 1.00 40.10  ? 12  ALA A HB3  2  
ATOM 2383  N N    . GLN A 1 13  ? 8.036   18.963  -19.602 1.00 39.64  ? 13  GLN A N    2  
ATOM 2384  C CA   . GLN A 1 13  ? 8.136   19.691  -20.883 1.00 39.02  ? 13  GLN A CA   2  
ATOM 2385  C C    . GLN A 1 13  ? 6.837   19.581  -21.705 1.00 38.35  ? 13  GLN A C    2  
ATOM 2386  O O    . GLN A 1 13  ? 6.250   20.608  -22.041 1.00 38.36  ? 13  GLN A O    2  
ATOM 2387  C CB   . GLN A 1 13  ? 9.392   19.269  -21.686 1.00 39.93  ? 13  GLN A CB   2  
ATOM 2388  C CG   . GLN A 1 13  ? 9.898   20.374  -22.640 1.00 40.25  ? 13  GLN A CG   2  
ATOM 2389  C CD   . GLN A 1 13  ? 11.399  20.266  -22.937 1.00 41.40  ? 13  GLN A CD   2  
ATOM 2390  O OE1  . GLN A 1 13  ? 12.226  20.190  -22.036 1.00 41.28  ? 13  GLN A OE1  2  
ATOM 2391  N NE2  . GLN A 1 13  ? 11.821  20.278  -24.185 1.00 42.66  ? 13  GLN A NE2  2  
ATOM 2392  H H    . GLN A 1 13  ? 7.889   19.526  -18.777 1.00 39.24  ? 13  GLN A H    2  
ATOM 2393  H HA   . GLN A 1 13  ? 8.247   20.748  -20.634 1.00 38.46  ? 13  GLN A HA   2  
ATOM 2394  H HB2  . GLN A 1 13  ? 10.182  19.032  -20.974 1.00 39.94  ? 13  GLN A HB2  2  
ATOM 2395  H HB3  . GLN A 1 13  ? 9.195   18.364  -22.261 1.00 40.49  ? 13  GLN A HB3  2  
ATOM 2396  H HG2  . GLN A 1 13  ? 9.330   20.333  -23.568 1.00 40.48  ? 13  GLN A HG2  2  
ATOM 2397  H HG3  . GLN A 1 13  ? 9.729   21.357  -22.196 1.00 39.50  ? 13  GLN A HG3  2  
ATOM 2398  H HE21 . GLN A 1 13  ? 11.175  20.428  -24.955 1.00 42.85  ? 13  GLN A HE21 2  
ATOM 2399  H HE22 . GLN A 1 13  ? 12.811  20.187  -24.327 1.00 43.45  ? 13  GLN A HE22 2  
ATOM 2400  N N    . THR A 1 14  ? 6.379   18.350  -21.994 1.00 37.85  ? 14  THR A N    2  
ATOM 2401  C CA   . THR A 1 14  ? 5.213   18.037  -22.846 1.00 37.31  ? 14  THR A CA   2  
ATOM 2402  C C    . THR A 1 14  ? 4.252   17.048  -22.168 1.00 36.15  ? 14  THR A C    2  
ATOM 2403  O O    . THR A 1 14  ? 3.813   16.068  -22.770 1.00 36.69  ? 14  THR A O    2  
ATOM 2404  C CB   . THR A 1 14  ? 5.665   17.540  -24.232 1.00 38.44  ? 14  THR A CB   2  
ATOM 2405  O OG1  . THR A 1 14  ? 6.368   16.335  -24.052 1.00 38.60  ? 14  THR A OG1  2  
ATOM 2406  C CG2  . THR A 1 14  ? 6.556   18.531  -24.983 1.00 38.50  ? 14  THR A CG2  2  
ATOM 2407  H H    . THR A 1 14  ? 6.934   17.564  -21.670 1.00 37.94  ? 14  THR A H    2  
ATOM 2408  H HA   . THR A 1 14  ? 4.642   18.956  -23.008 1.00 37.03  ? 14  THR A HA   2  
ATOM 2409  H HB   . THR A 1 14  ? 4.783   17.351  -24.844 1.00 39.25  ? 14  THR A HB   2  
ATOM 2410  H HG1  . THR A 1 14  ? 5.692   15.729  -23.716 1.00 38.61  ? 14  THR A HG1  2  
ATOM 2411  H HG21 . THR A 1 14  ? 7.510   18.656  -24.465 1.00 38.41  ? 14  THR A HG21 2  
ATOM 2412  H HG22 . THR A 1 14  ? 6.746   18.156  -25.986 1.00 39.01  ? 14  THR A HG22 2  
ATOM 2413  H HG23 . THR A 1 14  ? 6.053   19.494  -25.052 1.00 38.26  ? 14  THR A HG23 2  
ATOM 2414  N N    . ALA A 1 15  ? 3.972   17.278  -20.884 1.00 34.65  ? 15  ALA A N    2  
ATOM 2415  C CA   . ALA A 1 15  ? 2.999   16.528  -20.079 1.00 33.40  ? 15  ALA A CA   2  
ATOM 2416  C C    . ALA A 1 15  ? 2.317   17.470  -19.055 1.00 31.51  ? 15  ALA A C    2  
ATOM 2417  O O    . ALA A 1 15  ? 2.955   17.840  -18.068 1.00 30.91  ? 15  ALA A O    2  
ATOM 2418  C CB   . ALA A 1 15  ? 3.723   15.354  -19.400 1.00 33.74  ? 15  ALA A CB   2  
ATOM 2419  H H    . ALA A 1 15  ? 4.430   18.057  -20.437 1.00 34.39  ? 15  ALA A H    2  
ATOM 2420  H HA   . ALA A 1 15  ? 2.244   16.100  -20.739 1.00 33.75  ? 15  ALA A HA   2  
ATOM 2421  H HB1  . ALA A 1 15  ? 4.127   14.684  -20.161 1.00 34.33  ? 15  ALA A HB1  2  
ATOM 2422  H HB2  . ALA A 1 15  ? 4.541   15.721  -18.777 1.00 33.71  ? 15  ALA A HB2  2  
ATOM 2423  H HB3  . ALA A 1 15  ? 3.023   14.800  -18.778 1.00 33.59  ? 15  ALA A HB3  2  
ATOM 2424  N N    . PRO A 1 16  ? 1.071   17.924  -19.303 1.00 30.70  ? 16  PRO A N    2  
ATOM 2425  C CA   . PRO A 1 16  ? 0.342   18.847  -18.434 1.00 28.98  ? 16  PRO A CA   2  
ATOM 2426  C C    . PRO A 1 16  ? -0.526  18.109  -17.404 1.00 27.64  ? 16  PRO A C    2  
ATOM 2427  O O    . PRO A 1 16  ? -0.988  16.997  -17.644 1.00 28.07  ? 16  PRO A O    2  
ATOM 2428  C CB   . PRO A 1 16  ? -0.527  19.665  -19.395 1.00 29.05  ? 16  PRO A CB   2  
ATOM 2429  C CG   . PRO A 1 16  ? -0.900  18.642  -20.472 1.00 30.26  ? 16  PRO A CG   2  
ATOM 2430  C CD   . PRO A 1 16  ? 0.342   17.751  -20.556 1.00 31.55  ? 16  PRO A CD   2  
ATOM 2431  H HA   . PRO A 1 16  ? 1.037   19.510  -17.919 1.00 28.84  ? 16  PRO A HA   2  
ATOM 2432  H HB2  . PRO A 1 16  ? -1.409  20.081  -18.905 1.00 27.82  ? 16  PRO A HB2  2  
ATOM 2433  H HB3  . PRO A 1 16  ? 0.072   20.462  -19.841 1.00 29.73  ? 16  PRO A HB3  2  
ATOM 2434  H HG2  . PRO A 1 16  ? -1.756  18.052  -20.138 1.00 29.59  ? 16  PRO A HG2  2  
ATOM 2435  H HG3  . PRO A 1 16  ? -1.118  19.124  -21.426 1.00 30.97  ? 16  PRO A HG3  2  
ATOM 2436  H HD2  . PRO A 1 16  ? 0.043   16.711  -20.680 1.00 32.00  ? 16  PRO A HD2  2  
ATOM 2437  H HD3  . PRO A 1 16  ? 0.962   18.073  -21.393 1.00 32.73  ? 16  PRO A HD3  2  
ATOM 2438  N N    . ALA A 1 17  ? -0.830  18.785  -16.289 1.00 26.10  ? 17  ALA A N    2  
ATOM 2439  C CA   . ALA A 1 17  ? -1.787  18.345  -15.275 1.00 24.70  ? 17  ALA A CA   2  
ATOM 2440  C C    . ALA A 1 17  ? -2.474  19.567  -14.644 1.00 22.99  ? 17  ALA A C    2  
ATOM 2441  O O    . ALA A 1 17  ? -1.812  20.366  -13.979 1.00 22.56  ? 17  ALA A O    2  
ATOM 2442  C CB   . ALA A 1 17  ? -1.060  17.491  -14.226 1.00 24.76  ? 17  ALA A CB   2  
ATOM 2443  H H    . ALA A 1 17  ? -0.406  19.689  -16.150 1.00 25.96  ? 17  ALA A H    2  
ATOM 2444  H HA   . ALA A 1 17  ? -2.547  17.721  -15.752 1.00 25.06  ? 17  ALA A HA   2  
ATOM 2445  H HB1  . ALA A 1 17  ? -0.280  18.075  -13.738 1.00 24.29  ? 17  ALA A HB1  2  
ATOM 2446  H HB2  . ALA A 1 17  ? -1.766  17.141  -13.473 1.00 24.97  ? 17  ALA A HB2  2  
ATOM 2447  H HB3  . ALA A 1 17  ? -0.604  16.623  -14.708 1.00 25.27  ? 17  ALA A HB3  2  
ATOM 2448  N N    . ALA A 1 18  ? -3.787  19.691  -14.873 1.00 22.21  ? 18  ALA A N    2  
ATOM 2449  C CA   . ALA A 1 18  ? -4.767  20.664  -14.343 1.00 20.73  ? 18  ALA A CA   2  
ATOM 2450  C C    . ALA A 1 18  ? -5.933  20.849  -15.334 1.00 20.35  ? 18  ALA A C    2  
ATOM 2451  O O    . ALA A 1 18  ? -5.727  21.331  -16.447 1.00 21.07  ? 18  ALA A O    2  
ATOM 2452  C CB   . ALA A 1 18  ? -4.149  22.024  -13.959 1.00 20.38  ? 18  ALA A CB   2  
ATOM 2453  H H    . ALA A 1 18  ? -4.186  19.015  -15.512 1.00 22.86  ? 18  ALA A H    2  
ATOM 2454  H HA   . ALA A 1 18  ? -5.183  20.235  -13.430 1.00 20.38  ? 18  ALA A HA   2  
ATOM 2455  H HB1  . ALA A 1 18  ? -3.538  22.403  -14.784 1.00 21.01  ? 18  ALA A HB1  2  
ATOM 2456  H HB2  . ALA A 1 18  ? -4.941  22.745  -13.754 1.00 20.02  ? 18  ALA A HB2  2  
ATOM 2457  H HB3  . ALA A 1 18  ? -3.535  21.926  -13.061 1.00 20.13  ? 18  ALA A HB3  2  
ATOM 2458  N N    . GLN A 1 19  ? -7.148  20.501  -14.902 1.00 19.40  ? 19  GLN A N    2  
ATOM 2459  C CA   . GLN A 1 19  ? -8.382  20.621  -15.693 1.00 19.15  ? 19  GLN A CA   2  
ATOM 2460  C C    . GLN A 1 19  ? -9.329  21.574  -14.957 1.00 17.71  ? 19  GLN A C    2  
ATOM 2461  O O    . GLN A 1 19  ? -9.658  22.646  -15.458 1.00 17.80  ? 19  GLN A O    2  
ATOM 2462  C CB   . GLN A 1 19  ? -9.010  19.218  -15.909 1.00 19.80  ? 19  GLN A CB   2  
ATOM 2463  C CG   . GLN A 1 19  ? -9.068  18.789  -17.383 1.00 20.95  ? 19  GLN A CG   2  
ATOM 2464  C CD   . GLN A 1 19  ? -7.710  18.700  -18.078 1.00 21.38  ? 19  GLN A CD   2  
ATOM 2465  O OE1  . GLN A 1 19  ? -6.675  18.520  -17.459 1.00 20.91  ? 19  GLN A OE1  2  
ATOM 2466  N NE2  . GLN A 1 19  ? -7.693  18.847  -19.379 1.00 22.51  ? 19  GLN A NE2  2  
ATOM 2467  H H    . GLN A 1 19  ? -7.222  20.132  -13.969 1.00 18.96  ? 19  GLN A H    2  
ATOM 2468  H HA   . GLN A 1 19  ? -8.159  21.089  -16.658 1.00 19.81  ? 19  GLN A HA   2  
ATOM 2469  H HB2  . GLN A 1 19  ? -8.447  18.469  -15.347 1.00 20.08  ? 19  GLN A HB2  2  
ATOM 2470  H HB3  . GLN A 1 19  ? -10.028 19.214  -15.521 1.00 19.45  ? 19  GLN A HB3  2  
ATOM 2471  H HG2  . GLN A 1 19  ? -9.546  17.812  -17.441 1.00 21.28  ? 19  GLN A HG2  2  
ATOM 2472  H HG3  . GLN A 1 19  ? -9.701  19.491  -17.919 1.00 21.43  ? 19  GLN A HG3  2  
ATOM 2473  H HE21 . GLN A 1 19  ? -8.553  18.891  -19.904 1.00 23.10  ? 19  GLN A HE21 2  
ATOM 2474  H HE22 . GLN A 1 19  ? -6.790  18.877  -19.833 1.00 22.93  ? 19  GLN A HE22 2  
ATOM 2475  N N    . LYS A 1 20  ? -9.707  21.212  -13.726 1.00 16.53  ? 20  LYS A N    2  
ATOM 2476  C CA   . LYS A 1 20  ? -10.434 22.067  -12.780 1.00 15.14  ? 20  LYS A CA   2  
ATOM 2477  C C    . LYS A 1 20  ? -10.241 21.543  -11.338 1.00 13.70  ? 20  LYS A C    2  
ATOM 2478  O O    . LYS A 1 20  ? -9.396  20.675  -11.094 1.00 13.72  ? 20  LYS A O    2  
ATOM 2479  C CB   . LYS A 1 20  ? -11.921 22.165  -13.217 1.00 15.80  ? 20  LYS A CB   2  
ATOM 2480  C CG   . LYS A 1 20  ? -12.475 23.593  -13.076 1.00 15.95  ? 20  LYS A CG   2  
ATOM 2481  C CD   . LYS A 1 20  ? -13.928 23.698  -13.567 1.00 17.35  ? 20  LYS A CD   2  
ATOM 2482  C CE   . LYS A 1 20  ? -14.356 25.170  -13.600 1.00 18.15  ? 20  LYS A CE   2  
ATOM 2483  N NZ   . LYS A 1 20  ? -15.730 25.353  -14.124 1.00 19.60  ? 20  LYS A NZ   2  
ATOM 2484  H H    . LYS A 1 20  ? -9.431  20.302  -13.374 1.00 16.72  ? 20  LYS A H    2  
ATOM 2485  H HA   . LYS A 1 20  ? -9.988  23.063  -12.828 1.00 14.97  ? 20  LYS A HA   2  
ATOM 2486  H HB2  . LYS A 1 20  ? -12.010 21.884  -14.271 1.00 16.66  ? 20  LYS A HB2  2  
ATOM 2487  H HB3  . LYS A 1 20  ? -12.530 21.464  -12.644 1.00 15.69  ? 20  LYS A HB3  2  
ATOM 2488  H HG2  . LYS A 1 20  ? -12.426 23.906  -12.034 1.00 15.30  ? 20  LYS A HG2  2  
ATOM 2489  H HG3  . LYS A 1 20  ? -11.854 24.267  -13.673 1.00 16.01  ? 20  LYS A HG3  2  
ATOM 2490  H HD2  . LYS A 1 20  ? -14.001 23.282  -14.573 1.00 18.16  ? 20  LYS A HD2  2  
ATOM 2491  H HD3  . LYS A 1 20  ? -14.578 23.133  -12.894 1.00 17.25  ? 20  LYS A HD3  2  
ATOM 2492  H HE2  . LYS A 1 20  ? -14.291 25.590  -12.592 1.00 17.67  ? 20  LYS A HE2  2  
ATOM 2493  H HE3  . LYS A 1 20  ? -13.660 25.724  -14.237 1.00 18.38  ? 20  LYS A HE3  2  
ATOM 2494  H HZ1  . LYS A 1 20  ? -16.426 24.933  -13.527 1.00 19.90  ? 20  LYS A HZ1  2  
ATOM 2495  H HZ2  . LYS A 1 20  ? -15.921 26.352  -14.187 1.00 19.98  ? 20  LYS A HZ2  2  
ATOM 2496  H HZ3  . LYS A 1 20  ? -15.815 24.981  -15.066 1.00 20.18  ? 20  LYS A HZ3  2  
ATOM 2497  N N    . ALA A 1 21  ? -11.030 22.044  -10.386 1.00 12.76  ? 21  ALA A N    2  
ATOM 2498  C CA   . ALA A 1 21  ? -11.294 21.399  -9.100  1.00 11.71  ? 21  ALA A CA   2  
ATOM 2499  C C    . ALA A 1 21  ? -12.809 21.128  -8.964  1.00 11.19  ? 21  ALA A C    2  
ATOM 2500  O O    . ALA A 1 21  ? -13.593 21.629  -9.769  1.00 11.61  ? 21  ALA A O    2  
ATOM 2501  C CB   . ALA A 1 21  ? -10.753 22.306  -7.984  1.00 11.49  ? 21  ALA A CB   2  
ATOM 2502  H H    . ALA A 1 21  ? -11.703 22.742  -10.668 1.00 13.10  ? 21  ALA A H    2  
ATOM 2503  H HA   . ALA A 1 21  ? -10.785 20.433  -9.044  1.00 11.86  ? 21  ALA A HA   2  
ATOM 2504  H HB1  . ALA A 1 21  ? -10.896 21.831  -7.011  1.00 11.47  ? 21  ALA A HB1  2  
ATOM 2505  H HB2  . ALA A 1 21  ? -9.688  22.481  -8.131  1.00 11.54  ? 21  ALA A HB2  2  
ATOM 2506  H HB3  . ALA A 1 21  ? -11.280 23.261  -7.986  1.00 11.76  ? 21  ALA A HB3  2  
ATOM 2507  N N    . GLY A 1 22  ? -13.204 20.376  -7.928  1.00 10.59  ? 22  GLY A N    2  
ATOM 2508  C CA   . GLY A 1 22  ? -14.605 20.043  -7.617  1.00 10.22  ? 22  GLY A CA   2  
ATOM 2509  C C    . GLY A 1 22  ? -14.877 18.532  -7.590  1.00 9.67   ? 22  GLY A C    2  
ATOM 2510  O O    . GLY A 1 22  ? -14.682 17.846  -8.591  1.00 10.14  ? 22  GLY A O    2  
ATOM 2511  H H    . GLY A 1 22  ? -12.492 20.015  -7.310  1.00 10.63  ? 22  GLY A H    2  
ATOM 2512  H HA2  . GLY A 1 22  ? -14.844 20.451  -6.637  1.00 10.27  ? 22  GLY A HA2  2  
ATOM 2513  H HA3  . GLY A 1 22  ? -15.281 20.487  -8.348  1.00 10.58  ? 22  GLY A HA3  2  
ATOM 2514  N N    . ALA A 1 23  ? -15.353 18.043  -6.424  1.00 9.01   ? 23  ALA A N    2  
ATOM 2515  C CA   . ALA A 1 23  ? -15.614 16.629  -6.090  1.00 8.58   ? 23  ALA A CA   2  
ATOM 2516  C C    . ALA A 1 23  ? -16.177 16.434  -4.657  1.00 8.13   ? 23  ALA A C    2  
ATOM 2517  O O    . ALA A 1 23  ? -17.207 15.789  -4.491  1.00 8.99   ? 23  ALA A O    2  
ATOM 2518  C CB   . ALA A 1 23  ? -14.330 15.798  -6.288  1.00 8.73   ? 23  ALA A CB   2  
ATOM 2519  H H    . ALA A 1 23  ? -15.531 18.721  -5.701  1.00 9.01   ? 23  ALA A H    2  
ATOM 2520  H HA   . ALA A 1 23  ? -16.376 16.243  -6.777  1.00 9.15   ? 23  ALA A HA   2  
ATOM 2521  H HB1  . ALA A 1 23  ? -14.485 14.789  -5.896  1.00 9.20   ? 23  ALA A HB1  2  
ATOM 2522  H HB2  . ALA A 1 23  ? -14.092 15.718  -7.347  1.00 9.05   ? 23  ALA A HB2  2  
ATOM 2523  H HB3  . ALA A 1 23  ? -13.494 16.254  -5.762  1.00 8.65   ? 23  ALA A HB3  2  
ATOM 2524  N N    . GLN A 1 24  ? -15.506 16.994  -3.636  1.00 7.45   ? 24  GLN A N    2  
ATOM 2525  C CA   . GLN A 1 24  ? -15.829 16.935  -2.191  1.00 7.76   ? 24  GLN A CA   2  
ATOM 2526  C C    . GLN A 1 24  ? -15.644 15.533  -1.578  1.00 7.67   ? 24  GLN A C    2  
ATOM 2527  O O    . GLN A 1 24  ? -14.801 15.372  -0.698  1.00 8.23   ? 24  GLN A O    2  
ATOM 2528  C CB   . GLN A 1 24  ? -17.222 17.520  -1.856  1.00 8.74   ? 24  GLN A CB   2  
ATOM 2529  C CG   . GLN A 1 24  ? -17.332 19.030  -2.154  1.00 9.30   ? 24  GLN A CG   2  
ATOM 2530  C CD   . GLN A 1 24  ? -18.622 19.662  -1.604  1.00 10.95  ? 24  GLN A CD   2  
ATOM 2531  O OE1  . GLN A 1 24  ? -19.730 19.303  -1.992  1.00 11.69  ? 24  GLN A OE1  2  
ATOM 2532  N NE2  . GLN A 1 24  ? -18.535 20.637  -0.717  1.00 11.96  ? 24  GLN A NE2  2  
ATOM 2533  H H    . GLN A 1 24  ? -14.595 17.389  -3.853  1.00 7.20   ? 24  GLN A H    2  
ATOM 2534  H HA   . GLN A 1 24  ? -15.092 17.560  -1.677  1.00 8.06   ? 24  GLN A HA   2  
ATOM 2535  H HB2  . GLN A 1 24  ? -18.007 16.991  -2.390  1.00 9.01   ? 24  GLN A HB2  2  
ATOM 2536  H HB3  . GLN A 1 24  ? -17.402 17.380  -0.785  1.00 9.42   ? 24  GLN A HB3  2  
ATOM 2537  H HG2  . GLN A 1 24  ? -16.477 19.544  -1.713  1.00 9.41   ? 24  GLN A HG2  2  
ATOM 2538  H HG3  . GLN A 1 24  ? -17.306 19.192  -3.228  1.00 8.95   ? 24  GLN A HG3  2  
ATOM 2539  H HE21 . GLN A 1 24  ? -17.639 20.999  -0.429  1.00 11.75  ? 24  GLN A HE21 2  
ATOM 2540  H HE22 . GLN A 1 24  ? -19.394 21.069  -0.410  1.00 13.13  ? 24  GLN A HE22 2  
ATOM 2541  N N    . ALA A 1 25  ? -16.391 14.534  -2.058  1.00 7.30   ? 25  ALA A N    2  
ATOM 2542  C CA   . ALA A 1 25  ? -16.331 13.127  -1.643  1.00 7.37   ? 25  ALA A CA   2  
ATOM 2543  C C    . ALA A 1 25  ? -17.046 12.244  -2.681  1.00 6.70   ? 25  ALA A C    2  
ATOM 2544  O O    . ALA A 1 25  ? -18.248 12.383  -2.909  1.00 7.26   ? 25  ALA A O    2  
ATOM 2545  C CB   . ALA A 1 25  ? -16.951 12.965  -0.246  1.00 8.91   ? 25  ALA A CB   2  
ATOM 2546  H H    . ALA A 1 25  ? -17.054 14.764  -2.795  1.00 7.17   ? 25  ALA A H    2  
ATOM 2547  H HA   . ALA A 1 25  ? -15.284 12.830  -1.587  1.00 7.22   ? 25  ALA A HA   2  
ATOM 2548  H HB1  . ALA A 1 25  ? -17.989 13.300  -0.258  1.00 9.18   ? 25  ALA A HB1  2  
ATOM 2549  H HB2  . ALA A 1 25  ? -16.923 11.917  0.047   1.00 9.64   ? 25  ALA A HB2  2  
ATOM 2550  H HB3  . ALA A 1 25  ? -16.398 13.553  0.484   1.00 9.52   ? 25  ALA A HB3  2  
ATOM 2551  N N    . LEU A 1 26  ? -16.301 11.342  -3.333  1.00 5.82   ? 26  LEU A N    2  
ATOM 2552  C CA   . LEU A 1 26  ? -16.787 10.517  -4.457  1.00 5.21   ? 26  LEU A CA   2  
ATOM 2553  C C    . LEU A 1 26  ? -17.255 9.114   -3.994  1.00 5.14   ? 26  LEU A C    2  
ATOM 2554  O O    . LEU A 1 26  ? -16.737 8.617   -2.988  1.00 5.24   ? 26  LEU A O    2  
ATOM 2555  C CB   . LEU A 1 26  ? -15.663 10.388  -5.514  1.00 4.83   ? 26  LEU A CB   2  
ATOM 2556  C CG   . LEU A 1 26  ? -15.223 11.708  -6.184  1.00 5.34   ? 26  LEU A CG   2  
ATOM 2557  C CD1  . LEU A 1 26  ? -14.098 11.415  -7.185  1.00 5.84   ? 26  LEU A CD1  2  
ATOM 2558  C CD2  . LEU A 1 26  ? -16.385 12.418  -6.892  1.00 6.03   ? 26  LEU A CD2  2  
ATOM 2559  H H    . LEU A 1 26  ? -15.344 11.215  -3.041  1.00 5.82   ? 26  LEU A H    2  
ATOM 2560  H HA   . LEU A 1 26  ? -17.649 11.013  -4.905  1.00 5.58   ? 26  LEU A HA   2  
ATOM 2561  H HB2  . LEU A 1 26  ? -14.794 9.929   -5.032  1.00 4.96   ? 26  LEU A HB2  2  
ATOM 2562  H HB3  . LEU A 1 26  ? -15.992 9.702   -6.297  1.00 4.59   ? 26  LEU A HB3  2  
ATOM 2563  H HG   . LEU A 1 26  ? -14.828 12.374  -5.416  1.00 5.64   ? 26  LEU A HG   2  
ATOM 2564  H HD11 . LEU A 1 26  ? -13.752 12.346  -7.629  1.00 5.97   ? 26  LEU A HD11 2  
ATOM 2565  H HD12 . LEU A 1 26  ? -13.261 10.942  -6.673  1.00 6.44   ? 26  LEU A HD12 2  
ATOM 2566  H HD13 . LEU A 1 26  ? -14.458 10.754  -7.971  1.00 6.31   ? 26  LEU A HD13 2  
ATOM 2567  H HD21 . LEU A 1 26  ? -16.864 11.740  -7.600  1.00 6.18   ? 26  LEU A HD21 2  
ATOM 2568  H HD22 . LEU A 1 26  ? -17.119 12.764  -6.166  1.00 6.83   ? 26  LEU A HD22 2  
ATOM 2569  H HD23 . LEU A 1 26  ? -16.011 13.288  -7.432  1.00 6.27   ? 26  LEU A HD23 2  
ATOM 2570  N N    . PRO A 1 27  ? -18.138 8.413   -4.749  1.00 5.32   ? 27  PRO A N    2  
ATOM 2571  C CA   . PRO A 1 27  ? -18.576 7.037   -4.467  1.00 5.54   ? 27  PRO A CA   2  
ATOM 2572  C C    . PRO A 1 27  ? -17.496 5.993   -4.826  1.00 4.67   ? 27  PRO A C    2  
ATOM 2573  O O    . PRO A 1 27  ? -17.727 5.064   -5.598  1.00 4.80   ? 27  PRO A O    2  
ATOM 2574  C CB   . PRO A 1 27  ? -19.881 6.874   -5.258  1.00 6.47   ? 27  PRO A CB   2  
ATOM 2575  C CG   . PRO A 1 27  ? -19.642 7.745   -6.488  1.00 6.38   ? 27  PRO A CG   2  
ATOM 2576  C CD   . PRO A 1 27  ? -18.849 8.922   -5.919  1.00 5.84   ? 27  PRO A CD   2  
ATOM 2577  H HA   . PRO A 1 27  ? -18.800 6.939   -3.403  1.00 6.02   ? 27  PRO A HA   2  
ATOM 2578  H HB2  . PRO A 1 27  ? -20.099 5.841   -5.525  1.00 6.65   ? 27  PRO A HB2  2  
ATOM 2579  H HB3  . PRO A 1 27  ? -20.706 7.281   -4.676  1.00 7.23   ? 27  PRO A HB3  2  
ATOM 2580  H HG2  . PRO A 1 27  ? -19.028 7.204   -7.210  1.00 6.03   ? 27  PRO A HG2  2  
ATOM 2581  H HG3  . PRO A 1 27  ? -20.577 8.071   -6.942  1.00 7.24   ? 27  PRO A HG3  2  
ATOM 2582  H HD2  . PRO A 1 27  ? -18.164 9.308   -6.675  1.00 5.56   ? 27  PRO A HD2  2  
ATOM 2583  H HD3  . PRO A 1 27  ? -19.538 9.710   -5.607  1.00 6.45   ? 27  PRO A HD3  2  
ATOM 2584  N N    . VAL A 1 28  ? -16.298 6.160   -4.260  1.00 4.04   ? 28  VAL A N    2  
ATOM 2585  C CA   . VAL A 1 28  ? -15.098 5.349   -4.509  1.00 3.24   ? 28  VAL A CA   2  
ATOM 2586  C C    . VAL A 1 28  ? -14.410 5.074   -3.168  1.00 3.29   ? 28  VAL A C    2  
ATOM 2587  O O    . VAL A 1 28  ? -14.172 6.004   -2.396  1.00 3.75   ? 28  VAL A O    2  
ATOM 2588  C CB   . VAL A 1 28  ? -14.147 6.088   -5.492  1.00 2.86   ? 28  VAL A CB   2  
ATOM 2589  C CG1  . VAL A 1 28  ? -12.686 5.613   -5.415  1.00 3.53   ? 28  VAL A CG1  2  
ATOM 2590  C CG2  . VAL A 1 28  ? -14.643 5.928   -6.941  1.00 2.77   ? 28  VAL A CG2  2  
ATOM 2591  H H    . VAL A 1 28  ? -16.212 6.921   -3.584  1.00 4.35   ? 28  VAL A H    2  
ATOM 2592  H HA   . VAL A 1 28  ? -15.379 4.392   -4.949  1.00 3.22   ? 28  VAL A HA   2  
ATOM 2593  H HB   . VAL A 1 28  ? -14.150 7.153   -5.247  1.00 3.23   ? 28  VAL A HB   2  
ATOM 2594  H HG11 . VAL A 1 28  ? -12.643 4.529   -5.494  1.00 4.47   ? 28  VAL A HG11 2  
ATOM 2595  H HG12 . VAL A 1 28  ? -12.101 6.057   -6.222  1.00 3.28   ? 28  VAL A HG12 2  
ATOM 2596  H HG13 . VAL A 1 28  ? -12.243 5.922   -4.473  1.00 4.29   ? 28  VAL A HG13 2  
ATOM 2597  H HG21 . VAL A 1 28  ? -15.648 6.340   -7.043  1.00 3.52   ? 28  VAL A HG21 2  
ATOM 2598  H HG22 . VAL A 1 28  ? -13.984 6.468   -7.622  1.00 2.59   ? 28  VAL A HG22 2  
ATOM 2599  H HG23 . VAL A 1 28  ? -14.656 4.874   -7.219  1.00 3.69   ? 28  VAL A HG23 2  
ATOM 2600  N N    . THR A 1 29  ? -14.033 3.809   -2.919  1.00 3.06   ? 29  THR A N    2  
ATOM 2601  C CA   . THR A 1 29  ? -13.134 3.426   -1.821  1.00 3.09   ? 29  THR A CA   2  
ATOM 2602  C C    . THR A 1 29  ? -11.690 3.619   -2.273  1.00 2.32   ? 29  THR A C    2  
ATOM 2603  O O    . THR A 1 29  ? -11.055 2.700   -2.799  1.00 2.84   ? 29  THR A O    2  
ATOM 2604  C CB   . THR A 1 29  ? -13.399 2.009   -1.289  1.00 3.85   ? 29  THR A CB   2  
ATOM 2605  O OG1  . THR A 1 29  ? -13.198 1.059   -2.309  1.00 5.09   ? 29  THR A OG1  2  
ATOM 2606  C CG2  . THR A 1 29  ? -14.821 1.849   -0.750  1.00 4.59   ? 29  THR A CG2  2  
ATOM 2607  H H    . THR A 1 29  ? -14.290 3.089   -3.578  1.00 3.03   ? 29  THR A H    2  
ATOM 2608  H HA   . THR A 1 29  ? -13.301 4.100   -0.977  1.00 3.62   ? 29  THR A HA   2  
ATOM 2609  H HB   . THR A 1 29  ? -12.695 1.817   -0.477  1.00 4.02   ? 29  THR A HB   2  
ATOM 2610  H HG1  . THR A 1 29  ? -12.284 1.198   -2.602  1.00 5.73   ? 29  THR A HG1  2  
ATOM 2611  H HG21 . THR A 1 29  ? -15.552 1.964   -1.554  1.00 5.11   ? 29  THR A HG21 2  
ATOM 2612  H HG22 . THR A 1 29  ? -14.927 0.853   -0.313  1.00 5.63   ? 29  THR A HG22 2  
ATOM 2613  H HG23 . THR A 1 29  ? -15.009 2.591   0.021   1.00 4.51   ? 29  THR A HG23 2  
ATOM 2614  N N    . VAL A 1 30  ? -11.188 4.834   -2.087  1.00 2.10   ? 30  VAL A N    2  
ATOM 2615  C CA   . VAL A 1 30  ? -9.788  5.186   -2.347  1.00 2.49   ? 30  VAL A CA   2  
ATOM 2616  C C    . VAL A 1 30  ? -8.966  4.810   -1.119  1.00 2.19   ? 30  VAL A C    2  
ATOM 2617  O O    . VAL A 1 30  ? -9.405  4.983   0.015   1.00 2.49   ? 30  VAL A O    2  
ATOM 2618  C CB   . VAL A 1 30  ? -9.588  6.650   -2.802  1.00 3.84   ? 30  VAL A CB   2  
ATOM 2619  C CG1  . VAL A 1 30  ? -10.145 7.706   -1.838  1.00 4.72   ? 30  VAL A CG1  2  
ATOM 2620  C CG2  . VAL A 1 30  ? -8.106  6.949   -3.087  1.00 4.98   ? 30  VAL A CG2  2  
ATOM 2621  H H    . VAL A 1 30  ? -11.751 5.482   -1.534  1.00 2.45   ? 30  VAL A H    2  
ATOM 2622  H HA   . VAL A 1 30  ? -9.439  4.563   -3.171  1.00 2.66   ? 30  VAL A HA   2  
ATOM 2623  H HB   . VAL A 1 30  ? -10.121 6.765   -3.747  1.00 4.47   ? 30  VAL A HB   2  
ATOM 2624  H HG11 . VAL A 1 30  ? -11.225 7.585   -1.740  1.00 5.13   ? 30  VAL A HG11 2  
ATOM 2625  H HG12 . VAL A 1 30  ? -9.669  7.617   -0.863  1.00 5.07   ? 30  VAL A HG12 2  
ATOM 2626  H HG13 . VAL A 1 30  ? -9.956  8.702   -2.236  1.00 5.62   ? 30  VAL A HG13 2  
ATOM 2627  H HG21 . VAL A 1 30  ? -7.689  6.191   -3.747  1.00 5.45   ? 30  VAL A HG21 2  
ATOM 2628  H HG22 . VAL A 1 30  ? -8.014  7.925   -3.571  1.00 5.77   ? 30  VAL A HG22 2  
ATOM 2629  H HG23 . VAL A 1 30  ? -7.535  6.964   -2.157  1.00 5.47   ? 30  VAL A HG23 2  
ATOM 2630  N N    . GLN A 1 31  ? -7.809  4.208   -1.381  1.00 2.17   ? 31  GLN A N    2  
ATOM 2631  C CA   . GLN A 1 31  ? -7.013  3.458   -0.418  1.00 2.18   ? 31  GLN A CA   2  
ATOM 2632  C C    . GLN A 1 31  ? -6.758  4.183   0.916   1.00 2.14   ? 31  GLN A C    2  
ATOM 2633  O O    . GLN A 1 31  ? -5.843  4.994   1.051   1.00 3.44   ? 31  GLN A O    2  
ATOM 2634  C CB   . GLN A 1 31  ? -5.743  2.949   -1.126  1.00 2.59   ? 31  GLN A CB   2  
ATOM 2635  C CG   . GLN A 1 31  ? -4.772  4.012   -1.667  1.00 2.75   ? 31  GLN A CG   2  
ATOM 2636  C CD   . GLN A 1 31  ? -3.520  3.348   -2.222  1.00 2.86   ? 31  GLN A CD   2  
ATOM 2637  O OE1  . GLN A 1 31  ? -2.514  3.222   -1.547  1.00 3.71   ? 31  GLN A OE1  2  
ATOM 2638  N NE2  . GLN A 1 31  ? -3.542  2.860   -3.441  1.00 2.64   ? 31  GLN A NE2  2  
ATOM 2639  H H    . GLN A 1 31  ? -7.581  4.070   -2.353  1.00 2.48   ? 31  GLN A H    2  
ATOM 2640  H HA   . GLN A 1 31  ? -7.593  2.575   -0.147  1.00 2.27   ? 31  GLN A HA   2  
ATOM 2641  H HB2  . GLN A 1 31  ? -5.223  2.287   -0.442  1.00 2.76   ? 31  GLN A HB2  2  
ATOM 2642  H HB3  . GLN A 1 31  ? -6.042  2.338   -1.977  1.00 2.94   ? 31  GLN A HB3  2  
ATOM 2643  H HG2  . GLN A 1 31  ? -5.255  4.593   -2.454  1.00 3.27   ? 31  GLN A HG2  2  
ATOM 2644  H HG3  . GLN A 1 31  ? -4.459  4.693   -0.881  1.00 3.06   ? 31  GLN A HG3  2  
ATOM 2645  H HE21 . GLN A 1 31  ? -4.373  2.864   -3.997  1.00 2.63   ? 31  GLN A HE21 2  
ATOM 2646  H HE22 . GLN A 1 31  ? -2.725  2.321   -3.698  1.00 2.97   ? 31  GLN A HE22 2  
ATOM 2647  N N    . GLY A 1 32  ? -7.556  3.843   1.938   1.00 1.38   ? 32  GLY A N    2  
ATOM 2648  C CA   . GLY A 1 32  ? -7.371  4.304   3.321   1.00 1.52   ? 32  GLY A CA   2  
ATOM 2649  C C    . GLY A 1 32  ? -6.223  3.547   3.980   1.00 1.67   ? 32  GLY A C    2  
ATOM 2650  O O    . GLY A 1 32  ? -6.450  2.755   4.895   1.00 2.98   ? 32  GLY A O    2  
ATOM 2651  H H    . GLY A 1 32  ? -8.372  3.275   1.747   1.00 1.78   ? 32  GLY A H    2  
ATOM 2652  H HA2  . GLY A 1 32  ? -7.125  5.368   3.324   1.00 1.77   ? 32  GLY A HA2  2  
ATOM 2653  H HA3  . GLY A 1 32  ? -8.280  4.131   3.898   1.00 1.74   ? 32  GLY A HA3  2  
ATOM 2654  N N    . ALA A 1 33  ? -5.013  3.759   3.442   1.00 1.12   ? 33  ALA A N    2  
ATOM 2655  C CA   . ALA A 1 33  ? -3.815  2.930   3.580   1.00 1.06   ? 33  ALA A CA   2  
ATOM 2656  C C    . ALA A 1 33  ? -3.607  2.414   5.011   1.00 0.99   ? 33  ALA A C    2  
ATOM 2657  O O    . ALA A 1 33  ? -3.069  3.128   5.859   1.00 1.25   ? 33  ALA A O    2  
ATOM 2658  C CB   . ALA A 1 33  ? -2.618  3.741   3.058   1.00 1.39   ? 33  ALA A CB   2  
ATOM 2659  H H    . ALA A 1 33  ? -4.992  4.448   2.692   1.00 1.73   ? 33  ALA A H    2  
ATOM 2660  H HA   . ALA A 1 33  ? -3.925  2.065   2.932   1.00 1.10   ? 33  ALA A HA   2  
ATOM 2661  H HB1  . ALA A 1 33  ? -1.709  3.141   3.130   1.00 2.36   ? 33  ALA A HB1  2  
ATOM 2662  H HB2  . ALA A 1 33  ? -2.778  4.019   2.014   1.00 2.01   ? 33  ALA A HB2  2  
ATOM 2663  H HB3  . ALA A 1 33  ? -2.492  4.646   3.654   1.00 1.50   ? 33  ALA A HB3  2  
ATOM 2664  N N    . THR A 1 34  ? -4.071  1.180   5.267   1.00 0.91   ? 34  THR A N    2  
ATOM 2665  C CA   . THR A 1 34  ? -4.145  0.618   6.614   1.00 0.87   ? 34  THR A CA   2  
ATOM 2666  C C    . THR A 1 34  ? -2.861  -0.126  6.893   1.00 0.79   ? 34  THR A C    2  
ATOM 2667  O O    . THR A 1 34  ? -2.493  -1.026  6.147   1.00 0.94   ? 34  THR A O    2  
ATOM 2668  C CB   . THR A 1 34  ? -5.325  -0.348  6.772   1.00 1.04   ? 34  THR A CB   2  
ATOM 2669  O OG1  . THR A 1 34  ? -6.490  0.186   6.187   1.00 1.47   ? 34  THR A OG1  2  
ATOM 2670  C CG2  . THR A 1 34  ? -5.630  -0.637  8.242   1.00 1.39   ? 34  THR A CG2  2  
ATOM 2671  H H    . THR A 1 34  ? -4.482  0.638   4.520   1.00 1.09   ? 34  THR A H    2  
ATOM 2672  H HA   . THR A 1 34  ? -4.266  1.430   7.326   1.00 0.86   ? 34  THR A HA   2  
ATOM 2673  H HB   . THR A 1 34  ? -5.081  -1.286  6.281   1.00 1.09   ? 34  THR A HB   2  
ATOM 2674  H HG1  . THR A 1 34  ? -6.356  1.125   5.984   1.00 2.06   ? 34  THR A HG1  2  
ATOM 2675  H HG21 . THR A 1 34  ? -6.520  -1.257  8.317   1.00 2.14   ? 34  THR A HG21 2  
ATOM 2676  H HG22 . THR A 1 34  ? -4.799  -1.177  8.692   1.00 2.25   ? 34  THR A HG22 2  
ATOM 2677  H HG23 . THR A 1 34  ? -5.795  0.296   8.786   1.00 1.93   ? 34  THR A HG23 2  
ATOM 2678  N N    . VAL A 1 35  ? -2.205  0.212   7.992   1.00 0.66   ? 35  VAL A N    2  
ATOM 2679  C CA   . VAL A 1 35  ? -1.047  -0.560  8.489   1.00 0.60   ? 35  VAL A CA   2  
ATOM 2680  C C    . VAL A 1 35  ? -1.558  -1.736  9.316   1.00 0.61   ? 35  VAL A C    2  
ATOM 2681  O O    . VAL A 1 35  ? -2.571  -1.600  10.005  1.00 0.68   ? 35  VAL A O    2  
ATOM 2682  C CB   . VAL A 1 35  ? -0.069  0.247   9.371   1.00 0.66   ? 35  VAL A CB   2  
ATOM 2683  C CG1  . VAL A 1 35  ? 1.346   -0.364  9.347   1.00 0.73   ? 35  VAL A CG1  2  
ATOM 2684  C CG2  . VAL A 1 35  ? 0.051   1.721   8.949   1.00 1.01   ? 35  VAL A CG2  2  
ATOM 2685  H H    . VAL A 1 35  ? -2.608  0.953   8.553   1.00 0.69   ? 35  VAL A H    2  
ATOM 2686  H HA   . VAL A 1 35  ? -0.490  -0.930  7.626   1.00 0.64   ? 35  VAL A HA   2  
ATOM 2687  H HB   . VAL A 1 35  ? -0.438  0.195   10.401  1.00 0.98   ? 35  VAL A HB   2  
ATOM 2688  H HG11 . VAL A 1 35  ? 1.741   -0.363  8.332   1.00 1.65   ? 35  VAL A HG11 2  
ATOM 2689  H HG12 . VAL A 1 35  ? 2.015   0.216   9.989   1.00 1.87   ? 35  VAL A HG12 2  
ATOM 2690  H HG13 . VAL A 1 35  ? 1.331   -1.386  9.725   1.00 1.59   ? 35  VAL A HG13 2  
ATOM 2691  H HG21 . VAL A 1 35  ? 0.339   1.791   7.901   1.00 1.22   ? 35  VAL A HG21 2  
ATOM 2692  H HG22 . VAL A 1 35  ? -0.897  2.239   9.100   1.00 2.09   ? 35  VAL A HG22 2  
ATOM 2693  H HG23 . VAL A 1 35  ? 0.809   2.216   9.559   1.00 2.06   ? 35  VAL A HG23 2  
ATOM 2694  N N    . ALA A 1 36  ? -0.829  -2.853  9.313   1.00 0.64   ? 36  ALA A N    2  
ATOM 2695  C CA   . ALA A 1 36  ? -0.963  -3.870  10.348  1.00 0.78   ? 36  ALA A CA   2  
ATOM 2696  C C    . ALA A 1 36  ? -0.424  -3.368  11.699  1.00 0.87   ? 36  ALA A C    2  
ATOM 2697  O O    . ALA A 1 36  ? 0.779   -3.156  11.873  1.00 1.53   ? 36  ALA A O    2  
ATOM 2698  C CB   . ALA A 1 36  ? -0.286  -5.174  9.908   1.00 0.95   ? 36  ALA A CB   2  
ATOM 2699  H H    . ALA A 1 36  ? -0.024  -2.909  8.692   1.00 0.65   ? 36  ALA A H    2  
ATOM 2700  H HA   . ALA A 1 36  ? -2.021  -4.088  10.468  1.00 0.86   ? 36  ALA A HA   2  
ATOM 2701  H HB1  . ALA A 1 36  ? 0.623   -4.968  9.345   1.00 1.84   ? 36  ALA A HB1  2  
ATOM 2702  H HB2  . ALA A 1 36  ? -0.029  -5.764  10.786  1.00 2.02   ? 36  ALA A HB2  2  
ATOM 2703  H HB3  . ALA A 1 36  ? -0.978  -5.747  9.293   1.00 1.72   ? 36  ALA A HB3  2  
ATOM 2704  N N    . ALA A 1 37  ? -1.321  -3.228  12.669  1.00 0.76   ? 37  ALA A N    2  
ATOM 2705  C CA   . ALA A 1 37  ? -0.987  -3.132  14.084  1.00 0.88   ? 37  ALA A CA   2  
ATOM 2706  C C    . ALA A 1 37  ? -0.221  -4.388  14.558  1.00 0.92   ? 37  ALA A C    2  
ATOM 2707  O O    . ALA A 1 37  ? -0.522  -5.513  14.157  1.00 1.01   ? 37  ALA A O    2  
ATOM 2708  C CB   . ALA A 1 37  ? -2.279  -2.905  14.878  1.00 1.07   ? 37  ALA A CB   2  
ATOM 2709  H H    . ALA A 1 37  ? -2.286  -3.348  12.397  1.00 1.16   ? 37  ALA A H    2  
ATOM 2710  H HA   . ALA A 1 37  ? -0.340  -2.265  14.213  1.00 0.95   ? 37  ALA A HA   2  
ATOM 2711  H HB1  . ALA A 1 37  ? -2.809  -2.040  14.482  1.00 1.82   ? 37  ALA A HB1  2  
ATOM 2712  H HB2  . ALA A 1 37  ? -2.917  -3.784  14.798  1.00 2.12   ? 37  ALA A HB2  2  
ATOM 2713  H HB3  . ALA A 1 37  ? -2.045  -2.729  15.927  1.00 1.66   ? 37  ALA A HB3  2  
ATOM 2714  N N    . VAL A 1 38  ? 0.758   -4.197  15.440  1.00 1.02   ? 38  VAL A N    2  
ATOM 2715  C CA   . VAL A 1 38  ? 1.656   -5.244  15.974  1.00 1.10   ? 38  VAL A CA   2  
ATOM 2716  C C    . VAL A 1 38  ? 1.969   -4.950  17.455  1.00 1.39   ? 38  VAL A C    2  
ATOM 2717  O O    . VAL A 1 38  ? 1.888   -3.782  17.848  1.00 1.63   ? 38  VAL A O    2  
ATOM 2718  C CB   . VAL A 1 38  ? 2.982   -5.333  15.174  1.00 1.07   ? 38  VAL A CB   2  
ATOM 2719  C CG1  . VAL A 1 38  ? 2.774   -6.062  13.836  1.00 2.17   ? 38  VAL A CG1  2  
ATOM 2720  C CG2  . VAL A 1 38  ? 3.640   -3.962  14.924  1.00 1.98   ? 38  VAL A CG2  2  
ATOM 2721  H H    . VAL A 1 38  ? 0.936   -3.254  15.759  1.00 1.08   ? 38  VAL A H    2  
ATOM 2722  H HA   . VAL A 1 38  ? 1.164   -6.216  15.903  1.00 1.12   ? 38  VAL A HA   2  
ATOM 2723  H HB   . VAL A 1 38  ? 3.684   -5.932  15.756  1.00 2.10   ? 38  VAL A HB   2  
ATOM 2724  H HG11 . VAL A 1 38  ? 3.734   -6.200  13.336  1.00 2.73   ? 38  VAL A HG11 2  
ATOM 2725  H HG12 . VAL A 1 38  ? 2.334   -7.045  14.015  1.00 3.01   ? 38  VAL A HG12 2  
ATOM 2726  H HG13 . VAL A 1 38  ? 2.115   -5.487  13.183  1.00 2.92   ? 38  VAL A HG13 2  
ATOM 2727  H HG21 . VAL A 1 38  ? 3.771   -3.434  15.865  1.00 3.09   ? 38  VAL A HG21 2  
ATOM 2728  H HG22 . VAL A 1 38  ? 4.621   -4.103  14.463  1.00 2.61   ? 38  VAL A HG22 2  
ATOM 2729  H HG23 . VAL A 1 38  ? 3.026   -3.355  14.255  1.00 2.88   ? 38  VAL A HG23 2  
ATOM 2730  N N    . PRO A 1 39  ? 2.281   -5.971  18.284  1.00 1.50   ? 39  PRO A N    2  
ATOM 2731  C CA   . PRO A 1 39  ? 2.576   -5.775  19.700  1.00 1.83   ? 39  PRO A CA   2  
ATOM 2732  C C    . PRO A 1 39  ? 3.938   -5.081  19.920  1.00 1.87   ? 39  PRO A C    2  
ATOM 2733  O O    . PRO A 1 39  ? 4.714   -4.945  18.971  1.00 1.64   ? 39  PRO A O    2  
ATOM 2734  C CB   . PRO A 1 39  ? 2.520   -7.180  20.317  1.00 1.95   ? 39  PRO A CB   2  
ATOM 2735  C CG   . PRO A 1 39  ? 2.879   -8.108  19.165  1.00 1.67   ? 39  PRO A CG   2  
ATOM 2736  C CD   . PRO A 1 39  ? 2.307   -7.388  17.946  1.00 1.43   ? 39  PRO A CD   2  
ATOM 2737  H HA   . PRO A 1 39  ? 1.795   -5.158  20.152  1.00 2.08   ? 39  PRO A HA   2  
ATOM 2738  H HB2  . PRO A 1 39  ? 3.214   -7.310  21.145  1.00 2.12   ? 39  PRO A HB2  2  
ATOM 2739  H HB3  . PRO A 1 39  ? 1.501   -7.392  20.644  1.00 2.18   ? 39  PRO A HB3  2  
ATOM 2740  H HG2  . PRO A 1 39  ? 3.962   -8.183  19.077  1.00 1.61   ? 39  PRO A HG2  2  
ATOM 2741  H HG3  . PRO A 1 39  ? 2.440   -9.099  19.285  1.00 1.87   ? 39  PRO A HG3  2  
ATOM 2742  H HD2  . PRO A 1 39  ? 2.926   -7.581  17.070  1.00 1.25   ? 39  PRO A HD2  2  
ATOM 2743  H HD3  . PRO A 1 39  ? 1.285   -7.730  17.761  1.00 1.58   ? 39  PRO A HD3  2  
ATOM 2744  N N    . PRO A 1 40  ? 4.239   -4.645  21.164  1.00 2.31   ? 40  PRO A N    2  
ATOM 2745  C CA   . PRO A 1 40  ? 5.560   -4.156  21.551  1.00 2.56   ? 40  PRO A CA   2  
ATOM 2746  C C    . PRO A 1 40  ? 6.604   -5.277  21.515  1.00 2.61   ? 40  PRO A C    2  
ATOM 2747  O O    . PRO A 1 40  ? 6.253   -6.458  21.536  1.00 3.73   ? 40  PRO A O    2  
ATOM 2748  C CB   . PRO A 1 40  ? 5.394   -3.560  22.952  1.00 3.05   ? 40  PRO A CB   2  
ATOM 2749  C CG   . PRO A 1 40  ? 4.229   -4.355  23.532  1.00 3.14   ? 40  PRO A CG   2  
ATOM 2750  C CD   . PRO A 1 40  ? 3.340   -4.591  22.312  1.00 2.71   ? 40  PRO A CD   2  
ATOM 2751  H HA   . PRO A 1 40  ? 5.870   -3.365  20.872  1.00 2.49   ? 40  PRO A HA   2  
ATOM 2752  H HB2  . PRO A 1 40  ? 6.295   -3.662  23.559  1.00 3.25   ? 40  PRO A HB2  2  
ATOM 2753  H HB3  . PRO A 1 40  ? 5.111   -2.510  22.869  1.00 3.18   ? 40  PRO A HB3  2  
ATOM 2754  H HG2  . PRO A 1 40  ? 4.589   -5.312  23.917  1.00 3.21   ? 40  PRO A HG2  2  
ATOM 2755  H HG3  . PRO A 1 40  ? 3.704   -3.799  24.310  1.00 3.47   ? 40  PRO A HG3  2  
ATOM 2756  H HD2  . PRO A 1 40  ? 2.777   -5.516  22.442  1.00 2.74   ? 40  PRO A HD2  2  
ATOM 2757  H HD3  . PRO A 1 40  ? 2.655   -3.752  22.185  1.00 2.76   ? 40  PRO A HD3  2  
ATOM 2758  N N    . SER A 1 41  ? 7.887   -4.896  21.451  1.00 2.09   ? 41  SER A N    2  
ATOM 2759  C CA   . SER A 1 41  ? 9.046   -5.801  21.300  1.00 2.18   ? 41  SER A CA   2  
ATOM 2760  C C    . SER A 1 41  ? 9.191   -6.299  19.843  1.00 2.06   ? 41  SER A C    2  
ATOM 2761  O O    . SER A 1 41  ? 9.715   -7.379  19.582  1.00 2.47   ? 41  SER A O    2  
ATOM 2762  C CB   . SER A 1 41  ? 9.014   -6.941  22.337  1.00 2.41   ? 41  SER A CB   2  
ATOM 2763  O OG   . SER A 1 41  ? 10.315  -7.281  22.794  1.00 2.80   ? 41  SER A OG   2  
ATOM 2764  H H    . SER A 1 41  ? 8.098   -3.901  21.543  1.00 2.42   ? 41  SER A H    2  
ATOM 2765  H HA   . SER A 1 41  ? 9.947   -5.223  21.504  1.00 2.28   ? 41  SER A HA   2  
ATOM 2766  H HB2  . SER A 1 41  ? 8.436   -6.618  23.203  1.00 2.65   ? 41  SER A HB2  2  
ATOM 2767  H HB3  . SER A 1 41  ? 8.528   -7.815  21.908  1.00 2.29   ? 41  SER A HB3  2  
ATOM 2768  H HG   . SER A 1 41  ? 10.226  -8.078  23.335  1.00 3.58   ? 41  SER A HG   2  
ATOM 2769  N N    . ILE A 1 42  ? 8.678   -5.532  18.869  1.00 1.80   ? 42  ILE A N    2  
ATOM 2770  C CA   . ILE A 1 42  ? 8.624   -5.864  17.434  1.00 1.71   ? 42  ILE A CA   2  
ATOM 2771  C C    . ILE A 1 42  ? 9.313   -4.783  16.577  1.00 1.68   ? 42  ILE A C    2  
ATOM 2772  O O    . ILE A 1 42  ? 9.487   -3.647  17.022  1.00 2.37   ? 42  ILE A O    2  
ATOM 2773  C CB   . ILE A 1 42  ? 7.146   -6.095  17.025  1.00 1.85   ? 42  ILE A CB   2  
ATOM 2774  C CG1  . ILE A 1 42  ? 6.478   -7.244  17.815  1.00 2.11   ? 42  ILE A CG1  2  
ATOM 2775  C CG2  . ILE A 1 42  ? 6.937   -6.333  15.518  1.00 1.89   ? 42  ILE A CG2  2  
ATOM 2776  C CD1  . ILE A 1 42  ? 7.031   -8.655  17.558  1.00 2.37   ? 42  ILE A CD1  2  
ATOM 2777  H H    . ILE A 1 42  ? 8.235   -4.673  19.149  1.00 1.87   ? 42  ILE A H    2  
ATOM 2778  H HA   . ILE A 1 42  ? 9.167   -6.797  17.274  1.00 1.73   ? 42  ILE A HA   2  
ATOM 2779  H HB   . ILE A 1 42  ? 6.603   -5.183  17.270  1.00 2.08   ? 42  ILE A HB   2  
ATOM 2780  H HG12 . ILE A 1 42  ? 6.543   -7.042  18.885  1.00 2.28   ? 42  ILE A HG12 2  
ATOM 2781  H HG13 . ILE A 1 42  ? 5.419   -7.241  17.564  1.00 2.55   ? 42  ILE A HG13 2  
ATOM 2782  H HG21 . ILE A 1 42  ? 5.913   -6.652  15.324  1.00 2.48   ? 42  ILE A HG21 2  
ATOM 2783  H HG22 . ILE A 1 42  ? 7.094   -5.401  14.968  1.00 2.52   ? 42  ILE A HG22 2  
ATOM 2784  H HG23 . ILE A 1 42  ? 7.619   -7.100  15.152  1.00 1.87   ? 42  ILE A HG23 2  
ATOM 2785  H HD11 . ILE A 1 42  ? 6.902   -8.935  16.514  1.00 2.95   ? 42  ILE A HD11 2  
ATOM 2786  H HD12 . ILE A 1 42  ? 8.085   -8.711  17.827  1.00 2.86   ? 42  ILE A HD12 2  
ATOM 2787  H HD13 . ILE A 1 42  ? 6.480   -9.370  18.175  1.00 3.06   ? 42  ILE A HD13 2  
ATOM 2788  N N    . ARG A 1 43  ? 9.714   -5.170  15.357  1.00 1.30   ? 43  ARG A N    2  
ATOM 2789  C CA   . ARG A 1 43  ? 10.503  -4.400  14.371  1.00 1.36   ? 43  ARG A CA   2  
ATOM 2790  C C    . ARG A 1 43  ? 10.115  -4.692  12.898  1.00 1.23   ? 43  ARG A C    2  
ATOM 2791  O O    . ARG A 1 43  ? 10.861  -4.345  11.984  1.00 1.43   ? 43  ARG A O    2  
ATOM 2792  C CB   . ARG A 1 43  ? 11.999  -4.678  14.614  1.00 1.84   ? 43  ARG A CB   2  
ATOM 2793  C CG   . ARG A 1 43  ? 12.356  -6.179  14.598  1.00 2.86   ? 43  ARG A CG   2  
ATOM 2794  C CD   . ARG A 1 43  ? 13.875  -6.341  14.586  1.00 3.42   ? 43  ARG A CD   2  
ATOM 2795  N NE   . ARG A 1 43  ? 14.311  -7.720  14.862  1.00 4.25   ? 43  ARG A NE   2  
ATOM 2796  C CZ   . ARG A 1 43  ? 15.576  -8.076  15.060  1.00 4.71   ? 43  ARG A CZ   2  
ATOM 2797  N NH1  . ARG A 1 43  ? 16.563  -7.220  14.894  1.00 4.68   ? 43  ARG A NH1  2  
ATOM 2798  N NH2  . ARG A 1 43  ? 15.866  -9.319  15.361  1.00 5.60   ? 43  ARG A NH2  2  
ATOM 2799  H H    . ARG A 1 43  ? 9.499   -6.125  15.099  1.00 1.45   ? 43  ARG A H    2  
ATOM 2800  H HA   . ARG A 1 43  ? 10.337  -3.328  14.542  1.00 1.44   ? 43  ARG A HA   2  
ATOM 2801  H HB2  . ARG A 1 43  ? 12.584  -4.150  13.860  1.00 1.98   ? 43  ARG A HB2  2  
ATOM 2802  H HB3  . ARG A 1 43  ? 12.278  -4.263  15.583  1.00 2.29   ? 43  ARG A HB3  2  
ATOM 2803  H HG2  . ARG A 1 43  ? 11.948  -6.657  15.489  1.00 3.52   ? 43  ARG A HG2  2  
ATOM 2804  H HG3  . ARG A 1 43  ? 11.942  -6.654  13.708  1.00 3.30   ? 43  ARG A HG3  2  
ATOM 2805  H HD2  . ARG A 1 43  ? 14.240  -6.044  13.603  1.00 3.68   ? 43  ARG A HD2  2  
ATOM 2806  H HD3  . ARG A 1 43  ? 14.298  -5.676  15.340  1.00 3.44   ? 43  ARG A HD3  2  
ATOM 2807  H HE   . ARG A 1 43  ? 13.601  -8.439  14.927  1.00 4.76   ? 43  ARG A HE   2  
ATOM 2808  H HH11 . ARG A 1 43  ? 16.363  -6.258  14.626  1.00 4.30   ? 43  ARG A HH11 2  
ATOM 2809  H HH12 . ARG A 1 43  ? 17.515  -7.503  15.035  1.00 5.28   ? 43  ARG A HH12 2  
ATOM 2810  H HH21 . ARG A 1 43  ? 15.114  -9.990  15.502  1.00 6.00   ? 43  ARG A HH21 2  
ATOM 2811  H HH22 . ARG A 1 43  ? 16.811  -9.641  15.480  1.00 6.07   ? 43  ARG A HH22 2  
ATOM 2812  N N    . ASP A 1 44  ? 8.934   -5.267  12.665  1.00 1.08   ? 44  ASP A N    2  
ATOM 2813  C CA   . ASP A 1 44  ? 8.401   -5.605  11.343  1.00 1.06   ? 44  ASP A CA   2  
ATOM 2814  C C    . ASP A 1 44  ? 6.879   -5.399  11.326  1.00 0.98   ? 44  ASP A C    2  
ATOM 2815  O O    . ASP A 1 44  ? 6.226   -5.551  12.360  1.00 1.24   ? 44  ASP A O    2  
ATOM 2816  C CB   . ASP A 1 44  ? 8.729   -7.070  11.007  1.00 1.26   ? 44  ASP A CB   2  
ATOM 2817  C CG   . ASP A 1 44  ? 10.223  -7.292  10.762  1.00 1.39   ? 44  ASP A CG   2  
ATOM 2818  O OD1  . ASP A 1 44  ? 10.734  -6.827  9.722   1.00 1.91   ? 44  ASP A OD1  2  
ATOM 2819  O OD2  . ASP A 1 44  ? 10.902  -7.910  11.618  1.00 2.33   ? 44  ASP A OD2  2  
ATOM 2820  H H    . ASP A 1 44  ? 8.330   -5.449  13.451  1.00 1.14   ? 44  ASP A H    2  
ATOM 2821  H HA   . ASP A 1 44  ? 8.847   -4.965  10.579  1.00 1.07   ? 44  ASP A HA   2  
ATOM 2822  H HB2  . ASP A 1 44  ? 8.383   -7.716  11.814  1.00 1.44   ? 44  ASP A HB2  2  
ATOM 2823  H HB3  . ASP A 1 44  ? 8.187   -7.356  10.106  1.00 1.35   ? 44  ASP A HB3  2  
ATOM 2824  N N    . THR A 1 45  ? 6.337   -5.087  10.143  1.00 0.86   ? 45  THR A N    2  
ATOM 2825  C CA   . THR A 1 45  ? 4.907   -4.981  9.808   1.00 0.76   ? 45  THR A CA   2  
ATOM 2826  C C    . THR A 1 45  ? 4.727   -4.731  8.298   1.00 0.65   ? 45  THR A C    2  
ATOM 2827  O O    . THR A 1 45  ? 5.695   -4.778  7.536   1.00 0.83   ? 45  THR A O    2  
ATOM 2828  C CB   . THR A 1 45  ? 4.127   -4.017  10.728  1.00 1.01   ? 45  THR A CB   2  
ATOM 2829  O OG1  . THR A 1 45  ? 2.769   -4.292  10.509  1.00 2.40   ? 45  THR A OG1  2  
ATOM 2830  C CG2  . THR A 1 45  ? 4.394   -2.530  10.479  1.00 1.24   ? 45  THR A CG2  2  
ATOM 2831  H H    . THR A 1 45  ? 6.967   -4.974  9.364   1.00 1.00   ? 45  THR A H    2  
ATOM 2832  H HA   . THR A 1 45  ? 4.473   -5.963  9.984   1.00 0.87   ? 45  THR A HA   2  
ATOM 2833  H HB   . THR A 1 45  ? 4.342   -4.237  11.771  1.00 1.75   ? 45  THR A HB   2  
ATOM 2834  H HG1  . THR A 1 45  ? 2.208   -3.770  11.113  1.00 3.00   ? 45  THR A HG1  2  
ATOM 2835  H HG21 . THR A 1 45  ? 3.852   -1.940  11.219  1.00 2.09   ? 45  THR A HG21 2  
ATOM 2836  H HG22 . THR A 1 45  ? 5.463   -2.328  10.582  1.00 2.13   ? 45  THR A HG22 2  
ATOM 2837  H HG23 . THR A 1 45  ? 4.063   -2.248  9.483   1.00 2.40   ? 45  THR A HG23 2  
ATOM 2838  N N    . ALA A 1 46  ? 3.492   -4.489  7.854   1.00 0.80   ? 46  ALA A N    2  
ATOM 2839  C CA   . ALA A 1 46  ? 3.050   -4.342  6.466   1.00 0.93   ? 46  ALA A CA   2  
ATOM 2840  C C    . ALA A 1 46  ? 1.777   -3.482  6.370   1.00 0.77   ? 46  ALA A C    2  
ATOM 2841  O O    . ALA A 1 46  ? 1.157   -3.229  7.398   1.00 0.81   ? 46  ALA A O    2  
ATOM 2842  C CB   . ALA A 1 46  ? 2.867   -5.755  5.887   1.00 1.20   ? 46  ALA A CB   2  
ATOM 2843  H H    . ALA A 1 46  ? 2.785   -4.374  8.574   1.00 0.97   ? 46  ALA A H    2  
ATOM 2844  H HA   . ALA A 1 46  ? 3.816   -3.816  5.908   1.00 1.14   ? 46  ALA A HA   2  
ATOM 2845  H HB1  . ALA A 1 46  ? 2.486   -5.699  4.866   1.00 1.84   ? 46  ALA A HB1  2  
ATOM 2846  H HB2  . ALA A 1 46  ? 3.819   -6.290  5.888   1.00 2.06   ? 46  ALA A HB2  2  
ATOM 2847  H HB3  . ALA A 1 46  ? 2.151   -6.319  6.486   1.00 1.39   ? 46  ALA A HB3  2  
ATOM 2848  N N    . ALA A 1 47  ? 1.393   -3.042  5.169   1.00 0.78   ? 47  ALA A N    2  
ATOM 2849  C CA   . ALA A 1 47  ? 0.179   -2.267  4.929   1.00 0.71   ? 47  ALA A CA   2  
ATOM 2850  C C    . ALA A 1 47  ? -0.689  -2.894  3.832   1.00 0.77   ? 47  ALA A C    2  
ATOM 2851  O O    . ALA A 1 47  ? -0.212  -3.393  2.813   1.00 0.95   ? 47  ALA A O    2  
ATOM 2852  C CB   . ALA A 1 47  ? 0.517   -0.796  4.669   1.00 0.81   ? 47  ALA A CB   2  
ATOM 2853  H H    . ALA A 1 47  ? 1.926   -3.348  4.366   1.00 0.89   ? 47  ALA A H    2  
ATOM 2854  H HA   . ALA A 1 47  ? -0.416  -2.293  5.843   1.00 0.71   ? 47  ALA A HA   2  
ATOM 2855  H HB1  . ALA A 1 47  ? 0.992   -0.680  3.705   1.00 1.53   ? 47  ALA A HB1  2  
ATOM 2856  H HB2  . ALA A 1 47  ? -0.400  -0.212  4.666   1.00 1.94   ? 47  ALA A HB2  2  
ATOM 2857  H HB3  . ALA A 1 47  ? 1.170   -0.423  5.457   1.00 1.58   ? 47  ALA A HB3  2  
ATOM 2858  N N    . TYR A 1 48  ? -1.994  -2.852  4.070   1.00 0.87   ? 48  TYR A N    2  
ATOM 2859  C CA   . TYR A 1 48  ? -3.049  -3.661  3.466   1.00 1.18   ? 48  TYR A CA   2  
ATOM 2860  C C    . TYR A 1 48  ? -4.160  -2.723  2.963   1.00 1.31   ? 48  TYR A C    2  
ATOM 2861  O O    . TYR A 1 48  ? -4.889  -2.139  3.767   1.00 1.85   ? 48  TYR A O    2  
ATOM 2862  C CB   . TYR A 1 48  ? -3.648  -4.598  4.551   1.00 1.61   ? 48  TYR A CB   2  
ATOM 2863  C CG   . TYR A 1 48  ? -2.707  -5.590  5.216   1.00 1.84   ? 48  TYR A CG   2  
ATOM 2864  C CD1  . TYR A 1 48  ? -1.700  -5.139  6.091   1.00 3.14   ? 48  TYR A CD1  2  
ATOM 2865  C CD2  . TYR A 1 48  ? -2.876  -6.976  5.019   1.00 2.54   ? 48  TYR A CD2  2  
ATOM 2866  C CE1  . TYR A 1 48  ? -0.789  -6.044  6.660   1.00 3.98   ? 48  TYR A CE1  2  
ATOM 2867  C CE2  . TYR A 1 48  ? -2.005  -7.889  5.645   1.00 3.29   ? 48  TYR A CE2  2  
ATOM 2868  C CZ   . TYR A 1 48  ? -0.934  -7.425  6.442   1.00 3.72   ? 48  TYR A CZ   2  
ATOM 2869  O OH   . TYR A 1 48  ? -0.039  -8.293  6.990   1.00 4.83   ? 48  TYR A OH   2  
ATOM 2870  H H    . TYR A 1 48  ? -2.288  -2.297  4.867   1.00 0.91   ? 48  TYR A H    2  
ATOM 2871  H HA   . TYR A 1 48  ? -2.655  -4.253  2.638   1.00 1.25   ? 48  TYR A HA   2  
ATOM 2872  H HB2  . TYR A 1 48  ? -4.075  -3.985  5.350   1.00 2.17   ? 48  TYR A HB2  2  
ATOM 2873  H HB3  . TYR A 1 48  ? -4.480  -5.150  4.108   1.00 2.16   ? 48  TYR A HB3  2  
ATOM 2874  H HD1  . TYR A 1 48  ? -1.597  -4.089  6.313   1.00 4.07   ? 48  TYR A HD1  2  
ATOM 2875  H HD2  . TYR A 1 48  ? -3.680  -7.339  4.393   1.00 3.39   ? 48  TYR A HD2  2  
ATOM 2876  H HE1  . TYR A 1 48  ? 0.031   -5.684  7.259   1.00 5.30   ? 48  TYR A HE1  2  
ATOM 2877  H HE2  . TYR A 1 48  ? -2.130  -8.947  5.510   1.00 4.24   ? 48  TYR A HE2  2  
ATOM 2878  H HH   . TYR A 1 48  ? -0.050  -9.155  6.564   1.00 5.16   ? 48  TYR A HH   2  
ATOM 2879  N N    . MET A 1 49  ? -4.332  -2.562  1.646   1.00 1.06   ? 49  MET A N    2  
ATOM 2880  C CA   . MET A 1 49  ? -5.362  -1.654  1.117   1.00 1.37   ? 49  MET A CA   2  
ATOM 2881  C C    . MET A 1 49  ? -5.860  -1.971  -0.300  1.00 1.12   ? 49  MET A C    2  
ATOM 2882  O O    . MET A 1 49  ? -5.240  -2.705  -1.067  1.00 1.12   ? 49  MET A O    2  
ATOM 2883  C CB   . MET A 1 49  ? -4.907  -0.183  1.267   1.00 1.95   ? 49  MET A CB   2  
ATOM 2884  C CG   . MET A 1 49  ? -3.526  0.135   0.668   1.00 2.14   ? 49  MET A CG   2  
ATOM 2885  S SD   . MET A 1 49  ? -2.140  -0.049  1.818   1.00 3.76   ? 49  MET A SD   2  
ATOM 2886  C CE   . MET A 1 49  ? -0.908  0.938   0.934   1.00 4.57   ? 49  MET A CE   2  
ATOM 2887  H H    . MET A 1 49  ? -3.722  -3.045  0.991   1.00 0.97   ? 49  MET A H    2  
ATOM 2888  H HA   . MET A 1 49  ? -6.242  -1.764  1.752   1.00 1.81   ? 49  MET A HA   2  
ATOM 2889  H HB2  . MET A 1 49  ? -5.649  0.461   0.800   1.00 2.82   ? 49  MET A HB2  2  
ATOM 2890  H HB3  . MET A 1 49  ? -4.895  0.077   2.324   1.00 3.22   ? 49  MET A HB3  2  
ATOM 2891  H HG2  . MET A 1 49  ? -3.349  -0.496  -0.206  1.00 2.95   ? 49  MET A HG2  2  
ATOM 2892  H HG3  . MET A 1 49  ? -3.522  1.172   0.338   1.00 2.52   ? 49  MET A HG3  2  
ATOM 2893  H HE1  . MET A 1 49  ? 0.007   0.983   1.522   1.00 5.40   ? 49  MET A HE1  2  
ATOM 2894  H HE2  . MET A 1 49  ? -0.687  0.481   -0.033  1.00 5.21   ? 49  MET A HE2  2  
ATOM 2895  H HE3  . MET A 1 49  ? -1.280  1.950   0.768   1.00 4.60   ? 49  MET A HE3  2  
ATOM 2896  N N    . THR A 1 50  ? -7.001  -1.369  -0.627  1.00 1.18   ? 50  THR A N    2  
ATOM 2897  C CA   . THR A 1 50  ? -7.677  -1.404  -1.921  1.00 1.09   ? 50  THR A CA   2  
ATOM 2898  C C    . THR A 1 50  ? -7.734  -0.003  -2.499  1.00 1.45   ? 50  THR A C    2  
ATOM 2899  O O    . THR A 1 50  ? -8.079  0.924   -1.774  1.00 1.78   ? 50  THR A O    2  
ATOM 2900  C CB   . THR A 1 50  ? -9.121  -1.876  -1.727  1.00 1.33   ? 50  THR A CB   2  
ATOM 2901  O OG1  . THR A 1 50  ? -9.705  -1.150  -0.671  1.00 2.79   ? 50  THR A OG1  2  
ATOM 2902  C CG2  . THR A 1 50  ? -9.229  -3.363  -1.398  1.00 1.79   ? 50  THR A CG2  2  
ATOM 2903  H H    . THR A 1 50  ? -7.475  -0.846  0.094   1.00 1.45   ? 50  THR A H    2  
ATOM 2904  H HA   . THR A 1 50  ? -7.164  -2.072  -2.614  1.00 1.07   ? 50  THR A HA   2  
ATOM 2905  H HB   . THR A 1 50  ? -9.674  -1.662  -2.637  1.00 2.29   ? 50  THR A HB   2  
ATOM 2906  H HG1  . THR A 1 50  ? -9.620  -0.212  -0.897  1.00 3.94   ? 50  THR A HG1  2  
ATOM 2907  H HG21 . THR A 1 50  ? -10.191 -3.560  -0.933  1.00 2.51   ? 50  THR A HG21 2  
ATOM 2908  H HG22 . THR A 1 50  ? -9.156  -3.944  -2.313  1.00 2.14   ? 50  THR A HG22 2  
ATOM 2909  H HG23 . THR A 1 50  ? -8.445  -3.666  -0.704  1.00 2.97   ? 50  THR A HG23 2  
ATOM 2910  N N    . LEU A 1 51  ? -7.548  0.145   -3.807  1.00 1.63   ? 51  LEU A N    2  
ATOM 2911  C CA   . LEU A 1 51  ? -8.241  1.195   -4.565  1.00 1.71   ? 51  LEU A CA   2  
ATOM 2912  C C    . LEU A 1 51  ? -9.439  0.552   -5.290  1.00 1.57   ? 51  LEU A C    2  
ATOM 2913  O O    . LEU A 1 51  ? -9.656  -0.654  -5.158  1.00 1.94   ? 51  LEU A O    2  
ATOM 2914  C CB   . LEU A 1 51  ? -7.244  1.917   -5.504  1.00 2.10   ? 51  LEU A CB   2  
ATOM 2915  C CG   . LEU A 1 51  ? -7.248  3.453   -5.344  1.00 2.89   ? 51  LEU A CG   2  
ATOM 2916  C CD1  . LEU A 1 51  ? -6.068  4.076   -6.101  1.00 4.07   ? 51  LEU A CD1  2  
ATOM 2917  C CD2  . LEU A 1 51  ? -8.549  4.097   -5.843  1.00 3.28   ? 51  LEU A CD2  2  
ATOM 2918  H H    . LEU A 1 51  ? -7.305  -0.678  -4.336  1.00 1.62   ? 51  LEU A H    2  
ATOM 2919  H HA   . LEU A 1 51  ? -8.670  1.922   -3.872  1.00 1.76   ? 51  LEU A HA   2  
ATOM 2920  H HB2  . LEU A 1 51  ? -6.237  1.555   -5.291  1.00 2.33   ? 51  LEU A HB2  2  
ATOM 2921  H HB3  . LEU A 1 51  ? -7.457  1.654   -6.542  1.00 2.06   ? 51  LEU A HB3  2  
ATOM 2922  H HG   . LEU A 1 51  ? -7.125  3.688   -4.285  1.00 3.55   ? 51  LEU A HG   2  
ATOM 2923  H HD11 . LEU A 1 51  ? -5.136  3.584   -5.828  1.00 4.87   ? 51  LEU A HD11 2  
ATOM 2924  H HD12 . LEU A 1 51  ? -6.229  3.987   -7.171  1.00 4.32   ? 51  LEU A HD12 2  
ATOM 2925  H HD13 . LEU A 1 51  ? -5.990  5.135   -5.848  1.00 4.85   ? 51  LEU A HD13 2  
ATOM 2926  H HD21 . LEU A 1 51  ? -8.475  5.186   -5.781  1.00 3.87   ? 51  LEU A HD21 2  
ATOM 2927  H HD22 . LEU A 1 51  ? -8.733  3.822   -6.882  1.00 3.85   ? 51  LEU A HD22 2  
ATOM 2928  H HD23 . LEU A 1 51  ? -9.391  3.784   -5.231  1.00 3.67   ? 51  LEU A HD23 2  
ATOM 2929  N N    . THR A 1 52  ? -10.207 1.349   -6.039  1.00 1.95   ? 52  THR A N    2  
ATOM 2930  C CA   . THR A 1 52  ? -11.379 0.948   -6.823  1.00 2.10   ? 52  THR A CA   2  
ATOM 2931  C C    . THR A 1 52  ? -11.769 2.098   -7.739  1.00 2.21   ? 52  THR A C    2  
ATOM 2932  O O    . THR A 1 52  ? -11.499 3.255   -7.418  1.00 2.74   ? 52  THR A O    2  
ATOM 2933  C CB   . THR A 1 52  ? -12.528 0.480   -5.907  1.00 2.28   ? 52  THR A CB   2  
ATOM 2934  O OG1  . THR A 1 52  ? -13.305 -0.469  -6.592  1.00 2.69   ? 52  THR A OG1  2  
ATOM 2935  C CG2  . THR A 1 52  ? -13.465 1.589   -5.429  1.00 2.60   ? 52  THR A CG2  2  
ATOM 2936  H H    . THR A 1 52  ? -9.964  2.329   -6.099  1.00 2.57   ? 52  THR A H    2  
ATOM 2937  H HA   . THR A 1 52  ? -11.101 0.114   -7.453  1.00 2.28   ? 52  THR A HA   2  
ATOM 2938  H HB   . THR A 1 52  ? -12.104 -0.005  -5.025  1.00 2.39   ? 52  THR A HB   2  
ATOM 2939  H HG1  . THR A 1 52  ? -14.056 -0.020  -6.991  1.00 3.07   ? 52  THR A HG1  2  
ATOM 2940  H HG21 . THR A 1 52  ? -12.876 2.332   -4.895  1.00 3.49   ? 52  THR A HG21 2  
ATOM 2941  H HG22 . THR A 1 52  ? -13.976 2.064   -6.267  1.00 3.29   ? 52  THR A HG22 2  
ATOM 2942  H HG23 . THR A 1 52  ? -14.210 1.168   -4.757  1.00 2.52   ? 52  THR A HG23 2  
ATOM 2943  N N    . ASN A 1 53  ? -12.432 1.771   -8.843  1.00 1.88   ? 53  ASN A N    2  
ATOM 2944  C CA   . ASN A 1 53  ? -13.015 2.753   -9.751  1.00 1.93   ? 53  ASN A CA   2  
ATOM 2945  C C    . ASN A 1 53  ? -14.511 2.467   -9.933  1.00 2.01   ? 53  ASN A C    2  
ATOM 2946  O O    . ASN A 1 53  ? -14.885 1.326   -10.195 1.00 2.17   ? 53  ASN A O    2  
ATOM 2947  C CB   . ASN A 1 53  ? -12.321 2.654   -11.113 1.00 1.99   ? 53  ASN A CB   2  
ATOM 2948  C CG   . ASN A 1 53  ? -10.826 2.933   -11.095 1.00 2.63   ? 53  ASN A CG   2  
ATOM 2949  O OD1  . ASN A 1 53  ? -10.286 3.646   -10.266 1.00 3.78   ? 53  ASN A OD1  2  
ATOM 2950  N ND2  . ASN A 1 53  ? -10.143 2.369   -12.070 1.00 2.82   ? 53  ASN A ND2  2  
ATOM 2951  H H    . ASN A 1 53  ? -12.563 0.793   -9.059  1.00 1.79   ? 53  ASN A H    2  
ATOM 2952  H HA   . ASN A 1 53  ? -12.886 3.770   -9.363  1.00 2.05   ? 53  ASN A HA   2  
ATOM 2953  H HB2  . ASN A 1 53  ? -12.486 1.653   -11.514 1.00 2.33   ? 53  ASN A HB2  2  
ATOM 2954  H HB3  . ASN A 1 53  ? -12.780 3.358   -11.807 1.00 2.65   ? 53  ASN A HB3  2  
ATOM 2955  H HD21 . ASN A 1 53  ? -10.571 1.724   -12.714 1.00 2.73   ? 53  ASN A HD21 2  
ATOM 2956  H HD22 . ASN A 1 53  ? -9.177  2.645   -12.227 1.00 3.67   ? 53  ASN A HD22 2  
ATOM 2957  N N    . LYS A 1 54  ? -15.370 3.491   -9.852  1.00 2.08   ? 54  LYS A N    2  
ATOM 2958  C CA   . LYS A 1 54  ? -16.794 3.402   -10.237 1.00 2.31   ? 54  LYS A CA   2  
ATOM 2959  C C    . LYS A 1 54  ? -17.203 4.465   -11.289 1.00 2.32   ? 54  LYS A C    2  
ATOM 2960  O O    . LYS A 1 54  ? -18.388 4.733   -11.500 1.00 2.49   ? 54  LYS A O    2  
ATOM 2961  C CB   . LYS A 1 54  ? -17.683 3.409   -8.971  1.00 2.64   ? 54  LYS A CB   2  
ATOM 2962  C CG   . LYS A 1 54  ? -18.873 2.454   -9.171  1.00 3.06   ? 54  LYS A CG   2  
ATOM 2963  C CD   . LYS A 1 54  ? -19.875 2.458   -8.010  1.00 3.57   ? 54  LYS A CD   2  
ATOM 2964  C CE   . LYS A 1 54  ? -20.947 1.403   -8.315  1.00 4.36   ? 54  LYS A CE   2  
ATOM 2965  N NZ   . LYS A 1 54  ? -22.123 1.517   -7.430  1.00 4.78   ? 54  LYS A NZ   2  
ATOM 2966  H H    . LYS A 1 54  ? -15.023 4.377   -9.512  1.00 2.09   ? 54  LYS A H    2  
ATOM 2967  H HA   . LYS A 1 54  ? -16.936 2.443   -10.736 1.00 2.41   ? 54  LYS A HA   2  
ATOM 2968  H HB2  . LYS A 1 54  ? -17.110 3.062   -8.106  1.00 2.74   ? 54  LYS A HB2  2  
ATOM 2969  H HB3  . LYS A 1 54  ? -18.037 4.421   -8.766  1.00 2.96   ? 54  LYS A HB3  2  
ATOM 2970  H HG2  . LYS A 1 54  ? -19.402 2.727   -10.084 1.00 3.37   ? 54  LYS A HG2  2  
ATOM 2971  H HG3  . LYS A 1 54  ? -18.482 1.439   -9.294  1.00 3.31   ? 54  LYS A HG3  2  
ATOM 2972  H HD2  . LYS A 1 54  ? -19.363 2.214   -7.076  1.00 3.62   ? 54  LYS A HD2  2  
ATOM 2973  H HD3  . LYS A 1 54  ? -20.325 3.450   -7.931  1.00 3.92   ? 54  LYS A HD3  2  
ATOM 2974  H HE2  . LYS A 1 54  ? -21.275 1.539   -9.348  1.00 4.94   ? 54  LYS A HE2  2  
ATOM 2975  H HE3  . LYS A 1 54  ? -20.508 0.407   -8.226  1.00 4.64   ? 54  LYS A HE3  2  
ATOM 2976  H HZ1  . LYS A 1 54  ? -22.846 0.860   -7.695  1.00 5.29   ? 54  LYS A HZ1  2  
ATOM 2977  H HZ2  . LYS A 1 54  ? -21.911 1.310   -6.457  1.00 4.80   ? 54  LYS A HZ2  2  
ATOM 2978  H HZ3  . LYS A 1 54  ? -22.526 2.450   -7.462  1.00 5.20   ? 54  LYS A HZ3  2  
ATOM 2979  N N    . SER A 1 55  ? -16.206 5.026   -11.969 1.00 2.44   ? 55  SER A N    2  
ATOM 2980  C CA   . SER A 1 55  ? -16.305 5.981   -13.070 1.00 2.66   ? 55  SER A CA   2  
ATOM 2981  C C    . SER A 1 55  ? -15.080 5.782   -13.988 1.00 2.67   ? 55  SER A C    2  
ATOM 2982  O O    . SER A 1 55  ? -14.207 4.953   -13.720 1.00 2.92   ? 55  SER A O    2  
ATOM 2983  C CB   . SER A 1 55  ? -16.376 7.433   -12.549 1.00 2.96   ? 55  SER A CB   2  
ATOM 2984  O OG   . SER A 1 55  ? -17.513 7.696   -11.747 1.00 3.02   ? 55  SER A OG   2  
ATOM 2985  H H    . SER A 1 55  ? -15.280 4.667   -11.804 1.00 2.58   ? 55  SER A H    2  
ATOM 2986  H HA   . SER A 1 55  ? -17.205 5.786   -13.658 1.00 2.79   ? 55  SER A HA   2  
ATOM 2987  H HB2  . SER A 1 55  ? -15.478 7.630   -11.956 1.00 3.39   ? 55  SER A HB2  2  
ATOM 2988  H HB3  . SER A 1 55  ? -16.373 8.125   -13.390 1.00 3.18   ? 55  SER A HB3  2  
ATOM 2989  H HG   . SER A 1 55  ? -18.206 8.116   -12.271 1.00 3.43   ? 55  SER A HG   2  
ATOM 2990  N N    . ASP A 1 56  ? -14.995 6.554   -15.074 1.00 2.81   ? 56  ASP A N    2  
ATOM 2991  C CA   . ASP A 1 56  ? -14.110 6.419   -16.246 1.00 2.85   ? 56  ASP A CA   2  
ATOM 2992  C C    . ASP A 1 56  ? -12.628 6.796   -16.004 1.00 2.70   ? 56  ASP A C    2  
ATOM 2993  O O    . ASP A 1 56  ? -12.029 7.523   -16.795 1.00 3.16   ? 56  ASP A O    2  
ATOM 2994  C CB   . ASP A 1 56  ? -14.740 7.288   -17.366 1.00 3.57   ? 56  ASP A CB   2  
ATOM 2995  C CG   . ASP A 1 56  ? -14.800 8.792   -17.010 1.00 5.37   ? 56  ASP A CG   2  
ATOM 2996  O OD1  . ASP A 1 56  ? -15.523 9.131   -16.035 1.00 6.09   ? 56  ASP A OD1  2  
ATOM 2997  O OD2  . ASP A 1 56  ? -14.120 9.603   -17.681 1.00 6.74   ? 56  ASP A OD2  2  
ATOM 2998  H H    . ASP A 1 56  ? -15.652 7.324   -15.168 1.00 3.19   ? 56  ASP A H    2  
ATOM 2999  H HA   . ASP A 1 56  ? -14.108 5.367   -16.563 1.00 2.70   ? 56  ASP A HA   2  
ATOM 3000  H HB2  . ASP A 1 56  ? -14.171 7.152   -18.290 1.00 4.09   ? 56  ASP A HB2  2  
ATOM 3001  H HB3  . ASP A 1 56  ? -15.756 6.934   -17.556 1.00 3.14   ? 56  ASP A HB3  2  
ATOM 3002  N N    . GLN A 1 57  ? -12.050 6.359   -14.885 1.00 2.32   ? 57  GLN A N    2  
ATOM 3003  C CA   . GLN A 1 57  ? -10.788 6.887   -14.362 1.00 2.46   ? 57  GLN A CA   2  
ATOM 3004  C C    . GLN A 1 57  ? -9.676  5.818   -14.316 1.00 2.34   ? 57  GLN A C    2  
ATOM 3005  O O    . GLN A 1 57  ? -9.404  5.269   -13.248 1.00 2.54   ? 57  GLN A O    2  
ATOM 3006  C CB   . GLN A 1 57  ? -11.079 7.509   -12.978 1.00 2.71   ? 57  GLN A CB   2  
ATOM 3007  C CG   . GLN A 1 57  ? -12.132 8.638   -13.022 1.00 2.81   ? 57  GLN A CG   2  
ATOM 3008  C CD   . GLN A 1 57  ? -11.742 9.756   -13.984 1.00 3.90   ? 57  GLN A CD   2  
ATOM 3009  O OE1  . GLN A 1 57  ? -10.622 10.242  -13.968 1.00 4.66   ? 57  GLN A OE1  2  
ATOM 3010  N NE2  . GLN A 1 57  ? -12.603 10.182  -14.886 1.00 4.77   ? 57  GLN A NE2  2  
ATOM 3011  H H    . GLN A 1 57  ? -12.606 5.761   -14.279 1.00 2.10   ? 57  GLN A H    2  
ATOM 3012  H HA   . GLN A 1 57  ? -10.419 7.686   -15.010 1.00 2.72   ? 57  GLN A HA   2  
ATOM 3013  H HB2  . GLN A 1 57  ? -11.430 6.731   -12.299 1.00 2.80   ? 57  GLN A HB2  2  
ATOM 3014  H HB3  . GLN A 1 57  ? -10.152 7.918   -12.576 1.00 3.61   ? 57  GLN A HB3  2  
ATOM 3015  H HG2  . GLN A 1 57  ? -13.104 8.229   -13.304 1.00 2.52   ? 57  GLN A HG2  2  
ATOM 3016  H HG3  . GLN A 1 57  ? -12.235 9.065   -12.025 1.00 3.32   ? 57  GLN A HG3  2  
ATOM 3017  H HE21 . GLN A 1 57  ? -13.529 9.790   -14.995 1.00 4.73   ? 57  GLN A HE21 2  
ATOM 3018  H HE22 . GLN A 1 57  ? -12.256 10.852  -15.548 1.00 5.88   ? 57  GLN A HE22 2  
ATOM 3019  N N    . PRO A 1 58  ? -9.011  5.505   -15.451 1.00 2.25   ? 58  PRO A N    2  
ATOM 3020  C CA   . PRO A 1 58  ? -7.900  4.560   -15.510 1.00 2.48   ? 58  PRO A CA   2  
ATOM 3021  C C    . PRO A 1 58  ? -6.605  5.230   -15.017 1.00 2.87   ? 58  PRO A C    2  
ATOM 3022  O O    . PRO A 1 58  ? -5.761  5.657   -15.804 1.00 3.87   ? 58  PRO A O    2  
ATOM 3023  C CB   . PRO A 1 58  ? -7.833  4.107   -16.970 1.00 2.53   ? 58  PRO A CB   2  
ATOM 3024  C CG   . PRO A 1 58  ? -8.269  5.362   -17.730 1.00 2.40   ? 58  PRO A CG   2  
ATOM 3025  C CD   . PRO A 1 58  ? -9.314  5.981   -16.797 1.00 2.17   ? 58  PRO A CD   2  
ATOM 3026  H HA   . PRO A 1 58  ? -8.121  3.698   -14.889 1.00 2.51   ? 58  PRO A HA   2  
ATOM 3027  H HB2  . PRO A 1 58  ? -6.833  3.769   -17.245 1.00 2.88   ? 58  PRO A HB2  2  
ATOM 3028  H HB3  . PRO A 1 58  ? -8.558  3.309   -17.136 1.00 2.45   ? 58  PRO A HB3  2  
ATOM 3029  H HG2  . PRO A 1 58  ? -7.423  6.044   -17.843 1.00 2.63   ? 58  PRO A HG2  2  
ATOM 3030  H HG3  . PRO A 1 58  ? -8.691  5.114   -18.703 1.00 2.43   ? 58  PRO A HG3  2  
ATOM 3031  H HD2  . PRO A 1 58  ? -9.265  7.067   -16.855 1.00 2.28   ? 58  PRO A HD2  2  
ATOM 3032  H HD3  . PRO A 1 58  ? -10.299 5.628   -17.093 1.00 2.02   ? 58  PRO A HD3  2  
ATOM 3033  N N    . ILE A 1 59  ? -6.467  5.356   -13.695 1.00 2.20   ? 59  ILE A N    2  
ATOM 3034  C CA   . ILE A 1 59  ? -5.353  6.072   -13.048 1.00 2.38   ? 59  ILE A CA   2  
ATOM 3035  C C    . ILE A 1 59  ? -4.119  5.177   -12.895 1.00 2.40   ? 59  ILE A C    2  
ATOM 3036  O O    . ILE A 1 59  ? -4.148  4.146   -12.219 1.00 2.47   ? 59  ILE A O    2  
ATOM 3037  C CB   . ILE A 1 59  ? -5.793  6.655   -11.683 1.00 2.48   ? 59  ILE A CB   2  
ATOM 3038  C CG1  . ILE A 1 59  ? -7.021  7.593   -11.786 1.00 2.81   ? 59  ILE A CG1  2  
ATOM 3039  C CG2  . ILE A 1 59  ? -4.629  7.394   -10.991 1.00 2.97   ? 59  ILE A CG2  2  
ATOM 3040  C CD1  . ILE A 1 59  ? -6.888  8.764   -12.772 1.00 4.10   ? 59  ILE A CD1  2  
ATOM 3041  H H    . ILE A 1 59  ? -7.212  4.975   -13.117 1.00 1.70   ? 59  ILE A H    2  
ATOM 3042  H HA   . ILE A 1 59  ? -5.067  6.905   -13.693 1.00 2.70   ? 59  ILE A HA   2  
ATOM 3043  H HB   . ILE A 1 59  ? -6.080  5.822   -11.037 1.00 2.52   ? 59  ILE A HB   2  
ATOM 3044  H HG12 . ILE A 1 59  ? -7.890  7.005   -12.073 1.00 3.05   ? 59  ILE A HG12 2  
ATOM 3045  H HG13 . ILE A 1 59  ? -7.234  8.001   -10.797 1.00 3.08   ? 59  ILE A HG13 2  
ATOM 3046  H HG21 . ILE A 1 59  ? -4.976  7.848   -10.062 1.00 2.90   ? 59  ILE A HG21 2  
ATOM 3047  H HG22 . ILE A 1 59  ? -3.831  6.692   -10.742 1.00 3.66   ? 59  ILE A HG22 2  
ATOM 3048  H HG23 . ILE A 1 59  ? -4.230  8.169   -11.642 1.00 3.65   ? 59  ILE A HG23 2  
ATOM 3049  H HD11 . ILE A 1 59  ? -7.791  9.372   -12.726 1.00 4.29   ? 59  ILE A HD11 2  
ATOM 3050  H HD12 . ILE A 1 59  ? -6.032  9.387   -12.515 1.00 4.75   ? 59  ILE A HD12 2  
ATOM 3051  H HD13 . ILE A 1 59  ? -6.778  8.390   -13.793 1.00 5.07   ? 59  ILE A HD13 2  
ATOM 3052  N N    . LYS A 1 60  ? -2.989  5.610   -13.458 1.00 2.72   ? 60  LYS A N    2  
ATOM 3053  C CA   . LYS A 1 60  ? -1.715  4.890   -13.380 1.00 2.94   ? 60  LYS A CA   2  
ATOM 3054  C C    . LYS A 1 60  ? -1.014  5.168   -12.030 1.00 2.58   ? 60  LYS A C    2  
ATOM 3055  O O    . LYS A 1 60  ? -0.188  6.082   -11.923 1.00 2.94   ? 60  LYS A O    2  
ATOM 3056  C CB   . LYS A 1 60  ? -0.838  5.219   -14.612 1.00 3.57   ? 60  LYS A CB   2  
ATOM 3057  C CG   . LYS A 1 60  ? -1.348  4.711   -15.981 1.00 5.22   ? 60  LYS A CG   2  
ATOM 3058  C CD   . LYS A 1 60  ? -2.351  5.647   -16.683 1.00 4.96   ? 60  LYS A CD   2  
ATOM 3059  C CE   . LYS A 1 60  ? -2.834  5.128   -18.050 1.00 6.60   ? 60  LYS A CE   2  
ATOM 3060  N NZ   . LYS A 1 60  ? -1.860  5.390   -19.141 1.00 7.43   ? 60  LYS A NZ   2  
ATOM 3061  H H    . LYS A 1 60  ? -3.015  6.480   -13.973 1.00 3.02   ? 60  LYS A H    2  
ATOM 3062  H HA   . LYS A 1 60  ? -1.917  3.821   -13.411 1.00 3.22   ? 60  LYS A HA   2  
ATOM 3063  H HB2  . LYS A 1 60  ? -0.659  6.293   -14.667 1.00 3.01   ? 60  LYS A HB2  2  
ATOM 3064  H HB3  . LYS A 1 60  ? 0.124   4.731   -14.447 1.00 4.35   ? 60  LYS A HB3  2  
ATOM 3065  H HG2  . LYS A 1 60  ? -0.485  4.602   -16.639 1.00 6.57   ? 60  LYS A HG2  2  
ATOM 3066  H HG3  . LYS A 1 60  ? -1.797  3.725   -15.857 1.00 6.16   ? 60  LYS A HG3  2  
ATOM 3067  H HD2  . LYS A 1 60  ? -3.226  5.760   -16.050 1.00 4.73   ? 60  LYS A HD2  2  
ATOM 3068  H HD3  . LYS A 1 60  ? -1.904  6.632   -16.814 1.00 4.77   ? 60  LYS A HD3  2  
ATOM 3069  H HE2  . LYS A 1 60  ? -3.046  4.057   -17.973 1.00 7.34   ? 60  LYS A HE2  2  
ATOM 3070  H HE3  . LYS A 1 60  ? -3.773  5.638   -18.289 1.00 6.95   ? 60  LYS A HE3  2  
ATOM 3071  H HZ1  . LYS A 1 60  ? -0.975  4.917   -18.974 1.00 8.10   ? 60  LYS A HZ1  2  
ATOM 3072  H HZ2  . LYS A 1 60  ? -2.191  5.082   -20.051 1.00 8.19   ? 60  LYS A HZ2  2  
ATOM 3073  H HZ3  . LYS A 1 60  ? -1.651  6.383   -19.211 1.00 7.04   ? 60  LYS A HZ3  2  
ATOM 3074  N N    . LEU A 1 61  ? -1.367  4.438   -10.964 1.00 2.22   ? 61  LEU A N    2  
ATOM 3075  C CA   . LEU A 1 61  ? -0.721  4.531   -9.639  1.00 2.18   ? 61  LEU A CA   2  
ATOM 3076  C C    . LEU A 1 61  ? 0.497   3.608   -9.576  1.00 2.01   ? 61  LEU A C    2  
ATOM 3077  O O    . LEU A 1 61  ? 0.369   2.468   -9.986  1.00 2.48   ? 61  LEU A O    2  
ATOM 3078  C CB   . LEU A 1 61  ? -1.721  4.142   -8.524  1.00 2.76   ? 61  LEU A CB   2  
ATOM 3079  C CG   . LEU A 1 61  ? -1.845  5.165   -7.366  1.00 2.82   ? 61  LEU A CG   2  
ATOM 3080  C CD1  . LEU A 1 61  ? -0.500  5.551   -6.734  1.00 3.56   ? 61  LEU A CD1  2  
ATOM 3081  C CD2  . LEU A 1 61  ? -2.600  6.410   -7.842  1.00 3.02   ? 61  LEU A CD2  2  
ATOM 3082  H H    . LEU A 1 61  ? -2.074  3.728   -11.104 1.00 2.35   ? 61  LEU A H    2  
ATOM 3083  H HA   . LEU A 1 61  ? -0.387  5.553   -9.493  1.00 2.10   ? 61  LEU A HA   2  
ATOM 3084  H HB2  . LEU A 1 61  ? -2.707  3.990   -8.958  1.00 3.09   ? 61  LEU A HB2  2  
ATOM 3085  H HB3  . LEU A 1 61  ? -1.435  3.165   -8.118  1.00 3.24   ? 61  LEU A HB3  2  
ATOM 3086  H HG   . LEU A 1 61  ? -2.440  4.729   -6.567  1.00 3.84   ? 61  LEU A HG   2  
ATOM 3087  H HD11 . LEU A 1 61  ? 0.124   6.084   -7.443  1.00 3.99   ? 61  LEU A HD11 2  
ATOM 3088  H HD12 . LEU A 1 61  ? -0.677  6.200   -5.875  1.00 3.51   ? 61  LEU A HD12 2  
ATOM 3089  H HD13 . LEU A 1 61  ? 0.016   4.654   -6.390  1.00 5.01   ? 61  LEU A HD13 2  
ATOM 3090  H HD21 . LEU A 1 61  ? -3.612  6.131   -8.146  1.00 3.87   ? 61  LEU A HD21 2  
ATOM 3091  H HD22 . LEU A 1 61  ? -2.669  7.143   -7.036  1.00 3.10   ? 61  LEU A HD22 2  
ATOM 3092  H HD23 . LEU A 1 61  ? -2.089  6.850   -8.693  1.00 3.71   ? 61  LEU A HD23 2  
ATOM 3093  N N    . VAL A 1 62  ? 1.631   4.043   -9.019  1.00 1.57   ? 62  VAL A N    2  
ATOM 3094  C CA   . VAL A 1 62  ? 2.880   3.243   -8.978  1.00 1.47   ? 62  VAL A CA   2  
ATOM 3095  C C    . VAL A 1 62  ? 3.211   2.650   -7.595  1.00 1.55   ? 62  VAL A C    2  
ATOM 3096  O O    . VAL A 1 62  ? 4.016   1.728   -7.506  1.00 2.18   ? 62  VAL A O    2  
ATOM 3097  C CB   . VAL A 1 62  ? 4.098   4.042   -9.519  1.00 1.62   ? 62  VAL A CB   2  
ATOM 3098  C CG1  . VAL A 1 62  ? 3.771   4.713   -10.869 1.00 2.50   ? 62  VAL A CG1  2  
ATOM 3099  C CG2  . VAL A 1 62  ? 4.614   5.100   -8.531  1.00 1.88   ? 62  VAL A CG2  2  
ATOM 3100  H H    . VAL A 1 62  ? 1.683   5.005   -8.728  1.00 1.53   ? 62  VAL A H    2  
ATOM 3101  H HA   . VAL A 1 62  ? 2.753   2.400   -9.656  1.00 1.66   ? 62  VAL A HA   2  
ATOM 3102  H HB   . VAL A 1 62  ? 4.908   3.340   -9.702  1.00 2.79   ? 62  VAL A HB   2  
ATOM 3103  H HG11 . VAL A 1 62  ? 4.676   5.140   -11.296 1.00 3.16   ? 62  VAL A HG11 2  
ATOM 3104  H HG12 . VAL A 1 62  ? 3.371   3.973   -11.564 1.00 3.26   ? 62  VAL A HG12 2  
ATOM 3105  H HG13 . VAL A 1 62  ? 3.039   5.513   -10.737 1.00 3.19   ? 62  VAL A HG13 2  
ATOM 3106  H HG21 . VAL A 1 62  ? 5.399   5.696   -8.995  1.00 2.57   ? 62  VAL A HG21 2  
ATOM 3107  H HG22 . VAL A 1 62  ? 3.800   5.754   -8.226  1.00 2.42   ? 62  VAL A HG22 2  
ATOM 3108  H HG23 . VAL A 1 62  ? 5.029   4.621   -7.645  1.00 2.95   ? 62  VAL A HG23 2  
ATOM 3109  N N    . GLY A 1 63  ? 2.615   3.157   -6.506  1.00 1.42   ? 63  GLY A N    2  
ATOM 3110  C CA   . GLY A 1 63  ? 2.959   2.744   -5.135  1.00 1.78   ? 63  GLY A CA   2  
ATOM 3111  C C    . GLY A 1 63  ? 2.608   3.698   -4.003  1.00 1.10   ? 63  GLY A C    2  
ATOM 3112  O O    . GLY A 1 63  ? 2.101   4.792   -4.226  1.00 0.93   ? 63  GLY A O    2  
ATOM 3113  H H    . GLY A 1 63  ? 1.917   3.872   -6.626  1.00 1.48   ? 63  GLY A H    2  
ATOM 3114  H HA2  . GLY A 1 63  ? 2.401   1.844   -4.913  1.00 2.44   ? 63  GLY A HA2  2  
ATOM 3115  H HA3  . GLY A 1 63  ? 4.018   2.499   -5.077  1.00 2.35   ? 63  GLY A HA3  2  
ATOM 3116  N N    . ALA A 1 64  ? 2.898   3.236   -2.783  1.00 1.18   ? 64  ALA A N    2  
ATOM 3117  C CA   . ALA A 1 64  ? 2.678   3.927   -1.515  1.00 0.91   ? 64  ALA A CA   2  
ATOM 3118  C C    . ALA A 1 64  ? 3.955   3.821   -0.653  1.00 0.98   ? 64  ALA A C    2  
ATOM 3119  O O    . ALA A 1 64  ? 4.301   2.738   -0.184  1.00 1.44   ? 64  ALA A O    2  
ATOM 3120  C CB   . ALA A 1 64  ? 1.462   3.276   -0.833  1.00 1.23   ? 64  ALA A CB   2  
ATOM 3121  H H    . ALA A 1 64  ? 3.329   2.324   -2.711  1.00 1.64   ? 64  ALA A H    2  
ATOM 3122  H HA   . ALA A 1 64  ? 2.461   4.981   -1.688  1.00 0.85   ? 64  ALA A HA   2  
ATOM 3123  H HB1  . ALA A 1 64  ? 0.548   3.532   -1.372  1.00 1.92   ? 64  ALA A HB1  2  
ATOM 3124  H HB2  . ALA A 1 64  ? 1.578   2.189   -0.806  1.00 2.14   ? 64  ALA A HB2  2  
ATOM 3125  H HB3  . ALA A 1 64  ? 1.375   3.626   0.193   1.00 1.75   ? 64  ALA A HB3  2  
ATOM 3126  N N    . ALA A 1 65  ? 4.656   4.942   -0.470  1.00 0.94   ? 65  ALA A N    2  
ATOM 3127  C CA   . ALA A 1 65  ? 5.904   5.050   0.286   1.00 1.13   ? 65  ALA A CA   2  
ATOM 3128  C C    . ALA A 1 65  ? 5.677   5.598   1.708   1.00 0.96   ? 65  ALA A C    2  
ATOM 3129  O O    . ALA A 1 65  ? 4.660   6.245   1.984   1.00 0.96   ? 65  ALA A O    2  
ATOM 3130  C CB   . ALA A 1 65  ? 6.867   5.941   -0.514  1.00 1.55   ? 65  ALA A CB   2  
ATOM 3131  H H    . ALA A 1 65  ? 4.297   5.796   -0.881  1.00 1.07   ? 65  ALA A H    2  
ATOM 3132  H HA   . ALA A 1 65  ? 6.353   4.057   0.378   1.00 1.30   ? 65  ALA A HA   2  
ATOM 3133  H HB1  . ALA A 1 65  ? 7.029   5.516   -1.507  1.00 1.66   ? 65  ALA A HB1  2  
ATOM 3134  H HB2  . ALA A 1 65  ? 6.450   6.943   -0.621  1.00 2.47   ? 65  ALA A HB2  2  
ATOM 3135  H HB3  . ALA A 1 65  ? 7.832   6.007   -0.010  1.00 2.15   ? 65  ALA A HB3  2  
ATOM 3136  N N    . THR A 1 66  ? 6.650   5.383   2.603   1.00 0.97   ? 66  THR A N    2  
ATOM 3137  C CA   . THR A 1 66  ? 6.609   5.846   4.000   1.00 1.06   ? 66  THR A CA   2  
ATOM 3138  C C    . THR A 1 66  ? 8.012   5.862   4.619   1.00 1.21   ? 66  THR A C    2  
ATOM 3139  O O    . THR A 1 66  ? 8.790   4.959   4.317   1.00 1.15   ? 66  THR A O    2  
ATOM 3140  C CB   . THR A 1 66  ? 5.627   5.009   4.835   1.00 1.10   ? 66  THR A CB   2  
ATOM 3141  O OG1  . THR A 1 66  ? 5.549   5.583   6.116   1.00 1.51   ? 66  THR A OG1  2  
ATOM 3142  C CG2  . THR A 1 66  ? 6.018   3.542   5.013   1.00 1.13   ? 66  THR A CG2  2  
ATOM 3143  H H    . THR A 1 66  ? 7.491   4.902   2.302   1.00 1.06   ? 66  THR A H    2  
ATOM 3144  H HA   . THR A 1 66  ? 6.224   6.861   3.982   1.00 1.15   ? 66  THR A HA   2  
ATOM 3145  H HB   . THR A 1 66  ? 4.639   5.046   4.371   1.00 1.06   ? 66  THR A HB   2  
ATOM 3146  H HG1  . THR A 1 66  ? 4.732   6.118   6.146   1.00 2.14   ? 66  THR A HG1  2  
ATOM 3147  H HG21 . THR A 1 66  ? 5.238   3.029   5.576   1.00 1.99   ? 66  THR A HG21 2  
ATOM 3148  H HG22 . THR A 1 66  ? 6.119   3.060   4.040   1.00 1.59   ? 66  THR A HG22 2  
ATOM 3149  H HG23 . THR A 1 66  ? 6.960   3.457   5.558   1.00 1.80   ? 66  THR A HG23 2  
ATOM 3150  N N    . PRO A 1 67  ? 8.351   6.852   5.475   1.00 1.48   ? 67  PRO A N    2  
ATOM 3151  C CA   . PRO A 1 67  ? 9.605   6.917   6.228   1.00 1.63   ? 67  PRO A CA   2  
ATOM 3152  C C    . PRO A 1 67  ? 9.567   6.126   7.555   1.00 1.56   ? 67  PRO A C    2  
ATOM 3153  O O    . PRO A 1 67  ? 10.491  6.253   8.362   1.00 1.75   ? 67  PRO A O    2  
ATOM 3154  C CB   . PRO A 1 67  ? 9.818   8.418   6.472   1.00 2.03   ? 67  PRO A CB   2  
ATOM 3155  C CG   . PRO A 1 67  ? 8.390   8.920   6.681   1.00 2.10   ? 67  PRO A CG   2  
ATOM 3156  C CD   . PRO A 1 67  ? 7.601   8.088   5.673   1.00 1.74   ? 67  PRO A CD   2  
ATOM 3157  H HA   . PRO A 1 67  ? 10.423  6.524   5.626   1.00 1.61   ? 67  PRO A HA   2  
ATOM 3158  H HB2  . PRO A 1 67  ? 10.456  8.619   7.335   1.00 2.17   ? 67  PRO A HB2  2  
ATOM 3159  H HB3  . PRO A 1 67  ? 10.244  8.872   5.575   1.00 2.17   ? 67  PRO A HB3  2  
ATOM 3160  H HG2  . PRO A 1 67  ? 8.061   8.689   7.696   1.00 2.13   ? 67  PRO A HG2  2  
ATOM 3161  H HG3  . PRO A 1 67  ? 8.309   9.990   6.483   1.00 2.38   ? 67  PRO A HG3  2  
ATOM 3162  H HD2  . PRO A 1 67  ? 6.602   7.896   6.056   1.00 1.67   ? 67  PRO A HD2  2  
ATOM 3163  H HD3  . PRO A 1 67  ? 7.544   8.631   4.729   1.00 1.83   ? 67  PRO A HD3  2  
ATOM 3164  N N    . LEU A 1 68  ? 8.499   5.358   7.839   1.00 1.43   ? 68  LEU A N    2  
ATOM 3165  C CA   . LEU A 1 68  ? 8.368   4.627   9.109   1.00 1.52   ? 68  LEU A CA   2  
ATOM 3166  C C    . LEU A 1 68  ? 9.435   3.538   9.330   1.00 1.23   ? 68  LEU A C    2  
ATOM 3167  O O    . LEU A 1 68  ? 9.755   3.256   10.483  1.00 1.41   ? 68  LEU A O    2  
ATOM 3168  C CB   . LEU A 1 68  ? 6.959   4.010   9.225   1.00 1.87   ? 68  LEU A CB   2  
ATOM 3169  C CG   . LEU A 1 68  ? 6.042   4.777   10.194  1.00 2.61   ? 68  LEU A CG   2  
ATOM 3170  C CD1  . LEU A 1 68  ? 5.688   6.180   9.670   1.00 2.70   ? 68  LEU A CD1  2  
ATOM 3171  C CD2  . LEU A 1 68  ? 4.782   3.943   10.447  1.00 4.49   ? 68  LEU A CD2  2  
ATOM 3172  H H    . LEU A 1 68  ? 7.728   5.314   7.181   1.00 1.37   ? 68  LEU A H    2  
ATOM 3173  H HA   . LEU A 1 68  ? 8.510   5.340   9.922   1.00 1.83   ? 68  LEU A HA   2  
ATOM 3174  H HB2  . LEU A 1 68  ? 6.488   3.935   8.241   1.00 1.60   ? 68  LEU A HB2  2  
ATOM 3175  H HB3  . LEU A 1 68  ? 7.062   2.995   9.609   1.00 2.16   ? 68  LEU A HB3  2  
ATOM 3176  H HG   . LEU A 1 68  ? 6.561   4.891   11.145  1.00 3.01   ? 68  LEU A HG   2  
ATOM 3177  H HD11 . LEU A 1 68  ? 6.589   6.780   9.555   1.00 2.64   ? 68  LEU A HD11 2  
ATOM 3178  H HD12 . LEU A 1 68  ? 5.186   6.102   8.708   1.00 3.69   ? 68  LEU A HD12 2  
ATOM 3179  H HD13 . LEU A 1 68  ? 5.027   6.677   10.378  1.00 3.32   ? 68  LEU A HD13 2  
ATOM 3180  H HD21 . LEU A 1 68  ? 4.279   3.727   9.505   1.00 5.19   ? 68  LEU A HD21 2  
ATOM 3181  H HD22 . LEU A 1 68  ? 5.055   3.003   10.924  1.00 5.52   ? 68  LEU A HD22 2  
ATOM 3182  H HD23 . LEU A 1 68  ? 4.108   4.485   11.106  1.00 4.93   ? 68  LEU A HD23 2  
ATOM 3183  N N    . ALA A 1 69  ? 9.976   2.939   8.264   1.00 1.11   ? 69  ALA A N    2  
ATOM 3184  C CA   . ALA A 1 69  ? 10.993  1.893   8.345   1.00 1.24   ? 69  ALA A CA   2  
ATOM 3185  C C    . ALA A 1 69  ? 12.304  2.335   7.690   1.00 1.18   ? 69  ALA A C    2  
ATOM 3186  O O    . ALA A 1 69  ? 12.302  3.203   6.817   1.00 1.34   ? 69  ALA A O    2  
ATOM 3187  C CB   . ALA A 1 69  ? 10.435  0.617   7.710   1.00 1.61   ? 69  ALA A CB   2  
ATOM 3188  H H    . ALA A 1 69  ? 9.726   3.291   7.353   1.00 1.16   ? 69  ALA A H    2  
ATOM 3189  H HA   . ALA A 1 69  ? 11.217  1.678   9.389   1.00 1.35   ? 69  ALA A HA   2  
ATOM 3190  H HB1  . ALA A 1 69  ? 10.258  0.769   6.645   1.00 1.56   ? 69  ALA A HB1  2  
ATOM 3191  H HB2  . ALA A 1 69  ? 11.146  -0.197  7.836   1.00 2.73   ? 69  ALA A HB2  2  
ATOM 3192  H HB3  . ALA A 1 69  ? 9.504   0.343   8.200   1.00 2.39   ? 69  ALA A HB3  2  
ATOM 3193  N N    . THR A 1 70  ? 13.408  1.697   8.094   1.00 1.16   ? 70  THR A N    2  
ATOM 3194  C CA   . THR A 1 70  ? 14.734  1.877   7.488   1.00 1.18   ? 70  THR A CA   2  
ATOM 3195  C C    . THR A 1 70  ? 14.808  1.220   6.104   1.00 1.13   ? 70  THR A C    2  
ATOM 3196  O O    . THR A 1 70  ? 15.558  1.696   5.257   1.00 1.23   ? 70  THR A O    2  
ATOM 3197  C CB   . THR A 1 70  ? 15.801  1.356   8.462   1.00 1.35   ? 70  THR A CB   2  
ATOM 3198  O OG1  . THR A 1 70  ? 15.616  2.012   9.702   1.00 1.74   ? 70  THR A OG1  2  
ATOM 3199  C CG2  . THR A 1 70  ? 17.240  1.622   8.017   1.00 1.77   ? 70  THR A CG2  2  
ATOM 3200  H H    . THR A 1 70  ? 13.339  1.031   8.861   1.00 1.26   ? 70  THR A H    2  
ATOM 3201  H HA   . THR A 1 70  ? 14.909  2.936   7.328   1.00 1.23   ? 70  THR A HA   2  
ATOM 3202  H HB   . THR A 1 70  ? 15.669  0.282   8.606   1.00 1.60   ? 70  THR A HB   2  
ATOM 3203  H HG1  . THR A 1 70  ? 16.168  2.800   9.742   1.00 2.66   ? 70  THR A HG1  2  
ATOM 3204  H HG21 . THR A 1 70  ? 17.387  2.688   7.815   1.00 2.45   ? 70  THR A HG21 2  
ATOM 3205  H HG22 . THR A 1 70  ? 17.932  1.299   8.795   1.00 2.58   ? 70  THR A HG22 2  
ATOM 3206  H HG23 . THR A 1 70  ? 17.457  1.053   7.112   1.00 2.00   ? 70  THR A HG23 2  
ATOM 3207  N N    . SER A 1 71  ? 13.977  0.208   5.826   1.00 1.07   ? 71  SER A N    2  
ATOM 3208  C CA   . SER A 1 71  ? 13.801  -0.369  4.490   1.00 1.10   ? 71  SER A CA   2  
ATOM 3209  C C    . SER A 1 71  ? 12.304  -0.564  4.139   1.00 1.01   ? 71  SER A C    2  
ATOM 3210  O O    . SER A 1 71  ? 11.786  -1.681  4.263   1.00 0.90   ? 71  SER A O    2  
ATOM 3211  C CB   . SER A 1 71  ? 14.574  -1.699  4.411   1.00 1.24   ? 71  SER A CB   2  
ATOM 3212  O OG   . SER A 1 71  ? 14.206  -2.431  3.248   1.00 1.81   ? 71  SER A OG   2  
ATOM 3213  H H    . SER A 1 71  ? 13.437  -0.200  6.579   1.00 1.07   ? 71  SER A H    2  
ATOM 3214  H HA   . SER A 1 71  ? 14.241  0.286   3.737   1.00 1.17   ? 71  SER A HA   2  
ATOM 3215  H HB2  . SER A 1 71  ? 15.643  -1.496  4.392   1.00 1.82   ? 71  SER A HB2  2  
ATOM 3216  H HB3  . SER A 1 71  ? 14.341  -2.305  5.288   1.00 2.47   ? 71  SER A HB3  2  
ATOM 3217  H HG   . SER A 1 71  ? 13.254  -2.610  3.350   1.00 2.92   ? 71  SER A HG   2  
ATOM 3218  N N    . PRO A 1 72  ? 11.594  0.472   3.640   1.00 1.18   ? 72  PRO A N    2  
ATOM 3219  C CA   . PRO A 1 72  ? 10.277  0.281   3.049   1.00 1.16   ? 72  PRO A CA   2  
ATOM 3220  C C    . PRO A 1 72  ? 10.427  -0.477  1.720   1.00 1.15   ? 72  PRO A C    2  
ATOM 3221  O O    . PRO A 1 72  ? 11.248  -0.122  0.872   1.00 1.39   ? 72  PRO A O    2  
ATOM 3222  C CB   . PRO A 1 72  ? 9.690   1.685   2.881   1.00 1.42   ? 72  PRO A CB   2  
ATOM 3223  C CG   . PRO A 1 72  ? 10.926  2.560   2.688   1.00 1.61   ? 72  PRO A CG   2  
ATOM 3224  C CD   . PRO A 1 72  ? 11.998  1.867   3.531   1.00 1.46   ? 72  PRO A CD   2  
ATOM 3225  H HA   . PRO A 1 72  ? 9.641   -0.297  3.725   1.00 1.05   ? 72  PRO A HA   2  
ATOM 3226  H HB2  . PRO A 1 72  ? 9.006   1.745   2.033   1.00 1.49   ? 72  PRO A HB2  2  
ATOM 3227  H HB3  . PRO A 1 72  ? 9.179   1.975   3.799   1.00 1.47   ? 72  PRO A HB3  2  
ATOM 3228  H HG2  . PRO A 1 72  ? 11.222  2.546   1.638   1.00 1.67   ? 72  PRO A HG2  2  
ATOM 3229  H HG3  . PRO A 1 72  ? 10.753  3.583   3.017   1.00 1.80   ? 72  PRO A HG3  2  
ATOM 3230  H HD2  . PRO A 1 72  ? 12.957  1.982   3.033   1.00 1.52   ? 72  PRO A HD2  2  
ATOM 3231  H HD3  . PRO A 1 72  ? 12.029  2.317   4.522   1.00 1.55   ? 72  PRO A HD3  2  
ATOM 3232  N N    . MET A 1 73  ? 9.638   -1.541  1.553   1.00 1.01   ? 73  MET A N    2  
ATOM 3233  C CA   . MET A 1 73  ? 9.732   -2.506  0.453   1.00 1.11   ? 73  MET A CA   2  
ATOM 3234  C C    . MET A 1 73  ? 8.325   -2.899  -0.003  1.00 1.01   ? 73  MET A C    2  
ATOM 3235  O O    . MET A 1 73  ? 7.419   -2.918  0.823   1.00 1.34   ? 73  MET A O    2  
ATOM 3236  C CB   . MET A 1 73  ? 10.509  -3.717  0.980   1.00 1.25   ? 73  MET A CB   2  
ATOM 3237  C CG   . MET A 1 73  ? 10.895  -4.718  -0.113  1.00 1.47   ? 73  MET A CG   2  
ATOM 3238  S SD   . MET A 1 73  ? 11.932  -6.071  0.494   1.00 1.74   ? 73  MET A SD   2  
ATOM 3239  C CE   . MET A 1 73  ? 13.424  -5.139  0.927   1.00 3.01   ? 73  MET A CE   2  
ATOM 3240  H H    . MET A 1 73  ? 8.965   -1.768  2.285   1.00 0.94   ? 73  MET A H    2  
ATOM 3241  H HA   . MET A 1 73  ? 10.270  -2.068  -0.383  1.00 1.30   ? 73  MET A HA   2  
ATOM 3242  H HB2  . MET A 1 73  ? 11.421  -3.350  1.453   1.00 1.65   ? 73  MET A HB2  2  
ATOM 3243  H HB3  . MET A 1 73  ? 9.919   -4.230  1.743   1.00 1.32   ? 73  MET A HB3  2  
ATOM 3244  H HG2  . MET A 1 73  ? 9.994   -5.158  -0.542  1.00 2.22   ? 73  MET A HG2  2  
ATOM 3245  H HG3  . MET A 1 73  ? 11.439  -4.199  -0.906  1.00 2.48   ? 73  MET A HG3  2  
ATOM 3246  H HE1  . MET A 1 73  ? 13.702  -4.485  0.104   1.00 3.41   ? 73  MET A HE1  2  
ATOM 3247  H HE2  . MET A 1 73  ? 13.261  -4.544  1.826   1.00 4.20   ? 73  MET A HE2  2  
ATOM 3248  H HE3  . MET A 1 73  ? 14.235  -5.838  1.112   1.00 3.63   ? 73  MET A HE3  2  
ATOM 3249  N N    . LEU A 1 74  ? 8.114   -3.173  -1.295  1.00 0.83   ? 74  LEU A N    2  
ATOM 3250  C CA   . LEU A 1 74  ? 6.772   -3.263  -1.867  1.00 0.89   ? 74  LEU A CA   2  
ATOM 3251  C C    . LEU A 1 74  ? 6.615   -4.461  -2.800  1.00 0.94   ? 74  LEU A C    2  
ATOM 3252  O O    . LEU A 1 74  ? 7.481   -4.745  -3.621  1.00 1.07   ? 74  LEU A O    2  
ATOM 3253  C CB   . LEU A 1 74  ? 6.320   -1.928  -2.504  1.00 1.11   ? 74  LEU A CB   2  
ATOM 3254  C CG   . LEU A 1 74  ? 7.385   -0.826  -2.736  1.00 1.39   ? 74  LEU A CG   2  
ATOM 3255  C CD1  . LEU A 1 74  ? 8.361   -1.186  -3.868  1.00 2.07   ? 74  LEU A CD1  2  
ATOM 3256  C CD2  . LEU A 1 74  ? 6.726   0.527   -3.052  1.00 2.66   ? 74  LEU A CD2  2  
ATOM 3257  H H    . LEU A 1 74  ? 8.894   -3.224  -1.931  1.00 0.91   ? 74  LEU A H    2  
ATOM 3258  H HA   . LEU A 1 74  ? 6.081   -3.458  -1.056  1.00 0.93   ? 74  LEU A HA   2  
ATOM 3259  H HB2  . LEU A 1 74  ? 5.832   -2.161  -3.442  1.00 1.49   ? 74  LEU A HB2  2  
ATOM 3260  H HB3  . LEU A 1 74  ? 5.546   -1.508  -1.866  1.00 1.64   ? 74  LEU A HB3  2  
ATOM 3261  H HG   . LEU A 1 74  ? 7.955   -0.674  -1.820  1.00 2.43   ? 74  LEU A HG   2  
ATOM 3262  H HD11 . LEU A 1 74  ? 7.820   -1.296  -4.809  1.00 3.07   ? 74  LEU A HD11 2  
ATOM 3263  H HD12 . LEU A 1 74  ? 9.107   -0.399  -3.979  1.00 2.51   ? 74  LEU A HD12 2  
ATOM 3264  H HD13 . LEU A 1 74  ? 8.874   -2.121  -3.651  1.00 2.82   ? 74  LEU A HD13 2  
ATOM 3265  H HD21 . LEU A 1 74  ? 6.216   0.495   -4.013  1.00 3.39   ? 74  LEU A HD21 2  
ATOM 3266  H HD22 . LEU A 1 74  ? 6.013   0.786   -2.268  1.00 3.48   ? 74  LEU A HD22 2  
ATOM 3267  H HD23 . LEU A 1 74  ? 7.493   1.305   -3.093  1.00 3.31   ? 74  LEU A HD23 2  
ATOM 3268  N N    . MET A 1 75  ? 5.495   -5.175  -2.655  1.00 1.04   ? 75  MET A N    2  
ATOM 3269  C CA   . MET A 1 75  ? 5.165   -6.366  -3.436  1.00 1.25   ? 75  MET A CA   2  
ATOM 3270  C C    . MET A 1 75  ? 3.666   -6.414  -3.765  1.00 1.36   ? 75  MET A C    2  
ATOM 3271  O O    . MET A 1 75  ? 2.849   -5.843  -3.044  1.00 1.79   ? 75  MET A O    2  
ATOM 3272  C CB   . MET A 1 75  ? 5.561   -7.635  -2.655  1.00 1.49   ? 75  MET A CB   2  
ATOM 3273  C CG   . MET A 1 75  ? 7.053   -7.674  -2.288  1.00 1.96   ? 75  MET A CG   2  
ATOM 3274  S SD   . MET A 1 75  ? 7.576   -9.183  -1.438  1.00 2.15   ? 75  MET A SD   2  
ATOM 3275  C CE   . MET A 1 75  ? 9.335   -8.790  -1.243  1.00 3.33   ? 75  MET A CE   2  
ATOM 3276  H H    . MET A 1 75  ? 4.839   -4.939  -1.919  1.00 1.10   ? 75  MET A H    2  
ATOM 3277  H HA   . MET A 1 75  ? 5.717   -6.347  -4.372  1.00 1.38   ? 75  MET A HA   2  
ATOM 3278  H HB2  . MET A 1 75  ? 4.978   -7.695  -1.734  1.00 2.39   ? 75  MET A HB2  2  
ATOM 3279  H HB3  . MET A 1 75  ? 5.327   -8.517  -3.255  1.00 2.13   ? 75  MET A HB3  2  
ATOM 3280  H HG2  . MET A 1 75  ? 7.653   -7.558  -3.194  1.00 2.75   ? 75  MET A HG2  2  
ATOM 3281  H HG3  . MET A 1 75  ? 7.278   -6.836  -1.627  1.00 3.03   ? 75  MET A HG3  2  
ATOM 3282  H HE1  . MET A 1 75  ? 9.458   -7.892  -0.640  1.00 4.13   ? 75  MET A HE1  2  
ATOM 3283  H HE2  . MET A 1 75  ? 9.839   -9.623  -0.749  1.00 3.95   ? 75  MET A HE2  2  
ATOM 3284  H HE3  . MET A 1 75  ? 9.789   -8.634  -2.220  1.00 3.96   ? 75  MET A HE3  2  
ATOM 3285  N N    . THR A 1 76  ? 3.330   -7.118  -4.849  1.00 1.28   ? 76  THR A N    2  
ATOM 3286  C CA   . THR A 1 76  ? 1.977   -7.592  -5.189  1.00 1.33   ? 76  THR A CA   2  
ATOM 3287  C C    . THR A 1 76  ? 2.098   -8.838  -6.063  1.00 1.46   ? 76  THR A C    2  
ATOM 3288  O O    . THR A 1 76  ? 3.206   -9.188  -6.478  1.00 1.77   ? 76  THR A O    2  
ATOM 3289  C CB   . THR A 1 76  ? 1.136   -6.491  -5.855  1.00 1.54   ? 76  THR A CB   2  
ATOM 3290  O OG1  . THR A 1 76  ? -0.214  -6.879  -5.745  1.00 2.52   ? 76  THR A OG1  2  
ATOM 3291  C CG2  . THR A 1 76  ? 1.453   -6.279  -7.339  1.00 2.07   ? 76  THR A CG2  2  
ATOM 3292  H H    . THR A 1 76  ? 4.085   -7.486  -5.416  1.00 1.36   ? 76  THR A H    2  
ATOM 3293  H HA   . THR A 1 76  ? 1.470   -7.880  -4.270  1.00 1.29   ? 76  THR A HA   2  
ATOM 3294  H HB   . THR A 1 76  ? 1.278   -5.557  -5.314  1.00 1.66   ? 76  THR A HB   2  
ATOM 3295  H HG1  . THR A 1 76  ? -0.741  -6.079  -5.629  1.00 3.11   ? 76  THR A HG1  2  
ATOM 3296  H HG21 . THR A 1 76  ? 2.513   -6.085  -7.469  1.00 2.56   ? 76  THR A HG21 2  
ATOM 3297  H HG22 . THR A 1 76  ? 1.181   -7.165  -7.912  1.00 2.89   ? 76  THR A HG22 2  
ATOM 3298  H HG23 . THR A 1 76  ? 0.886   -5.437  -7.721  1.00 2.77   ? 76  THR A HG23 2  
ATOM 3299  N N    . THR A 1 77  ? 0.971   -9.482  -6.379  1.00 1.50   ? 77  THR A N    2  
ATOM 3300  C CA   . THR A 1 77  ? 0.839   -10.569 -7.358  1.00 1.70   ? 77  THR A CA   2  
ATOM 3301  C C    . THR A 1 77  ? -0.629  -10.681 -7.746  1.00 1.89   ? 77  THR A C    2  
ATOM 3302  O O    . THR A 1 77  ? -1.487  -10.693 -6.865  1.00 2.69   ? 77  THR A O    2  
ATOM 3303  C CB   . THR A 1 77  ? 1.385   -11.893 -6.795  1.00 1.72   ? 77  THR A CB   2  
ATOM 3304  O OG1  . THR A 1 77  ? 2.778   -11.828 -6.937  1.00 2.36   ? 77  THR A OG1  2  
ATOM 3305  C CG2  . THR A 1 77  ? 0.933   -13.162 -7.525  1.00 3.02   ? 77  THR A CG2  2  
ATOM 3306  H H    . THR A 1 77  ? 0.117   -9.124  -5.968  1.00 1.59   ? 77  THR A H    2  
ATOM 3307  H HA   . THR A 1 77  ? 1.411   -10.328 -8.253  1.00 2.11   ? 77  THR A HA   2  
ATOM 3308  H HB   . THR A 1 77  ? 1.119   -11.982 -5.743  1.00 2.06   ? 77  THR A HB   2  
ATOM 3309  H HG1  . THR A 1 77  ? 3.041   -10.947 -6.623  1.00 2.91   ? 77  THR A HG1  2  
ATOM 3310  H HG21 . THR A 1 77  ? -0.139  -13.312 -7.390  1.00 4.18   ? 77  THR A HG21 2  
ATOM 3311  H HG22 . THR A 1 77  ? 1.174   -13.089 -8.583  1.00 3.72   ? 77  THR A HG22 2  
ATOM 3312  H HG23 . THR A 1 77  ? 1.449   -14.018 -7.091  1.00 3.34   ? 77  THR A HG23 2  
ATOM 3313  N N    . THR A 1 78  ? -0.890  -10.784 -9.054  1.00 2.05   ? 78  THR A N    2  
ATOM 3314  C CA   . THR A 1 78  ? -2.203  -11.060 -9.664  1.00 2.17   ? 78  THR A CA   2  
ATOM 3315  C C    . THR A 1 78  ? -2.077  -11.276 -11.172 1.00 2.36   ? 78  THR A C    2  
ATOM 3316  O O    . THR A 1 78  ? -1.176  -10.735 -11.810 1.00 3.50   ? 78  THR A O    2  
ATOM 3317  C CB   . THR A 1 78  ? -3.255  -9.985  -9.328  1.00 3.92   ? 78  THR A CB   2  
ATOM 3318  O OG1  . THR A 1 78  ? -4.489  -10.480 -9.779  1.00 4.63   ? 78  THR A OG1  2  
ATOM 3319  C CG2  . THR A 1 78  ? -3.021  -8.621  -9.977  1.00 5.40   ? 78  THR A CG2  2  
ATOM 3320  H H    . THR A 1 78  ? -0.100  -10.731 -9.681  1.00 2.59   ? 78  THR A H    2  
ATOM 3321  H HA   . THR A 1 78  ? -2.564  -11.989 -9.228  1.00 2.09   ? 78  THR A HA   2  
ATOM 3322  H HB   . THR A 1 78  ? -3.316  -9.850  -8.249  1.00 4.19   ? 78  THR A HB   2  
ATOM 3323  H HG1  . THR A 1 78  ? -5.017  -9.728  -10.110 1.00 5.54   ? 78  THR A HG1  2  
ATOM 3324  H HG21 . THR A 1 78  ? -3.811  -7.941  -9.670  1.00 6.49   ? 78  THR A HG21 2  
ATOM 3325  H HG22 . THR A 1 78  ? -2.063  -8.219  -9.643  1.00 5.54   ? 78  THR A HG22 2  
ATOM 3326  H HG23 . THR A 1 78  ? -3.027  -8.699  -11.061 1.00 5.76   ? 78  THR A HG23 2  
ATOM 3327  N N    . HIS A 1 79  ? -3.009  -12.032 -11.749 1.00 2.46   ? 79  HIS A N    2  
ATOM 3328  C CA   . HIS A 1 79  ? -3.167  -12.266 -13.194 1.00 3.72   ? 79  HIS A CA   2  
ATOM 3329  C C    . HIS A 1 79  ? -4.578  -11.847 -13.686 1.00 4.12   ? 79  HIS A C    2  
ATOM 3330  O O    . HIS A 1 79  ? -5.110  -12.352 -14.677 1.00 5.64   ? 79  HIS A O    2  
ATOM 3331  C CB   . HIS A 1 79  ? -2.846  -13.745 -13.492 1.00 4.96   ? 79  HIS A CB   2  
ATOM 3332  C CG   . HIS A 1 79  ? -3.829  -14.743 -12.924 1.00 4.99   ? 79  HIS A CG   2  
ATOM 3333  N ND1  . HIS A 1 79  ? -4.958  -15.212 -13.557 1.00 6.12   ? 79  HIS A ND1  2  
ATOM 3334  C CD2  . HIS A 1 79  ? -3.776  -15.357 -11.700 1.00 4.72   ? 79  HIS A CD2  2  
ATOM 3335  C CE1  . HIS A 1 79  ? -5.579  -16.068 -12.728 1.00 6.20   ? 79  HIS A CE1  2  
ATOM 3336  N NE2  . HIS A 1 79  ? -4.897  -16.195 -11.580 1.00 5.48   ? 79  HIS A NE2  2  
ATOM 3337  H H    . HIS A 1 79  ? -3.739  -12.375 -11.138 1.00 2.33   ? 79  HIS A H    2  
ATOM 3338  H HA   . HIS A 1 79  ? -2.455  -11.643 -13.741 1.00 4.01   ? 79  HIS A HA   2  
ATOM 3339  H HB2  . HIS A 1 79  ? -2.802  -13.882 -14.579 1.00 6.05   ? 79  HIS A HB2  2  
ATOM 3340  H HB3  . HIS A 1 79  ? -1.848  -13.975 -13.108 1.00 5.49   ? 79  HIS A HB3  2  
ATOM 3341  H HD1  . HIS A 1 79  ? -5.281  -14.939 -14.476 1.00 7.11   ? 79  HIS A HD1  2  
ATOM 3342  H HD2  . HIS A 1 79  ? -3.004  -15.218 -10.954 1.00 4.66   ? 79  HIS A HD2  2  
ATOM 3343  H HE1  . HIS A 1 79  ? -6.503  -16.582 -12.953 1.00 7.16   ? 79  HIS A HE1  2  
ATOM 3344  N N    . SER A 1 80  ? -5.238  -10.966 -12.932 1.00 3.12   ? 80  SER A N    2  
ATOM 3345  C CA   . SER A 1 80  ? -6.665  -10.611 -13.001 1.00 3.53   ? 80  SER A CA   2  
ATOM 3346  C C    . SER A 1 80  ? -6.940  -9.399  -12.094 1.00 2.66   ? 80  SER A C    2  
ATOM 3347  O O    . SER A 1 80  ? -6.063  -8.976  -11.340 1.00 3.55   ? 80  SER A O    2  
ATOM 3348  C CB   . SER A 1 80  ? -7.544  -11.817 -12.617 1.00 4.80   ? 80  SER A CB   2  
ATOM 3349  O OG   . SER A 1 80  ? -7.478  -12.818 -13.614 1.00 6.60   ? 80  SER A OG   2  
ATOM 3350  H H    . SER A 1 80  ? -4.735  -10.544 -12.157 1.00 2.37   ? 80  SER A H    2  
ATOM 3351  H HA   . SER A 1 80  ? -6.922  -10.310 -14.019 1.00 4.87   ? 80  SER A HA   2  
ATOM 3352  H HB2  . SER A 1 80  ? -7.209  -12.224 -11.662 1.00 4.84   ? 80  SER A HB2  2  
ATOM 3353  H HB3  . SER A 1 80  ? -8.584  -11.501 -12.512 1.00 5.17   ? 80  SER A HB3  2  
ATOM 3354  H HG   . SER A 1 80  ? -6.621  -12.706 -14.073 1.00 6.97   ? 80  SER A HG   2  
ATOM 3355  N N    . GLY A 1 81  ? -8.132  -8.801  -12.177 1.00 2.51   ? 81  GLY A N    2  
ATOM 3356  C CA   . GLY A 1 81  ? -8.366  -7.406  -11.755 1.00 3.27   ? 81  GLY A CA   2  
ATOM 3357  C C    . GLY A 1 81  ? -8.213  -6.427  -12.927 1.00 3.52   ? 81  GLY A C    2  
ATOM 3358  O O    . GLY A 1 81  ? -7.935  -5.244  -12.742 1.00 4.76   ? 81  GLY A O    2  
ATOM 3359  H H    . GLY A 1 81  ? -8.868  -9.242  -12.727 1.00 3.03   ? 81  GLY A H    2  
ATOM 3360  H HA2  . GLY A 1 81  ? -9.385  -7.301  -11.389 1.00 4.03   ? 81  GLY A HA2  2  
ATOM 3361  H HA3  . GLY A 1 81  ? -7.661  -7.109  -10.980 1.00 3.95   ? 81  GLY A HA3  2  
ATOM 3362  N N    . GLY A 1 82  ? -8.349  -6.932  -14.161 1.00 3.07   ? 82  GLY A N    2  
ATOM 3363  C CA   . GLY A 1 82  ? -8.234  -6.182  -15.417 1.00 3.63   ? 82  GLY A CA   2  
ATOM 3364  C C    . GLY A 1 82  ? -6.811  -6.163  -15.966 1.00 3.38   ? 82  GLY A C    2  
ATOM 3365  O O    . GLY A 1 82  ? -6.643  -6.088  -17.181 1.00 3.74   ? 82  GLY A O    2  
ATOM 3366  H H    . GLY A 1 82  ? -8.521  -7.921  -14.238 1.00 3.02   ? 82  GLY A H    2  
ATOM 3367  H HA2  . GLY A 1 82  ? -8.871  -6.642  -16.172 1.00 4.19   ? 82  GLY A HA2  2  
ATOM 3368  H HA3  . GLY A 1 82  ? -8.532  -5.144  -15.269 1.00 4.00   ? 82  GLY A HA3  2  
ATOM 3369  N N    . MET A 1 83  ? -5.801  -6.283  -15.096 1.00 2.93   ? 83  MET A N    2  
ATOM 3370  C CA   . MET A 1 83  ? -4.385  -6.301  -15.473 1.00 2.76   ? 83  MET A CA   2  
ATOM 3371  C C    . MET A 1 83  ? -3.538  -7.022  -14.409 1.00 2.68   ? 83  MET A C    2  
ATOM 3372  O O    . MET A 1 83  ? -3.915  -7.072  -13.237 1.00 2.78   ? 83  MET A O    2  
ATOM 3373  C CB   . MET A 1 83  ? -3.917  -4.847  -15.702 1.00 3.03   ? 83  MET A CB   2  
ATOM 3374  C CG   . MET A 1 83  ? -2.561  -4.708  -16.404 1.00 3.37   ? 83  MET A CG   2  
ATOM 3375  S SD   . MET A 1 83  ? -2.176  -2.994  -16.851 1.00 4.59   ? 83  MET A SD   2  
ATOM 3376  C CE   . MET A 1 83  ? -0.710  -3.283  -17.869 1.00 5.05   ? 83  MET A CE   2  
ATOM 3377  H H    . MET A 1 83  ? -6.010  -6.325  -14.106 1.00 2.92   ? 83  MET A H    2  
ATOM 3378  H HA   . MET A 1 83  ? -4.316  -6.866  -16.401 1.00 2.85   ? 83  MET A HA   2  
ATOM 3379  H HB2  . MET A 1 83  ? -4.654  -4.341  -16.327 1.00 3.27   ? 83  MET A HB2  2  
ATOM 3380  H HB3  . MET A 1 83  ? -3.876  -4.324  -14.745 1.00 3.22   ? 83  MET A HB3  2  
ATOM 3381  H HG2  . MET A 1 83  ? -1.772  -5.084  -15.755 1.00 3.14   ? 83  MET A HG2  2  
ATOM 3382  H HG3  . MET A 1 83  ? -2.579  -5.302  -17.322 1.00 4.07   ? 83  MET A HG3  2  
ATOM 3383  H HE1  . MET A 1 83  ? -0.390  -2.335  -18.316 1.00 5.68   ? 83  MET A HE1  2  
ATOM 3384  H HE2  . MET A 1 83  ? 0.100   -3.682  -17.255 1.00 5.05   ? 83  MET A HE2  2  
ATOM 3385  H HE3  . MET A 1 83  ? -0.941  -3.978  -18.665 1.00 5.54   ? 83  MET A HE3  2  
ATOM 3386  N N    . ALA A 1 84  ? -2.401  -7.601  -14.805 1.00 2.70   ? 84  ALA A N    2  
ATOM 3387  C CA   . ALA A 1 84  ? -1.481  -8.264  -13.888 1.00 2.79   ? 84  ALA A CA   2  
ATOM 3388  C C    . ALA A 1 84  ? -0.757  -7.279  -12.945 1.00 3.63   ? 84  ALA A C    2  
ATOM 3389  O O    . ALA A 1 84  ? -0.701  -6.076  -13.198 1.00 4.65   ? 84  ALA A O    2  
ATOM 3390  C CB   . ALA A 1 84  ? -0.498  -9.111  -14.707 1.00 3.48   ? 84  ALA A CB   2  
ATOM 3391  H H    . ALA A 1 84  ? -2.206  -7.657  -15.791 1.00 2.78   ? 84  ALA A H    2  
ATOM 3392  H HA   . ALA A 1 84  ? -2.064  -8.932  -13.254 1.00 2.36   ? 84  ALA A HA   2  
ATOM 3393  H HB1  . ALA A 1 84  ? 0.151   -9.679  -14.036 1.00 3.69   ? 84  ALA A HB1  2  
ATOM 3394  H HB2  . ALA A 1 84  ? -1.050  -9.811  -15.338 1.00 3.33   ? 84  ALA A HB2  2  
ATOM 3395  H HB3  . ALA A 1 84  ? 0.116   -8.463  -15.334 1.00 4.76   ? 84  ALA A HB3  2  
ATOM 3396  N N    . GLY A 1 85  ? -0.182  -7.816  -11.867 1.00 3.49   ? 85  GLY A N    2  
ATOM 3397  C CA   . GLY A 1 85  ? 0.610   -7.101  -10.867 1.00 4.56   ? 85  GLY A CA   2  
ATOM 3398  C C    . GLY A 1 85  ? 1.918   -7.843  -10.601 1.00 3.64   ? 85  GLY A C    2  
ATOM 3399  O O    . GLY A 1 85  ? 1.907   -9.058  -10.413 1.00 2.87   ? 85  GLY A O    2  
ATOM 3400  H H    . GLY A 1 85  ? -0.218  -8.820  -11.781 1.00 2.71   ? 85  GLY A H    2  
ATOM 3401  H HA2  . GLY A 1 85  ? 0.811   -6.080  -11.193 1.00 6.06   ? 85  GLY A HA2  2  
ATOM 3402  H HA3  . GLY A 1 85  ? 0.055   -7.065  -9.934  1.00 5.05   ? 85  GLY A HA3  2  
ATOM 3403  N N    . MET A 1 86  ? 3.031   -7.109  -10.582 1.00 4.26   ? 86  MET A N    2  
ATOM 3404  C CA   . MET A 1 86  ? 4.407   -7.637  -10.600 1.00 3.90   ? 86  MET A CA   2  
ATOM 3405  C C    . MET A 1 86  ? 5.119   -7.517  -9.240  1.00 3.21   ? 86  MET A C    2  
ATOM 3406  O O    . MET A 1 86  ? 5.400   -6.416  -8.756  1.00 4.35   ? 86  MET A O    2  
ATOM 3407  C CB   . MET A 1 86  ? 5.194   -6.882  -11.688 1.00 5.90   ? 86  MET A CB   2  
ATOM 3408  C CG   . MET A 1 86  ? 6.646   -7.358  -11.861 1.00 5.95   ? 86  MET A CG   2  
ATOM 3409  S SD   . MET A 1 86  ? 6.800   -9.001  -12.600 1.00 5.81   ? 86  MET A SD   2  
ATOM 3410  C CE   . MET A 1 86  ? 8.576   -9.269  -12.372 1.00 6.54   ? 86  MET A CE   2  
ATOM 3411  H H    . MET A 1 86  ? 2.901   -6.120  -10.694 1.00 5.30   ? 86  MET A H    2  
ATOM 3412  H HA   . MET A 1 86  ? 4.380   -8.697  -10.873 1.00 3.32   ? 86  MET A HA   2  
ATOM 3413  H HB2  . MET A 1 86  ? 4.681   -6.997  -12.642 1.00 6.69   ? 86  MET A HB2  2  
ATOM 3414  H HB3  . MET A 1 86  ? 5.204   -5.821  -11.444 1.00 7.11   ? 86  MET A HB3  2  
ATOM 3415  H HG2  . MET A 1 86  ? 7.157   -6.652  -12.518 1.00 6.55   ? 86  MET A HG2  2  
ATOM 3416  H HG3  . MET A 1 86  ? 7.158   -7.341  -10.899 1.00 6.06   ? 86  MET A HG3  2  
ATOM 3417  H HE1  . MET A 1 86  ? 8.833   -9.216  -11.309 1.00 6.75   ? 86  MET A HE1  2  
ATOM 3418  H HE2  . MET A 1 86  ? 8.853   -10.245 -12.762 1.00 6.36   ? 86  MET A HE2  2  
ATOM 3419  H HE3  . MET A 1 86  ? 9.131   -8.497  -12.910 1.00 7.55   ? 86  MET A HE3  2  
ATOM 3420  N N    . LYS A 1 87  ? 5.525   -8.641  -8.642  1.00 1.94   ? 87  LYS A N    2  
ATOM 3421  C CA   . LYS A 1 87  ? 6.328   -8.651  -7.411  1.00 1.83   ? 87  LYS A CA   2  
ATOM 3422  C C    . LYS A 1 87  ? 7.692   -7.966  -7.657  1.00 1.19   ? 87  LYS A C    2  
ATOM 3423  O O    . LYS A 1 87  ? 8.456   -8.414  -8.511  1.00 1.88   ? 87  LYS A O    2  
ATOM 3424  C CB   . LYS A 1 87  ? 6.424   -10.092 -6.862  1.00 2.98   ? 87  LYS A CB   2  
ATOM 3425  C CG   . LYS A 1 87  ? 7.154   -10.176 -5.506  1.00 4.05   ? 87  LYS A CG   2  
ATOM 3426  C CD   . LYS A 1 87  ? 6.496   -11.122 -4.487  1.00 5.85   ? 87  LYS A CD   2  
ATOM 3427  C CE   . LYS A 1 87  ? 6.243   -12.549 -4.988  1.00 6.69   ? 87  LYS A CE   2  
ATOM 3428  N NZ   . LYS A 1 87  ? 5.746   -13.405 -3.888  1.00 8.34   ? 87  LYS A NZ   2  
ATOM 3429  H H    . LYS A 1 87  ? 5.339   -9.531  -9.091  1.00 1.91   ? 87  LYS A H    2  
ATOM 3430  H HA   . LYS A 1 87  ? 5.781   -8.064  -6.673  1.00 2.65   ? 87  LYS A HA   2  
ATOM 3431  H HB2  . LYS A 1 87  ? 5.411   -10.480 -6.753  1.00 3.91   ? 87  LYS A HB2  2  
ATOM 3432  H HB3  . LYS A 1 87  ? 6.945   -10.728 -7.580  1.00 3.29   ? 87  LYS A HB3  2  
ATOM 3433  H HG2  . LYS A 1 87  ? 8.181   -10.497 -5.685  1.00 4.07   ? 87  LYS A HG2  2  
ATOM 3434  H HG3  . LYS A 1 87  ? 7.194   -9.183  -5.057  1.00 4.43   ? 87  LYS A HG3  2  
ATOM 3435  H HD2  . LYS A 1 87  ? 7.138   -11.164 -3.607  1.00 6.58   ? 87  LYS A HD2  2  
ATOM 3436  H HD3  . LYS A 1 87  ? 5.543   -10.686 -4.186  1.00 6.60   ? 87  LYS A HD3  2  
ATOM 3437  H HE2  . LYS A 1 87  ? 5.495   -12.514 -5.784  1.00 7.03   ? 87  LYS A HE2  2  
ATOM 3438  H HE3  . LYS A 1 87  ? 7.170   -12.966 -5.385  1.00 6.42   ? 87  LYS A HE3  2  
ATOM 3439  H HZ1  . LYS A 1 87  ? 4.959   -12.958 -3.415  1.00 8.82   ? 87  LYS A HZ1  2  
ATOM 3440  H HZ2  . LYS A 1 87  ? 5.456   -14.315 -4.228  1.00 8.83   ? 87  LYS A HZ2  2  
ATOM 3441  H HZ3  . LYS A 1 87  ? 6.483   -13.575 -3.209  1.00 8.96   ? 87  LYS A HZ3  2  
ATOM 3442  N N    . MET A 1 88  ? 7.906   -6.849  -6.939  1.00 1.79   ? 88  MET A N    2  
ATOM 3443  C CA   . MET A 1 88  ? 8.925   -5.800  -7.011  1.00 2.04   ? 88  MET A CA   2  
ATOM 3444  C C    . MET A 1 88  ? 8.241   -4.428  -6.874  1.00 2.08   ? 88  MET A C    2  
ATOM 3445  O O    . MET A 1 88  ? 8.777   -3.526  -6.239  1.00 3.61   ? 88  MET A O    2  
ATOM 3446  C CB   . MET A 1 88  ? 9.792   -5.883  -8.281  1.00 2.62   ? 88  MET A CB   2  
ATOM 3447  C CG   . MET A 1 88  ? 10.784  -4.734  -8.268  1.00 3.46   ? 88  MET A CG   2  
ATOM 3448  S SD   . MET A 1 88  ? 11.943  -4.670  -9.658  1.00 4.29   ? 88  MET A SD   2  
ATOM 3449  C CE   . MET A 1 88  ? 12.985  -6.108  -9.308  1.00 4.54   ? 88  MET A CE   2  
ATOM 3450  H H    . MET A 1 88  ? 7.205   -6.592  -6.278  1.00 2.80   ? 88  MET A H    2  
ATOM 3451  H HA   . MET A 1 88  ? 9.561   -5.913  -6.134  1.00 2.39   ? 88  MET A HA   2  
ATOM 3452  H HB2  . MET A 1 88  ? 10.352  -6.820  -8.273  1.00 3.51   ? 88  MET A HB2  2  
ATOM 3453  H HB3  . MET A 1 88  ? 9.173   -5.829  -9.177  1.00 2.83   ? 88  MET A HB3  2  
ATOM 3454  H HG2  . MET A 1 88  ? 10.216  -3.807  -8.268  1.00 3.69   ? 88  MET A HG2  2  
ATOM 3455  H HG3  . MET A 1 88  ? 11.307  -4.795  -7.315  1.00 4.28   ? 88  MET A HG3  2  
ATOM 3456  H HE1  . MET A 1 88  ? 13.469  -5.979  -8.337  1.00 4.92   ? 88  MET A HE1  2  
ATOM 3457  H HE2  . MET A 1 88  ? 12.380  -7.019  -9.293  1.00 4.87   ? 88  MET A HE2  2  
ATOM 3458  H HE3  . MET A 1 88  ? 13.746  -6.193  -10.075 1.00 5.05   ? 88  MET A HE3  2  
ATOM 3459  N N    . VAL A 1 89  ? 7.049   -4.282  -7.468  1.00 1.30   ? 89  VAL A N    2  
ATOM 3460  C CA   . VAL A 1 89  ? 6.193   -3.088  -7.363  1.00 1.19   ? 89  VAL A CA   2  
ATOM 3461  C C    . VAL A 1 89  ? 4.857   -3.460  -6.707  1.00 1.46   ? 89  VAL A C    2  
ATOM 3462  O O    . VAL A 1 89  ? 4.481   -4.631  -6.739  1.00 2.39   ? 89  VAL A O    2  
ATOM 3463  C CB   . VAL A 1 89  ? 5.950   -2.404  -8.733  1.00 1.79   ? 89  VAL A CB   2  
ATOM 3464  C CG1  . VAL A 1 89  ? 7.254   -1.784  -9.264  1.00 2.21   ? 89  VAL A CG1  2  
ATOM 3465  C CG2  . VAL A 1 89  ? 5.353   -3.341  -9.796  1.00 3.64   ? 89  VAL A CG2  2  
ATOM 3466  H H    . VAL A 1 89  ? 6.656   -5.074  -7.969  1.00 2.09   ? 89  VAL A H    2  
ATOM 3467  H HA   . VAL A 1 89  ? 6.692   -2.362  -6.719  1.00 1.34   ? 89  VAL A HA   2  
ATOM 3468  H HB   . VAL A 1 89  ? 5.243   -1.591  -8.574  1.00 2.34   ? 89  VAL A HB   2  
ATOM 3469  H HG11 . VAL A 1 89  ? 7.989   -2.562  -9.473  1.00 3.08   ? 89  VAL A HG11 2  
ATOM 3470  H HG12 . VAL A 1 89  ? 7.050   -1.233  -10.184 1.00 2.97   ? 89  VAL A HG12 2  
ATOM 3471  H HG13 . VAL A 1 89  ? 7.661   -1.094  -8.528  1.00 2.50   ? 89  VAL A HG13 2  
ATOM 3472  H HG21 . VAL A 1 89  ? 6.062   -4.132  -10.040 1.00 4.29   ? 89  VAL A HG21 2  
ATOM 3473  H HG22 . VAL A 1 89  ? 4.422   -3.780  -9.436  1.00 4.78   ? 89  VAL A HG22 2  
ATOM 3474  H HG23 . VAL A 1 89  ? 5.136   -2.774  -10.702 1.00 4.13   ? 89  VAL A HG23 2  
ATOM 3475  N N    . PRO A 1 90  ? 4.128   -2.513  -6.093  1.00 1.22   ? 90  PRO A N    2  
ATOM 3476  C CA   . PRO A 1 90  ? 2.791   -2.744  -5.553  1.00 1.82   ? 90  PRO A CA   2  
ATOM 3477  C C    . PRO A 1 90  ? 1.703   -2.458  -6.603  1.00 2.11   ? 90  PRO A C    2  
ATOM 3478  O O    . PRO A 1 90  ? 0.705   -3.166  -6.618  1.00 3.71   ? 90  PRO A O    2  
ATOM 3479  C CB   . PRO A 1 90  ? 2.689   -1.780  -4.371  1.00 1.97   ? 90  PRO A CB   2  
ATOM 3480  C CG   . PRO A 1 90  ? 3.494   -0.584  -4.868  1.00 1.52   ? 90  PRO A CG   2  
ATOM 3481  C CD   . PRO A 1 90  ? 4.582   -1.173  -5.761  1.00 1.25   ? 90  PRO A CD   2  
ATOM 3482  H HA   . PRO A 1 90  ? 2.687   -3.766  -5.193  1.00 2.44   ? 90  PRO A HA   2  
ATOM 3483  H HB2  . PRO A 1 90  ? 1.656   -1.504  -4.153  1.00 2.24   ? 90  PRO A HB2  2  
ATOM 3484  H HB3  . PRO A 1 90  ? 3.161   -2.219  -3.493  1.00 2.60   ? 90  PRO A HB3  2  
ATOM 3485  H HG2  . PRO A 1 90  ? 2.842   0.008   -5.501  1.00 1.46   ? 90  PRO A HG2  2  
ATOM 3486  H HG3  . PRO A 1 90  ? 3.894   0.006   -4.045  1.00 2.20   ? 90  PRO A HG3  2  
ATOM 3487  H HD2  . PRO A 1 90  ? 4.694   -0.565  -6.653  1.00 1.58   ? 90  PRO A HD2  2  
ATOM 3488  H HD3  . PRO A 1 90  ? 5.531   -1.214  -5.239  1.00 1.90   ? 90  PRO A HD3  2  
ATOM 3489  N N    . TRP A 1 91  ? 1.892   -1.451  -7.475  1.00 1.60   ? 91  TRP A N    2  
ATOM 3490  C CA   . TRP A 1 91  ? 0.947   -1.026  -8.509  1.00 1.70   ? 91  TRP A CA   2  
ATOM 3491  C C    . TRP A 1 91  ? 1.631   -0.570  -9.813  1.00 2.59   ? 91  TRP A C    2  
ATOM 3492  O O    . TRP A 1 91  ? 2.856   -0.498  -9.920  1.00 4.32   ? 91  TRP A O    2  
ATOM 3493  C CB   . TRP A 1 91  ? 0.020   0.074   -7.963  1.00 3.22   ? 91  TRP A CB   2  
ATOM 3494  C CG   . TRP A 1 91  ? -0.987  -0.358  -6.958  1.00 4.23   ? 91  TRP A CG   2  
