data_2JR7
# 
_entry.id   2JR7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JR7         
RCSB  RCSB100187   
WWPDB D_1000100187 
BMRB  15377        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          15377 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JR7 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-06-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wu, F.'  1 
'Wu, J.'  2 
'Shi, Y.' 3 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of human DESR1, a CSL zinc-binding protein' 
_citation.journal_abbrev            Proteins 
_citation.journal_volume            71 
_citation.page_first                514 
_citation.page_last                 518 
_citation.year                      2008 
_citation.journal_id_ASTM           PSFGEY 
_citation.country                   US 
_citation.journal_id_ISSN           0887-3585 
_citation.journal_id_CSD            0867 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18214955 
_citation.pdbx_database_id_DOI      10.1002/prot.21915 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wu, F.'    1  ? 
primary 'Zhang, J.' 2  ? 
primary 'Sun, J.'   3  ? 
primary 'Huang, H.' 4  ? 
primary 'Ji, P.'    5  ? 
primary 'Chu, W.'   6  ? 
primary 'Yu, M.'    7  ? 
primary 'Yang, F.'  8  ? 
primary 'Wu, Z.'    9  ? 
primary 'Wu, J.'    10 ? 
primary 'Shi, Y.'   11 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DPH3 homolog' 10198.138 1 ? C66S ? ? 
2 non-polymer syn 'ZINC ION'     65.409    1 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'CSL-type zinc finger-containing protein 2, DelGEF- interacting protein 1, DelGIP1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVSGETVPAPSANKELV
KLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVSGETVPAPSANKELV
KLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  VAL n 
1 4  PHE n 
1 5  HIS n 
1 6  ASP n 
1 7  GLU n 
1 8  VAL n 
1 9  GLU n 
1 10 ILE n 
1 11 GLU n 
1 12 ASP n 
1 13 PHE n 
1 14 GLN n 
1 15 TYR n 
1 16 ASP n 
1 17 GLU n 
1 18 ASP n 
1 19 SER n 
1 20 GLU n 
1 21 THR n 
1 22 TYR n 
1 23 PHE n 
1 24 TYR n 
1 25 PRO n 
1 26 CYS n 
1 27 PRO n 
1 28 CYS n 
1 29 GLY n 
1 30 ASP n 
1 31 ASN n 
1 32 PHE n 
1 33 SER n 
1 34 ILE n 
1 35 THR n 
1 36 LYS n 
1 37 GLU n 
1 38 ASP n 
1 39 LEU n 
1 40 GLU n 
1 41 ASN n 
1 42 GLY n 
1 43 GLU n 
1 44 ASP n 
1 45 VAL n 
1 46 ALA n 
1 47 THR n 
1 48 CYS n 
1 49 PRO n 
1 50 SER n 
1 51 CYS n 
1 52 SER n 
1 53 LEU n 
1 54 ILE n 
1 55 ILE n 
1 56 LYS n 
1 57 VAL n 
1 58 ILE n 
1 59 TYR n 
1 60 ASP n 
1 61 LYS n 
1 62 ASP n 
1 63 GLN n 
1 64 PHE n 
1 65 VAL n 
1 66 SER n 
1 67 GLY n 
1 68 GLU n 
1 69 THR n 
1 70 VAL n 
1 71 PRO n 
1 72 ALA n 
1 73 PRO n 
1 74 SER n 
1 75 ALA n 
1 76 ASN n 
1 77 LYS n 
1 78 GLU n 
1 79 LEU n 
1 80 VAL n 
1 81 LYS n 
1 82 LEU n 
1 83 GLU n 
1 84 HIS n 
1 85 HIS n 
1 86 HIS n 
1 87 HIS n 
1 88 HIS n 
1 89 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'DPH3, DESR1, ZCSL2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)GOLD' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               'pET22b (+)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPH3_HUMAN 
_struct_ref.pdbx_db_accession          Q96FX2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFSITKEDLENGEDVATCPSCSLIIKVIYDKDQFVCGETVPAPSANKELV
K
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2JR7 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 81 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q96FX2 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  81 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       81 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JR7 SER A 66 ? UNP Q96FX2 CYS 66 ENGINEERED       66 1 
1 2JR7 LEU A 82 ? UNP Q96FX2 ?   ?  'expression tag' 82 2 
1 2JR7 GLU A 83 ? UNP Q96FX2 ?   ?  'expression tag' 83 3 
1 2JR7 HIS A 84 ? UNP Q96FX2 ?   ?  'expression tag' 84 4 
1 2JR7 HIS A 85 ? UNP Q96FX2 ?   ?  'expression tag' 85 5 
1 2JR7 HIS A 86 ? UNP Q96FX2 ?   ?  'expression tag' 86 6 
1 2JR7 HIS A 87 ? UNP Q96FX2 ?   ?  'expression tag' 87 7 
1 2JR7 HIS A 88 ? UNP Q96FX2 ?   ?  'expression tag' 88 8 
1 2JR7 HIS A 89 ? UNP Q96FX2 ?   ?  'expression tag' 89 9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 1H-15N NOESY' 
1 2 2 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1.5 mM [U-99% 13C; U-99% 15N] protein, 20 mM TRIS, 50 mM sodium chloride, 14 mM beta-mercaptoethanol, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 
'1.5 mM [U-99% 13C; U-99% 15N] protein, 20 mM TRIS, 50 mM sodium chloride, 14 mM beta-mercaptoethanol, 99.99% D2O'      2 
'99.99% D2O'      
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_pdbx_nmr_refine.entry_id           2JR7 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JR7 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JR7 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution' CNS     1.1  1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing           NMRPipe 2.2  2 
Goddard                                             'data analysis'      Sparky  3    3 
'David S. Wishart'                                  'data analysis'      CSI     1.0  4 
'Koradi, Billeter and Wuthrich'                     'data analysis'      MOLMOL  2K.2 5 
'Cornilescu, Delaglio and Bax'                      'data analysis'      TALOS   ?    6 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement           CNS     1.1  7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JR7 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2JR7 
_struct.title                     'Solution structure of human DESR1' 
_struct.pdbx_descriptor           'DPH3 homolog' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JR7 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'DESR1, CSL zinc finger, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 36 ? GLY A 42 ? LYS A 36 GLY A 42 1 ? 7 
HELX_P HELX_P2 2 ASP A 60 ? VAL A 65 ? ASP A 60 VAL A 65 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 26 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 26 A ZN 85 1_555 ? ? ? ? ? ? ? 2.418 ? 
metalc2 metalc ? ? A CYS 28 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 28 A ZN 85 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc3 metalc ? ? A CYS 48 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 48 A ZN 85 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc4 metalc ? ? A CYS 51 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 51 A ZN 85 1_555 ? ? ? ? ? ? ? 2.421 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 7  ? GLU A 9  ? GLU A 7  GLU A 9  
A 2 ILE A 54 ? ILE A 58 ? ILE A 54 ILE A 58 
A 3 VAL A 45 ? THR A 47 ? VAL A 45 THR A 47 
B 1 GLN A 14 ? TYR A 15 ? GLN A 14 TYR A 15 
B 2 THR A 21 ? PRO A 25 ? THR A 21 PRO A 25 
B 3 ASN A 31 ? THR A 35 ? ASN A 31 THR A 35 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 8  ? N VAL A 8  O LYS A 56 ? O LYS A 56 
A 2 3 O ILE A 55 ? O ILE A 55 N ALA A 46 ? N ALA A 46 
B 1 2 N GLN A 14 ? N GLN A 14 O PHE A 23 ? O PHE A 23 
B 2 3 N TYR A 22 ? N TYR A 22 O ILE A 34 ? O ILE A 34 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 85' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 26 ? CYS A 26 . ? 1_555 ? 
2 AC1 4 CYS A 28 ? CYS A 28 . ? 1_555 ? 
3 AC1 4 CYS A 48 ? CYS A 48 . ? 1_555 ? 
4 AC1 4 CYS A 51 ? CYS A 51 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2JR7 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1  ? 9.811   10.393  17.245  1.00 0.00 ? 1  MET A N    1  
ATOM   2     C  CA   . MET A 1 1  ? 10.027  9.268   16.294  1.00 0.00 ? 1  MET A CA   1  
ATOM   3     C  C    . MET A 1 1  ? 11.501  8.880   16.224  1.00 0.00 ? 1  MET A C    1  
ATOM   4     O  O    . MET A 1 1  ? 12.380  9.726   16.398  1.00 0.00 ? 1  MET A O    1  
ATOM   5     C  CB   . MET A 1 1  ? 9.526   9.689   14.908  1.00 0.00 ? 1  MET A CB   1  
ATOM   6     C  CG   . MET A 1 1  ? 8.046   9.423   14.687  1.00 0.00 ? 1  MET A CG   1  
ATOM   7     S  SD   . MET A 1 1  ? 6.998   10.746  15.320  1.00 0.00 ? 1  MET A SD   1  
ATOM   8     C  CE   . MET A 1 1  ? 5.694   9.799   16.101  1.00 0.00 ? 1  MET A CE   1  
ATOM   9     H  H1   . MET A 1 1  ? 10.154  11.265  16.792  1.00 0.00 ? 1  MET A H1   1  
ATOM   10    H  H2   . MET A 1 1  ? 10.351  10.184  18.112  1.00 0.00 ? 1  MET A H2   1  
ATOM   11    H  H3   . MET A 1 1  ? 8.793   10.453  17.443  1.00 0.00 ? 1  MET A H3   1  
ATOM   12    H  HA   . MET A 1 1  ? 9.454   8.416   16.635  1.00 0.00 ? 1  MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1  ? 9.703   10.747  14.780  1.00 0.00 ? 1  MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1  ? 10.083  9.148   14.156  1.00 0.00 ? 1  MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1  ? 7.866   9.317   13.627  1.00 0.00 ? 1  MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1  ? 7.783   8.501   15.187  1.00 0.00 ? 1  MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1  ? 4.980   10.472  16.551  1.00 0.00 ? 1  MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1  ? 6.118   9.162   16.864  1.00 0.00 ? 1  MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1  ? 5.197   9.191   15.359  1.00 0.00 ? 1  MET A HE3  1  
ATOM   20    N  N    . ALA A 1 2  ? 11.765  7.599   15.970  1.00 0.00 ? 2  ALA A N    1  
ATOM   21    C  CA   . ALA A 1 2  ? 13.136  7.101   15.878  1.00 0.00 ? 2  ALA A CA   1  
ATOM   22    C  C    . ALA A 1 2  ? 13.332  6.236   14.633  1.00 0.00 ? 2  ALA A C    1  
ATOM   23    O  O    . ALA A 1 2  ? 14.273  6.446   13.866  1.00 0.00 ? 2  ALA A O    1  
ATOM   24    C  CB   . ALA A 1 2  ? 13.502  6.325   17.135  1.00 0.00 ? 2  ALA A CB   1  
ATOM   25    H  H    . ALA A 1 2  ? 11.020  6.973   15.842  1.00 0.00 ? 2  ALA A H    1  
ATOM   26    H  HA   . ALA A 1 2  ? 13.794  7.956   15.812  1.00 0.00 ? 2  ALA A HA   1  
ATOM   27    H  HB1  . ALA A 1 2  ? 14.535  6.514   17.387  1.00 0.00 ? 2  ALA A HB1  1  
ATOM   28    H  HB2  . ALA A 1 2  ? 13.359  5.268   16.963  1.00 0.00 ? 2  ALA A HB2  1  
ATOM   29    H  HB3  . ALA A 1 2  ? 12.870  6.644   17.951  1.00 0.00 ? 2  ALA A HB3  1  
ATOM   30    N  N    . VAL A 1 3  ? 12.439  5.264   14.437  1.00 0.00 ? 3  VAL A N    1  
ATOM   31    C  CA   . VAL A 1 3  ? 12.516  4.369   13.287  1.00 0.00 ? 3  VAL A CA   1  
ATOM   32    C  C    . VAL A 1 3  ? 11.184  4.322   12.538  1.00 0.00 ? 3  VAL A C    1  
ATOM   33    O  O    . VAL A 1 3  ? 10.191  3.806   13.056  1.00 0.00 ? 3  VAL A O    1  
ATOM   34    C  CB   . VAL A 1 3  ? 12.925  2.938   13.707  1.00 0.00 ? 3  VAL A CB   1  
ATOM   35    C  CG1  . VAL A 1 3  ? 14.411  2.882   14.034  1.00 0.00 ? 3  VAL A CG1  1  
ATOM   36    C  CG2  . VAL A 1 3  ? 12.095  2.456   14.893  1.00 0.00 ? 3  VAL A CG2  1  
ATOM   37    H  H    . VAL A 1 3  ? 11.712  5.143   15.083  1.00 0.00 ? 3  VAL A H    1  
ATOM   38    H  HA   . VAL A 1 3  ? 13.274  4.754   12.620  1.00 0.00 ? 3  VAL A HA   1  
ATOM   39    H  HB   . VAL A 1 3  ? 12.739  2.275   12.873  1.00 0.00 ? 3  VAL A HB   1  
ATOM   40    H  HG11 . VAL A 1 3  ? 14.821  1.946   13.686  1.00 0.00 ? 3  VAL A HG11 1  
ATOM   41    H  HG12 . VAL A 1 3  ? 14.547  2.961   15.103  1.00 0.00 ? 3  VAL A HG12 1  
ATOM   42    H  HG13 . VAL A 1 3  ? 14.919  3.701   13.546  1.00 0.00 ? 3  VAL A HG13 1  
ATOM   43    H  HG21 . VAL A 1 3  ? 12.666  2.572   15.802  1.00 0.00 ? 3  VAL A HG21 1  
ATOM   44    H  HG22 . VAL A 1 3  ? 11.845  1.414   14.757  1.00 0.00 ? 3  VAL A HG22 1  
ATOM   45    H  HG23 . VAL A 1 3  ? 11.189  3.038   14.960  1.00 0.00 ? 3  VAL A HG23 1  
ATOM   46    N  N    . PHE A 1 4  ? 11.173  4.873   11.317  1.00 0.00 ? 4  PHE A N    1  
ATOM   47    C  CA   . PHE A 1 4  ? 9.970   4.907   10.485  1.00 0.00 ? 4  PHE A CA   1  
ATOM   48    C  C    . PHE A 1 4  ? 8.836   5.678   11.173  1.00 0.00 ? 4  PHE A C    1  
ATOM   49    O  O    . PHE A 1 4  ? 8.966   6.106   12.322  1.00 0.00 ? 4  PHE A O    1  
ATOM   50    C  CB   . PHE A 1 4  ? 9.520   3.479   10.163  1.00 0.00 ? 4  PHE A CB   1  
ATOM   51    C  CG   . PHE A 1 4  ? 9.773   3.058   8.741   1.00 0.00 ? 4  PHE A CG   1  
ATOM   52    C  CD1  . PHE A 1 4  ? 11.018  3.234   8.157   1.00 0.00 ? 4  PHE A CD1  1  
ATOM   53    C  CD2  . PHE A 1 4  ? 8.764   2.474   7.994   1.00 0.00 ? 4  PHE A CD2  1  
ATOM   54    C  CE1  . PHE A 1 4  ? 11.251  2.836   6.855   1.00 0.00 ? 4  PHE A CE1  1  
ATOM   55    C  CE2  . PHE A 1 4  ? 8.990   2.076   6.691   1.00 0.00 ? 4  PHE A CE2  1  
ATOM   56    C  CZ   . PHE A 1 4  ? 10.235  2.256   6.121   1.00 0.00 ? 4  PHE A CZ   1  
ATOM   57    H  H    . PHE A 1 4  ? 11.994  5.265   10.967  1.00 0.00 ? 4  PHE A H    1  
ATOM   58    H  HA   . PHE A 1 4  ? 10.218  5.411   9.564   1.00 0.00 ? 4  PHE A HA   1  
ATOM   59    H  HB2  . PHE A 1 4  ? 10.049  2.792   10.805  1.00 0.00 ? 4  PHE A HB2  1  
ATOM   60    H  HB3  . PHE A 1 4  ? 8.463   3.394   10.353  1.00 0.00 ? 4  PHE A HB3  1  
ATOM   61    H  HD1  . PHE A 1 4  ? 11.813  3.688   8.732   1.00 0.00 ? 4  PHE A HD1  1  
ATOM   62    H  HD2  . PHE A 1 4  ? 7.791   2.332   8.438   1.00 0.00 ? 4  PHE A HD2  1  
ATOM   63    H  HE1  . PHE A 1 4  ? 12.225  2.979   6.411   1.00 0.00 ? 4  PHE A HE1  1  
ATOM   64    H  HE2  . PHE A 1 4  ? 8.196   1.622   6.118   1.00 0.00 ? 4  PHE A HE2  1  
ATOM   65    H  HZ   . PHE A 1 4  ? 10.414  1.942   5.103   1.00 0.00 ? 4  PHE A HZ   1  
ATOM   66    N  N    . HIS A 1 5  ? 7.723   5.849   10.463  1.00 0.00 ? 5  HIS A N    1  
ATOM   67    C  CA   . HIS A 1 5  ? 6.570   6.559   11.009  1.00 0.00 ? 5  HIS A CA   1  
ATOM   68    C  C    . HIS A 1 5  ? 5.620   5.584   11.699  1.00 0.00 ? 5  HIS A C    1  
ATOM   69    O  O    . HIS A 1 5  ? 5.413   5.665   12.909  1.00 0.00 ? 5  HIS A O    1  
ATOM   70    C  CB   . HIS A 1 5  ? 5.828   7.317   9.903   1.00 0.00 ? 5  HIS A CB   1  
ATOM   71    C  CG   . HIS A 1 5  ? 4.736   8.207   10.411  1.00 0.00 ? 5  HIS A CG   1  
ATOM   72    N  ND1  . HIS A 1 5  ? 3.425   7.794   10.541  1.00 0.00 ? 5  HIS A ND1  1  
ATOM   73    C  CD2  . HIS A 1 5  ? 4.765   9.494   10.828  1.00 0.00 ? 5  HIS A CD2  1  
ATOM   74    C  CE1  . HIS A 1 5  ? 2.697   8.789   11.014  1.00 0.00 ? 5  HIS A CE1  1  
ATOM   75    N  NE2  . HIS A 1 5  ? 3.487   9.832   11.197  1.00 0.00 ? 5  HIS A NE2  1  
ATOM   76    H  H    . HIS A 1 5  ? 7.673   5.487   9.553   1.00 0.00 ? 5  HIS A H    1  
ATOM   77    H  HA   . HIS A 1 5  ? 6.931   7.267   11.741  1.00 0.00 ? 5  HIS A HA   1  
ATOM   78    H  HB2  . HIS A 1 5  ? 6.531   7.933   9.361   1.00 0.00 ? 5  HIS A HB2  1  
ATOM   79    H  HB3  . HIS A 1 5  ? 5.386   6.604   9.224   1.00 0.00 ? 5  HIS A HB3  1  
ATOM   80    H  HD1  . HIS A 1 5  ? 3.081   6.903   10.321  1.00 0.00 ? 5  HIS A HD1  1  
ATOM   81    H  HD2  . HIS A 1 5  ? 5.633   10.136  10.863  1.00 0.00 ? 5  HIS A HD2  1  
ATOM   82    H  HE1  . HIS A 1 5  ? 1.638   8.754   11.220  1.00 0.00 ? 5  HIS A HE1  1  
ATOM   83    H  HE2  . HIS A 1 5  ? 3.224   10.668  11.634  1.00 0.00 ? 5  HIS A HE2  1  
ATOM   84    N  N    . ASP A 1 6  ? 5.054   4.660   10.918  1.00 0.00 ? 6  ASP A N    1  
ATOM   85    C  CA   . ASP A 1 6  ? 4.127   3.659   11.445  1.00 0.00 ? 6  ASP A CA   1  
ATOM   86    C  C    . ASP A 1 6  ? 3.821   2.598   10.389  1.00 0.00 ? 6  ASP A C    1  
ATOM   87    O  O    . ASP A 1 6  ? 3.602   2.923   9.218   1.00 0.00 ? 6  ASP A O    1  
ATOM   88    C  CB   . ASP A 1 6  ? 2.821   4.321   11.903  1.00 0.00 ? 6  ASP A CB   1  
ATOM   89    C  CG   . ASP A 1 6  ? 2.801   4.618   13.392  1.00 0.00 ? 6  ASP A CG   1  
ATOM   90    O  OD1  . ASP A 1 6  ? 2.988   3.676   14.192  1.00 0.00 ? 6  ASP A OD1  1  
ATOM   91    O  OD2  . ASP A 1 6  ? 2.597   5.795   13.758  1.00 0.00 ? 6  ASP A OD2  1  
ATOM   92    H  H    . ASP A 1 6  ? 5.271   4.648   9.961   1.00 0.00 ? 6  ASP A H    1  
ATOM   93    H  HA   . ASP A 1 6  ? 4.599   3.185   12.291  1.00 0.00 ? 6  ASP A HA   1  
ATOM   94    H  HB2  . ASP A 1 6  ? 2.689   5.251   11.371  1.00 0.00 ? 6  ASP A HB2  1  
ATOM   95    H  HB3  . ASP A 1 6  ? 1.993   3.663   11.676  1.00 0.00 ? 6  ASP A HB3  1  
ATOM   96    N  N    . GLU A 1 7  ? 3.800   1.332   10.806  1.00 0.00 ? 7  GLU A N    1  
ATOM   97    C  CA   . GLU A 1 7  ? 3.512   0.227   9.892   1.00 0.00 ? 7  GLU A CA   1  
ATOM   98    C  C    . GLU A 1 7  ? 2.005   0.016   9.766   1.00 0.00 ? 7  GLU A C    1  
ATOM   99    O  O    . GLU A 1 7  ? 1.292   -0.026  10.770  1.00 0.00 ? 7  GLU A O    1  
ATOM   100   C  CB   . GLU A 1 7  ? 4.176   -1.069  10.371  1.00 0.00 ? 7  GLU A CB   1  
ATOM   101   C  CG   . GLU A 1 7  ? 5.631   -0.902  10.780  1.00 0.00 ? 7  GLU A CG   1  
ATOM   102   C  CD   . GLU A 1 7  ? 5.810   -0.790  12.281  1.00 0.00 ? 7  GLU A CD   1  
ATOM   103   O  OE1  . GLU A 1 7  ? 5.537   -1.782  12.989  1.00 0.00 ? 7  GLU A OE1  1  
ATOM   104   O  OE2  . GLU A 1 7  ? 6.222   0.292   12.749  1.00 0.00 ? 7  GLU A OE2  1  
ATOM   105   H  H    . GLU A 1 7  ? 3.979   1.136   11.751  1.00 0.00 ? 7  GLU A H    1  
ATOM   106   H  HA   . GLU A 1 7  ? 3.910   0.489   8.922   1.00 0.00 ? 7  GLU A HA   1  
ATOM   107   H  HB2  . GLU A 1 7  ? 3.628   -1.447  11.221  1.00 0.00 ? 7  GLU A HB2  1  
ATOM   108   H  HB3  . GLU A 1 7  ? 4.129   -1.797  9.574   1.00 0.00 ? 7  GLU A HB3  1  
ATOM   109   H  HG2  . GLU A 1 7  ? 6.190   -1.757  10.430  1.00 0.00 ? 7  GLU A HG2  1  
ATOM   110   H  HG3  . GLU A 1 7  ? 6.020   -0.006  10.318  1.00 0.00 ? 7  GLU A HG3  1  
ATOM   111   N  N    . VAL A 1 8  ? 1.524   -0.114  8.529   1.00 0.00 ? 8  VAL A N    1  
ATOM   112   C  CA   . VAL A 1 8  ? 0.101   -0.318  8.275   1.00 0.00 ? 8  VAL A CA   1  
ATOM   113   C  C    . VAL A 1 8  ? -0.128  -1.479  7.311   1.00 0.00 ? 8  VAL A C    1  
ATOM   114   O  O    . VAL A 1 8  ? 0.625   -1.662  6.352   1.00 0.00 ? 8  VAL A O    1  
ATOM   115   C  CB   . VAL A 1 8  ? -0.565  0.949   7.703   1.00 0.00 ? 8  VAL A CB   1  
ATOM   116   C  CG1  . VAL A 1 8  ? -2.078  0.782   7.663   1.00 0.00 ? 8  VAL A CG1  1  
ATOM   117   C  CG2  . VAL A 1 8  ? -0.180  2.178   8.516   1.00 0.00 ? 8  VAL A CG2  1  
ATOM   118   H  H    . VAL A 1 8  ? 2.142   -0.069  7.767   1.00 0.00 ? 8  VAL A H    1  
ATOM   119   H  HA   . VAL A 1 8  ? -0.373  -0.551  9.220   1.00 0.00 ? 8  VAL A HA   1  
ATOM   120   H  HB   . VAL A 1 8  ? -0.215  1.089   6.692   1.00 0.00 ? 8  VAL A HB   1  
ATOM   121   H  HG11 . VAL A 1 8  ? -2.550  1.726   7.885   1.00 0.00 ? 8  VAL A HG11 1  
ATOM   122   H  HG12 . VAL A 1 8  ? -2.379  0.048   8.396   1.00 0.00 ? 8  VAL A HG12 1  
ATOM   123   H  HG13 . VAL A 1 8  ? -2.376  0.451   6.679   1.00 0.00 ? 8  VAL A HG13 1  
ATOM   124   H  HG21 . VAL A 1 8  ? -1.012  2.865   8.546   1.00 0.00 ? 8  VAL A HG21 1  
ATOM   125   H  HG22 . VAL A 1 8  ? 0.670   2.661   8.058   1.00 0.00 ? 8  VAL A HG22 1  
ATOM   126   H  HG23 . VAL A 1 8  ? 0.076   1.880   9.523   1.00 0.00 ? 8  VAL A HG23 1  
ATOM   127   N  N    . GLU A 1 9  ? -1.176  -2.258  7.576   1.00 0.00 ? 9  GLU A N    1  
ATOM   128   C  CA   . GLU A 1 9  ? -1.523  -3.404  6.740   1.00 0.00 ? 9  GLU A CA   1  
ATOM   129   C  C    . GLU A 1 9  ? -1.980  -2.959  5.353   1.00 0.00 ? 9  GLU A C    1  
ATOM   130   O  O    . GLU A 1 9  ? -2.701  -1.968  5.212   1.00 0.00 ? 9  GLU A O    1  
ATOM   131   C  CB   . GLU A 1 9  ? -2.620  -4.239  7.406   1.00 0.00 ? 9  GLU A CB   1  
ATOM   132   C  CG   . GLU A 1 9  ? -2.098  -5.217  8.448   1.00 0.00 ? 9  GLU A CG   1  
ATOM   133   C  CD   . GLU A 1 9  ? -3.117  -6.283  8.809   1.00 0.00 ? 9  GLU A CD   1  
ATOM   134   O  OE1  . GLU A 1 9  ? -3.128  -7.341  8.147   1.00 0.00 ? 9  GLU A OE1  1  
ATOM   135   O  OE2  . GLU A 1 9  ? -3.901  -6.058  9.756   1.00 0.00 ? 9  GLU A OE2  1  
ATOM   136   H  H    . GLU A 1 9  ? -1.736  -2.053  8.355   1.00 0.00 ? 9  GLU A H    1  
ATOM   137   H  HA   . GLU A 1 9  ? -0.636  -4.012  6.634   1.00 0.00 ? 9  GLU A HA   1  
ATOM   138   H  HB2  . GLU A 1 9  ? -3.320  -3.572  7.889   1.00 0.00 ? 9  GLU A HB2  1  
ATOM   139   H  HB3  . GLU A 1 9  ? -3.141  -4.801  6.645   1.00 0.00 ? 9  GLU A HB3  1  
ATOM   140   H  HG2  . GLU A 1 9  ? -1.216  -5.703  8.058   1.00 0.00 ? 9  GLU A HG2  1  
ATOM   141   H  HG3  . GLU A 1 9  ? -1.840  -4.667  9.341   1.00 0.00 ? 9  GLU A HG3  1  
ATOM   142   N  N    . ILE A 1 10 ? -1.554  -3.703  4.333   1.00 0.00 ? 10 ILE A N    1  
ATOM   143   C  CA   . ILE A 1 10 ? -1.912  -3.406  2.947   1.00 0.00 ? 10 ILE A CA   1  
ATOM   144   C  C    . ILE A 1 10 ? -3.431  -3.365  2.753   1.00 0.00 ? 10 ILE A C    1  
ATOM   145   O  O    . ILE A 1 10 ? -3.929  -2.641  1.890   1.00 0.00 ? 10 ILE A O    1  
ATOM   146   C  CB   . ILE A 1 10 ? -1.292  -4.436  1.977   1.00 0.00 ? 10 ILE A CB   1  
ATOM   147   C  CG1  . ILE A 1 10 ? -1.502  -4.003  0.523   1.00 0.00 ? 10 ILE A CG1  1  
ATOM   148   C  CG2  . ILE A 1 10 ? -1.876  -5.826  2.213   1.00 0.00 ? 10 ILE A CG2  1  
ATOM   149   C  CD1  . ILE A 1 10 ? -0.284  -3.355  -0.097  1.00 0.00 ? 10 ILE A CD1  1  
ATOM   150   H  H    . ILE A 1 10 ? -0.983  -4.480  4.521   1.00 0.00 ? 10 ILE A H    1  
ATOM   151   H  HA   . ILE A 1 10 ? -1.508  -2.434  2.706   1.00 0.00 ? 10 ILE A HA   1  
ATOM   152   H  HB   . ILE A 1 10 ? -0.232  -4.485  2.177   1.00 0.00 ? 10 ILE A HB   1  
ATOM   153   H  HG12 . ILE A 1 10 ? -1.755  -4.867  -0.071  1.00 0.00 ? 10 ILE A HG12 1  
ATOM   154   H  HG13 . ILE A 1 10 ? -2.314  -3.292  0.479   1.00 0.00 ? 10 ILE A HG13 1  