ATOM 3495  C CD1  . TRP A 1 91  ? -1.968  -1.266  -7.179  1.00 3.39   ? 91  TRP A CD1  2  
ATOM 3496  C CD2  . TRP A 1 91  ? -1.145  0.057   -5.587  1.00 6.39   ? 91  TRP A CD2  2  
ATOM 3497  N NE1  . TRP A 1 91  ? -2.704  -1.441  -6.031  1.00 4.76   ? 91  TRP A NE1  2  
ATOM 3498  C CE2  . TRP A 1 91  ? -2.255  -0.626  -5.002  1.00 6.71   ? 91  TRP A CE2  2  
ATOM 3499  C CE3  . TRP A 1 91  ? -0.445  0.964   -4.752  1.00 8.20   ? 91  TRP A CE3  2  
ATOM 3500  C CZ2  . TRP A 1 91  ? -2.651  -0.429  -3.685  1.00 8.71   ? 91  TRP A CZ2  2  
ATOM 3501  C CZ3  . TRP A 1 91  ? -0.788  1.118   -3.411  1.00 10.20  ? 91  TRP A CZ3  2  
ATOM 3502  C CH2  . TRP A 1 91  ? -1.886  0.430   -2.863  1.00 10.47  ? 91  TRP A CH2  2  
ATOM 3503  H H    . TRP A 1 91  ? 2.713   -0.874  -7.362  1.00 2.37   ? 91  TRP A H    2  
ATOM 3504  H HA   . TRP A 1 91  ? 0.326   -1.872  -8.774  1.00 3.01   ? 91  TRP A HA   2  
ATOM 3505  H HB2  . TRP A 1 91  ? 0.630   0.877   -7.548  1.00 4.20   ? 91  TRP A HB2  2  
ATOM 3506  H HB3  . TRP A 1 91  ? -0.562  0.502   -8.778  1.00 3.79   ? 91  TRP A HB3  2  
ATOM 3507  H HD1  . TRP A 1 91  ? -2.104  -1.784  -8.117  1.00 2.19   ? 91  TRP A HD1  2  
ATOM 3508  H HE1  . TRP A 1 91  ? -3.415  -2.146  -5.930  1.00 4.40   ? 91  TRP A HE1  2  
ATOM 3509  H HE3  . TRP A 1 91  ? 0.376   1.513   -5.175  1.00 8.03   ? 91  TRP A HE3  2  
ATOM 3510  H HZ2  . TRP A 1 91  ? -3.500  -0.957  -3.271  1.00 8.89   ? 91  TRP A HZ2  2  
ATOM 3511  H HZ3  . TRP A 1 91  ? -0.200  1.783   -2.788  1.00 11.55  ? 91  TRP A HZ3  2  
ATOM 3512  H HH2  . TRP A 1 91  ? -2.149  0.573   -1.829  1.00 12.02  ? 91  TRP A HH2  2  
ATOM 3513  N N    . LEU A 1 92  ? 0.786   -0.252  -10.797 1.00 2.89   ? 92  LEU A N    2  
ATOM 3514  C CA   . LEU A 1 92  ? 1.116   0.338   -12.097 1.00 4.58   ? 92  LEU A CA   2  
ATOM 3515  C C    . LEU A 1 92  ? -0.113  1.001   -12.745 1.00 4.08   ? 92  LEU A C    2  
ATOM 3516  O O    . LEU A 1 92  ? -0.050  2.158   -13.163 1.00 4.76   ? 92  LEU A O    2  
ATOM 3517  C CB   . LEU A 1 92  ? 1.794   -0.712  -13.011 1.00 6.82   ? 92  LEU A CB   2  
ATOM 3518  C CG   . LEU A 1 92  ? 1.083   -2.089  -13.059 1.00 8.20   ? 92  LEU A CG   2  
ATOM 3519  C CD1  . LEU A 1 92  ? 0.934   -2.574  -14.505 1.00 9.94   ? 92  LEU A CD1  2  
ATOM 3520  C CD2  . LEU A 1 92  ? 1.848   -3.158  -12.266 1.00 9.47   ? 92  LEU A CD2  2  
ATOM 3521  H H    . LEU A 1 92  ? -0.191  -0.293  -10.561 1.00 2.63   ? 92  LEU A H    2  
ATOM 3522  H HA   . LEU A 1 92  ? 1.820   1.151   -11.933 1.00 5.21   ? 92  LEU A HA   2  
ATOM 3523  H HB2  . LEU A 1 92  ? 1.854   -0.286  -14.013 1.00 7.51   ? 92  LEU A HB2  2  
ATOM 3524  H HB3  . LEU A 1 92  ? 2.821   -0.850  -12.671 1.00 7.22   ? 92  LEU A HB3  2  
ATOM 3525  H HG   . LEU A 1 92  ? 0.083   -1.979  -12.622 1.00 7.41   ? 92  LEU A HG   2  
ATOM 3526  H HD11 . LEU A 1 92  ? 0.368   -1.843  -15.087 1.00 9.99   ? 92  LEU A HD11 2  
ATOM 3527  H HD12 . LEU A 1 92  ? 1.914   -2.703  -14.962 1.00 10.98  ? 92  LEU A HD12 2  
ATOM 3528  H HD13 . LEU A 1 92  ? 0.400   -3.520  -14.527 1.00 10.52  ? 92  LEU A HD13 2  
ATOM 3529  H HD21 . LEU A 1 92  ? 1.324   -4.109  -12.335 1.00 10.32  ? 92  LEU A HD21 2  
ATOM 3530  H HD22 . LEU A 1 92  ? 2.854   -3.280  -12.666 1.00 10.30  ? 92  LEU A HD22 2  
ATOM 3531  H HD23 . LEU A 1 92  ? 1.919   -2.883  -11.213 1.00 9.21   ? 92  LEU A HD23 2  
ATOM 3532  N N    . THR A 1 93  ? -1.249  0.289   -12.752 1.00 3.41   ? 93  THR A N    2  
ATOM 3533  C CA   . THR A 1 93  ? -2.514  0.689   -13.397 1.00 3.29   ? 93  THR A CA   2  
ATOM 3534  C C    . THR A 1 93  ? -3.709  0.343   -12.525 1.00 2.38   ? 93  THR A C    2  
ATOM 3535  O O    . THR A 1 93  ? -3.852  -0.795  -12.096 1.00 2.64   ? 93  THR A O    2  
ATOM 3536  C CB   . THR A 1 93  ? -2.679  -0.035  -14.745 1.00 4.67   ? 93  THR A CB   2  
ATOM 3537  O OG1  . THR A 1 93  ? -1.495  0.052   -15.498 1.00 5.72   ? 93  THR A OG1  2  
ATOM 3538  C CG2  . THR A 1 93  ? -3.791  0.576   -15.600 1.00 5.06   ? 93  THR A CG2  2  
ATOM 3539  H H    . THR A 1 93  ? -1.191  -0.651  -12.398 1.00 3.60   ? 93  THR A H    2  
ATOM 3540  H HA   . THR A 1 93  ? -2.503  1.761   -13.578 1.00 3.47   ? 93  THR A HA   2  
ATOM 3541  H HB   . THR A 1 93  ? -2.900  -1.089  -14.550 1.00 5.30   ? 93  THR A HB   2  
ATOM 3542  H HG1  . THR A 1 93  ? -1.559  -0.591  -16.216 1.00 6.48   ? 93  THR A HG1  2  
ATOM 3543  H HG21 . THR A 1 93  ? -3.856  0.038   -16.550 1.00 6.17   ? 93  THR A HG21 2  
ATOM 3544  H HG22 . THR A 1 93  ? -4.751  0.488   -15.095 1.00 5.08   ? 93  THR A HG22 2  
ATOM 3545  H HG23 . THR A 1 93  ? -3.579  1.625   -15.796 1.00 5.12   ? 93  THR A HG23 2  
ATOM 3546  N N    . ILE A 1 94  ? -4.606  1.299   -12.300 1.00 1.93   ? 94  ILE A N    2  
ATOM 3547  C CA   . ILE A 1 94  ? -5.928  1.051   -11.707 1.00 1.76   ? 94  ILE A CA   2  
ATOM 3548  C C    . ILE A 1 94  ? -6.970  1.244   -12.830 1.00 1.47   ? 94  ILE A C    2  
ATOM 3549  O O    . ILE A 1 94  ? -7.393  2.379   -13.065 1.00 1.85   ? 94  ILE A O    2  
ATOM 3550  C CB   . ILE A 1 94  ? -6.171  1.992   -10.498 1.00 2.55   ? 94  ILE A CB   2  
ATOM 3551  C CG1  . ILE A 1 94  ? -4.960  2.155   -9.541  1.00 4.41   ? 94  ILE A CG1  2  
ATOM 3552  C CG2  . ILE A 1 94  ? -7.408  1.517   -9.712  1.00 3.11   ? 94  ILE A CG2  2  
ATOM 3553  C CD1  . ILE A 1 94  ? -4.430  0.892   -8.847  1.00 5.78   ? 94  ILE A CD1  2  
ATOM 3554  H H    . ILE A 1 94  ? -4.409  2.257   -12.601 1.00 2.25   ? 94  ILE A H    2  
ATOM 3555  H HA   . ILE A 1 94  ? -5.984  0.032   -11.341 1.00 2.06   ? 94  ILE A HA   2  
ATOM 3556  H HB   . ILE A 1 94  ? -6.386  2.992   -10.885 1.00 2.80   ? 94  ILE A HB   2  
ATOM 3557  H HG12 . ILE A 1 94  ? -4.133  2.599   -10.092 1.00 5.14   ? 94  ILE A HG12 2  
ATOM 3558  H HG13 . ILE A 1 94  ? -5.231  2.869   -8.769  1.00 5.06   ? 94  ILE A HG13 2  
ATOM 3559  H HG21 . ILE A 1 94  ? -7.627  2.216   -8.905  1.00 3.58   ? 94  ILE A HG21 2  
ATOM 3560  H HG22 . ILE A 1 94  ? -8.276  1.472   -10.368 1.00 3.34   ? 94  ILE A HG22 2  
ATOM 3561  H HG23 . ILE A 1 94  ? -7.245  0.522   -9.291  1.00 4.06   ? 94  ILE A HG23 2  
ATOM 3562  H HD11 . ILE A 1 94  ? -3.625  1.171   -8.168  1.00 6.80   ? 94  ILE A HD11 2  
ATOM 3563  H HD12 . ILE A 1 94  ? -5.216  0.405   -8.269  1.00 5.75   ? 94  ILE A HD12 2  
ATOM 3564  H HD13 . ILE A 1 94  ? -4.028  0.203   -9.586  1.00 6.53   ? 94  ILE A HD13 2  
ATOM 3565  N N    . PRO A 1 95  ? -7.346  0.183   -13.578 1.00 1.52   ? 95  PRO A N    2  
ATOM 3566  C CA   . PRO A 1 95  ? -8.183  0.317   -14.766 1.00 1.83   ? 95  PRO A CA   2  
ATOM 3567  C C    . PRO A 1 95  ? -9.667  0.437   -14.399 1.00 1.67   ? 95  PRO A C    2  
ATOM 3568  O O    . PRO A 1 95  ? -10.146 -0.247  -13.493 1.00 2.23   ? 95  PRO A O    2  
ATOM 3569  C CB   . PRO A 1 95  ? -7.894  -0.931  -15.603 1.00 2.50   ? 95  PRO A CB   2  
ATOM 3570  C CG   . PRO A 1 95  ? -7.575  -1.989  -14.548 1.00 2.52   ? 95  PRO A CG   2  
ATOM 3571  C CD   . PRO A 1 95  ? -6.852  -1.185  -13.469 1.00 1.97   ? 95  PRO A CD   2  
ATOM 3572  H HA   . PRO A 1 95  ? -7.880  1.196   -15.336 1.00 2.19   ? 95  PRO A HA   2  
ATOM 3573  H HB2  . PRO A 1 95  ? -8.737  -1.219  -16.232 1.00 2.80   ? 95  PRO A HB2  2  
ATOM 3574  H HB3  . PRO A 1 95  ? -7.007  -0.759  -16.215 1.00 2.97   ? 95  PRO A HB3  2  
ATOM 3575  H HG2  . PRO A 1 95  ? -8.499  -2.395  -14.140 1.00 2.55   ? 95  PRO A HG2  2  
ATOM 3576  H HG3  . PRO A 1 95  ? -6.948  -2.791  -14.944 1.00 3.15   ? 95  PRO A HG3  2  
ATOM 3577  H HD2  . PRO A 1 95  ? -7.062  -1.604  -12.484 1.00 2.10   ? 95  PRO A HD2  2  
ATOM 3578  H HD3  . PRO A 1 95  ? -5.781  -1.206  -13.672 1.00 2.22   ? 95  PRO A HD3  2  
ATOM 3579  N N    . ALA A 1 96  ? -10.394 1.321   -15.097 1.00 1.72   ? 96  ALA A N    2  
ATOM 3580  C CA   . ALA A 1 96  ? -11.820 1.617   -14.857 1.00 1.84   ? 96  ALA A CA   2  
ATOM 3581  C C    . ALA A 1 96  ? -12.719 0.380   -14.921 1.00 1.83   ? 96  ALA A C    2  
ATOM 3582  O O    . ALA A 1 96  ? -13.538 0.159   -14.028 1.00 2.89   ? 96  ALA A O    2  
ATOM 3583  C CB   . ALA A 1 96  ? -12.250 2.720   -15.829 1.00 2.38   ? 96  ALA A CB   2  
ATOM 3584  H H    . ALA A 1 96  ? -9.920  1.881   -15.792 1.00 2.24   ? 96  ALA A H    2  
ATOM 3585  H HA   . ALA A 1 96  ? -11.958 1.965   -13.843 1.00 1.92   ? 96  ALA A HA   2  
ATOM 3586  H HB1  . ALA A 1 96  ? -12.151 2.381   -16.862 1.00 2.42   ? 96  ALA A HB1  2  
ATOM 3587  H HB2  . ALA A 1 96  ? -13.289 2.990   -15.637 1.00 3.31   ? 96  ALA A HB2  2  
ATOM 3588  H HB3  . ALA A 1 96  ? -11.630 3.603   -15.679 1.00 3.00   ? 96  ALA A HB3  2  
ATOM 3589  N N    . ARG A 1 97  ? -12.480 -0.474  -15.915 1.00 2.11   ? 97  ARG A N    2  
ATOM 3590  C CA   . ARG A 1 97  ? -12.755 -1.900  -15.766 1.00 2.29   ? 97  ARG A CA   2  
ATOM 3591  C C    . ARG A 1 97  ? -11.519 -2.663  -15.245 1.00 2.45   ? 97  ARG A C    2  
ATOM 3592  O O    . ARG A 1 97  ? -10.682 -3.127  -16.022 1.00 4.04   ? 97  ARG A O    2  
ATOM 3593  C CB   . ARG A 1 97  ? -13.283 -2.505  -17.080 1.00 2.52   ? 97  ARG A CB   2  
ATOM 3594  C CG   . ARG A 1 97  ? -14.804 -2.330  -17.247 1.00 2.83   ? 97  ARG A CG   2  
ATOM 3595  C CD   . ARG A 1 97  ? -15.298 -3.007  -18.535 1.00 3.34   ? 97  ARG A CD   2  
ATOM 3596  N NE   . ARG A 1 97  ? -16.772 -3.012  -18.651 1.00 4.01   ? 97  ARG A NE   2  
ATOM 3597  C CZ   . ARG A 1 97  ? -17.463 -3.324  -19.748 1.00 4.95   ? 97  ARG A CZ   2  
ATOM 3598  N NH1  . ARG A 1 97  ? -16.888 -3.658  -20.880 1.00 5.46   ? 97  ARG A NH1  2  
ATOM 3599  N NH2  . ARG A 1 97  ? -18.773 -3.298  -19.734 1.00 5.82   ? 97  ARG A NH2  2  
ATOM 3600  H H    . ARG A 1 97  ? -11.875 -0.157  -16.655 1.00 2.99   ? 97  ARG A H    2  
ATOM 3601  H HA   . ARG A 1 97  ? -13.527 -2.022  -15.010 1.00 2.36   ? 97  ARG A HA   2  
ATOM 3602  H HB2  . ARG A 1 97  ? -12.757 -2.074  -17.934 1.00 3.30   ? 97  ARG A HB2  2  
ATOM 3603  H HB3  . ARG A 1 97  ? -13.065 -3.572  -17.054 1.00 2.61   ? 97  ARG A HB3  2  
ATOM 3604  H HG2  . ARG A 1 97  ? -15.312 -2.784  -16.395 1.00 2.88   ? 97  ARG A HG2  2  
ATOM 3605  H HG3  . ARG A 1 97  ? -15.051 -1.266  -17.280 1.00 3.52   ? 97  ARG A HG3  2  
ATOM 3606  H HD2  . ARG A 1 97  ? -14.867 -2.472  -19.385 1.00 3.98   ? 97  ARG A HD2  2  
ATOM 3607  H HD3  . ARG A 1 97  ? -14.935 -4.038  -18.555 1.00 3.27   ? 97  ARG A HD3  2  
ATOM 3608  H HE   . ARG A 1 97  ? -17.307 -2.832  -17.811 1.00 4.13   ? 97  ARG A HE   2  
ATOM 3609  H HH11 . ARG A 1 97  ? -15.877 -3.741  -20.926 1.00 5.24   ? 97  ARG A HH11 2  
ATOM 3610  H HH12 . ARG A 1 97  ? -17.446 -3.889  -21.680 1.00 6.32   ? 97  ARG A HH12 2  
ATOM 3611  H HH21 . ARG A 1 97  ? -19.264 -3.173  -18.850 1.00 5.88   ? 97  ARG A HH21 2  
ATOM 3612  H HH22 . ARG A 1 97  ? -19.297 -3.584  -20.542 1.00 6.58   ? 97  ARG A HH22 2  
ATOM 3613  N N    . GLY A 1 98  ? -11.445 -2.859  -13.921 1.00 1.48   ? 98  GLY A N    2  
ATOM 3614  C CA   . GLY A 1 98  ? -10.770 -4.022  -13.334 1.00 1.59   ? 98  GLY A CA   2  
ATOM 3615  C C    . GLY A 1 98  ? -10.461 -3.938  -11.836 1.00 1.64   ? 98  GLY A C    2  
ATOM 3616  O O    . GLY A 1 98  ? -10.758 -4.896  -11.122 1.00 2.79   ? 98  GLY A O    2  
ATOM 3617  H H    . GLY A 1 98  ? -11.975 -2.241  -13.322 1.00 1.83   ? 98  GLY A H    2  
ATOM 3618  H HA2  . GLY A 1 98  ? -11.388 -4.912  -13.498 1.00 1.77   ? 98  GLY A HA2  2  
ATOM 3619  H HA3  . GLY A 1 98  ? -9.837  -4.188  -13.862 1.00 1.70   ? 98  GLY A HA3  2  
ATOM 3620  N N    . THR A 1 99  ? -9.903  -2.798  -11.399 1.00 1.56   ? 99  THR A N    2  
ATOM 3621  C CA   . THR A 1 99  ? -9.534  -2.470  -10.006 1.00 1.72   ? 99  THR A CA   2  
ATOM 3622  C C    . THR A 1 99  ? -8.366  -3.322  -9.505  1.00 1.46   ? 99  THR A C    2  
ATOM 3623  O O    . THR A 1 99  ? -8.522  -4.485  -9.148  1.00 1.74   ? 99  THR A O    2  
ATOM 3624  C CB   . THR A 1 99  ? -10.747 -2.572  -9.068  1.00 2.39   ? 99  THR A CB   2  
ATOM 3625  O OG1  . THR A 1 99  ? -11.620 -1.520  -9.412  1.00 3.47   ? 99  THR A OG1  2  
ATOM 3626  C CG2  . THR A 1 99  ? -10.368 -2.426  -7.595  1.00 2.84   ? 99  THR A CG2  2  
ATOM 3627  H H    . THR A 1 99  ? -9.748  -2.086  -12.100 1.00 2.33   ? 99  THR A H    2  
ATOM 3628  H HA   . THR A 1 99  ? -9.223  -1.427  -9.975  1.00 2.03   ? 99  THR A HA   2  
ATOM 3629  H HB   . THR A 1 99  ? -11.256 -3.528  -9.192  1.00 2.48   ? 99  THR A HB   2  
ATOM 3630  H HG1  . THR A 1 99  ? -12.482 -1.913  -9.589  1.00 3.83   ? 99  THR A HG1  2  
ATOM 3631  H HG21 . THR A 1 99  ? -9.913  -3.346  -7.231  1.00 2.61   ? 99  THR A HG21 2  
ATOM 3632  H HG22 . THR A 1 99  ? -9.656  -1.613  -7.484  1.00 3.65   ? 99  THR A HG22 2  
ATOM 3633  H HG23 . THR A 1 99  ? -11.257 -2.232  -6.998  1.00 3.59   ? 99  THR A HG23 2  
ATOM 3634  N N    . LEU A 1 100 ? -7.193  -2.702  -9.394  1.00 1.59   ? 100 LEU A N    2  
ATOM 3635  C CA   . LEU A 1 100 ? -6.007  -3.303  -8.763  1.00 1.80   ? 100 LEU A CA   2  
ATOM 3636  C C    . LEU A 1 100 ? -5.970  -3.046  -7.243  1.00 1.43   ? 100 LEU A C    2  
ATOM 3637  O O    . LEU A 1 100 ? -6.368  -1.978  -6.770  1.00 1.68   ? 100 LEU A O    2  
ATOM 3638  C CB   . LEU A 1 100 ? -4.731  -2.789  -9.461  1.00 2.82   ? 100 LEU A CB   2  
ATOM 3639  C CG   . LEU A 1 100 ? -4.097  -3.724  -10.511 1.00 4.50   ? 100 LEU A CG   2  
ATOM 3640  C CD1  . LEU A 1 100 ? -3.462  -4.954  -9.850  1.00 5.49   ? 100 LEU A CD1  2  
ATOM 3641  C CD2  . LEU A 1 100 ? -5.101  -4.156  -11.585 1.00 6.00   ? 100 LEU A CD2  2  
ATOM 3642  H H    . LEU A 1 100 ? -7.150  -1.751  -9.710  1.00 1.87   ? 100 LEU A H    2  
ATOM 3643  H HA   . LEU A 1 100 ? -6.066  -4.387  -8.896  1.00 1.96   ? 100 LEU A HA   2  
ATOM 3644  H HB2  . LEU A 1 100 ? -4.951  -1.836  -9.940  1.00 2.53   ? 100 LEU A HB2  2  
ATOM 3645  H HB3  . LEU A 1 100 ? -3.981  -2.592  -8.703  1.00 3.38   ? 100 LEU A HB3  2  
ATOM 3646  H HG   . LEU A 1 100 ? -3.296  -3.172  -11.002 1.00 4.77   ? 100 LEU A HG   2  
ATOM 3647  H HD11 . LEU A 1 100 ? -2.962  -5.557  -10.610 1.00 6.52   ? 100 LEU A HD11 2  
ATOM 3648  H HD12 . LEU A 1 100 ? -2.723  -4.641  -9.112  1.00 5.36   ? 100 LEU A HD12 2  
ATOM 3649  H HD13 . LEU A 1 100 ? -4.223  -5.564  -9.360  1.00 6.07   ? 100 LEU A HD13 2  
ATOM 3650  H HD21 . LEU A 1 100 ? -4.575  -4.680  -12.384 1.00 7.25   ? 100 LEU A HD21 2  
ATOM 3651  H HD22 . LEU A 1 100 ? -5.853  -4.820  -11.162 1.00 6.48   ? 100 LEU A HD22 2  
ATOM 3652  H HD23 . LEU A 1 100 ? -5.587  -3.281  -12.011 1.00 6.05   ? 100 LEU A HD23 2  
ATOM 3653  N N    . THR A 1 101 ? -5.441  -4.011  -6.479  1.00 1.24   ? 101 THR A N    2  
ATOM 3654  C CA   . THR A 1 101 ? -5.488  -4.083  -5.005  1.00 1.26   ? 101 THR A CA   2  
ATOM 3655  C C    . THR A 1 101 ? -4.162  -4.572  -4.412  1.00 1.13   ? 101 THR A C    2  
ATOM 3656  O O    . THR A 1 101 ? -3.283  -4.993  -5.159  1.00 1.77   ? 101 THR A O    2  
ATOM 3657  C CB   . THR A 1 101 ? -6.675  -4.975  -4.605  1.00 2.14   ? 101 THR A CB   2  
ATOM 3658  O OG1  . THR A 1 101 ? -6.898  -4.883  -3.227  1.00 3.49   ? 101 THR A OG1  2  
ATOM 3659  C CG2  . THR A 1 101 ? -6.482  -6.457  -4.946  1.00 2.52   ? 101 THR A CG2  2  
ATOM 3660  H H    . THR A 1 101 ? -5.031  -4.806  -6.945  1.00 1.40   ? 101 THR A H    2  
ATOM 3661  H HA   . THR A 1 101 ? -5.682  -3.091  -4.604  1.00 1.86   ? 101 THR A HA   2  
ATOM 3662  H HB   . THR A 1 101 ? -7.570  -4.613  -5.121  1.00 3.15   ? 101 THR A HB   2  
ATOM 3663  H HG1  . THR A 1 101 ? -7.652  -5.442  -3.014  1.00 4.10   ? 101 THR A HG1  2  
ATOM 3664  H HG21 . THR A 1 101 ? -5.620  -6.866  -4.415  1.00 2.94   ? 101 THR A HG21 2  
ATOM 3665  H HG22 . THR A 1 101 ? -7.370  -7.019  -4.670  1.00 3.06   ? 101 THR A HG22 2  
ATOM 3666  H HG23 . THR A 1 101 ? -6.323  -6.574  -6.021  1.00 3.36   ? 101 THR A HG23 2  
ATOM 3667  N N    . LEU A 1 102 ? -3.995  -4.495  -3.087  1.00 1.00   ? 102 LEU A N    2  
ATOM 3668  C CA   . LEU A 1 102 ? -2.747  -4.753  -2.379  1.00 1.38   ? 102 LEU A CA   2  
ATOM 3669  C C    . LEU A 1 102 ? -3.038  -5.392  -1.007  1.00 1.11   ? 102 LEU A C    2  
ATOM 3670  O O    . LEU A 1 102 ? -3.238  -4.706  -0.005  1.00 1.17   ? 102 LEU A O    2  
ATOM 3671  C CB   . LEU A 1 102 ? -2.053  -3.384  -2.292  1.00 2.06   ? 102 LEU A CB   2  
ATOM 3672  C CG   . LEU A 1 102 ? -0.620  -3.485  -1.789  1.00 3.16   ? 102 LEU A CG   2  
ATOM 3673  C CD1  . LEU A 1 102 ? 0.308   -3.961  -2.918  1.00 4.11   ? 102 LEU A CD1  2  
ATOM 3674  C CD2  . LEU A 1 102 ? -0.105  -2.143  -1.260  1.00 3.97   ? 102 LEU A CD2  2  
ATOM 3675  H H    . LEU A 1 102 ? -4.729  -4.081  -2.525  1.00 1.15   ? 102 LEU A H    2  
ATOM 3676  H HA   . LEU A 1 102 ? -2.133  -5.440  -2.963  1.00 1.83   ? 102 LEU A HA   2  
ATOM 3677  H HB2  . LEU A 1 102 ? -2.031  -2.930  -3.282  1.00 2.62   ? 102 LEU A HB2  2  
ATOM 3678  H HB3  . LEU A 1 102 ? -2.622  -2.733  -1.630  1.00 2.62   ? 102 LEU A HB3  2  
ATOM 3679  H HG   . LEU A 1 102 ? -0.629  -4.197  -0.971  1.00 3.86   ? 102 LEU A HG   2  
ATOM 3680  H HD11 . LEU A 1 102 ? 0.083   -4.995  -3.180  1.00 4.66   ? 102 LEU A HD11 2  
ATOM 3681  H HD12 . LEU A 1 102 ? 0.174   -3.338  -3.803  1.00 4.36   ? 102 LEU A HD12 2  
ATOM 3682  H HD13 . LEU A 1 102 ? 1.343   -3.889  -2.596  1.00 4.97   ? 102 LEU A HD13 2  
ATOM 3683  H HD21 . LEU A 1 102 ? -0.741  -1.806  -0.440  1.00 4.50   ? 102 LEU A HD21 2  
ATOM 3684  H HD22 . LEU A 1 102 ? 0.913   -2.259  -0.898  1.00 4.82   ? 102 LEU A HD22 2  
ATOM 3685  H HD23 . LEU A 1 102 ? -0.107  -1.402  -2.059  1.00 4.18   ? 102 LEU A HD23 2  
ATOM 3686  N N    . GLN A 1 103 ? -3.105  -6.722  -0.958  1.00 1.00   ? 103 GLN A N    2  
ATOM 3687  C CA   . GLN A 1 103 ? -3.601  -7.516  0.181   1.00 0.98   ? 103 GLN A CA   2  
ATOM 3688  C C    . GLN A 1 103 ? -2.775  -8.793  0.331   1.00 1.09   ? 103 GLN A C    2  
ATOM 3689  O O    . GLN A 1 103 ? -2.298  -9.318  -0.668  1.00 1.20   ? 103 GLN A O    2  
ATOM 3690  C CB   . GLN A 1 103 ? -5.063  -7.963  -0.050  1.00 1.21   ? 103 GLN A CB   2  
ATOM 3691  C CG   . GLN A 1 103 ? -6.107  -6.862  -0.328  1.00 1.55   ? 103 GLN A CG   2  
ATOM 3692  C CD   . GLN A 1 103 ? -6.483  -6.059  0.912   1.00 2.06   ? 103 GLN A CD   2  
ATOM 3693  O OE1  . GLN A 1 103 ? -7.602  -6.070  1.392   1.00 2.20   ? 103 GLN A OE1  2  
ATOM 3694  N NE2  . GLN A 1 103 ? -5.554  -5.338  1.497   1.00 3.52   ? 103 GLN A NE2  2  
ATOM 3695  H H    . GLN A 1 103 ? -2.752  -7.245  -1.753  1.00 1.06   ? 103 GLN A H    2  
ATOM 3696  H HA   . GLN A 1 103 ? -3.516  -6.944  1.107   1.00 1.02   ? 103 GLN A HA   2  
ATOM 3697  H HB2  . GLN A 1 103 ? -5.079  -8.677  -0.881  1.00 1.46   ? 103 GLN A HB2  2  
ATOM 3698  H HB3  . GLN A 1 103 ? -5.399  -8.516  0.832   1.00 1.50   ? 103 GLN A HB3  2  
ATOM 3699  H HG2  . GLN A 1 103 ? -5.751  -6.189  -1.102  1.00 2.59   ? 103 GLN A HG2  2  
ATOM 3700  H HG3  . GLN A 1 103 ? -7.018  -7.342  -0.702  1.00 2.13   ? 103 GLN A HG3  2  
ATOM 3701  H HE21 . GLN A 1 103 ? -4.672  -5.178  1.015   1.00 3.76   ? 103 GLN A HE21 2  
ATOM 3702  H HE22 . GLN A 1 103 ? -5.863  -4.782  2.280   1.00 4.55   ? 103 GLN A HE22 2  
ATOM 3703  N N    . ARG A 1 104 ? -2.739  -9.385  1.535   1.00 1.26   ? 104 ARG A N    2  
ATOM 3704  C CA   . ARG A 1 104 ? -2.166  -10.722 1.828   1.00 1.59   ? 104 ARG A CA   2  
ATOM 3705  C C    . ARG A 1 104 ? -2.795  -11.918 1.080   1.00 1.87   ? 104 ARG A C    2  
ATOM 3706  O O    . ARG A 1 104 ? -2.492  -13.071 1.373   1.00 2.44   ? 104 ARG A O    2  
ATOM 3707  C CB   . ARG A 1 104 ? -2.200  -10.979 3.348   1.00 1.75   ? 104 ARG A CB   2  
ATOM 3708  C CG   . ARG A 1 104 ? -3.637  -11.046 3.918   1.00 3.08   ? 104 ARG A CG   2  
ATOM 3709  C CD   . ARG A 1 104 ? -3.715  -11.498 5.384   1.00 3.68   ? 104 ARG A CD   2  
ATOM 3710  N NE   . ARG A 1 104 ? -3.187  -12.854 5.569   1.00 3.90   ? 104 ARG A NE   2  
ATOM 3711  C CZ   . ARG A 1 104 ? -3.183  -13.561 6.690   1.00 4.55   ? 104 ARG A CZ   2  
ATOM 3712  N NH1  . ARG A 1 104 ? -3.743  -13.164 7.812   1.00 5.19   ? 104 ARG A NH1  2  
ATOM 3713  N NH2  . ARG A 1 104 ? -2.526  -14.692 6.681   1.00 5.12   ? 104 ARG A NH2  2  
ATOM 3714  H H    . ARG A 1 104 ? -3.168  -8.906  2.312   1.00 1.30   ? 104 ARG A H    2  
ATOM 3715  H HA   . ARG A 1 104 ? -1.116  -10.692 1.521   1.00 1.69   ? 104 ARG A HA   2  
ATOM 3716  H HB2  . ARG A 1 104 ? -1.679  -11.914 3.548   1.00 2.32   ? 104 ARG A HB2  2  
ATOM 3717  H HB3  . ARG A 1 104 ? -1.633  -10.194 3.843   1.00 2.13   ? 104 ARG A HB3  2  
ATOM 3718  H HG2  . ARG A 1 104 ? -4.095  -10.060 3.840   1.00 4.01   ? 104 ARG A HG2  2  
ATOM 3719  H HG3  . ARG A 1 104 ? -4.233  -11.741 3.324   1.00 3.86   ? 104 ARG A HG3  2  
ATOM 3720  H HD2  . ARG A 1 104 ? -3.150  -10.809 6.011   1.00 3.92   ? 104 ARG A HD2  2  
ATOM 3721  H HD3  . ARG A 1 104 ? -4.759  -11.474 5.697   1.00 4.47   ? 104 ARG A HD3  2  
ATOM 3722  H HE   . ARG A 1 104 ? -2.686  -13.273 4.790   1.00 4.05   ? 104 ARG A HE   2  
ATOM 3723  H HH11 . ARG A 1 104 ? -4.254  -12.300 7.904   1.00 5.37   ? 104 ARG A HH11 2  
ATOM 3724  H HH12 . ARG A 1 104 ? -3.479  -13.640 8.669   1.00 5.85   ? 104 ARG A HH12 2  
ATOM 3725  H HH21 . ARG A 1 104 ? -2.000  -14.927 5.845   1.00 5.27   ? 104 ARG A HH21 2  
ATOM 3726  H HH22 . ARG A 1 104 ? -2.375  -15.237 7.519   1.00 5.75   ? 104 ARG A HH22 2  
ATOM 3727  N N    . ASP A 1 105 ? -3.723  -11.646 0.166   1.00 1.75   ? 105 ASP A N    2  
ATOM 3728  C CA   . ASP A 1 105 ? -4.349  -12.623 -0.742  1.00 2.06   ? 105 ASP A CA   2  
ATOM 3729  C C    . ASP A 1 105 ? -3.706  -12.616 -2.157  1.00 1.85   ? 105 ASP A C    2  
ATOM 3730  O O    . ASP A 1 105 ? -4.071  -13.455 -2.982  1.00 2.11   ? 105 ASP A O    2  
ATOM 3731  C CB   . ASP A 1 105 ? -5.867  -12.340 -0.790  1.00 2.46   ? 105 ASP A CB   2  
ATOM 3732  C CG   . ASP A 1 105 ? -6.702  -13.608 -1.039  1.00 3.12   ? 105 ASP A CG   2  
ATOM 3733  O OD1  . ASP A 1 105 ? -6.687  -14.511 -0.188  1.00 3.67   ? 105 ASP A OD1  2  
ATOM 3734  O OD2  . ASP A 1 105 ? -7.449  -13.633 -2.062  1.00 4.18   ? 105 ASP A OD2  2  
ATOM 3735  H H    . ASP A 1 105 ? -3.818  -10.675 -0.085  1.00 1.67   ? 105 ASP A H    2  
ATOM 3736  H HA   . ASP A 1 105 ? -4.210  -13.613 -0.316  1.00 2.44   ? 105 ASP A HA   2  
ATOM 3737  H HB2  . ASP A 1 105 ? -6.190  -11.927 0.171   1.00 3.19   ? 105 ASP A HB2  2  
ATOM 3738  H HB3  . ASP A 1 105 ? -6.073  -11.591 -1.560  1.00 2.68   ? 105 ASP A HB3  2  
ATOM 3739  N N    . GLY A 1 106 ? -2.748  -11.704 -2.407  1.00 1.65   ? 106 GLY A N    2  
ATOM 3740  C CA   . GLY A 1 106 ? -1.849  -11.702 -3.568  1.00 1.66   ? 106 GLY A CA   2  
ATOM 3741  C C    . GLY A 1 106 ? -0.421  -11.370 -3.144  1.00 2.04   ? 106 GLY A C    2  
ATOM 3742  O O    . GLY A 1 106 ? 0.482   -12.149 -3.405  1.00 2.80   ? 106 GLY A O    2  
ATOM 3743  H H    . GLY A 1 106 ? -2.524  -11.050 -1.661  1.00 1.73   ? 106 GLY A H    2  
ATOM 3744  H HA2  . GLY A 1 106 ? -1.868  -12.669 -4.072  1.00 2.01   ? 106 GLY A HA2  2  
ATOM 3745  H HA3  . GLY A 1 106 ? -2.181  -10.934 -4.267  1.00 1.66   ? 106 GLY A HA3  2  
ATOM 3746  N N    . ASP A 1 107 ? -0.254  -10.247 -2.443  1.00 1.96   ? 107 ASP A N    2  
ATOM 3747  C CA   . ASP A 1 107 ? 0.931   -9.705  -1.762  1.00 2.80   ? 107 ASP A CA   2  
ATOM 3748  C C    . ASP A 1 107 ? 0.727   -8.193  -1.532  1.00 1.86   ? 107 ASP A C    2  
ATOM 3749  O O    . ASP A 1 107 ? -0.253  -7.586  -1.977  1.00 1.67   ? 107 ASP A O    2  
ATOM 3750  C CB   . ASP A 1 107 ? 2.294   -10.041 -2.431  1.00 4.37   ? 107 ASP A CB   2  
ATOM 3751  C CG   . ASP A 1 107 ? 3.019   -11.280 -1.871  1.00 6.20   ? 107 ASP A CG   2  
ATOM 3752  O OD1  . ASP A 1 107 ? 2.867   -11.598 -0.671  1.00 7.03   ? 107 ASP A OD1  2  
ATOM 3753  O OD2  . ASP A 1 107 ? 3.822   -11.875 -2.636  1.00 7.19   ? 107 ASP A OD2  2  
ATOM 3754  H H    . ASP A 1 107 ? -1.093  -9.703  -2.266  1.00 1.71   ? 107 ASP A H    2  
ATOM 3755  H HA   . ASP A 1 107 ? 0.944   -10.137 -0.762  1.00 3.59   ? 107 ASP A HA   2  
ATOM 3756  H HB2  . ASP A 1 107 ? 2.163   -10.142 -3.505  1.00 4.39   ? 107 ASP A HB2  2  
ATOM 3757  H HB3  . ASP A 1 107 ? 2.980   -9.208  -2.284  1.00 4.82   ? 107 ASP A HB3  2  
ATOM 3758  N N    . HIS A 1 108 ? 1.632   -7.562  -0.780  1.00 1.68   ? 108 HIS A N    2  
ATOM 3759  C CA   . HIS A 1 108 ? 1.450   -6.204  -0.264  1.00 1.07   ? 108 HIS A CA   2  
ATOM 3760  C C    . HIS A 1 108 ? 2.762   -5.482  0.133   1.00 1.08   ? 108 HIS A C    2  
ATOM 3761  O O    . HIS A 1 108 ? 3.835   -6.081  0.072   1.00 1.51   ? 108 HIS A O    2  
ATOM 3762  C CB   . HIS A 1 108 ? 0.429   -6.279  0.885   1.00 1.24   ? 108 HIS A CB   2  
ATOM 3763  C CG   . HIS A 1 108 ? 0.885   -7.098  2.073   1.00 1.86   ? 108 HIS A CG   2  
ATOM 3764  N ND1  . HIS A 1 108 ? 2.169   -7.480  2.403   1.00 2.18   ? 108 HIS A ND1  2  
ATOM 3765  C CD2  . HIS A 1 108 ? 0.051   -7.655  2.998   1.00 2.98   ? 108 HIS A CD2  2  
ATOM 3766  C CE1  . HIS A 1 108 ? 2.098   -8.252  3.499   1.00 2.83   ? 108 HIS A CE1  2  
ATOM 3767  N NE2  . HIS A 1 108 ? 0.818   -8.390  3.894   1.00 3.38   ? 108 HIS A NE2  2  
ATOM 3768  H H    . HIS A 1 108 ? 2.462   -8.058  -0.498  1.00 2.24   ? 108 HIS A H    2  
ATOM 3769  H HA   . HIS A 1 108 ? 1.025   -5.611  -1.067  1.00 1.24   ? 108 HIS A HA   2  
ATOM 3770  H HB2  . HIS A 1 108 ? 0.177   -5.280  1.229   1.00 1.44   ? 108 HIS A HB2  2  
ATOM 3771  H HB3  . HIS A 1 108 ? -0.485  -6.739  0.500   1.00 1.32   ? 108 HIS A HB3  2  
ATOM 3772  H HD1  . HIS A 1 108 ? 3.015   -7.242  1.903   1.00 2.56   ? 108 HIS A HD1  2  
ATOM 3773  H HD2  . HIS A 1 108 ? -1.023  -7.557  3.021   1.00 3.76   ? 108 HIS A HD2  2  
ATOM 3774  H HE1  . HIS A 1 108 ? 2.953   -8.699  3.994   1.00 3.31   ? 108 HIS A HE1  2  
ATOM 3775  N N    . VAL A 1 109 ? 2.675   -4.213  0.560   1.00 0.84   ? 109 VAL A N    2  
ATOM 3776  C CA   . VAL A 1 109 ? 3.832   -3.375  0.950   1.00 0.77   ? 109 VAL A CA   2  
ATOM 3777  C C    . VAL A 1 109 ? 4.229   -3.644  2.414   1.00 0.76   ? 109 VAL A C    2  
ATOM 3778  O O    . VAL A 1 109 ? 3.361   -3.853  3.258   1.00 0.83   ? 109 VAL A O    2  
ATOM 3779  C CB   . VAL A 1 109 ? 3.560   -1.871  0.659   1.00 0.87   ? 109 VAL A CB   2  
ATOM 3780  C CG1  . VAL A 1 109 ? 2.382   -1.323  1.469   1.00 2.02   ? 109 VAL A CG1  2  
ATOM 3781  C CG2  . VAL A 1 109 ? 4.766   -0.961  0.927   1.00 1.57   ? 109 VAL A CG2  2  
ATOM 3782  H H    . VAL A 1 109 ? 1.750   -3.854  0.767   1.00 0.90   ? 109 VAL A H    2  
ATOM 3783  H HA   . VAL A 1 109 ? 4.663   -3.679  0.320   1.00 0.78   ? 109 VAL A HA   2  
ATOM 3784  H HB   . VAL A 1 109 ? 3.313   -1.785  -0.404  1.00 1.49   ? 109 VAL A HB   2  
ATOM 3785  H HG11 . VAL A 1 109 ? 1.494   -1.938  1.334   1.00 2.71   ? 109 VAL A HG11 2  
ATOM 3786  H HG12 . VAL A 1 109 ? 2.657   -1.314  2.521   1.00 3.08   ? 109 VAL A HG12 2  
ATOM 3787  H HG13 . VAL A 1 109 ? 2.153   -0.309  1.151   1.00 2.55   ? 109 VAL A HG13 2  
ATOM 3788  H HG21 . VAL A 1 109 ? 5.039   -0.984  1.982   1.00 2.21   ? 109 VAL A HG21 2  
ATOM 3789  H HG22 . VAL A 1 109 ? 5.615   -1.275  0.333   1.00 2.44   ? 109 VAL A HG22 2  
ATOM 3790  H HG23 . VAL A 1 109 ? 4.520   0.061   0.652   1.00 2.13   ? 109 VAL A HG23 2  
ATOM 3791  N N    . MET A 1 110 ? 5.533   -3.642  2.713   1.00 0.88   ? 110 MET A N    2  
ATOM 3792  C CA   . MET A 1 110 ? 6.120   -4.116  3.974   1.00 0.80   ? 110 MET A CA   2  
ATOM 3793  C C    . MET A 1 110 ? 7.135   -3.115  4.560   1.00 0.77   ? 110 MET A C    2  
ATOM 3794  O O    . MET A 1 110 ? 7.983   -2.554  3.865   1.00 0.88   ? 110 MET A O    2  
ATOM 3795  C CB   . MET A 1 110 ? 6.736   -5.511  3.802   1.00 0.87   ? 110 MET A CB   2  
ATOM 3796  C CG   . MET A 1 110 ? 5.709   -6.511  3.241   1.00 1.89   ? 110 MET A CG   2  
ATOM 3797  S SD   . MET A 1 110 ? 6.071   -8.267  3.514   1.00 1.94   ? 110 MET A SD   2  
ATOM 3798  C CE   . MET A 1 110 ? 7.696   -8.378  2.722   1.00 3.78   ? 110 MET A CE   2  
ATOM 3799  H H    . MET A 1 110 ? 6.187   -3.414  1.969   1.00 1.04   ? 110 MET A H    2  
ATOM 3800  H HA   . MET A 1 110 ? 5.322   -4.233  4.696   1.00 0.80   ? 110 MET A HA   2  
ATOM 3801  H HB2  . MET A 1 110 ? 7.586   -5.454  3.127   1.00 1.68   ? 110 MET A HB2  2  
ATOM 3802  H HB3  . MET A 1 110 ? 7.084   -5.865  4.775   1.00 1.67   ? 110 MET A HB3  2  
ATOM 3803  H HG2  . MET A 1 110 ? 4.743   -6.310  3.709   1.00 2.85   ? 110 MET A HG2  2  
ATOM 3804  H HG3  . MET A 1 110 ? 5.601   -6.349  2.163   1.00 2.96   ? 110 MET A HG3  2  
ATOM 3805  H HE1  . MET A 1 110 ? 8.412   -7.770  3.268   1.00 4.04   ? 110 MET A HE1  2  
ATOM 3806  H HE2  . MET A 1 110 ? 8.032   -9.417  2.724   1.00 4.30   ? 110 MET A HE2  2  
ATOM 3807  H HE3  . MET A 1 110 ? 7.626   -8.027  1.690   1.00 5.11   ? 110 MET A HE3  2  
ATOM 3808  N N    . LEU A 1 111 ? 7.029   -2.878  5.874   1.00 0.74   ? 111 LEU A N    2  
ATOM 3809  C CA   . LEU A 1 111 ? 7.734   -1.844  6.633   1.00 0.79   ? 111 LEU A CA   2  
ATOM 3810  C C    . LEU A 1 111 ? 8.892   -2.490  7.404   1.00 0.77   ? 111 LEU A C    2  
ATOM 3811  O O    . LEU A 1 111 ? 8.929   -2.448  8.632   1.00 0.98   ? 111 LEU A O    2  
ATOM 3812  C CB   . LEU A 1 111 ? 6.737   -1.088  7.544   1.00 0.93   ? 111 LEU A CB   2  
ATOM 3813  C CG   . LEU A 1 111 ? 5.711   -0.161  6.846   1.00 1.09   ? 111 LEU A CG   2  
ATOM 3814  C CD1  . LEU A 1 111 ? 4.549   -0.888  6.150   1.00 2.00   ? 111 LEU A CD1  2  
ATOM 3815  C CD2  . LEU A 1 111 ? 5.123   0.798   7.891   1.00 2.44   ? 111 LEU A CD2  2  
ATOM 3816  H H    . LEU A 1 111 ? 6.392   -3.453  6.412   1.00 0.75   ? 111 LEU A H    2  
ATOM 3817  H HA   . LEU A 1 111 ? 8.169   -1.135  5.938   1.00 0.87   ? 111 LEU A HA   2  
ATOM 3818  H HB2  . LEU A 1 111 ? 6.196   -1.826  8.136   1.00 1.07   ? 111 LEU A HB2  2  
ATOM 3819  H HB3  . LEU A 1 111 ? 7.336   -0.464  8.214   1.00 1.19   ? 111 LEU A HB3  2  
ATOM 3820  H HG   . LEU A 1 111 ? 6.228   0.438   6.099   1.00 1.80   ? 111 LEU A HG   2  
ATOM 3821  H HD11 . LEU A 1 111 ? 4.065   -1.553  6.859   1.00 2.85   ? 111 LEU A HD11 2  
ATOM 3822  H HD12 . LEU A 1 111 ? 3.812   -0.164  5.787   1.00 2.56   ? 111 LEU A HD12 2  
ATOM 3823  H HD13 . LEU A 1 111 ? 4.900   -1.462  5.293   1.00 2.94   ? 111 LEU A HD13 2  
ATOM 3824  H HD21 . LEU A 1 111 ? 5.925   1.374   8.355   1.00 3.43   ? 111 LEU A HD21 2  
ATOM 3825  H HD22 . LEU A 1 111 ? 4.420   1.491   7.419   1.00 2.85   ? 111 LEU A HD22 2  
ATOM 3826  H HD23 . LEU A 1 111 ? 4.603   0.228   8.658   1.00 3.27   ? 111 LEU A HD23 2  
ATOM 3827  N N    . MET A 1 112 ? 9.813   -3.124  6.670   1.00 0.73   ? 112 MET A N    2  
ATOM 3828  C CA   . MET A 1 112 ? 10.854  -3.989  7.234   1.00 0.83   ? 112 MET A CA   2  
ATOM 3829  C C    . MET A 1 112 ? 12.000  -3.193  7.869   1.00 0.95   ? 112 MET A C    2  
ATOM 3830  O O    . MET A 1 112 ? 12.512  -2.236  7.285   1.00 1.04   ? 112 MET A O    2  
ATOM 3831  C CB   . MET A 1 112 ? 11.349  -4.942  6.138   1.00 0.99   ? 112 MET A CB   2  
ATOM 3832  C CG   . MET A 1 112 ? 12.399  -5.935  6.657   1.00 1.18   ? 112 MET A CG   2  
ATOM 3833  S SD   . MET A 1 112 ? 12.708  -7.361  5.580   1.00 2.20   ? 112 MET A SD   2  
ATOM 3834  C CE   . MET A 1 112 ? 13.246  -6.518  4.070   1.00 3.10   ? 112 MET A CE   2  
ATOM 3835  H H    . MET A 1 112 ? 9.759   -3.065  5.658   1.00 0.82   ? 112 MET A H    2  
ATOM 3836  H HA   . MET A 1 112 ? 10.407  -4.602  8.013   1.00 0.85   ? 112 MET A HA   2  
ATOM 3837  H HB2  . MET A 1 112 ? 10.493  -5.510  5.755   1.00 1.21   ? 112 MET A HB2  2  
ATOM 3838  H HB3  . MET A 1 112 ? 11.773  -4.361  5.319   1.00 1.09   ? 112 MET A HB3  2  
ATOM 3839  H HG2  . MET A 1 112 ? 13.344  -5.412  6.817   1.00 1.45   ? 112 MET A HG2  2  
ATOM 3840  H HG3  . MET A 1 112 ? 12.054  -6.327  7.616   1.00 1.70   ? 112 MET A HG3  2  
ATOM 3841  H HE1  . MET A 1 112 ? 12.416  -5.958  3.648   1.00 4.24   ? 112 MET A HE1  2  
ATOM 3842  H HE2  . MET A 1 112 ? 14.072  -5.846  4.292   1.00 3.58   ? 112 MET A HE2  2  
ATOM 3843  H HE3  . MET A 1 112 ? 13.574  -7.265  3.335   1.00 3.74   ? 112 MET A HE3  2  
ATOM 3844  N N    . GLY A 1 113 ? 12.409  -3.589  9.083   1.00 1.07   ? 113 GLY A N    2  
ATOM 3845  C CA   . GLY A 1 113 ? 13.391  -2.830  9.861   1.00 1.23   ? 113 GLY A CA   2  
ATOM 3846  C C    . GLY A 1 113 ? 12.753  -1.563  10.424  1.00 1.28   ? 113 GLY A C    2  
ATOM 3847  O O    . GLY A 1 113 ? 13.208  -0.456  10.146  1.00 1.50   ? 113 GLY A O    2  
ATOM 3848  H H    . GLY A 1 113 ? 11.933  -4.365  9.537   1.00 1.05   ? 113 GLY A H    2  
ATOM 3849  H HA2  . GLY A 1 113 ? 13.740  -3.431  10.698  1.00 1.33   ? 113 GLY A HA2  2  
ATOM 3850  H HA3  . GLY A 1 113 ? 14.234  -2.536  9.234   1.00 1.29   ? 113 GLY A HA3  2  
ATOM 3851  N N    . LEU A 1 114 ? 11.665  -1.723  11.171  1.00 1.37   ? 114 LEU A N    2  
ATOM 3852  C CA   . LEU A 1 114 ? 10.934  -0.650  11.832  1.00 1.44   ? 114 LEU A CA   2  
ATOM 3853  C C    . LEU A 1 114 ? 11.746  -0.121  13.038  1.00 1.75   ? 114 LEU A C    2  
ATOM 3854  O O    . LEU A 1 114 ? 12.575  -0.818  13.630  1.00 2.71   ? 114 LEU A O    2  
ATOM 3855  C CB   . LEU A 1 114 ? 9.553   -1.230  12.216  1.00 1.70   ? 114 LEU A CB   2  
ATOM 3856  C CG   . LEU A 1 114 ? 8.429   -0.224  12.475  1.00 1.95   ? 114 LEU A CG   2  
ATOM 3857  C CD1  . LEU A 1 114 ? 7.916   0.425   11.183  1.00 2.39   ? 114 LEU A CD1  2  
ATOM 3858  C CD2  . LEU A 1 114 ? 7.283   -0.887  13.242  1.00 2.76   ? 114 LEU A CD2  2  
ATOM 3859  H H    . LEU A 1 114 ? 11.313  -2.663  11.300  1.00 1.51   ? 114 LEU A H    2  
ATOM 3860  H HA   . LEU A 1 114 ? 10.799  0.172   11.123  1.00 1.61   ? 114 LEU A HA   2  
ATOM 3861  H HB2  . LEU A 1 114 ? 9.200   -1.870  11.414  1.00 2.09   ? 114 LEU A HB2  2  
ATOM 3862  H HB3  . LEU A 1 114 ? 9.681   -1.850  13.099  1.00 2.02   ? 114 LEU A HB3  2  
ATOM 3863  H HG   . LEU A 1 114 ? 8.832   0.548   13.103  1.00 2.13   ? 114 LEU A HG   2  
ATOM 3864  H HD11 . LEU A 1 114 ? 7.446   -0.351  10.592  1.00 3.02   ? 114 LEU A HD11 2  
ATOM 3865  H HD12 . LEU A 1 114 ? 7.173   1.188   11.425  1.00 2.89   ? 114 LEU A HD12 2  
ATOM 3866  H HD13 . LEU A 1 114 ? 8.738   0.870   10.612  1.00 3.07   ? 114 LEU A HD13 2  
ATOM 3867  H HD21 . LEU A 1 114 ? 6.481   -0.159  13.408  1.00 3.18   ? 114 LEU A HD21 2  
ATOM 3868  H HD22 . LEU A 1 114 ? 6.906   -1.699  12.629  1.00 3.24   ? 114 LEU A HD22 2  
ATOM 3869  H HD23 . LEU A 1 114 ? 7.645   -1.285  14.194  1.00 3.33   ? 114 LEU A HD23 2  
ATOM 3870  N N    . LYS A 1 115 ? 11.467  1.122   13.427  1.00 1.35   ? 115 LYS A N    2  
ATOM 3871  C CA   . LYS A 1 115 ? 12.147  1.816   14.519  1.00 1.79   ? 115 LYS A CA   2  
ATOM 3872  C C    . LYS A 1 115 ? 11.474  1.635   15.897  1.00 2.35   ? 115 LYS A C    2  
ATOM 3873  O O    . LYS A 1 115 ? 12.161  1.319   16.869  1.00 3.10   ? 115 LYS A O    2  
ATOM 3874  C CB   . LYS A 1 115 ? 12.395  3.272   14.087  1.00 1.82   ? 115 LYS A CB   2  
ATOM 3875  C CG   . LYS A 1 115 ? 11.154  4.189   14.015  1.00 2.47   ? 115 LYS A CG   2  
ATOM 3876  C CD   . LYS A 1 115 ? 11.511  5.493   13.277  1.00 2.99   ? 115 LYS A CD   2  
ATOM 3877  C CE   . LYS A 1 115 ? 11.487  5.317   11.743  1.00 2.96   ? 115 LYS A CE   2  
ATOM 3878  N NZ   . LYS A 1 115 ? 12.033  6.484   10.999  1.00 3.79   ? 115 LYS A NZ   2  
ATOM 3879  H H    . LYS A 1 115 ? 10.714  1.576   12.950  1.00 1.23   ? 115 LYS A H    2  
ATOM 3880  H HA   . LYS A 1 115 ? 13.126  1.352   14.623  1.00 2.19   ? 115 LYS A HA   2  
ATOM 3881  H HB2  . LYS A 1 115 ? 13.064  3.715   14.805  1.00 2.62   ? 115 LYS A HB2  2  
ATOM 3882  H HB3  . LYS A 1 115 ? 12.987  3.247   13.156  1.00 2.14   ? 115 LYS A HB3  2  
ATOM 3883  H HG2  . LYS A 1 115 ? 10.414  3.687   13.384  1.00 2.61   ? 115 LYS A HG2  2  
ATOM 3884  H HG3  . LYS A 1 115 ? 10.796  4.423   15.034  1.00 3.38   ? 115 LYS A HG3  2  
ATOM 3885  H HD2  . LYS A 1 115 ? 10.805  6.260   13.565  1.00 3.80   ? 115 LYS A HD2  2  
ATOM 3886  H HD3  . LYS A 1 115 ? 12.462  5.892   13.612  1.00 3.25   ? 115 LYS A HD3  2  
ATOM 3887  H HE2  . LYS A 1 115 ? 12.098  4.447   11.491  1.00 2.62   ? 115 LYS A HE2  2  
ATOM 3888  H HE3  . LYS A 1 115 ? 10.431  5.151   11.479  1.00 3.23   ? 115 LYS A HE3  2  
ATOM 3889  H HZ1  . LYS A 1 115 ? 11.631  7.343   11.309  1.00 4.82   ? 115 LYS A HZ1  2  
ATOM 3890  H HZ2  . LYS A 1 115 ? 13.050  6.579   11.047  1.00 3.75   ? 115 LYS A HZ2  2  
ATOM 3891  H HZ3  . LYS A 1 115 ? 11.779  6.392   10.018  1.00 4.10   ? 115 LYS A HZ3  2  
ATOM 3892  N N    . ARG A 1 116 ? 10.133  1.710   15.941  1.00 2.30   ? 116 ARG A N    2  
ATOM 3893  C CA   . ARG A 1 116 ? 9.271   1.258   17.045  1.00 3.04   ? 116 ARG A CA   2  
ATOM 3894  C C    . ARG A 1 116 ? 7.872   0.857   16.516  1.00 2.28   ? 116 ARG A C    2  
ATOM 3895  O O    . ARG A 1 116 ? 7.433   1.426   15.517  1.00 1.70   ? 116 ARG A O    2  
ATOM 3896  C CB   . ARG A 1 116 ? 9.142   2.345   18.135  1.00 4.08   ? 116 ARG A CB   2  
ATOM 3897  C CG   . ARG A 1 116 ? 10.276  2.280   19.168  1.00 5.71   ? 116 ARG A CG   2  
ATOM 3898  C CD   . ARG A 1 116 ? 9.952   3.069   20.439  1.00 6.52   ? 116 ARG A CD   2  
ATOM 3899  N NE   . ARG A 1 116 ? 10.033  4.518   20.216  1.00 5.75   ? 116 ARG A NE   2  
ATOM 3900  C CZ   . ARG A 1 116 ? 9.852   5.461   21.127  1.00 6.16   ? 116 ARG A CZ   2  
ATOM 3901  N NH1  . ARG A 1 116 ? 9.352   5.206   22.320  1.00 7.23   ? 116 ARG A NH1  2  
ATOM 3902  N NH2  . ARG A 1 116 ? 10.189  6.686   20.803  1.00 6.00   ? 116 ARG A NH2  2  
ATOM 3903  H H    . ARG A 1 116 ? 9.661   1.993   15.095  1.00 1.96   ? 116 ARG A H    2  
ATOM 3904  H HA   . ARG A 1 116 ? 9.730   0.375   17.496  1.00 3.72   ? 116 ARG A HA   2  
ATOM 3905  H HB2  . ARG A 1 116 ? 9.088   3.337   17.685  1.00 3.68   ? 116 ARG A HB2  2  
ATOM 3906  H HB3  . ARG A 1 116 ? 8.201   2.193   18.663  1.00 4.65   ? 116 ARG A HB3  2  
ATOM 3907  H HG2  . ARG A 1 116 ? 10.430  1.239   19.459  1.00 6.76   ? 116 ARG A HG2  2  
ATOM 3908  H HG3  . ARG A 1 116 ? 11.193  2.682   18.735  1.00 5.79   ? 116 ARG A HG3  2  
ATOM 3909  H HD2  . ARG A 1 116 ? 8.963   2.799   20.805  1.00 7.08   ? 116 ARG A HD2  2  
ATOM 3910  H HD3  . ARG A 1 116 ? 10.690  2.798   21.201  1.00 7.76   ? 116 ARG A HD3  2  
ATOM 3911  H HE   . ARG A 1 116 ? 10.331  4.843   19.298  1.00 5.32   ? 116 ARG A HE   2  
ATOM 3912  H HH11 . ARG A 1 116 ? 9.040   4.279   22.552  1.00 7.80   ? 116 ARG A HH11 2  
ATOM 3913  H HH12 . ARG A 1 116 ? 9.304   5.927   23.026  1.00 7.78   ? 116 ARG A HH12 2  
ATOM 3914  H HH21 . ARG A 1 116 ? 10.494  6.870   19.845  1.00 5.76   ? 116 ARG A HH21 2  
ATOM 3915  H HH22 . ARG A 1 116 ? 9.955   7.481   21.381  1.00 6.38   ? 116 ARG A HH22 2  
ATOM 3916  N N    . PRO A 1 117 ? 7.194   -0.111  17.166  1.00 2.58   ? 117 PRO A N    2  
ATOM 3917  C CA   . PRO A 1 117 ? 5.853   -0.565  16.805  1.00 2.24   ? 117 PRO A CA   2  
ATOM 3918  C C    . PRO A 1 117 ? 4.777   0.436   17.249  1.00 2.01   ? 117 PRO A C    2  
ATOM 3919  O O    . PRO A 1 117 ? 5.032   1.322   18.068  1.00 2.47   ? 117 PRO A O    2  
ATOM 3920  C CB   . PRO A 1 117 ? 5.694   -1.937  17.469  1.00 3.17   ? 117 PRO A CB   2  
ATOM 3921  C CG   . PRO A 1 117 ? 6.561   -1.820  18.721  1.00 3.92   ? 117 PRO A CG   2  
ATOM 3922  C CD   . PRO A 1 117 ? 7.693   -0.892  18.291  1.00 3.56   ? 117 PRO A CD   2  
ATOM 3923  H HA   . PRO A 1 117 ? 5.787   -0.682  15.724  1.00 1.87   ? 117 PRO A HA   2  
ATOM 3924  H HB2  . PRO A 1 117 ? 4.652   -2.161  17.714  1.00 3.24   ? 117 PRO A HB2  2  
ATOM 3925  H HB3  . PRO A 1 117 ? 6.107   -2.702  16.807  1.00 3.42   ? 117 PRO A HB3  2  
ATOM 3926  H HG2  . PRO A 1 117 ? 5.984   -1.347  19.517  1.00 4.10   ? 117 PRO A HG2  2  
ATOM 3927  H HG3  . PRO A 1 117 ? 6.936   -2.797  19.029  1.00 4.63   ? 117 PRO A HG3  2  
ATOM 3928  H HD2  . PRO A 1 117 ? 7.988   -0.262  19.130  1.00 4.01   ? 117 PRO A HD2  2  
ATOM 3929  H HD3  . PRO A 1 117 ? 8.541   -1.490  17.963  1.00 3.74   ? 117 PRO A HD3  2  
ATOM 3930  N N    . LEU A 1 118 ? 3.571   0.292   16.686  1.00 1.59   ? 118 LEU A N    2  
ATOM 3931  C CA   . LEU A 1 118 ? 2.503   1.291   16.757  1.00 1.46   ? 118 LEU A CA   2  
ATOM 3932  C C    . LEU A 1 118 ? 1.342   0.844   17.667  1.00 1.58   ? 118 LEU A C    2  
ATOM 3933  O O    . LEU A 1 118 ? 1.063   -0.353  17.804  1.00 1.72   ? 118 LEU A O    2  
ATOM 3934  C CB   . LEU A 1 118 ? 1.959   1.574   15.338  1.00 1.42   ? 118 LEU A CB   2  
ATOM 3935  C CG   . LEU A 1 118 ? 2.998   1.855   14.230  1.00 1.54   ? 118 LEU A CG   2  
ATOM 3936  C CD1  . LEU A 1 118 ? 2.257   2.125   12.913  1.00 2.05   ? 118 LEU A CD1  2  
ATOM 3937  C CD2  . LEU A 1 118 ? 3.927   3.034   14.559  1.00 2.33   ? 118 LEU A CD2  2  
ATOM 3938  H H    . LEU A 1 118 ? 3.405   -0.507  16.093  1.00 1.60   ? 118 LEU A H    2  
ATOM 3939  H HA   . LEU A 1 118 ? 2.896   2.223   17.172  1.00 1.73   ? 118 LEU A HA   2  
ATOM 3940  H HB2  . LEU A 1 118 ? 1.364   0.713   15.032  1.00 1.74   ? 118 LEU A HB2  2  
ATOM 3941  H HB3  . LEU A 1 118 ? 1.287   2.430   15.410  1.00 1.63   ? 118 LEU A HB3  2  
ATOM 3942  H HG   . LEU A 1 118 ? 3.612   0.965   14.091  1.00 2.12   ? 118 LEU A HG   2  
ATOM 3943  H HD11 . LEU A 1 118 ? 2.973   2.255   12.106  1.00 2.77   ? 118 LEU A HD11 2  
ATOM 3944  H HD12 . LEU A 1 118 ? 1.610   1.285   12.670  1.00 2.86   ? 118 LEU A HD12 2  
ATOM 3945  H HD13 . LEU A 1 118 ? 1.652   3.028   13.002  1.00 2.70   ? 118 LEU A HD13 2  
ATOM 3946  H HD21 . LEU A 1 118 ? 4.516   2.812   15.448  1.00 3.38   ? 118 LEU A HD21 2  
ATOM 3947  H HD22 . LEU A 1 118 ? 4.607   3.208   13.728  1.00 2.97   ? 118 LEU A HD22 2  
ATOM 3948  H HD23 . LEU A 1 118 ? 3.341   3.931   14.738  1.00 2.47   ? 118 LEU A HD23 2  
ATOM 3949  N N    . LYS A 1 119 ? 0.580   1.822   18.170  1.00 1.73   ? 119 LYS A N    2  
ATOM 3950  C CA   . LYS A 1 119 ? -0.756  1.601   18.719  1.00 1.71   ? 119 LYS A CA   2  
ATOM 3951  C C    . LYS A 1 119 ? -1.759  1.370   17.566  1.00 1.51   ? 119 LYS A C    2  
ATOM 3952  O O    . LYS A 1 119 ? -1.510  1.741   16.423  1.00 1.62   ? 119 LYS A O    2  
ATOM 3953  C CB   . LYS A 1 119 ? -1.120  2.799   19.633  1.00 1.89   ? 119 LYS A CB   2  
ATOM 3954  C CG   . LYS A 1 119 ? -1.420  4.105   18.862  1.00 3.08   ? 119 LYS A CG   2  
ATOM 3955  C CD   . LYS A 1 119 ? -0.905  5.398   19.523  1.00 4.29   ? 119 LYS A CD   2  
ATOM 3956  C CE   . LYS A 1 119 ? -1.765  6.014   20.633  1.00 5.05   ? 119 LYS A CE   2  
ATOM 3957  N NZ   . LYS A 1 119 ? -1.801  5.212   21.876  1.00 4.90   ? 119 LYS A NZ   2  
ATOM 3958  H H    . LYS A 1 119 ? 0.840   2.782   17.973  1.00 1.83   ? 119 LYS A H    2  
ATOM 3959  H HA   . LYS A 1 119 ? -0.725  0.693   19.328  1.00 2.08   ? 119 LYS A HA   2  
ATOM 3960  H HB2  . LYS A 1 119 ? -1.990  2.541   20.240  1.00 2.14   ? 119 LYS A HB2  2  
ATOM 3961  H HB3  . LYS A 1 119 ? -0.283  2.963   20.314  1.00 2.73   ? 119 LYS A HB3  2  
ATOM 3962  H HG2  . LYS A 1 119 ? -0.940  4.048   17.884  1.00 3.69   ? 119 LYS A HG2  2  
ATOM 3963  H HG3  . LYS A 1 119 ? -2.493  4.186   18.687  1.00 3.60   ? 119 LYS A HG3  2  
ATOM 3964  H HD2  . LYS A 1 119 ? 0.119   5.247   19.874  1.00 4.83   ? 119 LYS A HD2  2  
ATOM 3965  H HD3  . LYS A 1 119 ? -0.859  6.147   18.736  1.00 4.79   ? 119 LYS A HD3  2  
ATOM 3966  H HE2  . LYS A 1 119 ? -1.357  7.004   20.858  1.00 5.76   ? 119 LYS A HE2  2  
ATOM 3967  H HE3  . LYS A 1 119 ? -2.782  6.155   20.258  1.00 5.58   ? 119 LYS A HE3  2  
ATOM 3968  H HZ1  . LYS A 1 119 ? -0.876  4.963   22.215  1.00 5.42   ? 119 LYS A HZ1  2  
ATOM 3969  H HZ2  . LYS A 1 119 ? -2.300  5.715   22.604  1.00 5.32   ? 119 LYS A HZ2  2  
ATOM 3970  H HZ3  . LYS A 1 119 ? -2.335  4.362   21.753  1.00 4.61   ? 119 LYS A HZ3  2  
ATOM 3971  N N    . VAL A 1 120 ? -2.941  0.843   17.870  1.00 1.62   ? 120 VAL A N    2  
ATOM 3972  C CA   . VAL A 1 120 ? -4.017  0.503   16.915  1.00 1.63   ? 120 VAL A CA   2  
ATOM 3973  C C    . VAL A 1 120 ? -4.786  1.742   16.382  1.00 1.73   ? 120 VAL A C    2  
ATOM 3974  O O    . VAL A 1 120 ? -5.986  1.680   16.125  1.00 2.22   ? 120 VAL A O    2  
ATOM 3975  C CB   . VAL A 1 120 ? -4.908  -0.611  17.534  1.00 1.68   ? 120 VAL A CB   2  
ATOM 3976  C CG1  . VAL A 1 120 ? -5.825  -0.126  18.672  1.00 2.12   ? 120 VAL A CG1  2  
ATOM 3977  C CG2  . VAL A 1 120 ? -5.677  -1.425  16.480  1.00 2.13   ? 120 VAL A CG2  2  
ATOM 3978  H H    . VAL A 1 120 ? -3.050  0.547   18.818  1.00 1.91   ? 120 VAL A H    2  
ATOM 3979  H HA   . VAL A 1 120 ? -3.518  0.057   16.051  1.00 1.77   ? 120 VAL A HA   2  
ATOM 3980  H HB   . VAL A 1 120 ? -4.217  -1.319  17.993  1.00 2.36   ? 120 VAL A HB   2  
ATOM 3981  H HG11 . VAL A 1 120 ? -6.276  -0.985  19.165  1.00 2.56   ? 120 VAL A HG11 2  
ATOM 3982  H HG12 . VAL A 1 120 ? -5.247  0.432   19.405  1.00 3.20   ? 120 VAL A HG12 2  
ATOM 3983  H HG13 . VAL A 1 120 ? -6.624  0.509   18.286  1.00 2.51   ? 120 VAL A HG13 2  
ATOM 3984  H HG21 . VAL A 1 120 ? -6.405  -0.808  15.955  1.00 2.62   ? 120 VAL A HG21 2  
ATOM 3985  H HG22 . VAL A 1 120 ? -4.966  -1.835  15.770  1.00 3.06   ? 120 VAL A HG22 2  
ATOM 3986  H HG23 . VAL A 1 120 ? -6.201  -2.249  16.963  1.00 2.63   ? 120 VAL A HG23 2  
ATOM 3987  N N    . GLY A 1 121 ? -4.103  2.887   16.243  1.00 1.95   ? 121 GLY A N    2  
ATOM 3988  C CA   . GLY A 1 121 ? -4.692  4.170   15.824  1.00 2.22   ? 121 GLY A CA   2  
ATOM 3989  C C    . GLY A 1 121 ? -3.729  5.356   15.684  1.00 2.31   ? 121 GLY A C    2  
ATOM 3990  O O    . GLY A 1 121 ? -4.165  6.501   15.764  1.00 2.48   ? 121 GLY A O    2  
ATOM 3991  H H    . GLY A 1 121 ? -3.096  2.826   16.329  1.00 2.34   ? 121 GLY A H    2  
ATOM 3992  H HA2  . GLY A 1 121 ? -5.194  4.025   14.867  1.00 2.39   ? 121 GLY A HA2  2  
ATOM 3993  H HA3  . GLY A 1 121 ? -5.466  4.439   16.538  1.00 2.25   ? 121 GLY A HA3  2  
ATOM 3994  N N    . GLU A 1 122 ? -2.430  5.092   15.516  1.00 2.25   ? 122 GLU A N    2  
ATOM 3995  C CA   . GLU A 1 122 ? -1.390  6.085   15.230  1.00 2.29   ? 122 GLU A CA   2  
ATOM 3996  C C    . GLU A 1 122 ? -1.706  6.870   13.940  1.00 2.03   ? 122 GLU A C    2  
ATOM 3997  O O    . GLU A 1 122 ? -2.294  6.324   12.992  1.00 1.95   ? 122 GLU A O    2  
ATOM 3998  C CB   . GLU A 1 122 ? -0.043  5.346   15.078  1.00 2.42   ? 122 GLU A CB   2  
ATOM 3999  C CG   . GLU A 1 122 ? 1.182   6.100   15.598  1.00 2.59   ? 122 GLU A CG   2  
ATOM 4000  C CD   . GLU A 1 122 ? 1.443   5.838   17.082  1.00 2.07   ? 122 GLU A CD   2  
ATOM 4001  O OE1  . GLU A 1 122 ? 1.695   4.672   17.460  1.00 2.70   ? 122 GLU A OE1  2  
ATOM 4002  O OE2  . GLU A 1 122 ? 1.387   6.826   17.857  1.00 2.53   ? 122 GLU A OE2  2  
ATOM 4003  H H    . GLU A 1 122 ? -2.139  4.128   15.483  1.00 2.17   ? 122 GLU A H    2  
ATOM 4004  H HA   . GLU A 1 122 ? -1.327  6.775   16.071  1.00 2.76   ? 122 GLU A HA   2  
ATOM 4005  H HB2  . GLU A 1 122 ? -0.090  4.381   15.577  1.00 2.86   ? 122 GLU A HB2  2  
ATOM 4006  H HB3  . GLU A 1 122 ? 0.126   5.140   14.024  1.00 2.49   ? 122 GLU A HB3  2  
ATOM 4007  H HG2  . GLU A 1 122 ? 2.053   5.760   15.046  1.00 2.97   ? 122 GLU A HG2  2  
ATOM 4008  H HG3  . GLU A 1 122 ? 1.067   7.171   15.414  1.00 3.06   ? 122 GLU A HG3  2  
ATOM 4009  N N    . THR A 1 123 ? -1.240  8.128   13.883  1.00 2.20   ? 123 THR A N    2  
ATOM 4010  C CA   . THR A 1 123 ? -1.160  8.929   12.652  1.00 2.29   ? 123 THR A CA   2  
ATOM 4011  C C    . THR A 1 123 ? 0.156   8.578   11.959  1.00 1.83   ? 123 THR A C    2  
ATOM 4012  O O    . THR A 1 123 ? 1.222   8.711   12.559  1.00 2.01   ? 123 THR A O    2  
ATOM 4013  C CB   . THR A 1 123 ? -1.208  10.436  12.958  1.00 3.06   ? 123 THR A CB   2  
ATOM 4014  O OG1  . THR A 1 123 ? -2.357  10.734  13.715  1.00 3.41   ? 123 THR A OG1  2  
ATOM 4015  C CG2  . THR A 1 123 ? -1.271  11.279  11.683  1.00 3.58   ? 123 THR A CG2  2  
ATOM 4016  H H    . THR A 1 123 ? -0.791  8.507   14.706  1.00 2.38   ? 123 THR A H    2  
ATOM 4017  H HA   . THR A 1 123 ? -1.993  8.664   12.001  1.00 2.40   ? 123 THR A HA   2  
ATOM 4018  H HB   . THR A 1 123 ? -0.326  10.720  13.535  1.00 3.89   ? 123 THR A HB   2  
ATOM 4019  H HG1  . THR A 1 123 ? -3.122  10.586  13.148  1.00 3.28   ? 123 THR A HG1  2  
ATOM 4020  H HG21 . THR A 1 123 ? -2.110  10.961  11.064  1.00 3.41   ? 123 THR A HG21 2  
ATOM 4021  H HG22 . THR A 1 123 ? -1.395  12.329  11.944  1.00 4.07   ? 123 THR A HG22 2  
ATOM 4022  H HG23 . THR A 1 123 ? -0.346  11.169  11.116  1.00 4.55   ? 123 THR A HG23 2  
ATOM 4023  N N    . VAL A 1 124 ? 0.087   8.132   10.703  1.00 1.35   ? 124 VAL A N    2  
ATOM 4024  C CA   . VAL A 1 124 ? 1.196   7.520   9.955   1.00 1.04   ? 124 VAL A CA   2  
ATOM 4025  C C    . VAL A 1 124 ? 1.413   8.300   8.658   1.00 0.98   ? 124 VAL A C    2  
ATOM 4026  O O    . VAL A 1 124 ? 0.457   8.660   7.969   1.00 1.01   ? 124 VAL A O    2  
ATOM 4027  C CB   . VAL A 1 124 ? 0.890   6.028   9.660   1.00 1.05   ? 124 VAL A CB   2  
ATOM 4028  C CG1  . VAL A 1 124 ? 1.918   5.393   8.709   1.00 2.11   ? 124 VAL A CG1  2  
ATOM 4029  C CG2  . VAL A 1 124 ? 0.825   5.219   10.970  1.00 2.10   ? 124 VAL A CG2  2  
ATOM 4030  H H    . VAL A 1 124 ? -0.808  8.133   10.216  1.00 1.35   ? 124 VAL A H    2  
ATOM 4031  H HA   . VAL A 1 124 ? 2.111   7.572   10.547  1.00 1.28   ? 124 VAL A HA   2  
ATOM 4032  H HB   . VAL A 1 124 ? -0.086  5.953   9.179   1.00 1.98   ? 124 VAL A HB   2  
ATOM 4033  H HG11 . VAL A 1 124 ? 2.922   5.585   9.079   1.00 3.03   ? 124 VAL A HG11 2  
ATOM 4034  H HG12 . VAL A 1 124 ? 1.755   4.315   8.641   1.00 2.62   ? 124 VAL A HG12 2  
ATOM 4035  H HG13 . VAL A 1 124 ? 1.818   5.812   7.712   1.00 2.92   ? 124 VAL A HG13 2  
ATOM 4036  H HG21 . VAL A 1 124 ? 1.775   5.286   11.502  1.00 2.57   ? 124 VAL A HG21 2  
ATOM 4037  H HG22 . VAL A 1 124 ? 0.029   5.601   11.608  1.00 3.06   ? 124 VAL A HG22 2  
ATOM 4038  H HG23 . VAL A 1 124 ? 0.607   4.174   10.755  1.00 2.92   ? 124 VAL A HG23 2  
ATOM 4039  N N    . ASN A 1 125 ? 2.677   8.561   8.327   1.00 1.05   ? 125 ASN A N    2  
ATOM 4040  C CA   . ASN A 1 125 ? 3.047   9.247   7.091   1.00 1.10   ? 125 ASN A CA   2  
ATOM 4041  C C    . ASN A 1 125 ? 2.873   8.328   5.866   1.00 0.84   ? 125 ASN A C    2  
ATOM 4042  O O    . ASN A 1 125 ? 3.434   7.229   5.865   1.00 1.07   ? 125 ASN A O    2  
ATOM 4043  C CB   . ASN A 1 125 ? 4.538   9.637   7.158   1.00 1.73   ? 125 ASN A CB   2  
ATOM 4044  C CG   . ASN A 1 125 ? 4.908   10.874  7.954   1.00 2.40   ? 125 ASN A CG   2  
ATOM 4045  O OD1  . ASN A 1 125 ? 5.586   11.745  7.435   1.00 3.42   ? 125 ASN A OD1  2  
ATOM 4046  N ND2  . ASN A 1 125 ? 4.557   10.987  9.220   1.00 2.57   ? 125 ASN A ND2  2  
ATOM 4047  H H    . ASN A 1 125 ? 3.406   8.182   8.908   1.00 1.16   ? 125 ASN A H    2  
ATOM 4048  H HA   . ASN A 1 125 ? 2.403   10.127  6.990   1.00 1.23   ? 125 ASN A HA   2  
ATOM 4049  H HB2  . ASN A 1 125 ? 5.099   8.790   7.556   1.00 1.72   ? 125 ASN A HB2  2  
ATOM 4050  H HB3  . ASN A 1 125 ? 4.884   9.801   6.136   1.00 2.09   ? 125 ASN A HB3  2  
ATOM 4051  H HD21 . ASN A 1 125 ? 3.975   10.294  9.665   1.00 2.71   ? 125 ASN A HD21 2  
ATOM 4052  H HD22 . ASN A 1 125 ? 4.912   11.796  9.715   1.00 3.12   ? 125 ASN A HD22 2  
ATOM 4053  N N    . ILE A 1 126 ? 2.250   8.775   4.764   1.00 0.87   ? 126 ILE A N    2  
ATOM 4054  C CA   . ILE A 1 126 ? 2.207   8.007   3.495   1.00 0.88   ? 126 ILE A CA   2  
ATOM 4055  C C    . ILE A 1 126 ? 2.323   8.934   2.280   1.00 0.92   ? 126 ILE A C    2  
ATOM 4056  O O    . ILE A 1 126 ? 1.767   10.028  2.279   1.00 0.94   ? 126 ILE A O    2  
ATOM 4057  C CB   . ILE A 1 126 ? 0.963   7.076   3.463   1.00 0.84   ? 126 ILE A CB   2  
ATOM 4058  C CG1  . ILE A 1 126 ? 1.071   5.914   2.452   1.00 1.77   ? 126 ILE A CG1  2  
ATOM 4059  C CG2  . ILE A 1 126 ? -0.374  7.822   3.294   1.00 1.63   ? 126 ILE A CG2  2  
ATOM 4060  C CD1  . ILE A 1 126 ? 0.902   6.262   0.968   1.00 3.13   ? 126 ILE A CD1  2  
ATOM 4061  H H    . ILE A 1 126 ? 1.805   9.693   4.755   1.00 1.08   ? 126 ILE A H    2  
ATOM 4062  H HA   . ILE A 1 126 ? 3.083   7.358   3.477   1.00 0.97   ? 126 ILE A HA   2  
ATOM 4063  H HB   . ILE A 1 126 ? 0.923   6.588   4.440   1.00 1.18   ? 126 ILE A HB   2  
ATOM 4064  H HG12 . ILE A 1 126 ? 2.029   5.412   2.591   1.00 2.35   ? 126 ILE A HG12 2  
ATOM 4065  H HG13 . ILE A 1 126 ? 0.301   5.183   2.707   1.00 1.93   ? 126 ILE A HG13 2  
ATOM 4066  H HG21 . ILE A 1 126 ? -0.351  8.493   2.436   1.00 2.24   ? 126 ILE A HG21 2  
ATOM 4067  H HG22 . ILE A 1 126 ? -1.188  7.113   3.151   1.00 2.28   ? 126 ILE A HG22 2  
ATOM 4068  H HG23 . ILE A 1 126 ? -0.578  8.400   4.191   1.00 2.97   ? 126 ILE A HG23 2  
ATOM 4069  H HD11 . ILE A 1 126 ? 1.839   6.074   0.446   1.00 3.58   ? 126 ILE A HD11 2  
ATOM 4070  H HD12 . ILE A 1 126 ? 0.122   5.633   0.535   1.00 3.89   ? 126 ILE A HD12 2  
ATOM 4071  H HD13 . ILE A 1 126 ? 0.621   7.300   0.824   1.00 4.02   ? 126 ILE A HD13 2  
ATOM 4072  N N    . THR A 1 127 ? 3.074   8.531   1.256   1.00 1.02   ? 127 THR A N    2  
ATOM 4073  C CA   . THR A 1 127 ? 3.203   9.251   -0.014  1.00 1.16   ? 127 THR A CA   2  
ATOM 4074  C C    . THR A 1 127 ? 2.808   8.302   -1.126  1.00 1.00   ? 127 THR A C    2  
ATOM 4075  O O    . THR A 1 127 ? 3.520   7.332   -1.373  1.00 1.10   ? 127 THR A O    2  
ATOM 4076  C CB   . THR A 1 127 ? 4.633   9.783   -0.173  1.00 1.47   ? 127 THR A CB   2  
ATOM 4077  O OG1  . THR A 1 127 ? 4.786   10.845  0.736   1.00 2.44   ? 127 THR A OG1  2  
ATOM 4078  C CG2  . THR A 1 127 ? 4.898   10.372  -1.557  1.00 2.12   ? 127 THR A CG2  2  
ATOM 4079  H H    . THR A 1 127 ? 3.538   7.629   1.333   1.00 1.04   ? 127 THR A H    2  
ATOM 4080  H HA   . THR A 1 127 ? 2.523   10.095  -0.038  1.00 1.29   ? 127 THR A HA   2  
ATOM 4081  H HB   . THR A 1 127 ? 5.355   8.991   0.048   1.00 1.24   ? 127 THR A HB   2  
ATOM 4082  H HG1  . THR A 1 127 ? 4.301   10.647  1.547   1.00 2.58   ? 127 THR A HG1  2  
ATOM 4083  H HG21 . THR A 1 127 ? 4.899   9.586   -2.308  1.00 2.94   ? 127 THR A HG21 2  
ATOM 4084  H HG22 . THR A 1 127 ? 4.131   11.109  -1.800  1.00 2.58   ? 127 THR A HG22 2  
ATOM 4085  H HG23 . THR A 1 127 ? 5.870   10.857  -1.564  1.00 2.43   ? 127 THR A HG23 2  
ATOM 4086  N N    . LEU A 1 128 ? 1.690   8.568   -1.814  1.00 1.06   ? 128 LEU A N    2  
ATOM 4087  C CA   . LEU A 1 128 ? 1.262   7.797   -2.989  1.00 1.11   ? 128 LEU A CA   2  
ATOM 4088  C C    . LEU A 1 128 ? 1.106   8.745   -4.179  1.00 1.66   ? 128 LEU A C    2  
ATOM 4089  O O    . LEU A 1 128 ? 0.278   9.647   -4.157  1.00 2.66   ? 128 LEU A O    2  
ATOM 4090  C CB   . LEU A 1 128 ? 0.004   6.935   -2.722  1.00 1.50   ? 128 LEU A CB   2  
ATOM 4091  C CG   . LEU A 1 128 ? -1.373  7.616   -2.532  1.00 1.63   ? 128 LEU A CG   2  
ATOM 4092  C CD1  . LEU A 1 128 ? -2.455  6.533   -2.448  1.00 2.87   ? 128 LEU A CD1  2  
ATOM 4093  C CD2  . LEU A 1 128 ? -1.484  8.496   -1.279  1.00 2.12   ? 128 LEU A CD2  2  
ATOM 4094  H H    . LEU A 1 128 ? 1.154   9.407   -1.598  1.00 1.29   ? 128 LEU A H    2  
ATOM 4095  H HA   . LEU A 1 128 ? 2.054   7.098   -3.254  1.00 0.92   ? 128 LEU A HA   2  
ATOM 4096  H HB2  . LEU A 1 128 ? -0.093  6.262   -3.573  1.00 2.68   ? 128 LEU A HB2  2  
ATOM 4097  H HB3  . LEU A 1 128 ? 0.198   6.297   -1.861  1.00 2.31   ? 128 LEU A HB3  2  
ATOM 4098  H HG   . LEU A 1 128 ? -1.599  8.218   -3.410  1.00 2.91   ? 128 LEU A HG   2  
ATOM 4099  H HD11 . LEU A 1 128 ? -2.295  5.924   -1.558  1.00 3.35   ? 128 LEU A HD11 2  
ATOM 4100  H HD12 . LEU A 1 128 ? -3.442  6.997   -2.394  1.00 3.59   ? 128 LEU A HD12 2  
ATOM 4101  H HD13 . LEU A 1 128 ? -2.418  5.900   -3.336  1.00 3.53   ? 128 LEU A HD13 2  
ATOM 4102  H HD21 . LEU A 1 128 ? -2.502  8.877   -1.184  1.00 2.98   ? 128 LEU A HD21 2  
ATOM 4103  H HD22 . LEU A 1 128 ? -1.240  7.920   -0.389  1.00 2.69   ? 128 LEU A HD22 2  
ATOM 4104  H HD23 . LEU A 1 128 ? -0.814  9.347   -1.359  1.00 3.11   ? 128 LEU A HD23 2  
ATOM 4105  N N    . LYS A 1 129 ? 1.948   8.579   -5.206  1.00 1.32   ? 129 LYS A N    2  
ATOM 4106  C CA   . LYS A 1 129 ? 1.971   9.443   -6.401  1.00 1.74   ? 129 LYS A CA   2  
ATOM 4107  C C    . LYS A 1 129 ? 1.570   8.646   -7.656  1.00 1.54   ? 129 LYS A C    2  
ATOM 4108  O O    . LYS A 1 129 ? 2.213   7.652   -8.005  1.00 1.17   ? 129 LYS A O    2  
ATOM 4109  C CB   . LYS A 1 129 ? 3.372   10.102  -6.495  1.00 2.10   ? 129 LYS A CB   2  
ATOM 4110  C CG   . LYS A 1 129 ? 3.459   11.150  -7.624  1.00 3.35   ? 129 LYS A CG   2  
ATOM 4111  C CD   . LYS A 1 129 ? 4.851   11.778  -7.825  1.00 3.69   ? 129 LYS A CD   2  
ATOM 4112  C CE   . LYS A 1 129 ? 5.314   12.674  -6.666  1.00 4.35   ? 129 LYS A CE   2  
ATOM 4113  N NZ   . LYS A 1 129 ? 6.590   13.354  -6.996  1.00 4.87   ? 129 LYS A NZ   2  
ATOM 4114  H H    . LYS A 1 129 ? 2.587   7.794   -5.190  1.00 1.26   ? 129 LYS A H    2  
ATOM 4115  H HA   . LYS A 1 129 ? 1.247   10.255  -6.298  1.00 2.26   ? 129 LYS A HA   2  
ATOM 4116  H HB2  . LYS A 1 129 ? 3.592   10.594  -5.542  1.00 2.81   ? 129 LYS A HB2  2  
ATOM 4117  H HB3  . LYS A 1 129 ? 4.117   9.325   -6.662  1.00 1.68   ? 129 LYS A HB3  2  
ATOM 4118  H HG2  . LYS A 1 129 ? 3.189   10.662  -8.559  1.00 3.77   ? 129 LYS A HG2  2  
ATOM 4119  H HG3  . LYS A 1 129 ? 2.733   11.945  -7.435  1.00 4.35   ? 129 LYS A HG3  2  
ATOM 4120  H HD2  . LYS A 1 129 ? 5.579   10.981  -7.987  1.00 3.50   ? 129 LYS A HD2  2  
ATOM 4121  H HD3  . LYS A 1 129 ? 4.808   12.377  -8.733  1.00 4.78   ? 129 LYS A HD3  2  
ATOM 4122  H HE2  . LYS A 1 129 ? 4.545   13.423  -6.464  1.00 5.52   ? 129 LYS A HE2  2  
ATOM 4123  H HE3  . LYS A 1 129 ? 5.442   12.063  -5.770  1.00 4.21   ? 129 LYS A HE3  2  
ATOM 4124  H HZ1  . LYS A 1 129 ? 7.329   12.711  -7.271  1.00 4.30   ? 129 LYS A HZ1  2  
ATOM 4125  H HZ2  . LYS A 1 129 ? 6.490   14.023  -7.744  1.00 5.84   ? 129 LYS A HZ2  2  
ATOM 4126  H HZ3  . LYS A 1 129 ? 6.941   13.929  -6.235  1.00 5.47   ? 129 LYS A HZ3  2  
ATOM 4127  N N    . ALA A 1 130 ? 0.488   9.064   -8.312  1.00 2.24   ? 130 ALA A N    2  
ATOM 4128  C CA   . ALA A 1 130 ? 0.146   8.672   -9.672  1.00 2.27   ? 130 ALA A CA   2  
ATOM 4129  C C    . ALA A 1 130 ? 1.197   9.198   -10.661 1.00 2.11   ? 130 ALA A C    2  
ATOM 4130  O O    . ALA A 1 130 ? 1.609   10.350  -10.551 1.00 2.63   ? 130 ALA A O    2  
ATOM 4131  C CB   . ALA A 1 130 ? -1.233  9.252   -9.987  1.00 2.96   ? 130 ALA A CB   2  
ATOM 4132  H H    . ALA A 1 130 ? -0.053  9.793   -7.875  1.00 2.89   ? 130 ALA A H    2  
ATOM 4133  H HA   . ALA A 1 130 ? 0.118   7.589   -9.745  1.00 2.08   ? 130 ALA A HA   2  
ATOM 4134  H HB1  . ALA A 1 130 ? -1.579  8.873   -10.945 1.00 4.09   ? 130 ALA A HB1  2  
ATOM 4135  H HB2  . ALA A 1 130 ? -1.954  8.992   -9.220  1.00 4.04   ? 130 ALA A HB2  2  
ATOM 4136  H HB3  . ALA A 1 130 ? -1.155  10.331  -10.044 1.00 2.20   ? 130 ALA A HB3  2  
ATOM 4137  N N    . THR A 1 131 ? 1.563   8.416   -11.683 1.00 1.78   ? 131 THR A N    2  
ATOM 4138  C CA   . THR A 1 131 ? 2.395   8.923   -12.798 1.00 1.94   ? 131 THR A CA   2  
ATOM 4139  C C    . THR A 1 131 ? 1.583   9.767   -13.776 1.00 3.04   ? 131 THR A C    2  
ATOM 4140  O O    . THR A 1 131 ? 2.127   10.708  -14.347 1.00 3.76   ? 131 THR A O    2  
ATOM 4141  C CB   . THR A 1 131 ? 3.175   7.801   -13.496 1.00 1.65   ? 131 THR A CB   2  
ATOM 4142  O OG1  . THR A 1 131 ? 4.071   8.382   -14.412 1.00 2.31   ? 131 THR A OG1  2  
ATOM 4143  C CG2  . THR A 1 131 ? 2.323   6.791   -14.263 1.00 2.42   ? 131 THR A CG2  2  
ATOM 4144  H H    . THR A 1 131 ? 1.174   7.485   -11.766 1.00 1.82   ? 131 THR A H    2  
ATOM 4145  H HA   . THR A 1 131 ? 3.152   9.584   -12.377 1.00 2.38   ? 131 THR A HA   2  
ATOM 4146  H HB   . THR A 1 131 ? 3.751   7.257   -12.748 1.00 2.10   ? 131 THR A HB   2  
ATOM 4147  H HG1  . THR A 1 131 ? 3.629   9.129   -14.839 1.00 2.64   ? 131 THR A HG1  2  
ATOM 4148  H HG21 . THR A 1 131 ? 2.978   6.088   -14.783 1.00 3.21   ? 131 THR A HG21 2  
ATOM 4149  H HG22 . THR A 1 131 ? 1.708   6.231   -13.565 1.00 2.94   ? 131 THR A HG22 2  
ATOM 4150  H HG23 . THR A 1 131 ? 1.693   7.293   -15.003 1.00 2.88   ? 131 THR A HG23 2  
ATOM 4151  N N    . ASP A 1 132 ? 0.288   9.463   -13.885 1.00 3.74   ? 132 ASP A N    2  
ATOM 4152  C CA   . ASP A 1 132 ? -0.737  10.176  -14.658 1.00 5.18   ? 132 ASP A CA   2  
ATOM 4153  C C    . ASP A 1 132 ? -1.923  10.412  -13.696 1.00 6.12   ? 132 ASP A C    2  
ATOM 4154  O O    . ASP A 1 132 ? -2.750  9.524   -13.476 1.00 7.28   ? 132 ASP A O    2  
ATOM 4155  C CB   . ASP A 1 132 ? -1.103  9.326   -15.900 1.00 5.61   ? 132 ASP A CB   2  
ATOM 4156  C CG   . ASP A 1 132 ? -1.484  10.151  -17.141 1.00 6.31   ? 132 ASP A CG   2  
ATOM 4157  O OD1  . ASP A 1 132 ? -2.620  10.662  -17.212 1.00 7.32   ? 132 ASP A OD1  2  
ATOM 4158  O OD2  . ASP A 1 132 ? -0.639  10.194  -18.081 1.00 6.33   ? 132 ASP A OD2  2  
ATOM 4159  H H    . ASP A 1 132 ? -0.033  8.654   -13.376 1.00 3.61   ? 132 ASP A H    2  
ATOM 4160  H HA   . ASP A 1 132 ? -0.341  11.135  -14.993 1.00 5.54   ? 132 ASP A HA   2  
ATOM 4161  H HB2  . ASP A 1 132 ? -0.239  8.709   -16.168 1.00 4.86   ? 132 ASP A HB2  2  
ATOM 4162  H HB3  . ASP A 1 132 ? -1.913  8.633   -15.660 1.00 6.69   ? 132 ASP A HB3  2  
ATOM 4163  N N    . GLY A 1 133 ? -1.931  11.570  -13.019 1.00 5.91   ? 133 GLY A N    2  
ATOM 4164  C CA   . GLY A 1 133 ? -2.810  11.893  -11.884 1.00 6.49   ? 133 GLY A CA   2  
ATOM 4165  C C    . GLY A 1 133 ? -2.335  13.142  -11.131 1.00 6.26   ? 133 GLY A C    2  
ATOM 4166  O O    . GLY A 1 133 ? -2.141  14.149  -11.804 1.00 7.04   ? 133 GLY A O    2  
ATOM 4167  H H    . GLY A 1 133 ? -1.226  12.258  -13.247 1.00 5.60   ? 133 GLY A H    2  
ATOM 4168  H HA2  . GLY A 1 133 ? -3.812  12.092  -12.264 1.00 7.64   ? 133 GLY A HA2  2  
ATOM 4169  H HA3  . GLY A 1 133 ? -2.894  11.035  -11.218 1.00 6.30   ? 133 GLY A HA3  2  
ATOM 4170  N N    . ARG A 1 134 ? -2.197  13.074  -9.783  1.00 5.65   ? 134 ARG A N    2  
ATOM 4171  C CA   . ARG A 1 134 ? -1.816  14.192  -8.854  1.00 5.68   ? 134 ARG A CA   2  
ATOM 4172  C C    . ARG A 1 134 ? -1.779  13.944  -7.319  1.00 5.20   ? 134 ARG A C    2  
ATOM 4173  O O    . ARG A 1 134 ? -1.512  14.874  -6.561  1.00 4.89   ? 134 ARG A O    2  
ATOM 4174  C CB   . ARG A 1 134 ? -2.623  15.481  -9.167  1.00 6.52   ? 134 ARG A CB   2  
ATOM 4175  C CG   . ARG A 1 134 ? -4.152  15.267  -9.091  1.00 8.57   ? 134 ARG A CG   2  
ATOM 4176  C CD   . ARG A 1 134 ? -4.940  15.941  -10.232 1.00 9.92   ? 134 ARG A CD   2  
ATOM 4177  N NE   . ARG A 1 134 ? -5.738  17.082  -9.759  1.00 11.24  ? 134 ARG A NE   2  
ATOM 4178  C CZ   . ARG A 1 134 ? -6.729  17.671  -10.412 1.00 12.77  ? 134 ARG A CZ   2  
ATOM 4179  N NH1  . ARG A 1 134 ? -7.077  17.341  -11.632 1.00 13.38  ? 134 ARG A NH1  2  
ATOM 4180  N NH2  . ARG A 1 134 ? -7.482  18.550  -9.797  1.00 14.03  ? 134 ARG A NH2  2  
ATOM 4181  H H    . ARG A 1 134 ? -2.360  12.168  -9.377  1.00 5.48   ? 134 ARG A H    2  
ATOM 4182  H HA   . ARG A 1 134 ? -0.762  14.380  -9.069  1.00 5.59   ? 134 ARG A HA   2  
ATOM 4183  H HB2  . ARG A 1 134 ? -2.344  16.276  -8.471  1.00 6.15   ? 134 ARG A HB2  2  
ATOM 4184  H HB3  . ARG A 1 134 ? -2.337  15.862  -10.145 1.00 6.56   ? 134 ARG A HB3  2  
ATOM 4185  H HG2  . ARG A 1 134 ? -4.383  14.207  -9.126  1.00 8.96   ? 134 ARG A HG2  2  
ATOM 4186  H HG3  . ARG A 1 134 ? -4.508  15.624  -8.119  1.00 9.19   ? 134 ARG A HG3  2  
ATOM 4187  H HD2  . ARG A 1 134 ? -4.267  16.251  -11.034 1.00 9.64   ? 134 ARG A HD2  2  
ATOM 4188  H HD3  . ARG A 1 134 ? -5.624  15.200  -10.641 1.00 10.62  ? 134 ARG A HD3  2  
ATOM 4189  H HE   . ARG A 1 134 ? -5.635  17.337  -8.781  1.00 11.26  ? 134 ARG A HE   2  
ATOM 4190  H HH11 . ARG A 1 134 ? -6.545  16.656  -12.163 1.00 12.70  ? 134 ARG A HH11 2  
ATOM 4191  H HH12 . ARG A 1 134 ? -7.952  17.673  -12.003 1.00 14.73  ? 134 ARG A HH12 2  
ATOM 4192  H HH21 . ARG A 1 134 ? -7.349  18.664  -8.792  1.00 13.96  ? 134 ARG A HH21 2  
ATOM 4193  H HH22 . ARG A 1 134 ? -8.256  19.004  -10.260 1.00 15.26  ? 134 ARG A HH22 2  
ATOM 4194  N N    . THR A 1 135 ? -2.032  12.726  -6.824  1.00 5.59   ? 135 THR A N    2  
ATOM 4195  C CA   . THR A 1 135 ? -1.889  12.359  -5.391  1.00 5.18   ? 135 THR A CA   2  
ATOM 4196  C C    . THR A 1 135 ? -0.422  12.452  -4.939  1.00 3.70   ? 135 THR A C    2  
ATOM 4197  O O    . THR A 1 135 ? 0.476   12.385  -5.778  1.00 3.73   ? 135 THR A O    2  
ATOM 4198  C CB   . THR A 1 135 ? -2.513  10.977  -5.132  1.00 6.39   ? 135 THR A CB   2  
ATOM 4199  O OG1  . THR A 1 135 ? -3.671  10.826  -5.921  1.00 7.86   ? 135 THR A OG1  2  
ATOM 4200  C CG2  . THR A 1 135 ? -2.954  10.796  -3.681  1.00 6.60   ? 135 THR A CG2  2  
ATOM 4201  H H    . THR A 1 135 ? -2.328  11.998  -7.454  1.00 6.45   ? 135 THR A H    2  
ATOM 4202  H HA   . THR A 1 135 ? -2.425  13.085  -4.787  1.00 5.48   ? 135 THR A HA   2  
ATOM 4203  H HB   . THR A 1 135 ? -1.800  10.197  -5.408  1.00 6.42   ? 135 THR A HB   2  
ATOM 4204  H HG1  . THR A 1 135 ? -4.376  11.360  -5.530  1.00 8.68   ? 135 THR A HG1  2  
ATOM 4205  H HG21 . THR A 1 135 ? -3.631  11.598  -3.383  1.00 6.94   ? 135 THR A HG21 2  
ATOM 4206  H HG22 . THR A 1 135 ? -3.465  9.842   -3.575  1.00 7.42   ? 135 THR A HG22 2  
ATOM 4207  H HG23 . THR A 1 135 ? -2.086  10.795  -3.024  1.00 6.12   ? 135 THR A HG23 2  
ATOM 4208  N N    . LEU A 1 136 ? -0.167  12.592  -3.629  1.00 3.14   ? 136 LEU A N    2  
ATOM 4209  C CA   . LEU A 1 136 ? 1.173   12.759  -3.033  1.00 2.16   ? 136 LEU A CA   2  
ATOM 4210  C C    . LEU A 1 136 ? 1.222   12.421  -1.521  1.00 1.73   ? 136 LEU A C    2  
ATOM 4211  O O    . LEU A 1 136 ? 0.786   11.343  -1.122  1.00 1.70   ? 136 LEU A O    2  
ATOM 4212  C CB   . LEU A 1 136 ? 1.811   14.125  -3.427  1.00 2.87   ? 136 LEU A CB   2  
ATOM 4213  C CG   . LEU A 1 136 ? 1.135   15.434  -2.937  1.00 3.36   ? 136 LEU A CG   2  
ATOM 4214  C CD1  . LEU A 1 136 ? 2.166   16.572  -3.002  1.00 4.11   ? 136 LEU A CD1  2  
ATOM 4215  C CD2  . LEU A 1 136 ? -0.092  15.838  -3.764  1.00 4.22   ? 136 LEU A CD2  2  
ATOM 4216  H H    . LEU A 1 136 ? -0.944  12.529  -2.990  1.00 3.93   ? 136 LEU A H    2  
ATOM 4217  H HA   . LEU A 1 136 ? 1.798   11.993  -3.496  1.00 2.49   ? 136 LEU A HA   2  
ATOM 4218  H HB2  . LEU A 1 136 ? 2.837   14.109  -3.061  1.00 3.10   ? 136 LEU A HB2  2  
ATOM 4219  H HB3  . LEU A 1 136 ? 1.889   14.173  -4.516  1.00 3.65   ? 136 LEU A HB3  2  
ATOM 4220  H HG   . LEU A 1 136 ? 0.821   15.329  -1.900  1.00 3.11   ? 136 LEU A HG   2  
ATOM 4221  H HD11 . LEU A 1 136 ? 1.712   17.504  -2.670  1.00 4.92   ? 136 LEU A HD11 2  
ATOM 4222  H HD12 . LEU A 1 136 ? 3.009   16.347  -2.346  1.00 4.15   ? 136 LEU A HD12 2  
ATOM 4223  H HD13 . LEU A 1 136 ? 2.527   16.695  -4.022  1.00 4.70   ? 136 LEU A HD13 2  
ATOM 4224  H HD21 . LEU A 1 136 ? 0.181   15.917  -4.817  1.00 4.36   ? 136 LEU A HD21 2  
ATOM 4225  H HD22 . LEU A 1 136 ? -0.890  15.110  -3.647  1.00 4.76   ? 136 LEU A HD22 2  
ATOM 4226  H HD23 . LEU A 1 136 ? -0.462  16.805  -3.423  1.00 4.87   ? 136 LEU A HD23 2  
ATOM 4227  N N    . ASN A 1 137 ? 1.805   13.292  -0.684  1.00 1.64   ? 137 ASN A N    2  
ATOM 4228  C CA   . ASN A 1 137 ? 1.987   13.148  0.758   1.00 1.48   ? 137 ASN A CA   2  
ATOM 4229  C C    . ASN A 1 137 ? 0.649   13.341  1.489   1.00 1.36   ? 137 ASN A C    2  
ATOM 4230  O O    . ASN A 1 137 ? 0.065   14.424  1.514   1.00 1.75   ? 137 ASN A O    2  
ATOM 4231  C CB   . ASN A 1 137 ? 3.065   14.132  1.246   1.00 1.78   ? 137 ASN A CB   2  
ATOM 4232  C CG   . ASN A 1 137 ? 3.389   13.960  2.729   1.00 2.33   ? 137 ASN A CG   2  
ATOM 4233  O OD1  . ASN A 1 137 ? 3.386   12.861  3.258   1.00 3.40   ? 137 ASN A OD1  2  
ATOM 4234  N ND2  . ASN A 1 137 ? 3.657   15.040  3.434   1.00 2.70   ? 137 ASN A ND2  2  
ATOM 4235  H H    . ASN A 1 137 ? 2.123   14.157  -1.065  1.00 1.92   ? 137 ASN A H    2  
ATOM 4236  H HA   . ASN A 1 137 ? 2.353   12.138  0.947   1.00 1.54   ? 137 ASN A HA   2  
ATOM 4237  H HB2  . ASN A 1 137 ? 3.982   13.971  0.680   1.00 2.80   ? 137 ASN A HB2  2  
ATOM 4238  H HB3  . ASN A 1 137 ? 2.726   15.151  1.062   1.00 1.79   ? 137 ASN A HB3  2  
ATOM 4239  H HD21 . ASN A 1 137 ? 3.639   15.946  3.003   1.00 2.77   ? 137 ASN A HD21 2  
ATOM 4240  H HD22 . ASN A 1 137 ? 3.895   14.923  4.405   1.00 3.55   ? 137 ASN A HD22 2  
ATOM 4241  N N    . VAL A 1 138 ? 0.186   12.248  2.070   1.00 1.09   ? 138 VAL A N    2  
ATOM 4242  C CA   . VAL A 1 138 ? -1.164  12.013  2.617   1.00 1.21   ? 138 VAL A CA   2  
ATOM 4243  C C    . VAL A 1 138 ? -1.072  11.390  4.028   1.00 0.98   ? 138 VAL A C    2  
ATOM 4244  O O    . VAL A 1 138 ? -0.044  10.831  4.411   1.00 1.05   ? 138 VAL A O    2  
ATOM 4245  C CB   . VAL A 1 138 ? -1.949  11.116  1.619   1.00 1.55   ? 138 VAL A CB   2  
ATOM 4246  C CG1  . VAL A 1 138 ? -3.264  10.529  2.166   1.00 1.69   ? 138 VAL A CG1  2  
ATOM 4247  C CG2  . VAL A 1 138 ? -2.301  11.903  0.340   1.00 2.00   ? 138 VAL A CG2  2  
ATOM 4248  H H    . VAL A 1 138 ? 0.815   11.448  2.012   1.00 0.95   ? 138 VAL A H    2  
ATOM 4249  H HA   . VAL A 1 138 ? -1.682  12.967  2.706   1.00 1.54   ? 138 VAL A HA   2  
ATOM 4250  H HB   . VAL A 1 138 ? -1.315  10.275  1.335   1.00 1.71   ? 138 VAL A HB   2  
ATOM 4251  H HG11 . VAL A 1 138 ? -3.799  10.004  1.371   1.00 2.20   ? 138 VAL A HG11 2  
ATOM 4252  H HG12 . VAL A 1 138 ? -3.053  9.806   2.951   1.00 2.08   ? 138 VAL A HG12 2  
ATOM 4253  H HG13 . VAL A 1 138 ? -3.900  11.325  2.556   1.00 2.56   ? 138 VAL A HG13 2  
ATOM 4254  H HG21 . VAL A 1 138 ? -2.796  11.250  -0.381  1.00 2.64   ? 138 VAL A HG21 2  
ATOM 4255  H HG22 . VAL A 1 138 ? -2.968  12.727  0.584   1.00 2.77   ? 138 VAL A HG22 2  
ATOM 4256  H HG23 . VAL A 1 138 ? -1.407  12.309  -0.128  1.00 2.36   ? 138 VAL A HG23 2  
ATOM 4257  N N    . ALA A 1 139 ? -2.140  11.505  4.823   1.00 1.09   ? 139 ALA A N    2  
ATOM 4258  C CA   . ALA A 1 139 ? -2.250  10.875  6.140   1.00 1.15   ? 139 ALA A CA   2  
ATOM 4259  C C    . ALA A 1 139 ? -2.816  9.440   6.059   1.00 1.15   ? 139 ALA A C    2  
ATOM 4260  O O    . ALA A 1 139 ? -3.956  9.230   5.640   1.00 1.44   ? 139 ALA A O    2  
ATOM 4261  C CB   . ALA A 1 139 ? -3.103  11.786  7.031   1.00 1.62   ? 139 ALA A CB   2  
ATOM 4262  H H    . ALA A 1 139 ? -2.954  11.976  4.456   1.00 1.33   ? 139 ALA A H    2  
ATOM 4263  H HA   . ALA A 1 139 ? -1.254  10.820  6.586   1.00 1.13   ? 139 ALA A HA   2  
ATOM 4264  H HB1  . ALA A 1 139 ? -2.638  12.772  7.105   1.00 2.65   ? 139 ALA A HB1  2  
ATOM 4265  H HB2  . ALA A 1 139 ? -4.103  11.897  6.613   1.00 1.80   ? 139 ALA A HB2  2  
ATOM 4266  H HB3  . ALA A 1 139 ? -3.177  11.362  8.031   1.00 2.42   ? 139 ALA A HB3  2  
ATOM 4267  N N    . ALA A 1 140 ? -2.037  8.463   6.534   1.00 1.18   ? 140 ALA A N    2  
ATOM 4268  C CA   . ALA A 1 140 ? -2.440  7.079   6.774   1.00 1.14   ? 140 ALA A CA   2  
ATOM 4269  C C    . ALA A 1 140 ? -2.735  6.844   8.262   1.00 1.13   ? 140 ALA A C    2  
ATOM 4270  O O    . ALA A 1 140 ? -2.224  7.560   9.134   1.00 1.26   ? 140 ALA A O    2  
ATOM 4271  C CB   . ALA A 1 140 ? -1.330  6.134   6.290   1.00 1.14   ? 140 ALA A CB   2  
ATOM 4272  H H    . ALA A 1 140 ? -1.136  8.730   6.914   1.00 1.40   ? 140 ALA A H    2  
ATOM 4273  H HA   . ALA A 1 140 ? -3.353  6.860   6.217   1.00 1.25   ? 140 ALA A HA   2  
ATOM 4274  H HB1  . ALA A 1 140 ? -1.317  6.114   5.204   1.00 1.71   ? 140 ALA A HB1  2  
ATOM 4275  H HB2  . ALA A 1 140 ? -0.360  6.458   6.666   1.00 2.10   ? 140 ALA A HB2  2  
ATOM 4276  H HB3  . ALA A 1 140 ? -1.519  5.119   6.640   1.00 1.61   ? 140 ALA A HB3  2  
ATOM 4277  N N    . THR A 1 141 ? -3.515  5.794   8.528   1.00 1.10   ? 141 THR A N    2  
ATOM 4278  C CA   . THR A 1 141 ? -3.962  5.368   9.860   1.00 1.16   ? 141 THR A CA   2  
ATOM 4279  C C    . THR A 1 141 ? -3.660  3.882   10.004  1.00 0.92   ? 141 THR A C    2  
ATOM 4280  O O    . THR A 1 141 ? -3.919  3.103   9.091   1.00 1.01   ? 141 THR A O    2  
ATOM 4281  C CB   . THR A 1 141 ? -5.475  5.591   10.032  1.00 1.48   ? 141 THR A CB   2  
ATOM 4282  O OG1  . THR A 1 141 ? -5.896  6.815   9.463   1.00 1.69   ? 141 THR A OG1  2  
ATOM 4283  C CG2  . THR A 1 141 ? -5.849  5.616   11.515  1.00 1.68   ? 141 THR A CG2  2  
ATOM 4284  H H    . THR A 1 141 ? -3.801  5.210   7.751   1.00 1.09   ? 141 THR A H    2  
ATOM 4285  H HA   . THR A 1 141 ? -3.430  5.934   10.626  1.00 1.22   ? 141 THR A HA   2  
ATOM 4286  H HB   . THR A 1 141 ? -6.002  4.765   9.540   1.00 1.51   ? 141 THR A HB   2  
ATOM 4287  H HG1  . THR A 1 141 ? -6.856  6.901   9.608   1.00 2.13   ? 141 THR A HG1  2  
ATOM 4288  H HG21 . THR A 1 141 ? -5.617  4.652   11.976  1.00 1.94   ? 141 THR A HG21 2  
ATOM 4289  H HG22 . THR A 1 141 ? -5.304  6.402   12.027  1.00 2.67   ? 141 THR A HG22 2  
ATOM 4290  H HG23 . THR A 1 141 ? -6.919  5.790   11.618  1.00 1.99   ? 141 THR A HG23 2  
ATOM 4291  N N    . VAL A 1 142 ? -3.150  3.481   11.161  1.00 1.03   ? 142 VAL A N    2  
ATOM 4292  C CA   . VAL A 1 142 ? -3.023  2.058   11.535  1.00 0.91   ? 142 VAL A CA   2  
ATOM 4293  C C    . VAL A 1 142 ? -4.304  1.571   12.231  1.00 1.12   ? 142 VAL A C    2  
ATOM 4294  O O    . VAL A 1 142 ? -4.814  2.259   13.112  1.00 1.54   ? 142 VAL A O    2  
ATOM 4295  C CB   . VAL A 1 142 ? -1.772  1.807   12.411  1.00 1.07   ? 142 VAL A CB   2  
ATOM 4296  C CG1  . VAL A 1 142 ? -1.622  2.811   13.544  1.00 2.73   ? 142 VAL A CG1  2  
ATOM 4297  C CG2  . VAL A 1 142 ? -1.698  0.382   12.989  1.00 2.32   ? 142 VAL A CG2  2  
ATOM 4298  H H    . VAL A 1 142 ? -2.944  4.192   11.856  1.00 1.33   ? 142 VAL A H    2  
ATOM 4299  H HA   . VAL A 1 142 ? -2.914  1.481   10.617  1.00 0.81   ? 142 VAL A HA   2  
ATOM 4300  H HB   . VAL A 1 142 ? -0.907  1.960   11.782  1.00 2.70   ? 142 VAL A HB   2  
ATOM 4301  H HG11 . VAL A 1 142 ? -1.543  3.816   13.139  1.00 4.02   ? 142 VAL A HG11 2  
ATOM 4302  H HG12 . VAL A 1 142 ? -2.478  2.746   14.203  1.00 3.23   ? 142 VAL A HG12 2  
ATOM 4303  H HG13 . VAL A 1 142 ? -0.711  2.596   14.096  1.00 3.45   ? 142 VAL A HG13 2  
ATOM 4304  H HG21 . VAL A 1 142 ? -1.844  -0.350  12.200  1.00 3.29   ? 142 VAL A HG21 2  
ATOM 4305  H HG22 . VAL A 1 142 ? -0.717  0.219   13.442  1.00 3.00   ? 142 VAL A HG22 2  
ATOM 4306  H HG23 . VAL A 1 142 ? -2.462  0.243   13.752  1.00 3.44   ? 142 VAL A HG23 2  
ATOM 4307  N N    . LYS A 1 143 ? -4.799  0.373   11.877  1.00 1.09   ? 143 LYS A N    2  
ATOM 4308  C CA   . LYS A 1 143 ? -5.959  -0.258  12.536  1.00 1.34   ? 143 LYS A CA   2  
ATOM 4309  C C    . LYS A 1 143 ? -6.082  -1.785  12.280  1.00 1.39   ? 143 LYS A C    2  
ATOM 4310  O O    . LYS A 1 143 ? -6.419  -2.230  11.180  1.00 2.00   ? 143 LYS A O    2  
ATOM 4311  C CB   . LYS A 1 143 ? -7.265  0.494   12.171  1.00 1.98   ? 143 LYS A CB   2  
ATOM 4312  C CG   . LYS A 1 143 ? -8.382  0.183   13.186  1.00 2.45   ? 143 LYS A CG   2  
ATOM 4313  C CD   . LYS A 1 143 ? -9.590  1.113   13.008  1.00 3.41   ? 143 LYS A CD   2  
ATOM 4314  C CE   . LYS A 1 143 ? -10.585 0.903   14.159  1.00 4.24   ? 143 LYS A CE   2  
ATOM 4315  N NZ   . LYS A 1 143 ? -11.694 1.885   14.133  1.00 5.17   ? 143 LYS A NZ   2  
ATOM 4316  H H    . LYS A 1 143 ? -4.331  -0.140  11.144  1.00 1.01   ? 143 LYS A H    2  
ATOM 4317  H HA   . LYS A 1 143 ? -5.812  -0.124  13.604  1.00 1.37   ? 143 LYS A HA   2  
ATOM 4318  H HB2  . LYS A 1 143 ? -7.085  1.568   12.184  1.00 2.38   ? 143 LYS A HB2  2  
ATOM 4319  H HB3  . LYS A 1 143 ? -7.589  0.220   11.165  1.00 2.23   ? 143 LYS A HB3  2  
ATOM 4320  H HG2  . LYS A 1 143 ? -8.700  -0.853  13.077  1.00 2.43   ? 143 LYS A HG2  2  
ATOM 4321  H HG3  . LYS A 1 143 ? -7.986  0.325   14.196  1.00 2.66   ? 143 LYS A HG3  2  
ATOM 4322  H HD2  . LYS A 1 143 ? -9.241  2.148   13.019  1.00 3.81   ? 143 LYS A HD2  2  
ATOM 4323  H HD3  . LYS A 1 143 ? -10.072 0.910   12.048  1.00 3.56   ? 143 LYS A HD3  2  
ATOM 4324  H HE2  . LYS A 1 143 ? -10.992 -0.111  14.099  1.00 4.15   ? 143 LYS A HE2  2  
ATOM 4325  H HE3  . LYS A 1 143 ? -10.050 1.001   15.106  1.00 4.76   ? 143 LYS A HE3  2  
ATOM 4326  H HZ1  . LYS A 1 143 ? -12.267 1.774   13.301  1.00 4.89   ? 143 LYS A HZ1  2  
ATOM 4327  H HZ2  . LYS A 1 143 ? -12.306 1.728   14.933  1.00 5.78   ? 143 LYS A HZ2  2  
ATOM 4328  H HZ3  . LYS A 1 143 ? -11.328 2.834   14.177  1.00 5.98   ? 143 LYS A HZ3  2  
ATOM 4329  N N    . LYS A 1 144 ? -5.813  -2.579  13.328  1.00 1.45   ? 144 LYS A N    2  
ATOM 4330  C CA   . LYS A 1 144 ? -5.834  -4.052  13.300  1.00 1.69   ? 144 LYS A CA   2  
ATOM 4331  C C    . LYS A 1 144 ? -4.971  -4.627  12.154  1.00 1.87   ? 144 LYS A C    2  
ATOM 4332  O O    . LYS A 1 144 ? -4.012  -3.973  11.758  1.00 3.40   ? 144 LYS A O    2  
ATOM 4333  C CB   . LYS A 1 144 ? -7.291  -4.580  13.365  1.00 3.07   ? 144 LYS A CB   2  
ATOM 4334  C CG   . LYS A 1 144 ? -7.400  -5.823  14.276  1.00 3.33   ? 144 LYS A CG   2  
ATOM 4335  C CD   . LYS A 1 144 ? -8.773  -6.515  14.215  1.00 4.61   ? 144 LYS A CD   2  
ATOM 4336  C CE   . LYS A 1 144 ? -8.803  -7.593  13.119  1.00 5.82   ? 144 LYS A CE   2  
ATOM 4337  N NZ   . LYS A 1 144 ? -10.141 -8.220  12.973  1.00 6.96   ? 144 LYS A NZ   2  
ATOM 4338  H H    . LYS A 1 144 ? -5.494  -2.124  14.175  1.00 1.75   ? 144 LYS A H    2  
ATOM 4339  H HA   . LYS A 1 144 ? -5.328  -4.386  14.209  1.00 2.41   ? 144 LYS A HA   2  
ATOM 4340  H HB2  . LYS A 1 144 ? -7.935  -3.809  13.788  1.00 4.23   ? 144 LYS A HB2  2  
ATOM 4341  H HB3  . LYS A 1 144 ? -7.660  -4.799  12.363  1.00 4.15   ? 144 LYS A HB3  2  
ATOM 4342  H HG2  . LYS A 1 144 ? -6.623  -6.544  14.025  1.00 3.68   ? 144 LYS A HG2  2  
ATOM 4343  H HG3  . LYS A 1 144 ? -7.228  -5.498  15.301  1.00 3.65   ? 144 LYS A HG3  2  
ATOM 4344  H HD2  . LYS A 1 144 ? -8.968  -6.988  15.182  1.00 4.77   ? 144 LYS A HD2  2  
ATOM 4345  H HD3  . LYS A 1 144 ? -9.554  -5.774  14.031  1.00 5.27   ? 144 LYS A HD3  2  
ATOM 4346  H HE2  . LYS A 1 144 ? -8.526  -7.136  12.164  1.00 6.19   ? 144 LYS A HE2  2  
ATOM 4347  H HE3  . LYS A 1 144 ? -8.073  -8.367  13.372  1.00 6.11   ? 144 LYS A HE3  2  
ATOM 4348  H HZ1  . LYS A 1 144 ? -10.750 -7.570  12.480  1.00 7.54   ? 144 LYS A HZ1  2  
ATOM 4349  H HZ2  . LYS A 1 144 ? -10.077 -9.064  12.403  1.00 7.55   ? 144 LYS A HZ2  2  
ATOM 4350  H HZ3  . LYS A 1 144 ? -10.561 -8.452  13.864  1.00 7.19   ? 144 LYS A HZ3  2  
ATOM 4351  N N    . ASN A 1 145 ? -5.282  -5.838  11.655  1.00 1.81   ? 145 ASN A N    2  
ATOM 4352  C CA   . ASN A 1 145 ? -4.536  -6.642  10.652  1.00 2.80   ? 145 ASN A CA   2  
ATOM 4353  C C    . ASN A 1 145 ? -3.106  -7.008  11.104  1.00 3.33   ? 145 ASN A C    2  
ATOM 4354  O O    . ASN A 1 145 ? -2.475  -6.231  11.806  1.00 4.85   ? 145 ASN A O    2  
ATOM 4355  C CB   . ASN A 1 145 ? -4.554  -5.964  9.270   1.00 4.13   ? 145 ASN A CB   2  
ATOM 4356  C CG   . ASN A 1 145 ? -5.953  -6.014  8.672   1.00 4.90   ? 145 ASN A CG   2  
ATOM 4357  O OD1  . ASN A 1 145 ? -6.329  -6.993  8.044   1.00 5.13   ? 145 ASN A OD1  2  
ATOM 4358  N ND2  . ASN A 1 145 ? -6.763  -4.998  8.908   1.00 5.85   ? 145 ASN A ND2  2  
ATOM 4359  H H    . ASN A 1 145 ? -6.105  -6.279  12.030  1.00 2.27   ? 145 ASN A H    2  
ATOM 4360  H HA   . ASN A 1 145 ? -5.066  -7.591  10.538  1.00 3.28   ? 145 ASN A HA   2  
ATOM 4361  H HB2  . ASN A 1 145 ? -4.211  -4.927  9.332   1.00 4.69   ? 145 ASN A HB2  2  
ATOM 4362  H HB3  . ASN A 1 145 ? -3.884  -6.494  8.592   1.00 4.64   ? 145 ASN A HB3  2  
ATOM 4363  H HD21 . ASN A 1 145 ? -6.451  -4.192  9.431   1.00 6.04   ? 145 ASN A HD21 2  
ATOM 4364  H HD22 . ASN A 1 145 ? -7.702  -5.020  8.517   1.00 6.69   ? 145 ASN A HD22 2  
ATOM 4365  N N    . ILE A 1 146 ? -2.572  -8.194  10.766  1.00 3.10   ? 146 ILE A N    2  
ATOM 4366  C CA   . ILE A 1 146 ? -1.353  -8.730  11.407  1.00 3.94   ? 146 ILE A CA   2  
ATOM 4367  C C    . ILE A 1 146 ? -0.869  -10.026 10.727  1.00 4.20   ? 146 ILE A C    2  
ATOM 4368  O O    . ILE A 1 146 ? -1.589  -11.022 10.656  1.00 4.43   ? 146 ILE A O    2  
ATOM 4369  C CB   . ILE A 1 146 ? -1.536  -8.860  12.955  1.00 4.34   ? 146 ILE A CB   2  
ATOM 4370  C CG1  . ILE A 1 146 ? -0.219  -9.244  13.650  1.00 6.10   ? 146 ILE A CG1  2  
ATOM 4371  C CG2  . ILE A 1 146 ? -2.683  -9.811  13.350  1.00 4.58   ? 146 ILE A CG2  2  
ATOM 4372  C CD1  . ILE A 1 146 ? -0.201  -8.999  15.163  1.00 7.73   ? 146 ILE A CD1  2  
ATOM 4373  H H    . ILE A 1 146 ? -3.051  -8.804  10.116  1.00 3.31   ? 146 ILE A H    2  
ATOM 4374  H HA   . ILE A 1 146 ? -0.577  -7.977  11.268  1.00 5.70   ? 146 ILE A HA   2  
ATOM 4375  H HB   . ILE A 1 146 ? -1.795  -7.882  13.360  1.00 4.89   ? 146 ILE A HB   2  
ATOM 4376  H HG12 . ILE A 1 146 ? -0.036  -10.298 13.485  1.00 6.11   ? 146 ILE A HG12 2  
ATOM 4377  H HG13 . ILE A 1 146 ? 0.597   -8.671  13.207  1.00 6.99   ? 146 ILE A HG13 2  
ATOM 4378  H HG21 . ILE A 1 146 ? -2.437  -10.836 13.082  1.00 4.81   ? 146 ILE A HG21 2  
ATOM 4379  H HG22 . ILE A 1 146 ? -2.861  -9.758  14.423  1.00 5.57   ? 146 ILE A HG22 2  
ATOM 4380  H HG23 . ILE A 1 146 ? -3.608  -9.525  12.844  1.00 4.58   ? 146 ILE A HG23 2  
ATOM 4381  H HD11 . ILE A 1 146 ? -0.444  -7.960  15.378  1.00 8.18   ? 146 ILE A HD11 2  
ATOM 4382  H HD12 . ILE A 1 146 ? -0.921  -9.650  15.661  1.00 8.16   ? 146 ILE A HD12 2  
ATOM 4383  H HD13 . ILE A 1 146 ? 0.793   -9.219  15.552  1.00 8.62   ? 146 ILE A HD13 2  
ATOM 4384  N N    . GLU A 1 147 ? 0.377   -10.006 10.257  1.00 4.88   ? 147 GLU A N    2  
ATOM 4385  C CA   . GLU A 1 147 ? 1.169   -11.172 9.803   1.00 6.09   ? 147 GLU A CA   2  
ATOM 4386  C C    . GLU A 1 147 ? 1.242   -12.295 10.868  1.00 6.10   ? 147 GLU A C    2  
ATOM 4387  O O    . GLU A 1 147 ? 1.192   -13.474 10.513  1.00 7.36   ? 147 GLU A O    2  
ATOM 4388  C CB   . GLU A 1 147 ? 2.587   -10.646 9.466   1.00 7.16   ? 147 GLU A CB   2  
ATOM 4389  C CG   . GLU A 1 147 ? 3.693   -11.682 9.173   1.00 8.42   ? 147 GLU A CG   2  
ATOM 4390  C CD   . GLU A 1 147 ? 3.677   -12.310 7.769   1.00 9.66   ? 147 GLU A CD   2  
ATOM 4391  O OE1  . GLU A 1 147 ? 2.764   -12.012 6.945   1.00 9.72   ? 147 GLU A OE1  2  
ATOM 4392  O OE2  . GLU A 1 147 ? 4.637   -13.059 7.493   1.00 10.98  ? 147 GLU A OE2  2  
ATOM 4393  H H    . GLU A 1 147 ? 0.804   -9.098  10.185  1.00 4.86   ? 147 GLU A H    2  
ATOM 4394  H HA   . GLU A 1 147 ? 0.724   -11.581 8.892   1.00 6.78   ? 147 GLU A HA   2  
ATOM 4395  H HB2  . GLU A 1 147 ? 2.522   -9.956  8.623   1.00 7.58   ? 147 GLU A HB2  2  
ATOM 4396  H HB3  . GLU A 1 147 ? 2.934   -10.059 10.325  1.00 6.90   ? 147 GLU A HB3  2  
ATOM 4397  H HG2  . GLU A 1 147 ? 4.652   -11.168 9.287   1.00 9.06   ? 147 GLU A HG2  2  
ATOM 4398  H HG3  . GLU A 1 147 ? 3.676   -12.473 9.926   1.00 8.26   ? 147 GLU A HG3  2  
ATOM 4399  N N    . GLY A 1 148 ? 1.312   -11.938 12.157  1.00 5.09   ? 148 GLY A N    2  
ATOM 4400  C CA   . GLY A 1 148 ? 1.203   -12.876 13.272  1.00 5.49   ? 148 GLY A CA   2  
ATOM 4401  C C    . GLY A 1 148 ? 2.486   -13.651 13.535  1.00 6.78   ? 148 GLY A C    2  
ATOM 4402  O O    . GLY A 1 148 ? 2.451   -14.879 13.578  1.00 7.66   ? 148 GLY A O    2  
ATOM 4403  H H    . GLY A 1 148 ? 1.317   -10.949 12.353  1.00 4.32   ? 148 GLY A H    2  
ATOM 4404  H HA2  . GLY A 1 148 ? 0.959   -12.326 14.176  1.00 5.05   ? 148 GLY A HA2  2  
ATOM 4405  H HA3  . GLY A 1 148 ? 0.413   -13.596 13.053  1.00 5.98   ? 148 GLY A HA3  2  
ATOM 4406  N N    . ARG A 1 149 ? 3.604   -12.952 13.753  1.00 7.17   ? 149 ARG A N    2  
ATOM 4407  C CA   . ARG A 1 149 ? 4.935   -13.552 13.999  1.00 8.68   ? 149 ARG A CA   2  
ATOM 4408  C C    . ARG A 1 149 ? 5.422   -13.398 15.438  1.00 8.80   ? 149 ARG A C    2  
ATOM 4409  O O    . ARG A 1 149 ? 5.136   -12.369 16.080  1.00 8.49   ? 149 ARG A O    2  
ATOM 4410  C CB   . ARG A 1 149 ? 5.962   -12.969 13.008  1.00 9.66   ? 149 ARG A CB   2  
ATOM 4411  C CG   . ARG A 1 149 ? 6.702   -14.063 12.221  1.00 11.61  ? 149 ARG A CG   2  
ATOM 4412  C CD   . ARG A 1 149 ? 5.824   -14.731 11.142  1.00 12.50  ? 149 ARG A CD   2  
ATOM 4413  N NE   . ARG A 1 149 ? 6.565   -15.765 10.400  1.00 14.32  ? 149 ARG A NE   2  
ATOM 4414  C CZ   . ARG A 1 149 ? 7.581   -15.557 9.588   1.00 16.00  ? 149 ARG A CZ   2  
ATOM 4415  N NH1  . ARG A 1 149 ? 7.862   -14.387 9.105   1.00 16.49  ? 149 ARG A NH1  2  
ATOM 4416  N NH2  . ARG A 1 149 ? 8.340   -16.523 9.172   1.00 17.52  ? 149 ARG A NH2  2  
ATOM 4417  O OXT  . ARG A 1 149 ? 6.047   -14.357 15.944  1.00 9.66   ? 149 ARG A OXT  2  
ATOM 4418  H H    . ARG A 1 149 ? 3.532   -11.947 13.842  1.00 6.51   ? 149 ARG A H    2  
ATOM 4419  H HA   . ARG A 1 149 ? 4.878   -14.628 13.854  1.00 9.54   ? 149 ARG A HA   2  
ATOM 4420  H HB2  . ARG A 1 149 ? 5.480   -12.294 12.298  1.00 9.38   ? 149 ARG A HB2  2  
ATOM 4421  H HB3  . ARG A 1 149 ? 6.700   -12.383 13.556  1.00 9.68   ? 149 ARG A HB3  2  
ATOM 4422  H HG2  . ARG A 1 149 ? 7.565   -13.600 11.740  1.00 12.33  ? 149 ARG A HG2  2  
ATOM 4423  H HG3  . ARG A 1 149 ? 7.069   -14.820 12.916  1.00 12.05  ? 149 ARG A HG3  2  
ATOM 4424  H HD2  . ARG A 1 149 ? 4.957   -15.190 11.617  1.00 12.13  ? 149 ARG A HD2  2  
ATOM 4425  H HD3  . ARG A 1 149 ? 5.468   -13.973 10.446  1.00 12.47  ? 149 ARG A HD3  2  
ATOM 4426  H HE   . ARG A 1 149 ? 6.287   -16.727 10.546  1.00 14.46  ? 149 ARG A HE   2  
ATOM 4427  H HH11 . ARG A 1 149 ? 7.141   -13.689 9.110   1.00 15.66  ? 149 ARG A HH11 2  
ATOM 4428  H HH12 . ARG A 1 149 ? 8.627   -14.323 8.450   1.00 17.97  ? 149 ARG A HH12 2  
ATOM 4429  H HH21 . ARG A 1 149 ? 8.130   -17.488 9.374   1.00 17.55  ? 149 ARG A HH21 2  
ATOM 4430  H HH22 . ARG A 1 149 ? 9.117   -16.285 8.570   1.00 18.82  ? 149 ARG A HH22 2  
ATOM 4431  N N    . MET A 1 1   ? -11.555 65.844  -14.261 1.00 64.49  ? 1   MET A N    3  
ATOM 4432  C CA   . MET A 1 1   ? -10.687 66.206  -15.401 1.00 64.56  ? 1   MET A CA   3  
ATOM 4433  C C    . MET A 1 1   ? -10.373 64.971  -16.241 1.00 63.64  ? 1   MET A C    3  
ATOM 4434  O O    . MET A 1 1   ? -11.017 64.757  -17.268 1.00 63.78  ? 1   MET A O    3  
ATOM 4435  C CB   . MET A 1 1   ? -9.411  66.959  -14.976 1.00 64.94  ? 1   MET A CB   3  
ATOM 4436  C CG   . MET A 1 1   ? -9.700  68.307  -14.301 1.00 65.77  ? 1   MET A CG   3  
ATOM 4437  S SD   . MET A 1 1   ? -10.312 68.209  -12.594 1.00 66.28  ? 1   MET A SD   3  
ATOM 4438  C CE   . MET A 1 1   ? -8.780  67.816  -11.701 1.00 66.43  ? 1   MET A CE   3  
ATOM 4439  H H1   . MET A 1 1   ? -11.161 65.086  -13.719 1.00 63.94  ? 1   MET A H1   3  
ATOM 4440  H H2   . MET A 1 1   ? -12.453 65.504  -14.593 1.00 64.77  ? 1   MET A H2   3  
ATOM 4441  H H3   . MET A 1 1   ? -11.722 66.641  -13.661 1.00 64.75  ? 1   MET A H3   3  
ATOM 4442  H HA   . MET A 1 1   ? -11.251 66.873  -16.052 1.00 65.12  ? 1   MET A HA   3  
ATOM 4443  H HB2  . MET A 1 1   ? -8.817  66.341  -14.302 1.00 64.58  ? 1   MET A HB2  3  
ATOM 4444  H HB3  . MET A 1 1   ? -8.819  67.155  -15.872 1.00 65.04  ? 1   MET A HB3  3  
ATOM 4445  H HG2  . MET A 1 1   ? -8.780  68.892  -14.294 1.00 65.69  ? 1   MET A HG2  3  
ATOM 4446  H HG3  . MET A 1 1   ? -10.428 68.850  -14.902 1.00 66.27  ? 1   MET A HG3  3  
ATOM 4447  H HE1  . MET A 1 1   ? -8.049  68.607  -11.866 1.00 66.61  ? 1   MET A HE1  3  
ATOM 4448  H HE2  . MET A 1 1   ? -8.991  67.741  -10.634 1.00 66.60  ? 1   MET A HE2  3  
ATOM 4449  H HE3  . MET A 1 1   ? -8.373  66.866  -12.049 1.00 66.27  ? 1   MET A HE3  3  
ATOM 4450  N N    . GLY A 1 2   ? -9.391  64.167  -15.805 1.00 62.78  ? 2   GLY A N    3  
ATOM 4451  C CA   . GLY A 1 2   ? -8.933  62.944  -16.470 1.00 61.89  ? 2   GLY A CA   3  
ATOM 4452  C C    . GLY A 1 2   ? -7.444  62.696  -16.229 1.00 61.09  ? 2   GLY A C    3  
ATOM 4453  O O    . GLY A 1 2   ? -6.600  63.264  -16.910 1.00 61.53  ? 2   GLY A O    3  
ATOM 4454  H H    . GLY A 1 2   ? -8.923  64.414  -14.947 1.00 62.76  ? 2   GLY A H    3  
ATOM 4455  H HA2  . GLY A 1 2   ? -9.504  62.101  -16.073 1.00 61.85  ? 2   GLY A HA2  3  
ATOM 4456  H HA3  . GLY A 1 2   ? -9.119  63.001  -17.543 1.00 61.90  ? 2   GLY A HA3  3  
ATOM 4457  N N    . HIS A 1 3   ? -7.115  61.832  -15.274 1.00 59.96  ? 3   HIS A N    3  
ATOM 4458  C CA   . HIS A 1 3   ? -5.770  61.304  -15.045 1.00 59.05  ? 3   HIS A CA   3  
ATOM 4459  C C    . HIS A 1 3   ? -5.977  59.833  -14.673 1.00 57.75  ? 3   HIS A C    3  
ATOM 4460  O O    . HIS A 1 3   ? -6.747  59.554  -13.758 1.00 57.45  ? 3   HIS A O    3  
ATOM 4461  C CB   . HIS A 1 3   ? -5.081  62.106  -13.923 1.00 59.19  ? 3   HIS A CB   3  
ATOM 4462  C CG   . HIS A 1 3   ? -3.610  61.807  -13.717 1.00 58.98  ? 3   HIS A CG   3  
ATOM 4463  N ND1  . HIS A 1 3   ? -2.604  62.747  -13.642 1.00 59.17  ? 3   HIS A ND1  3  
ATOM 4464  C CD2  . HIS A 1 3   ? -3.025  60.585  -13.495 1.00 58.65  ? 3   HIS A CD2  3  
ATOM 4465  C CE1  . HIS A 1 3   ? -1.447  62.100  -13.406 1.00 58.97  ? 3   HIS A CE1  3  
ATOM 4466  N NE2  . HIS A 1 3   ? -1.647  60.770  -13.317 1.00 58.65  ? 3   HIS A NE2  3  
ATOM 4467  H H    . HIS A 1 3   ? -7.852  61.402  -14.730 1.00 59.67  ? 3   HIS A H    3  
ATOM 4468  H HA   . HIS A 1 3   ? -5.170  61.376  -15.957 1.00 59.29  ? 3   HIS A HA   3  
ATOM 4469  H HB2  . HIS A 1 3   ? -5.173  63.171  -14.156 1.00 59.68  ? 3   HIS A HB2  3  
ATOM 4470  H HB3  . HIS A 1 3   ? -5.606  61.933  -12.982 1.00 59.09  ? 3   HIS A HB3  3  
ATOM 4471  H HD1  . HIS A 1 3   ? -2.724  63.759  -13.678 1.00 59.46  ? 3   HIS A HD1  3  
ATOM 4472  H HD2  . HIS A 1 3   ? -3.537  59.635  -13.431 1.00 58.48  ? 3   HIS A HD2  3  
ATOM 4473  H HE1  . HIS A 1 3   ? -0.491  62.589  -13.269 1.00 59.10  ? 3   HIS A HE1  3  
ATOM 4474  N N    . THR A 1 4   ? -5.368  58.886  -15.395 1.00 57.04  ? 4   THR A N    3  
ATOM 4475  C CA   . THR A 1 4   ? -5.696  57.459  -15.269 1.00 55.85  ? 4   THR A CA   3  
ATOM 4476  C C    . THR A 1 4   ? -4.561  56.601  -15.791 1.00 55.08  ? 4   THR A C    3  
ATOM 4477  O O    . THR A 1 4   ? -3.919  56.944  -16.779 1.00 55.61  ? 4   THR A O    3  
ATOM 4478  C CB   . THR A 1 4   ? -7.047  57.151  -15.931 1.00 55.98  ? 4   THR A CB   3  
ATOM 4479  O OG1  . THR A 1 4   ? -7.398  55.819  -15.633 1.00 55.41  ? 4   THR A OG1  3  
ATOM 4480  C CG2  . THR A 1 4   ? -7.067  57.313  -17.453 1.00 56.40  ? 4   THR A CG2  3  
ATOM 4481  H H    . THR A 1 4   ? -4.721  59.141  -16.130 1.00 57.39  ? 4   THR A H    3  
ATOM 4482  H HA   . THR A 1 4   ? -5.816  57.240  -14.205 1.00 55.47  ? 4   THR A HA   3  
ATOM 4483  H HB   . THR A 1 4   ? -7.803  57.810  -15.503 1.00 56.30  ? 4   THR A HB   3  
ATOM 4484  H HG1  . THR A 1 4   ? -8.362  55.794  -15.589 1.00 55.63  ? 4   THR A HG1  3  
ATOM 4485  H HG21 . THR A 1 4   ? -6.795  58.328  -17.728 1.00 56.72  ? 4   THR A HG21 3  
ATOM 4486  H HG22 . THR A 1 4   ? -6.364  56.614  -17.917 1.00 56.29  ? 4   THR A HG22 3  
ATOM 4487  H HG23 . THR A 1 4   ? -8.069  57.099  -17.829 1.00 56.60  ? 4   THR A HG23 3  
ATOM 4488  N N    . MET A 1 5   ? -4.285  55.498  -15.097 1.00 53.90  ? 5   MET A N    3  
ATOM 4489  C CA   . MET A 1 5   ? -3.144  54.619  -15.367 1.00 53.07  ? 5   MET A CA   3  
ATOM 4490  C C    . MET A 1 5   ? -3.332  53.264  -14.662 1.00 51.78  ? 5   MET A C    3  
ATOM 4491  O O    . MET A 1 5   ? -3.022  53.163  -13.467 1.00 51.27  ? 5   MET A O    3  
ATOM 4492  C CB   . MET A 1 5   ? -1.829  55.311  -14.951 1.00 53.09  ? 5   MET A CB   3  
ATOM 4493  C CG   . MET A 1 5   ? -0.600  54.576  -15.497 1.00 52.84  ? 5   MET A CG   3  
ATOM 4494  S SD   . MET A 1 5   ? 0.954   55.356  -15.003 1.00 53.14  ? 5   MET A SD   3  
ATOM 4495  C CE   . MET A 1 5   ? 2.079   54.503  -16.135 1.00 53.19  ? 5   MET A CE   3  
ATOM 4496  H H    . MET A 1 5   ? -4.891  55.288  -14.316 1.00 53.59  ? 5   MET A H    3  
ATOM 4497  H HA   . MET A 1 5   ? -3.085  54.466  -16.444 1.00 53.50  ? 5   MET A HA   3  
ATOM 4498  H HB2  . MET A 1 5   ? -1.805  56.328  -15.347 1.00 53.54  ? 5   MET A HB2  3  
ATOM 4499  H HB3  . MET A 1 5   ? -1.766  55.382  -13.864 1.00 52.98  ? 5   MET A HB3  3  
ATOM 4500  H HG2  . MET A 1 5   ? -0.598  53.541  -15.147 1.00 52.55  ? 5   MET A HG2  3  
ATOM 4501  H HG3  . MET A 1 5   ? -0.651  54.577  -16.587 1.00 52.86  ? 5   MET A HG3  3  
ATOM 4502  H HE1  . MET A 1 5   ? 3.108   54.783  -15.908 1.00 53.29  ? 5   MET A HE1  3  
ATOM 4503  H HE2  . MET A 1 5   ? 1.980   53.422  -16.021 1.00 52.87  ? 5   MET A HE2  3  
ATOM 4504  H HE3  . MET A 1 5   ? 1.861   54.790  -17.164 1.00 53.55  ? 5   MET A HE3  3  
ATOM 4505  N N    . PRO A 1 6   ? -3.867  52.244  -15.366 1.00 51.32  ? 6   PRO A N    3  
ATOM 4506  C CA   . PRO A 1 6   ? -3.921  50.878  -14.871 1.00 50.13  ? 6   PRO A CA   3  
ATOM 4507  C C    . PRO A 1 6   ? -2.566  50.195  -15.100 1.00 49.29  ? 6   PRO A C    3  
ATOM 4508  O O    . PRO A 1 6   ? -1.975  50.301  -16.178 1.00 49.72  ? 6   PRO A O    3  
ATOM 4509  C CB   . PRO A 1 6   ? -5.041  50.204  -15.666 1.00 50.24  ? 6   PRO A CB   3  
ATOM 4510  C CG   . PRO A 1 6   ? -5.002  50.922  -17.015 1.00 51.21  ? 6   PRO A CG   3  
ATOM 4511  C CD   . PRO A 1 6   ? -4.535  52.337  -16.662 1.00 52.03  ? 6   PRO A CD   3  
ATOM 4512  H HA   . PRO A 1 6   ? -4.170  50.862  -13.810 1.00 49.90  ? 6   PRO A HA   3  
ATOM 4513  H HB2  . PRO A 1 6   ? -4.885  49.131  -15.774 1.00 49.43  ? 6   PRO A HB2  3  
ATOM 4514  H HB3  . PRO A 1 6   ? -5.996  50.397  -15.181 1.00 50.63  ? 6   PRO A HB3  3  
ATOM 4515  H HG2  . PRO A 1 6   ? -4.267  50.448  -17.666 1.00 50.85  ? 6   PRO A HG2  3  
ATOM 4516  H HG3  . PRO A 1 6   ? -5.980  50.933  -17.494 1.00 51.75  ? 6   PRO A HG3  3  
ATOM 4517  H HD2  . PRO A 1 6   ? -3.855  52.702  -17.432 1.00 52.41  ? 6   PRO A HD2  3  
ATOM 4518  H HD3  . PRO A 1 6   ? -5.398  53.001  -16.576 1.00 52.78  ? 6   PRO A HD3  3  
ATOM 4519  N N    . ALA A 1 7   ? -2.086  49.471  -14.088 1.00 48.17  ? 7   ALA A N    3  
ATOM 4520  C CA   . ALA A 1 7   ? -0.819  48.740  -14.118 1.00 47.27  ? 7   ALA A CA   3  
ATOM 4521  C C    . ALA A 1 7   ? -0.942  47.453  -13.291 1.00 45.99  ? 7   ALA A C    3  
ATOM 4522  O O    . ALA A 1 7   ? -1.274  47.509  -12.105 1.00 45.65  ? 7   ALA A O    3  
ATOM 4523  C CB   . ALA A 1 7   ? 0.301   49.651  -13.588 1.00 47.25  ? 7   ALA A CB   3  
ATOM 4524  H H    . ALA A 1 7   ? -2.635  49.397  -13.241 1.00 47.93  ? 7   ALA A H    3  
ATOM 4525  H HA   . ALA A 1 7   ? -0.582  48.473  -15.148 1.00 47.66  ? 7   ALA A HA   3  
ATOM 4526  H HB1  . ALA A 1 7   ? 0.379   50.542  -14.209 1.00 47.63  ? 7   ALA A HB1  3  
ATOM 4527  H HB2  . ALA A 1 7   ? 0.083   49.947  -12.559 1.00 46.96  ? 7   ALA A HB2  3  
ATOM 4528  H HB3  . ALA A 1 7   ? 1.255   49.118  -13.609 1.00 47.27  ? 7   ALA A HB3  3  
ATOM 4529  N N    . HIS A 1 8   ? -0.706  46.300  -13.923 1.00 45.35  ? 8   HIS A N    3  
ATOM 4530  C CA   . HIS A 1 8   ? -1.015  44.989  -13.337 1.00 44.16  ? 8   HIS A CA   3  
ATOM 4531  C C    . HIS A 1 8   ? -0.115  43.851  -13.884 1.00 43.56  ? 8   HIS A C    3  
ATOM 4532  O O    . HIS A 1 8   ? -0.495  42.677  -13.853 1.00 43.66  ? 8   HIS A O    3  
ATOM 4533  C CB   . HIS A 1 8   ? -2.520  44.717  -13.536 1.00 44.31  ? 8   HIS A CB   3  
ATOM 4534  C CG   . HIS A 1 8   ? -3.089  43.805  -12.488 1.00 43.76  ? 8   HIS A CG   3  
ATOM 4535  N ND1  . HIS A 1 8   ? -2.811  42.469  -12.337 1.00 43.50  ? 8   HIS A ND1  3  
ATOM 4536  C CD2  . HIS A 1 8   ? -3.919  44.163  -11.465 1.00 43.54  ? 8   HIS A CD2  3  
ATOM 4537  C CE1  . HIS A 1 8   ? -3.457  42.025  -11.248 1.00 43.12  ? 8   HIS A CE1  3  
ATOM 4538  N NE2  . HIS A 1 8   ? -4.143  43.025  -10.677 1.00 43.12  ? 8   HIS A NE2  3  
ATOM 4539  H H    . HIS A 1 8   ? -0.526  46.336  -14.914 1.00 45.75  ? 8   HIS A H    3  
ATOM 4540  H HA   . HIS A 1 8   ? -0.821  45.039  -12.261 1.00 43.65  ? 8   HIS A HA   3  
ATOM 4541  H HB2  . HIS A 1 8   ? -3.082  45.654  -13.493 1.00 44.53  ? 8   HIS A HB2  3  
ATOM 4542  H HB3  . HIS A 1 8   ? -2.687  44.285  -14.525 1.00 44.75  ? 8   HIS A HB3  3  
ATOM 4543  H HD1  . HIS A 1 8   ? -2.140  41.957  -12.900 1.00 43.64  ? 8   HIS A HD1  3  
ATOM 4544  H HD2  . HIS A 1 8   ? -4.311  45.159  -11.293 1.00 43.73  ? 8   HIS A HD2  3  
ATOM 4545  H HE1  . HIS A 1 8   ? -3.423  41.013  -10.870 1.00 42.94  ? 8   HIS A HE1  3  
ATOM 4546  N N    . THR A 1 9   ? 1.065   44.191  -14.417 1.00 43.06  ? 9   THR A N    3  
ATOM 4547  C CA   . THR A 1 9   ? 2.038   43.235  -14.962 1.00 42.54  ? 9   THR A CA   3  
ATOM 4548  C C    . THR A 1 9   ? 2.757   42.521  -13.801 1.00 41.48  ? 9   THR A C    3  
ATOM 4549  O O    . THR A 1 9   ? 3.416   43.211  -13.022 1.00 41.37  ? 9   THR A O    3  
ATOM 4550  C CB   . THR A 1 9   ? 3.030   43.968  -15.872 1.00 42.84  ? 9   THR A CB   3  
ATOM 4551  O OG1  . THR A 1 9   ? 2.298   44.648  -16.874 1.00 42.92  ? 9   THR A OG1  3  
ATOM 4552  C CG2  . THR A 1 9   ? 4.013   43.009  -16.548 1.00 42.60  ? 9   THR A CG2  3  
ATOM 4553  H H    . THR A 1 9   ? 1.324   45.165  -14.419 1.00 43.11  ? 9   THR A H    3  
ATOM 4554  H HA   . THR A 1 9   ? 1.506   42.515  -15.578 1.00 42.86  ? 9   THR A HA   3  
ATOM 4555  H HB   . THR A 1 9   ? 3.595   44.697  -15.287 1.00 43.31  ? 9   THR A HB   3  
ATOM 4556  H HG1  . THR A 1 9   ? 2.542   44.258  -17.732 1.00 43.13  ? 9   THR A HG1  3  
ATOM 4557  H HG21 . THR A 1 9   ? 3.473   42.270  -17.144 1.00 42.59  ? 9   THR A HG21 3  
ATOM 4558  H HG22 . THR A 1 9   ? 4.691   43.568  -17.189 1.00 42.89  ? 9   THR A HG22 3  
ATOM 4559  H HG23 . THR A 1 9   ? 4.609   42.493  -15.795 1.00 42.26  ? 9   THR A HG23 3  
ATOM 4560  N N    . PRO A 1 10  ? 2.631   41.184  -13.657 1.00 40.80  ? 10  PRO A N    3  
ATOM 4561  C CA   . PRO A 1 10  ? 3.172   40.442  -12.520 1.00 39.80  ? 10  PRO A CA   3  
ATOM 4562  C C    . PRO A 1 10  ? 4.687   40.184  -12.659 1.00 39.22  ? 10  PRO A C    3  
ATOM 4563  O O    . PRO A 1 10  ? 5.222   40.300  -13.765 1.00 39.45  ? 10  PRO A O    3  
ATOM 4564  C CB   . PRO A 1 10  ? 2.381   39.126  -12.503 1.00 39.44  ? 10  PRO A CB   3  
ATOM 4565  C CG   . PRO A 1 10  ? 2.091   38.879  -13.980 1.00 40.07  ? 10  PRO A CG   3  
ATOM 4566  C CD   . PRO A 1 10  ? 1.867   40.290  -14.519 1.00 41.06  ? 10  PRO A CD   3  
ATOM 4567  H HA   . PRO A 1 10  ? 2.980   40.991  -11.597 1.00 39.85  ? 10  PRO A HA   3  
ATOM 4568  H HB2  . PRO A 1 10  ? 2.944   38.299  -12.066 1.00 38.67  ? 10  PRO A HB2  3  
ATOM 4569  H HB3  . PRO A 1 10  ? 1.442   39.272  -11.968 1.00 39.70  ? 10  PRO A HB3  3  
ATOM 4570  H HG2  . PRO A 1 10  ? 2.963   38.438  -14.463 1.00 39.74  ? 10  PRO A HG2  3  
ATOM 4571  H HG3  . PRO A 1 10  ? 1.213   38.248  -14.125 1.00 40.25  ? 10  PRO A HG3  3  
ATOM 4572  H HD2  . PRO A 1 10  ? 2.199   40.358  -15.557 1.00 41.45  ? 10  PRO A HD2  3  
ATOM 4573  H HD3  . PRO A 1 10  ? 0.808   40.540  -14.448 1.00 41.61  ? 10  PRO A HD3  3  
ATOM 4574  N N    . PRO A 1 11  ? 5.378   39.771  -11.574 1.00 38.56  ? 11  PRO A N    3  
ATOM 4575  C CA   . PRO A 1 11  ? 6.784   39.358  -11.598 1.00 38.04  ? 11  PRO A CA   3  
ATOM 4576  C C    . PRO A 1 11  ? 6.924   37.966  -12.243 1.00 37.39  ? 11  PRO A C    3  
ATOM 4577  O O    . PRO A 1 11  ? 7.152   36.955  -11.578 1.00 37.33  ? 11  PRO A O    3  
ATOM 4578  C CB   . PRO A 1 11  ? 7.242   39.421  -10.135 1.00 37.76  ? 11  PRO A CB   3  
ATOM 4579  C CG   . PRO A 1 11  ? 5.971   39.082  -9.359  1.00 37.72  ? 11  PRO A CG   3  
ATOM 4580  C CD   . PRO A 1 11  ? 4.867   39.713  -10.207 1.00 38.42  ? 11  PRO A CD   3  
ATOM 4581  H HA   . PRO A 1 11  ? 7.371   40.070  -12.179 1.00 38.44  ? 11  PRO A HA   3  
ATOM 4582  H HB2  . PRO A 1 11  ? 8.059   38.730  -9.916  1.00 37.24  ? 11  PRO A HB2  3  
ATOM 4583  H HB3  . PRO A 1 11  ? 7.548   40.441  -9.899  1.00 38.27  ? 11  PRO A HB3  3  
ATOM 4584  H HG2  . PRO A 1 11  ? 5.838   37.999  -9.327  1.00 37.17  ? 11  PRO A HG2  3  
ATOM 4585  H HG3  . PRO A 1 11  ? 5.992   39.493  -8.348  1.00 37.87  ? 11  PRO A HG3  3  
ATOM 4586  H HD2  . PRO A 1 11  ? 3.964   39.108  -10.139 1.00 38.32  ? 11  PRO A HD2  3  
ATOM 4587  H HD3  . PRO A 1 11  ? 4.665   40.723  -9.850  1.00 39.00  ? 11  PRO A HD3  3  
ATOM 4588  N N    . ALA A 1 12  ? 6.750   37.915  -13.569 1.00 37.00  ? 12  ALA A N    3  
ATOM 4589  C CA   . ALA A 1 12  ? 6.627   36.694  -14.365 1.00 36.42  ? 12  ALA A CA   3  
ATOM 4590  C C    . ALA A 1 12  ? 7.973   35.960  -14.564 1.00 35.89  ? 12  ALA A C    3  
ATOM 4591  O O    . ALA A 1 12  ? 8.582   36.025  -15.636 1.00 36.36  ? 12  ALA A O    3  
ATOM 4592  C CB   . ALA A 1 12  ? 5.945   37.074  -15.687 1.00 36.84  ? 12  ALA A CB   3  
ATOM 4593  H H    . ALA A 1 12  ? 6.518   38.792  -14.029 1.00 37.15  ? 12  ALA A H    3  
ATOM 4594  H HA   . ALA A 1 12  ? 5.966   36.006  -13.837 1.00 36.15  ? 12  ALA A HA   3  
ATOM 4595  H HB1  . ALA A 1 12  ? 6.561   37.784  -16.239 1.00 37.42  ? 12  ALA A HB1  3  
ATOM 4596  H HB2  . ALA A 1 12  ? 5.806   36.180  -16.300 1.00 37.13  ? 12  ALA A HB2  3  
ATOM 4597  H HB3  . ALA A 1 12  ? 4.971   37.521  -15.491 1.00 36.39  ? 12  ALA A HB3  3  
ATOM 4598  N N    . GLN A 1 13  ? 8.440   35.264  -13.521 1.00 35.02  ? 13  GLN A N    3  
ATOM 4599  C CA   . GLN A 1 13  ? 9.736   34.577  -13.486 1.00 34.55  ? 13  GLN A CA   3  
ATOM 4600  C C    . GLN A 1 13  ? 9.804   33.537  -12.343 1.00 33.60  ? 13  GLN A C    3  
ATOM 4601  O O    . GLN A 1 13  ? 10.790  33.494  -11.609 1.00 34.05  ? 13  GLN A O    3  
ATOM 4602  C CB   . GLN A 1 13  ? 10.859  35.648  -13.434 1.00 34.98  ? 13  GLN A CB   3  
ATOM 4603  C CG   . GLN A 1 13  ? 12.282  35.106  -13.684 1.00 35.51  ? 13  GLN A CG   3  
ATOM 4604  C CD   . GLN A 1 13  ? 13.202  36.142  -14.329 1.00 36.55  ? 13  GLN A CD   3  
ATOM 4605  O OE1  . GLN A 1 13  ? 13.702  35.957  -15.428 1.00 37.05  ? 13  GLN A OE1  3  
ATOM 4606  N NE2  . GLN A 1 13  ? 13.430  37.291  -13.718 1.00 37.04  ? 13  GLN A NE2  3  