ATOM   155   H  HG21 . ILE A 1 10 ? -1.143  -6.573  1.949   1.00 0.00 ? 10 ILE A HG21 1  
ATOM   156   H  HG22 . ILE A 1 10 ? -2.757  -5.956  1.603   1.00 0.00 ? 10 ILE A HG22 1  
ATOM   157   H  HG23 . ILE A 1 10 ? -2.141  -5.934  3.255   1.00 0.00 ? 10 ILE A HG23 1  
ATOM   158   H  HD11 . ILE A 1 10 ? -0.222  -3.630  -1.140  1.00 0.00 ? 10 ILE A HD11 1  
ATOM   159   H  HD12 . ILE A 1 10 ? 0.605   -3.691  0.415   1.00 0.00 ? 10 ILE A HD12 1  
ATOM   160   H  HD13 . ILE A 1 10 ? -0.364  -2.282  -0.012  1.00 0.00 ? 10 ILE A HD13 1  
ATOM   161   N  N    . GLU A 1 11 ? -4.163  -4.132  3.566   1.00 0.00 ? 11 GLU A N    1  
ATOM   162   C  CA   . GLU A 1 11 ? -5.622  -4.162  3.485   1.00 0.00 ? 11 GLU A CA   1  
ATOM   163   C  C    . GLU A 1 11 ? -6.205  -2.765  3.713   1.00 0.00 ? 11 GLU A C    1  
ATOM   164   O  O    . GLU A 1 11 ? -7.230  -2.410  3.132   1.00 0.00 ? 11 GLU A O    1  
ATOM   165   C  CB   . GLU A 1 11 ? -6.190  -5.145  4.509   1.00 0.00 ? 11 GLU A CB   1  
ATOM   166   C  CG   . GLU A 1 11 ? -5.870  -6.598  4.193   1.00 0.00 ? 11 GLU A CG   1  
ATOM   167   C  CD   . GLU A 1 11 ? -6.374  -7.554  5.254   1.00 0.00 ? 11 GLU A CD   1  
ATOM   168   O  OE1  . GLU A 1 11 ? -5.679  -7.726  6.277   1.00 0.00 ? 11 GLU A OE1  1  
ATOM   169   O  OE2  . GLU A 1 11 ? -7.463  -8.135  5.062   1.00 0.00 ? 11 GLU A OE2  1  
ATOM   170   H  H    . GLU A 1 11 ? -3.712  -4.683  4.241   1.00 0.00 ? 11 GLU A H    1  
ATOM   171   H  HA   . GLU A 1 11 ? -5.892  -4.492  2.492   1.00 0.00 ? 11 GLU A HA   1  
ATOM   172   H  HB2  . GLU A 1 11 ? -5.782  -4.911  5.481   1.00 0.00 ? 11 GLU A HB2  1  
ATOM   173   H  HB3  . GLU A 1 11 ? -7.263  -5.033  4.541   1.00 0.00 ? 11 GLU A HB3  1  
ATOM   174   H  HG2  . GLU A 1 11 ? -6.330  -6.857  3.251   1.00 0.00 ? 11 GLU A HG2  1  
ATOM   175   H  HG3  . GLU A 1 11 ? -4.798  -6.707  4.111   1.00 0.00 ? 11 GLU A HG3  1  
ATOM   176   N  N    . ASP A 1 12 ? -5.531  -1.974  4.552   1.00 0.00 ? 12 ASP A N    1  
ATOM   177   C  CA   . ASP A 1 12 ? -5.964  -0.611  4.844   1.00 0.00 ? 12 ASP A CA   1  
ATOM   178   C  C    . ASP A 1 12 ? -5.695  0.311   3.653   1.00 0.00 ? 12 ASP A C    1  
ATOM   179   O  O    . ASP A 1 12 ? -6.450  1.252   3.403   1.00 0.00 ? 12 ASP A O    1  
ATOM   180   C  CB   . ASP A 1 12 ? -5.244  -0.081  6.086   1.00 0.00 ? 12 ASP A CB   1  
ATOM   181   C  CG   . ASP A 1 12 ? -6.038  0.993   6.802   1.00 0.00 ? 12 ASP A CG   1  
ATOM   182   O  OD1  . ASP A 1 12 ? -6.169  2.106   6.249   1.00 0.00 ? 12 ASP A OD1  1  
ATOM   183   O  OD2  . ASP A 1 12 ? -6.528  0.723   7.918   1.00 0.00 ? 12 ASP A OD2  1  
ATOM   184   H  H    . ASP A 1 12 ? -4.714  -2.314  4.976   1.00 0.00 ? 12 ASP A H    1  
ATOM   185   H  HA   . ASP A 1 12 ? -7.027  -0.634  5.036   1.00 0.00 ? 12 ASP A HA   1  
ATOM   186   H  HB2  . ASP A 1 12 ? -5.076  -0.897  6.774   1.00 0.00 ? 12 ASP A HB2  1  
ATOM   187   H  HB3  . ASP A 1 12 ? -4.292  0.336   5.793   1.00 0.00 ? 12 ASP A HB3  1  
ATOM   188   N  N    . PHE A 1 13 ? -4.613  0.030   2.921   1.00 0.00 ? 13 PHE A N    1  
ATOM   189   C  CA   . PHE A 1 13 ? -4.232  0.826   1.752   1.00 0.00 ? 13 PHE A CA   1  
ATOM   190   C  C    . PHE A 1 13 ? -5.315  0.784   0.669   1.00 0.00 ? 13 PHE A C    1  
ATOM   191   O  O    . PHE A 1 13 ? -6.284  0.025   0.768   1.00 0.00 ? 13 PHE A O    1  
ATOM   192   C  CB   . PHE A 1 13 ? -2.912  0.309   1.170   1.00 0.00 ? 13 PHE A CB   1  
ATOM   193   C  CG   . PHE A 1 13 ? -1.683  0.923   1.783   1.00 0.00 ? 13 PHE A CG   1  
ATOM   194   C  CD1  . PHE A 1 13 ? -1.388  0.739   3.126   1.00 0.00 ? 13 PHE A CD1  1  
ATOM   195   C  CD2  . PHE A 1 13 ? -0.814  1.673   1.007   1.00 0.00 ? 13 PHE A CD2  1  
ATOM   196   C  CE1  . PHE A 1 13 ? -0.252  1.296   3.681   1.00 0.00 ? 13 PHE A CE1  1  
ATOM   197   C  CE2  . PHE A 1 13 ? 0.323   2.229   1.556   1.00 0.00 ? 13 PHE A CE2  1  
ATOM   198   C  CZ   . PHE A 1 13 ? 0.605   2.041   2.895   1.00 0.00 ? 13 PHE A CZ   1  
ATOM   199   H  H    . PHE A 1 13 ? -4.054  -0.734  3.176   1.00 0.00 ? 13 PHE A H    1  
ATOM   200   H  HA   . PHE A 1 13 ? -4.098  1.847   2.076   1.00 0.00 ? 13 PHE A HA   1  
ATOM   201   H  HB2  . PHE A 1 13 ? -2.855  -0.759  1.320   1.00 0.00 ? 13 PHE A HB2  1  
ATOM   202   H  HB3  . PHE A 1 13 ? -2.893  0.517   0.111   1.00 0.00 ? 13 PHE A HB3  1  
ATOM   203   H  HD1  . PHE A 1 13 ? -2.059  0.158   3.741   1.00 0.00 ? 13 PHE A HD1  1  
ATOM   204   H  HD2  . PHE A 1 13 ? -1.034  1.823   -0.040  1.00 0.00 ? 13 PHE A HD2  1  
ATOM   205   H  HE1  . PHE A 1 13 ? -0.034  1.148   4.728   1.00 0.00 ? 13 PHE A HE1  1  
ATOM   206   H  HE2  . PHE A 1 13 ? 0.992   2.812   0.940   1.00 0.00 ? 13 PHE A HE2  1  
ATOM   207   H  HZ   . PHE A 1 13 ? 1.495   2.475   3.326   1.00 0.00 ? 13 PHE A HZ   1  
ATOM   208   N  N    . GLN A 1 14 ? -5.138  1.603   -0.371  1.00 0.00 ? 14 GLN A N    1  
ATOM   209   C  CA   . GLN A 1 14 ? -6.091  1.663   -1.478  1.00 0.00 ? 14 GLN A CA   1  
ATOM   210   C  C    . GLN A 1 14 ? -5.477  1.098   -2.757  1.00 0.00 ? 14 GLN A C    1  
ATOM   211   O  O    . GLN A 1 14 ? -4.614  1.732   -3.370  1.00 0.00 ? 14 GLN A O    1  
ATOM   212   C  CB   . GLN A 1 14 ? -6.542  3.108   -1.716  1.00 0.00 ? 14 GLN A CB   1  
ATOM   213   C  CG   . GLN A 1 14 ? -7.959  3.227   -2.262  1.00 0.00 ? 14 GLN A CG   1  
ATOM   214   C  CD   . GLN A 1 14 ? -8.114  4.367   -3.253  1.00 0.00 ? 14 GLN A CD   1  
ATOM   215   O  OE1  . GLN A 1 14 ? -8.526  4.160   -4.394  1.00 0.00 ? 14 GLN A OE1  1  
ATOM   216   N  NE2  . GLN A 1 14 ? -7.786  5.582   -2.822  1.00 0.00 ? 14 GLN A NE2  1  
ATOM   217   H  H    . GLN A 1 14 ? -4.346  2.179   -0.395  1.00 0.00 ? 14 GLN A H    1  
ATOM   218   H  HA   . GLN A 1 14 ? -6.950  1.067   -1.209  1.00 0.00 ? 14 GLN A HA   1  
ATOM   219   H  HB2  . GLN A 1 14 ? -6.492  3.647   -0.782  1.00 0.00 ? 14 GLN A HB2  1  
ATOM   220   H  HB3  . GLN A 1 14 ? -5.867  3.569   -2.423  1.00 0.00 ? 14 GLN A HB3  1  
ATOM   221   H  HG2  . GLN A 1 14 ? -8.220  2.304   -2.758  1.00 0.00 ? 14 GLN A HG2  1  
ATOM   222   H  HG3  . GLN A 1 14 ? -8.634  3.396   -1.437  1.00 0.00 ? 14 GLN A HG3  1  
ATOM   223   H  HE21 . GLN A 1 14 ? -7.466  5.678   -1.901  1.00 0.00 ? 14 GLN A HE21 1  
ATOM   224   H  HE22 . GLN A 1 14 ? -7.879  6.333   -3.445  1.00 0.00 ? 14 GLN A HE22 1  
ATOM   225   N  N    . TYR A 1 15 ? -5.927  -0.091  -3.162  1.00 0.00 ? 15 TYR A N    1  
ATOM   226   C  CA   . TYR A 1 15 ? -5.419  -0.726  -4.377  1.00 0.00 ? 15 TYR A CA   1  
ATOM   227   C  C    . TYR A 1 15 ? -5.795  0.094   -5.611  1.00 0.00 ? 15 TYR A C    1  
ATOM   228   O  O    . TYR A 1 15 ? -6.938  0.536   -5.749  1.00 0.00 ? 15 TYR A O    1  
ATOM   229   C  CB   . TYR A 1 15 ? -5.958  -2.156  -4.511  1.00 0.00 ? 15 TYR A CB   1  
ATOM   230   C  CG   . TYR A 1 15 ? -5.482  -2.873  -5.761  1.00 0.00 ? 15 TYR A CG   1  
ATOM   231   C  CD1  . TYR A 1 15 ? -4.136  -3.163  -5.952  1.00 0.00 ? 15 TYR A CD1  1  
ATOM   232   C  CD2  . TYR A 1 15 ? -6.380  -3.256  -6.750  1.00 0.00 ? 15 TYR A CD2  1  
ATOM   233   C  CE1  . TYR A 1 15 ? -3.700  -3.816  -7.089  1.00 0.00 ? 15 TYR A CE1  1  
ATOM   234   C  CE2  . TYR A 1 15 ? -5.952  -3.909  -7.890  1.00 0.00 ? 15 TYR A CE2  1  
ATOM   235   C  CZ   . TYR A 1 15 ? -4.611  -4.187  -8.055  1.00 0.00 ? 15 TYR A CZ   1  
ATOM   236   O  OH   . TYR A 1 15 ? -4.179  -4.837  -9.189  1.00 0.00 ? 15 TYR A OH   1  
ATOM   237   H  H    . TYR A 1 15 ? -6.618  -0.547  -2.636  1.00 0.00 ? 15 TYR A H    1  
ATOM   238   H  HA   . TYR A 1 15 ? -4.342  -0.763  -4.300  1.00 0.00 ? 15 TYR A HA   1  
ATOM   239   H  HB2  . TYR A 1 15 ? -5.639  -2.734  -3.658  1.00 0.00 ? 15 TYR A HB2  1  
ATOM   240   H  HB3  . TYR A 1 15 ? -7.038  -2.125  -4.536  1.00 0.00 ? 15 TYR A HB3  1  
ATOM   241   H  HD1  . TYR A 1 15 ? -3.424  -2.872  -5.195  1.00 0.00 ? 15 TYR A HD1  1  
ATOM   242   H  HD2  . TYR A 1 15 ? -7.430  -3.038  -6.620  1.00 0.00 ? 15 TYR A HD2  1  
ATOM   243   H  HE1  . TYR A 1 15 ? -2.649  -4.033  -7.217  1.00 0.00 ? 15 TYR A HE1  1  
ATOM   244   H  HE2  . TYR A 1 15 ? -6.667  -4.198  -8.647  1.00 0.00 ? 15 TYR A HE2  1  
ATOM   245   H  HH   . TYR A 1 15 ? -4.521  -5.734  -9.199  1.00 0.00 ? 15 TYR A HH   1  
ATOM   246   N  N    . ASP A 1 16 ? -4.826  0.291   -6.503  1.00 0.00 ? 16 ASP A N    1  
ATOM   247   C  CA   . ASP A 1 16 ? -5.044  1.053   -7.726  1.00 0.00 ? 16 ASP A CA   1  
ATOM   248   C  C    . ASP A 1 16 ? -5.003  0.134   -8.942  1.00 0.00 ? 16 ASP A C    1  
ATOM   249   O  O    . ASP A 1 16 ? -3.930  -0.211  -9.433  1.00 0.00 ? 16 ASP A O    1  
ATOM   250   C  CB   . ASP A 1 16 ? -3.989  2.159   -7.863  1.00 0.00 ? 16 ASP A CB   1  
ATOM   251   C  CG   . ASP A 1 16 ? -4.490  3.366   -8.638  1.00 0.00 ? 16 ASP A CG   1  
ATOM   252   O  OD1  . ASP A 1 16 ? -5.254  3.179   -9.609  1.00 0.00 ? 16 ASP A OD1  1  
ATOM   253   O  OD2  . ASP A 1 16 ? -4.114  4.499   -8.277  1.00 0.00 ? 16 ASP A OD2  1  
ATOM   254   H  H    . ASP A 1 16 ? -3.938  -0.089  -6.334  1.00 0.00 ? 16 ASP A H    1  
ATOM   255   H  HA   . ASP A 1 16 ? -6.022  1.507   -7.665  1.00 0.00 ? 16 ASP A HA   1  
ATOM   256   H  HB2  . ASP A 1 16 ? -3.695  2.489   -6.878  1.00 0.00 ? 16 ASP A HB2  1  
ATOM   257   H  HB3  . ASP A 1 16 ? -3.124  1.762   -8.374  1.00 0.00 ? 16 ASP A HB3  1  
ATOM   258   N  N    . GLU A 1 17 ? -6.182  -0.261  -9.422  1.00 0.00 ? 17 GLU A N    1  
ATOM   259   C  CA   . GLU A 1 17 ? -6.287  -1.143  -10.588 1.00 0.00 ? 17 GLU A CA   1  
ATOM   260   C  C    . GLU A 1 17 ? -5.625  -0.529  -11.826 1.00 0.00 ? 17 GLU A C    1  
ATOM   261   O  O    . GLU A 1 17 ? -5.190  -1.253  -12.723 1.00 0.00 ? 17 GLU A O    1  
ATOM   262   C  CB   . GLU A 1 17 ? -7.755  -1.459  -10.898 1.00 0.00 ? 17 GLU A CB   1  
ATOM   263   C  CG   . GLU A 1 17 ? -8.684  -0.256  -10.796 1.00 0.00 ? 17 GLU A CG   1  
ATOM   264   C  CD   . GLU A 1 17 ? -9.862  -0.345  -11.748 1.00 0.00 ? 17 GLU A CD   1  
ATOM   265   O  OE1  . GLU A 1 17 ? -9.668  -0.107  -12.959 1.00 0.00 ? 17 GLU A OE1  1  
ATOM   266   O  OE2  . GLU A 1 17 ? -10.981 -0.648  -11.281 1.00 0.00 ? 17 GLU A OE2  1  
ATOM   267   H  H    . GLU A 1 17 ? -7.001  0.049   -8.982  1.00 0.00 ? 17 GLU A H    1  
ATOM   268   H  HA   . GLU A 1 17 ? -5.778  -2.065  -10.348 1.00 0.00 ? 17 GLU A HA   1  
ATOM   269   H  HB2  . GLU A 1 17 ? -7.817  -1.848  -11.905 1.00 0.00 ? 17 GLU A HB2  1  
ATOM   270   H  HB3  . GLU A 1 17 ? -8.100  -2.216  -10.209 1.00 0.00 ? 17 GLU A HB3  1  
ATOM   271   H  HG2  . GLU A 1 17 ? -9.063  -0.197  -9.787  1.00 0.00 ? 17 GLU A HG2  1  
ATOM   272   H  HG3  . GLU A 1 17 ? -8.123  0.639   -11.022 1.00 0.00 ? 17 GLU A HG3  1  