ATOM 4607  H H    . GLN A 1 13  ? 7.944   35.374  -12.644 1.00 34.77  ? 13  GLN A H    3  
ATOM 4608  H HA   . GLN A 1 13  ? 9.843   34.024  -14.419 1.00 34.74  ? 13  GLN A HA   3  
ATOM 4609  H HB2  . GLN A 1 13  ? 10.662  36.398  -14.207 1.00 35.29  ? 13  GLN A HB2  3  
ATOM 4610  H HB3  . GLN A 1 13  ? 10.836  36.160  -12.474 1.00 34.75  ? 13  GLN A HB3  3  
ATOM 4611  H HG2  . GLN A 1 13  ? 12.721  34.784  -12.742 1.00 35.34  ? 13  GLN A HG2  3  
ATOM 4612  H HG3  . GLN A 1 13  ? 12.229  34.242  -14.355 1.00 35.44  ? 13  GLN A HG3  3  
ATOM 4613  H HE21 . GLN A 1 13  ? 13.099  37.472  -12.783 1.00 36.77  ? 13  GLN A HE21 3  
ATOM 4614  H HE22 . GLN A 1 13  ? 14.054  37.942  -14.174 1.00 37.80  ? 13  GLN A HE22 3  
ATOM 4615  N N    . THR A 1 14  ? 8.756   32.714  -12.149 1.00 32.37  ? 14  THR A N    3  
ATOM 4616  C CA   . THR A 1 14  ? 8.672   31.736  -11.044 1.00 31.36  ? 14  THR A CA   3  
ATOM 4617  C C    . THR A 1 14  ? 7.729   30.580  -11.377 1.00 30.18  ? 14  THR A C    3  
ATOM 4618  O O    . THR A 1 14  ? 6.707   30.773  -12.034 1.00 30.04  ? 14  THR A O    3  
ATOM 4619  C CB   . THR A 1 14  ? 8.299   32.439  -9.729  1.00 31.28  ? 14  THR A CB   3  
ATOM 4620  O OG1  . THR A 1 14  ? 8.281   31.496  -8.677  1.00 30.88  ? 14  THR A OG1  3  
ATOM 4621  C CG2  . THR A 1 14  ? 6.937   33.143  -9.769  1.00 30.82  ? 14  THR A CG2  3  
ATOM 4622  H H    . THR A 1 14  ? 7.960   32.762  -12.776 1.00 32.15  ? 14  THR A H    3  
ATOM 4623  H HA   . THR A 1 14  ? 9.665   31.315  -10.892 1.00 31.70  ? 14  THR A HA   3  
ATOM 4624  H HB   . THR A 1 14  ? 9.060   33.188  -9.510  1.00 32.04  ? 14  THR A HB   3  
ATOM 4625  H HG1  . THR A 1 14  ? 8.041   31.984  -7.878  1.00 30.83  ? 14  THR A HG1  3  
ATOM 4626  H HG21 . THR A 1 14  ? 6.752   33.639  -8.817  1.00 30.53  ? 14  THR A HG21 3  
ATOM 4627  H HG22 . THR A 1 14  ? 6.929   33.900  -10.548 1.00 31.00  ? 14  THR A HG22 3  
ATOM 4628  H HG23 . THR A 1 14  ? 6.138   32.423  -9.956  1.00 30.77  ? 14  THR A HG23 3  
ATOM 4629  N N    . ALA A 1 15  ? 8.088   29.377  -10.921 1.00 29.46  ? 15  ALA A N    3  
ATOM 4630  C CA   . ALA A 1 15  ? 7.370   28.118  -11.147 1.00 28.40  ? 15  ALA A CA   3  
ATOM 4631  C C    . ALA A 1 15  ? 7.922   27.021  -10.207 1.00 27.73  ? 15  ALA A C    3  
ATOM 4632  O O    . ALA A 1 15  ? 9.064   26.593  -10.420 1.00 28.14  ? 15  ALA A O    3  
ATOM 4633  C CB   . ALA A 1 15  ? 7.507   27.708  -12.628 1.00 28.78  ? 15  ALA A CB   3  
ATOM 4634  H H    . ALA A 1 15  ? 8.938   29.321  -10.383 1.00 29.76  ? 15  ALA A H    3  
ATOM 4635  H HA   . ALA A 1 15  ? 6.312   28.287  -10.949 1.00 28.01  ? 15  ALA A HA   3  
ATOM 4636  H HB1  . ALA A 1 15  ? 8.563   27.590  -12.889 1.00 29.11  ? 15  ALA A HB1  3  
ATOM 4637  H HB2  . ALA A 1 15  ? 6.995   26.762  -12.802 1.00 28.95  ? 15  ALA A HB2  3  
ATOM 4638  H HB3  . ALA A 1 15  ? 7.072   28.466  -13.282 1.00 28.76  ? 15  ALA A HB3  3  
ATOM 4639  N N    . PRO A 1 16  ? 7.162   26.576  -9.181  1.00 26.88  ? 16  PRO A N    3  
ATOM 4640  C CA   . PRO A 1 16  ? 7.601   25.526  -8.268  1.00 26.34  ? 16  PRO A CA   3  
ATOM 4641  C C    . PRO A 1 16  ? 7.453   24.147  -8.926  1.00 25.62  ? 16  PRO A C    3  
ATOM 4642  O O    . PRO A 1 16  ? 8.446   23.544  -9.313  1.00 26.16  ? 16  PRO A O    3  
ATOM 4643  C CB   . PRO A 1 16  ? 6.763   25.715  -6.997  1.00 25.97  ? 16  PRO A CB   3  
ATOM 4644  C CG   . PRO A 1 16  ? 5.472   26.374  -7.484  1.00 25.78  ? 16  PRO A CG   3  
ATOM 4645  C CD   . PRO A 1 16  ? 5.908   27.167  -8.718  1.00 26.62  ? 16  PRO A CD   3  
ATOM 4646  H HA   . PRO A 1 16  ? 8.654   25.664  -8.017  1.00 26.95  ? 16  PRO A HA   3  
ATOM 4647  H HB2  . PRO A 1 16  ? 6.573   24.773  -6.481  1.00 25.35  ? 16  PRO A HB2  3  
ATOM 4648  H HB3  . PRO A 1 16  ? 7.284   26.404  -6.331  1.00 26.68  ? 16  PRO A HB3  3  
ATOM 4649  H HG2  . PRO A 1 16  ? 4.747   25.614  -7.774  1.00 25.04  ? 16  PRO A HG2  3  
ATOM 4650  H HG3  . PRO A 1 16  ? 5.044   27.025  -6.724  1.00 26.00  ? 16  PRO A HG3  3  
ATOM 4651  H HD2  . PRO A 1 16  ? 5.138   27.113  -9.487  1.00 26.46  ? 16  PRO A HD2  3  
ATOM 4652  H HD3  . PRO A 1 16  ? 6.083   28.207  -8.436  1.00 27.34  ? 16  PRO A HD3  3  
ATOM 4653  N N    . ALA A 1 17  ? 6.215   23.658  -9.073  1.00 24.52  ? 17  ALA A N    3  
ATOM 4654  C CA   . ALA A 1 17  ? 5.860   22.377  -9.693  1.00 23.82  ? 17  ALA A CA   3  
ATOM 4655  C C    . ALA A 1 17  ? 4.365   22.389  -10.080 1.00 22.55  ? 17  ALA A C    3  
ATOM 4656  O O    . ALA A 1 17  ? 3.596   21.539  -9.634  1.00 22.37  ? 17  ALA A O    3  
ATOM 4657  C CB   . ALA A 1 17  ? 6.223   21.240  -8.719  1.00 24.02  ? 17  ALA A CB   3  
ATOM 4658  H H    . ALA A 1 17  ? 5.451   24.166  -8.652  1.00 24.21  ? 17  ALA A H    3  
ATOM 4659  H HA   . ALA A 1 17  ? 6.441   22.245  -10.610 1.00 24.27  ? 17  ALA A HA   3  
ATOM 4660  H HB1  . ALA A 1 17  ? 5.957   20.279  -9.167  1.00 24.06  ? 17  ALA A HB1  3  
ATOM 4661  H HB2  . ALA A 1 17  ? 7.297   21.244  -8.518  1.00 24.96  ? 17  ALA A HB2  3  
ATOM 4662  H HB3  . ALA A 1 17  ? 5.678   21.361  -7.782  1.00 23.42  ? 17  ALA A HB3  3  
ATOM 4663  N N    . ALA A 1 18  ? 3.947   23.447  -10.795 1.00 21.80  ? 18  ALA A N    3  
ATOM 4664  C CA   . ALA A 1 18  ? 2.556   23.854  -11.072 1.00 20.59  ? 18  ALA A CA   3  
ATOM 4665  C C    . ALA A 1 18  ? 1.759   24.237  -9.795  1.00 19.22  ? 18  ALA A C    3  
ATOM 4666  O O    . ALA A 1 18  ? 2.159   23.928  -8.674  1.00 19.39  ? 18  ALA A O    3  
ATOM 4667  C CB   . ALA A 1 18  ? 1.842   22.794  -11.932 1.00 20.85  ? 18  ALA A CB   3  
ATOM 4668  H H    . ALA A 1 18  ? 4.683   24.052  -11.120 1.00 22.23  ? 18  ALA A H    3  
ATOM 4669  H HA   . ALA A 1 18  ? 2.610   24.755  -11.684 1.00 20.73  ? 18  ALA A HA   3  
ATOM 4670  H HB1  . ALA A 1 18  ? 0.875   23.166  -12.260 1.00 20.82  ? 18  ALA A HB1  3  
ATOM 4671  H HB2  . ALA A 1 18  ? 2.439   22.573  -12.821 1.00 21.34  ? 18  ALA A HB2  3  
ATOM 4672  H HB3  . ALA A 1 18  ? 1.695   21.874  -11.364 1.00 20.84  ? 18  ALA A HB3  3  
ATOM 4673  N N    . GLN A 1 19  ? 0.631   24.937  -9.955  1.00 18.07  ? 19  GLN A N    3  
ATOM 4674  C CA   . GLN A 1 19  ? -0.169  25.470  -8.840  1.00 16.86  ? 19  GLN A CA   3  
ATOM 4675  C C    . GLN A 1 19  ? -1.573  25.838  -9.344  1.00 15.73  ? 19  GLN A C    3  
ATOM 4676  O O    . GLN A 1 19  ? -1.885  27.002  -9.589  1.00 15.70  ? 19  GLN A O    3  
ATOM 4677  C CB   . GLN A 1 19  ? 0.600   26.629  -8.147  1.00 17.26  ? 19  GLN A CB   3  
ATOM 4678  C CG   . GLN A 1 19  ? 0.162   26.955  -6.700  1.00 16.93  ? 19  GLN A CG   3  
ATOM 4679  C CD   . GLN A 1 19  ? 1.206   27.799  -5.934  1.00 17.58  ? 19  GLN A CD   3  
ATOM 4680  O OE1  . GLN A 1 19  ? 2.242   28.180  -6.451  1.00 18.13  ? 19  GLN A OE1  3  
ATOM 4681  N NE2  . GLN A 1 19  ? 1.012   28.121  -4.675  1.00 17.81  ? 19  GLN A NE2  3  
ATOM 4682  H H    . GLN A 1 19  ? 0.336   25.181  -10.888 1.00 18.20  ? 19  GLN A H    3  
ATOM 4683  H HA   . GLN A 1 19  ? -0.292  24.669  -8.107  1.00 16.78  ? 19  GLN A HA   3  
ATOM 4684  H HB2  . GLN A 1 19  ? 1.653   26.356  -8.104  1.00 18.09  ? 19  GLN A HB2  3  
ATOM 4685  H HB3  . GLN A 1 19  ? 0.535   27.531  -8.757  1.00 17.36  ? 19  GLN A HB3  3  
ATOM 4686  H HG2  . GLN A 1 19  ? -0.787  27.492  -6.717  1.00 16.46  ? 19  GLN A HG2  3  
ATOM 4687  H HG3  . GLN A 1 19  ? 0.024   26.025  -6.151  1.00 17.05  ? 19  GLN A HG3  3  
ATOM 4688  H HE21 . GLN A 1 19  ? 0.131   27.955  -4.205  1.00 17.53  ? 19  GLN A HE21 3  
ATOM 4689  H HE22 . GLN A 1 19  ? 1.763   28.621  -4.224  1.00 18.47  ? 19  GLN A HE22 3  
ATOM 4690  N N    . LYS A 1 20  ? -2.436  24.832  -9.535  1.00 15.03  ? 20  LYS A N    3  
ATOM 4691  C CA   . LYS A 1 20  ? -3.851  24.983  -9.926  1.00 14.07  ? 20  LYS A CA   3  
ATOM 4692  C C    . LYS A 1 20  ? -4.717  23.870  -9.294  1.00 13.14  ? 20  LYS A C    3  
ATOM 4693  O O    . LYS A 1 20  ? -4.203  22.789  -9.017  1.00 13.36  ? 20  LYS A O    3  
ATOM 4694  C CB   . LYS A 1 20  ? -3.977  25.038  -11.467 1.00 14.75  ? 20  LYS A CB   3  
ATOM 4695  C CG   . LYS A 1 20  ? -3.795  23.679  -12.177 1.00 15.33  ? 20  LYS A CG   3  
ATOM 4696  C CD   . LYS A 1 20  ? -3.838  23.796  -13.710 1.00 16.79  ? 20  LYS A CD   3  
ATOM 4697  C CE   . LYS A 1 20  ? -2.514  24.331  -14.261 1.00 17.94  ? 20  LYS A CE   3  
ATOM 4698  N NZ   . LYS A 1 20  ? -2.584  24.650  -15.707 1.00 19.40  ? 20  LYS A NZ   3  
ATOM 4699  H H    . LYS A 1 20  ? -2.139  23.887  -9.311  1.00 15.31  ? 20  LYS A H    3  
ATOM 4700  H HA   . LYS A 1 20  ? -4.211  25.936  -9.532  1.00 13.87  ? 20  LYS A HA   3  
ATOM 4701  H HB2  . LYS A 1 20  ? -4.970  25.419  -11.716 1.00 14.76  ? 20  LYS A HB2  3  
ATOM 4702  H HB3  . LYS A 1 20  ? -3.245  25.751  -11.853 1.00 15.23  ? 20  LYS A HB3  3  
ATOM 4703  H HG2  . LYS A 1 20  ? -2.854  23.223  -11.879 1.00 15.42  ? 20  LYS A HG2  3  
ATOM 4704  H HG3  . LYS A 1 20  ? -4.607  23.015  -11.873 1.00 14.93  ? 20  LYS A HG3  3  
ATOM 4705  H HD2  . LYS A 1 20  ? -4.019  22.808  -14.138 1.00 17.31  ? 20  LYS A HD2  3  
ATOM 4706  H HD3  . LYS A 1 20  ? -4.663  24.450  -14.002 1.00 16.76  ? 20  LYS A HD3  3  
ATOM 4707  H HE2  . LYS A 1 20  ? -2.228  25.234  -13.715 1.00 17.68  ? 20  LYS A HE2  3  
ATOM 4708  H HE3  . LYS A 1 20  ? -1.728  23.583  -14.098 1.00 18.17  ? 20  LYS A HE3  3  
ATOM 4709  H HZ1  . LYS A 1 20  ? -3.204  25.433  -15.891 1.00 19.62  ? 20  LYS A HZ1  3  
ATOM 4710  H HZ2  . LYS A 1 20  ? -1.649  24.893  -16.025 1.00 20.18  ? 20  LYS A HZ2  3  
ATOM 4711  H HZ3  . LYS A 1 20  ? -2.873  23.865  -16.283 1.00 19.73  ? 20  LYS A HZ3  3  
ATOM 4712  N N    . ALA A 1 21  ? -6.005  24.137  -9.054  1.00 12.37  ? 21  ALA A N    3  
ATOM 4713  C CA   . ALA A 1 21  ? -6.937  23.222  -8.380  1.00 11.55  ? 21  ALA A CA   3  
ATOM 4714  C C    . ALA A 1 21  ? -8.362  23.307  -8.961  1.00 11.00  ? 21  ALA A C    3  
ATOM 4715  O O    . ALA A 1 21  ? -8.670  24.236  -9.714  1.00 11.28  ? 21  ALA A O    3  
ATOM 4716  C CB   . ALA A 1 21  ? -6.913  23.546  -6.879  1.00 11.45  ? 21  ALA A CB   3  
ATOM 4717  H H    . ALA A 1 21  ? -6.380  25.036  -9.316  1.00 12.55  ? 21  ALA A H    3  
ATOM 4718  H HA   . ALA A 1 21  ? -6.593  22.195  -8.517  1.00 11.80  ? 21  ALA A HA   3  
ATOM 4719  H HB1  . ALA A 1 21  ? -5.904  23.424  -6.487  1.00 11.64  ? 21  ALA A HB1  3  
ATOM 4720  H HB2  . ALA A 1 21  ? -7.241  24.575  -6.715  1.00 11.60  ? 21  ALA A HB2  3  
ATOM 4721  H HB3  . ALA A 1 21  ? -7.577  22.872  -6.336  1.00 11.50  ? 21  ALA A HB3  3  
ATOM 4722  N N    . GLY A 1 22  ? -9.202  22.332  -8.595  1.00 10.52  ? 22  GLY A N    3  
ATOM 4723  C CA   . GLY A 1 22  ? -10.589 22.187  -9.047  1.00 10.15  ? 22  GLY A CA   3  
ATOM 4724  C C    . GLY A 1 22  ? -11.012 20.719  -9.169  1.00 9.50   ? 22  GLY A C    3  
ATOM 4725  O O    . GLY A 1 22  ? -10.276 19.923  -9.755  1.00 9.89   ? 22  GLY A O    3  
ATOM 4726  H H    . GLY A 1 22  ? -8.846  21.621  -7.973  1.00 10.62  ? 22  GLY A H    3  
ATOM 4727  H HA2  . GLY A 1 22  ? -11.238 22.675  -8.317  1.00 10.15  ? 22  GLY A HA2  3  
ATOM 4728  H HA3  . GLY A 1 22  ? -10.737 22.683  -10.003 1.00 10.66  ? 22  GLY A HA3  3  
ATOM 4729  N N    . ALA A 1 23  ? -12.196 20.414  -8.614  1.00 8.81   ? 23  ALA A N    3  
ATOM 4730  C CA   . ALA A 1 23  ? -12.829 19.096  -8.419  1.00 8.17   ? 23  ALA A CA   3  
ATOM 4731  C C    . ALA A 1 23  ? -12.285 18.339  -7.182  1.00 7.28   ? 23  ALA A C    3  
ATOM 4732  O O    . ALA A 1 23  ? -11.202 18.646  -6.682  1.00 7.54   ? 23  ALA A O    3  
ATOM 4733  C CB   . ALA A 1 23  ? -12.785 18.254  -9.706  1.00 9.01   ? 23  ALA A CB   3  
ATOM 4734  H H    . ALA A 1 23  ? -12.685 21.191  -8.201  1.00 8.91   ? 23  ALA A H    3  
ATOM 4735  H HA   . ALA A 1 23  ? -13.885 19.294  -8.206  1.00 8.33   ? 23  ALA A HA   3  
ATOM 4736  H HB1  . ALA A 1 23  ? -13.098 18.860  -10.558 1.00 9.52   ? 23  ALA A HB1  3  
ATOM 4737  H HB2  . ALA A 1 23  ? -11.781 17.876  -9.883  1.00 9.28   ? 23  ALA A HB2  3  
ATOM 4738  H HB3  . ALA A 1 23  ? -13.466 17.403  -9.618  1.00 9.38   ? 23  ALA A HB3  3  
ATOM 4739  N N    . GLN A 1 24  ? -13.051 17.351  -6.699  1.00 6.85   ? 24  GLN A N    3  
ATOM 4740  C CA   . GLN A 1 24  ? -12.774 16.524  -5.509  1.00 6.61   ? 24  GLN A CA   3  
ATOM 4741  C C    . GLN A 1 24  ? -13.817 15.411  -5.312  1.00 6.28   ? 24  GLN A C    3  
ATOM 4742  O O    . GLN A 1 24  ? -13.455 14.281  -4.981  1.00 6.82   ? 24  GLN A O    3  
ATOM 4743  C CB   . GLN A 1 24  ? -12.608 17.366  -4.212  1.00 6.96   ? 24  GLN A CB   3  
ATOM 4744  C CG   . GLN A 1 24  ? -13.820 18.186  -3.719  1.00 7.65   ? 24  GLN A CG   3  
ATOM 4745  C CD   . GLN A 1 24  ? -14.111 19.427  -4.559  1.00 8.21   ? 24  GLN A CD   3  
ATOM 4746  O OE1  . GLN A 1 24  ? -14.811 19.378  -5.558  1.00 8.41   ? 24  GLN A OE1  3  
ATOM 4747  N NE2  . GLN A 1 24  ? -13.577 20.572  -4.196  1.00 9.04   ? 24  GLN A NE2  3  
ATOM 4748  H H    . GLN A 1 24  ? -13.923 17.186  -7.179  1.00 7.15   ? 24  GLN A H    3  
ATOM 4749  H HA   . GLN A 1 24  ? -11.820 16.020  -5.669  1.00 7.18   ? 24  GLN A HA   3  
ATOM 4750  H HB2  . GLN A 1 24  ? -12.360 16.662  -3.420  1.00 7.32   ? 24  GLN A HB2  3  
ATOM 4751  H HB3  . GLN A 1 24  ? -11.754 18.030  -4.311  1.00 7.23   ? 24  GLN A HB3  3  
ATOM 4752  H HG2  . GLN A 1 24  ? -14.712 17.560  -3.676  1.00 7.94   ? 24  GLN A HG2  3  
ATOM 4753  H HG3  . GLN A 1 24  ? -13.613 18.506  -2.703  1.00 8.13   ? 24  GLN A HG3  3  
ATOM 4754  H HE21 . GLN A 1 24  ? -12.953 20.635  -3.399  1.00 9.36   ? 24  GLN A HE21 3  
ATOM 4755  H HE22 . GLN A 1 24  ? -13.771 21.381  -4.769  1.00 9.61   ? 24  GLN A HE22 3  
ATOM 4756  N N    . ALA A 1 25  ? -15.110 15.692  -5.517  1.00 5.79   ? 25  ALA A N    3  
ATOM 4757  C CA   . ALA A 1 25  ? -16.175 14.691  -5.440  1.00 5.65   ? 25  ALA A CA   3  
ATOM 4758  C C    . ALA A 1 25  ? -16.347 13.993  -6.800  1.00 5.18   ? 25  ALA A C    3  
ATOM 4759  O O    . ALA A 1 25  ? -16.818 14.611  -7.751  1.00 5.63   ? 25  ALA A O    3  
ATOM 4760  C CB   . ALA A 1 25  ? -17.465 15.378  -4.965  1.00 6.54   ? 25  ALA A CB   3  
ATOM 4761  H H    . ALA A 1 25  ? -15.382 16.639  -5.750  1.00 5.81   ? 25  ALA A H    3  
ATOM 4762  H HA   . ALA A 1 25  ? -15.909 13.937  -4.701  1.00 5.77   ? 25  ALA A HA   3  
ATOM 4763  H HB1  . ALA A 1 25  ? -17.301 15.842  -3.991  1.00 7.05   ? 25  ALA A HB1  3  
ATOM 4764  H HB2  . ALA A 1 25  ? -17.769 16.144  -5.682  1.00 6.77   ? 25  ALA A HB2  3  
ATOM 4765  H HB3  . ALA A 1 25  ? -18.266 14.640  -4.877  1.00 7.08   ? 25  ALA A HB3  3  
ATOM 4766  N N    . LEU A 1 26  ? -15.921 12.729  -6.901  1.00 4.71   ? 26  LEU A N    3  
ATOM 4767  C CA   . LEU A 1 26  ? -15.895 11.955  -8.150  1.00 4.60   ? 26  LEU A CA   3  
ATOM 4768  C C    . LEU A 1 26  ? -16.360 10.500  -7.931  1.00 4.37   ? 26  LEU A C    3  
ATOM 4769  O O    . LEU A 1 26  ? -16.249 9.981   -6.808  1.00 4.12   ? 26  LEU A O    3  
ATOM 4770  C CB   . LEU A 1 26  ? -14.458 11.998  -8.715  1.00 4.79   ? 26  LEU A CB   3  
ATOM 4771  C CG   . LEU A 1 26  ? -14.016 13.357  -9.300  1.00 5.61   ? 26  LEU A CG   3  
ATOM 4772  C CD1  . LEU A 1 26  ? -12.520 13.298  -9.649  1.00 6.34   ? 26  LEU A CD1  3  
ATOM 4773  C CD2  . LEU A 1 26  ? -14.809 13.730  -10.562 1.00 6.65   ? 26  LEU A CD2  3  
ATOM 4774  H H    . LEU A 1 26  ? -15.505 12.303  -6.089  1.00 4.75   ? 26  LEU A H    3  
ATOM 4775  H HA   . LEU A 1 26  ? -16.579 12.421  -8.860  1.00 5.15   ? 26  LEU A HA   3  
ATOM 4776  H HB2  . LEU A 1 26  ? -13.769 11.736  -7.910  1.00 4.69   ? 26  LEU A HB2  3  
ATOM 4777  H HB3  . LEU A 1 26  ? -14.352 11.245  -9.495  1.00 4.95   ? 26  LEU A HB3  3  
ATOM 4778  H HG   . LEU A 1 26  ? -14.150 14.141  -8.555  1.00 5.66   ? 26  LEU A HG   3  
ATOM 4779  H HD11 . LEU A 1 26  ? -11.941 13.065  -8.755  1.00 6.50   ? 26  LEU A HD11 3  
ATOM 4780  H HD12 . LEU A 1 26  ? -12.339 12.531  -10.404 1.00 6.89   ? 26  LEU A HD12 3  
ATOM 4781  H HD13 . LEU A 1 26  ? -12.191 14.265  -10.034 1.00 6.92   ? 26  LEU A HD13 3  
ATOM 4782  H HD21 . LEU A 1 26  ? -15.860 13.882  -10.321 1.00 6.63   ? 26  LEU A HD21 3  
ATOM 4783  H HD22 . LEU A 1 26  ? -14.422 14.660  -10.983 1.00 7.51   ? 26  LEU A HD22 3  
ATOM 4784  H HD23 . LEU A 1 26  ? -14.723 12.939  -11.312 1.00 7.20   ? 26  LEU A HD23 3  
ATOM 4785  N N    . PRO A 1 27  ? -16.852 9.807   -8.979  1.00 4.88   ? 27  PRO A N    3  
ATOM 4786  C CA   . PRO A 1 27  ? -17.277 8.407   -8.911  1.00 5.06   ? 27  PRO A CA   3  
ATOM 4787  C C    . PRO A 1 27  ? -16.056 7.468   -8.855  1.00 4.37   ? 27  PRO A C    3  
ATOM 4788  O O    . PRO A 1 27  ? -15.701 6.815   -9.830  1.00 4.93   ? 27  PRO A O    3  
ATOM 4789  C CB   . PRO A 1 27  ? -18.175 8.206   -10.142 1.00 6.29   ? 27  PRO A CB   3  
ATOM 4790  C CG   . PRO A 1 27  ? -17.598 9.178   -11.167 1.00 6.54   ? 27  PRO A CG   3  
ATOM 4791  C CD   . PRO A 1 27  ? -17.127 10.349  -10.307 1.00 5.78   ? 27  PRO A CD   3  
ATOM 4792  H HA   . PRO A 1 27  ? -17.877 8.243   -8.013  1.00 5.19   ? 27  PRO A HA   3  
ATOM 4793  H HB2  . PRO A 1 27  ? -18.170 7.185   -10.521 1.00 6.63   ? 27  PRO A HB2  3  
ATOM 4794  H HB3  . PRO A 1 27  ? -19.197 8.507   -9.896  1.00 6.87   ? 27  PRO A HB3  3  
ATOM 4795  H HG2  . PRO A 1 27  ? -16.745 8.721   -11.673 1.00 6.54   ? 27  PRO A HG2  3  
ATOM 4796  H HG3  . PRO A 1 27  ? -18.356 9.486   -11.887 1.00 7.46   ? 27  PRO A HG3  3  
ATOM 4797  H HD2  . PRO A 1 27  ? -16.240 10.799  -10.751 1.00 5.80   ? 27  PRO A HD2  3  
ATOM 4798  H HD3  . PRO A 1 27  ? -17.927 11.087  -10.239 1.00 6.19   ? 27  PRO A HD3  3  
ATOM 4799  N N    . VAL A 1 28  ? -15.387 7.435   -7.702  1.00 3.48   ? 28  VAL A N    3  
ATOM 4800  C CA   . VAL A 1 28  ? -14.111 6.746   -7.432  1.00 2.86   ? 28  VAL A CA   3  
ATOM 4801  C C    . VAL A 1 28  ? -13.862 6.775   -5.917  1.00 2.74   ? 28  VAL A C    3  
ATOM 4802  O O    . VAL A 1 28  ? -14.335 7.693   -5.241  1.00 3.22   ? 28  VAL A O    3  
ATOM 4803  C CB   . VAL A 1 28  ? -12.938 7.398   -8.220  1.00 2.78   ? 28  VAL A CB   3  
ATOM 4804  C CG1  . VAL A 1 28  ? -12.695 8.859   -7.800  1.00 3.21   ? 28  VAL A CG1  3  
ATOM 4805  C CG2  . VAL A 1 28  ? -11.598 6.649   -8.125  1.00 3.29   ? 28  VAL A CG2  3  
ATOM 4806  H H    . VAL A 1 28  ? -15.711 8.071   -6.971  1.00 3.55   ? 28  VAL A H    3  
ATOM 4807  H HA   . VAL A 1 28  ? -14.218 5.708   -7.752  1.00 3.07   ? 28  VAL A HA   3  
ATOM 4808  H HB   . VAL A 1 28  ? -13.228 7.409   -9.267  1.00 3.40   ? 28  VAL A HB   3  
ATOM 4809  H HG11 . VAL A 1 28  ? -12.311 8.910   -6.781  1.00 3.49   ? 28  VAL A HG11 3  
ATOM 4810  H HG12 . VAL A 1 28  ? -11.972 9.323   -8.471  1.00 3.88   ? 28  VAL A HG12 3  
ATOM 4811  H HG13 . VAL A 1 28  ? -13.624 9.421   -7.858  1.00 3.85   ? 28  VAL A HG13 3  
ATOM 4812  H HG21 . VAL A 1 28  ? -11.249 6.597   -7.095  1.00 3.79   ? 28  VAL A HG21 3  
ATOM 4813  H HG22 . VAL A 1 28  ? -11.699 5.646   -8.531  1.00 3.33   ? 28  VAL A HG22 3  
ATOM 4814  H HG23 . VAL A 1 28  ? -10.844 7.168   -8.717  1.00 4.34   ? 28  VAL A HG23 3  
ATOM 4815  N N    . THR A 1 29  ? -13.125 5.809   -5.363  1.00 2.60   ? 29  THR A N    3  
ATOM 4816  C CA   . THR A 1 29  ? -12.790 5.762   -3.932  1.00 2.65   ? 29  THR A CA   3  
ATOM 4817  C C    . THR A 1 29  ? -11.351 5.313   -3.744  1.00 2.47   ? 29  THR A C    3  
ATOM 4818  O O    . THR A 1 29  ? -10.943 4.257   -4.219  1.00 2.62   ? 29  THR A O    3  
ATOM 4819  C CB   . THR A 1 29  ? -13.728 4.816   -3.182  1.00 2.96   ? 29  THR A CB   3  
ATOM 4820  O OG1  . THR A 1 29  ? -15.060 5.099   -3.543  1.00 3.48   ? 29  THR A OG1  3  
ATOM 4821  C CG2  . THR A 1 29  ? -13.620 4.946   -1.660  1.00 3.49   ? 29  THR A CG2  3  
ATOM 4822  H H    . THR A 1 29  ? -12.803 5.047   -5.953  1.00 2.78   ? 29  THR A H    3  
ATOM 4823  H HA   . THR A 1 29  ? -12.908 6.759   -3.514  1.00 3.14   ? 29  THR A HA   3  
ATOM 4824  H HB   . THR A 1 29  ? -13.467 3.798   -3.457  1.00 3.06   ? 29  THR A HB   3  
ATOM 4825  H HG1  . THR A 1 29  ? -15.218 6.031   -3.357  1.00 3.65   ? 29  THR A HG1  3  
ATOM 4826  H HG21 . THR A 1 29  ? -13.813 5.974   -1.350  1.00 3.99   ? 29  THR A HG21 3  
ATOM 4827  H HG22 . THR A 1 29  ? -14.350 4.286   -1.187  1.00 4.00   ? 29  THR A HG22 3  
ATOM 4828  H HG23 . THR A 1 29  ? -12.626 4.642   -1.330  1.00 3.85   ? 29  THR A HG23 3  
ATOM 4829  N N    . VAL A 1 30  ? -10.619 6.147   -3.020  1.00 2.84   ? 30  VAL A N    3  
ATOM 4830  C CA   . VAL A 1 30  ? -9.210  5.985   -2.628  1.00 3.06   ? 30  VAL A CA   3  
ATOM 4831  C C    . VAL A 1 30  ? -9.122  5.229   -1.296  1.00 2.37   ? 30  VAL A C    3  
ATOM 4832  O O    . VAL A 1 30  ? -10.000 5.368   -0.446  1.00 2.62   ? 30  VAL A O    3  
ATOM 4833  C CB   . VAL A 1 30  ? -8.495  7.361   -2.573  1.00 4.35   ? 30  VAL A CB   3  
ATOM 4834  C CG1  . VAL A 1 30  ? -9.079  8.317   -1.517  1.00 5.13   ? 30  VAL A CG1  3  
ATOM 4835  C CG2  . VAL A 1 30  ? -6.978  7.225   -2.383  1.00 5.45   ? 30  VAL A CG2  3  
ATOM 4836  H H    . VAL A 1 30  ? -11.133 6.902   -2.605  1.00 3.26   ? 30  VAL A H    3  
ATOM 4837  H HA   . VAL A 1 30  ? -8.716  5.393   -3.393  1.00 3.22   ? 30  VAL A HA   3  
ATOM 4838  H HB   . VAL A 1 30  ? -8.642  7.835   -3.548  1.00 4.93   ? 30  VAL A HB   3  
ATOM 4839  H HG11 . VAL A 1 30  ? -8.911  7.924   -0.514  1.00 5.26   ? 30  VAL A HG11 3  
ATOM 4840  H HG12 . VAL A 1 30  ? -8.592  9.290   -1.598  1.00 6.08   ? 30  VAL A HG12 3  
ATOM 4841  H HG13 . VAL A 1 30  ? -10.148 8.452   -1.677  1.00 5.41   ? 30  VAL A HG13 3  
ATOM 4842  H HG21 . VAL A 1 30  ? -6.506  8.200   -2.493  1.00 6.17   ? 30  VAL A HG21 3  
ATOM 4843  H HG22 . VAL A 1 30  ? -6.747  6.836   -1.393  1.00 5.67   ? 30  VAL A HG22 3  
ATOM 4844  H HG23 . VAL A 1 30  ? -6.575  6.551   -3.139  1.00 6.17   ? 30  VAL A HG23 3  
ATOM 4845  N N    . GLN A 1 31  ? -8.064  4.444   -1.091  1.00 2.05   ? 31  GLN A N    3  
ATOM 4846  C CA   . GLN A 1 31  ? -7.813  3.803   0.199   1.00 1.87   ? 31  GLN A CA   3  
ATOM 4847  C C    . GLN A 1 31  ? -7.463  4.792   1.327   1.00 2.12   ? 31  GLN A C    3  
ATOM 4848  O O    . GLN A 1 31  ? -6.852  5.830   1.098   1.00 3.50   ? 31  GLN A O    3  
ATOM 4849  C CB   . GLN A 1 31  ? -6.702  2.748   0.075   1.00 2.08   ? 31  GLN A CB   3  
ATOM 4850  C CG   . GLN A 1 31  ? -5.312  3.281   -0.342  1.00 2.32   ? 31  GLN A CG   3  
ATOM 4851  C CD   . GLN A 1 31  ? -5.123  3.410   -1.852  1.00 2.07   ? 31  GLN A CD   3  
ATOM 4852  O OE1  . GLN A 1 31  ? -5.001  4.491   -2.397  1.00 2.88   ? 31  GLN A OE1  3  
ATOM 4853  N NE2  . GLN A 1 31  ? -5.129  2.330   -2.597  1.00 1.84   ? 31  GLN A NE2  3  
ATOM 4854  H H    . GLN A 1 31  ? -7.396  4.314   -1.837  1.00 2.47   ? 31  GLN A H    3  
ATOM 4855  H HA   . GLN A 1 31  ? -8.734  3.292   0.492   1.00 2.07   ? 31  GLN A HA   3  
ATOM 4856  H HB2  . GLN A 1 31  ? -6.598  2.268   1.049   1.00 2.39   ? 31  GLN A HB2  3  
ATOM 4857  H HB3  . GLN A 1 31  ? -7.028  1.981   -0.622  1.00 2.37   ? 31  GLN A HB3  3  
ATOM 4858  H HG2  . GLN A 1 31  ? -5.107  4.242   0.126   1.00 3.20   ? 31  GLN A HG2  3  
ATOM 4859  H HG3  . GLN A 1 31  ? -4.557  2.592   0.022   1.00 2.79   ? 31  GLN A HG3  3  
ATOM 4860  H HE21 . GLN A 1 31  ? -5.478  1.454   -2.255  1.00 1.99   ? 31  GLN A HE21 3  
ATOM 4861  H HE22 . GLN A 1 31  ? -5.046  2.480   -3.590  1.00 2.19   ? 31  GLN A HE22 3  
ATOM 4862  N N    . GLY A 1 32  ? -7.723  4.375   2.573   1.00 1.50   ? 32  GLY A N    3  
ATOM 4863  C CA   . GLY A 1 32  ? -7.203  4.993   3.807   1.00 1.64   ? 32  GLY A CA   3  
ATOM 4864  C C    . GLY A 1 32  ? -5.883  4.367   4.281   1.00 1.53   ? 32  GLY A C    3  
ATOM 4865  O O    . GLY A 1 32  ? -5.622  4.342   5.479   1.00 2.22   ? 32  GLY A O    3  
ATOM 4866  H H    . GLY A 1 32  ? -8.253  3.521   2.685   1.00 1.94   ? 32  GLY A H    3  
ATOM 4867  H HA2  . GLY A 1 32  ? -7.022  6.056   3.644   1.00 1.91   ? 32  GLY A HA2  3  
ATOM 4868  H HA3  . GLY A 1 32  ? -7.927  4.858   4.610   1.00 1.86   ? 32  GLY A HA3  3  
ATOM 4869  N N    . ALA A 1 33  ? -5.106  3.824   3.328   1.00 1.09   ? 33  ALA A N    3  
ATOM 4870  C CA   . ALA A 1 33  ? -3.856  3.048   3.439   1.00 1.03   ? 33  ALA A CA   3  
ATOM 4871  C C    . ALA A 1 33  ? -3.559  2.410   4.817   1.00 0.99   ? 33  ALA A C    3  
ATOM 4872  O O    . ALA A 1 33  ? -2.791  2.947   5.613   1.00 1.43   ? 33  ALA A O    3  
ATOM 4873  C CB   . ALA A 1 33  ? -2.709  3.928   2.922   1.00 1.34   ? 33  ALA A CB   3  
ATOM 4874  H H    . ALA A 1 33  ? -5.417  4.016   2.389   1.00 1.32   ? 33  ALA A H    3  
ATOM 4875  H HA   . ALA A 1 33  ? -3.934  2.211   2.744   1.00 1.06   ? 33  ALA A HA   3  
ATOM 4876  H HB1  . ALA A 1 33  ? -1.790  3.342   2.883   1.00 2.24   ? 33  ALA A HB1  3  
ATOM 4877  H HB2  . ALA A 1 33  ? -2.933  4.292   1.919   1.00 2.01   ? 33  ALA A HB2  3  
ATOM 4878  H HB3  . ALA A 1 33  ? -2.558  4.777   3.589   1.00 1.50   ? 33  ALA A HB3  3  
ATOM 4879  N N    . THR A 1 34  ? -4.151  1.242   5.087   1.00 0.89   ? 34  THR A N    3  
ATOM 4880  C CA   . THR A 1 34  ? -4.189  0.643   6.427   1.00 0.84   ? 34  THR A CA   3  
ATOM 4881  C C    . THR A 1 34  ? -2.985  -0.253  6.710   1.00 0.79   ? 34  THR A C    3  
ATOM 4882  O O    . THR A 1 34  ? -2.740  -1.216  5.984   1.00 0.98   ? 34  THR A O    3  
ATOM 4883  C CB   . THR A 1 34  ? -5.478  -0.155  6.609   1.00 0.98   ? 34  THR A CB   3  
ATOM 4884  O OG1  . THR A 1 34  ? -6.554  0.529   5.996   1.00 1.45   ? 34  THR A OG1  3  
ATOM 4885  C CG2  . THR A 1 34  ? -5.823  -0.325  8.083   1.00 1.27   ? 34  THR A CG2  3  
ATOM 4886  H H    . THR A 1 34  ? -4.763  0.832   4.400   1.00 1.17   ? 34  THR A H    3  
ATOM 4887  H HA   . THR A 1 34  ? -4.202  1.457   7.151   1.00 0.83   ? 34  THR A HA   3  
ATOM 4888  H HB   . THR A 1 34  ? -5.361  -1.138  6.160   1.00 1.04   ? 34  THR A HB   3  
ATOM 4889  H HG1  . THR A 1 34  ? -7.377  0.158   6.328   1.00 2.22   ? 34  THR A HG1  3  
ATOM 4890  H HG21 . THR A 1 34  ? -5.883  0.653   8.570   1.00 2.22   ? 34  THR A HG21 3  
ATOM 4891  H HG22 . THR A 1 34  ? -6.785  -0.831  8.164   1.00 1.99   ? 34  THR A HG22 3  
ATOM 4892  H HG23 . THR A 1 34  ? -5.063  -0.929  8.574   1.00 2.14   ? 34  THR A HG23 3  
ATOM 4893  N N    . VAL A 1 35  ? -2.308  0.020   7.823   1.00 0.65   ? 35  VAL A N    3  
ATOM 4894  C CA   . VAL A 1 35  ? -1.223  -0.801  8.399   1.00 0.62   ? 35  VAL A CA   3  
ATOM 4895  C C    . VAL A 1 35  ? -1.824  -1.879  9.317   1.00 0.68   ? 35  VAL A C    3  
ATOM 4896  O O    . VAL A 1 35  ? -2.850  -1.643  9.953   1.00 0.76   ? 35  VAL A O    3  
ATOM 4897  C CB   . VAL A 1 35  ? -0.213  0.091   9.168   1.00 0.62   ? 35  VAL A CB   3  
ATOM 4898  C CG1  . VAL A 1 35  ? 0.924   -0.711  9.827   1.00 1.04   ? 35  VAL A CG1  3  
ATOM 4899  C CG2  . VAL A 1 35  ? 0.429   1.150   8.255   1.00 0.83   ? 35  VAL A CG2  3  
ATOM 4900  H H    . VAL A 1 35  ? -2.632  0.830   8.345   1.00 0.67   ? 35  VAL A H    3  
ATOM 4901  H HA   . VAL A 1 35  ? -0.686  -1.293  7.592   1.00 0.64   ? 35  VAL A HA   3  
ATOM 4902  H HB   . VAL A 1 35  ? -0.762  0.611   9.947   1.00 0.81   ? 35  VAL A HB   3  
ATOM 4903  H HG11 . VAL A 1 35  ? 0.533   -1.354  10.613  1.00 2.29   ? 35  VAL A HG11 3  
ATOM 4904  H HG12 . VAL A 1 35  ? 1.431   -1.322  9.078   1.00 1.69   ? 35  VAL A HG12 3  
ATOM 4905  H HG13 . VAL A 1 35  ? 1.642   -0.030  10.281  1.00 1.65   ? 35  VAL A HG13 3  
ATOM 4906  H HG21 . VAL A 1 35  ? 1.051   1.817   8.847   1.00 1.76   ? 35  VAL A HG21 3  
ATOM 4907  H HG22 . VAL A 1 35  ? 1.054   0.670   7.505   1.00 2.17   ? 35  VAL A HG22 3  
ATOM 4908  H HG23 . VAL A 1 35  ? -0.336  1.746   7.755   1.00 1.49   ? 35  VAL A HG23 3  
ATOM 4909  N N    . ALA A 1 36  ? -1.211  -3.063  9.424   1.00 0.76   ? 36  ALA A N    3  
ATOM 4910  C CA   . ALA A 1 36  ? -1.771  -4.199  10.173  1.00 1.11   ? 36  ALA A CA   3  
ATOM 4911  C C    . ALA A 1 36  ? -1.719  -4.093  11.710  1.00 1.68   ? 36  ALA A C    3  
ATOM 4912  O O    . ALA A 1 36  ? -2.547  -4.685  12.396  1.00 3.69   ? 36  ALA A O    3  
ATOM 4913  C CB   . ALA A 1 36  ? -1.036  -5.457  9.702   1.00 1.11   ? 36  ALA A CB   3  
ATOM 4914  H H    . ALA A 1 36  ? -0.416  -3.263  8.824   1.00 0.79   ? 36  ALA A H    3  
ATOM 4915  H HA   . ALA A 1 36  ? -2.824  -4.285  9.932   1.00 1.27   ? 36  ALA A HA   3  
ATOM 4916  H HB1  . ALA A 1 36  ? -1.167  -5.588  8.626   1.00 1.72   ? 36  ALA A HB1  3  
ATOM 4917  H HB2  . ALA A 1 36  ? 0.026   -5.368  9.924   1.00 1.55   ? 36  ALA A HB2  3  
ATOM 4918  H HB3  . ALA A 1 36  ? -1.424  -6.330  10.223  1.00 2.10   ? 36  ALA A HB3  3  
ATOM 4919  N N    . ALA A 1 37  ? -0.732  -3.343  12.202  1.00 0.92   ? 37  ALA A N    3  
ATOM 4920  C CA   . ALA A 1 37  ? -0.225  -3.173  13.589  1.00 0.98   ? 37  ALA A CA   3  
ATOM 4921  C C    . ALA A 1 37  ? 0.890   -4.182  13.921  1.00 1.24   ? 37  ALA A C    3  
ATOM 4922  O O    . ALA A 1 37  ? 0.893   -5.274  13.364  1.00 1.68   ? 37  ALA A O    3  
ATOM 4923  C CB   . ALA A 1 37  ? -1.334  -3.285  14.653  1.00 1.26   ? 37  ALA A CB   3  
ATOM 4924  H H    . ALA A 1 37  ? -0.182  -2.931  11.471  1.00 2.11   ? 37  ALA A H    3  
ATOM 4925  H HA   . ALA A 1 37  ? 0.210   -2.175  13.665  1.00 0.91   ? 37  ALA A HA   3  
ATOM 4926  H HB1  . ALA A 1 37  ? -2.211  -2.706  14.367  1.00 1.60   ? 37  ALA A HB1  3  
ATOM 4927  H HB2  . ALA A 1 37  ? -1.634  -4.330  14.770  1.00 2.44   ? 37  ALA A HB2  3  
ATOM 4928  H HB3  . ALA A 1 37  ? -0.968  -2.926  15.614  1.00 1.94   ? 37  ALA A HB3  3  
ATOM 4929  N N    . VAL A 1 38  ? 1.773   -3.844  14.876  1.00 1.15   ? 38  VAL A N    3  
ATOM 4930  C CA   . VAL A 1 38  ? 2.668   -4.788  15.594  1.00 1.13   ? 38  VAL A CA   3  
ATOM 4931  C C    . VAL A 1 38  ? 3.092   -4.232  16.972  1.00 1.19   ? 38  VAL A C    3  
ATOM 4932  O O    . VAL A 1 38  ? 3.254   -3.017  17.104  1.00 1.32   ? 38  VAL A O    3  
ATOM 4933  C CB   . VAL A 1 38  ? 3.966   -5.192  14.838  1.00 1.27   ? 38  VAL A CB   3  
ATOM 4934  C CG1  . VAL A 1 38  ? 3.744   -5.996  13.550  1.00 2.06   ? 38  VAL A CG1  3  
ATOM 4935  C CG2  . VAL A 1 38  ? 4.878   -3.992  14.554  1.00 2.27   ? 38  VAL A CG2  3  
ATOM 4936  H H    . VAL A 1 38  ? 1.700   -2.907  15.260  1.00 1.04   ? 38  VAL A H    3  
ATOM 4937  H HA   . VAL A 1 38  ? 2.080   -5.694  15.749  1.00 1.13   ? 38  VAL A HA   3  
ATOM 4938  H HB   . VAL A 1 38  ? 4.519   -5.854  15.505  1.00 2.27   ? 38  VAL A HB   3  
ATOM 4939  H HG11 . VAL A 1 38  ? 4.689   -6.433  13.227  1.00 3.00   ? 38  VAL A HG11 3  
ATOM 4940  H HG12 . VAL A 1 38  ? 3.044   -6.809  13.738  1.00 2.64   ? 38  VAL A HG12 3  
ATOM 4941  H HG13 . VAL A 1 38  ? 3.369   -5.354  12.756  1.00 2.69   ? 38  VAL A HG13 3  
ATOM 4942  H HG21 . VAL A 1 38  ? 5.274   -3.614  15.494  1.00 3.05   ? 38  VAL A HG21 3  
ATOM 4943  H HG22 . VAL A 1 38  ? 5.726   -4.298  13.948  1.00 3.21   ? 38  VAL A HG22 3  
ATOM 4944  H HG23 . VAL A 1 38  ? 4.329   -3.203  14.041  1.00 2.96   ? 38  VAL A HG23 3  
ATOM 4945  N N    . PRO A 1 39  ? 3.308   -5.096  17.989  1.00 1.21   ? 39  PRO A N    3  
ATOM 4946  C CA   . PRO A 1 39  ? 3.813   -4.702  19.306  1.00 1.37   ? 39  PRO A CA   3  
ATOM 4947  C C    . PRO A 1 39  ? 5.328   -4.373  19.309  1.00 1.41   ? 39  PRO A C    3  
ATOM 4948  O O    . PRO A 1 39  ? 6.044   -4.758  18.385  1.00 1.36   ? 39  PRO A O    3  
ATOM 4949  C CB   . PRO A 1 39  ? 3.451   -5.863  20.243  1.00 1.44   ? 39  PRO A CB   3  
ATOM 4950  C CG   . PRO A 1 39  ? 3.345   -7.082  19.335  1.00 1.35   ? 39  PRO A CG   3  
ATOM 4951  C CD   . PRO A 1 39  ? 2.915   -6.502  17.990  1.00 1.19   ? 39  PRO A CD   3  
ATOM 4952  H HA   . PRO A 1 39  ? 3.271   -3.816  19.636  1.00 1.54   ? 39  PRO A HA   3  
ATOM 4953  H HB2  . PRO A 1 39  ? 4.202   -6.028  21.017  1.00 1.55   ? 39  PRO A HB2  3  
ATOM 4954  H HB3  . PRO A 1 39  ? 2.477   -5.669  20.695  1.00 1.59   ? 39  PRO A HB3  3  
ATOM 4955  H HG2  . PRO A 1 39  ? 4.323   -7.552  19.249  1.00 1.42   ? 39  PRO A HG2  3  
ATOM 4956  H HG3  . PRO A 1 39  ? 2.616   -7.802  19.710  1.00 1.52   ? 39  PRO A HG3  3  
ATOM 4957  H HD2  . PRO A 1 39  ? 3.387   -7.051  17.175  1.00 1.17   ? 39  PRO A HD2  3  
ATOM 4958  H HD3  . PRO A 1 39  ? 1.829   -6.570  17.900  1.00 1.26   ? 39  PRO A HD3  3  
ATOM 4959  N N    . PRO A 1 40  ? 5.839   -3.653  20.334  1.00 1.61   ? 40  PRO A N    3  
ATOM 4960  C CA   . PRO A 1 40  ? 7.130   -2.949  20.300  1.00 1.73   ? 40  PRO A CA   3  
ATOM 4961  C C    . PRO A 1 40  ? 8.407   -3.785  20.122  1.00 1.88   ? 40  PRO A C    3  
ATOM 4962  O O    . PRO A 1 40  ? 9.442   -3.207  19.804  1.00 3.18   ? 40  PRO A O    3  
ATOM 4963  C CB   . PRO A 1 40  ? 7.198   -2.123  21.593  1.00 1.98   ? 40  PRO A CB   3  
ATOM 4964  C CG   . PRO A 1 40  ? 6.128   -2.721  22.501  1.00 2.03   ? 40  PRO A CG   3  
ATOM 4965  C CD   . PRO A 1 40  ? 5.090   -3.217  21.506  1.00 1.81   ? 40  PRO A CD   3  
ATOM 4966  H HA   . PRO A 1 40  ? 7.103   -2.252  19.467  1.00 1.68   ? 40  PRO A HA   3  
ATOM 4967  H HB2  . PRO A 1 40  ? 8.180   -2.193  22.062  1.00 2.11   ? 40  PRO A HB2  3  
ATOM 4968  H HB3  . PRO A 1 40  ? 6.953   -1.082  21.375  1.00 2.07   ? 40  PRO A HB3  3  
ATOM 4969  H HG2  . PRO A 1 40  ? 6.544   -3.568  23.049  1.00 2.10   ? 40  PRO A HG2  3  
ATOM 4970  H HG3  . PRO A 1 40  ? 5.714   -1.983  23.187  1.00 2.21   ? 40  PRO A HG3  3  
ATOM 4971  H HD2  . PRO A 1 40  ? 4.517   -4.026  21.949  1.00 1.84   ? 40  PRO A HD2  3  
ATOM 4972  H HD3  . PRO A 1 40  ? 4.427   -2.397  21.227  1.00 1.86   ? 40  PRO A HD3  3  
ATOM 4973  N N    . SER A 1 41  ? 8.382   -5.109  20.302  1.00 1.75   ? 41  SER A N    3  
ATOM 4974  C CA   . SER A 1 41  ? 9.567   -5.947  20.021  1.00 1.86   ? 41  SER A CA   3  
ATOM 4975  C C    . SER A 1 41  ? 9.806   -6.225  18.519  1.00 1.74   ? 41  SER A C    3  
ATOM 4976  O O    . SER A 1 41  ? 10.867  -6.750  18.174  1.00 1.93   ? 41  SER A O    3  
ATOM 4977  C CB   . SER A 1 41  ? 9.495   -7.283  20.778  1.00 2.18   ? 41  SER A CB   3  
ATOM 4978  O OG   . SER A 1 41  ? 10.738  -7.971  20.702  1.00 2.56   ? 41  SER A OG   3  
ATOM 4979  H H    . SER A 1 41  ? 7.509   -5.538  20.570  1.00 2.59   ? 41  SER A H    3  
ATOM 4980  H HA   . SER A 1 41  ? 10.453  -5.421  20.380  1.00 1.98   ? 41  SER A HA   3  
ATOM 4981  H HB2  . SER A 1 41  ? 9.259   -7.093  21.825  1.00 2.44   ? 41  SER A HB2  3  
ATOM 4982  H HB3  . SER A 1 41  ? 8.707   -7.902  20.346  1.00 2.11   ? 41  SER A HB3  3  
ATOM 4983  H HG   . SER A 1 41  ? 11.121  -7.794  19.819  1.00 3.14   ? 41  SER A HG   3  
ATOM 4984  N N    . ILE A 1 42  ? 8.846   -5.923  17.634  1.00 1.54   ? 42  ILE A N    3  
ATOM 4985  C CA   . ILE A 1 42  ? 8.945   -6.155  16.191  1.00 1.48   ? 42  ILE A CA   3  
ATOM 4986  C C    . ILE A 1 42  ? 9.120   -4.814  15.468  1.00 1.35   ? 42  ILE A C    3  
ATOM 4987  O O    . ILE A 1 42  ? 8.225   -3.972  15.429  1.00 1.58   ? 42  ILE A O    3  
ATOM 4988  C CB   . ILE A 1 42  ? 7.729   -6.940  15.648  1.00 1.60   ? 42  ILE A CB   3  
ATOM 4989  C CG1  . ILE A 1 42  ? 7.380   -8.212  16.457  1.00 1.98   ? 42  ILE A CG1  3  
ATOM 4990  C CG2  . ILE A 1 42  ? 8.035   -7.393  14.205  1.00 1.77   ? 42  ILE A CG2  3  
ATOM 4991  C CD1  . ILE A 1 42  ? 6.520   -7.984  17.702  1.00 2.72   ? 42  ILE A CD1  3  
ATOM 4992  H H    . ILE A 1 42  ? 7.983   -5.509  17.967  1.00 1.49   ? 42  ILE A H    3  
ATOM 4993  H HA   . ILE A 1 42  ? 9.827   -6.764  15.997  1.00 1.54   ? 42  ILE A HA   3  
ATOM 4994  H HB   . ILE A 1 42  ? 6.857   -6.284  15.622  1.00 1.63   ? 42  ILE A HB   3  
ATOM 4995  H HG12 . ILE A 1 42  ? 6.792   -8.860  15.818  1.00 3.06   ? 42  ILE A HG12 3  
ATOM 4996  H HG13 . ILE A 1 42  ? 8.291   -8.745  16.729  1.00 3.09   ? 42  ILE A HG13 3  
ATOM 4997  H HG21 . ILE A 1 42  ? 8.857   -8.111  14.199  1.00 2.75   ? 42  ILE A HG21 3  
ATOM 4998  H HG22 . ILE A 1 42  ? 7.151   -7.858  13.765  1.00 1.96   ? 42  ILE A HG22 3  
ATOM 4999  H HG23 . ILE A 1 42  ? 8.307   -6.544  13.586  1.00 2.34   ? 42  ILE A HG23 3  
ATOM 5000  H HD11 . ILE A 1 42  ? 5.681   -7.343  17.437  1.00 3.92   ? 42  ILE A HD11 3  
ATOM 5001  H HD12 . ILE A 1 42  ? 6.139   -8.943  18.052  1.00 3.28   ? 42  ILE A HD12 3  
ATOM 5002  H HD13 . ILE A 1 42  ? 7.090   -7.532  18.507  1.00 3.30   ? 42  ILE A HD13 3  
ATOM 5003  N N    . ARG A 1 43  ? 10.299  -4.636  14.875  1.00 1.37   ? 43  ARG A N    3  
ATOM 5004  C CA   . ARG A 1 43  ? 10.688  -3.479  14.066  1.00 1.37   ? 43  ARG A CA   3  
ATOM 5005  C C    . ARG A 1 43  ? 10.312  -3.648  12.579  1.00 1.25   ? 43  ARG A C    3  
ATOM 5006  O O    . ARG A 1 43  ? 10.984  -3.079  11.725  1.00 1.32   ? 43  ARG A O    3  
ATOM 5007  C CB   . ARG A 1 43  ? 12.185  -3.202  14.299  1.00 1.61   ? 43  ARG A CB   3  
ATOM 5008  C CG   . ARG A 1 43  ? 13.121  -4.361  13.919  1.00 2.19   ? 43  ARG A CG   3  
ATOM 5009  C CD   . ARG A 1 43  ? 14.573  -3.968  14.199  1.00 2.70   ? 43  ARG A CD   3  
ATOM 5010  N NE   . ARG A 1 43  ? 15.470  -5.104  13.950  1.00 3.47   ? 43  ARG A NE   3  
ATOM 5011  C CZ   . ARG A 1 43  ? 16.754  -5.179  14.272  1.00 4.06   ? 43  ARG A CZ   3  
ATOM 5012  N NH1  . ARG A 1 43  ? 17.388  -4.229  14.927  1.00 4.12   ? 43  ARG A NH1  3  
ATOM 5013  N NH2  . ARG A 1 43  ? 17.404  -6.271  13.946  1.00 4.98   ? 43  ARG A NH2  3  
ATOM 5014  H H    . ARG A 1 43  ? 10.978  -5.377  14.964  1.00 1.61   ? 43  ARG A H    3  
ATOM 5015  H HA   . ARG A 1 43  ? 10.149  -2.593  14.414  1.00 1.40   ? 43  ARG A HA   3  
ATOM 5016  H HB2  . ARG A 1 43  ? 12.465  -2.324  13.724  1.00 2.06   ? 43  ARG A HB2  3  
ATOM 5017  H HB3  . ARG A 1 43  ? 12.327  -2.967  15.355  1.00 2.07   ? 43  ARG A HB3  3  
ATOM 5018  H HG2  . ARG A 1 43  ? 12.874  -5.244  14.510  1.00 2.74   ? 43  ARG A HG2  3  
ATOM 5019  H HG3  . ARG A 1 43  ? 13.007  -4.598  12.862  1.00 2.74   ? 43  ARG A HG3  3  
ATOM 5020  H HD2  . ARG A 1 43  ? 14.844  -3.125  13.560  1.00 3.01   ? 43  ARG A HD2  3  
ATOM 5021  H HD3  . ARG A 1 43  ? 14.661  -3.665  15.243  1.00 2.84   ? 43  ARG A HD3  3  
ATOM 5022  H HE   . ARG A 1 43  ? 15.086  -5.891  13.441  1.00 3.92   ? 43  ARG A HE   3  
ATOM 5023  H HH11 . ARG A 1 43  ? 16.901  -3.430  15.308  1.00 3.78   ? 43  ARG A HH11 3  
ATOM 5024  H HH12 . ARG A 1 43  ? 18.373  -4.312  15.123  1.00 4.81   ? 43  ARG A HH12 3  
ATOM 5025  H HH21 . ARG A 1 43  ? 16.928  -6.978  13.387  1.00 5.34   ? 43  ARG A HH21 3  
ATOM 5026  H HH22 . ARG A 1 43  ? 18.359  -6.412  14.228  1.00 5.50   ? 43  ARG A HH22 3  
ATOM 5027  N N    . ASP A 1 44  ? 9.260   -4.397  12.264  1.00 1.20   ? 44  ASP A N    3  
ATOM 5028  C CA   . ASP A 1 44  ? 8.756   -4.612  10.910  1.00 1.25   ? 44  ASP A CA   3  
ATOM 5029  C C    . ASP A 1 44  ? 7.226   -4.687  11.012  1.00 1.15   ? 44  ASP A C    3  
ATOM 5030  O O    . ASP A 1 44  ? 6.698   -5.392  11.874  1.00 1.16   ? 44  ASP A O    3  
ATOM 5031  C CB   . ASP A 1 44  ? 9.281   -5.931  10.303  1.00 1.41   ? 44  ASP A CB   3  
ATOM 5032  C CG   . ASP A 1 44  ? 10.806  -6.111  10.225  1.00 1.54   ? 44  ASP A CG   3  
ATOM 5033  O OD1  . ASP A 1 44  ? 11.494  -5.203  9.655   1.00 2.60   ? 44  ASP A OD1  3  
ATOM 5034  O OD2  . ASP A 1 44  ? 11.257  -7.193  10.634  1.00 1.78   ? 44  ASP A OD2  3  
ATOM 5035  H H    . ASP A 1 44  ? 8.685   -4.748  13.015  1.00 1.26   ? 44  ASP A H    3  
ATOM 5036  H HA   . ASP A 1 44  ? 9.041   -3.779  10.263  1.00 1.35   ? 44  ASP A HA   3  
ATOM 5037  H HB2  . ASP A 1 44  ? 8.876   -6.756  10.898  1.00 1.44   ? 44  ASP A HB2  3  
ATOM 5038  H HB3  . ASP A 1 44  ? 8.867   -6.025  9.295   1.00 1.58   ? 44  ASP A HB3  3  
ATOM 5039  N N    . THR A 1 45  ? 6.506   -4.009  10.121  1.00 1.15   ? 45  THR A N    3  
ATOM 5040  C CA   . THR A 1 45  ? 5.045   -4.124  9.991   1.00 1.04   ? 45  THR A CA   3  
ATOM 5041  C C    . THR A 1 45  ? 4.683   -4.074  8.519   1.00 0.98   ? 45  THR A C    3  
ATOM 5042  O O    . THR A 1 45  ? 5.540   -3.780  7.689   1.00 1.13   ? 45  THR A O    3  
ATOM 5043  C CB   . THR A 1 45  ? 4.315   -3.080  10.847  1.00 1.13   ? 45  THR A CB   3  
ATOM 5044  O OG1  . THR A 1 45  ? 2.945   -3.423  10.910  1.00 2.23   ? 45  THR A OG1  3  
ATOM 5045  C CG2  . THR A 1 45  ? 4.429   -1.650  10.317  1.00 1.71   ? 45  THR A CG2  3  
ATOM 5046  H H    . THR A 1 45  ? 7.004   -3.490  9.410   1.00 1.20   ? 45  THR A H    3  
ATOM 5047  H HA   . THR A 1 45  ? 4.749   -5.108  10.355  1.00 1.11   ? 45  THR A HA   3  
ATOM 5048  H HB   . THR A 1 45  ? 4.732   -3.104  11.853  1.00 1.93   ? 45  THR A HB   3  
ATOM 5049  H HG1  . THR A 1 45  ? 2.856   -4.199  11.477  1.00 2.95   ? 45  THR A HG1  3  
ATOM 5050  H HG21 . THR A 1 45  ? 5.479   -1.365  10.244  1.00 2.36   ? 45  THR A HG21 3  
ATOM 5051  H HG22 . THR A 1 45  ? 3.961   -1.575  9.334   1.00 2.59   ? 45  THR A HG22 3  
ATOM 5052  H HG23 . THR A 1 45  ? 3.927   -0.970  11.001  1.00 2.31   ? 45  THR A HG23 3  
ATOM 5053  N N    . ALA A 1 46  ? 3.436   -4.369  8.171   1.00 0.93   ? 46  ALA A N    3  
ATOM 5054  C CA   . ALA A 1 46  ? 2.964   -4.460  6.794   1.00 0.93   ? 46  ALA A CA   3  
ATOM 5055  C C    . ALA A 1 46  ? 1.595   -3.795  6.620   1.00 0.74   ? 46  ALA A C    3  
ATOM 5056  O O    . ALA A 1 46  ? 0.757   -3.835  7.520   1.00 0.85   ? 46  ALA A O    3  
ATOM 5057  C CB   . ALA A 1 46  ? 2.931   -5.938  6.385   1.00 1.22   ? 46  ALA A CB   3  
ATOM 5058  H H    . ALA A 1 46  ? 2.763   -4.500  8.912   1.00 0.99   ? 46  ALA A H    3  
ATOM 5059  H HA   . ALA A 1 46  ? 3.664   -3.933  6.146   1.00 1.10   ? 46  ALA A HA   3  
ATOM 5060  H HB1  . ALA A 1 46  ? 2.169   -6.466  6.959   1.00 1.92   ? 46  ALA A HB1  3  
ATOM 5061  H HB2  . ALA A 1 46  ? 2.710   -6.024  5.319   1.00 1.81   ? 46  ALA A HB2  3  
ATOM 5062  H HB3  . ALA A 1 46  ? 3.898   -6.402  6.581   1.00 2.43   ? 46  ALA A HB3  3  
ATOM 5063  N N    . ALA A 1 47  ? 1.374   -3.198  5.450   1.00 0.81   ? 47  ALA A N    3  
ATOM 5064  C CA   . ALA A 1 47  ? 0.134   -2.526  5.080   1.00 0.75   ? 47  ALA A CA   3  
ATOM 5065  C C    . ALA A 1 47  ? -0.538  -3.195  3.875   1.00 0.84   ? 47  ALA A C    3  
ATOM 5066  O O    . ALA A 1 47  ? 0.107   -3.842  3.042   1.00 1.06   ? 47  ALA A O    3  
ATOM 5067  C CB   . ALA A 1 47  ? 0.432   -1.040  4.840   1.00 0.85   ? 47  ALA A CB   3  
ATOM 5068  H H    . ALA A 1 47  ? 2.106   -3.248  4.751   1.00 1.02   ? 47  ALA A H    3  
ATOM 5069  H HA   . ALA A 1 47  ? -0.575  -2.595  5.907   1.00 0.78   ? 47  ALA A HA   3  
ATOM 5070  H HB1  . ALA A 1 47  ? 1.100   -0.903  3.995   1.00 1.39   ? 47  ALA A HB1  3  
ATOM 5071  H HB2  . ALA A 1 47  ? -0.498  -0.501  4.653   1.00 1.95   ? 47  ALA A HB2  3  
ATOM 5072  H HB3  . ALA A 1 47  ? 0.901   -0.619  5.726   1.00 1.69   ? 47  ALA A HB3  3  
ATOM 5073  N N    . TYR A 1 48  ? -1.854  -3.019  3.800   1.00 0.86   ? 48  TYR A N    3  
ATOM 5074  C CA   . TYR A 1 48  ? -2.759  -3.563  2.789   1.00 0.97   ? 48  TYR A CA   3  
ATOM 5075  C C    . TYR A 1 48  ? -3.883  -2.564  2.465   1.00 0.99   ? 48  TYR A C    3  
ATOM 5076  O O    . TYR A 1 48  ? -4.208  -1.694  3.274   1.00 1.18   ? 48  TYR A O    3  
ATOM 5077  C CB   . TYR A 1 48  ? -3.312  -4.920  3.262   1.00 1.61   ? 48  TYR A CB   3  
ATOM 5078  C CG   . TYR A 1 48  ? -3.673  -5.054  4.740   1.00 1.25   ? 48  TYR A CG   3  
ATOM 5079  C CD1  . TYR A 1 48  ? -4.633  -4.217  5.351   1.00 2.65   ? 48  TYR A CD1  3  
ATOM 5080  C CD2  . TYR A 1 48  ? -3.056  -6.058  5.511   1.00 2.09   ? 48  TYR A CD2  3  
ATOM 5081  C CE1  . TYR A 1 48  ? -4.949  -4.361  6.719   1.00 3.77   ? 48  TYR A CE1  3  
ATOM 5082  C CE2  . TYR A 1 48  ? -3.386  -6.224  6.868   1.00 2.63   ? 48  TYR A CE2  3  
ATOM 5083  C CZ   . TYR A 1 48  ? -4.337  -5.381  7.482   1.00 3.36   ? 48  TYR A CZ   3  
ATOM 5084  O OH   . TYR A 1 48  ? -4.654  -5.564  8.796   1.00 4.59   ? 48  TYR A OH   3  
ATOM 5085  H H    . TYR A 1 48  ? -2.287  -2.457  4.533   1.00 0.88   ? 48  TYR A H    3  
ATOM 5086  H HA   . TYR A 1 48  ? -2.199  -3.718  1.869   1.00 0.99   ? 48  TYR A HA   3  
ATOM 5087  H HB2  . TYR A 1 48  ? -4.191  -5.172  2.670   1.00 2.64   ? 48  TYR A HB2  3  
ATOM 5088  H HB3  . TYR A 1 48  ? -2.554  -5.669  3.031   1.00 2.78   ? 48  TYR A HB3  3  
ATOM 5089  H HD1  . TYR A 1 48  ? -5.134  -3.449  4.781   1.00 3.50   ? 48  TYR A HD1  3  
ATOM 5090  H HD2  . TYR A 1 48  ? -2.322  -6.709  5.059   1.00 3.25   ? 48  TYR A HD2  3  
ATOM 5091  H HE1  . TYR A 1 48  ? -5.677  -3.708  7.180   1.00 5.28   ? 48  TYR A HE1  3  
ATOM 5092  H HE2  . TYR A 1 48  ? -2.903  -7.000  7.440   1.00 3.46   ? 48  TYR A HE2  3  
ATOM 5093  H HH   . TYR A 1 48  ? -5.220  -4.870  9.148   1.00 5.36   ? 48  TYR A HH   3  
ATOM 5094  N N    . MET A 1 49  ? -4.477  -2.654  1.274   1.00 1.00   ? 49  MET A N    3  
ATOM 5095  C CA   . MET A 1 49  ? -5.383  -1.632  0.738   1.00 1.23   ? 49  MET A CA   3  
ATOM 5096  C C    . MET A 1 49  ? -5.999  -2.004  -0.612  1.00 1.06   ? 49  MET A C    3  
ATOM 5097  O O    . MET A 1 49  ? -5.464  -2.817  -1.364  1.00 1.07   ? 49  MET A O    3  
ATOM 5098  C CB   . MET A 1 49  ? -4.685  -0.259  0.658   1.00 1.56   ? 49  MET A CB   3  
ATOM 5099  C CG   . MET A 1 49  ? -3.364  -0.257  -0.123  1.00 2.35   ? 49  MET A CG   3  
ATOM 5100  S SD   . MET A 1 49  ? -2.196  1.031   0.384   1.00 3.33   ? 49  MET A SD   3  
ATOM 5101  C CE   . MET A 1 49  ? -1.490  0.226   1.847   1.00 4.57   ? 49  MET A CE   3  
ATOM 5102  H H    . MET A 1 49  ? -4.168  -3.382  0.635   1.00 0.93   ? 49  MET A H    3  
ATOM 5103  H HA   . MET A 1 49  ? -6.212  -1.540  1.442   1.00 1.61   ? 49  MET A HA   3  
ATOM 5104  H HB2  . MET A 1 49  ? -5.361  0.441   0.181   1.00 2.47   ? 49  MET A HB2  3  
ATOM 5105  H HB3  . MET A 1 49  ? -4.503  0.115   1.664   1.00 2.63   ? 49  MET A HB3  3  
ATOM 5106  H HG2  . MET A 1 49  ? -2.861  -1.218  -0.015  1.00 3.38   ? 49  MET A HG2  3  
ATOM 5107  H HG3  . MET A 1 49  ? -3.587  -0.133  -1.184  1.00 3.17   ? 49  MET A HG3  3  
ATOM 5108  H HE1  . MET A 1 49  ? -0.994  -0.703  1.558   1.00 5.39   ? 49  MET A HE1  3  
ATOM 5109  H HE2  . MET A 1 49  ? -0.754  0.886   2.303   1.00 5.25   ? 49  MET A HE2  3  
ATOM 5110  H HE3  . MET A 1 49  ? -2.269  0.004   2.578   1.00 4.79   ? 49  MET A HE3  3  
ATOM 5111  N N    . THR A 1 50  ? -7.124  -1.358  -0.925  1.00 1.12   ? 50  THR A N    3  
ATOM 5112  C CA   . THR A 1 50  ? -7.962  -1.604  -2.110  1.00 1.07   ? 50  THR A CA   3  
ATOM 5113  C C    . THR A 1 50  ? -8.060  -0.339  -2.961  1.00 1.27   ? 50  THR A C    3  
ATOM 5114  O O    . THR A 1 50  ? -7.365  0.638   -2.692  1.00 2.16   ? 50  THR A O    3  
ATOM 5115  C CB   . THR A 1 50  ? -9.367  -2.073  -1.676  1.00 1.34   ? 50  THR A CB   3  
ATOM 5116  O OG1  . THR A 1 50  ? -9.364  -2.554  -0.352  1.00 2.18   ? 50  THR A OG1  3  
ATOM 5117  C CG2  . THR A 1 50  ? -9.876  -3.213  -2.562  1.00 1.65   ? 50  THR A CG2  3  
ATOM 5118  H H    . THR A 1 50  ? -7.513  -0.736  -0.231  1.00 1.33   ? 50  THR A H    3  
ATOM 5119  H HA   . THR A 1 50  ? -7.506  -2.375  -2.735  1.00 1.13   ? 50  THR A HA   3  
ATOM 5120  H HB   . THR A 1 50  ? -10.051 -1.221  -1.722  1.00 2.20   ? 50  THR A HB   3  
ATOM 5121  H HG1  . THR A 1 50  ? -10.014 -3.260  -0.291  1.00 2.65   ? 50  THR A HG1  3  
ATOM 5122  H HG21 . THR A 1 50  ? -9.208  -4.074  -2.482  1.00 2.40   ? 50  THR A HG21 3  
ATOM 5123  H HG22 . THR A 1 50  ? -10.878 -3.509  -2.250  1.00 2.23   ? 50  THR A HG22 3  
ATOM 5124  H HG23 . THR A 1 50  ? -9.920  -2.899  -3.603  1.00 2.68   ? 50  THR A HG23 3  
ATOM 5125  N N    . LEU A 1 51  ? -8.969  -0.325  -3.937  1.00 1.31   ? 51  LEU A N    3  
ATOM 5126  C CA   . LEU A 1 51  ? -9.400  0.839   -4.723  1.00 1.37   ? 51  LEU A CA   3  
ATOM 5127  C C    . LEU A 1 51  ? -10.826 0.558   -5.238  1.00 1.33   ? 51  LEU A C    3  
ATOM 5128  O O    . LEU A 1 51  ? -11.254 -0.594  -5.237  1.00 2.00   ? 51  LEU A O    3  
ATOM 5129  C CB   . LEU A 1 51  ? -8.360  1.058   -5.859  1.00 1.82   ? 51  LEU A CB   3  
ATOM 5130  C CG   . LEU A 1 51  ? -8.055  2.485   -6.369  1.00 2.59   ? 51  LEU A CG   3  
ATOM 5131  C CD1  . LEU A 1 51  ? -9.181  3.139   -7.180  1.00 3.55   ? 51  LEU A CD1  3  
ATOM 5132  C CD2  . LEU A 1 51  ? -7.607  3.417   -5.237  1.00 3.31   ? 51  LEU A CD2  3  
ATOM 5133  H H    . LEU A 1 51  ? -9.460  -1.188  -4.132  1.00 1.84   ? 51  LEU A H    3  
ATOM 5134  H HA   . LEU A 1 51  ? -9.436  1.707   -4.063  1.00 1.49   ? 51  LEU A HA   3  
ATOM 5135  H HB2  . LEU A 1 51  ? -7.401  0.673   -5.508  1.00 2.07   ? 51  LEU A HB2  3  
ATOM 5136  H HB3  . LEU A 1 51  ? -8.633  0.435   -6.709  1.00 2.02   ? 51  LEU A HB3  3  
ATOM 5137  H HG   . LEU A 1 51  ? -7.208  2.388   -7.048  1.00 3.40   ? 51  LEU A HG   3  
ATOM 5138  H HD11 . LEU A 1 51  ? -9.599  2.427   -7.890  1.00 4.47   ? 51  LEU A HD11 3  
ATOM 5139  H HD12 . LEU A 1 51  ? -9.961  3.509   -6.520  1.00 3.98   ? 51  LEU A HD12 3  
ATOM 5140  H HD13 . LEU A 1 51  ? -8.781  3.990   -7.734  1.00 4.12   ? 51  LEU A HD13 3  
ATOM 5141  H HD21 . LEU A 1 51  ? -6.767  2.974   -4.707  1.00 4.05   ? 51  LEU A HD21 3  
ATOM 5142  H HD22 . LEU A 1 51  ? -7.303  4.380   -5.645  1.00 4.04   ? 51  LEU A HD22 3  
ATOM 5143  H HD23 . LEU A 1 51  ? -8.421  3.572   -4.533  1.00 3.75   ? 51  LEU A HD23 3  
ATOM 5144  N N    . THR A 1 52  ? -11.538 1.577   -5.724  1.00 1.43   ? 52  THR A N    3  
ATOM 5145  C CA   . THR A 1 52  ? -12.750 1.439   -6.557  1.00 1.69   ? 52  THR A CA   3  
ATOM 5146  C C    . THR A 1 52  ? -12.794 2.595   -7.539  1.00 1.81   ? 52  THR A C    3  
ATOM 5147  O O    . THR A 1 52  ? -12.594 3.731   -7.149  1.00 2.19   ? 52  THR A O    3  
ATOM 5148  C CB   . THR A 1 52  ? -14.008 1.336   -5.665  1.00 2.26   ? 52  THR A CB   3  
ATOM 5149  O OG1  . THR A 1 52  ? -14.380 -0.018  -5.606  1.00 2.25   ? 52  THR A OG1  3  
ATOM 5150  C CG2  . THR A 1 52  ? -15.244 2.085   -6.166  1.00 3.08   ? 52  THR A CG2  3  
ATOM 5151  H H    . THR A 1 52  ? -11.169 2.514   -5.597  1.00 1.89   ? 52  THR A H    3  
ATOM 5152  H HA   . THR A 1 52  ? -12.678 0.512   -7.127  1.00 1.75   ? 52  THR A HA   3  
ATOM 5153  H HB   . THR A 1 52  ? -13.779 1.694   -4.657  1.00 2.74   ? 52  THR A HB   3  
ATOM 5154  H HG1  . THR A 1 52  ? -15.091 -0.096  -4.960  1.00 2.47   ? 52  THR A HG1  3  
ATOM 5155  H HG21 . THR A 1 52  ? -16.097 1.845   -5.537  1.00 3.43   ? 52  THR A HG21 3  
ATOM 5156  H HG22 . THR A 1 52  ? -15.073 3.163   -6.113  1.00 3.62   ? 52  THR A HG22 3  
ATOM 5157  H HG23 . THR A 1 52  ? -15.471 1.796   -7.194  1.00 3.74   ? 52  THR A HG23 3  
ATOM 5158  N N    . ASN A 1 53  ? -13.058 2.331   -8.815  1.00 1.81   ? 53  ASN A N    3  
ATOM 5159  C CA   . ASN A 1 53  ? -13.219 3.336   -9.875  1.00 2.10   ? 53  ASN A CA   3  
ATOM 5160  C C    . ASN A 1 53  ? -14.583 3.133   -10.553 1.00 2.53   ? 53  ASN A C    3  
ATOM 5161  O O    . ASN A 1 53  ? -14.751 2.236   -11.374 1.00 3.17   ? 53  ASN A O    3  
ATOM 5162  C CB   . ASN A 1 53  ? -12.054 3.245   -10.883 1.00 2.22   ? 53  ASN A CB   3  
ATOM 5163  C CG   . ASN A 1 53  ? -11.809 1.865   -11.480 1.00 2.02   ? 53  ASN A CG   3  
ATOM 5164  O OD1  . ASN A 1 53  ? -11.306 0.953   -10.836 1.00 3.18   ? 53  ASN A OD1  3  
ATOM 5165  N ND2  . ASN A 1 53  ? -12.141 1.684   -12.739 1.00 2.23   ? 53  ASN A ND2  3  
ATOM 5166  H H    . ASN A 1 53  ? -13.161 1.359   -9.092  1.00 1.82   ? 53  ASN A H    3  
ATOM 5167  H HA   . ASN A 1 53  ? -13.217 4.331   -9.444  1.00 2.13   ? 53  ASN A HA   3  
ATOM 5168  H HB2  . ASN A 1 53  ? -12.244 3.955   -11.687 1.00 3.05   ? 53  ASN A HB2  3  
ATOM 5169  H HB3  . ASN A 1 53  ? -11.124 3.559   -10.414 1.00 3.11   ? 53  ASN A HB3  3  
ATOM 5170  H HD21 . ASN A 1 53  ? -12.612 2.411   -13.273 1.00 2.52   ? 53  ASN A HD21 3  
ATOM 5171  H HD22 . ASN A 1 53  ? -12.087 0.757   -13.120 1.00 3.06   ? 53  ASN A HD22 3  
ATOM 5172  N N    . LYS A 1 54  ? -15.590 3.943   -10.220 1.00 2.31   ? 54  LYS A N    3  
ATOM 5173  C CA   . LYS A 1 54  ? -16.981 3.726   -10.670 1.00 2.53   ? 54  LYS A CA   3  
ATOM 5174  C C    . LYS A 1 54  ? -17.257 4.336   -12.067 1.00 2.59   ? 54  LYS A C    3  
ATOM 5175  O O    . LYS A 1 54  ? -18.314 4.901   -12.335 1.00 2.97   ? 54  LYS A O    3  
ATOM 5176  C CB   . LYS A 1 54  ? -17.955 4.127   -9.541  1.00 3.02   ? 54  LYS A CB   3  
ATOM 5177  C CG   . LYS A 1 54  ? -19.295 3.369   -9.619  1.00 3.42   ? 54  LYS A CG   3  
ATOM 5178  C CD   . LYS A 1 54  ? -20.197 3.658   -8.408  1.00 4.00   ? 54  LYS A CD   3  
ATOM 5179  C CE   . LYS A 1 54  ? -21.466 2.790   -8.470  1.00 4.68   ? 54  LYS A CE   3  
ATOM 5180  N NZ   . LYS A 1 54  ? -22.400 3.053   -7.347  1.00 5.11   ? 54  LYS A NZ   3  
ATOM 5181  H H    . LYS A 1 54  ? -15.413 4.743   -9.623  1.00 2.12   ? 54  LYS A H    3  
ATOM 5182  H HA   . LYS A 1 54  ? -17.099 2.652   -10.817 1.00 2.45   ? 54  LYS A HA   3  
ATOM 5183  H HB2  . LYS A 1 54  ? -17.494 3.886   -8.584  1.00 3.00   ? 54  LYS A HB2  3  
ATOM 5184  H HB3  . LYS A 1 54  ? -18.132 5.197   -9.571  1.00 3.51   ? 54  LYS A HB3  3  
ATOM 5185  H HG2  . LYS A 1 54  ? -19.825 3.651   -10.530 1.00 3.79   ? 54  LYS A HG2  3  
ATOM 5186  H HG3  . LYS A 1 54  ? -19.093 2.299   -9.651  1.00 3.46   ? 54  LYS A HG3  3  
ATOM 5187  H HD2  . LYS A 1 54  ? -19.656 3.429   -7.490  1.00 3.92   ? 54  LYS A HD2  3  
ATOM 5188  H HD3  . LYS A 1 54  ? -20.478 4.713   -8.406  1.00 4.53   ? 54  LYS A HD3  3  
ATOM 5189  H HE2  . LYS A 1 54  ? -21.988 2.996   -9.410  1.00 5.33   ? 54  LYS A HE2  3  
ATOM 5190  H HE3  . LYS A 1 54  ? -21.183 1.732   -8.464  1.00 4.75   ? 54  LYS A HE3  3  
ATOM 5191  H HZ1  . LYS A 1 54  ? -23.259 2.523   -7.491  1.00 5.49   ? 54  LYS A HZ1  3  
ATOM 5192  H HZ2  . LYS A 1 54  ? -22.010 2.803   -6.444  1.00 5.03   ? 54  LYS A HZ2  3  
ATOM 5193  H HZ3  . LYS A 1 54  ? -22.689 4.027   -7.330  1.00 5.74   ? 54  LYS A HZ3  3  
ATOM 5194  N N    . SER A 1 55  ? -16.298 4.180   -12.987 1.00 2.45   ? 55  SER A N    3  
ATOM 5195  C CA   . SER A 1 55  ? -16.355 4.494   -14.426 1.00 2.69   ? 55  SER A CA   3  
ATOM 5196  C C    . SER A 1 55  ? -15.085 3.988   -15.146 1.00 2.60   ? 55  SER A C    3  
ATOM 5197  O O    . SER A 1 55  ? -14.116 3.605   -14.481 1.00 2.80   ? 55  SER A O    3  
ATOM 5198  C CB   . SER A 1 55  ? -16.539 6.002   -14.706 1.00 3.31   ? 55  SER A CB   3  
ATOM 5199  O OG   . SER A 1 55  ? -15.395 6.766   -14.367 1.00 4.82   ? 55  SER A OG   3  
ATOM 5200  H H    . SER A 1 55  ? -15.465 3.670   -12.711 1.00 2.33   ? 55  SER A H    3  
ATOM 5201  H HA   . SER A 1 55  ? -17.212 3.974   -14.860 1.00 2.72   ? 55  SER A HA   3  
ATOM 5202  H HB2  . SER A 1 55  ? -16.734 6.131   -15.772 1.00 4.62   ? 55  SER A HB2  3  
ATOM 5203  H HB3  . SER A 1 55  ? -17.403 6.385   -14.159 1.00 2.38   ? 55  SER A HB3  3  
ATOM 5204  H HG   . SER A 1 55  ? -15.197 7.384   -15.096 1.00 6.06   ? 55  SER A HG   3  
ATOM 5205  N N    . ASP A 1 56  ? -15.075 4.047   -16.484 1.00 2.86   ? 56  ASP A N    3  
ATOM 5206  C CA   . ASP A 1 56  ? -13.979 3.698   -17.389 1.00 2.94   ? 56  ASP A CA   3  
ATOM 5207  C C    . ASP A 1 56  ? -12.774 4.655   -17.284 1.00 3.01   ? 56  ASP A C    3  
ATOM 5208  O O    . ASP A 1 56  ? -12.171 5.016   -18.289 1.00 3.60   ? 56  ASP A O    3  
ATOM 5209  C CB   . ASP A 1 56  ? -14.527 3.660   -18.825 1.00 3.35   ? 56  ASP A CB   3  
ATOM 5210  C CG   . ASP A 1 56  ? -15.758 2.781   -19.003 1.00 3.62   ? 56  ASP A CG   3  
ATOM 5211  O OD1  . ASP A 1 56  ? -16.825 3.150   -18.472 1.00 3.53   ? 56  ASP A OD1  3  
ATOM 5212  O OD2  . ASP A 1 56  ? -15.670 1.753   -19.703 1.00 4.81   ? 56  ASP A OD2  3  
ATOM 5213  H H    . ASP A 1 56  ? -15.967 4.221   -16.943 1.00 3.34   ? 56  ASP A H    3  
ATOM 5214  H HA   . ASP A 1 56  ? -13.638 2.698   -17.128 1.00 2.76   ? 56  ASP A HA   3  
ATOM 5215  H HB2  . ASP A 1 56  ? -14.787 4.667   -19.133 1.00 3.39   ? 56  ASP A HB2  3  
ATOM 5216  H HB3  . ASP A 1 56  ? -13.749 3.301   -19.495 1.00 4.27   ? 56  ASP A HB3  3  
ATOM 5217  N N    . GLN A 1 57  ? -12.444 5.137   -16.087 1.00 2.56   ? 57  GLN A N    3  
ATOM 5218  C CA   . GLN A 1 57  ? -11.370 6.098   -15.827 1.00 2.68   ? 57  GLN A CA   3  
ATOM 5219  C C    . GLN A 1 57  ? -10.025 5.385   -15.592 1.00 2.78   ? 57  GLN A C    3  
ATOM 5220  O O    . GLN A 1 57  ? -9.914  4.586   -14.659 1.00 3.02   ? 57  GLN A O    3  
ATOM 5221  C CB   . GLN A 1 57  ? -11.752 7.015   -14.639 1.00 2.78   ? 57  GLN A CB   3  
ATOM 5222  C CG   . GLN A 1 57  ? -12.057 6.280   -13.317 1.00 3.18   ? 57  GLN A CG   3  
ATOM 5223  C CD   . GLN A 1 57  ? -12.542 7.187   -12.199 1.00 3.32   ? 57  GLN A CD   3  
ATOM 5224  O OE1  . GLN A 1 57  ? -11.755 7.701   -11.417 1.00 4.09   ? 57  GLN A OE1  3  
ATOM 5225  N NE2  . GLN A 1 57  ? -13.835 7.383   -12.051 1.00 3.42   ? 57  GLN A NE2  3  
ATOM 5226  H H    . GLN A 1 57  ? -12.927 4.747   -15.282 1.00 2.30   ? 57  GLN A H    3  
ATOM 5227  H HA   . GLN A 1 57  ? -11.281 6.740   -16.702 1.00 2.73   ? 57  GLN A HA   3  
ATOM 5228  H HB2  . GLN A 1 57  ? -10.935 7.719   -14.465 1.00 3.60   ? 57  GLN A HB2  3  
ATOM 5229  H HB3  . GLN A 1 57  ? -12.633 7.593   -14.916 1.00 2.90   ? 57  GLN A HB3  3  
ATOM 5230  H HG2  . GLN A 1 57  ? -12.816 5.524   -13.485 1.00 3.41   ? 57  GLN A HG2  3  
ATOM 5231  H HG3  . GLN A 1 57  ? -11.158 5.785   -12.954 1.00 4.17   ? 57  GLN A HG3  3  
ATOM 5232  H HE21 . GLN A 1 57  ? -14.493 6.985   -12.717 1.00 3.50   ? 57  GLN A HE21 3  
ATOM 5233  H HE22 . GLN A 1 57  ? -14.146 7.835   -11.211 1.00 4.02   ? 57  GLN A HE22 3  
ATOM 5234  N N    . PRO A 1 58  ? -8.978  5.671   -16.392 1.00 2.76   ? 58  PRO A N    3  
ATOM 5235  C CA   . PRO A 1 58  ? -7.612  5.315   -16.048 1.00 2.84   ? 58  PRO A CA   3  
ATOM 5236  C C    . PRO A 1 58  ? -6.970  6.445   -15.224 1.00 2.59   ? 58  PRO A C    3  
ATOM 5237  O O    . PRO A 1 58  ? -6.592  7.494   -15.747 1.00 3.01   ? 58  PRO A O    3  
ATOM 5238  C CB   . PRO A 1 58  ? -6.917  5.079   -17.388 1.00 3.11   ? 58  PRO A CB   3  
ATOM 5239  C CG   . PRO A 1 58  ? -7.621  6.052   -18.337 1.00 3.03   ? 58  PRO A CG   3  
ATOM 5240  C CD   . PRO A 1 58  ? -9.027  6.218   -17.745 1.00 2.82   ? 58  PRO A CD   3  
ATOM 5241  H HA   . PRO A 1 58  ? -7.590  4.391   -15.472 1.00 2.99   ? 58  PRO A HA   3  
ATOM 5242  H HB2  . PRO A 1 58  ? -5.844  5.258   -17.337 1.00 3.21   ? 58  PRO A HB2  3  
ATOM 5243  H HB3  . PRO A 1 58  ? -7.108  4.057   -17.714 1.00 3.35   ? 58  PRO A HB3  3  
ATOM 5244  H HG2  . PRO A 1 58  ? -7.103  7.010   -18.328 1.00 3.01   ? 58  PRO A HG2  3  
ATOM 5245  H HG3  . PRO A 1 58  ? -7.655  5.651   -19.350 1.00 3.21   ? 58  PRO A HG3  3  
ATOM 5246  H HD2  . PRO A 1 58  ? -9.303  7.273   -17.730 1.00 2.69   ? 58  PRO A HD2  3  
ATOM 5247  H HD3  . PRO A 1 58  ? -9.733  5.646   -18.342 1.00 2.97   ? 58  PRO A HD3  3  
ATOM 5248  N N    . ILE A 1 59  ? -6.833  6.210   -13.916 1.00 2.06   ? 59  ILE A N    3  
ATOM 5249  C CA   . ILE A 1 59  ? -5.951  6.975   -13.020 1.00 1.98   ? 59  ILE A CA   3  
ATOM 5250  C C    . ILE A 1 59  ? -4.568  6.307   -12.965 1.00 1.98   ? 59  ILE A C    3  
ATOM 5251  O O    . ILE A 1 59  ? -4.481  5.080   -12.912 1.00 2.31   ? 59  ILE A O    3  
ATOM 5252  C CB   . ILE A 1 59  ? -6.602  7.154   -11.622 1.00 2.11   ? 59  ILE A CB   3  
ATOM 5253  C CG1  . ILE A 1 59  ? -5.746  7.994   -10.645 1.00 3.25   ? 59  ILE A CG1  3  
ATOM 5254  C CG2  . ILE A 1 59  ? -6.940  5.815   -10.937 1.00 2.98   ? 59  ILE A CG2  3  
ATOM 5255  C CD1  . ILE A 1 59  ? -5.470  9.426   -11.121 1.00 4.38   ? 59  ILE A CD1  3  
ATOM 5256  H H    . ILE A 1 59  ? -7.191  5.328   -13.574 1.00 1.93   ? 59  ILE A H    3  
ATOM 5257  H HA   . ILE A 1 59  ? -5.819  7.964   -13.455 1.00 2.12   ? 59  ILE A HA   3  
ATOM 5258  H HB   . ILE A 1 59  ? -7.545  7.686   -11.768 1.00 2.97   ? 59  ILE A HB   3  
ATOM 5259  H HG12 . ILE A 1 59  ? -6.275  8.064   -9.694  1.00 3.32   ? 59  ILE A HG12 3  
ATOM 5260  H HG13 . ILE A 1 59  ? -4.796  7.493   -10.454 1.00 4.49   ? 59  ILE A HG13 3  
ATOM 5261  H HG21 . ILE A 1 59  ? -7.427  6.003   -9.981  1.00 3.30   ? 59  ILE A HG21 3  
ATOM 5262  H HG22 . ILE A 1 59  ? -7.631  5.241   -11.554 1.00 4.14   ? 59  ILE A HG22 3  
ATOM 5263  H HG23 . ILE A 1 59  ? -6.033  5.235   -10.761 1.00 3.66   ? 59  ILE A HG23 3  
ATOM 5264  H HD11 . ILE A 1 59  ? -4.947  9.972   -10.334 1.00 5.23   ? 59  ILE A HD11 3  
ATOM 5265  H HD12 . ILE A 1 59  ? -4.842  9.422   -12.010 1.00 5.27   ? 59  ILE A HD12 3  
ATOM 5266  H HD13 . ILE A 1 59  ? -6.409  9.933   -11.339 1.00 4.26   ? 59  ILE A HD13 3  
ATOM 5267  N N    . LYS A 1 60  ? -3.488  7.099   -12.981 1.00 1.90   ? 60  LYS A N    3  
ATOM 5268  C CA   . LYS A 1 60  ? -2.093  6.623   -13.009 1.00 2.13   ? 60  LYS A CA   3  
ATOM 5269  C C    . LYS A 1 60  ? -1.310  6.978   -11.738 1.00 1.64   ? 60  LYS A C    3  
ATOM 5270  O O    . LYS A 1 60  ? -1.288  8.139   -11.339 1.00 1.47   ? 60  LYS A O    3  
ATOM 5271  C CB   . LYS A 1 60  ? -1.405  7.135   -14.287 1.00 2.89   ? 60  LYS A CB   3  
ATOM 5272  C CG   . LYS A 1 60  ? -1.252  8.671   -14.388 1.00 3.70   ? 60  LYS A CG   3  
ATOM 5273  C CD   . LYS A 1 60  ? -0.744  9.115   -15.769 1.00 4.72   ? 60  LYS A CD   3  
ATOM 5274  C CE   . LYS A 1 60  ? -0.484  10.631  -15.791 1.00 5.80   ? 60  LYS A CE   3  
ATOM 5275  N NZ   . LYS A 1 60  ? 0.049   11.077  -17.105 1.00 6.63   ? 60  LYS A NZ   3  
ATOM 5276  H H    . LYS A 1 60  ? -3.624  8.101   -12.977 1.00 1.90   ? 60  LYS A H    3  
ATOM 5277  H HA   . LYS A 1 60  ? -2.110  5.538   -13.076 1.00 2.44   ? 60  LYS A HA   3  
ATOM 5278  H HB2  . LYS A 1 60  ? -0.420  6.670   -14.339 1.00 3.01   ? 60  LYS A HB2  3  
ATOM 5279  H HB3  . LYS A 1 60  ? -1.985  6.772   -15.136 1.00 3.18   ? 60  LYS A HB3  3  
ATOM 5280  H HG2  . LYS A 1 60  ? -2.213  9.151   -14.201 1.00 3.76   ? 60  LYS A HG2  3  
ATOM 5281  H HG3  . LYS A 1 60  ? -0.532  9.006   -13.637 1.00 3.99   ? 60  LYS A HG3  3  
ATOM 5282  H HD2  . LYS A 1 60  ? 0.187   8.590   -15.991 1.00 5.11   ? 60  LYS A HD2  3  
ATOM 5283  H HD3  . LYS A 1 60  ? -1.483  8.853   -16.527 1.00 4.85   ? 60  LYS A HD3  3  
ATOM 5284  H HE2  . LYS A 1 60  ? -1.415  11.160  -15.560 1.00 5.85   ? 60  LYS A HE2  3  
ATOM 5285  H HE3  . LYS A 1 60  ? 0.239   10.860  -15.004 1.00 6.41   ? 60  LYS A HE3  3  
ATOM 5286  H HZ1  . LYS A 1 60  ? -0.642  10.987  -17.837 1.00 6.69   ? 60  LYS A HZ1  3  
ATOM 5287  H HZ2  . LYS A 1 60  ? 0.369   12.043  -17.089 1.00 7.21   ? 60  LYS A HZ2  3  
ATOM 5288  H HZ3  . LYS A 1 60  ? 0.851   10.504  -17.365 1.00 7.03   ? 60  LYS A HZ3  3  
ATOM 5289  N N    . LEU A 1 61  ? -0.622  6.016   -11.107 1.00 1.77   ? 61  LEU A N    3  
ATOM 5290  C CA   . LEU A 1 61  ? -0.024  6.185   -9.771  1.00 1.39   ? 61  LEU A CA   3  
ATOM 5291  C C    . LEU A 1 61  ? 0.926   5.018   -9.456  1.00 1.26   ? 61  LEU A C    3  
ATOM 5292  O O    . LEU A 1 61  ? 0.717   3.894   -9.917  1.00 1.73   ? 61  LEU A O    3  
ATOM 5293  C CB   . LEU A 1 61  ? -1.158  6.427   -8.736  1.00 1.57   ? 61  LEU A CB   3  
ATOM 5294  C CG   . LEU A 1 61  ? -0.809  7.067   -7.372  1.00 1.73   ? 61  LEU A CG   3  
ATOM 5295  C CD1  . LEU A 1 61  ? -2.062  7.794   -6.851  1.00 2.23   ? 61  LEU A CD1  3  
ATOM 5296  C CD2  . LEU A 1 61  ? -0.322  6.071   -6.315  1.00 3.03   ? 61  LEU A CD2  3  
ATOM 5297  H H    . LEU A 1 61  ? -0.591  5.090   -11.515 1.00 2.30   ? 61  LEU A H    3  
ATOM 5298  H HA   . LEU A 1 61  ? 0.579   7.086   -9.811  1.00 1.47   ? 61  LEU A HA   3  
ATOM 5299  H HB2  . LEU A 1 61  ? -1.889  7.094   -9.191  1.00 2.19   ? 61  LEU A HB2  3  
ATOM 5300  H HB3  . LEU A 1 61  ? -1.694  5.500   -8.580  1.00 2.10   ? 61  LEU A HB3  3  
ATOM 5301  H HG   . LEU A 1 61  ? -0.026  7.811   -7.510  1.00 2.26   ? 61  LEU A HG   3  
ATOM 5302  H HD11 . LEU A 1 61  ? -2.946  7.165   -6.959  1.00 2.97   ? 61  LEU A HD11 3  
ATOM 5303  H HD12 . LEU A 1 61  ? -1.952  8.049   -5.800  1.00 2.93   ? 61  LEU A HD12 3  
ATOM 5304  H HD13 . LEU A 1 61  ? -2.211  8.703   -7.427  1.00 2.73   ? 61  LEU A HD13 3  
ATOM 5305  H HD21 . LEU A 1 61  ? -1.159  5.589   -5.811  1.00 3.59   ? 61  LEU A HD21 3  
ATOM 5306  H HD22 . LEU A 1 61  ? 0.285   5.307   -6.778  1.00 3.99   ? 61  LEU A HD22 3  
ATOM 5307  H HD23 . LEU A 1 61  ? 0.283   6.592   -5.577  1.00 3.58   ? 61  LEU A HD23 3  
ATOM 5308  N N    . VAL A 1 62  ? 2.002   5.310   -8.719  1.00 1.05   ? 62  VAL A N    3  
ATOM 5309  C CA   . VAL A 1 62  ? 3.150   4.396   -8.545  1.00 1.19   ? 62  VAL A CA   3  
ATOM 5310  C C    . VAL A 1 62  ? 2.947   3.383   -7.397  1.00 1.15   ? 62  VAL A C    3  
ATOM 5311  O O    . VAL A 1 62  ? 3.330   2.222   -7.527  1.00 1.69   ? 62  VAL A O    3  
ATOM 5312  C CB   . VAL A 1 62  ? 4.476   5.191   -8.390  1.00 1.63   ? 62  VAL A CB   3  
ATOM 5313  C CG1  . VAL A 1 62  ? 4.614   6.261   -9.491  1.00 2.54   ? 62  VAL A CG1  3  
ATOM 5314  C CG2  . VAL A 1 62  ? 4.650   5.852   -7.009  1.00 2.78   ? 62  VAL A CG2  3  
ATOM 5315  H H    . VAL A 1 62  ? 2.099   6.253   -8.367  1.00 1.19   ? 62  VAL A H    3  
ATOM 5316  H HA   . VAL A 1 62  ? 3.244   3.825   -9.472  1.00 1.45   ? 62  VAL A HA   3  
ATOM 5317  H HB   . VAL A 1 62  ? 5.295   4.496   -8.538  1.00 2.37   ? 62  VAL A HB   3  
ATOM 5318  H HG11 . VAL A 1 62  ? 5.620   6.693   -9.461  1.00 3.40   ? 62  VAL A HG11 3  
ATOM 5319  H HG12 . VAL A 1 62  ? 4.460   5.809   -10.470 1.00 2.91   ? 62  VAL A HG12 3  
ATOM 5320  H HG13 . VAL A 1 62  ? 3.889   7.062   -9.346  1.00 3.38   ? 62  VAL A HG13 3  
ATOM 5321  H HG21 . VAL A 1 62  ? 3.787   6.476   -6.779  1.00 3.47   ? 62  VAL A HG21 3  
ATOM 5322  H HG22 . VAL A 1 62  ? 4.755   5.089   -6.235  1.00 3.62   ? 62  VAL A HG22 3  
ATOM 5323  H HG23 . VAL A 1 62  ? 5.550   6.468   -7.000  1.00 3.51   ? 62  VAL A HG23 3  
ATOM 5324  N N    . GLY A 1 63  ? 2.286   3.802   -6.310  1.00 1.13   ? 63  GLY A N    3  
ATOM 5325  C CA   . GLY A 1 63  ? 1.895   2.983   -5.157  1.00 1.20   ? 63  GLY A CA   3  
ATOM 5326  C C    . GLY A 1 63  ? 1.845   3.805   -3.868  1.00 0.87   ? 63  GLY A C    3  
ATOM 5327  O O    . GLY A 1 63  ? 1.882   5.034   -3.914  1.00 0.90   ? 63  GLY A O    3  
ATOM 5328  H H    . GLY A 1 63  ? 2.086   4.792   -6.233  1.00 1.52   ? 63  GLY A H    3  
ATOM 5329  H HA2  . GLY A 1 63  ? 0.901   2.572   -5.332  1.00 1.56   ? 63  GLY A HA2  3  
ATOM 5330  H HA3  . GLY A 1 63  ? 2.580   2.146   -5.030  1.00 1.58   ? 63  GLY A HA3  3  
ATOM 5331  N N    . ALA A 1 64  ? 1.754   3.124   -2.724  1.00 1.03   ? 64  ALA A N    3  
ATOM 5332  C CA   . ALA A 1 64  ? 1.830   3.739   -1.396  1.00 1.07   ? 64  ALA A CA   3  
ATOM 5333  C C    . ALA A 1 64  ? 3.261   3.675   -0.832  1.00 0.98   ? 64  ALA A C    3  
ATOM 5334  O O    . ALA A 1 64  ? 3.940   2.661   -0.977  1.00 1.06   ? 64  ALA A O    3  
ATOM 5335  C CB   . ALA A 1 64  ? 0.829   3.027   -0.476  1.00 1.41   ? 64  ALA A CB   3  
ATOM 5336  H H    . ALA A 1 64  ? 1.782   2.119   -2.764  1.00 1.28   ? 64  ALA A H    3  
ATOM 5337  H HA   . ALA A 1 64  ? 1.542   4.790   -1.465  1.00 1.22   ? 64  ALA A HA   3  
ATOM 5338  H HB1  . ALA A 1 64  ? -0.184  3.158   -0.856  1.00 2.12   ? 64  ALA A HB1  3  
ATOM 5339  H HB2  . ALA A 1 64  ? 1.058   1.960   -0.424  1.00 2.22   ? 64  ALA A HB2  3  
ATOM 5340  H HB3  . ALA A 1 64  ? 0.888   3.442   0.527   1.00 1.87   ? 64  ALA A HB3  3  
ATOM 5341  N N    . ALA A 1 65  ? 3.715   4.744   -0.170  1.00 1.11   ? 65  ALA A N    3  
ATOM 5342  C CA   . ALA A 1 65  ? 5.077   4.875   0.368   1.00 1.16   ? 65  ALA A CA   3  
ATOM 5343  C C    . ALA A 1 65  ? 5.123   5.596   1.733   1.00 1.12   ? 65  ALA A C    3  
ATOM 5344  O O    . ALA A 1 65  ? 4.140   6.225   2.133   1.00 1.14   ? 65  ALA A O    3  
ATOM 5345  C CB   . ALA A 1 65  ? 5.917   5.614   -0.688  1.00 1.55   ? 65  ALA A CB   3  
ATOM 5346  H H    . ALA A 1 65  ? 3.120   5.567   -0.145  1.00 1.29   ? 65  ALA A H    3  
ATOM 5347  H HA   . ALA A 1 65  ? 5.499   3.876   0.508   1.00 1.10   ? 65  ALA A HA   3  
ATOM 5348  H HB1  . ALA A 1 65  ? 5.499   6.607   -0.871  1.00 2.81   ? 65  ALA A HB1  3  
ATOM 5349  H HB2  . ALA A 1 65  ? 6.949   5.714   -0.354  1.00 1.63   ? 65  ALA A HB2  3  
ATOM 5350  H HB3  . ALA A 1 65  ? 5.910   5.050   -1.624  1.00 2.09   ? 65  ALA A HB3  3  
ATOM 5351  N N    . THR A 1 66  ? 6.272   5.526   2.429   1.00 1.14   ? 66  THR A N    3  
ATOM 5352  C CA   . THR A 1 66  ? 6.526   6.172   3.735   1.00 1.19   ? 66  THR A CA   3  
ATOM 5353  C C    . THR A 1 66  ? 8.033   6.199   4.049   1.00 1.21   ? 66  THR A C    3  
ATOM 5354  O O    . THR A 1 66  ? 8.712   5.246   3.666   1.00 1.27   ? 66  THR A O    3  
ATOM 5355  C CB   . THR A 1 66  ? 5.728   5.471   4.848   1.00 1.25   ? 66  THR A CB   3  
ATOM 5356  O OG1  . THR A 1 66  ? 5.907   6.169   6.051   1.00 1.58   ? 66  THR A OG1  3  
ATOM 5357  C CG2  . THR A 1 66  ? 6.148   4.024   5.103   1.00 1.30   ? 66  THR A CG2  3  
ATOM 5358  H H    . THR A 1 66  ? 7.037   4.979   2.045   1.00 1.17   ? 66  THR A H    3  
ATOM 5359  H HA   . THR A 1 66  ? 6.157   7.191   3.671   1.00 1.26   ? 66  THR A HA   3  
ATOM 5360  H HB   . THR A 1 66  ? 4.667   5.483   4.592   1.00 1.20   ? 66  THR A HB   3  
ATOM 5361  H HG1  . THR A 1 66  ? 5.052   6.563   6.296   1.00 2.25   ? 66  THR A HG1  3  
ATOM 5362  H HG21 . THR A 1 66  ? 7.166   3.980   5.495   1.00 2.00   ? 66  THR A HG21 3  
ATOM 5363  H HG22 . THR A 1 66  ? 5.472   3.582   5.830   1.00 2.10   ? 66  THR A HG22 3  
ATOM 5364  H HG23 . THR A 1 66  ? 6.096   3.452   4.180   1.00 1.66   ? 66  THR A HG23 3  
ATOM 5365  N N    . PRO A 1 67  ? 8.561   7.236   4.736   1.00 1.27   ? 67  PRO A N    3  
ATOM 5366  C CA   . PRO A 1 67  ? 9.967   7.327   5.140   1.00 1.29   ? 67  PRO A CA   3  
ATOM 5367  C C    . PRO A 1 67  ? 10.262  6.748   6.540   1.00 1.17   ? 67  PRO A C    3  
ATOM 5368  O O    . PRO A 1 67  ? 11.377  6.898   7.029   1.00 1.29   ? 67  PRO A O    3  
ATOM 5369  C CB   . PRO A 1 67  ? 10.274  8.830   5.073   1.00 1.49   ? 67  PRO A CB   3  
ATOM 5370  C CG   . PRO A 1 67  ? 8.964   9.456   5.549   1.00 1.54   ? 67  PRO A CG   3  
ATOM 5371  C CD   . PRO A 1 67  ? 7.907   8.523   4.958   1.00 1.45   ? 67  PRO A CD   3  
ATOM 5372  H HA   . PRO A 1 67  ? 10.602  6.803   4.425   1.00 1.35   ? 67  PRO A HA   3  
ATOM 5373  H HB2  . PRO A 1 67  ? 11.120  9.120   5.699   1.00 1.52   ? 67  PRO A HB2  3  
ATOM 5374  H HB3  . PRO A 1 67  ? 10.461  9.114   4.036   1.00 1.63   ? 67  PRO A HB3  3  
ATOM 5375  H HG2  . PRO A 1 67  ? 8.918   9.431   6.637   1.00 1.51   ? 67  PRO A HG2  3  
ATOM 5376  H HG3  . PRO A 1 67  ? 8.852   10.477  5.183   1.00 1.72   ? 67  PRO A HG3  3  
ATOM 5377  H HD2  . PRO A 1 67  ? 7.066   8.431   5.645   1.00 1.46   ? 67  PRO A HD2  3  
ATOM 5378  H HD3  . PRO A 1 67  ? 7.570   8.926   4.003   1.00 1.60   ? 67  PRO A HD3  3  
ATOM 5379  N N    . LEU A 1 68  ? 9.291   6.118   7.223   1.00 1.07   ? 68  LEU A N    3  
ATOM 5380  C CA   . LEU A 1 68  ? 9.439   5.616   8.609   1.00 1.10   ? 68  LEU A CA   3  
ATOM 5381  C C    . LEU A 1 68  ? 10.233  4.291   8.727   1.00 1.07   ? 68  LEU A C    3  
ATOM 5382  O O    . LEU A 1 68  ? 10.685  3.923   9.818   1.00 1.22   ? 68  LEU A O    3  
ATOM 5383  C CB   . LEU A 1 68  ? 8.026   5.462   9.223   1.00 1.22   ? 68  LEU A CB   3  
ATOM 5384  C CG   . LEU A 1 68  ? 7.409   6.723   9.874   1.00 1.50   ? 68  LEU A CG   3  
ATOM 5385  C CD1  . LEU A 1 68  ? 8.155   7.108   11.162  1.00 2.75   ? 68  LEU A CD1  3  
ATOM 5386  C CD2  . LEU A 1 68  ? 7.343   7.940   8.938   1.00 2.25   ? 68  LEU A CD2  3  
ATOM 5387  H H    . LEU A 1 68  ? 8.370   6.058   6.804   1.00 1.07   ? 68  LEU A H    3  
ATOM 5388  H HA   . LEU A 1 68  ? 10.004  6.350   9.188   1.00 1.20   ? 68  LEU A HA   3  
ATOM 5389  H HB2  . LEU A 1 68  ? 7.339   5.089   8.461   1.00 1.24   ? 68  LEU A HB2  3  
ATOM 5390  H HB3  . LEU A 1 68  ? 8.067   4.697   9.999   1.00 1.27   ? 68  LEU A HB3  3  
ATOM 5391  H HG   . LEU A 1 68  ? 6.386   6.471   10.155  1.00 2.00   ? 68  LEU A HG   3  
ATOM 5392  H HD11 . LEU A 1 68  ? 8.184   6.256   11.841  1.00 3.47   ? 68  LEU A HD11 3  
ATOM 5393  H HD12 . LEU A 1 68  ? 9.174   7.426   10.940  1.00 3.63   ? 68  LEU A HD12 3  
ATOM 5394  H HD13 . LEU A 1 68  ? 7.632   7.927   11.657  1.00 3.16   ? 68  LEU A HD13 3  
ATOM 5395  H HD21 . LEU A 1 68  ? 6.811   8.752   9.433   1.00 2.63   ? 68  LEU A HD21 3  
ATOM 5396  H HD22 . LEU A 1 68  ? 8.347   8.282   8.689   1.00 3.32   ? 68  LEU A HD22 3  
ATOM 5397  H HD23 . LEU A 1 68  ? 6.809   7.679   8.026   1.00 2.86   ? 68  LEU A HD23 3  
ATOM 5398  N N    . ALA A 1 69  ? 10.403  3.591   7.604   1.00 1.07   ? 69  ALA A N    3  
ATOM 5399  C CA   . ALA A 1 69  ? 11.212  2.388   7.470   1.00 1.12   ? 69  ALA A CA   3  
ATOM 5400  C C    . ALA A 1 69  ? 12.596  2.727   6.914   1.00 1.19   ? 69  ALA A C    3  
ATOM 5401  O O    . ALA A 1 69  ? 12.729  3.607   6.064   1.00 1.42   ? 69  ALA A O    3  
ATOM 5402  C CB   . ALA A 1 69  ? 10.456  1.413   6.558   1.00 1.28   ? 69  ALA A CB   3  
ATOM 5403  H H    . ALA A 1 69  ? 10.068  4.018   6.755   1.00 1.13   ? 69  ALA A H    3  
ATOM 5404  H HA   . ALA A 1 69  ? 11.350  1.925   8.447   1.00 1.15   ? 69  ALA A HA   3  
ATOM 5405  H HB1  . ALA A 1 69  ? 11.035  0.505   6.417   1.00 1.94   ? 69  ALA A HB1  3  
ATOM 5406  H HB2  . ALA A 1 69  ? 9.503   1.154   7.013   1.00 1.70   ? 69  ALA A HB2  3  
ATOM 5407  H HB3  . ALA A 1 69  ? 10.275  1.873   5.586   1.00 1.99   ? 69  ALA A HB3  3  
ATOM 5408  N N    . THR A 1 70  ? 13.617  1.966   7.325   1.00 1.14   ? 70  THR A N    3  
ATOM 5409  C CA   . THR A 1 70  ? 14.946  1.980   6.687   1.00 1.18   ? 70  THR A CA   3  
ATOM 5410  C C    . THR A 1 70  ? 14.872  1.352   5.293   1.00 1.08   ? 70  THR A C    3  
ATOM 5411  O O    . THR A 1 70  ? 15.658  1.678   4.413   1.00 1.20   ? 70  THR A O    3  
ATOM 5412  C CB   . THR A 1 70  ? 15.998  1.281   7.560   1.00 1.34   ? 70  THR A CB   3  
ATOM 5413  O OG1  . THR A 1 70  ? 15.947  1.797   8.870   1.00 1.53   ? 70  THR A OG1  3  
ATOM 5414  C CG2  . THR A 1 70  ? 17.425  1.498   7.054   1.00 1.86   ? 70  THR A CG2  3  
ATOM 5415  H H    . THR A 1 70  ? 13.456  1.285   8.056   1.00 1.17   ? 70  THR A H    3  
ATOM 5416  H HA   . THR A 1 70  ? 15.259  3.017   6.548   1.00 1.30   ? 70  THR A HA   3  
ATOM 5417  H HB   . THR A 1 70  ? 15.795  0.207   7.594   1.00 1.68   ? 70  THR A HB   3  
ATOM 5418  H HG1  . THR A 1 70  ? 15.253  1.310   9.346   1.00 2.15   ? 70  THR A HG1  3  
ATOM 5419  H HG21 . THR A 1 70  ? 17.625  2.561   6.944   1.00 2.56   ? 70  THR A HG21 3  
ATOM 5420  H HG22 . THR A 1 70  ? 18.136  1.073   7.771   1.00 2.39   ? 70  THR A HG22 3  
ATOM 5421  H HG23 . THR A 1 70  ? 17.569  1.001   6.094   1.00 2.35   ? 70  THR A HG23 3  
ATOM 5422  N N    . SER A 1 71  ? 13.901  0.477   5.038   1.00 1.00   ? 71  SER A N    3  
ATOM 5423  C CA   . SER A 1 71  ? 13.628  -0.065  3.700   1.00 0.99   ? 71  SER A CA   3  
ATOM 5424  C C    . SER A 1 71  ? 12.132  -0.370  3.505   1.00 0.88   ? 71  SER A C    3  
ATOM 5425  O O    . SER A 1 71  ? 11.695  -1.500  3.757   1.00 0.93   ? 71  SER A O    3  
ATOM 5426  C CB   . SER A 1 71  ? 14.494  -1.308  3.461   1.00 1.11   ? 71  SER A CB   3  
ATOM 5427  O OG   . SER A 1 71  ? 15.852  -0.938  3.278   1.00 1.85   ? 71  SER A OG   3  
ATOM 5428  H H    . SER A 1 71  ? 13.360  0.098   5.809   1.00 0.99   ? 71  SER A H    3  
ATOM 5429  H HA   . SER A 1 71  ? 13.916  0.656   2.938   1.00 1.06   ? 71  SER A HA   3  
ATOM 5430  H HB2  . SER A 1 71  ? 14.404  -1.986  4.313   1.00 1.17   ? 71  SER A HB2  3  
ATOM 5431  H HB3  . SER A 1 71  ? 14.149  -1.824  2.563   1.00 1.67   ? 71  SER A HB3  3  
ATOM 5432  H HG   . SER A 1 71  ? 16.023  -0.082  3.713   1.00 2.76   ? 71  SER A HG   3  
ATOM 5433  N N    . PRO A 1 72  ? 11.322  0.623   3.068   1.00 0.92   ? 72  PRO A N    3  
ATOM 5434  C CA   . PRO A 1 72  ? 9.965   0.372   2.606   1.00 0.92   ? 72  PRO A CA   3  
ATOM 5435  C C    . PRO A 1 72  ? 10.048  -0.474  1.333   1.00 0.99   ? 72  PRO A C    3  
ATOM 5436  O O    . PRO A 1 72  ? 10.766  -0.140  0.395   1.00 1.18   ? 72  PRO A O    3  
ATOM 5437  C CB   . PRO A 1 72  ? 9.328   1.747   2.384   1.00 1.10   ? 72  PRO A CB   3  
ATOM 5438  C CG   . PRO A 1 72  ? 10.522  2.637   2.050   1.00 1.22   ? 72  PRO A CG   3  
ATOM 5439  C CD   . PRO A 1 72  ? 11.660  2.032   2.873   1.00 1.10   ? 72  PRO A CD   3  
ATOM 5440  H HA   . PRO A 1 72  ? 9.399   -0.161  3.372   1.00 0.85   ? 72  PRO A HA   3  
ATOM 5441  H HB2  . PRO A 1 72  ? 8.590   1.734   1.581   1.00 1.19   ? 72  PRO A HB2  3  
ATOM 5442  H HB3  . PRO A 1 72  ? 8.869   2.090   3.314   1.00 1.13   ? 72  PRO A HB3  3  
ATOM 5443  H HG2  . PRO A 1 72  ? 10.755  2.553   0.987   1.00 1.31   ? 72  PRO A HG2  3  
ATOM 5444  H HG3  . PRO A 1 72  ? 10.345  3.677   2.315   1.00 1.35   ? 72  PRO A HG3  3  
ATOM 5445  H HD2  . PRO A 1 72  ? 12.590  2.166   2.325   1.00 1.21   ? 72  PRO A HD2  3  
ATOM 5446  H HD3  . PRO A 1 72  ? 11.718  2.531   3.843   1.00 1.13   ? 72  PRO A HD3  3  
ATOM 5447  N N    . MET A 1 73  ? 9.338   -1.597  1.342   1.00 0.94   ? 73  MET A N    3  
ATOM 5448  C CA   . MET A 1 73  ? 9.500   -2.721  0.424   1.00 0.94   ? 73  MET A CA   3  
ATOM 5449  C C    . MET A 1 73  ? 8.106   -3.118  -0.049  1.00 0.85   ? 73  MET A C    3  
ATOM 5450  O O    . MET A 1 73  ? 7.250   -3.415  0.777   1.00 1.00   ? 73  MET A O    3  
ATOM 5451  C CB   . MET A 1 73  ? 10.181  -3.841  1.226   1.00 1.06   ? 73  MET A CB   3  
ATOM 5452  C CG   . MET A 1 73  ? 10.335  -5.169  0.480   1.00 1.07   ? 73  MET A CG   3  
ATOM 5453  S SD   . MET A 1 73  ? 11.459  -5.165  -0.937  1.00 2.32   ? 73  MET A SD   3  
ATOM 5454  C CE   . MET A 1 73  ? 11.494  -6.955  -1.208  1.00 2.59   ? 73  MET A CE   3  
ATOM 5455  H H    . MET A 1 73  ? 8.732   -1.780  2.141   1.00 0.93   ? 73  MET A H    3  
ATOM 5456  H HA   . MET A 1 73  ? 10.119  -2.447  -0.430  1.00 1.03   ? 73  MET A HA   3  
ATOM 5457  H HB2  . MET A 1 73  ? 11.163  -3.488  1.545   1.00 1.46   ? 73  MET A HB2  3  
ATOM 5458  H HB3  . MET A 1 73  ? 9.596   -4.031  2.129   1.00 1.40   ? 73  MET A HB3  3  
ATOM 5459  H HG2  . MET A 1 73  ? 10.709  -5.894  1.203   1.00 1.67   ? 73  MET A HG2  3  
ATOM 5460  H HG3  . MET A 1 73  ? 9.352   -5.513  0.151   1.00 1.91   ? 73  MET A HG3  3  
ATOM 5461  H HE1  . MET A 1 73  ? 11.863  -7.447  -0.307  1.00 2.78   ? 73  MET A HE1  3  
ATOM 5462  H HE2  . MET A 1 73  ? 10.487  -7.313  -1.429  1.00 3.51   ? 73  MET A HE2  3  
ATOM 5463  H HE3  . MET A 1 73  ? 12.161  -7.188  -2.034  1.00 3.19   ? 73  MET A HE3  3  
ATOM 5464  N N    . LEU A 1 74  ? 7.843   -3.089  -1.357  1.00 0.88   ? 74  LEU A N    3  
ATOM 5465  C CA   . LEU A 1 74  ? 6.472   -3.020  -1.870  1.00 1.02   ? 74  LEU A CA   3  
ATOM 5466  C C    . LEU A 1 74  ? 6.264   -3.795  -3.173  1.00 1.24   ? 74  LEU A C    3  
ATOM 5467  O O    . LEU A 1 74  ? 6.842   -3.479  -4.216  1.00 1.70   ? 74  LEU A O    3  
ATOM 5468  C CB   . LEU A 1 74  ? 6.021   -1.538  -1.943  1.00 1.58   ? 74  LEU A CB   3  
ATOM 5469  C CG   . LEU A 1 74  ? 6.670   -0.592  -2.986  1.00 1.62   ? 74  LEU A CG   3  
ATOM 5470  C CD1  . LEU A 1 74  ? 6.032   0.795   -2.845  1.00 2.91   ? 74  LEU A CD1  3  
ATOM 5471  C CD2  . LEU A 1 74  ? 8.193   -0.440  -2.855  1.00 2.34   ? 74  LEU A CD2  3  
ATOM 5472  H H    . LEU A 1 74  ? 8.590   -2.852  -1.992  1.00 1.04   ? 74  LEU A H    3  
ATOM 5473  H HA   . LEU A 1 74  ? 5.821   -3.505  -1.142  1.00 0.90   ? 74  LEU A HA   3  
ATOM 5474  H HB2  . LEU A 1 74  ? 4.943   -1.536  -2.112  1.00 2.61   ? 74  LEU A HB2  3  
ATOM 5475  H HB3  . LEU A 1 74  ? 6.181   -1.095  -0.960  1.00 2.24   ? 74  LEU A HB3  3  
ATOM 5476  H HG   . LEU A 1 74  ? 6.446   -0.955  -3.990  1.00 2.58   ? 74  LEU A HG   3  
ATOM 5477  H HD11 . LEU A 1 74  ? 6.269   1.221   -1.867  1.00 3.44   ? 74  LEU A HD11 3  
ATOM 5478  H HD12 . LEU A 1 74  ? 6.410   1.461   -3.622  1.00 3.28   ? 74  LEU A HD12 3  
ATOM 5479  H HD13 . LEU A 1 74  ? 4.949   0.728   -2.945  1.00 4.22   ? 74  LEU A HD13 3  
ATOM 5480  H HD21 . LEU A 1 74  ? 8.463   -0.198  -1.829  1.00 3.29   ? 74  LEU A HD21 3  
ATOM 5481  H HD22 . LEU A 1 74  ? 8.690   -1.366  -3.157  1.00 3.06   ? 74  LEU A HD22 3  
ATOM 5482  H HD23 . LEU A 1 74  ? 8.546   0.351   -3.514  1.00 2.99   ? 74  LEU A HD23 3  
ATOM 5483  N N    . MET A 1 75  ? 5.360   -4.775  -3.123  1.00 1.20   ? 75  MET A N    3  
ATOM 5484  C CA   . MET A 1 75  ? 4.807   -5.490  -4.274  1.00 1.84   ? 75  MET A CA   3  
ATOM 5485  C C    . MET A 1 75  ? 3.283   -5.663  -4.111  1.00 1.90   ? 75  MET A C    3  
ATOM 5486  O O    . MET A 1 75  ? 2.700   -5.280  -3.101  1.00 2.17   ? 75  MET A O    3  
ATOM 5487  C CB   . MET A 1 75  ? 5.528   -6.844  -4.447  1.00 2.23   ? 75  MET A CB   3  
ATOM 5488  C CG   . MET A 1 75  ? 6.983   -6.652  -4.903  1.00 3.33   ? 75  MET A CG   3  
ATOM 5489  S SD   . MET A 1 75  ? 8.213   -6.734  -3.574  1.00 3.65   ? 75  MET A SD   3  
ATOM 5490  C CE   . MET A 1 75  ? 9.480   -5.659  -4.281  1.00 5.74   ? 75  MET A CE   3  
ATOM 5491  H H    . MET A 1 75  ? 4.935   -4.997  -2.221  1.00 1.03   ? 75  MET A H    3  
ATOM 5492  H HA   . MET A 1 75  ? 4.982   -4.917  -5.178  1.00 2.37   ? 75  MET A HA   3  
ATOM 5493  H HB2  . MET A 1 75  ? 5.498   -7.414  -3.515  1.00 2.09   ? 75  MET A HB2  3  
ATOM 5494  H HB3  . MET A 1 75  ? 5.020   -7.428  -5.215  1.00 3.17   ? 75  MET A HB3  3  
ATOM 5495  H HG2  . MET A 1 75  ? 7.227   -7.417  -5.640  1.00 3.92   ? 75  MET A HG2  3  
ATOM 5496  H HG3  . MET A 1 75  ? 7.072   -5.681  -5.391  1.00 4.47   ? 75  MET A HG3  3  
ATOM 5497  H HE1  . MET A 1 75  ? 10.288  -5.526  -3.573  1.00 6.04   ? 75  MET A HE1  3  
ATOM 5498  H HE2  . MET A 1 75  ? 9.879   -6.104  -5.202  1.00 6.32   ? 75  MET A HE2  3  
ATOM 5499  H HE3  . MET A 1 75  ? 9.055   -4.686  -4.513  1.00 6.82   ? 75  MET A HE3  3  
ATOM 5500  N N    . THR A 1 76  ? 2.660   -6.284  -5.112  1.00 1.95   ? 76  THR A N    3  
ATOM 5501  C CA   . THR A 1 76  ? 1.448   -7.105  -5.069  1.00 1.79   ? 76  THR A CA   3  
ATOM 5502  C C    . THR A 1 76  ? 1.202   -7.579  -6.484  1.00 2.37   ? 76  THR A C    3  
ATOM 5503  O O    . THR A 1 76  ? 1.498   -6.865  -7.439  1.00 3.40   ? 76  THR A O    3  
ATOM 5504  C CB   . THR A 1 76  ? 0.205   -6.415  -4.498  1.00 2.64   ? 76  THR A CB   3  
ATOM 5505  O OG1  . THR A 1 76  ? -0.696  -7.436  -4.150  1.00 3.66   ? 76  THR A OG1  3  
ATOM 5506  C CG2  . THR A 1 76  ? -0.488  -5.454  -5.468  1.00 3.49   ? 76  THR A CG2  3  
ATOM 5507  H H    . THR A 1 76  ? 3.135   -6.280  -6.008  1.00 2.26   ? 76  THR A H    3  
ATOM 5508  H HA   . THR A 1 76  ? 1.657   -7.969  -4.438  1.00 1.14   ? 76  THR A HA   3  
ATOM 5509  H HB   . THR A 1 76  ? 0.469   -5.890  -3.589  1.00 2.70   ? 76  THR A HB   3  
ATOM 5510  H HG1  . THR A 1 76  ? -0.415  -7.798  -3.283  1.00 4.36   ? 76  THR A HG1  3  
ATOM 5511  H HG21 . THR A 1 76  ? -1.144  -4.781  -4.927  1.00 4.87   ? 76  THR A HG21 3  
ATOM 5512  H HG22 . THR A 1 76  ? 0.240   -4.845  -5.988  1.00 3.13   ? 76  THR A HG22 3  
ATOM 5513  H HG23 . THR A 1 76  ? -1.068  -6.005  -6.204  1.00 4.01   ? 76  THR A HG23 3  
ATOM 5514  N N    . THR A 1 77  ? 0.674   -8.786  -6.641  1.00 1.94   ? 77  THR A N    3  
ATOM 5515  C CA   . THR A 1 77  ? 0.216   -9.332  -7.920  1.00 2.72   ? 77  THR A CA   3  
ATOM 5516  C C    . THR A 1 77  ? -0.502  -10.644 -7.643  1.00 1.85   ? 77  THR A C    3  
ATOM 5517  O O    . THR A 1 77  ? -0.087  -11.401 -6.769  1.00 2.39   ? 77  THR A O    3  
ATOM 5518  C CB   . THR A 1 77  ? 1.317   -9.541  -8.981  1.00 3.96   ? 77  THR A CB   3  
ATOM 5519  O OG1  . THR A 1 77  ? 2.545   -8.896  -8.738  1.00 4.73   ? 77  THR A OG1  3  
ATOM 5520  C CG2  . THR A 1 77  ? 0.829   -9.065  -10.345 1.00 5.95   ? 77  THR A CG2  3  
ATOM 5521  H H    . THR A 1 77  ? 0.443   -9.320  -5.818  1.00 1.37   ? 77  THR A H    3  
ATOM 5522  H HA   . THR A 1 77  ? -0.513  -8.622  -8.315  1.00 4.11   ? 77  THR A HA   3  
ATOM 5523  H HB   . THR A 1 77  ? 1.514   -10.603 -9.032  1.00 3.75   ? 77  THR A HB   3  
ATOM 5524  H HG1  . THR A 1 77  ? 2.327   -7.958  -8.569  1.00 5.53   ? 77  THR A HG1  3  
ATOM 5525  H HG21 . THR A 1 77  ? 1.588   -9.251  -11.099 1.00 6.24   ? 77  THR A HG21 3  
ATOM 5526  H HG22 . THR A 1 77  ? -0.086  -9.598  -10.618 1.00 6.60   ? 77  THR A HG22 3  
ATOM 5527  H HG23 . THR A 1 77  ? 0.614   -7.997  -10.297 1.00 7.03   ? 77  THR A HG23 3  
ATOM 5528  N N    . THR A 1 78  ? -1.577  -10.874 -8.391  1.00 2.32   ? 78  THR A N    3  
ATOM 5529  C CA   . THR A 1 78  ? -2.596  -11.926 -8.252  1.00 2.28   ? 78  THR A CA   3  
ATOM 5530  C C    . THR A 1 78  ? -3.692  -11.591 -9.254  1.00 2.50   ? 78  THR A C    3  
ATOM 5531  O O    . THR A 1 78  ? -3.703  -10.483 -9.789  1.00 3.68   ? 78  THR A O    3  
ATOM 5532  C CB   . THR A 1 78  ? -3.111  -12.057 -6.803  1.00 3.88   ? 78  THR A CB   3  
ATOM 5533  O OG1  . THR A 1 78  ? -4.060  -13.088 -6.772  1.00 4.24   ? 78  THR A OG1  3  
ATOM 5534  C CG2  . THR A 1 78  ? -3.760  -10.779 -6.264  1.00 5.85   ? 78  THR A CG2  3  
ATOM 5535  H H    . THR A 1 78  ? -1.818  -10.156 -9.066  1.00 3.52   ? 78  THR A H    3  
ATOM 5536  H HA   . THR A 1 78  ? -2.161  -12.883 -8.528  1.00 2.13   ? 78  THR A HA   3  
ATOM 5537  H HB   . THR A 1 78  ? -2.285  -12.337 -6.151  1.00 4.15   ? 78  THR A HB   3  
ATOM 5538  H HG1  . THR A 1 78  ? -4.170  -13.358 -5.851  1.00 4.82   ? 78  THR A HG1  3  
ATOM 5539  H HG21 . THR A 1 78  ? -4.076  -10.946 -5.240  1.00 7.03   ? 78  THR A HG21 3  
ATOM 5540  H HG22 . THR A 1 78  ? -3.045  -9.958  -6.275  1.00 6.03   ? 78  THR A HG22 3  
ATOM 5541  H HG23 . THR A 1 78  ? -4.631  -10.515 -6.868  1.00 6.44   ? 78  THR A HG23 3  
ATOM 5542  N N    . HIS A 1 79  ? -4.612  -12.506 -9.527  1.00 2.46   ? 79  HIS A N    3  
ATOM 5543  C CA   . HIS A 1 79  ? -5.750  -12.178 -10.385 1.00 3.17   ? 79  HIS A CA   3  
ATOM 5544  C C    . HIS A 1 79  ? -6.690  -11.206 -9.638  1.00 3.48   ? 79  HIS A C    3  
ATOM 5545  O O    . HIS A 1 79  ? -7.481  -11.597 -8.782  1.00 4.74   ? 79  HIS A O    3  
ATOM 5546  C CB   . HIS A 1 79  ? -6.460  -13.441 -10.907 1.00 4.39   ? 79  HIS A CB   3  
ATOM 5547  C CG   . HIS A 1 79  ? -7.333  -13.218 -12.129 1.00 5.32   ? 79  HIS A CG   3  
ATOM 5548  N ND1  . HIS A 1 79  ? -7.753  -14.188 -13.019 1.00 6.44   ? 79  HIS A ND1  3  
ATOM 5549  C CD2  . HIS A 1 79  ? -7.838  -12.027 -12.591 1.00 6.20   ? 79  HIS A CD2  3  
ATOM 5550  C CE1  . HIS A 1 79  ? -8.474  -13.590 -13.985 1.00 7.58   ? 79  HIS A CE1  3  
ATOM 5551  N NE2  . HIS A 1 79  ? -8.560  -12.264 -13.768 1.00 7.61   ? 79  HIS A NE2  3  
ATOM 5552  H H    . HIS A 1 79  ? -4.660  -13.300 -8.901  1.00 2.81   ? 79  HIS A H    3  
ATOM 5553  H HA   . HIS A 1 79  ? -5.368  -11.652 -11.262 1.00 3.21   ? 79  HIS A HA   3  
ATOM 5554  H HB2  . HIS A 1 79  ? -5.700  -14.176 -11.177 1.00 4.67   ? 79  HIS A HB2  3  
ATOM 5555  H HB3  . HIS A 1 79  ? -7.071  -13.871 -10.112 1.00 5.24   ? 79  HIS A HB3  3  
ATOM 5556  H HD1  . HIS A 1 79  ? -7.579  -15.192 -12.966 1.00 6.87   ? 79  HIS A HD1  3  
ATOM 5557  H HD2  . HIS A 1 79  ? -7.696  -11.061 -12.133 1.00 6.37   ? 79  HIS A HD2  3  
ATOM 5558  H HE1  . HIS A 1 79  ? -8.925  -14.108 -14.823 1.00 8.76   ? 79  HIS A HE1  3  
ATOM 5559  N N    . SER A 1 80  ? -6.577  -9.909  -9.943  1.00 2.86   ? 80  SER A N    3  
ATOM 5560  C CA   . SER A 1 80  ? -7.534  -8.888  -9.476  1.00 3.44   ? 80  SER A CA   3  
ATOM 5561  C C    . SER A 1 80  ? -8.783  -8.882  -10.375 1.00 3.55   ? 80  SER A C    3  
ATOM 5562  O O    . SER A 1 80  ? -9.828  -9.431  -10.009 1.00 4.85   ? 80  SER A O    3  
ATOM 5563  C CB   . SER A 1 80  ? -6.854  -7.503  -9.417  1.00 3.67   ? 80  SER A CB   3  
ATOM 5564  O OG   . SER A 1 80  ? -7.731  -6.531  -8.852  1.00 5.09   ? 80  SER A OG   3  
ATOM 5565  H H    . SER A 1 80  ? -5.781  -9.628  -10.509 1.00 2.40   ? 80  SER A H    3  
ATOM 5566  H HA   . SER A 1 80  ? -7.868  -9.142  -8.468  1.00 4.30   ? 80  SER A HA   3  
ATOM 5567  H HB2  . SER A 1 80  ? -5.956  -7.575  -8.799  1.00 3.79   ? 80  SER A HB2  3  
ATOM 5568  H HB3  . SER A 1 80  ? -6.551  -7.192  -10.421 1.00 3.43   ? 80  SER A HB3  3  
ATOM 5569  H HG   . SER A 1 80  ? -7.622  -5.672  -9.312  1.00 5.70   ? 80  SER A HG   3  
ATOM 5570  N N    . GLY A 1 81  ? -8.653  -8.305  -11.582 1.00 2.75   ? 81  GLY A N    3  
ATOM 5571  C CA   . GLY A 1 81  ? -9.733  -8.152  -12.559 1.00 3.11   ? 81  GLY A CA   3  
ATOM 5572  C C    . GLY A 1 81  ? -9.228  -7.989  -13.993 1.00 2.93   ? 81  GLY A C    3  
ATOM 5573  O O    . GLY A 1 81  ? -9.470  -6.953  -14.605 1.00 3.58   ? 81  GLY A O    3  
ATOM 5574  H H    . GLY A 1 81  ? -7.782  -7.834  -11.770 1.00 2.61   ? 81  GLY A H    3  
ATOM 5575  H HA2  . GLY A 1 81  ? -10.400 -9.014  -12.506 1.00 3.56   ? 81  GLY A HA2  3  
ATOM 5576  H HA3  . GLY A 1 81  ? -10.315 -7.269  -12.300 1.00 3.51   ? 81  GLY A HA3  3  
ATOM 5577  N N    . GLY A 1 82  ? -8.531  -9.008  -14.518 1.00 2.87   ? 82  GLY A N    3  
ATOM 5578  C CA   . GLY A 1 82  ? -8.069  -9.069  -15.914 1.00 3.14   ? 82  GLY A CA   3  
ATOM 5579  C C    . GLY A 1 82  ? -6.561  -8.865  -16.087 1.00 2.92   ? 82  GLY A C    3  
ATOM 5580  O O    . GLY A 1 82  ? -6.055  -9.012  -17.200 1.00 3.32   ? 82  GLY A O    3  
ATOM 5581  H H    . GLY A 1 82  ? -8.371  -9.832  -13.950 1.00 3.25   ? 82  GLY A H    3  
ATOM 5582  H HA2  . GLY A 1 82  ? -8.292  -10.062 -16.300 1.00 3.58   ? 82  GLY A HA2  3  
ATOM 5583  H HA3  . GLY A 1 82  ? -8.579  -8.320  -16.518 1.00 3.35   ? 82  GLY A HA3  3  
ATOM 5584  N N    . MET A 1 83  ? -5.859  -8.585  -14.982 1.00 2.50   ? 83  MET A N    3  
ATOM 5585  C CA   . MET A 1 83  ? -4.404  -8.569  -14.834 1.00 2.37   ? 83  MET A CA   3  
ATOM 5586  C C    . MET A 1 83  ? -3.990  -9.518  -13.696 1.00 2.30   ? 83  MET A C    3  
ATOM 5587  O O    . MET A 1 83  ? -4.755  -9.678  -12.737 1.00 2.55   ? 83  MET A O    3  
ATOM 5588  C CB   . MET A 1 83  ? -3.949  -7.118  -14.573 1.00 2.31   ? 83  MET A CB   3  
ATOM 5589  C CG   . MET A 1 83  ? -2.429  -6.944  -14.449 1.00 2.75   ? 83  MET A CG   3  
ATOM 5590  S SD   . MET A 1 83  ? -1.500  -7.412  -15.929 1.00 4.13   ? 83  MET A SD   3  
ATOM 5591  C CE   . MET A 1 83  ? 0.178   -7.125  -15.310 1.00 4.80   ? 83  MET A CE   3  
ATOM 5592  H H    . MET A 1 83  ? -6.395  -8.524  -14.131 1.00 2.47   ? 83  MET A H    3  
ATOM 5593  H HA   . MET A 1 83  ? -3.967  -8.933  -15.759 1.00 2.64   ? 83  MET A HA   3  
ATOM 5594  H HB2  . MET A 1 83  ? -4.298  -6.488  -15.394 1.00 2.49   ? 83  MET A HB2  3  
ATOM 5595  H HB3  . MET A 1 83  ? -4.413  -6.761  -13.650 1.00 2.37   ? 83  MET A HB3  3  
ATOM 5596  H HG2  . MET A 1 83  ? -2.217  -5.897  -14.239 1.00 2.73   ? 83  MET A HG2  3  
ATOM 5597  H HG3  . MET A 1 83  ? -2.062  -7.526  -13.603 1.00 3.34   ? 83  MET A HG3  3  
ATOM 5598  H HE1  . MET A 1 83  ? 0.893   -7.252  -16.129 1.00 5.22   ? 83  MET A HE1  3  
ATOM 5599  H HE2  . MET A 1 83  ? 0.272   -6.117  -14.914 1.00 4.93   ? 83  MET A HE2  3  
ATOM 5600  H HE3  . MET A 1 83  ? 0.408   -7.849  -14.526 1.00 5.44   ? 83  MET A HE3  3  
ATOM 5601  N N    . ALA A 1 84  ? -2.802  -10.134 -13.795 1.00 2.23   ? 84  ALA A N    3  
ATOM 5602  C CA   . ALA A 1 84  ? -2.334  -11.169 -12.865 1.00 2.33   ? 84  ALA A CA   3  
ATOM 5603  C C    . ALA A 1 84  ? -0.794  -11.309 -12.829 1.00 2.53   ? 84  ALA A C    3  
ATOM 5604  O O    . ALA A 1 84  ? -0.098  -10.666 -13.603 1.00 2.71   ? 84  ALA A O    3  
ATOM 5605  C CB   . ALA A 1 84  ? -3.029  -12.500 -13.208 1.00 2.83   ? 84  ALA A CB   3  
ATOM 5606  H H    . ALA A 1 84  ? -2.188  -9.887  -14.562 1.00 2.31   ? 84  ALA A H    3  
ATOM 5607  H HA   . ALA A 1 84  ? -2.638  -10.875 -11.865 1.00 2.16   ? 84  ALA A HA   3  
ATOM 5608  H HB1  . ALA A 1 84  ? -4.109  -12.372 -13.216 1.00 3.39   ? 84  ALA A HB1  3  
ATOM 5609  H HB2  . ALA A 1 84  ? -2.703  -12.841 -14.192 1.00 2.77   ? 84  ALA A HB2  3  
ATOM 5610  H HB3  . ALA A 1 84  ? -2.777  -13.262 -12.467 1.00 3.77   ? 84  ALA A HB3  3  
ATOM 5611  N N    . GLY A 1 85  ? -0.262  -12.140 -11.919 1.00 2.75   ? 85  GLY A N    3  
ATOM 5612  C CA   . GLY A 1 85  ? 1.167   -12.424 -11.742 1.00 3.17   ? 85  GLY A CA   3  
ATOM 5613  C C    . GLY A 1 85  ? 1.477   -12.918 -10.326 1.00 3.31   ? 85  GLY A C    3  
ATOM 5614  O O    . GLY A 1 85  ? 0.623   -13.534 -9.682  1.00 3.98   ? 85  GLY A O    3  
ATOM 5615  H H    . GLY A 1 85  ? -0.870  -12.623 -11.280 1.00 2.80   ? 85  GLY A H    3  
ATOM 5616  H HA2  . GLY A 1 85  ? 1.472   -13.194 -12.449 1.00 3.75   ? 85  GLY A HA2  3  
ATOM 5617  H HA3  . GLY A 1 85  ? 1.752   -11.530 -11.964 1.00 3.20   ? 85  GLY A HA3  3  
ATOM 5618  N N    . MET A 1 86  ? 2.689   -12.610 -9.854  1.00 3.13   ? 86  MET A N    3  
ATOM 5619  C CA   . MET A 1 86  ? 3.146   -12.720 -8.454  1.00 3.35   ? 86  MET A CA   3  
ATOM 5620  C C    . MET A 1 86  ? 4.440   -11.909 -8.241  1.00 2.99   ? 86  MET A C    3  
ATOM 5621  O O    . MET A 1 86  ? 5.393   -12.079 -9.003  1.00 3.48   ? 86  MET A O    3  
ATOM 5622  C CB   . MET A 1 86  ? 3.347   -14.203 -8.071  1.00 4.62   ? 86  MET A CB   3  
ATOM 5623  C CG   . MET A 1 86  ? 3.865   -14.399 -6.639  1.00 5.93   ? 86  MET A CG   3  
ATOM 5624  S SD   . MET A 1 86  ? 4.142   -16.130 -6.202  1.00 7.19   ? 86  MET A SD   3  
ATOM 5625  C CE   . MET A 1 86  ? 5.023   -15.881 -4.637  1.00 8.47   ? 86  MET A CE   3  
ATOM 5626  H H    . MET A 1 86  ? 3.287   -12.114 -10.497 1.00 3.14   ? 86  MET A H    3  
ATOM 5627  H HA   . MET A 1 86  ? 2.371   -12.315 -7.798  1.00 3.23   ? 86  MET A HA   3  
ATOM 5628  H HB2  . MET A 1 86  ? 2.398   -14.734 -8.164  1.00 5.19   ? 86  MET A HB2  3  
ATOM 5629  H HB3  . MET A 1 86  ? 4.057   -14.661 -8.761  1.00 4.60   ? 86  MET A HB3  3  
ATOM 5630  H HG2  . MET A 1 86  ? 4.815   -13.881 -6.530  1.00 6.09   ? 86  MET A HG2  3  
ATOM 5631  H HG3  . MET A 1 86  ? 3.156   -13.967 -5.931  1.00 6.50   ? 86  MET A HG3  3  
ATOM 5632  H HE1  . MET A 1 86  ? 4.407   -15.317 -3.940  1.00 8.95   ? 86  MET A HE1  3  
ATOM 5633  H HE2  . MET A 1 86  ? 5.265   -16.847 -4.197  1.00 9.48   ? 86  MET A HE2  3  
ATOM 5634  H HE3  . MET A 1 86  ? 5.956   -15.340 -4.821  1.00 8.22   ? 86  MET A HE3  3  
ATOM 5635  N N    . LYS A 1 87  ? 4.500   -11.086 -7.184  1.00 2.71   ? 87  LYS A N    3  
ATOM 5636  C CA   . LYS A 1 87  ? 5.750   -10.522 -6.640  1.00 2.68   ? 87  LYS A CA   3  
ATOM 5637  C C    . LYS A 1 87  ? 6.530   -9.630  -7.644  1.00 2.03   ? 87  LYS A C    3  
ATOM 5638  O O    . LYS A 1 87  ? 7.744   -9.752  -7.769  1.00 2.18   ? 87  LYS A O    3  
ATOM 5639  C CB   . LYS A 1 87  ? 6.558   -11.694 -6.010  1.00 3.90   ? 87  LYS A CB   3  
ATOM 5640  C CG   . LYS A 1 87  ? 7.927   -11.431 -5.345  1.00 4.40   ? 87  LYS A CG   3  
ATOM 5641  C CD   . LYS A 1 87  ? 8.038   -10.103 -4.582  1.00 5.48   ? 87  LYS A CD   3  
ATOM 5642  C CE   . LYS A 1 87  ? 9.139   -10.135 -3.522  1.00 6.76   ? 87  LYS A CE   3  
ATOM 5643  N NZ   . LYS A 1 87  ? 10.488  -10.011 -4.121  1.00 7.45   ? 87  LYS A NZ   3  
ATOM 5644  H H    . LYS A 1 87  ? 3.652   -10.960 -6.648  1.00 2.98   ? 87  LYS A H    3  
ATOM 5645  H HA   . LYS A 1 87  ? 5.468   -9.860  -5.821  1.00 3.11   ? 87  LYS A HA   3  
ATOM 5646  H HB2  . LYS A 1 87  ? 5.922   -12.137 -5.239  1.00 4.95   ? 87  LYS A HB2  3  
ATOM 5647  H HB3  . LYS A 1 87  ? 6.725   -12.462 -6.764  1.00 4.32   ? 87  LYS A HB3  3  
ATOM 5648  H HG2  . LYS A 1 87  ? 8.118   -12.254 -4.656  1.00 5.21   ? 87  LYS A HG2  3  
ATOM 5649  H HG3  . LYS A 1 87  ? 8.709   -11.463 -6.106  1.00 4.18   ? 87  LYS A HG3  3  
ATOM 5650  H HD2  . LYS A 1 87  ? 8.238   -9.296  -5.281  1.00 5.48   ? 87  LYS A HD2  3  
ATOM 5651  H HD3  . LYS A 1 87  ? 7.098   -9.902  -4.083  1.00 6.20   ? 87  LYS A HD3  3  
ATOM 5652  H HE2  . LYS A 1 87  ? 8.966   -9.322  -2.808  1.00 7.33   ? 87  LYS A HE2  3  
ATOM 5653  H HE3  . LYS A 1 87  ? 9.060   -11.074 -2.967  1.00 7.15   ? 87  LYS A HE3  3  
ATOM 5654  H HZ1  . LYS A 1 87  ? 11.184  -10.346 -3.460  1.00 8.03   ? 87  LYS A HZ1  3  
ATOM 5655  H HZ2  . LYS A 1 87  ? 10.576  -10.597 -4.950  1.00 7.47   ? 87  LYS A HZ2  3  
ATOM 5656  H HZ3  . LYS A 1 87  ? 10.691  -9.060  -4.392  1.00 7.82   ? 87  LYS A HZ3  3  
ATOM 5657  N N    . MET A 1 88  ? 5.869   -8.667  -8.308  1.00 2.61   ? 88  MET A N    3  
ATOM 5658  C CA   . MET A 1 88  ? 6.530   -7.699  -9.217  1.00 3.10   ? 88  MET A CA   3  
ATOM 5659  C C    . MET A 1 88  ? 5.882   -6.303  -9.185  1.00 2.91   ? 88  MET A C    3  
ATOM 5660  O O    . MET A 1 88  ? 5.023   -6.017  -10.011 1.00 3.90   ? 88  MET A O    3  
ATOM 5661  C CB   . MET A 1 88  ? 6.544   -8.231  -10.671 1.00 4.56   ? 88  MET A CB   3  
ATOM 5662  C CG   . MET A 1 88  ? 7.316   -9.539  -10.880 1.00 5.45   ? 88  MET A CG   3  
ATOM 5663  S SD   . MET A 1 88  ? 7.590   -9.990  -12.615 1.00 6.89   ? 88  MET A SD   3  
ATOM 5664  C CE   . MET A 1 88  ? 5.880   -10.258 -13.156 1.00 8.65   ? 88  MET A CE   3  
ATOM 5665  H H    . MET A 1 88  ? 4.855   -8.658  -8.255  1.00 3.36   ? 88  MET A H    3  
ATOM 5666  H HA   . MET A 1 88  ? 7.561   -7.561  -8.895  1.00 3.07   ? 88  MET A HA   3  
ATOM 5667  H HB2  . MET A 1 88  ? 5.517   -8.373  -11.006 1.00 5.44   ? 88  MET A HB2  3  
ATOM 5668  H HB3  . MET A 1 88  ? 7.002   -7.469  -11.306 1.00 4.65   ? 88  MET A HB3  3  
ATOM 5669  H HG2  . MET A 1 88  ? 8.297   -9.443  -10.410 1.00 5.13   ? 88  MET A HG2  3  
ATOM 5670  H HG3  . MET A 1 88  ? 6.789   -10.351 -10.386 1.00 5.96   ? 88  MET A HG3  3  
ATOM 5671  H HE1  . MET A 1 88  ? 5.329   -9.321  -13.144 1.00 9.02   ? 88  MET A HE1  3  
ATOM 5672  H HE2  . MET A 1 88  ? 5.872   -10.652 -14.177 1.00 9.31   ? 88  MET A HE2  3  
ATOM 5673  H HE3  . MET A 1 88  ? 5.395   -10.983 -12.504 1.00 9.30   ? 88  MET A HE3  3  
ATOM 5674  N N    . VAL A 1 89  ? 6.319   -5.435  -8.250  1.00 2.11   ? 89  VAL A N    3  
ATOM 5675  C CA   . VAL A 1 89  ? 5.832   -4.041  -8.050  1.00 1.86   ? 89  VAL A CA   3  
ATOM 5676  C C    . VAL A 1 89  ? 4.383   -4.064  -7.497  1.00 1.60   ? 89  VAL A C    3  
ATOM 5677  O O    . VAL A 1 89  ? 3.751   -5.116  -7.587  1.00 2.28   ? 89  VAL A O    3  
ATOM 5678  C CB   . VAL A 1 89  ? 5.978   -3.174  -9.342  1.00 2.36   ? 89  VAL A CB   3  
ATOM 5679  C CG1  . VAL A 1 89  ? 5.699   -1.680  -9.110  1.00 2.57   ? 89  VAL A CG1  3  
ATOM 5680  C CG2  . VAL A 1 89  ? 7.416   -3.268  -9.900  1.00 2.98   ? 89  VAL A CG2  3  
ATOM 5681  H H    . VAL A 1 89  ? 7.050   -5.738  -7.633  1.00 2.20   ? 89  VAL A H    3  
ATOM 5682  H HA   . VAL A 1 89  ? 6.477   -3.605  -7.288  1.00 1.92   ? 89  VAL A HA   3  
ATOM 5683  H HB   . VAL A 1 89  ? 5.284   -3.517  -10.105 1.00 3.36   ? 89  VAL A HB   3  
ATOM 5684  H HG11 . VAL A 1 89  ? 5.929   -1.109  -10.012 1.00 3.24   ? 89  VAL A HG11 3  
ATOM 5685  H HG12 . VAL A 1 89  ? 4.647   -1.525  -8.892  1.00 3.67   ? 89  VAL A HG12 3  
ATOM 5686  H HG13 . VAL A 1 89  ? 6.309   -1.303  -8.288  1.00 2.49   ? 89  VAL A HG13 3  
ATOM 5687  H HG21 . VAL A 1 89  ? 7.524   -2.623  -10.770 1.00 3.66   ? 89  VAL A HG21 3  
ATOM 5688  H HG22 . VAL A 1 89  ? 8.134   -2.962  -9.138  1.00 3.05   ? 89  VAL A HG22 3  
ATOM 5689  H HG23 . VAL A 1 89  ? 7.642   -4.288  -10.215 1.00 3.90   ? 89  VAL A HG23 3  
ATOM 5690  N N    . PRO A 1 90  ? 3.846   -3.025  -6.816  1.00 1.20   ? 90  PRO A N    3  
ATOM 5691  C CA   . PRO A 1 90  ? 2.429   -2.989  -6.456  1.00 1.35   ? 90  PRO A CA   3  
ATOM 5692  C C    . PRO A 1 90  ? 1.560   -2.326  -7.513  1.00 1.65   ? 90  PRO A C    3  
ATOM 5693  O O    . PRO A 1 90  ? 0.420   -2.736  -7.688  1.00 3.31   ? 90  PRO A O    3  
ATOM 5694  C CB   . PRO A 1 90  ? 2.308   -2.176  -5.167  1.00 1.44   ? 90  PRO A CB   3  
ATOM 5695  C CG   . PRO A 1 90  ? 3.744   -1.864  -4.760  1.00 1.62   ? 90  PRO A CG   3  
ATOM 5696  C CD   . PRO A 1 90  ? 4.543   -1.998  -6.056  1.00 1.23   ? 90  PRO A CD   3  
ATOM 5697  H HA   . PRO A 1 90  ? 2.071   -3.996  -6.279  1.00 1.69   ? 90  PRO A HA   3  
ATOM 5698  H HB2  . PRO A 1 90  ? 1.769   -1.242  -5.333  1.00 1.73   ? 90  PRO A HB2  3  
ATOM 5699  H HB3  . PRO A 1 90  ? 1.781   -2.768  -4.425  1.00 1.67   ? 90  PRO A HB3  3  
ATOM 5700  H HG2  . PRO A 1 90  ? 3.826   -0.864  -4.339  1.00 2.04   ? 90  PRO A HG2  3  
ATOM 5701  H HG3  . PRO A 1 90  ? 4.063   -2.610  -4.042  1.00 2.28   ? 90  PRO A HG3  3  
ATOM 5702  H HD2  . PRO A 1 90  ? 4.500   -1.046  -6.580  1.00 1.53   ? 90  PRO A HD2  3  
ATOM 5703  H HD3  . PRO A 1 90  ? 5.577   -2.259  -5.854  1.00 1.74   ? 90  PRO A HD3  3  
ATOM 5704  N N    . TRP A 1 91  ? 2.092   -1.247  -8.109  1.00 1.31   ? 91  TRP A N    3  
ATOM 5705  C CA   . TRP A 1 91  ? 1.391   -0.187  -8.837  1.00 1.46   ? 91  TRP A CA   3  
ATOM 5706  C C    . TRP A 1 91  ? 0.183   0.437   -8.102  1.00 1.86   ? 91  TRP A C    3  
ATOM 5707  O O    . TRP A 1 91  ? -0.326  -0.041  -7.089  1.00 2.43   ? 91  TRP A O    3  
ATOM 5708  C CB   . TRP A 1 91  ? 1.103   -0.614  -10.294 1.00 1.77   ? 91  TRP A CB   3  
ATOM 5709  C CG   . TRP A 1 91  ? 0.395   -1.916  -10.529 1.00 1.98   ? 91  TRP A CG   3  
ATOM 5710  C CD1  . TRP A 1 91  ? -0.911  -2.182  -10.282 1.00 1.85   ? 91  TRP A CD1  3  
ATOM 5711  C CD2  . TRP A 1 91  ? 0.973   -3.175  -10.999 1.00 2.71   ? 91  TRP A CD2  3  
ATOM 5712  N NE1  . TRP A 1 91  ? -1.166  -3.515  -10.536 1.00 2.39   ? 91  TRP A NE1  3  
ATOM 5713  C CE2  . TRP A 1 91  ? -0.055  -4.164  -11.031 1.00 3.00   ? 91  TRP A CE2  3  
ATOM 5714  C CE3  . TRP A 1 91  ? 2.268   -3.595  -11.373 1.00 3.31   ? 91  TRP A CE3  3  
ATOM 5715  C CZ2  . TRP A 1 91  ? 0.175   -5.481  -11.462 1.00 3.86   ? 91  TRP A CZ2  3  
ATOM 5716  C CZ3  . TRP A 1 91  ? 2.511   -4.912  -11.808 1.00 4.15   ? 91  TRP A CZ3  3  
ATOM 5717  C CH2  . TRP A 1 91  ? 1.469   -5.851  -11.867 1.00 4.44   ? 91  TRP A CH2  3  
ATOM 5718  H H    . TRP A 1 91  ? 3.063   -1.059  -7.915  1.00 2.38   ? 91  TRP A H    3  
ATOM 5719  H HA   . TRP A 1 91  ? 2.107   0.627   -8.927  1.00 1.84   ? 91  TRP A HA   3  