ATOM   273   N  N    . ASP A 1 18 ? -5.564  0.807   -11.870 1.00 0.00 ? 18 ASP A N    1  
ATOM   274   C  CA   . ASP A 1 18 ? -4.967  1.527   -12.996 1.00 0.00 ? 18 ASP A CA   1  
ATOM   275   C  C    . ASP A 1 18 ? -3.594  0.964   -13.369 1.00 0.00 ? 18 ASP A C    1  
ATOM   276   O  O    . ASP A 1 18 ? -3.337  0.668   -14.536 1.00 0.00 ? 18 ASP A O    1  
ATOM   277   C  CB   . ASP A 1 18 ? -4.840  3.017   -12.669 1.00 0.00 ? 18 ASP A CB   1  
ATOM   278   C  CG   . ASP A 1 18 ? -4.745  3.877   -13.915 1.00 0.00 ? 18 ASP A CG   1  
ATOM   279   O  OD1  . ASP A 1 18 ? -3.626  4.034   -14.445 1.00 0.00 ? 18 ASP A OD1  1  
ATOM   280   O  OD2  . ASP A 1 18 ? -5.793  4.389   -14.364 1.00 0.00 ? 18 ASP A OD2  1  
ATOM   281   H  H    . ASP A 1 18 ? -5.938  1.323   -11.126 1.00 0.00 ? 18 ASP A H    1  
ATOM   282   H  HA   . ASP A 1 18 ? -5.628  1.414   -13.843 1.00 0.00 ? 18 ASP A HA   1  
ATOM   283   H  HB2  . ASP A 1 18 ? -5.705  3.331   -12.102 1.00 0.00 ? 18 ASP A HB2  1  
ATOM   284   H  HB3  . ASP A 1 18 ? -3.950  3.174   -12.076 1.00 0.00 ? 18 ASP A HB3  1  
ATOM   285   N  N    . SER A 1 19 ? -2.716  0.825   -12.374 1.00 0.00 ? 19 SER A N    1  
ATOM   286   C  CA   . SER A 1 19 ? -1.369  0.302   -12.610 1.00 0.00 ? 19 SER A CA   1  
ATOM   287   C  C    . SER A 1 19 ? -0.842  -0.461  -11.387 1.00 0.00 ? 19 SER A C    1  
ATOM   288   O  O    . SER A 1 19 ? 0.362   -0.462  -11.119 1.00 0.00 ? 19 SER A O    1  
ATOM   289   C  CB   . SER A 1 19 ? -0.424  1.454   -12.973 1.00 0.00 ? 19 SER A CB   1  
ATOM   290   O  OG   . SER A 1 19 ? 0.841   0.976   -13.400 1.00 0.00 ? 19 SER A OG   1  
ATOM   291   H  H    . SER A 1 19 ? -2.977  1.083   -11.464 1.00 0.00 ? 19 SER A H    1  
ATOM   292   H  HA   . SER A 1 19 ? -1.424  -0.381  -13.445 1.00 0.00 ? 19 SER A HA   1  
ATOM   293   H  HB2  . SER A 1 19 ? -0.859  2.033   -13.773 1.00 0.00 ? 19 SER A HB2  1  
ATOM   294   H  HB3  . SER A 1 19 ? -0.284  2.085   -12.107 1.00 0.00 ? 19 SER A HB3  1  
ATOM   295   H  HG   . SER A 1 19 ? 1.529   1.342   -12.837 1.00 0.00 ? 19 SER A HG   1  
ATOM   296   N  N    . GLU A 1 20 ? -1.748  -1.116  -10.655 1.00 0.00 ? 20 GLU A N    1  
ATOM   297   C  CA   . GLU A 1 20 ? -1.386  -1.892  -9.466  1.00 0.00 ? 20 GLU A CA   1  
ATOM   298   C  C    . GLU A 1 20 ? -0.511  -1.081  -8.504  1.00 0.00 ? 20 GLU A C    1  
ATOM   299   O  O    . GLU A 1 20 ? 0.695   -1.321  -8.387  1.00 0.00 ? 20 GLU A O    1  
ATOM   300   C  CB   . GLU A 1 20 ? -0.668  -3.182  -9.873  1.00 0.00 ? 20 GLU A CB   1  
ATOM   301   C  CG   . GLU A 1 20 ? -1.385  -3.964  -10.963 1.00 0.00 ? 20 GLU A CG   1  
ATOM   302   C  CD   . GLU A 1 20 ? -0.432  -4.500  -12.013 1.00 0.00 ? 20 GLU A CD   1  
ATOM   303   O  OE1  . GLU A 1 20 ? -0.022  -3.719  -12.897 1.00 0.00 ? 20 GLU A OE1  1  
ATOM   304   O  OE2  . GLU A 1 20 ? -0.095  -5.700  -11.948 1.00 0.00 ? 20 GLU A OE2  1  
ATOM   305   H  H    . GLU A 1 20 ? -2.691  -1.083  -10.925 1.00 0.00 ? 20 GLU A H    1  
ATOM   306   H  HA   . GLU A 1 20 ? -2.303  -2.151  -8.958  1.00 0.00 ? 20 GLU A HA   1  
ATOM   307   H  HB2  . GLU A 1 20 ? 0.320   -2.932  -10.229 1.00 0.00 ? 20 GLU A HB2  1  
ATOM   308   H  HB3  . GLU A 1 20 ? -0.578  -3.817  -9.005  1.00 0.00 ? 20 GLU A HB3  1  
ATOM   309   H  HG2  . GLU A 1 20 ? -1.904  -4.795  -10.510 1.00 0.00 ? 20 GLU A HG2  1  
ATOM   310   H  HG3  . GLU A 1 20 ? -2.100  -3.314  -11.445 1.00 0.00 ? 20 GLU A HG3  1  
ATOM   311   N  N    . THR A 1 21 ? -1.128  -0.123  -7.811  1.00 0.00 ? 21 THR A N    1  
ATOM   312   C  CA   . THR A 1 21 ? -0.412  0.720   -6.852  1.00 0.00 ? 21 THR A CA   1  
ATOM   313   C  C    . THR A 1 21 ? -1.244  0.927   -5.586  1.00 0.00 ? 21 THR A C    1  
ATOM   314   O  O    . THR A 1 21 ? -2.467  1.012   -5.649  1.00 0.00 ? 21 THR A O    1  
ATOM   315   C  CB   . THR A 1 21 ? -0.066  2.077   -7.481  1.00 0.00 ? 21 THR A CB   1  
ATOM   316   O  OG1  . THR A 1 21 ? 0.470   1.915   -8.786  1.00 0.00 ? 21 THR A OG1  1  
ATOM   317   C  CG2  . THR A 1 21 ? 0.936   2.877   -6.673  1.00 0.00 ? 21 THR A CG2  1  
ATOM   318   H  H    . THR A 1 21 ? -2.089  0.017   -7.945  1.00 0.00 ? 21 THR A H    1  
ATOM   319   H  HA   . THR A 1 21 ? 0.504   0.212   -6.586  1.00 0.00 ? 21 THR A HA   1  
ATOM   320   H  HB   . THR A 1 21 ? -0.971  2.666   -7.559  1.00 0.00 ? 21 THR A HB   1  
ATOM   321   H  HG1  . THR A 1 21 ? 1.131   1.216   -8.781  1.00 0.00 ? 21 THR A HG1  1  
ATOM   322   H  HG21 . THR A 1 21 ? 1.008   3.876   -7.076  1.00 0.00 ? 21 THR A HG21 1  
ATOM   323   H  HG22 . THR A 1 21 ? 1.903   2.398   -6.723  1.00 0.00 ? 21 THR A HG22 1  
ATOM   324   H  HG23 . THR A 1 21 ? 0.611   2.928   -5.644  1.00 0.00 ? 21 THR A HG23 1  
ATOM   325   N  N    . TYR A 1 22 ? -0.576  1.008   -4.437  1.00 0.00 ? 22 TYR A N    1  
ATOM   326   C  CA   . TYR A 1 22 ? -1.267  1.208   -3.162  1.00 0.00 ? 22 TYR A CA   1  
ATOM   327   C  C    . TYR A 1 22 ? -0.928  2.575   -2.575  1.00 0.00 ? 22 TYR A C    1  
ATOM   328   O  O    . TYR A 1 22 ? 0.215   3.026   -2.658  1.00 0.00 ? 22 TYR A O    1  
ATOM   329   C  CB   . TYR A 1 22 ? -0.897  0.101   -2.168  1.00 0.00 ? 22 TYR A CB   1  
ATOM   330   C  CG   . TYR A 1 22 ? -1.228  -1.292  -2.658  1.00 0.00 ? 22 TYR A CG   1  
ATOM   331   C  CD1  . TYR A 1 22 ? -0.409  -1.937  -3.578  1.00 0.00 ? 22 TYR A CD1  1  
ATOM   332   C  CD2  . TYR A 1 22 ? -2.358  -1.961  -2.203  1.00 0.00 ? 22 TYR A CD2  1  
ATOM   333   C  CE1  . TYR A 1 22 ? -0.707  -3.206  -4.029  1.00 0.00 ? 22 TYR A CE1  1  
ATOM   334   C  CE2  . TYR A 1 22 ? -2.661  -3.233  -2.650  1.00 0.00 ? 22 TYR A CE2  1  
ATOM   335   C  CZ   . TYR A 1 22 ? -1.833  -3.851  -3.562  1.00 0.00 ? 22 TYR A CZ   1  
ATOM   336   O  OH   . TYR A 1 22 ? -2.134  -5.116  -4.011  1.00 0.00 ? 22 TYR A OH   1  
ATOM   337   H  H    . TYR A 1 22 ? 0.402   0.935   -4.445  1.00 0.00 ? 22 TYR A H    1  
ATOM   338   H  HA   . TYR A 1 22 ? -2.328  1.166   -3.352  1.00 0.00 ? 22 TYR A HA   1  
ATOM   339   H  HB2  . TYR A 1 22 ? 0.163   0.141   -1.975  1.00 0.00 ? 22 TYR A HB2  1  
ATOM   340   H  HB3  . TYR A 1 22 ? -1.432  0.265   -1.245  1.00 0.00 ? 22 TYR A HB3  1  
ATOM   341   H  HD1  . TYR A 1 22 ? 0.471   -1.431  -3.942  1.00 0.00 ? 22 TYR A HD1  1  
ATOM   342   H  HD2  . TYR A 1 22 ? -3.004  -1.475  -1.487  1.00 0.00 ? 22 TYR A HD2  1  
ATOM   343   H  HE1  . TYR A 1 22 ? -0.058  -3.688  -4.744  1.00 0.00 ? 22 TYR A HE1  1  
ATOM   344   H  HE2  . TYR A 1 22 ? -3.543  -3.738  -2.284  1.00 0.00 ? 22 TYR A HE2  1  
ATOM   345   H  HH   . TYR A 1 22 ? -1.817  -5.764  -3.378  1.00 0.00 ? 22 TYR A HH   1  
ATOM   346   N  N    . PHE A 1 23 ? -1.928  3.236   -1.996  1.00 0.00 ? 23 PHE A N    1  
ATOM   347   C  CA   . PHE A 1 23 ? -1.732  4.563   -1.411  1.00 0.00 ? 23 PHE A CA   1  
ATOM   348   C  C    . PHE A 1 23 ? -2.271  4.634   0.016   1.00 0.00 ? 23 PHE A C    1  
ATOM   349   O  O    . PHE A 1 23 ? -3.209  3.917   0.373   1.00 0.00 ? 23 PHE A O    1  
ATOM   350   C  CB   . PHE A 1 23 ? -2.411  5.628   -2.279  1.00 0.00 ? 23 PHE A CB   1  
ATOM   351   C  CG   . PHE A 1 23 ? -1.956  5.620   -3.713  1.00 0.00 ? 23 PHE A CG   1  
ATOM   352   C  CD1  . PHE A 1 23 ? -2.382  4.629   -4.583  1.00 0.00 ? 23 PHE A CD1  1  
ATOM   353   C  CD2  . PHE A 1 23 ? -1.102  6.602   -4.190  1.00 0.00 ? 23 PHE A CD2  1  
ATOM   354   C  CE1  . PHE A 1 23 ? -1.965  4.616   -5.899  1.00 0.00 ? 23 PHE A CE1  1  
ATOM   355   C  CE2  . PHE A 1 23 ? -0.683  6.595   -5.507  1.00 0.00 ? 23 PHE A CE2  1  
ATOM   356   C  CZ   . PHE A 1 23 ? -1.115  5.600   -6.362  1.00 0.00 ? 23 PHE A CZ   1  
ATOM   357   H  H    . PHE A 1 23 ? -2.821  2.830   -1.971  1.00 0.00 ? 23 PHE A H    1  
ATOM   358   H  HA   . PHE A 1 23 ? -0.670  4.757   -1.390  1.00 0.00 ? 23 PHE A HA   1  
ATOM   359   H  HB2  . PHE A 1 23 ? -3.477  5.463   -2.268  1.00 0.00 ? 23 PHE A HB2  1  
ATOM   360   H  HB3  . PHE A 1 23 ? -2.199  6.605   -1.867  1.00 0.00 ? 23 PHE A HB3  1  
ATOM   361   H  HD1  . PHE A 1 23 ? -3.048  3.859   -4.224  1.00 0.00 ? 23 PHE A HD1  1  
ATOM   362   H  HD2  . PHE A 1 23 ? -0.763  7.380   -3.522  1.00 0.00 ? 23 PHE A HD2  1  
ATOM   363   H  HE1  . PHE A 1 23 ? -2.305  3.838   -6.566  1.00 0.00 ? 23 PHE A HE1  1  
ATOM   364   H  HE2  . PHE A 1 23 ? -0.018  7.366   -5.866  1.00 0.00 ? 23 PHE A HE2  1  
ATOM   365   H  HZ   . PHE A 1 23 ? -0.787  5.593   -7.392  1.00 0.00 ? 23 PHE A HZ   1  
ATOM   366   N  N    . TYR A 1 24 ? -1.672  5.509   0.829   1.00 0.00 ? 24 TYR A N    1  
ATOM   367   C  CA   . TYR A 1 24 ? -2.092  5.681   2.219   1.00 0.00 ? 24 TYR A CA   1  
ATOM   368   C  C    . TYR A 1 24 ? -2.367  7.151   2.537   1.00 0.00 ? 24 TYR A C    1  
ATOM   369   O  O    . TYR A 1 24 ? -1.603  8.029   2.145   1.00 0.00 ? 24 TYR A O    1  
ATOM   370   C  CB   . TYR A 1 24 ? -1.025  5.140   3.175   1.00 0.00 ? 24 TYR A CB   1  
ATOM   371   C  CG   . TYR A 1 24 ? -1.564  4.815   4.548   1.00 0.00 ? 24 TYR A CG   1  
ATOM   372   C  CD1  . TYR A 1 24 ? -2.391  3.717   4.747   1.00 0.00 ? 24 TYR A CD1  1  
ATOM   373   C  CD2  . TYR A 1 24 ? -1.254  5.610   5.645   1.00 0.00 ? 24 TYR A CD2  1  
ATOM   374   C  CE1  . TYR A 1 24 ? -2.893  3.420   5.997   1.00 0.00 ? 24 TYR A CE1  1  
ATOM   375   C  CE2  . TYR A 1 24 ? -1.753  5.319   6.899   1.00 0.00 ? 24 TYR A CE2  1  
ATOM   376   C  CZ   . TYR A 1 24 ? -2.572  4.224   7.071   1.00 0.00 ? 24 TYR A CZ   1  
ATOM   377   O  OH   . TYR A 1 24 ? -3.072  3.931   8.320   1.00 0.00 ? 24 TYR A OH   1  
ATOM   378   H  H    . TYR A 1 24 ? -0.930  6.053   0.484   1.00 0.00 ? 24 TYR A H    1  
ATOM   379   H  HA   . TYR A 1 24 ? -3.002  5.119   2.359   1.00 0.00 ? 24 TYR A HA   1  
ATOM   380   H  HB2  . TYR A 1 24 ? -0.604  4.238   2.760   1.00 0.00 ? 24 TYR A HB2  1  
ATOM   381   H  HB3  . TYR A 1 24 ? -0.244  5.879   3.289   1.00 0.00 ? 24 TYR A HB3  1  
ATOM   382   H  HD1  . TYR A 1 24 ? -2.641  3.087   3.905   1.00 0.00 ? 24 TYR A HD1  1  
ATOM   383   H  HD2  . TYR A 1 24 ? -0.613  6.468   5.507   1.00 0.00 ? 24 TYR A HD2  1  
ATOM   384   H  HE1  . TYR A 1 24 ? -3.533  2.562   6.130   1.00 0.00 ? 24 TYR A HE1  1  
ATOM   385   H  HE2  . TYR A 1 24 ? -1.501  5.948   7.740   1.00 0.00 ? 24 TYR A HE2  1  
ATOM   386   H  HH   . TYR A 1 24 ? -4.002  3.697   8.249   1.00 0.00 ? 24 TYR A HH   1  
ATOM   387   N  N    . PRO A 1 25 ? -3.467  7.438   3.264   1.00 0.00 ? 25 PRO A N    1  
ATOM   388   C  CA   . PRO A 1 25 ? -3.833  8.812   3.636   1.00 0.00 ? 25 PRO A CA   1  
ATOM   389   C  C    . PRO A 1 25 ? -2.853  9.431   4.630   1.00 0.00 ? 25 PRO A C    1  
ATOM   390   O  O    . PRO A 1 25 ? -2.610  8.877   5.706   1.00 0.00 ? 25 PRO A O    1  