ATOM 5720  H HB2  . TRP A 1 91  ? 0.550   0.169   -10.805 1.00 2.05   ? 91  TRP A HB2  3  
ATOM 5721  H HB3  . TRP A 1 91  ? 2.065   -0.687  -10.806 1.00 2.09   ? 91  TRP A HB3  3  
ATOM 5722  H HD1  . TRP A 1 91  ? -1.631  -1.495  -9.858  1.00 1.62   ? 91  TRP A HD1  3  
ATOM 5723  H HE1  . TRP A 1 91  ? -2.011  -3.970  -10.236 1.00 2.44   ? 91  TRP A HE1  3  
ATOM 5724  H HE3  . TRP A 1 91  ? 3.085   -2.896  -11.316 1.00 3.21   ? 91  TRP A HE3  3  
ATOM 5725  H HZ2  . TRP A 1 91  ? -0.630  -6.198  -11.473 1.00 4.15   ? 91  TRP A HZ2  3  
ATOM 5726  H HZ3  . TRP A 1 91  ? 3.513   -5.203  -12.086 1.00 4.64   ? 91  TRP A HZ3  3  
ATOM 5727  H HH2  . TRP A 1 91  ? 1.673   -6.855  -12.200 1.00 5.15   ? 91  TRP A HH2  3  
ATOM 5728  N N    . LEU A 1 92  ? -0.300  1.550   -8.658  1.00 2.06   ? 92  LEU A N    3  
ATOM 5729  C CA   . LEU A 1 92  ? -1.672  2.034   -8.514  1.00 2.69   ? 92  LEU A CA   3  
ATOM 5730  C C    . LEU A 1 92  ? -2.128  2.733   -9.810  1.00 2.21   ? 92  LEU A C    3  
ATOM 5731  O O    . LEU A 1 92  ? -2.958  3.636   -9.777  1.00 2.89   ? 92  LEU A O    3  
ATOM 5732  C CB   . LEU A 1 92  ? -1.821  2.878   -7.228  1.00 4.22   ? 92  LEU A CB   3  
ATOM 5733  C CG   . LEU A 1 92  ? -3.304  3.045   -6.809  1.00 5.09   ? 92  LEU A CG   3  
ATOM 5734  C CD1  . LEU A 1 92  ? -3.519  2.563   -5.369  1.00 6.60   ? 92  LEU A CD1  3  
ATOM 5735  C CD2  . LEU A 1 92  ? -3.868  4.476   -6.845  1.00 6.17   ? 92  LEU A CD2  3  
ATOM 5736  H H    . LEU A 1 92  ? 0.293   2.043   -9.317  1.00 2.01   ? 92  LEU A H    3  
ATOM 5737  H HA   . LEU A 1 92  ? -2.306  1.153   -8.413  1.00 3.09   ? 92  LEU A HA   3  
ATOM 5738  H HB2  . LEU A 1 92  ? -1.277  2.380   -6.424  1.00 4.87   ? 92  LEU A HB2  3  
ATOM 5739  H HB3  . LEU A 1 92  ? -1.352  3.839   -7.371  1.00 4.53   ? 92  LEU A HB3  3  
ATOM 5740  H HG   . LEU A 1 92  ? -3.913  2.442   -7.483  1.00 4.40   ? 92  LEU A HG   3  
ATOM 5741  H HD11 . LEU A 1 92  ? -2.972  1.646   -5.173  1.00 6.91   ? 92  LEU A HD11 3  
ATOM 5742  H HD12 . LEU A 1 92  ? -3.169  3.310   -4.653  1.00 7.12   ? 92  LEU A HD12 3  
ATOM 5743  H HD13 . LEU A 1 92  ? -4.578  2.376   -5.220  1.00 7.44   ? 92  LEU A HD13 3  
ATOM 5744  H HD21 . LEU A 1 92  ? -3.347  5.103   -6.125  1.00 6.84   ? 92  LEU A HD21 3  
ATOM 5745  H HD22 . LEU A 1 92  ? -3.772  4.911   -7.838  1.00 6.21   ? 92  LEU A HD22 3  
ATOM 5746  H HD23 . LEU A 1 92  ? -4.928  4.459   -6.591  1.00 6.90   ? 92  LEU A HD23 3  
ATOM 5747  N N    . THR A 1 93  ? -1.602  2.310   -10.970 1.00 2.05   ? 93  THR A N    3  
ATOM 5748  C CA   . THR A 1 93  ? -2.170  2.655   -12.277 1.00 2.49   ? 93  THR A CA   3  
ATOM 5749  C C    . THR A 1 93  ? -3.311  1.685   -12.558 1.00 2.19   ? 93  THR A C    3  
ATOM 5750  O O    . THR A 1 93  ? -3.154  0.470   -12.453 1.00 2.47   ? 93  THR A O    3  
ATOM 5751  C CB   . THR A 1 93  ? -1.088  2.734   -13.364 1.00 3.67   ? 93  THR A CB   3  
ATOM 5752  O OG1  . THR A 1 93  ? -1.610  3.451   -14.458 1.00 4.18   ? 93  THR A OG1  3  
ATOM 5753  C CG2  . THR A 1 93  ? -0.540  1.397   -13.864 1.00 4.83   ? 93  THR A CG2  3  
ATOM 5754  H H    . THR A 1 93  ? -0.927  1.561   -10.942 1.00 2.36   ? 93  THR A H    3  
ATOM 5755  H HA   . THR A 1 93  ? -2.612  3.646   -12.198 1.00 2.67   ? 93  THR A HA   3  
ATOM 5756  H HB   . THR A 1 93  ? -0.251  3.309   -12.967 1.00 4.31   ? 93  THR A HB   3  
ATOM 5757  H HG1  . THR A 1 93  ? -2.359  2.963   -14.819 1.00 4.44   ? 93  THR A HG1  3  
ATOM 5758  H HG21 . THR A 1 93  ? -0.165  0.810   -13.026 1.00 5.54   ? 93  THR A HG21 3  
ATOM 5759  H HG22 . THR A 1 93  ? -1.313  0.831   -14.379 1.00 4.85   ? 93  THR A HG22 3  
ATOM 5760  H HG23 . THR A 1 93  ? 0.285   1.580   -14.557 1.00 5.82   ? 93  THR A HG23 3  
ATOM 5761  N N    . ILE A 1 94  ? -4.498  2.219   -12.828 1.00 2.02   ? 94  ILE A N    3  
ATOM 5762  C CA   . ILE A 1 94  ? -5.722  1.427   -13.011 1.00 1.88   ? 94  ILE A CA   3  
ATOM 5763  C C    . ILE A 1 94  ? -6.022  1.321   -14.518 1.00 2.06   ? 94  ILE A C    3  
ATOM 5764  O O    . ILE A 1 94  ? -6.255  2.356   -15.145 1.00 2.39   ? 94  ILE A O    3  
ATOM 5765  C CB   . ILE A 1 94  ? -6.890  2.039   -12.185 1.00 2.17   ? 94  ILE A CB   3  
ATOM 5766  C CG1  . ILE A 1 94  ? -6.907  1.555   -10.714 1.00 2.95   ? 94  ILE A CG1  3  
ATOM 5767  C CG2  . ILE A 1 94  ? -8.280  1.695   -12.753 1.00 3.12   ? 94  ILE A CG2  3  
ATOM 5768  C CD1  . ILE A 1 94  ? -5.691  1.943   -9.872  1.00 4.57   ? 94  ILE A CD1  3  
ATOM 5769  H H    . ILE A 1 94  ? -4.559  3.237   -12.885 1.00 2.29   ? 94  ILE A H    3  
ATOM 5770  H HA   . ILE A 1 94  ? -5.548  0.427   -12.622 1.00 2.08   ? 94  ILE A HA   3  
ATOM 5771  H HB   . ILE A 1 94  ? -6.796  3.127   -12.198 1.00 2.90   ? 94  ILE A HB   3  
ATOM 5772  H HG12 . ILE A 1 94  ? -7.782  1.975   -10.215 1.00 3.32   ? 94  ILE A HG12 3  
ATOM 5773  H HG13 . ILE A 1 94  ? -7.002  0.468   -10.697 1.00 3.51   ? 94  ILE A HG13 3  
ATOM 5774  H HG21 . ILE A 1 94  ? -8.389  0.616   -12.877 1.00 3.98   ? 94  ILE A HG21 3  
ATOM 5775  H HG22 . ILE A 1 94  ? -9.058  2.060   -12.082 1.00 3.51   ? 94  ILE A HG22 3  
ATOM 5776  H HG23 . ILE A 1 94  ? -8.432  2.199   -13.704 1.00 3.95   ? 94  ILE A HG23 3  
ATOM 5777  H HD11 . ILE A 1 94  ? -4.809  1.405   -10.210 1.00 5.38   ? 94  ILE A HD11 3  
ATOM 5778  H HD12 . ILE A 1 94  ? -5.525  3.017   -9.942  1.00 4.94   ? 94  ILE A HD12 3  
ATOM 5779  H HD13 . ILE A 1 94  ? -5.877  1.682   -8.832  1.00 5.41   ? 94  ILE A HD13 3  
ATOM 5780  N N    . PRO A 1 95  ? -6.102  0.105   -15.105 1.00 2.30   ? 95  PRO A N    3  
ATOM 5781  C CA   . PRO A 1 95  ? -6.553  -0.104  -16.482 1.00 2.82   ? 95  PRO A CA   3  
ATOM 5782  C C    . PRO A 1 95  ? -8.092  -0.062  -16.563 1.00 2.62   ? 95  PRO A C    3  
ATOM 5783  O O    . PRO A 1 95  ? -8.751  -1.026  -16.938 1.00 3.12   ? 95  PRO A O    3  
ATOM 5784  C CB   . PRO A 1 95  ? -5.927  -1.436  -16.904 1.00 3.49   ? 95  PRO A CB   3  
ATOM 5785  C CG   . PRO A 1 95  ? -5.916  -2.232  -15.601 1.00 3.23   ? 95  PRO A CG   3  
ATOM 5786  C CD   . PRO A 1 95  ? -5.666  -1.164  -14.534 1.00 2.55   ? 95  PRO A CD   3  
ATOM 5787  H HA   . PRO A 1 95  ? -6.158  0.684   -17.125 1.00 3.15   ? 95  PRO A HA   3  
ATOM 5788  H HB2  . PRO A 1 95  ? -6.491  -1.942  -17.688 1.00 3.92   ? 95  PRO A HB2  3  
ATOM 5789  H HB3  . PRO A 1 95  ? -4.903  -1.257  -17.237 1.00 3.92   ? 95  PRO A HB3  3  
ATOM 5790  H HG2  . PRO A 1 95  ? -6.895  -2.685  -15.449 1.00 3.19   ? 95  PRO A HG2  3  
ATOM 5791  H HG3  . PRO A 1 95  ? -5.138  -2.995  -15.601 1.00 3.75   ? 95  PRO A HG3  3  
ATOM 5792  H HD2  . PRO A 1 95  ? -6.224  -1.405  -13.629 1.00 2.42   ? 95  PRO A HD2  3  
ATOM 5793  H HD3  . PRO A 1 95  ? -4.598  -1.111  -14.314 1.00 2.72   ? 95  PRO A HD3  3  
ATOM 5794  N N    . ALA A 1 96  ? -8.651  1.074   -16.136 1.00 2.45   ? 96  ALA A N    3  
ATOM 5795  C CA   . ALA A 1 96  ? -10.039 1.545   -16.268 1.00 2.50   ? 96  ALA A CA   3  
ATOM 5796  C C    . ALA A 1 96  ? -11.203 0.674   -15.779 1.00 2.30   ? 96  ALA A C    3  
ATOM 5797  O O    . ALA A 1 96  ? -12.351 1.106   -15.794 1.00 2.91   ? 96  ALA A O    3  
ATOM 5798  C CB   . ALA A 1 96  ? -10.229 2.054   -17.706 1.00 2.90   ? 96  ALA A CB   3  
ATOM 5799  H H    . ALA A 1 96  ? -7.992  1.792   -15.845 1.00 2.85   ? 96  ALA A H    3  
ATOM 5800  H HA   . ALA A 1 96  ? -10.106 2.356   -15.559 1.00 2.67   ? 96  ALA A HA   3  
ATOM 5801  H HB1  . ALA A 1 96  ? -11.237 2.442   -17.837 1.00 2.73   ? 96  ALA A HB1  3  
ATOM 5802  H HB2  . ALA A 1 96  ? -9.512  2.849   -17.915 1.00 3.82   ? 96  ALA A HB2  3  
ATOM 5803  H HB3  . ALA A 1 96  ? -10.075 1.235   -18.412 1.00 3.38   ? 96  ALA A HB3  3  
ATOM 5804  N N    . ARG A 1 97  ? -10.913 -0.525  -15.291 1.00 2.41   ? 97  ARG A N    3  
ATOM 5805  C CA   . ARG A 1 97  ? -11.878 -1.524  -14.823 1.00 2.22   ? 97  ARG A CA   3  
ATOM 5806  C C    . ARG A 1 97  ? -11.218 -2.554  -13.888 1.00 1.98   ? 97  ARG A C    3  
ATOM 5807  O O    . ARG A 1 97  ? -11.899 -3.405  -13.325 1.00 2.17   ? 97  ARG A O    3  
ATOM 5808  C CB   . ARG A 1 97  ? -12.453 -2.169  -16.104 1.00 2.42   ? 97  ARG A CB   3  
ATOM 5809  C CG   . ARG A 1 97  ? -13.554 -3.229  -15.942 1.00 2.40   ? 97  ARG A CG   3  
ATOM 5810  C CD   . ARG A 1 97  ? -14.086 -3.618  -17.330 1.00 2.72   ? 97  ARG A CD   3  
ATOM 5811  N NE   . ARG A 1 97  ? -15.110 -4.673  -17.244 1.00 3.00   ? 97  ARG A NE   3  
ATOM 5812  C CZ   . ARG A 1 97  ? -15.971 -5.031  -18.190 1.00 3.62   ? 97  ARG A CZ   3  
ATOM 5813  N NH1  . ARG A 1 97  ? -16.010 -4.457  -19.373 1.00 4.28   ? 97  ARG A NH1  3  
ATOM 5814  N NH2  . ARG A 1 97  ? -16.832 -5.988  -17.928 1.00 4.24   ? 97  ARG A NH2  3  
ATOM 5815  H H    . ARG A 1 97  ? -9.988  -0.844  -15.546 1.00 3.20   ? 97  ARG A H    3  
ATOM 5816  H HA   . ARG A 1 97  ? -12.674 -1.012  -14.281 1.00 2.36   ? 97  ARG A HA   3  
ATOM 5817  H HB2  . ARG A 1 97  ? -12.863 -1.374  -16.728 1.00 2.69   ? 97  ARG A HB2  3  
ATOM 5818  H HB3  . ARG A 1 97  ? -11.618 -2.613  -16.647 1.00 3.07   ? 97  ARG A HB3  3  
ATOM 5819  H HG2  . ARG A 1 97  ? -13.148 -4.118  -15.458 1.00 3.04   ? 97  ARG A HG2  3  
ATOM 5820  H HG3  . ARG A 1 97  ? -14.368 -2.824  -15.338 1.00 2.56   ? 97  ARG A HG3  3  
ATOM 5821  H HD2  . ARG A 1 97  ? -14.517 -2.733  -17.802 1.00 3.14   ? 97  ARG A HD2  3  
ATOM 5822  H HD3  . ARG A 1 97  ? -13.256 -3.971  -17.947 1.00 3.22   ? 97  ARG A HD3  3  
ATOM 5823  H HE   . ARG A 1 97  ? -15.151 -5.207  -16.385 1.00 3.34   ? 97  ARG A HE   3  
ATOM 5824  H HH11 . ARG A 1 97  ? -15.272 -3.816  -19.654 1.00 4.39   ? 97  ARG A HH11 3  
ATOM 5825  H HH12 . ARG A 1 97  ? -16.657 -4.797  -20.065 1.00 5.05   ? 97  ARG A HH12 3  
ATOM 5826  H HH21 . ARG A 1 97  ? -16.760 -6.493  -17.047 1.00 4.47   ? 97  ARG A HH21 3  
ATOM 5827  H HH22 . ARG A 1 97  ? -17.531 -6.276  -18.611 1.00 4.86   ? 97  ARG A HH22 3  
ATOM 5828  N N    . GLY A 1 98  ? -9.880  -2.495  -13.759 1.00 1.94   ? 98  GLY A N    3  
ATOM 5829  C CA   . GLY A 1 98  ? -9.079  -3.641  -13.285 1.00 1.90   ? 98  GLY A CA   3  
ATOM 5830  C C    . GLY A 1 98  ? -8.732  -3.589  -11.798 1.00 2.02   ? 98  GLY A C    3  
ATOM 5831  O O    . GLY A 1 98  ? -8.489  -4.639  -11.207 1.00 3.14   ? 98  GLY A O    3  
ATOM 5832  H H    . GLY A 1 98  ? -9.416  -1.646  -14.073 1.00 2.19   ? 98  GLY A H    3  
ATOM 5833  H HA2  . GLY A 1 98  ? -9.625  -4.571  -13.458 1.00 1.89   ? 98  GLY A HA2  3  
ATOM 5834  H HA3  . GLY A 1 98  ? -8.139  -3.672  -13.830 1.00 1.98   ? 98  GLY A HA3  3  
ATOM 5835  N N    . THR A 1 99  ? -8.711  -2.360  -11.262 1.00 1.97   ? 99  THR A N    3  
ATOM 5836  C CA   . THR A 1 99  ? -8.739  -1.987  -9.839  1.00 2.05   ? 99  THR A CA   3  
ATOM 5837  C C    . THR A 1 99  ? -7.538  -2.508  -9.057  1.00 1.65   ? 99  THR A C    3  
ATOM 5838  O O    . THR A 1 99  ? -7.263  -3.707  -8.974  1.00 1.68   ? 99  THR A O    3  
ATOM 5839  C CB   . THR A 1 99  ? -10.083 -2.415  -9.236  1.00 2.50   ? 99  THR A CB   3  
ATOM 5840  O OG1  . THR A 1 99  ? -11.106 -1.893  -10.057 1.00 3.44   ? 99  THR A OG1  3  
ATOM 5841  C CG2  . THR A 1 99  ? -10.307 -1.862  -7.832  1.00 3.21   ? 99  THR A CG2  3  
ATOM 5842  H H    . THR A 1 99  ? -8.972  -1.628  -11.897 1.00 2.63   ? 99  THR A H    3  
ATOM 5843  H HA   . THR A 1 99  ? -8.723  -0.900  -9.778  1.00 2.38   ? 99  THR A HA   3  
ATOM 5844  H HB   . THR A 1 99  ? -10.150 -3.505  -9.213  1.00 2.46   ? 99  THR A HB   3  
ATOM 5845  H HG1  . THR A 1 99  ? -11.083 -0.925  -10.069 1.00 4.33   ? 99  THR A HG1  3  
ATOM 5846  H HG21 . THR A 1 99  ? -11.267 -2.211  -7.459  1.00 3.40   ? 99  THR A HG21 3  
ATOM 5847  H HG22 . THR A 1 99  ? -9.526  -2.217  -7.155  1.00 3.34   ? 99  THR A HG22 3  
ATOM 5848  H HG23 . THR A 1 99  ? -10.307 -0.772  -7.854  1.00 4.59   ? 99  THR A HG23 3  
ATOM 5849  N N    . LEU A 1 100 ? -6.791  -1.591  -8.445  1.00 1.61   ? 100 LEU A N    3  
ATOM 5850  C CA   . LEU A 1 100 ? -5.693  -1.953  -7.563  1.00 1.48   ? 100 LEU A CA   3  
ATOM 5851  C C    . LEU A 1 100 ? -6.191  -2.716  -6.320  1.00 1.18   ? 100 LEU A C    3  
ATOM 5852  O O    . LEU A 1 100 ? -6.947  -2.203  -5.494  1.00 1.25   ? 100 LEU A O    3  
ATOM 5853  C CB   . LEU A 1 100 ? -4.868  -0.701  -7.261  1.00 2.03   ? 100 LEU A CB   3  
ATOM 5854  C CG   . LEU A 1 100 ? -3.622  -0.895  -6.382  1.00 3.19   ? 100 LEU A CG   3  
ATOM 5855  C CD1  . LEU A 1 100 ? -3.939  -0.924  -4.877  1.00 4.43   ? 100 LEU A CD1  3  
ATOM 5856  C CD2  . LEU A 1 100 ? -2.746  -2.099  -6.763  1.00 4.43   ? 100 LEU A CD2  3  
ATOM 5857  H H    . LEU A 1 100 ? -6.968  -0.614  -8.617  1.00 1.88   ? 100 LEU A H    3  
ATOM 5858  H HA   . LEU A 1 100 ? -5.049  -2.629  -8.126  1.00 1.56   ? 100 LEU A HA   3  
ATOM 5859  H HB2  . LEU A 1 100 ? -4.521  -0.306  -8.217  1.00 2.20   ? 100 LEU A HB2  3  
ATOM 5860  H HB3  . LEU A 1 100 ? -5.503  0.061   -6.809  1.00 2.35   ? 100 LEU A HB3  3  
ATOM 5861  H HG   . LEU A 1 100 ? -3.036  -0.008  -6.577  1.00 3.66   ? 100 LEU A HG   3  
ATOM 5862  H HD11 . LEU A 1 100 ? -3.021  -0.756  -4.313  1.00 5.13   ? 100 LEU A HD11 3  
ATOM 5863  H HD12 . LEU A 1 100 ? -4.651  -0.139  -4.623  1.00 4.85   ? 100 LEU A HD12 3  
ATOM 5864  H HD13 . LEU A 1 100 ? -4.355  -1.887  -4.585  1.00 5.17   ? 100 LEU A HD13 3  
ATOM 5865  H HD21 . LEU A 1 100 ? -3.247  -3.038  -6.548  1.00 5.19   ? 100 LEU A HD21 3  
ATOM 5866  H HD22 . LEU A 1 100 ? -2.498  -2.055  -7.823  1.00 4.62   ? 100 LEU A HD22 3  
ATOM 5867  H HD23 . LEU A 1 100 ? -1.821  -2.072  -6.187  1.00 5.48   ? 100 LEU A HD23 3  
ATOM 5868  N N    . THR A 1 101 ? -5.703  -3.952  -6.236  1.00 1.19   ? 101 THR A N    3  
ATOM 5869  C CA   . THR A 1 101 ? -5.856  -4.946  -5.177  1.00 1.35   ? 101 THR A CA   3  
ATOM 5870  C C    . THR A 1 101 ? -4.476  -5.097  -4.563  1.00 1.18   ? 101 THR A C    3  
ATOM 5871  O O    . THR A 1 101 ? -3.588  -5.588  -5.248  1.00 1.81   ? 101 THR A O    3  
ATOM 5872  C CB   . THR A 1 101 ? -6.324  -6.236  -5.874  1.00 2.20   ? 101 THR A CB   3  
ATOM 5873  O OG1  . THR A 1 101 ? -7.709  -6.092  -6.070  1.00 2.88   ? 101 THR A OG1  3  
ATOM 5874  C CG2  . THR A 1 101 ? -6.139  -7.567  -5.142  1.00 2.91   ? 101 THR A CG2  3  
ATOM 5875  H H    . THR A 1 101 ? -5.106  -4.238  -6.995  1.00 1.28   ? 101 THR A H    3  
ATOM 5876  H HA   . THR A 1 101 ? -6.584  -4.627  -4.431  1.00 1.67   ? 101 THR A HA   3  
ATOM 5877  H HB   . THR A 1 101 ? -5.805  -6.300  -6.838  1.00 2.50   ? 101 THR A HB   3  
ATOM 5878  H HG1  . THR A 1 101 ? -7.902  -6.329  -6.994  1.00 3.26   ? 101 THR A HG1  3  
ATOM 5879  H HG21 . THR A 1 101 ? -6.804  -7.621  -4.283  1.00 3.12   ? 101 THR A HG21 3  
ATOM 5880  H HG22 . THR A 1 101 ? -6.390  -8.384  -5.820  1.00 3.85   ? 101 THR A HG22 3  
ATOM 5881  H HG23 . THR A 1 101 ? -5.105  -7.697  -4.825  1.00 3.43   ? 101 THR A HG23 3  
ATOM 5882  N N    . LEU A 1 102 ? -4.270  -4.654  -3.320  1.00 0.99   ? 102 LEU A N    3  
ATOM 5883  C CA   . LEU A 1 102 ? -2.979  -4.667  -2.621  1.00 1.33   ? 102 LEU A CA   3  
ATOM 5884  C C    . LEU A 1 102 ? -3.157  -5.322  -1.241  1.00 1.08   ? 102 LEU A C    3  
ATOM 5885  O O    . LEU A 1 102 ? -3.177  -4.670  -0.202  1.00 1.20   ? 102 LEU A O    3  
ATOM 5886  C CB   . LEU A 1 102 ? -2.424  -3.216  -2.649  1.00 2.04   ? 102 LEU A CB   3  
ATOM 5887  C CG   . LEU A 1 102 ? -1.191  -2.865  -1.792  1.00 2.92   ? 102 LEU A CG   3  
ATOM 5888  C CD1  . LEU A 1 102 ? -0.044  -3.853  -1.969  1.00 4.06   ? 102 LEU A CD1  3  
ATOM 5889  C CD2  . LEU A 1 102 ? -0.677  -1.463  -2.160  1.00 3.58   ? 102 LEU A CD2  3  
ATOM 5890  H H    . LEU A 1 102 ? -5.024  -4.167  -2.844  1.00 1.16   ? 102 LEU A H    3  
ATOM 5891  H HA   . LEU A 1 102 ? -2.283  -5.303  -3.170  1.00 1.79   ? 102 LEU A HA   3  
ATOM 5892  H HB2  . LEU A 1 102 ? -2.182  -2.990  -3.687  1.00 2.76   ? 102 LEU A HB2  3  
ATOM 5893  H HB3  . LEU A 1 102 ? -3.214  -2.528  -2.352  1.00 2.85   ? 102 LEU A HB3  3  
ATOM 5894  H HG   . LEU A 1 102 ? -1.484  -2.861  -0.744  1.00 3.63   ? 102 LEU A HG   3  
ATOM 5895  H HD11 . LEU A 1 102 ? 0.291   -3.833  -3.004  1.00 4.37   ? 102 LEU A HD11 3  
ATOM 5896  H HD12 . LEU A 1 102 ? 0.789   -3.580  -1.324  1.00 5.01   ? 102 LEU A HD12 3  
ATOM 5897  H HD13 . LEU A 1 102 ? -0.378  -4.856  -1.710  1.00 4.65   ? 102 LEU A HD13 3  
ATOM 5898  H HD21 . LEU A 1 102 ? 0.120   -1.169  -1.478  1.00 4.35   ? 102 LEU A HD21 3  
ATOM 5899  H HD22 . LEU A 1 102 ? -0.294  -1.459  -3.182  1.00 3.90   ? 102 LEU A HD22 3  
ATOM 5900  H HD23 . LEU A 1 102 ? -1.484  -0.733  -2.093  1.00 4.09   ? 102 LEU A HD23 3  
ATOM 5901  N N    . GLN A 1 103 ? -3.319  -6.648  -1.230  1.00 0.97   ? 103 GLN A N    3  
ATOM 5902  C CA   . GLN A 1 103 ? -3.458  -7.477  -0.024  1.00 1.00   ? 103 GLN A CA   3  
ATOM 5903  C C    . GLN A 1 103 ? -2.676  -8.780  -0.207  1.00 1.15   ? 103 GLN A C    3  
ATOM 5904  O O    . GLN A 1 103 ? -2.357  -9.149  -1.336  1.00 1.29   ? 103 GLN A O    3  
ATOM 5905  C CB   . GLN A 1 103 ? -4.929  -7.857  0.267   1.00 1.22   ? 103 GLN A CB   3  
ATOM 5906  C CG   . GLN A 1 103 ? -5.900  -6.674  0.470   1.00 1.71   ? 103 GLN A CG   3  
ATOM 5907  C CD   . GLN A 1 103 ? -6.840  -6.386  -0.703  1.00 1.84   ? 103 GLN A CD   3  
ATOM 5908  O OE1  . GLN A 1 103 ? -7.986  -6.021  -0.516  1.00 2.34   ? 103 GLN A OE1  3  
ATOM 5909  N NE2  . GLN A 1 103 ? -6.425  -6.548  -1.936  1.00 2.86   ? 103 GLN A NE2  3  
ATOM 5910  H H    . GLN A 1 103 ? -3.141  -7.145  -2.096  1.00 1.08   ? 103 GLN A H    3  
ATOM 5911  H HA   . GLN A 1 103 ? -3.044  -6.949  0.837   1.00 1.13   ? 103 GLN A HA   3  
ATOM 5912  H HB2  . GLN A 1 103 ? -5.295  -8.564  -0.489  1.00 1.43   ? 103 GLN A HB2  3  
ATOM 5913  H HB3  . GLN A 1 103 ? -4.933  -8.414  1.206   1.00 1.55   ? 103 GLN A HB3  3  
ATOM 5914  H HG2  . GLN A 1 103 ? -6.526  -6.898  1.335   1.00 2.79   ? 103 GLN A HG2  3  
ATOM 5915  H HG3  . GLN A 1 103 ? -5.346  -5.768  0.700   1.00 2.81   ? 103 GLN A HG3  3  
ATOM 5916  H HE21 . GLN A 1 103 ? -5.498  -6.871  -2.133  1.00 2.99   ? 103 GLN A HE21 3  
ATOM 5917  H HE22 . GLN A 1 103 ? -7.105  -6.346  -2.652  1.00 3.84   ? 103 GLN A HE22 3  
ATOM 5918  N N    . ARG A 1 104 ? -2.497  -9.532  0.888   1.00 1.35   ? 104 ARG A N    3  
ATOM 5919  C CA   . ARG A 1 104 ? -1.852  -10.855 0.960   1.00 1.67   ? 104 ARG A CA   3  
ATOM 5920  C C    . ARG A 1 104 ? -2.429  -11.958 0.049   1.00 1.88   ? 104 ARG A C    3  
ATOM 5921  O O    . ARG A 1 104 ? -2.013  -13.108 0.150   1.00 2.23   ? 104 ARG A O    3  
ATOM 5922  C CB   . ARG A 1 104 ? -1.795  -11.311 2.436   1.00 1.83   ? 104 ARG A CB   3  
ATOM 5923  C CG   . ARG A 1 104 ? -3.137  -11.436 3.190   1.00 2.74   ? 104 ARG A CG   3  
ATOM 5924  C CD   . ARG A 1 104 ? -4.059  -12.589 2.747   1.00 3.96   ? 104 ARG A CD   3  
ATOM 5925  N NE   . ARG A 1 104 ? -5.277  -12.118 2.049   1.00 5.48   ? 104 ARG A NE   3  
ATOM 5926  C CZ   . ARG A 1 104 ? -6.435  -11.784 2.611   1.00 6.77   ? 104 ARG A CZ   3  
ATOM 5927  N NH1  . ARG A 1 104 ? -6.602  -11.694 3.913   1.00 6.79   ? 104 ARG A NH1  3  
ATOM 5928  N NH2  . ARG A 1 104 ? -7.464  -11.522 1.844   1.00 8.51   ? 104 ARG A NH2  3  
ATOM 5929  H H    . ARG A 1 104 ? -2.820  -9.158  1.767   1.00 1.39   ? 104 ARG A H    3  
ATOM 5930  H HA   . ARG A 1 104 ? -0.820  -10.716 0.631   1.00 1.76   ? 104 ARG A HA   3  
ATOM 5931  H HB2  . ARG A 1 104 ? -1.263  -12.260 2.501   1.00 2.72   ? 104 ARG A HB2  3  
ATOM 5932  H HB3  . ARG A 1 104 ? -1.189  -10.582 2.978   1.00 2.18   ? 104 ARG A HB3  3  
ATOM 5933  H HG2  . ARG A 1 104 ? -2.895  -11.607 4.239   1.00 3.34   ? 104 ARG A HG2  3  
ATOM 5934  H HG3  . ARG A 1 104 ? -3.676  -10.489 3.146   1.00 3.41   ? 104 ARG A HG3  3  
ATOM 5935  H HD2  . ARG A 1 104 ? -3.511  -13.287 2.112   1.00 4.45   ? 104 ARG A HD2  3  
ATOM 5936  H HD3  . ARG A 1 104 ? -4.352  -13.159 3.630   1.00 4.18   ? 104 ARG A HD3  3  
ATOM 5937  H HE   . ARG A 1 104 ? -5.292  -12.164 1.031   1.00 6.10   ? 104 ARG A HE   3  
ATOM 5938  H HH11 . ARG A 1 104 ? -5.843  -11.920 4.531   1.00 5.78   ? 104 ARG A HH11 3  
ATOM 5939  H HH12 . ARG A 1 104 ? -7.511  -11.443 4.279   1.00 8.13   ? 104 ARG A HH12 3  
ATOM 5940  H HH21 . ARG A 1 104 ? -7.324  -11.544 0.832   1.00 8.84   ? 104 ARG A HH21 3  
ATOM 5941  H HH22 . ARG A 1 104 ? -8.397  -11.382 2.217   1.00 9.70   ? 104 ARG A HH22 3  
ATOM 5942  N N    . ASP A 1 105 ? -3.369  -11.644 -0.848  1.00 1.93   ? 105 ASP A N    3  
ATOM 5943  C CA   . ASP A 1 105 ? -3.893  -12.539 -1.887  1.00 2.19   ? 105 ASP A CA   3  
ATOM 5944  C C    . ASP A 1 105 ? -2.818  -12.957 -2.905  1.00 2.00   ? 105 ASP A C    3  
ATOM 5945  O O    . ASP A 1 105 ? -2.984  -13.954 -3.607  1.00 2.21   ? 105 ASP A O    3  
ATOM 5946  C CB   . ASP A 1 105 ? -5.079  -11.876 -2.600  1.00 2.70   ? 105 ASP A CB   3  
ATOM 5947  C CG   . ASP A 1 105 ? -6.384  -12.108 -1.844  1.00 2.98   ? 105 ASP A CG   3  
ATOM 5948  O OD1  . ASP A 1 105 ? -6.444  -11.757 -0.646  1.00 3.22   ? 105 ASP A OD1  3  
ATOM 5949  O OD2  . ASP A 1 105 ? -7.344  -12.639 -2.447  1.00 3.77   ? 105 ASP A OD2  3  
ATOM 5950  H H    . ASP A 1 105 ? -3.573  -10.662 -0.958  1.00 2.03   ? 105 ASP A H    3  
ATOM 5951  H HA   . ASP A 1 105 ? -4.265  -13.435 -1.398  1.00 2.55   ? 105 ASP A HA   3  
ATOM 5952  H HB2  . ASP A 1 105 ? -4.898  -10.806 -2.717  1.00 3.08   ? 105 ASP A HB2  3  
ATOM 5953  H HB3  . ASP A 1 105 ? -5.185  -12.307 -3.596  1.00 3.17   ? 105 ASP A HB3  3  
ATOM 5954  N N    . GLY A 1 106 ? -1.706  -12.218 -2.951  1.00 1.96   ? 106 GLY A N    3  
ATOM 5955  C CA   . GLY A 1 106 ? -0.424  -12.708 -3.460  1.00 2.48   ? 106 GLY A CA   3  
ATOM 5956  C C    . GLY A 1 106 ? 0.734   -12.256 -2.578  1.00 3.08   ? 106 GLY A C    3  
ATOM 5957  O O    . GLY A 1 106 ? 1.551   -13.070 -2.149  1.00 4.18   ? 106 GLY A O    3  
ATOM 5958  H H    . GLY A 1 106 ? -1.686  -11.405 -2.346  1.00 1.96   ? 106 GLY A H    3  
ATOM 5959  H HA2  . GLY A 1 106 ? -0.422  -13.795 -3.520  1.00 2.64   ? 106 GLY A HA2  3  
ATOM 5960  H HA3  . GLY A 1 106 ? -0.260  -12.303 -4.457  1.00 2.84   ? 106 GLY A HA3  3  
ATOM 5961  N N    . ASP A 1 107 ? 0.760   -10.955 -2.280  1.00 2.74   ? 107 ASP A N    3  
ATOM 5962  C CA   . ASP A 1 107 ? 1.842   -10.198 -1.633  1.00 3.44   ? 107 ASP A CA   3  
ATOM 5963  C C    . ASP A 1 107 ? 1.381   -8.738  -1.411  1.00 2.44   ? 107 ASP A C    3  
ATOM 5964  O O    . ASP A 1 107 ? 0.336   -8.349  -1.928  1.00 2.32   ? 107 ASP A O    3  
ATOM 5965  C CB   . ASP A 1 107 ? 3.116   -10.262 -2.502  1.00 4.90   ? 107 ASP A CB   3  
ATOM 5966  C CG   . ASP A 1 107 ? 4.395   -9.884  -1.748  1.00 6.34   ? 107 ASP A CG   3  
ATOM 5967  O OD1  . ASP A 1 107 ? 4.312   -9.524  -0.545  1.00 6.93   ? 107 ASP A OD1  3  
ATOM 5968  O OD2  . ASP A 1 107 ? 5.458   -9.974  -2.389  1.00 7.29   ? 107 ASP A OD2  3  
ATOM 5969  H H    . ASP A 1 107 ? -0.017  -10.388 -2.593  1.00 2.33   ? 107 ASP A H    3  
ATOM 5970  H HA   . ASP A 1 107 ? 2.054   -10.650 -0.665  1.00 4.05   ? 107 ASP A HA   3  
ATOM 5971  H HB2  . ASP A 1 107 ? 3.257   -11.277 -2.880  1.00 5.71   ? 107 ASP A HB2  3  
ATOM 5972  H HB3  . ASP A 1 107 ? 2.995   -9.608  -3.369  1.00 4.68   ? 107 ASP A HB3  3  
ATOM 5973  N N    . HIS A 1 108 ? 2.137   -7.905  -0.693  1.00 2.03   ? 108 HIS A N    3  
ATOM 5974  C CA   . HIS A 1 108 ? 1.774   -6.516  -0.377  1.00 1.23   ? 108 HIS A CA   3  
ATOM 5975  C C    . HIS A 1 108 ? 2.992   -5.628  -0.008  1.00 1.11   ? 108 HIS A C    3  
ATOM 5976  O O    . HIS A 1 108 ? 4.051   -5.751  -0.629  1.00 1.15   ? 108 HIS A O    3  
ATOM 5977  C CB   . HIS A 1 108 ? 0.558   -6.489  0.586   1.00 1.11   ? 108 HIS A CB   3  
ATOM 5978  C CG   . HIS A 1 108 ? 0.722   -7.170  1.926   1.00 1.84   ? 108 HIS A CG   3  
ATOM 5979  N ND1  . HIS A 1 108 ? 0.523   -6.599  3.165   1.00 3.46   ? 108 HIS A ND1  3  
ATOM 5980  C CD2  . HIS A 1 108 ? 0.899   -8.512  2.136   1.00 2.27   ? 108 HIS A CD2  3  
ATOM 5981  C CE1  . HIS A 1 108 ? 0.586   -7.569  4.089   1.00 4.02   ? 108 HIS A CE1  3  
ATOM 5982  N NE2  . HIS A 1 108 ? 0.804   -8.755  3.503   1.00 3.16   ? 108 HIS A NE2  3  
ATOM 5983  H H    . HIS A 1 108 ? 3.052   -8.251  -0.386  1.00 2.54   ? 108 HIS A H    3  
ATOM 5984  H HA   . HIS A 1 108 ? 1.419   -6.080  -1.308  1.00 1.63   ? 108 HIS A HA   3  
ATOM 5985  H HB2  . HIS A 1 108 ? 0.242   -5.459  0.738   1.00 1.42   ? 108 HIS A HB2  3  
ATOM 5986  H HB3  . HIS A 1 108 ? -0.269  -6.994  0.083   1.00 1.21   ? 108 HIS A HB3  3  
ATOM 5987  H HD1  . HIS A 1 108 ? 0.334   -5.620  3.348   1.00 4.44   ? 108 HIS A HD1  3  
ATOM 5988  H HD2  . HIS A 1 108 ? 1.040   -9.265  1.376   1.00 2.95   ? 108 HIS A HD2  3  
ATOM 5989  H HE1  . HIS A 1 108 ? 0.468   -7.424  5.155   1.00 5.36   ? 108 HIS A HE1  3  
ATOM 5990  N N    . VAL A 1 109 ? 2.854   -4.685  0.934   1.00 1.14   ? 109 VAL A N    3  
ATOM 5991  C CA   . VAL A 1 109 ? 3.909   -3.713  1.273   1.00 0.93   ? 109 VAL A CA   3  
ATOM 5992  C C    . VAL A 1 109 ? 4.332   -3.856  2.742   1.00 0.89   ? 109 VAL A C    3  
ATOM 5993  O O    . VAL A 1 109 ? 3.492   -3.808  3.640   1.00 1.00   ? 109 VAL A O    3  
ATOM 5994  C CB   . VAL A 1 109 ? 3.517   -2.267  0.867   1.00 0.97   ? 109 VAL A CB   3  
ATOM 5995  C CG1  . VAL A 1 109 ? 2.084   -1.882  1.271   1.00 2.08   ? 109 VAL A CG1  3  
ATOM 5996  C CG2  . VAL A 1 109 ? 4.482   -1.212  1.443   1.00 1.50   ? 109 VAL A CG2  3  
ATOM 5997  H H    . VAL A 1 109 ? 1.993   -4.642  1.465   1.00 1.35   ? 109 VAL A H    3  
ATOM 5998  H HA   . VAL A 1 109 ? 4.791   -3.948  0.688   1.00 0.92   ? 109 VAL A HA   3  
ATOM 5999  H HB   . VAL A 1 109 ? 3.569   -2.204  -0.225  1.00 1.44   ? 109 VAL A HB   3  
ATOM 6000  H HG11 . VAL A 1 109 ? 1.883   -0.844  1.001   1.00 2.37   ? 109 VAL A HG11 3  
ATOM 6001  H HG12 . VAL A 1 109 ? 1.359   -2.511  0.754   1.00 2.93   ? 109 VAL A HG12 3  
ATOM 6002  H HG13 . VAL A 1 109 ? 1.964   -2.005  2.341   1.00 3.07   ? 109 VAL A HG13 3  
ATOM 6003  H HG21 . VAL A 1 109 ? 4.274   -0.238  0.996   1.00 2.07   ? 109 VAL A HG21 3  
ATOM 6004  H HG22 . VAL A 1 109 ? 4.364   -1.133  2.524   1.00 2.34   ? 109 VAL A HG22 3  
ATOM 6005  H HG23 . VAL A 1 109 ? 5.513   -1.483  1.221   1.00 2.55   ? 109 VAL A HG23 3  
ATOM 6006  N N    . MET A 1 110 ? 5.634   -4.056  2.964   1.00 0.87   ? 110 MET A N    3  
ATOM 6007  C CA   . MET A 1 110 ? 6.315   -4.166  4.260   1.00 0.94   ? 110 MET A CA   3  
ATOM 6008  C C    . MET A 1 110 ? 7.149   -2.919  4.560   1.00 0.86   ? 110 MET A C    3  
ATOM 6009  O O    . MET A 1 110 ? 7.836   -2.364  3.702   1.00 0.91   ? 110 MET A O    3  
ATOM 6010  C CB   . MET A 1 110 ? 7.253   -5.382  4.281   1.00 1.23   ? 110 MET A CB   3  
ATOM 6011  C CG   . MET A 1 110 ? 6.515   -6.723  4.300   1.00 1.30   ? 110 MET A CG   3  
ATOM 6012  S SD   . MET A 1 110 ? 7.607   -8.172  4.373   1.00 1.75   ? 110 MET A SD   3  
ATOM 6013  C CE   . MET A 1 110 ? 8.341   -7.944  6.018   1.00 2.42   ? 110 MET A CE   3  
ATOM 6014  H H    . MET A 1 110 ? 6.238   -4.049  2.145   1.00 0.89   ? 110 MET A H    3  
ATOM 6015  H HA   . MET A 1 110 ? 5.589   -4.263  5.068   1.00 1.01   ? 110 MET A HA   3  
ATOM 6016  H HB2  . MET A 1 110 ? 7.910   -5.347  3.409   1.00 1.96   ? 110 MET A HB2  3  
ATOM 6017  H HB3  . MET A 1 110 ? 7.875   -5.320  5.174   1.00 2.06   ? 110 MET A HB3  3  
ATOM 6018  H HG2  . MET A 1 110 ? 5.839   -6.755  5.152   1.00 2.11   ? 110 MET A HG2  3  
ATOM 6019  H HG3  . MET A 1 110 ? 5.912   -6.798  3.391   1.00 2.17   ? 110 MET A HG3  3  
ATOM 6020  H HE1  . MET A 1 110 ? 8.925   -8.832  6.279   1.00 3.19   ? 110 MET A HE1  3  
ATOM 6021  H HE2  . MET A 1 110 ? 9.012   -7.082  6.017   1.00 3.42   ? 110 MET A HE2  3  
ATOM 6022  H HE3  . MET A 1 110 ? 7.561   -7.808  6.760   1.00 2.60   ? 110 MET A HE3  3  
ATOM 6023  N N    . LEU A 1 111 ? 7.112   -2.494  5.815   1.00 0.89   ? 111 LEU A N    3  
ATOM 6024  C CA   . LEU A 1 111 ? 7.846   -1.358  6.342   1.00 0.90   ? 111 LEU A CA   3  
ATOM 6025  C C    . LEU A 1 111 ? 9.041   -1.906  7.127   1.00 0.97   ? 111 LEU A C    3  
ATOM 6026  O O    . LEU A 1 111 ? 9.063   -1.900  8.355   1.00 1.25   ? 111 LEU A O    3  
ATOM 6027  C CB   . LEU A 1 111 ? 6.857   -0.499  7.154   1.00 0.96   ? 111 LEU A CB   3  
ATOM 6028  C CG   . LEU A 1 111 ? 5.604   -0.024  6.383   1.00 0.97   ? 111 LEU A CG   3  
ATOM 6029  C CD1  . LEU A 1 111 ? 4.823   0.978   7.247   1.00 2.35   ? 111 LEU A CD1  3  
ATOM 6030  C CD2  . LEU A 1 111 ? 5.963   0.619   5.033   1.00 2.11   ? 111 LEU A CD2  3  
ATOM 6031  H H    . LEU A 1 111 ? 6.545   -3.010  6.477   1.00 0.96   ? 111 LEU A H    3  
ATOM 6032  H HA   . LEU A 1 111 ? 8.250   -0.758  5.526   1.00 0.90   ? 111 LEU A HA   3  
ATOM 6033  H HB2  . LEU A 1 111 ? 6.531   -1.062  8.030   1.00 1.22   ? 111 LEU A HB2  3  
ATOM 6034  H HB3  . LEU A 1 111 ? 7.394   0.375   7.498   1.00 1.26   ? 111 LEU A HB3  3  
ATOM 6035  H HG   . LEU A 1 111 ? 4.953   -0.879  6.192   1.00 1.82   ? 111 LEU A HG   3  
ATOM 6036  H HD11 . LEU A 1 111 ? 3.927   1.304   6.718   1.00 2.93   ? 111 LEU A HD11 3  
ATOM 6037  H HD12 . LEU A 1 111 ? 4.522   0.504   8.181   1.00 3.03   ? 111 LEU A HD12 3  
ATOM 6038  H HD13 . LEU A 1 111 ? 5.445   1.844   7.474   1.00 3.39   ? 111 LEU A HD13 3  
ATOM 6039  H HD21 . LEU A 1 111 ? 6.762   1.347   5.172   1.00 2.87   ? 111 LEU A HD21 3  
ATOM 6040  H HD22 . LEU A 1 111 ? 6.301   -0.142  4.330   1.00 3.13   ? 111 LEU A HD22 3  
ATOM 6041  H HD23 . LEU A 1 111 ? 5.087   1.105   4.605   1.00 2.89   ? 111 LEU A HD23 3  
ATOM 6042  N N    . MET A 1 112 ? 9.989   -2.489  6.382   1.00 0.77   ? 112 MET A N    3  
ATOM 6043  C CA   . MET A 1 112 ? 11.061  -3.329  6.916   1.00 0.78   ? 112 MET A CA   3  
ATOM 6044  C C    . MET A 1 112 ? 12.227  -2.476  7.424   1.00 0.92   ? 112 MET A C    3  
ATOM 6045  O O    . MET A 1 112 ? 12.578  -1.434  6.857   1.00 0.94   ? 112 MET A O    3  
ATOM 6046  C CB   . MET A 1 112 ? 11.503  -4.345  5.844   1.00 0.82   ? 112 MET A CB   3  
ATOM 6047  C CG   . MET A 1 112 ? 12.339  -5.489  6.433   1.00 1.07   ? 112 MET A CG   3  
ATOM 6048  S SD   . MET A 1 112 ? 12.828  -6.771  5.246   1.00 1.91   ? 112 MET A SD   3  
ATOM 6049  C CE   . MET A 1 112 ? 13.628  -7.902  6.412   1.00 2.21   ? 112 MET A CE   3  
ATOM 6050  H H    . MET A 1 112 ? 9.930   -2.410  5.375   1.00 0.70   ? 112 MET A H    3  
ATOM 6051  H HA   . MET A 1 112 ? 10.660  -3.887  7.766   1.00 0.85   ? 112 MET A HA   3  
ATOM 6052  H HB2  . MET A 1 112 ? 10.617  -4.782  5.384   1.00 0.98   ? 112 MET A HB2  3  
ATOM 6053  H HB3  . MET A 1 112 ? 12.077  -3.839  5.067   1.00 0.95   ? 112 MET A HB3  3  
ATOM 6054  H HG2  . MET A 1 112 ? 13.246  -5.078  6.875   1.00 1.40   ? 112 MET A HG2  3  
ATOM 6055  H HG3  . MET A 1 112 ? 11.767  -5.967  7.230   1.00 1.55   ? 112 MET A HG3  3  
ATOM 6056  H HE1  . MET A 1 112 ? 12.902  -8.239  7.150   1.00 3.04   ? 112 MET A HE1  3  
ATOM 6057  H HE2  . MET A 1 112 ? 14.028  -8.769  5.880   1.00 3.13   ? 112 MET A HE2  3  
ATOM 6058  H HE3  . MET A 1 112 ? 14.447  -7.391  6.920   1.00 2.47   ? 112 MET A HE3  3  
ATOM 6059  N N    . GLY A 1 113 ? 12.824  -2.887  8.542   1.00 1.14   ? 113 GLY A N    3  
ATOM 6060  C CA   . GLY A 1 113 ? 13.861  -2.094  9.213   1.00 1.41   ? 113 GLY A CA   3  
ATOM 6061  C C    . GLY A 1 113 ? 13.275  -0.811  9.806   1.00 1.51   ? 113 GLY A C    3  
ATOM 6062  O O    . GLY A 1 113 ? 13.865  0.262   9.665   1.00 1.84   ? 113 GLY A O    3  
ATOM 6063  H H    . GLY A 1 113 ? 12.469  -3.727  9.005   1.00 1.16   ? 113 GLY A H    3  
ATOM 6064  H HA2  . GLY A 1 113 ? 14.299  -2.678  10.022  1.00 1.56   ? 113 GLY A HA2  3  
ATOM 6065  H HA3  . GLY A 1 113 ? 14.628  -1.812  8.493   1.00 1.47   ? 113 GLY A HA3  3  
ATOM 6066  N N    . LEU A 1 114 ? 12.093  -0.889  10.419  1.00 1.41   ? 114 LEU A N    3  
ATOM 6067  C CA   . LEU A 1 114 ? 11.485  0.203   11.172  1.00 1.58   ? 114 LEU A CA   3  
ATOM 6068  C C    . LEU A 1 114 ? 12.278  0.497   12.461  1.00 1.83   ? 114 LEU A C    3  
ATOM 6069  O O    . LEU A 1 114 ? 13.212  -0.207  12.843  1.00 2.69   ? 114 LEU A O    3  
ATOM 6070  C CB   . LEU A 1 114 ? 10.014  -0.161  11.467  1.00 1.69   ? 114 LEU A CB   3  
ATOM 6071  C CG   . LEU A 1 114 ? 9.066   1.053   11.463  1.00 2.06   ? 114 LEU A CG   3  
ATOM 6072  C CD1  . LEU A 1 114 ? 8.503   1.326   10.065  1.00 2.81   ? 114 LEU A CD1  3  
ATOM 6073  C CD2  . LEU A 1 114 ? 7.907   0.806   12.431  1.00 2.65   ? 114 LEU A CD2  3  
ATOM 6074  H H    . LEU A 1 114 ? 11.657  -1.798  10.513  1.00 1.38   ? 114 LEU A H    3  
ATOM 6075  H HA   . LEU A 1 114 ? 11.516  1.099   10.552  1.00 1.97   ? 114 LEU A HA   3  
ATOM 6076  H HB2  . LEU A 1 114 ? 9.651   -0.885  10.734  1.00 2.07   ? 114 LEU A HB2  3  
ATOM 6077  H HB3  . LEU A 1 114 ? 9.983   -0.653  12.440  1.00 1.85   ? 114 LEU A HB3  3  
ATOM 6078  H HG   . LEU A 1 114 ? 9.622   1.930   11.792  1.00 2.17   ? 114 LEU A HG   3  
ATOM 6079  H HD11 . LEU A 1 114 ? 7.900   2.231   10.077  1.00 3.14   ? 114 LEU A HD11 3  
ATOM 6080  H HD12 . LEU A 1 114 ? 9.319   1.448   9.358   1.00 3.80   ? 114 LEU A HD12 3  
ATOM 6081  H HD13 . LEU A 1 114 ? 7.883   0.488   9.751   1.00 3.21   ? 114 LEU A HD13 3  
ATOM 6082  H HD21 . LEU A 1 114 ? 7.329   -0.064  12.114  1.00 3.06   ? 114 LEU A HD21 3  
ATOM 6083  H HD22 . LEU A 1 114 ? 8.299   0.626   13.430  1.00 3.16   ? 114 LEU A HD22 3  
ATOM 6084  H HD23 . LEU A 1 114 ? 7.254   1.680   12.459  1.00 3.41   ? 114 LEU A HD23 3  
ATOM 6085  N N    . LYS A 1 115 ? 11.898  1.577   13.143  1.00 1.57   ? 115 LYS A N    3  
ATOM 6086  C CA   . LYS A 1 115 ? 12.644  2.143   14.274  1.00 2.04   ? 115 LYS A CA   3  
ATOM 6087  C C    . LYS A 1 115 ? 11.829  2.215   15.583  1.00 2.29   ? 115 LYS A C    3  
ATOM 6088  O O    . LYS A 1 115 ? 12.417  2.230   16.661  1.00 2.93   ? 115 LYS A O    3  
ATOM 6089  C CB   . LYS A 1 115 ? 13.175  3.520   13.827  1.00 2.18   ? 115 LYS A CB   3  
ATOM 6090  C CG   . LYS A 1 115 ? 14.049  3.368   12.565  1.00 3.15   ? 115 LYS A CG   3  
ATOM 6091  C CD   . LYS A 1 115 ? 14.864  4.616   12.213  1.00 3.38   ? 115 LYS A CD   3  
ATOM 6092  C CE   . LYS A 1 115 ? 14.003  5.637   11.465  1.00 3.24   ? 115 LYS A CE   3  
ATOM 6093  N NZ   . LYS A 1 115 ? 14.775  6.863   11.164  1.00 4.09   ? 115 LYS A NZ   3  
ATOM 6094  H H    . LYS A 1 115 ? 11.194  2.145   12.714  1.00 1.60   ? 115 LYS A H    3  
ATOM 6095  H HA   . LYS A 1 115 ? 13.506  1.511   14.503  1.00 2.43   ? 115 LYS A HA   3  
ATOM 6096  H HB2  . LYS A 1 115 ? 12.343  4.198   13.625  1.00 2.27   ? 115 LYS A HB2  3  
ATOM 6097  H HB3  . LYS A 1 115 ? 13.778  3.937   14.636  1.00 2.78   ? 115 LYS A HB3  3  
ATOM 6098  H HG2  . LYS A 1 115 ? 14.728  2.534   12.729  1.00 3.98   ? 115 LYS A HG2  3  
ATOM 6099  H HG3  . LYS A 1 115 ? 13.427  3.115   11.704  1.00 3.76   ? 115 LYS A HG3  3  
ATOM 6100  H HD2  . LYS A 1 115 ? 15.281  5.058   13.120  1.00 4.31   ? 115 LYS A HD2  3  
ATOM 6101  H HD3  . LYS A 1 115 ? 15.690  4.317   11.565  1.00 3.73   ? 115 LYS A HD3  3  
ATOM 6102  H HE2  . LYS A 1 115 ? 13.640  5.179   10.540  1.00 3.09   ? 115 LYS A HE2  3  
ATOM 6103  H HE3  . LYS A 1 115 ? 13.130  5.896   12.077  1.00 3.65   ? 115 LYS A HE3  3  
ATOM 6104  H HZ1  . LYS A 1 115 ? 15.695  6.677   10.764  1.00 4.71   ? 115 LYS A HZ1  3  
ATOM 6105  H HZ2  . LYS A 1 115 ? 14.235  7.484   10.580  1.00 4.22   ? 115 LYS A HZ2  3  
ATOM 6106  H HZ3  . LYS A 1 115 ? 14.898  7.386   12.027  1.00 4.68   ? 115 LYS A HZ3  3  
ATOM 6107  N N    . ARG A 1 116 ? 10.489  2.219   15.487  1.00 2.08   ? 116 ARG A N    3  
ATOM 6108  C CA   . ARG A 1 116 ? 9.516   2.142   16.590  1.00 2.46   ? 116 ARG A CA   3  
ATOM 6109  C C    . ARG A 1 116 ? 8.109   1.973   15.974  1.00 1.67   ? 116 ARG A C    3  
ATOM 6110  O O    . ARG A 1 116 ? 7.752   2.818   15.150  1.00 1.62   ? 116 ARG A O    3  
ATOM 6111  C CB   . ARG A 1 116 ? 9.607   3.392   17.502  1.00 3.43   ? 116 ARG A CB   3  
ATOM 6112  C CG   . ARG A 1 116 ? 9.438   3.050   18.993  1.00 4.84   ? 116 ARG A CG   3  
ATOM 6113  C CD   . ARG A 1 116 ? 9.635   4.303   19.861  1.00 5.44   ? 116 ARG A CD   3  
ATOM 6114  N NE   . ARG A 1 116 ? 9.588   3.987   21.307  1.00 6.47   ? 116 ARG A NE   3  
ATOM 6115  C CZ   . ARG A 1 116 ? 9.239   4.820   22.285  1.00 6.94   ? 116 ARG A CZ   3  
ATOM 6116  N NH1  . ARG A 1 116 ? 8.909   6.073   22.045  1.00 6.63   ? 116 ARG A NH1  3  
ATOM 6117  N NH2  . ARG A 1 116 ? 9.172   4.394   23.530  1.00 8.12   ? 116 ARG A NH2  3  
ATOM 6118  H H    . ARG A 1 116 ? 10.105  2.253   14.556  1.00 1.84   ? 116 ARG A H    3  
ATOM 6119  H HA   . ARG A 1 116 ? 9.783   1.268   17.183  1.00 3.02   ? 116 ARG A HA   3  
ATOM 6120  H HB2  . ARG A 1 116 ? 10.577  3.873   17.381  1.00 4.07   ? 116 ARG A HB2  3  
ATOM 6121  H HB3  . ARG A 1 116 ? 8.852   4.123   17.205  1.00 3.20   ? 116 ARG A HB3  3  
ATOM 6122  H HG2  . ARG A 1 116 ? 8.442   2.640   19.161  1.00 5.13   ? 116 ARG A HG2  3  
ATOM 6123  H HG3  . ARG A 1 116 ? 10.185  2.305   19.273  1.00 5.71   ? 116 ARG A HG3  3  
ATOM 6124  H HD2  . ARG A 1 116 ? 10.605  4.750   19.626  1.00 6.06   ? 116 ARG A HD2  3  
ATOM 6125  H HD3  . ARG A 1 116 ? 8.851   5.018   19.609  1.00 4.96   ? 116 ARG A HD3  3  
ATOM 6126  H HE   . ARG A 1 116 ? 9.863   3.051   21.570  1.00 7.20   ? 116 ARG A HE   3  
ATOM 6127  H HH11 . ARG A 1 116 ? 8.868   6.416   21.106  1.00 6.09   ? 116 ARG A HH11 3  
ATOM 6128  H HH12 . ARG A 1 116 ? 8.613   6.693   22.794  1.00 7.23   ? 116 ARG A HH12 3  
ATOM 6129  H HH21 . ARG A 1 116 ? 9.421   3.443   23.780  1.00 8.80   ? 116 ARG A HH21 3  
ATOM 6130  H HH22 . ARG A 1 116 ? 8.906   5.019   24.276  1.00 8.59   ? 116 ARG A HH22 3  
ATOM 6131  N N    . PRO A 1 117 ? 7.370   0.883   16.267  1.00 2.02   ? 117 PRO A N    3  
ATOM 6132  C CA   . PRO A 1 117 ? 6.119   0.556   15.581  1.00 2.12   ? 117 PRO A CA   3  
ATOM 6133  C C    . PRO A 1 117 ? 4.907   1.260   16.199  1.00 1.66   ? 117 PRO A C    3  
ATOM 6134  O O    . PRO A 1 117 ? 5.007   1.864   17.269  1.00 1.98   ? 117 PRO A O    3  
ATOM 6135  C CB   . PRO A 1 117 ? 5.992   -0.964  15.676  1.00 3.47   ? 117 PRO A CB   3  
ATOM 6136  C CG   . PRO A 1 117 ? 6.619   -1.253  17.034  1.00 3.96   ? 117 PRO A CG   3  
ATOM 6137  C CD   . PRO A 1 117 ? 7.772   -0.249  17.092  1.00 3.22   ? 117 PRO A CD   3  
ATOM 6138  H HA   . PRO A 1 117 ? 6.164   0.841   14.531  1.00 2.23   ? 117 PRO A HA   3  
ATOM 6139  H HB2  . PRO A 1 117 ? 4.954   -1.294  15.628  1.00 3.86   ? 117 PRO A HB2  3  
ATOM 6140  H HB3  . PRO A 1 117 ? 6.584   -1.430  14.887  1.00 3.96   ? 117 PRO A HB3  3  
ATOM 6141  H HG2  . PRO A 1 117 ? 5.896   -1.040  17.823  1.00 4.11   ? 117 PRO A HG2  3  
ATOM 6142  H HG3  . PRO A 1 117 ? 6.970   -2.283  17.103  1.00 4.89   ? 117 PRO A HG3  3  
ATOM 6143  H HD2  . PRO A 1 117 ? 7.947   0.058   18.122  1.00 3.68   ? 117 PRO A HD2  3  
ATOM 6144  H HD3  . PRO A 1 117 ? 8.668   -0.713  16.677  1.00 3.44   ? 117 PRO A HD3  3  
ATOM 6145  N N    . LEU A 1 118 ? 3.773   1.173   15.490  1.00 1.51   ? 118 LEU A N    3  
ATOM 6146  C CA   . LEU A 1 118 ? 2.500   1.808   15.817  1.00 1.19   ? 118 LEU A CA   3  
ATOM 6147  C C    . LEU A 1 118 ? 1.351   0.782   15.910  1.00 1.45   ? 118 LEU A C    3  
ATOM 6148  O O    . LEU A 1 118 ? 1.408   -0.321  15.356  1.00 1.94   ? 118 LEU A O    3  
ATOM 6149  C CB   . LEU A 1 118 ? 2.196   2.917   14.784  1.00 1.36   ? 118 LEU A CB   3  
ATOM 6150  C CG   . LEU A 1 118 ? 3.368   3.910   14.560  1.00 1.94   ? 118 LEU A CG   3  
ATOM 6151  C CD1  . LEU A 1 118 ? 4.225   3.524   13.338  1.00 2.79   ? 118 LEU A CD1  3  
ATOM 6152  C CD2  . LEU A 1 118 ? 2.858   5.345   14.376  1.00 2.41   ? 118 LEU A CD2  3  
ATOM 6153  H H    . LEU A 1 118 ? 3.805   0.671   14.619  1.00 2.00   ? 118 LEU A H    3  
ATOM 6154  H HA   . LEU A 1 118 ? 2.576   2.289   16.794  1.00 1.42   ? 118 LEU A HA   3  
ATOM 6155  H HB2  . LEU A 1 118 ? 1.917   2.467   13.828  1.00 1.78   ? 118 LEU A HB2  3  
ATOM 6156  H HB3  . LEU A 1 118 ? 1.332   3.473   15.147  1.00 1.61   ? 118 LEU A HB3  3  
ATOM 6157  H HG   . LEU A 1 118 ? 4.011   3.903   15.441  1.00 2.32   ? 118 LEU A HG   3  
ATOM 6158  H HD11 . LEU A 1 118 ? 5.033   4.242   13.216  1.00 4.13   ? 118 LEU A HD11 3  
ATOM 6159  H HD12 . LEU A 1 118 ? 4.665   2.537   13.468  1.00 3.14   ? 118 LEU A HD12 3  
ATOM 6160  H HD13 . LEU A 1 118 ? 3.617   3.516   12.435  1.00 2.85   ? 118 LEU A HD13 3  
ATOM 6161  H HD21 . LEU A 1 118 ? 3.689   6.010   14.145  1.00 3.01   ? 118 LEU A HD21 3  
ATOM 6162  H HD22 . LEU A 1 118 ? 2.124   5.387   13.571  1.00 2.65   ? 118 LEU A HD22 3  
ATOM 6163  H HD23 . LEU A 1 118 ? 2.392   5.686   15.299  1.00 3.07   ? 118 LEU A HD23 3  
ATOM 6164  N N    . LYS A 1 119 ? 0.304   1.161   16.643  1.00 1.37   ? 119 LYS A N    3  
ATOM 6165  C CA   . LYS A 1 119 ? -0.852  0.326   17.012  1.00 1.57   ? 119 LYS A CA   3  
ATOM 6166  C C    . LYS A 1 119 ? -2.162  0.878   16.416  1.00 1.07   ? 119 LYS A C    3  
ATOM 6167  O O    . LYS A 1 119 ? -2.231  2.050   16.057  1.00 1.05   ? 119 LYS A O    3  
ATOM 6168  C CB   . LYS A 1 119 ? -0.896  0.276   18.552  1.00 2.18   ? 119 LYS A CB   3  
ATOM 6169  C CG   . LYS A 1 119 ? -1.037  1.670   19.191  1.00 2.26   ? 119 LYS A CG   3  
ATOM 6170  C CD   . LYS A 1 119 ? -1.096  1.578   20.714  1.00 2.51   ? 119 LYS A CD   3  
ATOM 6171  C CE   . LYS A 1 119 ? -1.286  2.984   21.295  1.00 3.55   ? 119 LYS A CE   3  
ATOM 6172  N NZ   . LYS A 1 119 ? -1.691  2.919   22.715  1.00 3.97   ? 119 LYS A NZ   3  
ATOM 6173  H H    . LYS A 1 119 ? 0.311   2.111   16.994  1.00 1.32   ? 119 LYS A H    3  
ATOM 6174  H HA   . LYS A 1 119 ? -0.702  -0.695  16.637  1.00 1.99   ? 119 LYS A HA   3  
ATOM 6175  H HB2  . LYS A 1 119 ? -1.737  -0.342  18.860  1.00 2.68   ? 119 LYS A HB2  3  
ATOM 6176  H HB3  . LYS A 1 119 ? 0.019   -0.193  18.921  1.00 3.52   ? 119 LYS A HB3  3  
ATOM 6177  H HG2  . LYS A 1 119 ? -0.189  2.295   18.927  1.00 3.47   ? 119 LYS A HG2  3  
ATOM 6178  H HG3  . LYS A 1 119 ? -1.952  2.149   18.840  1.00 2.46   ? 119 LYS A HG3  3  
ATOM 6179  H HD2  . LYS A 1 119 ? -1.945  0.952   20.995  1.00 2.55   ? 119 LYS A HD2  3  
ATOM 6180  H HD3  . LYS A 1 119 ? -0.175  1.136   21.105  1.00 3.29   ? 119 LYS A HD3  3  
ATOM 6181  H HE2  . LYS A 1 119 ? -0.347  3.530   21.199  1.00 4.42   ? 119 LYS A HE2  3  
ATOM 6182  H HE3  . LYS A 1 119 ? -2.063  3.503   20.717  1.00 4.02   ? 119 LYS A HE3  3  
ATOM 6183  H HZ1  . LYS A 1 119 ? -1.784  3.845   23.104  1.00 4.68   ? 119 LYS A HZ1  3  
ATOM 6184  H HZ2  . LYS A 1 119 ? -2.607  2.483   22.763  1.00 3.95   ? 119 LYS A HZ2  3  
ATOM 6185  H HZ3  . LYS A 1 119 ? -1.040  2.355   23.258  1.00 4.59   ? 119 LYS A HZ3  3  
ATOM 6186  N N    . VAL A 1 120 ? -3.220  0.064   16.344  1.00 1.24   ? 120 VAL A N    3  
ATOM 6187  C CA   . VAL A 1 120 ? -4.483  0.334   15.583  1.00 1.27   ? 120 VAL A CA   3  
ATOM 6188  C C    . VAL A 1 120 ? -4.916  1.822   15.565  1.00 1.54   ? 120 VAL A C    3  
ATOM 6189  O O    . VAL A 1 120 ? -4.827  2.546   14.570  1.00 2.73   ? 120 VAL A O    3  
ATOM 6190  C CB   . VAL A 1 120 ? -5.621  -0.624  16.030  1.00 1.48   ? 120 VAL A CB   3  
ATOM 6191  C CG1  . VAL A 1 120 ? -5.659  -0.934  17.537  1.00 1.64   ? 120 VAL A CG1  3  
ATOM 6192  C CG2  . VAL A 1 120 ? -7.034  -0.189  15.589  1.00 2.57   ? 120 VAL A CG2  3  
ATOM 6193  H H    . VAL A 1 120 ? -3.071  -0.852  16.744  1.00 1.66   ? 120 VAL A H    3  
ATOM 6194  H HA   . VAL A 1 120 ? -4.299  0.084   14.549  1.00 1.46   ? 120 VAL A HA   3  
ATOM 6195  H HB   . VAL A 1 120 ? -5.412  -1.564  15.522  1.00 2.15   ? 120 VAL A HB   3  
ATOM 6196  H HG11 . VAL A 1 120 ? -5.799  -0.025  18.121  1.00 2.44   ? 120 VAL A HG11 3  
ATOM 6197  H HG12 . VAL A 1 120 ? -6.484  -1.617  17.755  1.00 2.32   ? 120 VAL A HG12 3  
ATOM 6198  H HG13 . VAL A 1 120 ? -4.734  -1.417  17.852  1.00 2.50   ? 120 VAL A HG13 3  
ATOM 6199  H HG21 . VAL A 1 120 ? -7.012  0.234   14.587  1.00 3.52   ? 120 VAL A HG21 3  
ATOM 6200  H HG22 . VAL A 1 120 ? -7.701  -1.056  15.593  1.00 2.90   ? 120 VAL A HG22 3  
ATOM 6201  H HG23 . VAL A 1 120 ? -7.440  0.561   16.270  1.00 3.32   ? 120 VAL A HG23 3  
ATOM 6202  N N    . GLY A 1 121 ? -5.338  2.297   16.727  1.00 1.26   ? 121 GLY A N    3  
ATOM 6203  C CA   . GLY A 1 121 ? -5.894  3.634   16.991  1.00 1.83   ? 121 GLY A CA   3  
ATOM 6204  C C    . GLY A 1 121 ? -4.894  4.764   16.907  1.00 1.98   ? 121 GLY A C    3  
ATOM 6205  O O    . GLY A 1 121 ? -5.234  5.879   17.287  1.00 2.37   ? 121 GLY A O    3  
ATOM 6206  H H    . GLY A 1 121 ? -5.523  1.598   17.401  1.00 1.59   ? 121 GLY A H    3  
ATOM 6207  H HA2  . GLY A 1 121 ? -6.688  3.858   16.282  1.00 2.06   ? 121 GLY A HA2  3  
ATOM 6208  H HA3  . GLY A 1 121 ? -6.344  3.635   17.975  1.00 2.12   ? 121 GLY A HA3  3  
ATOM 6209  N N    . GLU A 1 122 ? -3.707  4.531   16.393  1.00 1.70   ? 122 GLU A N    3  
ATOM 6210  C CA   . GLU A 1 122 ? -2.691  5.564   16.096  1.00 1.62   ? 122 GLU A CA   3  
ATOM 6211  C C    . GLU A 1 122 ? -2.603  5.806   14.566  1.00 1.53   ? 122 GLU A C    3  
ATOM 6212  O O    . GLU A 1 122 ? -2.938  4.957   13.725  1.00 1.54   ? 122 GLU A O    3  
ATOM 6213  C CB   . GLU A 1 122 ? -1.343  5.046   16.654  1.00 1.61   ? 122 GLU A CB   3  
ATOM 6214  C CG   . GLU A 1 122 ? -0.267  6.113   16.721  1.00 1.59   ? 122 GLU A CG   3  
ATOM 6215  C CD   . GLU A 1 122 ? 0.906   5.776   17.632  1.00 1.78   ? 122 GLU A CD   3  
ATOM 6216  O OE1  . GLU A 1 122 ? 1.204   4.594   17.972  1.00 2.60   ? 122 GLU A OE1  3  
ATOM 6217  O OE2  . GLU A 1 122 ? 1.568   6.748   17.999  1.00 2.16   ? 122 GLU A OE2  3  
ATOM 6218  H H    . GLU A 1 122 ? -3.557  3.582   16.078  1.00 1.47   ? 122 GLU A H    3  
ATOM 6219  H HA   . GLU A 1 122 ? -2.907  6.530   16.610  1.00 1.82   ? 122 GLU A HA   3  
ATOM 6220  H HB2  . GLU A 1 122 ? -1.500  4.662   17.657  1.00 1.85   ? 122 GLU A HB2  3  
ATOM 6221  H HB3  . GLU A 1 122 ? -0.950  4.193   16.103  1.00 1.63   ? 122 GLU A HB3  3  
ATOM 6222  H HG2  . GLU A 1 122 ? 0.088   6.297   15.721  1.00 1.47   ? 122 GLU A HG2  3  
ATOM 6223  H HG3  . GLU A 1 122 ? -0.730  7.024   17.086  1.00 1.81   ? 122 GLU A HG3  3  
ATOM 6224  N N    . THR A 1 123 ? -2.152  7.000   14.184  1.00 1.57   ? 123 THR A N    3  
ATOM 6225  C CA   . THR A 1 123 ? -2.044  7.493   12.792  1.00 1.60   ? 123 THR A CA   3  
ATOM 6226  C C    . THR A 1 123 ? -0.622  7.338   12.258  1.00 1.33   ? 123 THR A C    3  
ATOM 6227  O O    . THR A 1 123 ? 0.329   7.421   13.035  1.00 1.44   ? 123 THR A O    3  
ATOM 6228  C CB   . THR A 1 123 ? -2.439  8.968   12.701  1.00 2.05   ? 123 THR A CB   3  
ATOM 6229  O OG1  . THR A 1 123 ? -1.634  9.708   13.587  1.00 3.37   ? 123 THR A OG1  3  
ATOM 6230  C CG2  . THR A 1 123 ? -3.913  9.218   13.032  1.00 2.98   ? 123 THR A CG2  3  
ATOM 6231  H H    . THR A 1 123 ? -1.941  7.643   14.925  1.00 1.62   ? 123 THR A H    3  
ATOM 6232  H HA   . THR A 1 123 ? -2.731  6.913   12.169  1.00 1.73   ? 123 THR A HA   3  
ATOM 6233  H HB   . THR A 1 123 ? -2.258  9.322   11.684  1.00 2.30   ? 123 THR A HB   3  
ATOM 6234  H HG1  . THR A 1 123 ? -0.772  9.262   13.646  1.00 4.22   ? 123 THR A HG1  3  
ATOM 6235  H HG21 . THR A 1 123 ? -4.541  8.631   12.364  1.00 3.40   ? 123 THR A HG21 3  
ATOM 6236  H HG22 . THR A 1 123 ? -4.128  8.938   14.062  1.00 4.02   ? 123 THR A HG22 3  
ATOM 6237  H HG23 . THR A 1 123 ? -4.149  10.280  12.900  1.00 3.57   ? 123 THR A HG23 3  
ATOM 6238  N N    . VAL A 1 124 ? -0.495  7.218   10.935  1.00 1.07   ? 124 VAL A N    3  
ATOM 6239  C CA   . VAL A 1 124 ? 0.743   6.950   10.198  1.00 0.95   ? 124 VAL A CA   3  
ATOM 6240  C C    . VAL A 1 124 ? 0.884   7.859   8.977   1.00 0.79   ? 124 VAL A C    3  
ATOM 6241  O O    . VAL A 1 124 ? -0.112  8.177   8.323   1.00 0.81   ? 124 VAL A O    3  
ATOM 6242  C CB   . VAL A 1 124 ? 0.842   5.477   9.747   1.00 1.14   ? 124 VAL A CB   3  
ATOM 6243  C CG1  . VAL A 1 124 ? 1.290   4.580   10.905  1.00 2.38   ? 124 VAL A CG1  3  
ATOM 6244  C CG2  . VAL A 1 124 ? -0.455  4.926   9.133   1.00 2.71   ? 124 VAL A CG2  3  
ATOM 6245  H H    . VAL A 1 124 ? -1.345  7.231   10.381  1.00 1.05   ? 124 VAL A H    3  
ATOM 6246  H HA   . VAL A 1 124 ? 1.578   7.168   10.851  1.00 1.11   ? 124 VAL A HA   3  
ATOM 6247  H HB   . VAL A 1 124 ? 1.613   5.434   8.983   1.00 2.11   ? 124 VAL A HB   3  
ATOM 6248  H HG11 . VAL A 1 124 ? 0.554   4.602   11.712  1.00 3.27   ? 124 VAL A HG11 3  
ATOM 6249  H HG12 . VAL A 1 124 ? 1.407   3.555   10.559  1.00 3.09   ? 124 VAL A HG12 3  
ATOM 6250  H HG13 . VAL A 1 124 ? 2.251   4.933   11.280  1.00 3.22   ? 124 VAL A HG13 3  
ATOM 6251  H HG21 . VAL A 1 124 ? -0.270  3.933   8.733   1.00 3.53   ? 124 VAL A HG21 3  
ATOM 6252  H HG22 . VAL A 1 124 ? -1.238  4.857   9.892   1.00 3.38   ? 124 VAL A HG22 3  
ATOM 6253  H HG23 . VAL A 1 124 ? -0.781  5.571   8.319   1.00 3.63   ? 124 VAL A HG23 3  
ATOM 6254  N N    . ASN A 1 125 ? 2.123   8.267   8.674   1.00 0.82   ? 125 ASN A N    3  
ATOM 6255  C CA   . ASN A 1 125 ? 2.428   9.137   7.531   1.00 0.80   ? 125 ASN A CA   3  
ATOM 6256  C C    . ASN A 1 125 ? 2.560   8.312   6.233   1.00 0.75   ? 125 ASN A C    3  
ATOM 6257  O O    . ASN A 1 125 ? 3.376   7.385   6.150   1.00 0.92   ? 125 ASN A O    3  
ATOM 6258  C CB   . ASN A 1 125 ? 3.711   9.944   7.803   1.00 1.05   ? 125 ASN A CB   3  
ATOM 6259  C CG   . ASN A 1 125 ? 3.806   10.472  9.229   1.00 1.65   ? 125 ASN A CG   3  
ATOM 6260  O OD1  . ASN A 1 125 ? 4.345   9.812   10.107  1.00 3.07   ? 125 ASN A OD1  3  
ATOM 6261  N ND2  . ASN A 1 125 ? 3.289   11.649  9.525   1.00 1.54   ? 125 ASN A ND2  3  
ATOM 6262  H H    . ASN A 1 125 ? 2.887   8.008   9.286   1.00 0.92   ? 125 ASN A H    3  
ATOM 6263  H HA   . ASN A 1 125 ? 1.606   9.845   7.410   1.00 0.85   ? 125 ASN A HA   3  
ATOM 6264  H HB2  . ASN A 1 125 ? 4.578   9.308   7.653   1.00 1.21   ? 125 ASN A HB2  3  
ATOM 6265  H HB3  . ASN A 1 125 ? 3.772   10.773  7.099   1.00 1.07   ? 125 ASN A HB3  3  
ATOM 6266  H HD21 . ASN A 1 125 ? 2.767   12.177  8.845   1.00 2.15   ? 125 ASN A HD21 3  
ATOM 6267  H HD22 . ASN A 1 125 ? 3.416   11.957  10.469  1.00 1.89   ? 125 ASN A HD22 3  
ATOM 6268  N N    . ILE A 1 126 ? 1.794   8.646   5.189   1.00 0.81   ? 126 ILE A N    3  
ATOM 6269  C CA   . ILE A 1 126 ? 1.755   7.917   3.906   1.00 0.93   ? 126 ILE A CA   3  
ATOM 6270  C C    . ILE A 1 126 ? 1.897   8.888   2.724   1.00 1.03   ? 126 ILE A C    3  
ATOM 6271  O O    . ILE A 1 126 ? 1.750   10.104  2.864   1.00 0.93   ? 126 ILE A O    3  
ATOM 6272  C CB   . ILE A 1 126 ? 0.489   7.014   3.848   1.00 1.00   ? 126 ILE A CB   3  
ATOM 6273  C CG1  . ILE A 1 126 ? 0.501   5.973   2.696   1.00 1.80   ? 126 ILE A CG1  3  
ATOM 6274  C CG2  . ILE A 1 126 ? -0.817  7.824   3.895   1.00 2.14   ? 126 ILE A CG2  3  
ATOM 6275  C CD1  . ILE A 1 126 ? -0.279  6.328   1.417   1.00 3.37   ? 126 ILE A CD1  3  
ATOM 6276  H H    . ILE A 1 126 ? 1.193   9.463   5.273   1.00 0.93   ? 126 ILE A H    3  
ATOM 6277  H HA   . ILE A 1 126 ? 2.625   7.255   3.850   1.00 0.97   ? 126 ILE A HA   3  
ATOM 6278  H HB   . ILE A 1 126 ? 0.511   6.423   4.765   1.00 1.23   ? 126 ILE A HB   3  
ATOM 6279  H HG12 . ILE A 1 126 ? 1.531   5.746   2.428   1.00 2.46   ? 126 ILE A HG12 3  
ATOM 6280  H HG13 . ILE A 1 126 ? 0.074   5.048   3.083   1.00 1.80   ? 126 ILE A HG13 3  
ATOM 6281  H HG21 . ILE A 1 126 ? -1.667  7.163   3.754   1.00 2.56   ? 126 ILE A HG21 3  
ATOM 6282  H HG22 . ILE A 1 126 ? -0.923  8.309   4.865   1.00 3.25   ? 126 ILE A HG22 3  
ATOM 6283  H HG23 . ILE A 1 126 ? -0.831  8.580   3.110   1.00 2.65   ? 126 ILE A HG23 3  
ATOM 6284  H HD11 . ILE A 1 126 ? -1.350  6.304   1.608   1.00 4.29   ? 126 ILE A HD11 3  
ATOM 6285  H HD12 . ILE A 1 126 ? -0.013  7.315   1.055   1.00 4.39   ? 126 ILE A HD12 3  
ATOM 6286  H HD13 . ILE A 1 126 ? -0.054  5.601   0.641   1.00 3.56   ? 126 ILE A HD13 3  
ATOM 6287  N N    . THR A 1 127 ? 2.249   8.368   1.549   1.00 1.39   ? 127 THR A N    3  
ATOM 6288  C CA   . THR A 1 127 ? 2.522   9.134   0.325   1.00 1.51   ? 127 THR A CA   3  
ATOM 6289  C C    . THR A 1 127 ? 2.107   8.317   -0.895  1.00 1.44   ? 127 THR A C    3  
ATOM 6290  O O    . THR A 1 127 ? 2.278   7.101   -0.877  1.00 1.72   ? 127 THR A O    3  
ATOM 6291  C CB   . THR A 1 127 ? 4.010   9.499   0.335   1.00 1.61   ? 127 THR A CB   3  
ATOM 6292  O OG1  . THR A 1 127 ? 4.200   10.410  1.394   1.00 2.33   ? 127 THR A OG1  3  
ATOM 6293  C CG2  . THR A 1 127 ? 4.511   10.185  -0.930  1.00 1.95   ? 127 THR A CG2  3  
ATOM 6294  H H    . THR A 1 127 ? 2.460   7.378   1.515   1.00 1.55   ? 127 THR A H    3  
ATOM 6295  H HA   . THR A 1 127 ? 1.926   10.041  0.332   1.00 1.65   ? 127 THR A HA   3  
ATOM 6296  H HB   . THR A 1 127 ? 4.605   8.599   0.509   1.00 1.58   ? 127 THR A HB   3  
ATOM 6297  H HG1  . THR A 1 127 ? 3.401   10.391  1.947   1.00 2.97   ? 127 THR A HG1  3  
ATOM 6298  H HG21 . THR A 1 127 ? 4.387   9.532   -1.793  1.00 2.93   ? 127 THR A HG21 3  
ATOM 6299  H HG22 . THR A 1 127 ? 3.967   11.112  -1.075  1.00 2.38   ? 127 THR A HG22 3  
ATOM 6300  H HG23 . THR A 1 127 ? 5.572   10.412  -0.817  1.00 1.98   ? 127 THR A HG23 3  
ATOM 6301  N N    . LEU A 1 128 ? 1.556   8.963   -1.932  1.00 1.25   ? 128 LEU A N    3  
ATOM 6302  C CA   . LEU A 1 128 ? 0.964   8.294   -3.101  1.00 1.33   ? 128 LEU A CA   3  
ATOM 6303  C C    . LEU A 1 128 ? 1.008   9.145   -4.385  1.00 1.80   ? 128 LEU A C    3  
ATOM 6304  O O    . LEU A 1 128 ? 0.012   9.321   -5.083  1.00 3.21   ? 128 LEU A O    3  
ATOM 6305  C CB   . LEU A 1 128 ? -0.442  7.748   -2.763  1.00 1.37   ? 128 LEU A CB   3  
ATOM 6306  C CG   . LEU A 1 128 ? -1.578  8.752   -2.446  1.00 1.95   ? 128 LEU A CG   3  
ATOM 6307  C CD1  . LEU A 1 128 ? -2.928  8.013   -2.533  1.00 2.79   ? 128 LEU A CD1  3  
ATOM 6308  C CD2  . LEU A 1 128 ? -1.466  9.403   -1.061  1.00 2.74   ? 128 LEU A CD2  3  
ATOM 6309  H H    . LEU A 1 128 ? 1.382   9.957   -1.848  1.00 1.28   ? 128 LEU A H    3  
ATOM 6310  H HA   . LEU A 1 128 ? 1.588   7.426   -3.315  1.00 1.23   ? 128 LEU A HA   3  
ATOM 6311  H HB2  . LEU A 1 128 ? -0.755  7.165   -3.626  1.00 2.31   ? 128 LEU A HB2  3  
ATOM 6312  H HB3  . LEU A 1 128 ? -0.358  7.037   -1.945  1.00 2.04   ? 128 LEU A HB3  3  
ATOM 6313  H HG   . LEU A 1 128 ? -1.595  9.546   -3.191  1.00 3.24   ? 128 LEU A HG   3  
ATOM 6314  H HD11 . LEU A 1 128 ? -2.971  7.221   -1.784  1.00 3.17   ? 128 LEU A HD11 3  
ATOM 6315  H HD12 . LEU A 1 128 ? -3.745  8.714   -2.361  1.00 3.53   ? 128 LEU A HD12 3  
ATOM 6316  H HD13 . LEU A 1 128 ? -3.052  7.574   -3.522  1.00 3.34   ? 128 LEU A HD13 3  
ATOM 6317  H HD21 . LEU A 1 128 ? -1.372  8.639   -0.291  1.00 3.08   ? 128 LEU A HD21 3  
ATOM 6318  H HD22 . LEU A 1 128 ? -0.614  10.076  -1.020  1.00 3.70   ? 128 LEU A HD22 3  
ATOM 6319  H HD23 . LEU A 1 128 ? -2.364  9.989   -0.866  1.00 3.69   ? 128 LEU A HD23 3  
ATOM 6320  N N    . LYS A 1 129 ? 2.170   9.707   -4.722  1.00 1.48   ? 129 LYS A N    3  
ATOM 6321  C CA   . LYS A 1 129 ? 2.330   10.619  -5.850  1.00 1.82   ? 129 LYS A CA   3  
ATOM 6322  C C    . LYS A 1 129 ? 2.069   9.878   -7.165  1.00 1.34   ? 129 LYS A C    3  
ATOM 6323  O O    . LYS A 1 129 ? 2.529   8.752   -7.398  1.00 1.23   ? 129 LYS A O    3  
ATOM 6324  C CB   . LYS A 1 129 ? 3.748   11.239  -5.831  1.00 2.56   ? 129 LYS A CB   3  
ATOM 6325  C CG   . LYS A 1 129 ? 3.766   12.601  -6.551  1.00 3.60   ? 129 LYS A CG   3  
ATOM 6326  C CD   . LYS A 1 129 ? 5.143   13.236  -6.810  1.00 4.17   ? 129 LYS A CD   3  
ATOM 6327  C CE   . LYS A 1 129 ? 5.912   12.524  -7.942  1.00 4.27   ? 129 LYS A CE   3  
ATOM 6328  N NZ   . LYS A 1 129 ? 6.819   13.442  -8.683  1.00 5.24   ? 129 LYS A NZ   3  
ATOM 6329  H H    . LYS A 1 129 ? 2.988   9.508   -4.190  1.00 2.06   ? 129 LYS A H    3  
ATOM 6330  H HA   . LYS A 1 129 ? 1.571   11.408  -5.757  1.00 2.13   ? 129 LYS A HA   3  
ATOM 6331  H HB2  . LYS A 1 129 ? 4.065   11.383  -4.798  1.00 3.27   ? 129 LYS A HB2  3  
ATOM 6332  H HB3  . LYS A 1 129 ? 4.450   10.555  -6.310  1.00 2.20   ? 129 LYS A HB3  3  
ATOM 6333  H HG2  . LYS A 1 129 ? 3.285   12.493  -7.518  1.00 3.78   ? 129 LYS A HG2  3  
ATOM 6334  H HG3  . LYS A 1 129 ? 3.176   13.301  -5.957  1.00 4.43   ? 129 LYS A HG3  3  
ATOM 6335  H HD2  . LYS A 1 129 ? 4.963   14.273  -7.101  1.00 5.28   ? 129 LYS A HD2  3  
ATOM 6336  H HD3  . LYS A 1 129 ? 5.735   13.238  -5.892  1.00 4.12   ? 129 LYS A HD3  3  
ATOM 6337  H HE2  . LYS A 1 129 ? 6.485   11.697  -7.514  1.00 3.86   ? 129 LYS A HE2  3  
ATOM 6338  H HE3  . LYS A 1 129 ? 5.184   12.103  -8.641  1.00 4.70   ? 129 LYS A HE3  3  
ATOM 6339  H HZ1  . LYS A 1 129 ? 6.291   14.169  -9.150  1.00 6.11   ? 129 LYS A HZ1  3  
ATOM 6340  H HZ2  . LYS A 1 129 ? 7.486   13.880  -8.063  1.00 5.49   ? 129 LYS A HZ2  3  
ATOM 6341  H HZ3  . LYS A 1 129 ? 7.334   12.935  -9.393  1.00 5.28   ? 129 LYS A HZ3  3  
ATOM 6342  N N    . ALA A 1 130 ? 1.347   10.542  -8.057  1.00 1.47   ? 130 ALA A N    3  
ATOM 6343  C CA   . ALA A 1 130 ? 1.314   10.113  -9.462  1.00 1.23   ? 130 ALA A CA   3  
ATOM 6344  C C    . ALA A 1 130 ? 2.643   10.382  -10.181 1.00 1.39   ? 130 ALA A C    3  
ATOM 6345  O O    . ALA A 1 130 ? 3.450   11.194  -9.726  1.00 1.75   ? 130 ALA A O    3  
ATOM 6346  C CB   . ALA A 1 130 ? 0.119   10.707  -10.214 1.00 1.62   ? 130 ALA A CB   3  
ATOM 6347  H H    . ALA A 1 130 ? 1.042   11.465  -7.761  1.00 1.92   ? 130 ALA A H    3  
ATOM 6348  H HA   . ALA A 1 130 ? 1.175   9.037   -9.477  1.00 1.12   ? 130 ALA A HA   3  
ATOM 6349  H HB1  . ALA A 1 130 ? 0.156   11.792  -10.221 1.00 2.11   ? 130 ALA A HB1  3  
ATOM 6350  H HB2  . ALA A 1 130 ? 0.109   10.377  -11.252 1.00 2.49   ? 130 ALA A HB2  3  
ATOM 6351  H HB3  . ALA A 1 130 ? -0.815  10.371  -9.762  1.00 1.96   ? 130 ALA A HB3  3  
ATOM 6352  N N    . THR A 1 131 ? 2.811   9.723   -11.338 1.00 1.44   ? 131 THR A N    3  
ATOM 6353  C CA   . THR A 1 131 ? 3.904   9.889   -12.314 1.00 1.87   ? 131 THR A CA   3  
ATOM 6354  C C    . THR A 1 131 ? 4.304   11.337  -12.591 1.00 2.28   ? 131 THR A C    3  
ATOM 6355  O O    . THR A 1 131 ? 5.459   11.573  -12.935 1.00 2.75   ? 131 THR A O    3  
ATOM 6356  C CB   . THR A 1 131 ? 3.555   9.187   -13.633 1.00 2.21   ? 131 THR A CB   3  
ATOM 6357  O OG1  . THR A 1 131 ? 2.487   9.890   -14.219 1.00 3.39   ? 131 THR A OG1  3  
ATOM 6358  C CG2  . THR A 1 131 ? 3.125   7.731   -13.437 1.00 2.33   ? 131 THR A CG2  3  
ATOM 6359  H H    . THR A 1 131 ? 2.105   9.055   -11.593 1.00 1.37   ? 131 THR A H    3  
ATOM 6360  H HA   . THR A 1 131 ? 4.787   9.415   -11.902 1.00 1.93   ? 131 THR A HA   3  
ATOM 6361  H HB   . THR A 1 131 ? 4.420   9.209   -14.297 1.00 3.38   ? 131 THR A HB   3  
ATOM 6362  H HG1  . THR A 1 131 ? 2.849   10.725  -14.540 1.00 3.86   ? 131 THR A HG1  3  
ATOM 6363  H HG21 . THR A 1 131 ? 3.032   7.257   -14.416 1.00 2.70   ? 131 THR A HG21 3  
ATOM 6364  H HG22 . THR A 1 131 ? 3.890   7.190   -12.885 1.00 3.38   ? 131 THR A HG22 3  
ATOM 6365  H HG23 . THR A 1 131 ? 2.164   7.641   -12.921 1.00 2.82   ? 131 THR A HG23 3  
ATOM 6366  N N    . ASP A 1 132 ? 3.352   12.266  -12.485 1.00 2.31   ? 132 ASP A N    3  
ATOM 6367  C CA   . ASP A 1 132 ? 3.567   13.716  -12.417 1.00 2.98   ? 132 ASP A CA   3  
ATOM 6368  C C    . ASP A 1 132 ? 2.327   14.418  -11.825 1.00 2.99   ? 132 ASP A C    3  
ATOM 6369  O O    . ASP A 1 132 ? 1.650   15.201  -12.497 1.00 3.38   ? 132 ASP A O    3  
ATOM 6370  C CB   . ASP A 1 132 ? 3.991   14.271  -13.790 1.00 3.58   ? 132 ASP A CB   3  
ATOM 6371  C CG   . ASP A 1 132 ? 4.426   15.735  -13.702 1.00 5.02   ? 132 ASP A CG   3  
ATOM 6372  O OD1  . ASP A 1 132 ? 5.070   16.104  -12.694 1.00 6.26   ? 132 ASP A OD1  3  
ATOM 6373  O OD2  . ASP A 1 132 ? 4.141   16.470  -14.679 1.00 5.44   ? 132 ASP A OD2  3  
ATOM 6374  H H    . ASP A 1 132 ? 2.425   11.939  -12.280 1.00 2.05   ? 132 ASP A H    3  
ATOM 6375  H HA   . ASP A 1 132 ? 4.396   13.901  -11.731 1.00 3.54   ? 132 ASP A HA   3  
ATOM 6376  H HB2  . ASP A 1 132 ? 4.836   13.703  -14.178 1.00 4.22   ? 132 ASP A HB2  3  
ATOM 6377  H HB3  . ASP A 1 132 ? 3.164   14.164  -14.498 1.00 3.15   ? 132 ASP A HB3  3  
ATOM 6378  N N    . GLY A 1 133 ? 1.968   14.053  -10.582 1.00 3.01   ? 133 GLY A N    3  
ATOM 6379  C CA   . GLY A 1 133 ? 0.789   14.627  -9.916  1.00 3.43   ? 133 GLY A CA   3  
ATOM 6380  C C    . GLY A 1 133 ? 0.263   13.890  -8.682  1.00 3.94   ? 133 GLY A C    3  
ATOM 6381  O O    . GLY A 1 133 ? 1.027   13.424  -7.833  1.00 4.60   ? 133 GLY A O    3  
ATOM 6382  H H    . GLY A 1 133 ? 2.521   13.358  -10.100 1.00 3.08   ? 133 GLY A H    3  
ATOM 6383  H HA2  . GLY A 1 133 ? 1.020   15.651  -9.616  1.00 4.05   ? 133 GLY A HA2  3  
ATOM 6384  H HA3  . GLY A 1 133 ? -0.015  14.706  -10.648 1.00 3.59   ? 133 GLY A HA3  3  
ATOM 6385  N N    . ARG A 1 134 ? -1.065  13.809  -8.576  1.00 4.51   ? 134 ARG A N    3  
ATOM 6386  C CA   . ARG A 1 134 ? -1.871  13.406  -7.439  1.00 5.82   ? 134 ARG A CA   3  
ATOM 6387  C C    . ARG A 1 134 ? -1.374  14.058  -6.151  1.00 4.85   ? 134 ARG A C    3  
ATOM 6388  O O    . ARG A 1 134 ? -1.278  15.283  -6.061  1.00 4.80   ? 134 ARG A O    3  
ATOM 6389  C CB   . ARG A 1 134 ? -2.116  11.879  -7.483  1.00 7.19   ? 134 ARG A CB   3  
ATOM 6390  C CG   . ARG A 1 134 ? -3.511  11.402  -7.025  1.00 9.34   ? 134 ARG A CG   3  
ATOM 6391  C CD   . ARG A 1 134 ? -3.642  10.991  -5.550  1.00 10.53  ? 134 ARG A CD   3  
ATOM 6392  N NE   . ARG A 1 134 ? -4.306  9.675   -5.404  1.00 12.74  ? 134 ARG A NE   3  
ATOM 6393  C CZ   . ARG A 1 134 ? -5.618  9.442   -5.367  1.00 14.35  ? 134 ARG A CZ   3  
ATOM 6394  N NH1  . ARG A 1 134 ? -6.508  10.410  -5.259  1.00 14.34  ? 134 ARG A NH1  3  
ATOM 6395  N NH2  . ARG A 1 134 ? -6.069  8.199   -5.347  1.00 16.28  ? 134 ARG A NH2  3  
ATOM 6396  H H    . ARG A 1 134 ? -1.606  14.020  -9.389  1.00 4.54   ? 134 ARG A H    3  
ATOM 6397  H HA   . ARG A 1 134 ? -2.838  13.855  -7.602  1.00 7.43   ? 134 ARG A HA   3  
ATOM 6398  H HB2  . ARG A 1 134 ? -2.083  11.596  -8.533  1.00 7.46   ? 134 ARG A HB2  3  
ATOM 6399  H HB3  . ARG A 1 134 ? -1.326  11.317  -6.988  1.00 7.10   ? 134 ARG A HB3  3  
ATOM 6400  H HG2  . ARG A 1 134 ? -4.258  12.166  -7.247  1.00 9.50   ? 134 ARG A HG2  3  
ATOM 6401  H HG3  . ARG A 1 134 ? -3.769  10.537  -7.643  1.00 10.39  ? 134 ARG A HG3  3  
ATOM 6402  H HD2  . ARG A 1 134 ? -2.653  10.914  -5.101  1.00 10.08  ? 134 ARG A HD2  3  
ATOM 6403  H HD3  . ARG A 1 134 ? -4.201  11.751  -5.015  1.00 10.55  ? 134 ARG A HD3  3  
ATOM 6404  H HE   . ARG A 1 134 ? -3.700  8.873   -5.431  1.00 13.23  ? 134 ARG A HE   3  
ATOM 6405  H HH11 . ARG A 1 134 ? -6.232  11.381  -5.429  1.00 13.11  ? 134 ARG A HH11 3  
ATOM 6406  H HH12 . ARG A 1 134 ? -7.494  10.232  -5.198  1.00 15.71  ? 134 ARG A HH12 3  
ATOM 6407  H HH21 . ARG A 1 134 ? -5.441  7.417   -5.442  1.00 16.63  ? 134 ARG A HH21 3  
ATOM 6408  H HH22 . ARG A 1 134 ? -7.065  8.041   -5.312  1.00 17.52  ? 134 ARG A HH22 3  
ATOM 6409  N N    . THR A 1 135 ? -1.023  13.228  -5.180  1.00 4.66   ? 135 THR A N    3  
ATOM 6410  C CA   . THR A 1 135 ? -0.833  13.655  -3.782  1.00 4.29   ? 135 THR A CA   3  
ATOM 6411  C C    . THR A 1 135 ? 0.328   12.964  -3.107  1.00 2.92   ? 135 THR A C    3  
ATOM 6412  O O    . THR A 1 135 ? 0.492   11.754  -3.210  1.00 3.63   ? 135 THR A O    3  
ATOM 6413  C CB   . THR A 1 135 ? -2.097  13.445  -2.928  1.00 6.00   ? 135 THR A CB   3  
ATOM 6414  O OG1  . THR A 1 135 ? -3.241  13.716  -3.686  1.00 7.56   ? 135 THR A OG1  3  
ATOM 6415  C CG2  . THR A 1 135 ? -2.144  14.399  -1.733  1.00 6.33   ? 135 THR A CG2  3  
ATOM 6416  H H    . THR A 1 135 ? -1.012  12.261  -5.446  1.00 5.25   ? 135 THR A H    3  
ATOM 6417  H HA   . THR A 1 135 ? -0.605  14.715  -3.824  1.00 4.36   ? 135 THR A HA   3  
ATOM 6418  H HB   . THR A 1 135 ? -2.136  12.413  -2.579  1.00 6.30   ? 135 THR A HB   3  
ATOM 6419  H HG1  . THR A 1 135 ? -4.003  13.334  -3.209  1.00 8.53   ? 135 THR A HG1  3  
ATOM 6420  H HG21 . THR A 1 135 ? -1.283  14.237  -1.087  1.00 6.05   ? 135 THR A HG21 3  
ATOM 6421  H HG22 . THR A 1 135 ? -2.146  15.436  -2.078  1.00 6.85   ? 135 THR A HG22 3  
ATOM 6422  H HG23 . THR A 1 135 ? -3.049  14.219  -1.158  1.00 6.99   ? 135 THR A HG23 3  
ATOM 6423  N N    . LEU A 1 136 ? 1.125   13.754  -2.387  1.00 2.21   ? 136 LEU A N    3  
ATOM 6424  C CA   . LEU A 1 136 ? 2.262   13.310  -1.591  1.00 1.50   ? 136 LEU A CA   3  
ATOM 6425  C C    . LEU A 1 136 ? 1.853   13.028  -0.124  1.00 1.41   ? 136 LEU A C    3  
ATOM 6426  O O    . LEU A 1 136 ? 1.037   12.142  0.104   1.00 1.67   ? 136 LEU A O    3  
ATOM 6427  C CB   . LEU A 1 136 ? 3.466   14.257  -1.800  1.00 2.71   ? 136 LEU A CB   3  
ATOM 6428  C CG   . LEU A 1 136 ? 3.208   15.772  -1.595  1.00 3.40   ? 136 LEU A CG   3  
ATOM 6429  C CD1  . LEU A 1 136 ? 4.493   16.452  -1.112  1.00 4.55   ? 136 LEU A CD1  3  
ATOM 6430  C CD2  . LEU A 1 136 ? 2.752   16.482  -2.885  1.00 4.13   ? 136 LEU A CD2  3  
ATOM 6431  H H    . LEU A 1 136 ? 0.883   14.730  -2.350  1.00 3.31   ? 136 LEU A H    3  
ATOM 6432  H HA   . LEU A 1 136 ? 2.558   12.340  -1.987  1.00 1.85   ? 136 LEU A HA   3  
ATOM 6433  H HB2  . LEU A 1 136 ? 4.258   13.919  -1.129  1.00 3.36   ? 136 LEU A HB2  3  
ATOM 6434  H HB3  . LEU A 1 136 ? 3.849   14.107  -2.811  1.00 3.19   ? 136 LEU A HB3  3  
ATOM 6435  H HG   . LEU A 1 136 ? 2.444   15.913  -0.830  1.00 3.14   ? 136 LEU A HG   3  
ATOM 6436  H HD11 . LEU A 1 136 ? 5.288   16.330  -1.849  1.00 4.99   ? 136 LEU A HD11 3  
ATOM 6437  H HD12 . LEU A 1 136 ? 4.306   17.516  -0.955  1.00 5.07   ? 136 LEU A HD12 3  
ATOM 6438  H HD13 . LEU A 1 136 ? 4.805   16.013  -0.169  1.00 5.21   ? 136 LEU A HD13 3  
ATOM 6439  H HD21 . LEU A 1 136 ? 3.504   16.360  -3.666  1.00 4.53   ? 136 LEU A HD21 3  
ATOM 6440  H HD22 . LEU A 1 136 ? 1.805   16.085  -3.241  1.00 4.34   ? 136 LEU A HD22 3  
ATOM 6441  H HD23 . LEU A 1 136 ? 2.617   17.546  -2.689  1.00 4.91   ? 136 LEU A HD23 3  
ATOM 6442  N N    . ASN A 1 137 ? 2.414   13.736  0.859   1.00 1.45   ? 137 ASN A N    3  
ATOM 6443  C CA   . ASN A 1 137 ? 2.180   13.545  2.292   1.00 1.45   ? 137 ASN A CA   3  
ATOM 6444  C C    . ASN A 1 137 ? 0.688   13.605  2.670   1.00 1.58   ? 137 ASN A C    3  
ATOM 6445  O O    . ASN A 1 137 ? 0.063   14.670  2.725   1.00 2.04   ? 137 ASN A O    3  
ATOM 6446  C CB   . ASN A 1 137 ? 3.006   14.565  3.087   1.00 1.67   ? 137 ASN A CB   3  
ATOM 6447  C CG   . ASN A 1 137 ? 2.824   14.384  4.589   1.00 2.60   ? 137 ASN A CG   3  
ATOM 6448  O OD1  . ASN A 1 137 ? 2.675   13.281  5.090   1.00 3.70   ? 137 ASN A OD1  3  
ATOM 6449  N ND2  . ASN A 1 137 ? 2.801   15.461  5.344   1.00 2.97   ? 137 ASN A ND2  3  
ATOM 6450  H H    . ASN A 1 137 ? 3.110   14.407  0.610   1.00 1.76   ? 137 ASN A H    3  
ATOM 6451  H HA   . ASN A 1 137 ? 2.554   12.554  2.552   1.00 1.36   ? 137 ASN A HA   3  
ATOM 6452  H HB2  . ASN A 1 137 ? 4.058   14.444  2.845   1.00 2.06   ? 137 ASN A HB2  3  
ATOM 6453  H HB3  . ASN A 1 137 ? 2.702   15.573  2.803   1.00 1.89   ? 137 ASN A HB3  3  
ATOM 6454  H HD21 . ASN A 1 137 ? 2.943   16.368  4.937   1.00 2.95   ? 137 ASN A HD21 3  
ATOM 6455  H HD22 . ASN A 1 137 ? 2.713   15.344  6.345   1.00 3.80   ? 137 ASN A HD22 3  
ATOM 6456  N N    . VAL A 1 138 ? 0.147   12.431  2.977   1.00 1.32   ? 138 VAL A N    3  
ATOM 6457  C CA   . VAL A 1 138 ? -1.229  12.162  3.418   1.00 1.49   ? 138 VAL A CA   3  
ATOM 6458  C C    . VAL A 1 138 ? -1.204  11.423  4.773   1.00 1.29   ? 138 VAL A C    3  
ATOM 6459  O O    . VAL A 1 138 ? -0.206  10.790  5.120   1.00 1.26   ? 138 VAL A O    3  
ATOM 6460  C CB   . VAL A 1 138 ? -1.984  11.388  2.301   1.00 1.76   ? 138 VAL A CB   3  
ATOM 6461  C CG1  . VAL A 1 138 ? -3.298  10.721  2.744   1.00 1.91   ? 138 VAL A CG1  3  
ATOM 6462  C CG2  . VAL A 1 138 ? -2.325  12.361  1.156   1.00 2.27   ? 138 VAL A CG2  3  
ATOM 6463  H H    . VAL A 1 138 ? 0.767   11.630  2.853   1.00 1.12   ? 138 VAL A H    3  
ATOM 6464  H HA   . VAL A 1 138 ? -1.734  13.111  3.573   1.00 1.83   ? 138 VAL A HA   3  
ATOM 6465  H HB   . VAL A 1 138 ? -1.331  10.605  1.910   1.00 1.82   ? 138 VAL A HB   3  
ATOM 6466  H HG11 . VAL A 1 138 ? -3.961  11.461  3.200   1.00 2.78   ? 138 VAL A HG11 3  
ATOM 6467  H HG12 . VAL A 1 138 ? -3.800  10.279  1.881   1.00 1.97   ? 138 VAL A HG12 3  
ATOM 6468  H HG13 . VAL A 1 138 ? -3.090  9.924   3.454   1.00 2.36   ? 138 VAL A HG13 3  
ATOM 6469  H HG21 . VAL A 1 138 ? -1.415  12.790  0.743   1.00 2.61   ? 138 VAL A HG21 3  
ATOM 6470  H HG22 . VAL A 1 138 ? -2.854  11.840  0.357   1.00 2.41   ? 138 VAL A HG22 3  
ATOM 6471  H HG23 . VAL A 1 138 ? -2.960  13.168  1.524   1.00 3.19   ? 138 VAL A HG23 3  
ATOM 6472  N N    . ALA A 1 139 ? -2.279  11.535  5.562   1.00 1.42   ? 139 ALA A N    3  
ATOM 6473  C CA   . ALA A 1 139 ? -2.438  10.816  6.828   1.00 1.44   ? 139 ALA A CA   3  
ATOM 6474  C C    . ALA A 1 139 ? -3.266  9.528   6.646   1.00 1.45   ? 139 ALA A C    3  
ATOM 6475  O O    . ALA A 1 139 ? -4.273  9.522   5.939   1.00 1.74   ? 139 ALA A O    3  
ATOM 6476  C CB   . ALA A 1 139 ? -3.087  11.764  7.840   1.00 2.04   ? 139 ALA A CB   3  
ATOM 6477  H H    . ALA A 1 139 ? -3.087  12.032  5.213   1.00 1.65   ? 139 ALA A H    3  
ATOM 6478  H HA   . ALA A 1 139 ? -1.452  10.537  7.209   1.00 1.24   ? 139 ALA A HA   3  
ATOM 6479  H HB1  . ALA A 1 139 ? -2.502  12.676  7.934   1.00 2.93   ? 139 ALA A HB1  3  
ATOM 6480  H HB2  . ALA A 1 139 ? -4.100  12.010  7.525   1.00 1.99   ? 139 ALA A HB2  3  
ATOM 6481  H HB3  . ALA A 1 139 ? -3.133  11.277  8.817   1.00 2.99   ? 139 ALA A HB3  3  
ATOM 6482  N N    . ALA A 1 140 ? -2.861  8.457   7.329   1.00 1.36   ? 140 ALA A N    3  
ATOM 6483  C CA   . ALA A 1 140 ? -3.543  7.160   7.352   1.00 1.43   ? 140 ALA A CA   3  
ATOM 6484  C C    . ALA A 1 140 ? -3.505  6.532   8.758   1.00 1.21   ? 140 ALA A C    3  
ATOM 6485  O O    . ALA A 1 140 ? -3.028  7.167   9.707   1.00 1.23   ? 140 ALA A O    3  
ATOM 6486  C CB   . ALA A 1 140 ? -2.915  6.276   6.271   1.00 1.54   ? 140 ALA A CB   3  
ATOM 6487  H H    . ALA A 1 140 ? -2.005  8.533   7.866   1.00 1.36   ? 140 ALA A H    3  
ATOM 6488  H HA   . ALA A 1 140 ? -4.603  7.288   7.108   1.00 1.88   ? 140 ALA A HA   3  
ATOM 6489  H HB1  . ALA A 1 140 ? -3.191  6.669   5.290   1.00 2.40   ? 140 ALA A HB1  3  
ATOM 6490  H HB2  . ALA A 1 140 ? -1.830  6.253   6.369   1.00 1.68   ? 140 ALA A HB2  3  
ATOM 6491  H HB3  . ALA A 1 140 ? -3.297  5.261   6.341   1.00 2.31   ? 140 ALA A HB3  3  
ATOM 6492  N N    . THR A 1 141 ? -4.046  5.315   8.907   1.00 1.15   ? 141 THR A N    3  
ATOM 6493  C CA   . THR A 1 141 ? -4.372  4.700   10.207  1.00 1.13   ? 141 THR A CA   3  
ATOM 6494  C C    . THR A 1 141 ? -3.787  3.296   10.286  1.00 0.91   ? 141 THR A C    3  
ATOM 6495  O O    . THR A 1 141 ? -3.624  2.636   9.254   1.00 0.85   ? 141 THR A O    3  
ATOM 6496  C CB   . THR A 1 141 ? -5.898  4.631   10.406  1.00 1.39   ? 141 THR A CB   3  
ATOM 6497  O OG1  . THR A 1 141 ? -6.574  5.666   9.725   1.00 1.50   ? 141 THR A OG1  3  
ATOM 6498  C CG2  . THR A 1 141 ? -6.282  4.771   11.880  1.00 1.57   ? 141 THR A CG2  3  
ATOM 6499  H H    . THR A 1 141 ? -4.335  4.813   8.077   1.00 1.18   ? 141 THR A H    3  
ATOM 6500  H HA   . THR A 1 141 ? -3.930  5.287   11.013  1.00 1.19   ? 141 THR A HA   3  
ATOM 6501  H HB   . THR A 1 141 ? -6.264  3.680   10.016  1.00 1.50   ? 141 THR A HB   3  
ATOM 6502  H HG1  . THR A 1 141 ? -6.252  6.499   10.080  1.00 2.25   ? 141 THR A HG1  3  
ATOM 6503  H HG21 . THR A 1 141 ? -5.830  3.978   12.469  1.00 2.29   ? 141 THR A HG21 3  
ATOM 6504  H HG22 . THR A 1 141 ? -5.946  5.731   12.270  1.00 2.21   ? 141 THR A HG22 3  
ATOM 6505  H HG23 . THR A 1 141 ? -7.366  4.700   11.983  1.00 1.79   ? 141 THR A HG23 3  
ATOM 6506  N N    . VAL A 1 142 ? -3.517  2.803   11.497  1.00 0.94   ? 142 VAL A N    3  
ATOM 6507  C CA   . VAL A 1 142 ? -3.301  1.368   11.672  1.00 0.83   ? 142 VAL A CA   3  
ATOM 6508  C C    . VAL A 1 142 ? -4.693  0.734   11.886  1.00 0.89   ? 142 VAL A C    3  
ATOM 6509  O O    . VAL A 1 142 ? -5.646  1.419   12.257  1.00 1.10   ? 142 VAL A O    3  
ATOM 6510  C CB   . VAL A 1 142 ? -2.293  1.146   12.826  1.00 1.02   ? 142 VAL A CB   3  
ATOM 6511  C CG1  . VAL A 1 142 ? -1.860  -0.316  12.941  1.00 1.53   ? 142 VAL A CG1  3  
ATOM 6512  C CG2  . VAL A 1 142 ? -1.014  2.001   12.719  1.00 1.24   ? 142 VAL A CG2  3  
ATOM 6513  H H    . VAL A 1 142 ? -3.702  3.329   12.368  1.00 1.17   ? 142 VAL A H    3  
ATOM 6514  H HA   . VAL A 1 142 ? -2.880  0.940   10.762  1.00 0.75   ? 142 VAL A HA   3  
ATOM 6515  H HB   . VAL A 1 142 ? -2.781  1.423   13.745  1.00 1.43   ? 142 VAL A HB   3  
ATOM 6516  H HG11 . VAL A 1 142 ? -1.214  -0.430  13.808  1.00 2.11   ? 142 VAL A HG11 3  
ATOM 6517  H HG12 . VAL A 1 142 ? -2.730  -0.957  13.080  1.00 2.16   ? 142 VAL A HG12 3  
ATOM 6518  H HG13 . VAL A 1 142 ? -1.325  -0.623  12.045  1.00 2.29   ? 142 VAL A HG13 3  
ATOM 6519  H HG21 . VAL A 1 142 ? -1.251  3.059   12.771  1.00 1.93   ? 142 VAL A HG21 3  
ATOM 6520  H HG22 . VAL A 1 142 ? -0.352  1.771   13.557  1.00 2.29   ? 142 VAL A HG22 3  
ATOM 6521  H HG23 . VAL A 1 142 ? -0.482  1.800   11.789  1.00 2.05   ? 142 VAL A HG23 3  
ATOM 6522  N N    . LYS A 1 143 ? -4.864  -0.568  11.639  1.00 0.94   ? 143 LYS A N    3  
ATOM 6523  C CA   . LYS A 1 143 ? -6.091  -1.292  12.009  1.00 1.06   ? 143 LYS A CA   3  
ATOM 6524  C C    . LYS A 1 143 ? -5.837  -2.815  12.048  1.00 1.22   ? 143 LYS A C    3  
ATOM 6525  O O    . LYS A 1 143 ? -5.772  -3.501  11.022  1.00 1.77   ? 143 LYS A O    3  
ATOM 6526  C CB   . LYS A 1 143 ? -7.257  -0.898  11.062  1.00 1.24   ? 143 LYS A CB   3  
ATOM 6527  C CG   . LYS A 1 143 ? -8.648  -0.869  11.717  1.00 1.50   ? 143 LYS A CG   3  
ATOM 6528  C CD   . LYS A 1 143 ? -9.660  -0.198  10.767  1.00 2.00   ? 143 LYS A CD   3  
ATOM 6529  C CE   . LYS A 1 143 ? -11.076 -0.127  11.360  1.00 2.57   ? 143 LYS A CE   3  
ATOM 6530  N NZ   . LYS A 1 143 ? -11.984 0.674   10.499  1.00 3.26   ? 143 LYS A NZ   3  
ATOM 6531  H H    . LYS A 1 143 ? -4.084  -1.094  11.253  1.00 0.98   ? 143 LYS A H    3  
ATOM 6532  H HA   . LYS A 1 143 ? -6.340  -0.964  13.031  1.00 1.10   ? 143 LYS A HA   3  
ATOM 6533  H HB2  . LYS A 1 143 ? -7.072  0.101   10.665  1.00 1.49   ? 143 LYS A HB2  3  
ATOM 6534  H HB3  . LYS A 1 143 ? -7.288  -1.588  10.217  1.00 1.66   ? 143 LYS A HB3  3  
ATOM 6535  H HG2  . LYS A 1 143 ? -8.969  -1.885  11.949  1.00 1.87   ? 143 LYS A HG2  3  
ATOM 6536  H HG3  . LYS A 1 143 ? -8.603  -0.295  12.643  1.00 1.70   ? 143 LYS A HG3  3  
ATOM 6537  H HD2  . LYS A 1 143 ? -9.315  0.818   10.553  1.00 2.33   ? 143 LYS A HD2  3  
ATOM 6538  H HD3  . LYS A 1 143 ? -9.697  -0.755  9.829   1.00 2.30   ? 143 LYS A HD3  3  
ATOM 6539  H HE2  . LYS A 1 143 ? -11.467 -1.143  11.475  1.00 2.88   ? 143 LYS A HE2  3  
ATOM 6540  H HE3  . LYS A 1 143 ? -11.018 0.340   12.345  1.00 2.98   ? 143 LYS A HE3  3  
ATOM 6541  H HZ1  . LYS A 1 143 ? -12.066 0.268   9.570   1.00 3.48   ? 143 LYS A HZ1  3  
ATOM 6542  H HZ2  . LYS A 1 143 ? -12.915 0.738   10.888  1.00 3.60   ? 143 LYS A HZ2  3  
ATOM 6543  H HZ3  . LYS A 1 143 ? -11.633 1.622   10.371  1.00 3.98   ? 143 LYS A HZ3  3  
ATOM 6544  N N    . LYS A 1 144 ? -5.702  -3.338  13.265  1.00 1.35   ? 144 LYS A N    3  
ATOM 6545  C CA   . LYS A 1 144 ? -5.541  -4.769  13.513  1.00 1.61   ? 144 LYS A CA   3  
ATOM 6546  C C    . LYS A 1 144 ? -6.805  -5.580  13.207  1.00 2.14   ? 144 LYS A C    3  
ATOM 6547  O O    . LYS A 1 144 ? -7.887  -5.270  13.704  1.00 3.26   ? 144 LYS A O    3  
ATOM 6548  C CB   . LYS A 1 144 ? -5.004  -5.010  14.934  1.00 2.46   ? 144 LYS A CB   3  
ATOM 6549  C CG   . LYS A 1 144 ? -5.836  -4.384  16.065  1.00 3.64   ? 144 LYS A CG   3  
ATOM 6550  C CD   . LYS A 1 144 ? -6.639  -5.382  16.904  1.00 4.39   ? 144 LYS A CD   3  
ATOM 6551  C CE   . LYS A 1 144 ? -7.126  -4.614  18.135  1.00 5.80   ? 144 LYS A CE   3  
ATOM 6552  N NZ   . LYS A 1 144 ? -8.103  -5.365  18.950  1.00 6.65   ? 144 LYS A NZ   3  
ATOM 6553  H H    . LYS A 1 144 ? -5.711  -2.727  14.065  1.00 1.66   ? 144 LYS A H    3  
ATOM 6554  H HA   . LYS A 1 144 ? -4.785  -5.131  12.826  1.00 2.02   ? 144 LYS A HA   3  
ATOM 6555  H HB2  . LYS A 1 144 ? -4.899  -6.082  15.096  1.00 2.97   ? 144 LYS A HB2  3  
ATOM 6556  H HB3  . LYS A 1 144 ? -4.001  -4.584  14.981  1.00 2.85   ? 144 LYS A HB3  3  
ATOM 6557  H HG2  . LYS A 1 144 ? -5.140  -3.859  16.718  1.00 4.48   ? 144 LYS A HG2  3  
ATOM 6558  H HG3  . LYS A 1 144 ? -6.526  -3.638  15.673  1.00 4.18   ? 144 LYS A HG3  3  
ATOM 6559  H HD2  . LYS A 1 144 ? -7.484  -5.756  16.323  1.00 4.16   ? 144 LYS A HD2  3  
ATOM 6560  H HD3  . LYS A 1 144 ? -6.005  -6.216  17.218  1.00 5.14   ? 144 LYS A HD3  3  
ATOM 6561  H HE2  . LYS A 1 144 ? -6.256  -4.370  18.747  1.00 6.70   ? 144 LYS A HE2  3  
ATOM 6562  H HE3  . LYS A 1 144 ? -7.572  -3.667  17.818  1.00 6.01   ? 144 LYS A HE3  3  
ATOM 6563  H HZ1  . LYS A 1 144 ? -7.733  -6.254  19.279  1.00 6.78   ? 144 LYS A HZ1  3  
ATOM 6564  H HZ2  . LYS A 1 144 ? -8.359  -4.811  19.762  1.00 7.49   ? 144 LYS A HZ2  3  
ATOM 6565  H HZ3  . LYS A 1 144 ? -8.948  -5.557  18.438  1.00 6.83   ? 144 LYS A HZ3  3  
ATOM 6566  N N    . ASN A 1 145 ? -6.626  -6.637  12.414  1.00 2.20   ? 145 ASN A N    3  
ATOM 6567  C CA   . ASN A 1 145 ? -7.631  -7.662  12.101  1.00 3.23   ? 145 ASN A CA   3  
ATOM 6568  C C    . ASN A 1 145 ? -6.938  -8.926  11.551  1.00 2.97   ? 145 ASN A C    3  
ATOM 6569  O O    . ASN A 1 145 ? -7.411  -9.572  10.618  1.00 3.78   ? 145 ASN A O    3  
ATOM 6570  C CB   . ASN A 1 145 ? -8.730  -7.097  11.164  1.00 4.50   ? 145 ASN A CB   3  
ATOM 6571  C CG   . ASN A 1 145 ? -10.087 -7.756  11.381  1.00 5.60   ? 145 ASN A CG   3  
ATOM 6572  O OD1  . ASN A 1 145 ? -11.057 -7.103  11.716  1.00 6.29   ? 145 ASN A OD1  3  
ATOM 6573  N ND2  . ASN A 1 145 ? -10.190 -9.061  11.238  1.00 6.48   ? 145 ASN A ND2  3  
ATOM 6574  H H    . ASN A 1 145 ? -5.710  -6.747  12.016  1.00 2.09   ? 145 ASN A H    3  
ATOM 6575  H HA   . ASN A 1 145 ? -8.124  -7.939  13.043  1.00 3.85   ? 145 ASN A HA   3  
ATOM 6576  H HB2  . ASN A 1 145 ? -8.862  -6.025  11.345  1.00 4.95   ? 145 ASN A HB2  3  
ATOM 6577  H HB3  . ASN A 1 145 ? -8.428  -7.211  10.122  1.00 4.76   ? 145 ASN A HB3  3  
ATOM 6578  H HD21 . ASN A 1 145 ? -9.399  -9.617  10.936  1.00 6.72   ? 145 ASN A HD21 3  
ATOM 6579  H HD22 . ASN A 1 145 ? -11.083 -9.489  11.465  1.00 7.32   ? 145 ASN A HD22 3  
ATOM 6580  N N    . ILE A 1 146 ? -5.735  -9.202  12.065  1.00 2.38   ? 146 ILE A N    3  
ATOM 6581  C CA   . ILE A 1 146 ? -4.718  -10.127 11.579  1.00 2.42   ? 146 ILE A CA   3  
ATOM 6582  C C    . ILE A 1 146 ? -3.728  -10.297 12.745  1.00 2.74   ? 146 ILE A C    3  
ATOM 6583  O O    . ILE A 1 146 ? -4.136  -10.235 13.896  1.00 3.74   ? 146 ILE A O    3  
ATOM 6584  C CB   . ILE A 1 146 ? -4.163  -9.608  10.221  1.00 2.68   ? 146 ILE A CB   3  
ATOM 6585  C CG1  . ILE A 1 146 ? -3.355  -10.678 9.452   1.00 3.45   ? 146 ILE A CG1  3  
ATOM 6586  C CG2  . ILE A 1 146 ? -3.398  -8.282  10.380  1.00 3.79   ? 146 ILE A CG2  3  
ATOM 6587  C CD1  . ILE A 1 146 ? -3.167  -10.351 7.964   1.00 4.21   ? 146 ILE A CD1  3  
ATOM 6588  H H    . ILE A 1 146 ? -5.446  -8.734  12.915  1.00 2.53   ? 146 ILE A H    3  
ATOM 6589  H HA   . ILE A 1 146 ? -5.184  -11.099 11.418  1.00 2.84   ? 146 ILE A HA   3  
ATOM 6590  H HB   . ILE A 1 146 ? -5.026  -9.392  9.592   1.00 3.12   ? 146 ILE A HB   3  
ATOM 6591  H HG12 . ILE A 1 146 ? -2.365  -10.795 9.889   1.00 3.96   ? 146 ILE A HG12 3  
ATOM 6592  H HG13 . ILE A 1 146 ? -3.877  -11.635 9.519   1.00 4.08   ? 146 ILE A HG13 3  
ATOM 6593  H HG21 . ILE A 1 146 ? -2.456  -8.428  10.909  1.00 4.18   ? 146 ILE A HG21 3  
ATOM 6594  H HG22 . ILE A 1 146 ? -3.172  -7.871  9.403   1.00 4.71   ? 146 ILE A HG22 3  
ATOM 6595  H HG23 . ILE A 1 146 ? -3.998  -7.552  10.920  1.00 4.55   ? 146 ILE A HG23 3  
ATOM 6596  H HD11 . ILE A 1 146 ? -2.553  -9.457  7.845   1.00 4.61   ? 146 ILE A HD11 3  
ATOM 6597  H HD12 . ILE A 1 146 ? -2.664  -11.185 7.472   1.00 4.91   ? 146 ILE A HD12 3  
ATOM 6598  H HD13 . ILE A 1 146 ? -4.139  -10.194 7.490   1.00 4.59   ? 146 ILE A HD13 3  
ATOM 6599  N N    . GLU A 1 147 ? -2.446  -10.470 12.485  1.00 2.72   ? 147 GLU A N    3  
ATOM 6600  C CA   . GLU A 1 147 ? -1.431  -10.949 13.441  1.00 3.38   ? 147 GLU A CA   3  
ATOM 6601  C C    . GLU A 1 147 ? -0.737  -9.795  14.200  1.00 3.58   ? 147 GLU A C    3  
ATOM 6602  O O    . GLU A 1 147 ? 0.490   -9.772  14.324  1.00 5.03   ? 147 GLU A O    3  
ATOM 6603  C CB   . GLU A 1 147 ? -0.455  -11.906 12.708  1.00 4.52   ? 147 GLU A CB   3  
ATOM 6604  C CG   . GLU A 1 147 ? -1.240  -13.046 12.019  1.00 5.40   ? 147 GLU A CG   3  
ATOM 6605  C CD   . GLU A 1 147 ? -0.402  -14.207 11.467  1.00 6.71   ? 147 GLU A CD   3  
ATOM 6606  O OE1  . GLU A 1 147 ? 0.817   -14.076 11.246  1.00 7.26   ? 147 GLU A OE1  3  
ATOM 6607  O OE2  . GLU A 1 147 ? -1.063  -15.269 11.248  1.00 7.67   ? 147 GLU A OE2  3  
ATOM 6608  H H    . GLU A 1 147 ? -2.158  -10.299 11.542  1.00 2.81   ? 147 GLU A H    3  
ATOM 6609  H HA   . GLU A 1 147 ? -1.945  -11.543 14.200  1.00 3.84   ? 147 GLU A HA   3  
ATOM 6610  H HB2  . GLU A 1 147 ? 0.119   -11.354 11.960  1.00 5.09   ? 147 GLU A HB2  3  
ATOM 6611  H HB3  . GLU A 1 147 ? 0.225   -12.335 13.441  1.00 4.93   ? 147 GLU A HB3  3  
ATOM 6612  H HG2  . GLU A 1 147 ? -1.952  -13.450 12.741  1.00 5.47   ? 147 GLU A HG2  3  
ATOM 6613  H HG3  . GLU A 1 147 ? -1.812  -12.633 11.186  1.00 5.89   ? 147 GLU A HG3  3  
ATOM 6614  N N    . GLY A 1 148 ? -1.534  -8.823  14.671  1.00 3.21   ? 148 GLY A N    3  
ATOM 6615  C CA   . GLY A 1 148 ? -1.142  -7.611  15.382  1.00 4.36   ? 148 GLY A CA   3  
ATOM 6616  C C    . GLY A 1 148 ? -2.246  -7.200  16.363  1.00 5.13   ? 148 GLY A C    3  
ATOM 6617  O O    . GLY A 1 148 ? -3.318  -7.806  16.400  1.00 5.75   ? 148 GLY A O    3  
ATOM 6618  H H    . GLY A 1 148 ? -2.533  -8.976  14.642  1.00 3.03   ? 148 GLY A H    3  
ATOM 6619  H HA2  . GLY A 1 148 ? -0.200  -7.769  15.905  1.00 4.67   ? 148 GLY A HA2  3  
ATOM 6620  H HA3  . GLY A 1 148 ? -1.000  -6.810  14.658  1.00 5.25   ? 148 GLY A HA3  3  
ATOM 6621  N N    . ARG A 1 149 ? -1.983  -6.170  17.167  1.00 5.63   ? 149 ARG A N    3  
ATOM 6622  C CA   . ARG A 1 149 ? -2.829  -5.740  18.310  1.00 6.82   ? 149 ARG A CA   3  
ATOM 6623  C C    . ARG A 1 149 ? -3.084  -4.224  18.414  1.00 8.25   ? 149 ARG A C    3  
ATOM 6624  O O    . ARG A 1 149 ? -2.362  -3.429  17.771  1.00 8.92   ? 149 ARG A O    3  
ATOM 6625  C CB   . ARG A 1 149 ? -2.251  -6.313  19.628  1.00 6.92   ? 149 ARG A CB   3  
ATOM 6626  C CG   . ARG A 1 149 ? -3.305  -7.044  20.488  1.00 7.69   ? 149 ARG A CG   3  
ATOM 6627  C CD   . ARG A 1 149 ? -3.621  -8.454  19.954  1.00 7.72   ? 149 ARG A CD   3  
ATOM 6628  N NE   . ARG A 1 149 ? -4.796  -9.053  20.616  1.00 9.16   ? 149 ARG A NE   3  
ATOM 6629  C CZ   . ARG A 1 149 ? -4.868  -9.889  21.635  1.00 9.76   ? 149 ARG A CZ   3  
ATOM 6630  N NH1  . ARG A 1 149 ? -3.836  -10.378 22.262  1.00 9.24   ? 149 ARG A NH1  3  
ATOM 6631  N NH2  . ARG A 1 149 ? -6.026  -10.286 22.054  1.00 11.26  ? 149 ARG A NH2  3  
ATOM 6632  O OXT  . ARG A 1 149 ? -4.049  -3.872  19.130  1.00 9.16   ? 149 ARG A OXT  3  
ATOM 6633  H H    . ARG A 1 149 ? -1.145  -5.656  16.969  1.00 5.45   ? 149 ARG A H    3  
ATOM 6634  H HA   . ARG A 1 149 ? -3.821  -6.157  18.168  1.00 7.17   ? 149 ARG A HA   3  
ATOM 6635  H HB2  . ARG A 1 149 ? -1.437  -7.008  19.418  1.00 6.27   ? 149 ARG A HB2  3  
ATOM 6636  H HB3  . ARG A 1 149 ? -1.832  -5.496  20.216  1.00 7.70   ? 149 ARG A HB3  3  
ATOM 6637  H HG2  . ARG A 1 149 ? -2.925  -7.140  21.507  1.00 8.04   ? 149 ARG A HG2  3  
ATOM 6638  H HG3  . ARG A 1 149 ? -4.220  -6.447  20.514  1.00 8.46   ? 149 ARG A HG3  3  
ATOM 6639  H HD2  . ARG A 1 149 ? -3.838  -8.389  18.888  1.00 7.68   ? 149 ARG A HD2  3  
ATOM 6640  H HD3  . ARG A 1 149 ? -2.751  -9.096  20.080  1.00 7.24   ? 149 ARG A HD3  3  
ATOM 6641  H HE   . ARG A 1 149 ? -5.701  -8.752  20.268  1.00 10.04  ? 149 ARG A HE   3  
ATOM 6642  H HH11 . ARG A 1 149 ? -2.915  -10.114 21.977  1.00 8.37   ? 149 ARG A HH11 3  
ATOM 6643  H HH12 . ARG A 1 149 ? -4.023  -10.998 23.038  1.00 9.99   ? 149 ARG A HH12 3  
ATOM 6644  H HH21 . ARG A 1 149 ? -6.855  -9.910  21.601  1.00 12.02  ? 149 ARG A HH21 3  
ATOM 6645  H HH22 . ARG A 1 149 ? -6.084  -10.908 22.848  1.00 11.81  ? 149 ARG A HH22 3  
ATOM 6646  N N    . MET A 1 1   ? 1.088   81.271  -41.862 1.00 78.61  ? 1   MET A N    4  
ATOM 6647  C CA   . MET A 1 1   ? 2.369   81.960  -41.566 1.00 78.67  ? 1   MET A CA   4  
ATOM 6648  C C    . MET A 1 1   ? 3.386   81.055  -40.863 1.00 77.53  ? 1   MET A C    4  
ATOM 6649  O O    . MET A 1 1   ? 4.574   81.359  -40.911 1.00 77.61  ? 1   MET A O    4  
ATOM 6650  C CB   . MET A 1 1   ? 2.157   83.225  -40.715 1.00 79.06  ? 1   MET A CB   4  
ATOM 6651  C CG   . MET A 1 1   ? 1.416   84.350  -41.449 1.00 80.16  ? 1   MET A CG   4  
ATOM 6652  S SD   . MET A 1 1   ? 1.171   85.816  -40.409 1.00 80.79  ? 1   MET A SD   4  
ATOM 6653  C CE   . MET A 1 1   ? 0.411   86.951  -41.600 1.00 82.28  ? 1   MET A CE   4  
ATOM 6654  H H1   . MET A 1 1   ? 1.249   80.359  -42.275 1.00 78.36  ? 1   MET A H1   4  
ATOM 6655  H H2   . MET A 1 1   ? 0.511   81.822  -42.479 1.00 79.23  ? 1   MET A H2   4  
ATOM 6656  H H3   . MET A 1 1   ? 0.572   81.119  -41.001 1.00 78.22  ? 1   MET A H3   4  
ATOM 6657  H HA   . MET A 1 1   ? 2.837   82.257  -42.507 1.00 79.39  ? 1   MET A HA   4  
ATOM 6658  H HB2  . MET A 1 1   ? 1.608   82.964  -39.811 1.00 78.60  ? 1   MET A HB2  4  
ATOM 6659  H HB3  . MET A 1 1   ? 3.130   83.616  -40.414 1.00 79.05  ? 1   MET A HB3  4  
ATOM 6660  H HG2  . MET A 1 1   ? 1.995   84.638  -42.328 1.00 80.54  ? 1   MET A HG2  4  
ATOM 6661  H HG3  . MET A 1 1   ? 0.440   83.991  -41.775 1.00 80.28  ? 1   MET A HG3  4  
ATOM 6662  H HE1  . MET A 1 1   ? 1.099   87.130  -42.425 1.00 82.82  ? 1   MET A HE1  4  
ATOM 6663  H HE2  . MET A 1 1   ? -0.518  86.524  -41.981 1.00 82.48  ? 1   MET A HE2  4  
ATOM 6664  H HE3  . MET A 1 1   ? 0.194   87.899  -41.106 1.00 82.53  ? 1   MET A HE3  4  
ATOM 6665  N N    . GLY A 1 2   ? 2.957   79.976  -40.195 1.00 76.52  ? 2   GLY A N    4  
ATOM 6666  C CA   . GLY A 1 2   ? 3.823   79.046  -39.460 1.00 75.40  ? 2   GLY A CA   4  
ATOM 6667  C C    . GLY A 1 2   ? 3.258   78.699  -38.087 1.00 74.27  ? 2   GLY A C    4  
ATOM 6668  O O    . GLY A 1 2   ? 3.904   78.966  -37.078 1.00 74.07  ? 2   GLY A O    4  
ATOM 6669  H H    . GLY A 1 2   ? 1.968   79.752  -40.186 1.00 76.53  ? 2   GLY A H    4  
ATOM 6670  H HA2  . GLY A 1 2   ? 3.892   78.117  -40.026 1.00 75.56  ? 2   GLY A HA2  4  
ATOM 6671  H HA3  . GLY A 1 2   ? 4.825   79.456  -39.335 1.00 75.25  ? 2   GLY A HA3  4  
ATOM 6672  N N    . HIS A 1 3   ? 2.051   78.135  -38.027 1.00 73.57  ? 3   HIS A N    4  
ATOM 6673  C CA   . HIS A 1 3   ? 1.368   77.823  -36.770 1.00 72.47  ? 3   HIS A CA   4  
ATOM 6674  C C    . HIS A 1 3   ? 0.761   76.406  -36.781 1.00 71.21  ? 3   HIS A C    4  
ATOM 6675  O O    . HIS A 1 3   ? 0.112   75.997  -37.743 1.00 71.38  ? 3   HIS A O    4  
ATOM 6676  C CB   . HIS A 1 3   ? 0.297   78.894  -36.507 1.00 73.13  ? 3   HIS A CB   4  
ATOM 6677  C CG   . HIS A 1 3   ? -0.140  78.986  -35.064 1.00 72.46  ? 3   HIS A CG   4  
ATOM 6678  N ND1  . HIS A 1 3   ? 0.189   79.989  -34.176 1.00 72.51  ? 3   HIS A ND1  4  
ATOM 6679  C CD2  . HIS A 1 3   ? -0.950  78.109  -34.393 1.00 71.79  ? 3   HIS A CD2  4  
ATOM 6680  C CE1  . HIS A 1 3   ? -0.391  79.713  -32.998 1.00 71.89  ? 3   HIS A CE1  4  
ATOM 6681  N NE2  . HIS A 1 3   ? -1.091  78.568  -33.080 1.00 71.42  ? 3   HIS A NE2  4  
ATOM 6682  H H    . HIS A 1 3   ? 1.552   77.928  -38.892 1.00 73.80  ? 3   HIS A H    4  
ATOM 6683  H HA   . HIS A 1 3   ? 2.090   77.871  -35.953 1.00 72.11  ? 3   HIS A HA   4  
ATOM 6684  H HB2  . HIS A 1 3   ? 0.691   79.870  -36.795 1.00 73.84  ? 3   HIS A HB2  4  
ATOM 6685  H HB3  . HIS A 1 3   ? -0.574  78.692  -37.133 1.00 73.54  ? 3   HIS A HB3  4  
ATOM 6686  H HD1  . HIS A 1 3   ? 0.720   80.824  -34.377 1.00 73.00  ? 3   HIS A HD1  4  
ATOM 6687  H HD2  . HIS A 1 3   ? -1.416  77.224  -34.806 1.00 71.63  ? 3   HIS A HD2  4  
ATOM 6688  H HE1  . HIS A 1 3   ? -0.332  80.343  -32.119 1.00 71.83  ? 3   HIS A HE1  4  
ATOM 6689  N N    . THR A 1 4   ? 0.974   75.681  -35.677 1.00 70.00  ? 4   THR A N    4  
ATOM 6690  C CA   . THR A 1 4   ? 0.468   74.346  -35.333 1.00 68.66  ? 4   THR A CA   4  
ATOM 6691  C C    . THR A 1 4   ? 0.959   73.994  -33.927 1.00 67.50  ? 4   THR A C    4  
ATOM 6692  O O    . THR A 1 4   ? 1.893   74.613  -33.411 1.00 67.74  ? 4   THR A O    4  
ATOM 6693  C CB   . THR A 1 4   ? 0.825   73.272  -36.380 1.00 68.57  ? 4   THR A CB   4  
ATOM 6694  O OG1  . THR A 1 4   ? 0.209   72.062  -36.002 1.00 67.77  ? 4   THR A OG1  4  
ATOM 6695  C CG2  . THR A 1 4   ? 2.330   73.026  -36.527 1.00 68.57  ? 4   THR A CG2  4  
ATOM 6696  H H    . THR A 1 4   ? 1.545   76.096  -34.953 1.00 70.01  ? 4   THR A H    4  
ATOM 6697  H HA   . THR A 1 4   ? -0.620  74.399  -35.295 1.00 68.62  ? 4   THR A HA   4  
ATOM 6698  H HB   . THR A 1 4   ? 0.427   73.566  -37.352 1.00 69.20  ? 4   THR A HB   4  
ATOM 6699  H HG1  . THR A 1 4   ? -0.366  71.776  -36.739 1.00 68.06  ? 4   THR A HG1  4  
ATOM 6700  H HG21 . THR A 1 4   ? 2.820   73.938  -36.861 1.00 69.17  ? 4   THR A HG21 4  
ATOM 6701  H HG22 . THR A 1 4   ? 2.764   72.709  -35.577 1.00 67.95  ? 4   THR A HG22 4  
ATOM 6702  H HG23 . THR A 1 4   ? 2.497   72.249  -37.274 1.00 68.65  ? 4   THR A HG23 4  
ATOM 6703  N N    . MET A 1 5   ? 0.327   72.986  -33.325 1.00 66.30  ? 5   MET A N    4  
ATOM 6704  C CA   . MET A 1 5   ? 0.702   72.350  -32.060 1.00 65.08  ? 5   MET A CA   4  
ATOM 6705  C C    . MET A 1 5   ? 0.182   70.892  -32.042 1.00 63.83  ? 5   MET A C    4  
ATOM 6706  O O    . MET A 1 5   ? -1.002  70.669  -31.759 1.00 63.40  ? 5   MET A O    4  
ATOM 6707  C CB   . MET A 1 5   ? 0.174   73.190  -30.883 1.00 64.97  ? 5   MET A CB   4  
ATOM 6708  C CG   . MET A 1 5   ? 0.797   72.730  -29.561 1.00 64.15  ? 5   MET A CG   4  
ATOM 6709  S SD   . MET A 1 5   ? 0.308   73.725  -28.130 1.00 64.22  ? 5   MET A SD   4  
ATOM 6710  C CE   . MET A 1 5   ? 1.505   73.083  -26.930 1.00 63.48  ? 5   MET A CE   4  
ATOM 6711  H H    . MET A 1 5   ? -0.402  72.549  -33.873 1.00 66.25  ? 5   MET A H    4  
ATOM 6712  H HA   . MET A 1 5   ? 1.789   72.351  -31.991 1.00 65.24  ? 5   MET A HA   4  
ATOM 6713  H HB2  . MET A 1 5   ? 0.444   74.237  -31.037 1.00 65.54  ? 5   MET A HB2  4  
ATOM 6714  H HB3  . MET A 1 5   ? -0.915  73.124  -30.825 1.00 65.02  ? 5   MET A HB3  4  
ATOM 6715  H HG2  . MET A 1 5   ? 0.512   71.693  -29.375 1.00 63.70  ? 5   MET A HG2  4  
ATOM 6716  H HG3  . MET A 1 5   ? 1.881   72.784  -29.657 1.00 64.02  ? 5   MET A HG3  4  
ATOM 6717  H HE1  . MET A 1 5   ? 2.518   73.293  -27.273 1.00 63.81  ? 5   MET A HE1  4  
ATOM 6718  H HE2  . MET A 1 5   ? 1.353   73.568  -25.963 1.00 63.32  ? 5   MET A HE2  4  
ATOM 6719  H HE3  . MET A 1 5   ? 1.375   72.007  -26.810 1.00 62.97  ? 5   MET A HE3  4  
ATOM 6720  N N    . PRO A 1 6   ? 1.023   69.890  -32.383 1.00 63.31  ? 6   PRO A N    4  
ATOM 6721  C CA   . PRO A 1 6   ? 0.630   68.483  -32.416 1.00 62.16  ? 6   PRO A CA   4  
ATOM 6722  C C    . PRO A 1 6   ? 0.747   67.830  -31.031 1.00 60.80  ? 6   PRO A C    4  
ATOM 6723  O O    . PRO A 1 6   ? 1.753   68.010  -30.343 1.00 60.71  ? 6   PRO A O    4  
ATOM 6724  C CB   . PRO A 1 6   ? 1.579   67.830  -33.426 1.00 62.42  ? 6   PRO A CB   4  
ATOM 6725  C CG   . PRO A 1 6   ? 2.863   68.649  -33.288 1.00 63.14  ? 6   PRO A CG   4  
ATOM 6726  C CD   . PRO A 1 6   ? 2.352   70.055  -32.966 1.00 63.97  ? 6   PRO A CD   4  
ATOM 6727  H HA   . PRO A 1 6   ? -0.394  68.382  -32.777 1.00 62.23  ? 6   PRO A HA   4  
ATOM 6728  H HB2  . PRO A 1 6   ? 1.749   66.773  -33.215 1.00 61.48  ? 6   PRO A HB2  4  
ATOM 6729  H HB3  . PRO A 1 6   ? 1.177   67.952  -34.433 1.00 63.18  ? 6   PRO A HB3  4  
ATOM 6730  H HG2  . PRO A 1 6   ? 3.455   68.273  -32.454 1.00 62.40  ? 6   PRO A HG2  4  
ATOM 6731  H HG3  . PRO A 1 6   ? 3.452   68.635  -34.206 1.00 63.84  ? 6   PRO A HG3  4  
ATOM 6732  H HD2  . PRO A 1 6   ? 3.030   70.540  -32.264 1.00 64.04  ? 6   PRO A HD2  4  
ATOM 6733  H HD3  . PRO A 1 6   ? 2.283   70.640  -33.887 1.00 65.02  ? 6   PRO A HD3  4  
ATOM 6734  N N    . ALA A 1 7   ? -0.257  67.025  -30.655 1.00 59.80  ? 7   ALA A N    4  
ATOM 6735  C CA   . ALA A 1 7   ? -0.321  66.269  -29.396 1.00 58.41  ? 7   ALA A CA   4  
ATOM 6736  C C    . ALA A 1 7   ? -1.459  65.227  -29.410 1.00 57.42  ? 7   ALA A C    4  
ATOM 6737  O O    . ALA A 1 7   ? -2.573  65.515  -29.841 1.00 57.69  ? 7   ALA A O    4  
ATOM 6738  C CB   . ALA A 1 7   ? -0.483  67.241  -28.212 1.00 58.16  ? 7   ALA A CB   4  
ATOM 6739  H H    . ALA A 1 7   ? -1.059  66.941  -31.264 1.00 60.02  ? 7   ALA A H    4  
ATOM 6740  H HA   . ALA A 1 7   ? 0.621   65.736  -29.272 1.00 58.34  ? 7   ALA A HA   4  
ATOM 6741  H HB1  . ALA A 1 7   ? 0.380   67.900  -28.137 1.00 58.46  ? 7   ALA A HB1  4  
ATOM 6742  H HB2  . ALA A 1 7   ? -1.381  67.846  -28.349 1.00 58.33  ? 7   ALA A HB2  4  
ATOM 6743  H HB3  . ALA A 1 7   ? -0.568  66.685  -27.278 1.00 57.57  ? 7   ALA A HB3  4  
ATOM 6744  N N    . HIS A 1 8   ? -1.203  64.027  -28.881 1.00 56.32  ? 8   HIS A N    4  
ATOM 6745  C CA   . HIS A 1 8   ? -2.197  62.975  -28.638 1.00 55.24  ? 8   HIS A CA   4  
ATOM 6746  C C    . HIS A 1 8   ? -1.608  61.916  -27.681 1.00 53.99  ? 8   HIS A C    4  
ATOM 6747  O O    . HIS A 1 8   ? -0.390  61.695  -27.669 1.00 54.08  ? 8   HIS A O    4  
ATOM 6748  C CB   . HIS A 1 8   ? -2.672  62.341  -29.962 1.00 55.79  ? 8   HIS A CB   4  
ATOM 6749  C CG   . HIS A 1 8   ? -3.698  61.244  -29.781 1.00 55.23  ? 8   HIS A CG   4  
ATOM 6750  N ND1  . HIS A 1 8   ? -3.667  59.996  -30.360 1.00 54.98  ? 8   HIS A ND1  4  
ATOM 6751  C CD2  . HIS A 1 8   ? -4.819  61.288  -28.993 1.00 54.97  ? 8   HIS A CD2  4  
ATOM 6752  C CE1  . HIS A 1 8   ? -4.736  59.311  -29.925 1.00 54.58  ? 8   HIS A CE1  4  
ATOM 6753  N NE2  . HIS A 1 8   ? -5.452  60.045  -29.060 1.00 54.53  ? 8   HIS A NE2  4  
ATOM 6754  H H    . HIS A 1 8   ? -0.266  63.835  -28.545 1.00 56.20  ? 8   HIS A H    4  
ATOM 6755  H HA   . HIS A 1 8   ? -3.062  63.432  -28.154 1.00 55.01  ? 8   HIS A HA   4  
ATOM 6756  H HB2  . HIS A 1 8   ? -3.115  63.108  -30.598 1.00 56.39  ? 8   HIS A HB2  4  
ATOM 6757  H HB3  . HIS A 1 8   ? -1.809  61.935  -30.493 1.00 56.17  ? 8   HIS A HB3  4  
ATOM 6758  H HD1  . HIS A 1 8   ? -2.988  59.653  -31.027 1.00 55.16  ? 8   HIS A HD1  4  
ATOM 6759  H HD2  . HIS A 1 8   ? -5.153  62.128  -28.402 1.00 55.13  ? 8   HIS A HD2  4  
ATOM 6760  H HE1  . HIS A 1 8   ? -4.981  58.300  -30.221 1.00 54.39  ? 8   HIS A HE1  4  
ATOM 6761  N N    . THR A 1 9   ? -2.446  61.261  -26.866 1.00 52.90  ? 9   THR A N    4  
ATOM 6762  C CA   . THR A 1 9   ? -2.058  60.224  -25.890 1.00 51.65  ? 9   THR A CA   4  
ATOM 6763  C C    . THR A 1 9   ? -3.296  59.389  -25.531 1.00 50.75  ? 9   THR A C    4  
ATOM 6764  O O    . THR A 1 9   ? -4.044  59.801  -24.645 1.00 50.52  ? 9   THR A O    4  
ATOM 6765  C CB   . THR A 1 9   ? -1.455  60.830  -24.607 1.00 51.13  ? 9   THR A CB   4  
ATOM 6766  O OG1  . THR A 1 9   ? -0.359  61.643  -24.927 1.00 51.52  ? 9   THR A OG1  4  
ATOM 6767  C CG2  . THR A 1 9   ? -0.923  59.755  -23.658 1.00 49.88  ? 9   THR A CG2  4  
ATOM 6768  H H    . THR A 1 9   ? -3.434  61.472  -26.935 1.00 52.97  ? 9   THR A H    4  
ATOM 6769  H HA   . THR A 1 9   ? -1.303  59.573  -26.326 1.00 51.83  ? 9   THR A HA   4  
ATOM 6770  H HB   . THR A 1 9   ? -2.203  61.436  -24.090 1.00 51.50  ? 9   THR A HB   4  
ATOM 6771  H HG1  . THR A 1 9   ? -0.241  61.626  -25.889 1.00 51.91  ? 9   THR A HG1  4  
ATOM 6772  H HG21 . THR A 1 9   ? -1.735  59.129  -23.293 1.00 49.43  ? 9   THR A HG21 4  
ATOM 6773  H HG22 . THR A 1 9   ? -0.185  59.137  -24.171 1.00 49.78  ? 9   THR A HG22 4  
ATOM 6774  H HG23 . THR A 1 9   ? -0.446  60.235  -22.802 1.00 49.58  ? 9   THR A HG23 4  
ATOM 6775  N N    . PRO A 1 10  ? -3.547  58.250  -26.205 1.00 50.34  ? 10  PRO A N    4  
ATOM 6776  C CA   . PRO A 1 10  ? -4.667  57.378  -25.879 1.00 49.49  ? 10  PRO A CA   4  
ATOM 6777  C C    . PRO A 1 10  ? -4.283  56.502  -24.666 1.00 48.01  ? 10  PRO A C    4  
ATOM 6778  O O    . PRO A 1 10  ? -3.369  55.681  -24.792 1.00 47.53  ? 10  PRO A O    4  
ATOM 6779  C CB   . PRO A 1 10  ? -4.920  56.566  -27.154 1.00 49.76  ? 10  PRO A CB   4  
ATOM 6780  C CG   . PRO A 1 10  ? -3.548  56.486  -27.824 1.00 50.15  ? 10  PRO A CG   4  
ATOM 6781  C CD   . PRO A 1 10  ? -2.829  57.759  -27.373 1.00 50.83  ? 10  PRO A CD   4  
ATOM 6782  H HA   . PRO A 1 10  ? -5.555  57.971  -25.669 1.00 49.88  ? 10  PRO A HA   4  
ATOM 6783  H HB2  . PRO A 1 10  ? -5.326  55.577  -26.939 1.00 48.90  ? 10  PRO A HB2  4  
ATOM 6784  H HB3  . PRO A 1 10  ? -5.602  57.121  -27.801 1.00 50.69  ? 10  PRO A HB3  4  
ATOM 6785  H HG2  . PRO A 1 10  ? -3.007  55.618  -27.452 1.00 49.24  ? 10  PRO A HG2  4  
ATOM 6786  H HG3  . PRO A 1 10  ? -3.633  56.438  -28.910 1.00 50.90  ? 10  PRO A HG3  4  
ATOM 6787  H HD2  . PRO A 1 10  ? -1.792  57.529  -27.122 1.00 50.61  ? 10  PRO A HD2  4  
ATOM 6788  H HD3  . PRO A 1 10  ? -2.862  58.507  -28.162 1.00 51.95  ? 10  PRO A HD3  4  
ATOM 6789  N N    . PRO A 1 11  ? -4.931  56.672  -23.492 1.00 47.35  ? 11  PRO A N    4  
ATOM 6790  C CA   . PRO A 1 11  ? -4.559  55.966  -22.271 1.00 46.01  ? 11  PRO A CA   4  
ATOM 6791  C C    . PRO A 1 11  ? -5.097  54.533  -22.297 1.00 44.99  ? 11  PRO A C    4  
ATOM 6792  O O    . PRO A 1 11  ? -6.238  54.300  -22.694 1.00 45.27  ? 11  PRO A O    4  
ATOM 6793  C CB   . PRO A 1 11  ? -5.171  56.782  -21.129 1.00 45.95  ? 11  PRO A CB   4  
ATOM 6794  C CG   . PRO A 1 11  ? -6.438  57.361  -21.759 1.00 46.87  ? 11  PRO A CG   4  
ATOM 6795  C CD   . PRO A 1 11  ? -6.029  57.594  -23.214 1.00 47.93  ? 11  PRO A CD   4  
ATOM 6796  H HA   . PRO A 1 11  ? -3.472  55.949  -22.164 1.00 45.91  ? 11  PRO A HA   4  
ATOM 6797  H HB2  . PRO A 1 11  ? -5.393  56.168  -20.255 1.00 44.98  ? 11  PRO A HB2  4  
ATOM 6798  H HB3  . PRO A 1 11  ? -4.493  57.595  -20.862 1.00 46.40  ? 11  PRO A HB3  4  
ATOM 6799  H HG2  . PRO A 1 11  ? -7.242  56.626  -21.715 1.00 46.36  ? 11  PRO A HG2  4  
ATOM 6800  H HG3  . PRO A 1 11  ? -6.743  58.287  -21.272 1.00 47.34  ? 11  PRO A HG3  4  
ATOM 6801  H HD2  . PRO A 1 11  ? -6.876  57.408  -23.875 1.00 48.32  ? 11  PRO A HD2  4  
ATOM 6802  H HD3  . PRO A 1 11  ? -5.688  58.622  -23.322 1.00 48.76  ? 11  PRO A HD3  4  
ATOM 6803  N N    . ALA A 1 12  ? -4.290  53.566  -21.843 1.00 43.84  ? 12  ALA A N    4  
ATOM 6804  C CA   . ALA A 1 12  ? -4.628  52.145  -21.894 1.00 42.83  ? 12  ALA A CA   4  
ATOM 6805  C C    . ALA A 1 12  ? -3.950  51.358  -20.760 1.00 41.37  ? 12  ALA A C    4  
ATOM 6806  O O    . ALA A 1 12  ? -2.769  51.567  -20.475 1.00 41.28  ? 12  ALA A O    4  
ATOM 6807  C CB   . ALA A 1 12  ? -4.239  51.596  -23.276 1.00 43.27  ? 12  ALA A CB   4  
ATOM 6808  H H    . ALA A 1 12  ? -3.372  53.816  -21.497 1.00 43.71  ? 12  ALA A H    4  
ATOM 6809  H HA   . ALA A 1 12  ? -5.710  52.041  -21.775 1.00 42.93  ? 12  ALA A HA   4  
ATOM 6810  H HB1  . ALA A 1 12  ? -4.770  52.147  -24.056 1.00 44.04  ? 12  ALA A HB1  4  
ATOM 6811  H HB2  . ALA A 1 12  ? -3.167  51.706  -23.431 1.00 43.48  ? 12  ALA A HB2  4  
ATOM 6812  H HB3  . ALA A 1 12  ? -4.505  50.543  -23.351 1.00 42.70  ? 12  ALA A HB3  4  
ATOM 6813  N N    . GLN A 1 13  ? -4.708  50.438  -20.155 1.00 40.31  ? 13  GLN A N    4  
ATOM 6814  C CA   . GLN A 1 13  ? -4.376  49.628  -18.975 1.00 38.88  ? 13  GLN A CA   4  
ATOM 6815  C C    . GLN A 1 13  ? -5.475  48.547  -18.818 1.00 37.90  ? 13  GLN A C    4  
ATOM 6816  O O    . GLN A 1 13  ? -6.449  48.555  -19.583 1.00 38.39  ? 13  GLN A O    4  
ATOM 6817  C CB   . GLN A 1 13  ? -4.246  50.555  -17.736 1.00 38.88  ? 13  GLN A CB   4  
ATOM 6818  C CG   . GLN A 1 13  ? -3.191  50.123  -16.693 1.00 38.27  ? 13  GLN A CG   4  
ATOM 6819  C CD   . GLN A 1 13  ? -2.932  51.194  -15.619 1.00 38.71  ? 13  GLN A CD   4  
ATOM 6820  O OE1  . GLN A 1 13  ? -3.760  52.058  -15.347 1.00 39.01  ? 13  GLN A OE1  4  
ATOM 6821  N NE2  . GLN A 1 13  ? -1.775  51.214  -14.977 1.00 38.91  ? 13  GLN A NE2  4  
ATOM 6822  H H    . GLN A 1 13  ? -5.646  50.295  -20.503 1.00 40.57  ? 13  GLN A H    4  
ATOM 6823  H HA   . GLN A 1 13  ? -3.421  49.132  -19.160 1.00 38.63  ? 13  GLN A HA   4  
ATOM 6824  H HB2  . GLN A 1 13  ? -3.963  51.557  -18.061 1.00 39.56  ? 13  GLN A HB2  4  
ATOM 6825  H HB3  . GLN A 1 13  ? -5.218  50.642  -17.246 1.00 38.81  ? 13  GLN A HB3  4  
ATOM 6826  H HG2  . GLN A 1 13  ? -3.512  49.205  -16.196 1.00 37.77  ? 13  GLN A HG2  4  
ATOM 6827  H HG3  . GLN A 1 13  ? -2.250  49.924  -17.208 1.00 38.11  ? 13  GLN A HG3  4  
ATOM 6828  H HE21 . GLN A 1 13  ? -1.059  50.536  -15.168 1.00 38.77  ? 13  GLN A HE21 4  
ATOM 6829  H HE22 . GLN A 1 13  ? -1.632  51.962  -14.311 1.00 39.29  ? 13  GLN A HE22 4  
ATOM 6830  N N    . THR A 1 14  ? -5.342  47.621  -17.854 1.00 36.59  ? 14  THR A N    4  
ATOM 6831  C CA   . THR A 1 14  ? -6.370  46.621  -17.489 1.00 35.54  ? 14  THR A CA   4  