ATOM   391   C  CB   . PRO A 1 25 ? -5.215  8.656   4.274   1.00 0.00 ? 25 PRO A CB   1  
ATOM   392   C  CG   . PRO A 1 25 ? -5.259  7.247   4.753   1.00 0.00 ? 25 PRO A CG   1  
ATOM   393   C  CD   . PRO A 1 25 ? -4.436  6.452   3.780   1.00 0.00 ? 25 PRO A CD   1  
ATOM   394   H  HA   . PRO A 1 25 ? -3.905  9.448   2.767   1.00 0.00 ? 25 PRO A HA   1  
ATOM   395   H  HB2  . PRO A 1 25 ? -5.317  9.356   5.091   1.00 0.00 ? 25 PRO A HB2  1  
ATOM   396   H  HB3  . PRO A 1 25 ? -5.978  8.845   3.533   1.00 0.00 ? 25 PRO A HB3  1  
ATOM   397   H  HG2  . PRO A 1 25 ? -4.833  7.182   5.745   1.00 0.00 ? 25 PRO A HG2  1  
ATOM   398   H  HG3  . PRO A 1 25 ? -6.280  6.893   4.759   1.00 0.00 ? 25 PRO A HG3  1  
ATOM   399   H  HD2  . PRO A 1 25 ? -3.930  5.644   4.287   1.00 0.00 ? 25 PRO A HD2  1  
ATOM   400   H  HD3  . PRO A 1 25 ? -5.057  6.069   2.985   1.00 0.00 ? 25 PRO A HD3  1  
ATOM   401   N  N    . CYS A 1 26 ? -2.293  10.582  4.263   1.00 0.00 ? 26 CYS A N    1  
ATOM   402   C  CA   . CYS A 1 26 ? -1.343  11.282  5.120   1.00 0.00 ? 26 CYS A CA   1  
ATOM   403   C  C    . CYS A 1 26 ? -1.986  12.518  5.746   1.00 0.00 ? 26 CYS A C    1  
ATOM   404   O  O    . CYS A 1 26 ? -2.766  13.219  5.096   1.00 0.00 ? 26 CYS A O    1  
ATOM   405   C  CB   . CYS A 1 26 ? -0.102  11.684  4.317   1.00 0.00 ? 26 CYS A CB   1  
ATOM   406   S  SG   . CYS A 1 26 ? 1.477   11.298  5.137   1.00 0.00 ? 26 CYS A SG   1  
ATOM   407   H  H    . CYS A 1 26 ? -2.528  10.976  3.395   1.00 0.00 ? 26 CYS A H    1  
ATOM   408   H  HA   . CYS A 1 26 ? -1.047  10.606  5.906   1.00 0.00 ? 26 CYS A HA   1  
ATOM   409   H  HB2  . CYS A 1 26 ? -0.113  11.167  3.369   1.00 0.00 ? 26 CYS A HB2  1  
ATOM   410   H  HB3  . CYS A 1 26 ? -0.127  12.750  4.140   1.00 0.00 ? 26 CYS A HB3  1  
ATOM   411   N  N    . PRO A 1 27 ? -1.658  12.810  7.021   1.00 0.00 ? 27 PRO A N    1  
ATOM   412   C  CA   . PRO A 1 27 ? -2.203  13.974  7.733   1.00 0.00 ? 27 PRO A CA   1  
ATOM   413   C  C    . PRO A 1 27 ? -1.695  15.305  7.172   1.00 0.00 ? 27 PRO A C    1  
ATOM   414   O  O    . PRO A 1 27 ? -2.283  16.356  7.435   1.00 0.00 ? 27 PRO A O    1  
ATOM   415   C  CB   . PRO A 1 27 ? -1.711  13.780  9.169   1.00 0.00 ? 27 PRO A CB   1  
ATOM   416   C  CG   . PRO A 1 27 ? -0.491  12.935  9.043   1.00 0.00 ? 27 PRO A CG   1  
ATOM   417   C  CD   . PRO A 1 27 ? -0.730  12.032  7.866   1.00 0.00 ? 27 PRO A CD   1  
ATOM   418   H  HA   . PRO A 1 27 ? -3.283  13.971  7.718   1.00 0.00 ? 27 PRO A HA   1  
ATOM   419   H  HB2  . PRO A 1 27 ? -1.482  14.742  9.605   1.00 0.00 ? 27 PRO A HB2  1  
ATOM   420   H  HB3  . PRO A 1 27 ? -2.475  13.288  9.750   1.00 0.00 ? 27 PRO A HB3  1  
ATOM   421   H  HG2  . PRO A 1 27 ? 0.374   13.559  8.868   1.00 0.00 ? 27 PRO A HG2  1  
ATOM   422   H  HG3  . PRO A 1 27 ? -0.355  12.351  9.940   1.00 0.00 ? 27 PRO A HG3  1  
ATOM   423   H  HD2  . PRO A 1 27 ? 0.199   11.836  7.346   1.00 0.00 ? 27 PRO A HD2  1  
ATOM   424   H  HD3  . PRO A 1 27 ? -1.188  11.107  8.186   1.00 0.00 ? 27 PRO A HD3  1  
ATOM   425   N  N    . CYS A 1 28 ? -0.608  15.259  6.399   1.00 0.00 ? 28 CYS A N    1  
ATOM   426   C  CA   . CYS A 1 28 ? -0.041  16.467  5.807   1.00 0.00 ? 28 CYS A CA   1  
ATOM   427   C  C    . CYS A 1 28 ? -0.960  17.036  4.721   1.00 0.00 ? 28 CYS A C    1  
ATOM   428   O  O    . CYS A 1 28 ? -1.013  18.252  4.519   1.00 0.00 ? 28 CYS A O    1  
ATOM   429   C  CB   . CYS A 1 28 ? 1.344   16.174  5.221   1.00 0.00 ? 28 CYS A CB   1  
ATOM   430   S  SG   . CYS A 1 28 ? 1.338   14.992  3.830   1.00 0.00 ? 28 CYS A SG   1  
ATOM   431   H  H    . CYS A 1 28 ? -0.181  14.394  6.219   1.00 0.00 ? 28 CYS A H    1  
ATOM   432   H  HA   . CYS A 1 28 ? 0.061   17.200  6.594   1.00 0.00 ? 28 CYS A HA   1  
ATOM   433   H  HB2  . CYS A 1 28 ? 1.778   17.097  4.867   1.00 0.00 ? 28 CYS A HB2  1  
ATOM   434   H  HB3  . CYS A 1 28 ? 1.974   15.762  5.996   1.00 0.00 ? 28 CYS A HB3  1  
ATOM   435   N  N    . GLY A 1 29 ? -1.680  16.149  4.025   1.00 0.00 ? 29 GLY A N    1  
ATOM   436   C  CA   . GLY A 1 29 ? -2.583  16.578  2.967   1.00 0.00 ? 29 GLY A CA   1  
ATOM   437   C  C    . GLY A 1 29 ? -2.613  15.613  1.793   1.00 0.00 ? 29 GLY A C    1  
ATOM   438   O  O    . GLY A 1 29 ? -3.675  15.353  1.225   1.00 0.00 ? 29 GLY A O    1  
ATOM   439   H  H    . GLY A 1 29 ? -1.593  15.194  4.230   1.00 0.00 ? 29 GLY A H    1  
ATOM   440   H  HA2  . GLY A 1 29 ? -3.579  16.660  3.375   1.00 0.00 ? 29 GLY A HA2  1  
ATOM   441   H  HA3  . GLY A 1 29 ? -2.269  17.548  2.613   1.00 0.00 ? 29 GLY A HA3  1  
ATOM   442   N  N    . ASP A 1 30 ? -1.445  15.084  1.430   1.00 0.00 ? 30 ASP A N    1  
ATOM   443   C  CA   . ASP A 1 30 ? -1.330  14.142  0.319   1.00 0.00 ? 30 ASP A CA   1  
ATOM   444   C  C    . ASP A 1 30 ? -1.473  12.697  0.804   1.00 0.00 ? 30 ASP A C    1  
ATOM   445   O  O    . ASP A 1 30 ? -1.844  12.453  1.955   1.00 0.00 ? 30 ASP A O    1  
ATOM   446   C  CB   . ASP A 1 30 ? 0.018   14.334  -0.384  1.00 0.00 ? 30 ASP A CB   1  
ATOM   447   C  CG   . ASP A 1 30 ? -0.081  14.193  -1.891  1.00 0.00 ? 30 ASP A CG   1  
ATOM   448   O  OD1  . ASP A 1 30 ? -0.758  15.030  -2.525  1.00 0.00 ? 30 ASP A OD1  1  
ATOM   449   O  OD2  . ASP A 1 30 ? 0.516   13.244  -2.438  1.00 0.00 ? 30 ASP A OD2  1  
ATOM   450   H  H    . ASP A 1 30 ? -0.634  15.332  1.925   1.00 0.00 ? 30 ASP A H    1  
ATOM   451   H  HA   . ASP A 1 30 ? -2.126  14.355  -0.381  1.00 0.00 ? 30 ASP A HA   1  
ATOM   452   H  HB2  . ASP A 1 30 ? 0.394   15.320  -0.161  1.00 0.00 ? 30 ASP A HB2  1  
ATOM   453   H  HB3  . ASP A 1 30 ? 0.716   13.595  -0.015  1.00 0.00 ? 30 ASP A HB3  1  
ATOM   454   N  N    . ASN A 1 31 ? -1.185  11.737  -0.082  1.00 0.00 ? 31 ASN A N    1  
ATOM   455   C  CA   . ASN A 1 31 ? -1.289  10.323  0.260   1.00 0.00 ? 31 ASN A CA   1  
ATOM   456   C  C    . ASN A 1 31 ? -0.063  9.549   -0.228  1.00 0.00 ? 31 ASN A C    1  
ATOM   457   O  O    . ASN A 1 31 ? 0.399   9.748   -1.353  1.00 0.00 ? 31 ASN A O    1  
ATOM   458   C  CB   . ASN A 1 31 ? -2.559  9.714   -0.347  1.00 0.00 ? 31 ASN A CB   1  
ATOM   459   C  CG   . ASN A 1 31 ? -3.808  10.533  -0.063  1.00 0.00 ? 31 ASN A CG   1  
ATOM   460   O  OD1  . ASN A 1 31 ? -3.931  11.676  -0.505  1.00 0.00 ? 31 ASN A OD1  1  
ATOM   461   N  ND2  . ASN A 1 31 ? -4.750  9.950   0.671   1.00 0.00 ? 31 ASN A ND2  1  
ATOM   462   H  H    . ASN A 1 31 ? -0.901  11.987  -0.985  1.00 0.00 ? 31 ASN A H    1  
ATOM   463   H  HA   . ASN A 1 31 ? -1.343  10.245  1.335   1.00 0.00 ? 31 ASN A HA   1  
ATOM   464   H  HB2  . ASN A 1 31 ? -2.438  9.646   -1.419  1.00 0.00 ? 31 ASN A HB2  1  
ATOM   465   H  HB3  . ASN A 1 31 ? -2.701  8.722   0.057   1.00 0.00 ? 31 ASN A HB3  1  
ATOM   466   H  HD21 . ASN A 1 31 ? -4.594  9.038   0.988   1.00 0.00 ? 31 ASN A HD21 1  
ATOM   467   H  HD22 . ASN A 1 31 ? -5.568  10.459  0.861   1.00 0.00 ? 31 ASN A HD22 1  
ATOM   468   N  N    . PHE A 1 32 ? 0.445   8.656   0.626   1.00 0.00 ? 32 PHE A N    1  
ATOM   469   C  CA   . PHE A 1 32 ? 1.608   7.829   0.293   1.00 0.00 ? 32 PHE A CA   1  
ATOM   470   C  C    . PHE A 1 32 ? 1.322   6.961   -0.935  1.00 0.00 ? 32 PHE A C    1  
ATOM   471   O  O    . PHE A 1 32 ? 0.166   6.795   -1.326  1.00 0.00 ? 32 PHE A O    1  
ATOM   472   C  CB   . PHE A 1 32 ? 1.977   6.932   1.478   1.00 0.00 ? 32 PHE A CB   1  
ATOM   473   C  CG   . PHE A 1 32 ? 2.806   7.613   2.534   1.00 0.00 ? 32 PHE A CG   1  
ATOM   474   C  CD1  . PHE A 1 32 ? 4.138   7.910   2.302   1.00 0.00 ? 32 PHE A CD1  1  
ATOM   475   C  CD2  . PHE A 1 32 ? 2.255   7.946   3.763   1.00 0.00 ? 32 PHE A CD2  1  
ATOM   476   C  CE1  . PHE A 1 32 ? 4.905   8.527   3.271   1.00 0.00 ? 32 PHE A CE1  1  
ATOM   477   C  CE2  . PHE A 1 32 ? 3.019   8.562   4.736   1.00 0.00 ? 32 PHE A CE2  1  
ATOM   478   C  CZ   . PHE A 1 32 ? 4.345   8.853   4.489   1.00 0.00 ? 32 PHE A CZ   1  
ATOM   479   H  H    . PHE A 1 32 ? 0.018   8.541   1.502   1.00 0.00 ? 32 PHE A H    1  
ATOM   480   H  HA   . PHE A 1 32 ? 2.436   8.487   0.074   1.00 0.00 ? 32 PHE A HA   1  
ATOM   481   H  HB2  . PHE A 1 32 ? 1.070   6.579   1.947   1.00 0.00 ? 32 PHE A HB2  1  
ATOM   482   H  HB3  . PHE A 1 32 ? 2.538   6.084   1.114   1.00 0.00 ? 32 PHE A HB3  1  
ATOM   483   H  HD1  . PHE A 1 32 ? 4.577   7.658   1.348   1.00 0.00 ? 32 PHE A HD1  1  
ATOM   484   H  HD2  . PHE A 1 32 ? 1.216   7.721   3.958   1.00 0.00 ? 32 PHE A HD2  1  
ATOM   485   H  HE1  . PHE A 1 32 ? 5.942   8.752   3.077   1.00 0.00 ? 32 PHE A HE1  1  
ATOM   486   H  HE2  . PHE A 1 32 ? 2.579   8.817   5.689   1.00 0.00 ? 32 PHE A HE2  1  
ATOM   487   H  HZ   . PHE A 1 32 ? 4.945   9.333   5.248   1.00 0.00 ? 32 PHE A HZ   1  
ATOM   488   N  N    . SER A 1 33 ? 2.375   6.407   -1.540  1.00 0.00 ? 33 SER A N    1  
ATOM   489   C  CA   . SER A 1 33 ? 2.217   5.559   -2.722  1.00 0.00 ? 33 SER A CA   1  
ATOM   490   C  C    . SER A 1 33 ? 3.271   4.451   -2.768  1.00 0.00 ? 33 SER A C    1  
ATOM   491   O  O    . SER A 1 33 ? 4.442   4.681   -2.458  1.00 0.00 ? 33 SER A O    1  
ATOM   492   C  CB   . SER A 1 33 ? 2.295   6.407   -3.995  1.00 0.00 ? 33 SER A CB   1  
ATOM   493   O  OG   . SER A 1 33 ? 3.531   7.094   -4.079  1.00 0.00 ? 33 SER A OG   1  
ATOM   494   H  H    . SER A 1 33 ? 3.274   6.572   -1.185  1.00 0.00 ? 33 SER A H    1  
ATOM   495   H  HA   . SER A 1 33 ? 1.240   5.101   -2.669  1.00 0.00 ? 33 SER A HA   1  
ATOM   496   H  HB2  . SER A 1 33 ? 2.194   5.766   -4.858  1.00 0.00 ? 33 SER A HB2  1  
ATOM   497   H  HB3  . SER A 1 33 ? 1.494   7.131   -3.991  1.00 0.00 ? 33 SER A HB3  1  
ATOM   498   H  HG   . SER A 1 33 ? 3.653   7.428   -4.971  1.00 0.00 ? 33 SER A HG   1  
ATOM   499   N  N    . ILE A 1 34 ? 2.840   3.250   -3.160  1.00 0.00 ? 34 ILE A N    1  
ATOM   500   C  CA   . ILE A 1 34 ? 3.731   2.096   -3.262  1.00 0.00 ? 34 ILE A CA   1  
ATOM   501   C  C    . ILE A 1 34 ? 3.228   1.109   -4.321  1.00 0.00 ? 34 ILE A C    1  
ATOM   502   O  O    . ILE A 1 34 ? 2.084   0.654   -4.264  1.00 0.00 ? 34 ILE A O    1  
ATOM   503   C  CB   . ILE A 1 34 ? 3.880   1.370   -1.905  1.00 0.00 ? 34 ILE A CB   1  
ATOM   504   C  CG1  . ILE A 1 34 ? 4.853   0.194   -2.030  1.00 0.00 ? 34 ILE A CG1  1  
ATOM   505   C  CG2  . ILE A 1 34 ? 2.524   0.896   -1.396  1.00 0.00 ? 34 ILE A CG2  1  
ATOM   506   C  CD1  . ILE A 1 34 ? 5.430   -0.256  -0.707  1.00 0.00 ? 34 ILE A CD1  1  
ATOM   507   H  H    . ILE A 1 34 ? 1.894   3.138   -3.395  1.00 0.00 ? 34 ILE A H    1  
ATOM   508   H  HA   . ILE A 1 34 ? 4.706   2.458   -3.559  1.00 0.00 ? 34 ILE A HA   1  