ATOM 6832  C C    . THR A 1 14  ? -7.409  47.246  -16.551 1.00 34.94  ? 14  THR A C    4  
ATOM 6833  O O    . THR A 1 14  ? -7.070  48.117  -15.758 1.00 35.15  ? 14  THR A O    4  
ATOM 6834  C CB   . THR A 1 14  ? -5.724  45.407  -16.788 1.00 34.85  ? 14  THR A CB   4  
ATOM 6835  O OG1  . THR A 1 14  ? -4.667  44.887  -17.557 1.00 34.91  ? 14  THR A OG1  4  
ATOM 6836  C CG2  . THR A 1 14  ? -6.690  44.242  -16.549 1.00 34.18  ? 14  THR A CG2  4  
ATOM 6837  H H    . THR A 1 14  ? -4.534  47.661  -17.253 1.00 36.33  ? 14  THR A H    4  
ATOM 6838  H HA   . THR A 1 14  ? -6.872  46.294  -18.398 1.00 35.83  ? 14  THR A HA   4  
ATOM 6839  H HB   . THR A 1 14  ? -5.320  45.727  -15.825 1.00 34.93  ? 14  THR A HB   4  
ATOM 6840  H HG1  . THR A 1 14  ? -5.007  44.636  -18.423 1.00 35.30  ? 14  THR A HG1  4  
ATOM 6841  H HG21 . THR A 1 14  ? -7.216  43.987  -17.470 1.00 34.42  ? 14  THR A HG21 4  
ATOM 6842  H HG22 . THR A 1 14  ? -6.137  43.368  -16.203 1.00 33.48  ? 14  THR A HG22 4  
ATOM 6843  H HG23 . THR A 1 14  ? -7.415  44.501  -15.775 1.00 34.29  ? 14  THR A HG23 4  
ATOM 6844  N N    . ALA A 1 15  ? -8.647  46.755  -16.605 1.00 34.33  ? 15  ALA A N    4  
ATOM 6845  C CA   . ALA A 1 15  ? -9.727  47.079  -15.661 1.00 33.76  ? 15  ALA A CA   4  
ATOM 6846  C C    . ALA A 1 15  ? -10.765 45.938  -15.530 1.00 32.82  ? 15  ALA A C    4  
ATOM 6847  O O    . ALA A 1 15  ? -10.994 45.492  -14.404 1.00 32.25  ? 15  ALA A O    4  
ATOM 6848  C CB   . ALA A 1 15  ? -10.339 48.436  -16.037 1.00 34.73  ? 15  ALA A CB   4  
ATOM 6849  H H    . ALA A 1 15  ? -8.830  46.034  -17.282 1.00 34.32  ? 15  ALA A H    4  
ATOM 6850  H HA   . ALA A 1 15  ? -9.283  47.188  -14.669 1.00 33.42  ? 15  ALA A HA   4  
ATOM 6851  H HB1  . ALA A 1 15  ? -11.187 48.654  -15.386 1.00 34.64  ? 15  ALA A HB1  4  
ATOM 6852  H HB2  . ALA A 1 15  ? -9.593  49.224  -15.909 1.00 35.16  ? 15  ALA A HB2  4  
ATOM 6853  H HB3  . ALA A 1 15  ? -10.671 48.440  -17.071 1.00 35.24  ? 15  ALA A HB3  4  
ATOM 6854  N N    . PRO A 1 16  ? -11.347 45.406  -16.631 1.00 32.72  ? 16  PRO A N    4  
ATOM 6855  C CA   . PRO A 1 16  ? -12.123 44.172  -16.582 1.00 31.77  ? 16  PRO A CA   4  
ATOM 6856  C C    . PRO A 1 16  ? -11.218 42.955  -16.370 1.00 30.23  ? 16  PRO A C    4  
ATOM 6857  O O    . PRO A 1 16  ? -10.190 42.821  -17.034 1.00 30.22  ? 16  PRO A O    4  
ATOM 6858  C CB   . PRO A 1 16  ? -12.860 44.078  -17.921 1.00 32.41  ? 16  PRO A CB   4  
ATOM 6859  C CG   . PRO A 1 16  ? -11.967 44.865  -18.880 1.00 33.14  ? 16  PRO A CG   4  
ATOM 6860  C CD   . PRO A 1 16  ? -11.376 45.955  -17.986 1.00 33.65  ? 16  PRO A CD   4  
ATOM 6861  H HA   . PRO A 1 16  ? -12.854 44.229  -15.776 1.00 31.88  ? 16  PRO A HA   4  
ATOM 6862  H HB2  . PRO A 1 16  ? -12.989 43.044  -18.246 1.00 31.62  ? 16  PRO A HB2  4  
ATOM 6863  H HB3  . PRO A 1 16  ? -13.830 44.568  -17.839 1.00 33.29  ? 16  PRO A HB3  4  
ATOM 6864  H HG2  . PRO A 1 16  ? -11.168 44.220  -19.249 1.00 32.39  ? 16  PRO A HG2  4  
ATOM 6865  H HG3  . PRO A 1 16  ? -12.538 45.288  -19.708 1.00 34.10  ? 16  PRO A HG3  4  
ATOM 6866  H HD2  . PRO A 1 16  ? -10.388 46.224  -18.355 1.00 33.70  ? 16  PRO A HD2  4  
ATOM 6867  H HD3  . PRO A 1 16  ? -12.033 46.824  -18.005 1.00 34.75  ? 16  PRO A HD3  4  
ATOM 6868  N N    . ALA A 1 17  ? -11.661 42.053  -15.486 1.00 29.04  ? 17  ALA A N    4  
ATOM 6869  C CA   . ALA A 1 17  ? -11.099 40.733  -15.202 1.00 27.52  ? 17  ALA A CA   4  
ATOM 6870  C C    . ALA A 1 17  ? -12.064 39.946  -14.291 1.00 26.42  ? 17  ALA A C    4  
ATOM 6871  O O    . ALA A 1 17  ? -12.747 40.541  -13.449 1.00 26.69  ? 17  ALA A O    4  
ATOM 6872  C CB   . ALA A 1 17  ? -9.718  40.871  -14.541 1.00 27.07  ? 17  ALA A CB   4  
ATOM 6873  H H    . ALA A 1 17  ? -12.479 42.300  -14.944 1.00 29.24  ? 17  ALA A H    4  
ATOM 6874  H HA   . ALA A 1 17  ? -10.987 40.190  -16.144 1.00 27.65  ? 17  ALA A HA   4  
ATOM 6875  H HB1  . ALA A 1 17  ? -9.027  41.376  -15.215 1.00 27.40  ? 17  ALA A HB1  4  
ATOM 6876  H HB2  . ALA A 1 17  ? -9.805  41.453  -13.623 1.00 27.35  ? 17  ALA A HB2  4  
ATOM 6877  H HB3  . ALA A 1 17  ? -9.317  39.886  -14.306 1.00 26.30  ? 17  ALA A HB3  4  
ATOM 6878  N N    . ALA A 1 18  ? -12.104 38.616  -14.420 1.00 25.29  ? 18  ALA A N    4  
ATOM 6879  C CA   . ALA A 1 18  ? -12.934 37.736  -13.589 1.00 24.17  ? 18  ALA A CA   4  
ATOM 6880  C C    . ALA A 1 18  ? -12.434 36.282  -13.591 1.00 22.59  ? 18  ALA A C    4  
ATOM 6881  O O    . ALA A 1 18  ? -12.045 35.741  -14.625 1.00 22.75  ? 18  ALA A O    4  
ATOM 6882  C CB   . ALA A 1 18  ? -14.396 37.809  -14.058 1.00 25.14  ? 18  ALA A CB   4  
ATOM 6883  H H    . ALA A 1 18  ? -11.531 38.171  -15.124 1.00 25.29  ? 18  ALA A H    4  
ATOM 6884  H HA   . ALA A 1 18  ? -12.884 38.100  -12.561 1.00 23.95  ? 18  ALA A HA   4  
ATOM 6885  H HB1  . ALA A 1 18  ? -15.020 37.169  -13.432 1.00 25.19  ? 18  ALA A HB1  4  
ATOM 6886  H HB2  . ALA A 1 18  ? -14.766 38.834  -13.989 1.00 25.70  ? 18  ALA A HB2  4  
ATOM 6887  H HB3  . ALA A 1 18  ? -14.476 37.465  -15.091 1.00 25.40  ? 18  ALA A HB3  4  
ATOM 6888  N N    . GLN A 1 19  ? -12.493 35.628  -12.429 1.00 21.24  ? 19  GLN A N    4  
ATOM 6889  C CA   . GLN A 1 19  ? -12.084 34.238  -12.223 1.00 19.73  ? 19  GLN A CA   4  
ATOM 6890  C C    . GLN A 1 19  ? -12.779 33.713  -10.960 1.00 18.53  ? 19  GLN A C    4  
ATOM 6891  O O    . GLN A 1 19  ? -12.821 34.410  -9.951  1.00 18.56  ? 19  GLN A O    4  
ATOM 6892  C CB   . GLN A 1 19  ? -10.546 34.171  -12.114 1.00 19.30  ? 19  GLN A CB   4  
ATOM 6893  C CG   . GLN A 1 19  ? -10.003 32.733  -12.011 1.00 18.65  ? 19  GLN A CG   4  
ATOM 6894  C CD   . GLN A 1 19  ? -8.480  32.668  -11.868 1.00 18.49  ? 19  GLN A CD   4  
ATOM 6895  O OE1  . GLN A 1 19  ? -7.727  33.554  -12.239 1.00 18.97  ? 19  GLN A OE1  4  
ATOM 6896  N NE2  . GLN A 1 19  ? -7.934  31.601  -11.318 1.00 18.08  ? 19  GLN A NE2  4  
ATOM 6897  H H    . GLN A 1 19  ? -12.822 36.121  -11.611 1.00 21.36  ? 19  GLN A H    4  
ATOM 6898  H HA   . GLN A 1 19  ? -12.403 33.642  -13.080 1.00 20.06  ? 19  GLN A HA   4  
ATOM 6899  H HB2  . GLN A 1 19  ? -10.104 34.638  -12.998 1.00 20.13  ? 19  GLN A HB2  4  
ATOM 6900  H HB3  . GLN A 1 19  ? -10.222 34.733  -11.236 1.00 18.93  ? 19  GLN A HB3  4  
ATOM 6901  H HG2  . GLN A 1 19  ? -10.449 32.245  -11.145 1.00 18.18  ? 19  GLN A HG2  4  
ATOM 6902  H HG3  . GLN A 1 19  ? -10.288 32.172  -12.901 1.00 19.05  ? 19  GLN A HG3  4  
ATOM 6903  H HE21 . GLN A 1 19  ? -8.500  30.832  -10.995 1.00 17.85  ? 19  GLN A HE21 4  
ATOM 6904  H HE22 . GLN A 1 19  ? -6.941  31.624  -11.201 1.00 18.21  ? 19  GLN A HE22 4  
ATOM 6905  N N    . LYS A 1 20  ? -13.317 32.490  -11.011 1.00 17.68  ? 20  LYS A N    4  
ATOM 6906  C CA   . LYS A 1 20  ? -14.075 31.849  -9.923  1.00 16.64  ? 20  LYS A CA   4  
ATOM 6907  C C    . LYS A 1 20  ? -14.232 30.337  -10.205 1.00 15.64  ? 20  LYS A C    4  
ATOM 6908  O O    . LYS A 1 20  ? -14.063 29.907  -11.351 1.00 15.89  ? 20  LYS A O    4  
ATOM 6909  C CB   . LYS A 1 20  ? -15.435 32.572  -9.743  1.00 17.41  ? 20  LYS A CB   4  
ATOM 6910  C CG   . LYS A 1 20  ? -15.878 32.729  -8.277  1.00 17.50  ? 20  LYS A CG   4  
ATOM 6911  C CD   . LYS A 1 20  ? -17.193 33.532  -8.215  1.00 18.97  ? 20  LYS A CD   4  
ATOM 6912  C CE   . LYS A 1 20  ? -17.822 33.646  -6.817  1.00 19.52  ? 20  LYS A CE   4  
ATOM 6913  N NZ   . LYS A 1 20  ? -18.388 32.361  -6.335  1.00 19.61  ? 20  LYS A NZ   4  
ATOM 6914  H H    . LYS A 1 20  ? -13.246 31.965  -11.874 1.00 17.92  ? 20  LYS A H    4  
ATOM 6915  H HA   . LYS A 1 20  ? -13.494 31.959  -9.007  1.00 16.25  ? 20  LYS A HA   4  
ATOM 6916  H HB2  . LYS A 1 20  ? -15.375 33.573  -10.171 1.00 18.08  ? 20  LYS A HB2  4  
ATOM 6917  H HB3  . LYS A 1 20  ? -16.203 32.032  -10.300 1.00 17.59  ? 20  LYS A HB3  4  
ATOM 6918  H HG2  . LYS A 1 20  ? -16.014 31.746  -7.827  1.00 17.00  ? 20  LYS A HG2  4  
ATOM 6919  H HG3  . LYS A 1 20  ? -15.110 33.267  -7.720  1.00 17.28  ? 20  LYS A HG3  4  
ATOM 6920  H HD2  . LYS A 1 20  ? -16.989 34.544  -8.573  1.00 19.64  ? 20  LYS A HD2  4  
ATOM 6921  H HD3  . LYS A 1 20  ? -17.923 33.085  -8.893  1.00 19.28  ? 20  LYS A HD3  4  
ATOM 6922  H HE2  . LYS A 1 20  ? -17.085 34.034  -6.107  1.00 19.21  ? 20  LYS A HE2  4  
ATOM 6923  H HE3  . LYS A 1 20  ? -18.632 34.379  -6.874  1.00 20.47  ? 20  LYS A HE3  4  
ATOM 6924  H HZ1  . LYS A 1 20  ? -19.065 32.524  -5.598  1.00 20.28  ? 20  LYS A HZ1  4  
ATOM 6925  H HZ2  . LYS A 1 20  ? -18.840 31.855  -7.097  1.00 19.89  ? 20  LYS A HZ2  4  
ATOM 6926  H HZ3  . LYS A 1 20  ? -17.667 31.741  -6.000  1.00 18.99  ? 20  LYS A HZ3  4  
ATOM 6927  N N    . ALA A 1 21  ? -14.558 29.536  -9.181  1.00 14.70  ? 21  ALA A N    4  
ATOM 6928  C CA   . ALA A 1 21  ? -14.748 28.084  -9.282  1.00 13.80  ? 21  ALA A CA   4  
ATOM 6929  C C    . ALA A 1 21  ? -15.378 27.500  -8.003  1.00 12.82  ? 21  ALA A C    4  
ATOM 6930  O O    . ALA A 1 21  ? -14.759 27.521  -6.936  1.00 12.01  ? 21  ALA A O    4  
ATOM 6931  C CB   . ALA A 1 21  ? -13.416 27.382  -9.607  1.00 13.47  ? 21  ALA A CB   4  
ATOM 6932  H H    . ALA A 1 21  ? -14.769 29.959  -8.292  1.00 14.79  ? 21  ALA A H    4  
ATOM 6933  H HA   . ALA A 1 21  ? -15.432 27.892  -10.110 1.00 14.38  ? 21  ALA A HA   4  
ATOM 6934  H HB1  . ALA A 1 21  ? -12.689 27.585  -8.821  1.00 13.20  ? 21  ALA A HB1  4  
ATOM 6935  H HB2  . ALA A 1 21  ? -13.575 26.304  -9.673  1.00 13.36  ? 21  ALA A HB2  4  
ATOM 6936  H HB3  . ALA A 1 21  ? -13.015 27.726  -10.561 1.00 13.95  ? 21  ALA A HB3  4  
ATOM 6937  N N    . GLY A 1 22  ? -16.601 26.981  -8.150  1.00 13.14  ? 22  GLY A N    4  
ATOM 6938  C CA   . GLY A 1 22  ? -17.390 26.288  -7.129  1.00 12.53  ? 22  GLY A CA   4  
ATOM 6939  C C    . GLY A 1 22  ? -17.502 24.805  -7.456  1.00 11.65  ? 22  GLY A C    4  
ATOM 6940  O O    . GLY A 1 22  ? -16.477 24.133  -7.535  1.00 11.10  ? 22  GLY A O    4  
ATOM 6941  H H    . GLY A 1 22  ? -17.045 27.110  -9.049  1.00 14.03  ? 22  GLY A H    4  
ATOM 6942  H HA2  . GLY A 1 22  ? -16.927 26.394  -6.147  1.00 12.32  ? 22  GLY A HA2  4  
ATOM 6943  H HA3  . GLY A 1 22  ? -18.386 26.728  -7.108  1.00 13.14  ? 22  GLY A HA3  4  
ATOM 6944  N N    . ALA A 1 23  ? -18.730 24.298  -7.627  1.00 11.78  ? 23  ALA A N    4  
ATOM 6945  C CA   . ALA A 1 23  ? -19.074 22.924  -8.034  1.00 11.19  ? 23  ALA A CA   4  
ATOM 6946  C C    . ALA A 1 23  ? -18.807 21.853  -6.957  1.00 10.00  ? 23  ALA A C    4  
ATOM 6947  O O    . ALA A 1 23  ? -17.944 21.986  -6.087  1.00 9.58   ? 23  ALA A O    4  
ATOM 6948  C CB   . ALA A 1 23  ? -18.402 22.555  -9.369  1.00 11.25  ? 23  ALA A CB   4  
ATOM 6949  H H    . ALA A 1 23  ? -19.496 24.945  -7.519  1.00 12.52  ? 23  ALA A H    4  
ATOM 6950  H HA   . ALA A 1 23  ? -20.151 22.915  -8.212  1.00 12.03  ? 23  ALA A HA   4  
ATOM 6951  H HB1  . ALA A 1 23  ? -17.328 22.418  -9.230  1.00 10.63  ? 23  ALA A HB1  4  
ATOM 6952  H HB2  . ALA A 1 23  ? -18.814 21.617  -9.748  1.00 11.39  ? 23  ALA A HB2  4  
ATOM 6953  H HB3  . ALA A 1 23  ? -18.571 23.340  -10.107 1.00 12.25  ? 23  ALA A HB3  4  
ATOM 6954  N N    . GLN A 1 24  ? -19.543 20.745  -7.049  1.00 9.88   ? 24  GLN A N    4  
ATOM 6955  C CA   . GLN A 1 24  ? -19.421 19.571  -6.186  1.00 9.11   ? 24  GLN A CA   4  
ATOM 6956  C C    . GLN A 1 24  ? -19.846 18.316  -6.967  1.00 8.85   ? 24  GLN A C    4  
ATOM 6957  O O    . GLN A 1 24  ? -20.623 18.401  -7.917  1.00 10.10  ? 24  GLN A O    4  
ATOM 6958  C CB   . GLN A 1 24  ? -20.291 19.721  -4.923  1.00 10.00  ? 24  GLN A CB   4  
ATOM 6959  C CG   . GLN A 1 24  ? -19.770 20.774  -3.925  1.00 10.47  ? 24  GLN A CG   4  
ATOM 6960  C CD   . GLN A 1 24  ? -20.612 20.852  -2.657  1.00 12.00  ? 24  GLN A CD   4  
ATOM 6961  O OE1  . GLN A 1 24  ? -21.833 20.750  -2.701  1.00 13.12  ? 24  GLN A OE1  4  
ATOM 6962  N NE2  . GLN A 1 24  ? -20.010 21.019  -1.493  1.00 12.51  ? 24  GLN A NE2  4  
ATOM 6963  H H    . GLN A 1 24  ? -20.165 20.642  -7.838  1.00 10.57  ? 24  GLN A H    4  
ATOM 6964  H HA   . GLN A 1 24  ? -18.378 19.446  -5.891  1.00 8.56   ? 24  GLN A HA   4  
ATOM 6965  H HB2  . GLN A 1 24  ? -21.311 19.973  -5.221  1.00 10.85  ? 24  GLN A HB2  4  
ATOM 6966  H HB3  . GLN A 1 24  ? -20.322 18.762  -4.404  1.00 10.03  ? 24  GLN A HB3  4  
ATOM 6967  H HG2  . GLN A 1 24  ? -18.738 20.542  -3.662  1.00 9.95   ? 24  GLN A HG2  4  
ATOM 6968  H HG3  . GLN A 1 24  ? -19.803 21.763  -4.377  1.00 10.73  ? 24  GLN A HG3  4  
ATOM 6969  H HE21 . GLN A 1 24  ? -19.001 21.056  -1.412  1.00 11.93  ? 24  GLN A HE21 4  
ATOM 6970  H HE22 . GLN A 1 24  ? -20.616 21.193  -0.707  1.00 13.74  ? 24  GLN A HE22 4  
ATOM 6971  N N    . ALA A 1 25  ? -19.342 17.160  -6.533  1.00 7.56   ? 25  ALA A N    4  
ATOM 6972  C CA   . ALA A 1 25  ? -19.598 15.821  -7.075  1.00 7.22   ? 25  ALA A CA   4  
ATOM 6973  C C    . ALA A 1 25  ? -19.009 14.788  -6.103  1.00 6.28   ? 25  ALA A C    4  
ATOM 6974  O O    . ALA A 1 25  ? -18.000 15.075  -5.454  1.00 6.05   ? 25  ALA A O    4  
ATOM 6975  C CB   . ALA A 1 25  ? -18.974 15.688  -8.475  1.00 7.50   ? 25  ALA A CB   4  
ATOM 6976  H H    . ALA A 1 25  ? -18.719 17.179  -5.737  1.00 7.04   ? 25  ALA A H    4  
ATOM 6977  H HA   . ALA A 1 25  ? -20.676 15.662  -7.147  1.00 8.04   ? 25  ALA A HA   4  
ATOM 6978  H HB1  . ALA A 1 25  ? -19.146 14.682  -8.861  1.00 8.05   ? 25  ALA A HB1  4  
ATOM 6979  H HB2  . ALA A 1 25  ? -19.426 16.408  -9.158  1.00 8.09   ? 25  ALA A HB2  4  
ATOM 6980  H HB3  . ALA A 1 25  ? -17.899 15.873  -8.427  1.00 7.27   ? 25  ALA A HB3  4  
ATOM 6981  N N    . LEU A 1 26  ? -19.629 13.607  -5.983  1.00 6.43   ? 26  LEU A N    4  
ATOM 6982  C CA   . LEU A 1 26  ? -19.219 12.566  -5.032  1.00 6.05   ? 26  LEU A CA   4  
ATOM 6983  C C    . LEU A 1 26  ? -18.059 11.751  -5.647  1.00 4.77   ? 26  LEU A C    4  
ATOM 6984  O O    . LEU A 1 26  ? -18.277 11.106  -6.682  1.00 4.93   ? 26  LEU A O    4  
ATOM 6985  C CB   . LEU A 1 26  ? -20.422 11.659  -4.686  1.00 7.57   ? 26  LEU A CB   4  
ATOM 6986  C CG   . LEU A 1 26  ? -21.420 12.219  -3.648  1.00 9.50   ? 26  LEU A CG   4  
ATOM 6987  C CD1  . LEU A 1 26  ? -22.102 13.530  -4.077  1.00 10.46  ? 26  LEU A CD1  4  
ATOM 6988  C CD2  . LEU A 1 26  ? -22.497 11.160  -3.368  1.00 10.80  ? 26  LEU A CD2  4  
ATOM 6989  H H    . LEU A 1 26  ? -20.426 13.408  -6.568  1.00 7.27   ? 26  LEU A H    4  
ATOM 6990  H HA   . LEU A 1 26  ? -18.881 13.039  -4.107  1.00 6.44   ? 26  LEU A HA   4  
ATOM 6991  H HB2  . LEU A 1 26  ? -20.955 11.401  -5.603  1.00 8.04   ? 26  LEU A HB2  4  
ATOM 6992  H HB3  . LEU A 1 26  ? -20.025 10.728  -4.278  1.00 7.36   ? 26  LEU A HB3  4  
ATOM 6993  H HG   . LEU A 1 26  ? -20.882 12.405  -2.717  1.00 9.79   ? 26  LEU A HG   4  
ATOM 6994  H HD11 . LEU A 1 26  ? -22.561 13.410  -5.059  1.00 10.72  ? 26  LEU A HD11 4  
ATOM 6995  H HD12 . LEU A 1 26  ? -22.871 13.799  -3.354  1.00 11.42  ? 26  LEU A HD12 4  
ATOM 6996  H HD13 . LEU A 1 26  ? -21.374 14.341  -4.106  1.00 10.32  ? 26  LEU A HD13 4  
ATOM 6997  H HD21 . LEU A 1 26  ? -23.064 10.951  -4.276  1.00 10.95  ? 26  LEU A HD21 4  
ATOM 6998  H HD22 . LEU A 1 26  ? -22.030 10.239  -3.018  1.00 11.04  ? 26  LEU A HD22 4  
ATOM 6999  H HD23 . LEU A 1 26  ? -23.178 11.517  -2.595  1.00 11.79  ? 26  LEU A HD23 4  
ATOM 7000  N N    . PRO A 1 27  ? -16.838 11.784  -5.069  1.00 4.79   ? 27  PRO A N    4  
ATOM 7001  C CA   . PRO A 1 27  ? -15.666 11.149  -5.655  1.00 4.78   ? 27  PRO A CA   4  
ATOM 7002  C C    . PRO A 1 27  ? -15.546 9.680   -5.233  1.00 4.07   ? 27  PRO A C    4  
ATOM 7003  O O    . PRO A 1 27  ? -16.006 9.292   -4.160  1.00 4.99   ? 27  PRO A O    4  
ATOM 7004  C CB   . PRO A 1 27  ? -14.478 11.959  -5.129  1.00 6.66   ? 27  PRO A CB   4  
ATOM 7005  C CG   . PRO A 1 27  ? -14.932 12.344  -3.721  1.00 7.37   ? 27  PRO A CG   4  
ATOM 7006  C CD   . PRO A 1 27  ? -16.441 12.547  -3.887  1.00 6.29   ? 27  PRO A CD   4  
ATOM 7007  H HA   . PRO A 1 27  ? -15.695 11.216  -6.743  1.00 5.00   ? 27  PRO A HA   4  
ATOM 7008  H HB2  . PRO A 1 27  ? -13.553 11.384  -5.113  1.00 7.43   ? 27  PRO A HB2  4  
ATOM 7009  H HB3  . PRO A 1 27  ? -14.352 12.860  -5.730  1.00 7.30   ? 27  PRO A HB3  4  
ATOM 7010  H HG2  . PRO A 1 27  ? -14.744 11.519  -3.032  1.00 7.75   ? 27  PRO A HG2  4  
ATOM 7011  H HG3  . PRO A 1 27  ? -14.439 13.250  -3.370  1.00 8.76   ? 27  PRO A HG3  4  
ATOM 7012  H HD2  . PRO A 1 27  ? -16.969 12.194  -3.001  1.00 7.05   ? 27  PRO A HD2  4  
ATOM 7013  H HD3  . PRO A 1 27  ? -16.639 13.605  -4.043  1.00 6.61   ? 27  PRO A HD3  4  
ATOM 7014  N N    . VAL A 1 28  ? -14.840 8.894   -6.047  1.00 3.12   ? 28  VAL A N    4  
ATOM 7015  C CA   . VAL A 1 28  ? -14.379 7.540   -5.684  1.00 2.44   ? 28  VAL A CA   4  
ATOM 7016  C C    . VAL A 1 28  ? -13.534 7.568   -4.410  1.00 2.62   ? 28  VAL A C    4  
ATOM 7017  O O    . VAL A 1 28  ? -12.682 8.443   -4.223  1.00 3.26   ? 28  VAL A O    4  
ATOM 7018  C CB   . VAL A 1 28  ? -13.616 6.866   -6.847  1.00 2.25   ? 28  VAL A CB   4  
ATOM 7019  C CG1  . VAL A 1 28  ? -12.295 7.560   -7.221  1.00 2.72   ? 28  VAL A CG1  4  
ATOM 7020  C CG2  . VAL A 1 28  ? -13.352 5.380   -6.575  1.00 2.79   ? 28  VAL A CG2  4  
ATOM 7021  H H    . VAL A 1 28  ? -14.605 9.245   -6.981  1.00 3.52   ? 28  VAL A H    4  
ATOM 7022  H HA   . VAL A 1 28  ? -15.275 6.950   -5.490  1.00 2.56   ? 28  VAL A HA   4  
ATOM 7023  H HB   . VAL A 1 28  ? -14.276 6.912   -7.713  1.00 2.72   ? 28  VAL A HB   4  
ATOM 7024  H HG11 . VAL A 1 28  ? -11.568 7.452   -6.415  1.00 3.31   ? 28  VAL A HG11 4  
ATOM 7025  H HG12 . VAL A 1 28  ? -11.880 7.099   -8.118  1.00 3.18   ? 28  VAL A HG12 4  
ATOM 7026  H HG13 . VAL A 1 28  ? -12.462 8.619   -7.416  1.00 3.23   ? 28  VAL A HG13 4  
ATOM 7027  H HG21 . VAL A 1 28  ? -12.927 4.918   -7.466  1.00 3.20   ? 28  VAL A HG21 4  
ATOM 7028  H HG22 . VAL A 1 28  ? -12.647 5.259   -5.756  1.00 3.35   ? 28  VAL A HG22 4  
ATOM 7029  H HG23 . VAL A 1 28  ? -14.289 4.887   -6.320  1.00 3.69   ? 28  VAL A HG23 4  
ATOM 7030  N N    . THR A 1 29  ? -13.772 6.610   -3.507  1.00 2.49   ? 29  THR A N    4  
ATOM 7031  C CA   . THR A 1 29  ? -13.027 6.490   -2.250  1.00 2.76   ? 29  THR A CA   4  
ATOM 7032  C C    . THR A 1 29  ? -11.611 5.970   -2.502  1.00 2.43   ? 29  THR A C    4  
ATOM 7033  O O    . THR A 1 29  ? -11.280 5.448   -3.565  1.00 2.65   ? 29  THR A O    4  
ATOM 7034  C CB   . THR A 1 29  ? -13.780 5.629   -1.210  1.00 3.25   ? 29  THR A CB   4  
ATOM 7035  O OG1  . THR A 1 29  ? -14.965 5.086   -1.744  1.00 3.30   ? 29  THR A OG1  4  
ATOM 7036  C CG2  . THR A 1 29  ? -14.187 6.470   -0.001  1.00 4.28   ? 29  THR A CG2  4  
ATOM 7037  H H    . THR A 1 29  ? -14.522 5.946   -3.668  1.00 2.54   ? 29  THR A H    4  
ATOM 7038  H HA   . THR A 1 29  ? -12.921 7.498   -1.846  1.00 3.36   ? 29  THR A HA   4  
ATOM 7039  H HB   . THR A 1 29  ? -13.144 4.808   -0.868  1.00 3.57   ? 29  THR A HB   4  
ATOM 7040  H HG1  . THR A 1 29  ? -15.331 4.477   -1.070  1.00 3.76   ? 29  THR A HG1  4  
ATOM 7041  H HG21 . THR A 1 29  ? -13.307 6.884   0.488   1.00 4.70   ? 29  THR A HG21 4  
ATOM 7042  H HG22 . THR A 1 29  ? -14.841 7.280   -0.326  1.00 5.08   ? 29  THR A HG22 4  
ATOM 7043  H HG23 . THR A 1 29  ? -14.726 5.847   0.715   1.00 4.55   ? 29  THR A HG23 4  
ATOM 7044  N N    . VAL A 1 30  ? -10.765 6.143   -1.493  1.00 2.58   ? 30  VAL A N    4  
ATOM 7045  C CA   . VAL A 1 30  ? -9.340  5.803   -1.528  1.00 2.73   ? 30  VAL A CA   4  
ATOM 7046  C C    . VAL A 1 30  ? -9.080  4.456   -0.845  1.00 1.97   ? 30  VAL A C    4  
ATOM 7047  O O    . VAL A 1 30  ? -9.737  4.100   0.129   1.00 2.17   ? 30  VAL A O    4  
ATOM 7048  C CB   . VAL A 1 30  ? -8.494  6.954   -0.922  1.00 4.09   ? 30  VAL A CB   4  
ATOM 7049  C CG1  . VAL A 1 30  ? -8.782  7.192   0.572   1.00 5.15   ? 30  VAL A CG1  4  
ATOM 7050  C CG2  . VAL A 1 30  ? -6.985  6.738   -1.132  1.00 5.25   ? 30  VAL A CG2  4  
ATOM 7051  H H    . VAL A 1 30  ? -11.145 6.515   -0.640  1.00 2.93   ? 30  VAL A H    4  
ATOM 7052  H HA   . VAL A 1 30  ? -9.041  5.696   -2.572  1.00 2.96   ? 30  VAL A HA   4  
ATOM 7053  H HB   . VAL A 1 30  ? -8.765  7.868   -1.455  1.00 4.54   ? 30  VAL A HB   4  
ATOM 7054  H HG11 . VAL A 1 30  ? -8.220  8.061   0.918   1.00 5.91   ? 30  VAL A HG11 4  
ATOM 7055  H HG12 . VAL A 1 30  ? -9.844  7.384   0.728   1.00 5.41   ? 30  VAL A HG12 4  
ATOM 7056  H HG13 . VAL A 1 30  ? -8.483  6.326   1.162   1.00 5.75   ? 30  VAL A HG13 4  
ATOM 7057  H HG21 . VAL A 1 30  ? -6.626  5.911   -0.522  1.00 5.63   ? 30  VAL A HG21 4  
ATOM 7058  H HG22 . VAL A 1 30  ? -6.783  6.528   -2.183  1.00 5.64   ? 30  VAL A HG22 4  
ATOM 7059  H HG23 . VAL A 1 30  ? -6.444  7.640   -0.847  1.00 6.23   ? 30  VAL A HG23 4  
ATOM 7060  N N    . GLN A 1 31  ? -8.068  3.748   -1.347  1.00 1.92   ? 31  GLN A N    4  
ATOM 7061  C CA   . GLN A 1 31  ? -7.501  2.497   -0.835  1.00 2.09   ? 31  GLN A CA   4  
ATOM 7062  C C    . GLN A 1 31  ? -6.985  2.494   0.616   1.00 2.33   ? 31  GLN A C    4  
ATOM 7063  O O    . GLN A 1 31  ? -6.544  1.448   1.095   1.00 3.67   ? 31  GLN A O    4  
ATOM 7064  C CB   . GLN A 1 31  ? -6.413  2.062   -1.837  1.00 2.54   ? 31  GLN A CB   4  
ATOM 7065  C CG   . GLN A 1 31  ? -5.207  3.013   -1.981  1.00 2.50   ? 31  GLN A CG   4  
ATOM 7066  C CD   . GLN A 1 31  ? -4.434  2.746   -3.270  1.00 2.72   ? 31  GLN A CD   4  
ATOM 7067  O OE1  . GLN A 1 31  ? -4.117  3.643   -4.037  1.00 3.66   ? 31  GLN A OE1  4  
ATOM 7068  N NE2  . GLN A 1 31  ? -4.163  1.513   -3.637  1.00 2.52   ? 31  GLN A NE2  4  
ATOM 7069  H H    . GLN A 1 31  ? -7.732  4.028   -2.250  1.00 2.35   ? 31  GLN A H    4  
ATOM 7070  H HA   . GLN A 1 31  ? -8.303  1.760   -0.835  1.00 2.34   ? 31  GLN A HA   4  
ATOM 7071  H HB2  . GLN A 1 31  ? -6.039  1.083   -1.553  1.00 2.96   ? 31  GLN A HB2  4  
ATOM 7072  H HB3  . GLN A 1 31  ? -6.882  1.967   -2.819  1.00 2.93   ? 31  GLN A HB3  4  
ATOM 7073  H HG2  . GLN A 1 31  ? -5.542  4.051   -2.006  1.00 2.86   ? 31  GLN A HG2  4  
ATOM 7074  H HG3  . GLN A 1 31  ? -4.544  2.894   -1.129  1.00 2.73   ? 31  GLN A HG3  4  
ATOM 7075  H HE21 . GLN A 1 31  ? -4.316  0.739   -3.016  1.00 2.58   ? 31  GLN A HE21 4  
ATOM 7076  H HE22 . GLN A 1 31  ? -3.792  1.386   -4.563  1.00 2.90   ? 31  GLN A HE22 4  
ATOM 7077  N N    . GLY A 1 32  ? -7.057  3.628   1.319   1.00 1.74   ? 32  GLY A N    4  
ATOM 7078  C CA   . GLY A 1 32  ? -6.950  3.784   2.783   1.00 1.83   ? 32  GLY A CA   4  
ATOM 7079  C C    . GLY A 1 32  ? -5.541  3.655   3.373   1.00 1.64   ? 32  GLY A C    4  
ATOM 7080  O O    . GLY A 1 32  ? -5.233  4.329   4.352   1.00 2.00   ? 32  GLY A O    4  
ATOM 7081  H H    . GLY A 1 32  ? -7.442  4.407   0.812   1.00 2.07   ? 32  GLY A H    4  
ATOM 7082  H HA2  . GLY A 1 32  ? -7.328  4.771   3.061   1.00 1.94   ? 32  GLY A HA2  4  
ATOM 7083  H HA3  . GLY A 1 32  ? -7.568  3.022   3.262   1.00 2.35   ? 32  GLY A HA3  4  
ATOM 7084  N N    . ALA A 1 33  ? -4.704  2.809   2.766   1.00 1.49   ? 33  ALA A N    4  
ATOM 7085  C CA   . ALA A 1 33  ? -3.297  2.587   3.111   1.00 1.37   ? 33  ALA A CA   4  
ATOM 7086  C C    . ALA A 1 33  ? -3.107  2.020   4.531   1.00 1.36   ? 33  ALA A C    4  
ATOM 7087  O O    . ALA A 1 33  ? -2.074  2.262   5.154   1.00 2.25   ? 33  ALA A O    4  
ATOM 7088  C CB   . ALA A 1 33  ? -2.522  3.891   2.868   1.00 1.39   ? 33  ALA A CB   4  
ATOM 7089  H H    . ALA A 1 33  ? -5.100  2.279   2.001   1.00 1.75   ? 33  ALA A H    4  
ATOM 7090  H HA   . ALA A 1 33  ? -2.908  1.826   2.441   1.00 1.52   ? 33  ALA A HA   4  
ATOM 7091  H HB1  . ALA A 1 33  ? -2.832  4.638   3.590   1.00 2.13   ? 33  ALA A HB1  4  
ATOM 7092  H HB2  . ALA A 1 33  ? -1.452  3.708   2.980   1.00 2.39   ? 33  ALA A HB2  4  
ATOM 7093  H HB3  . ALA A 1 33  ? -2.727  4.279   1.874   1.00 1.96   ? 33  ALA A HB3  4  
ATOM 7094  N N    . THR A 1 34  ? -4.110  1.303   5.058   1.00 0.87   ? 34  THR A N    4  
ATOM 7095  C CA   . THR A 1 34  ? -4.226  1.043   6.500   1.00 0.88   ? 34  THR A CA   4  
ATOM 7096  C C    . THR A 1 34  ? -3.156  0.061   6.953   1.00 0.85   ? 34  THR A C    4  
ATOM 7097  O O    . THR A 1 34  ? -3.069  -1.037  6.419   1.00 1.18   ? 34  THR A O    4  
ATOM 7098  C CB   . THR A 1 34  ? -5.613  0.537   6.891   1.00 1.23   ? 34  THR A CB   4  
ATOM 7099  O OG1  . THR A 1 34  ? -6.622  1.322   6.291   1.00 1.77   ? 34  THR A OG1  4  
ATOM 7100  C CG2  . THR A 1 34  ? -5.830  0.603   8.406   1.00 1.61   ? 34  THR A CG2  4  
ATOM 7101  H H    . THR A 1 34  ? -4.867  1.024   4.447   1.00 1.25   ? 34  THR A H    4  
ATOM 7102  H HA   . THR A 1 34  ? -4.070  1.992   6.999   1.00 0.93   ? 34  THR A HA   4  
ATOM 7103  H HB   . THR A 1 34  ? -5.697  -0.497  6.571   1.00 1.27   ? 34  THR A HB   4  
ATOM 7104  H HG1  . THR A 1 34  ? -6.721  1.040   5.364   1.00 2.02   ? 34  THR A HG1  4  
ATOM 7105  H HG21 . THR A 1 34  ? -5.767  1.635   8.748   1.00 2.88   ? 34  THR A HG21 4  
ATOM 7106  H HG22 . THR A 1 34  ? -6.816  0.208   8.647   1.00 1.98   ? 34  THR A HG22 4  
ATOM 7107  H HG23 . THR A 1 34  ? -5.080  0.005   8.924   1.00 2.12   ? 34  THR A HG23 4  
ATOM 7108  N N    . VAL A 1 35  ? -2.350  0.428   7.944   1.00 0.69   ? 35  VAL A N    4  
ATOM 7109  C CA   . VAL A 1 35  ? -1.218  -0.400  8.423   1.00 0.61   ? 35  VAL A CA   4  
ATOM 7110  C C    . VAL A 1 35  ? -1.680  -1.428  9.460   1.00 0.67   ? 35  VAL A C    4  
ATOM 7111  O O    . VAL A 1 35  ? -2.543  -1.126  10.279  1.00 0.77   ? 35  VAL A O    4  
ATOM 7112  C CB   . VAL A 1 35  ? -0.084  0.455   9.033   1.00 0.55   ? 35  VAL A CB   4  
ATOM 7113  C CG1  . VAL A 1 35  ? 1.174   -0.365  9.381   1.00 0.72   ? 35  VAL A CG1  4  
ATOM 7114  C CG2  . VAL A 1 35  ? 0.341   1.572   8.059   1.00 0.73   ? 35  VAL A CG2  4  
ATOM 7115  H H    . VAL A 1 35  ? -2.546  1.333   8.368   1.00 0.76   ? 35  VAL A H    4  
ATOM 7116  H HA   . VAL A 1 35  ? -0.805  -0.935  7.569   1.00 0.62   ? 35  VAL A HA   4  
ATOM 7117  H HB   . VAL A 1 35  ? -0.472  0.883   9.959   1.00 0.81   ? 35  VAL A HB   4  
ATOM 7118  H HG11 . VAL A 1 35  ? 1.976   0.301   9.704   1.00 1.64   ? 35  VAL A HG11 4  
ATOM 7119  H HG12 . VAL A 1 35  ? 0.968   -1.047  10.202  1.00 1.87   ? 35  VAL A HG12 4  
ATOM 7120  H HG13 . VAL A 1 35  ? 1.511   -0.931  8.512   1.00 1.50   ? 35  VAL A HG13 4  
ATOM 7121  H HG21 . VAL A 1 35  ? 1.197   2.115   8.462   1.00 1.69   ? 35  VAL A HG21 4  
ATOM 7122  H HG22 . VAL A 1 35  ? 0.625   1.143   7.097   1.00 2.02   ? 35  VAL A HG22 4  
ATOM 7123  H HG23 . VAL A 1 35  ? -0.476  2.278   7.908   1.00 1.63   ? 35  VAL A HG23 4  
ATOM 7124  N N    . ALA A 1 36  ? -1.059  -2.612  9.484   1.00 0.69   ? 36  ALA A N    4  
ATOM 7125  C CA   . ALA A 1 36  ? -1.181  -3.566  10.582  1.00 0.86   ? 36  ALA A CA   4  
ATOM 7126  C C    . ALA A 1 36  ? -0.565  -3.024  11.888  1.00 1.01   ? 36  ALA A C    4  
ATOM 7127  O O    . ALA A 1 36  ? 0.650   -3.062  12.075  1.00 1.57   ? 36  ALA A O    4  
ATOM 7128  C CB   . ALA A 1 36  ? -0.514  -4.886  10.175  1.00 1.03   ? 36  ALA A CB   4  
ATOM 7129  H H    . ALA A 1 36  ? -0.389  -2.834  8.751   1.00 0.68   ? 36  ALA A H    4  
ATOM 7130  H HA   . ALA A 1 36  ? -2.239  -3.761  10.755  1.00 0.92   ? 36  ALA A HA   4  
ATOM 7131  H HB1  . ALA A 1 36  ? -0.674  -5.635  10.949  1.00 1.94   ? 36  ALA A HB1  4  
ATOM 7132  H HB2  . ALA A 1 36  ? -0.919  -5.241  9.228   1.00 1.64   ? 36  ALA A HB2  4  
ATOM 7133  H HB3  . ALA A 1 36  ? 0.559   -4.736  10.058  1.00 1.89   ? 36  ALA A HB3  4  
ATOM 7134  N N    . ALA A 1 37  ? -1.424  -2.585  12.810  1.00 0.92   ? 37  ALA A N    4  
ATOM 7135  C CA   . ALA A 1 37  ? -1.067  -2.340  14.223  1.00 1.05   ? 37  ALA A CA   4  
ATOM 7136  C C    . ALA A 1 37  ? -0.238  -3.498  14.799  1.00 1.06   ? 37  ALA A C    4  
ATOM 7137  O O    . ALA A 1 37  ? -0.612  -4.661  14.620  1.00 1.16   ? 37  ALA A O    4  
ATOM 7138  C CB   . ALA A 1 37  ? -2.337  -2.111  15.068  1.00 1.20   ? 37  ALA A CB   4  
ATOM 7139  H H    . ALA A 1 37  ? -2.344  -2.337  12.472  1.00 1.13   ? 37  ALA A H    4  
ATOM 7140  H HA   . ALA A 1 37  ? -0.448  -1.445  14.264  1.00 1.13   ? 37  ALA A HA   4  
ATOM 7141  H HB1  . ALA A 1 37  ? -2.925  -3.027  15.099  1.00 1.79   ? 37  ALA A HB1  4  
ATOM 7142  H HB2  . ALA A 1 37  ? -2.048  -1.849  16.088  1.00 1.92   ? 37  ALA A HB2  4  
ATOM 7143  H HB3  . ALA A 1 37  ? -2.947  -1.308  14.662  1.00 2.14   ? 37  ALA A HB3  4  
ATOM 7144  N N    . VAL A 1 38  ? 0.862   -3.192  15.495  1.00 1.10   ? 38  VAL A N    4  
ATOM 7145  C CA   . VAL A 1 38  ? 1.907   -4.169  15.849  1.00 1.11   ? 38  VAL A CA   4  
ATOM 7146  C C    . VAL A 1 38  ? 2.541   -3.798  17.205  1.00 1.17   ? 38  VAL A C    4  
ATOM 7147  O O    . VAL A 1 38  ? 2.734   -2.606  17.458  1.00 1.28   ? 38  VAL A O    4  
ATOM 7148  C CB   . VAL A 1 38  ? 2.954   -4.269  14.696  1.00 1.29   ? 38  VAL A CB   4  
ATOM 7149  C CG1  . VAL A 1 38  ? 4.401   -4.514  15.143  1.00 2.18   ? 38  VAL A CG1  4  
ATOM 7150  C CG2  . VAL A 1 38  ? 2.561   -5.409  13.735  1.00 2.18   ? 38  VAL A CG2  4  
ATOM 7151  H H    . VAL A 1 38  ? 1.061   -2.214  15.674  1.00 1.16   ? 38  VAL A H    4  
ATOM 7152  H HA   . VAL A 1 38  ? 1.431   -5.144  15.954  1.00 1.09   ? 38  VAL A HA   4  
ATOM 7153  H HB   . VAL A 1 38  ? 2.953   -3.326  14.145  1.00 2.63   ? 38  VAL A HB   4  
ATOM 7154  H HG11 . VAL A 1 38  ? 4.758   -3.686  15.756  1.00 3.27   ? 38  VAL A HG11 4  
ATOM 7155  H HG12 . VAL A 1 38  ? 4.453   -5.443  15.707  1.00 2.71   ? 38  VAL A HG12 4  
ATOM 7156  H HG13 . VAL A 1 38  ? 5.053   -4.592  14.273  1.00 2.82   ? 38  VAL A HG13 4  
ATOM 7157  H HG21 . VAL A 1 38  ? 3.279   -5.486  12.919  1.00 2.67   ? 38  VAL A HG21 4  
ATOM 7158  H HG22 . VAL A 1 38  ? 2.541   -6.359  14.273  1.00 2.78   ? 38  VAL A HG22 4  
ATOM 7159  H HG23 . VAL A 1 38  ? 1.578   -5.227  13.306  1.00 3.46   ? 38  VAL A HG23 4  
ATOM 7160  N N    . PRO A 1 39  ? 2.850   -4.785  18.079  1.00 1.21   ? 39  PRO A N    4  
ATOM 7161  C CA   . PRO A 1 39  ? 3.395   -4.552  19.417  1.00 1.34   ? 39  PRO A CA   4  
ATOM 7162  C C    . PRO A 1 39  ? 4.888   -4.171  19.394  1.00 1.35   ? 39  PRO A C    4  
ATOM 7163  O O    . PRO A 1 39  ? 5.583   -4.442  18.410  1.00 1.28   ? 39  PRO A O    4  
ATOM 7164  C CB   . PRO A 1 39  ? 3.177   -5.865  20.178  1.00 1.45   ? 39  PRO A CB   4  
ATOM 7165  C CG   . PRO A 1 39  ? 3.242   -6.920  19.080  1.00 1.39   ? 39  PRO A CG   4  
ATOM 7166  C CD   . PRO A 1 39  ? 2.594   -6.210  17.895  1.00 1.24   ? 39  PRO A CD   4  
ATOM 7167  H HA   . PRO A 1 39  ? 2.826   -3.759  19.902  1.00 1.48   ? 39  PRO A HA   4  
ATOM 7168  H HB2  . PRO A 1 39  ? 3.940   -6.042  20.938  1.00 1.56   ? 39  PRO A HB2  4  
ATOM 7169  H HB3  . PRO A 1 39  ? 2.182   -5.865  20.626  1.00 1.56   ? 39  PRO A HB3  4  
ATOM 7170  H HG2  . PRO A 1 39  ? 4.282   -7.154  18.847  1.00 1.44   ? 39  PRO A HG2  4  
ATOM 7171  H HG3  . PRO A 1 39  ? 2.696   -7.823  19.357  1.00 1.52   ? 39  PRO A HG3  4  
ATOM 7172  H HD2  . PRO A 1 39  ? 3.015   -6.583  16.963  1.00 1.23   ? 39  PRO A HD2  4  
ATOM 7173  H HD3  . PRO A 1 39  ? 1.518   -6.391  17.912  1.00 1.30   ? 39  PRO A HD3  4  
ATOM 7174  N N    . PRO A 1 40  ? 5.413   -3.562  20.479  1.00 1.55   ? 40  PRO A N    4  
ATOM 7175  C CA   . PRO A 1 40  ? 6.813   -3.161  20.578  1.00 1.67   ? 40  PRO A CA   4  
ATOM 7176  C C    . PRO A 1 40  ? 7.758   -4.368  20.620  1.00 1.72   ? 40  PRO A C    4  
ATOM 7177  O O    . PRO A 1 40  ? 7.389   -5.448  21.077  1.00 2.71   ? 40  PRO A O    4  
ATOM 7178  C CB   . PRO A 1 40  ? 6.919   -2.294  21.837  1.00 1.95   ? 40  PRO A CB   4  
ATOM 7179  C CG   . PRO A 1 40  ? 5.786   -2.819  22.716  1.00 2.01   ? 40  PRO A CG   4  
ATOM 7180  C CD   . PRO A 1 40  ? 4.705   -3.188  21.698  1.00 1.78   ? 40  PRO A CD   4  
ATOM 7181  H HA   . PRO A 1 40  ? 7.067   -2.555  19.708  1.00 1.65   ? 40  PRO A HA   4  
ATOM 7182  H HB2  . PRO A 1 40  ? 7.890   -2.384  22.326  1.00 2.08   ? 40  PRO A HB2  4  
ATOM 7183  H HB3  . PRO A 1 40  ? 6.725   -1.251  21.580  1.00 2.04   ? 40  PRO A HB3  4  
ATOM 7184  H HG2  . PRO A 1 40  ? 6.119   -3.715  23.240  1.00 2.07   ? 40  PRO A HG2  4  
ATOM 7185  H HG3  . PRO A 1 40  ? 5.440   -2.066  23.423  1.00 2.21   ? 40  PRO A HG3  4  
ATOM 7186  H HD2  . PRO A 1 40  ? 4.103   -4.011  22.085  1.00 1.81   ? 40  PRO A HD2  4  
ATOM 7187  H HD3  . PRO A 1 40  ? 4.078   -2.317  21.498  1.00 1.84   ? 40  PRO A HD3  4  
ATOM 7188  N N    . SER A 1 41  ? 8.973   -4.147  20.105  1.00 1.85   ? 41  SER A N    4  
ATOM 7189  C CA   . SER A 1 41  ? 10.057  -5.114  19.814  1.00 2.00   ? 41  SER A CA   4  
ATOM 7190  C C    . SER A 1 41  ? 9.982   -5.662  18.378  1.00 1.83   ? 41  SER A C    4  
ATOM 7191  O O    . SER A 1 41  ? 10.938  -6.277  17.907  1.00 2.02   ? 41  SER A O    4  
ATOM 7192  C CB   . SER A 1 41  ? 10.130  -6.293  20.800  1.00 2.28   ? 41  SER A CB   4  
ATOM 7193  O OG   . SER A 1 41  ? 11.338  -7.010  20.615  1.00 2.67   ? 41  SER A OG   4  
ATOM 7194  H H    . SER A 1 41  ? 9.161   -3.203  19.798  1.00 2.65   ? 41  SER A H    4  
ATOM 7195  H HA   . SER A 1 41  ? 11.007  -4.581  19.893  1.00 2.18   ? 41  SER A HA   4  
ATOM 7196  H HB2  . SER A 1 41  ? 10.094  -5.912  21.820  1.00 2.58   ? 41  SER A HB2  4  
ATOM 7197  H HB3  . SER A 1 41  ? 9.285   -6.962  20.636  1.00 2.11   ? 41  SER A HB3  4  
ATOM 7198  H HG   . SER A 1 41  ? 11.405  -7.256  19.677  1.00 3.27   ? 41  SER A HG   4  
ATOM 7199  N N    . ILE A 1 42  ? 8.864   -5.457  17.673  1.00 1.57   ? 42  ILE A N    4  
ATOM 7200  C CA   . ILE A 1 42  ? 8.655   -5.954  16.311  1.00 1.42   ? 42  ILE A CA   4  
ATOM 7201  C C    . ILE A 1 42  ? 8.923   -4.831  15.296  1.00 1.35   ? 42  ILE A C    4  
ATOM 7202  O O    . ILE A 1 42  ? 8.162   -3.870  15.194  1.00 1.66   ? 42  ILE A O    4  
ATOM 7203  C CB   . ILE A 1 42  ? 7.241   -6.556  16.190  1.00 1.45   ? 42  ILE A CB   4  
ATOM 7204  C CG1  . ILE A 1 42  ? 6.915   -7.618  17.270  1.00 1.83   ? 42  ILE A CG1  4  
ATOM 7205  C CG2  . ILE A 1 42  ? 7.015   -7.139  14.785  1.00 1.42   ? 42  ILE A CG2  4  
ATOM 7206  C CD1  . ILE A 1 42  ? 7.868   -8.821  17.328  1.00 2.25   ? 42  ILE A CD1  4  
ATOM 7207  H H    . ILE A 1 42  ? 8.108   -4.948  18.113  1.00 1.52   ? 42  ILE A H    4  
ATOM 7208  H HA   . ILE A 1 42  ? 9.365   -6.754  16.112  1.00 1.44   ? 42  ILE A HA   4  
ATOM 7209  H HB   . ILE A 1 42  ? 6.539   -5.742  16.330  1.00 1.53   ? 42  ILE A HB   4  
ATOM 7210  H HG12 . ILE A 1 42  ? 6.909   -7.140  18.251  1.00 2.05   ? 42  ILE A HG12 4  
ATOM 7211  H HG13 . ILE A 1 42  ? 5.903   -7.989  17.102  1.00 2.12   ? 42  ILE A HG13 4  
ATOM 7212  H HG21 . ILE A 1 42  ? 7.776   -7.885  14.554  1.00 2.02   ? 42  ILE A HG21 4  
ATOM 7213  H HG22 . ILE A 1 42  ? 6.026   -7.599  14.726  1.00 2.09   ? 42  ILE A HG22 4  
ATOM 7214  H HG23 . ILE A 1 42  ? 7.062   -6.342  14.043  1.00 2.17   ? 42  ILE A HG23 4  
ATOM 7215  H HD11 . ILE A 1 42  ? 7.838   -9.371  16.389  1.00 2.84   ? 42  ILE A HD11 4  
ATOM 7216  H HD12 . ILE A 1 42  ? 8.886   -8.491  17.532  1.00 3.07   ? 42  ILE A HD12 4  
ATOM 7217  H HD13 . ILE A 1 42  ? 7.551   -9.483  18.134  1.00 2.68   ? 42  ILE A HD13 4  
ATOM 7218  N N    . ARG A 1 43  ? 10.035  -4.961  14.558  1.00 1.21   ? 43  ARG A N    4  
ATOM 7219  C CA   . ARG A 1 43  ? 10.513  -4.023  13.531  1.00 1.23   ? 43  ARG A CA   4  
ATOM 7220  C C    . ARG A 1 43  ? 10.002  -4.360  12.119  1.00 1.04   ? 43  ARG A C    4  
ATOM 7221  O O    . ARG A 1 43  ? 10.601  -3.924  11.136  1.00 1.18   ? 43  ARG A O    4  
ATOM 7222  C CB   . ARG A 1 43  ? 12.048  -3.897  13.629  1.00 1.56   ? 43  ARG A CB   4  
ATOM 7223  C CG   . ARG A 1 43  ? 12.808  -5.197  13.309  1.00 2.47   ? 43  ARG A CG   4  
ATOM 7224  C CD   . ARG A 1 43  ? 14.297  -5.061  13.638  1.00 2.90   ? 43  ARG A CD   4  
ATOM 7225  N NE   . ARG A 1 43  ? 15.020  -6.268  13.189  1.00 3.86   ? 43  ARG A NE   4  
ATOM 7226  C CZ   . ARG A 1 43  ? 16.333  -6.470  13.270  1.00 4.51   ? 43  ARG A CZ   4  
ATOM 7227  N NH1  . ARG A 1 43  ? 17.143  -5.698  13.966  1.00 4.43   ? 43  ARG A NH1  4  
ATOM 7228  N NH2  . ARG A 1 43  ? 16.856  -7.529  12.694  1.00 5.60   ? 43  ARG A NH2  4  
ATOM 7229  H H    . ARG A 1 43  ? 10.628  -5.759  14.732  1.00 1.32   ? 43  ARG A H    4  
ATOM 7230  H HA   . ARG A 1 43  ? 10.106  -3.034  13.763  1.00 1.30   ? 43  ARG A HA   4  
ATOM 7231  H HB2  . ARG A 1 43  ? 12.386  -3.115  12.943  1.00 1.94   ? 43  ARG A HB2  4  
ATOM 7232  H HB3  . ARG A 1 43  ? 12.294  -3.589  14.648  1.00 1.87   ? 43  ARG A HB3  4  
ATOM 7233  H HG2  . ARG A 1 43  ? 12.394  -6.028  13.875  1.00 3.06   ? 43  ARG A HG2  4  
ATOM 7234  H HG3  . ARG A 1 43  ? 12.699  -5.412  12.254  1.00 3.08   ? 43  ARG A HG3  4  
ATOM 7235  H HD2  . ARG A 1 43  ? 14.699  -4.167  13.147  1.00 3.02   ? 43  ARG A HD2  4  
ATOM 7236  H HD3  . ARG A 1 43  ? 14.418  -4.969  14.715  1.00 3.07   ? 43  ARG A HD3  4  
ATOM 7237  H HE   . ARG A 1 43  ? 14.478  -6.918  12.641  1.00 4.36   ? 43  ARG A HE   4  
ATOM 7238  H HH11 . ARG A 1 43  ? 16.825  -4.932  14.533  1.00 3.94   ? 43  ARG A HH11 4  
ATOM 7239  H HH12 . ARG A 1 43  ? 18.124  -5.949  13.994  1.00 5.17   ? 43  ARG A HH12 4  
ATOM 7240  H HH21 . ARG A 1 43  ? 16.295  -8.200  12.191  1.00 6.02   ? 43  ARG A HH21 4  
ATOM 7241  H HH22 . ARG A 1 43  ? 17.859  -7.677  12.797  1.00 6.17   ? 43  ARG A HH22 4  
ATOM 7242  N N    . ASP A 1 44  ? 8.894   -5.087  12.000  1.00 0.91   ? 44  ASP A N    4  
ATOM 7243  C CA   . ASP A 1 44  ? 8.331   -5.572  10.741  1.00 0.90   ? 44  ASP A CA   4  
ATOM 7244  C C    . ASP A 1 44  ? 6.809   -5.355  10.738  1.00 0.79   ? 44  ASP A C    4  
ATOM 7245  O O    . ASP A 1 44  ? 6.112   -5.746  11.678  1.00 0.92   ? 44  ASP A O    4  
ATOM 7246  C CB   . ASP A 1 44  ? 8.633   -7.075  10.582  1.00 1.16   ? 44  ASP A CB   4  
ATOM 7247  C CG   . ASP A 1 44  ? 10.099  -7.416  10.285  1.00 1.40   ? 44  ASP A CG   4  
ATOM 7248  O OD1  . ASP A 1 44  ? 10.983  -7.143  11.127  1.00 1.91   ? 44  ASP A OD1  4  
ATOM 7249  O OD2  . ASP A 1 44  ? 10.333  -8.041  9.222   1.00 2.53   ? 44  ASP A OD2  4  
ATOM 7250  H H    . ASP A 1 44  ? 8.405   -5.329  12.849  1.00 0.98   ? 44  ASP A H    4  
ATOM 7251  H HA   . ASP A 1 44  ? 8.763   -5.027  9.898   1.00 0.98   ? 44  ASP A HA   4  
ATOM 7252  H HB2  . ASP A 1 44  ? 8.337   -7.598  11.492  1.00 1.31   ? 44  ASP A HB2  4  
ATOM 7253  H HB3  . ASP A 1 44  ? 8.014   -7.463  9.770   1.00 1.33   ? 44  ASP A HB3  4  
ATOM 7254  N N    . THR A 1 45  ? 6.280   -4.752  9.663   1.00 0.70   ? 45  THR A N    4  
ATOM 7255  C CA   . THR A 1 45  ? 4.841   -4.491  9.491   1.00 0.73   ? 45  THR A CA   4  
ATOM 7256  C C    . THR A 1 45  ? 4.399   -4.683  8.044   1.00 0.59   ? 45  THR A C    4  
ATOM 7257  O O    . THR A 1 45  ? 5.207   -4.623  7.118   1.00 0.67   ? 45  THR A O    4  
ATOM 7258  C CB   . THR A 1 45  ? 4.437   -3.092  9.978   1.00 1.07   ? 45  THR A CB   4  
ATOM 7259  O OG1  . THR A 1 45  ? 5.083   -2.109  9.216   1.00 2.68   ? 45  THR A OG1  4  
ATOM 7260  C CG2  . THR A 1 45  ? 4.748   -2.845  11.450  1.00 1.36   ? 45  THR A CG2  4  
ATOM 7261  H H    . THR A 1 45  ? 6.894   -4.463  8.913   1.00 0.73   ? 45  THR A H    4  
ATOM 7262  H HA   . THR A 1 45  ? 4.289   -5.209  10.102  1.00 0.96   ? 45  THR A HA   4  
ATOM 7263  H HB   . THR A 1 45  ? 3.360   -2.971  9.847   1.00 1.90   ? 45  THR A HB   4  
ATOM 7264  H HG1  . THR A 1 45  ? 6.029   -2.314  9.141   1.00 3.54   ? 45  THR A HG1  4  
ATOM 7265  H HG21 . THR A 1 45  ? 4.326   -1.887  11.754  1.00 2.10   ? 45  THR A HG21 4  
ATOM 7266  H HG22 . THR A 1 45  ? 4.289   -3.629  12.047  1.00 2.50   ? 45  THR A HG22 4  
ATOM 7267  H HG23 . THR A 1 45  ? 5.825   -2.847  11.625  1.00 2.26   ? 45  THR A HG23 4  
ATOM 7268  N N    . ALA A 1 46  ? 3.094   -4.879  7.854   1.00 0.73   ? 46  ALA A N    4  
ATOM 7269  C CA   . ALA A 1 46  ? 2.433   -5.050  6.561   1.00 0.87   ? 46  ALA A CA   4  
ATOM 7270  C C    . ALA A 1 46  ? 1.186   -4.151  6.487   1.00 0.89   ? 46  ALA A C    4  
ATOM 7271  O O    . ALA A 1 46  ? 0.566   -3.891  7.515   1.00 0.94   ? 46  ALA A O    4  
ATOM 7272  C CB   . ALA A 1 46  ? 2.121   -6.540  6.391   1.00 1.09   ? 46  ALA A CB   4  
ATOM 7273  H H    . ALA A 1 46  ? 2.488   -4.853  8.660   1.00 0.87   ? 46  ALA A H    4  
ATOM 7274  H HA   . ALA A 1 46  ? 3.107   -4.755  5.768   1.00 0.98   ? 46  ALA A HA   4  
ATOM 7275  H HB1  . ALA A 1 46  ? 2.975   -7.140  6.708   1.00 2.10   ? 46  ALA A HB1  4  
ATOM 7276  H HB2  . ALA A 1 46  ? 1.252   -6.816  6.989   1.00 2.17   ? 46  ALA A HB2  4  
ATOM 7277  H HB3  . ALA A 1 46  ? 1.938   -6.757  5.342   1.00 1.64   ? 46  ALA A HB3  4  
ATOM 7278  N N    . ALA A 1 47  ? 0.818   -3.647  5.306   1.00 0.98   ? 47  ALA A N    4  
ATOM 7279  C CA   . ALA A 1 47  ? -0.211  -2.612  5.160   1.00 0.91   ? 47  ALA A CA   4  
ATOM 7280  C C    . ALA A 1 47  ? -1.137  -2.862  3.957   1.00 0.96   ? 47  ALA A C    4  
ATOM 7281  O O    . ALA A 1 47  ? -0.761  -3.487  2.963   1.00 1.14   ? 47  ALA A O    4  
ATOM 7282  C CB   . ALA A 1 47  ? 0.483   -1.242  5.123   1.00 0.99   ? 47  ALA A CB   4  
ATOM 7283  H H    . ALA A 1 47  ? 1.376   -3.855  4.485   1.00 1.04   ? 47  ALA A H    4  
ATOM 7284  H HA   . ALA A 1 47  ? -0.862  -2.623  6.040   1.00 0.94   ? 47  ALA A HA   4  
ATOM 7285  H HB1  . ALA A 1 47  ? 1.204   -1.190  4.310   1.00 1.37   ? 47  ALA A HB1  4  
ATOM 7286  H HB2  . ALA A 1 47  ? -0.256  -0.450  5.003   1.00 1.89   ? 47  ALA A HB2  4  
ATOM 7287  H HB3  . ALA A 1 47  ? 1.010   -1.083  6.063   1.00 2.02   ? 47  ALA A HB3  4  
ATOM 7288  N N    . TYR A 1 48  ? -2.388  -2.434  4.090   1.00 1.00   ? 48  TYR A N    4  
ATOM 7289  C CA   . TYR A 1 48  ? -3.527  -2.883  3.289   1.00 1.14   ? 48  TYR A CA   4  
ATOM 7290  C C    . TYR A 1 48  ? -4.030  -1.803  2.321   1.00 0.88   ? 48  TYR A C    4  
ATOM 7291  O O    . TYR A 1 48  ? -4.106  -0.622  2.667   1.00 1.11   ? 48  TYR A O    4  
ATOM 7292  C CB   . TYR A 1 48  ? -4.650  -3.313  4.247   1.00 1.77   ? 48  TYR A CB   4  
ATOM 7293  C CG   . TYR A 1 48  ? -4.213  -4.244  5.370   1.00 1.78   ? 48  TYR A CG   4  
ATOM 7294  C CD1  . TYR A 1 48  ? -3.613  -5.490  5.088   1.00 2.06   ? 48  TYR A CD1  4  
ATOM 7295  C CD2  . TYR A 1 48  ? -4.380  -3.840  6.708   1.00 3.08   ? 48  TYR A CD2  4  
ATOM 7296  C CE1  . TYR A 1 48  ? -3.198  -6.329  6.140   1.00 2.72   ? 48  TYR A CE1  4  
ATOM 7297  C CE2  . TYR A 1 48  ? -3.954  -4.663  7.763   1.00 3.52   ? 48  TYR A CE2  4  
ATOM 7298  C CZ   . TYR A 1 48  ? -3.363  -5.914  7.481   1.00 3.04   ? 48  TYR A CZ   4  
ATOM 7299  O OH   . TYR A 1 48  ? -2.951  -6.702  8.508   1.00 3.88   ? 48  TYR A OH   4  
ATOM 7300  H H    . TYR A 1 48  ? -2.605  -1.891  4.921   1.00 1.00   ? 48  TYR A H    4  
ATOM 7301  H HA   . TYR A 1 48  ? -3.225  -3.752  2.706   1.00 1.32   ? 48  TYR A HA   4  
ATOM 7302  H HB2  . TYR A 1 48  ? -5.080  -2.413  4.692   1.00 2.44   ? 48  TYR A HB2  4  
ATOM 7303  H HB3  . TYR A 1 48  ? -5.444  -3.797  3.678   1.00 2.31   ? 48  TYR A HB3  4  
ATOM 7304  H HD1  . TYR A 1 48  ? -3.470  -5.811  4.067   1.00 2.79   ? 48  TYR A HD1  4  
ATOM 7305  H HD2  . TYR A 1 48  ? -4.824  -2.881  6.929   1.00 4.13   ? 48  TYR A HD2  4  
ATOM 7306  H HE1  . TYR A 1 48  ? -2.752  -7.291  5.936   1.00 3.67   ? 48  TYR A HE1  4  
ATOM 7307  H HE2  . TYR A 1 48  ? -4.083  -4.333  8.783   1.00 4.70   ? 48  TYR A HE2  4  
ATOM 7308  H HH   . TYR A 1 48  ? -3.106  -6.264  9.344   1.00 4.43   ? 48  TYR A HH   4  
ATOM 7309  N N    . MET A 1 49  ? -4.392  -2.225  1.103   1.00 0.85   ? 49  MET A N    4  
ATOM 7310  C CA   . MET A 1 49  ? -4.835  -1.330  0.029   1.00 1.19   ? 49  MET A CA   4  
ATOM 7311  C C    . MET A 1 49  ? -5.733  -2.048  -0.988  1.00 1.10   ? 49  MET A C    4  
ATOM 7312  O O    . MET A 1 49  ? -5.401  -3.138  -1.455  1.00 1.16   ? 49  MET A O    4  
ATOM 7313  C CB   . MET A 1 49  ? -3.607  -0.725  -0.672  1.00 1.81   ? 49  MET A CB   4  
ATOM 7314  C CG   . MET A 1 49  ? -3.040  0.546   -0.045  1.00 2.30   ? 49  MET A CG   4  
ATOM 7315  S SD   . MET A 1 49  ? -1.849  1.337   -1.157  1.00 3.84   ? 49  MET A SD   4  
ATOM 7316  C CE   . MET A 1 49  ? -1.433  2.812   -0.207  1.00 4.66   ? 49  MET A CE   4  
ATOM 7317  H H    . MET A 1 49  ? -4.297  -3.210  0.877   1.00 0.93   ? 49  MET A H    4  
ATOM 7318  H HA   . MET A 1 49  ? -5.420  -0.529  0.470   1.00 1.59   ? 49  MET A HA   4  
ATOM 7319  H HB2  . MET A 1 49  ? -2.797  -1.450  -0.668  1.00 2.49   ? 49  MET A HB2  4  
ATOM 7320  H HB3  . MET A 1 49  ? -3.869  -0.505  -1.705  1.00 2.43   ? 49  MET A HB3  4  
ATOM 7321  H HG2  . MET A 1 49  ? -3.851  1.236   0.185   1.00 2.67   ? 49  MET A HG2  4  
ATOM 7322  H HG3  . MET A 1 49  ? -2.530  0.282   0.881   1.00 2.82   ? 49  MET A HG3  4  
ATOM 7323  H HE1  . MET A 1 49  ? -1.042  2.525   0.770   1.00 4.91   ? 49  MET A HE1  4  
ATOM 7324  H HE2  . MET A 1 49  ? -0.674  3.386   -0.741  1.00 5.64   ? 49  MET A HE2  4  
ATOM 7325  H HE3  . MET A 1 49  ? -2.317  3.433   -0.093  1.00 4.75   ? 49  MET A HE3  4  
ATOM 7326  N N    . THR A 1 50  ? -6.840  -1.403  -1.380  1.00 1.16   ? 50  THR A N    4  
ATOM 7327  C CA   . THR A 1 50  ? -7.872  -1.929  -2.300  1.00 1.15   ? 50  THR A CA   4  
ATOM 7328  C C    . THR A 1 50  ? -8.479  -0.775  -3.094  1.00 1.35   ? 50  THR A C    4  
ATOM 7329  O O    . THR A 1 50  ? -8.768  0.262   -2.503  1.00 1.62   ? 50  THR A O    4  
ATOM 7330  C CB   . THR A 1 50  ? -9.017  -2.559  -1.493  1.00 1.26   ? 50  THR A CB   4  
ATOM 7331  O OG1  . THR A 1 50  ? -8.519  -3.334  -0.427  1.00 2.10   ? 50  THR A OG1  4  
ATOM 7332  C CG2  . THR A 1 50  ? -9.879  -3.495  -2.345  1.00 1.68   ? 50  THR A CG2  4  
ATOM 7333  H H    . THR A 1 50  ? -7.055  -0.517  -0.937  1.00 1.32   ? 50  THR A H    4  
ATOM 7334  H HA   . THR A 1 50  ? -7.449  -2.663  -2.985  1.00 1.25   ? 50  THR A HA   4  
ATOM 7335  H HB   . THR A 1 50  ? -9.623  -1.736  -1.091  1.00 1.89   ? 50  THR A HB   4  
ATOM 7336  H HG1  . THR A 1 50  ? -8.155  -4.140  -0.801  1.00 2.54   ? 50  THR A HG1  4  
ATOM 7337  H HG21 . THR A 1 50  ? -10.324 -2.956  -3.177  1.00 2.22   ? 50  THR A HG21 4  
ATOM 7338  H HG22 . THR A 1 50  ? -9.276  -4.313  -2.739  1.00 2.36   ? 50  THR A HG22 4  
ATOM 7339  H HG23 . THR A 1 50  ? -10.683 -3.901  -1.733  1.00 2.49   ? 50  THR A HG23 4  
ATOM 7340  N N    . LEU A 1 51  ? -8.714  -0.911  -4.402  1.00 1.51   ? 51  LEU A N    4  
ATOM 7341  C CA   . LEU A 1 51  ? -9.482  0.106   -5.150  1.00 1.68   ? 51  LEU A CA   4  
ATOM 7342  C C    . LEU A 1 51  ? -10.988 0.050   -4.815  1.00 1.54   ? 51  LEU A C    4  
ATOM 7343  O O    . LEU A 1 51  ? -11.433 -0.868  -4.125  1.00 2.73   ? 51  LEU A O    4  
ATOM 7344  C CB   . LEU A 1 51  ? -9.161  -0.003  -6.658  1.00 2.73   ? 51  LEU A CB   4  
ATOM 7345  C CG   . LEU A 1 51  ? -9.921  -1.024  -7.547  1.00 5.12   ? 51  LEU A CG   4  
ATOM 7346  C CD1  . LEU A 1 51  ? -10.149 -2.402  -6.916  1.00 6.75   ? 51  LEU A CD1  4  
ATOM 7347  C CD2  . LEU A 1 51  ? -11.273 -0.515  -8.076  1.00 6.07   ? 51  LEU A CD2  4  
ATOM 7348  H H    . LEU A 1 51  ? -8.454  -1.772  -4.871  1.00 1.61   ? 51  LEU A H    4  
ATOM 7349  H HA   . LEU A 1 51  ? -9.141  1.092   -4.812  1.00 1.80   ? 51  LEU A HA   4  
ATOM 7350  H HB2  . LEU A 1 51  ? -9.304  0.987   -7.090  1.00 3.22   ? 51  LEU A HB2  4  
ATOM 7351  H HB3  . LEU A 1 51  ? -8.093  -0.218  -6.752  1.00 2.39   ? 51  LEU A HB3  4  
ATOM 7352  H HG   . LEU A 1 51  ? -9.296  -1.168  -8.429  1.00 5.87   ? 51  LEU A HG   4  
ATOM 7353  H HD11 . LEU A 1 51  ? -9.198  -2.895  -6.740  1.00 7.30   ? 51  LEU A HD11 4  
ATOM 7354  H HD12 . LEU A 1 51  ? -10.694 -2.337  -5.982  1.00 7.09   ? 51  LEU A HD12 4  
ATOM 7355  H HD13 . LEU A 1 51  ? -10.749 -3.012  -7.589  1.00 7.74   ? 51  LEU A HD13 4  
ATOM 7356  H HD21 . LEU A 1 51  ? -12.055 -0.646  -7.331  1.00 6.61   ? 51  LEU A HD21 4  
ATOM 7357  H HD22 . LEU A 1 51  ? -11.203 0.534   -8.363  1.00 5.81   ? 51  LEU A HD22 4  
ATOM 7358  H HD23 . LEU A 1 51  ? -11.557 -1.097  -8.955  1.00 7.23   ? 51  LEU A HD23 4  
ATOM 7359  N N    . THR A 1 52  ? -11.792 0.996   -5.330  1.00 1.27   ? 52  THR A N    4  
ATOM 7360  C CA   . THR A 1 52  ? -13.247 1.006   -5.098  1.00 1.69   ? 52  THR A CA   4  
ATOM 7361  C C    . THR A 1 52  ? -14.057 1.806   -6.137  1.00 1.72   ? 52  THR A C    4  
ATOM 7362  O O    . THR A 1 52  ? -15.067 2.419   -5.797  1.00 2.46   ? 52  THR A O    4  
ATOM 7363  C CB   . THR A 1 52  ? -13.504 1.373   -3.627  1.00 2.43   ? 52  THR A CB   4  
ATOM 7364  O OG1  . THR A 1 52  ? -14.862 1.185   -3.342  1.00 3.41   ? 52  THR A OG1  4  
ATOM 7365  C CG2  . THR A 1 52  ? -13.116 2.801   -3.262  1.00 3.38   ? 52  THR A CG2  4  
ATOM 7366  H H    . THR A 1 52  ? -11.378 1.796   -5.784  1.00 1.80   ? 52  THR A H    4  
ATOM 7367  H HA   . THR A 1 52  ? -13.596 -0.021  -5.206  1.00 2.22   ? 52  THR A HA   4  
ATOM 7368  H HB   . THR A 1 52  ? -12.906 0.715   -2.988  1.00 2.41   ? 52  THR A HB   4  
ATOM 7369  H HG1  . THR A 1 52  ? -15.329 1.722   -4.004  1.00 3.62   ? 52  THR A HG1  4  
ATOM 7370  H HG21 . THR A 1 52  ? -13.688 3.524   -3.841  1.00 3.79   ? 52  THR A HG21 4  
ATOM 7371  H HG22 . THR A 1 52  ? -13.312 2.952   -2.203  1.00 4.02   ? 52  THR A HG22 4  
ATOM 7372  H HG23 . THR A 1 52  ? -12.053 2.956   -3.438  1.00 4.18   ? 52  THR A HG23 4  
ATOM 7373  N N    . ASN A 1 53  ? -13.649 1.819   -7.415  1.00 1.44   ? 53  ASN A N    4  
ATOM 7374  C CA   . ASN A 1 53  ? -14.349 2.533   -8.471  1.00 1.45   ? 53  ASN A CA   4  
ATOM 7375  C C    . ASN A 1 53  ? -15.621 1.799   -8.922  1.00 1.56   ? 53  ASN A C    4  
ATOM 7376  O O    . ASN A 1 53  ? -15.619 0.575   -9.057  1.00 1.81   ? 53  ASN A O    4  
ATOM 7377  C CB   . ASN A 1 53  ? -13.331 2.649   -9.594  1.00 1.52   ? 53  ASN A CB   4  
ATOM 7378  C CG   . ASN A 1 53  ? -13.830 3.221   -10.904 1.00 2.18   ? 53  ASN A CG   4  
ATOM 7379  O OD1  . ASN A 1 53  ? -14.865 3.866   -11.059 1.00 3.69   ? 53  ASN A OD1  4  
ATOM 7380  N ND2  . ASN A 1 53  ? -13.059 2.942   -11.918 1.00 2.18   ? 53  ASN A ND2  4  
ATOM 7381  H H    . ASN A 1 53  ? -12.900 1.239   -7.763  1.00 1.61   ? 53  ASN A H    4  
ATOM 7382  H HA   . ASN A 1 53  ? -14.621 3.527   -8.129  1.00 1.64   ? 53  ASN A HA   4  
ATOM 7383  H HB2  . ASN A 1 53  ? -12.488 3.256   -9.267  1.00 2.62   ? 53  ASN A HB2  4  
ATOM 7384  H HB3  . ASN A 1 53  ? -12.964 1.642   -9.805  1.00 2.22   ? 53  ASN A HB3  4  
ATOM 7385  H HD21 . ASN A 1 53  ? -12.160 2.523   -11.747 1.00 1.92   ? 53  ASN A HD21 4  
ATOM 7386  H HD22 . ASN A 1 53  ? -13.346 3.237   -12.817 1.00 3.21   ? 53  ASN A HD22 4  
ATOM 7387  N N    . LYS A 1 54  ? -16.674 2.576   -9.205  1.00 1.70   ? 54  LYS A N    4  
ATOM 7388  C CA   . LYS A 1 54  ? -17.999 2.066   -9.608  1.00 2.02   ? 54  LYS A CA   4  
ATOM 7389  C C    . LYS A 1 54  ? -18.709 2.943   -10.673 1.00 1.93   ? 54  LYS A C    4  
ATOM 7390  O O    . LYS A 1 54  ? -19.933 2.956   -10.748 1.00 2.55   ? 54  LYS A O    4  
ATOM 7391  C CB   . LYS A 1 54  ? -18.826 1.826   -8.321  1.00 2.68   ? 54  LYS A CB   4  
ATOM 7392  C CG   . LYS A 1 54  ? -19.785 0.624   -8.430  1.00 3.36   ? 54  LYS A CG   4  
ATOM 7393  C CD   . LYS A 1 54  ? -20.422 0.285   -7.069  1.00 4.01   ? 54  LYS A CD   4  
ATOM 7394  C CE   . LYS A 1 54  ? -21.222 -1.028  -7.134  1.00 4.93   ? 54  LYS A CE   4  
ATOM 7395  N NZ   . LYS A 1 54  ? -21.686 -1.451  -5.785  1.00 5.32   ? 54  LYS A NZ   4  
ATOM 7396  H H    . LYS A 1 54  ? -16.537 3.579   -9.120  1.00 1.78   ? 54  LYS A H    4  
ATOM 7397  H HA   . LYS A 1 54  ? -17.846 1.098   -10.093 1.00 2.07   ? 54  LYS A HA   4  
ATOM 7398  H HB2  . LYS A 1 54  ? -18.140 1.617   -7.498  1.00 2.85   ? 54  LYS A HB2  4  
ATOM 7399  H HB3  . LYS A 1 54  ? -19.384 2.728   -8.063  1.00 2.95   ? 54  LYS A HB3  4  
ATOM 7400  H HG2  . LYS A 1 54  ? -20.570 0.840   -9.156  1.00 3.50   ? 54  LYS A HG2  4  
ATOM 7401  H HG3  . LYS A 1 54  ? -19.222 -0.243  -8.775  1.00 3.71   ? 54  LYS A HG3  4  
ATOM 7402  H HD2  . LYS A 1 54  ? -19.624 0.171   -6.330  1.00 4.17   ? 54  LYS A HD2  4  
ATOM 7403  H HD3  . LYS A 1 54  ? -21.078 1.103   -6.764  1.00 4.15   ? 54  LYS A HD3  4  
ATOM 7404  H HE2  . LYS A 1 54  ? -22.079 -0.902  -7.802  1.00 5.28   ? 54  LYS A HE2  4  
ATOM 7405  H HE3  . LYS A 1 54  ? -20.581 -1.807  -7.557  1.00 5.44   ? 54  LYS A HE3  4  
ATOM 7406  H HZ1  . LYS A 1 54  ? -22.161 -2.348  -5.815  1.00 5.96   ? 54  LYS A HZ1  4  
ATOM 7407  H HZ2  . LYS A 1 54  ? -20.895 -1.523  -5.142  1.00 5.59   ? 54  LYS A HZ2  4  
ATOM 7408  H HZ3  . LYS A 1 54  ? -22.326 -0.771  -5.404  1.00 5.21   ? 54  LYS A HZ3  4  
ATOM 7409  N N    . SER A 1 55  ? -17.945 3.669   -11.500 1.00 1.51   ? 55  SER A N    4  
ATOM 7410  C CA   . SER A 1 55  ? -18.453 4.604   -12.528 1.00 1.68   ? 55  SER A CA   4  
ATOM 7411  C C    . SER A 1 55  ? -17.474 4.754   -13.714 1.00 1.76   ? 55  SER A C    4  
ATOM 7412  O O    . SER A 1 55  ? -17.719 4.159   -14.763 1.00 2.96   ? 55  SER A O    4  
ATOM 7413  C CB   . SER A 1 55  ? -18.724 5.991   -11.913 1.00 2.05   ? 55  SER A CB   4  
ATOM 7414  O OG   . SER A 1 55  ? -19.983 6.073   -11.261 1.00 2.53   ? 55  SER A OG   4  
ATOM 7415  H H    . SER A 1 55  ? -16.939 3.564   -11.424 1.00 1.46   ? 55  SER A H    4  
ATOM 7416  H HA   . SER A 1 55  ? -19.388 4.219   -12.943 1.00 1.81   ? 55  SER A HA   4  
ATOM 7417  H HB2  . SER A 1 55  ? -17.935 6.234   -11.203 1.00 2.27   ? 55  SER A HB2  4  
ATOM 7418  H HB3  . SER A 1 55  ? -18.712 6.741   -12.711 1.00 2.32   ? 55  SER A HB3  4  
ATOM 7419  H HG   . SER A 1 55  ? -20.635 6.368   -11.924 1.00 2.82   ? 55  SER A HG   4  
ATOM 7420  N N    . ASP A 1 56  ? -16.372 5.504   -13.525 1.00 1.87   ? 56  ASP A N    4  
ATOM 7421  C CA   . ASP A 1 56  ? -15.317 5.904   -14.479 1.00 2.25   ? 56  ASP A CA   4  
ATOM 7422  C C    . ASP A 1 56  ? -14.359 6.878   -13.750 1.00 2.66   ? 56  ASP A C    4  
ATOM 7423  O O    . ASP A 1 56  ? -14.104 7.996   -14.188 1.00 3.35   ? 56  ASP A O    4  
ATOM 7424  C CB   . ASP A 1 56  ? -15.852 6.497   -15.809 1.00 2.76   ? 56  ASP A CB   4  
ATOM 7425  C CG   . ASP A 1 56  ? -14.711 6.788   -16.806 1.00 3.91   ? 56  ASP A CG   4  
ATOM 7426  O OD1  . ASP A 1 56  ? -13.948 5.845   -17.112 1.00 4.51   ? 56  ASP A OD1  4  
ATOM 7427  O OD2  . ASP A 1 56  ? -14.577 7.939   -17.288 1.00 5.22   ? 56  ASP A OD2  4  
ATOM 7428  H H    . ASP A 1 56  ? -16.243 5.880   -12.604 1.00 2.77   ? 56  ASP A H    4  
ATOM 7429  H HA   . ASP A 1 56  ? -14.752 5.007   -14.738 1.00 2.13   ? 56  ASP A HA   4  
ATOM 7430  H HB2  . ASP A 1 56  ? -16.537 5.794   -16.283 1.00 2.41   ? 56  ASP A HB2  4  
ATOM 7431  H HB3  . ASP A 1 56  ? -16.401 7.418   -15.599 1.00 3.80   ? 56  ASP A HB3  4  
ATOM 7432  N N    . GLN A 1 57  ? -13.863 6.480   -12.576 1.00 2.48   ? 57  GLN A N    4  
ATOM 7433  C CA   . GLN A 1 57  ? -12.865 7.260   -11.845 1.00 2.90   ? 57  GLN A CA   4  
ATOM 7434  C C    . GLN A 1 57  ? -11.690 6.347   -11.450 1.00 2.88   ? 57  GLN A C    4  
ATOM 7435  O O    . GLN A 1 57  ? -11.803 5.586   -10.480 1.00 2.91   ? 57  GLN A O    4  
ATOM 7436  C CB   . GLN A 1 57  ? -13.491 7.950   -10.621 1.00 3.17   ? 57  GLN A CB   4  
ATOM 7437  C CG   . GLN A 1 57  ? -14.563 8.993   -10.991 1.00 2.86   ? 57  GLN A CG   4  
ATOM 7438  C CD   . GLN A 1 57  ? -14.836 10.024  -9.879  1.00 3.77   ? 57  GLN A CD   4  
ATOM 7439  O OE1  . GLN A 1 57  ? -14.662 9.787   -8.696  1.00 4.94   ? 57  GLN A OE1  4  
ATOM 7440  N NE2  . GLN A 1 57  ? -15.302 11.208  -10.217 1.00 4.05   ? 57  GLN A NE2  4  
ATOM 7441  H H    . GLN A 1 57  ? -14.089 5.555   -12.234 1.00 2.09   ? 57  GLN A H    4  
ATOM 7442  H HA   . GLN A 1 57  ? -12.472 8.063   -12.473 1.00 3.19   ? 57  GLN A HA   4  
ATOM 7443  H HB2  . GLN A 1 57  ? -13.906 7.204   -9.953  1.00 3.68   ? 57  GLN A HB2  4  
ATOM 7444  H HB3  . GLN A 1 57  ? -12.690 8.435   -10.072 1.00 3.88   ? 57  GLN A HB3  4  
ATOM 7445  H HG2  . GLN A 1 57  ? -14.218 9.522   -11.879 1.00 3.06   ? 57  GLN A HG2  4  
ATOM 7446  H HG3  . GLN A 1 57  ? -15.499 8.470   -11.206 1.00 2.88   ? 57  GLN A HG3  4  
ATOM 7447  H HE21 . GLN A 1 57  ? -15.387 11.438  -11.191 1.00 4.17   ? 57  GLN A HE21 4  
ATOM 7448  H HE22 . GLN A 1 57  ? -15.538 11.845  -9.466  1.00 4.74   ? 57  GLN A HE22 4  
ATOM 7449  N N    . PRO A 1 58  ? -10.563 6.399   -12.187 1.00 2.97   ? 58  PRO A N    4  
ATOM 7450  C CA   . PRO A 1 58  ? -9.317  5.815   -11.742 1.00 3.13   ? 58  PRO A CA   4  
ATOM 7451  C C    . PRO A 1 58  ? -8.482  6.834   -10.966 1.00 3.29   ? 58  PRO A C    4  
ATOM 7452  O O    . PRO A 1 58  ? -8.622  8.046   -11.127 1.00 3.79   ? 58  PRO A O    4  
ATOM 7453  C CB   . PRO A 1 58  ? -8.597  5.389   -13.011 1.00 3.22   ? 58  PRO A CB   4  
ATOM 7454  C CG   . PRO A 1 58  ? -8.963  6.530   -13.968 1.00 3.28   ? 58  PRO A CG   4  
ATOM 7455  C CD   . PRO A 1 58  ? -10.405 6.883   -13.556 1.00 3.03   ? 58  PRO A CD   4  
ATOM 7456  H HA   . PRO A 1 58  ? -9.499  4.949   -11.114 1.00 3.16   ? 58  PRO A HA   4  
ATOM 7457  H HB2  . PRO A 1 58  ? -7.521  5.232   -12.821 1.00 3.44   ? 58  PRO A HB2  4  
ATOM 7458  H HB3  . PRO A 1 58  ? -9.050  4.476   -13.388 1.00 3.14   ? 58  PRO A HB3  4  
ATOM 7459  H HG2  . PRO A 1 58  ? -8.303  7.385   -13.794 1.00 3.50   ? 58  PRO A HG2  4  
ATOM 7460  H HG3  . PRO A 1 58  ? -8.904  6.215   -15.012 1.00 3.33   ? 58  PRO A HG3  4  
ATOM 7461  H HD2  . PRO A 1 58  ? -10.558 7.959   -13.623 1.00 3.14   ? 58  PRO A HD2  4  
ATOM 7462  H HD3  . PRO A 1 58  ? -11.104 6.361   -14.213 1.00 2.90   ? 58  PRO A HD3  4  
ATOM 7463  N N    . ILE A 1 59  ? -7.544  6.301   -10.186 1.00 2.98   ? 59  ILE A N    4  
ATOM 7464  C CA   . ILE A 1 59  ? -6.555  7.034   -9.387  1.00 3.07   ? 59  ILE A CA   4  
ATOM 7465  C C    . ILE A 1 59  ? -5.171  6.481   -9.771  1.00 2.74   ? 59  ILE A C    4  
ATOM 7466  O O    . ILE A 1 59  ? -4.477  5.870   -8.968  1.00 3.72   ? 59  ILE A O    4  
ATOM 7467  C CB   . ILE A 1 59  ? -6.897  6.933   -7.872  1.00 3.42   ? 59  ILE A CB   4  
ATOM 7468  C CG1  . ILE A 1 59  ? -8.351  7.354   -7.531  1.00 3.86   ? 59  ILE A CG1  4  
ATOM 7469  C CG2  . ILE A 1 59  ? -5.924  7.761   -7.008  1.00 3.65   ? 59  ILE A CG2  4  
ATOM 7470  C CD1  . ILE A 1 59  ? -8.692  8.836   -7.760  1.00 3.96   ? 59  ILE A CD1  4  
ATOM 7471  H H    . ILE A 1 59  ? -7.469  5.290   -10.203 1.00 2.77   ? 59  ILE A H    4  
ATOM 7472  H HA   . ILE A 1 59  ? -6.570  8.089   -9.662  1.00 3.27   ? 59  ILE A HA   4  
ATOM 7473  H HB   . ILE A 1 59  ? -6.800  5.888   -7.579  1.00 3.64   ? 59  ILE A HB   4  
ATOM 7474  H HG12 . ILE A 1 59  ? -9.052  6.747   -8.100  1.00 3.83   ? 59  ILE A HG12 4  
ATOM 7475  H HG13 . ILE A 1 59  ? -8.537  7.131   -6.481  1.00 4.99   ? 59  ILE A HG13 4  
ATOM 7476  H HG21 . ILE A 1 59  ? -6.252  7.759   -5.968  1.00 4.43   ? 59  ILE A HG21 4  
ATOM 7477  H HG22 . ILE A 1 59  ? -4.920  7.340   -7.037  1.00 3.84   ? 59  ILE A HG22 4  
ATOM 7478  H HG23 . ILE A 1 59  ? -5.878  8.792   -7.362  1.00 3.68   ? 59  ILE A HG23 4  
ATOM 7479  H HD11 . ILE A 1 59  ? -8.125  9.466   -7.075  1.00 4.86   ? 59  ILE A HD11 4  
ATOM 7480  H HD12 . ILE A 1 59  ? -8.470  9.128   -8.785  1.00 3.62   ? 59  ILE A HD12 4  
ATOM 7481  H HD13 . ILE A 1 59  ? -9.753  8.993   -7.573  1.00 4.47   ? 59  ILE A HD13 4  
ATOM 7482  N N    . LYS A 1 60  ? -4.809  6.615   -11.053 1.00 1.81   ? 60  LYS A N    4  
ATOM 7483  C CA   . LYS A 1 60  ? -3.633  5.973   -11.653 1.00 1.82   ? 60  LYS A CA   4  
ATOM 7484  C C    . LYS A 1 60  ? -2.299  6.283   -10.935 1.00 1.44   ? 60  LYS A C    4  
ATOM 7485  O O    . LYS A 1 60  ? -1.621  7.276   -11.218 1.00 1.47   ? 60  LYS A O    4  
ATOM 7486  C CB   . LYS A 1 60  ? -3.612  6.207   -13.179 1.00 2.49   ? 60  LYS A CB   4  
ATOM 7487  C CG   . LYS A 1 60  ? -3.782  7.670   -13.625 1.00 3.14   ? 60  LYS A CG   4  
ATOM 7488  C CD   . LYS A 1 60  ? -3.848  7.779   -15.157 1.00 3.83   ? 60  LYS A CD   4  
ATOM 7489  C CE   . LYS A 1 60  ? -4.229  9.201   -15.594 1.00 4.52   ? 60  LYS A CE   4  
ATOM 7490  N NZ   . LYS A 1 60  ? -3.137  10.173  -15.364 1.00 5.05   ? 60  LYS A NZ   4  
ATOM 7491  H H    . LYS A 1 60  ? -5.481  7.027   -11.677 1.00 1.91   ? 60  LYS A H    4  
ATOM 7492  H HA   . LYS A 1 60  ? -3.784  4.903   -11.519 1.00 2.18   ? 60  LYS A HA   4  
ATOM 7493  H HB2  . LYS A 1 60  ? -2.677  5.815   -13.588 1.00 2.56   ? 60  LYS A HB2  4  
ATOM 7494  H HB3  . LYS A 1 60  ? -4.432  5.625   -13.606 1.00 2.97   ? 60  LYS A HB3  4  
ATOM 7495  H HG2  . LYS A 1 60  ? -4.713  8.070   -13.217 1.00 3.44   ? 60  LYS A HG2  4  
ATOM 7496  H HG3  . LYS A 1 60  ? -2.951  8.267   -13.250 1.00 3.38   ? 60  LYS A HG3  4  
ATOM 7497  H HD2  . LYS A 1 60  ? -2.892  7.489   -15.596 1.00 4.04   ? 60  LYS A HD2  4  
ATOM 7498  H HD3  . LYS A 1 60  ? -4.614  7.095   -15.527 1.00 4.31   ? 60  LYS A HD3  4  
ATOM 7499  H HE2  . LYS A 1 60  ? -4.479  9.191   -16.660 1.00 5.01   ? 60  LYS A HE2  4  
ATOM 7500  H HE3  . LYS A 1 60  ? -5.122  9.510   -15.043 1.00 5.04   ? 60  LYS A HE3  4  
ATOM 7501  H HZ1  . LYS A 1 60  ? -2.413  10.070  -16.069 1.00 5.46   ? 60  LYS A HZ1  4  
ATOM 7502  H HZ2  . LYS A 1 60  ? -3.481  11.125  -15.480 1.00 5.50   ? 60  LYS A HZ2  4  
ATOM 7503  H HZ3  . LYS A 1 60  ? -2.743  10.088  -14.441 1.00 5.41   ? 60  LYS A HZ3  4  
ATOM 7504  N N    . LEU A 1 61  ? -1.930  5.412   -9.987  1.00 1.56   ? 61  LEU A N    4  
ATOM 7505  C CA   . LEU A 1 61  ? -0.750  5.509   -9.112  1.00 1.43   ? 61  LEU A CA   4  
ATOM 7506  C C    . LEU A 1 61  ? 0.546   5.084   -9.840  1.00 1.26   ? 61  LEU A C    4  
ATOM 7507  O O    . LEU A 1 61  ? 0.525   4.863   -11.047 1.00 2.20   ? 61  LEU A O    4  
ATOM 7508  C CB   . LEU A 1 61  ? -1.013  4.635   -7.862  1.00 2.29   ? 61  LEU A CB   4  
ATOM 7509  C CG   . LEU A 1 61  ? -0.563  5.237   -6.516  1.00 2.89   ? 61  LEU A CG   4  
ATOM 7510  C CD1  . LEU A 1 61  ? -1.478  6.408   -6.122  1.00 2.90   ? 61  LEU A CD1  4  
ATOM 7511  C CD2  . LEU A 1 61  ? -0.624  4.150   -5.436  1.00 4.36   ? 61  LEU A CD2  4  
ATOM 7512  H H    . LEU A 1 61  ? -2.626  4.718   -9.750  1.00 2.02   ? 61  LEU A H    4  
ATOM 7513  H HA   . LEU A 1 61  ? -0.650  6.547   -8.798  1.00 1.65   ? 61  LEU A HA   4  
ATOM 7514  H HB2  . LEU A 1 61  ? -2.079  4.463   -7.767  1.00 2.55   ? 61  LEU A HB2  4  
ATOM 7515  H HB3  . LEU A 1 61  ? -0.553  3.655   -8.003  1.00 2.84   ? 61  LEU A HB3  4  
ATOM 7516  H HG   . LEU A 1 61  ? 0.464   5.592   -6.597  1.00 3.16   ? 61  LEU A HG   4  
ATOM 7517  H HD11 . LEU A 1 61  ? -2.520  6.086   -6.108  1.00 3.55   ? 61  LEU A HD11 4  
ATOM 7518  H HD12 . LEU A 1 61  ? -1.212  6.760   -5.127  1.00 3.49   ? 61  LEU A HD12 4  
ATOM 7519  H HD13 . LEU A 1 61  ? -1.365  7.235   -6.822  1.00 2.92   ? 61  LEU A HD13 4  
ATOM 7520  H HD21 . LEU A 1 61  ? -1.651  3.812   -5.300  1.00 4.83   ? 61  LEU A HD21 4  
ATOM 7521  H HD22 . LEU A 1 61  ? -0.005  3.301   -5.723  1.00 5.22   ? 61  LEU A HD22 4  
ATOM 7522  H HD23 . LEU A 1 61  ? -0.258  4.547   -4.490  1.00 4.83   ? 61  LEU A HD23 4  
ATOM 7523  N N    . VAL A 1 62  ? 1.629   4.898   -9.083  1.00 1.03   ? 62  VAL A N    4  
ATOM 7524  C CA   . VAL A 1 62  ? 2.666   3.885   -9.369  1.00 1.23   ? 62  VAL A CA   4  
ATOM 7525  C C    . VAL A 1 62  ? 2.782   2.896   -8.193  1.00 1.42   ? 62  VAL A C    4  
ATOM 7526  O O    . VAL A 1 62  ? 2.691   1.691   -8.410  1.00 2.09   ? 62  VAL A O    4  
ATOM 7527  C CB   . VAL A 1 62  ? 4.049   4.513   -9.645  1.00 1.52   ? 62  VAL A CB   4  
ATOM 7528  C CG1  . VAL A 1 62  ? 5.108   3.448   -9.991  1.00 2.44   ? 62  VAL A CG1  4  
ATOM 7529  C CG2  . VAL A 1 62  ? 3.996   5.539   -10.781 1.00 2.54   ? 62  VAL A CG2  4  
ATOM 7530  H H    . VAL A 1 62  ? 1.610   5.278   -8.150  1.00 1.33   ? 62  VAL A H    4  
ATOM 7531  H HA   . VAL A 1 62  ? 2.366   3.321   -10.254 1.00 1.38   ? 62  VAL A HA   4  
ATOM 7532  H HB   . VAL A 1 62  ? 4.357   5.021   -8.737  1.00 2.07   ? 62  VAL A HB   4  
ATOM 7533  H HG11 . VAL A 1 62  ? 6.062   3.929   -10.205 1.00 3.08   ? 62  VAL A HG11 4  
ATOM 7534  H HG12 . VAL A 1 62  ? 5.256   2.769   -9.151  1.00 3.00   ? 62  VAL A HG12 4  
ATOM 7535  H HG13 . VAL A 1 62  ? 4.792   2.876   -10.863 1.00 3.39   ? 62  VAL A HG13 4  
ATOM 7536  H HG21 . VAL A 1 62  ? 3.592   5.082   -11.686 1.00 3.64   ? 62  VAL A HG21 4  
ATOM 7537  H HG22 . VAL A 1 62  ? 3.365   6.370   -10.479 1.00 3.01   ? 62  VAL A HG22 4  
ATOM 7538  H HG23 . VAL A 1 62  ? 4.994   5.927   -10.987 1.00 3.04   ? 62  VAL A HG23 4  
ATOM 7539  N N    . GLY A 1 63  ? 2.921   3.378   -6.943  1.00 1.61   ? 63  GLY A N    4  
ATOM 7540  C CA   . GLY A 1 63  ? 2.892   2.527   -5.740  1.00 1.86   ? 63  GLY A CA   4  
ATOM 7541  C C    . GLY A 1 63  ? 2.909   3.274   -4.404  1.00 1.48   ? 63  GLY A C    4  
ATOM 7542  O O    . GLY A 1 63  ? 2.554   4.447   -4.348  1.00 1.25   ? 63  GLY A O    4  
ATOM 7543  H H    . GLY A 1 63  ? 3.062   4.370   -6.804  1.00 2.05   ? 63  GLY A H    4  
ATOM 7544  H HA2  . GLY A 1 63  ? 1.997   1.908   -5.770  1.00 2.23   ? 63  GLY A HA2  4  
ATOM 7545  H HA3  . GLY A 1 63  ? 3.730   1.837   -5.764  1.00 2.29   ? 63  GLY A HA3  4  
ATOM 7546  N N    . ALA A 1 64  ? 3.280   2.577   -3.328  1.00 1.65   ? 64  ALA A N    4  
ATOM 7547  C CA   . ALA A 1 64  ? 3.182   3.047   -1.946  1.00 1.43   ? 64  ALA A CA   4  
ATOM 7548  C C    . ALA A 1 64  ? 4.526   2.885   -1.216  1.00 1.27   ? 64  ALA A C    4  
ATOM 7549  O O    . ALA A 1 64  ? 5.150   1.828   -1.323  1.00 1.54   ? 64  ALA A O    4  
ATOM 7550  C CB   . ALA A 1 64  ? 2.076   2.210   -1.282  1.00 1.94   ? 64  ALA A CB   4  
ATOM 7551  H H    . ALA A 1 64  ? 3.623   1.637   -3.449  1.00 2.02   ? 64  ALA A H    4  
ATOM 7552  H HA   . ALA A 1 64  ? 2.903   4.105   -1.923  1.00 1.26   ? 64  ALA A HA   4  
ATOM 7553  H HB1  . ALA A 1 64  ? 1.977   2.466   -0.227  1.00 2.25   ? 64  ALA A HB1  4  
ATOM 7554  H HB2  . ALA A 1 64  ? 1.127   2.386   -1.788  1.00 2.21   ? 64  ALA A HB2  4  
ATOM 7555  H HB3  . ALA A 1 64  ? 2.322   1.150   -1.352  1.00 3.00   ? 64  ALA A HB3  4  
ATOM 7556  N N    . ALA A 1 65  ? 4.966   3.913   -0.478  1.00 1.03   ? 65  ALA A N    4  
ATOM 7557  C CA   . ALA A 1 65  ? 6.223   3.927   0.284   1.00 0.97   ? 65  ALA A CA   4  
ATOM 7558  C C    . ALA A 1 65  ? 6.155   4.890   1.498   1.00 0.89   ? 65  ALA A C    4  
ATOM 7559  O O    . ALA A 1 65  ? 5.095   5.433   1.801   1.00 0.88   ? 65  ALA A O    4  
ATOM 7560  C CB   . ALA A 1 65  ? 7.366   4.269   -0.690  1.00 1.13   ? 65  ALA A CB   4  
ATOM 7561  H H    . ALA A 1 65  ? 4.430   4.777   -0.498  1.00 1.02   ? 65  ALA A H    4  
ATOM 7562  H HA   . ALA A 1 65  ? 6.403   2.925   0.682   1.00 1.04   ? 65  ALA A HA   4  
ATOM 7563  H HB1  . ALA A 1 65  ? 8.333   4.201   -0.189  1.00 2.29   ? 65  ALA A HB1  4  
ATOM 7564  H HB2  . ALA A 1 65  ? 7.364   3.568   -1.525  1.00 2.18   ? 65  ALA A HB2  4  
ATOM 7565  H HB3  . ALA A 1 65  ? 7.230   5.282   -1.078  1.00 1.48   ? 65  ALA A HB3  4  
ATOM 7566  N N    . THR A 1 66  ? 7.276   5.100   2.205   1.00 0.99   ? 66  THR A N    4  
ATOM 7567  C CA   . THR A 1 66  ? 7.376   5.906   3.442   1.00 1.11   ? 66  THR A CA   4  
ATOM 7568  C C    . THR A 1 66  ? 8.843   6.120   3.840   1.00 1.25   ? 66  THR A C    4  
ATOM 7569  O O    . THR A 1 66  ? 9.650   5.230   3.566   1.00 1.38   ? 66  THR A O    4  
ATOM 7570  C CB   . THR A 1 66  ? 6.592   5.242   4.594   1.00 1.20   ? 66  THR A CB   4  
ATOM 7571  O OG1  . THR A 1 66  ? 6.609   6.085   5.716   1.00 1.52   ? 66  THR A OG1  4  
ATOM 7572  C CG2  . THR A 1 66  ? 7.188   3.906   5.044   1.00 1.50   ? 66  THR A CG2  4  
ATOM 7573  H H    . THR A 1 66  ? 8.123   4.635   1.905   1.00 1.09   ? 66  THR A H    4  
ATOM 7574  H HA   . THR A 1 66  ? 6.920   6.874   3.238   1.00 1.17   ? 66  THR A HA   4  
ATOM 7575  H HB   . THR A 1 66  ? 5.556   5.081   4.291   1.00 1.11   ? 66  THR A HB   4  
ATOM 7576  H HG1  . THR A 1 66  ? 5.721   6.471   5.827   1.00 2.13   ? 66  THR A HG1  4  
ATOM 7577  H HG21 . THR A 1 66  ? 6.524   3.440   5.771   1.00 1.72   ? 66  THR A HG21 4  
ATOM 7578  H HG22 . THR A 1 66  ? 7.299   3.249   4.185   1.00 2.00   ? 66  THR A HG22 4  
ATOM 7579  H HG23 . THR A 1 66  ? 8.165   4.052   5.501   1.00 2.52   ? 66  THR A HG23 4  
ATOM 7580  N N    . PRO A 1 67  ? 9.198   7.237   4.508   1.00 1.30   ? 67  PRO A N    4  
ATOM 7581  C CA   . PRO A 1 67  ? 10.466  7.386   5.220   1.00 1.34   ? 67  PRO A CA   4  
ATOM 7582  C C    . PRO A 1 67  ? 10.438  6.755   6.626   1.00 1.19   ? 67  PRO A C    4  
ATOM 7583  O O    . PRO A 1 67  ? 11.472  6.703   7.290   1.00 1.21   ? 67  PRO A O    4  
ATOM 7584  C CB   . PRO A 1 67  ? 10.676  8.902   5.308   1.00 1.54   ? 67  PRO A CB   4  
ATOM 7585  C CG   . PRO A 1 67  ? 9.252   9.437   5.447   1.00 1.53   ? 67  PRO A CG   4  
ATOM 7586  C CD   . PRO A 1 67  ? 8.446   8.489   4.558   1.00 1.41   ? 67  PRO A CD   4  
ATOM 7587  H HA   . PRO A 1 67  ? 11.285  6.938   4.655   1.00 1.44   ? 67  PRO A HA   4  
ATOM 7588  H HB2  . PRO A 1 67  ? 11.300  9.191   6.152   1.00 1.58   ? 67  PRO A HB2  4  
ATOM 7589  H HB3  . PRO A 1 67  ? 11.113  9.264   4.377   1.00 1.71   ? 67  PRO A HB3  4  
ATOM 7590  H HG2  . PRO A 1 67  ? 8.921   9.345   6.482   1.00 1.47   ? 67  PRO A HG2  4  
ATOM 7591  H HG3  . PRO A 1 67  ? 9.171   10.471  5.110   1.00 1.71   ? 67  PRO A HG3  4  
ATOM 7592  H HD2  . PRO A 1 67  ? 7.449   8.349   4.971   1.00 1.36   ? 67  PRO A HD2  4  
ATOM 7593  H HD3  . PRO A 1 67  ? 8.372   8.909   3.553   1.00 1.54   ? 67  PRO A HD3  4  
ATOM 7594  N N    . LEU A 1 68  ? 9.277   6.292   7.116   1.00 1.13   ? 68  LEU A N    4  
ATOM 7595  C CA   . LEU A 1 68  ? 9.115   5.775   8.484   1.00 1.11   ? 68  LEU A CA   4  
ATOM 7596  C C    . LEU A 1 68  ? 9.602   4.324   8.669   1.00 0.98   ? 68  LEU A C    4  
ATOM 7597  O O    . LEU A 1 68  ? 9.652   3.835   9.797   1.00 1.21   ? 68  LEU A O    4  
ATOM 7598  C CB   . LEU A 1 68  ? 7.651   5.958   8.930   1.00 1.36   ? 68  LEU A CB   4  
ATOM 7599  C CG   . LEU A 1 68  ? 7.148   7.422   8.906   1.00 1.78   ? 68  LEU A CG   4  
ATOM 7600  C CD1  . LEU A 1 68  ? 5.683   7.462   9.359   1.00 2.65   ? 68  LEU A CD1  4  
ATOM 7601  C CD2  . LEU A 1 68  ? 7.981   8.357   9.799   1.00 2.61   ? 68  LEU A CD2  4  
ATOM 7602  H H    . LEU A 1 68  ? 8.442   6.343   6.540   1.00 1.18   ? 68  LEU A H    4  
ATOM 7603  H HA   . LEU A 1 68  ? 9.735   6.375   9.146   1.00 1.16   ? 68  LEU A HA   4  
ATOM 7604  H HB2  . LEU A 1 68  ? 7.008   5.351   8.291   1.00 1.28   ? 68  LEU A HB2  4  
ATOM 7605  H HB3  . LEU A 1 68  ? 7.553   5.578   9.948   1.00 1.55   ? 68  LEU A HB3  4  
ATOM 7606  H HG   . LEU A 1 68  ? 7.189   7.804   7.885   1.00 2.90   ? 68  LEU A HG   4  
ATOM 7607  H HD11 . LEU A 1 68  ? 5.073   6.879   8.668   1.00 3.54   ? 68  LEU A HD11 4  
ATOM 7608  H HD12 . LEU A 1 68  ? 5.591   7.047   10.365  1.00 3.23   ? 68  LEU A HD12 4  
ATOM 7609  H HD13 . LEU A 1 68  ? 5.323   8.488   9.367   1.00 3.35   ? 68  LEU A HD13 4  
ATOM 7610  H HD21 . LEU A 1 68  ? 8.018   7.967   10.819  1.00 3.02   ? 68  LEU A HD21 4  
ATOM 7611  H HD22 . LEU A 1 68  ? 8.995   8.446   9.411   1.00 3.67   ? 68  LEU A HD22 4  
ATOM 7612  H HD23 . LEU A 1 68  ? 7.537   9.350   9.811   1.00 3.31   ? 68  LEU A HD23 4  
ATOM 7613  N N    . ALA A 1 69  ? 10.035  3.658   7.592   1.00 0.96   ? 69  ALA A N    4  
ATOM 7614  C CA   . ALA A 1 69  ? 10.693  2.352   7.611   1.00 0.95   ? 69  ALA A CA   4  
ATOM 7615  C C    . ALA A 1 69  ? 12.113  2.457   7.027   1.00 0.93   ? 69  ALA A C    4  
ATOM 7616  O O    . ALA A 1 69  ? 12.324  3.210   6.076   1.00 1.15   ? 69  ALA A O    4  
ATOM 7617  C CB   . ALA A 1 69  ? 9.828   1.384   6.799   1.00 1.12   ? 69  ALA A CB   4  
ATOM 7618  H H    . ALA A 1 69  ? 10.039  4.153   6.712   1.00 1.17   ? 69  ALA A H    4  
ATOM 7619  H HA   . ALA A 1 69  ? 10.771  1.984   8.636   1.00 1.01   ? 69  ALA A HA   4  
ATOM 7620  H HB1  . ALA A 1 69  ? 9.816   1.685   5.750   1.00 1.98   ? 69  ALA A HB1  4  
ATOM 7621  H HB2  . ALA A 1 69  ? 10.223  0.372   6.875   1.00 1.82   ? 69  ALA A HB2  4  
ATOM 7622  H HB3  . ALA A 1 69  ? 8.815   1.401   7.186   1.00 1.88   ? 69  ALA A HB3  4  
ATOM 7623  N N    . THR A 1 70  ? 13.066  1.687   7.572   1.00 0.89   ? 70  THR A N    4  
ATOM 7624  C CA   . THR A 1 70  ? 14.458  1.623   7.088   1.00 0.96   ? 70  THR A CA   4  
ATOM 7625  C C    . THR A 1 70  ? 14.529  1.011   5.696   1.00 0.92   ? 70  THR A C    4  
ATOM 7626  O O    . THR A 1 70  ? 15.230  1.529   4.841   1.00 1.04   ? 70  THR A O    4  
ATOM 7627  C CB   . THR A 1 70  ? 15.359  0.834   8.044   1.00 1.13   ? 70  THR A CB   4  
ATOM 7628  O OG1  . THR A 1 70  ? 15.182  1.351   9.337   1.00 1.60   ? 70  THR A OG1  4  
ATOM 7629  C CG2  . THR A 1 70  ? 16.847  0.967   7.712   1.00 1.46   ? 70  THR A CG2  4  
ATOM 7630  H H    . THR A 1 70  ? 12.819  1.112   8.369   1.00 0.97   ? 70  THR A H    4  
ATOM 7631  H HA   . THR A 1 70  ? 14.860  2.636   7.008   1.00 1.10   ? 70  THR A HA   4  
ATOM 7632  H HB   . THR A 1 70  ? 15.085  -0.224  8.038   1.00 1.52   ? 70  THR A HB   4  
ATOM 7633  H HG1  . THR A 1 70  ? 14.448  0.874   9.749   1.00 2.57   ? 70  THR A HG1  4  
ATOM 7634  H HG21 . THR A 1 70  ? 17.056  0.532   6.735   1.00 2.14   ? 70  THR A HG21 4  
ATOM 7635  H HG22 . THR A 1 70  ? 17.132  2.019   7.704   1.00 2.32   ? 70  THR A HG22 4  
ATOM 7636  H HG23 . THR A 1 70  ? 17.437  0.441   8.463   1.00 2.40   ? 70  THR A HG23 4  
ATOM 7637  N N    . SER A 1 71  ? 13.776  -0.060  5.449   1.00 0.86   ? 71  SER A N    4  
ATOM 7638  C CA   . SER A 1 71  ? 13.651  -0.669  4.120   1.00 0.94   ? 71  SER A CA   4  
ATOM 7639  C C    . SER A 1 71  ? 12.165  -0.831  3.765   1.00 0.85   ? 71  SER A C    4  
ATOM 7640  O O    . SER A 1 71  ? 11.598  -1.898  4.026   1.00 0.85   ? 71  SER A O    4  
ATOM 7641  C CB   . SER A 1 71  ? 14.381  -2.026  4.090   1.00 1.08   ? 71  SER A CB   4  
ATOM 7642  O OG   . SER A 1 71  ? 14.217  -2.705  2.849   1.00 1.95   ? 71  SER A OG   4  
ATOM 7643  H H    . SER A 1 71  ? 13.193  -0.443  6.189   1.00 0.85   ? 71  SER A H    4  
ATOM 7644  H HA   . SER A 1 71  ? 14.133  -0.042  3.370   1.00 1.05   ? 71  SER A HA   4  
ATOM 7645  H HB2  . SER A 1 71  ? 15.444  -1.857  4.266   1.00 1.60   ? 71  SER A HB2  4  
ATOM 7646  H HB3  . SER A 1 71  ? 13.998  -2.657  4.893   1.00 2.15   ? 71  SER A HB3  4  
ATOM 7647  H HG   . SER A 1 71  ? 13.298  -3.011  2.804   1.00 3.08   ? 71  SER A HG   4  
ATOM 7648  N N    . PRO A 1 72  ? 11.503  0.187   3.177   1.00 0.89   ? 72  PRO A N    4  
ATOM 7649  C CA   . PRO A 1 72  ? 10.130  0.047   2.712   1.00 0.90   ? 72  PRO A CA   4  
ATOM 7650  C C    . PRO A 1 72  ? 10.087  -0.957  1.552   1.00 0.86   ? 72  PRO A C    4  
ATOM 7651  O O    . PRO A 1 72  ? 10.943  -0.935  0.668   1.00 1.01   ? 72  PRO A O    4  
ATOM 7652  C CB   . PRO A 1 72  ? 9.680   1.456   2.311   1.00 1.03   ? 72  PRO A CB   4  
ATOM 7653  C CG   . PRO A 1 72  ? 10.988  2.144   1.919   1.00 1.08   ? 72  PRO A CG   4  
ATOM 7654  C CD   . PRO A 1 72  ? 12.023  1.508   2.850   1.00 1.03   ? 72  PRO A CD   4  
ATOM 7655  H HA   . PRO A 1 72  ? 9.498   -0.316  3.521   1.00 0.91   ? 72  PRO A HA   4  
ATOM 7656  H HB2  . PRO A 1 72  ? 8.962   1.442   1.491   1.00 1.07   ? 72  PRO A HB2  4  
ATOM 7657  H HB3  . PRO A 1 72  ? 9.256   1.959   3.182   1.00 1.11   ? 72  PRO A HB3  4  
ATOM 7658  H HG2  . PRO A 1 72  ? 11.231  1.902   0.883   1.00 1.08   ? 72  PRO A HG2  4  
ATOM 7659  H HG3  . PRO A 1 72  ? 10.933  3.226   2.055   1.00 1.19   ? 72  PRO A HG3  4  
ATOM 7660  H HD2  . PRO A 1 72  ? 12.984  1.451   2.341   1.00 1.07   ? 72  PRO A HD2  4  
ATOM 7661  H HD3  . PRO A 1 72  ? 12.113  2.102   3.759   1.00 1.11   ? 72  PRO A HD3  4  
ATOM 7662  N N    . MET A 1 73  ? 9.098   -1.854  1.574   1.00 0.91   ? 73  MET A N    4  
ATOM 7663  C CA   . MET A 1 73  ? 8.949   -2.952  0.617   1.00 1.02   ? 73  MET A CA   4  
ATOM 7664  C C    . MET A 1 73  ? 7.541   -2.916  0.014   1.00 1.20   ? 73  MET A C    4  
ATOM 7665  O O    . MET A 1 73  ? 6.551   -2.716  0.717   1.00 1.64   ? 73  MET A O    4  
ATOM 7666  C CB   . MET A 1 73  ? 9.235   -4.268  1.362   1.00 1.17   ? 73  MET A CB   4  
ATOM 7667  C CG   . MET A 1 73  ? 9.413   -5.499  0.463   1.00 1.54   ? 73  MET A CG   4  
ATOM 7668  S SD   . MET A 1 73  ? 11.120  -5.890  -0.014  1.00 1.79   ? 73  MET A SD   4  
ATOM 7669  C CE   . MET A 1 73  ? 11.472  -4.596  -1.230  1.00 3.23   ? 73  MET A CE   4  
ATOM 7670  H H    . MET A 1 73  ? 8.413   -1.835  2.325   1.00 1.02   ? 73  MET A H    4  
ATOM 7671  H HA   . MET A 1 73  ? 9.673   -2.833  -0.185  1.00 1.02   ? 73  MET A HA   4  
ATOM 7672  H HB2  . MET A 1 73  ? 10.139  -4.156  1.964   1.00 1.25   ? 73  MET A HB2  4  
ATOM 7673  H HB3  . MET A 1 73  ? 8.416   -4.460  2.052   1.00 1.47   ? 73  MET A HB3  4  
ATOM 7674  H HG2  . MET A 1 73  ? 9.042   -6.356  1.027   1.00 2.20   ? 73  MET A HG2  4  
ATOM 7675  H HG3  . MET A 1 73  ? 8.789   -5.420  -0.425  1.00 2.37   ? 73  MET A HG3  4  
ATOM 7676  H HE1  . MET A 1 73  ? 12.423  -4.820  -1.715  1.00 3.46   ? 73  MET A HE1  4  
ATOM 7677  H HE2  . MET A 1 73  ? 10.693  -4.556  -1.991  1.00 4.30   ? 73  MET A HE2  4  
ATOM 7678  H HE3  . MET A 1 73  ? 11.569  -3.632  -0.733  1.00 4.04   ? 73  MET A HE3  4  
ATOM 7679  N N    . LEU A 1 74  ? 7.428   -3.095  -1.302  1.00 1.07   ? 74  LEU A N    4  
ATOM 7680  C CA   . LEU A 1 74  ? 6.169   -2.939  -2.032  1.00 1.16   ? 74  LEU A CA   4  
ATOM 7681  C C    . LEU A 1 74  ? 5.978   -4.083  -3.027  1.00 1.21   ? 74  LEU A C    4  
ATOM 7682  O O    . LEU A 1 74  ? 6.675   -4.166  -4.034  1.00 1.34   ? 74  LEU A O    4  
ATOM 7683  C CB   . LEU A 1 74  ? 6.075   -1.517  -2.636  1.00 1.31   ? 74  LEU A CB   4  
ATOM 7684  C CG   . LEU A 1 74  ? 7.023   -1.101  -3.790  1.00 1.67   ? 74  LEU A CG   4  
ATOM 7685  C CD1  . LEU A 1 74  ? 6.692   0.343   -4.202  1.00 2.61   ? 74  LEU A CD1  4  
ATOM 7686  C CD2  . LEU A 1 74  ? 8.520   -1.184  -3.454  1.00 2.50   ? 74  LEU A CD2  4  
ATOM 7687  H H    . LEU A 1 74  ? 8.266   -3.230  -1.846  1.00 1.09   ? 74  LEU A H    4  
ATOM 7688  H HA   . LEU A 1 74  ? 5.348   -3.020  -1.322  1.00 1.19   ? 74  LEU A HA   4  
ATOM 7689  H HB2  . LEU A 1 74  ? 5.051   -1.389  -2.989  1.00 2.19   ? 74  LEU A HB2  4  
ATOM 7690  H HB3  . LEU A 1 74  ? 6.205   -0.804  -1.819  1.00 1.86   ? 74  LEU A HB3  4  
ATOM 7691  H HG   . LEU A 1 74  ? 6.838   -1.734  -4.653  1.00 2.92   ? 74  LEU A HG   4  
ATOM 7692  H HD11 . LEU A 1 74  ? 7.282   0.623   -5.076  1.00 3.21   ? 74  LEU A HD11 4  
ATOM 7693  H HD12 . LEU A 1 74  ? 5.635   0.428   -4.457  1.00 3.81   ? 74  LEU A HD12 4  
ATOM 7694  H HD13 . LEU A 1 74  ? 6.917   1.028   -3.384  1.00 2.94   ? 74  LEU A HD13 4  
ATOM 7695  H HD21 . LEU A 1 74  ? 9.106   -0.736  -4.257  1.00 3.42   ? 74  LEU A HD21 4  
ATOM 7696  H HD22 . LEU A 1 74  ? 8.728   -0.658  -2.521  1.00 3.02   ? 74  LEU A HD22 4  
ATOM 7697  H HD23 . LEU A 1 74  ? 8.825   -2.227  -3.368  1.00 3.38   ? 74  LEU A HD23 4  
ATOM 7698  N N    . MET A 1 75  ? 5.048   -4.994  -2.736  1.00 1.23   ? 75  MET A N    4  
ATOM 7699  C CA   . MET A 1 75  ? 4.839   -6.204  -3.538  1.00 1.38   ? 75  MET A CA   4  
ATOM 7700  C C    . MET A 1 75  ? 3.371   -6.462  -3.827  1.00 1.44   ? 75  MET A C    4  
ATOM 7701  O O    . MET A 1 75  ? 2.481   -5.918  -3.182  1.00 1.85   ? 75  MET A O    4  
ATOM 7702  C CB   . MET A 1 75  ? 5.489   -7.405  -2.820  1.00 1.51   ? 75  MET A CB   4  
ATOM 7703  C CG   . MET A 1 75  ? 7.021   -7.297  -2.781  1.00 2.08   ? 75  MET A CG   4  
ATOM 7704  S SD   . MET A 1 75  ? 7.837   -8.676  -1.940  1.00 2.15   ? 75  MET A SD   4  
ATOM 7705  C CE   . MET A 1 75  ? 9.553   -8.232  -2.311  1.00 3.63   ? 75  MET A CE   4  
ATOM 7706  H H    . MET A 1 75  ? 4.506   -4.921  -1.879  1.00 1.22   ? 75  MET A H    4  
ATOM 7707  H HA   . MET A 1 75  ? 5.272   -6.092  -4.531  1.00 1.55   ? 75  MET A HA   4  
ATOM 7708  H HB2  . MET A 1 75  ? 5.106   -7.468  -1.799  1.00 2.32   ? 75  MET A HB2  4  
ATOM 7709  H HB3  . MET A 1 75  ? 5.220   -8.329  -3.333  1.00 2.12   ? 75  MET A HB3  4  
ATOM 7710  H HG2  . MET A 1 75  ? 7.405   -7.226  -3.799  1.00 2.93   ? 75  MET A HG2  4  
ATOM 7711  H HG3  . MET A 1 75  ? 7.299   -6.384  -2.255  1.00 3.14   ? 75  MET A HG3  4  
ATOM 7712  H HE1  . MET A 1 75  ? 9.753   -8.380  -3.375  1.00 4.24   ? 75  MET A HE1  4  
ATOM 7713  H HE2  . MET A 1 75  ? 9.729   -7.185  -2.067  1.00 4.51   ? 75  MET A HE2  4  
ATOM 7714  H HE3  . MET A 1 75  ? 10.228  -8.853  -1.726  1.00 4.10   ? 75  MET A HE3  4  
ATOM 7715  N N    . THR A 1 76  ? 3.167   -7.310  -4.833  1.00 1.30   ? 76  THR A N    4  
ATOM 7716  C CA   . THR A 1 76  ? 1.895   -7.831  -5.319  1.00 1.28   ? 76  THR A CA   4  
ATOM 7717  C C    . THR A 1 76  ? 2.187   -9.037  -6.211  1.00 1.36   ? 76  THR A C    4  
ATOM 7718  O O    . THR A 1 76  ? 3.260   -9.121  -6.805  1.00 1.62   ? 76  THR A O    4  
ATOM 7719  C CB   . THR A 1 76  ? 1.127   -6.809  -6.144  1.00 1.48   ? 76  THR A CB   4  
ATOM 7720  O OG1  . THR A 1 76  ? 1.996   -6.228  -7.081  1.00 2.56   ? 76  THR A OG1  4  
ATOM 7721  C CG2  . THR A 1 76  ? 0.412   -5.706  -5.382  1.00 2.88   ? 76  THR A CG2  4  
ATOM 7722  H H    . THR A 1 76  ? 3.972   -7.624  -5.355  1.00 1.39   ? 76  THR A H    4  
ATOM 7723  H HA   . THR A 1 76  ? 1.263   -8.140  -4.492  1.00 1.24   ? 76  THR A HA   4  
ATOM 7724  H HB   . THR A 1 76  ? 0.363   -7.391  -6.624  1.00 2.33   ? 76  THR A HB   4  
ATOM 7725  H HG1  . THR A 1 76  ? 1.527   -6.112  -7.919  1.00 3.02   ? 76  THR A HG1  4  
ATOM 7726  H HG21 . THR A 1 76  ? -0.127  -6.138  -4.536  1.00 4.22   ? 76  THR A HG21 4  
ATOM 7727  H HG22 . THR A 1 76  ? 1.130   -4.970  -5.033  1.00 3.19   ? 76  THR A HG22 4  
ATOM 7728  H HG23 . THR A 1 76  ? -0.302  -5.217  -6.042  1.00 3.47   ? 76  THR A HG23 4  
ATOM 7729  N N    . THR A 1 77  ? 1.227   -9.948  -6.356  1.00 1.32   ? 77  THR A N    4  
ATOM 7730  C CA   . THR A 1 77  ? 1.276   -11.122 -7.236  1.00 1.46   ? 77  THR A CA   4  
ATOM 7731  C C    . THR A 1 77  ? -0.112  -11.379 -7.795  1.00 1.53   ? 77  THR A C    4  
ATOM 7732  O O    . THR A 1 77  ? -1.086  -10.880 -7.231  1.00 2.35   ? 77  THR A O    4  
ATOM 7733  C CB   . THR A 1 77  ? 1.759   -12.368 -6.474  1.00 1.63   ? 77  THR A CB   4  
ATOM 7734  O OG1  . THR A 1 77  ? 1.321   -12.345 -5.141  1.00 2.30   ? 77  THR A OG1  4  
ATOM 7735  C CG2  . THR A 1 77  ? 3.269   -12.562 -6.513  1.00 2.47   ? 77  THR A CG2  4  
ATOM 7736  H H    . THR A 1 77  ? 0.370   -9.859  -5.829  1.00 1.32   ? 77  THR A H    4  
ATOM 7737  H HA   . THR A 1 77  ? 1.936   -10.937 -8.078  1.00 1.82   ? 77  THR A HA   4  
ATOM 7738  H HB   . THR A 1 77  ? 1.312   -13.239 -6.934  1.00 1.90   ? 77  THR A HB   4  
ATOM 7739  H HG1  . THR A 1 77  ? 2.089   -12.226 -4.547  1.00 2.53   ? 77  THR A HG1  4  
ATOM 7740  H HG21 . THR A 1 77  ? 3.765   -11.664 -6.157  1.00 3.14   ? 77  THR A HG21 4  
ATOM 7741  H HG22 . THR A 1 77  ? 3.541   -13.409 -5.883  1.00 3.05   ? 77  THR A HG22 4  
ATOM 7742  H HG23 . THR A 1 77  ? 3.578   -12.773 -7.536  1.00 3.14   ? 77  THR A HG23 4  
ATOM 7743  N N    . THR A 1 78  ? -0.178  -12.195 -8.854  1.00 1.56   ? 78  THR A N    4  
ATOM 7744  C CA   . THR A 1 78  ? -1.371  -12.888 -9.406  1.00 1.74   ? 78  THR A CA   4  
ATOM 7745  C C    . THR A 1 78  ? -1.945  -12.025 -10.530 1.00 1.86   ? 78  THR A C    4  
ATOM 7746  O O    . THR A 1 78  ? -1.195  -11.594 -11.406 1.00 3.04   ? 78  THR A O    4  
ATOM 7747  C CB   . THR A 1 78  ? -2.417  -13.424 -8.378  1.00 3.10   ? 78  THR A CB   4  
ATOM 7748  O OG1  . THR A 1 78  ? -3.160  -12.389 -7.756  1.00 3.52   ? 78  THR A OG1  4  
ATOM 7749  C CG2  . THR A 1 78  ? -1.759  -14.262 -7.272  1.00 5.10   ? 78  THR A CG2  4  
ATOM 7750  H H    . THR A 1 78  ? 0.705   -12.413 -9.300  1.00 2.10   ? 78  THR A H    4  
ATOM 7751  H HA   . THR A 1 78  ? -1.000  -13.812 -9.865  1.00 2.31   ? 78  THR A HA   4  
ATOM 7752  H HB   . THR A 1 78  ? -3.125  -14.090 -8.918  1.00 3.50   ? 78  THR A HB   4  
ATOM 7753  H HG1  . THR A 1 78  ? -2.526  -11.738 -7.382  1.00 3.94   ? 78  THR A HG1  4  
ATOM 7754  H HG21 . THR A 1 78  ? -1.180  -15.065 -7.713  1.00 5.74   ? 78  THR A HG21 4  
ATOM 7755  H HG22 . THR A 1 78  ? -1.104  -13.675 -6.631  1.00 5.48   ? 78  THR A HG22 4  
ATOM 7756  H HG23 . THR A 1 78  ? -2.519  -14.698 -6.635  1.00 6.21   ? 78  THR A HG23 4  
ATOM 7757  N N    . HIS A 1 79  ? -3.279  -11.875 -10.543 1.00 1.79   ? 79  HIS A N    4  
ATOM 7758  C CA   . HIS A 1 79  ? -4.054  -11.230 -11.587 1.00 2.76   ? 79  HIS A CA   4  
ATOM 7759  C C    . HIS A 1 79  ? -4.566  -9.903  -11.029 1.00 2.96   ? 79  HIS A C    4  
ATOM 7760  O O    . HIS A 1 79  ? -4.144  -9.489  -9.957  1.00 4.09   ? 79  HIS A O    4  
ATOM 7761  C CB   . HIS A 1 79  ? -5.156  -12.188 -12.115 1.00 4.11   ? 79  HIS A CB   4  
ATOM 7762  C CG   . HIS A 1 79  ? -4.592  -13.469 -12.724 1.00 4.67   ? 79  HIS A CG   4  
ATOM 7763  N ND1  . HIS A 1 79  ? -5.243  -14.674 -12.864 1.00 5.63   ? 79  HIS A ND1  4  
ATOM 7764  C CD2  . HIS A 1 79  ? -3.348  -13.666 -13.273 1.00 5.30   ? 79  HIS A CD2  4  
ATOM 7765  C CE1  . HIS A 1 79  ? -4.438  -15.545 -13.498 1.00 6.49   ? 79  HIS A CE1  4  
ATOM 7766  N NE2  . HIS A 1 79  ? -3.257  -14.974 -13.773 1.00 6.45   ? 79  HIS A NE2  4  
ATOM 7767  H H    . HIS A 1 79  ? -3.792  -12.153 -9.720  1.00 1.80   ? 79  HIS A H    4  
ATOM 7768  H HA   . HIS A 1 79  ? -3.386  -10.964 -12.391 1.00 3.13   ? 79  HIS A HA   4  
ATOM 7769  H HB2  . HIS A 1 79  ? -5.782  -12.461 -11.247 1.00 4.54   ? 79  HIS A HB2  4  
ATOM 7770  H HB3  . HIS A 1 79  ? -5.722  -11.665 -12.917 1.00 5.18   ? 79  HIS A HB3  4  
ATOM 7771  H HD1  . HIS A 1 79  ? -6.184  -14.882 -12.570 1.00 6.11   ? 79  HIS A HD1  4  
ATOM 7772  H HD2  . HIS A 1 79  ? -2.565  -12.933 -13.341 1.00 5.47   ? 79  HIS A HD2  4  
ATOM 7773  H HE1  . HIS A 1 79  ? -4.710  -16.567 -13.735 1.00 7.48   ? 79  HIS A HE1  4  
ATOM 7774  N N    . SER A 1 80  ? -5.468  -9.234  -11.750 1.00 2.72   ? 80  SER A N    4  
ATOM 7775  C CA   . SER A 1 80  ? -6.156  -7.958  -11.407 1.00 3.25   ? 80  SER A CA   4  
ATOM 7776  C C    . SER A 1 80  ? -7.202  -7.599  -12.481 1.00 3.29   ? 80  SER A C    4  
ATOM 7777  O O    . SER A 1 80  ? -8.269  -7.079  -12.161 1.00 4.39   ? 80  SER A O    4  
ATOM 7778  C CB   . SER A 1 80  ? -5.154  -6.791  -11.299 1.00 3.92   ? 80  SER A CB   4  
ATOM 7779  O OG   . SER A 1 80  ? -4.369  -6.851  -10.125 1.00 4.84   ? 80  SER A OG   4  
ATOM 7780  H H    . SER A 1 80  ? -5.784  -9.747  -12.552 1.00 2.80   ? 80  SER A H    4  
ATOM 7781  H HA   . SER A 1 80  ? -6.690  -8.041  -10.453 1.00 3.88   ? 80  SER A HA   4  
ATOM 7782  H HB2  . SER A 1 80  ? -4.489  -6.803  -12.164 1.00 4.29   ? 80  SER A HB2  4  
ATOM 7783  H HB3  . SER A 1 80  ? -5.703  -5.848  -11.280 1.00 4.23   ? 80  SER A HB3  4  
ATOM 7784  H HG   . SER A 1 80  ? -4.189  -7.796  -9.931  1.00 4.69   ? 80  SER A HG   4  
ATOM 7785  N N    . GLY A 1 81  ? -6.917  -7.911  -13.755 1.00 3.19   ? 81  GLY A N    4  
ATOM 7786  C CA   . GLY A 1 81  ? -7.820  -7.740  -14.903 1.00 3.63   ? 81  GLY A CA   4  
ATOM 7787  C C    . GLY A 1 81  ? -7.071  -7.480  -16.215 1.00 3.79   ? 81  GLY A C    4  
ATOM 7788  O O    . GLY A 1 81  ? -6.698  -6.343  -16.499 1.00 4.70   ? 81  GLY A O    4  
ATOM 7789  H H    . GLY A 1 81  ? -5.993  -8.259  -13.952 1.00 3.75   ? 81  GLY A H    4  
ATOM 7790  H HA2  . GLY A 1 81  ? -8.415  -8.643  -15.027 1.00 4.00   ? 81  GLY A HA2  4  
ATOM 7791  H HA3  . GLY A 1 81  ? -8.513  -6.914  -14.729 1.00 3.89   ? 81  GLY A HA3  4  
ATOM 7792  N N    . GLY A 1 82  ? -6.820  -8.532  -17.006 1.00 3.63   ? 82  GLY A N    4  
ATOM 7793  C CA   . GLY A 1 82  ? -6.183  -8.465  -18.329 1.00 4.00   ? 82  GLY A CA   4  
ATOM 7794  C C    . GLY A 1 82  ? -4.666  -8.568  -18.205 1.00 3.76   ? 82  GLY A C    4  
ATOM 7795  O O    . GLY A 1 82  ? -4.029  -9.292  -18.972 1.00 4.20   ? 82  GLY A O    4  
ATOM 7796  H H    . GLY A 1 82  ? -6.935  -9.452  -16.615 1.00 3.78   ? 82  GLY A H    4  
ATOM 7797  H HA2  . GLY A 1 82  ? -6.528  -9.300  -18.941 1.00 4.36   ? 82  GLY A HA2  4  
ATOM 7798  H HA3  . GLY A 1 82  ? -6.418  -7.512  -18.810 1.00 4.29   ? 82  GLY A HA3  4  
ATOM 7799  N N    . MET A 1 83  ? -4.120  -7.912  -17.176 1.00 3.35   ? 83  MET A N    4  
ATOM 7800  C CA   . MET A 1 83  ? -2.737  -8.058  -16.744 1.00 3.05   ? 83  MET A CA   4  
ATOM 7801  C C    . MET A 1 83  ? -2.577  -8.984  -15.535 1.00 2.58   ? 83  MET A C    4  
ATOM 7802  O O    . MET A 1 83  ? -3.491  -9.175  -14.722 1.00 2.70   ? 83  MET A O    4  
ATOM 7803  C CB   . MET A 1 83  ? -2.099  -6.684  -16.456 1.00 3.30   ? 83  MET A CB   4  
ATOM 7804  C CG   . MET A 1 83  ? -1.460  -6.046  -17.692 1.00 4.13   ? 83  MET A CG   4  
ATOM 7805  S SD   . MET A 1 83  ? -2.603  -5.495  -18.981 1.00 5.18   ? 83  MET A SD   4  
ATOM 7806  C CE   . MET A 1 83  ? -1.412  -4.584  -19.990 1.00 6.14   ? 83  MET A CE   4  
ATOM 7807  H H    . MET A 1 83  ? -4.721  -7.303  -16.641 1.00 3.54   ? 83  MET A H    4  
ATOM 7808  H HA   . MET A 1 83  ? -2.219  -8.543  -17.563 1.00 3.23   ? 83  MET A HA   4  
ATOM 7809  H HB2  . MET A 1 83  ? -2.840  -6.007  -16.031 1.00 2.89   ? 83  MET A HB2  4  
ATOM 7810  H HB3  . MET A 1 83  ? -1.304  -6.805  -15.718 1.00 3.83   ? 83  MET A HB3  4  
ATOM 7811  H HG2  . MET A 1 83  ? -0.896  -5.176  -17.355 1.00 4.32   ? 83  MET A HG2  4  
ATOM 7812  H HG3  . MET A 1 83  ? -0.747  -6.747  -18.131 1.00 4.74   ? 83  MET A HG3  4  
ATOM 7813  H HE1  . MET A 1 83  ? -1.929  -4.106  -20.822 1.00 6.92   ? 83  MET A HE1  4  
ATOM 7814  H HE2  . MET A 1 83  ? -0.932  -3.817  -19.380 1.00 6.01   ? 83  MET A HE2  4  
ATOM 7815  H HE3  . MET A 1 83  ? -0.654  -5.274  -20.363 1.00 6.62   ? 83  MET A HE3  4  
ATOM 7816  N N    . ALA A 1 84  ? -1.353  -9.500  -15.429 1.00 2.37   ? 84  ALA A N    4  
ATOM 7817  C CA   . ALA A 1 84  ? -0.798  -10.251 -14.311 1.00 2.04   ? 84  ALA A CA   4  
ATOM 7818  C C    . ALA A 1 84  ? 0.496   -9.580  -13.819 1.00 2.07   ? 84  ALA A C    4  
ATOM 7819  O O    . ALA A 1 84  ? 1.093   -8.785  -14.548 1.00 2.55   ? 84  ALA A O    4  
ATOM 7820  C CB   . ALA A 1 84  ? -0.541  -11.690 -14.781 1.00 2.45   ? 84  ALA A CB   4  
ATOM 7821  H H    . ALA A 1 84  ? -0.672  -9.213  -16.114 1.00 2.65   ? 84  ALA A H    4  
ATOM 7822  H HA   . ALA A 1 84  ? -1.512  -10.251 -13.495 1.00 1.94   ? 84  ALA A HA   4  
ATOM 7823  H HB1  . ALA A 1 84  ? -1.460  -12.122 -15.182 1.00 2.44   ? 84  ALA A HB1  4  
ATOM 7824  H HB2  . ALA A 1 84  ? 0.221   -11.692 -15.564 1.00 3.44   ? 84  ALA A HB2  4  
ATOM 7825  H HB3  . ALA A 1 84  ? -0.192  -12.296 -13.942 1.00 3.01   ? 84  ALA A HB3  4  
ATOM 7826  N N    . GLY A 1 85  ? 0.950   -9.902  -12.600 1.00 1.91   ? 85  GLY A N    4  
ATOM 7827  C CA   . GLY A 1 85  ? 2.151   -9.334  -12.007 1.00 2.42   ? 85  GLY A CA   4  
ATOM 7828  C C    . GLY A 1 85  ? 2.765   -10.212 -10.923 1.00 1.85   ? 85  GLY A C    4  
ATOM 7829  O O    . GLY A 1 85  ? 2.231   -11.249 -10.523 1.00 1.98   ? 85  GLY A O    4  
ATOM 7830  H H    . GLY A 1 85  ? 0.459   -10.585 -12.039 1.00 1.66   ? 85  GLY A H    4  
ATOM 7831  H HA2  . GLY A 1 85  ? 2.897   -9.152  -12.781 1.00 3.21   ? 85  GLY A HA2  4  
ATOM 7832  H HA3  . GLY A 1 85  ? 1.900   -8.372  -11.566 1.00 2.98   ? 85  GLY A HA3  4  
ATOM 7833  N N    . MET A 1 86  ? 3.922   -9.753  -10.472 1.00 2.18   ? 86  MET A N    4  
ATOM 7834  C CA   . MET A 1 86  ? 4.852   -10.471 -9.600  1.00 1.87   ? 86  MET A CA   4  
ATOM 7835  C C    . MET A 1 86  ? 5.644   -9.544  -8.668  1.00 1.96   ? 86  MET A C    4  
ATOM 7836  O O    . MET A 1 86  ? 5.848   -8.356  -8.929  1.00 2.90   ? 86  MET A O    4  
ATOM 7837  C CB   . MET A 1 86  ? 5.782   -11.381 -10.433 1.00 2.64   ? 86  MET A CB   4  
ATOM 7838  C CG   . MET A 1 86  ? 6.865   -10.639 -11.241 1.00 3.68   ? 86  MET A CG   4  
ATOM 7839  S SD   . MET A 1 86  ? 6.299   -9.604  -12.616 1.00 5.41   ? 86  MET A SD   4  
ATOM 7840  C CE   . MET A 1 86  ? 7.848   -8.728  -12.952 1.00 6.98   ? 86  MET A CE   4  
ATOM 7841  H H    . MET A 1 86  ? 4.227   -8.880  -10.866 1.00 3.02   ? 86  MET A H    4  
ATOM 7842  H HA   . MET A 1 86  ? 4.253   -11.114 -8.955  1.00 1.67   ? 86  MET A HA   4  
ATOM 7843  H HB2  . MET A 1 86  ? 6.288   -12.064 -9.747  1.00 3.23   ? 86  MET A HB2  4  
ATOM 7844  H HB3  . MET A 1 86  ? 5.182   -11.988 -11.114 1.00 2.95   ? 86  MET A HB3  4  
ATOM 7845  H HG2  . MET A 1 86  ? 7.454   -10.017 -10.563 1.00 4.11   ? 86  MET A HG2  4  
ATOM 7846  H HG3  . MET A 1 86  ? 7.547   -11.386 -11.654 1.00 4.26   ? 86  MET A HG3  4  
ATOM 7847  H HE1  . MET A 1 86  ? 8.642   -9.446  -13.183 1.00 7.11   ? 86  MET A HE1  4  
ATOM 7848  H HE2  . MET A 1 86  ? 7.718   -8.053  -13.790 1.00 7.89   ? 86  MET A HE2  4  
ATOM 7849  H HE3  . MET A 1 86  ? 8.146   -8.146  -12.074 1.00 7.44   ? 86  MET A HE3  4  
ATOM 7850  N N    . LYS A 1 87  ? 6.114   -10.118 -7.563  1.00 1.75   ? 87  LYS A N    4  
ATOM 7851  C CA   . LYS A 1 87  ? 6.523   -9.404  -6.350  1.00 2.30   ? 87  LYS A CA   4  
ATOM 7852  C C    . LYS A 1 87  ? 7.842   -8.599  -6.428  1.00 1.93   ? 87  LYS A C    4  
ATOM 7853  O O    . LYS A 1 87  ? 8.805   -8.926  -5.743  1.00 2.83   ? 87  LYS A O    4  
ATOM 7854  C CB   . LYS A 1 87  ? 6.425   -10.383 -5.159  1.00 3.91   ? 87  LYS A CB   4  
ATOM 7855  C CG   . LYS A 1 87  ? 7.237   -11.694 -5.263  1.00 4.56   ? 87  LYS A CG   4  
ATOM 7856  C CD   . LYS A 1 87  ? 6.632   -12.812 -4.397  1.00 6.42   ? 87  LYS A CD   4  
ATOM 7857  C CE   . LYS A 1 87  ? 6.633   -12.473 -2.900  1.00 7.60   ? 87  LYS A CE   4  
ATOM 7858  N NZ   . LYS A 1 87  ? 5.542   -13.173 -2.182  1.00 9.18   ? 87  LYS A NZ   4  
ATOM 7859  H H    . LYS A 1 87  ? 5.951   -11.107 -7.459  1.00 1.99   ? 87  LYS A H    4  
ATOM 7860  H HA   . LYS A 1 87  ? 5.759   -8.650  -6.173  1.00 2.72   ? 87  LYS A HA   4  
ATOM 7861  H HB2  . LYS A 1 87  ? 6.728   -9.867  -4.253  1.00 4.80   ? 87  LYS A HB2  4  
ATOM 7862  H HB3  . LYS A 1 87  ? 5.373   -10.633 -5.030  1.00 4.61   ? 87  LYS A HB3  4  
ATOM 7863  H HG2  . LYS A 1 87  ? 7.247   -12.053 -6.290  1.00 4.41   ? 87  LYS A HG2  4  
ATOM 7864  H HG3  . LYS A 1 87  ? 8.269   -11.512 -4.955  1.00 4.69   ? 87  LYS A HG3  4  
ATOM 7865  H HD2  . LYS A 1 87  ? 5.607   -12.986 -4.728  1.00 6.81   ? 87  LYS A HD2  4  
ATOM 7866  H HD3  . LYS A 1 87  ? 7.191   -13.738 -4.549  1.00 7.11   ? 87  LYS A HD3  4  
ATOM 7867  H HE2  . LYS A 1 87  ? 7.608   -12.718 -2.474  1.00 8.09   ? 87  LYS A HE2  4  
ATOM 7868  H HE3  . LYS A 1 87  ? 6.464   -11.398 -2.785  1.00 7.36   ? 87  LYS A HE3  4  
ATOM 7869  H HZ1  . LYS A 1 87  ? 5.587   -14.183 -2.228  1.00 9.54   ? 87  LYS A HZ1  4  
ATOM 7870  H HZ2  . LYS A 1 87  ? 5.487   -12.869 -1.220  1.00 9.93   ? 87  LYS A HZ2  4  
ATOM 7871  H HZ3  . LYS A 1 87  ? 4.640   -12.879 -2.566  1.00 9.64   ? 87  LYS A HZ3  4  
ATOM 7872  N N    . MET A 1 88  ? 7.861   -7.511  -7.214  1.00 1.63   ? 88  MET A N    4  
ATOM 7873  C CA   . MET A 1 88  ? 8.885   -6.442  -7.168  1.00 1.97   ? 88  MET A CA   4  
ATOM 7874  C C    . MET A 1 88  ? 8.317   -5.012  -7.060  1.00 2.02   ? 88  MET A C    4  
ATOM 7875  O O    . MET A 1 88  ? 9.056   -4.100  -6.689  1.00 3.44   ? 88  MET A O    4  
ATOM 7876  C CB   . MET A 1 88  ? 9.787   -6.518  -8.414  1.00 2.62   ? 88  MET A CB   4  
ATOM 7877  C CG   . MET A 1 88  ? 10.888  -7.575  -8.286  1.00 3.25   ? 88  MET A CG   4  
ATOM 7878  S SD   . MET A 1 88  ? 11.966  -7.639  -9.744  1.00 4.10   ? 88  MET A SD   4  
ATOM 7879  C CE   . MET A 1 88  ? 13.455  -8.318  -8.977  1.00 5.29   ? 88  MET A CE   4  
ATOM 7880  H H    . MET A 1 88  ? 7.127   -7.453  -7.914  1.00 2.08   ? 88  MET A H    4  
ATOM 7881  H HA   . MET A 1 88  ? 9.508   -6.570  -6.283  1.00 2.34   ? 88  MET A HA   4  
ATOM 7882  H HB2  . MET A 1 88  ? 9.182   -6.721  -9.299  1.00 3.15   ? 88  MET A HB2  4  
ATOM 7883  H HB3  . MET A 1 88  ? 10.287  -5.555  -8.559  1.00 3.13   ? 88  MET A HB3  4  
ATOM 7884  H HG2  . MET A 1 88  ? 11.497  -7.318  -7.414  1.00 3.52   ? 88  MET A HG2  4  
ATOM 7885  H HG3  . MET A 1 88  ? 10.450  -8.559  -8.118  1.00 3.66   ? 88  MET A HG3  4  
ATOM 7886  H HE1  . MET A 1 88  ? 13.784  -7.648  -8.177  1.00 5.38   ? 88  MET A HE1  4  
ATOM 7887  H HE2  . MET A 1 88  ? 13.244  -9.301  -8.566  1.00 6.08   ? 88  MET A HE2  4  
ATOM 7888  H HE3  . MET A 1 88  ? 14.242  -8.391  -9.730  1.00 5.91   ? 88  MET A HE3  4  
ATOM 7889  N N    . VAL A 1 89  ? 7.034   -4.821  -7.387  1.00 1.44   ? 89  VAL A N    4  
ATOM 7890  C CA   . VAL A 1 89  ? 6.363   -3.511  -7.467  1.00 1.33   ? 89  VAL A CA   4  
ATOM 7891  C C    . VAL A 1 89  ? 4.841   -3.703  -7.624  1.00 1.29   ? 89  VAL A C    4  
ATOM 7892  O O    . VAL A 1 89  ? 4.441   -4.664  -8.284  1.00 1.68   ? 89  VAL A O    4  
ATOM 7893  C CB   . VAL A 1 89  ? 6.957   -2.651  -8.620  1.00 1.59   ? 89  VAL A CB   4  
ATOM 7894  C CG1  . VAL A 1 89  ? 6.673   -3.226  -10.021 1.00 3.24   ? 89  VAL A CG1  4  
ATOM 7895  C CG2  . VAL A 1 89  ? 6.543   -1.173  -8.552  1.00 2.36   ? 89  VAL A CG2  4  
ATOM 7896  H H    . VAL A 1 89  ? 6.505   -5.620  -7.699  1.00 2.20   ? 89  VAL A H    4  
ATOM 7897  H HA   . VAL A 1 89  ? 6.568   -3.002  -6.528  1.00 1.36   ? 89  VAL A HA   4  
ATOM 7898  H HB   . VAL A 1 89  ? 8.040   -2.649  -8.518  1.00 2.39   ? 89  VAL A HB   4  
ATOM 7899  H HG11 . VAL A 1 89  ? 5.613   -3.156  -10.256 1.00 4.02   ? 89  VAL A HG11 4  
ATOM 7900  H HG12 . VAL A 1 89  ? 7.236   -2.661  -10.766 1.00 3.73   ? 89  VAL A HG12 4  
ATOM 7901  H HG13 . VAL A 1 89  ? 6.985   -4.268  -10.073 1.00 4.28   ? 89  VAL A HG13 4  
ATOM 7902  H HG21 . VAL A 1 89  ? 5.467   -1.068  -8.664  1.00 3.39   ? 89  VAL A HG21 4  
ATOM 7903  H HG22 . VAL A 1 89  ? 6.856   -0.747  -7.599  1.00 3.01   ? 89  VAL A HG22 4  
ATOM 7904  H HG23 . VAL A 1 89  ? 7.034   -0.618  -9.354  1.00 2.82   ? 89  VAL A HG23 4  
ATOM 7905  N N    . PRO A 1 90  ? 3.991   -2.835  -7.038  1.00 1.12   ? 90  PRO A N    4  
ATOM 7906  C CA   . PRO A 1 90  ? 2.568   -2.742  -7.360  1.00 1.26   ? 90  PRO A CA   4  
ATOM 7907  C C    . PRO A 1 90  ? 2.375   -2.039  -8.718  1.00 1.63   ? 90  PRO A C    4  
ATOM 7908  O O    . PRO A 1 90  ? 3.239   -2.112  -9.593  1.00 3.03   ? 90  PRO A O    4  
ATOM 7909  C CB   . PRO A 1 90  ? 1.955   -2.005  -6.157  1.00 1.46   ? 90  PRO A CB   4  
ATOM 7910  C CG   . PRO A 1 90  ? 3.070   -1.049  -5.760  1.00 1.52   ? 90  PRO A CG   4  
ATOM 7911  C CD   . PRO A 1 90  ? 4.319   -1.899  -5.975  1.00 1.15   ? 90  PRO A CD   4  
ATOM 7912  H HA   . PRO A 1 90  ? 2.117   -3.731  -7.425  1.00 1.34   ? 90  PRO A HA   4  
ATOM 7913  H HB2  . PRO A 1 90  ? 1.029   -1.478  -6.384  1.00 1.71   ? 90  PRO A HB2  4  
ATOM 7914  H HB3  . PRO A 1 90  ? 1.787   -2.716  -5.346  1.00 1.58   ? 90  PRO A HB3  4  
ATOM 7915  H HG2  . PRO A 1 90  ? 3.083   -0.208  -6.451  1.00 1.85   ? 90  PRO A HG2  4  
ATOM 7916  H HG3  . PRO A 1 90  ? 2.977   -0.710  -4.728  1.00 1.83   ? 90  PRO A HG3  4  
ATOM 7917  H HD2  . PRO A 1 90  ? 5.155   -1.258  -6.241  1.00 1.34   ? 90  PRO A HD2  4  
ATOM 7918  H HD3  . PRO A 1 90  ? 4.543   -2.458  -5.066  1.00 1.22   ? 90  PRO A HD3  4  
ATOM 7919  N N    . TRP A 1 91  ? 1.239   -1.368  -8.931  1.00 1.22   ? 91  TRP A N    4  
ATOM 7920  C CA   . TRP A 1 91  ? 0.885   -0.741  -10.204 1.00 1.48   ? 91  TRP A CA   4  
ATOM 7921  C C    . TRP A 1 91  ? 0.038   0.525   -10.029 1.00 1.83   ? 91  TRP A C    4  
ATOM 7922  O O    . TRP A 1 91  ? -0.343  0.894   -8.918  1.00 2.31   ? 91  TRP A O    4  
ATOM 7923  C CB   . TRP A 1 91  ? 0.236   -1.788  -11.129 1.00 1.94   ? 91  TRP A CB   4  
ATOM 7924  C CG   . TRP A 1 91  ? -0.525  -2.923  -10.511 1.00 2.03   ? 91  TRP A CG   4  
ATOM 7925  C CD1  . TRP A 1 91  ? -1.831  -2.903  -10.170 1.00 1.84   ? 91  TRP A CD1  4  
ATOM 7926  C CD2  . TRP A 1 91  ? -0.047  -4.274  -10.208 1.00 2.67   ? 91  TRP A CD2  4  
ATOM 7927  N NE1  . TRP A 1 91  ? -2.217  -4.173  -9.768  1.00 2.23   ? 91  TRP A NE1  4  
ATOM 7928  C CE2  . TRP A 1 91  ? -1.154  -5.049  -9.753  1.00 2.77   ? 91  TRP A CE2  4  
ATOM 7929  C CE3  . TRP A 1 91  ? 1.204   -4.922  -10.284 1.00 3.33   ? 91  TRP A CE3  4  
ATOM 7930  C CZ2  . TRP A 1 91  ? -1.026  -6.410  -9.421  1.00 3.46   ? 91  TRP A CZ2  4  
ATOM 7931  C CZ3  . TRP A 1 91  ? 1.344   -6.283  -9.952  1.00 4.03   ? 91  TRP A CZ3  4  
ATOM 7932  C CH2  . TRP A 1 91  ? 0.228   -7.030  -9.531  1.00 4.09   ? 91  TRP A CH2  4  
ATOM 7933  H H    . TRP A 1 91  ? 0.555   -1.312  -8.191  1.00 1.86   ? 91  TRP A H    4  
ATOM 7934  H HA   . TRP A 1 91  ? 1.787   -0.406  -10.699 1.00 1.85   ? 91  TRP A HA   4  
ATOM 7935  H HB2  . TRP A 1 91  ? -0.424  -1.289  -11.833 1.00 2.33   ? 91  TRP A HB2  4  
ATOM 7936  H HB3  . TRP A 1 91  ? 1.033   -2.233  -11.723 1.00 2.27   ? 91  TRP A HB3  4  
ATOM 7937  H HD1  . TRP A 1 91  ? -2.462  -2.021  -10.258 1.00 1.72   ? 91  TRP A HD1  4  
ATOM 7938  H HE1  . TRP A 1 91  ? -3.174  -4.459  -9.617  1.00 2.32   ? 91  TRP A HE1  4  
ATOM 7939  H HE3  . TRP A 1 91  ? 2.073   -4.364  -10.601 1.00 3.34   ? 91  TRP A HE3  4  
ATOM 7940  H HZ2  . TRP A 1 91  ? -1.887  -6.975  -9.093  1.00 3.55   ? 91  TRP A HZ2  4  
ATOM 7941  H HZ3  . TRP A 1 91  ? 2.315   -6.752  -10.017 1.00 4.56   ? 91  TRP A HZ3  4  
ATOM 7942  H HH2  . TRP A 1 91  ? 0.337   -8.080  -9.289  1.00 4.66   ? 91  TRP A HH2  4  
ATOM 7943  N N    . LEU A 1 92  ? -0.283  1.199   -11.137 1.00 2.27   ? 92  LEU A N    4  