ATOM   509   H  HB   . ILE A 1 34 ? 4.274   2.077   -1.190  1.00 0.00 ? 34 ILE A HB   1  
ATOM   510   H  HG12 . ILE A 1 34 ? 4.337   -0.648  -2.467  1.00 0.00 ? 34 ILE A HG12 1  
ATOM   511   H  HG13 . ILE A 1 34 ? 5.673   0.479   -2.671  1.00 0.00 ? 34 ILE A HG13 1  
ATOM   512   H  HG21 . ILE A 1 34 ? 1.742   1.474   -1.864  1.00 0.00 ? 34 ILE A HG21 1  
ATOM   513   H  HG22 . ILE A 1 34 ? 2.477   1.025   -0.325  1.00 0.00 ? 34 ILE A HG22 1  
ATOM   514   H  HG23 . ILE A 1 34 ? 2.394   -0.149  -1.639  1.00 0.00 ? 34 ILE A HG23 1  
ATOM   515   H  HD11 . ILE A 1 34 ? 4.786   0.065   0.097   1.00 0.00 ? 34 ILE A HD11 1  
ATOM   516   H  HD12 . ILE A 1 34 ? 6.412   0.178   -0.578  1.00 0.00 ? 34 ILE A HD12 1  
ATOM   517   H  HD13 . ILE A 1 34 ? 5.510   -1.332  -0.698  1.00 0.00 ? 34 ILE A HD13 1  
ATOM   518   N  N    . THR A 1 35 ? 4.087   0.784   -5.286  1.00 0.00 ? 35 THR A N    1  
ATOM   519   C  CA   . THR A 1 35 ? 3.730   -0.145  -6.360  1.00 0.00 ? 35 THR A CA   1  
ATOM   520   C  C    . THR A 1 35 ? 3.643   -1.585  -5.849  1.00 0.00 ? 35 THR A C    1  
ATOM   521   O  O    . THR A 1 35 ? 4.340   -1.961  -4.904  1.00 0.00 ? 35 THR A O    1  
ATOM   522   C  CB   . THR A 1 35 ? 4.752   -0.055  -7.499  1.00 0.00 ? 35 THR A CB   1  
ATOM   523   O  OG1  . THR A 1 35 ? 6.060   0.134   -6.986  1.00 0.00 ? 35 THR A OG1  1  
ATOM   524   C  CG2  . THR A 1 35 ? 4.476   1.078   -8.465  1.00 0.00 ? 35 THR A CG2  1  
ATOM   525   H  H    . THR A 1 35 ? 4.984   1.182   -5.279  1.00 0.00 ? 35 THR A H    1  
ATOM   526   H  HA   . THR A 1 35 ? 2.761   0.145   -6.738  1.00 0.00 ? 35 THR A HA   1  
ATOM   527   H  HB   . THR A 1 35 ? 4.736   -0.980  -8.061  1.00 0.00 ? 35 THR A HB   1  
ATOM   528   H  HG1  . THR A 1 35 ? 6.655   -0.515  -7.370  1.00 0.00 ? 35 THR A HG1  1  
ATOM   529   H  HG21 . THR A 1 35 ? 5.236   1.089   -9.234  1.00 0.00 ? 35 THR A HG21 1  
ATOM   530   H  HG22 . THR A 1 35 ? 4.492   2.018   -7.931  1.00 0.00 ? 35 THR A HG22 1  
ATOM   531   H  HG23 . THR A 1 35 ? 3.507   0.938   -8.918  1.00 0.00 ? 35 THR A HG23 1  
ATOM   532   N  N    . LYS A 1 36 ? 2.786   -2.389  -6.486  1.00 0.00 ? 36 LYS A N    1  
ATOM   533   C  CA   . LYS A 1 36 ? 2.613   -3.794  -6.103  1.00 0.00 ? 36 LYS A CA   1  
ATOM   534   C  C    . LYS A 1 36 ? 3.929   -4.559  -6.234  1.00 0.00 ? 36 LYS A C    1  
ATOM   535   O  O    . LYS A 1 36 ? 4.243   -5.413  -5.402  1.00 0.00 ? 36 LYS A O    1  
ATOM   536   C  CB   . LYS A 1 36 ? 1.538   -4.458  -6.972  1.00 0.00 ? 36 LYS A CB   1  
ATOM   537   C  CG   . LYS A 1 36 ? 1.273   -5.916  -6.617  1.00 0.00 ? 36 LYS A CG   1  
ATOM   538   C  CD   . LYS A 1 36 ? 0.128   -6.051  -5.628  1.00 0.00 ? 36 LYS A CD   1  
ATOM   539   C  CE   . LYS A 1 36 ? -0.245  -7.507  -5.394  1.00 0.00 ? 36 LYS A CE   1  
ATOM   540   N  NZ   . LYS A 1 36 ? -0.878  -8.123  -6.595  1.00 0.00 ? 36 LYS A NZ   1  
ATOM   541   H  H    . LYS A 1 36 ? 2.263   -2.030  -7.235  1.00 0.00 ? 36 LYS A H    1  
ATOM   542   H  HA   . LYS A 1 36 ? 2.296   -3.819  -5.071  1.00 0.00 ? 36 LYS A HA   1  
ATOM   543   H  HB2  . LYS A 1 36 ? 0.615   -3.909  -6.863  1.00 0.00 ? 36 LYS A HB2  1  
ATOM   544   H  HB3  . LYS A 1 36 ? 1.851   -4.414  -8.005  1.00 0.00 ? 36 LYS A HB3  1  
ATOM   545   H  HG2  . LYS A 1 36 ? 1.022   -6.454  -7.518  1.00 0.00 ? 36 LYS A HG2  1  
ATOM   546   H  HG3  . LYS A 1 36 ? 2.165   -6.339  -6.181  1.00 0.00 ? 36 LYS A HG3  1  
ATOM   547   H  HD2  . LYS A 1 36 ? 0.425   -5.612  -4.687  1.00 0.00 ? 36 LYS A HD2  1  
ATOM   548   H  HD3  . LYS A 1 36 ? -0.733  -5.526  -6.017  1.00 0.00 ? 36 LYS A HD3  1  
ATOM   549   H  HE2  . LYS A 1 36 ? 0.651   -8.059  -5.148  1.00 0.00 ? 36 LYS A HE2  1  
ATOM   550   H  HE3  . LYS A 1 36 ? -0.937  -7.559  -4.566  1.00 0.00 ? 36 LYS A HE3  1  
ATOM   551   H  HZ1  . LYS A 1 36 ? -1.602  -7.486  -6.985  1.00 0.00 ? 36 LYS A HZ1  1  
ATOM   552   H  HZ2  . LYS A 1 36 ? -1.326  -9.026  -6.341  1.00 0.00 ? 36 LYS A HZ2  1  
ATOM   553   H  HZ3  . LYS A 1 36 ? -0.161  -8.300  -7.327  1.00 0.00 ? 36 LYS A HZ3  1  
ATOM   554   N  N    . GLU A 1 37 ? 4.695   -4.239  -7.280  1.00 0.00 ? 37 GLU A N    1  
ATOM   555   C  CA   . GLU A 1 37 ? 5.982   -4.889  -7.521  1.00 0.00 ? 37 GLU A CA   1  
ATOM   556   C  C    . GLU A 1 37 ? 6.944   -4.645  -6.358  1.00 0.00 ? 37 GLU A C    1  
ATOM   557   O  O    . GLU A 1 37 ? 7.703   -5.538  -5.976  1.00 0.00 ? 37 GLU A O    1  
ATOM   558   C  CB   . GLU A 1 37 ? 6.601   -4.373  -8.823  1.00 0.00 ? 37 GLU A CB   1  
ATOM   559   C  CG   . GLU A 1 37 ? 7.614   -5.328  -9.439  1.00 0.00 ? 37 GLU A CG   1  
ATOM   560   C  CD   . GLU A 1 37 ? 8.853   -4.621  -9.958  1.00 0.00 ? 37 GLU A CD   1  
ATOM   561   O  OE1  . GLU A 1 37 ? 8.706   -3.619  -10.691 1.00 0.00 ? 37 GLU A OE1  1  
ATOM   562   O  OE2  . GLU A 1 37 ? 9.972   -5.073  -9.633  1.00 0.00 ? 37 GLU A OE2  1  
ATOM   563   H  H    . GLU A 1 37 ? 4.388   -3.548  -7.903  1.00 0.00 ? 37 GLU A H    1  
ATOM   564   H  HA   . GLU A 1 37 ? 5.805   -5.950  -7.612  1.00 0.00 ? 37 GLU A HA   1  
ATOM   565   H  HB2  . GLU A 1 37 ? 5.812   -4.208  -9.541  1.00 0.00 ? 37 GLU A HB2  1  
ATOM   566   H  HB3  . GLU A 1 37 ? 7.096   -3.435  -8.624  1.00 0.00 ? 37 GLU A HB3  1  
ATOM   567   H  HG2  . GLU A 1 37 ? 7.916   -6.043  -8.688  1.00 0.00 ? 37 GLU A HG2  1  
ATOM   568   H  HG3  . GLU A 1 37 ? 7.144   -5.850  -10.260 1.00 0.00 ? 37 GLU A HG3  1  
ATOM   569   N  N    . ASP A 1 38 ? 6.900   -3.435  -5.793  1.00 0.00 ? 38 ASP A N    1  
ATOM   570   C  CA   . ASP A 1 38 ? 7.761   -3.082  -4.666  1.00 0.00 ? 38 ASP A CA   1  
ATOM   571   C  C    . ASP A 1 38 ? 7.541   -4.040  -3.502  1.00 0.00 ? 38 ASP A C    1  
ATOM   572   O  O    . ASP A 1 38 ? 8.495   -4.563  -2.933  1.00 0.00 ? 38 ASP A O    1  
ATOM   573   C  CB   . ASP A 1 38 ? 7.483   -1.642  -4.209  1.00 0.00 ? 38 ASP A CB   1  
ATOM   574   C  CG   . ASP A 1 38 ? 8.338   -0.613  -4.928  1.00 0.00 ? 38 ASP A CG   1  
ATOM   575   O  OD1  . ASP A 1 38 ? 8.736   -0.863  -6.088  1.00 0.00 ? 38 ASP A OD1  1  
ATOM   576   O  OD2  . ASP A 1 38 ? 8.608   0.450   -4.331  1.00 0.00 ? 38 ASP A OD2  1  
ATOM   577   H  H    . ASP A 1 38 ? 6.271   -2.768  -6.140  1.00 0.00 ? 38 ASP A H    1  
ATOM   578   H  HA   . ASP A 1 38 ? 8.787   -3.158  -4.994  1.00 0.00 ? 38 ASP A HA   1  
ATOM   579   H  HB2  . ASP A 1 38 ? 6.445   -1.407  -4.393  1.00 0.00 ? 38 ASP A HB2  1  
ATOM   580   H  HB3  . ASP A 1 38 ? 7.680   -1.568  -3.149  1.00 0.00 ? 38 ASP A HB3  1  
ATOM   581   N  N    . LEU A 1 39 ? 6.274   -4.275  -3.166  1.00 0.00 ? 39 LEU A N    1  
ATOM   582   C  CA   . LEU A 1 39 ? 5.923   -5.181  -2.075  1.00 0.00 ? 39 LEU A CA   1  
ATOM   583   C  C    . LEU A 1 39 ? 6.345   -6.616  -2.399  1.00 0.00 ? 39 LEU A C    1  
ATOM   584   O  O    . LEU A 1 39 ? 6.771   -7.359  -1.516  1.00 0.00 ? 39 LEU A O    1  
ATOM   585   C  CB   . LEU A 1 39 ? 4.420   -5.120  -1.799  1.00 0.00 ? 39 LEU A CB   1  
ATOM   586   C  CG   . LEU A 1 39 ? 3.860   -3.711  -1.587  1.00 0.00 ? 39 LEU A CG   1  
ATOM   587   C  CD1  . LEU A 1 39 ? 2.407   -3.642  -2.029  1.00 0.00 ? 39 LEU A CD1  1  
ATOM   588   C  CD2  . LEU A 1 39 ? 3.999   -3.291  -0.131  1.00 0.00 ? 39 LEU A CD2  1  
ATOM   589   H  H    . LEU A 1 39 ? 5.558   -3.833  -3.670  1.00 0.00 ? 39 LEU A H    1  
ATOM   590   H  HA   . LEU A 1 39 ? 6.455   -4.854  -1.192  1.00 0.00 ? 39 LEU A HA   1  
ATOM   591   H  HB2  . LEU A 1 39 ? 3.905   -5.570  -2.635  1.00 0.00 ? 39 LEU A HB2  1  
ATOM   592   H  HB3  . LEU A 1 39 ? 4.214   -5.703  -0.914  1.00 0.00 ? 39 LEU A HB3  1  
ATOM   593   H  HG   . LEU A 1 39 ? 4.422   -3.014  -2.191  1.00 0.00 ? 39 LEU A HG   1  
ATOM   594   H  HD11 . LEU A 1 39 ? 1.826   -4.359  -1.469  1.00 0.00 ? 39 LEU A HD11 1  
ATOM   595   H  HD12 . LEU A 1 39 ? 2.342   -3.870  -3.082  1.00 0.00 ? 39 LEU A HD12 1  
ATOM   596   H  HD13 . LEU A 1 39 ? 2.023   -2.648  -1.850  1.00 0.00 ? 39 LEU A HD13 1  
ATOM   597   H  HD21 . LEU A 1 39 ? 3.294   -3.843  0.472   1.00 0.00 ? 39 LEU A HD21 1  
ATOM   598   H  HD22 . LEU A 1 39 ? 3.802   -2.234  -0.041  1.00 0.00 ? 39 LEU A HD22 1  
ATOM   599   H  HD23 . LEU A 1 39 ? 5.004   -3.500  0.207   1.00 0.00 ? 39 LEU A HD23 1  
ATOM   600   N  N    . GLU A 1 40 ? 6.231   -6.999  -3.673  1.00 0.00 ? 40 GLU A N    1  
ATOM   601   C  CA   . GLU A 1 40 ? 6.611   -8.345  -4.105  1.00 0.00 ? 40 GLU A CA   1  
ATOM   602   C  C    . GLU A 1 40 ? 8.117   -8.579  -3.948  1.00 0.00 ? 40 GLU A C    1  
ATOM   603   O  O    . GLU A 1 40 ? 8.553   -9.713  -3.749  1.00 0.00 ? 40 GLU A O    1  
ATOM   604   C  CB   . GLU A 1 40 ? 6.208   -8.574  -5.562  1.00 0.00 ? 40 GLU A CB   1  
ATOM   605   C  CG   . GLU A 1 40 ? 4.704   -8.614  -5.781  1.00 0.00 ? 40 GLU A CG   1  
ATOM   606   C  CD   . GLU A 1 40 ? 4.330   -8.881  -7.226  1.00 0.00 ? 40 GLU A CD   1  
ATOM   607   O  OE1  . GLU A 1 40 ? 4.704   -8.070  -8.097  1.00 0.00 ? 40 GLU A OE1  1  
ATOM   608   O  OE2  . GLU A 1 40 ? 3.658   -9.898  -7.486  1.00 0.00 ? 40 GLU A OE2  1  
ATOM   609   H  H    . GLU A 1 40 ? 5.889   -6.361  -4.337  1.00 0.00 ? 40 GLU A H    1  
ATOM   610   H  HA   . GLU A 1 40 ? 6.085   -9.052  -3.482  1.00 0.00 ? 40 GLU A HA   1  
ATOM   611   H  HB2  . GLU A 1 40 ? 6.617   -7.777  -6.165  1.00 0.00 ? 40 GLU A HB2  1  
ATOM   612   H  HB3  . GLU A 1 40 ? 6.625   -9.515  -5.894  1.00 0.00 ? 40 GLU A HB3  1  
ATOM   613   H  HG2  . GLU A 1 40 ? 4.285   -9.396  -5.166  1.00 0.00 ? 40 GLU A HG2  1  
ATOM   614   H  HG3  . GLU A 1 40 ? 4.287   -7.664  -5.487  1.00 0.00 ? 40 GLU A HG3  1  
ATOM   615   N  N    . ASN A 1 41 ? 8.904   -7.506  -4.047  1.00 0.00 ? 41 ASN A N    1  
ATOM   616   C  CA   . ASN A 1 41 ? 10.358  -7.603  -3.924  1.00 0.00 ? 41 ASN A CA   1  
ATOM   617   C  C    . ASN A 1 41 ? 10.826  -7.394  -2.485  1.00 0.00 ? 41 ASN A C    1  
ATOM   618   O  O    . ASN A 1 41 ? 11.803  -8.007  -2.052  1.00 0.00 ? 41 ASN A O    1  
ATOM   619   C  CB   . ASN A 1 41 ? 11.033  -6.570  -4.830  1.00 0.00 ? 41 ASN A CB   1  
ATOM   620   C  CG   . ASN A 1 41 ? 11.363  -7.126  -6.202  1.00 0.00 ? 41 ASN A CG   1  
ATOM   621   O  OD1  . ASN A 1 41 ? 11.187  -8.318  -6.466  1.00 0.00 ? 41 ASN A OD1  1  
ATOM   622   N  ND2  . ASN A 1 41 ? 11.848  -6.265  -7.087  1.00 0.00 ? 41 ASN A ND2  1  
ATOM   623   H  H    . ASN A 1 41 ? 8.500   -6.628  -4.214  1.00 0.00 ? 41 ASN A H    1  
ATOM   624   H  HA   . ASN A 1 41 ? 10.652  -8.590  -4.245  1.00 0.00 ? 41 ASN A HA   1  
ATOM   625   H  HB2  . ASN A 1 41 ? 10.374  -5.724  -4.955  1.00 0.00 ? 41 ASN A HB2  1  
ATOM   626   H  HB3  . ASN A 1 41 ? 11.951  -6.240  -4.365  1.00 0.00 ? 41 ASN A HB3  1  