ATOM 7944  C CA   . LEU A 1 92  ? -1.352  2.192   -11.166 1.00 2.81   ? 92  LEU A CA   4  
ATOM 7945  C C    . LEU A 1 92  ? -2.630  1.677   -10.471 1.00 2.27   ? 92  LEU A C    4  
ATOM 7946  O O    . LEU A 1 92  ? -3.215  0.679   -10.881 1.00 3.64   ? 92  LEU A O    4  
ATOM 7947  C CB   . LEU A 1 92  ? -1.568  2.735   -12.597 1.00 4.77   ? 92  LEU A CB   4  
ATOM 7948  C CG   . LEU A 1 92  ? -2.404  1.883   -13.578 1.00 6.31   ? 92  LEU A CG   4  
ATOM 7949  C CD1  . LEU A 1 92  ? -2.614  2.670   -14.881 1.00 8.18   ? 92  LEU A CD1  4  
ATOM 7950  C CD2  . LEU A 1 92  ? -1.751  0.533   -13.909 1.00 7.53   ? 92  LEU A CD2  4  
ATOM 7951  H H    . LEU A 1 92  ? 0.202   0.977   -11.992 1.00 2.54   ? 92  LEU A H    4  
ATOM 7952  H HA   . LEU A 1 92  ? -0.996  3.026   -10.581 1.00 3.28   ? 92  LEU A HA   4  
ATOM 7953  H HB2  . LEU A 1 92  ? -2.072  3.693   -12.500 1.00 5.40   ? 92  LEU A HB2  4  
ATOM 7954  H HB3  . LEU A 1 92  ? -0.595  2.944   -13.047 1.00 5.04   ? 92  LEU A HB3  4  
ATOM 7955  H HG   . LEU A 1 92  ? -3.382  1.702   -13.127 1.00 5.74   ? 92  LEU A HG   4  
ATOM 7956  H HD11 . LEU A 1 92  ? -3.220  2.088   -15.575 1.00 9.05   ? 92  LEU A HD11 4  
ATOM 7957  H HD12 . LEU A 1 92  ? -3.134  3.604   -14.671 1.00 8.45   ? 92  LEU A HD12 4  
ATOM 7958  H HD13 . LEU A 1 92  ? -1.652  2.890   -15.348 1.00 8.83   ? 92  LEU A HD13 4  
ATOM 7959  H HD21 . LEU A 1 92  ? -2.271  0.053   -14.738 1.00 8.57   ? 92  LEU A HD21 4  
ATOM 7960  H HD22 . LEU A 1 92  ? -0.705  0.676   -14.185 1.00 7.96   ? 92  LEU A HD22 4  
ATOM 7961  H HD23 . LEU A 1 92  ? -1.821  -0.125  -13.048 1.00 7.51   ? 92  LEU A HD23 4  
ATOM 7962  N N    . THR A 1 93  ? -3.054  2.351   -9.397  1.00 2.58   ? 93  THR A N    4  
ATOM 7963  C CA   . THR A 1 93  ? -4.350  2.117   -8.758  1.00 3.90   ? 93  THR A CA   4  
ATOM 7964  C C    . THR A 1 93  ? -5.465  2.359   -9.754  1.00 3.20   ? 93  THR A C    4  
ATOM 7965  O O    . THR A 1 93  ? -5.461  3.348   -10.475 1.00 3.99   ? 93  THR A O    4  
ATOM 7966  C CB   . THR A 1 93  ? -4.459  2.936   -7.475  1.00 6.28   ? 93  THR A CB   4  
ATOM 7967  O OG1  . THR A 1 93  ? -3.681  2.390   -6.447  1.00 7.51   ? 93  THR A OG1  4  
ATOM 7968  C CG2  . THR A 1 93  ? -5.865  3.091   -6.914  1.00 7.95   ? 93  THR A CG2  4  
ATOM 7969  H H    . THR A 1 93  ? -2.451  3.044   -8.987  1.00 3.23   ? 93  THR A H    4  
ATOM 7970  H HA   . THR A 1 93  ? -4.427  1.081   -8.511  1.00 4.45   ? 93  THR A HA   4  
ATOM 7971  H HB   . THR A 1 93  ? -4.060  3.901   -7.717  1.00 6.46   ? 93  THR A HB   4  
ATOM 7972  H HG1  . THR A 1 93  ? -3.719  3.027   -5.707  1.00 8.59   ? 93  THR A HG1  4  
ATOM 7973  H HG21 . THR A 1 93  ? -5.835  3.603   -5.955  1.00 8.99   ? 93  THR A HG21 4  
ATOM 7974  H HG22 . THR A 1 93  ? -6.436  3.714   -7.594  1.00 8.11   ? 93  THR A HG22 4  
ATOM 7975  H HG23 . THR A 1 93  ? -6.335  2.116   -6.796  1.00 8.40   ? 93  THR A HG23 4  
ATOM 7976  N N    . ILE A 1 94  ? -6.392  1.396   -9.761  1.00 3.06   ? 94  ILE A N    4  
ATOM 7977  C CA   . ILE A 1 94  ? -7.523  1.242   -10.687 1.00 2.38   ? 94  ILE A CA   4  
ATOM 7978  C C    . ILE A 1 94  ? -7.149  1.627   -12.131 1.00 1.93   ? 94  ILE A C    4  
ATOM 7979  O O    . ILE A 1 94  ? -7.402  2.759   -12.534 1.00 2.26   ? 94  ILE A O    4  
ATOM 7980  C CB   . ILE A 1 94  ? -8.832  1.856   -10.104 1.00 2.85   ? 94  ILE A CB   4  
ATOM 7981  C CG1  . ILE A 1 94  ? -9.995  2.082   -11.087 1.00 3.55   ? 94  ILE A CG1  4  
ATOM 7982  C CG2  . ILE A 1 94  ? -8.642  3.134   -9.278  1.00 3.69   ? 94  ILE A CG2  4  
ATOM 7983  C CD1  . ILE A 1 94  ? -10.485 0.816   -11.777 1.00 4.56   ? 94  ILE A CD1  4  
ATOM 7984  H H    . ILE A 1 94  ? -6.234  0.647   -9.115  1.00 4.14   ? 94  ILE A H    4  
ATOM 7985  H HA   . ILE A 1 94  ? -7.744  0.182   -10.742 1.00 2.58   ? 94  ILE A HA   4  
ATOM 7986  H HB   . ILE A 1 94  ? -9.196  1.129   -9.385  1.00 3.61   ? 94  ILE A HB   4  
ATOM 7987  H HG12 . ILE A 1 94  ? -10.827 2.480   -10.520 1.00 4.54   ? 94  ILE A HG12 4  
ATOM 7988  H HG13 . ILE A 1 94  ? -9.740  2.821   -11.841 1.00 3.80   ? 94  ILE A HG13 4  
ATOM 7989  H HG21 . ILE A 1 94  ? -9.588  3.654   -9.115  1.00 4.21   ? 94  ILE A HG21 4  
ATOM 7990  H HG22 . ILE A 1 94  ? -8.254  2.864   -8.301  1.00 4.47   ? 94  ILE A HG22 4  
ATOM 7991  H HG23 . ILE A 1 94  ? -7.949  3.790   -9.790  1.00 4.14   ? 94  ILE A HG23 4  
ATOM 7992  H HD11 . ILE A 1 94  ? -9.711  0.443   -12.444 1.00 4.82   ? 94  ILE A HD11 4  
ATOM 7993  H HD12 . ILE A 1 94  ? -10.752 0.067   -11.032 1.00 5.18   ? 94  ILE A HD12 4  
ATOM 7994  H HD13 . ILE A 1 94  ? -11.371 1.035   -12.365 1.00 5.38   ? 94  ILE A HD13 4  
ATOM 7995  N N    . PRO A 1 95  ? -6.604  0.699   -12.946 1.00 2.04   ? 95  PRO A N    4  
ATOM 7996  C CA   . PRO A 1 95  ? -6.500  0.886   -14.388 1.00 2.67   ? 95  PRO A CA   4  
ATOM 7997  C C    . PRO A 1 95  ? -7.897  0.916   -15.035 1.00 2.37   ? 95  PRO A C    4  
ATOM 7998  O O    . PRO A 1 95  ? -8.376  -0.099  -15.523 1.00 2.53   ? 95  PRO A O    4  
ATOM 7999  C CB   . PRO A 1 95  ? -5.611  -0.258  -14.895 1.00 3.48   ? 95  PRO A CB   4  
ATOM 8000  C CG   . PRO A 1 95  ? -5.705  -1.336  -13.822 1.00 3.16   ? 95  PRO A CG   4  
ATOM 8001  C CD   . PRO A 1 95  ? -5.986  -0.560  -12.542 1.00 2.42   ? 95  PRO A CD   4  
ATOM 8002  H HA   . PRO A 1 95  ? -6.001  1.831   -14.606 1.00 3.23   ? 95  PRO A HA   4  
ATOM 8003  H HB2  . PRO A 1 95  ? -5.935  -0.661  -15.852 1.00 3.90   ? 95  PRO A HB2  4  
ATOM 8004  H HB3  . PRO A 1 95  ? -4.583  0.084   -14.966 1.00 4.07   ? 95  PRO A HB3  4  
ATOM 8005  H HG2  . PRO A 1 95  ? -6.541  -1.992  -14.045 1.00 3.09   ? 95  PRO A HG2  4  
ATOM 8006  H HG3  . PRO A 1 95  ? -4.786  -1.917  -13.745 1.00 3.81   ? 95  PRO A HG3  4  
ATOM 8007  H HD2  . PRO A 1 95  ? -6.628  -1.149  -11.890 1.00 2.26   ? 95  PRO A HD2  4  
ATOM 8008  H HD3  . PRO A 1 95  ? -5.045  -0.347  -12.040 1.00 2.79   ? 95  PRO A HD3  4  
ATOM 8009  N N    . ALA A 1 96  ? -8.558  2.082   -14.980 1.00 2.66   ? 96  ALA A N    4  
ATOM 8010  C CA   . ALA A 1 96  ? -9.781  2.472   -15.700 1.00 2.83   ? 96  ALA A CA   4  
ATOM 8011  C C    . ALA A 1 96  ? -10.759 1.326   -16.035 1.00 2.92   ? 96  ALA A C    4  
ATOM 8012  O O    . ALA A 1 96  ? -11.120 1.123   -17.190 1.00 3.87   ? 96  ALA A O    4  
ATOM 8013  C CB   . ALA A 1 96  ? -9.364  3.320   -16.911 1.00 3.60   ? 96  ALA A CB   4  
ATOM 8014  H H    . ALA A 1 96  ? -8.112  2.811   -14.434 1.00 3.27   ? 96  ALA A H    4  
ATOM 8015  H HA   . ALA A 1 96  ? -10.363 3.105   -15.029 1.00 2.66   ? 96  ALA A HA   4  
ATOM 8016  H HB1  . ALA A 1 96  ? -8.746  2.728   -17.586 1.00 4.21   ? 96  ALA A HB1  4  
ATOM 8017  H HB2  . ALA A 1 96  ? -10.249 3.656   -17.450 1.00 3.56   ? 96  ALA A HB2  4  
ATOM 8018  H HB3  . ALA A 1 96  ? -8.807  4.196   -16.585 1.00 4.44   ? 96  ALA A HB3  4  
ATOM 8019  N N    . ARG A 1 97  ? -11.145 0.604   -14.966 1.00 2.58   ? 97  ARG A N    4  
ATOM 8020  C CA   . ARG A 1 97  ? -12.112 -0.510  -14.800 1.00 2.52   ? 97  ARG A CA   4  
ATOM 8021  C C    . ARG A 1 97  ? -11.484 -1.729  -14.092 1.00 2.24   ? 97  ARG A C    4  
ATOM 8022  O O    . ARG A 1 97  ? -12.212 -2.566  -13.555 1.00 2.44   ? 97  ARG A O    4  
ATOM 8023  C CB   . ARG A 1 97  ? -12.814 -0.869  -16.125 1.00 2.77   ? 97  ARG A CB   4  
ATOM 8024  C CG   . ARG A 1 97  ? -13.897 -1.954  -16.042 1.00 2.56   ? 97  ARG A CG   4  
ATOM 8025  C CD   . ARG A 1 97  ? -13.349 -3.332  -16.435 1.00 2.97   ? 97  ARG A CD   4  
ATOM 8026  N NE   . ARG A 1 97  ? -14.218 -4.422  -15.959 1.00 3.24   ? 97  ARG A NE   4  
ATOM 8027  C CZ   . ARG A 1 97  ? -15.448 -4.699  -16.376 1.00 3.48   ? 97  ARG A CZ   4  
ATOM 8028  N NH1  . ARG A 1 97  ? -16.019 -4.076  -17.387 1.00 3.82   ? 97  ARG A NH1  4  
ATOM 8029  N NH2  . ARG A 1 97  ? -16.132 -5.658  -15.802 1.00 4.25   ? 97  ARG A NH2  4  
ATOM 8030  H H    . ARG A 1 97  ? -10.688 0.881   -14.114 1.00 2.88   ? 97  ARG A H    4  
ATOM 8031  H HA   . ARG A 1 97  ? -12.893 -0.148  -14.128 1.00 2.62   ? 97  ARG A HA   4  
ATOM 8032  H HB2  . ARG A 1 97  ? -13.307 0.032   -16.493 1.00 3.19   ? 97  ARG A HB2  4  
ATOM 8033  H HB3  . ARG A 1 97  ? -12.070 -1.166  -16.857 1.00 3.34   ? 97  ARG A HB3  4  
ATOM 8034  H HG2  . ARG A 1 97  ? -14.314 -1.973  -15.036 1.00 2.82   ? 97  ARG A HG2  4  
ATOM 8035  H HG3  . ARG A 1 97  ? -14.703 -1.696  -16.732 1.00 3.08   ? 97  ARG A HG3  4  
ATOM 8036  H HD2  . ARG A 1 97  ? -13.235 -3.387  -17.517 1.00 3.45   ? 97  ARG A HD2  4  
ATOM 8037  H HD3  . ARG A 1 97  ? -12.364 -3.476  -15.987 1.00 3.57   ? 97  ARG A HD3  4  
ATOM 8038  H HE   . ARG A 1 97  ? -13.853 -4.971  -15.197 1.00 3.92   ? 97  ARG A HE   4  
ATOM 8039  H HH11 . ARG A 1 97  ? -15.544 -3.336  -17.870 1.00 3.90   ? 97  ARG A HH11 4  
ATOM 8040  H HH12 . ARG A 1 97  ? -16.973 -4.333  -17.635 1.00 4.54   ? 97  ARG A HH12 4  
ATOM 8041  H HH21 . ARG A 1 97  ? -15.761 -6.187  -15.029 1.00 4.75   ? 97  ARG A HH21 4  
ATOM 8042  H HH22 . ARG A 1 97  ? -17.074 -5.836  -16.150 1.00 4.69   ? 97  ARG A HH22 4  
ATOM 8043  N N    . GLY A 1 98  ? -10.145 -1.798  -14.028 1.00 2.12   ? 98  GLY A N    4  
ATOM 8044  C CA   . GLY A 1 98  ? -9.381  -2.918  -13.443 1.00 1.99   ? 98  GLY A CA   4  
ATOM 8045  C C    . GLY A 1 98  ? -9.093  -2.796  -11.937 1.00 1.98   ? 98  GLY A C    4  
ATOM 8046  O O    . GLY A 1 98  ? -8.976  -1.706  -11.380 1.00 3.22   ? 98  GLY A O    4  
ATOM 8047  H H    . GLY A 1 98  ? -9.639  -1.058  -14.507 1.00 2.38   ? 98  GLY A H    4  
ATOM 8048  H HA2  . GLY A 1 98  ? -9.942  -3.844  -13.595 1.00 2.01   ? 98  GLY A HA2  4  
ATOM 8049  H HA3  . GLY A 1 98  ? -8.429  -3.010  -13.962 1.00 2.02   ? 98  GLY A HA3  4  
ATOM 8050  N N    . THR A 1 99  ? -8.958  -3.935  -11.258 1.00 1.72   ? 99  THR A N    4  
ATOM 8051  C CA   . THR A 1 99  ? -9.037  -4.057  -9.786  1.00 1.92   ? 99  THR A CA   4  
ATOM 8052  C C    . THR A 1 99  ? -7.645  -4.165  -9.152  1.00 1.72   ? 99  THR A C    4  
ATOM 8053  O O    . THR A 1 99  ? -7.180  -5.244  -8.794  1.00 1.88   ? 99  THR A O    4  
ATOM 8054  C CB   . THR A 1 99  ? -9.955  -5.245  -9.471  1.00 2.67   ? 99  THR A CB   4  
ATOM 8055  O OG1  . THR A 1 99  ? -11.261 -4.794  -9.750  1.00 3.28   ? 99  THR A OG1  4  
ATOM 8056  C CG2  . THR A 1 99  ? -9.997  -5.837  -8.058  1.00 2.99   ? 99  THR A CG2  4  
ATOM 8057  H H    . THR A 1 99  ? -9.010  -4.783  -11.806 1.00 2.41   ? 99  THR A H    4  
ATOM 8058  H HA   . THR A 1 99  ? -9.534  -3.163  -9.391  1.00 1.99   ? 99  THR A HA   4  
ATOM 8059  H HB   . THR A 1 99  ? -9.680  -6.043  -10.156 1.00 3.25   ? 99  THR A HB   4  
ATOM 8060  H HG1  . THR A 1 99  ? -11.829 -5.567  -9.820  1.00 3.94   ? 99  THR A HG1  4  
ATOM 8061  H HG21 . THR A 1 99  ? -9.199  -6.571  -7.943  1.00 3.58   ? 99  THR A HG21 4  
ATOM 8062  H HG22 . THR A 1 99  ? -9.877  -5.069  -7.303  1.00 3.08   ? 99  THR A HG22 4  
ATOM 8063  H HG23 . THR A 1 99  ? -10.943 -6.354  -7.892  1.00 3.51   ? 99  THR A HG23 4  
ATOM 8064  N N    . LEU A 1 100 ? -6.974  -3.024  -8.976  1.00 1.61   ? 100 LEU A N    4  
ATOM 8065  C CA   . LEU A 1 100 ? -5.738  -2.954  -8.182  1.00 1.51   ? 100 LEU A CA   4  
ATOM 8066  C C    . LEU A 1 100 ? -6.010  -3.394  -6.735  1.00 1.39   ? 100 LEU A C    4  
ATOM 8067  O O    . LEU A 1 100 ? -6.851  -2.816  -6.040  1.00 1.45   ? 100 LEU A O    4  
ATOM 8068  C CB   . LEU A 1 100 ? -5.030  -1.579  -8.284  1.00 1.76   ? 100 LEU A CB   4  
ATOM 8069  C CG   . LEU A 1 100 ? -3.876  -1.462  -7.245  1.00 2.74   ? 100 LEU A CG   4  
ATOM 8070  C CD1  . LEU A 1 100 ? -2.625  -0.710  -7.719  1.00 3.46   ? 100 LEU A CD1  4  
ATOM 8071  C CD2  . LEU A 1 100 ? -4.327  -0.830  -5.913  1.00 4.00   ? 100 LEU A CD2  4  
ATOM 8072  H H    . LEU A 1 100 ? -7.390  -2.182  -9.319  1.00 1.75   ? 100 LEU A H    4  
ATOM 8073  H HA   . LEU A 1 100 ? -5.060  -3.693  -8.609  1.00 1.60   ? 100 LEU A HA   4  
ATOM 8074  H HB2  . LEU A 1 100 ? -4.625  -1.493  -9.293  1.00 2.26   ? 100 LEU A HB2  4  
ATOM 8075  H HB3  . LEU A 1 100 ? -5.742  -0.769  -8.145  1.00 1.94   ? 100 LEU A HB3  4  
ATOM 8076  H HG   . LEU A 1 100 ? -3.543  -2.477  -7.056  1.00 3.49   ? 100 LEU A HG   4  
ATOM 8077  H HD11 . LEU A 1 100 ? -1.734  -1.239  -7.384  1.00 4.20   ? 100 LEU A HD11 4  
ATOM 8078  H HD12 . LEU A 1 100 ? -2.601  -0.633  -8.794  1.00 3.71   ? 100 LEU A HD12 4  
ATOM 8079  H HD13 . LEU A 1 100 ? -2.585  0.299   -7.320  1.00 4.16   ? 100 LEU A HD13 4  
ATOM 8080  H HD21 . LEU A 1 100 ? -4.980  0.021   -6.098  1.00 4.24   ? 100 LEU A HD21 4  
ATOM 8081  H HD22 . LEU A 1 100 ? -4.846  -1.550  -5.287  1.00 4.81   ? 100 LEU A HD22 4  
ATOM 8082  H HD23 . LEU A 1 100 ? -3.460  -0.488  -5.352  1.00 4.88   ? 100 LEU A HD23 4  
ATOM 8083  N N    . THR A 1 101 ? -5.227  -4.387  -6.300  1.00 1.40   ? 101 THR A N    4  
ATOM 8084  C CA   . THR A 1 101 ? -5.406  -5.155  -5.073  1.00 1.43   ? 101 THR A CA   4  
ATOM 8085  C C    . THR A 1 101 ? -4.039  -5.399  -4.442  1.00 1.42   ? 101 THR A C    4  
ATOM 8086  O O    . THR A 1 101 ? -3.187  -6.053  -5.040  1.00 2.14   ? 101 THR A O    4  
ATOM 8087  C CB   . THR A 1 101 ? -6.080  -6.475  -5.457  1.00 2.20   ? 101 THR A CB   4  
ATOM 8088  O OG1  . THR A 1 101 ? -7.340  -6.164  -6.007  1.00 2.80   ? 101 THR A OG1  4  
ATOM 8089  C CG2  . THR A 1 101 ? -6.294  -7.406  -4.260  1.00 2.72   ? 101 THR A CG2  4  
ATOM 8090  H H    . THR A 1 101 ? -4.560  -4.773  -6.952  1.00 1.51   ? 101 THR A H    4  
ATOM 8091  H HA   . THR A 1 101 ? -6.054  -4.625  -4.375  1.00 1.58   ? 101 THR A HA   4  
ATOM 8092  H HB   . THR A 1 101 ? -5.466  -6.968  -6.219  1.00 2.59   ? 101 THR A HB   4  
ATOM 8093  H HG1  . THR A 1 101 ? -7.226  -5.995  -6.956  1.00 3.06   ? 101 THR A HG1  4  
ATOM 8094  H HG21 . THR A 1 101 ? -5.336  -7.715  -3.843  1.00 3.27   ? 101 THR A HG21 4  
ATOM 8095  H HG22 . THR A 1 101 ? -6.881  -6.898  -3.495  1.00 2.89   ? 101 THR A HG22 4  
ATOM 8096  H HG23 . THR A 1 101 ? -6.830  -8.298  -4.586  1.00 3.52   ? 101 THR A HG23 4  
ATOM 8097  N N    . LEU A 1 102 ? -3.834  -4.863  -3.238  1.00 1.13   ? 102 LEU A N    4  
ATOM 8098  C CA   . LEU A 1 102 ? -2.661  -5.078  -2.393  1.00 1.47   ? 102 LEU A CA   4  
ATOM 8099  C C    . LEU A 1 102 ? -3.157  -5.716  -1.090  1.00 1.14   ? 102 LEU A C    4  
ATOM 8100  O O    . LEU A 1 102 ? -3.381  -5.038  -0.082  1.00 1.17   ? 102 LEU A O    4  
ATOM 8101  C CB   . LEU A 1 102 ? -1.958  -3.730  -2.134  1.00 2.08   ? 102 LEU A CB   4  
ATOM 8102  C CG   . LEU A 1 102 ? -0.944  -3.265  -3.192  1.00 2.86   ? 102 LEU A CG   4  
ATOM 8103  C CD1  . LEU A 1 102 ? -1.605  -2.841  -4.508  1.00 3.72   ? 102 LEU A CD1  4  
ATOM 8104  C CD2  . LEU A 1 102 ? -0.133  -2.082  -2.639  1.00 3.61   ? 102 LEU A CD2  4  
ATOM 8105  H H    . LEU A 1 102 ? -4.564  -4.296  -2.827  1.00 1.16   ? 102 LEU A H    4  
ATOM 8106  H HA   . LEU A 1 102 ? -1.966  -5.773  -2.868  1.00 1.98   ? 102 LEU A HA   4  
ATOM 8107  H HB2  . LEU A 1 102 ? -2.730  -2.977  -2.046  1.00 2.27   ? 102 LEU A HB2  4  
ATOM 8108  H HB3  . LEU A 1 102 ? -1.428  -3.795  -1.184  1.00 2.76   ? 102 LEU A HB3  4  
ATOM 8109  H HG   . LEU A 1 102 ? -0.264  -4.086  -3.378  1.00 3.56   ? 102 LEU A HG   4  
ATOM 8110  H HD11 . LEU A 1 102 ? -0.874  -2.377  -5.167  1.00 4.49   ? 102 LEU A HD11 4  
ATOM 8111  H HD12 . LEU A 1 102 ? -2.016  -3.705  -5.023  1.00 4.37   ? 102 LEU A HD12 4  
ATOM 8112  H HD13 . LEU A 1 102 ? -2.401  -2.131  -4.299  1.00 4.21   ? 102 LEU A HD13 4  
ATOM 8113  H HD21 . LEU A 1 102 ? 0.601   -1.753  -3.375  1.00 4.18   ? 102 LEU A HD21 4  
ATOM 8114  H HD22 . LEU A 1 102 ? -0.795  -1.249  -2.401  1.00 3.81   ? 102 LEU A HD22 4  
ATOM 8115  H HD23 . LEU A 1 102 ? 0.399   -2.389  -1.741  1.00 4.37   ? 102 LEU A HD23 4  
ATOM 8116  N N    . GLN A 1 103 ? -3.317  -7.038  -1.113  1.00 1.06   ? 103 GLN A N    4  
ATOM 8117  C CA   . GLN A 1 103 ? -3.817  -7.868  -0.017  1.00 1.11   ? 103 GLN A CA   4  
ATOM 8118  C C    . GLN A 1 103 ? -3.070  -9.191  0.018   1.00 1.31   ? 103 GLN A C    4  
ATOM 8119  O O    . GLN A 1 103 ? -2.572  -9.629  -1.014  1.00 1.41   ? 103 GLN A O    4  
ATOM 8120  C CB   . GLN A 1 103 ? -5.320  -8.153  -0.208  1.00 1.30   ? 103 GLN A CB   4  
ATOM 8121  C CG   . GLN A 1 103 ? -6.262  -6.963  0.015   1.00 1.55   ? 103 GLN A CG   4  
ATOM 8122  C CD   . GLN A 1 103 ? -6.237  -6.516  1.473   1.00 2.31   ? 103 GLN A CD   4  
ATOM 8123  O OE1  . GLN A 1 103 ? -7.112  -6.811  2.269   1.00 2.60   ? 103 GLN A OE1  4  
ATOM 8124  N NE2  . GLN A 1 103 ? -5.200  -5.850  1.903   1.00 3.76   ? 103 GLN A NE2  4  
ATOM 8125  H H    . GLN A 1 103 ? -2.967  -7.550  -1.918  1.00 1.15   ? 103 GLN A H    4  
ATOM 8126  H HA   . GLN A 1 103 ? -3.617  -7.397  0.942   1.00 1.17   ? 103 GLN A HA   4  
ATOM 8127  H HB2  . GLN A 1 103 ? -5.481  -8.539  -1.214  1.00 1.63   ? 103 GLN A HB2  4  
ATOM 8128  H HB3  . GLN A 1 103 ? -5.620  -8.934  0.495   1.00 1.69   ? 103 GLN A HB3  4  
ATOM 8129  H HG2  . GLN A 1 103 ? -5.982  -6.132  -0.631  1.00 2.45   ? 103 GLN A HG2  4  
ATOM 8130  H HG3  . GLN A 1 103 ? -7.281  -7.269  -0.241  1.00 2.21   ? 103 GLN A HG3  4  
ATOM 8131  H HE21 . GLN A 1 103 ? -4.440  -5.641  1.253   1.00 3.84   ? 103 GLN A HE21 4  
ATOM 8132  H HE22 . GLN A 1 103 ? -5.200  -5.583  2.876   1.00 4.98   ? 103 GLN A HE22 4  
ATOM 8133  N N    . ARG A 1 104 ? -3.049  -9.867  1.175   1.00 1.51   ? 104 ARG A N    4  
ATOM 8134  C CA   . ARG A 1 104 ? -2.474  -11.209 1.300   1.00 1.87   ? 104 ARG A CA   4  
ATOM 8135  C C    . ARG A 1 104 ? -3.303  -12.307 0.586   1.00 2.17   ? 104 ARG A C    4  
ATOM 8136  O O    . ARG A 1 104 ? -2.974  -13.484 0.701   1.00 2.69   ? 104 ARG A O    4  
ATOM 8137  C CB   . ARG A 1 104 ? -2.171  -11.517 2.780   1.00 1.89   ? 104 ARG A CB   4  
ATOM 8138  C CG   . ARG A 1 104 ? -0.810  -12.222 2.925   1.00 2.77   ? 104 ARG A CG   4  
ATOM 8139  C CD   . ARG A 1 104 ? -0.507  -12.584 4.388   1.00 3.06   ? 104 ARG A CD   4  
ATOM 8140  N NE   . ARG A 1 104 ? 0.835   -13.177 4.575   1.00 4.19   ? 104 ARG A NE   4  
ATOM 8141  C CZ   . ARG A 1 104 ? 1.261   -14.358 4.142   1.00 4.82   ? 104 ARG A CZ   4  
ATOM 8142  N NH1  . ARG A 1 104 ? 0.512   -15.165 3.423   1.00 4.88   ? 104 ARG A NH1  4  
ATOM 8143  N NH2  . ARG A 1 104 ? 2.475   -14.755 4.439   1.00 6.13   ? 104 ARG A NH2  4  
ATOM 8144  H H    . ARG A 1 104 ? -3.487  -9.468  1.993   1.00 1.52   ? 104 ARG A H    4  
ATOM 8145  H HA   . ARG A 1 104 ? -1.521  -11.170 0.772   1.00 2.06   ? 104 ARG A HA   4  
ATOM 8146  H HB2  . ARG A 1 104 ? -2.123  -10.586 3.348   1.00 1.98   ? 104 ARG A HB2  4  
ATOM 8147  H HB3  . ARG A 1 104 ? -2.966  -12.137 3.200   1.00 2.65   ? 104 ARG A HB3  4  
ATOM 8148  H HG2  . ARG A 1 104 ? -0.814  -13.125 2.317   1.00 3.83   ? 104 ARG A HG2  4  
ATOM 8149  H HG3  . ARG A 1 104 ? -0.026  -11.559 2.555   1.00 3.38   ? 104 ARG A HG3  4  
ATOM 8150  H HD2  . ARG A 1 104 ? -0.567  -11.675 4.988   1.00 3.01   ? 104 ARG A HD2  4  
ATOM 8151  H HD3  . ARG A 1 104 ? -1.264  -13.280 4.750   1.00 3.53   ? 104 ARG A HD3  4  
ATOM 8152  H HE   . ARG A 1 104 ? 1.503   -12.648 5.124   1.00 5.07   ? 104 ARG A HE   4  
ATOM 8153  H HH11 . ARG A 1 104 ? -0.394  -14.864 3.111   1.00 4.60   ? 104 ARG A HH11 4  
ATOM 8154  H HH12 . ARG A 1 104 ? 0.892   -16.051 3.127   1.00 5.76   ? 104 ARG A HH12 4  
ATOM 8155  H HH21 . ARG A 1 104 ? 3.061   -14.162 5.027   1.00 6.81   ? 104 ARG A HH21 4  
ATOM 8156  H HH22 . ARG A 1 104 ? 2.829   -15.632 4.075   1.00 6.76   ? 104 ARG A HH22 4  
ATOM 8157  N N    . ASP A 1 105 ? -4.327  -11.909 -0.184  1.00 2.05   ? 105 ASP A N    4  
ATOM 8158  C CA   . ASP A 1 105 ? -4.844  -12.613 -1.367  1.00 2.28   ? 105 ASP A CA   4  
ATOM 8159  C C    . ASP A 1 105 ? -3.691  -13.067 -2.284  1.00 1.97   ? 105 ASP A C    4  
ATOM 8160  O O    . ASP A 1 105 ? -3.759  -14.156 -2.850  1.00 2.18   ? 105 ASP A O    4  
ATOM 8161  C CB   . ASP A 1 105 ? -5.741  -11.665 -2.201  1.00 2.61   ? 105 ASP A CB   4  
ATOM 8162  C CG   . ASP A 1 105 ? -7.090  -11.243 -1.598  1.00 3.25   ? 105 ASP A CG   4  
ATOM 8163  O OD1  . ASP A 1 105 ? -7.090  -10.863 -0.393  1.00 3.49   ? 105 ASP A OD1  4  
ATOM 8164  O OD2  . ASP A 1 105 ? -8.085  -11.199 -2.345  1.00 4.30   ? 105 ASP A OD2  4  
ATOM 8165  H H    . ASP A 1 105 ? -4.640  -10.957 -0.094  1.00 1.93   ? 105 ASP A H    4  
ATOM 8166  H HA   . ASP A 1 105 ? -5.418  -13.488 -1.063  1.00 2.94   ? 105 ASP A HA   4  
ATOM 8167  H HB2  . ASP A 1 105 ? -5.175  -10.761 -2.433  1.00 2.95   ? 105 ASP A HB2  4  
ATOM 8168  H HB3  . ASP A 1 105 ? -5.949  -12.165 -3.150  1.00 2.98   ? 105 ASP A HB3  4  
ATOM 8169  N N    . GLY A 1 106 ? -2.641  -12.237 -2.412  1.00 1.83   ? 106 GLY A N    4  
ATOM 8170  C CA   . GLY A 1 106 ? -1.391  -12.570 -3.106  1.00 2.15   ? 106 GLY A CA   4  
ATOM 8171  C C    . GLY A 1 106 ? -0.152  -11.994 -2.419  1.00 2.71   ? 106 GLY A C    4  
ATOM 8172  O O    . GLY A 1 106 ? 0.776   -12.745 -2.124  1.00 3.80   ? 106 GLY A O    4  
ATOM 8173  H H    . GLY A 1 106 ? -2.679  -11.353 -1.913  1.00 1.82   ? 106 GLY A H    4  
ATOM 8174  H HA2  . GLY A 1 106 ? -1.284  -13.651 -3.196  1.00 2.48   ? 106 GLY A HA2  4  
ATOM 8175  H HA3  . GLY A 1 106 ? -1.433  -12.161 -4.117  1.00 2.16   ? 106 GLY A HA3  4  
ATOM 8176  N N    . ASP A 1 107 ? -0.142  -10.679 -2.165  1.00 2.30   ? 107 ASP A N    4  
ATOM 8177  C CA   . ASP A 1 107 ? 0.994   -9.843  -1.767  1.00 2.88   ? 107 ASP A CA   4  
ATOM 8178  C C    . ASP A 1 107 ? 0.530   -8.373  -1.666  1.00 1.88   ? 107 ASP A C    4  
ATOM 8179  O O    . ASP A 1 107 ? -0.514  -7.977  -2.197  1.00 1.88   ? 107 ASP A O    4  
ATOM 8180  C CB   . ASP A 1 107 ? 2.193   -9.962  -2.734  1.00 4.19   ? 107 ASP A CB   4  
ATOM 8181  C CG   . ASP A 1 107 ? 3.186   -11.097 -2.475  1.00 5.98   ? 107 ASP A CG   4  
ATOM 8182  O OD1  . ASP A 1 107 ? 3.851   -11.110 -1.420  1.00 7.23   ? 107 ASP A OD1  4  
ATOM 8183  O OD2  . ASP A 1 107 ? 3.395   -11.908 -3.418  1.00 6.68   ? 107 ASP A OD2  4  
ATOM 8184  H H    . ASP A 1 107 ? -1.028  -10.176 -2.260  1.00 1.89   ? 107 ASP A H    4  
ATOM 8185  H HA   . ASP A 1 107 ? 1.322   -10.153 -0.782  1.00 3.59   ? 107 ASP A HA   4  
ATOM 8186  H HB2  . ASP A 1 107 ? 1.800   -10.069 -3.736  1.00 4.17   ? 107 ASP A HB2  4  
ATOM 8187  H HB3  . ASP A 1 107 ? 2.770   -9.037  -2.689  1.00 4.50   ? 107 ASP A HB3  4  
ATOM 8188  N N    . HIS A 1 108 ? 1.323   -7.540  -0.988  1.00 1.54   ? 108 HIS A N    4  
ATOM 8189  C CA   . HIS A 1 108 ? 0.967   -6.169  -0.634  1.00 1.07   ? 108 HIS A CA   4  
ATOM 8190  C C    . HIS A 1 108 ? 2.176   -5.303  -0.211  1.00 1.04   ? 108 HIS A C    4  
ATOM 8191  O O    . HIS A 1 108 ? 3.324   -5.739  -0.264  1.00 1.26   ? 108 HIS A O    4  
ATOM 8192  C CB   . HIS A 1 108 ? -0.187  -6.195  0.393   1.00 1.54   ? 108 HIS A CB   4  
ATOM 8193  C CG   . HIS A 1 108 ? 0.056   -6.848  1.729   1.00 2.26   ? 108 HIS A CG   4  
ATOM 8194  N ND1  . HIS A 1 108 ? -0.150  -6.250  2.945   1.00 3.91   ? 108 HIS A ND1  4  
ATOM 8195  C CD2  . HIS A 1 108 ? 0.196   -8.191  1.964   1.00 2.55   ? 108 HIS A CD2  4  
ATOM 8196  C CE1  . HIS A 1 108 ? -0.144  -7.205  3.887   1.00 4.50   ? 108 HIS A CE1  4  
ATOM 8197  N NE2  . HIS A 1 108 ? 0.081   -8.411  3.340   1.00 3.58   ? 108 HIS A NE2  4  
ATOM 8198  H H    . HIS A 1 108 ? 2.266   -7.833  -0.788  1.00 1.97   ? 108 HIS A H    4  
ATOM 8199  H HA   . HIS A 1 108 ? 0.587   -5.695  -1.541  1.00 1.39   ? 108 HIS A HA   4  
ATOM 8200  H HB2  . HIS A 1 108 ? -0.558  -5.186  0.563   1.00 1.94   ? 108 HIS A HB2  4  
ATOM 8201  H HB3  . HIS A 1 108 ? -0.995  -6.767  -0.046  1.00 1.58   ? 108 HIS A HB3  4  
ATOM 8202  H HD1  . HIS A 1 108 ? -0.332  -5.259  3.091   1.00 4.86   ? 108 HIS A HD1  4  
ATOM 8203  H HD2  . HIS A 1 108 ? 0.289   -8.959  1.210   1.00 3.00   ? 108 HIS A HD2  4  
ATOM 8204  H HE1  . HIS A 1 108 ? -0.291  -7.028  4.944   1.00 5.87   ? 108 HIS A HE1  4  
ATOM 8205  N N    . VAL A 1 109 ? 1.924   -4.056  0.197   1.00 1.13   ? 109 VAL A N    4  
ATOM 8206  C CA   . VAL A 1 109 ? 2.933   -3.130  0.741   1.00 1.25   ? 109 VAL A CA   4  
ATOM 8207  C C    . VAL A 1 109 ? 3.274   -3.506  2.195   1.00 1.21   ? 109 VAL A C    4  
ATOM 8208  O O    . VAL A 1 109 ? 2.408   -3.931  2.961   1.00 1.25   ? 109 VAL A O    4  
ATOM 8209  C CB   . VAL A 1 109 ? 2.487   -1.654  0.568   1.00 1.56   ? 109 VAL A CB   4  
ATOM 8210  C CG1  . VAL A 1 109 ? 1.079   -1.361  1.116   1.00 2.62   ? 109 VAL A CG1  4  
ATOM 8211  C CG2  . VAL A 1 109 ? 3.493   -0.657  1.168   1.00 1.63   ? 109 VAL A CG2  4  
ATOM 8212  H H    . VAL A 1 109 ? 0.965   -3.765  0.246   1.00 1.37   ? 109 VAL A H    4  
ATOM 8213  H HA   . VAL A 1 109 ? 3.839   -3.253  0.148   1.00 1.28   ? 109 VAL A HA   4  
ATOM 8214  H HB   . VAL A 1 109 ? 2.448   -1.460  -0.506  1.00 2.08   ? 109 VAL A HB   4  
ATOM 8215  H HG11 . VAL A 1 109 ? 0.826   -0.312  0.955   1.00 3.04   ? 109 VAL A HG11 4  
ATOM 8216  H HG12 . VAL A 1 109 ? 0.332   -1.973  0.609   1.00 3.48   ? 109 VAL A HG12 4  
ATOM 8217  H HG13 . VAL A 1 109 ? 1.045   -1.575  2.179   1.00 3.30   ? 109 VAL A HG13 4  
ATOM 8218  H HG21 . VAL A 1 109 ? 3.522   -0.751  2.255   1.00 2.09   ? 109 VAL A HG21 4  
ATOM 8219  H HG22 . VAL A 1 109 ? 4.487   -0.845  0.762   1.00 2.04   ? 109 VAL A HG22 4  
ATOM 8220  H HG23 . VAL A 1 109 ? 3.202   0.363   0.915   1.00 2.44   ? 109 VAL A HG23 4  
ATOM 8221  N N    . MET A 1 110 ? 4.555   -3.400  2.560   1.00 1.34   ? 110 MET A N    4  
ATOM 8222  C CA   . MET A 1 110 ? 5.137   -3.862  3.824   1.00 1.25   ? 110 MET A CA   4  
ATOM 8223  C C    . MET A 1 110 ? 6.252   -2.928  4.280   1.00 1.06   ? 110 MET A C    4  
ATOM 8224  O O    . MET A 1 110 ? 7.208   -2.651  3.556   1.00 0.96   ? 110 MET A O    4  
ATOM 8225  C CB   . MET A 1 110 ? 5.675   -5.299  3.690   1.00 1.37   ? 110 MET A CB   4  
ATOM 8226  C CG   . MET A 1 110 ? 4.625   -6.323  3.241   1.00 2.54   ? 110 MET A CG   4  
ATOM 8227  S SD   . MET A 1 110 ? 5.203   -8.041  3.182   1.00 2.56   ? 110 MET A SD   4  
ATOM 8228  C CE   . MET A 1 110 ? 5.574   -8.335  4.929   1.00 2.71   ? 110 MET A CE   4  
ATOM 8229  H H    . MET A 1 110 ? 5.217   -3.053  1.871   1.00 1.55   ? 110 MET A H    4  
ATOM 8230  H HA   . MET A 1 110 ? 4.380   -3.829  4.593   1.00 1.28   ? 110 MET A HA   4  
ATOM 8231  H HB2  . MET A 1 110 ? 6.491   -5.315  2.969   1.00 1.47   ? 110 MET A HB2  4  
ATOM 8232  H HB3  . MET A 1 110 ? 6.074   -5.597  4.660   1.00 2.04   ? 110 MET A HB3  4  
ATOM 8233  H HG2  . MET A 1 110 ? 3.761   -6.269  3.899   1.00 3.48   ? 110 MET A HG2  4  
ATOM 8234  H HG3  . MET A 1 110 ? 4.292   -6.063  2.235   1.00 3.40   ? 110 MET A HG3  4  
ATOM 8235  H HE1  . MET A 1 110 ? 5.821   -9.387  5.074   1.00 3.26   ? 110 MET A HE1  4  
ATOM 8236  H HE2  . MET A 1 110 ? 6.431   -7.732  5.232   1.00 2.71   ? 110 MET A HE2  4  
ATOM 8237  H HE3  . MET A 1 110 ? 4.714   -8.072  5.542   1.00 3.67   ? 110 MET A HE3  4  
ATOM 8238  N N    . LEU A 1 111 ? 6.132   -2.415  5.501   1.00 1.11   ? 111 LEU A N    4  
ATOM 8239  C CA   . LEU A 1 111 ? 7.023   -1.392  6.022   1.00 1.01   ? 111 LEU A CA   4  
ATOM 8240  C C    . LEU A 1 111 ? 8.005   -2.072  6.992   1.00 1.04   ? 111 LEU A C    4  
ATOM 8241  O O    . LEU A 1 111 ? 7.695   -2.311  8.162   1.00 1.18   ? 111 LEU A O    4  
ATOM 8242  C CB   . LEU A 1 111 ? 6.186   -0.228  6.590   1.00 1.25   ? 111 LEU A CB   4  
ATOM 8243  C CG   . LEU A 1 111 ? 5.221   0.513   5.632   1.00 1.46   ? 111 LEU A CG   4  
ATOM 8244  C CD1  . LEU A 1 111 ? 5.803   0.724   4.225   1.00 2.98   ? 111 LEU A CD1  4  
ATOM 8245  C CD2  . LEU A 1 111 ? 3.837   -0.150  5.531   1.00 2.38   ? 111 LEU A CD2  4  
ATOM 8246  H H    . LEU A 1 111 ? 5.435   -2.802  6.125   1.00 1.22   ? 111 LEU A H    4  
ATOM 8247  H HA   . LEU A 1 111 ? 7.617   -0.986  5.206   1.00 0.89   ? 111 LEU A HA   4  
ATOM 8248  H HB2  . LEU A 1 111 ? 5.614   -0.563  7.443   1.00 1.49   ? 111 LEU A HB2  4  
ATOM 8249  H HB3  . LEU A 1 111 ? 6.878   0.504   6.975   1.00 1.45   ? 111 LEU A HB3  4  
ATOM 8250  H HG   . LEU A 1 111 ? 5.054   1.498   6.069   1.00 2.44   ? 111 LEU A HG   4  
ATOM 8251  H HD11 . LEU A 1 111 ? 5.783   -0.207  3.657   1.00 3.66   ? 111 LEU A HD11 4  
ATOM 8252  H HD12 . LEU A 1 111 ? 5.212   1.468   3.693   1.00 3.93   ? 111 LEU A HD12 4  
ATOM 8253  H HD13 . LEU A 1 111 ? 6.834   1.068   4.299   1.00 3.77   ? 111 LEU A HD13 4  
ATOM 8254  H HD21 . LEU A 1 111 ? 3.163   0.500   4.974   1.00 3.28   ? 111 LEU A HD21 4  
ATOM 8255  H HD22 . LEU A 1 111 ? 3.896   -1.108  5.018   1.00 3.20   ? 111 LEU A HD22 4  
ATOM 8256  H HD23 . LEU A 1 111 ? 3.423   -0.303  6.529   1.00 2.98   ? 111 LEU A HD23 4  
ATOM 8257  N N    . MET A 1 112 ? 9.162   -2.464  6.445   1.00 0.99   ? 112 MET A N    4  
ATOM 8258  C CA   . MET A 1 112 ? 10.131  -3.369  7.060   1.00 1.06   ? 112 MET A CA   4  
ATOM 8259  C C    . MET A 1 112 ? 11.371  -2.615  7.551   1.00 0.89   ? 112 MET A C    4  
ATOM 8260  O O    . MET A 1 112 ? 11.786  -1.600  6.988   1.00 0.92   ? 112 MET A O    4  
ATOM 8261  C CB   . MET A 1 112 ? 10.448  -4.485  6.058   1.00 1.41   ? 112 MET A CB   4  
ATOM 8262  C CG   . MET A 1 112 ? 11.327  -5.607  6.627   1.00 1.59   ? 112 MET A CG   4  
ATOM 8263  S SD   . MET A 1 112 ? 11.546  -6.950  5.436   1.00 2.69   ? 112 MET A SD   4  
ATOM 8264  C CE   . MET A 1 112 ? 12.857  -7.863  6.276   1.00 2.44   ? 112 MET A CE   4  
ATOM 8265  H H    . MET A 1 112 ? 9.369   -2.199  5.491   1.00 0.96   ? 112 MET A H    4  
ATOM 8266  H HA   . MET A 1 112 ? 9.673   -3.828  7.927   1.00 1.19   ? 112 MET A HA   4  
ATOM 8267  H HB2  . MET A 1 112 ? 9.500   -4.929  5.719   1.00 1.72   ? 112 MET A HB2  4  
ATOM 8268  H HB3  . MET A 1 112 ? 10.955  -4.049  5.197   1.00 1.50   ? 112 MET A HB3  4  
ATOM 8269  H HG2  . MET A 1 112 ? 12.316  -5.209  6.868   1.00 1.47   ? 112 MET A HG2  4  
ATOM 8270  H HG3  . MET A 1 112 ? 10.867  -6.024  7.528   1.00 2.05   ? 112 MET A HG3  4  
ATOM 8271  H HE1  . MET A 1 112 ? 13.736  -7.229  6.369   1.00 2.39   ? 112 MET A HE1  4  
ATOM 8272  H HE2  . MET A 1 112 ? 12.507  -8.164  7.264   1.00 3.21   ? 112 MET A HE2  4  
ATOM 8273  H HE3  . MET A 1 112 ? 13.114  -8.752  5.693   1.00 2.95   ? 112 MET A HE3  4  
ATOM 8274  N N    . GLY A 1 113 ? 11.940  -3.068  8.672   1.00 0.90   ? 113 GLY A N    4  
ATOM 8275  C CA   . GLY A 1 113 ? 12.957  -2.305  9.399   1.00 1.03   ? 113 GLY A CA   4  
ATOM 8276  C C    . GLY A 1 113 ? 12.324  -1.073  10.046  1.00 1.05   ? 113 GLY A C    4  
ATOM 8277  O O    . GLY A 1 113 ? 12.859  0.023   9.954   1.00 1.38   ? 113 GLY A O    4  
ATOM 8278  H H    . GLY A 1 113 ? 11.562  -3.895  9.129   1.00 0.91   ? 113 GLY A H    4  
ATOM 8279  H HA2  . GLY A 1 113 ? 13.382  -2.919  10.189  1.00 1.14   ? 113 GLY A HA2  4  
ATOM 8280  H HA3  . GLY A 1 113 ? 13.757  -1.978  8.731   1.00 1.12   ? 113 GLY A HA3  4  
ATOM 8281  N N    . LEU A 1 114 ? 11.137  -1.228  10.624  1.00 0.99   ? 114 LEU A N    4  
ATOM 8282  C CA   . LEU A 1 114 ? 10.431  -0.166  11.316  1.00 1.08   ? 114 LEU A CA   4  
ATOM 8283  C C    . LEU A 1 114 ? 11.159  0.215   12.625  1.00 1.31   ? 114 LEU A C    4  
ATOM 8284  O O    . LEU A 1 114 ? 11.913  -0.556  13.205  1.00 2.30   ? 114 LEU A O    4  
ATOM 8285  C CB   . LEU A 1 114 ? 8.963   -0.569  11.557  1.00 1.45   ? 114 LEU A CB   4  
ATOM 8286  C CG   . LEU A 1 114 ? 8.007   0.636   11.533  1.00 1.90   ? 114 LEU A CG   4  
ATOM 8287  C CD1  . LEU A 1 114 ? 7.635   1.019   10.098  1.00 2.66   ? 114 LEU A CD1  4  
ATOM 8288  C CD2  . LEU A 1 114 ? 6.765   0.393   12.385  1.00 2.75   ? 114 LEU A CD2  4  
ATOM 8289  H H    . LEU A 1 114 ? 10.756  -2.173  10.663  1.00 1.08   ? 114 LEU A H    4  
ATOM 8290  H HA   . LEU A 1 114 ? 10.443  0.729   10.679  1.00 1.40   ? 114 LEU A HA   4  
ATOM 8291  H HB2  . LEU A 1 114 ? 8.645   -1.285  10.800  1.00 1.92   ? 114 LEU A HB2  4  
ATOM 8292  H HB3  . LEU A 1 114 ? 8.896   -1.095  12.509  1.00 1.70   ? 114 LEU A HB3  4  
ATOM 8293  H HG   . LEU A 1 114 ? 8.514   1.486   11.971  1.00 1.89   ? 114 LEU A HG   4  
ATOM 8294  H HD11 . LEU A 1 114 ? 7.019   1.915   10.117  1.00 3.06   ? 114 LEU A HD11 4  
ATOM 8295  H HD12 . LEU A 1 114 ? 8.528   1.213   9.501   1.00 3.40   ? 114 LEU A HD12 4  
ATOM 8296  H HD13 . LEU A 1 114 ? 7.060   0.211   9.648   1.00 3.36   ? 114 LEU A HD13 4  
ATOM 8297  H HD21 . LEU A 1 114 ? 6.138   1.286   12.364  1.00 3.47   ? 114 LEU A HD21 4  
ATOM 8298  H HD22 . LEU A 1 114 ? 6.217   -0.438  11.955  1.00 3.34   ? 114 LEU A HD22 4  
ATOM 8299  H HD23 . LEU A 1 114 ? 7.055   0.151   13.414  1.00 2.94   ? 114 LEU A HD23 4  
ATOM 8300  N N    . LYS A 1 115 ? 10.890  1.441   13.073  1.00 0.95   ? 115 LYS A N    4  
ATOM 8301  C CA   . LYS A 1 115 ? 11.631  2.182   14.099  1.00 1.41   ? 115 LYS A CA   4  
ATOM 8302  C C    . LYS A 1 115 ? 10.740  2.873   15.160  1.00 1.56   ? 115 LYS A C    4  
ATOM 8303  O O    . LYS A 1 115 ? 11.257  3.197   16.229  1.00 2.25   ? 115 LYS A O    4  
ATOM 8304  C CB   . LYS A 1 115 ? 12.586  3.183   13.397  1.00 1.82   ? 115 LYS A CB   4  
ATOM 8305  C CG   . LYS A 1 115 ? 11.930  4.002   12.269  1.00 2.02   ? 115 LYS A CG   4  
ATOM 8306  C CD   . LYS A 1 115 ? 12.884  5.006   11.610  1.00 2.47   ? 115 LYS A CD   4  
ATOM 8307  C CE   . LYS A 1 115 ? 12.145  5.604   10.404  1.00 2.96   ? 115 LYS A CE   4  
ATOM 8308  N NZ   . LYS A 1 115 ? 12.865  6.730   9.765   1.00 3.81   ? 115 LYS A NZ   4  
ATOM 8309  H H    . LYS A 1 115 ? 10.247  1.957   12.498  1.00 1.12   ? 115 LYS A H    4  
ATOM 8310  H HA   . LYS A 1 115 ? 12.262  1.477   14.657  1.00 1.77   ? 115 LYS A HA   4  
ATOM 8311  H HB2  . LYS A 1 115 ? 13.008  3.863   14.141  1.00 2.44   ? 115 LYS A HB2  4  
ATOM 8312  H HB3  . LYS A 1 115 ? 13.412  2.614   12.962  1.00 2.42   ? 115 LYS A HB3  4  
ATOM 8313  H HG2  . LYS A 1 115 ? 11.595  3.320   11.489  1.00 2.18   ? 115 LYS A HG2  4  
ATOM 8314  H HG3  . LYS A 1 115 ? 11.066  4.537   12.668  1.00 2.58   ? 115 LYS A HG3  4  
ATOM 8315  H HD2  . LYS A 1 115 ? 13.123  5.791   12.322  1.00 3.08   ? 115 LYS A HD2  4  
ATOM 8316  H HD3  . LYS A 1 115 ? 13.810  4.507   11.308  1.00 2.83   ? 115 LYS A HD3  4  
ATOM 8317  H HE2  . LYS A 1 115 ? 12.040  4.822   9.660   1.00 3.12   ? 115 LYS A HE2  4  
ATOM 8318  H HE3  . LYS A 1 115 ? 11.135  5.923   10.741  1.00 3.30   ? 115 LYS A HE3  4  
ATOM 8319  H HZ1  . LYS A 1 115 ? 12.367  7.031   8.929   1.00 4.63   ? 115 LYS A HZ1  4  
ATOM 8320  H HZ2  . LYS A 1 115 ? 12.767  7.504   10.398  1.00 4.21   ? 115 LYS A HZ2  4  
ATOM 8321  H HZ3  . LYS A 1 115 ? 13.856  6.566   9.598   1.00 3.88   ? 115 LYS A HZ3  4  
ATOM 8322  N N    . ARG A 1 116 ? 9.420   3.006   14.930  1.00 1.25   ? 116 ARG A N    4  
ATOM 8323  C CA   . ARG A 1 116 ? 8.441   3.446   15.941  1.00 1.48   ? 116 ARG A CA   4  
ATOM 8324  C C    . ARG A 1 116 ? 7.098   2.674   15.802  1.00 1.11   ? 116 ARG A C    4  
ATOM 8325  O O    . ARG A 1 116 ? 6.401   2.863   14.806  1.00 1.08   ? 116 ARG A O    4  
ATOM 8326  C CB   . ARG A 1 116 ? 8.290   4.987   15.933  1.00 2.00   ? 116 ARG A CB   4  
ATOM 8327  C CG   . ARG A 1 116 ? 7.848   5.654   14.613  1.00 3.21   ? 116 ARG A CG   4  
ATOM 8328  C CD   . ARG A 1 116 ? 7.819   7.195   14.702  1.00 3.63   ? 116 ARG A CD   4  
ATOM 8329  N NE   . ARG A 1 116 ? 9.165   7.804   14.649  1.00 4.63   ? 116 ARG A NE   4  
ATOM 8330  C CZ   . ARG A 1 116 ? 9.876   8.296   15.658  1.00 5.12   ? 116 ARG A CZ   4  
ATOM 8331  N NH1  . ARG A 1 116 ? 9.377   8.530   16.853  1.00 4.96   ? 116 ARG A NH1  4  
ATOM 8332  N NH2  . ARG A 1 116 ? 11.129  8.626   15.437  1.00 6.47   ? 116 ARG A NH2  4  
ATOM 8333  H H    . ARG A 1 116 ? 9.067   2.715   14.029  1.00 1.21   ? 116 ARG A H    4  
ATOM 8334  H HA   . ARG A 1 116 ? 8.863   3.217   16.919  1.00 1.83   ? 116 ARG A HA   4  
ATOM 8335  H HB2  . ARG A 1 116 ? 7.580   5.260   16.713  1.00 2.46   ? 116 ARG A HB2  4  
ATOM 8336  H HB3  . ARG A 1 116 ? 9.251   5.411   16.226  1.00 3.11   ? 116 ARG A HB3  4  
ATOM 8337  H HG2  . ARG A 1 116 ? 8.521   5.360   13.807  1.00 4.34   ? 116 ARG A HG2  4  
ATOM 8338  H HG3  . ARG A 1 116 ? 6.837   5.320   14.370  1.00 3.84   ? 116 ARG A HG3  4  
ATOM 8339  H HD2  . ARG A 1 116 ? 7.264   7.571   13.843  1.00 4.21   ? 116 ARG A HD2  4  
ATOM 8340  H HD3  . ARG A 1 116 ? 7.284   7.504   15.597  1.00 3.46   ? 116 ARG A HD3  4  
ATOM 8341  H HE   . ARG A 1 116 ? 9.641   7.803   13.751  1.00 5.52   ? 116 ARG A HE   4  
ATOM 8342  H HH11 . ARG A 1 116 ? 8.380   8.560   17.004  1.00 4.54   ? 116 ARG A HH11 4  
ATOM 8343  H HH12 . ARG A 1 116 ? 9.981   8.893   17.581  1.00 5.80   ? 116 ARG A HH12 4  
ATOM 8344  H HH21 . ARG A 1 116 ? 11.489  8.580   14.482  1.00 7.17   ? 116 ARG A HH21 4  
ATOM 8345  H HH22 . ARG A 1 116 ? 11.727  8.944   16.182  1.00 7.09   ? 116 ARG A HH22 4  
ATOM 8346  N N    . PRO A 1 117 ? 6.752   1.757   16.735  1.00 1.35   ? 117 PRO A N    4  
ATOM 8347  C CA   . PRO A 1 117 ? 5.597   0.857   16.616  1.00 1.38   ? 117 PRO A CA   4  
ATOM 8348  C C    . PRO A 1 117 ? 4.300   1.556   17.040  1.00 1.20   ? 117 PRO A C    4  
ATOM 8349  O O    . PRO A 1 117 ? 4.319   2.367   17.966  1.00 1.67   ? 117 PRO A O    4  
ATOM 8350  C CB   . PRO A 1 117 ? 5.916   -0.342  17.516  1.00 2.21   ? 117 PRO A CB   4  
ATOM 8351  C CG   . PRO A 1 117 ? 6.761   0.286   18.626  1.00 2.55   ? 117 PRO A CG   4  
ATOM 8352  C CD   . PRO A 1 117 ? 7.548   1.372   17.894  1.00 2.06   ? 117 PRO A CD   4  
ATOM 8353  H HA   . PRO A 1 117 ? 5.494   0.510   15.587  1.00 1.39   ? 117 PRO A HA   4  
ATOM 8354  H HB2  . PRO A 1 117 ? 5.013   -0.818  17.908  1.00 2.42   ? 117 PRO A HB2  4  
ATOM 8355  H HB3  . PRO A 1 117 ? 6.516   -1.067  16.959  1.00 2.50   ? 117 PRO A HB3  4  
ATOM 8356  H HG2  . PRO A 1 117 ? 6.107   0.742   19.375  1.00 2.69   ? 117 PRO A HG2  4  
ATOM 8357  H HG3  . PRO A 1 117 ? 7.427   -0.441  19.090  1.00 3.13   ? 117 PRO A HG3  4  
ATOM 8358  H HD2  . PRO A 1 117 ? 7.704   2.221   18.557  1.00 2.28   ? 117 PRO A HD2  4  
ATOM 8359  H HD3  . PRO A 1 117 ? 8.510   0.971   17.575  1.00 2.22   ? 117 PRO A HD3  4  
ATOM 8360  N N    . LEU A 1 118 ? 3.184   1.236   16.368  1.00 1.00   ? 118 LEU A N    4  
ATOM 8361  C CA   . LEU A 1 118 ? 1.945   2.035   16.388  1.00 0.95   ? 118 LEU A CA   4  
ATOM 8362  C C    . LEU A 1 118 ? 0.688   1.258   16.838  1.00 0.98   ? 118 LEU A C    4  
ATOM 8363  O O    . LEU A 1 118 ? 0.654   0.018   16.850  1.00 1.20   ? 118 LEU A O    4  
ATOM 8364  C CB   . LEU A 1 118 ? 1.719   2.616   14.976  1.00 1.14   ? 118 LEU A CB   4  
ATOM 8365  C CG   . LEU A 1 118 ? 2.910   3.380   14.359  1.00 1.46   ? 118 LEU A CG   4  
ATOM 8366  C CD1  . LEU A 1 118 ? 2.515   3.855   12.958  1.00 2.52   ? 118 LEU A CD1  4  
ATOM 8367  C CD2  . LEU A 1 118 ? 3.348   4.594   15.193  1.00 2.42   ? 118 LEU A CD2  4  
ATOM 8368  H H    . LEU A 1 118 ? 3.232   0.502   15.673  1.00 1.24   ? 118 LEU A H    4  
ATOM 8369  H HA   . LEU A 1 118 ? 2.054   2.877   17.080  1.00 1.14   ? 118 LEU A HA   4  
ATOM 8370  H HB2  . LEU A 1 118 ? 1.450   1.798   14.304  1.00 1.35   ? 118 LEU A HB2  4  
ATOM 8371  H HB3  . LEU A 1 118 ? 0.870   3.299   15.027  1.00 1.48   ? 118 LEU A HB3  4  
ATOM 8372  H HG   . LEU A 1 118 ? 3.759   2.703   14.254  1.00 1.38   ? 118 LEU A HG   4  
ATOM 8373  H HD11 . LEU A 1 118 ? 1.661   4.529   13.027  1.00 3.72   ? 118 LEU A HD11 4  
ATOM 8374  H HD12 . LEU A 1 118 ? 3.352   4.378   12.497  1.00 3.22   ? 118 LEU A HD12 4  
ATOM 8375  H HD13 . LEU A 1 118 ? 2.249   3.000   12.335  1.00 2.53   ? 118 LEU A HD13 4  
ATOM 8376  H HD21 . LEU A 1 118 ? 3.673   4.283   16.184  1.00 3.33   ? 118 LEU A HD21 4  
ATOM 8377  H HD22 . LEU A 1 118 ? 4.181   5.096   14.703  1.00 3.03   ? 118 LEU A HD22 4  
ATOM 8378  H HD23 . LEU A 1 118 ? 2.522   5.298   15.295  1.00 2.86   ? 118 LEU A HD23 4  
ATOM 8379  N N    . LYS A 1 119 ? -0.370  2.014   17.165  1.00 0.96   ? 119 LYS A N    4  
ATOM 8380  C CA   . LYS A 1 119 ? -1.711  1.558   17.577  1.00 1.04   ? 119 LYS A CA   4  
ATOM 8381  C C    . LYS A 1 119 ? -2.810  1.992   16.577  1.00 1.17   ? 119 LYS A C    4  
ATOM 8382  O O    . LYS A 1 119 ? -2.668  2.997   15.898  1.00 1.37   ? 119 LYS A O    4  
ATOM 8383  C CB   . LYS A 1 119 ? -1.992  2.098   19.002  1.00 1.26   ? 119 LYS A CB   4  
ATOM 8384  C CG   . LYS A 1 119 ? -2.214  3.625   19.037  1.00 2.43   ? 119 LYS A CG   4  
ATOM 8385  C CD   . LYS A 1 119 ? -1.902  4.283   20.390  1.00 3.00   ? 119 LYS A CD   4  
ATOM 8386  C CE   . LYS A 1 119 ? -1.770  5.803   20.183  1.00 4.92   ? 119 LYS A CE   4  
ATOM 8387  N NZ   . LYS A 1 119 ? -1.199  6.479   21.371  1.00 5.94   ? 119 LYS A NZ   4  
ATOM 8388  H H    . LYS A 1 119 ? -0.227  3.023   17.104  1.00 1.04   ? 119 LYS A H    4  
ATOM 8389  H HA   . LYS A 1 119 ? -1.706  0.467   17.621  1.00 1.26   ? 119 LYS A HA   4  
ATOM 8390  H HB2  . LYS A 1 119 ? -2.869  1.603   19.420  1.00 2.15   ? 119 LYS A HB2  4  
ATOM 8391  H HB3  . LYS A 1 119 ? -1.138  1.843   19.632  1.00 1.97   ? 119 LYS A HB3  4  
ATOM 8392  H HG2  . LYS A 1 119 ? -1.560  4.077   18.302  1.00 3.21   ? 119 LYS A HG2  4  
ATOM 8393  H HG3  . LYS A 1 119 ? -3.244  3.851   18.754  1.00 3.29   ? 119 LYS A HG3  4  
ATOM 8394  H HD2  . LYS A 1 119 ? -2.689  4.062   21.112  1.00 3.39   ? 119 LYS A HD2  4  
ATOM 8395  H HD3  . LYS A 1 119 ? -0.957  3.890   20.768  1.00 2.66   ? 119 LYS A HD3  4  
ATOM 8396  H HE2  . LYS A 1 119 ? -1.108  5.980   19.327  1.00 5.43   ? 119 LYS A HE2  4  
ATOM 8397  H HE3  . LYS A 1 119 ? -2.750  6.225   19.946  1.00 5.64   ? 119 LYS A HE3  4  
ATOM 8398  H HZ1  . LYS A 1 119 ? -0.287  6.096   21.581  1.00 6.34   ? 119 LYS A HZ1  4  
ATOM 8399  H HZ2  . LYS A 1 119 ? -1.062  7.469   21.192  1.00 6.88   ? 119 LYS A HZ2  4  
ATOM 8400  H HZ3  . LYS A 1 119 ? -1.811  6.385   22.178  1.00 5.87   ? 119 LYS A HZ3  4  
ATOM 8401  N N    . VAL A 1 120 ? -3.944  1.284   16.543  1.00 1.42   ? 120 VAL A N    4  
ATOM 8402  C CA   . VAL A 1 120 ? -5.081  1.437   15.591  1.00 1.84   ? 120 VAL A CA   4  
ATOM 8403  C C    . VAL A 1 120 ? -5.385  2.888   15.162  1.00 2.14   ? 120 VAL A C    4  
ATOM 8404  O O    . VAL A 1 120 ? -4.985  3.330   14.092  1.00 3.21   ? 120 VAL A O    4  
ATOM 8405  C CB   . VAL A 1 120 ? -6.337  0.655   16.077  1.00 2.26   ? 120 VAL A CB   4  
ATOM 8406  C CG1  . VAL A 1 120 ? -6.688  0.861   17.563  1.00 2.52   ? 120 VAL A CG1  4  
ATOM 8407  C CG2  . VAL A 1 120 ? -7.593  0.901   15.218  1.00 3.51   ? 120 VAL A CG2  4  
ATOM 8408  H H    . VAL A 1 120 ? -4.011  0.547   17.223  1.00 1.54   ? 120 VAL A H    4  
ATOM 8409  H HA   . VAL A 1 120 ? -4.768  0.939   14.679  1.00 1.89   ? 120 VAL A HA   4  
ATOM 8410  H HB   . VAL A 1 120 ? -6.081  -0.401  15.966  1.00 2.26   ? 120 VAL A HB   4  
ATOM 8411  H HG11 . VAL A 1 120 ? -7.543  0.236   17.825  1.00 2.73   ? 120 VAL A HG11 4  
ATOM 8412  H HG12 . VAL A 1 120 ? -5.851  0.568   18.198  1.00 2.73   ? 120 VAL A HG12 4  
ATOM 8413  H HG13 . VAL A 1 120 ? -6.946  1.898   17.769  1.00 3.55   ? 120 VAL A HG13 4  
ATOM 8414  H HG21 . VAL A 1 120 ? -8.023  1.881   15.429  1.00 4.49   ? 120 VAL A HG21 4  
ATOM 8415  H HG22 . VAL A 1 120 ? -7.348  0.850   14.160  1.00 4.25   ? 120 VAL A HG22 4  
ATOM 8416  H HG23 . VAL A 1 120 ? -8.345  0.141   15.440  1.00 3.56   ? 120 VAL A HG23 4  
ATOM 8417  N N    . GLY A 1 121 ? -6.061  3.660   16.000  1.00 1.81   ? 121 GLY A N    4  
ATOM 8418  C CA   . GLY A 1 121 ? -6.529  5.013   15.670  1.00 2.03   ? 121 GLY A CA   4  
ATOM 8419  C C    . GLY A 1 121 ? -5.447  6.062   15.357  1.00 1.87   ? 121 GLY A C    4  
ATOM 8420  O O    . GLY A 1 121 ? -5.792  7.195   15.039  1.00 2.11   ? 121 GLY A O    4  
ATOM 8421  H H    . GLY A 1 121 ? -6.470  3.185   16.785  1.00 2.07   ? 121 GLY A H    4  
ATOM 8422  H HA2  . GLY A 1 121 ? -7.169  4.958   14.789  1.00 2.21   ? 121 GLY A HA2  4  
ATOM 8423  H HA3  . GLY A 1 121 ? -7.115  5.375   16.508  1.00 2.24   ? 121 GLY A HA3  4  
ATOM 8424  N N    . GLU A 1 122 ? -4.159  5.721   15.431  1.00 1.63   ? 122 GLU A N    4  
ATOM 8425  C CA   . GLU A 1 122 ? -3.021  6.593   15.127  1.00 1.47   ? 122 GLU A CA   4  
ATOM 8426  C C    . GLU A 1 122 ? -2.918  6.936   13.625  1.00 1.44   ? 122 GLU A C    4  
ATOM 8427  O O    . GLU A 1 122 ? -3.388  6.186   12.760  1.00 1.52   ? 122 GLU A O    4  
ATOM 8428  C CB   . GLU A 1 122 ? -1.769  5.869   15.659  1.00 1.27   ? 122 GLU A CB   4  
ATOM 8429  C CG   . GLU A 1 122 ? -0.499  6.701   15.837  1.00 1.30   ? 122 GLU A CG   4  
ATOM 8430  C CD   . GLU A 1 122 ? 0.341   6.182   17.015  1.00 1.34   ? 122 GLU A CD   4  
ATOM 8431  O OE1  . GLU A 1 122 ? 0.474   4.952   17.228  1.00 2.13   ? 122 GLU A OE1  4  
ATOM 8432  O OE2  . GLU A 1 122 ? 0.803   7.032   17.806  1.00 2.35   ? 122 GLU A OE2  4  
ATOM 8433  H H    . GLU A 1 122 ? -3.942  4.743   15.557  1.00 1.59   ? 122 GLU A H    4  
ATOM 8434  H HA   . GLU A 1 122 ? -3.147  7.520   15.688  1.00 1.71   ? 122 GLU A HA   4  
ATOM 8435  H HB2  . GLU A 1 122 ? -2.037  5.485   16.643  1.00 1.45   ? 122 GLU A HB2  4  
ATOM 8436  H HB3  . GLU A 1 122 ? -1.532  5.029   15.006  1.00 1.24   ? 122 GLU A HB3  4  
ATOM 8437  H HG2  . GLU A 1 122 ? 0.088   6.668   14.919  1.00 1.36   ? 122 GLU A HG2  4  
ATOM 8438  H HG3  . GLU A 1 122 ? -0.776  7.740   16.036  1.00 1.58   ? 122 GLU A HG3  4  
ATOM 8439  N N    . THR A 1 123 ? -2.298  8.087   13.324  1.00 1.53   ? 123 THR A N    4  
ATOM 8440  C CA   . THR A 1 123 ? -1.998  8.586   11.968  1.00 1.66   ? 123 THR A CA   4  
ATOM 8441  C C    . THR A 1 123 ? -0.568  8.225   11.586  1.00 1.28   ? 123 THR A C    4  
ATOM 8442  O O    . THR A 1 123 ? 0.341   8.510   12.359  1.00 1.41   ? 123 THR A O    4  
ATOM 8443  C CB   . THR A 1 123 ? -2.143  10.115  11.902  1.00 2.27   ? 123 THR A CB   4  
ATOM 8444  O OG1  . THR A 1 123 ? -1.280  10.725  12.841  1.00 3.60   ? 123 THR A OG1  4  
ATOM 8445  C CG2  . THR A 1 123 ? -3.569  10.588  12.183  1.00 2.73   ? 123 THR A CG2  4  
ATOM 8446  H H    . THR A 1 123 ? -1.962  8.644   14.094  1.00 1.59   ? 123 THR A H    4  
ATOM 8447  H HA   . THR A 1 123 ? -2.690  8.132   11.254  1.00 1.83   ? 123 THR A HA   4  
ATOM 8448  H HB   . THR A 1 123 ? -1.860  10.452  10.905  1.00 2.85   ? 123 THR A HB   4  
ATOM 8449  H HG1  . THR A 1 123 ? -0.462  10.202  12.870  1.00 4.26   ? 123 THR A HG1  4  
ATOM 8450  H HG21 . THR A 1 123 ? -3.625  11.671  12.062  1.00 3.44   ? 123 THR A HG21 4  
ATOM 8451  H HG22 . THR A 1 123 ? -4.256  10.117  11.481  1.00 3.09   ? 123 THR A HG22 4  
ATOM 8452  H HG23 . THR A 1 123 ? -3.860  10.330  13.202  1.00 3.66   ? 123 THR A HG23 4  
ATOM 8453  N N    . VAL A 1 124 ? -0.350  7.695   10.389  1.00 1.00   ? 124 VAL A N    4  
ATOM 8454  C CA   . VAL A 1 124 ? 0.977   7.316   9.876   1.00 0.92   ? 124 VAL A CA   4  
ATOM 8455  C C    . VAL A 1 124 ? 1.161   7.799   8.435   1.00 0.96   ? 124 VAL A C    4  
ATOM 8456  O O    . VAL A 1 124 ? 0.221   7.819   7.649   1.00 1.10   ? 124 VAL A O    4  
ATOM 8457  C CB   . VAL A 1 124 ? 1.219   5.799   10.052  1.00 1.10   ? 124 VAL A CB   4  
ATOM 8458  C CG1  . VAL A 1 124 ? 0.221   4.912   9.295   1.00 1.96   ? 124 VAL A CG1  4  
ATOM 8459  C CG2  . VAL A 1 124 ? 2.654   5.383   9.689   1.00 2.35   ? 124 VAL A CG2  4  
ATOM 8460  H H    . VAL A 1 124 ? -1.167  7.491   9.808   1.00 0.98   ? 124 VAL A H    4  
ATOM 8461  H HA   . VAL A 1 124 ? 1.730   7.829   10.479  1.00 1.03   ? 124 VAL A HA   4  
ATOM 8462  H HB   . VAL A 1 124 ? 1.083   5.589   11.111  1.00 2.01   ? 124 VAL A HB   4  
ATOM 8463  H HG11 . VAL A 1 124 ? 0.321   3.890   9.653   1.00 2.80   ? 124 VAL A HG11 4  
ATOM 8464  H HG12 . VAL A 1 124 ? -0.803  5.233   9.480   1.00 2.96   ? 124 VAL A HG12 4  
ATOM 8465  H HG13 . VAL A 1 124 ? 0.430   4.937   8.227   1.00 2.55   ? 124 VAL A HG13 4  
ATOM 8466  H HG21 . VAL A 1 124 ? 2.845   5.539   8.626   1.00 3.14   ? 124 VAL A HG21 4  
ATOM 8467  H HG22 . VAL A 1 124 ? 3.360   5.968   10.277  1.00 3.45   ? 124 VAL A HG22 4  
ATOM 8468  H HG23 . VAL A 1 124 ? 2.802   4.327   9.918   1.00 2.96   ? 124 VAL A HG23 4  
ATOM 8469  N N    . ASN A 1 125 ? 2.370   8.251   8.106   1.00 1.01   ? 125 ASN A N    4  
ATOM 8470  C CA   . ASN A 1 125 ? 2.660   9.019   6.896   1.00 1.02   ? 125 ASN A CA   4  
ATOM 8471  C C    . ASN A 1 125 ? 3.146   8.110   5.752   1.00 1.02   ? 125 ASN A C    4  
ATOM 8472  O O    . ASN A 1 125 ? 4.211   7.485   5.820   1.00 1.17   ? 125 ASN A O    4  
ATOM 8473  C CB   . ASN A 1 125 ? 3.655   10.141  7.247   1.00 1.09   ? 125 ASN A CB   4  
ATOM 8474  C CG   . ASN A 1 125 ? 3.187   10.958  8.448   1.00 1.30   ? 125 ASN A CG   4  
ATOM 8475  O OD1  . ASN A 1 125 ? 3.355   10.563  9.594   1.00 2.34   ? 125 ASN A OD1  4  
ATOM 8476  N ND2  . ASN A 1 125 ? 2.532   12.076  8.212   1.00 1.91   ? 125 ASN A ND2  4  
ATOM 8477  H H    . ASN A 1 125 ? 3.095   8.223   8.809   1.00 1.00   ? 125 ASN A H    4  
ATOM 8478  H HA   . ASN A 1 125 ? 1.738   9.503   6.576   1.00 1.07   ? 125 ASN A HA   4  
ATOM 8479  H HB2  . ASN A 1 125 ? 4.622   9.719   7.499   1.00 1.17   ? 125 ASN A HB2  4  
ATOM 8480  H HB3  . ASN A 1 125 ? 3.776   10.794  6.379   1.00 1.17   ? 125 ASN A HB3  4  
ATOM 8481  H HD21 . ASN A 1 125 ? 2.392   12.402  7.268   1.00 2.99   ? 125 ASN A HD21 4  
ATOM 8482  H HD22 . ASN A 1 125 ? 2.196   12.590  9.008   1.00 1.94   ? 125 ASN A HD22 4  
ATOM 8483  N N    . ILE A 1 126 ? 2.344   8.025   4.686   1.00 1.05   ? 126 ILE A N    4  
ATOM 8484  C CA   . ILE A 1 126 ? 2.591   7.237   3.468   1.00 1.05   ? 126 ILE A CA   4  
ATOM 8485  C C    . ILE A 1 126 ? 2.765   8.188   2.270   1.00 1.01   ? 126 ILE A C    4  
ATOM 8486  O O    . ILE A 1 126 ? 2.074   9.210   2.181   1.00 1.08   ? 126 ILE A O    4  
ATOM 8487  C CB   . ILE A 1 126 ? 1.450   6.192   3.302   1.00 1.12   ? 126 ILE A CB   4  
ATOM 8488  C CG1  . ILE A 1 126 ? 1.809   5.023   2.364   1.00 1.91   ? 126 ILE A CG1  4  
ATOM 8489  C CG2  . ILE A 1 126 ? 0.091   6.802   2.920   1.00 1.16   ? 126 ILE A CG2  4  
ATOM 8490  C CD1  . ILE A 1 126 ? 1.581   5.258   0.866   1.00 2.82   ? 126 ILE A CD1  4  
ATOM 8491  H H    . ILE A 1 126 ? 1.516   8.613   4.683   1.00 1.16   ? 126 ILE A H    4  
ATOM 8492  H HA   . ILE A 1 126 ? 3.531   6.692   3.583   1.00 1.05   ? 126 ILE A HA   4  
ATOM 8493  H HB   . ILE A 1 126 ? 1.317   5.734   4.285   1.00 1.76   ? 126 ILE A HB   4  
ATOM 8494  H HG12 . ILE A 1 126 ? 2.844   4.738   2.534   1.00 2.74   ? 126 ILE A HG12 4  
ATOM 8495  H HG13 . ILE A 1 126 ? 1.206   4.160   2.649   1.00 2.07   ? 126 ILE A HG13 4  
ATOM 8496  H HG21 . ILE A 1 126 ? -0.256  7.468   3.705   1.00 2.03   ? 126 ILE A HG21 4  
ATOM 8497  H HG22 . ILE A 1 126 ? 0.168   7.352   1.985   1.00 1.83   ? 126 ILE A HG22 4  
ATOM 8498  H HG23 . ILE A 1 126 ? -0.646  6.014   2.788   1.00 2.17   ? 126 ILE A HG23 4  
ATOM 8499  H HD11 . ILE A 1 126 ? 0.546   5.032   0.615   1.00 3.40   ? 126 ILE A HD11 4  
ATOM 8500  H HD12 . ILE A 1 126 ? 1.787   6.285   0.584   1.00 3.77   ? 126 ILE A HD12 4  
ATOM 8501  H HD13 . ILE A 1 126 ? 2.238   4.611   0.297   1.00 3.31   ? 126 ILE A HD13 4  
ATOM 8502  N N    . THR A 1 127 ? 3.693   7.852   1.362   1.00 0.98   ? 127 THR A N    4  
ATOM 8503  C CA   . THR A 1 127 ? 4.029   8.613   0.149   1.00 0.96   ? 127 THR A CA   4  
ATOM 8504  C C    . THR A 1 127 ? 3.621   7.817   -1.101  1.00 0.96   ? 127 THR A C    4  
ATOM 8505  O O    . THR A 1 127 ? 3.999   6.643   -1.205  1.00 1.10   ? 127 THR A O    4  
ATOM 8506  C CB   . THR A 1 127 ? 5.524   8.976   0.144   1.00 1.03   ? 127 THR A CB   4  
ATOM 8507  O OG1  . THR A 1 127 ? 5.928   9.464   1.412   1.00 1.38   ? 127 THR A OG1  4  
ATOM 8508  C CG2  . THR A 1 127 ? 5.776   10.097  -0.860  1.00 1.48   ? 127 THR A CG2  4  
ATOM 8509  H H    . THR A 1 127 ? 4.222   7.005   1.520   1.00 1.04   ? 127 THR A H    4  
ATOM 8510  H HA   . THR A 1 127 ? 3.484   9.545   0.188   1.00 0.98   ? 127 THR A HA   4  
ATOM 8511  H HB   . THR A 1 127 ? 6.122   8.100   -0.114  1.00 1.20   ? 127 THR A HB   4  
ATOM 8512  H HG1  . THR A 1 127 ? 6.676   10.069  1.296   1.00 2.46   ? 127 THR A HG1  4  
ATOM 8513  H HG21 . THR A 1 127 ? 5.165   10.965  -0.601  1.00 2.19   ? 127 THR A HG21 4  
ATOM 8514  H HG22 . THR A 1 127 ? 6.830   10.382  -0.844  1.00 2.27   ? 127 THR A HG22 4  
ATOM 8515  H HG23 . THR A 1 127 ? 5.524   9.754   -1.864  1.00 2.78   ? 127 THR A HG23 4  
ATOM 8516  N N    . LEU A 1 128 ? 2.843   8.410   -2.035  1.00 1.00   ? 128 LEU A N    4  
ATOM 8517  C CA   . LEU A 1 128 ? 2.160   7.634   -3.094  1.00 0.99   ? 128 LEU A CA   4  
ATOM 8518  C C    . LEU A 1 128 ? 2.037   8.346   -4.459  1.00 1.36   ? 128 LEU A C    4  
ATOM 8519  O O    . LEU A 1 128 ? 0.997   8.311   -5.113  1.00 2.98   ? 128 LEU A O    4  
ATOM 8520  C CB   . LEU A 1 128 ? 0.843   7.032   -2.542  1.00 1.38   ? 128 LEU A CB   4  
ATOM 8521  C CG   . LEU A 1 128 ? -0.173  7.960   -1.835  1.00 1.28   ? 128 LEU A CG   4  
ATOM 8522  C CD1  . LEU A 1 128 ? -0.750  9.055   -2.742  1.00 2.39   ? 128 LEU A CD1  4  
ATOM 8523  C CD2  . LEU A 1 128 ? -1.335  7.105   -1.297  1.00 1.95   ? 128 LEU A CD2  4  
ATOM 8524  H H    . LEU A 1 128 ? 2.546   9.385   -1.910  1.00 1.08   ? 128 LEU A H    4  
ATOM 8525  H HA   . LEU A 1 128 ? 2.791   6.774   -3.322  1.00 1.07   ? 128 LEU A HA   4  
ATOM 8526  H HB2  . LEU A 1 128 ? 0.334   6.519   -3.357  1.00 2.40   ? 128 LEU A HB2  4  
ATOM 8527  H HB3  . LEU A 1 128 ? 1.124   6.256   -1.828  1.00 2.47   ? 128 LEU A HB3  4  
ATOM 8528  H HG   . LEU A 1 128 ? 0.311   8.433   -0.982  1.00 2.36   ? 128 LEU A HG   4  
ATOM 8529  H HD11 . LEU A 1 128 ? -1.491  9.643   -2.204  1.00 3.15   ? 128 LEU A HD11 4  
ATOM 8530  H HD12 . LEU A 1 128 ? 0.039   9.727   -3.066  1.00 3.24   ? 128 LEU A HD12 4  
ATOM 8531  H HD13 . LEU A 1 128 ? -1.229  8.612   -3.615  1.00 3.01   ? 128 LEU A HD13 4  
ATOM 8532  H HD21 . LEU A 1 128 ? -0.956  6.353   -0.607  1.00 2.97   ? 128 LEU A HD21 4  
ATOM 8533  H HD22 . LEU A 1 128 ? -2.047  7.737   -0.761  1.00 2.55   ? 128 LEU A HD22 4  
ATOM 8534  H HD23 . LEU A 1 128 ? -1.849  6.610   -2.121  1.00 2.57   ? 128 LEU A HD23 4  
ATOM 8535  N N    . LYS A 1 129 ? 3.147   8.941   -4.924  1.00 0.93   ? 129 LYS A N    4  
ATOM 8536  C CA   . LYS A 1 129 ? 3.268   9.605   -6.230  1.00 1.04   ? 129 LYS A CA   4  
ATOM 8537  C C    . LYS A 1 129 ? 2.605   8.798   -7.367  1.00 0.97   ? 129 LYS A C    4  
ATOM 8538  O O    . LYS A 1 129 ? 2.944   7.644   -7.658  1.00 1.11   ? 129 LYS A O    4  
ATOM 8539  C CB   . LYS A 1 129 ? 4.745   9.884   -6.575  1.00 1.50   ? 129 LYS A CB   4  
ATOM 8540  C CG   . LYS A 1 129 ? 5.369   11.125  -5.920  1.00 2.16   ? 129 LYS A CG   4  
ATOM 8541  C CD   . LYS A 1 129 ? 6.712   11.579  -6.528  1.00 2.73   ? 129 LYS A CD   4  
ATOM 8542  C CE   . LYS A 1 129 ? 7.766   10.466  -6.660  1.00 2.63   ? 129 LYS A CE   4  
ATOM 8543  N NZ   . LYS A 1 129 ? 9.126   11.013  -6.922  1.00 3.24   ? 129 LYS A NZ   4  
ATOM 8544  H H    . LYS A 1 129 ? 3.978   8.868   -4.371  1.00 1.90   ? 129 LYS A H    4  
ATOM 8545  H HA   . LYS A 1 129 ? 2.761   10.567  -6.186  1.00 1.25   ? 129 LYS A HA   4  
ATOM 8546  H HB2  . LYS A 1 129 ? 5.319   9.020   -6.264  1.00 1.95   ? 129 LYS A HB2  4  
ATOM 8547  H HB3  . LYS A 1 129 ? 4.822   10.015  -7.654  1.00 1.98   ? 129 LYS A HB3  4  
ATOM 8548  H HG2  . LYS A 1 129 ? 4.679   11.959  -6.025  1.00 2.75   ? 129 LYS A HG2  4  
ATOM 8549  H HG3  . LYS A 1 129 ? 5.517   10.923  -4.859  1.00 2.65   ? 129 LYS A HG3  4  
ATOM 8550  H HD2  . LYS A 1 129 ? 6.527   12.005  -7.516  1.00 3.47   ? 129 LYS A HD2  4  
ATOM 8551  H HD3  . LYS A 1 129 ? 7.113   12.372  -5.892  1.00 3.47   ? 129 LYS A HD3  4  
ATOM 8552  H HE2  . LYS A 1 129 ? 7.796   9.893   -5.728  1.00 2.89   ? 129 LYS A HE2  4  
ATOM 8553  H HE3  . LYS A 1 129 ? 7.473   9.793   -7.472  1.00 2.85   ? 129 LYS A HE3  4  
ATOM 8554  H HZ1  . LYS A 1 129 ? 9.785   10.256  -7.038  1.00 3.46   ? 129 LYS A HZ1  4  
ATOM 8555  H HZ2  . LYS A 1 129 ? 9.167   11.615  -7.743  1.00 3.95   ? 129 LYS A HZ2  4  
ATOM 8556  H HZ3  . LYS A 1 129 ? 9.456   11.513  -6.098  1.00 3.76   ? 129 LYS A HZ3  4  
ATOM 8557  N N    . ALA A 1 130 ? 1.654   9.443   -8.038  1.00 1.31   ? 130 ALA A N    4  
ATOM 8558  C CA   . ALA A 1 130 ? 1.089   8.963   -9.301  1.00 1.52   ? 130 ALA A CA   4  
ATOM 8559  C C    . ALA A 1 130 ? 2.143   8.895   -10.426 1.00 1.60   ? 130 ALA A C    4  
ATOM 8560  O O    . ALA A 1 130 ? 3.240   9.432   -10.279 1.00 1.76   ? 130 ALA A O    4  
ATOM 8561  C CB   . ALA A 1 130 ? -0.104  9.851   -9.668  1.00 1.91   ? 130 ALA A CB   4  
ATOM 8562  H H    . ALA A 1 130 ? 1.301   10.293  -7.622  1.00 1.73   ? 130 ALA A H    4  
ATOM 8563  H HA   . ALA A 1 130 ? 0.733   7.950   -9.147  1.00 1.54   ? 130 ALA A HA   4  
ATOM 8564  H HB1  . ALA A 1 130 ? -0.833  9.853   -8.855  1.00 2.83   ? 130 ALA A HB1  4  
ATOM 8565  H HB2  . ALA A 1 130 ? 0.231   10.870  -9.845  1.00 1.94   ? 130 ALA A HB2  4  
ATOM 8566  H HB3  . ALA A 1 130 ? -0.597  9.489   -10.569 1.00 2.42   ? 130 ALA A HB3  4  
ATOM 8567  N N    . THR A 1 131 ? 1.786   8.255   -11.551 1.00 1.69   ? 131 THR A N    4  
ATOM 8568  C CA   . THR A 1 131 ? 2.650   8.085   -12.744 1.00 1.92   ? 131 THR A CA   4  
ATOM 8569  C C    . THR A 1 131 ? 3.089   9.408   -13.386 1.00 2.02   ? 131 THR A C    4  
ATOM 8570  O O    . THR A 1 131 ? 4.133   9.450   -14.030 1.00 2.47   ? 131 THR A O    4  
ATOM 8571  C CB   . THR A 1 131 ? 1.966   7.139   -13.750 1.00 2.16   ? 131 THR A CB   4  
ATOM 8572  O OG1  . THR A 1 131 ? 2.834   6.876   -14.825 1.00 2.47   ? 131 THR A OG1  4  
ATOM 8573  C CG2  . THR A 1 131 ? 0.667   7.695   -14.344 1.00 2.76   ? 131 THR A CG2  4  
ATOM 8574  H H    . THR A 1 131 ? 0.877   7.809   -11.560 1.00 1.73   ? 131 THR A H    4  
ATOM 8575  H HA   . THR A 1 131 ? 3.575   7.611   -12.423 1.00 2.08   ? 131 THR A HA   4  
ATOM 8576  H HB   . THR A 1 131 ? 1.740   6.196   -13.248 1.00 2.51   ? 131 THR A HB   4  
ATOM 8577  H HG1  . THR A 1 131 ? 3.548   6.318   -14.497 1.00 2.72   ? 131 THR A HG1  4  
ATOM 8578  H HG21 . THR A 1 131 ? 0.870   8.622   -14.879 1.00 3.18   ? 131 THR A HG21 4  
ATOM 8579  H HG22 . THR A 1 131 ? 0.258   6.966   -15.044 1.00 3.31   ? 131 THR A HG22 4  
ATOM 8580  H HG23 . THR A 1 131 ? -0.063  7.871   -13.555 1.00 3.38   ? 131 THR A HG23 4  
ATOM 8581  N N    . ASP A 1 132 ? 2.333   10.481  -13.131 1.00 1.90   ? 132 ASP A N    4  
ATOM 8582  C CA   . ASP A 1 132 ? 2.645   11.860  -13.512 1.00 2.22   ? 132 ASP A CA   4  
ATOM 8583  C C    . ASP A 1 132 ? 3.214   12.687  -12.332 1.00 2.43   ? 132 ASP A C    4  
ATOM 8584  O O    . ASP A 1 132 ? 3.053   13.907  -12.255 1.00 3.06   ? 132 ASP A O    4  
ATOM 8585  C CB   . ASP A 1 132 ? 1.355   12.450  -14.094 1.00 2.97   ? 132 ASP A CB   4  
ATOM 8586  C CG   . ASP A 1 132 ? 1.553   13.752  -14.862 1.00 3.80   ? 132 ASP A CG   4  
ATOM 8587  O OD1  . ASP A 1 132 ? 2.588   13.886  -15.572 1.00 3.83   ? 132 ASP A OD1  4  
ATOM 8588  O OD2  . ASP A 1 132 ? 0.657   14.604  -14.844 1.00 5.04   ? 132 ASP A OD2  4  
ATOM 8589  H H    . ASP A 1 132 ? 1.504   10.336  -12.586 1.00 1.81   ? 132 ASP A H    4  
ATOM 8590  H HA   . ASP A 1 132 ? 3.408   11.841  -14.290 1.00 2.52   ? 132 ASP A HA   4  
ATOM 8591  H HB2  . ASP A 1 132 ? 0.918   11.733  -14.789 1.00 2.97   ? 132 ASP A HB2  4  
ATOM 8592  H HB3  . ASP A 1 132 ? 0.634   12.607  -13.293 1.00 3.75   ? 132 ASP A HB3  4  
ATOM 8593  N N    . GLY A 1 133 ? 3.786   12.014  -11.326 1.00 2.71   ? 133 GLY A N    4  
ATOM 8594  C CA   . GLY A 1 133 ? 4.271   12.572  -10.046 1.00 3.53   ? 133 GLY A CA   4  
ATOM 8595  C C    . GLY A 1 133 ? 3.159   13.020  -9.078  1.00 2.92   ? 133 GLY A C    4  
ATOM 8596  O O    . GLY A 1 133 ? 3.428   13.407  -7.943  1.00 3.77   ? 133 GLY A O    4  
ATOM 8597  H H    . GLY A 1 133 ? 3.866   11.009  -11.442 1.00 2.81   ? 133 GLY A H    4  
ATOM 8598  H HA2  . GLY A 1 133 ? 4.865   11.814  -9.537  1.00 5.17   ? 133 GLY A HA2  4  
ATOM 8599  H HA3  . GLY A 1 133 ? 4.885   13.449  -10.256 1.00 4.12   ? 133 GLY A HA3  4  
ATOM 8600  N N    . ARG A 1 134 ? 1.910   12.975  -9.551  1.00 2.79   ? 134 ARG A N    4  
ATOM 8601  C CA   . ARG A 1 134 ? 0.755   13.758  -9.095  1.00 3.82   ? 134 ARG A CA   4  
ATOM 8602  C C    . ARG A 1 134 ? 0.162   13.265  -7.757  1.00 3.89   ? 134 ARG A C    4  
ATOM 8603  O O    . ARG A 1 134 ? -0.654  12.346  -7.764  1.00 4.93   ? 134 ARG A O    4  
ATOM 8604  C CB   . ARG A 1 134 ? -0.259  13.745  -10.265 1.00 5.41   ? 134 ARG A CB   4  
ATOM 8605  C CG   . ARG A 1 134 ? -1.160  14.976  -10.402 1.00 6.58   ? 134 ARG A CG   4  
ATOM 8606  C CD   . ARG A 1 134 ? -2.329  15.048  -9.408  1.00 7.80   ? 134 ARG A CD   4  
ATOM 8607  N NE   . ARG A 1 134 ? -3.365  15.980  -9.894  1.00 9.46   ? 134 ARG A NE   4  
ATOM 8608  C CZ   . ARG A 1 134 ? -3.229  17.272  -10.170 1.00 10.03  ? 134 ARG A CZ   4  
ATOM 8609  N NH1  . ARG A 1 134 ? -2.166  17.957  -9.792  1.00 9.34   ? 134 ARG A NH1  4  
ATOM 8610  N NH2  . ARG A 1 134 ? -4.194  17.877  -10.833 1.00 11.70  ? 134 ARG A NH2  4  
ATOM 8611  H H    . ARG A 1 134 ? 1.831   12.609  -10.488 1.00 2.96   ? 134 ARG A H    4  
ATOM 8612  H HA   . ARG A 1 134 ? 1.095   14.785  -8.956  1.00 4.15   ? 134 ARG A HA   4  
ATOM 8613  H HB2  . ARG A 1 134 ? 0.303   13.701  -11.201 1.00 5.48   ? 134 ARG A HB2  4  
ATOM 8614  H HB3  . ARG A 1 134 ? -0.880  12.847  -10.233 1.00 6.34   ? 134 ARG A HB3  4  
ATOM 8615  H HG2  . ARG A 1 134 ? -0.542  15.873  -10.325 1.00 6.15   ? 134 ARG A HG2  4  
ATOM 8616  H HG3  . ARG A 1 134 ? -1.579  14.945  -11.410 1.00 7.66   ? 134 ARG A HG3  4  
ATOM 8617  H HD2  . ARG A 1 134 ? -2.771  14.055  -9.306  1.00 8.40   ? 134 ARG A HD2  4  
ATOM 8618  H HD3  . ARG A 1 134 ? -1.976  15.349  -8.428  1.00 7.32   ? 134 ARG A HD3  4  
ATOM 8619  H HE   . ARG A 1 134 ? -4.271  15.569  -10.062 1.00 10.52  ? 134 ARG A HE   4  
ATOM 8620  H HH11 . ARG A 1 134 ? -1.494  17.535  -9.148  1.00 8.29   ? 134 ARG A HH11 4  
ATOM 8621  H HH12 . ARG A 1 134 ? -2.093  18.943  -9.964  1.00 10.15  ? 134 ARG A HH12 4  
ATOM 8622  H HH21 . ARG A 1 134 ? -4.993  17.330  -11.148 1.00 12.53  ? 134 ARG A HH21 4  
ATOM 8623  H HH22 . ARG A 1 134 ? -4.111  18.839  -11.107 1.00 12.34  ? 134 ARG A HH22 4  
ATOM 8624  N N    . THR A 1 135 ? 0.604   13.885  -6.653  1.00 3.42   ? 135 THR A N    4  
ATOM 8625  C CA   . THR A 1 135 ? 0.157   13.717  -5.248  1.00 3.54   ? 135 THR A CA   4  
ATOM 8626  C C    . THR A 1 135 ? 0.741   12.491  -4.577  1.00 2.70   ? 135 THR A C    4  
ATOM 8627  O O    . THR A 1 135 ? 0.864   11.425  -5.161  1.00 3.69   ? 135 THR A O    4  
ATOM 8628  C CB   . THR A 1 135 ? -1.369  13.741  -5.078  1.00 5.40   ? 135 THR A CB   4  
ATOM 8629  O OG1  . THR A 1 135 ? -1.972  14.746  -5.859  1.00 6.76   ? 135 THR A OG1  4  
ATOM 8630  C CG2  . THR A 1 135 ? -1.801  14.026  -3.641  1.00 5.82   ? 135 THR A CG2  4  
ATOM 8631  H H    . THR A 1 135 ? 1.228   14.658  -6.841  1.00 3.62   ? 135 THR A H    4  
ATOM 8632  H HA   . THR A 1 135 ? 0.577   14.526  -4.663  1.00 3.62   ? 135 THR A HA   4  
ATOM 8633  H HB   . THR A 1 135 ? -1.755  12.770  -5.372  1.00 5.91   ? 135 THR A HB   4  
ATOM 8634  H HG1  . THR A 1 135 ? -1.309  15.420  -6.111  1.00 7.01   ? 135 THR A HG1  4  
ATOM 8635  H HG21 . THR A 1 135 ? -1.473  13.226  -2.979  1.00 5.51   ? 135 THR A HG21 4  
ATOM 8636  H HG22 . THR A 1 135 ? -1.377  14.976  -3.316  1.00 6.16   ? 135 THR A HG22 4  
ATOM 8637  H HG23 . THR A 1 135 ? -2.887  14.086  -3.597  1.00 6.65   ? 135 THR A HG23 4  
ATOM 8638  N N    . LEU A 1 136 ? 1.165   12.688  -3.328  1.00 1.96   ? 136 LEU A N    4  
ATOM 8639  C CA   . LEU A 1 136 ? 2.116   11.836  -2.642  1.00 1.75   ? 136 LEU A CA   4  
ATOM 8640  C C    . LEU A 1 136 ? 1.930   11.768  -1.118  1.00 1.37   ? 136 LEU A C    4  
ATOM 8641  O O    . LEU A 1 136 ? 1.708   10.671  -0.625  1.00 1.27   ? 136 LEU A O    4  
ATOM 8642  C CB   . LEU A 1 136 ? 3.538   12.223  -3.094  1.00 2.59   ? 136 LEU A CB   4  
ATOM 8643  C CG   . LEU A 1 136 ? 4.133   13.579  -2.647  1.00 3.46   ? 136 LEU A CG   4  
ATOM 8644  C CD1  . LEU A 1 136 ? 5.603   13.644  -3.094  1.00 4.79   ? 136 LEU A CD1  4  
ATOM 8645  C CD2  . LEU A 1 136 ? 3.391   14.810  -3.194  1.00 3.89   ? 136 LEU A CD2  4  
ATOM 8646  H H    . LEU A 1 136 ? 1.054   13.608  -2.950  1.00 2.56   ? 136 LEU A H    4  
ATOM 8647  H HA   . LEU A 1 136 ? 1.941   10.829  -3.001  1.00 2.83   ? 136 LEU A HA   4  
ATOM 8648  H HB2  . LEU A 1 136 ? 4.210   11.435  -2.758  1.00 3.22   ? 136 LEU A HB2  4  
ATOM 8649  H HB3  . LEU A 1 136 ? 3.545   12.206  -4.180  1.00 3.02   ? 136 LEU A HB3  4  
ATOM 8650  H HG   . LEU A 1 136 ? 4.112   13.633  -1.564  1.00 3.53   ? 136 LEU A HG   4  
ATOM 8651  H HD11 . LEU A 1 136 ? 6.155   12.795  -2.692  1.00 5.76   ? 136 LEU A HD11 4  
ATOM 8652  H HD12 . LEU A 1 136 ? 5.666   13.634  -4.184  1.00 5.21   ? 136 LEU A HD12 4  
ATOM 8653  H HD13 . LEU A 1 136 ? 6.063   14.562  -2.722  1.00 5.08   ? 136 LEU A HD13 4  
ATOM 8654  H HD21 . LEU A 1 136 ? 2.413   14.904  -2.724  1.00 3.81   ? 136 LEU A HD21 4  
ATOM 8655  H HD22 . LEU A 1 136 ? 3.953   15.716  -2.963  1.00 4.84   ? 136 LEU A HD22 4  
ATOM 8656  H HD23 . LEU A 1 136 ? 3.277   14.731  -4.277  1.00 4.49   ? 136 LEU A HD23 4  
ATOM 8657  N N    . ASN A 1 137 ? 1.991   12.877  -0.375  1.00 1.50   ? 137 ASN A N    4  
ATOM 8658  C CA   . ASN A 1 137 ? 2.006   12.875  1.087   1.00 1.36   ? 137 ASN A CA   4  
ATOM 8659  C C    . ASN A 1 137 ? 0.587   12.645  1.620   1.00 1.39   ? 137 ASN A C    4  
ATOM 8660  O O    . ASN A 1 137 ? -0.281  13.516  1.491   1.00 1.82   ? 137 ASN A O    4  
ATOM 8661  C CB   . ASN A 1 137 ? 2.611   14.192  1.609   1.00 1.63   ? 137 ASN A CB   4  
ATOM 8662  C CG   . ASN A 1 137 ? 2.615   14.286  3.139   1.00 2.07   ? 137 ASN A CG   4  
ATOM 8663  O OD1  . ASN A 1 137 ? 2.628   13.289  3.849   1.00 3.18   ? 137 ASN A OD1  4  
ATOM 8664  N ND2  . ASN A 1 137 ? 2.547   15.486  3.677   1.00 2.31   ? 137 ASN A ND2  4  
ATOM 8665  H H    . ASN A 1 137 ? 2.002   13.771  -0.824  1.00 1.91   ? 137 ASN A H    4  
ATOM 8666  H HA   . ASN A 1 137 ? 2.642   12.057  1.429   1.00 1.24   ? 137 ASN A HA   4  
ATOM 8667  H HB2  . ASN A 1 137 ? 3.642   14.280  1.264   1.00 2.36   ? 137 ASN A HB2  4  
ATOM 8668  H HB3  . ASN A 1 137 ? 2.042   15.032  1.207   1.00 2.03   ? 137 ASN A HB3  4  
ATOM 8669  H HD21 . ASN A 1 137 ? 2.489   16.320  3.102   1.00 2.51   ? 137 ASN A HD21 4  
ATOM 8670  H HD22 . ASN A 1 137 ? 2.619   15.557  4.681   1.00 3.01   ? 137 ASN A HD22 4  
ATOM 8671  N N    . VAL A 1 138 ? 0.359   11.462  2.180   1.00 1.13   ? 138 VAL A N    4  
ATOM 8672  C CA   . VAL A 1 138 ? -0.953  11.049  2.712   1.00 1.25   ? 138 VAL A CA   4  
ATOM 8673  C C    . VAL A 1 138 ? -0.878  10.566  4.168   1.00 1.05   ? 138 VAL A C    4  
ATOM 8674  O O    . VAL A 1 138 ? 0.009   9.806   4.557   1.00 1.15   ? 138 VAL A O    4  
ATOM 8675  C CB   . VAL A 1 138 ? -1.628  10.020  1.772   1.00 1.63   ? 138 VAL A CB   4  
ATOM 8676  C CG1  . VAL A 1 138 ? -2.930  9.435   2.349   1.00 1.83   ? 138 VAL A CG1  4  
ATOM 8677  C CG2  . VAL A 1 138 ? -1.966  10.690  0.427   1.00 2.00   ? 138 VAL A CG2  4  
ATOM 8678  H H    . VAL A 1 138 ? 1.104   10.766  2.083   1.00 1.02   ? 138 VAL A H    4  
ATOM 8679  H HA   . VAL A 1 138 ? -1.593  11.925  2.720   1.00 1.52   ? 138 VAL A HA   4  
ATOM 8680  H HB   . VAL A 1 138 ? -0.942  9.201   1.576   1.00 1.80   ? 138 VAL A HB   4  
ATOM 8681  H HG11 . VAL A 1 138 ? -3.618  10.240  2.613   1.00 2.16   ? 138 VAL A HG11 4  
ATOM 8682  H HG12 . VAL A 1 138 ? -3.406  8.785   1.613   1.00 2.19   ? 138 VAL A HG12 4  
ATOM 8683  H HG13 . VAL A 1 138 ? -2.712  8.834   3.231   1.00 2.61   ? 138 VAL A HG13 4  
ATOM 8684  H HG21 . VAL A 1 138 ? -2.537  11.602  0.593   1.00 2.50   ? 138 VAL A HG21 4  
ATOM 8685  H HG22 . VAL A 1 138 ? -1.051  10.936  -0.111  1.00 2.42   ? 138 VAL A HG22 4  
ATOM 8686  H HG23 . VAL A 1 138 ? -2.558  10.016  -0.190  1.00 3.06   ? 138 VAL A HG23 4  
ATOM 8687  N N    . ALA A 1 139 ? -1.856  10.999  4.974   1.00 1.13   ? 139 ALA A N    4  
ATOM 8688  C CA   . ALA A 1 139 ? -2.144  10.420  6.283   1.00 1.19   ? 139 ALA A CA   4  
ATOM 8689  C C    . ALA A 1 139 ? -2.905  9.093   6.107   1.00 1.12   ? 139 ALA A C    4  
ATOM 8690  O O    . ALA A 1 139 ? -4.112  9.066   5.866   1.00 1.56   ? 139 ALA A O    4  
ATOM 8691  C CB   . ALA A 1 139 ? -2.927  11.444  7.119   1.00 1.66   ? 139 ALA A CB   4  
ATOM 8692  H H    . ALA A 1 139 ? -2.537  11.642  4.597   1.00 1.35   ? 139 ALA A H    4  
ATOM 8693  H HA   . ALA A 1 139 ? -1.207  10.210  6.805   1.00 1.19   ? 139 ALA A HA   4  
ATOM 8694  H HB1  . ALA A 1 139 ? -2.341  12.356  7.238   1.00 2.64   ? 139 ALA A HB1  4  
ATOM 8695  H HB2  . ALA A 1 139 ? -3.872  11.685  6.629   1.00 1.77   ? 139 ALA A HB2  4  
ATOM 8696  H HB3  . ALA A 1 139 ? -3.137  11.027  8.106   1.00 2.55   ? 139 ALA A HB3  4  
ATOM 8697  N N    . ALA A 1 140 ? -2.176  7.985   6.216   1.00 1.17   ? 140 ALA A N    4  
ATOM 8698  C CA   . ALA A 1 140 ? -2.736  6.662   6.453   1.00 1.03   ? 140 ALA A CA   4  
ATOM 8699  C C    . ALA A 1 140 ? -3.105  6.492   7.936   1.00 0.91   ? 140 ALA A C    4  
ATOM 8700  O O    . ALA A 1 140 ? -2.615  7.217   8.812   1.00 1.00   ? 140 ALA A O    4  
ATOM 8701  C CB   . ALA A 1 140 ? -1.711  5.611   6.013   1.00 1.10   ? 140 ALA A CB   4  
ATOM 8702  H H    . ALA A 1 140 ? -1.189  8.100   6.405   1.00 1.58   ? 140 ALA A H    4  
ATOM 8703  H HA   . ALA A 1 140 ? -3.646  6.541   5.860   1.00 1.15   ? 140 ALA A HA   4  
ATOM 8704  H HB1  . ALA A 1 140 ? -1.504  5.720   4.953   1.00 1.77   ? 140 ALA A HB1  4  
ATOM 8705  H HB2  . ALA A 1 140 ? -0.777  5.733   6.557   1.00 1.81   ? 140 ALA A HB2  4  
ATOM 8706  H HB3  . ALA A 1 140 ? -2.098  4.610   6.204   1.00 1.90   ? 140 ALA A HB3  4  
ATOM 8707  N N    . THR A 1 141 ? -3.940  5.490   8.215   1.00 0.90   ? 141 THR A N    4  
ATOM 8708  C CA   . THR A 1 141 ? -4.353  5.089   9.570   1.00 0.91   ? 141 THR A CA   4  
ATOM 8709  C C    . THR A 1 141 ? -3.789  3.703   9.855   1.00 0.79   ? 141 THR A C    4  
ATOM 8710  O O    . THR A 1 141 ? -3.329  3.001   8.951   1.00 0.82   ? 141 THR A O    4  
ATOM 8711  C CB   . THR A 1 141 ? -5.886  5.143   9.693   1.00 1.11   ? 141 THR A CB   4  
ATOM 8712  O OG1  . THR A 1 141 ? -6.341  6.338   9.103   1.00 1.27   ? 141 THR A OG1  4  
ATOM 8713  C CG2  . THR A 1 141 ? -6.401  5.181   11.133  1.00 1.27   ? 141 THR A CG2  4  
ATOM 8714  H H    . THR A 1 141 ? -4.271  4.923   7.445   1.00 0.96   ? 141 THR A H    4  
ATOM 8715  H HA   . THR A 1 141 ? -3.929  5.771   10.309  1.00 0.95   ? 141 THR A HA   4  
ATOM 8716  H HB   . THR A 1 141 ? -6.325  4.291   9.169   1.00 1.16   ? 141 THR A HB   4  
ATOM 8717  H HG1  . THR A 1 141 ? -5.777  7.047   9.424   1.00 2.21   ? 141 THR A HG1  4  
ATOM 8718  H HG21 . THR A 1 141 ? -5.884  5.951   11.702  1.00 2.16   ? 141 THR A HG21 4  
ATOM 8719  H HG22 . THR A 1 141 ? -7.468  5.397   11.130  1.00 1.86   ? 141 THR A HG22 4  
ATOM 8720  H HG23 . THR A 1 141 ? -6.260  4.218   11.616  1.00 1.58   ? 141 THR A HG23 4  
ATOM 8721  N N    . VAL A 1 142 ? -3.835  3.289   11.113  1.00 0.83   ? 142 VAL A N    4  
ATOM 8722  C CA   . VAL A 1 142 ? -3.515  1.914   11.521  1.00 0.77   ? 142 VAL A CA   4  
ATOM 8723  C C    . VAL A 1 142 ? -4.825  1.161   11.876  1.00 0.84   ? 142 VAL A C    4  
ATOM 8724  O O    . VAL A 1 142 ? -5.878  1.771   12.053  1.00 1.18   ? 142 VAL A O    4  
ATOM 8725  C CB   . VAL A 1 142 ? -2.467  1.942   12.669  1.00 0.86   ? 142 VAL A CB   4  
ATOM 8726  C CG1  . VAL A 1 142 ? -1.720  0.622   12.847  1.00 1.30   ? 142 VAL A CG1  4  
ATOM 8727  C CG2  . VAL A 1 142 ? -1.385  3.030   12.503  1.00 1.39   ? 142 VAL A CG2  4  
ATOM 8728  H H    . VAL A 1 142 ? -4.124  3.947   11.837  1.00 0.98   ? 142 VAL A H    4  
ATOM 8729  H HA   . VAL A 1 142 ? -3.054  1.401   10.677  1.00 0.76   ? 142 VAL A HA   4  
ATOM 8730  H HB   . VAL A 1 142 ? -2.984  2.115   13.598  1.00 1.21   ? 142 VAL A HB   4  
ATOM 8731  H HG11 . VAL A 1 142 ? -1.142  0.653   13.773  1.00 1.99   ? 142 VAL A HG11 4  
ATOM 8732  H HG12 . VAL A 1 142 ? -2.436  -0.186  12.906  1.00 1.81   ? 142 VAL A HG12 4  
ATOM 8733  H HG13 . VAL A 1 142 ? -1.045  0.438   12.016  1.00 2.24   ? 142 VAL A HG13 4  
ATOM 8734  H HG21 . VAL A 1 142 ? -0.877  2.909   11.546  1.00 1.94   ? 142 VAL A HG21 4  
ATOM 8735  H HG22 . VAL A 1 142 ? -1.823  4.025   12.557  1.00 2.52   ? 142 VAL A HG22 4  
ATOM 8736  H HG23 . VAL A 1 142 ? -0.652  2.951   13.307  1.00 2.01   ? 142 VAL A HG23 4  
ATOM 8737  N N    . LYS A 1 143 ? -4.780  -0.171  11.953  1.00 0.93   ? 143 LYS A N    4  
ATOM 8738  C CA   . LYS A 1 143 ? -5.771  -1.085  12.562  1.00 1.15   ? 143 LYS A CA   4  
ATOM 8739  C C    . LYS A 1 143 ? -5.166  -2.514  12.608  1.00 1.36   ? 143 LYS A C    4  
ATOM 8740  O O    . LYS A 1 143 ? -4.304  -2.848  11.797  1.00 2.17   ? 143 LYS A O    4  
ATOM 8741  C CB   . LYS A 1 143 ? -7.136  -1.031  11.820  1.00 1.38   ? 143 LYS A CB   4  
ATOM 8742  C CG   . LYS A 1 143 ? -8.270  -1.818  12.510  1.00 1.91   ? 143 LYS A CG   4  
ATOM 8743  C CD   . LYS A 1 143 ? -9.672  -1.501  11.946  1.00 2.33   ? 143 LYS A CD   4  
ATOM 8744  C CE   . LYS A 1 143 ? -10.242 -0.159  12.450  1.00 2.78   ? 143 LYS A CE   4  
ATOM 8745  N NZ   . LYS A 1 143 ? -11.559 0.163   11.834  1.00 3.15   ? 143 LYS A NZ   4  
ATOM 8746  H H    . LYS A 1 143 ? -3.938  -0.605  11.589  1.00 1.03   ? 143 LYS A H    4  
ATOM 8747  H HA   . LYS A 1 143 ? -5.927  -0.734  13.588  1.00 1.21   ? 143 LYS A HA   4  
ATOM 8748  H HB2  . LYS A 1 143 ? -7.466  0.003   11.737  1.00 1.59   ? 143 LYS A HB2  4  
ATOM 8749  H HB3  . LYS A 1 143 ? -7.005  -1.414  10.806  1.00 1.63   ? 143 LYS A HB3  4  
ATOM 8750  H HG2  . LYS A 1 143 ? -8.083  -2.885  12.375  1.00 2.24   ? 143 LYS A HG2  4  
ATOM 8751  H HG3  . LYS A 1 143 ? -8.267  -1.606  13.580  1.00 2.25   ? 143 LYS A HG3  4  
ATOM 8752  H HD2  . LYS A 1 143 ? -9.625  -1.501  10.857  1.00 2.66   ? 143 LYS A HD2  4  
ATOM 8753  H HD3  . LYS A 1 143 ? -10.353 -2.301  12.251  1.00 3.43   ? 143 LYS A HD3  4  
ATOM 8754  H HE2  . LYS A 1 143 ? -10.358 -0.220  13.538  1.00 3.70   ? 143 LYS A HE2  4  
ATOM 8755  H HE3  . LYS A 1 143 ? -9.526  0.639   12.230  1.00 3.24   ? 143 LYS A HE3  4  
ATOM 8756  H HZ1  . LYS A 1 143 ? -11.468 0.341   10.842  1.00 3.31   ? 143 LYS A HZ1  4  
ATOM 8757  H HZ2  . LYS A 1 143 ? -12.222 -0.597  11.972  1.00 3.30   ? 143 LYS A HZ2  4  
ATOM 8758  H HZ3  . LYS A 1 143 ? -11.978 0.997   12.242  1.00 3.96   ? 143 LYS A HZ3  4  
ATOM 8759  N N    . LYS A 1 144 ? -5.551  -3.368  13.558  1.00 1.44   ? 144 LYS A N    4  
ATOM 8760  C CA   . LYS A 1 144 ? -5.016  -4.747  13.631  1.00 1.64   ? 144 LYS A CA   4  
ATOM 8761  C C    . LYS A 1 144 ? -5.632  -5.666  12.555  1.00 1.62   ? 144 LYS A C    4  
ATOM 8762  O O    . LYS A 1 144 ? -6.801  -5.478  12.228  1.00 2.42   ? 144 LYS A O    4  
ATOM 8763  C CB   . LYS A 1 144 ? -5.198  -5.285  15.060  1.00 2.51   ? 144 LYS A CB   4  
ATOM 8764  C CG   . LYS A 1 144 ? -6.601  -5.859  15.336  1.00 3.27   ? 144 LYS A CG   4  
ATOM 8765  C CD   . LYS A 1 144 ? -7.008  -5.781  16.807  1.00 4.36   ? 144 LYS A CD   4  
ATOM 8766  C CE   . LYS A 1 144 ? -5.929  -6.246  17.794  1.00 5.37   ? 144 LYS A CE   4  
ATOM 8767  N NZ   . LYS A 1 144 ? -6.343  -6.012  19.196  1.00 6.64   ? 144 LYS A NZ   4  
ATOM 8768  H H    . LYS A 1 144 ? -6.268  -3.099  14.214  1.00 1.93   ? 144 LYS A H    4  
ATOM 8769  H HA   . LYS A 1 144 ? -3.945  -4.704  13.441  1.00 2.10   ? 144 LYS A HA   4  
ATOM 8770  H HB2  . LYS A 1 144 ? -4.466  -6.074  15.237  1.00 3.09   ? 144 LYS A HB2  4  
ATOM 8771  H HB3  . LYS A 1 144 ? -4.984  -4.476  15.759  1.00 2.95   ? 144 LYS A HB3  4  
ATOM 8772  H HG2  . LYS A 1 144 ? -7.349  -5.297  14.775  1.00 3.61   ? 144 LYS A HG2  4  
ATOM 8773  H HG3  . LYS A 1 144 ? -6.639  -6.899  15.011  1.00 3.67   ? 144 LYS A HG3  4  
ATOM 8774  H HD2  . LYS A 1 144 ? -7.235  -4.737  17.004  1.00 4.46   ? 144 LYS A HD2  4  
ATOM 8775  H HD3  . LYS A 1 144 ? -7.921  -6.362  16.959  1.00 5.16   ? 144 LYS A HD3  4  
ATOM 8776  H HE2  . LYS A 1 144 ? -5.728  -7.312  17.648  1.00 5.81   ? 144 LYS A HE2  4  
ATOM 8777  H HE3  . LYS A 1 144 ? -5.002  -5.699  17.600  1.00 5.39   ? 144 LYS A HE3  4  
ATOM 8778  H HZ1  . LYS A 1 144 ? -5.553  -6.171  19.814  1.00 7.22   ? 144 LYS A HZ1  4  
ATOM 8779  H HZ2  . LYS A 1 144 ? -6.702  -5.063  19.317  1.00 7.09   ? 144 LYS A HZ2  4  
ATOM 8780  H HZ3  . LYS A 1 144 ? -7.074  -6.666  19.448  1.00 7.05   ? 144 LYS A HZ3  4  
ATOM 8781  N N    . ASN A 1 145 ? -4.900  -6.668  12.039  1.00 1.77   ? 145 ASN A N    4  
ATOM 8782  C CA   . ASN A 1 145 ? -5.502  -7.745  11.213  1.00 2.47   ? 145 ASN A CA   4  
ATOM 8783  C C    . ASN A 1 145 ? -4.626  -9.000  10.964  1.00 2.47   ? 145 ASN A C    4  
ATOM 8784  O O    . ASN A 1 145 ? -4.955  -9.804  10.092  1.00 3.32   ? 145 ASN A O    4  
ATOM 8785  C CB   . ASN A 1 145 ? -6.093  -7.189  9.887   1.00 3.60   ? 145 ASN A CB   4  
ATOM 8786  C CG   . ASN A 1 145 ? -7.533  -7.651  9.693   1.00 4.44   ? 145 ASN A CG   4  
ATOM 8787  O OD1  . ASN A 1 145 ? -7.836  -8.486  8.843   1.00 4.83   ? 145 ASN A OD1  4  
ATOM 8788  N ND2  . ASN A 1 145 ? -8.438  -7.147  10.516  1.00 5.32   ? 145 ASN A ND2  4  
ATOM 8789  H H    . ASN A 1 145 ? -3.974  -6.813  12.409  1.00 2.04   ? 145 ASN A H    4  
ATOM 8790  H HA   . ASN A 1 145 ? -6.338  -8.124  11.805  1.00 3.00   ? 145 ASN A HA   4  
ATOM 8791  H HB2  . ASN A 1 145 ? -6.085  -6.100  9.876   1.00 4.00   ? 145 ASN A HB2  4  
ATOM 8792  H HB3  . ASN A 1 145 ? -5.499  -7.515  9.033   1.00 4.17   ? 145 ASN A HB3  4  
ATOM 8793  H HD21 . ASN A 1 145 ? -8.155  -6.458  11.208  1.00 5.45   ? 145 ASN A HD21 4  
ATOM 8794  H HD22 . ASN A 1 145 ? -9.391  -7.469  10.461  1.00 6.14   ? 145 ASN A HD22 4  
ATOM 8795  N N    . ILE A 1 146 ? -3.523  -9.190  11.705  1.00 2.35   ? 146 ILE A N    4  
ATOM 8796  C CA   . ILE A 1 146 ? -2.662  -10.393 11.608  1.00 2.90   ? 146 ILE A CA   4  
ATOM 8797  C C    . ILE A 1 146 ? -2.219  -10.830 13.008  1.00 3.14   ? 146 ILE A C    4  
ATOM 8798  O O    . ILE A 1 146 ? -2.611  -11.908 13.441  1.00 3.66   ? 146 ILE A O    4  
ATOM 8799  C CB   . ILE A 1 146 ? -1.462  -10.194 10.635  1.00 3.47   ? 146 ILE A CB   4  
ATOM 8800  C CG1  . ILE A 1 146 ? -1.941  -10.005 9.174   1.00 3.82   ? 146 ILE A CG1  4  
ATOM 8801  C CG2  . ILE A 1 146 ? -0.501  -11.402 10.705  1.00 4.68   ? 146 ILE A CG2  4  
ATOM 8802  C CD1  . ILE A 1 146 ? -0.836  -9.702  8.153   1.00 4.81   ? 146 ILE A CD1  4  
ATOM 8803  H H    . ILE A 1 146 ? -3.509  -8.672  12.578  1.00 2.53   ? 146 ILE A H    4  
ATOM 8804  H HA   . ILE A 1 146 ? -3.260  -11.223 11.228  1.00 3.28   ? 146 ILE A HA   4  
ATOM 8805  H HB   . ILE A 1 146 ? -0.913  -9.300  10.933  1.00 3.82   ? 146 ILE A HB   4  
ATOM 8806  H HG12 . ILE A 1 146 ? -2.484  -10.895 8.851   1.00 4.19   ? 146 ILE A HG12 4  
ATOM 8807  H HG13 . ILE A 1 146 ? -2.630  -9.167  9.138   1.00 4.09   ? 146 ILE A HG13 4  
ATOM 8808  H HG21 . ILE A 1 146 ? -0.111  -11.539 11.711  1.00 5.29   ? 146 ILE A HG21 4  
ATOM 8809  H HG22 . ILE A 1 146 ? -1.019  -12.312 10.400  1.00 5.16   ? 146 ILE A HG22 4  
ATOM 8810  H HG23 . ILE A 1 146 ? 0.358   -11.245 10.057  1.00 5.34   ? 146 ILE A HG23 4  
ATOM 8811  H HD11 . ILE A 1 146 ? -0.210  -10.578 7.992   1.00 5.58   ? 146 ILE A HD11 4  
ATOM 8812  H HD12 . ILE A 1 146 ? -1.294  -9.431  7.201   1.00 5.24   ? 146 ILE A HD12 4  
ATOM 8813  H HD13 . ILE A 1 146 ? -0.224  -8.867  8.501   1.00 5.16   ? 146 ILE A HD13 4  
ATOM 8814  N N    . GLU A 1 147 ? -1.432  -9.996  13.701  1.00 3.15   ? 147 GLU A N    4  
ATOM 8815  C CA   . GLU A 1 147 ? -0.972  -10.200 15.086  1.00 3.83   ? 147 GLU A CA   4  
ATOM 8816  C C    . GLU A 1 147 ? -0.033  -11.417 15.238  1.00 3.85   ? 147 GLU A C    4  
ATOM 8817  O O    . GLU A 1 147 ? -0.240  -12.303 16.068  1.00 4.68   ? 147 GLU A O    4  
ATOM 8818  C CB   . GLU A 1 147 ? -2.181  -10.205 16.036  1.00 4.94   ? 147 GLU A CB   4  
ATOM 8819  C CG   . GLU A 1 147 ? -1.779  -9.905  17.485  1.00 6.38   ? 147 GLU A CG   4  
ATOM 8820  C CD   . GLU A 1 147 ? -2.995  -9.583  18.347  1.00 7.99   ? 147 GLU A CD   4  
ATOM 8821  O OE1  . GLU A 1 147 ? -3.870  -8.799  17.899  1.00 8.41   ? 147 GLU A OE1  4  
ATOM 8822  O OE2  . GLU A 1 147 ? -3.043  -10.032 19.508  1.00 9.38   ? 147 GLU A OE2  4  
ATOM 8823  H H    . GLU A 1 147 ? -1.190  -9.120  13.277  1.00 2.96   ? 147 GLU A H    4  
ATOM 8824  H HA   . GLU A 1 147 ? -0.377  -9.323  15.344  1.00 4.89   ? 147 GLU A HA   4  
ATOM 8825  H HB2  . GLU A 1 147 ? -2.859  -9.421  15.700  1.00 5.60   ? 147 GLU A HB2  4  
ATOM 8826  H HB3  . GLU A 1 147 ? -2.707  -11.159 15.981  1.00 5.11   ? 147 GLU A HB3  4  
ATOM 8827  H HG2  . GLU A 1 147 ? -1.258  -10.766 17.907  1.00 6.46   ? 147 GLU A HG2  4  
ATOM 8828  H HG3  . GLU A 1 147 ? -1.109  -9.042  17.506  1.00 6.86   ? 147 GLU A HG3  4  
ATOM 8829  N N    . GLY A 1 148 ? 1.007   -11.455 14.395  1.00 3.97   ? 148 GLY A N    4  
ATOM 8830  C CA   . GLY A 1 148 ? 1.871   -12.621 14.163  1.00 5.43   ? 148 GLY A CA   4  
ATOM 8831  C C    . GLY A 1 148 ? 2.971   -12.870 15.200  1.00 6.16   ? 148 GLY A C    4  
ATOM 8832  O O    . GLY A 1 148 ? 3.829   -13.717 14.964  1.00 7.55   ? 148 GLY A O    4  
ATOM 8833  H H    . GLY A 1 148 ? 1.154   -10.650 13.807  1.00 3.66   ? 148 GLY A H    4  
ATOM 8834  H HA2  . GLY A 1 148 ? 1.246   -13.514 14.154  1.00 5.83   ? 148 GLY A HA2  4  
ATOM 8835  H HA3  . GLY A 1 148 ? 2.356   -12.518 13.195  1.00 6.36   ? 148 GLY A HA3  4  
ATOM 8836  N N    . ARG A 1 149 ? 2.942   -12.179 16.345  1.00 5.60   ? 149 ARG A N    4  
ATOM 8837  C CA   . ARG A 1 149 ? 3.854   -12.324 17.505  1.00 6.46   ? 149 ARG A CA   4  
ATOM 8838  C C    . ARG A 1 149 ? 3.346   -11.515 18.693  1.00 6.28   ? 149 ARG A C    4  
ATOM 8839  O O    . ARG A 1 149 ? 2.960   -12.182 19.680  1.00 6.90   ? 149 ARG A O    4  
ATOM 8840  C CB   . ARG A 1 149 ? 5.310   -11.927 17.152  1.00 7.36   ? 149 ARG A CB   4  
ATOM 8841  C CG   . ARG A 1 149 ? 6.387   -12.372 18.170  1.00 8.66   ? 149 ARG A CG   4  
ATOM 8842  C CD   . ARG A 1 149 ? 6.195   -11.858 19.608  1.00 8.78   ? 149 ARG A CD   4  
ATOM 8843  N NE   . ARG A 1 149 ? 7.408   -12.003 20.426  1.00 10.17  ? 149 ARG A NE   4  
ATOM 8844  C CZ   . ARG A 1 149 ? 7.488   -11.911 21.739  1.00 10.78  ? 149 ARG A CZ   4  
ATOM 8845  N NH1  . ARG A 1 149 ? 6.470   -11.747 22.531  1.00 10.36  ? 149 ARG A NH1  4  
ATOM 8846  N NH2  . ARG A 1 149 ? 8.647   -12.013 22.304  1.00 12.12  ? 149 ARG A NH2  4  
ATOM 8847  O OXT  . ARG A 1 149 ? 3.442   -10.274 18.650  1.00 6.26   ? 149 ARG A OXT  4  
ATOM 8848  H H    . ARG A 1 149 ? 2.165   -11.545 16.481  1.00 4.76   ? 149 ARG A H    4  
ATOM 8849  H HA   . ARG A 1 149 ? 3.840   -13.363 17.826  1.00 7.21   ? 149 ARG A HA   4  
ATOM 8850  H HB2  . ARG A 1 149 ? 5.585   -12.364 16.192  1.00 7.72   ? 149 ARG A HB2  4  
ATOM 8851  H HB3  . ARG A 1 149 ? 5.360   -10.842 17.035  1.00 7.24   ? 149 ARG A HB3  4  
ATOM 8852  H HG2  . ARG A 1 149 ? 6.424   -13.464 18.192  1.00 9.10   ? 149 ARG A HG2  4  
ATOM 8853  H HG3  . ARG A 1 149 ? 7.348   -12.006 17.802  1.00 9.69   ? 149 ARG A HG3  4  
ATOM 8854  H HD2  . ARG A 1 149 ? 5.903   -10.806 19.580  1.00 8.79   ? 149 ARG A HD2  4  
ATOM 8855  H HD3  . ARG A 1 149 ? 5.399   -12.436 20.074  1.00 8.27   ? 149 ARG A HD3  4  
ATOM 8856  H HE   . ARG A 1 149 ? 8.275   -12.198 19.947  1.00 10.90  ? 149 ARG A HE   4  
ATOM 8857  H HH11 . ARG A 1 149 ? 5.533   -11.636 22.137  1.00 9.47   ? 149 ARG A HH11 4  
ATOM 8858  H HH12 . ARG A 1 149 ? 6.583   -11.765 23.526  1.00 11.06  ? 149 ARG A HH12 4  
ATOM 8859  H HH21 . ARG A 1 149 ? 9.455   -12.136 21.701  1.00 12.70  ? 149 ARG A HH21 4  
ATOM 8860  H HH22 . ARG A 1 149 ? 8.725   -11.963 23.307  1.00 12.68  ? 149 ARG A HH22 4  
ATOM 8861  N N    . MET A 1 1   ? 68.856  18.757  -10.184 1.00 99.77  ? 1   MET A N    5  
ATOM 8862  C CA   . MET A 1 1   ? 68.261  19.048  -8.861  1.00 98.92  ? 1   MET A CA   5  
ATOM 8863  C C    . MET A 1 1   ? 66.767  18.739  -8.900  1.00 97.22  ? 1   MET A C    5  
ATOM 8864  O O    . MET A 1 1   ? 66.156  18.908  -9.951  1.00 96.80  ? 1   MET A O    5  
ATOM 8865  C CB   . MET A 1 1   ? 68.511  20.499  -8.418  1.00 98.72  ? 1   MET A CB   5  
ATOM 8866  C CG   . MET A 1 1   ? 69.983  20.768  -8.065  1.00 100.17 ? 1   MET A CG   5  
ATOM 8867  S SD   . MET A 1 1   ? 71.180  20.699  -9.435  1.00 101.41 ? 1   MET A SD   5  
ATOM 8868  C CE   . MET A 1 1   ? 70.848  22.276  -10.268 1.00 101.23 ? 1   MET A CE   5  
ATOM 8869  H H1   . MET A 1 1   ? 68.410  19.306  -10.910 1.00 99.15  ? 1   MET A H1   5  
ATOM 8870  H H2   . MET A 1 1   ? 68.729  17.774  -10.396 1.00 100.38 ? 1   MET A H2   5  
ATOM 8871  H H3   . MET A 1 1   ? 69.847  18.959  -10.185 1.00 100.41 ? 1   MET A H3   5  
ATOM 8872  H HA   . MET A 1 1   ? 68.715  18.376  -8.133  1.00 99.75  ? 1   MET A HA   5  
ATOM 8873  H HB2  . MET A 1 1   ? 68.187  21.189  -9.197  1.00 98.17  ? 1   MET A HB2  5  
ATOM 8874  H HB3  . MET A 1 1   ? 67.920  20.697  -7.525  1.00 98.10  ? 1   MET A HB3  5  
ATOM 8875  H HG2  . MET A 1 1   ? 70.055  21.755  -7.604  1.00 99.91  ? 1   MET A HG2  5  
ATOM 8876  H HG3  . MET A 1 1   ? 70.290  20.037  -7.314  1.00 100.79 ? 1   MET A HG3  5  
ATOM 8877  H HE1  . MET A 1 1   ? 70.994  23.099  -9.569  1.00 101.21 ? 1   MET A HE1  5  
ATOM 8878  H HE2  . MET A 1 1   ? 71.538  22.394  -11.105 1.00 101.81 ? 1   MET A HE2  5  
ATOM 8879  H HE3  . MET A 1 1   ? 69.825  22.293  -10.645 1.00 100.62 ? 1   MET A HE3  5  
ATOM 8880  N N    . GLY A 1 2   ? 66.189  18.285  -7.781  1.00 96.30  ? 2   GLY A N    5  
ATOM 8881  C CA   . GLY A 1 2   ? 64.813  17.765  -7.729  1.00 94.78  ? 2   GLY A CA   5  
ATOM 8882  C C    . GLY A 1 2   ? 63.729  18.842  -7.685  1.00 92.93  ? 2   GLY A C    5  
ATOM 8883  O O    . GLY A 1 2   ? 63.967  19.990  -7.309  1.00 92.79  ? 2   GLY A O    5  
ATOM 8884  H H    . GLY A 1 2   ? 66.754  18.176  -6.952  1.00 96.76  ? 2   GLY A H    5  
ATOM 8885  H HA2  . GLY A 1 2   ? 64.629  17.158  -8.616  1.00 95.07  ? 2   GLY A HA2  5  
ATOM 8886  H HA3  . GLY A 1 2   ? 64.692  17.140  -6.845  1.00 94.67  ? 2   GLY A HA3  5  
ATOM 8887  N N    . HIS A 1 3   ? 62.498  18.470  -8.035  1.00 91.52  ? 3   HIS A N    5  
ATOM 8888  C CA   . HIS A 1 3   ? 61.350  19.380  -8.111  1.00 89.65  ? 3   HIS A CA   5  
ATOM 8889  C C    . HIS A 1 3   ? 60.028  18.656  -7.777  1.00 88.10  ? 3   HIS A C    5  
ATOM 8890  O O    . HIS A 1 3   ? 59.929  17.440  -7.969  1.00 88.59  ? 3   HIS A O    5  
ATOM 8891  C CB   . HIS A 1 3   ? 61.302  19.999  -9.522  1.00 89.65  ? 3   HIS A CB   5  
ATOM 8892  C CG   . HIS A 1 3   ? 61.201  19.002  -10.656 1.00 89.88  ? 3   HIS A CG   5  
ATOM 8893  N ND1  . HIS A 1 3   ? 60.073  18.303  -11.029 1.00 89.17  ? 3   HIS A ND1  5  
ATOM 8894  C CD2  . HIS A 1 3   ? 62.204  18.625  -11.514 1.00 90.89  ? 3   HIS A CD2  5  
ATOM 8895  C CE1  . HIS A 1 3   ? 60.390  17.527  -12.083 1.00 89.76  ? 3   HIS A CE1  5  
ATOM 8896  N NE2  . HIS A 1 3   ? 61.679  17.693  -12.423 1.00 90.80  ? 3   HIS A NE2  5  
ATOM 8897  H H    . HIS A 1 3   ? 62.327  17.504  -8.292  1.00 91.72  ? 3   HIS A H    5  
ATOM 8898  H HA   . HIS A 1 3   ? 61.478  20.193  -7.388  1.00 89.40  ? 3   HIS A HA   5  
ATOM 8899  H HB2  . HIS A 1 3   ? 60.447  20.677  -9.587  1.00 88.99  ? 3   HIS A HB2  5  
ATOM 8900  H HB3  . HIS A 1 3   ? 62.201  20.598  -9.675  1.00 90.19  ? 3   HIS A HB3  5  
ATOM 8901  H HD1  . HIS A 1 3   ? 59.172  18.337  -10.570 1.00 88.41  ? 3   HIS A HD1  5  
ATOM 8902  H HD2  . HIS A 1 3   ? 63.227  18.982  -11.490 1.00 91.68  ? 3   HIS A HD2  5  
ATOM 8903  H HE1  . HIS A 1 3   ? 59.707  16.855  -12.589 1.00 89.48  ? 3   HIS A HE1  5  
ATOM 8904  N N    . THR A 1 4   ? 59.036  19.413  -7.287  1.00 86.31  ? 4   THR A N    5  
ATOM 8905  C CA   . THR A 1 4   ? 57.664  18.958  -7.016  1.00 84.64  ? 4   THR A CA   5  
ATOM 8906  C C    . THR A 1 4   ? 56.738  19.385  -8.160  1.00 83.19  ? 4   THR A C    5  
ATOM 8907  O O    . THR A 1 4   ? 57.210  19.822  -9.209  1.00 83.48  ? 4   THR A O    5  
ATOM 8908  C CB   . THR A 1 4   ? 57.180  19.474  -5.648  1.00 84.00  ? 4   THR A CB   5  
ATOM 8909  O OG1  . THR A 1 4   ? 57.217  20.883  -5.624  1.00 83.15  ? 4   THR A OG1  5  
ATOM 8910  C CG2  . THR A 1 4   ? 58.046  18.948  -4.503  1.00 84.76  ? 4   THR A CG2  5  
ATOM 8911  H H    . THR A 1 4   ? 59.200  20.401  -7.176  1.00 86.07  ? 4   THR A H    5  
ATOM 8912  H HA   . THR A 1 4   ? 57.652  17.869  -6.997  1.00 84.97  ? 4   THR A HA   5  
ATOM 8913  H HB   . THR A 1 4   ? 56.158  19.134  -5.474  1.00 83.73  ? 4   THR A HB   5  
ATOM 8914  H HG1  . THR A 1 4   ? 57.096  21.163  -4.710  1.00 83.05  ? 4   THR A HG1  5  
ATOM 8915  H HG21 . THR A 1 4   ? 58.097  17.863  -4.548  1.00 85.20  ? 4   THR A HG21 5  
ATOM 8916  H HG22 . THR A 1 4   ? 59.055  19.354  -4.562  1.00 85.21  ? 4   THR A HG22 5  
ATOM 8917  H HG23 . THR A 1 4   ? 57.604  19.233  -3.549  1.00 84.48  ? 4   THR A HG23 5  
ATOM 8918  N N    . MET A 1 5   ? 55.423  19.277  -7.961  1.00 81.68  ? 5   MET A N    5  
ATOM 8919  C CA   . MET A 1 5   ? 54.360  19.672  -8.897  1.00 80.13  ? 5   MET A CA   5  
ATOM 8920  C C    . MET A 1 5   ? 53.061  19.976  -8.112  1.00 78.24  ? 5   MET A C    5  
ATOM 8921  O O    . MET A 1 5   ? 53.025  19.667  -6.915  1.00 78.19  ? 5   MET A O    5  
ATOM 8922  C CB   . MET A 1 5   ? 54.196  18.592  -9.991  1.00 80.58  ? 5   MET A CB   5  
ATOM 8923  C CG   . MET A 1 5   ? 53.437  17.326  -9.574  1.00 80.24  ? 5   MET A CG   5  
ATOM 8924  S SD   . MET A 1 5   ? 54.279  16.240  -8.395  1.00 81.31  ? 5   MET A SD   5  
ATOM 8925  C CE   . MET A 1 5   ? 53.050  14.914  -8.394  1.00 80.80  ? 5   MET A CE   5  
ATOM 8926  H H    . MET A 1 5   ? 55.095  18.932  -7.069  1.00 81.56  ? 5   MET A H    5  
ATOM 8927  H HA   . MET A 1 5   ? 54.673  20.595  -9.385  1.00 80.08  ? 5   MET A HA   5  
ATOM 8928  H HB2  . MET A 1 5   ? 53.676  19.025  -10.842 1.00 80.52  ? 5   MET A HB2  5  
ATOM 8929  H HB3  . MET A 1 5   ? 55.182  18.301  -10.358 1.00 81.32  ? 5   MET A HB3  5  
ATOM 8930  H HG2  . MET A 1 5   ? 52.461  17.604  -9.167  1.00 79.23  ? 5   MET A HG2  5  
ATOM 8931  H HG3  . MET A 1 5   ? 53.245  16.745  -10.478 1.00 80.34  ? 5   MET A HG3  5  
ATOM 8932  H HE1  . MET A 1 5   ? 52.084  15.303  -8.078  1.00 79.97  ? 5   MET A HE1  5  
ATOM 8933  H HE2  . MET A 1 5   ? 52.952  14.490  -9.393  1.00 80.90  ? 5   MET A HE2  5  
ATOM 8934  H HE3  . MET A 1 5   ? 53.359  14.126  -7.707  1.00 81.27  ? 5   MET A HE3  5  
ATOM 8935  N N    . PRO A 1 6   ? 52.026  20.607  -8.706  1.00 76.75  ? 6   PRO A N    5  
ATOM 8936  C CA   . PRO A 1 6   ? 50.771  20.881  -8.010  1.00 74.91  ? 6   PRO A CA   5  
ATOM 8937  C C    . PRO A 1 6   ? 49.839  19.659  -7.992  1.00 74.02  ? 6   PRO A C    5  
ATOM 8938  O O    . PRO A 1 6   ? 50.002  18.709  -8.758  1.00 74.57  ? 6   PRO A O    5  
ATOM 8939  C CB   . PRO A 1 6   ? 50.145  22.049  -8.779  1.00 73.91  ? 6   PRO A CB   5  
ATOM 8940  C CG   . PRO A 1 6   ? 50.611  21.806  -10.212 1.00 74.82  ? 6   PRO A CG   5  
ATOM 8941  C CD   . PRO A 1 6   ? 52.015  21.227  -10.030 1.00 76.77  ? 6   PRO A CD   5  
ATOM 8942  H HA   . PRO A 1 6   ? 50.969  21.199  -6.984  1.00 74.97  ? 6   PRO A HA   5  
ATOM 8943  H HB2  . PRO A 1 6   ? 49.057  22.074  -8.705  1.00 72.47  ? 6   PRO A HB2  5  
ATOM 8944  H HB3  . PRO A 1 6   ? 50.564  22.989  -8.420  1.00 74.21  ? 6   PRO A HB3  5  
ATOM 8945  H HG2  . PRO A 1 6   ? 49.967  21.058  -10.676 1.00 74.25  ? 6   PRO A HG2  5  
ATOM 8946  H HG3  . PRO A 1 6   ? 50.622  22.722  -10.803 1.00 74.77  ? 6   PRO A HG3  5  
ATOM 8947  H HD2  . PRO A 1 6   ? 52.204  20.503  -10.825 1.00 77.33  ? 6   PRO A HD2  5  
ATOM 8948  H HD3  . PRO A 1 6   ? 52.749  22.036  -10.057 1.00 77.55  ? 6   PRO A HD3  5  
ATOM 8949  N N    . ALA A 1 7   ? 48.825  19.729  -7.128  1.00 72.63  ? 7   ALA A N    5  
ATOM 8950  C CA   . ALA A 1 7   ? 47.657  18.844  -7.105  1.00 71.42  ? 7   ALA A CA   5  
ATOM 8951  C C    . ALA A 1 7   ? 46.385  19.648  -7.442  1.00 69.43  ? 7   ALA A C    5  
ATOM 8952  O O    . ALA A 1 7   ? 46.454  20.854  -7.662  1.00 68.94  ? 7   ALA A O    5  
ATOM 8953  C CB   . ALA A 1 7   ? 47.566  18.190  -5.720  1.00 71.57  ? 7   ALA A CB   5  
ATOM 8954  H H    . ALA A 1 7   ? 48.763  20.557  -6.553  1.00 72.29  ? 7   ALA A H    5  
ATOM 8955  H HA   . ALA A 1 7   ? 47.786  18.069  -7.865  1.00 71.92  ? 7   ALA A HA   5  
ATOM 8956  H HB1  . ALA A 1 7   ? 48.508  17.691  -5.497  1.00 72.47  ? 7   ALA A HB1  5  
ATOM 8957  H HB2  . ALA A 1 7   ? 47.375  18.949  -4.957  1.00 71.20  ? 7   ALA A HB2  5  
ATOM 8958  H HB3  . ALA A 1 7   ? 46.767  17.449  -5.710  1.00 71.25  ? 7   ALA A HB3  5  
ATOM 8959  N N    . HIS A 1 8   ? 45.220  19.006  -7.500  1.00 68.31  ? 8   HIS A N    5  
ATOM 8960  C CA   . HIS A 1 8   ? 43.931  19.635  -7.879  1.00 66.42  ? 8   HIS A CA   5  
ATOM 8961  C C    . HIS A 1 8   ? 42.725  18.819  -7.320  1.00 65.24  ? 8   HIS A C    5  
ATOM 8962  O O    . HIS A 1 8   ? 42.893  17.896  -6.517  1.00 65.83  ? 8   HIS A O    5  
ATOM 8963  C CB   . HIS A 1 8   ? 43.851  19.967  -9.406  1.00 66.64  ? 8   HIS A CB   5  
ATOM 8964  C CG   . HIS A 1 8   ? 43.941  18.720  -10.292 1.00 67.15  ? 8   HIS A CG   5  
ATOM 8965  N ND1  . HIS A 1 8   ? 44.803  18.562  -11.351 1.00 67.90  ? 8   HIS A ND1  5  
ATOM 8966  C CD2  . HIS A 1 8   ? 43.159  17.587  -10.309 1.00 67.05  ? 8   HIS A CD2  5  
ATOM 8967  C CE1  . HIS A 1 8   ? 44.525  17.439  -12.036 1.00 68.21  ? 8   HIS A CE1  5  
ATOM 8968  N NE2  . HIS A 1 8   ? 43.512  16.801  -11.424 1.00 67.70  ? 8   HIS A NE2  5  
ATOM 8969  H H    . HIS A 1 8   ? 45.211  18.017  -7.296  1.00 68.81  ? 8   HIS A H    5  
ATOM 8970  H HA   . HIS A 1 8   ? 43.914  20.595  -7.367  1.00 65.72  ? 8   HIS A HA   5  
ATOM 8971  H HB2  . HIS A 1 8   ? 42.853  20.444  -9.616  1.00 66.17  ? 8   HIS A HB2  5  
ATOM 8972  H HB3  . HIS A 1 8   ? 44.752  20.599  -9.651  1.00 67.02  ? 8   HIS A HB3  5  
ATOM 8973  H HD1  . HIS A 1 8   ? 45.460  19.256  -11.643 1.00 68.18  ? 8   HIS A HD1  5  
ATOM 8974  H HD2  . HIS A 1 8   ? 42.314  17.372  -9.670  1.00 66.54  ? 8   HIS A HD2  5  
ATOM 8975  H HE1  . HIS A 1 8   ? 45.073  17.094  -12.917 1.00 68.86  ? 8   HIS A HE1  5  
ATOM 8976  N N    . THR A 1 9   ? 41.502  19.174  -7.735  1.00 63.61  ? 9   THR A N    5  
ATOM 8977  C CA   . THR A 1 9   ? 40.228  18.544  -7.381  1.00 62.31  ? 9   THR A CA   5  
ATOM 8978  C C    . THR A 1 9   ? 39.180  18.782  -8.482  1.00 60.88  ? 9   THR A C    5  
ATOM 8979  O O    . THR A 1 9   ? 39.247  19.830  -9.134  1.00 60.54  ? 9   THR A O    5  
ATOM 8980  C CB   . THR A 1 9   ? 39.759  19.060  -6.013  1.00 61.63  ? 9   THR A CB   5  
ATOM 8981  O OG1  . THR A 1 9   ? 38.616  18.353  -5.613  1.00 60.85  ? 9   THR A OG1  5  
ATOM 8982  C CG2  . THR A 1 9   ? 39.443  20.558  -5.962  1.00 60.48  ? 9   THR A CG2  5  
ATOM 8983  H H    . THR A 1 9   ? 41.452  19.933  -8.394  1.00 63.27  ? 9   THR A H    5  
ATOM 8984  H HA   . THR A 1 9   ? 40.429  17.477  -7.295  1.00 63.03  ? 9   THR A HA   5  
ATOM 8985  H HB   . THR A 1 9   ? 40.549  18.854  -5.290  1.00 62.68  ? 9   THR A HB   5  
ATOM 8986  H HG1  . THR A 1 9   ? 37.856  18.692  -6.103  1.00 60.29  ? 9   THR A HG1  5  
ATOM 8987  H HG21 . THR A 1 9   ? 39.148  20.824  -4.950  1.00 60.15  ? 9   THR A HG21 5  
ATOM 8988  H HG22 . THR A 1 9   ? 40.323  21.143  -6.237  1.00 60.72  ? 9   THR A HG22 5  
ATOM 8989  H HG23 . THR A 1 9   ? 38.625  20.794  -6.641  1.00 59.82  ? 9   THR A HG23 5  
ATOM 8990  N N    . PRO A 1 10  ? 38.226  17.850  -8.686  1.00 60.12  ? 10  PRO A N    5  
ATOM 8991  C CA   . PRO A 1 10  ? 37.024  18.084  -9.486  1.00 58.63  ? 10  PRO A CA   5  
ATOM 8992  C C    . PRO A 1 10  ? 35.997  18.960  -8.739  1.00 56.70  ? 10  PRO A C    5  
ATOM 8993  O O    . PRO A 1 10  ? 36.093  19.093  -7.515  1.00 56.40  ? 10  PRO A O    5  
ATOM 8994  C CB   . PRO A 1 10  ? 36.453  16.691  -9.778  1.00 58.68  ? 10  PRO A CB   5  
ATOM 8995  C CG   . PRO A 1 10  ? 36.883  15.878  -8.562  1.00 59.39  ? 10  PRO A CG   5  
ATOM 8996  C CD   . PRO A 1 10  ? 38.254  16.464  -8.229  1.00 60.78  ? 10  PRO A CD   5  
ATOM 8997  H HA   . PRO A 1 10  ? 37.296  18.566  -10.425 1.00 59.01  ? 10  PRO A HA   5  
ATOM 8998  H HB2  . PRO A 1 10  ? 35.371  16.693  -9.899  1.00 57.30  ? 10  PRO A HB2  5  
ATOM 8999  H HB3  . PRO A 1 10  ? 36.922  16.286  -10.672 1.00 59.76  ? 10  PRO A HB3  5  
ATOM 9000  H HG2  . PRO A 1 10  ? 36.191  16.059  -7.737  1.00 58.23  ? 10  PRO A HG2  5  
ATOM 9001  H HG3  . PRO A 1 10  ? 36.942  14.814  -8.786  1.00 60.14  ? 10  PRO A HG3  5  
ATOM 9002  H HD2  . PRO A 1 10  ? 38.435  16.386  -7.156  1.00 60.85  ? 10  PRO A HD2  5  
ATOM 9003  H HD3  . PRO A 1 10  ? 39.023  15.923  -8.786  1.00 62.20  ? 10  PRO A HD3  5  
ATOM 9004  N N    . PRO A 1 11  ? 35.002  19.538  -9.449  1.00 55.46  ? 11  PRO A N    5  
ATOM 9005  C CA   . PRO A 1 11  ? 33.926  20.347  -8.874  1.00 53.58  ? 11  PRO A CA   5  
ATOM 9006  C C    . PRO A 1 11  ? 32.751  19.493  -8.352  1.00 52.35  ? 11  PRO A C    5  
ATOM 9007  O O    . PRO A 1 11  ? 32.707  18.277  -8.539  1.00 52.89  ? 11  PRO A O    5  
ATOM 9008  C CB   . PRO A 1 11  ? 33.489  21.261  -10.027 1.00 53.09  ? 11  PRO A CB   5  
ATOM 9009  C CG   . PRO A 1 11  ? 33.654  20.358  -11.250 1.00 54.20  ? 11  PRO A CG   5  
ATOM 9010  C CD   . PRO A 1 11  ? 34.907  19.552  -10.907 1.00 55.91  ? 11  PRO A CD   5  
ATOM 9011  H HA   . PRO A 1 11  ? 34.310  20.958  -8.056  1.00 53.53  ? 11  PRO A HA   5  
ATOM 9012  H HB2  . PRO A 1 11  ? 32.461  21.615  -9.921  1.00 51.68  ? 11  PRO A HB2  5  
ATOM 9013  H HB3  . PRO A 1 11  ? 34.174  22.107  -10.100 1.00 53.61  ? 11  PRO A HB3  5  
ATOM 9014  H HG2  . PRO A 1 11  ? 32.796  19.688  -11.335 1.00 53.51  ? 11  PRO A HG2  5  
ATOM 9015  H HG3  . PRO A 1 11  ? 33.786  20.939  -12.167 1.00 54.56  ? 11  PRO A HG3  5  
ATOM 9016  H HD2  . PRO A 1 11  ? 34.824  18.544  -11.312 1.00 56.46  ? 11  PRO A HD2  5  
ATOM 9017  H HD3  . PRO A 1 11  ? 35.783  20.050  -11.322 1.00 56.93  ? 11  PRO A HD3  5  
ATOM 9018  N N    . ALA A 1 12  ? 31.762  20.151  -7.729  1.00 50.74  ? 12  ALA A N    5  
ATOM 9019  C CA   . ALA A 1 12  ? 30.542  19.543  -7.178  1.00 49.43  ? 12  ALA A CA   5  
ATOM 9020  C C    . ALA A 1 12  ? 29.321  19.649  -8.132  1.00 47.78  ? 12  ALA A C    5  
ATOM 9021  O O    . ALA A 1 12  ? 29.457  19.990  -9.310  1.00 47.79  ? 12  ALA A O    5  
ATOM 9022  C CB   . ALA A 1 12  ? 30.288  20.192  -5.807  1.00 49.14  ? 12  ALA A CB   5  
ATOM 9023  H H    . ALA A 1 12  ? 31.843  21.154  -7.657  1.00 50.43  ? 12  ALA A H    5  
ATOM 9024  H HA   . ALA A 1 12  ? 30.722  18.479  -7.014  1.00 49.99  ? 12  ALA A HA   5  
ATOM 9025  H HB1  . ALA A 1 12  ? 29.470  19.687  -5.288  1.00 48.88  ? 12  ALA A HB1  5  
ATOM 9026  H HB2  . ALA A 1 12  ? 31.181  20.109  -5.189  1.00 49.94  ? 12  ALA A HB2  5  
ATOM 9027  H HB3  . ALA A 1 12  ? 30.036  21.246  -5.928  1.00 48.52  ? 12  ALA A HB3  5  
ATOM 9028  N N    . GLN A 1 13  ? 28.127  19.342  -7.627  1.00 46.42  ? 13  GLN A N    5  
ATOM 9029  C CA   . GLN A 1 13  ? 26.863  19.363  -8.366  1.00 44.82  ? 13  GLN A CA   5  
ATOM 9030  C C    . GLN A 1 13  ? 25.688  19.488  -7.387  1.00 43.43  ? 13  GLN A C    5  
ATOM 9031  O O    . GLN A 1 13  ? 25.836  19.141  -6.213  1.00 43.88  ? 13  GLN A O    5  
ATOM 9032  C CB   . GLN A 1 13  ? 26.745  18.140  -9.297  1.00 45.10  ? 13  GLN A CB   5  
ATOM 9033  C CG   . GLN A 1 13  ? 26.904  16.763  -8.613  1.00 45.50  ? 13  GLN A CG   5  
ATOM 9034  C CD   . GLN A 1 13  ? 26.846  15.606  -9.614  1.00 46.39  ? 13  GLN A CD   5  
ATOM 9035  O OE1  . GLN A 1 13  ? 26.284  15.718  -10.698 1.00 46.19  ? 13  GLN A OE1  5  
ATOM 9036  N NE2  . GLN A 1 13  ? 27.439  14.455  -9.327  1.00 47.54  ? 13  GLN A NE2  5  
ATOM 9037  H H    . GLN A 1 13  ? 28.052  19.112  -6.647  1.00 46.53  ? 13  GLN A H    5  
ATOM 9038  H HA   . GLN A 1 13  ? 26.852  20.256  -8.996  1.00 44.49  ? 13  GLN A HA   5  
ATOM 9039  H HB2  . GLN A 1 13  ? 25.772  18.173  -9.791  1.00 44.56  ? 13  GLN A HB2  5  
ATOM 9040  H HB3  . GLN A 1 13  ? 27.508  18.219  -10.074 1.00 45.69  ? 13  GLN A HB3  5  
ATOM 9041  H HG2  . GLN A 1 13  ? 27.863  16.721  -8.097  1.00 45.92  ? 13  GLN A HG2  5  
ATOM 9042  H HG3  . GLN A 1 13  ? 26.117  16.626  -7.874  1.00 44.84  ? 13  GLN A HG3  5  
ATOM 9043  H HE21 . GLN A 1 13  ? 27.968  14.335  -8.475  1.00 47.83  ? 13  GLN A HE21 5  
ATOM 9044  H HE22 . GLN A 1 13  ? 27.420  13.737  -10.034 1.00 48.21  ? 13  GLN A HE22 5  
ATOM 9045  N N    . THR A 1 14  ? 24.549  20.018  -7.857  1.00 41.84  ? 14  THR A N    5  
ATOM 9046  C CA   . THR A 1 14  ? 23.380  20.409  -7.055  1.00 40.35  ? 14  THR A CA   5  
ATOM 9047  C C    . THR A 1 14  ? 22.169  19.561  -7.430  1.00 39.08  ? 14  THR A C    5  
ATOM 9048  O O    . THR A 1 14  ? 21.986  19.199  -8.589  1.00 39.21  ? 14  THR A O    5  
ATOM 9049  C CB   . THR A 1 14  ? 23.073  21.900  -7.267  1.00 40.08  ? 14  THR A CB   5  
ATOM 9050  O OG1  . THR A 1 14  ? 23.162  22.204  -8.642  1.00 39.93  ? 14  THR A OG1  5  
ATOM 9051  C CG2  . THR A 1 14  ? 24.082  22.790  -6.543  1.00 40.64  ? 14  THR A CG2  5  
ATOM 9052  H H    . THR A 1 14  ? 24.471  20.246  -8.838  1.00 41.63  ? 14  THR A H    5  
ATOM 9053  H HA   . THR A 1 14  ? 23.593  20.241  -6.000  1.00 40.46  ? 14  THR A HA   5  
ATOM 9054  H HB   . THR A 1 14  ? 22.069  22.125  -6.898  1.00 39.77  ? 14  THR A HB   5  
ATOM 9055  H HG1  . THR A 1 14  ? 22.819  23.104  -8.799  1.00 39.64  ? 14  THR A HG1  5  
ATOM 9056  H HG21 . THR A 1 14  ? 24.065  22.572  -5.478  1.00 40.51  ? 14  THR A HG21 5  