ATOM   627   H  HD21 . ASN A 1 41 ? 11.967  -5.333  -6.812  1.00 0.00 ? 41 ASN A HD21 1  
ATOM   628   H  HD22 . ASN A 1 41 ? 12.069  -6.599  -7.982  1.00 0.00 ? 41 ASN A HD22 1  
ATOM   629   N  N    . GLY A 1 42 ? 10.139  -6.514  -1.759  1.00 0.00 ? 42 GLY A N    1  
ATOM   630   C  CA   . GLY A 1 42 ? 10.513  -6.222  -0.388  1.00 0.00 ? 42 GLY A CA   1  
ATOM   631   C  C    . GLY A 1 42 ? 10.362  -4.750  -0.040  1.00 0.00 ? 42 GLY A C    1  
ATOM   632   O  O    . GLY A 1 42 ? 10.393  -4.386  1.136   1.00 0.00 ? 42 GLY A O    1  
ATOM   633   H  H    . GLY A 1 42 ? 9.377   -6.045  -2.163  1.00 0.00 ? 42 GLY A H    1  
ATOM   634   H  HA2  . GLY A 1 42 ? 9.890   -6.805  0.274   1.00 0.00 ? 42 GLY A HA2  1  
ATOM   635   H  HA3  . GLY A 1 42 ? 11.544  -6.509  -0.239  1.00 0.00 ? 42 GLY A HA3  1  
ATOM   636   N  N    . GLU A 1 43 ? 10.192  -3.901  -1.063  1.00 0.00 ? 43 GLU A N    1  
ATOM   637   C  CA   . GLU A 1 43 ? 10.026  -2.468  -0.860  1.00 0.00 ? 43 GLU A CA   1  
ATOM   638   C  C    . GLU A 1 43 ? 8.695   -2.173  -0.170  1.00 0.00 ? 43 GLU A C    1  
ATOM   639   O  O    . GLU A 1 43 ? 7.722   -1.781  -0.812  1.00 0.00 ? 43 GLU A O    1  
ATOM   640   C  CB   . GLU A 1 43 ? 10.106  -1.719  -2.196  1.00 0.00 ? 43 GLU A CB   1  
ATOM   641   C  CG   . GLU A 1 43 ? 11.527  -1.515  -2.698  1.00 0.00 ? 43 GLU A CG   1  
ATOM   642   C  CD   . GLU A 1 43 ? 12.407  -0.797  -1.690  1.00 0.00 ? 43 GLU A CD   1  
ATOM   643   O  OE1  . GLU A 1 43 ? 12.019  0.300   -1.231  1.00 0.00 ? 43 GLU A OE1  1  
ATOM   644   O  OE2  . GLU A 1 43 ? 13.485  -1.333  -1.359  1.00 0.00 ? 43 GLU A OE2  1  
ATOM   645   H  H    . GLU A 1 43 ? 10.172  -4.251  -1.977  1.00 0.00 ? 43 GLU A H    1  
ATOM   646   H  HA   . GLU A 1 43 ? 10.829  -2.133  -0.222  1.00 0.00 ? 43 GLU A HA   1  
ATOM   647   H  HB2  . GLU A 1 43 ? 9.561   -2.276  -2.944  1.00 0.00 ? 43 GLU A HB2  1  
ATOM   648   H  HB3  . GLU A 1 43 ? 9.647   -0.748  -2.081  1.00 0.00 ? 43 GLU A HB3  1  
ATOM   649   H  HG2  . GLU A 1 43 ? 11.961  -2.480  -2.908  1.00 0.00 ? 43 GLU A HG2  1  
ATOM   650   H  HG3  . GLU A 1 43 ? 11.493  -0.931  -3.606  1.00 0.00 ? 43 GLU A HG3  1  
ATOM   651   N  N    . ASP A 1 44 ? 8.666   -2.367  1.144   1.00 0.00 ? 44 ASP A N    1  
ATOM   652   C  CA   . ASP A 1 44 ? 7.465   -2.122  1.944   1.00 0.00 ? 44 ASP A CA   1  
ATOM   653   C  C    . ASP A 1 44 ? 7.515   -0.732  2.575   1.00 0.00 ? 44 ASP A C    1  
ATOM   654   O  O    . ASP A 1 44 ? 7.118   -0.546  3.728   1.00 0.00 ? 44 ASP A O    1  
ATOM   655   C  CB   . ASP A 1 44 ? 7.314   -3.194  3.033   1.00 0.00 ? 44 ASP A CB   1  
ATOM   656   C  CG   . ASP A 1 44 ? 8.601   -3.464  3.797   1.00 0.00 ? 44 ASP A CG   1  
ATOM   657   O  OD1  . ASP A 1 44 ? 9.189   -2.508  4.345   1.00 0.00 ? 44 ASP A OD1  1  
ATOM   658   O  OD2  . ASP A 1 44 ? 9.012   -4.640  3.855   1.00 0.00 ? 44 ASP A OD2  1  
ATOM   659   H  H    . ASP A 1 44 ? 9.478   -2.681  1.587   1.00 0.00 ? 44 ASP A H    1  
ATOM   660   H  HA   . ASP A 1 44 ? 6.609   -2.171  1.285   1.00 0.00 ? 44 ASP A HA   1  
ATOM   661   H  HB2  . ASP A 1 44 ? 6.566   -2.871  3.740   1.00 0.00 ? 44 ASP A HB2  1  
ATOM   662   H  HB3  . ASP A 1 44 ? 6.992   -4.115  2.573   1.00 0.00 ? 44 ASP A HB3  1  
ATOM   663   N  N    . VAL A 1 45 ? 8.008   0.241   1.812   1.00 0.00 ? 45 VAL A N    1  
ATOM   664   C  CA   . VAL A 1 45 ? 8.113   1.609   2.297   1.00 0.00 ? 45 VAL A CA   1  
ATOM   665   C  C    . VAL A 1 45 ? 7.442   2.592   1.343   1.00 0.00 ? 45 VAL A C    1  
ATOM   666   O  O    . VAL A 1 45 ? 7.645   2.541   0.129   1.00 0.00 ? 45 VAL A O    1  
ATOM   667   C  CB   . VAL A 1 45 ? 9.586   2.023   2.510   1.00 0.00 ? 45 VAL A CB   1  
ATOM   668   C  CG1  . VAL A 1 45 ? 10.374  1.950   1.208   1.00 0.00 ? 45 VAL A CG1  1  
ATOM   669   C  CG2  . VAL A 1 45 ? 9.660   3.419   3.116   1.00 0.00 ? 45 VAL A CG2  1  
ATOM   670   H  H    . VAL A 1 45 ? 8.309   0.032   0.904   1.00 0.00 ? 45 VAL A H    1  
ATOM   671   H  HA   . VAL A 1 45 ? 7.611   1.655   3.251   1.00 0.00 ? 45 VAL A HA   1  
ATOM   672   H  HB   . VAL A 1 45 ? 10.031  1.332   3.209   1.00 0.00 ? 45 VAL A HB   1  
ATOM   673   H  HG11 . VAL A 1 45 ? 10.449  2.937   0.775   1.00 0.00 ? 45 VAL A HG11 1  
ATOM   674   H  HG12 . VAL A 1 45 ? 9.869   1.293   0.516   1.00 0.00 ? 45 VAL A HG12 1  
ATOM   675   H  HG13 . VAL A 1 45 ? 11.364  1.567   1.407   1.00 0.00 ? 45 VAL A HG13 1  
ATOM   676   H  HG21 . VAL A 1 45 ? 9.124   3.431   4.054   1.00 0.00 ? 45 VAL A HG21 1  
ATOM   677   H  HG22 . VAL A 1 45 ? 9.215   4.131   2.438   1.00 0.00 ? 45 VAL A HG22 1  
ATOM   678   H  HG23 . VAL A 1 45 ? 10.693  3.681   3.289   1.00 0.00 ? 45 VAL A HG23 1  
ATOM   679   N  N    . ALA A 1 46 ? 6.647   3.495   1.910   1.00 0.00 ? 46 ALA A N    1  
ATOM   680   C  CA   . ALA A 1 46 ? 5.951   4.505   1.126   1.00 0.00 ? 46 ALA A CA   1  
ATOM   681   C  C    . ALA A 1 46 ? 6.495   5.891   1.443   1.00 0.00 ? 46 ALA A C    1  
ATOM   682   O  O    . ALA A 1 46 ? 6.714   6.228   2.610   1.00 0.00 ? 46 ALA A O    1  
ATOM   683   C  CB   . ALA A 1 46 ? 4.453   4.444   1.387   1.00 0.00 ? 46 ALA A CB   1  
ATOM   684   H  H    . ALA A 1 46 ? 6.533   3.488   2.884   1.00 0.00 ? 46 ALA A H    1  
ATOM   685   H  HA   . ALA A 1 46 ? 6.121   4.292   0.081   1.00 0.00 ? 46 ALA A HA   1  
ATOM   686   H  HB1  . ALA A 1 46 ? 4.208   3.509   1.869   1.00 0.00 ? 46 ALA A HB1  1  
ATOM   687   H  HB2  . ALA A 1 46 ? 3.923   4.514   0.450   1.00 0.00 ? 46 ALA A HB2  1  
ATOM   688   H  HB3  . ALA A 1 46 ? 4.165   5.265   2.027   1.00 0.00 ? 46 ALA A HB3  1  
ATOM   689   N  N    . THR A 1 47 ? 6.720   6.686   0.402   1.00 0.00 ? 47 THR A N    1  
ATOM   690   C  CA   . THR A 1 47 ? 7.247   8.035   0.570   1.00 0.00 ? 47 THR A CA   1  
ATOM   691   C  C    . THR A 1 47 ? 6.267   9.071   0.026   1.00 0.00 ? 47 THR A C    1  
ATOM   692   O  O    . THR A 1 47 ? 5.754   8.931   -1.087  1.00 0.00 ? 47 THR A O    1  
ATOM   693   C  CB   . THR A 1 47 ? 8.607   8.169   -0.125  1.00 0.00 ? 47 THR A CB   1  
ATOM   694   O  OG1  . THR A 1 47 ? 9.321   6.940   -0.090  1.00 0.00 ? 47 THR A OG1  1  
ATOM   695   C  CG2  . THR A 1 47 ? 9.494   9.229   0.495   1.00 0.00 ? 47 THR A CG2  1  
ATOM   696   H  H    . THR A 1 47 ? 6.533   6.356   -0.502  1.00 0.00 ? 47 THR A H    1  
ATOM   697   H  HA   . THR A 1 47 ? 7.376   8.207   1.628   1.00 0.00 ? 47 THR A HA   1  
ATOM   698   H  HB   . THR A 1 47 ? 8.447   8.437   -1.160  1.00 0.00 ? 47 THR A HB   1  
ATOM   699   H  HG1  . THR A 1 47 ? 9.381   6.626   0.816   1.00 0.00 ? 47 THR A HG1  1  
ATOM   700   H  HG21 . THR A 1 47 ? 10.262  8.754   1.087   1.00 0.00 ? 47 THR A HG21 1  
ATOM   701   H  HG22 . THR A 1 47 ? 8.900   9.874   1.126   1.00 0.00 ? 47 THR A HG22 1  
ATOM   702   H  HG23 . THR A 1 47 ? 9.955   9.815   -0.288  1.00 0.00 ? 47 THR A HG23 1  
ATOM   703   N  N    . CYS A 1 48 ? 6.011   10.110  0.822   1.00 0.00 ? 48 CYS A N    1  
ATOM   704   C  CA   . CYS A 1 48 ? 5.094   11.173  0.427   1.00 0.00 ? 48 CYS A CA   1  
ATOM   705   C  C    . CYS A 1 48 ? 5.831   12.256  -0.356  1.00 0.00 ? 48 CYS A C    1  
ATOM   706   O  O    . CYS A 1 48 ? 6.937   12.652  0.012   1.00 0.00 ? 48 CYS A O    1  
ATOM   707   C  CB   . CYS A 1 48 ? 4.421   11.787  1.660   1.00 0.00 ? 48 CYS A CB   1  
ATOM   708   S  SG   . CYS A 1 48 ? 2.641   12.118  1.457   1.00 0.00 ? 48 CYS A SG   1  
ATOM   709   H  H    . CYS A 1 48 ? 6.451   10.161  1.697   1.00 0.00 ? 48 CYS A H    1  
ATOM   710   H  HA   . CYS A 1 48 ? 4.335   10.737  -0.205  1.00 0.00 ? 48 CYS A HA   1  
ATOM   711   H  HB2  . CYS A 1 48 ? 4.533   11.115  2.497   1.00 0.00 ? 48 CYS A HB2  1  
ATOM   712   H  HB3  . CYS A 1 48 ? 4.903   12.725  1.893   1.00 0.00 ? 48 CYS A HB3  1  
ATOM   713   N  N    . PRO A 1 49 ? 5.224   12.753  -1.449  1.00 0.00 ? 49 PRO A N    1  
ATOM   714   C  CA   . PRO A 1 49 ? 5.829   13.800  -2.282  1.00 0.00 ? 49 PRO A CA   1  
ATOM   715   C  C    . PRO A 1 49 ? 5.765   15.193  -1.641  1.00 0.00 ? 49 PRO A C    1  
ATOM   716   O  O    . PRO A 1 49 ? 6.311   16.154  -2.187  1.00 0.00 ? 49 PRO A O    1  
ATOM   717   C  CB   . PRO A 1 49 ? 4.988   13.757  -3.556  1.00 0.00 ? 49 PRO A CB   1  
ATOM   718   C  CG   . PRO A 1 49 ? 3.651   13.269  -3.113  1.00 0.00 ? 49 PRO A CG   1  
ATOM   719   C  CD   . PRO A 1 49 ? 3.900   12.338  -1.957  1.00 0.00 ? 49 PRO A CD   1  
ATOM   720   H  HA   . PRO A 1 49 ? 6.855   13.566  -2.519  1.00 0.00 ? 49 PRO A HA   1  
ATOM   721   H  HB2  . PRO A 1 49 ? 4.926   14.748  -3.984  1.00 0.00 ? 49 PRO A HB2  1  
ATOM   722   H  HB3  . PRO A 1 49 ? 5.439   13.080  -4.266  1.00 0.00 ? 49 PRO A HB3  1  
ATOM   723   H  HG2  . PRO A 1 49 ? 3.043   14.103  -2.796  1.00 0.00 ? 49 PRO A HG2  1  
ATOM   724   H  HG3  . PRO A 1 49 ? 3.167   12.740  -3.919  1.00 0.00 ? 49 PRO A HG3  1  
ATOM   725   H  HD2  . PRO A 1 49 ? 3.137   12.466  -1.200  1.00 0.00 ? 49 PRO A HD2  1  
ATOM   726   H  HD3  . PRO A 1 49 ? 3.925   11.313  -2.298  1.00 0.00 ? 49 PRO A HD3  1  
ATOM   727   N  N    . SER A 1 50 ? 5.094   15.299  -0.488  1.00 0.00 ? 50 SER A N    1  
ATOM   728   C  CA   . SER A 1 50 ? 4.966   16.574  0.209   1.00 0.00 ? 50 SER A CA   1  
ATOM   729   C  C    . SER A 1 50 ? 5.786   16.581  1.499   1.00 0.00 ? 50 SER A C    1  
ATOM   730   O  O    . SER A 1 50 ? 6.778   17.306  1.603   1.00 0.00 ? 50 SER A O    1  
ATOM   731   C  CB   . SER A 1 50 ? 3.494   16.862  0.515   1.00 0.00 ? 50 SER A CB   1  
ATOM   732   O  OG   . SER A 1 50 ? 2.793   17.233  -0.660  1.00 0.00 ? 50 SER A OG   1  
ATOM   733   H  H    . SER A 1 50 ? 4.676   14.505  -0.101  1.00 0.00 ? 50 SER A H    1  
ATOM   734   H  HA   . SER A 1 50 ? 5.343   17.346  -0.444  1.00 0.00 ? 50 SER A HA   1  
ATOM   735   H  HB2  . SER A 1 50 ? 3.034   15.976  0.928   1.00 0.00 ? 50 SER A HB2  1  
ATOM   736   H  HB3  . SER A 1 50 ? 3.428   17.668  1.231   1.00 0.00 ? 50 SER A HB3  1  
ATOM   737   H  HG   . SER A 1 50 ? 2.590   16.447  -1.173  1.00 0.00 ? 50 SER A HG   1  
ATOM   738   N  N    . CYS A 1 51 ? 5.371   15.775  2.479   1.00 0.00 ? 51 CYS A N    1  
ATOM   739   C  CA   . CYS A 1 51 ? 6.078   15.701  3.758   1.00 0.00 ? 51 CYS A CA   1  
ATOM   740   C  C    . CYS A 1 51 ? 7.398   14.937  3.631   1.00 0.00 ? 51 CYS A C    1  
ATOM   741   O  O    . CYS A 1 51 ? 8.332   15.173  4.403   1.00 0.00 ? 51 CYS A O    1  
ATOM   742   C  CB   . CYS A 1 51 ? 5.197   15.047  4.825   1.00 0.00 ? 51 CYS A CB   1  
ATOM   743   S  SG   . CYS A 1 51 ? 4.811   13.292  4.510   1.00 0.00 ? 51 CYS A SG   1  
ATOM   744   H  H    . CYS A 1 51 ? 4.575   15.218  2.338   1.00 0.00 ? 51 CYS A H    1  