ATOM 9057  H HG22 . THR A 1 14  ? 25.086  22.616  -6.932  1.00 41.45  ? 14  THR A HG22 5  
ATOM 9058  H HG23 . THR A 1 14  ? 23.814  23.837  -6.693  1.00 40.51  ? 14  THR A HG23 5  
ATOM 9059  N N    . ALA A 1 15  ? 21.340  19.226  -6.440  1.00 37.94  ? 15  ALA A N    5  
ATOM 9060  C CA   . ALA A 1 15  ? 20.160  18.380  -6.628  1.00 36.70  ? 15  ALA A CA   5  
ATOM 9061  C C    . ALA A 1 15  ? 18.919  19.202  -7.050  1.00 35.02  ? 15  ALA A C    5  
ATOM 9062  O O    . ALA A 1 15  ? 18.801  20.357  -6.625  1.00 34.39  ? 15  ALA A O    5  
ATOM 9063  C CB   . ALA A 1 15  ? 19.912  17.609  -5.323  1.00 36.66  ? 15  ALA A CB   5  
ATOM 9064  H H    . ALA A 1 15  ? 21.514  19.585  -5.517  1.00 37.97  ? 15  ALA A H    5  
ATOM 9065  H HA   . ALA A 1 15  ? 20.379  17.661  -7.419  1.00 37.19  ? 15  ALA A HA   5  
ATOM 9066  H HB1  . ALA A 1 15  ? 19.046  16.950  -5.438  1.00 36.24  ? 15  ALA A HB1  5  
ATOM 9067  H HB2  . ALA A 1 15  ? 20.786  17.002  -5.081  1.00 37.57  ? 15  ALA A HB2  5  
ATOM 9068  H HB3  . ALA A 1 15  ? 19.712  18.304  -4.509  1.00 36.26  ? 15  ALA A HB3  5  
ATOM 9069  N N    . PRO A 1 16  ? 17.983  18.627  -7.834  1.00 34.40  ? 16  PRO A N    5  
ATOM 9070  C CA   . PRO A 1 16  ? 16.699  19.252  -8.134  1.00 32.82  ? 16  PRO A CA   5  
ATOM 9071  C C    . PRO A 1 16  ? 15.790  19.258  -6.896  1.00 31.30  ? 16  PRO A C    5  
ATOM 9072  O O    . PRO A 1 16  ? 16.031  18.539  -5.928  1.00 31.50  ? 16  PRO A O    5  
ATOM 9073  C CB   . PRO A 1 16  ? 16.109  18.429  -9.284  1.00 33.02  ? 16  PRO A CB   5  
ATOM 9074  C CG   . PRO A 1 16  ? 16.664  17.029  -9.020  1.00 34.13  ? 16  PRO A CG   5  
ATOM 9075  C CD   . PRO A 1 16  ? 18.055  17.307  -8.450  1.00 35.30  ? 16  PRO A CD   5  
ATOM 9076  H HA   . PRO A 1 16  ? 16.851  20.279  -8.464  1.00 32.81  ? 16  PRO A HA   5  
ATOM 9077  H HB2  . PRO A 1 16  ? 15.016  18.439  -9.290  1.00 31.81  ? 16  PRO A HB2  5  
ATOM 9078  H HB3  . PRO A 1 16  ? 16.501  18.802  -10.233 1.00 33.82  ? 16  PRO A HB3  5  
ATOM 9079  H HG2  . PRO A 1 16  ? 16.053  16.528  -8.268  1.00 33.36  ? 16  PRO A HG2  5  
ATOM 9080  H HG3  . PRO A 1 16  ? 16.712  16.434  -9.932  1.00 34.93  ? 16  PRO A HG3  5  
ATOM 9081  H HD2  . PRO A 1 16  ? 18.316  16.539  -7.721  1.00 35.66  ? 16  PRO A HD2  5  
ATOM 9082  H HD3  . PRO A 1 16  ? 18.789  17.328  -9.258  1.00 36.49  ? 16  PRO A HD3  5  
ATOM 9083  N N    . ALA A 1 17  ? 14.732  20.073  -6.928  1.00 29.89  ? 17  ALA A N    5  
ATOM 9084  C CA   . ALA A 1 17  ? 13.781  20.223  -5.823  1.00 28.41  ? 17  ALA A CA   5  
ATOM 9085  C C    . ALA A 1 17  ? 12.473  19.433  -6.044  1.00 27.30  ? 17  ALA A C    5  
ATOM 9086  O O    . ALA A 1 17  ? 11.988  19.279  -7.171  1.00 27.16  ? 17  ALA A O    5  
ATOM 9087  C CB   . ALA A 1 17  ? 13.500  21.721  -5.637  1.00 27.74  ? 17  ALA A CB   5  
ATOM 9088  H H    . ALA A 1 17  ? 14.556  20.600  -7.769  1.00 29.91  ? 17  ALA A H    5  
ATOM 9089  H HA   . ALA A 1 17  ? 14.245  19.848  -4.905  1.00 28.75  ? 17  ALA A HA   5  
ATOM 9090  H HB1  . ALA A 1 17  ? 14.433  22.256  -5.459  1.00 28.03  ? 17  ALA A HB1  5  
ATOM 9091  H HB2  . ALA A 1 17  ? 13.014  22.128  -6.523  1.00 27.80  ? 17  ALA A HB2  5  
ATOM 9092  H HB3  . ALA A 1 17  ? 12.841  21.875  -4.780  1.00 27.07  ? 17  ALA A HB3  5  
ATOM 9093  N N    . ALA A 1 18  ? 11.858  18.983  -4.944  1.00 26.61  ? 18  ALA A N    5  
ATOM 9094  C CA   . ALA A 1 18  ? 10.503  18.438  -4.927  1.00 25.44  ? 18  ALA A CA   5  
ATOM 9095  C C    . ALA A 1 18  ? 9.457   19.578  -4.958  1.00 23.97  ? 18  ALA A C    5  
ATOM 9096  O O    . ALA A 1 18  ? 9.786   20.734  -4.718  1.00 24.09  ? 18  ALA A O    5  
ATOM 9097  C CB   . ALA A 1 18  ? 10.348  17.541  -3.690  1.00 25.75  ? 18  ALA A CB   5  
ATOM 9098  H H    . ALA A 1 18  ? 12.298  19.169  -4.056  1.00 26.93  ? 18  ALA A H    5  
ATOM 9099  H HA   . ALA A 1 18  ? 10.362  17.823  -5.816  1.00 25.57  ? 18  ALA A HA   5  
ATOM 9100  H HB1  . ALA A 1 18  ? 11.100  16.747  -3.708  1.00 26.62  ? 18  ALA A HB1  5  
ATOM 9101  H HB2  . ALA A 1 18  ? 10.472  18.127  -2.777  1.00 25.69  ? 18  ALA A HB2  5  
ATOM 9102  H HB3  . ALA A 1 18  ? 9.359   17.081  -3.675  1.00 25.36  ? 18  ALA A HB3  5  
ATOM 9103  N N    . GLN A 1 19  ? 8.189   19.254  -5.236  1.00 22.71  ? 19  GLN A N    5  
ATOM 9104  C CA   . GLN A 1 19  ? 7.078   20.216  -5.235  1.00 21.29  ? 19  GLN A CA   5  
ATOM 9105  C C    . GLN A 1 19  ? 5.750   19.479  -5.014  1.00 20.09  ? 19  GLN A C    5  
ATOM 9106  O O    . GLN A 1 19  ? 5.591   18.337  -5.454  1.00 20.32  ? 19  GLN A O    5  
ATOM 9107  C CB   . GLN A 1 19  ? 7.068   21.045  -6.541  1.00 21.31  ? 19  GLN A CB   5  
ATOM 9108  C CG   . GLN A 1 19  ? 6.150   22.281  -6.455  1.00 20.40  ? 19  GLN A CG   5  
ATOM 9109  C CD   . GLN A 1 19  ? 6.092   23.092  -7.756  1.00 20.44  ? 19  GLN A CD   5  
ATOM 9110  O OE1  . GLN A 1 19  ? 6.974   23.056  -8.593  1.00 21.02  ? 19  GLN A OE1  5  
ATOM 9111  N NE2  . GLN A 1 19  ? 5.030   23.832  -7.983  1.00 20.04  ? 19  GLN A NE2  5  
ATOM 9112  H H    . GLN A 1 19  ? 7.925   18.286  -5.347  1.00 22.77  ? 19  GLN A H    5  
ATOM 9113  H HA   . GLN A 1 19  ? 7.228   20.903  -4.401  1.00 21.26  ? 19  GLN A HA   5  
ATOM 9114  H HB2  . GLN A 1 19  ? 8.082   21.388  -6.755  1.00 22.22  ? 19  GLN A HB2  5  
ATOM 9115  H HB3  . GLN A 1 19  ? 6.743   20.409  -7.364  1.00 21.35  ? 19  GLN A HB3  5  
ATOM 9116  H HG2  . GLN A 1 19  ? 5.135   21.961  -6.223  1.00 19.62  ? 19  GLN A HG2  5  
ATOM 9117  H HG3  . GLN A 1 19  ? 6.500   22.939  -5.659  1.00 20.74  ? 19  GLN A HG3  5  
ATOM 9118  H HE21 . GLN A 1 19  ? 4.277   23.873  -7.321  1.00 19.68  ? 19  GLN A HE21 5  
ATOM 9119  H HE22 . GLN A 1 19  ? 4.968   24.280  -8.892  1.00 20.29  ? 19  GLN A HE22 5  
ATOM 9120  N N    . LYS A 1 20  ? 4.808   20.138  -4.325  1.00 18.98  ? 20  LYS A N    5  
ATOM 9121  C CA   . LYS A 1 20  ? 3.450   19.668  -4.020  1.00 17.79  ? 20  LYS A CA   5  
ATOM 9122  C C    . LYS A 1 20  ? 2.478   19.783  -5.229  1.00 16.84  ? 20  LYS A C    5  
ATOM 9123  O O    . LYS A 1 20  ? 2.878   20.162  -6.327  1.00 17.19  ? 20  LYS A O    5  
ATOM 9124  C CB   . LYS A 1 20  ? 2.966   20.481  -2.797  1.00 17.42  ? 20  LYS A CB   5  
ATOM 9125  C CG   . LYS A 1 20  ? 3.776   20.195  -1.514  1.00 18.15  ? 20  LYS A CG   5  
ATOM 9126  C CD   . LYS A 1 20  ? 3.592   21.303  -0.467  1.00 18.39  ? 20  LYS A CD   5  
ATOM 9127  C CE   . LYS A 1 20  ? 4.306   20.922  0.837   1.00 19.29  ? 20  LYS A CE   5  
ATOM 9128  N NZ   . LYS A 1 20  ? 4.451   22.078  1.752   1.00 19.75  ? 20  LYS A NZ   5  
ATOM 9129  H H    . LYS A 1 20  ? 5.026   21.074  -4.018  1.00 19.09  ? 20  LYS A H    5  
ATOM 9130  H HA   . LYS A 1 20  ? 3.489   18.611  -3.754  1.00 18.12  ? 20  LYS A HA   5  
ATOM 9131  H HB2  . LYS A 1 20  ? 3.036   21.542  -3.044  1.00 17.32  ? 20  LYS A HB2  5  
ATOM 9132  H HB3  . LYS A 1 20  ? 1.919   20.260  -2.584  1.00 16.94  ? 20  LYS A HB3  5  
ATOM 9133  H HG2  . LYS A 1 20  ? 3.458   19.237  -1.101  1.00 18.15  ? 20  LYS A HG2  5  
ATOM 9134  H HG3  . LYS A 1 20  ? 4.841   20.137  -1.743  1.00 18.81  ? 20  LYS A HG3  5  
ATOM 9135  H HD2  . LYS A 1 20  ? 3.995   22.241  -0.861  1.00 18.61  ? 20  LYS A HD2  5  
ATOM 9136  H HD3  . LYS A 1 20  ? 2.531   21.438  -0.260  1.00 17.95  ? 20  LYS A HD3  5  
ATOM 9137  H HE2  . LYS A 1 20  ? 3.763   20.106  1.327   1.00 19.25  ? 20  LYS A HE2  5  
ATOM 9138  H HE3  . LYS A 1 20  ? 5.309   20.561  0.598   1.00 19.93  ? 20  LYS A HE3  5  
ATOM 9139  H HZ1  . LYS A 1 20  ? 4.751   21.743  2.670   1.00 20.46  ? 20  LYS A HZ1  5  
ATOM 9140  H HZ2  . LYS A 1 20  ? 5.143   22.740  1.426   1.00 20.08  ? 20  LYS A HZ2  5  
ATOM 9141  H HZ3  . LYS A 1 20  ? 3.564   22.542  1.899   1.00 19.28  ? 20  LYS A HZ3  5  
ATOM 9142  N N    . ALA A 1 21  ? 1.187   19.483  -5.026  1.00 15.82  ? 21  ALA A N    5  
ATOM 9143  C CA   . ALA A 1 21  ? 0.129   19.509  -6.052  1.00 15.02  ? 21  ALA A CA   5  
ATOM 9144  C C    . ALA A 1 21  ? -1.270  19.739  -5.439  1.00 13.83  ? 21  ALA A C    5  
ATOM 9145  O O    . ALA A 1 21  ? -1.450  19.556  -4.234  1.00 13.77  ? 21  ALA A O    5  
ATOM 9146  C CB   . ALA A 1 21  ? 0.182   18.187  -6.832  1.00 15.60  ? 21  ALA A CB   5  
ATOM 9147  H H    . ALA A 1 21  ? 0.895   19.239  -4.091  1.00 15.74  ? 21  ALA A H    5  
ATOM 9148  H HA   . ALA A 1 21  ? 0.323   20.332  -6.746  1.00 15.16  ? 21  ALA A HA   5  
ATOM 9149  H HB1  . ALA A 1 21  ? 1.156   18.076  -7.312  1.00 16.21  ? 21  ALA A HB1  5  
ATOM 9150  H HB2  . ALA A 1 21  ? 0.008   17.342  -6.163  1.00 15.68  ? 21  ALA A HB2  5  
ATOM 9151  H HB3  . ALA A 1 21  ? -0.588  18.183  -7.605  1.00 15.61  ? 21  ALA A HB3  5  
ATOM 9152  N N    . GLY A 1 22  ? -2.253  20.121  -6.267  1.00 13.15  ? 22  GLY A N    5  
ATOM 9153  C CA   . GLY A 1 22  ? -3.622  20.447  -5.840  1.00 12.16  ? 22  GLY A CA   5  
ATOM 9154  C C    . GLY A 1 22  ? -4.624  19.322  -6.114  1.00 11.32  ? 22  GLY A C    5  
ATOM 9155  O O    . GLY A 1 22  ? -5.038  19.103  -7.256  1.00 11.27  ? 22  GLY A O    5  
ATOM 9156  H H    . GLY A 1 22  ? -2.040  20.219  -7.256  1.00 13.51  ? 22  GLY A H    5  
ATOM 9157  H HA2  . GLY A 1 22  ? -3.636  20.680  -4.773  1.00 12.17  ? 22  GLY A HA2  5  
ATOM 9158  H HA3  . GLY A 1 22  ? -3.971  21.324  -6.390  1.00 12.22  ? 22  GLY A HA3  5  
ATOM 9159  N N    . ALA A 1 23  ? -5.063  18.649  -5.047  1.00 10.93  ? 23  ALA A N    5  
ATOM 9160  C CA   . ALA A 1 23  ? -6.175  17.702  -5.075  1.00 10.14  ? 23  ALA A CA   5  
ATOM 9161  C C    . ALA A 1 23  ? -7.531  18.388  -4.810  1.00 9.02   ? 23  ALA A C    5  
ATOM 9162  O O    . ALA A 1 23  ? -7.612  19.603  -4.603  1.00 9.25   ? 23  ALA A O    5  
ATOM 9163  C CB   . ALA A 1 23  ? -5.877  16.596  -4.056  1.00 10.90  ? 23  ALA A CB   5  
ATOM 9164  H H    . ALA A 1 23  ? -4.674  18.883  -4.146  1.00 11.32  ? 23  ALA A H    5  
ATOM 9165  H HA   . ALA A 1 23  ? -6.230  17.245  -6.065  1.00 10.28  ? 23  ALA A HA   5  
ATOM 9166  H HB1  . ALA A 1 23  ? -5.927  17.012  -3.050  1.00 11.14  ? 23  ALA A HB1  5  
ATOM 9167  H HB2  . ALA A 1 23  ? -6.603  15.789  -4.139  1.00 10.83  ? 23  ALA A HB2  5  
ATOM 9168  H HB3  . ALA A 1 23  ? -4.880  16.186  -4.226  1.00 11.72  ? 23  ALA A HB3  5  
ATOM 9169  N N    . GLN A 1 24  ? -8.587  17.576  -4.795  1.00 8.29   ? 24  GLN A N    5  
ATOM 9170  C CA   . GLN A 1 24  ? -9.986  17.959  -4.633  1.00 7.59   ? 24  GLN A CA   5  
ATOM 9171  C C    . GLN A 1 24  ? -10.805 16.739  -4.187  1.00 7.25   ? 24  GLN A C    5  
ATOM 9172  O O    . GLN A 1 24  ? -10.328 15.605  -4.272  1.00 7.65   ? 24  GLN A O    5  
ATOM 9173  C CB   . GLN A 1 24  ? -10.511 18.564  -5.951  1.00 7.38   ? 24  GLN A CB   5  
ATOM 9174  C CG   . GLN A 1 24  ? -10.588 17.554  -7.122  1.00 7.85   ? 24  GLN A CG   5  
ATOM 9175  C CD   . GLN A 1 24  ? -10.588 18.211  -8.504  1.00 8.54   ? 24  GLN A CD   5  
ATOM 9176  O OE1  . GLN A 1 24  ? -10.663 19.422  -8.666  1.00 8.70   ? 24  GLN A OE1  5  
ATOM 9177  N NE2  . GLN A 1 24  ? -10.420 17.454  -9.581  1.00 9.53   ? 24  GLN A NE2  5  
ATOM 9178  H H    . GLN A 1 24  ? -8.421  16.585  -4.892  1.00 8.55   ? 24  GLN A H    5  
ATOM 9179  H HA   . GLN A 1 24  ? -10.053 18.723  -3.851  1.00 8.07   ? 24  GLN A HA   5  
ATOM 9180  H HB2  . GLN A 1 24  ? -11.505 18.984  -5.791  1.00 7.05   ? 24  GLN A HB2  5  
ATOM 9181  H HB3  . GLN A 1 24  ? -9.852  19.388  -6.232  1.00 8.01   ? 24  GLN A HB3  5  
ATOM 9182  H HG2  . GLN A 1 24  ? -9.727  16.887  -7.086  1.00 8.49   ? 24  GLN A HG2  5  
ATOM 9183  H HG3  . GLN A 1 24  ? -11.486 16.943  -7.018  1.00 7.76   ? 24  GLN A HG3  5  
ATOM 9184  H HE21 . GLN A 1 24  ? -10.285 16.459  -9.496  1.00 9.87   ? 24  GLN A HE21 5  
ATOM 9185  H HE22 . GLN A 1 24  ? -10.224 17.958  -10.429 1.00 10.24  ? 24  GLN A HE22 5  
ATOM 9186  N N    . ALA A 1 25  ? -12.033 16.956  -3.716  1.00 6.90   ? 25  ALA A N    5  
ATOM 9187  C CA   . ALA A 1 25  ? -12.959 15.891  -3.329  1.00 6.74   ? 25  ALA A CA   5  
ATOM 9188  C C    . ALA A 1 25  ? -13.728 15.335  -4.544  1.00 5.91   ? 25  ALA A C    5  
ATOM 9189  O O    . ALA A 1 25  ? -14.067 16.077  -5.468  1.00 6.19   ? 25  ALA A O    5  
ATOM 9190  C CB   . ALA A 1 25  ? -13.915 16.450  -2.272  1.00 7.67   ? 25  ALA A CB   5  
ATOM 9191  H H    . ALA A 1 25  ? -12.393 17.898  -3.707  1.00 7.00   ? 25  ALA A H    5  
ATOM 9192  H HA   . ALA A 1 25  ? -12.393 15.072  -2.879  1.00 7.01   ? 25  ALA A HA   5  
ATOM 9193  H HB1  . ALA A 1 25  ? -14.499 17.272  -2.691  1.00 7.78   ? 25  ALA A HB1  5  
ATOM 9194  H HB2  . ALA A 1 25  ? -14.597 15.664  -1.945  1.00 7.88   ? 25  ALA A HB2  5  
ATOM 9195  H HB3  . ALA A 1 25  ? -13.350 16.810  -1.412  1.00 8.60   ? 25  ALA A HB3  5  
ATOM 9196  N N    . LEU A 1 26  ? -14.037 14.032  -4.536  1.00 5.26   ? 26  LEU A N    5  
ATOM 9197  C CA   . LEU A 1 26  ? -14.766 13.344  -5.612  1.00 4.72   ? 26  LEU A CA   5  
ATOM 9198  C C    . LEU A 1 26  ? -15.703 12.272  -5.026  1.00 4.44   ? 26  LEU A C    5  
ATOM 9199  O O    . LEU A 1 26  ? -15.338 11.643  -4.030  1.00 4.41   ? 26  LEU A O    5  
ATOM 9200  C CB   . LEU A 1 26  ? -13.757 12.688  -6.585  1.00 4.65   ? 26  LEU A CB   5  
ATOM 9201  C CG   . LEU A 1 26  ? -12.949 13.652  -7.482  1.00 5.54   ? 26  LEU A CG   5  
ATOM 9202  C CD1  . LEU A 1 26  ? -11.857 12.866  -8.222  1.00 6.29   ? 26  LEU A CD1  5  
ATOM 9203  C CD2  . LEU A 1 26  ? -13.840 14.372  -8.508  1.00 6.19   ? 26  LEU A CD2  5  
ATOM 9204  H H    . LEU A 1 26  ? -13.787 13.477  -3.729  1.00 5.45   ? 26  LEU A H    5  
ATOM 9205  H HA   . LEU A 1 26  ? -15.367 14.075  -6.147  1.00 5.18   ? 26  LEU A HA   5  
ATOM 9206  H HB2  . LEU A 1 26  ? -13.054 12.098  -5.993  1.00 4.69   ? 26  LEU A HB2  5  
ATOM 9207  H HB3  . LEU A 1 26  ? -14.293 11.994  -7.235  1.00 4.45   ? 26  LEU A HB3  5  
ATOM 9208  H HG   . LEU A 1 26  ? -12.453 14.397  -6.861  1.00 5.91   ? 26  LEU A HG   5  
ATOM 9209  H HD11 . LEU A 1 26  ? -11.192 12.391  -7.501  1.00 6.79   ? 26  LEU A HD11 5  
ATOM 9210  H HD12 . LEU A 1 26  ? -12.307 12.097  -8.853  1.00 6.48   ? 26  LEU A HD12 5  
ATOM 9211  H HD13 . LEU A 1 26  ? -11.269 13.541  -8.844  1.00 6.89   ? 26  LEU A HD13 5  
ATOM 9212  H HD21 . LEU A 1 26  ? -14.575 14.996  -8.000  1.00 6.34   ? 26  LEU A HD21 5  
ATOM 9213  H HD22 . LEU A 1 26  ? -13.228 15.013  -9.141  1.00 7.08   ? 26  LEU A HD22 5  
ATOM 9214  H HD23 . LEU A 1 26  ? -14.359 13.643  -9.131  1.00 6.40   ? 26  LEU A HD23 5  
ATOM 9215  N N    . PRO A 1 27  ? -16.867 11.995  -5.652  1.00 4.71   ? 27  PRO A N    5  
ATOM 9216  C CA   . PRO A 1 27  ? -17.767 10.918  -5.250  1.00 4.90   ? 27  PRO A CA   5  
ATOM 9217  C C    . PRO A 1 27  ? -17.182 9.556   -5.664  1.00 4.14   ? 27  PRO A C    5  
ATOM 9218  O O    . PRO A 1 27  ? -17.615 8.943   -6.638  1.00 4.37   ? 27  PRO A O    5  
ATOM 9219  C CB   . PRO A 1 27  ? -19.107 11.252  -5.920  1.00 6.00   ? 27  PRO A CB   5  
ATOM 9220  C CG   . PRO A 1 27  ? -18.683 11.943  -7.215  1.00 6.11   ? 27  PRO A CG   5  
ATOM 9221  C CD   . PRO A 1 27  ? -17.418 12.701  -6.805  1.00 5.43   ? 27  PRO A CD   5  
ATOM 9222  H HA   . PRO A 1 27  ? -17.905 10.924  -4.166  1.00 5.19   ? 27  PRO A HA   5  
ATOM 9223  H HB2  . PRO A 1 27  ? -19.721 10.370  -6.106  1.00 6.33   ? 27  PRO A HB2  5  
ATOM 9224  H HB3  . PRO A 1 27  ? -19.657 11.959  -5.298  1.00 6.61   ? 27  PRO A HB3  5  
ATOM 9225  H HG2  . PRO A 1 27  ? -18.434 11.194  -7.969  1.00 6.00   ? 27  PRO A HG2  5  
ATOM 9226  H HG3  . PRO A 1 27  ? -19.454 12.615  -7.588  1.00 7.00   ? 27  PRO A HG3  5  
ATOM 9227  H HD2  . PRO A 1 27  ? -16.708 12.723  -7.635  1.00 5.36   ? 27  PRO A HD2  5  
ATOM 9228  H HD3  . PRO A 1 27  ? -17.684 13.716  -6.506  1.00 5.90   ? 27  PRO A HD3  5  
ATOM 9229  N N    . VAL A 1 28  ? -16.151 9.112   -4.941  1.00 3.55   ? 28  VAL A N    5  
ATOM 9230  C CA   . VAL A 1 28  ? -15.453 7.835   -5.159  1.00 2.85   ? 28  VAL A CA   5  
ATOM 9231  C C    . VAL A 1 28  ? -14.685 7.447   -3.887  1.00 2.81   ? 28  VAL A C    5  
ATOM 9232  O O    . VAL A 1 28  ? -14.179 8.330   -3.191  1.00 3.32   ? 28  VAL A O    5  
ATOM 9233  C CB   . VAL A 1 28  ? -14.544 7.903   -6.414  1.00 2.55   ? 28  VAL A CB   5  
ATOM 9234  C CG1  . VAL A 1 28  ? -13.284 8.762   -6.216  1.00 3.11   ? 28  VAL A CG1  5  
ATOM 9235  C CG2  . VAL A 1 28  ? -14.160 6.500   -6.902  1.00 2.55   ? 28  VAL A CG2  5  
ATOM 9236  H H    . VAL A 1 28  ? -15.783 9.711   -4.196  1.00 3.81   ? 28  VAL A H    5  
ATOM 9237  H HA   . VAL A 1 28  ? -16.219 7.081   -5.334  1.00 2.98   ? 28  VAL A HA   5  
ATOM 9238  H HB   . VAL A 1 28  ? -15.111 8.360   -7.227  1.00 2.85   ? 28  VAL A HB   5  
ATOM 9239  H HG11 . VAL A 1 28  ? -12.604 8.289   -5.505  1.00 3.47   ? 28  VAL A HG11 5  
ATOM 9240  H HG12 . VAL A 1 28  ? -12.769 8.883   -7.170  1.00 3.32   ? 28  VAL A HG12 5  
ATOM 9241  H HG13 . VAL A 1 28  ? -13.562 9.747   -5.843  1.00 4.03   ? 28  VAL A HG13 5  
ATOM 9242  H HG21 . VAL A 1 28  ? -15.064 5.908   -7.047  1.00 3.21   ? 28  VAL A HG21 5  
ATOM 9243  H HG22 . VAL A 1 28  ? -13.633 6.574   -7.854  1.00 2.56   ? 28  VAL A HG22 5  
ATOM 9244  H HG23 . VAL A 1 28  ? -13.516 6.005   -6.178  1.00 3.26   ? 28  VAL A HG23 5  
ATOM 9245  N N    . THR A 1 29  ? -14.618 6.144   -3.580  1.00 2.50   ? 29  THR A N    5  
ATOM 9246  C CA   . THR A 1 29  ? -13.928 5.590   -2.404  1.00 2.52   ? 29  THR A CA   5  
ATOM 9247  C C    . THR A 1 29  ? -12.502 5.203   -2.787  1.00 2.07   ? 29  THR A C    5  
ATOM 9248  O O    . THR A 1 29  ? -12.151 5.059   -3.953  1.00 2.47   ? 29  THR A O    5  
ATOM 9249  C CB   . THR A 1 29  ? -14.746 4.422   -1.824  1.00 3.04   ? 29  THR A CB   5  
ATOM 9250  O OG1  . THR A 1 29  ? -15.933 4.948   -1.290  1.00 3.67   ? 29  THR A OG1  5  
ATOM 9251  C CG2  . THR A 1 29  ? -14.100 3.668   -0.657  1.00 3.67   ? 29  THR A CG2  5  
ATOM 9252  H H    . THR A 1 29  ? -14.989 5.482   -4.246  1.00 2.44   ? 29  THR A H    5  
ATOM 9253  H HA   . THR A 1 29  ? -13.870 6.369   -1.642  1.00 3.06   ? 29  THR A HA   5  
ATOM 9254  H HB   . THR A 1 29  ? -14.996 3.723   -2.620  1.00 3.27   ? 29  THR A HB   5  
ATOM 9255  H HG1  . THR A 1 29  ? -16.585 4.212   -1.254  1.00 4.17   ? 29  THR A HG1  5  
ATOM 9256  H HG21 . THR A 1 29  ? -13.237 3.099   -1.000  1.00 4.09   ? 29  THR A HG21 5  
ATOM 9257  H HG22 . THR A 1 29  ? -13.808 4.367   0.126   1.00 4.19   ? 29  THR A HG22 5  
ATOM 9258  H HG23 . THR A 1 29  ? -14.817 2.958   -0.244  1.00 4.27   ? 29  THR A HG23 5  
ATOM 9259  N N    . VAL A 1 30  ? -11.642 5.077   -1.785  1.00 2.09   ? 30  VAL A N    5  
ATOM 9260  C CA   . VAL A 1 30  ? -10.194 4.988   -1.928  1.00 2.27   ? 30  VAL A CA   5  
ATOM 9261  C C    . VAL A 1 30  ? -9.611  4.041   -0.886  1.00 1.79   ? 30  VAL A C    5  
ATOM 9262  O O    . VAL A 1 30  ? -10.199 3.810   0.168   1.00 2.13   ? 30  VAL A O    5  
ATOM 9263  C CB   . VAL A 1 30  ? -9.519  6.375   -1.822  1.00 3.54   ? 30  VAL A CB   5  
ATOM 9264  C CG1  . VAL A 1 30  ? -9.805  7.246   -3.056  1.00 4.77   ? 30  VAL A CG1  5  
ATOM 9265  C CG2  . VAL A 1 30  ? -9.878  7.141   -0.536  1.00 4.38   ? 30  VAL A CG2  5  
ATOM 9266  H H    . VAL A 1 30  ? -12.002 5.085   -0.845  1.00 2.52   ? 30  VAL A H    5  
ATOM 9267  H HA   . VAL A 1 30  ? -9.960  4.569   -2.908  1.00 2.46   ? 30  VAL A HA   5  
ATOM 9268  H HB   . VAL A 1 30  ? -8.448  6.192   -1.799  1.00 3.96   ? 30  VAL A HB   5  
ATOM 9269  H HG11 . VAL A 1 30  ? -9.201  8.153   -3.012  1.00 5.45   ? 30  VAL A HG11 5  
ATOM 9270  H HG12 . VAL A 1 30  ? -9.548  6.701   -3.964  1.00 5.37   ? 30  VAL A HG12 5  
ATOM 9271  H HG13 . VAL A 1 30  ? -10.858 7.527   -3.090  1.00 5.16   ? 30  VAL A HG13 5  
ATOM 9272  H HG21 . VAL A 1 30  ? -10.943 7.373   -0.513  1.00 4.69   ? 30  VAL A HG21 5  
ATOM 9273  H HG22 . VAL A 1 30  ? -9.620  6.547   0.341   1.00 4.93   ? 30  VAL A HG22 5  
ATOM 9274  H HG23 . VAL A 1 30  ? -9.315  8.074   -0.497  1.00 5.17   ? 30  VAL A HG23 5  
ATOM 9275  N N    . GLN A 1 31  ? -8.431  3.520   -1.220  1.00 1.73   ? 31  GLN A N    5  
ATOM 9276  C CA   . GLN A 1 31  ? -7.664  2.547   -0.450  1.00 1.85   ? 31  GLN A CA   5  
ATOM 9277  C C    . GLN A 1 31  ? -7.448  2.892   1.024   1.00 1.91   ? 31  GLN A C    5  
ATOM 9278  O O    . GLN A 1 31  ? -7.346  1.974   1.834   1.00 3.17   ? 31  GLN A O    5  
ATOM 9279  C CB   . GLN A 1 31  ? -6.301  2.358   -1.144  1.00 2.24   ? 31  GLN A CB   5  
ATOM 9280  C CG   . GLN A 1 31  ? -5.461  3.639   -1.356  1.00 2.25   ? 31  GLN A CG   5  
ATOM 9281  C CD   . GLN A 1 31  ? -4.116  3.374   -2.048  1.00 2.45   ? 31  GLN A CD   5  
ATOM 9282  O OE1  . GLN A 1 31  ? -3.058  3.681   -1.537  1.00 3.32   ? 31  GLN A OE1  5  
ATOM 9283  N NE2  . GLN A 1 31  ? -4.098  2.789   -3.221  1.00 2.24   ? 31  GLN A NE2  5  
ATOM 9284  H H    . GLN A 1 31  ? -8.097  3.730   -2.147  1.00 2.14   ? 31  GLN A H    5  
ATOM 9285  H HA   . GLN A 1 31  ? -8.203  1.600   -0.454  1.00 2.22   ? 31  GLN A HA   5  
ATOM 9286  H HB2  . GLN A 1 31  ? -5.728  1.682   -0.517  1.00 2.48   ? 31  GLN A HB2  5  
ATOM 9287  H HB3  . GLN A 1 31  ? -6.467  1.886   -2.111  1.00 2.73   ? 31  GLN A HB3  5  
ATOM 9288  H HG2  . GLN A 1 31  ? -6.013  4.345   -1.972  1.00 2.79   ? 31  GLN A HG2  5  
ATOM 9289  H HG3  . GLN A 1 31  ? -5.255  4.108   -0.393  1.00 2.50   ? 31  GLN A HG3  5  
ATOM 9290  H HE21 . GLN A 1 31  ? -4.938  2.492   -3.685  1.00 2.16   ? 31  GLN A HE21 5  
ATOM 9291  H HE22 . GLN A 1 31  ? -3.181  2.641   -3.621  1.00 2.67   ? 31  GLN A HE22 5  
ATOM 9292  N N    . GLY A 1 32  ? -7.322  4.183   1.343   1.00 1.61   ? 32  GLY A N    5  
ATOM 9293  C CA   . GLY A 1 32  ? -7.023  4.733   2.674   1.00 1.61   ? 32  GLY A CA   5  
ATOM 9294  C C    . GLY A 1 32  ? -5.571  4.510   3.092   1.00 1.56   ? 32  GLY A C    5  
ATOM 9295  O O    . GLY A 1 32  ? -4.894  5.462   3.466   1.00 2.39   ? 32  GLY A O    5  
ATOM 9296  H H    . GLY A 1 32  ? -7.423  4.832   0.581   1.00 2.35   ? 32  GLY A H    5  
ATOM 9297  H HA2  . GLY A 1 32  ? -7.224  5.804   2.686   1.00 1.79   ? 32  GLY A HA2  5  
ATOM 9298  H HA3  . GLY A 1 32  ? -7.655  4.238   3.413   1.00 1.80   ? 32  GLY A HA3  5  
ATOM 9299  N N    . ALA A 1 33  ? -5.140  3.249   3.004   1.00 1.13   ? 33  ALA A N    5  
ATOM 9300  C CA   . ALA A 1 33  ? -3.903  2.623   3.467   1.00 1.16   ? 33  ALA A CA   5  
ATOM 9301  C C    . ALA A 1 33  ? -4.009  2.275   4.961   1.00 1.03   ? 33  ALA A C    5  
ATOM 9302  O O    . ALA A 1 33  ? -4.217  3.149   5.806   1.00 1.32   ? 33  ALA A O    5  
ATOM 9303  C CB   . ALA A 1 33  ? -2.651  3.434   3.105   1.00 1.50   ? 33  ALA A CB   5  
ATOM 9304  H H    . ALA A 1 33  ? -5.859  2.614   2.678   1.00 1.42   ? 33  ALA A H    5  
ATOM 9305  H HA   . ALA A 1 33  ? -3.821  1.678   2.934   1.00 1.26   ? 33  ALA A HA   5  
ATOM 9306  H HB1  . ALA A 1 33  ? -1.761  2.910   3.455   1.00 2.49   ? 33  ALA A HB1  5  
ATOM 9307  H HB2  . ALA A 1 33  ? -2.591  3.569   2.024   1.00 2.17   ? 33  ALA A HB2  5  
ATOM 9308  H HB3  . ALA A 1 33  ? -2.683  4.407   3.585   1.00 1.49   ? 33  ALA A HB3  5  
ATOM 9309  N N    . THR A 1 34  ? -3.872  0.977   5.259   1.00 1.01   ? 34  THR A N    5  
ATOM 9310  C CA   . THR A 1 34  ? -4.034  0.406   6.603   1.00 0.95   ? 34  THR A CA   5  
ATOM 9311  C C    . THR A 1 34  ? -2.794  -0.384  6.958   1.00 0.90   ? 34  THR A C    5  
ATOM 9312  O O    . THR A 1 34  ? -2.427  -1.280  6.206   1.00 1.04   ? 34  THR A O    5  
ATOM 9313  C CB   . THR A 1 34  ? -5.221  -0.548  6.692   1.00 1.12   ? 34  THR A CB   5  
ATOM 9314  O OG1  . THR A 1 34  ? -6.376  0.070   6.186   1.00 1.50   ? 34  THR A OG1  5  
ATOM 9315  C CG2  . THR A 1 34  ? -5.524  -0.932  8.137   1.00 1.51   ? 34  THR A CG2  5  
ATOM 9316  H H    . THR A 1 34  ? -3.681  0.331   4.503   1.00 1.28   ? 34  THR A H    5  
ATOM 9317  H HA   . THR A 1 34  ? -4.208  1.203   7.318   1.00 0.95   ? 34  THR A HA   5  
ATOM 9318  H HB   . THR A 1 34  ? -4.991  -1.450  6.131   1.00 1.18   ? 34  THR A HB   5  
ATOM 9319  H HG1  . THR A 1 34  ? -6.554  -0.298  5.315   1.00 2.06   ? 34  THR A HG1  5  
ATOM 9320  H HG21 . THR A 1 34  ? -4.701  -1.506  8.563   1.00 2.55   ? 34  THR A HG21 5  
ATOM 9321  H HG22 . THR A 1 34  ? -5.681  -0.028  8.726   1.00 1.70   ? 34  THR A HG22 5  
ATOM 9322  H HG23 . THR A 1 34  ? -6.425  -1.545  8.165   1.00 2.23   ? 34  THR A HG23 5  
ATOM 9323  N N    . VAL A 1 35  ? -2.197  -0.088  8.102   1.00 0.77   ? 35  VAL A N    5  
ATOM 9324  C CA   . VAL A 1 35  ? -1.050  -0.847  8.650   1.00 0.73   ? 35  VAL A CA   5  
ATOM 9325  C C    . VAL A 1 35  ? -1.538  -2.014  9.513   1.00 0.76   ? 35  VAL A C    5  
ATOM 9326  O O    . VAL A 1 35  ? -2.463  -1.839  10.305  1.00 0.83   ? 35  VAL A O    5  
ATOM 9327  C CB   . VAL A 1 35  ? -0.116  0.040   9.501   1.00 0.80   ? 35  VAL A CB   5  
ATOM 9328  C CG1  . VAL A 1 35  ? 1.153   -0.727  9.914   1.00 1.08   ? 35  VAL A CG1  5  
ATOM 9329  C CG2  . VAL A 1 35  ? 0.299   1.323   8.754   1.00 0.89   ? 35  VAL A CG2  5  
ATOM 9330  H H    . VAL A 1 35  ? -2.601  0.691   8.623   1.00 0.77   ? 35  VAL A H    5  
ATOM 9331  H HA   . VAL A 1 35  ? -0.470  -1.244  7.818   1.00 0.73   ? 35  VAL A HA   5  
ATOM 9332  H HB   . VAL A 1 35  ? -0.647  0.306   10.416  1.00 0.98   ? 35  VAL A HB   5  
ATOM 9333  H HG11 . VAL A 1 35  ? 0.907   -1.492  10.648  1.00 2.24   ? 35  VAL A HG11 5  
ATOM 9334  H HG12 . VAL A 1 35  ? 1.606   -1.201  9.043   1.00 1.65   ? 35  VAL A HG12 5  
ATOM 9335  H HG13 . VAL A 1 35  ? 1.873   -0.051  10.371  1.00 1.73   ? 35  VAL A HG13 5  
ATOM 9336  H HG21 . VAL A 1 35  ? -0.573  1.944   8.549   1.00 1.55   ? 35  VAL A HG21 5  
ATOM 9337  H HG22 . VAL A 1 35  ? 0.986   1.907   9.366   1.00 2.00   ? 35  VAL A HG22 5  
ATOM 9338  H HG23 . VAL A 1 35  ? 0.786   1.071   7.812   1.00 1.52   ? 35  VAL A HG23 5  
ATOM 9339  N N    . ALA A 1 36  ? -0.901  -3.185  9.442   1.00 0.77   ? 36  ALA A N    5  
ATOM 9340  C CA   . ALA A 1 36  ? -1.142  -4.253  10.410  1.00 0.91   ? 36  ALA A CA   5  
ATOM 9341  C C    . ALA A 1 36  ? -0.413  -3.958  11.741  1.00 1.03   ? 36  ALA A C    5  
ATOM 9342  O O    . ALA A 1 36  ? 0.813   -4.064  11.816  1.00 1.55   ? 36  ALA A O    5  
ATOM 9343  C CB   . ALA A 1 36  ? -0.733  -5.590  9.777   1.00 1.07   ? 36  ALA A CB   5  
ATOM 9344  H H    . ALA A 1 36  ? -0.140  -3.301  8.774   1.00 0.77   ? 36  ALA A H    5  
ATOM 9345  H HA   . ALA A 1 36  ? -2.211  -4.306  10.624  1.00 0.94   ? 36  ALA A HA   5  
ATOM 9346  H HB1  . ALA A 1 36  ? -1.334  -5.776  8.886   1.00 1.70   ? 36  ALA A HB1  5  
ATOM 9347  H HB2  . ALA A 1 36  ? 0.319   -5.559  9.492   1.00 1.61   ? 36  ALA A HB2  5  
ATOM 9348  H HB3  . ALA A 1 36  ? -0.884  -6.401  10.490  1.00 2.00   ? 36  ALA A HB3  5  
ATOM 9349  N N    . ALA A 1 37  ? -1.168  -3.576  12.779  1.00 0.95   ? 37  ALA A N    5  
ATOM 9350  C CA   . ALA A 1 37  ? -0.683  -3.474  14.163  1.00 1.03   ? 37  ALA A CA   5  
ATOM 9351  C C    . ALA A 1 37  ? 0.200   -4.671  14.583  1.00 1.04   ? 37  ALA A C    5  
ATOM 9352  O O    . ALA A 1 37  ? -0.132  -5.820  14.299  1.00 1.16   ? 37  ALA A O    5  
ATOM 9353  C CB   . ALA A 1 37  ? -1.890  -3.351  15.108  1.00 1.26   ? 37  ALA A CB   5  
ATOM 9354  H H    . ALA A 1 37  ? -2.124  -3.302  12.577  1.00 1.15   ? 37  ALA A H    5  
ATOM 9355  H HA   . ALA A 1 37  ? -0.080  -2.568  14.246  1.00 1.06   ? 37  ALA A HA   5  
ATOM 9356  H HB1  . ALA A 1 37  ? -2.503  -2.493  14.842  1.00 1.54   ? 37  ALA A HB1  5  
ATOM 9357  H HB2  . ALA A 1 37  ? -2.498  -4.256  15.047  1.00 2.37   ? 37  ALA A HB2  5  
ATOM 9358  H HB3  . ALA A 1 37  ? -1.540  -3.230  16.135  1.00 2.00   ? 37  ALA A HB3  5  
ATOM 9359  N N    . VAL A 1 38  ? 1.278   -4.381  15.312  1.00 1.06   ? 38  VAL A N    5  
ATOM 9360  C CA   . VAL A 1 38  ? 2.260   -5.355  15.830  1.00 1.11   ? 38  VAL A CA   5  
ATOM 9361  C C    . VAL A 1 38  ? 2.738   -4.928  17.230  1.00 1.23   ? 38  VAL A C    5  
ATOM 9362  O O    . VAL A 1 38  ? 2.706   -3.731  17.525  1.00 1.32   ? 38  VAL A O    5  
ATOM 9363  C CB   . VAL A 1 38  ? 3.484   -5.510  14.888  1.00 1.13   ? 38  VAL A CB   5  
ATOM 9364  C CG1  . VAL A 1 38  ? 3.154   -6.423  13.698  1.00 2.29   ? 38  VAL A CG1  5  
ATOM 9365  C CG2  . VAL A 1 38  ? 4.056   -4.168  14.398  1.00 1.86   ? 38  VAL A CG2  5  
ATOM 9366  H H    . VAL A 1 38  ? 1.445   -3.406  15.519  1.00 1.10   ? 38  VAL A H    5  
ATOM 9367  H HA   . VAL A 1 38  ? 1.768   -6.327  15.922  1.00 1.19   ? 38  VAL A HA   5  
ATOM 9368  H HB   . VAL A 1 38  ? 4.270   -6.009  15.451  1.00 2.19   ? 38  VAL A HB   5  
ATOM 9369  H HG11 . VAL A 1 38  ? 4.053   -6.599  13.107  1.00 3.03   ? 38  VAL A HG11 5  
ATOM 9370  H HG12 . VAL A 1 38  ? 2.786   -7.384  14.061  1.00 3.04   ? 38  VAL A HG12 5  
ATOM 9371  H HG13 . VAL A 1 38  ? 2.395   -5.963  13.068  1.00 2.95   ? 38  VAL A HG13 5  
ATOM 9372  H HG21 . VAL A 1 38  ? 4.974   -4.344  13.835  1.00 2.41   ? 38  VAL A HG21 5  
ATOM 9373  H HG22 . VAL A 1 38  ? 3.342   -3.658  13.750  1.00 2.75   ? 38  VAL A HG22 5  
ATOM 9374  H HG23 . VAL A 1 38  ? 4.291   -3.526  15.246  1.00 2.76   ? 38  VAL A HG23 5  
ATOM 9375  N N    . PRO A 1 39  ? 3.177   -5.860  18.102  1.00 1.34   ? 39  PRO A N    5  
ATOM 9376  C CA   . PRO A 1 39  ? 3.657   -5.546  19.451  1.00 1.49   ? 39  PRO A CA   5  
ATOM 9377  C C    . PRO A 1 39  ? 5.029   -4.839  19.413  1.00 1.42   ? 39  PRO A C    5  
ATOM 9378  O O    . PRO A 1 39  ? 5.773   -5.020  18.452  1.00 1.33   ? 39  PRO A O    5  
ATOM 9379  C CB   . PRO A 1 39  ? 3.722   -6.895  20.179  1.00 1.66   ? 39  PRO A CB   5  
ATOM 9380  C CG   . PRO A 1 39  ? 3.987   -7.893  19.052  1.00 1.65   ? 39  PRO A CG   5  
ATOM 9381  C CD   . PRO A 1 39  ? 3.202   -7.301  17.883  1.00 1.46   ? 39  PRO A CD   5  
ATOM 9382  H HA   . PRO A 1 39  ? 2.928   -4.904  19.947  1.00 1.65   ? 39  PRO A HA   5  
ATOM 9383  H HB2  . PRO A 1 39  ? 4.509   -6.927  20.936  1.00 1.73   ? 39  PRO A HB2  5  
ATOM 9384  H HB3  . PRO A 1 39  ? 2.752   -7.112  20.627  1.00 1.85   ? 39  PRO A HB3  5  
ATOM 9385  H HG2  . PRO A 1 39  ? 5.050   -7.896  18.814  1.00 1.64   ? 39  PRO A HG2  5  
ATOM 9386  H HG3  . PRO A 1 39  ? 3.645   -8.897  19.306  1.00 1.93   ? 39  PRO A HG3  5  
ATOM 9387  H HD2  . PRO A 1 39  ? 3.685   -7.565  16.943  1.00 1.41   ? 39  PRO A HD2  5  
ATOM 9388  H HD3  . PRO A 1 39  ? 2.183   -7.686  17.894  1.00 1.61   ? 39  PRO A HD3  5  
ATOM 9389  N N    . PRO A 1 40  ? 5.415   -4.077  20.459  1.00 1.59   ? 40  PRO A N    5  
ATOM 9390  C CA   . PRO A 1 40  ? 6.618   -3.232  20.454  1.00 1.66   ? 40  PRO A CA   5  
ATOM 9391  C C    . PRO A 1 40  ? 7.954   -3.987  20.343  1.00 1.71   ? 40  PRO A C    5  
ATOM 9392  O O    . PRO A 1 40  ? 8.975   -3.374  20.042  1.00 2.88   ? 40  PRO A O    5  
ATOM 9393  C CB   . PRO A 1 40  ? 6.553   -2.424  21.754  1.00 1.95   ? 40  PRO A CB   5  
ATOM 9394  C CG   . PRO A 1 40  ? 5.652   -3.245  22.672  1.00 2.05   ? 40  PRO A CG   5  
ATOM 9395  C CD   . PRO A 1 40  ? 4.669   -3.883  21.695  1.00 1.87   ? 40  PRO A CD   5  
ATOM 9396  H HA   . PRO A 1 40  ? 6.560   -2.545  19.610  1.00 1.65   ? 40  PRO A HA   5  
ATOM 9397  H HB2  . PRO A 1 40  ? 7.542   -2.292  22.193  1.00 2.06   ? 40  PRO A HB2  5  
ATOM 9398  H HB3  . PRO A 1 40  ? 6.092   -1.455  21.559  1.00 2.07   ? 40  PRO A HB3  5  
ATOM 9399  H HG2  . PRO A 1 40  ? 6.240   -4.023  23.162  1.00 2.10   ? 40  PRO A HG2  5  
ATOM 9400  H HG3  . PRO A 1 40  ? 5.147   -2.624  23.412  1.00 2.28   ? 40  PRO A HG3  5  
ATOM 9401  H HD2  . PRO A 1 40  ? 4.300   -4.826  22.100  1.00 1.97   ? 40  PRO A HD2  5  
ATOM 9402  H HD3  . PRO A 1 40  ? 3.838   -3.199  21.511  1.00 1.97   ? 40  PRO A HD3  5  
ATOM 9403  N N    . SER A 1 41  ? 7.962   -5.304  20.560  1.00 1.88   ? 41  SER A N    5  
ATOM 9404  C CA   . SER A 1 41  ? 9.120   -6.175  20.281  1.00 1.94   ? 41  SER A CA   5  
ATOM 9405  C C    . SER A 1 41  ? 9.230   -6.610  18.803  1.00 1.81   ? 41  SER A C    5  
ATOM 9406  O O    . SER A 1 41  ? 10.138  -7.363  18.455  1.00 2.04   ? 41  SER A O    5  
ATOM 9407  C CB   . SER A 1 41  ? 9.067   -7.411  21.188  1.00 2.19   ? 41  SER A CB   5  
ATOM 9408  O OG   . SER A 1 41  ? 10.295  -8.114  21.164  1.00 2.49   ? 41  SER A OG   5  
ATOM 9409  H H    . SER A 1 41  ? 7.091   -5.731  20.831  1.00 2.86   ? 41  SER A H    5  
ATOM 9410  H HA   . SER A 1 41  ? 10.037  -5.633  20.512  1.00 2.05   ? 41  SER A HA   5  
ATOM 9411  H HB2  . SER A 1 41  ? 8.869   -7.096  22.212  1.00 2.42   ? 41  SER A HB2  5  
ATOM 9412  H HB3  . SER A 1 41  ? 8.262   -8.072  20.861  1.00 2.13   ? 41  SER A HB3  5  
ATOM 9413  H HG   . SER A 1 41  ? 10.499  -8.345  20.238  1.00 2.98   ? 41  SER A HG   5  
ATOM 9414  N N    . ILE A 1 42  ? 8.310   -6.180  17.930  1.00 1.55   ? 42  ILE A N    5  
ATOM 9415  C CA   . ILE A 1 42  ? 8.286   -6.452  16.489  1.00 1.44   ? 42  ILE A CA   5  
ATOM 9416  C C    . ILE A 1 42  ? 8.169   -5.110  15.752  1.00 1.48   ? 42  ILE A C    5  
ATOM 9417  O O    . ILE A 1 42  ? 7.132   -4.455  15.794  1.00 1.99   ? 42  ILE A O    5  
ATOM 9418  C CB   . ILE A 1 42  ? 7.087   -7.375  16.164  1.00 1.54   ? 42  ILE A CB   5  
ATOM 9419  C CG1  . ILE A 1 42  ? 7.143   -8.726  16.913  1.00 2.01   ? 42  ILE A CG1  5  
ATOM 9420  C CG2  . ILE A 1 42  ? 6.936   -7.599  14.647  1.00 1.47   ? 42  ILE A CG2  5  
ATOM 9421  C CD1  . ILE A 1 42  ? 8.263   -9.686  16.486  1.00 2.56   ? 42  ILE A CD1  5  
ATOM 9422  H H    . ILE A 1 42  ? 7.541   -5.608  18.269  1.00 1.50   ? 42  ILE A H    5  
ATOM 9423  H HA   . ILE A 1 42  ? 9.211   -6.942  16.183  1.00 1.43   ? 42  ILE A HA   5  
ATOM 9424  H HB   . ILE A 1 42  ? 6.178   -6.872  16.500  1.00 1.70   ? 42  ILE A HB   5  
ATOM 9425  H HG12 . ILE A 1 42  ? 7.238   -8.549  17.983  1.00 2.20   ? 42  ILE A HG12 5  
ATOM 9426  H HG13 . ILE A 1 42  ? 6.186   -9.221  16.774  1.00 2.31   ? 42  ILE A HG13 5  
ATOM 9427  H HG21 . ILE A 1 42  ? 6.154   -8.334  14.452  1.00 2.08   ? 42  ILE A HG21 5  
ATOM 9428  H HG22 . ILE A 1 42  ? 6.647   -6.667  14.164  1.00 1.83   ? 42  ILE A HG22 5  
ATOM 9429  H HG23 . ILE A 1 42  ? 7.875   -7.948  14.212  1.00 1.88   ? 42  ILE A HG23 5  
ATOM 9430  H HD11 . ILE A 1 42  ? 8.137   -9.977  15.443  1.00 3.38   ? 42  ILE A HD11 5  
ATOM 9431  H HD12 . ILE A 1 42  ? 9.237   -9.217  16.620  1.00 3.20   ? 42  ILE A HD12 5  
ATOM 9432  H HD13 . ILE A 1 42  ? 8.219   -10.583 17.104  1.00 2.87   ? 42  ILE A HD13 5  
ATOM 9433  N N    . ARG A 1 43  ? 9.248   -4.683  15.089  1.00 1.34   ? 43  ARG A N    5  
ATOM 9434  C CA   . ARG A 1 43  ? 9.337   -3.396  14.366  1.00 1.60   ? 43  ARG A CA   5  
ATOM 9435  C C    . ARG A 1 43  ? 9.504   -3.601  12.851  1.00 1.29   ? 43  ARG A C    5  
ATOM 9436  O O    . ARG A 1 43  ? 10.201  -2.843  12.184  1.00 1.47   ? 43  ARG A O    5  
ATOM 9437  C CB   . ARG A 1 43  ? 10.440  -2.525  14.998  1.00 2.36   ? 43  ARG A CB   5  
ATOM 9438  C CG   . ARG A 1 43  ? 10.084  -2.210  16.465  1.00 4.31   ? 43  ARG A CG   5  
ATOM 9439  C CD   . ARG A 1 43  ? 11.239  -1.566  17.227  1.00 4.99   ? 43  ARG A CD   5  
ATOM 9440  N NE   . ARG A 1 43  ? 11.061  -1.861  18.664  1.00 6.56   ? 43  ARG A NE   5  
ATOM 9441  C CZ   . ARG A 1 43  ? 12.007  -1.939  19.586  1.00 6.99   ? 43  ARG A CZ   5  
ATOM 9442  N NH1  . ARG A 1 43  ? 13.279  -1.754  19.329  1.00 6.14   ? 43  ARG A NH1  5  
ATOM 9443  N NH2  . ARG A 1 43  ? 11.663  -2.311  20.798  1.00 8.50   ? 43  ARG A NH2  5  
ATOM 9444  H H    . ARG A 1 43  ? 10.089  -5.238  15.156  1.00 1.46   ? 43  ARG A H    5  
ATOM 9445  H HA   . ARG A 1 43  ? 8.396   -2.853  14.486  1.00 1.75   ? 43  ARG A HA   5  
ATOM 9446  H HB2  . ARG A 1 43  ? 11.392  -3.057  14.956  1.00 2.17   ? 43  ARG A HB2  5  
ATOM 9447  H HB3  . ARG A 1 43  ? 10.531  -1.585  14.450  1.00 2.88   ? 43  ARG A HB3  5  
ATOM 9448  H HG2  . ARG A 1 43  ? 9.219   -1.550  16.496  1.00 5.34   ? 43  ARG A HG2  5  
ATOM 9449  H HG3  . ARG A 1 43  ? 9.821   -3.132  16.979  1.00 4.89   ? 43  ARG A HG3  5  
ATOM 9450  H HD2  . ARG A 1 43  ? 12.162  -2.015  16.892  1.00 4.58   ? 43  ARG A HD2  5  
ATOM 9451  H HD3  . ARG A 1 43  ? 11.264  -0.488  17.029  1.00 5.20   ? 43  ARG A HD3  5  
ATOM 9452  H HE   . ARG A 1 43  ? 10.120  -2.067  18.953  1.00 7.52   ? 43  ARG A HE   5  
ATOM 9453  H HH11 . ARG A 1 43  ? 13.593  -1.568  18.398  1.00 5.14   ? 43  ARG A HH11 5  
ATOM 9454  H HH12 . ARG A 1 43  ? 13.927  -1.781  20.096  1.00 6.72   ? 43  ARG A HH12 5  
ATOM 9455  H HH21 . ARG A 1 43  ? 10.695  -2.551  21.001  1.00 9.32   ? 43  ARG A HH21 5  
ATOM 9456  H HH22 . ARG A 1 43  ? 12.358  -2.398  21.519  1.00 8.90   ? 43  ARG A HH22 5  
ATOM 9457  N N    . ASP A 1 44  ? 8.852   -4.638  12.339  1.00 1.03   ? 44  ASP A N    5  
ATOM 9458  C CA   . ASP A 1 44  ? 8.665   -4.970  10.931  1.00 1.03   ? 44  ASP A CA   5  
ATOM 9459  C C    . ASP A 1 44  ? 7.218   -5.447  10.793  1.00 0.84   ? 44  ASP A C    5  
ATOM 9460  O O    . ASP A 1 44  ? 6.766   -6.289  11.573  1.00 1.04   ? 44  ASP A O    5  
ATOM 9461  C CB   . ASP A 1 44  ? 9.630   -6.092  10.510  1.00 1.45   ? 44  ASP A CB   5  
ATOM 9462  C CG   . ASP A 1 44  ? 10.567  -5.659  9.385   1.00 2.05   ? 44  ASP A CG   5  
ATOM 9463  O OD1  . ASP A 1 44  ? 11.507  -4.864  9.664   1.00 2.85   ? 44  ASP A OD1  5  
ATOM 9464  O OD2  . ASP A 1 44  ? 10.331  -6.086  8.247   1.00 3.03   ? 44  ASP A OD2  5  
ATOM 9465  H H    . ASP A 1 44  ? 8.294   -5.171  12.988  1.00 1.03   ? 44  ASP A H    5  
ATOM 9466  H HA   . ASP A 1 44  ? 8.825   -4.087  10.306  1.00 1.14   ? 44  ASP A HA   5  
ATOM 9467  H HB2  . ASP A 1 44  ? 10.198  -6.439  11.365  1.00 2.28   ? 44  ASP A HB2  5  
ATOM 9468  H HB3  . ASP A 1 44  ? 9.063   -6.957  10.161  1.00 1.39   ? 44  ASP A HB3  5  
ATOM 9469  N N    . THR A 1 45  ? 6.471   -4.929  9.816   1.00 0.72   ? 45  THR A N    5  
ATOM 9470  C CA   . THR A 1 45  ? 5.070   -5.306  9.558   1.00 0.91   ? 45  THR A CA   5  
ATOM 9471  C C    . THR A 1 45  ? 4.722   -5.058  8.085   1.00 0.73   ? 45  THR A C    5  
ATOM 9472  O O    . THR A 1 45  ? 5.627   -4.868  7.278   1.00 0.79   ? 45  THR A O    5  
ATOM 9473  C CB   . THR A 1 45  ? 4.112   -4.633  10.568  1.00 1.36   ? 45  THR A CB   5  
ATOM 9474  O OG1  . THR A 1 45  ? 2.811   -5.164  10.416  1.00 2.86   ? 45  THR A OG1  5  
ATOM 9475  C CG2  . THR A 1 45  ? 4.024   -3.112  10.408  1.00 1.38   ? 45  THR A CG2  5  
ATOM 9476  H H    . THR A 1 45  ? 6.904   -4.279  9.175   1.00 0.73   ? 45  THR A H    5  
ATOM 9477  H HA   . THR A 1 45  ? 5.004   -6.379  9.733   1.00 1.26   ? 45  THR A HA   5  
ATOM 9478  H HB   . THR A 1 45  ? 4.462   -4.852  11.577  1.00 1.99   ? 45  THR A HB   5  
ATOM 9479  H HG1  . THR A 1 45  ? 2.199   -4.726  11.045  1.00 3.30   ? 45  THR A HG1  5  
ATOM 9480  H HG21 . THR A 1 45  ? 3.393   -2.699  11.195  1.00 2.24   ? 45  THR A HG21 5  
ATOM 9481  H HG22 . THR A 1 45  ? 5.020   -2.672  10.494  1.00 1.94   ? 45  THR A HG22 5  
ATOM 9482  H HG23 . THR A 1 45  ? 3.593   -2.857  9.439   1.00 2.57   ? 45  THR A HG23 5  
ATOM 9483  N N    . ALA A 1 46  ? 3.441   -5.069  7.720   1.00 0.77   ? 46  ALA A N    5  
ATOM 9484  C CA   . ALA A 1 46  ? 2.937   -4.803  6.376   1.00 0.79   ? 46  ALA A CA   5  
ATOM 9485  C C    . ALA A 1 46  ? 1.721   -3.870  6.392   1.00 0.70   ? 46  ALA A C    5  
ATOM 9486  O O    . ALA A 1 46  ? 1.064   -3.703  7.418   1.00 0.78   ? 46  ALA A O    5  
ATOM 9487  C CB   . ALA A 1 46  ? 2.640   -6.133  5.669   1.00 1.11   ? 46  ALA A CB   5  
ATOM 9488  H H    . ALA A 1 46  ? 2.763   -5.125  8.475   1.00 0.91   ? 46  ALA A H    5  
ATOM 9489  H HA   . ALA A 1 46  ? 3.709   -4.278  5.825   1.00 0.91   ? 46  ALA A HA   5  
ATOM 9490  H HB1  . ALA A 1 46  ? 3.518   -6.776  5.688   1.00 2.05   ? 46  ALA A HB1  5  
ATOM 9491  H HB2  . ALA A 1 46  ? 1.813   -6.640  6.170   1.00 1.65   ? 46  ALA A HB2  5  
ATOM 9492  H HB3  . ALA A 1 46  ? 2.367   -5.943  4.630   1.00 2.23   ? 46  ALA A HB3  5  
ATOM 9493  N N    . ALA A 1 47  ? 1.439   -3.280  5.233   1.00 0.75   ? 47  ALA A N    5  
ATOM 9494  C CA   . ALA A 1 47  ? 0.282   -2.430  4.991   1.00 0.71   ? 47  ALA A CA   5  
ATOM 9495  C C    . ALA A 1 47  ? -0.405  -2.798  3.668   1.00 0.79   ? 47  ALA A C    5  
ATOM 9496  O O    . ALA A 1 47  ? 0.228   -3.294  2.726   1.00 1.04   ? 47  ALA A O    5  
ATOM 9497  C CB   . ALA A 1 47  ? 0.711   -0.956  5.049   1.00 0.88   ? 47  ALA A CB   5  
ATOM 9498  H H    . ALA A 1 47  ? 2.039   -3.464  4.438   1.00 0.89   ? 47  ALA A H    5  
ATOM 9499  H HA   . ALA A 1 47  ? -0.449  -2.604  5.781   1.00 0.75   ? 47  ALA A HA   5  
ATOM 9500  H HB1  . ALA A 1 47  ? -0.154  -0.312  4.884   1.00 1.81   ? 47  ALA A HB1  5  
ATOM 9501  H HB2  . ALA A 1 47  ? 1.127   -0.739  6.033   1.00 2.21   ? 47  ALA A HB2  5  
ATOM 9502  H HB3  . ALA A 1 47  ? 1.462   -0.750  4.290   1.00 1.49   ? 47  ALA A HB3  5  
ATOM 9503  N N    . TYR A 1 48  ? -1.720  -2.560  3.636   1.00 0.77   ? 48  TYR A N    5  
ATOM 9504  C CA   . TYR A 1 48  ? -2.647  -2.984  2.583   1.00 0.95   ? 48  TYR A CA   5  
ATOM 9505  C C    . TYR A 1 48  ? -3.481  -1.812  2.018   1.00 0.96   ? 48  TYR A C    5  
ATOM 9506  O O    . TYR A 1 48  ? -3.761  -0.836  2.727   1.00 1.07   ? 48  TYR A O    5  
ATOM 9507  C CB   . TYR A 1 48  ? -3.590  -4.064  3.150   1.00 1.31   ? 48  TYR A CB   5  
ATOM 9508  C CG   . TYR A 1 48  ? -2.950  -5.155  3.999   1.00 1.49   ? 48  TYR A CG   5  
ATOM 9509  C CD1  . TYR A 1 48  ? -1.878  -5.923  3.501   1.00 3.00   ? 48  TYR A CD1  5  
ATOM 9510  C CD2  . TYR A 1 48  ? -3.444  -5.406  5.294   1.00 1.84   ? 48  TYR A CD2  5  
ATOM 9511  C CE1  . TYR A 1 48  ? -1.292  -6.924  4.299   1.00 3.72   ? 48  TYR A CE1  5  
ATOM 9512  C CE2  . TYR A 1 48  ? -2.860  -6.400  6.099   1.00 2.47   ? 48  TYR A CE2  5  
ATOM 9513  C CZ   . TYR A 1 48  ? -1.782  -7.162  5.603   1.00 3.13   ? 48  TYR A CZ   5  
ATOM 9514  O OH   . TYR A 1 48  ? -1.225  -8.117  6.392   1.00 4.07   ? 48  TYR A OH   5  
ATOM 9515  H H    . TYR A 1 48  ? -2.125  -2.123  4.460   1.00 0.77   ? 48  TYR A H    5  
ATOM 9516  H HA   . TYR A 1 48  ? -2.077  -3.420  1.760   1.00 1.10   ? 48  TYR A HA   5  
ATOM 9517  H HB2  . TYR A 1 48  ? -4.350  -3.562  3.755   1.00 1.73   ? 48  TYR A HB2  5  
ATOM 9518  H HB3  . TYR A 1 48  ? -4.111  -4.540  2.320   1.00 2.04   ? 48  TYR A HB3  5  
ATOM 9519  H HD1  . TYR A 1 48  ? -1.482  -5.713  2.516   1.00 3.97   ? 48  TYR A HD1  5  
ATOM 9520  H HD2  . TYR A 1 48  ? -4.265  -4.821  5.684   1.00 2.69   ? 48  TYR A HD2  5  
ATOM 9521  H HE1  . TYR A 1 48  ? -0.469  -7.503  3.916   1.00 5.07   ? 48  TYR A HE1  5  
ATOM 9522  H HE2  . TYR A 1 48  ? -3.225  -6.584  7.096   1.00 3.26   ? 48  TYR A HE2  5  
ATOM 9523  H HH   . TYR A 1 48  ? -0.497  -8.569  5.966   1.00 4.84   ? 48  TYR A HH   5  
ATOM 9524  N N    . MET A 1 49  ? -3.906  -1.945  0.756   1.00 1.03   ? 49  MET A N    5  
ATOM 9525  C CA   . MET A 1 49  ? -4.607  -0.942  -0.053  1.00 1.33   ? 49  MET A CA   5  
ATOM 9526  C C    . MET A 1 49  ? -5.517  -1.624  -1.095  1.00 1.16   ? 49  MET A C    5  
ATOM 9527  O O    . MET A 1 49  ? -5.259  -2.754  -1.501  1.00 1.11   ? 49  MET A O    5  
ATOM 9528  C CB   . MET A 1 49  ? -3.567  -0.055  -0.778  1.00 1.78   ? 49  MET A CB   5  
ATOM 9529  C CG   . MET A 1 49  ? -2.602  0.719   0.132   1.00 2.47   ? 49  MET A CG   5  
ATOM 9530  S SD   . MET A 1 49  ? -1.044  -0.138  0.484   1.00 3.98   ? 49  MET A SD   5  
ATOM 9531  C CE   . MET A 1 49  ? -0.413  0.927   1.801   1.00 4.92   ? 49  MET A CE   5  
ATOM 9532  H H    . MET A 1 49  ? -3.655  -2.811  0.280   1.00 1.03   ? 49  MET A H    5  
ATOM 9533  H HA   . MET A 1 49  ? -5.226  -0.329  0.605   1.00 1.66   ? 49  MET A HA   5  
ATOM 9534  H HB2  . MET A 1 49  ? -2.978  -0.660  -1.455  1.00 2.44   ? 49  MET A HB2  5  
ATOM 9535  H HB3  . MET A 1 49  ? -4.088  0.651   -1.410  1.00 2.09   ? 49  MET A HB3  5  
ATOM 9536  H HG2  . MET A 1 49  ? -2.346  1.661   -0.349  1.00 3.30   ? 49  MET A HG2  5  
ATOM 9537  H HG3  . MET A 1 49  ? -3.110  0.954   1.063   1.00 2.58   ? 49  MET A HG3  5  
ATOM 9538  H HE1  . MET A 1 49  ? -1.065  0.856   2.669   1.00 5.16   ? 49  MET A HE1  5  
ATOM 9539  H HE2  . MET A 1 49  ? 0.585   0.596   2.087   1.00 5.97   ? 49  MET A HE2  5  
ATOM 9540  H HE3  . MET A 1 49  ? -0.364  1.960   1.451   1.00 5.08   ? 49  MET A HE3  5  
ATOM 9541  N N    . THR A 1 50  ? -6.556  -0.939  -1.592  1.00 1.30   ? 50  THR A N    5  
ATOM 9542  C CA   . THR A 1 50  ? -7.393  -1.338  -2.751  1.00 1.31   ? 50  THR A CA   5  
ATOM 9543  C C    . THR A 1 50  ? -8.183  -0.128  -3.237  1.00 1.33   ? 50  THR A C    5  
ATOM 9544  O O    . THR A 1 50  ? -8.867  0.499   -2.435  1.00 1.59   ? 50  THR A O    5  
ATOM 9545  C CB   . THR A 1 50  ? -8.346  -2.495  -2.399  1.00 1.55   ? 50  THR A CB   5  
ATOM 9546  O OG1  . THR A 1 50  ? -7.593  -3.677  -2.299  1.00 2.57   ? 50  THR A OG1  5  
ATOM 9547  C CG2  . THR A 1 50  ? -9.400  -2.770  -3.475  1.00 2.12   ? 50  THR A CG2  5  
ATOM 9548  H H    . THR A 1 50  ? -6.851  -0.114  -1.081  1.00 1.45   ? 50  THR A H    5  
ATOM 9549  H HA   . THR A 1 50  ? -6.740  -1.679  -3.554  1.00 1.42   ? 50  THR A HA   5  
ATOM 9550  H HB   . THR A 1 50  ? -8.847  -2.286  -1.451  1.00 1.86   ? 50  THR A HB   5  
ATOM 9551  H HG1  . THR A 1 50  ? -6.746  -3.441  -1.879  1.00 3.24   ? 50  THR A HG1  5  
ATOM 9552  H HG21 . THR A 1 50  ? -9.949  -3.678  -3.225  1.00 2.32   ? 50  THR A HG21 5  
ATOM 9553  H HG22 . THR A 1 50  ? -10.111 -1.944  -3.535  1.00 2.68   ? 50  THR A HG22 5  
ATOM 9554  H HG23 . THR A 1 50  ? -8.911  -2.899  -4.442  1.00 3.40   ? 50  THR A HG23 5  
ATOM 9555  N N    . LEU A 1 51  ? -8.072  0.248   -4.514  1.00 1.47   ? 51  LEU A N    5  
ATOM 9556  C CA   . LEU A 1 51  ? -8.777  1.430   -5.050  1.00 1.56   ? 51  LEU A CA   5  
ATOM 9557  C C    . LEU A 1 51  ? -10.084 0.987   -5.723  1.00 1.42   ? 51  LEU A C    5  
ATOM 9558  O O    . LEU A 1 51  ? -10.053 0.134   -6.609  1.00 1.82   ? 51  LEU A O    5  
ATOM 9559  C CB   . LEU A 1 51  ? -7.852  2.209   -6.014  1.00 1.99   ? 51  LEU A CB   5  
ATOM 9560  C CG   . LEU A 1 51  ? -7.991  3.752   -6.002  1.00 2.78   ? 51  LEU A CG   5  
ATOM 9561  C CD1  . LEU A 1 51  ? -9.431  4.247   -6.179  1.00 3.63   ? 51  LEU A CD1  5  
ATOM 9562  C CD2  . LEU A 1 51  ? -7.385  4.348   -4.725  1.00 3.71   ? 51  LEU A CD2  5  
ATOM 9563  H H    . LEU A 1 51  ? -7.573  -0.361  -5.156  1.00 1.68   ? 51  LEU A H    5  
ATOM 9564  H HA   . LEU A 1 51  ? -9.043  2.078   -4.218  1.00 1.64   ? 51  LEU A HA   5  
ATOM 9565  H HB2  . LEU A 1 51  ? -6.811  1.970   -5.782  1.00 2.18   ? 51  LEU A HB2  5  
ATOM 9566  H HB3  . LEU A 1 51  ? -8.041  1.852   -7.029  1.00 2.03   ? 51  LEU A HB3  5  
ATOM 9567  H HG   . LEU A 1 51  ? -7.417  4.142   -6.838  1.00 3.51   ? 51  LEU A HG   5  
ATOM 9568  H HD11 . LEU A 1 51  ? -9.890  3.762   -7.040  1.00 4.29   ? 51  LEU A HD11 5  
ATOM 9569  H HD12 . LEU A 1 51  ? -10.020 4.033   -5.289  1.00 4.10   ? 51  LEU A HD12 5  
ATOM 9570  H HD13 . LEU A 1 51  ? -9.433  5.324   -6.343  1.00 4.40   ? 51  LEU A HD13 5  
ATOM 9571  H HD21 . LEU A 1 51  ? -7.919  3.987   -3.853  1.00 4.03   ? 51  LEU A HD21 5  
ATOM 9572  H HD22 . LEU A 1 51  ? -6.335  4.065   -4.648  1.00 4.50   ? 51  LEU A HD22 5  
ATOM 9573  H HD23 . LEU A 1 51  ? -7.450  5.435   -4.758  1.00 4.48   ? 51  LEU A HD23 5  
ATOM 9574  N N    . THR A 1 52  ? -11.224 1.574   -5.330  1.00 1.35   ? 52  THR A N    5  
ATOM 9575  C CA   . THR A 1 52  ? -12.556 1.133   -5.761  1.00 1.39   ? 52  THR A CA   5  
ATOM 9576  C C    . THR A 1 52  ? -13.369 2.279   -6.371  1.00 1.48   ? 52  THR A C    5  
ATOM 9577  O O    . THR A 1 52  ? -13.836 3.185   -5.686  1.00 1.86   ? 52  THR A O    5  
ATOM 9578  C CB   . THR A 1 52  ? -13.263 0.408   -4.608  1.00 1.81   ? 52  THR A CB   5  
ATOM 9579  O OG1  . THR A 1 52  ? -14.469 -0.100  -5.112  1.00 2.19   ? 52  THR A OG1  5  
ATOM 9580  C CG2  . THR A 1 52  ? -13.585 1.234   -3.364  1.00 2.69   ? 52  THR A CG2  5  
ATOM 9581  H H    . THR A 1 52  ? -11.176 2.322   -4.650  1.00 1.60   ? 52  THR A H    5  
ATOM 9582  H HA   . THR A 1 52  ? -12.439 0.376   -6.542  1.00 1.52   ? 52  THR A HA   5  
ATOM 9583  H HB   . THR A 1 52  ? -12.626 -0.418  -4.291  1.00 2.13   ? 52  THR A HB   5  
ATOM 9584  H HG1  . THR A 1 52  ? -15.049 0.658   -5.272  1.00 2.70   ? 52  THR A HG1  5  
ATOM 9585  H HG21 . THR A 1 52  ? -12.707 1.795   -3.042  1.00 3.67   ? 52  THR A HG21 5  
ATOM 9586  H HG22 . THR A 1 52  ? -14.400 1.924   -3.571  1.00 2.83   ? 52  THR A HG22 5  
ATOM 9587  H HG23 . THR A 1 52  ? -13.895 0.571   -2.555  1.00 3.45   ? 52  THR A HG23 5  
ATOM 9588  N N    . ASN A 1 53  ? -13.594 2.177   -7.681  1.00 1.48   ? 53  ASN A N    5  
ATOM 9589  C CA   . ASN A 1 53  ? -14.519 3.034   -8.409  1.00 1.67   ? 53  ASN A CA   5  
ATOM 9590  C C    . ASN A 1 53  ? -15.973 2.651   -8.127  1.00 2.04   ? 53  ASN A C    5  
ATOM 9591  O O    . ASN A 1 53  ? -16.285 1.537   -7.700  1.00 2.55   ? 53  ASN A O    5  
ATOM 9592  C CB   . ASN A 1 53  ? -14.237 2.950   -9.918  1.00 1.81   ? 53  ASN A CB   5  
ATOM 9593  C CG   . ASN A 1 53  ? -13.321 4.059   -10.411 1.00 2.51   ? 53  ASN A CG   5  
ATOM 9594  O OD1  . ASN A 1 53  ? -12.508 4.607   -9.686  1.00 3.47   ? 53  ASN A OD1  5  
ATOM 9595  N ND2  . ASN A 1 53  ? -13.410 4.444   -11.668 1.00 3.20   ? 53  ASN A ND2  5  
ATOM 9596  H H    . ASN A 1 53  ? -13.206 1.399   -8.182  1.00 1.59   ? 53  ASN A H    5  
ATOM 9597  H HA   . ASN A 1 53  ? -14.379 4.061   -8.073  1.00 1.73   ? 53  ASN A HA   5  
ATOM 9598  H HB2  . ASN A 1 53  ? -13.811 1.982   -10.170 1.00 1.99   ? 53  ASN A HB2  5  
ATOM 9599  H HB3  . ASN A 1 53  ? -15.173 3.025   -10.463 1.00 2.87   ? 53  ASN A HB3  5  
ATOM 9600  H HD21 . ASN A 1 53  ? -14.136 4.089   -12.277 1.00 3.45   ? 53  ASN A HD21 5  
ATOM 9601  H HD22 . ASN A 1 53  ? -12.761 5.154   -11.950 1.00 4.01   ? 53  ASN A HD22 5  
ATOM 9602  N N    . LYS A 1 54  ? -16.872 3.568   -8.475  1.00 2.00   ? 54  LYS A N    5  
ATOM 9603  C CA   . LYS A 1 54  ? -18.336 3.397   -8.410  1.00 2.36   ? 54  LYS A CA   5  
ATOM 9604  C C    . LYS A 1 54  ? -18.967 4.337   -9.457  1.00 2.36   ? 54  LYS A C    5  
ATOM 9605  O O    . LYS A 1 54  ? -19.910 5.080   -9.194  1.00 2.81   ? 54  LYS A O    5  
ATOM 9606  C CB   . LYS A 1 54  ? -18.795 3.587   -6.942  1.00 2.86   ? 54  LYS A CB   5  
ATOM 9607  C CG   . LYS A 1 54  ? -20.247 3.151   -6.664  1.00 3.43   ? 54  LYS A CG   5  
ATOM 9608  C CD   . LYS A 1 54  ? -20.524 2.940   -5.159  1.00 4.04   ? 54  LYS A CD   5  
ATOM 9609  C CE   . LYS A 1 54  ? -20.066 1.550   -4.679  1.00 4.54   ? 54  LYS A CE   5  
ATOM 9610  N NZ   . LYS A 1 54  ? -20.223 1.367   -3.213  1.00 5.24   ? 54  LYS A NZ   5  
ATOM 9611  H H    . LYS A 1 54  ? -16.507 4.438   -8.851  1.00 1.91   ? 54  LYS A H    5  
ATOM 9612  H HA   . LYS A 1 54  ? -18.582 2.378   -8.719  1.00 2.40   ? 54  LYS A HA   5  
ATOM 9613  H HB2  . LYS A 1 54  ? -18.139 2.993   -6.304  1.00 2.91   ? 54  LYS A HB2  5  
ATOM 9614  H HB3  . LYS A 1 54  ? -18.673 4.634   -6.657  1.00 3.24   ? 54  LYS A HB3  5  
ATOM 9615  H HG2  . LYS A 1 54  ? -20.920 3.924   -7.034  1.00 3.83   ? 54  LYS A HG2  5  
ATOM 9616  H HG3  . LYS A 1 54  ? -20.468 2.227   -7.196  1.00 3.60   ? 54  LYS A HG3  5  
ATOM 9617  H HD2  . LYS A 1 54  ? -20.026 3.720   -4.581  1.00 4.42   ? 54  LYS A HD2  5  
ATOM 9618  H HD3  . LYS A 1 54  ? -21.600 3.027   -4.988  1.00 4.48   ? 54  LYS A HD3  5  
ATOM 9619  H HE2  . LYS A 1 54  ? -20.662 0.797   -5.200  1.00 4.84   ? 54  LYS A HE2  5  
ATOM 9620  H HE3  . LYS A 1 54  ? -19.014 1.407   -4.949  1.00 4.85   ? 54  LYS A HE3  5  
ATOM 9621  H HZ1  . LYS A 1 54  ? -20.061 0.405   -2.938  1.00 5.58   ? 54  LYS A HZ1  5  
ATOM 9622  H HZ2  . LYS A 1 54  ? -19.540 1.922   -2.702  1.00 5.85   ? 54  LYS A HZ2  5  
ATOM 9623  H HZ3  . LYS A 1 54  ? -21.136 1.642   -2.864  1.00 5.39   ? 54  LYS A HZ3  5  
ATOM 9624  N N    . SER A 1 55  ? -18.310 4.384   -10.626 1.00 2.02   ? 55  SER A N    5  
ATOM 9625  C CA   . SER A 1 55  ? -18.312 5.372   -11.723 1.00 2.10   ? 55  SER A CA   5  
ATOM 9626  C C    . SER A 1 55  ? -17.064 5.135   -12.617 1.00 2.01   ? 55  SER A C    5  
ATOM 9627  O O    . SER A 1 55  ? -16.249 4.253   -12.341 1.00 2.33   ? 55  SER A O    5  
ATOM 9628  C CB   . SER A 1 55  ? -18.345 6.829   -11.216 1.00 2.44   ? 55  SER A CB   5  
ATOM 9629  O OG   . SER A 1 55  ? -19.614 7.167   -10.693 1.00 2.81   ? 55  SER A OG   5  
ATOM 9630  H H    . SER A 1 55  ? -17.630 3.646   -10.767 1.00 1.87   ? 55  SER A H    5  
ATOM 9631  H HA   . SER A 1 55  ? -19.195 5.218   -12.350 1.00 2.21   ? 55  SER A HA   5  
ATOM 9632  H HB2  . SER A 1 55  ? -17.580 6.958   -10.449 1.00 2.72   ? 55  SER A HB2  5  
ATOM 9633  H HB3  . SER A 1 55  ? -18.131 7.513   -12.039 1.00 2.62   ? 55  SER A HB3  5  
ATOM 9634  H HG   . SER A 1 55  ? -19.863 6.443   -10.075 1.00 2.98   ? 55  SER A HG   5  
ATOM 9635  N N    . ASP A 1 56  ? -16.887 5.918   -13.682 1.00 2.09   ? 56  ASP A N    5  
ATOM 9636  C CA   . ASP A 1 56  ? -15.993 5.667   -14.827 1.00 2.03   ? 56  ASP A CA   5  
ATOM 9637  C C    . ASP A 1 56  ? -14.689 6.503   -14.822 1.00 1.93   ? 56  ASP A C    5  
ATOM 9638  O O    . ASP A 1 56  ? -14.194 6.892   -15.882 1.00 2.02   ? 56  ASP A O    5  
ATOM 9639  C CB   . ASP A 1 56  ? -16.817 5.918   -16.109 1.00 2.36   ? 56  ASP A CB   5  
ATOM 9640  C CG   . ASP A 1 56  ? -17.201 7.387   -16.351 1.00 4.02   ? 56  ASP A CG   5  
ATOM 9641  O OD1  . ASP A 1 56  ? -17.491 8.108   -15.366 1.00 5.28   ? 56  ASP A OD1  5  
ATOM 9642  O OD2  . ASP A 1 56  ? -17.251 7.788   -17.540 1.00 4.75   ? 56  ASP A OD2  5  
ATOM 9643  H H    . ASP A 1 56  ? -17.552 6.670   -13.852 1.00 2.47   ? 56  ASP A H    5  
ATOM 9644  H HA   . ASP A 1 56  ? -15.706 4.617   -14.821 1.00 1.97   ? 56  ASP A HA   5  
ATOM 9645  H HB2  . ASP A 1 56  ? -16.242 5.556   -16.964 1.00 2.17   ? 56  ASP A HB2  5  
ATOM 9646  H HB3  . ASP A 1 56  ? -17.732 5.326   -16.061 1.00 2.92   ? 56  ASP A HB3  5  
ATOM 9647  N N    . GLN A 1 57  ? -14.151 6.842   -13.640 1.00 2.08   ? 57  GLN A N    5  
ATOM 9648  C CA   . GLN A 1 57  ? -13.204 7.967   -13.502 1.00 2.30   ? 57  GLN A CA   5  
ATOM 9649  C C    . GLN A 1 57  ? -11.803 7.568   -12.964 1.00 2.50   ? 57  GLN A C    5  
ATOM 9650  O O    . GLN A 1 57  ? -11.391 8.080   -11.918 1.00 3.30   ? 57  GLN A O    5  
ATOM 9651  C CB   . GLN A 1 57  ? -13.871 9.085   -12.656 1.00 2.64   ? 57  GLN A CB   5  
ATOM 9652  C CG   . GLN A 1 57  ? -15.366 9.290   -12.962 1.00 2.81   ? 57  GLN A CG   5  
ATOM 9653  C CD   . GLN A 1 57  ? -15.863 10.715  -12.712 1.00 3.68   ? 57  GLN A CD   5  
ATOM 9654  O OE1  . GLN A 1 57  ? -16.164 11.468  -13.629 1.00 4.72   ? 57  GLN A OE1  5  
ATOM 9655  N NE2  . GLN A 1 57  ? -16.025 11.118  -11.475 1.00 3.90   ? 57  GLN A NE2  5  
ATOM 9656  H H    . GLN A 1 57  ? -14.569 6.438   -12.810 1.00 2.28   ? 57  GLN A H    5  
ATOM 9657  H HA   . GLN A 1 57  ? -13.028 8.391   -14.490 1.00 2.25   ? 57  GLN A HA   5  
ATOM 9658  H HB2  . GLN A 1 57  ? -13.779 8.858   -11.593 1.00 3.07   ? 57  GLN A HB2  5  
ATOM 9659  H HB3  . GLN A 1 57  ? -13.335 10.017  -12.845 1.00 3.10   ? 57  GLN A HB3  5  
ATOM 9660  H HG2  . GLN A 1 57  ? -15.564 9.040   -13.998 1.00 2.82   ? 57  GLN A HG2  5  
ATOM 9661  H HG3  . GLN A 1 57  ? -15.948 8.607   -12.347 1.00 3.04   ? 57  GLN A HG3  5  
ATOM 9662  H HE21 . GLN A 1 57  ? -15.838 10.508  -10.699 1.00 3.80   ? 57  GLN A HE21 5  
ATOM 9663  H HE22 . GLN A 1 57  ? -16.499 12.005  -11.359 1.00 4.66   ? 57  GLN A HE22 5  
ATOM 9664  N N    . PRO A 1 58  ? -11.058 6.647   -13.616 1.00 2.14   ? 58  PRO A N    5  
ATOM 9665  C CA   . PRO A 1 58  ? -9.870  6.027   -13.039 1.00 2.35   ? 58  PRO A CA   5  
ATOM 9666  C C    . PRO A 1 58  ? -8.592  6.859   -13.256 1.00 1.86   ? 58  PRO A C    5  
ATOM 9667  O O    . PRO A 1 58  ? -8.603  7.909   -13.897 1.00 2.26   ? 58  PRO A O    5  
ATOM 9668  C CB   . PRO A 1 58  ? -9.788  4.667   -13.727 1.00 2.88   ? 58  PRO A CB   5  
ATOM 9669  C CG   . PRO A 1 58  ? -10.187 5.031   -15.157 1.00 2.63   ? 58  PRO A CG   5  
ATOM 9670  C CD   . PRO A 1 58  ? -11.298 6.064   -14.933 1.00 2.11   ? 58  PRO A CD   5  
ATOM 9671  H HA   . PRO A 1 58  ? -10.011 5.877   -11.968 1.00 2.94   ? 58  PRO A HA   5  
ATOM 9672  H HB2  . PRO A 1 58  ? -8.802  4.208   -13.628 1.00 3.10   ? 58  PRO A HB2  5  
ATOM 9673  H HB3  . PRO A 1 58  ? -10.542 4.005   -13.304 1.00 3.52   ? 58  PRO A HB3  5  
ATOM 9674  H HG2  . PRO A 1 58  ? -9.348  5.500   -15.672 1.00 2.54   ? 58  PRO A HG2  5  
ATOM 9675  H HG3  . PRO A 1 58  ? -10.543 4.163   -15.714 1.00 3.21   ? 58  PRO A HG3  5  
ATOM 9676  H HD2  . PRO A 1 58  ? -11.271 6.828   -15.713 1.00 1.85   ? 58  PRO A HD2  5  
ATOM 9677  H HD3  . PRO A 1 58  ? -12.253 5.551   -14.947 1.00 2.46   ? 58  PRO A HD3  5  
ATOM 9678  N N    . ILE A 1 59  ? -7.482  6.384   -12.682 1.00 1.51   ? 59  ILE A N    5  
ATOM 9679  C CA   . ILE A 1 59  ? -6.254  7.168   -12.443 1.00 1.68   ? 59  ILE A CA   5  
ATOM 9680  C C    . ILE A 1 59  ? -4.981  6.339   -12.707 1.00 1.72   ? 59  ILE A C    5  
ATOM 9681  O O    . ILE A 1 59  ? -5.014  5.108   -12.733 1.00 2.09   ? 59  ILE A O    5  
ATOM 9682  C CB   . ILE A 1 59  ? -6.218  7.665   -10.972 1.00 2.16   ? 59  ILE A CB   5  
ATOM 9683  C CG1  . ILE A 1 59  ? -7.576  7.854   -10.237 1.00 2.35   ? 59  ILE A CG1  5  
ATOM 9684  C CG2  . ILE A 1 59  ? -5.448  9.000   -10.856 1.00 2.93   ? 59  ILE A CG2  5  
ATOM 9685  C CD1  . ILE A 1 59  ? -8.130  6.584   -9.572  1.00 3.43   ? 59  ILE A CD1  5  
ATOM 9686  H H    . ILE A 1 59  ? -7.552  5.494   -12.211 1.00 1.52   ? 59  ILE A H    5  
ATOM 9687  H HA   . ILE A 1 59  ? -6.244  8.034   -13.108 1.00 1.87   ? 59  ILE A HA   5  
ATOM 9688  H HB   . ILE A 1 59  ? -5.657  6.896   -10.448 1.00 2.75   ? 59  ILE A HB   5  
ATOM 9689  H HG12 . ILE A 1 59  ? -7.463  8.589   -9.438  1.00 2.99   ? 59  ILE A HG12 5  
ATOM 9690  H HG13 . ILE A 1 59  ? -8.316  8.256   -10.927 1.00 2.98   ? 59  ILE A HG13 5  
ATOM 9691  H HG21 . ILE A 1 59  ? -4.448  8.929   -11.276 1.00 3.82   ? 59  ILE A HG21 5  
ATOM 9692  H HG22 . ILE A 1 59  ? -5.992  9.793   -11.372 1.00 3.78   ? 59  ILE A HG22 5  
ATOM 9693  H HG23 . ILE A 1 59  ? -5.338  9.277   -9.807  1.00 3.01   ? 59  ILE A HG23 5  
ATOM 9694  H HD11 . ILE A 1 59  ? -8.235  5.774   -10.287 1.00 4.25   ? 59  ILE A HD11 5  
ATOM 9695  H HD12 . ILE A 1 59  ? -7.462  6.268   -8.771  1.00 4.26   ? 59  ILE A HD12 5  
ATOM 9696  H HD13 . ILE A 1 59  ? -9.109  6.800   -9.144  1.00 3.87   ? 59  ILE A HD13 5  
ATOM 9697  N N    . LYS A 1 60  ? -3.814  6.984   -12.785 1.00 1.66   ? 60  LYS A N    5  
ATOM 9698  C CA   . LYS A 1 60  ? -2.510  6.330   -12.949 1.00 1.92   ? 60  LYS A CA   5  
ATOM 9699  C C    . LYS A 1 60  ? -1.416  6.925   -12.040 1.00 1.72   ? 60  LYS A C    5  
ATOM 9700  O O    . LYS A 1 60  ? -1.394  8.128   -11.790 1.00 1.57   ? 60  LYS A O    5  
ATOM 9701  C CB   . LYS A 1 60  ? -2.116  6.452   -14.438 1.00 2.64   ? 60  LYS A CB   5  
ATOM 9702  C CG   . LYS A 1 60  ? -1.947  7.918   -14.914 1.00 3.46   ? 60  LYS A CG   5  
ATOM 9703  C CD   . LYS A 1 60  ? -2.102  8.102   -16.430 1.00 4.27   ? 60  LYS A CD   5  
ATOM 9704  C CE   . LYS A 1 60  ? -3.540  7.811   -16.894 1.00 4.90   ? 60  LYS A CE   5  
ATOM 9705  N NZ   . LYS A 1 60  ? -3.702  8.038   -18.347 1.00 5.74   ? 60  LYS A NZ   5  
ATOM 9706  H H    . LYS A 1 60  ? -3.816  7.994   -12.714 1.00 1.68   ? 60  LYS A H    5  
ATOM 9707  H HA   . LYS A 1 60  ? -2.640  5.272   -12.659 1.00 2.10   ? 60  LYS A HA   5  
ATOM 9708  H HB2  . LYS A 1 60  ? -1.182  5.918   -14.614 1.00 2.82   ? 60  LYS A HB2  5  
ATOM 9709  H HB3  . LYS A 1 60  ? -2.889  5.964   -15.026 1.00 2.85   ? 60  LYS A HB3  5  
ATOM 9710  H HG2  . LYS A 1 60  ? -2.675  8.570   -14.433 1.00 3.54   ? 60  LYS A HG2  5  
ATOM 9711  H HG3  . LYS A 1 60  ? -0.954  8.266   -14.624 1.00 3.89   ? 60  LYS A HG3  5  
ATOM 9712  H HD2  . LYS A 1 60  ? -1.851  9.137   -16.678 1.00 4.61   ? 60  LYS A HD2  5  
ATOM 9713  H HD3  . LYS A 1 60  ? -1.397  7.445   -16.943 1.00 4.88   ? 60  LYS A HD3  5  
ATOM 9714  H HE2  . LYS A 1 60  ? -3.782  6.770   -16.672 1.00 5.27   ? 60  LYS A HE2  5  
ATOM 9715  H HE3  . LYS A 1 60  ? -4.232  8.457   -16.344 1.00 5.11   ? 60  LYS A HE3  5  
ATOM 9716  H HZ1  . LYS A 1 60  ? -4.582  7.679   -18.700 1.00 6.26   ? 60  LYS A HZ1  5  
ATOM 9717  H HZ2  . LYS A 1 60  ? -3.675  9.030   -18.574 1.00 5.85   ? 60  LYS A HZ2  5  
ATOM 9718  H HZ3  . LYS A 1 60  ? -2.968  7.568   -18.873 1.00 6.20   ? 60  LYS A HZ3  5  
ATOM 9719  N N    . LEU A 1 61  ? -0.520  6.071   -11.540 1.00 2.05   ? 61  LEU A N    5  
ATOM 9720  C CA   . LEU A 1 61  ? 0.519   6.390   -10.552 1.00 2.07   ? 61  LEU A CA   5  
ATOM 9721  C C    . LEU A 1 61  ? 1.581   5.275   -10.549 1.00 2.08   ? 61  LEU A C    5  
ATOM 9722  O O    . LEU A 1 61  ? 1.461   4.351   -11.345 1.00 2.62   ? 61  LEU A O    5  
ATOM 9723  C CB   . LEU A 1 61  ? -0.162  6.746   -9.199  1.00 2.19   ? 61  LEU A CB   5  
ATOM 9724  C CG   . LEU A 1 61  ? -0.149  5.756   -8.017  1.00 2.71   ? 61  LEU A CG   5  
ATOM 9725  C CD1  . LEU A 1 61  ? -0.899  6.386   -6.838  1.00 2.84   ? 61  LEU A CD1  5  
ATOM 9726  C CD2  . LEU A 1 61  ? -0.814  4.416   -8.360  1.00 4.32   ? 61  LEU A CD2  5  
ATOM 9727  H H    . LEU A 1 61  ? -0.535  5.112   -11.856 1.00 2.51   ? 61  LEU A H    5  
ATOM 9728  H HA   . LEU A 1 61  ? 1.031   7.283   -10.901 1.00 2.23   ? 61  LEU A HA   5  
ATOM 9729  H HB2  . LEU A 1 61  ? 0.291   7.670   -8.844  1.00 3.37   ? 61  LEU A HB2  5  
ATOM 9730  H HB3  . LEU A 1 61  ? -1.211  6.976   -9.396  1.00 2.80   ? 61  LEU A HB3  5  
ATOM 9731  H HG   . LEU A 1 61  ? 0.879   5.591   -7.701  1.00 3.40   ? 61  LEU A HG   5  
ATOM 9732  H HD11 . LEU A 1 61  ? -1.939  6.581   -7.105  1.00 3.06   ? 61  LEU A HD11 5  
ATOM 9733  H HD12 . LEU A 1 61  ? -0.870  5.704   -5.989  1.00 3.74   ? 61  LEU A HD12 5  
ATOM 9734  H HD13 . LEU A 1 61  ? -0.419  7.322   -6.552  1.00 3.19   ? 61  LEU A HD13 5  
ATOM 9735  H HD21 . LEU A 1 61  ? -0.238  3.903   -9.124  1.00 5.40   ? 61  LEU A HD21 5  
ATOM 9736  H HD22 . LEU A 1 61  ? -0.840  3.777   -7.476  1.00 4.76   ? 61  LEU A HD22 5  
ATOM 9737  H HD23 . LEU A 1 61  ? -1.831  4.578   -8.717  1.00 4.80   ? 61  LEU A HD23 5  
ATOM 9738  N N    . VAL A 1 62  ? 2.581   5.335   -9.679  1.00 1.70   ? 62  VAL A N    5  
ATOM 9739  C CA   . VAL A 1 62  ? 3.572   4.275   -9.444  1.00 1.64   ? 62  VAL A CA   5  
ATOM 9740  C C    . VAL A 1 62  ? 3.612   3.976   -7.938  1.00 1.73   ? 62  VAL A C    5  
ATOM 9741  O O    . VAL A 1 62  ? 4.564   4.291   -7.227  1.00 2.89   ? 62  VAL A O    5  
ATOM 9742  C CB   . VAL A 1 62  ? 4.959   4.600   -10.060 1.00 2.10   ? 62  VAL A CB   5  
ATOM 9743  C CG1  . VAL A 1 62  ? 4.912   4.396   -11.584 1.00 2.99   ? 62  VAL A CG1  5  
ATOM 9744  C CG2  . VAL A 1 62  ? 5.460   6.031   -9.776  1.00 2.39   ? 62  VAL A CG2  5  
ATOM 9745  H H    . VAL A 1 62  ? 2.621   6.125   -9.043  1.00 1.60   ? 62  VAL A H    5  
ATOM 9746  H HA   . VAL A 1 62  ? 3.216   3.358   -9.917  1.00 1.49   ? 62  VAL A HA   5  
ATOM 9747  H HB   . VAL A 1 62  ? 5.691   3.895   -9.661  1.00 2.90   ? 62  VAL A HB   5  
ATOM 9748  H HG11 . VAL A 1 62  ? 4.599   3.377   -11.812 1.00 3.69   ? 62  VAL A HG11 5  
ATOM 9749  H HG12 . VAL A 1 62  ? 4.208   5.095   -12.037 1.00 3.52   ? 62  VAL A HG12 5  
ATOM 9750  H HG13 . VAL A 1 62  ? 5.901   4.561   -12.011 1.00 3.70   ? 62  VAL A HG13 5  
ATOM 9751  H HG21 . VAL A 1 62  ? 4.797   6.769   -10.230 1.00 2.98   ? 62  VAL A HG21 5  
ATOM 9752  H HG22 . VAL A 1 62  ? 5.509   6.207   -8.705  1.00 2.59   ? 62  VAL A HG22 5  
ATOM 9753  H HG23 . VAL A 1 62  ? 6.461   6.159   -10.190 1.00 3.35   ? 62  VAL A HG23 5  
ATOM 9754  N N    . GLY A 1 63  ? 2.494   3.416   -7.463  1.00 1.61   ? 63  GLY A N    5  
ATOM 9755  C CA   . GLY A 1 63  ? 2.338   2.870   -6.115  1.00 1.64   ? 63  GLY A CA   5  
ATOM 9756  C C    . GLY A 1 63  ? 2.034   3.870   -4.996  1.00 1.30   ? 63  GLY A C    5  
ATOM 9757  O O    . GLY A 1 63  ? 2.035   5.092   -5.174  1.00 1.41   ? 63  GLY A O    5  
ATOM 9758  H H    . GLY A 1 63  ? 1.786   3.169   -8.137  1.00 2.44   ? 63  GLY A H    5  
ATOM 9759  H HA2  . GLY A 1 63  ? 1.541   2.127   -6.130  1.00 2.07   ? 63  GLY A HA2  5  
ATOM 9760  H HA3  . GLY A 1 63  ? 3.275   2.378   -5.845  1.00 1.96   ? 63  GLY A HA3  5  
ATOM 9761  N N    . ALA A 1 64  ? 1.821   3.303   -3.802  1.00 1.31   ? 64  ALA A N    5  
ATOM 9762  C CA   . ALA A 1 64  ? 1.975   3.977   -2.514  1.00 1.30   ? 64  ALA A CA   5  
ATOM 9763  C C    . ALA A 1 64  ? 3.370   3.699   -1.918  1.00 1.26   ? 64  ALA A C    5  
ATOM 9764  O O    . ALA A 1 64  ? 4.023   2.724   -2.282  1.00 1.58   ? 64  ALA A O    5  
ATOM 9765  C CB   . ALA A 1 64  ? 0.852   3.500   -1.580  1.00 1.53   ? 64  ALA A CB   5  
ATOM 9766  H H    . ALA A 1 64  ? 1.828   2.294   -3.769  1.00 1.47   ? 64  ALA A H    5  
ATOM 9767  H HA   . ALA A 1 64  ? 1.872   5.050   -2.655  1.00 1.35   ? 64  ALA A HA   5  
ATOM 9768  H HB1  . ALA A 1 64  ? 0.920   4.011   -0.618  1.00 1.75   ? 64  ALA A HB1  5  
ATOM 9769  H HB2  . ALA A 1 64  ? -0.125  3.711   -2.020  1.00 2.53   ? 64  ALA A HB2  5  
ATOM 9770  H HB3  . ALA A 1 64  ? 0.938   2.424   -1.413  1.00 2.03   ? 64  ALA A HB3  5  
ATOM 9771  N N    . ALA A 1 65  ? 3.808   4.525   -0.969  1.00 1.10   ? 65  ALA A N    5  
ATOM 9772  C CA   . ALA A 1 65  ? 5.016   4.339   -0.172  1.00 1.09   ? 65  ALA A CA   5  
ATOM 9773  C C    . ALA A 1 65  ? 4.850   5.076   1.172   1.00 1.20   ? 65  ALA A C    5  
ATOM 9774  O O    . ALA A 1 65  ? 3.753   5.522   1.524   1.00 1.32   ? 65  ALA A O    5  
ATOM 9775  C CB   . ALA A 1 65  ? 6.257   4.773   -0.978  1.00 1.06   ? 65  ALA A CB   5  
ATOM 9776  H H    . ALA A 1 65  ? 3.273   5.356   -0.756  1.00 1.15   ? 65  ALA A H    5  
ATOM 9777  H HA   . ALA A 1 65  ? 5.124   3.276   0.055   1.00 1.15   ? 65  ALA A HA   5  
ATOM 9778  H HB1  . ALA A 1 65  ? 6.218   5.839   -1.194  1.00 1.97   ? 65  ALA A HB1  5  
ATOM 9779  H HB2  . ALA A 1 65  ? 7.170   4.549   -0.427  1.00 1.52   ? 65  ALA A HB2  5  
ATOM 9780  H HB3  . ALA A 1 65  ? 6.286   4.227   -1.922  1.00 2.03   ? 65  ALA A HB3  5  
ATOM 9781  N N    . THR A 1 66  ? 5.912   5.137   1.978   1.00 1.27   ? 66  THR A N    5  
ATOM 9782  C CA   . THR A 1 66  ? 5.781   5.287   3.428   1.00 1.51   ? 66  THR A CA   5  
ATOM 9783  C C    . THR A 1 66  ? 7.141   5.640   4.031   1.00 1.61   ? 66  THR A C    5  
ATOM 9784  O O    . THR A 1 66  ? 8.061   4.834   3.906   1.00 1.46   ? 66  THR A O    5  
ATOM 9785  C CB   . THR A 1 66  ? 5.145   4.021   4.022   1.00 1.71   ? 66  THR A CB   5  
ATOM 9786  O OG1  . THR A 1 66  ? 5.152   4.142   5.423   1.00 2.18   ? 66  THR A OG1  5  
ATOM 9787  C CG2  . THR A 1 66  ? 5.806   2.697   3.631   1.00 1.79   ? 66  THR A CG2  5  
ATOM 9788  H H    . THR A 1 66  ? 6.802   4.800   1.636   1.00 1.28   ? 66  THR A H    5  
ATOM 9789  H HA   . THR A 1 66  ? 5.072   6.086   3.630   1.00 1.84   ? 66  THR A HA   5  
ATOM 9790  H HB   . THR A 1 66  ? 4.113   3.972   3.678   1.00 1.85   ? 66  THR A HB   5  
ATOM 9791  H HG1  . THR A 1 66  ? 4.631   3.415   5.778   1.00 2.87   ? 66  THR A HG1  5  
ATOM 9792  H HG21 . THR A 1 66  ? 5.126   1.882   3.854   1.00 2.71   ? 66  THR A HG21 5  
ATOM 9793  H HG22 . THR A 1 66  ? 5.987   2.658   2.561   1.00 2.60   ? 66  THR A HG22 5  
ATOM 9794  H HG23 . THR A 1 66  ? 6.747   2.562   4.170   1.00 1.57   ? 66  THR A HG23 5  
ATOM 9795  N N    . PRO A 1 67  ? 7.296   6.832   4.644   1.00 1.95   ? 67  PRO A N    5  
ATOM 9796  C CA   . PRO A 1 67  ? 8.556   7.285   5.229   1.00 2.08   ? 67  PRO A CA   5  
ATOM 9797  C C    . PRO A 1 67  ? 8.747   6.794   6.676   1.00 1.93   ? 67  PRO A C    5  
ATOM 9798  O O    . PRO A 1 67  ? 9.634   7.280   7.378   1.00 2.22   ? 67  PRO A O    5  
ATOM 9799  C CB   . PRO A 1 67  ? 8.481   8.812   5.133   1.00 2.53   ? 67  PRO A CB   5  
ATOM 9800  C CG   . PRO A 1 67  ? 7.002   9.102   5.359   1.00 2.62   ? 67  PRO A CG   5  
ATOM 9801  C CD   . PRO A 1 67  ? 6.319   7.920   4.672   1.00 2.30   ? 67  PRO A CD   5  
ATOM 9802  H HA   . PRO A 1 67  ? 9.397   6.930   4.632   1.00 2.05   ? 67  PRO A HA   5  
ATOM 9803  H HB2  . PRO A 1 67  ? 9.107   9.310   5.869   1.00 2.68   ? 67  PRO A HB2  5  
ATOM 9804  H HB3  . PRO A 1 67  ? 8.763   9.131   4.128   1.00 2.67   ? 67  PRO A HB3  5  
ATOM 9805  H HG2  . PRO A 1 67  ? 6.781   9.094   6.425   1.00 2.61   ? 67  PRO A HG2  5  
ATOM 9806  H HG3  . PRO A 1 67  ? 6.701   10.052  4.918   1.00 2.92   ? 67  PRO A HG3  5  
ATOM 9807  H HD2  . PRO A 1 67  ? 5.422   7.632   5.225   1.00 2.29   ? 67  PRO A HD2  5  
ATOM 9808  H HD3  . PRO A 1 67  ? 6.059   8.199   3.650   1.00 2.42   ? 67  PRO A HD3  5  
ATOM 9809  N N    . LEU A 1 68  ? 7.898   5.877   7.162   1.00 1.64   ? 68  LEU A N    5  
ATOM 9810  C CA   . LEU A 1 68  ? 7.968   5.337   8.527   1.00 1.54   ? 68  LEU A CA   5  
ATOM 9811  C C    . LEU A 1 68  ? 8.958   4.164   8.632   1.00 1.25   ? 68  LEU A C    5  
ATOM 9812  O O    . LEU A 1 68  ? 9.373   3.804   9.733   1.00 1.36   ? 68  LEU A O    5  
ATOM 9813  C CB   . LEU A 1 68  ? 6.550   4.912   8.965   1.00 1.69   ? 68  LEU A CB   5  
ATOM 9814  C CG   . LEU A 1 68  ? 5.651   6.056   9.483   1.00 2.11   ? 68  LEU A CG   5  
ATOM 9815  C CD1  . LEU A 1 68  ? 5.468   7.217   8.494   1.00 3.05   ? 68  LEU A CD1  5  
ATOM 9816  C CD2  . LEU A 1 68  ? 4.271   5.499   9.853   1.00 3.72   ? 68  LEU A CD2  5  
ATOM 9817  H H    . LEU A 1 68  ? 7.184   5.505   6.548   1.00 1.58   ? 68  LEU A H    5  
ATOM 9818  H HA   . LEU A 1 68  ? 8.331   6.106   9.215   1.00 1.75   ? 68  LEU A HA   5  
ATOM 9819  H HB2  . LEU A 1 68  ? 6.053   4.396   8.145   1.00 1.64   ? 68  LEU A HB2  5  
ATOM 9820  H HB3  . LEU A 1 68  ? 6.649   4.195   9.783   1.00 1.65   ? 68  LEU A HB3  5  
ATOM 9821  H HG   . LEU A 1 68  ? 6.102   6.460   10.391  1.00 2.17   ? 68  LEU A HG   5  
ATOM 9822  H HD11 . LEU A 1 68  ? 6.408   7.759   8.380   1.00 3.20   ? 68  LEU A HD11 5  
ATOM 9823  H HD12 . LEU A 1 68  ? 5.144   6.835   7.526   1.00 4.13   ? 68  LEU A HD12 5  
ATOM 9824  H HD13 . LEU A 1 68  ? 4.723   7.917   8.872   1.00 3.70   ? 68  LEU A HD13 5  
ATOM 9825  H HD21 . LEU A 1 68  ? 3.669   6.283   10.316  1.00 4.17   ? 68  LEU A HD21 5  
ATOM 9826  H HD22 . LEU A 1 68  ? 3.759   5.130   8.961   1.00 4.54   ? 68  LEU A HD22 5  
ATOM 9827  H HD23 . LEU A 1 68  ? 4.381   4.683   10.568  1.00 4.52   ? 68  LEU A HD23 5  
ATOM 9828  N N    . ALA A 1 69  ? 9.323   3.576   7.488   1.00 1.11   ? 69  ALA A N    5  
ATOM 9829  C CA   . ALA A 1 69  ? 10.235  2.440   7.351   1.00 1.10   ? 69  ALA A CA   5  
ATOM 9830  C C    . ALA A 1 69  ? 11.448  2.812   6.479   1.00 1.33   ? 69  ALA A C    5  
ATOM 9831  O O    . ALA A 1 69  ? 11.298  3.480   5.457   1.00 1.64   ? 69  ALA A O    5  
ATOM 9832  C CB   . ALA A 1 69  ? 9.433   1.299   6.712   1.00 1.19   ? 69  ALA A CB   5  
ATOM 9833  H H    . ALA A 1 69  ? 8.971   3.976   6.631   1.00 1.22   ? 69  ALA A H    5  
ATOM 9834  H HA   . ALA A 1 69  ? 10.590  2.122   8.333   1.00 1.11   ? 69  ALA A HA   5  
ATOM 9835  H HB1  . ALA A 1 69  ? 8.611   1.021   7.371   1.00 2.22   ? 69  ALA A HB1  5  
ATOM 9836  H HB2  . ALA A 1 69  ? 9.033   1.608   5.741   1.00 2.20   ? 69  ALA A HB2  5  
ATOM 9837  H HB3  . ALA A 1 69  ? 10.071  0.432   6.569   1.00 1.56   ? 69  ALA A HB3  5  
ATOM 9838  N N    . THR A 1 70  ? 12.648  2.351   6.853   1.00 1.39   ? 70  THR A N    5  
ATOM 9839  C CA   . THR A 1 70  ? 13.897  2.571   6.091   1.00 1.65   ? 70  THR A CA   5  
ATOM 9840  C C    . THR A 1 70  ? 13.987  1.673   4.851   1.00 1.42   ? 70  THR A C    5  
ATOM 9841  O O    . THR A 1 70  ? 14.826  1.902   3.981   1.00 1.42   ? 70  THR A O    5  
ATOM 9842  C CB   . THR A 1 70  ? 15.104  2.472   7.047   1.00 2.02   ? 70  THR A CB   5  
ATOM 9843  O OG1  . THR A 1 70  ? 15.015  3.559   7.952   1.00 2.61   ? 70  THR A OG1  5  
ATOM 9844  C CG2  . THR A 1 70  ? 16.471  2.620   6.373   1.00 2.57   ? 70  THR A CG2  5  
ATOM 9845  H H    . THR A 1 70  ? 12.698  1.824   7.722   1.00 1.37   ? 70  THR A H    5  
ATOM 9846  H HA   . THR A 1 70  ? 13.868  3.588   5.686   1.00 1.95   ? 70  THR A HA   5  
ATOM 9847  H HB   . THR A 1 70  ? 15.076  1.517   7.592   1.00 1.97   ? 70  THR A HB   5  
ATOM 9848  H HG1  . THR A 1 70  ? 15.183  4.367   7.447   1.00 3.76   ? 70  THR A HG1  5  
ATOM 9849  H HG21 . THR A 1 70  ? 16.694  1.734   5.781   1.00 2.77   ? 70  THR A HG21 5  
ATOM 9850  H HG22 . THR A 1 70  ? 16.499  3.498   5.729   1.00 3.93   ? 70  THR A HG22 5  
ATOM 9851  H HG23 . THR A 1 70  ? 17.248  2.709   7.129   1.00 2.75   ? 70  THR A HG23 5  
ATOM 9852  N N    . SER A 1 71  ? 13.095  0.699   4.677   1.00 1.35   ? 71  SER A N    5  
ATOM 9853  C CA   . SER A 1 71  ? 12.816  0.076   3.380   1.00 1.32   ? 71  SER A CA   5  
ATOM 9854  C C    . SER A 1 71  ? 11.324  -0.268  3.222   1.00 1.16   ? 71  SER A C    5  
ATOM 9855  O O    . SER A 1 71  ? 10.873  -1.288  3.746   1.00 1.05   ? 71  SER A O    5  
ATOM 9856  C CB   . SER A 1 71  ? 13.709  -1.153  3.180   1.00 1.35   ? 71  SER A CB   5  
ATOM 9857  O OG   . SER A 1 71  ? 15.014  -0.705  2.847   1.00 1.85   ? 71  SER A OG   5  
ATOM 9858  H H    . SER A 1 71  ? 12.539  0.381   5.470   1.00 1.37   ? 71  SER A H    5  
ATOM 9859  H HA   . SER A 1 71  ? 13.085  0.763   2.580   1.00 1.46   ? 71  SER A HA   5  
ATOM 9860  H HB2  . SER A 1 71  ? 13.734  -1.748  4.094   1.00 1.45   ? 71  SER A HB2  5  
ATOM 9861  H HB3  . SER A 1 71  ? 13.328  -1.765  2.363   1.00 1.85   ? 71  SER A HB3  5  
ATOM 9862  H HG   . SER A 1 71  ? 15.220  0.046   3.426   1.00 2.65   ? 71  SER A HG   5  
ATOM 9863  N N    . PRO A 1 72  ? 10.541  0.541   2.476   1.00 1.22   ? 72  PRO A N    5  
ATOM 9864  C CA   . PRO A 1 72  ? 9.249   0.102   1.976   1.00 1.13   ? 72  PRO A CA   5  
ATOM 9865  C C    . PRO A 1 72  ? 9.505   -0.973  0.915   1.00 1.04   ? 72  PRO A C    5  
ATOM 9866  O O    . PRO A 1 72  ? 10.090  -0.691  -0.132  1.00 1.27   ? 72  PRO A O    5  
ATOM 9867  C CB   . PRO A 1 72  ? 8.570   1.357   1.436   1.00 1.30   ? 72  PRO A CB   5  
ATOM 9868  C CG   . PRO A 1 72  ? 9.728   2.271   1.035   1.00 1.45   ? 72  PRO A CG   5  
ATOM 9869  C CD   . PRO A 1 72  ? 10.838  1.893   2.016   1.00 1.42   ? 72  PRO A CD   5  
ATOM 9870  H HA   . PRO A 1 72  ? 8.648   -0.316  2.784   1.00 1.06   ? 72  PRO A HA   5  
ATOM 9871  H HB2  . PRO A 1 72  ? 7.905   1.143   0.598   1.00 1.30   ? 72  PRO A HB2  5  
ATOM 9872  H HB3  . PRO A 1 72  ? 8.025   1.827   2.251   1.00 1.34   ? 72  PRO A HB3  5  
ATOM 9873  H HG2  . PRO A 1 72  ? 10.046  2.038   0.014   1.00 1.45   ? 72  PRO A HG2  5  
ATOM 9874  H HG3  . PRO A 1 72  ? 9.456   3.325   1.125   1.00 1.60   ? 72  PRO A HG3  5  
ATOM 9875  H HD2  . PRO A 1 72  ? 11.797  1.951   1.505   1.00 1.48   ? 72  PRO A HD2  5  
ATOM 9876  H HD3  . PRO A 1 72  ? 10.829  2.570   2.869   1.00 1.50   ? 72  PRO A HD3  5  
ATOM 9877  N N    . MET A 1 73  ? 9.112   -2.210  1.222   1.00 0.80   ? 73  MET A N    5  
ATOM 9878  C CA   . MET A 1 73  ? 9.413   -3.410  0.429   1.00 0.73   ? 73  MET A CA   5  
ATOM 9879  C C    . MET A 1 73  ? 8.105   -3.981  -0.110  1.00 0.79   ? 73  MET A C    5  
ATOM 9880  O O    . MET A 1 73  ? 7.334   -4.615  0.608   1.00 1.14   ? 73  MET A O    5  
ATOM 9881  C CB   . MET A 1 73  ? 10.186  -4.403  1.309   1.00 0.85   ? 73  MET A CB   5  
ATOM 9882  C CG   . MET A 1 73  ? 10.926  -5.491  0.518   1.00 1.04   ? 73  MET A CG   5  
ATOM 9883  S SD   . MET A 1 73  ? 9.899   -6.595  -0.489  1.00 2.59   ? 73  MET A SD   5  
ATOM 9884  C CE   . MET A 1 73  ? 11.143  -7.795  -1.015  1.00 2.92   ? 73  MET A CE   5  
ATOM 9885  H H    . MET A 1 73  ? 8.616   -2.349  2.101   1.00 0.80   ? 73  MET A H    5  
ATOM 9886  H HA   . MET A 1 73  ? 10.051  -3.138  -0.413  1.00 0.80   ? 73  MET A HA   5  
ATOM 9887  H HB2  . MET A 1 73  ? 10.934  -3.843  1.870   1.00 1.24   ? 73  MET A HB2  5  
ATOM 9888  H HB3  . MET A 1 73  ? 9.510   -4.867  2.028   1.00 1.05   ? 73  MET A HB3  5  
ATOM 9889  H HG2  . MET A 1 73  ? 11.666  -5.015  -0.123  1.00 2.38   ? 73  MET A HG2  5  
ATOM 9890  H HG3  . MET A 1 73  ? 11.464  -6.106  1.245   1.00 2.19   ? 73  MET A HG3  5  
ATOM 9891  H HE1  . MET A 1 73  ? 11.600  -8.256  -0.142  1.00 3.22   ? 73  MET A HE1  5  
ATOM 9892  H HE2  . MET A 1 73  ? 10.656  -8.567  -1.611  1.00 3.85   ? 73  MET A HE2  5  
ATOM 9893  H HE3  . MET A 1 73  ? 11.908  -7.298  -1.615  1.00 3.06   ? 73  MET A HE3  5  
ATOM 9894  N N    . LEU A 1 74  ? 7.816   -3.691  -1.378  1.00 0.82   ? 74  LEU A N    5  
ATOM 9895  C CA   . LEU A 1 74  ? 6.492   -3.853  -1.980  1.00 0.98   ? 74  LEU A CA   5  
ATOM 9896  C C    . LEU A 1 74  ? 6.513   -5.021  -2.978  1.00 0.98   ? 74  LEU A C    5  
ATOM 9897  O O    . LEU A 1 74  ? 7.118   -4.894  -4.043  1.00 1.02   ? 74  LEU A O    5  
ATOM 9898  C CB   . LEU A 1 74  ? 6.030   -2.516  -2.611  1.00 1.26   ? 74  LEU A CB   5  
ATOM 9899  C CG   . LEU A 1 74  ? 6.504   -1.199  -1.943  1.00 1.88   ? 74  LEU A CG   5  
ATOM 9900  C CD1  . LEU A 1 74  ? 7.836   -0.699  -2.533  1.00 1.71   ? 74  LEU A CD1  5  
ATOM 9901  C CD2  . LEU A 1 74  ? 5.484   -0.062  -2.105  1.00 3.27   ? 74  LEU A CD2  5  
ATOM 9902  H H    . LEU A 1 74  ? 8.516   -3.196  -1.906  1.00 0.98   ? 74  LEU A H    5  
ATOM 9903  H HA   . LEU A 1 74  ? 5.777   -4.111  -1.205  1.00 1.06   ? 74  LEU A HA   5  
ATOM 9904  H HB2  . LEU A 1 74  ? 6.350   -2.490  -3.649  1.00 1.38   ? 74  LEU A HB2  5  
ATOM 9905  H HB3  . LEU A 1 74  ? 4.938   -2.541  -2.603  1.00 1.95   ? 74  LEU A HB3  5  
ATOM 9906  H HG   . LEU A 1 74  ? 6.632   -1.371  -0.876  1.00 2.92   ? 74  LEU A HG   5  
ATOM 9907  H HD11 . LEU A 1 74  ? 8.147   0.210   -2.016  1.00 2.49   ? 74  LEU A HD11 5  
ATOM 9908  H HD12 . LEU A 1 74  ? 8.620   -1.444  -2.419  1.00 2.45   ? 74  LEU A HD12 5  
ATOM 9909  H HD13 . LEU A 1 74  ? 7.718   -0.477  -3.594  1.00 2.21   ? 74  LEU A HD13 5  
ATOM 9910  H HD21 . LEU A 1 74  ? 5.462   0.293   -3.132  1.00 3.60   ? 74  LEU A HD21 5  
ATOM 9911  H HD22 . LEU A 1 74  ? 4.485   -0.392  -1.826  1.00 4.29   ? 74  LEU A HD22 5  
ATOM 9912  H HD23 . LEU A 1 74  ? 5.767   0.768   -1.458  1.00 4.07   ? 74  LEU A HD23 5  
ATOM 9913  N N    . MET A 1 75  ? 5.935   -6.173  -2.635  1.00 1.29   ? 75  MET A N    5  
ATOM 9914  C CA   . MET A 1 75  ? 6.156   -7.455  -3.334  1.00 1.66   ? 75  MET A CA   5  
ATOM 9915  C C    . MET A 1 75  ? 4.838   -8.081  -3.807  1.00 1.89   ? 75  MET A C    5  
ATOM 9916  O O    . MET A 1 75  ? 3.905   -8.210  -3.009  1.00 2.25   ? 75  MET A O    5  
ATOM 9917  C CB   . MET A 1 75  ? 6.916   -8.405  -2.395  1.00 1.85   ? 75  MET A CB   5  
ATOM 9918  C CG   . MET A 1 75  ? 7.507   -9.609  -3.137  1.00 2.53   ? 75  MET A CG   5  
ATOM 9919  S SD   . MET A 1 75  ? 8.493   -10.686 -2.067  1.00 2.78   ? 75  MET A SD   5  
ATOM 9920  C CE   . MET A 1 75  ? 9.102   -11.850 -3.309  1.00 4.30   ? 75  MET A CE   5  
ATOM 9921  H H    . MET A 1 75  ? 5.377   -6.177  -1.785  1.00 1.46   ? 75  MET A H    5  
ATOM 9922  H HA   . MET A 1 75  ? 6.780   -7.282  -4.209  1.00 1.84   ? 75  MET A HA   5  
ATOM 9923  H HB2  . MET A 1 75  ? 7.741   -7.859  -1.936  1.00 2.63   ? 75  MET A HB2  5  
ATOM 9924  H HB3  . MET A 1 75  ? 6.255   -8.750  -1.597  1.00 2.51   ? 75  MET A HB3  5  
ATOM 9925  H HG2  . MET A 1 75  ? 6.702   -10.200 -3.580  1.00 3.36   ? 75  MET A HG2  5  
ATOM 9926  H HG3  . MET A 1 75  ? 8.150   -9.240  -3.938  1.00 3.41   ? 75  MET A HG3  5  
ATOM 9927  H HE1  . MET A 1 75  ? 8.260   -12.308 -3.831  1.00 4.79   ? 75  MET A HE1  5  
ATOM 9928  H HE2  . MET A 1 75  ? 9.730   -11.328 -4.030  1.00 4.88   ? 75  MET A HE2  5  
ATOM 9929  H HE3  . MET A 1 75  ? 9.684   -12.630 -2.818  1.00 5.10   ? 75  MET A HE3  5  
ATOM 9930  N N    . THR A 1 76  ? 4.805   -8.498  -5.083  1.00 1.95   ? 76  THR A N    5  
ATOM 9931  C CA   . THR A 1 76  ? 3.601   -8.956  -5.791  1.00 2.01   ? 76  THR A CA   5  
ATOM 9932  C C    . THR A 1 76  ? 3.841   -10.225 -6.605  1.00 2.25   ? 76  THR A C    5  
ATOM 9933  O O    . THR A 1 76  ? 4.951   -10.513 -7.061  1.00 2.66   ? 76  THR A O    5  
ATOM 9934  C CB   . THR A 1 76  ? 2.958   -7.811  -6.596  1.00 2.28   ? 76  THR A CB   5  
ATOM 9935  O OG1  . THR A 1 76  ? 2.021   -8.317  -7.511  1.00 2.79   ? 76  THR A OG1  5  
ATOM 9936  C CG2  . THR A 1 76  ? 3.937   -6.950  -7.392  1.00 2.99   ? 76  THR A CG2  5  
ATOM 9937  H H    . THR A 1 76  ? 5.647   -8.429  -5.643  1.00 2.01   ? 76  THR A H    5  
ATOM 9938  H HA   . THR A 1 76  ? 2.871   -9.240  -5.032  1.00 1.76   ? 76  THR A HA   5  
ATOM 9939  H HB   . THR A 1 76  ? 2.420   -7.179  -5.887  1.00 2.10   ? 76  THR A HB   5  
ATOM 9940  H HG1  . THR A 1 76  ? 1.230   -8.545  -6.994  1.00 2.84   ? 76  THR A HG1  5  
ATOM 9941  H HG21 . THR A 1 76  ? 4.522   -7.577  -8.063  1.00 3.98   ? 76  THR A HG21 5  
ATOM 9942  H HG22 . THR A 1 76  ? 3.374   -6.221  -7.978  1.00 2.79   ? 76  THR A HG22 5  
ATOM 9943  H HG23 . THR A 1 76  ? 4.592   -6.403  -6.717  1.00 3.59   ? 76  THR A HG23 5  
ATOM 9944  N N    . THR A 1 77  ? 2.760   -11.000 -6.728  1.00 2.07   ? 77  THR A N    5  
ATOM 9945  C CA   . THR A 1 77  ? 2.697   -12.371 -7.244  1.00 2.30   ? 77  THR A CA   5  
ATOM 9946  C C    . THR A 1 77  ? 1.673   -12.422 -8.373  1.00 2.38   ? 77  THR A C    5  
ATOM 9947  O O    . THR A 1 77  ? 1.935   -11.883 -9.442  1.00 3.60   ? 77  THR A O    5  
ATOM 9948  C CB   . THR A 1 77  ? 2.527   -13.380 -6.093  1.00 2.23   ? 77  THR A CB   5  
ATOM 9949  O OG1  . THR A 1 77  ? 3.515   -13.105 -5.124  1.00 2.79   ? 77  THR A OG1  5  
ATOM 9950  C CG2  . THR A 1 77  ? 2.809   -14.818 -6.526  1.00 3.20   ? 77  THR A CG2  5  
ATOM 9951  H H    . THR A 1 77  ? 1.895   -10.573 -6.416  1.00 1.84   ? 77  THR A H    5  
ATOM 9952  H HA   . THR A 1 77  ? 3.634   -12.621 -7.714  1.00 2.91   ? 77  THR A HA   5  
ATOM 9953  H HB   . THR A 1 77  ? 1.529   -13.301 -5.655  1.00 2.06   ? 77  THR A HB   5  
ATOM 9954  H HG1  . THR A 1 77  ? 3.340   -13.627 -4.337  1.00 3.51   ? 77  THR A HG1  5  
ATOM 9955  H HG21 . THR A 1 77  ? 2.089   -15.144 -7.267  1.00 3.72   ? 77  THR A HG21 5  
ATOM 9956  H HG22 . THR A 1 77  ? 3.809   -14.883 -6.954  1.00 3.55   ? 77  THR A HG22 5  
ATOM 9957  H HG23 . THR A 1 77  ? 2.742   -15.483 -5.662  1.00 4.13   ? 77  THR A HG23 5  
ATOM 9958  N N    . THR A 1 78  ? 0.543   -13.101 -8.189  1.00 2.16   ? 78  THR A N    5  
ATOM 9959  C CA   . THR A 1 78  ? -0.344  -13.541 -9.283  1.00 2.37   ? 78  THR A CA   5  
ATOM 9960  C C    . THR A 1 78  ? -1.843  -13.513 -8.976  1.00 2.36   ? 78  THR A C    5  
ATOM 9961  O O    . THR A 1 78  ? -2.601  -14.414 -9.319  1.00 3.62   ? 78  THR A O    5  
ATOM 9962  C CB   . THR A 1 78  ? 0.040   -14.939 -9.736  1.00 4.35   ? 78  THR A CB   5  
ATOM 9963  O OG1  . THR A 1 78  ? 0.075   -15.771 -8.601  1.00 5.17   ? 78  THR A OG1  5  
ATOM 9964  C CG2  . THR A 1 78  ? 1.379   -15.021 -10.468 1.00 5.68   ? 78  THR A CG2  5  
ATOM 9965  H H    . THR A 1 78  ? 0.509   -13.610 -7.331  1.00 2.88   ? 78  THR A H    5  
ATOM 9966  H HA   . THR A 1 78  ? -0.209  -12.862 -10.118 1.00 2.29   ? 78  THR A HA   5  
ATOM 9967  H HB   . THR A 1 78  ? -0.756  -15.232 -10.408 1.00 4.67   ? 78  THR A HB   5  
ATOM 9968  H HG1  . THR A 1 78  ? 0.314   -16.671 -8.859  1.00 6.34   ? 78  THR A HG1  5  
ATOM 9969  H HG21 . THR A 1 78  ? 2.195   -14.791 -9.788  1.00 6.20   ? 78  THR A HG21 5  
ATOM 9970  H HG22 . THR A 1 78  ? 1.516   -16.027 -10.861 1.00 6.66   ? 78  THR A HG22 5  
ATOM 9971  H HG23 . THR A 1 78  ? 1.388   -14.314 -11.297 1.00 5.74   ? 78  THR A HG23 5  
ATOM 9972  N N    . HIS A 1 79  ? -2.297  -12.414 -8.406  1.00 2.47   ? 79  HIS A N    5  
ATOM 9973  C CA   . HIS A 1 79  ? -3.729  -12.113 -8.317  1.00 3.34   ? 79  HIS A CA   5  
ATOM 9974  C C    . HIS A 1 79  ? -4.070  -10.639 -8.600  1.00 3.47   ? 79  HIS A C    5  
ATOM 9975  O O    . HIS A 1 79  ? -3.365  -9.735  -8.171  1.00 4.83   ? 79  HIS A O    5  
ATOM 9976  C CB   . HIS A 1 79  ? -4.283  -12.504 -6.936  1.00 4.89   ? 79  HIS A CB   5  
ATOM 9977  C CG   . HIS A 1 79  ? -4.514  -13.985 -6.719  1.00 5.31   ? 79  HIS A CG   5  
ATOM 9978  N ND1  . HIS A 1 79  ? -3.947  -14.753 -5.731  1.00 6.47   ? 79  HIS A ND1  5  
ATOM 9979  C CD2  . HIS A 1 79  ? -5.402  -14.786 -7.391  1.00 5.34   ? 79  HIS A CD2  5  
ATOM 9980  C CE1  . HIS A 1 79  ? -4.474  -15.989 -5.814  1.00 6.91   ? 79  HIS A CE1  5  
ATOM 9981  N NE2  . HIS A 1 79  ? -5.379  -16.063 -6.814  1.00 6.29   ? 79  HIS A NE2  5  
ATOM 9982  H H    . HIS A 1 79  ? -1.628  -11.681 -8.280  1.00 2.80   ? 79  HIS A H    5  
ATOM 9983  H HA   . HIS A 1 79  ? -4.242  -12.703 -9.076  1.00 3.56   ? 79  HIS A HA   5  
ATOM 9984  H HB2  . HIS A 1 79  ? -3.624  -12.125 -6.159  1.00 5.78   ? 79  HIS A HB2  5  
ATOM 9985  H HB3  . HIS A 1 79  ? -5.246  -12.018 -6.791  1.00 5.54   ? 79  HIS A HB3  5  
ATOM 9986  H HD1  . HIS A 1 79  ? -3.285  -14.419 -5.035  1.00 7.19   ? 79  HIS A HD1  5  
ATOM 9987  H HD2  . HIS A 1 79  ? -6.034  -14.471 -8.210  1.00 5.21   ? 79  HIS A HD2  5  
ATOM 9988  H HE1  . HIS A 1 79  ? -4.213  -16.812 -5.159  1.00 7.95   ? 79  HIS A HE1  5  
ATOM 9989  N N    . SER A 1 80  ? -5.202  -10.458 -9.283  1.00 2.76   ? 80  SER A N    5  
ATOM 9990  C CA   . SER A 1 80  ? -6.044  -9.269  -9.509  1.00 3.07   ? 80  SER A CA   5  
ATOM 9991  C C    . SER A 1 80  ? -7.035  -9.560  -10.668 1.00 2.87   ? 80  SER A C    5  
ATOM 9992  O O    . SER A 1 80  ? -7.096  -10.687 -11.173 1.00 3.52   ? 80  SER A O    5  
ATOM 9993  C CB   . SER A 1 80  ? -5.256  -7.958  -9.702  1.00 3.38   ? 80  SER A CB   5  
ATOM 9994  O OG   . SER A 1 80  ? -6.131  -6.830  -9.635  1.00 4.50   ? 80  SER A OG   5  
ATOM 9995  H H    . SER A 1 80  ? -5.546  -11.286 -9.755  1.00 2.61   ? 80  SER A H    5  
ATOM 9996  H HA   . SER A 1 80  ? -6.657  -9.133  -8.619  1.00 4.01   ? 80  SER A HA   5  
ATOM 9997  H HB2  . SER A 1 80  ? -4.515  -7.838  -8.914  1.00 3.71   ? 80  SER A HB2  5  
ATOM 9998  H HB3  . SER A 1 80  ? -4.753  -7.977  -10.665 1.00 3.55   ? 80  SER A HB3  5  
ATOM 9999  H HG   . SER A 1 80  ? -6.218  -6.551  -8.696  1.00 5.03   ? 80  SER A HG   5  
ATOM 10000 N N    . GLY A 1 81  ? -7.843  -8.580  -11.098 1.00 2.69   ? 81  GLY A N    5  
ATOM 10001 C CA   . GLY A 1 81  ? -8.992  -8.747  -12.011 1.00 3.02   ? 81  GLY A CA   5  
ATOM 10002 C C    . GLY A 1 81  ? -8.614  -8.943  -13.485 1.00 2.92   ? 81  GLY A C    5  
ATOM 10003 O O    . GLY A 1 81  ? -8.943  -8.108  -14.332 1.00 3.31   ? 81  GLY A O    5  
ATOM 10004 H H    . GLY A 1 81  ? -7.701  -7.666  -10.686 1.00 2.93   ? 81  GLY A H    5  
ATOM 10005 H HA2  . GLY A 1 81  ? -9.559  -9.629  -11.703 1.00 3.56   ? 81  GLY A HA2  5  
ATOM 10006 H HA3  . GLY A 1 81  ? -9.634  -7.865  -11.947 1.00 3.32   ? 81  GLY A HA3  5  
ATOM 10007 N N    . GLY A 1 82  ? -7.923  -10.045 -13.788 1.00 3.28   ? 82  GLY A N    5  
ATOM 10008 C CA   . GLY A 1 82  ? -7.361  -10.341 -15.108 1.00 3.69   ? 82  GLY A CA   5  
ATOM 10009 C C    . GLY A 1 82  ? -5.940  -9.806  -15.235 1.00 3.30   ? 82  GLY A C    5  
ATOM 10010 O O    . GLY A 1 82  ? -5.499  -9.512  -16.342 1.00 3.45   ? 82  GLY A O    5  
ATOM 10011 H H    . GLY A 1 82  ? -7.630  -10.625 -13.011 1.00 3.71   ? 82  GLY A H    5  
ATOM 10012 H HA2  . GLY A 1 82  ? -7.323  -11.421 -15.253 1.00 4.29   ? 82  GLY A HA2  5  
ATOM 10013 H HA3  . GLY A 1 82  ? -7.970  -9.890  -15.891 1.00 3.98   ? 82  GLY A HA3  5  
ATOM 10014 N N    . MET A 1 83  ? -5.246  -9.647  -14.104 1.00 2.96   ? 83  MET A N    5  
ATOM 10015 C CA   . MET A 1 83  ? -3.885  -9.123  -14.018 1.00 2.63   ? 83  MET A CA   5  
ATOM 10016 C C    . MET A 1 83  ? -3.126  -9.848  -12.906 1.00 2.43   ? 83  MET A C    5  
ATOM 10017 O O    . MET A 1 83  ? -3.718  -10.238 -11.901 1.00 2.65   ? 83  MET A O    5  
ATOM 10018 C CB   . MET A 1 83  ? -3.927  -7.596  -13.824 1.00 2.56   ? 83  MET A CB   5  
ATOM 10019 C CG   . MET A 1 83  ? -2.537  -6.947  -13.831 1.00 2.87   ? 83  MET A CG   5  
ATOM 10020 S SD   . MET A 1 83  ? -1.559  -7.290  -15.321 1.00 4.01   ? 83  MET A SD   5  
ATOM 10021 C CE   . MET A 1 83  ? 0.013   -6.553  -14.805 1.00 4.58   ? 83  MET A CE   5  
ATOM 10022 H H    . MET A 1 83  ? -5.663  -9.962  -13.234 1.00 3.09   ? 83  MET A H    5  
ATOM 10023 H HA   . MET A 1 83  ? -3.390  -9.345  -14.960 1.00 2.83   ? 83  MET A HA   5  
ATOM 10024 H HB2  . MET A 1 83  ? -4.510  -7.158  -14.634 1.00 2.71   ? 83  MET A HB2  5  
ATOM 10025 H HB3  . MET A 1 83  ? -4.426  -7.360  -12.884 1.00 2.65   ? 83  MET A HB3  5  
ATOM 10026 H HG2  . MET A 1 83  ? -2.659  -5.865  -13.742 1.00 2.86   ? 83  MET A HG2  5  
ATOM 10027 H HG3  . MET A 1 83  ? -1.981  -7.282  -12.953 1.00 3.51   ? 83  MET A HG3  5  
ATOM 10028 H HE1  . MET A 1 83  ? 0.384   -7.053  -13.908 1.00 5.28   ? 83  MET A HE1  5  
ATOM 10029 H HE2  . MET A 1 83  ? 0.754   -6.662  -15.598 1.00 5.22   ? 83  MET A HE2  5  
ATOM 10030 H HE3  . MET A 1 83  ? -0.120  -5.493  -14.591 1.00 4.55   ? 83  MET A HE3  5  
ATOM 10031 N N    . ALA A 1 84  ? -1.830  -10.072 -13.121 1.00 2.29   ? 84  ALA A N    5  
ATOM 10032 C CA   . ALA A 1 84  ? -0.969  -10.978 -12.365 1.00 2.24   ? 84  ALA A CA   5  
ATOM 10033 C C    . ALA A 1 84  ? 0.483   -10.848 -12.866 1.00 2.18   ? 84  ALA A C    5  
ATOM 10034 O O    . ALA A 1 84  ? 0.719   -10.188 -13.880 1.00 2.41   ? 84  ALA A O    5  
ATOM 10035 C CB   . ALA A 1 84  ? -1.513  -12.411 -12.557 1.00 2.69   ? 84  ALA A CB   5  
ATOM 10036 H H    . ALA A 1 84  ? -1.404  -9.645  -13.936 1.00 2.41   ? 84  ALA A H    5  
ATOM 10037 H HA   . ALA A 1 84  ? -0.997  -10.706 -11.307 1.00 2.21   ? 84  ALA A HA   5  
ATOM 10038 H HB1  . ALA A 1 84  ? -0.820  -13.150 -12.162 1.00 3.22   ? 84  ALA A HB1  5  
ATOM 10039 H HB2  . ALA A 1 84  ? -2.473  -12.523 -12.048 1.00 3.42   ? 84  ALA A HB2  5  
ATOM 10040 H HB3  . ALA A 1 84  ? -1.651  -12.613 -13.621 1.00 2.81   ? 84  ALA A HB3  5  
ATOM 10041 N N    . GLY A 1 85  ? 1.426   -11.539 -12.216 1.00 2.22   ? 85  GLY A N    5  
ATOM 10042 C CA   . GLY A 1 85  ? 2.781   -11.740 -12.742 1.00 2.62   ? 85  GLY A CA   5  
ATOM 10043 C C    . GLY A 1 85  ? 3.848   -11.269 -11.764 1.00 2.11   ? 85  GLY A C    5  
ATOM 10044 O O    . GLY A 1 85  ? 4.039   -10.071 -11.568 1.00 2.76   ? 85  GLY A O    5  
ATOM 10045 H H    . GLY A 1 85  ? 1.212   -11.896 -11.284 1.00 2.18   ? 85  GLY A H    5  
ATOM 10046 H HA2  . GLY A 1 85  ? 2.927   -12.804 -12.929 1.00 3.36   ? 85  GLY A HA2  5  
ATOM 10047 H HA3  . GLY A 1 85  ? 2.921   -11.204 -13.682 1.00 3.21   ? 85  GLY A HA3  5  
ATOM 10048 N N    . MET A 1 86  ? 4.570   -12.241 -11.204 1.00 2.49   ? 86  MET A N    5  
ATOM 10049 C CA   . MET A 1 86  ? 5.496   -12.045 -10.088 1.00 2.14   ? 86  MET A CA   5  
ATOM 10050 C C    . MET A 1 86  ? 6.558   -10.970 -10.371 1.00 2.17   ? 86  MET A C    5  
ATOM 10051 O O    . MET A 1 86  ? 7.171   -10.961 -11.448 1.00 3.07   ? 86  MET A O    5  
ATOM 10052 C CB   . MET A 1 86  ? 6.110   -13.409 -9.746  1.00 3.12   ? 86  MET A CB   5  
ATOM 10053 C CG   . MET A 1 86  ? 6.838   -13.427 -8.402  1.00 4.08   ? 86  MET A CG   5  
ATOM 10054 S SD   . MET A 1 86  ? 7.722   -14.978 -8.101  1.00 5.24   ? 86  MET A SD   5  
ATOM 10055 C CE   . MET A 1 86  ? 6.365   -16.041 -7.553  1.00 6.33   ? 86  MET A CE   5  
ATOM 10056 H H    . MET A 1 86  ? 4.351   -13.188 -11.464 1.00 3.61   ? 86  MET A H    5  
ATOM 10057 H HA   . MET A 1 86  ? 4.911   -11.703 -9.237  1.00 1.82   ? 86  MET A HA   5  
ATOM 10058 H HB2  . MET A 1 86  ? 5.318   -14.158 -9.708  1.00 3.44   ? 86  MET A HB2  5  
ATOM 10059 H HB3  . MET A 1 86  ? 6.810   -13.691 -10.534 1.00 3.74   ? 86  MET A HB3  5  
ATOM 10060 H HG2  . MET A 1 86  ? 7.574   -12.622 -8.390  1.00 4.53   ? 86  MET A HG2  5  
ATOM 10061 H HG3  . MET A 1 86  ? 6.129   -13.242 -7.589  1.00 4.41   ? 86  MET A HG3  5  
ATOM 10062 H HE1  . MET A 1 86  ? 5.950   -15.646 -6.625  1.00 6.76   ? 86  MET A HE1  5  
ATOM 10063 H HE2  . MET A 1 86  ? 5.589   -16.087 -8.317  1.00 6.51   ? 86  MET A HE2  5  
ATOM 10064 H HE3  . MET A 1 86  ? 6.748   -17.044 -7.360  1.00 7.19   ? 86  MET A HE3  5  
ATOM 10065 N N    . LYS A 1 87  ? 6.747   -10.069 -9.400  1.00 1.82   ? 87  LYS A N    5  
ATOM 10066 C CA   . LYS A 1 87  ? 7.565   -8.852  -9.463  1.00 2.45   ? 87  LYS A CA   5  
ATOM 10067 C C    . LYS A 1 87  ? 7.572   -8.084  -8.120  1.00 1.15   ? 87  LYS A C    5  
ATOM 10068 O O    . LYS A 1 87  ? 7.201   -8.615  -7.073  1.00 1.81   ? 87  LYS A O    5  
ATOM 10069 C CB   . LYS A 1 87  ? 7.153   -7.994  -10.694 1.00 4.40   ? 87  LYS A CB   5  
ATOM 10070 C CG   . LYS A 1 87  ? 8.274   -7.999  -11.747 1.00 5.77   ? 87  LYS A CG   5  
ATOM 10071 C CD   . LYS A 1 87  ? 7.784   -7.625  -13.159 1.00 7.60   ? 87  LYS A CD   5  
ATOM 10072 C CE   . LYS A 1 87  ? 8.415   -8.563  -14.198 1.00 8.94   ? 87  LYS A CE   5  
ATOM 10073 N NZ   . LYS A 1 87  ? 7.778   -9.902  -14.184 1.00 9.48   ? 87  LYS A NZ   5  
ATOM 10074 H H    . LYS A 1 87  ? 6.176   -10.168 -8.563  1.00 1.73   ? 87  LYS A H    5  
ATOM 10075 H HA   . LYS A 1 87  ? 8.596   -9.174  -9.598  1.00 3.72   ? 87  LYS A HA   5  
ATOM 10076 H HB2  . LYS A 1 87  ? 6.236   -8.396  -11.128 1.00 5.17   ? 87  LYS A HB2  5  
ATOM 10077 H HB3  . LYS A 1 87  ? 6.927   -6.962  -10.421 1.00 5.01   ? 87  LYS A HB3  5  
ATOM 10078 H HG2  . LYS A 1 87  ? 9.056   -7.302  -11.442 1.00 6.12   ? 87  LYS A HG2  5  
ATOM 10079 H HG3  . LYS A 1 87  ? 8.726   -8.990  -11.781 1.00 5.70   ? 87  LYS A HG3  5  
ATOM 10080 H HD2  . LYS A 1 87  ? 6.697   -7.687  -13.230 1.00 7.72   ? 87  LYS A HD2  5  
ATOM 10081 H HD3  . LYS A 1 87  ? 8.078   -6.596  -13.373 1.00 8.37   ? 87  LYS A HD3  5  
ATOM 10082 H HE2  . LYS A 1 87  ? 8.314   -8.124  -15.194 1.00 10.06  ? 87  LYS A HE2  5  
ATOM 10083 H HE3  . LYS A 1 87  ? 9.481   -8.671  -13.976 1.00 8.91   ? 87  LYS A HE3  5  
ATOM 10084 H HZ1  . LYS A 1 87  ? 7.628   -10.230 -13.232 1.00 9.20   ? 87  LYS A HZ1  5  
ATOM 10085 H HZ2  . LYS A 1 87  ? 6.880   -9.856  -14.659 1.00 10.03  ? 87  LYS A HZ2  5  
ATOM 10086 H HZ3  . LYS A 1 87  ? 8.391   -10.568 -14.646 1.00 10.02  ? 87  LYS A HZ3  5  
ATOM 10087 N N    . MET A 1 88  ? 8.028   -6.831  -8.133  1.00 1.61   ? 88  MET A N    5  
ATOM 10088 C CA   . MET A 1 88  ? 8.054   -5.934  -6.969  1.00 1.78   ? 88  MET A CA   5  
ATOM 10089 C C    . MET A 1 88  ? 7.811   -4.491  -7.415  1.00 1.70   ? 88  MET A C    5  
ATOM 10090 O O    . MET A 1 88  ? 8.110   -4.161  -8.560  1.00 2.52   ? 88  MET A O    5  
ATOM 10091 C CB   . MET A 1 88  ? 9.380   -6.078  -6.196  1.00 3.37   ? 88  MET A CB   5  
ATOM 10092 C CG   . MET A 1 88  ? 10.617  -5.705  -7.027  1.00 3.44   ? 88  MET A CG   5  
ATOM 10093 S SD   . MET A 1 88  ? 12.178  -5.920  -6.139  1.00 5.33   ? 88  MET A SD   5  
ATOM 10094 C CE   . MET A 1 88  ? 13.326  -5.675  -7.515  1.00 5.33   ? 88  MET A CE   5  
ATOM 10095 H H    . MET A 1 88  ? 8.251   -6.414  -9.024  1.00 2.80   ? 88  MET A H    5  
ATOM 10096 H HA   . MET A 1 88  ? 7.238   -6.211  -6.298  1.00 2.15   ? 88  MET A HA   5  
ATOM 10097 H HB2  . MET A 1 88  ? 9.353   -5.437  -5.314  1.00 4.66   ? 88  MET A HB2  5  
ATOM 10098 H HB3  . MET A 1 88  ? 9.481   -7.110  -5.855  1.00 4.22   ? 88  MET A HB3  5  
ATOM 10099 H HG2  . MET A 1 88  ? 10.644  -6.333  -7.916  1.00 2.89   ? 88  MET A HG2  5  
ATOM 10100 H HG3  . MET A 1 88  ? 10.540  -4.664  -7.348  1.00 4.13   ? 88  MET A HG3  5  
ATOM 10101 H HE1  . MET A 1 88  ? 14.350  -5.733  -7.151  1.00 5.84   ? 88  MET A HE1  5  
ATOM 10102 H HE2  . MET A 1 88  ? 13.173  -6.446  -8.271  1.00 5.39   ? 88  MET A HE2  5  
ATOM 10103 H HE3  . MET A 1 88  ? 13.166  -4.690  -7.961  1.00 5.48   ? 88  MET A HE3  5  
ATOM 10104 N N    . VAL A 1 89  ? 7.290   -3.663  -6.507  1.00 1.71   ? 89  VAL A N    5  
ATOM 10105 C CA   . VAL A 1 89  ? 6.859   -2.266  -6.683  1.00 1.63   ? 89  VAL A CA   5  
ATOM 10106 C C    . VAL A 1 89  ? 5.481   -2.213  -7.382  1.00 1.53   ? 89  VAL A C    5  
ATOM 10107 O O    . VAL A 1 89  ? 5.391   -2.594  -8.551  1.00 1.98   ? 89  VAL A O    5  
ATOM 10108 C CB   . VAL A 1 89  ? 7.884   -1.352  -7.404  1.00 2.04   ? 89  VAL A CB   5  
ATOM 10109 C CG1  . VAL A 1 89  ? 7.423   0.117   -7.346  1.00 2.69   ? 89  VAL A CG1  5  
ATOM 10110 C CG2  . VAL A 1 89  ? 9.273   -1.429  -6.739  1.00 3.55   ? 89  VAL A CG2  5  
ATOM 10111 H H    . VAL A 1 89  ? 7.169   -4.058  -5.577  1.00 2.39   ? 89  VAL A H    5  
ATOM 10112 H HA   . VAL A 1 89  ? 6.778   -1.876  -5.675  1.00 1.65   ? 89  VAL A HA   5  
ATOM 10113 H HB   . VAL A 1 89  ? 7.984   -1.629  -8.453  1.00 2.17   ? 89  VAL A HB   5  
ATOM 10114 H HG11 . VAL A 1 89  ? 6.483   0.240   -7.881  1.00 3.03   ? 89  VAL A HG11 5  
ATOM 10115 H HG12 . VAL A 1 89  ? 7.287   0.430   -6.309  1.00 3.73   ? 89  VAL A HG12 5  
ATOM 10116 H HG13 . VAL A 1 89  ? 8.168   0.760   -7.816  1.00 3.44   ? 89  VAL A HG13 5  
ATOM 10117 H HG21 . VAL A 1 89  ? 9.958   -0.736  -7.230  1.00 4.26   ? 89  VAL A HG21 5  
ATOM 10118 H HG22 . VAL A 1 89  ? 9.199   -1.167  -5.682  1.00 4.34   ? 89  VAL A HG22 5  
ATOM 10119 H HG23 . VAL A 1 89  ? 9.686   -2.432  -6.829  1.00 4.12   ? 89  VAL A HG23 5  
ATOM 10120 N N    . PRO A 1 90  ? 4.416   -1.748  -6.692  1.00 1.28   ? 90  PRO A N    5  
ATOM 10121 C CA   . PRO A 1 90  ? 3.077   -1.640  -7.247  1.00 1.51   ? 90  PRO A CA   5  
ATOM 10122 C C    . PRO A 1 90  ? 2.989   -0.531  -8.292  1.00 1.90   ? 90  PRO A C    5  
ATOM 10123 O O    . PRO A 1 90  ? 3.711   0.466   -8.274  1.00 3.10   ? 90  PRO A O    5  
ATOM 10124 C CB   . PRO A 1 90  ? 2.132   -1.378  -6.072  1.00 1.60   ? 90  PRO A CB   5  
ATOM 10125 C CG   . PRO A 1 90  ? 3.031   -0.724  -5.034  1.00 1.41   ? 90  PRO A CG   5  
ATOM 10126 C CD   . PRO A 1 90  ? 4.362   -1.420  -5.280  1.00 1.16   ? 90  PRO A CD   5  
ATOM 10127 H HA   . PRO A 1 90  ? 2.799   -2.590  -7.711  1.00 1.67   ? 90  PRO A HA   5  
ATOM 10128 H HB2  . PRO A 1 90  ? 1.295   -0.740  -6.354  1.00 1.91   ? 90  PRO A HB2  5  
ATOM 10129 H HB3  . PRO A 1 90  ? 1.768   -2.324  -5.678  1.00 1.78   ? 90  PRO A HB3  5  
ATOM 10130 H HG2  . PRO A 1 90  ? 3.131   0.337   -5.239  1.00 1.57   ? 90  PRO A HG2  5  
ATOM 10131 H HG3  . PRO A 1 90  ? 2.670   -0.888  -4.018  1.00 1.68   ? 90  PRO A HG3  5  
ATOM 10132 H HD2  . PRO A 1 90  ? 5.179   -0.762  -4.998  1.00 1.43   ? 90  PRO A HD2  5  
ATOM 10133 H HD3  . PRO A 1 90  ? 4.382   -2.350  -4.716  1.00 1.28   ? 90  PRO A HD3  5  
ATOM 10134 N N    . TRP A 1 91  ? 2.054   -0.753  -9.206  1.00 1.50   ? 91  TRP A N    5  
ATOM 10135 C CA   . TRP A 1 91  ? 1.853   -0.038  -10.464 1.00 1.89   ? 91  TRP A CA   5  
ATOM 10136 C C    . TRP A 1 91  ? 0.671   0.947   -10.399 1.00 2.23   ? 91  TRP A C    5  
ATOM 10137 O O    . TRP A 1 91  ? 0.157   1.292   -9.332  1.00 2.69   ? 91  TRP A O    5  
ATOM 10138 C CB   . TRP A 1 91  ? 1.708   -1.124  -11.565 1.00 2.37   ? 91  TRP A CB   5  
ATOM 10139 C CG   . TRP A 1 91  ? 1.116   -2.437  -11.125 1.00 2.54   ? 91  TRP A CG   5  
ATOM 10140 C CD1  . TRP A 1 91  ? -0.059  -2.604  -10.469 1.00 2.33   ? 91  TRP A CD1  5  
ATOM 10141 C CD2  . TRP A 1 91  ? 1.745   -3.760  -11.169 1.00 3.15   ? 91  TRP A CD2  5  
ATOM 10142 N NE1  . TRP A 1 91  ? -0.154  -3.913  -10.038 1.00 2.71   ? 91  TRP A NE1  5  
ATOM 10143 C CE2  . TRP A 1 91  ? 0.909   -4.679  -10.467 1.00 3.25   ? 91  TRP A CE2  5  
ATOM 10144 C CE3  . TRP A 1 91  ? 2.954   -4.270  -11.693 1.00 3.77   ? 91  TRP A CE3  5  
ATOM 10145 C CZ2  . TRP A 1 91  ? 1.254   -6.027  -10.294 1.00 3.90   ? 91  TRP A CZ2  5  
ATOM 10146 C CZ3  . TRP A 1 91  ? 3.302   -5.627  -11.543 1.00 4.43   ? 91  TRP A CZ3  5  
ATOM 10147 C CH2  . TRP A 1 91  ? 2.452   -6.507  -10.850 1.00 4.49   ? 91  TRP A CH2  5  
ATOM 10148 H H    . TRP A 1 91  ? 1.495   -1.589  -9.093  1.00 1.80   ? 91  TRP A H    5  
ATOM 10149 H HA   . TRP A 1 91  ? 2.744   0.552   -10.680 1.00 2.17   ? 91  TRP A HA   5  
ATOM 10150 H HB2  . TRP A 1 91  ? 1.149   -0.761  -12.425 1.00 2.78   ? 91  TRP A HB2  5  
ATOM 10151 H HB3  . TRP A 1 91  ? 2.715   -1.337  -11.926 1.00 2.60   ? 91  TRP A HB3  5  
ATOM 10152 H HD1  . TRP A 1 91  ? -0.762  -1.815  -10.215 1.00 2.11   ? 91  TRP A HD1  5  
ATOM 10153 H HE1  . TRP A 1 91  ? -0.841  -4.228  -9.365  1.00 2.73   ? 91  TRP A HE1  5  
ATOM 10154 H HE3  . TRP A 1 91  ? 3.632   -3.598  -12.198 1.00 3.78   ? 91  TRP A HE3  5  
ATOM 10155 H HZ2  . TRP A 1 91  ? 0.613   -6.685  -9.725  1.00 4.00   ? 91  TRP A HZ2  5  
ATOM 10156 H HZ3  . TRP A 1 91  ? 4.235   -5.994  -11.946 1.00 4.94   ? 91  TRP A HZ3  5  
ATOM 10157 H HH2  . TRP A 1 91  ? 2.734   -7.543  -10.718 1.00 5.04   ? 91  TRP A HH2  5  
ATOM 10158 N N    . LEU A 1 92  ? 0.254   1.436   -11.572 1.00 2.65   ? 92  LEU A N    5  
ATOM 10159 C CA   . LEU A 1 92  ? -0.870  2.342   -11.754 1.00 3.21   ? 92  LEU A CA   5  
ATOM 10160 C C    . LEU A 1 92  ? -2.190  1.765   -11.226 1.00 2.34   ? 92  LEU A C    5  
ATOM 10161 O O    . LEU A 1 92  ? -2.432  0.562   -11.286 1.00 3.74   ? 92  LEU A O    5  
ATOM 10162 C CB   . LEU A 1 92  ? -0.945  2.799   -13.227 1.00 5.21   ? 92  LEU A CB   5  
ATOM 10163 C CG   . LEU A 1 92  ? -1.925  2.001   -14.111 1.00 6.70   ? 92  LEU A CG   5  
ATOM 10164 C CD1  . LEU A 1 92  ? -2.159  2.757   -15.427 1.00 8.59   ? 92  LEU A CD1  5  
ATOM 10165 C CD2  . LEU A 1 92  ? -1.399  0.593   -14.428 1.00 7.89   ? 92  LEU A CD2  5  
ATOM 10166 H H    . LEU A 1 92  ? 0.795   1.190   -12.386 1.00 2.88   ? 92  LEU A H    5  
ATOM 10167 H HA   . LEU A 1 92  ? -0.652  3.209   -11.140 1.00 3.68   ? 92  LEU A HA   5  
ATOM 10168 H HB2  . LEU A 1 92  ? -1.263  3.833   -13.231 1.00 5.79   ? 92  LEU A HB2  5  
ATOM 10169 H HB3  . LEU A 1 92  ? 0.053   2.784   -13.674 1.00 5.53   ? 92  LEU A HB3  5  
ATOM 10170 H HG   . LEU A 1 92  ? -2.881  1.941   -13.578 1.00 6.02   ? 92  LEU A HG   5  
ATOM 10171 H HD11 . LEU A 1 92  ? -1.211  2.941   -15.931 1.00 9.34   ? 92  LEU A HD11 5  
ATOM 10172 H HD12 . LEU A 1 92  ? -2.799  2.171   -16.088 1.00 9.50   ? 92  LEU A HD12 5  
ATOM 10173 H HD13 . LEU A 1 92  ? -2.654  3.702   -15.225 1.00 8.84   ? 92  LEU A HD13 5  
ATOM 10174 H HD21 . LEU A 1 92  ? -1.248  0.021   -13.515 1.00 7.81   ? 92  LEU A HD21 5  
ATOM 10175 H HD22 . LEU A 1 92  ? -2.120  0.060   -15.048 1.00 8.69   ? 92  LEU A HD22 5  
ATOM 10176 H HD23 . LEU A 1 92  ? -0.452  0.659   -14.963 1.00 8.71   ? 92  LEU A HD23 5  
ATOM 10177 N N    . THR A 1 93  ? -3.083  2.663   -10.786 1.00 2.04   ? 93  THR A N    5  
ATOM 10178 C CA   . THR A 1 93  ? -4.342  2.282   -10.135 1.00 2.89   ? 93  THR A CA   5  
ATOM 10179 C C    . THR A 1 93  ? -5.471  1.831   -11.031 1.00 2.31   ? 93  THR A C    5  
ATOM 10180 O O    . THR A 1 93  ? -6.161  0.887   -10.664 1.00 3.15   ? 93  THR A O    5  
ATOM 10181 C CB   . THR A 1 93  ? -4.743  3.222   -8.997  1.00 5.21   ? 93  THR A CB   5  
ATOM 10182 O OG1  . THR A 1 93  ? -5.960  2.785   -8.456  1.00 6.71   ? 93  THR A OG1  5  
ATOM 10183 C CG2  . THR A 1 93  ? -4.961  4.657   -9.437  1.00 6.08   ? 93  THR A CG2  5  
ATOM 10184 H H    . THR A 1 93  ? -2.805  3.626   -10.772 1.00 2.97   ? 93  THR A H    5  
ATOM 10185 H HA   . THR A 1 93  ? -4.117  1.358   -9.686  1.00 3.48   ? 93  THR A HA   5  
ATOM 10186 H HB   . THR A 1 93  ? -3.971  3.200   -8.224  1.00 5.88   ? 93  THR A HB   5  
ATOM 10187 H HG1  . THR A 1 93  ? -6.137  1.895   -8.786  1.00 7.21   ? 93  THR A HG1  5  
ATOM 10188 H HG21 . THR A 1 93  ? -4.052  5.063   -9.876  1.00 5.95   ? 93  THR A HG21 5  
ATOM 10189 H HG22 . THR A 1 93  ? -5.769  4.683   -10.167 1.00 6.35   ? 93  THR A HG22 5  
ATOM 10190 H HG23 . THR A 1 93  ? -5.234  5.258   -8.568  1.00 7.23   ? 93  THR A HG23 5  
ATOM 10191 N N    . ILE A 1 94  ? -5.660  2.495   -12.153 1.00 1.68   ? 94  ILE A N    5  
ATOM 10192 C CA   . ILE A 1 94  ? -6.666  2.242   -13.186 1.00 1.99   ? 94  ILE A CA   5  
ATOM 10193 C C    . ILE A 1 94  ? -7.808  1.252   -12.810 1.00 1.56   ? 94  ILE A C    5  
ATOM 10194 O O    . ILE A 1 94  ? -7.834  0.100   -13.252 1.00 2.63   ? 94  ILE A O    5  
ATOM 10195 C CB   . ILE A 1 94  ? -5.916  2.054   -14.516 1.00 3.98   ? 94  ILE A CB   5  
ATOM 10196 C CG1  . ILE A 1 94  ? -6.804  2.304   -15.753 1.00 5.53   ? 94  ILE A CG1  5  
ATOM 10197 C CG2  . ILE A 1 94  ? -5.211  0.691   -14.636 1.00 5.17   ? 94  ILE A CG2  5  
ATOM 10198 C CD1  . ILE A 1 94  ? -6.887  3.792   -16.114 1.00 6.86   ? 94  ILE A CD1  5  
ATOM 10199 H H    . ILE A 1 94  ? -5.068  3.304   -12.301 1.00 1.99   ? 94  ILE A H    5  
ATOM 10200 H HA   . ILE A 1 94  ? -7.160  3.192   -13.309 1.00 3.58   ? 94  ILE A HA   5  
ATOM 10201 H HB   . ILE A 1 94  ? -5.153  2.847   -14.488 1.00 4.80   ? 94  ILE A HB   5  
ATOM 10202 H HG12 . ILE A 1 94  ? -6.388  1.783   -16.615 1.00 6.60   ? 94  ILE A HG12 5  
ATOM 10203 H HG13 . ILE A 1 94  ? -7.808  1.913   -15.578 1.00 5.37   ? 94  ILE A HG13 5  
ATOM 10204 H HG21 . ILE A 1 94  ? -5.931  -0.101  -14.840 1.00 5.88   ? 94  ILE A HG21 5  
ATOM 10205 H HG22 . ILE A 1 94  ? -4.508  0.714   -15.465 1.00 6.36   ? 94  ILE A HG22 5  
ATOM 10206 H HG23 . ILE A 1 94  ? -4.674  0.450   -13.719 1.00 5.09   ? 94  ILE A HG23 5  
ATOM 10207 H HD11 . ILE A 1 94  ? -7.206  4.382   -15.256 1.00 6.79   ? 94  ILE A HD11 5  
ATOM 10208 H HD12 . ILE A 1 94  ? -5.908  4.145   -16.438 1.00 7.77   ? 94  ILE A HD12 5  
ATOM 10209 H HD13 . ILE A 1 94  ? -7.597  3.927   -16.930 1.00 7.59   ? 94  ILE A HD13 5  
ATOM 10210 N N    . PRO A 1 95  ? -8.753  1.693   -11.946 1.00 3.23   ? 95  PRO A N    5  
ATOM 10211 C CA   . PRO A 1 95  ? -10.013 0.999   -11.674 1.00 4.43   ? 95  PRO A CA   5  
ATOM 10212 C C    . PRO A 1 95  ? -11.014 1.267   -12.819 1.00 3.30   ? 95  PRO A C    5  
ATOM 10213 O O    . PRO A 1 95  ? -10.614 1.186   -13.975 1.00 2.65   ? 95  PRO A O    5  
ATOM 10214 C CB   . PRO A 1 95  ? -10.431 1.502   -10.282 1.00 6.91   ? 95  PRO A CB   5  
ATOM 10215 C CG   . PRO A 1 95  ? -9.970  2.957   -10.334 1.00 7.25   ? 95  PRO A CG   5  
ATOM 10216 C CD   . PRO A 1 95  ? -8.632  2.836   -11.044 1.00 5.19   ? 95  PRO A CD   5  
ATOM 10217 H HA   . PRO A 1 95  ? -9.826  -0.071  -11.620 1.00 5.07   ? 95  PRO A HA   5  
ATOM 10218 H HB2  . PRO A 1 95  ? -11.497 1.406   -10.080 1.00 7.82   ? 95  PRO A HB2  5  
ATOM 10219 H HB3  . PRO A 1 95  ? -9.863  0.970   -9.516  1.00 7.91   ? 95  PRO A HB3  5  
ATOM 10220 H HG2  . PRO A 1 95  ? -10.643 3.543   -10.956 1.00 7.52   ? 95  PRO A HG2  5  
ATOM 10221 H HG3  . PRO A 1 95  ? -9.869  3.393   -9.340  1.00 8.98   ? 95  PRO A HG3  5  
ATOM 10222 H HD2  . PRO A 1 95  ? -8.395  3.760   -11.561 1.00 5.51   ? 95  PRO A HD2  5  
ATOM 10223 H HD3  . PRO A 1 95  ? -7.872  2.638   -10.293 1.00 5.56   ? 95  PRO A HD3  5  
ATOM 10224 N N    . ALA A 1 96  ? -12.295 1.550   -12.529 1.00 3.93   ? 96  ALA A N    5  
ATOM 10225 C CA   . ALA A 1 96  ? -13.413 1.690   -13.479 1.00 3.21   ? 96  ALA A CA   5  
ATOM 10226 C C    . ALA A 1 96  ? -13.808 0.299   -13.982 1.00 2.55   ? 96  ALA A C    5  
ATOM 10227 O O    . ALA A 1 96  ? -13.466 -0.110  -15.090 1.00 2.59   ? 96  ALA A O    5  
ATOM 10228 C CB   . ALA A 1 96  ? -13.140 2.704   -14.602 1.00 3.22   ? 96  ALA A CB   5  
ATOM 10229 H H    . ALA A 1 96  ? -12.530 1.575   -11.549 1.00 5.32   ? 96  ALA A H    5  
ATOM 10230 H HA   . ALA A 1 96  ? -14.275 2.072   -12.934 1.00 3.57   ? 96  ALA A HA   5  
ATOM 10231 H HB1  . ALA A 1 96  ? -14.043 2.845   -15.195 1.00 3.68   ? 96  ALA A HB1  5  
ATOM 10232 H HB2  . ALA A 1 96  ? -12.842 3.653   -14.176 1.00 4.09   ? 96  ALA A HB2  5  
ATOM 10233 H HB3  . ALA A 1 96  ? -12.358 2.348   -15.271 1.00 2.77   ? 96  ALA A HB3  5  
ATOM 10234 N N    . ARG A 1 97  ? -14.426 -0.474  -13.080 1.00 2.92   ? 97  ARG A N    5  
ATOM 10235 C CA   . ARG A 1 97  ? -14.671 -1.917  -13.226 1.00 2.40   ? 97  ARG A CA   5  
ATOM 10236 C C    . ARG A 1 97  ? -13.379 -2.758  -13.106 1.00 1.96   ? 97  ARG A C    5  
ATOM 10237 O O    . ARG A 1 97  ? -13.469 -3.987  -13.080 1.00 2.16   ? 97  ARG A O    5  
ATOM 10238 C CB   . ARG A 1 97  ? -15.448 -2.212  -14.529 1.00 2.46   ? 97  ARG A CB   5  
ATOM 10239 C CG   . ARG A 1 97  ? -16.361 -3.449  -14.459 1.00 2.82   ? 97  ARG A CG   5  
ATOM 10240 C CD   . ARG A 1 97  ? -15.940 -4.599  -15.381 1.00 2.87   ? 97  ARG A CD   5  
ATOM 10241 N NE   . ARG A 1 97  ? -15.224 -5.669  -14.656 1.00 3.65   ? 97  ARG A NE   5  
ATOM 10242 C CZ   . ARG A 1 97  ? -15.288 -6.965  -14.963 1.00 4.51   ? 97  ARG A CZ   5  
ATOM 10243 N NH1  . ARG A 1 97  ? -15.833 -7.359  -16.094 1.00 4.56   ? 97  ARG A NH1  5  
ATOM 10244 N NH2  . ARG A 1 97  ? -14.807 -7.896  -14.162 1.00 5.90   ? 97  ARG A NH2  5  
ATOM 10245 H H    . ARG A 1 97  ? -14.671 -0.063  -12.186 1.00 3.99   ? 97  ARG A H    5  
ATOM 10246 H HA   . ARG A 1 97  ? -15.304 -2.189  -12.382 1.00 2.54   ? 97  ARG A HA   5  
ATOM 10247 H HB2  . ARG A 1 97  ? -16.096 -1.358  -14.736 1.00 3.05   ? 97  ARG A HB2  5  
ATOM 10248 H HB3  . ARG A 1 97  ? -14.757 -2.300  -15.367 1.00 2.46   ? 97  ARG A HB3  5  
ATOM 10249 H HG2  . ARG A 1 97  ? -16.463 -3.804  -13.434 1.00 3.34   ? 97  ARG A HG2  5  
ATOM 10250 H HG3  . ARG A 1 97  ? -17.356 -3.133  -14.779 1.00 3.43   ? 97  ARG A HG3  5  
ATOM 10251 H HD2  . ARG A 1 97  ? -16.856 -5.015  -15.811 1.00 3.88   ? 97  ARG A HD2  5  
ATOM 10252 H HD3  . ARG A 1 97  ? -15.328 -4.231  -16.204 1.00 2.63   ? 97  ARG A HD3  5  
ATOM 10253 H HE   . ARG A 1 97  ? -14.653 -5.387  -13.867 1.00 4.22   ? 97  ARG A HE   5  
ATOM 10254 H HH11 . ARG A 1 97  ? -16.140 -6.701  -16.785 1.00 4.18   ? 97  ARG A HH11 5  
ATOM 10255 H HH12 . ARG A 1 97  ? -15.937 -8.354  -16.282 1.00 5.45   ? 97  ARG A HH12 5  
ATOM 10256 H HH21 . ARG A 1 97  ? -14.413 -7.673  -13.256 1.00 6.46   ? 97  ARG A HH21 5  
ATOM 10257 H HH22 . ARG A 1 97  ? -14.913 -8.867  -14.434 1.00 6.62   ? 97  ARG A HH22 5  
ATOM 10258 N N    . GLY A 1 98  ? -12.195 -2.128  -12.994 1.00 1.87   ? 98  GLY A N    5  
ATOM 10259 C CA   . GLY A 1 98  ? -10.996 -2.692  -12.369 1.00 1.93   ? 98  GLY A CA   5  
ATOM 10260 C C    . GLY A 1 98  ? -10.930 -2.288  -10.891 1.00 2.16   ? 98  GLY A C    5  
ATOM 10261 O O    . GLY A 1 98  ? -11.874 -1.693  -10.366 1.00 3.42   ? 98  GLY A O    5  
ATOM 10262 H H    . GLY A 1 98  ? -12.178 -1.125  -13.092 1.00 2.17   ? 98  GLY A H    5  
ATOM 10263 H HA2  . GLY A 1 98  ? -11.002 -3.784  -12.433 1.00 1.82   ? 98  GLY A HA2  5  
ATOM 10264 H HA3  . GLY A 1 98  ? -10.111 -2.296  -12.872 1.00 2.23   ? 98  GLY A HA3  5  
ATOM 10265 N N    . THR A 1 99  ? -9.820  -2.597  -10.215 1.00 1.59   ? 99  THR A N    5  
ATOM 10266 C CA   . THR A 1 99  ? -9.677  -2.486  -8.753  1.00 1.72   ? 99  THR A CA   5  
ATOM 10267 C C    . THR A 1 99  ? -8.265  -2.869  -8.339  1.00 1.48   ? 99  THR A C    5  
ATOM 10268 O O    . THR A 1 99  ? -8.052  -3.948  -7.786  1.00 1.88   ? 99  THR A O    5  
ATOM 10269 C CB   . THR A 1 99  ? -10.788 -3.243  -7.995  1.00 2.19   ? 99  THR A CB   5  
ATOM 10270 O OG1  . THR A 1 99  ? -10.484 -3.273  -6.626  1.00 3.44   ? 99  THR A OG1  5  
ATOM 10271 C CG2  . THR A 1 99  ? -11.044 -4.682  -8.455  1.00 2.60   ? 99  THR A CG2  5  
ATOM 10272 H H    . THR A 1 99  ? -9.035  -2.961  -10.751 1.00 1.93   ? 99  THR A H    5  
ATOM 10273 H HA   . THR A 1 99  ? -9.810  -1.441  -8.479  1.00 1.94   ? 99  THR A HA   5  
ATOM 10274 H HB   . THR A 1 99  ? -11.708 -2.673  -8.116  1.00 3.11   ? 99  THR A HB   5  
ATOM 10275 H HG1  . THR A 1 99  ? -9.634  -3.725  -6.549  1.00 4.08   ? 99  THR A HG1  5  
ATOM 10276 H HG21 . THR A 1 99  ? -10.129 -5.268  -8.419  1.00 2.81   ? 99  THR A HG21 5  
ATOM 10277 H HG22 . THR A 1 99  ? -11.784 -5.141  -7.804  1.00 3.43   ? 99  THR A HG22 5  
ATOM 10278 H HG23 . THR A 1 99  ? -11.435 -4.690  -9.470  1.00 3.59   ? 99  THR A HG23 5  
ATOM 10279 N N    . LEU A 1 100 ? -7.302  -1.980  -8.626  1.00 1.30   ? 100 LEU A N    5  
ATOM 10280 C CA   . LEU A 1 100 ? -5.903  -2.149  -8.201  1.00 1.33   ? 100 LEU A CA   5  
ATOM 10281 C C    . LEU A 1 100 ? -5.868  -2.676  -6.765  1.00 1.26   ? 100 LEU A C    5  
ATOM 10282 O O    . LEU A 1 100 ? -6.480  -2.118  -5.850  1.00 1.30   ? 100 LEU A O    5  
ATOM 10283 C CB   . LEU A 1 100 ? -5.014  -0.901  -8.464  1.00 1.72   ? 100 LEU A CB   5  
ATOM 10284 C CG   . LEU A 1 100 ? -3.850  -0.704  -7.459  1.00 2.63   ? 100 LEU A CG   5  
ATOM 10285 C CD1  . LEU A 1 100 ? -2.531  -0.247  -8.094  1.00 3.56   ? 100 LEU A CD1  5  
ATOM 10286 C CD2  . LEU A 1 100 ? -4.213  0.293   -6.344  1.00 3.86   ? 100 LEU A CD2  5  
ATOM 10287 H H    . LEU A 1 100 ? -7.548  -1.171  -9.173  1.00 1.51   ? 100 LEU A H    5  
ATOM 10288 H HA   . LEU A 1 100 ? -5.500  -2.944  -8.832  1.00 1.38   ? 100 LEU A HA   5  
ATOM 10289 H HB2  . LEU A 1 100 ? -4.596  -1.023  -9.465  1.00 2.21   ? 100 LEU A HB2  5  
ATOM 10290 H HB3  . LEU A 1 100 ? -5.610  0.006   -8.492  1.00 2.09   ? 100 LEU A HB3  5  
ATOM 10291 H HG   . LEU A 1 100 ? -3.642  -1.668  -7.017  1.00 3.18   ? 100 LEU A HG   5  
ATOM 10292 H HD11 . LEU A 1 100 ? -1.720  -0.369  -7.375  1.00 4.27   ? 100 LEU A HD11 5  
ATOM 10293 H HD12 . LEU A 1 100 ? -2.310  -0.860  -8.966  1.00 3.87   ? 100 LEU A HD12 5  
ATOM 10294 H HD13 . LEU A 1 100 ? -2.571  0.801   -8.381  1.00 4.27   ? 100 LEU A HD13 5  
ATOM 10295 H HD21 . LEU A 1 100 ? -4.359  1.286   -6.764  1.00 4.26   ? 100 LEU A HD21 5  
ATOM 10296 H HD22 . LEU A 1 100 ? -5.125  -0.010  -5.836  1.00 4.42   ? 100 LEU A HD22 5  
ATOM 10297 H HD23 . LEU A 1 100 ? -3.405  0.341   -5.614  1.00 4.82   ? 100 LEU A HD23 5  
ATOM 10298 N N    . THR A 1 101 ? -5.184  -3.810  -6.639  1.00 1.35   ? 101 THR A N    5  
ATOM 10299 C CA   . THR A 1 101 ? -5.235  -4.745  -5.525  1.00 1.44   ? 101 THR A CA   5  
ATOM 10300 C C    . THR A 1 101 ? -3.879  -4.708  -4.844  1.00 1.37   ? 101 THR A C    5  
ATOM 10301 O O    . THR A 1 101 ? -2.865  -4.732  -5.533  1.00 2.08   ? 101 THR A O    5  
ATOM 10302 C CB   . THR A 1 101 ? -5.497  -6.148  -6.080  1.00 2.33   ? 101 THR A CB   5  
ATOM 10303 O OG1  . THR A 1 101 ? -6.565  -6.122  -7.008  1.00 3.16   ? 101 THR A OG1  5  
ATOM 10304 C CG2  . THR A 1 101 ? -5.877  -7.123  -4.972  1.00 2.71   ? 101 THR A CG2  5  
ATOM 10305 H H    . THR A 1 101 ? -4.630  -4.106  -7.430  1.00 1.50   ? 101 THR A H    5  
ATOM 10306 H HA   . THR A 1 101 ? -6.011  -4.467  -4.811  1.00 1.62   ? 101 THR A HA   5  
ATOM 10307 H HB   . THR A 1 101 ? -4.594  -6.491  -6.601  1.00 2.73   ? 101 THR A HB   5  
ATOM 10308 H HG1  . THR A 1 101 ? -7.088  -5.311  -6.869  1.00 2.96   ? 101 THR A HG1  5  
ATOM 10309 H HG21 . THR A 1 101 ? -6.782  -6.790  -4.466  1.00 2.91   ? 101 THR A HG21 5  
ATOM 10310 H HG22 . THR A 1 101 ? -6.044  -8.113  -5.398  1.00 3.55   ? 101 THR A HG22 5  
ATOM 10311 H HG23 . THR A 1 101 ? -5.067  -7.197  -4.248  1.00 3.24   ? 101 THR A HG23 5  
ATOM 10312 N N    . LEU A 1 102 ? -3.879  -4.638  -3.514  1.00 1.12   ? 102 LEU A N    5  
ATOM 10313 C CA   . LEU A 1 102 ? -2.687  -4.476  -2.678  1.00 1.46   ? 102 LEU A CA   5  
ATOM 10314 C C    . LEU A 1 102 ? -2.949  -5.118  -1.298  1.00 1.20   ? 102 LEU A C    5  
ATOM 10315 O O    . LEU A 1 102 ? -3.154  -4.445  -0.289  1.00 1.26   ? 102 LEU A O    5  
ATOM 10316 C CB   . LEU A 1 102 ? -2.311  -2.976  -2.626  1.00 2.13   ? 102 LEU A CB   5  
ATOM 10317 C CG   . LEU A 1 102 ? -1.047  -2.591  -3.421  1.00 2.91   ? 102 LEU A CG   5  
ATOM 10318 C CD1  . LEU A 1 102 ? -1.036  -1.081  -3.702  1.00 4.04   ? 102 LEU A CD1  5  
ATOM 10319 C CD2  . LEU A 1 102 ? 0.227   -2.945  -2.637  1.00 3.81   ? 102 LEU A CD2  5  
ATOM 10320 H H    . LEU A 1 102 ? -4.770  -4.547  -3.049  1.00 1.24   ? 102 LEU A H    5  
ATOM 10321 H HA   . LEU A 1 102 ? -1.867  -5.015  -3.142  1.00 1.97   ? 102 LEU A HA   5  
ATOM 10322 H HB2  . LEU A 1 102 ? -3.159  -2.403  -3.006  1.00 2.55   ? 102 LEU A HB2  5  
ATOM 10323 H HB3  . LEU A 1 102 ? -2.154  -2.676  -1.594  1.00 2.67   ? 102 LEU A HB3  5  
ATOM 10324 H HG   . LEU A 1 102 ? -1.046  -3.114  -4.376  1.00 3.44   ? 102 LEU A HG   5  
ATOM 10325 H HD11 . LEU A 1 102 ? -1.931  -0.806  -4.260  1.00 4.60   ? 102 LEU A HD11 5  
ATOM 10326 H HD12 . LEU A 1 102 ? -1.004  -0.522  -2.766  1.00 4.53   ? 102 LEU A HD12 5  
ATOM 10327 H HD13 . LEU A 1 102 ? -0.162  -0.824  -4.300  1.00 4.86   ? 102 LEU A HD13 5  
ATOM 10328 H HD21 . LEU A 1 102 ? 1.108   -2.683  -3.224  1.00 4.48   ? 102 LEU A HD21 5  
ATOM 10329 H HD22 . LEU A 1 102 ? 0.252   -2.406  -1.690  1.00 4.22   ? 102 LEU A HD22 5  
ATOM 10330 H HD23 . LEU A 1 102 ? 0.255   -4.012  -2.440  1.00 4.48   ? 102 LEU A HD23 5  
ATOM 10331 N N    . GLN A 1 103 ? -3.007  -6.446  -1.245  1.00 1.06   ? 103 GLN A N    5  
ATOM 10332 C CA   . GLN A 1 103 ? -3.284  -7.183  -0.002  1.00 1.08   ? 103 GLN A CA   5  
ATOM 10333 C C    . GLN A 1 103 ? -2.446  -8.475  0.036   1.00 1.11   ? 103 GLN A C    5  
ATOM 10334 O O    . GLN A 1 103 ? -1.664  -8.755  -0.876  1.00 1.27   ? 103 GLN A O    5  
ATOM 10335 C CB   . GLN A 1 103 ? -4.804  -7.461  0.160   1.00 1.32   ? 103 GLN A CB   5  
ATOM 10336 C CG   . GLN A 1 103 ? -5.736  -6.240  -0.014  1.00 1.79   ? 103 GLN A CG   5  
ATOM 10337 C CD   . GLN A 1 103 ? -7.218  -6.586  -0.144  1.00 1.71   ? 103 GLN A CD   5  
ATOM 10338 O OE1  . GLN A 1 103 ? -8.040  -6.297  0.723   1.00 1.99   ? 103 GLN A OE1  5  
ATOM 10339 N NE2  . GLN A 1 103 ? -7.614  -7.184  -1.247  1.00 2.83   ? 103 GLN A NE2  5  
ATOM 10340 H H    . GLN A 1 103 ? -2.553  -6.955  -2.010  1.00 1.13   ? 103 GLN A H    5  
ATOM 10341 H HA   . GLN A 1 103 ? -2.957  -6.578  0.844   1.00 1.21   ? 103 GLN A HA   5  
ATOM 10342 H HB2  . GLN A 1 103 ? -5.091  -8.229  -0.551  1.00 1.46   ? 103 GLN A HB2  5  
ATOM 10343 H HB3  . GLN A 1 103 ? -4.982  -7.870  1.154   1.00 1.60   ? 103 GLN A HB3  5  
ATOM 10344 H HG2  . GLN A 1 103 ? -5.602  -5.556  0.823   1.00 2.79   ? 103 GLN A HG2  5  
ATOM 10345 H HG3  . GLN A 1 103 ? -5.481  -5.707  -0.926  1.00 2.61   ? 103 GLN A HG3  5  
ATOM 10346 H HE21 . GLN A 1 103 ? -6.930  -7.621  -1.870  1.00 3.22   ? 103 GLN A HE21 5  
ATOM 10347 H HE22 . GLN A 1 103 ? -8.593  -7.258  -1.407  1.00 3.68   ? 103 GLN A HE22 5  
ATOM 10348 N N    . ARG A 1 104 ? -2.620  -9.318  1.064   1.00 1.26   ? 104 ARG A N    5  
ATOM 10349 C CA   . ARG A 1 104 ? -1.973  -10.642 1.140   1.00 1.57   ? 104 ARG A CA   5  
ATOM 10350 C C    . ARG A 1 104 ? -2.419  -11.635 0.040   1.00 1.82   ? 104 ARG A C    5  
ATOM 10351 O O    . ARG A 1 104 ? -2.118  -12.829 0.134   1.00 2.17   ? 104 ARG A O    5  
ATOM 10352 C CB   . ARG A 1 104 ? -2.155  -11.243 2.545   1.00 1.83   ? 104 ARG A CB   5  
ATOM 10353 C CG   . ARG A 1 104 ? -3.587  -11.747 2.835   1.00 3.11   ? 104 ARG A CG   5  
ATOM 10354 C CD   . ARG A 1 104 ? -3.643  -13.182 3.379   1.00 3.66   ? 104 ARG A CD   5  
ATOM 10355 N NE   . ARG A 1 104 ? -3.064  -14.163 2.445   1.00 4.28   ? 104 ARG A NE   5  
ATOM 10356 C CZ   . ARG A 1 104 ? -2.849  -15.456 2.671   1.00 4.80   ? 104 ARG A CZ   5  
ATOM 10357 N NH1  . ARG A 1 104 ? -3.223  -16.056 3.786   1.00 4.86   ? 104 ARG A NH1  5  
ATOM 10358 N NH2  . ARG A 1 104 ? -2.241  -16.163 1.744   1.00 5.80   ? 104 ARG A NH2  5  
ATOM 10359 H H    . ARG A 1 104 ? -3.260  -9.056  1.798   1.00 1.36   ? 104 ARG A H    5  
ATOM 10360 H HA   . ARG A 1 104 ? -0.906  -10.481 0.989   1.00 1.60   ? 104 ARG A HA   5  
ATOM 10361 H HB2  . ARG A 1 104 ? -1.443  -12.062 2.656   1.00 2.55   ? 104 ARG A HB2  5  
ATOM 10362 H HB3  . ARG A 1 104 ? -1.884  -10.495 3.291   1.00 1.98   ? 104 ARG A HB3  5  
ATOM 10363 H HG2  . ARG A 1 104 ? -4.038  -11.084 3.574   1.00 3.77   ? 104 ARG A HG2  5  
ATOM 10364 H HG3  . ARG A 1 104 ? -4.205  -11.696 1.942   1.00 4.08   ? 104 ARG A HG3  5  
ATOM 10365 H HD2  . ARG A 1 104 ? -3.102  -13.226 4.326   1.00 3.53   ? 104 ARG A HD2  5  
ATOM 10366 H HD3  . ARG A 1 104 ? -4.689  -13.438 3.554   1.00 4.47   ? 104 ARG A HD3  5  
ATOM 10367 H HE   . ARG A 1 104 ? -2.759  -13.806 1.543   1.00 4.77   ? 104 ARG A HE   5  
ATOM 10368 H HH11 . ARG A 1 104 ? -3.761  -15.534 4.474   1.00 4.72   ? 104 ARG A HH11 5  
ATOM 10369 H HH12 . ARG A 1 104 ? -3.032  -17.034 3.935   1.00 5.48   ? 104 ARG A HH12 5  
ATOM 10370 H HH21 . ARG A 1 104 ? -1.961  -15.709 0.886   1.00 6.27   ? 104 ARG A HH21 5  
ATOM 10371 H HH22 . ARG A 1 104 ? -2.033  -17.141 1.889   1.00 6.34   ? 104 ARG A HH22 5  
ATOM 10372 N N    . ASP A 1 105 ? -3.198  -11.176 -0.940  1.00 1.99   ? 105 ASP A N    5  
ATOM 10373 C CA   . ASP A 1 105 ? -3.751  -11.942 -2.053  1.00 2.29   ? 105 ASP A CA   5  
ATOM 10374 C C    . ASP A 1 105 ? -2.786  -11.994 -3.251  1.00 2.10   ? 105 ASP A C    5  
ATOM 10375 O O    . ASP A 1 105 ? -2.598  -13.064 -3.839  1.00 2.29   ? 105 ASP A O    5  
ATOM 10376 C CB   . ASP A 1 105 ? -5.121  -11.347 -2.454  1.00 2.71   ? 105 ASP A CB   5  
ATOM 10377 C CG   . ASP A 1 105 ? -5.194  -9.814  -2.615  1.00 4.27   ? 105 ASP A CG   5  
ATOM 10378 O OD1  . ASP A 1 105 ? -4.142  -9.152  -2.739  1.00 5.60   ? 105 ASP A OD1  5  
ATOM 10379 O OD2  . ASP A 1 105 ? -6.330  -9.286  -2.542  1.00 4.95   ? 105 ASP A OD2  5  
ATOM 10380 H H    . ASP A 1 105 ? -3.253  -10.167 -1.039  1.00 2.20   ? 105 ASP A H    5  
ATOM 10381 H HA   . ASP A 1 105 ? -3.922  -12.969 -1.726  1.00 2.63   ? 105 ASP A HA   5  
ATOM 10382 H HB2  . ASP A 1 105 ? -5.445  -11.818 -3.386  1.00 3.50   ? 105 ASP A HB2  5  
ATOM 10383 H HB3  . ASP A 1 105 ? -5.835  -11.634 -1.681  1.00 2.60   ? 105 ASP A HB3  5  
ATOM 10384 N N    . GLY A 1 106 ? -2.163  -10.860 -3.585  1.00 1.98   ? 106 GLY A N    5  
ATOM 10385 C CA   . GLY A 1 106 ? -1.330  -10.711 -4.773  1.00 2.07   ? 106 GLY A CA   5  
ATOM 10386 C C    . GLY A 1 106 ? -0.302  -9.585  -4.763  1.00 2.21   ? 106 GLY A C    5  
ATOM 10387 O O    . GLY A 1 106 ? 0.458   -9.555  -5.725  1.00 2.78   ? 106 GLY A O    5  
ATOM 10388 H H    . GLY A 1 106 ? -2.460  -10.018 -3.091  1.00 2.09   ? 106 GLY A H    5  
ATOM 10389 H HA2  . GLY A 1 106 ? -0.811  -11.649 -4.969  1.00 2.26   ? 106 GLY A HA2  5  
ATOM 10390 H HA3  . GLY A 1 106 ? -1.993  -10.514 -5.617  1.00 2.17   ? 106 GLY A HA3  5  
ATOM 10391 N N    . ASP A 1 107 ? -0.217  -8.713  -3.746  1.00 2.00   ? 107 ASP A N    5  
ATOM 10392 C CA   . ASP A 1 107 ? 0.647   -7.515  -3.745  1.00 2.38   ? 107 ASP A CA   5  
ATOM 10393 C C    . ASP A 1 107 ? 0.643   -6.848  -2.364  1.00 1.59   ? 107 ASP A C    5  
ATOM 10394 O O    . ASP A 1 107 ? -0.401  -6.400  -1.923  1.00 1.55   ? 107 ASP A O    5  
ATOM 10395 C CB   . ASP A 1 107 ? 0.150   -6.529  -4.836  1.00 3.45   ? 107 ASP A CB   5  
ATOM 10396 C CG   . ASP A 1 107 ? 1.015   -5.288  -5.099  1.00 4.96   ? 107 ASP A CG   5  
ATOM 10397 O OD1  . ASP A 1 107 ? 2.104   -5.159  -4.490  1.00 5.68   ? 107 ASP A OD1  5  
ATOM 10398 O OD2  . ASP A 1 107 ? 0.602   -4.504  -5.982  1.00 5.92   ? 107 ASP A OD2  5  
ATOM 10399 H H    . ASP A 1 107 ? -0.832  -8.833  -2.950  1.00 1.84   ? 107 ASP A H    5  
ATOM 10400 H HA   . ASP A 1 107 ? 1.665   -7.809  -3.975  1.00 2.93   ? 107 ASP A HA   5  
ATOM 10401 H HB2  . ASP A 1 107 ? 0.072   -7.058  -5.783  1.00 3.84   ? 107 ASP A HB2  5  
ATOM 10402 H HB3  . ASP A 1 107 ? -0.857  -6.211  -4.580  1.00 3.58   ? 107 ASP A HB3  5  
ATOM 10403 N N    . HIS A 1 108 ? 1.763   -6.737  -1.649  1.00 1.36   ? 108 HIS A N    5  
ATOM 10404 C CA   . HIS A 1 108 ? 1.759   -6.052  -0.344  1.00 1.10   ? 108 HIS A CA   5  
ATOM 10405 C C    . HIS A 1 108 ? 3.059   -5.295  -0.035  1.00 1.04   ? 108 HIS A C    5  
ATOM 10406 O O    . HIS A 1 108 ? 4.133   -5.734  -0.451  1.00 1.22   ? 108 HIS A O    5  
ATOM 10407 C CB   . HIS A 1 108 ? 1.353   -7.015  0.796   1.00 1.32   ? 108 HIS A CB   5  
ATOM 10408 C CG   . HIS A 1 108 ? 2.456   -7.811  1.471   1.00 1.69   ? 108 HIS A CG   5  
ATOM 10409 N ND1  . HIS A 1 108 ? 3.683   -8.155  0.949   1.00 2.37   ? 108 HIS A ND1  5  
ATOM 10410 C CD2  . HIS A 1 108 ? 2.441   -8.280  2.760   1.00 2.42   ? 108 HIS A CD2  5  
ATOM 10411 C CE1  . HIS A 1 108 ? 4.382   -8.798  1.898   1.00 2.67   ? 108 HIS A CE1  5  
ATOM 10412 N NE2  . HIS A 1 108 ? 3.667   -8.897  3.034   1.00 2.71   ? 108 HIS A NE2  5  
ATOM 10413 H H    . HIS A 1 108 ? 2.638   -7.053  -2.056  1.00 1.70   ? 108 HIS A H    5  
ATOM 10414 H HA   . HIS A 1 108 ? 0.983   -5.287  -0.393  1.00 1.26   ? 108 HIS A HA   5  
ATOM 10415 H HB2  . HIS A 1 108 ? 0.869   -6.418  1.568   1.00 1.45   ? 108 HIS A HB2  5  
ATOM 10416 H HB3  . HIS A 1 108 ? 0.601   -7.709  0.420   1.00 1.49   ? 108 HIS A HB3  5  
ATOM 10417 H HD1  . HIS A 1 108 ? 4.049   -7.828  0.062   1.00 3.04   ? 108 HIS A HD1  5  
ATOM 10418 H HD2  . HIS A 1 108 ? 1.627   -8.163  3.460   1.00 3.20   ? 108 HIS A HD2  5  
ATOM 10419 H HE1  . HIS A 1 108 ? 5.402   -9.142  1.779   1.00 3.35   ? 108 HIS A HE1  5  
ATOM 10420 N N    . VAL A 1 109 ? 2.966   -4.194  0.724   1.00 0.94   ? 109 VAL A N    5  
ATOM 10421 C CA   . VAL A 1 109 ? 4.123   -3.403  1.169   1.00 0.89   ? 109 VAL A CA   5  
ATOM 10422 C C    . VAL A 1 109 ? 4.475   -3.727  2.618   1.00 0.88   ? 109 VAL A C    5  
ATOM 10423 O O    . VAL A 1 109 ? 3.765   -3.336  3.542   1.00 1.16   ? 109 VAL A O    5  
ATOM 10424 C CB   . VAL A 1 109 ? 3.935   -1.892  0.909   1.00 0.94   ? 109 VAL A CB   5  
ATOM 10425 C CG1  . VAL A 1 109 ? 2.577   -1.317  1.341   1.00 1.91   ? 109 VAL A CG1  5  
ATOM 10426 C CG2  . VAL A 1 109 ? 5.072   -1.052  1.522   1.00 1.78   ? 109 VAL A CG2  5  
ATOM 10427 H H    . VAL A 1 109 ? 2.050   -3.883  1.032   1.00 0.96   ? 109 VAL A H    5  
ATOM 10428 H HA   . VAL A 1 109 ? 4.979   -3.692  0.573   1.00 0.91   ? 109 VAL A HA   5  
ATOM 10429 H HB   . VAL A 1 109 ? 3.986   -1.766  -0.169  1.00 1.28   ? 109 VAL A HB   5  
ATOM 10430 H HG11 . VAL A 1 109 ? 2.440   -1.433  2.413   1.00 2.97   ? 109 VAL A HG11 5  
ATOM 10431 H HG12 . VAL A 1 109 ? 2.536   -0.254  1.093   1.00 2.73   ? 109 VAL A HG12 5  
ATOM 10432 H HG13 . VAL A 1 109 ? 1.765   -1.820  0.816   1.00 2.49   ? 109 VAL A HG13 5  
ATOM 10433 H HG21 . VAL A 1 109 ? 5.048   -0.040  1.110   1.00 2.38   ? 109 VAL A HG21 5  
ATOM 10434 H HG22 . VAL A 1 109 ? 4.958   -0.990  2.603   1.00 2.47   ? 109 VAL A HG22 5  
ATOM 10435 H HG23 . VAL A 1 109 ? 6.037   -1.503  1.297   1.00 2.89   ? 109 VAL A HG23 5  
ATOM 10436 N N    . MET A 1 110 ? 5.604   -4.411  2.813   1.00 0.87   ? 110 MET A N    5  
ATOM 10437 C CA   . MET A 1 110 ? 6.241   -4.544  4.119   1.00 0.83   ? 110 MET A CA   5  
ATOM 10438 C C    . MET A 1 110 ? 6.955   -3.249  4.503   1.00 0.70   ? 110 MET A C    5  
ATOM 10439 O O    . MET A 1 110 ? 7.667   -2.635  3.709   1.00 0.80   ? 110 MET A O    5  
ATOM 10440 C CB   . MET A 1 110 ? 7.190   -5.751  4.176   1.00 1.09   ? 110 MET A CB   5  
ATOM 10441 C CG   . MET A 1 110 ? 6.383   -7.021  4.468   1.00 1.35   ? 110 MET A CG   5  
ATOM 10442 S SD   . MET A 1 110 ? 7.339   -8.532  4.778   1.00 1.67   ? 110 MET A SD   5  
ATOM 10443 C CE   . MET A 1 110 ? 8.226   -8.048  6.290   1.00 2.40   ? 110 MET A CE   5  
ATOM 10444 H H    . MET A 1 110 ? 6.146   -4.667  1.990   1.00 1.05   ? 110 MET A H    5  
ATOM 10445 H HA   . MET A 1 110 ? 5.467   -4.705  4.863   1.00 0.89   ? 110 MET A HA   5  
ATOM 10446 H HB2  . MET A 1 110 ? 7.737   -5.856  3.240   1.00 1.68   ? 110 MET A HB2  5  
ATOM 10447 H HB3  . MET A 1 110 ? 7.903   -5.597  4.984   1.00 1.91   ? 110 MET A HB3  5  
ATOM 10448 H HG2  . MET A 1 110 ? 5.769   -6.839  5.349   1.00 2.18   ? 110 MET A HG2  5  
ATOM 10449 H HG3  . MET A 1 110 ? 5.716   -7.192  3.625   1.00 2.19   ? 110 MET A HG3  5  
ATOM 10450 H HE1  . MET A 1 110 ? 8.990   -7.303  6.063   1.00 3.36   ? 110 MET A HE1  5  
ATOM 10451 H HE2  . MET A 1 110 ? 7.535   -7.623  7.019   1.00 2.75   ? 110 MET A HE2  5  
ATOM 10452 H HE3  . MET A 1 110 ? 8.718   -8.915  6.730   1.00 2.93   ? 110 MET A HE3  5  
ATOM 10453 N N    . LEU A 1 111 ? 6.751   -2.856  5.758   1.00 0.68   ? 111 LEU A N    5  
ATOM 10454 C CA   . LEU A 1 111 ? 7.322   -1.693  6.422   1.00 0.76   ? 111 LEU A CA   5  
ATOM 10455 C C    . LEU A 1 111 ? 8.656   -2.085  7.074   1.00 0.78   ? 111 LEU A C    5  
ATOM 10456 O O    . LEU A 1 111 ? 8.811   -2.013  8.295   1.00 1.08   ? 111 LEU A O    5  
ATOM 10457 C CB   . LEU A 1 111 ? 6.299   -1.154  7.447   1.00 0.93   ? 111 LEU A CB   5  
ATOM 10458 C CG   . LEU A 1 111 ? 4.877   -0.839  6.944   1.00 1.50   ? 111 LEU A CG   5  
ATOM 10459 C CD1  . LEU A 1 111 ? 4.110   -0.070  8.029   1.00 2.71   ? 111 LEU A CD1  5  
ATOM 10460 C CD2  . LEU A 1 111 ? 4.885   0.016   5.676   1.00 1.79   ? 111 LEU A CD2  5  
ATOM 10461 H H    . LEU A 1 111 ? 6.224   -3.491  6.344   1.00 0.70   ? 111 LEU A H    5  
ATOM 10462 H HA   . LEU A 1 111 ? 7.543   -0.924  5.682   1.00 0.97   ? 111 LEU A HA   5  
ATOM 10463 H HB2  . LEU A 1 111 ? 6.207   -1.868  8.267   1.00 1.16   ? 111 LEU A HB2  5  
ATOM 10464 H HB3  . LEU A 1 111 ? 6.720   -0.240  7.854   1.00 1.09   ? 111 LEU A HB3  5  
ATOM 10465 H HG   . LEU A 1 111 ? 4.351   -1.773  6.736   1.00 2.68   ? 111 LEU A HG   5  
ATOM 10466 H HD11 . LEU A 1 111 ? 4.104   -0.636  8.957   1.00 3.74   ? 111 LEU A HD11 5  
ATOM 10467 H HD12 . LEU A 1 111 ? 4.583   0.897   8.212   1.00 3.15   ? 111 LEU A HD12 5  
ATOM 10468 H HD13 . LEU A 1 111 ? 3.084   0.096   7.704   1.00 3.39   ? 111 LEU A HD13 5  
ATOM 10469 H HD21 . LEU A 1 111 ? 5.354   -0.528  4.857   1.00 2.76   ? 111 LEU A HD21 5  
ATOM 10470 H HD22 . LEU A 1 111 ? 3.863   0.264   5.385   1.00 2.64   ? 111 LEU A HD22 5  
ATOM 10471 H HD23 . LEU A 1 111 ? 5.444   0.931   5.870   1.00 2.26   ? 111 LEU A HD23 5  
ATOM 10472 N N    . MET A 1 112 ? 9.597   -2.566  6.255   1.00 0.75   ? 112 MET A N    5  
ATOM 10473 C CA   . MET A 1 112 ? 10.846  -3.164  6.737   1.00 0.89   ? 112 MET A CA   5  
ATOM 10474 C C    . MET A 1 112 ? 11.770  -2.102  7.337   1.00 1.02   ? 112 MET A C    5  
ATOM 10475 O O    . MET A 1 112 ? 12.080  -1.103  6.685   1.00 1.10   ? 112 MET A O    5  
ATOM 10476 C CB   . MET A 1 112 ? 11.532  -3.956  5.610   1.00 1.04   ? 112 MET A CB   5  
ATOM 10477 C CG   . MET A 1 112 ? 12.714  -4.775  6.137   1.00 1.36   ? 112 MET A CG   5  
ATOM 10478 S SD   . MET A 1 112 ? 13.678  -5.628  4.859   1.00 1.90   ? 112 MET A SD   5  
ATOM 10479 C CE   . MET A 1 112 ? 14.939  -6.324  5.955   1.00 2.29   ? 112 MET A CE   5  
ATOM 10480 H H    . MET A 1 112 ? 9.440   -2.533  5.256   1.00 0.83   ? 112 MET A H    5  
ATOM 10481 H HA   . MET A 1 112 ? 10.586  -3.867  7.523   1.00 0.90   ? 112 MET A HA   5  
ATOM 10482 H HB2  . MET A 1 112 ? 10.814  -4.638  5.152   1.00 1.04   ? 112 MET A HB2  5  
ATOM 10483 H HB3  . MET A 1 112 ? 11.897  -3.269  4.849   1.00 1.24   ? 112 MET A HB3  5  
ATOM 10484 H HG2  . MET A 1 112 ? 13.391  -4.113  6.681   1.00 1.86   ? 112 MET A HG2  5  
ATOM 10485 H HG3  . MET A 1 112 ? 12.333  -5.512  6.847   1.00 1.60   ? 112 MET A HG3  5  
ATOM 10486 H HE1  . MET A 1 112 ? 15.681  -6.859  5.365   1.00 3.01   ? 112 MET A HE1  5  
ATOM 10487 H HE2  . MET A 1 112 ? 15.432  -5.517  6.502   1.00 3.23   ? 112 MET A HE2  5  
ATOM 10488 H HE3  . MET A 1 112 ? 14.469  -6.998  6.668   1.00 2.42   ? 112 MET A HE3  5  
ATOM 10489 N N    . GLY A 1 113 ? 12.200  -2.290  8.586   1.00 1.15   ? 113 GLY A N    5  
ATOM 10490 C CA   . GLY A 1 113 ? 12.991  -1.290  9.307   1.00 1.39   ? 113 GLY A CA   5  
ATOM 10491 C C    . GLY A 1 113 ? 12.139  -0.099  9.743   1.00 1.47   ? 113 GLY A C    5  
ATOM 10492 O O    . GLY A 1 113 ? 12.513  1.054   9.494   1.00 1.91   ? 113 GLY A O    5  
ATOM 10493 H H    . GLY A 1 113 ? 11.925  -3.148  9.067   1.00 1.15   ? 113 GLY A H    5  
ATOM 10494 H HA2  . GLY A 1 113 ? 13.407  -1.749  10.201  1.00 1.53   ? 113 GLY A HA2  5  
ATOM 10495 H HA3  . GLY A 1 113 ? 13.795  -0.926  8.671   1.00 1.48   ? 113 GLY A HA3  5  
ATOM 10496 N N    . LEU A 1 114 ? 10.999  -0.378  10.382  1.00 1.23   ? 114 LEU A N    5  
ATOM 10497 C CA   . LEU A 1 114 ? 10.222  0.588   11.151  1.00 1.26   ? 114 LEU A CA   5  
ATOM 10498 C C    . LEU A 1 114 ? 11.007  0.991   12.417  1.00 1.26   ? 114 LEU A C    5  
ATOM 10499 O O    . LEU A 1 114 ? 12.166  0.618   12.595  1.00 2.14   ? 114 LEU A O    5  
ATOM 10500 C CB   . LEU A 1 114 ? 8.861   -0.058  11.484  1.00 1.53   ? 114 LEU A CB   5  
ATOM 10501 C CG   . LEU A 1 114 ? 7.727   0.967   11.654  1.00 2.03   ? 114 LEU A CG   5  
ATOM 10502 C CD1  . LEU A 1 114 ? 6.971   1.182   10.339  1.00 2.73   ? 114 LEU A CD1  5  
ATOM 10503 C CD2  . LEU A 1 114 ? 6.761   0.497   12.750  1.00 2.75   ? 114 LEU A CD2  5  
ATOM 10504 H H    . LEU A 1 114 ? 10.760  -1.350  10.526  1.00 1.18   ? 114 LEU A H    5  
ATOM 10505 H HA   . LEU A 1 114 ? 10.068  1.483   10.547  1.00 1.65   ? 114 LEU A HA   5  
ATOM 10506 H HB2  . LEU A 1 114 ? 8.579   -0.763  10.699  1.00 1.92   ? 114 LEU A HB2  5  
ATOM 10507 H HB3  . LEU A 1 114 ? 8.974   -0.635  12.402  1.00 1.72   ? 114 LEU A HB3  5  
ATOM 10508 H HG   . LEU A 1 114 ? 8.151   1.921   11.957  1.00 2.14   ? 114 LEU A HG   5  
ATOM 10509 H HD11 . LEU A 1 114 ? 7.667   1.466   9.552   1.00 3.08   ? 114 LEU A HD11 5  
ATOM 10510 H HD12 . LEU A 1 114 ? 6.456   0.262   10.062  1.00 3.32   ? 114 LEU A HD12 5  
ATOM 10511 H HD13 . LEU A 1 114 ? 6.235   1.973   10.464  1.00 3.45   ? 114 LEU A HD13 5  
ATOM 10512 H HD21 . LEU A 1 114 ? 5.978   1.238   12.884  1.00 3.50   ? 114 LEU A HD21 5  
ATOM 10513 H HD22 . LEU A 1 114 ? 6.314   -0.458  12.471  1.00 3.19   ? 114 LEU A HD22 5  
ATOM 10514 H HD23 . LEU A 1 114 ? 7.295   0.383   13.693  1.00 2.94   ? 114 LEU A HD23 5  
ATOM 10515 N N    . LYS A 1 115 ? 10.382  1.734   13.334  1.00 1.04   ? 115 LYS A N    5  
ATOM 10516 C CA   . LYS A 1 115 ? 11.011  2.169   14.589  1.00 1.45   ? 115 LYS A CA   5  
ATOM 10517 C C    . LYS A 1 115 ? 9.974   2.657   15.608  1.00 1.59   ? 115 LYS A C    5  
ATOM 10518 O O    . LYS A 1 115 ? 9.749   1.993   16.618  1.00 2.39   ? 115 LYS A O    5  
ATOM 10519 C CB   . LYS A 1 115 ? 12.158  3.175   14.314  1.00 1.84   ? 115 LYS A CB   5  
ATOM 10520 C CG   . LYS A 1 115 ? 11.810  4.401   13.438  1.00 2.21   ? 115 LYS A CG   5  
ATOM 10521 C CD   . LYS A 1 115 ? 13.008  4.899   12.615  1.00 2.50   ? 115 LYS A CD   5  
ATOM 10522 C CE   . LYS A 1 115 ? 13.268  3.955   11.431  1.00 2.65   ? 115 LYS A CE   5  
ATOM 10523 N NZ   . LYS A 1 115 ? 14.492  4.327   10.680  1.00 3.55   ? 115 LYS A NZ   5  
ATOM 10524 H H    . LYS A 1 115 ? 9.415   1.972   13.172  1.00 1.38   ? 115 LYS A H    5  
ATOM 10525 H HA   . LYS A 1 115 ? 11.473  1.289   15.044  1.00 1.89   ? 115 LYS A HA   5  
ATOM 10526 H HB2  . LYS A 1 115 ? 12.547  3.534   15.268  1.00 2.62   ? 115 LYS A HB2  5  
ATOM 10527 H HB3  . LYS A 1 115 ? 12.978  2.627   13.849  1.00 2.25   ? 115 LYS A HB3  5  
ATOM 10528 H HG2  . LYS A 1 115 ? 10.993  4.175   12.751  1.00 2.37   ? 115 LYS A HG2  5  
ATOM 10529 H HG3  . LYS A 1 115 ? 11.482  5.207   14.090  1.00 3.09   ? 115 LYS A HG3  5  
ATOM 10530 H HD2  . LYS A 1 115 ? 12.781  5.896   12.231  1.00 3.03   ? 115 LYS A HD2  5  
ATOM 10531 H HD3  . LYS A 1 115 ? 13.890  4.962   13.256  1.00 2.87   ? 115 LYS A HD3  5  
ATOM 10532 H HE2  . LYS A 1 115 ? 13.357  2.936   11.815  1.00 2.68   ? 115 LYS A HE2  5  
ATOM 10533 H HE3  . LYS A 1 115 ? 12.400  3.977   10.765  1.00 2.77   ? 115 LYS A HE3  5  
ATOM 10534 H HZ1  . LYS A 1 115 ? 14.437  5.275   10.318  1.00 3.91   ? 115 LYS A HZ1  5  
ATOM 10535 H HZ2  . LYS A 1 115 ? 15.322  4.263   11.268  1.00 4.20   ? 115 LYS A HZ2  5  
ATOM 10536 H HZ3  . LYS A 1 115 ? 14.629  3.713   9.883   1.00 3.96   ? 115 LYS A HZ3  5  
ATOM 10537 N N    . ARG A 1 116 ? 9.297   3.771   15.311  1.00 1.48   ? 116 ARG A N    5  
ATOM 10538 C CA   . ARG A 1 116 ? 8.225   4.335   16.144  1.00 1.79   ? 116 ARG A CA   5  
ATOM 10539 C C    . ARG A 1 116 ? 6.952   3.458   16.012  1.00 1.48   ? 116 ARG A C    5  
ATOM 10540 O O    . ARG A 1 116 ? 6.636   3.080   14.880  1.00 1.19   ? 116 ARG A O    5  
ATOM 10541 C CB   . ARG A 1 116 ? 8.040   5.809   15.738  1.00 2.27   ? 116 ARG A CB   5  
ATOM 10542 C CG   . ARG A 1 116 ? 7.265   6.651   16.761  1.00 3.07   ? 116 ARG A CG   5  
ATOM 10543 C CD   . ARG A 1 116 ? 7.452   8.154   16.495  1.00 3.40   ? 116 ARG A CD   5  
ATOM 10544 N NE   . ARG A 1 116 ? 8.723   8.673   17.050  1.00 3.89   ? 116 ARG A NE   5  
ATOM 10545 C CZ   . ARG A 1 116 ? 8.852   9.583   18.016  1.00 4.58   ? 116 ARG A CZ   5  
ATOM 10546 N NH1  . ARG A 1 116 ? 7.826   10.090  18.668  1.00 4.97   ? 116 ARG A NH1  5  
ATOM 10547 N NH2  . ARG A 1 116 ? 10.058  10.001  18.321  1.00 5.49   ? 116 ARG A NH2  5  
ATOM 10548 H H    . ARG A 1 116 ? 9.509   4.213   14.430  1.00 1.76   ? 116 ARG A H    5  
ATOM 10549 H HA   . ARG A 1 116 ? 8.578   4.314   17.175  1.00 2.15   ? 116 ARG A HA   5  
ATOM 10550 H HB2  . ARG A 1 116 ? 9.035   6.250   15.628  1.00 2.66   ? 116 ARG A HB2  5  
ATOM 10551 H HB3  . ARG A 1 116 ? 7.541   5.862   14.767  1.00 2.73   ? 116 ARG A HB3  5  
ATOM 10552 H HG2  . ARG A 1 116 ? 6.205   6.401   16.689  1.00 3.81   ? 116 ARG A HG2  5  
ATOM 10553 H HG3  . ARG A 1 116 ? 7.608   6.424   17.771  1.00 3.68   ? 116 ARG A HG3  5  
ATOM 10554 H HD2  . ARG A 1 116 ? 7.422   8.340   15.419  1.00 3.76   ? 116 ARG A HD2  5  
ATOM 10555 H HD3  . ARG A 1 116 ? 6.607   8.682   16.932  1.00 3.81   ? 116 ARG A HD3  5  
ATOM 10556 H HE   . ARG A 1 116 ? 9.594   8.367   16.620  1.00 4.31   ? 116 ARG A HE   5  
ATOM 10557 H HH11 . ARG A 1 116 ? 6.884   9.768   18.486  1.00 4.89   ? 116 ARG A HH11 5  
ATOM 10558 H HH12 . ARG A 1 116 ? 7.952   10.799  19.381  1.00 5.75   ? 116 ARG A HH12 5  
ATOM 10559 H HH21 . ARG A 1 116 ? 10.850  9.637   17.793  1.00 5.85   ? 116 ARG A HH21 5  
ATOM 10560 H HH22 . ARG A 1 116 ? 10.229  10.748  18.982  1.00 6.16   ? 116 ARG A HH22 5  
ATOM 10561 N N    . PRO A 1 117 ? 6.278   3.058   17.117  1.00 1.79   ? 117 PRO A N    5  
ATOM 10562 C CA   . PRO A 1 117 ? 5.282   1.977   17.121  1.00 1.57   ? 117 PRO A CA   5  
ATOM 10563 C C    . PRO A 1 117 ? 3.909   2.426   16.605  1.00 1.29   ? 117 PRO A C    5  
ATOM 10564 O O    . PRO A 1 117 ? 3.639   3.621   16.538  1.00 1.79   ? 117 PRO A O    5  
ATOM 10565 C CB   . PRO A 1 117 ? 5.196   1.513   18.580  1.00 2.30   ? 117 PRO A CB   5  
ATOM 10566 C CG   . PRO A 1 117 ? 5.491   2.791   19.358  1.00 2.81   ? 117 PRO A CG   5  
ATOM 10567 C CD   . PRO A 1 117 ? 6.548   3.473   18.490  1.00 2.54   ? 117 PRO A CD   5  
ATOM 10568 H HA   . PRO A 1 117 ? 5.630   1.145   16.506  1.00 1.46   ? 117 PRO A HA   5  
ATOM 10569 H HB2  . PRO A 1 117 ? 4.218   1.104   18.836  1.00 2.33   ? 117 PRO A HB2  5  
ATOM 10570 H HB3  . PRO A 1 117 ? 5.978   0.778   18.778  1.00 2.59   ? 117 PRO A HB3  5  
ATOM 10571 H HG2  . PRO A 1 117 ? 4.597   3.414   19.407  1.00 2.88   ? 117 PRO A HG2  5  
ATOM 10572 H HG3  . PRO A 1 117 ? 5.867   2.584   20.360  1.00 3.40   ? 117 PRO A HG3  5  
ATOM 10573 H HD2  . PRO A 1 117 ? 6.473   4.556   18.594  1.00 2.81   ? 117 PRO A HD2  5  
ATOM 10574 H HD3  . PRO A 1 117 ? 7.540   3.129   18.788  1.00 2.78   ? 117 PRO A HD3  5  
ATOM 10575 N N    . LEU A 1 118 ? 3.046   1.460   16.238  1.00 1.00   ? 118 LEU A N    5  
ATOM 10576 C CA   . LEU A 1 118 ? 1.791   1.688   15.503  1.00 1.15   ? 118 LEU A CA   5  
ATOM 10577 C C    . LEU A 1 118 ? 0.669   0.747   15.999  1.00 1.25   ? 118 LEU A C    5  
ATOM 10578 O O    . LEU A 1 118 ? 0.748   -0.471  15.825  1.00 1.54   ? 118 LEU A O    5  
ATOM 10579 C CB   . LEU A 1 118 ? 2.063   1.475   13.994  1.00 1.54   ? 118 LEU A CB   5  
ATOM 10580 C CG   . LEU A 1 118 ? 3.147   2.367   13.351  1.00 1.50   ? 118 LEU A CG   5  
ATOM 10581 C CD1  . LEU A 1 118 ? 3.378   1.921   11.900  1.00 2.41   ? 118 LEU A CD1  5  
ATOM 10582 C CD2  . LEU A 1 118 ? 2.772   3.856   13.347  1.00 1.78   ? 118 LEU A CD2  5  
ATOM 10583 H H    . LEU A 1 118 ? 3.311   0.496   16.385  1.00 1.23   ? 118 LEU A H    5  
ATOM 10584 H HA   . LEU A 1 118 ? 1.463   2.718   15.660  1.00 1.47   ? 118 LEU A HA   5  
ATOM 10585 H HB2  . LEU A 1 118 ? 2.340   0.431   13.842  1.00 2.00   ? 118 LEU A HB2  5  
ATOM 10586 H HB3  . LEU A 1 118 ? 1.139   1.634   13.446  1.00 2.16   ? 118 LEU A HB3  5  
ATOM 10587 H HG   . LEU A 1 118 ? 4.086   2.244   13.889  1.00 1.54   ? 118 LEU A HG   5  
ATOM 10588 H HD11 . LEU A 1 118 ? 2.470   2.066   11.316  1.00 3.12   ? 118 LEU A HD11 5  
ATOM 10589 H HD12 . LEU A 1 118 ? 4.180   2.511   11.459  1.00 3.05   ? 118 LEU A HD12 5  
ATOM 10590 H HD13 . LEU A 1 118 ? 3.664   0.870   11.873  1.00 2.98   ? 118 LEU A HD13 5  
ATOM 10591 H HD21 . LEU A 1 118 ? 3.590   4.442   12.922  1.00 2.37   ? 118 LEU A HD21 5  
ATOM 10592 H HD22 . LEU A 1 118 ? 1.878   4.002   12.752  1.00 2.48   ? 118 LEU A HD22 5  
ATOM 10593 H HD23 . LEU A 1 118 ? 2.580   4.213   14.353  1.00 2.25   ? 118 LEU A HD23 5  
ATOM 10594 N N    . LYS A 1 119 ? -0.387  1.304   16.613  1.00 1.14   ? 119 LYS A N    5  
ATOM 10595 C CA   . LYS A 1 119 ? -1.523  0.564   17.205  1.00 1.20   ? 119 LYS A CA   5  
ATOM 10596 C C    . LYS A 1 119 ? -2.859  0.899   16.497  1.00 0.92   ? 119 LYS A C    5  
ATOM 10597 O O    . LYS A 1 119 ? -3.071  2.041   16.097  1.00 0.99   ? 119 LYS A O    5  
ATOM 10598 C CB   . LYS A 1 119 ? -1.540  0.854   18.727  1.00 1.57   ? 119 LYS A CB   5  
ATOM 10599 C CG   . LYS A 1 119 ? -2.581  0.063   19.549  1.00 2.51   ? 119 LYS A CG   5  
ATOM 10600 C CD   . LYS A 1 119 ? -2.278  0.081   21.064  1.00 3.08   ? 119 LYS A CD   5  
ATOM 10601 C CE   . LYS A 1 119 ? -3.373  -0.648  21.868  1.00 4.41   ? 119 LYS A CE   5  
ATOM 10602 N NZ   . LYS A 1 119 ? -2.960  -0.978  23.261  1.00 5.11   ? 119 LYS A NZ   5  
ATOM 10603 H H    . LYS A 1 119 ? -0.410  2.312   16.688  1.00 1.12   ? 119 LYS A H    5  
ATOM 10604 H HA   . LYS A 1 119 ? -1.338  -0.503  17.075  1.00 1.54   ? 119 LYS A HA   5  
ATOM 10605 H HB2  . LYS A 1 119 ? -0.548  0.612   19.119  1.00 2.26   ? 119 LYS A HB2  5  
ATOM 10606 H HB3  . LYS A 1 119 ? -1.705  1.922   18.891  1.00 1.78   ? 119 LYS A HB3  5  
ATOM 10607 H HG2  . LYS A 1 119 ? -3.565  0.499   19.378  1.00 2.87   ? 119 LYS A HG2  5  
ATOM 10608 H HG3  . LYS A 1 119 ? -2.591  -0.974  19.211  1.00 3.28   ? 119 LYS A HG3  5  
ATOM 10609 H HD2  . LYS A 1 119 ? -1.321  -0.416  21.231  1.00 3.42   ? 119 LYS A HD2  5  
ATOM 10610 H HD3  . LYS A 1 119 ? -2.205  1.113   21.414  1.00 2.85   ? 119 LYS A HD3  5  
ATOM 10611 H HE2  . LYS A 1 119 ? -4.276  -0.032  21.880  1.00 4.69   ? 119 LYS A HE2  5  
ATOM 10612 H HE3  . LYS A 1 119 ? -3.624  -1.576  21.349  1.00 5.07   ? 119 LYS A HE3  5  
ATOM 10613 H HZ1  . LYS A 1 119 ? -2.651  -0.151  23.763  1.00 4.93   ? 119 LYS A HZ1  5  
ATOM 10614 H HZ2  . LYS A 1 119 ? -3.731  -1.393  23.782  1.00 5.76   ? 119 LYS A HZ2  5  
ATOM 10615 H HZ3  . LYS A 1 119 ? -2.194  -1.648  23.259  1.00 5.89   ? 119 LYS A HZ3  5  
ATOM 10616 N N    . VAL A 1 120 ? -3.751  -0.100  16.390  1.00 1.20   ? 120 VAL A N    5  
ATOM 10617 C CA   . VAL A 1 120 ? -5.046  -0.212  15.655  1.00 1.23   ? 120 VAL A CA   5  
ATOM 10618 C C    . VAL A 1 120 ? -5.829  1.075   15.342  1.00 1.27   ? 120 VAL A C    5  
ATOM 10619 O O    . VAL A 1 120 ? -6.406  1.195   14.268  1.00 1.81   ? 120 VAL A O    5  
ATOM 10620 C CB   . VAL A 1 120 ? -5.986  -1.205  16.406  1.00 1.35   ? 120 VAL A CB   5  
ATOM 10621 C CG1  . VAL A 1 120 ? -6.188  -0.869  17.896  1.00 1.60   ? 120 VAL A CG1  5  
ATOM 10622 C CG2  . VAL A 1 120 ? -7.375  -1.394  15.767  1.00 2.36   ? 120 VAL A CG2  5  
ATOM 10623 H H    . VAL A 1 120 ? -3.446  -0.963  16.808  1.00 1.63   ? 120 VAL A H    5  
ATOM 10624 H HA   . VAL A 1 120 ? -4.800  -0.675  14.700  1.00 1.39   ? 120 VAL A HA   5  
ATOM 10625 H HB   . VAL A 1 120 ? -5.487  -2.174  16.370  1.00 1.86   ? 120 VAL A HB   5  
ATOM 10626 H HG11 . VAL A 1 120 ? -6.685  0.094   18.012  1.00 2.41   ? 120 VAL A HG11 5  
ATOM 10627 H HG12 . VAL A 1 120 ? -6.805  -1.635  18.367  1.00 2.49   ? 120 VAL A HG12 5  
ATOM 10628 H HG13 . VAL A 1 120 ? -5.232  -0.849  18.416  1.00 2.21   ? 120 VAL A HG13 5  
ATOM 10629 H HG21 . VAL A 1 120 ? -7.962  -2.100  16.352  1.00 3.11   ? 120 VAL A HG21 5  
ATOM 10630 H HG22 . VAL A 1 120 ? -7.928  -0.456  15.737  1.00 3.12   ? 120 VAL A HG22 5  
ATOM 10631 H HG23 . VAL A 1 120 ? -7.271  -1.795  14.765  1.00 3.11   ? 120 VAL A HG23 5  
ATOM 10632 N N    . GLY A 1 121 ? -5.892  1.997   16.298  1.00 1.21   ? 121 GLY A N    5  
ATOM 10633 C CA   . GLY A 1 121 ? -6.737  3.194   16.288  1.00 1.51   ? 121 GLY A CA   5  
ATOM 10634 C C    . GLY A 1 121 ? -5.975  4.515   16.216  1.00 1.56   ? 121 GLY A C    5  
ATOM 10635 O O    . GLY A 1 121 ? -6.599  5.559   16.388  1.00 1.78   ? 121 GLY A O    5  
ATOM 10636 H H    . GLY A 1 121 ? -5.301  1.832   17.088  1.00 1.33   ? 121 GLY A H    5  
ATOM 10637 H HA2  . GLY A 1 121 ? -7.426  3.159   15.444  1.00 1.65   ? 121 GLY A HA2  5  
ATOM 10638 H HA3  . GLY A 1 121 ? -7.313  3.214   17.210  1.00 1.72   ? 121 GLY A HA3  5  
ATOM 10639 N N    . GLU A 1 122 ? -4.655  4.486   16.007  1.00 1.46   ? 122 GLU A N    5  
ATOM 10640 C CA   . GLU A 1 122 ? -3.817  5.662   15.780  1.00 1.43   ? 122 GLU A CA   5  
ATOM 10641 C C    . GLU A 1 122 ? -3.544  5.840   14.267  1.00 1.35   ? 122 GLU A C    5  
ATOM 10642 O O    . GLU A 1 122 ? -3.632  4.892   13.471  1.00 1.41   ? 122 GLU A O    5  
ATOM 10643 C CB   . GLU A 1 122 ? -2.555  5.553   16.669  1.00 1.58   ? 122 GLU A CB   5  
ATOM 10644 C CG   . GLU A 1 122 ? -1.785  6.883   16.765  1.00 1.69   ? 122 GLU A CG   5  
ATOM 10645 C CD   . GLU A 1 122 ? -0.858  7.046   17.991  1.00 1.96   ? 122 GLU A CD   5  
ATOM 10646 O OE1  . GLU A 1 122 ? -0.854  6.203   18.913  1.00 2.62   ? 122 GLU A OE1  5  
ATOM 10647 O OE2  . GLU A 1 122 ? -0.170  8.096   18.069  1.00 2.54   ? 122 GLU A OE2  5  
ATOM 10648 H H    . GLU A 1 122 ? -4.197  3.595   15.872  1.00 1.37   ? 122 GLU A H    5  
ATOM 10649 H HA   . GLU A 1 122 ? -4.371  6.540   16.112  1.00 1.62   ? 122 GLU A HA   5  
ATOM 10650 H HB2  . GLU A 1 122 ? -2.887  5.276   17.670  1.00 1.85   ? 122 GLU A HB2  5  
ATOM 10651 H HB3  . GLU A 1 122 ? -1.896  4.770   16.292  1.00 1.63   ? 122 GLU A HB3  5  
ATOM 10652 H HG2  . GLU A 1 122 ? -1.201  6.993   15.850  1.00 1.66   ? 122 GLU A HG2  5  
ATOM 10653 H HG3  . GLU A 1 122 ? -2.516  7.691   16.797  1.00 1.88   ? 122 GLU A HG3  5  
ATOM 10654 N N    . THR A 1 123 ? -3.279  7.090   13.861  1.00 1.42   ? 123 THR A N    5  
ATOM 10655 C CA   . THR A 1 123 ? -3.199  7.546   12.463  1.00 1.64   ? 123 THR A CA   5  
ATOM 10656 C C    . THR A 1 123 ? -1.773  7.961   12.091  1.00 1.40   ? 123 THR A C    5  
ATOM 10657 O O    . THR A 1 123 ? -1.008  8.434   12.923  1.00 1.55   ? 123 THR A O    5  
ATOM 10658 C CB   . THR A 1 123 ? -4.287  8.610   12.221  1.00 2.42   ? 123 THR A CB   5  
ATOM 10659 O OG1  . THR A 1 123 ? -5.422  7.909   11.748  1.00 3.70   ? 123 THR A OG1  5  
ATOM 10660 C CG2  . THR A 1 123 ? -3.960  9.712   11.208  1.00 2.66   ? 123 THR A CG2  5  
ATOM 10661 H H    . THR A 1 123 ? -3.162  7.793   14.576  1.00 1.46   ? 123 THR A H    5  
ATOM 10662 H HA   . THR A 1 123 ? -3.438  6.699   11.827  1.00 1.77   ? 123 THR A HA   5  
ATOM 10663 H HB   . THR A 1 123 ? -4.533  9.099   13.167  1.00 3.07   ? 123 THR A HB   5  
ATOM 10664 H HG1  . THR A 1 123 ? -6.150  7.993   12.382  1.00 4.41   ? 123 THR A HG1  5  
ATOM 10665 H HG21 . THR A 1 123 ? -4.811  10.388  11.126  1.00 3.27   ? 123 THR A HG21 5  
ATOM 10666 H HG22 . THR A 1 123 ? -3.098  10.285  11.549  1.00 2.85   ? 123 THR A HG22 5  
ATOM 10667 H HG23 . THR A 1 123 ? -3.756  9.293   10.225  1.00 3.34   ? 123 THR A HG23 5  
ATOM 10668 N N    . VAL A 1 124 ? -1.429  7.720   10.828  1.00 1.20   ? 124 VAL A N    5  
ATOM 10669 C CA   . VAL A 1 124 ? -0.074  7.592   10.283  1.00 1.10   ? 124 VAL A CA   5  
ATOM 10670 C C    . VAL A 1 124 ? 0.061   8.355   8.959   1.00 1.08   ? 124 VAL A C    5  
ATOM 10671 O O    . VAL A 1 124 ? -0.934  8.762   8.356   1.00 1.23   ? 124 VAL A O    5  
ATOM 10672 C CB   . VAL A 1 124 ? 0.287   6.096   10.087  1.00 1.22   ? 124 VAL A CB   5  
ATOM 10673 C CG1  . VAL A 1 124 ? -0.096  5.216   11.289  1.00 2.75   ? 124 VAL A CG1  5  
ATOM 10674 C CG2  . VAL A 1 124 ? -0.280  5.431   8.820   1.00 2.71   ? 124 VAL A CG2  5  
ATOM 10675 H H    . VAL A 1 124 ? -2.166  7.428   10.198  1.00 1.19   ? 124 VAL A H    5  
ATOM 10676 H HA   . VAL A 1 124 ? 0.630   8.020   10.999  1.00 1.15   ? 124 VAL A HA   5  
ATOM 10677 H HB   . VAL A 1 124 ? 1.362   6.078   9.993   1.00 1.75   ? 124 VAL A HB   5  
ATOM 10678 H HG11 . VAL A 1 124 ? 0.301   5.648   12.207  1.00 3.65   ? 124 VAL A HG11 5  
ATOM 10679 H HG12 . VAL A 1 124 ? -1.181  5.130   11.373  1.00 3.85   ? 124 VAL A HG12 5  
ATOM 10680 H HG13 . VAL A 1 124 ? 0.313   4.216   11.151  1.00 3.14   ? 124 VAL A HG13 5  
ATOM 10681 H HG21 . VAL A 1 124 ? 0.086   4.409   8.749   1.00 3.22   ? 124 VAL A HG21 5  
ATOM 10682 H HG22 . VAL A 1 124 ? -1.363  5.411   8.861   1.00 3.67   ? 124 VAL A HG22 5  
ATOM 10683 H HG23 . VAL A 1 124 ? 0.047   5.960   7.925   1.00 3.46   ? 124 VAL A HG23 5  
ATOM 10684 N N    . ASN A 1 125 ? 1.295   8.542   8.476   1.00 1.06   ? 125 ASN A N    5  
ATOM 10685 C CA   . ASN A 1 125 ? 1.562   9.252   7.221   1.00 1.15   ? 125 ASN A CA   5  
ATOM 10686 C C    . ASN A 1 125 ? 1.956   8.281   6.087   1.00 1.12   ? 125 ASN A C    5  
ATOM 10687 O O    . ASN A 1 125 ? 2.831   7.428   6.246   1.00 1.19   ? 125 ASN A O    5  
ATOM 10688 C CB   . ASN A 1 125 ? 2.657   10.317  7.418   1.00 1.32   ? 125 ASN A CB   5  
ATOM 10689 C CG   . ASN A 1 125 ? 2.254   11.541  8.247   1.00 1.68   ? 125 ASN A CG   5  
ATOM 10690 O OD1  . ASN A 1 125 ? 2.992   12.526  8.290   1.00 2.38   ? 125 ASN A OD1  5  
ATOM 10691 N ND2  . ASN A 1 125 ? 1.109   11.543  8.923   1.00 2.05   ? 125 ASN A ND2  5  
ATOM 10692 H H    . ASN A 1 125 ? 2.086   8.168   8.984   1.00 1.11   ? 125 ASN A H    5  
ATOM 10693 H HA   . ASN A 1 125 ? 0.654   9.763   6.903   1.00 1.23   ? 125 ASN A HA   5  
ATOM 10694 H HB2  . ASN A 1 125 ? 3.527   9.855   7.881   1.00 1.31   ? 125 ASN A HB2  5  
ATOM 10695 H HB3  . ASN A 1 125 ? 2.955   10.684  6.436   1.00 1.43   ? 125 ASN A HB3  5  
ATOM 10696 H HD21 . ASN A 1 125 ? 0.504   10.739  8.894   1.00 2.61   ? 125 ASN A HD21 5  
ATOM 10697 H HD22 . ASN A 1 125 ? 0.887   12.333  9.503   1.00 2.19   ? 125 ASN A HD22 5  
ATOM 10698 N N    . ILE A 1 126 ? 1.328   8.455   4.921   1.00 1.13   ? 126 ILE A N    5  
ATOM 10699 C CA   . ILE A 1 126 ? 1.588   7.702   3.680   1.00 1.08   ? 126 ILE A CA   5  
ATOM 10700 C C    . ILE A 1 126 ? 1.916   8.675   2.537   1.00 1.03   ? 126 ILE A C    5  
ATOM 10701 O O    . ILE A 1 126 ? 1.504   9.844   2.552   1.00 1.01   ? 126 ILE A O    5  
ATOM 10702 C CB   . ILE A 1 126 ? 0.373   6.783   3.391   1.00 1.13   ? 126 ILE A CB   5  
ATOM 10703 C CG1  . ILE A 1 126 ? 0.342   5.590   4.378   1.00 1.71   ? 126 ILE A CG1  5  
ATOM 10704 C CG2  . ILE A 1 126 ? 0.266   6.275   1.939   1.00 1.58   ? 126 ILE A CG2  5  
ATOM 10705 C CD1  . ILE A 1 126 ? 1.511   4.600   4.306   1.00 2.21   ? 126 ILE A CD1  5  
ATOM 10706 H H    . ILE A 1 126 ? 0.665   9.220   4.848   1.00 1.20   ? 126 ILE A H    5  
ATOM 10707 H HA   . ILE A 1 126 ? 2.475   7.081   3.807   1.00 1.10   ? 126 ILE A HA   5  
ATOM 10708 H HB   . ILE A 1 126 ? -0.532  7.369   3.569   1.00 1.87   ? 126 ILE A HB   5  
ATOM 10709 H HG12 . ILE A 1 126 ? 0.308   5.974   5.394   1.00 2.81   ? 126 ILE A HG12 5  
ATOM 10710 H HG13 . ILE A 1 126 ? -0.575  5.030   4.214   1.00 2.09   ? 126 ILE A HG13 5  
ATOM 10711 H HG21 . ILE A 1 126 ? 0.097   7.111   1.260   1.00 2.07   ? 126 ILE A HG21 5  
ATOM 10712 H HG22 . ILE A 1 126 ? 1.170   5.748   1.642   1.00 2.71   ? 126 ILE A HG22 5  
ATOM 10713 H HG23 . ILE A 1 126 ? -0.585  5.595   1.848   1.00 2.39   ? 126 ILE A HG23 5  
ATOM 10714 H HD11 . ILE A 1 126 ? 2.432   5.091   4.617   1.00 2.97   ? 126 ILE A HD11 5  
ATOM 10715 H HD12 . ILE A 1 126 ? 1.318   3.774   4.991   1.00 3.23   ? 126 ILE A HD12 5  
ATOM 10716 H HD13 . ILE A 1 126 ? 1.621   4.200   3.299   1.00 2.32   ? 126 ILE A HD13 5  
ATOM 10717 N N    . THR A 1 127 ? 2.723   8.215   1.575   1.00 1.03   ? 127 THR A N    5  
ATOM 10718 C CA   . THR A 1 127 ? 3.322   9.037   0.520   1.00 0.92   ? 127 THR A CA   5  
ATOM 10719 C C    . THR A 1 127 ? 3.333   8.243   -0.779  1.00 0.74   ? 127 THR A C    5  
ATOM 10720 O O    . THR A 1 127 ? 4.148   7.348   -0.959  1.00 1.07   ? 127 THR A O    5  
ATOM 10721 C CB   . THR A 1 127 ? 4.749   9.434   0.912   1.00 1.18   ? 127 THR A CB   5  
ATOM 10722 O OG1  . THR A 1 127 ? 4.759   10.014  2.191   1.00 1.91   ? 127 THR A OG1  5  
ATOM 10723 C CG2  . THR A 1 127 ? 5.296   10.470  -0.055  1.00 1.39   ? 127 THR A CG2  5  
ATOM 10724 H H    . THR A 1 127 ? 3.006   7.240   1.613   1.00 1.11   ? 127 THR A H    5  
ATOM 10725 H HA   . THR A 1 127 ? 2.739   9.947   0.363   1.00 1.05   ? 127 THR A HA   5  
ATOM 10726 H HB   . THR A 1 127 ? 5.397   8.553   0.915   1.00 1.35   ? 127 THR A HB   5  
ATOM 10727 H HG1  . THR A 1 127 ? 3.896   10.417  2.340   1.00 2.73   ? 127 THR A HG1  5  
ATOM 10728 H HG21 . THR A 1 127 ? 6.291   10.771  0.271   1.00 2.00   ? 127 THR A HG21 5  
ATOM 10729 H HG22 . THR A 1 127 ? 5.367   10.035  -1.048  1.00 1.84   ? 127 THR A HG22 5  
ATOM 10730 H HG23 . THR A 1 127 ? 4.643   11.338  -0.079  1.00 2.28   ? 127 THR A HG23 5  
ATOM 10731 N N    . LEU A 1 128 ? 2.428   8.559   -1.701  1.00 0.70   ? 128 LEU A N    5  
ATOM 10732 C CA   . LEU A 1 128 ? 2.328   7.939   -3.028  1.00 0.89   ? 128 LEU A CA   5  
ATOM 10733 C C    . LEU A 1 128 ? 3.223   8.666   -4.041  1.00 1.30   ? 128 LEU A C    5  
ATOM 10734 O O    . LEU A 1 128 ? 3.695   9.767   -3.765  1.00 2.09   ? 128 LEU A O    5  
ATOM 10735 C CB   . LEU A 1 128 ? 0.849   7.915   -3.477  1.00 1.31   ? 128 LEU A CB   5  
ATOM 10736 C CG   . LEU A 1 128 ? -0.129  7.293   -2.450  1.00 1.41   ? 128 LEU A CG   5  
ATOM 10737 C CD1  . LEU A 1 128 ? -0.808  8.360   -1.574  1.00 2.03   ? 128 LEU A CD1  5  
ATOM 10738 C CD2  . LEU A 1 128 ? -1.219  6.483   -3.164  1.00 2.39   ? 128 LEU A CD2  5  
ATOM 10739 H H    . LEU A 1 128 ? 1.842   9.367   -1.516  1.00 0.86   ? 128 LEU A H    5  
ATOM 10740 H HA   . LEU A 1 128 ? 2.695   6.913   -2.978  1.00 0.86   ? 128 LEU A HA   5  
ATOM 10741 H HB2  . LEU A 1 128 ? 0.520   8.928   -3.717  1.00 1.99   ? 128 LEU A HB2  5  
ATOM 10742 H HB3  . LEU A 1 128 ? 0.799   7.341   -4.402  1.00 2.35   ? 128 LEU A HB3  5  
ATOM 10743 H HG   . LEU A 1 128 ? 0.415   6.608   -1.800  1.00 2.47   ? 128 LEU A HG   5  
ATOM 10744 H HD11 . LEU A 1 128 ? -1.370  9.054   -2.201  1.00 2.81   ? 128 LEU A HD11 5  
ATOM 10745 H HD12 . LEU A 1 128 ? -1.493  7.881   -0.873  1.00 2.63   ? 128 LEU A HD12 5  
ATOM 10746 H HD13 . LEU A 1 128 ? -0.070  8.917   -1.000  1.00 3.28   ? 128 LEU A HD13 5  
ATOM 10747 H HD21 . LEU A 1 128 ? -1.925  6.086   -2.434  1.00 2.76   ? 128 LEU A HD21 5  
ATOM 10748 H HD22 . LEU A 1 128 ? -1.755  7.116   -3.873  1.00 3.01   ? 128 LEU A HD22 5  
ATOM 10749 H HD23 . LEU A 1 128 ? -0.764  5.645   -3.691  1.00 3.61   ? 128 LEU A HD23 5  
ATOM 10750 N N    . LYS A 1 129 ? 3.447   8.079   -5.224  1.00 1.29   ? 129 LYS A N    5  
ATOM 10751 C CA   . LYS A 1 129 ? 4.171   8.736   -6.325  1.00 1.57   ? 129 LYS A CA   5  
ATOM 10752 C C    . LYS A 1 129 ? 3.403   8.641   -7.658  1.00 1.36   ? 129 LYS A C    5  
ATOM 10753 O O    . LYS A 1 129 ? 3.014   7.556   -8.094  1.00 1.29   ? 129 LYS A O    5  
ATOM 10754 C CB   . LYS A 1 129 ? 5.608   8.180   -6.434  1.00 1.99   ? 129 LYS A CB   5  
ATOM 10755 C CG   . LYS A 1 129 ? 6.435   8.464   -5.161  1.00 2.93   ? 129 LYS A CG   5  
ATOM 10756 C CD   . LYS A 1 129 ? 7.960   8.497   -5.344  1.00 3.39   ? 129 LYS A CD   5  
ATOM 10757 C CE   . LYS A 1 129 ? 8.532   7.215   -5.961  1.00 3.95   ? 129 LYS A CE   5  
ATOM 10758 N NZ   . LYS A 1 129 ? 10.013  7.183   -5.872  1.00 4.67   ? 129 LYS A NZ   5  
ATOM 10759 H H    . LYS A 1 129 ? 3.075   7.150   -5.381  1.00 1.53   ? 129 LYS A H    5  
ATOM 10760 H HA   . LYS A 1 129 ? 4.257   9.801   -6.100  1.00 1.80   ? 129 LYS A HA   5  
ATOM 10761 H HB2  . LYS A 1 129 ? 5.575   7.103   -6.601  1.00 2.88   ? 129 LYS A HB2  5  
ATOM 10762 H HB3  . LYS A 1 129 ? 6.093   8.646   -7.292  1.00 1.83   ? 129 LYS A HB3  5  
ATOM 10763 H HG2  . LYS A 1 129 ? 6.154   9.434   -4.762  1.00 3.14   ? 129 LYS A HG2  5  
ATOM 10764 H HG3  . LYS A 1 129 ? 6.189   7.714   -4.407  1.00 4.00   ? 129 LYS A HG3  5  
ATOM 10765 H HD2  . LYS A 1 129 ? 8.228   9.348   -5.974  1.00 3.41   ? 129 LYS A HD2  5  
ATOM 10766 H HD3  . LYS A 1 129 ? 8.415   8.654   -4.363  1.00 4.15   ? 129 LYS A HD3  5  
ATOM 10767 H HE2  . LYS A 1 129 ? 8.120   6.347   -5.441  1.00 4.61   ? 129 LYS A HE2  5  
ATOM 10768 H HE3  . LYS A 1 129 ? 8.226   7.162   -7.011  1.00 3.87   ? 129 LYS A HE3  5  
ATOM 10769 H HZ1  . LYS A 1 129 ? 10.431  8.072   -6.136  1.00 4.48   ? 129 LYS A HZ1  5  
ATOM 10770 H HZ2  . LYS A 1 129 ? 10.312  6.996   -4.915  1.00 5.36   ? 129 LYS A HZ2  5  
ATOM 10771 H HZ3  . LYS A 1 129 ? 10.383  6.458   -6.479  1.00 5.21   ? 129 LYS A HZ3  5  
ATOM 10772 N N    . ALA A 1 130 ? 3.161   9.783   -8.303  1.00 1.54   ? 130 ALA A N    5  
ATOM 10773 C CA   . ALA A 1 130 ? 2.555   9.892   -9.635  1.00 1.47   ? 130 ALA A CA   5  
ATOM 10774 C C    . ALA A 1 130 ? 3.645   9.901   -10.721 1.00 1.57   ? 130 ALA A C    5  
ATOM 10775 O O    . ALA A 1 130 ? 4.635   10.608  -10.547 1.00 1.79   ? 130 ALA A O    5  
ATOM 10776 C CB   . ALA A 1 130 ? 1.701   11.167  -9.678  1.00 1.70   ? 130 ALA A CB   5  
ATOM 10777 H H    . ALA A 1 130 ? 3.527   10.642  -7.895  1.00 1.91   ? 130 ALA A H    5  
ATOM 10778 H HA   . ALA A 1 130 ? 1.902   9.042   -9.805  1.00 1.42   ? 130 ALA A HA   5  
ATOM 10779 H HB1  . ALA A 1 130 ? 0.941   11.138  -8.895  1.00 1.97   ? 130 ALA A HB1  5  
ATOM 10780 H HB2  . ALA A 1 130 ? 2.335   12.042  -9.532  1.00 2.70   ? 130 ALA A HB2  5  
ATOM 10781 H HB3  . ALA A 1 130 ? 1.207   11.250  -10.649 1.00 2.04   ? 130 ALA A HB3  5  
ATOM 10782 N N    . THR A 1 131 ? 3.450   9.130   -11.806 1.00 1.57   ? 131 THR A N    5  
ATOM 10783 C CA   . THR A 1 131 ? 4.404   8.923   -12.918 1.00 1.80   ? 131 THR A CA   5  
ATOM 10784 C C    . THR A 1 131 ? 4.860   10.240  -13.533 1.00 2.01   ? 131 THR A C    5  
ATOM 10785 O O    . THR A 1 131 ? 6.012   10.622  -13.370 1.00 2.49   ? 131 THR A O    5  
ATOM 10786 C CB   . THR A 1 131 ? 3.863   7.917   -13.964 1.00 1.91   ? 131 THR A CB   5  
ATOM 10787 O OG1  . THR A 1 131 ? 4.699   7.892   -15.097 1.00 2.63   ? 131 THR A OG1  5  
ATOM 10788 C CG2  . THR A 1 131 ? 2.419   8.117   -14.449 1.00 2.18   ? 131 THR A CG2  5  
ATOM 10789 H H    . THR A 1 131 ? 2.579   8.630   -11.874 1.00 1.53   ? 131 THR A H    5  
ATOM 10790 H HA   . THR A 1 131 ? 5.319   8.483   -12.515 1.00 1.97   ? 131 THR A HA   5  
ATOM 10791 H HB   . THR A 1 131 ? 3.895   6.926   -13.510 1.00 2.20   ? 131 THR A HB   5  
ATOM 10792 H HG1  . THR A 1 131 ? 4.478   8.641   -15.693 1.00 2.81   ? 131 THR A HG1  5  
ATOM 10793 H HG21 . THR A 1 131 ? 2.169   7.307   -15.135 1.00 2.73   ? 131 THR A HG21 5  
ATOM 10794 H HG22 . THR A 1 131 ? 1.724   8.085   -13.612 1.00 2.60   ? 131 THR A HG22 5  
ATOM 10795 H HG23 . THR A 1 131 ? 2.306   9.057   -14.985 1.00 2.84   ? 131 THR A HG23 5  
ATOM 10796 N N    . ASP A 1 132 ? 3.953   10.950  -14.195 1.00 2.07   ? 132 ASP A N    5  
ATOM 10797 C CA   . ASP A 1 132 ? 4.259   12.146  -14.971 1.00 2.54   ? 132 ASP A CA   5  
ATOM 10798 C C    . ASP A 1 132 ? 4.053   13.400  -14.091 1.00 2.88   ? 132 ASP A C    5  
ATOM 10799 O O    . ASP A 1 132 ? 3.430   14.386  -14.500 1.00 3.38   ? 132 ASP A O    5  
ATOM 10800 C CB   . ASP A 1 132 ? 3.427   12.091  -16.270 1.00 2.65   ? 132 ASP A CB   5  
ATOM 10801 C CG   . ASP A 1 132 ? 3.910   11.013  -17.270 1.00 3.28   ? 132 ASP A CG   5  
ATOM 10802 O OD1  . ASP A 1 132 ? 3.987   9.819   -16.897 1.00 4.18   ? 132 ASP A OD1  5  
ATOM 10803 O OD2  . ASP A 1 132 ? 4.159   11.399  -18.440 1.00 3.89   ? 132 ASP A OD2  5  
ATOM 10804 H H    . ASP A 1 132 ? 3.030   10.564  -14.291 1.00 2.14   ? 132 ASP A H    5  
ATOM 10805 H HA   . ASP A 1 132 ? 5.315   12.125  -15.254 1.00 2.86   ? 132 ASP A HA   5  
ATOM 10806 H HB2  . ASP A 1 132 ? 2.378   11.909  -16.021 1.00 2.58   ? 132 ASP A HB2  5  
ATOM 10807 H HB3  . ASP A 1 132 ? 3.485   13.067  -16.756 1.00 3.22   ? 132 ASP A HB3  5  
ATOM 10808 N N    . GLY A 1 133 ? 4.560   13.338  -12.850 1.00 2.99   ? 133 GLY A N    5  
ATOM 10809 C CA   . GLY A 1 133 ? 4.314   14.330  -11.803 1.00 3.38   ? 133 GLY A CA   5  
ATOM 10810 C C    . GLY A 1 133 ? 5.376   14.364  -10.706 1.00 3.70   ? 133 GLY A C    5  
ATOM 10811 O O    . GLY A 1 133 ? 6.362   15.091  -10.829 1.00 4.54   ? 133 GLY A O    5  
ATOM 10812 H H    . GLY A 1 133 ? 5.105   12.510  -12.618 1.00 2.99   ? 133 GLY A H    5  
ATOM 10813 H HA2  . GLY A 1 133 ? 4.253   15.322  -12.250 1.00 4.01   ? 133 GLY A HA2  5  
ATOM 10814 H HA3  . GLY A 1 133 ? 3.342   14.120  -11.355 1.00 3.24   ? 133 GLY A HA3  5  
ATOM 10815 N N    . ARG A 1 134 ? 5.101   13.709  -9.567  1.00 3.49   ? 134 ARG A N    5  
ATOM 10816 C CA   . ARG A 1 134 ? 5.796   13.875  -8.285  1.00 4.02   ? 134 ARG A CA   5  
ATOM 10817 C C    . ARG A 1 134 ? 5.217   12.969  -7.186  1.00 4.00   ? 134 ARG A C    5  
ATOM 10818 O O    . ARG A 1 134 ? 4.275   12.203  -7.392  1.00 4.47   ? 134 ARG A O    5  
ATOM 10819 C CB   . ARG A 1 134 ? 5.809   15.375  -7.869  1.00 4.54   ? 134 ARG A CB   5  
ATOM 10820 C CG   . ARG A 1 134 ? 7.230   15.976  -7.921  1.00 6.12   ? 134 ARG A CG   5  
ATOM 10821 C CD   . ARG A 1 134 ? 7.244   17.414  -8.457  1.00 6.74   ? 134 ARG A CD   5  
ATOM 10822 N NE   . ARG A 1 134 ? 8.628   17.928  -8.575  1.00 8.24   ? 134 ARG A NE   5  
ATOM 10823 C CZ   . ARG A 1 134 ? 9.503   17.598  -9.522  1.00 9.49   ? 134 ARG A CZ   5  
ATOM 10824 N NH1  . ARG A 1 134 ? 9.198   16.843  -10.557 1.00 9.78   ? 134 ARG A NH1  5  
ATOM 10825 N NH2  . ARG A 1 134 ? 10.738  18.041  -9.458  1.00 10.85  ? 134 ARG A NH2  5  
ATOM 10826 H H    . ARG A 1 134 ? 4.326   13.070  -9.554  1.00 3.30   ? 134 ARG A H    5  
ATOM 10827 H HA   . ARG A 1 134 ? 6.823   13.541  -8.434  1.00 4.45   ? 134 ARG A HA   5  
ATOM 10828 H HB2  . ARG A 1 134 ? 5.146   15.951  -8.517  1.00 4.18   ? 134 ARG A HB2  5  
ATOM 10829 H HB3  . ARG A 1 134 ? 5.419   15.512  -6.859  1.00 4.70   ? 134 ARG A HB3  5  
ATOM 10830 H HG2  . ARG A 1 134 ? 7.663   15.955  -6.921  1.00 6.73   ? 134 ARG A HG2  5  
ATOM 10831 H HG3  . ARG A 1 134 ? 7.861   15.375  -8.573  1.00 6.87   ? 134 ARG A HG3  5  
ATOM 10832 H HD2  . ARG A 1 134 ? 6.767   17.445  -9.437  1.00 6.70   ? 134 ARG A HD2  5  
ATOM 10833 H HD3  . ARG A 1 134 ? 6.675   18.055  -7.783  1.00 6.68   ? 134 ARG A HD3  5  
ATOM 10834 H HE   . ARG A 1 134 ? 8.937   18.581  -7.878  1.00 8.58   ? 134 ARG A HE   5  
ATOM 10835 H HH11 . ARG A 1 134 ? 8.283   16.444  -10.683 1.00 8.97   ? 134 ARG A HH11 5  
ATOM 10836 H HH12 . ARG A 1 134 ? 9.931   16.632  -11.230 1.00 11.03  ? 134 ARG A HH12 5  
ATOM 10837 H HH21 . ARG A 1 134 ? 11.079  18.608  -8.680  1.00 11.02  ? 134 ARG A HH21 5  
ATOM 10838 H HH22 . ARG A 1 134 ? 11.392  17.710  -10.165 1.00 11.92  ? 134 ARG A HH22 5  
ATOM 10839 N N    . THR A 1 135 ? 5.831   13.074  -6.012  1.00 4.16   ? 135 THR A N    5  
ATOM 10840 C CA   . THR A 1 135 ? 5.473   12.556  -4.682  1.00 4.14   ? 135 THR A CA   5  
ATOM 10841 C C    . THR A 1 135 ? 4.141   13.154  -4.189  1.00 2.36   ? 135 THR A C    5  
ATOM 10842 O O    . THR A 1 135 ? 3.793   14.252  -4.610  1.00 2.65   ? 135 THR A O    5  
ATOM 10843 C CB   . THR A 1 135 ? 6.615   12.988  -3.748  1.00 5.81   ? 135 THR A CB   5  
ATOM 10844 O OG1  . THR A 1 135 ? 7.881   12.818  -4.358  1.00 7.36   ? 135 THR A OG1  5  
ATOM 10845 C CG2  . THR A 1 135 ? 6.637   12.234  -2.431  1.00 6.57   ? 135 THR A CG2  5  
ATOM 10846 H H    . THR A 1 135 ? 6.645   13.665  -6.027  1.00 4.70   ? 135 THR A H    5  
ATOM 10847 H HA   . THR A 1 135 ? 5.394   11.471  -4.709  1.00 4.88   ? 135 THR A HA   5  
ATOM 10848 H HB   . THR A 1 135 ? 6.480   14.051  -3.555  1.00 5.80   ? 135 THR A HB   5  
ATOM 10849 H HG1  . THR A 1 135 ? 8.556   13.197  -3.763  1.00 8.34   ? 135 THR A HG1  5  
ATOM 10850 H HG21 . THR A 1 135 ? 5.749   12.494  -1.855  1.00 6.25   ? 135 THR A HG21 5  
ATOM 10851 H HG22 . THR A 1 135 ? 6.660   11.161  -2.622  1.00 6.79   ? 135 THR A HG22 5  
ATOM 10852 H HG23 . THR A 1 135 ? 7.515   12.518  -1.852  1.00 7.70   ? 135 THR A HG23 5  
ATOM 10853 N N    . LEU A 1 136 ? 3.409   12.492  -3.274  1.00 1.57   ? 136 LEU A N    5  
ATOM 10854 C CA   . LEU A 1 136 ? 2.070   12.916  -2.800  1.00 1.54   ? 136 LEU A CA   5  
ATOM 10855 C C    . LEU A 1 136 ? 1.745   12.383  -1.387  1.00 1.38   ? 136 LEU A C    5  
ATOM 10856 O O    . LEU A 1 136 ? 1.593   11.186  -1.183  1.00 1.27   ? 136 LEU A O    5  
ATOM 10857 C CB   . LEU A 1 136 ? 1.028   12.492  -3.864  1.00 3.38   ? 136 LEU A CB   5  
ATOM 10858 C CG   . LEU A 1 136 ? -0.281  13.315  -3.901  1.00 4.43   ? 136 LEU A CG   5  
ATOM 10859 C CD1  . LEU A 1 136 ? -1.073  12.935  -5.163  1.00 6.51   ? 136 LEU A CD1  5  
ATOM 10860 C CD2  . LEU A 1 136 ? -1.179  13.100  -2.675  1.00 4.83   ? 136 LEU A CD2  5  
ATOM 10861 H H    . LEU A 1 136 ? 3.711   11.555  -3.031  1.00 2.49   ? 136 LEU A H    5  
ATOM 10862 H HA   . LEU A 1 136 ? 2.079   14.001  -2.739  1.00 2.43   ? 136 LEU A HA   5  
ATOM 10863 H HB2  . LEU A 1 136 ? 1.488   12.598  -4.852  1.00 4.17   ? 136 LEU A HB2  5  
ATOM 10864 H HB3  . LEU A 1 136 ? 0.791   11.436  -3.738  1.00 3.86   ? 136 LEU A HB3  5  
ATOM 10865 H HG   . LEU A 1 136 ? -0.028  14.373  -3.966  1.00 4.23   ? 136 LEU A HG   5  
ATOM 10866 H HD11 . LEU A 1 136 ? -1.990  13.522  -5.215  1.00 7.20   ? 136 LEU A HD11 5  
ATOM 10867 H HD12 . LEU A 1 136 ? -0.478  13.143  -6.052  1.00 6.84   ? 136 LEU A HD12 5  
ATOM 10868 H HD13 . LEU A 1 136 ? -1.329  11.874  -5.140  1.00 7.51   ? 136 LEU A HD13 5  
ATOM 10869 H HD21 . LEU A 1 136 ? -2.121  13.636  -2.808  1.00 5.35   ? 136 LEU A HD21 5  
ATOM 10870 H HD22 . LEU A 1 136 ? -1.390  12.037  -2.559  1.00 5.51   ? 136 LEU A HD22 5  
ATOM 10871 H HD23 . LEU A 1 136 ? -0.702  13.483  -1.779  1.00 4.83   ? 136 LEU A HD23 5  
ATOM 10872 N N    . ASN A 1 137 ? 1.622   13.274  -0.393  1.00 1.64   ? 137 ASN A N    5  
ATOM 10873 C CA   . ASN A 1 137 ? 1.458   12.997  1.036   1.00 1.60   ? 137 ASN A CA   5  
ATOM 10874 C C    . ASN A 1 137 ? -0.033  12.950  1.403   1.00 1.67   ? 137 ASN A C    5  
ATOM 10875 O O    . ASN A 1 137 ? -0.783  13.890  1.150   1.00 2.08   ? 137 ASN A O    5  
ATOM 10876 C CB   . ASN A 1 137 ? 2.205   14.100  1.817   1.00 1.73   ? 137 ASN A CB   5  
ATOM 10877 C CG   . ASN A 1 137 ? 2.126   13.997  3.342   1.00 2.26   ? 137 ASN A CG   5  
ATOM 10878 O OD1  . ASN A 1 137 ? 1.532   13.096  3.924   1.00 3.47   ? 137 ASN A OD1  5  
ATOM 10879 N ND2  . ASN A 1 137 ? 2.747   14.933  4.047   1.00 2.47   ? 137 ASN A ND2  5  
ATOM 10880 H H    . ASN A 1 137 ? 1.545   14.242  -0.625  1.00 2.07   ? 137 ASN A H    5  
ATOM 10881 H HA   . ASN A 1 137 ? 1.919   12.040  1.270   1.00 1.59   ? 137 ASN A HA   5  
ATOM 10882 H HB2  . ASN A 1 137 ? 3.257   14.077  1.533   1.00 2.26   ? 137 ASN A HB2  5  
ATOM 10883 H HB3  . ASN A 1 137 ? 1.802   15.070  1.529   1.00 2.11   ? 137 ASN A HB3  5  
ATOM 10884 H HD21 . ASN A 1 137 ? 3.257   15.674  3.594   1.00 2.55   ? 137 ASN A HD21 5  
ATOM 10885 H HD22 . ASN A 1 137 ? 2.670   14.894  5.047   1.00 3.27   ? 137 ASN A HD22 5  
ATOM 10886 N N    . VAL A 1 138 ? -0.438  11.838  2.003   1.00 1.40   ? 138 VAL A N    5  
ATOM 10887 C CA   . VAL A 1 138 ? -1.817  11.486  2.412   1.00 1.49   ? 138 VAL A CA   5  
ATOM 10888 C C    . VAL A 1 138 ? -1.840  10.893  3.836   1.00 1.24   ? 138 VAL A C    5  
ATOM 10889 O O    . VAL A 1 138 ? -0.939  10.143  4.211   1.00 1.26   ? 138 VAL A O    5  
ATOM 10890 C CB   . VAL A 1 138 ? -2.435  10.481  1.404   1.00 1.81   ? 138 VAL A CB   5  
ATOM 10891 C CG1  . VAL A 1 138 ? -3.858  10.039  1.787   1.00 1.98   ? 138 VAL A CG1  5  
ATOM 10892 C CG2  . VAL A 1 138 ? -2.494  11.079  -0.012  1.00 2.13   ? 138 VAL A CG2  5  
ATOM 10893 H H    . VAL A 1 138 ? 0.303   11.164  2.169   1.00 1.20   ? 138 VAL A H    5  
ATOM 10894 H HA   . VAL A 1 138 ? -2.420  12.392  2.406   1.00 1.77   ? 138 VAL A HA   5  
ATOM 10895 H HB   . VAL A 1 138 ? -1.801  9.591   1.364   1.00 1.99   ? 138 VAL A HB   5  
ATOM 10896 H HG11 . VAL A 1 138 ? -4.496  10.911  1.935   1.00 2.53   ? 138 VAL A HG11 5  
ATOM 10897 H HG12 . VAL A 1 138 ? -4.283  9.415   1.000   1.00 2.44   ? 138 VAL A HG12 5  
ATOM 10898 H HG13 . VAL A 1 138 ? -3.831  9.445   2.699   1.00 2.34   ? 138 VAL A HG13 5  
ATOM 10899 H HG21 . VAL A 1 138 ? -1.485  11.254  -0.381  1.00 2.27   ? 138 VAL A HG21 5  
ATOM 10900 H HG22 . VAL A 1 138 ? -2.985  10.385  -0.696  1.00 2.80   ? 138 VAL A HG22 5  
ATOM 10901 H HG23 . VAL A 1 138 ? -3.046  12.019  0.000   1.00 2.69   ? 138 VAL A HG23 5  
ATOM 10902 N N    . ALA A 1 139 ? -2.860  11.228  4.636   1.00 1.29   ? 139 ALA A N    5  
ATOM 10903 C CA   . ALA A 1 139 ? -3.084  10.637  5.968   1.00 1.23   ? 139 ALA A CA   5  
ATOM 10904 C C    . ALA A 1 139 ? -3.822  9.288   5.884   1.00 1.35   ? 139 ALA A C    5  
ATOM 10905 O O    . ALA A 1 139 ? -4.794  9.154   5.139   1.00 1.62   ? 139 ALA A O    5  
ATOM 10906 C CB   . ALA A 1 139 ? -3.839  11.627  6.867   1.00 1.57   ? 139 ALA A CB   5  
ATOM 10907 H H    . ALA A 1 139 ? -3.574  11.846  4.258   1.00 1.53   ? 139 ALA A H    5  
ATOM 10908 H HA   . ALA A 1 139 ? -2.114  10.452  6.432   1.00 1.10   ? 139 ALA A HA   5  
ATOM 10909 H HB1  . ALA A 1 139 ? -4.822  11.848  6.450   1.00 2.34   ? 139 ALA A HB1  5  
ATOM 10910 H HB2  . ALA A 1 139 ? -3.974  11.193  7.859   1.00 2.20   ? 139 ALA A HB2  5  
ATOM 10911 H HB3  . ALA A 1 139 ? -3.276  12.552  6.961   1.00 2.15   ? 139 ALA A HB3  5  
ATOM 10912 N N    . ALA A 1 140 ? -3.363  8.325   6.690   1.00 1.34   ? 140 ALA A N    5  
ATOM 10913 C CA   . ALA A 1 140 ? -3.729  6.907   6.682   1.00 1.31   ? 140 ALA A CA   5  
ATOM 10914 C C    . ALA A 1 140 ? -3.771  6.350   8.122   1.00 1.10   ? 140 ALA A C    5  
ATOM 10915 O O    . ALA A 1 140 ? -3.445  7.082   9.062   1.00 1.14   ? 140 ALA A O    5  
ATOM 10916 C CB   . ALA A 1 140 ? -2.654  6.212   5.846   1.00 1.36   ? 140 ALA A CB   5  
ATOM 10917 H H    . ALA A 1 140 ? -2.634  8.585   7.343   1.00 1.39   ? 140 ALA A H    5  
ATOM 10918 H HA   . ALA A 1 140 ? -4.708  6.760   6.217   1.00 1.48   ? 140 ALA A HA   5  
ATOM 10919 H HB1  . ALA A 1 140 ? -2.821  5.141   5.824   1.00 2.11   ? 140 ALA A HB1  5  
ATOM 10920 H HB2  . ALA A 1 140 ? -2.684  6.593   4.826   1.00 2.35   ? 140 ALA A HB2  5  
ATOM 10921 H HB3  . ALA A 1 140 ? -1.679  6.406   6.284   1.00 1.48   ? 140 ALA A HB3  5  
ATOM 10922 N N    . THR A 1 141 ? -4.097  5.068   8.345   1.00 0.97   ? 141 THR A N    5  
ATOM 10923 C CA   . THR A 1 141 ? -4.322  4.536   9.714   1.00 0.93   ? 141 THR A CA   5  
ATOM 10924 C C    . THR A 1 141 ? -3.706  3.146   9.913   1.00 0.81   ? 141 THR A C    5  
ATOM 10925 O O    . THR A 1 141 ? -3.262  2.491   8.970   1.00 0.81   ? 141 THR A O    5  
ATOM 10926 C CB   . THR A 1 141 ? -5.836  4.543   10.030  1.00 1.19   ? 141 THR A CB   5  
ATOM 10927 O OG1  . THR A 1 141 ? -6.427  5.739   9.550   1.00 1.38   ? 141 THR A OG1  5  
ATOM 10928 C CG2  . THR A 1 141 ? -6.208  4.505   11.519  1.00 1.40   ? 141 THR A CG2  5  
ATOM 10929 H H    . THR A 1 141 ? -4.283  4.457   7.555   1.00 1.00   ? 141 THR A H    5  
ATOM 10930 H HA   . THR A 1 141 ? -3.838  5.185   10.437  1.00 0.97   ? 141 THR A HA   5  
ATOM 10931 H HB   . THR A 1 141 ? -6.284  3.676   9.537   1.00 1.23   ? 141 THR A HB   5  
ATOM 10932 H HG1  . THR A 1 141 ? -6.029  6.476   10.041  1.00 2.25   ? 141 THR A HG1  5  
ATOM 10933 H HG21 . THR A 1 141 ? -5.933  3.561   11.980  1.00 2.27   ? 141 THR A HG21 5  
ATOM 10934 H HG22 . THR A 1 141 ? -5.717  5.316   12.053  1.00 2.07   ? 141 THR A HG22 5  
ATOM 10935 H HG23 . THR A 1 141 ? -7.289  4.621   11.623  1.00 1.63   ? 141 THR A HG23 5  
ATOM 10936 N N    . VAL A 1 142 ? -3.671  2.673   11.155  1.00 0.88   ? 142 VAL A N    5  
ATOM 10937 C CA   . VAL A 1 142 ? -3.413  1.266   11.499  1.00 0.86   ? 142 VAL A CA   5  
ATOM 10938 C C    . VAL A 1 142 ? -4.755  0.496   11.538  1.00 1.09   ? 142 VAL A C    5  
ATOM 10939 O O    . VAL A 1 142 ? -5.820  1.108   11.477  1.00 1.61   ? 142 VAL A O    5  
ATOM 10940 C CB   . VAL A 1 142 ? -2.646  1.197   12.849  1.00 1.04   ? 142 VAL A CB   5  
ATOM 10941 C CG1  . VAL A 1 142 ? -2.053  -0.183  13.185  1.00 1.45   ? 142 VAL A CG1  5  
ATOM 10942 C CG2  . VAL A 1 142 ? -1.477  2.197   12.921  1.00 1.28   ? 142 VAL A CG2  5  
ATOM 10943 H H    . VAL A 1 142 ? -3.976  3.288   11.913  1.00 1.05   ? 142 VAL A H    5  
ATOM 10944 H HA   . VAL A 1 142 ? -2.802  0.832   10.713  1.00 0.80   ? 142 VAL A HA   5  
ATOM 10945 H HB   . VAL A 1 142 ? -3.353  1.458   13.631  1.00 1.54   ? 142 VAL A HB   5  
ATOM 10946 H HG11 . VAL A 1 142 ? -1.517  -0.138  14.130  1.00 2.07   ? 142 VAL A HG11 5  
ATOM 10947 H HG12 . VAL A 1 142 ? -2.836  -0.923  13.294  1.00 2.17   ? 142 VAL A HG12 5  
ATOM 10948 H HG13 . VAL A 1 142 ? -1.361  -0.502  12.408  1.00 2.09   ? 142 VAL A HG13 5  
ATOM 10949 H HG21 . VAL A 1 142 ? -0.998  2.129   13.896  1.00 2.33   ? 142 VAL A HG21 5  
ATOM 10950 H HG22 . VAL A 1 142 ? -0.752  1.985   12.136  1.00 1.64   ? 142 VAL A HG22 5  
ATOM 10951 H HG23 . VAL A 1 142 ? -1.822  3.220   12.813  1.00 2.05   ? 142 VAL A HG23 5  
ATOM 10952 N N    . LYS A 1 143 ? -4.737  -0.837  11.682  1.00 1.11   ? 143 LYS A N    5  
ATOM 10953 C CA   . LYS A 1 143 ? -5.858  -1.651  12.185  1.00 1.26   ? 143 LYS A CA   5  
ATOM 10954 C C    . LYS A 1 143 ? -5.380  -3.063  12.637  1.00 1.47   ? 143 LYS A C    5  
ATOM 10955 O O    . LYS A 1 143 ? -4.198  -3.390  12.514  1.00 2.52   ? 143 LYS A O    5  
ATOM 10956 C CB   . LYS A 1 143 ? -6.997  -1.714  11.133  1.00 1.64   ? 143 LYS A CB   5  
ATOM 10957 C CG   . LYS A 1 143 ? -8.422  -1.790  11.719  1.00 1.71   ? 143 LYS A CG   5  
ATOM 10958 C CD   . LYS A 1 143 ? -9.380  -0.821  11.000  1.00 1.92   ? 143 LYS A CD   5  
ATOM 10959 C CE   . LYS A 1 143 ? -10.825 -1.035  11.473  1.00 2.41   ? 143 LYS A CE   5  
ATOM 10960 N NZ   . LYS A 1 143 ? -11.747 0.028   11.000  1.00 2.96   ? 143 LYS A NZ   5  
ATOM 10961 H H    . LYS A 1 143 ? -3.847  -1.313  11.568  1.00 1.26   ? 143 LYS A H    5  
ATOM 10962 H HA   . LYS A 1 143 ? -6.225  -1.117  13.069  1.00 1.17   ? 143 LYS A HA   5  
ATOM 10963 H HB2  . LYS A 1 143 ? -6.953  -0.825  10.511  1.00 1.86   ? 143 LYS A HB2  5  
ATOM 10964 H HB3  . LYS A 1 143 ? -6.832  -2.560  10.464  1.00 2.19   ? 143 LYS A HB3  5  
ATOM 10965 H HG2  . LYS A 1 143 ? -8.789  -2.814  11.624  1.00 2.12   ? 143 LYS A HG2  5  
ATOM 10966 H HG3  . LYS A 1 143 ? -8.409  -1.526  12.776  1.00 1.93   ? 143 LYS A HG3  5  
ATOM 10967 H HD2  . LYS A 1 143 ? -9.069  0.203   11.221  1.00 2.22   ? 143 LYS A HD2  5  
ATOM 10968 H HD3  . LYS A 1 143 ? -9.328  -0.983  9.921   1.00 2.26   ? 143 LYS A HD3  5  
ATOM 10969 H HE2  . LYS A 1 143 ? -11.170 -2.005  11.108  1.00 2.87   ? 143 LYS A HE2  5  
ATOM 10970 H HE3  . LYS A 1 143 ? -10.848 -1.061  12.566  1.00 2.83   ? 143 LYS A HE3  5  
ATOM 10971 H HZ1  . LYS A 1 143 ? -11.622 0.279   10.026  1.00 3.35   ? 143 LYS A HZ1  5  
ATOM 10972 H HZ2  . LYS A 1 143 ? -12.708 -0.280  11.127  1.00 3.24   ? 143 LYS A HZ2  5  
ATOM 10973 H HZ3  . LYS A 1 143 ? -11.648 0.880   11.548  1.00 3.67   ? 143 LYS A HZ3  5  
ATOM 10974 N N    . LYS A 1 144 ? -6.285  -3.899  13.165  1.00 1.76   ? 144 LYS A N    5  
ATOM 10975 C CA   . LYS A 1 144 ? -6.035  -5.296  13.593  1.00 1.99   ? 144 LYS A CA   5  
ATOM 10976 C C    . LYS A 1 144 ? -6.739  -6.329  12.675  1.00 2.25   ? 144 LYS A C    5  
ATOM 10977 O O    . LYS A 1 144 ? -7.897  -6.138  12.291  1.00 3.12   ? 144 LYS A O    5  
ATOM 10978 C CB   . LYS A 1 144 ? -6.408  -5.443  15.086  1.00 2.78   ? 144 LYS A CB   5  
ATOM 10979 C CG   . LYS A 1 144 ? -7.867  -5.084  15.443  1.00 3.74   ? 144 LYS A CG   5  
ATOM 10980 C CD   . LYS A 1 144 ? -8.058  -4.814  16.947  1.00 4.75   ? 144 LYS A CD   5  
ATOM 10981 C CE   . LYS A 1 144 ? -8.006  -6.058  17.836  1.00 5.59   ? 144 LYS A CE   5  
ATOM 10982 N NZ   . LYS A 1 144 ? -9.192  -6.920  17.646  1.00 6.25   ? 144 LYS A NZ   5  
ATOM 10983 H H    . LYS A 1 144 ? -7.229  -3.561  13.244  1.00 2.59   ? 144 LYS A H    5  
ATOM 10984 H HA   . LYS A 1 144 ? -4.966  -5.502  13.520  1.00 2.27   ? 144 LYS A HA   5  
ATOM 10985 H HB2  . LYS A 1 144 ? -6.210  -6.470  15.400  1.00 3.42   ? 144 LYS A HB2  5  
ATOM 10986 H HB3  . LYS A 1 144 ? -5.738  -4.794  15.654  1.00 2.98   ? 144 LYS A HB3  5  
ATOM 10987 H HG2  . LYS A 1 144 ? -8.160  -4.177  14.916  1.00 4.11   ? 144 LYS A HG2  5  
ATOM 10988 H HG3  . LYS A 1 144 ? -8.534  -5.882  15.115  1.00 4.22   ? 144 LYS A HG3  5  
ATOM 10989 H HD2  . LYS A 1 144 ? -7.279  -4.128  17.287  1.00 4.76   ? 144 LYS A HD2  5  
ATOM 10990 H HD3  . LYS A 1 144 ? -9.020  -4.318  17.098  1.00 5.65   ? 144 LYS A HD3  5  
ATOM 10991 H HE2  . LYS A 1 144 ? -7.095  -6.624  17.621  1.00 5.77   ? 144 LYS A HE2  5  
ATOM 10992 H HE3  . LYS A 1 144 ? -7.961  -5.736  18.880  1.00 6.11   ? 144 LYS A HE3  5  
ATOM 10993 H HZ1  . LYS A 1 144 ? -10.055 -6.399  17.724  1.00 6.72   ? 144 LYS A HZ1  5  
ATOM 10994 H HZ2  . LYS A 1 144 ? -9.139  -7.394  16.751  1.00 6.21   ? 144 LYS A HZ2  5  
ATOM 10995 H HZ3  . LYS A 1 144 ? -9.190  -7.639  18.370  1.00 6.92   ? 144 LYS A HZ3  5  
ATOM 10996 N N    . ASN A 1 145 ? -6.033  -7.396  12.279  1.00 2.20   ? 145 ASN A N    5  
ATOM 10997 C CA   . ASN A 1 145 ? -6.431  -8.301  11.179  1.00 2.84   ? 145 ASN A CA   5  
ATOM 10998 C C    . ASN A 1 145 ? -5.561  -9.575  11.047  1.00 2.68   ? 145 ASN A C    5  
ATOM 10999 O O    . ASN A 1 145 ? -5.696  -10.285 10.055  1.00 3.55   ? 145 ASN A O    5  
ATOM 11000 C CB   . ASN A 1 145 ? -6.455  -7.528  9.827   1.00 3.73   ? 145 ASN A CB   5  
ATOM 11001 C CG   . ASN A 1 145 ? -7.648  -7.879  8.926   1.00 4.79   ? 145 ASN A CG   5  
ATOM 11002 O OD1  . ASN A 1 145 ? -7.517  -8.268  7.771   1.00 5.28   ? 145 ASN A OD1  5  
ATOM 11003 N ND2  . ASN A 1 145 ? -8.844  -7.687  9.432   1.00 5.76   ? 145 ASN A ND2  5  
ATOM 11004 H H    . ASN A 1 145 ? -5.178  -7.604  12.781  1.00 2.28   ? 145 ASN A H    5  
ATOM 11005 H HA   . ASN A 1 145 ? -7.437  -8.648  11.406  1.00 3.59   ? 145 ASN A HA   5  
ATOM 11006 H HB2  . ASN A 1 145 ? -6.508  -6.456  10.005  1.00 4.02   ? 145 ASN A HB2  5  
ATOM 11007 H HB3  . ASN A 1 145 ? -5.528  -7.709  9.284   1.00 4.11   ? 145 ASN A HB3  5  
ATOM 11008 H HD21 . ASN A 1 145 ? -8.962  -7.360  10.379  1.00 5.93   ? 145 ASN A HD21 5  
ATOM 11009 H HD22 . ASN A 1 145 ? -9.653  -7.943  8.880   1.00 6.64   ? 145 ASN A HD22 5  
ATOM 11010 N N    . ILE A 1 146 ? -4.624  -9.830  11.977  1.00 2.31   ? 146 ILE A N    5  
ATOM 11011 C CA   . ILE A 1 146 ? -3.542  -10.842 11.869  1.00 2.69   ? 146 ILE A CA   5  
ATOM 11012 C C    . ILE A 1 146 ? -2.677  -10.962 13.140  1.00 3.01   ? 146 ILE A C    5  
ATOM 11013 O O    . ILE A 1 146 ? -2.509  -12.065 13.650  1.00 3.79   ? 146 ILE A O    5  
ATOM 11014 C CB   . ILE A 1 146 ? -2.678  -10.611 10.589  1.00 2.93   ? 146 ILE A CB   5  
ATOM 11015 C CG1  . ILE A 1 146 ? -1.606  -11.711 10.456  1.00 4.35   ? 146 ILE A CG1  5  
ATOM 11016 C CG2  . ILE A 1 146 ? -2.051  -9.201  10.522  1.00 3.69   ? 146 ILE A CG2  5  
ATOM 11017 C CD1  . ILE A 1 146 ? -0.863  -11.714 9.111   1.00 5.08   ? 146 ILE A CD1  5  
ATOM 11018 H H    . ILE A 1 146 ? -4.698  -9.330  12.865  1.00 2.52   ? 146 ILE A H    5  
ATOM 11019 H HA   . ILE A 1 146 ? -4.017  -11.820 11.756  1.00 3.24   ? 146 ILE A HA   5  
ATOM 11020 H HB   . ILE A 1 146 ? -3.325  -10.713 9.718   1.00 2.97   ? 146 ILE A HB   5  
ATOM 11021 H HG12 . ILE A 1 146 ? -0.874  -11.586 11.250  1.00 4.97   ? 146 ILE A HG12 5  
ATOM 11022 H HG13 . ILE A 1 146 ? -2.081  -12.686 10.578  1.00 5.08   ? 146 ILE A HG13 5  
ATOM 11023 H HG21 . ILE A 1 146 ? -1.644  -9.023  9.529   1.00 4.26   ? 146 ILE A HG21 5  
ATOM 11024 H HG22 . ILE A 1 146 ? -2.801  -8.432  10.711  1.00 4.30   ? 146 ILE A HG22 5  
ATOM 11025 H HG23 . ILE A 1 146 ? -1.244  -9.102  11.249  1.00 4.42   ? 146 ILE A HG23 5  
ATOM 11026 H HD11 . ILE A 1 146 ? -0.270  -10.806 9.001   1.00 5.44   ? 146 ILE A HD11 5  
ATOM 11027 H HD12 . ILE A 1 146 ? -0.188  -12.572 9.076   1.00 6.05   ? 146 ILE A HD12 5  
ATOM 11028 H HD13 . ILE A 1 146 ? -1.578  -11.790 8.291   1.00 5.02   ? 146 ILE A HD13 5  
ATOM 11029 N N    . GLU A 1 147 ? -2.154  -9.841  13.655  1.00 2.91   ? 147 GLU A N    5  
ATOM 11030 C CA   . GLU A 1 147 ? -1.353  -9.663  14.875  1.00 3.77   ? 147 GLU A CA   5  
ATOM 11031 C C    . GLU A 1 147 ? -0.223  -10.693 15.168  1.00 3.69   ? 147 GLU A C    5  
ATOM 11032 O O    . GLU A 1 147 ? 0.232   -10.863 16.303  1.00 4.82   ? 147 GLU A O    5  
ATOM 11033 C CB   . GLU A 1 147 ? -2.266  -9.253  16.047  1.00 5.13   ? 147 GLU A CB   5  
ATOM 11034 C CG   . GLU A 1 147 ? -3.567  -10.055 16.259  1.00 6.13   ? 147 GLU A CG   5  
ATOM 11035 C CD   . GLU A 1 147 ? -4.767  -9.615  15.395  1.00 7.29   ? 147 GLU A CD   5  
ATOM 11036 O OE1  . GLU A 1 147 ? -4.650  -8.726  14.511  1.00 7.91   ? 147 GLU A OE1  5  
ATOM 11037 O OE2  . GLU A 1 147 ? -5.871  -10.176 15.602  1.00 8.08   ? 147 GLU A OE2  5  
ATOM 11038 H H    . GLU A 1 147 ? -2.519  -8.976  13.298  1.00 2.63   ? 147 GLU A H    5  
ATOM 11039 H HA   . GLU A 1 147 ? -0.774  -8.761  14.674  1.00 4.79   ? 147 GLU A HA   5  
ATOM 11040 H HB2  . GLU A 1 147 ? -1.679  -9.302  16.951  1.00 6.18   ? 147 GLU A HB2  5  
ATOM 11041 H HB3  . GLU A 1 147 ? -2.531  -8.203  15.925  1.00 5.38   ? 147 GLU A HB3  5  
ATOM 11042 H HG2  . GLU A 1 147 ? -3.367  -11.114 16.095  1.00 5.92   ? 147 GLU A HG2  5  
ATOM 11043 H HG3  . GLU A 1 147 ? -3.859  -9.939  17.304  1.00 6.96   ? 147 GLU A HG3  5  
ATOM 11044 N N    . GLY A 1 148 ? 0.304   -11.321 14.113  1.00 3.58   ? 148 GLY A N    5  
ATOM 11045 C CA   . GLY A 1 148 ? 1.555   -12.088 14.074  1.00 5.06   ? 148 GLY A CA   5  
ATOM 11046 C C    . GLY A 1 148 ? 1.990   -12.296 12.625  1.00 6.54   ? 148 GLY A C    5  
ATOM 11047 O O    . GLY A 1 148 ? 1.210   -12.810 11.832  1.00 7.34   ? 148 GLY A O    5  
ATOM 11048 H H    . GLY A 1 148 ? -0.187  -11.218 13.237  1.00 3.28   ? 148 GLY A H    5  
ATOM 11049 H HA2  . GLY A 1 148 ? 2.328   -11.563 14.634  1.00 5.47   ? 148 GLY A HA2  5  
ATOM 11050 H HA3  . GLY A 1 148 ? 1.397   -13.061 14.533  1.00 5.65   ? 148 GLY A HA3  5  
ATOM 11051 N N    . ARG A 1 149 ? 3.200   -11.859 12.265  1.00 7.49   ? 149 ARG A N    5  
ATOM 11052 C CA   . ARG A 1 149 ? 3.668   -11.797 10.862  1.00 9.53   ? 149 ARG A CA   5  
ATOM 11053 C C    . ARG A 1 149 ? 4.295   -13.096 10.365  1.00 11.08  ? 149 ARG A C    5  
ATOM 11054 O O    . ARG A 1 149 ? 3.905   -13.502 9.228   1.00 12.31  ? 149 ARG A O    5  
ATOM 11055 C CB   . ARG A 1 149 ? 4.612   -10.588 10.684  1.00 10.16  ? 149 ARG A CB   5  
ATOM 11056 C CG   . ARG A 1 149 ? 5.000   -10.323 9.213   1.00 12.34  ? 149 ARG A CG   5  
ATOM 11057 C CD   . ARG A 1 149 ? 3.801   -9.885  8.357   1.00 13.31  ? 149 ARG A CD   5  
ATOM 11058 N NE   . ARG A 1 149 ? 4.057   -10.030 6.913   1.00 15.41  ? 149 ARG A NE   5  
ATOM 11059 C CZ   . ARG A 1 149 ? 3.838   -11.122 6.197   1.00 16.86  ? 149 ARG A CZ   5  
ATOM 11060 N NH1  . ARG A 1 149 ? 3.583   -12.286 6.717   1.00 16.71  ? 149 ARG A NH1  5  
ATOM 11061 N NH2  . ARG A 1 149 ? 3.910   -11.076 4.904   1.00 18.72  ? 149 ARG A NH2  5  
ATOM 11062 O OXT  . ARG A 1 149 ? 5.186   -13.630 11.041  1.00 11.41  ? 149 ARG A OXT  5  
ATOM 11063 H H    . ARG A 1 149 ? 3.853   -11.608 12.991  1.00 7.08   ? 149 ARG A H    5  
ATOM 11064 H HA   . ARG A 1 149 ? 2.787   -11.669 10.248  1.00 10.02  ? 149 ARG A HA   5  
ATOM 11065 H HB2  . ARG A 1 149 ? 4.128   -9.695  11.087  1.00 9.40   ? 149 ARG A HB2  5  
ATOM 11066 H HB3  . ARG A 1 149 ? 5.526   -10.776 11.253  1.00 10.20  ? 149 ARG A HB3  5  
ATOM 11067 H HG2  . ARG A 1 149 ? 5.750   -9.531  9.191   1.00 12.74  ? 149 ARG A HG2  5  
ATOM 11068 H HG3  . ARG A 1 149 ? 5.450   -11.223 8.788   1.00 13.20  ? 149 ARG A HG3  5  
ATOM 11069 H HD2  . ARG A 1 149 ? 2.920   -10.475 8.604   1.00 12.94  ? 149 ARG A HD2  5  
ATOM 11070 H HD3  . ARG A 1 149 ? 3.568   -8.842  8.587   1.00 13.15  ? 149 ARG A HD3  5  
ATOM 11071 H HE   . ARG A 1 149 ? 4.367   -9.217  6.410   1.00 15.92  ? 149 ARG A HE   5  
ATOM 11072 H HH11 . ARG A 1 149 ? 3.643   -12.461 7.716   1.00 15.44  ? 149 ARG A HH11 5  
ATOM 11073 H HH12 . ARG A 1 149 ? 3.513   -13.090 6.101   1.00 18.03  ? 149 ARG A HH12 5  
ATOM 11074 H HH21 . ARG A 1 149 ? 4.070   -10.209 4.395   1.00 19.10  ? 149 ARG A HH21 5  
ATOM 11075 H HH22 . ARG A 1 149 ? 3.730   -11.898 4.331   1.00 19.92  ? 149 ARG A HH22 5  
ATOM 11076 N N    . MET A 1 1   ? 72.663  28.220  6.729   1.00 100.06 ? 1   MET A N    6  
ATOM 11077 C CA   . MET A 1 1   ? 72.358  26.779  6.932   1.00 100.05 ? 1   MET A CA   6  
ATOM 11078 C C    . MET A 1 1   ? 70.983  26.616  7.576   1.00 98.47  ? 1   MET A C    6  
ATOM 11079 O O    . MET A 1 1   ? 70.674  27.361  8.499   1.00 98.19  ? 1   MET A O    6  
ATOM 11080 C CB   . MET A 1 1   ? 73.400  26.088  7.824   1.00 101.21 ? 1   MET A CB   6  
ATOM 11081 C CG   . MET A 1 1   ? 74.803  26.026  7.214   1.00 102.66 ? 1   MET A CG   6  
ATOM 11082 S SD   . MET A 1 1   ? 76.013  25.194  8.282   1.00 104.13 ? 1   MET A SD   6  
ATOM 11083 C CE   . MET A 1 1   ? 75.529  23.459  8.068   1.00 104.76 ? 1   MET A CE   6  
ATOM 11084 H H1   . MET A 1 1   ? 71.953  28.627  6.133   1.00 99.23  ? 1   MET A H1   6  
ATOM 11085 H H2   . MET A 1 1   ? 73.558  28.356  6.271   1.00 101.03 ? 1   MET A H2   6  
ATOM 11086 H H3   . MET A 1 1   ? 72.667  28.716  7.613   1.00 99.91  ? 1   MET A H3   6  
ATOM 11087 H HA   . MET A 1 1   ? 72.336  26.285  5.958   1.00 100.41 ? 1   MET A HA   6  
ATOM 11088 H HB2  . MET A 1 1   ? 73.458  26.604  8.785   1.00 101.06 ? 1   MET A HB2  6  
ATOM 11089 H HB3  . MET A 1 1   ? 73.066  25.069  8.015   1.00 101.22 ? 1   MET A HB3  6  
ATOM 11090 H HG2  . MET A 1 1   ? 74.760  25.505  6.257   1.00 102.73 ? 1   MET A HG2  6  
ATOM 11091 H HG3  . MET A 1 1   ? 75.154  27.043  7.037   1.00 102.78 ? 1   MET A HG3  6  
ATOM 11092 H HE1  . MET A 1 1   ? 74.526  23.301  8.467   1.00 104.26 ? 1   MET A HE1  6  
ATOM 11093 H HE2  . MET A 1 1   ? 75.546  23.204  7.007   1.00 104.79 ? 1   MET A HE2  6  
ATOM 11094 H HE3  . MET A 1 1   ? 76.232  22.822  8.605   1.00 105.66 ? 1   MET A HE3  6  
ATOM 11095 N N    . GLY A 1 2   ? 70.164  25.648  7.143   1.00 97.50  ? 2   GLY A N    6  
ATOM 11096 C CA   . GLY A 1 2   ? 68.806  25.461  7.672   1.00 95.95  ? 2   GLY A CA   6  
ATOM 11097 C C    . GLY A 1 2   ? 67.991  24.402  6.939   1.00 94.88  ? 2   GLY A C    6  
ATOM 11098 O O    . GLY A 1 2   ? 68.543  23.486  6.339   1.00 95.56  ? 2   GLY A O    6  
ATOM 11099 H H    . GLY A 1 2   ? 70.439  25.066  6.363   1.00 97.80  ? 2   GLY A H    6  
ATOM 11100 H HA2  . GLY A 1 2   ? 68.864  25.192  8.726   1.00 96.40  ? 2   GLY A HA2  6  
ATOM 11101 H HA3  . GLY A 1 2   ? 68.285  26.418  7.613   1.00 95.08  ? 2   GLY A HA3  6  
ATOM 11102 N N    . HIS A 1 3   ? 66.667  24.529  7.007   1.00 93.23  ? 3   HIS A N    6  
ATOM 11103 C CA   . HIS A 1 3   ? 65.634  23.713  6.341   1.00 91.89  ? 3   HIS A CA   6  
ATOM 11104 C C    . HIS A 1 3   ? 64.258  24.394  6.505   1.00 89.92  ? 3   HIS A C    6  
ATOM 11105 O O    . HIS A 1 3   ? 64.157  25.368  7.262   1.00 89.81  ? 3   HIS A O    6  
ATOM 11106 C CB   . HIS A 1 3   ? 65.620  22.263  6.872   1.00 92.48  ? 3   HIS A CB   6  
ATOM 11107 C CG   . HIS A 1 3   ? 66.110  21.282  5.837   1.00 92.92  ? 3   HIS A CG   6  
ATOM 11108 N ND1  . HIS A 1 3   ? 67.427  21.018  5.547   1.00 93.78  ? 3   HIS A ND1  6  
ATOM 11109 C CD2  . HIS A 1 3   ? 65.353  20.574  4.942   1.00 92.59  ? 3   HIS A CD2  6  
ATOM 11110 C CE1  . HIS A 1 3   ? 67.469  20.166  4.514   1.00 93.98  ? 3   HIS A CE1  6  
ATOM 11111 N NE2  . HIS A 1 3   ? 66.226  19.885  4.089   1.00 93.27  ? 3   HIS A NE2  6  
ATOM 11112 H H    . HIS A 1 3   ? 66.289  25.315  7.524   1.00 92.79  ? 3   HIS A H    6  
ATOM 11113 H HA   . HIS A 1 3   ? 65.842  23.691  5.270   1.00 91.90  ? 3   HIS A HA   6  
ATOM 11114 H HB2  . HIS A 1 3   ? 66.244  22.183  7.766   1.00 93.28  ? 3   HIS A HB2  6  
ATOM 11115 H HB3  . HIS A 1 3   ? 64.611  21.974  7.172   1.00 91.87  ? 3   HIS A HB3  6  
ATOM 11116 H HD1  . HIS A 1 3   ? 68.219  21.500  5.962   1.00 94.18  ? 3   HIS A HD1  6  
ATOM 11117 H HD2  . HIS A 1 3   ? 64.272  20.571  4.878   1.00 91.96  ? 3   HIS A HD2  6  
ATOM 11118 H HE1  . HIS A 1 3   ? 68.376  19.796  4.054   1.00 94.63  ? 3   HIS A HE1  6  
ATOM 11119 N N    . THR A 1 4   ? 63.217  23.901  5.814   1.00 88.44  ? 4   THR A N    6  
ATOM 11120 C CA   . THR A 1 4   ? 61.852  24.452  5.858   1.00 86.50  ? 4   THR A CA   6  
ATOM 11121 C C    . THR A 1 4   ? 60.796  23.377  5.625   1.00 85.34  ? 4   THR A C    6  
ATOM 11122 O O    . THR A 1 4   ? 61.133  22.227  5.355   1.00 85.90  ? 4   THR A O    6  
ATOM 11123 C CB   . THR A 1 4   ? 61.715  25.650  4.912   1.00 85.92  ? 4   THR A CB   6  
ATOM 11124 O OG1  . THR A 1 4   ? 60.590  26.390  5.313   1.00 84.52  ? 4   THR A OG1  6  
ATOM 11125 C CG2  . THR A 1 4   ? 61.575  25.291  3.431   1.00 85.73  ? 4   THR A CG2  6  
ATOM 11126 H H    . THR A 1 4   ? 63.341  23.063  5.265   1.00 88.67  ? 4   THR A H    6  
ATOM 11127 H HA   . THR A 1 4   ? 61.679  24.827  6.868   1.00 86.34  ? 4   THR A HA   6  
ATOM 11128 H HB   . THR A 1 4   ? 62.602  26.275  5.026   1.00 86.78  ? 4   THR A HB   6  
ATOM 11129 H HG1  . THR A 1 4   ? 60.898  27.302  5.441   1.00 84.64  ? 4   THR A HG1  6  
ATOM 11130 H HG21 . THR A 1 4   ? 62.421  24.679  3.113   1.00 86.54  ? 4   THR A HG21 6  
ATOM 11131 H HG22 . THR A 1 4   ? 60.650  24.743  3.262   1.00 85.01  ? 4   THR A HG22 6  
ATOM 11132 H HG23 . THR A 1 4   ? 61.555  26.205  2.840   1.00 85.58  ? 4   THR A HG23 6  
ATOM 11133 N N    . MET A 1 5   ? 59.533  23.764  5.776   1.00 83.76  ? 5   MET A N    6  
ATOM 11134 C CA   . MET A 1 5   ? 58.393  22.874  5.991   1.00 82.51  ? 5   MET A CA   6  
ATOM 11135 C C    . MET A 1 5   ? 57.474  22.737  4.761   1.00 80.96  ? 5   MET A C    6  
ATOM 11136 O O    . MET A 1 5   ? 57.317  23.704  4.001   1.00 80.45  ? 5   MET A O    6  
ATOM 11137 C CB   . MET A 1 5   ? 57.600  23.365  7.221   1.00 82.12  ? 5   MET A CB   6  
ATOM 11138 C CG   . MET A 1 5   ? 57.250  24.863  7.180   1.00 81.23  ? 5   MET A CG   6  
ATOM 11139 S SD   . MET A 1 5   ? 56.241  25.452  8.561   1.00 80.76  ? 5   MET A SD   6  
ATOM 11140 C CE   . MET A 1 5   ? 54.614  24.972  7.932   1.00 79.57  ? 5   MET A CE   6  
ATOM 11141 H H    . MET A 1 5   ? 59.377  24.761  5.848   1.00 83.43  ? 5   MET A H    6  
ATOM 11142 H HA   . MET A 1 5   ? 58.795  21.889  6.230   1.00 83.09  ? 5   MET A HA   6  
ATOM 11143 H HB2  . MET A 1 5   ? 56.683  22.784  7.312   1.00 82.02  ? 5   MET A HB2  6  
ATOM 11144 H HB3  . MET A 1 5   ? 58.197  23.180  8.114   1.00 82.67  ? 5   MET A HB3  6  
ATOM 11145 H HG2  . MET A 1 5   ? 58.174  25.441  7.197   1.00 81.56  ? 5   MET A HG2  6  
ATOM 11146 H HG3  . MET A 1 5   ? 56.729  25.092  6.251   1.00 80.61  ? 5   MET A HG3  6  
ATOM 11147 H HE1  . MET A 1 5   ? 54.450  25.437  6.957   1.00 79.25  ? 5   MET A HE1  6  
ATOM 11148 H HE2  . MET A 1 5   ? 54.554  23.890  7.832   1.00 79.76  ? 5   MET A HE2  6  
ATOM 11149 H HE3  . MET A 1 5   ? 53.842  25.318  8.619   1.00 79.01  ? 5   MET A HE3  6  
ATOM 11150 N N    . PRO A 1 6   ? 56.812  21.570  4.594   1.00 80.23  ? 6   PRO A N    6  
ATOM 11151 C CA   . PRO A 1 6   ? 55.601  21.402  3.792   1.00 78.53  ? 6   PRO A CA   6  
ATOM 11152 C C    . PRO A 1 6   ? 54.354  21.803  4.612   1.00 77.02  ? 6   PRO A C    6  
ATOM 11153 O O    . PRO A 1 6   ? 54.472  22.210  5.769   1.00 77.26  ? 6   PRO A O    6  
ATOM 11154 C CB   . PRO A 1 6   ? 55.596  19.909  3.439   1.00 78.69  ? 6   PRO A CB   6  
ATOM 11155 C CG   . PRO A 1 6   ? 56.138  19.270  4.719   1.00 79.78  ? 6   PRO A CG   6  
ATOM 11156 C CD   . PRO A 1 6   ? 57.152  20.298  5.227   1.00 81.03  ? 6   PRO A CD   6  
ATOM 11157 H HA   . PRO A 1 6   ? 55.649  21.998  2.880   1.00 78.37  ? 6   PRO A HA   6  
ATOM 11158 H HB2  . PRO A 1 6   ? 54.604  19.531  3.183   1.00 77.42  ? 6   PRO A HB2  6  
ATOM 11159 H HB3  . PRO A 1 6   ? 56.290  19.726  2.618   1.00 79.46  ? 6   PRO A HB3  6  
ATOM 11160 H HG2  . PRO A 1 6   ? 55.330  19.155  5.444   1.00 78.94  ? 6   PRO A HG2  6  
ATOM 11161 H HG3  . PRO A 1 6   ? 56.610  18.308  4.519   1.00 80.54  ? 6   PRO A HG3  6  
ATOM 11162 H HD2  . PRO A 1 6   ? 57.091  20.366  6.313   1.00 81.23  ? 6   PRO A HD2  6  
ATOM 11163 H HD3  . PRO A 1 6   ? 58.155  19.999  4.919   1.00 82.29  ? 6   PRO A HD3  6  
ATOM 11164 N N    . ALA A 1 7   ? 53.157  21.655  4.026   1.00 75.51  ? 7   ALA A N    6  
ATOM 11165 C CA   . ALA A 1 7   ? 51.864  22.004  4.625   1.00 73.90  ? 7   ALA A CA   6  
ATOM 11166 C C    . ALA A 1 7   ? 50.689  21.354  3.859   1.00 72.31  ? 7   ALA A C    6  
ATOM 11167 O O    . ALA A 1 7   ? 50.890  20.667  2.859   1.00 72.36  ? 7   ALA A O    6  
ATOM 11168 C CB   . ALA A 1 7   ? 51.743  23.541  4.678   1.00 73.45  ? 7   ALA A CB   6  
ATOM 11169 H H    . ALA A 1 7   ? 53.122  21.254  3.099   1.00 75.48  ? 7   ALA A H    6  
ATOM 11170 H HA   . ALA A 1 7   ? 51.842  21.617  5.645   1.00 74.25  ? 7   ALA A HA   6  
ATOM 11171 H HB1  . ALA A 1 7   ? 50.802  23.841  5.139   1.00 72.73  ? 7   ALA A HB1  6  
ATOM 11172 H HB2  . ALA A 1 7   ? 52.559  23.959  5.267   1.00 74.08  ? 7   ALA A HB2  6  
ATOM 11173 H HB3  . ALA A 1 7   ? 51.791  23.952  3.669   1.00 73.29  ? 7   ALA A HB3  6  
ATOM 11174 N N    . HIS A 1 8   ? 49.458  21.604  4.312   1.00 70.94  ? 8   HIS A N    6  
ATOM 11175 C CA   . HIS A 1 8   ? 48.213  21.286  3.602   1.00 69.26  ? 8   HIS A CA   6  
ATOM 11176 C C    . HIS A 1 8   ? 47.352  22.558  3.369   1.00 67.79  ? 8   HIS A C    6  
ATOM 11177 O O    . HIS A 1 8   ? 47.870  23.679  3.326   1.00 68.14  ? 8   HIS A O    6  
ATOM 11178 C CB   . HIS A 1 8   ? 47.481  20.136  4.337   1.00 69.34  ? 8   HIS A CB   6  
ATOM 11179 C CG   . HIS A 1 8   ? 46.901  20.464  5.701   1.00 68.84  ? 8   HIS A CG   6  
ATOM 11180 N ND1  . HIS A 1 8   ? 45.577  20.739  5.997   1.00 67.78  ? 8   HIS A ND1  6  
ATOM 11181 C CD2  . HIS A 1 8   ? 47.561  20.421  6.901   1.00 69.43  ? 8   HIS A CD2  6  
ATOM 11182 C CE1  . HIS A 1 8   ? 45.454  20.864  7.328   1.00 67.74  ? 8   HIS A CE1  6  
ATOM 11183 N NE2  . HIS A 1 8   ? 46.641  20.677  7.926   1.00 68.73  ? 8   HIS A NE2  6  
ATOM 11184 H H    . HIS A 1 8   ? 49.376  22.223  5.103   1.00 71.02  ? 8   HIS A H    6  
ATOM 11185 H HA   . HIS A 1 8   ? 48.461  20.911  2.604   1.00 69.09  ? 8   HIS A HA   6  
ATOM 11186 H HB2  . HIS A 1 8   ? 46.674  19.760  3.700   1.00 69.22  ? 8   HIS A HB2  6  
ATOM 11187 H HB3  . HIS A 1 8   ? 48.188  19.309  4.466   1.00 70.01  ? 8   HIS A HB3  6  
ATOM 11188 H HD1  . HIS A 1 8   ? 44.808  20.822  5.339   1.00 67.18  ? 8   HIS A HD1  6  
ATOM 11189 H HD2  . HIS A 1 8   ? 48.605  20.176  7.041   1.00 70.34  ? 8   HIS A HD2  6  
ATOM 11190 H HE1  . HIS A 1 8   ? 44.526  21.067  7.854   1.00 67.06  ? 8   HIS A HE1  6  
ATOM 11191 N N    . THR A 1 9   ? 46.037  22.372  3.205   1.00 66.19  ? 9   THR A N    6  
ATOM 11192 C CA   . THR A 1 9   ? 44.980  23.385  3.033   1.00 64.65  ? 9   THR A CA   6  
ATOM 11193 C C    . THR A 1 9   ? 43.758  22.940  3.865   1.00 63.28  ? 9   THR A C    6  
ATOM 11194 O O    . THR A 1 9   ? 43.677  21.731  4.130   1.00 63.40  ? 9   THR A O    6  
ATOM 11195 C CB   . THR A 1 9   ? 44.660  23.515  1.533   1.00 64.15  ? 9   THR A CB   6  
ATOM 11196 O OG1  . THR A 1 9   ? 43.821  24.620  1.329   1.00 63.10  ? 9   THR A OG1  6  
ATOM 11197 C CG2  . THR A 1 9   ? 43.975  22.289  0.919   1.00 63.46  ? 9   THR A CG2  6  
ATOM 11198 H H    . THR A 1 9   ? 45.699  21.421  3.278   1.00 66.06  ? 9   THR A H    6  
ATOM 11199 H HA   . THR A 1 9   ? 45.334  24.345  3.397   1.00 64.99  ? 9   THR A HA   6  
ATOM 11200 H HB   . THR A 1 9   ? 45.595  23.696  1.000   1.00 65.18  ? 9   THR A HB   6  
ATOM 11201 H HG1  . THR A 1 9   ? 43.871  24.885  0.403   1.00 63.12  ? 9   THR A HG1  6  
ATOM 11202 H HG21 . THR A 1 9   ? 44.565  21.394  1.103   1.00 64.13  ? 9   THR A HG21 6  
ATOM 11203 H HG22 . THR A 1 9   ? 42.979  22.160  1.347   1.00 62.58  ? 9   THR A HG22 6  
ATOM 11204 H HG23 . THR A 1 9   ? 43.881  22.429  -0.158  1.00 63.25  ? 9   THR A HG23 6  
ATOM 11205 N N    . PRO A 1 10  ? 42.850  23.828  4.331   1.00 62.12  ? 10  PRO A N    6  
ATOM 11206 C CA   . PRO A 1 10  ? 41.658  23.410  5.072   1.00 60.82  ? 10  PRO A CA   6  
ATOM 11207 C C    . PRO A 1 10  ? 40.638  22.682  4.172   1.00 59.34  ? 10  PRO A C    6  
ATOM 11208 O O    . PRO A 1 10  ? 40.589  22.961  2.974   1.00 58.92  ? 10  PRO A O    6  
ATOM 11209 C CB   . PRO A 1 10  ? 41.061  24.690  5.666   1.00 60.19  ? 10  PRO A CB   6  
ATOM 11210 C CG   . PRO A 1 10  ? 41.527  25.765  4.692   1.00 60.49  ? 10  PRO A CG   6  
ATOM 11211 C CD   . PRO A 1 10  ? 42.930  25.283  4.323   1.00 62.13  ? 10  PRO A CD   6  
ATOM 11212 H HA   . PRO A 1 10  ? 41.960  22.754  5.888   1.00 61.48  ? 10  PRO A HA   6  
ATOM 11213 H HB2  . PRO A 1 10  ? 39.974  24.651  5.738   1.00 58.85  ? 10  PRO A HB2  6  
ATOM 11214 H HB3  . PRO A 1 10  ? 41.493  24.876  6.651   1.00 61.07  ? 10  PRO A HB3  6  
ATOM 11215 H HG2  . PRO A 1 10  ? 40.890  25.766  3.808   1.00 59.43  ? 10  PRO A HG2  6  
ATOM 11216 H HG3  . PRO A 1 10  ? 41.537  26.752  5.152   1.00 60.70  ? 10  PRO A HG3  6  
ATOM 11217 H HD2  . PRO A 1 10  ? 43.213  25.688  3.356   1.00 62.16  ? 10  PRO A HD2  6  
ATOM 11218 H HD3  . PRO A 1 10  ? 43.641  25.610  5.088   1.00 63.27  ? 10  PRO A HD3  6  
ATOM 11219 N N    . PRO A 1 11  ? 39.808  21.771  4.727   1.00 58.57  ? 11  PRO A N    6  
ATOM 11220 C CA   . PRO A 1 11  ? 38.830  20.988  3.974   1.00 57.18  ? 11  PRO A CA   6  
ATOM 11221 C C    . PRO A 1 11  ? 37.515  21.748  3.732   1.00 55.47  ? 11  PRO A C    6  
ATOM 11222 O O    . PRO A 1 11  ? 37.056  22.523  4.575   1.00 55.21  ? 11  PRO A O    6  
ATOM 11223 C CB   . PRO A 1 11  ? 38.593  19.734  4.823   1.00 57.35  ? 11  PRO A CB   6  
ATOM 11224 C CG   . PRO A 1 11  ? 38.755  20.257  6.252   1.00 58.01  ? 11  PRO A CG   6  
ATOM 11225 C CD   . PRO A 1 11  ? 39.858  21.307  6.109   1.00 59.16  ? 11  PRO A CD   6  
ATOM 11226 H HA   . PRO A 1 11  ? 39.255  20.693  3.013   1.00 57.41  ? 11  PRO A HA   6  
ATOM 11227 H HB2  . PRO A 1 11  ? 37.603  19.302  4.659   1.00 56.16  ? 11  PRO A HB2  6  
ATOM 11228 H HB3  . PRO A 1 11  ? 39.374  19.000  4.614   1.00 58.34  ? 11  PRO A HB3  6  
ATOM 11229 H HG2  . PRO A 1 11  ? 37.829  20.737  6.580   1.00 56.98  ? 11  PRO A HG2  6  
ATOM 11230 H HG3  . PRO A 1 11  ? 39.042  19.463  6.943   1.00 58.76  ? 11  PRO A HG3  6  
ATOM 11231 H HD2  . PRO A 1 11  ? 39.692  22.127  6.809   1.00 59.15  ? 11  PRO A HD2  6  
ATOM 11232 H HD3  . PRO A 1 11  ? 40.825  20.841  6.301   1.00 60.46  ? 11  PRO A HD3  6  
ATOM 11233 N N    . ALA A 1 12  ? 36.876  21.475  2.589   1.00 54.35  ? 12  ALA A N    6  
ATOM 11234 C CA   . ALA A 1 12  ? 35.557  21.988  2.226   1.00 52.70  ? 12  ALA A CA   6  
ATOM 11235 C C    . ALA A 1 12  ? 34.451  20.949  2.474   1.00 51.41  ? 12  ALA A C    6  
ATOM 11236 O O    . ALA A 1 12  ? 34.692  19.743  2.523   1.00 51.87  ? 12  ALA A O    6  
ATOM 11237 C CB   . ALA A 1 12  ? 35.591  22.433  0.757   1.00 52.67  ? 12  ALA A CB   6  
ATOM 11238 H H    . ALA A 1 12  ? 37.285  20.794  1.967   1.00 54.68  ? 12  ALA A H    6  
ATOM 11239 H HA   . ALA A 1 12  ? 35.327  22.859  2.843   1.00 52.50  ? 12  ALA A HA   6  
ATOM 11240 H HB1  . ALA A 1 12  ? 36.394  23.156  0.608   1.00 53.28  ? 12  ALA A HB1  6  
ATOM 11241 H HB2  . ALA A 1 12  ? 35.760  21.573  0.110   1.00 53.09  ? 12  ALA A HB2  6  
ATOM 11242 H HB3  . ALA A 1 12  ? 34.642  22.897  0.482   1.00 51.69  ? 12  ALA A HB3  6  
ATOM 11243 N N    . GLN A 1 13  ? 33.212  21.429  2.564   1.00 49.82  ? 13  GLN A N    6  
ATOM 11244 C CA   . GLN A 1 13  ? 31.994  20.633  2.709   1.00 48.42  ? 13  GLN A CA   6  
ATOM 11245 C C    . GLN A 1 13  ? 30.993  21.029  1.609   1.00 47.06  ? 13  GLN A C    6  
ATOM 11246 O O    . GLN A 1 13  ? 31.242  21.982  0.867   1.00 47.21  ? 13  GLN A O    6  
ATOM 11247 C CB   . GLN A 1 13  ? 31.421  20.863  4.122   1.00 47.98  ? 13  GLN A CB   6  
ATOM 11248 C CG   . GLN A 1 13  ? 30.977  22.321  4.352   1.00 47.15  ? 13  GLN A CG   6  
ATOM 11249 C CD   . GLN A 1 13  ? 30.547  22.604  5.783   1.00 47.28  ? 13  GLN A CD   6  
ATOM 11250 O OE1  . GLN A 1 13  ? 29.985  21.770  6.480   1.00 47.24  ? 13  GLN A OE1  6  
ATOM 11251 N NE2  . GLN A 1 13  ? 30.784  23.808  6.257   1.00 47.53  ? 13  GLN A NE2  6  
ATOM 11252 H H    . GLN A 1 13  ? 33.075  22.419  2.413   1.00 49.58  ? 13  GLN A H    6  
ATOM 11253 H HA   . GLN A 1 13  ? 32.226  19.575  2.598   1.00 48.78  ? 13  GLN A HA   6  
ATOM 11254 H HB2  . GLN A 1 13  ? 30.568  20.198  4.278   1.00 47.60  ? 13  GLN A HB2  6  
ATOM 11255 H HB3  . GLN A 1 13  ? 32.187  20.601  4.856   1.00 48.76  ? 13  GLN A HB3  6  
ATOM 11256 H HG2  . GLN A 1 13  ? 31.802  22.992  4.106   1.00 47.39  ? 13  GLN A HG2  6  
ATOM 11257 H HG3  . GLN A 1 13  ? 30.141  22.559  3.693   1.00 46.27  ? 13  GLN A HG3  6  
ATOM 11258 H HE21 . GLN A 1 13  ? 31.241  24.498  5.683   1.00 47.65  ? 13  GLN A HE21 6  
ATOM 11259 H HE22 . GLN A 1 13  ? 30.423  24.048  7.166   1.00 47.61  ? 13  GLN A HE22 6  
ATOM 11260 N N    . THR A 1 14  ? 29.845  20.340  1.532   1.00 45.78  ? 14  THR A N    6  
ATOM 11261 C CA   . THR A 1 14  ? 28.709  20.718  0.678   1.00 44.32  ? 14  THR A CA   6  
ATOM 11262 C C    . THR A 1 14  ? 27.453  20.811  1.531   1.00 42.89  ? 14  THR A C    6  
ATOM 11263 O O    . THR A 1 14  ? 27.294  20.062  2.493   1.00 43.21  ? 14  THR A O    6  
ATOM 11264 C CB   . THR A 1 14  ? 28.545  19.737  -0.495  1.00 44.60  ? 14  THR A CB   6  
ATOM 11265 O OG1  . THR A 1 14  ? 27.524  20.198  -1.359  1.00 43.39  ? 14  THR A OG1  6  
ATOM 11266 C CG2  . THR A 1 14  ? 28.217  18.298  -0.076  1.00 44.95  ? 14  THR A CG2  6  
ATOM 11267 H H    . THR A 1 14  ? 29.671  19.606  2.209   1.00 45.78  ? 14  THR A H    6  
ATOM 11268 H HA   . THR A 1 14  ? 28.902  21.703  0.257   1.00 44.14  ? 14  THR A HA   6  
ATOM 11269 H HB   . THR A 1 14  ? 29.483  19.720  -1.054  1.00 45.64  ? 14  THR A HB   6  
ATOM 11270 H HG1  . THR A 1 14  ? 26.679  20.172  -0.885  1.00 42.89  ? 14  THR A HG1  6  
ATOM 11271 H HG21 . THR A 1 14  ? 27.251  18.254  0.431   1.00 44.16  ? 14  THR A HG21 6  
ATOM 11272 H HG22 . THR A 1 14  ? 28.189  17.665  -0.961  1.00 45.12  ? 14  THR A HG22 6  
ATOM 11273 H HG23 . THR A 1 14  ? 28.990  17.920  0.591   1.00 45.92  ? 14  THR A HG23 6  
ATOM 11274 N N    . ALA A 1 15  ? 26.538  21.691  1.144   1.00 41.40  ? 15  ALA A N    6  
ATOM 11275 C CA   . ALA A 1 15  ? 25.170  21.689  1.658   1.00 39.88  ? 15  ALA A CA   6  
ATOM 11276 C C    . ALA A 1 15  ? 24.308  20.623  0.936   1.00 38.87  ? 15  ALA A C    6  
ATOM 11277 O O    . ALA A 1 15  ? 24.602  20.311  -0.228  1.00 38.78  ? 15  ALA A O    6  
ATOM 11278 C CB   . ALA A 1 15  ? 24.587  23.097  1.478   1.00 39.01  ? 15  ALA A CB   6  
ATOM 11279 H H    . ALA A 1 15  ? 26.738  22.273  0.346   1.00 41.33  ? 15  ALA A H    6  
ATOM 11280 H HA   . ALA A 1 15  ? 25.197  21.460  2.725   1.00 40.24  ? 15  ALA A HA   6  
ATOM 11281 H HB1