ATOM   745   H  HA   . CYS A 1 51 ? 6.299   16.713  4.065   1.00 0.00 ? 51 CYS A HA   1  
ATOM   746   H  HB2  . CYS A 1 51 ? 5.700   15.108  5.780   1.00 0.00 ? 51 CYS A HB2  1  
ATOM   747   H  HB3  . CYS A 1 51 ? 4.261   15.583  4.885   1.00 0.00 ? 51 CYS A HB3  1  
ATOM   748   N  N    . SER A 1 52 ? 7.467   14.017  2.664   1.00 0.00 ? 52 SER A N    1  
ATOM   749   C  CA   . SER A 1 52 ? 8.670   13.214  2.440   1.00 0.00 ? 52 SER A CA   1  
ATOM   750   C  C    . SER A 1 52 ? 8.946   12.300  3.636   1.00 0.00 ? 52 SER A C    1  
ATOM   751   O  O    . SER A 1 52 ? 10.097  12.126  4.047   1.00 0.00 ? 52 SER A O    1  
ATOM   752   C  CB   . SER A 1 52 ? 9.877   14.119  2.173   1.00 0.00 ? 52 SER A CB   1  
ATOM   753   O  OG   . SER A 1 52 ? 9.566   15.124  1.222   1.00 0.00 ? 52 SER A OG   1  
ATOM   754   H  H    . SER A 1 52 ? 6.689   13.871  2.088   1.00 0.00 ? 52 SER A H    1  
ATOM   755   H  HA   . SER A 1 52 ? 8.496   12.598  1.570   1.00 0.00 ? 52 SER A HA   1  
ATOM   756   H  HB2  . SER A 1 52 ? 10.180  14.594  3.093   1.00 0.00 ? 52 SER A HB2  1  
ATOM   757   H  HB3  . SER A 1 52 ? 10.694  13.523  1.792   1.00 0.00 ? 52 SER A HB3  1  
ATOM   758   H  HG   . SER A 1 52 ? 9.541   15.980  1.657   1.00 0.00 ? 52 SER A HG   1  
ATOM   759   N  N    . LEU A 1 53 ? 7.883   11.716  4.186   1.00 0.00 ? 53 LEU A N    1  
ATOM   760   C  CA   . LEU A 1 53 ? 8.002   10.817  5.329   1.00 0.00 ? 53 LEU A CA   1  
ATOM   761   C  C    . LEU A 1 53 ? 8.108   9.367   4.867   1.00 0.00 ? 53 LEU A C    1  
ATOM   762   O  O    . LEU A 1 53 ? 8.094   9.086   3.666   1.00 0.00 ? 53 LEU A O    1  
ATOM   763   C  CB   . LEU A 1 53 ? 6.798   10.983  6.263   1.00 0.00 ? 53 LEU A CB   1  
ATOM   764   C  CG   . LEU A 1 53 ? 6.922   12.108  7.294   1.00 0.00 ? 53 LEU A CG   1  
ATOM   765   C  CD1  . LEU A 1 53 ? 5.545   12.552  7.766   1.00 0.00 ? 53 LEU A CD1  1  
ATOM   766   C  CD2  . LEU A 1 53 ? 7.776   11.664  8.474   1.00 0.00 ? 53 LEU A CD2  1  
ATOM   767   H  H    . LEU A 1 53 ? 6.994   11.890  3.810   1.00 0.00 ? 53 LEU A H    1  
ATOM   768   H  HA   . LEU A 1 53 ? 8.903   11.080  5.865   1.00 0.00 ? 53 LEU A HA   1  
ATOM   769   H  HB2  . LEU A 1 53 ? 5.924   11.174  5.657   1.00 0.00 ? 53 LEU A HB2  1  
ATOM   770   H  HB3  . LEU A 1 53 ? 6.649   10.056  6.795   1.00 0.00 ? 53 LEU A HB3  1  
ATOM   771   H  HG   . LEU A 1 53 ? 7.404   12.958  6.832   1.00 0.00 ? 53 LEU A HG   1  
ATOM   772   H  HD11 . LEU A 1 53 ? 4.813   12.324  7.003   1.00 0.00 ? 53 LEU A HD11 1  
ATOM   773   H  HD12 . LEU A 1 53 ? 5.553   13.616  7.948   1.00 0.00 ? 53 LEU A HD12 1  
ATOM   774   H  HD13 . LEU A 1 53 ? 5.289   12.031  8.676   1.00 0.00 ? 53 LEU A HD13 1  
ATOM   775   H  HD21 . LEU A 1 53 ? 8.789   11.495  8.143   1.00 0.00 ? 53 LEU A HD21 1  
ATOM   776   H  HD22 . LEU A 1 53 ? 7.374   10.749  8.885   1.00 0.00 ? 53 LEU A HD22 1  
ATOM   777   H  HD23 . LEU A 1 53 ? 7.767   12.432  9.233   1.00 0.00 ? 53 LEU A HD23 1  
ATOM   778   N  N    . ILE A 1 54 ? 8.212   8.447   5.825   1.00 0.00 ? 54 ILE A N    1  
ATOM   779   C  CA   . ILE A 1 54 ? 8.318   7.025   5.515   1.00 0.00 ? 54 ILE A CA   1  
ATOM   780   C  C    . ILE A 1 54 ? 7.304   6.212   6.318   1.00 0.00 ? 54 ILE A C    1  
ATOM   781   O  O    . ILE A 1 54 ? 7.038   6.514   7.482   1.00 0.00 ? 54 ILE A O    1  
ATOM   782   C  CB   . ILE A 1 54 ? 9.738   6.487   5.809   1.00 0.00 ? 54 ILE A CB   1  
ATOM   783   C  CG1  . ILE A 1 54 ? 10.200  6.917   7.208   1.00 0.00 ? 54 ILE A CG1  1  
ATOM   784   C  CG2  . ILE A 1 54 ? 10.721  6.969   4.750   1.00 0.00 ? 54 ILE A CG2  1  
ATOM   785   C  CD1  . ILE A 1 54 ? 11.590  6.437   7.564   1.00 0.00 ? 54 ILE A CD1  1  
ATOM   786   H  H    . ILE A 1 54 ? 8.217   8.732   6.763   1.00 0.00 ? 54 ILE A H    1  
ATOM   787   H  HA   . ILE A 1 54 ? 8.116   6.895   4.461   1.00 0.00 ? 54 ILE A HA   1  
ATOM   788   H  HB   . ILE A 1 54 ? 9.704   5.409   5.765   1.00 0.00 ? 54 ILE A HB   1  
ATOM   789   H  HG12 . ILE A 1 54 ? 10.201  7.994   7.265   1.00 0.00 ? 54 ILE A HG12 1  
ATOM   790   H  HG13 . ILE A 1 54 ? 9.514   6.522   7.943   1.00 0.00 ? 54 ILE A HG13 1  
ATOM   791   H  HG21 . ILE A 1 54 ? 11.707  6.587   4.973   1.00 0.00 ? 54 ILE A HG21 1  
ATOM   792   H  HG22 . ILE A 1 54 ? 10.748  8.049   4.746   1.00 0.00 ? 54 ILE A HG22 1  
ATOM   793   H  HG23 . ILE A 1 54 ? 10.409  6.614   3.778   1.00 0.00 ? 54 ILE A HG23 1  
ATOM   794   H  HD11 . ILE A 1 54 ? 11.694  6.392   8.638   1.00 0.00 ? 54 ILE A HD11 1  
ATOM   795   H  HD12 . ILE A 1 54 ? 12.322  7.122   7.161   1.00 0.00 ? 54 ILE A HD12 1  
ATOM   796   H  HD13 . ILE A 1 54 ? 11.750  5.454   7.146   1.00 0.00 ? 54 ILE A HD13 1  
ATOM   797   N  N    . ILE A 1 55 ? 6.752   5.173   5.693   1.00 0.00 ? 55 ILE A N    1  
ATOM   798   C  CA   . ILE A 1 55 ? 5.775   4.306   6.354   1.00 0.00 ? 55 ILE A CA   1  
ATOM   799   C  C    . ILE A 1 55 ? 5.952   2.854   5.918   1.00 0.00 ? 55 ILE A C    1  
ATOM   800   O  O    . ILE A 1 55 ? 6.277   2.580   4.761   1.00 0.00 ? 55 ILE A O    1  
ATOM   801   C  CB   . ILE A 1 55 ? 4.319   4.742   6.072   1.00 0.00 ? 55 ILE A CB   1  
ATOM   802   C  CG1  . ILE A 1 55 ? 4.050   4.802   4.565   1.00 0.00 ? 55 ILE A CG1  1  
ATOM   803   C  CG2  . ILE A 1 55 ? 4.024   6.085   6.723   1.00 0.00 ? 55 ILE A CG2  1  
ATOM   804   C  CD1  . ILE A 1 55 ? 2.605   4.533   4.200   1.00 0.00 ? 55 ILE A CD1  1  
ATOM   805   H  H    . ILE A 1 55 ? 7.012   4.978   4.768   1.00 0.00 ? 55 ILE A H    1  
ATOM   806   H  HA   . ILE A 1 55 ? 5.947   4.371   7.419   1.00 0.00 ? 55 ILE A HA   1  
ATOM   807   H  HB   . ILE A 1 55 ? 3.662   4.008   6.516   1.00 0.00 ? 55 ILE A HB   1  
ATOM   808   H  HG12 . ILE A 1 55 ? 4.307   5.784   4.198   1.00 0.00 ? 55 ILE A HG12 1  
ATOM   809   H  HG13 . ILE A 1 55 ? 4.659   4.066   4.065   1.00 0.00 ? 55 ILE A HG13 1  
ATOM   810   H  HG21 . ILE A 1 55 ? 4.123   5.996   7.794   1.00 0.00 ? 55 ILE A HG21 1  
ATOM   811   H  HG22 . ILE A 1 55 ? 3.018   6.390   6.478   1.00 0.00 ? 55 ILE A HG22 1  
ATOM   812   H  HG23 . ILE A 1 55 ? 4.722   6.824   6.357   1.00 0.00 ? 55 ILE A HG23 1  
ATOM   813   H  HD11 . ILE A 1 55 ? 2.184   3.820   4.893   1.00 0.00 ? 55 ILE A HD11 1  
ATOM   814   H  HD12 . ILE A 1 55 ? 2.555   4.133   3.198   1.00 0.00 ? 55 ILE A HD12 1  
ATOM   815   H  HD13 . ILE A 1 55 ? 2.045   5.454   4.247   1.00 0.00 ? 55 ILE A HD13 1  
ATOM   816   N  N    . LYS A 1 56 ? 5.745   1.929   6.852   1.00 0.00 ? 56 LYS A N    1  
ATOM   817   C  CA   . LYS A 1 56 ? 5.890   0.507   6.560   1.00 0.00 ? 56 LYS A CA   1  
ATOM   818   C  C    . LYS A 1 56 ? 4.577   -0.107  6.117   1.00 0.00 ? 56 LYS A C    1  
ATOM   819   O  O    . LYS A 1 56 ? 3.521   0.148   6.699   1.00 0.00 ? 56 LYS A O    1  
ATOM   820   C  CB   . LYS A 1 56 ? 6.435   -0.242  7.779   1.00 0.00 ? 56 LYS A CB   1  
ATOM   821   C  CG   . LYS A 1 56 ? 7.503   -1.268  7.436   1.00 0.00 ? 56 LYS A CG   1  
ATOM   822   C  CD   . LYS A 1 56 ? 6.908   -2.497  6.766   1.00 0.00 ? 56 LYS A CD   1  
ATOM   823   C  CE   . LYS A 1 56 ? 7.830   -3.699  6.898   1.00 0.00 ? 56 LYS A CE   1  
ATOM   824   N  NZ   . LYS A 1 56 ? 7.289   -4.899  6.199   1.00 0.00 ? 56 LYS A NZ   1  
ATOM   825   H  H    . LYS A 1 56 ? 5.493   2.209   7.758   1.00 0.00 ? 56 LYS A H    1  
ATOM   826   H  HA   . LYS A 1 56 ? 6.590   0.408   5.747   1.00 0.00 ? 56 LYS A HA   1  
ATOM   827   H  HB2  . LYS A 1 56 ? 6.863   0.474   8.466   1.00 0.00 ? 56 LYS A HB2  1  
ATOM   828   H  HB3  . LYS A 1 56 ? 5.618   -0.753  8.268   1.00 0.00 ? 56 LYS A HB3  1  
ATOM   829   H  HG2  . LYS A 1 56 ? 8.218   -0.818  6.766   1.00 0.00 ? 56 LYS A HG2  1  
ATOM   830   H  HG3  . LYS A 1 56 ? 8.000   -1.569  8.347   1.00 0.00 ? 56 LYS A HG3  1  
ATOM   831   H  HD2  . LYS A 1 56 ? 5.960   -2.729  7.230   1.00 0.00 ? 56 LYS A HD2  1  
ATOM   832   H  HD3  . LYS A 1 56 ? 6.758   -2.285  5.719   1.00 0.00 ? 56 LYS A HD3  1  
ATOM   833   H  HE2  . LYS A 1 56 ? 8.790   -3.447  6.470   1.00 0.00 ? 56 LYS A HE2  1  
ATOM   834   H  HE3  . LYS A 1 56 ? 7.954   -3.928  7.946   1.00 0.00 ? 56 LYS A HE3  1  
ATOM   835   H  HZ1  . LYS A 1 56 ? 8.064   -5.423  5.740   1.00 0.00 ? 56 LYS A HZ1  1  
ATOM   836   H  HZ2  . LYS A 1 56 ? 6.602   -4.613  5.471   1.00 0.00 ? 56 LYS A HZ2  1  
ATOM   837   H  HZ3  . LYS A 1 56 ? 6.816   -5.528  6.878   1.00 0.00 ? 56 LYS A HZ3  1  
ATOM   838   N  N    . VAL A 1 57 ? 4.660   -0.921  5.072   1.00 0.00 ? 57 VAL A N    1  
ATOM   839   C  CA   . VAL A 1 57 ? 3.495   -1.585  4.520   1.00 0.00 ? 57 VAL A CA   1  
ATOM   840   C  C    . VAL A 1 57 ? 3.535   -3.082  4.809   1.00 0.00 ? 57 VAL A C    1  
ATOM   841   O  O    . VAL A 1 57 ? 4.411   -3.796  4.318   1.00 0.00 ? 57 VAL A O    1  
ATOM   842   C  CB   . VAL A 1 57 ? 3.380   -1.354  2.996   1.00 0.00 ? 57 VAL A CB   1  
ATOM   843   C  CG1  . VAL A 1 57 ? 1.923   -1.232  2.606   1.00 0.00 ? 57 VAL A CG1  1  
ATOM   844   C  CG2  . VAL A 1 57 ? 4.149   -0.110  2.564   1.00 0.00 ? 57 VAL A CG2  1  
ATOM   845   H  H    . VAL A 1 57 ? 5.536   -1.074  4.656   1.00 0.00 ? 57 VAL A H    1  
ATOM   846   H  HA   . VAL A 1 57 ? 2.619   -1.162  4.992   1.00 0.00 ? 57 VAL A HA   1  
ATOM   847   H  HB   . VAL A 1 57 ? 3.805   -2.209  2.484   1.00 0.00 ? 57 VAL A HB   1  
ATOM   848   H  HG11 . VAL A 1 57 ? 1.414   -2.160  2.813   1.00 0.00 ? 57 VAL A HG11 1  
ATOM   849   H  HG12 . VAL A 1 57 ? 1.849   -1.003  1.554   1.00 0.00 ? 57 VAL A HG12 1  
ATOM   850   H  HG13 . VAL A 1 57 ? 1.472   -0.438  3.181   1.00 0.00 ? 57 VAL A HG13 1  
ATOM   851   H  HG21 . VAL A 1 57 ? 3.630   0.368   1.746   1.00 0.00 ? 57 VAL A HG21 1  
ATOM   852   H  HG22 . VAL A 1 57 ? 5.139   -0.393  2.243   1.00 0.00 ? 57 VAL A HG22 1  
ATOM   853   H  HG23 . VAL A 1 57 ? 4.221   0.578   3.394   1.00 0.00 ? 57 VAL A HG23 1  
ATOM   854   N  N    . ILE A 1 58 ? 2.583   -3.551  5.614   1.00 0.00 ? 58 ILE A N    1  
ATOM   855   C  CA   . ILE A 1 58 ? 2.506   -4.964  5.973   1.00 0.00 ? 58 ILE A CA   1  
ATOM   856   C  C    . ILE A 1 58 ? 1.586   -5.714  5.016   1.00 0.00 ? 58 ILE A C    1  
ATOM   857   O  O    . ILE A 1 58 ? 0.504   -5.235  4.682   1.00 0.00 ? 58 ILE A O    1  
ATOM   858   C  CB   . ILE A 1 58 ? 2.003   -5.158  7.418   1.00 0.00 ? 58 ILE A CB   1  
ATOM   859   C  CG1  . ILE A 1 58 ? 2.784   -4.259  8.385   1.00 0.00 ? 58 ILE A CG1  1  
ATOM   860   C  CG2  . ILE A 1 58 ? 2.116   -6.620  7.834   1.00 0.00 ? 58 ILE A CG2  1  
ATOM   861   C  CD1  . ILE A 1 58 ? 4.265   -4.569  8.441   1.00 0.00 ? 58 ILE A CD1  1  
ATOM   862   H  H    . ILE A 1 58 ? 1.914   -2.930  5.976   1.00 0.00 ? 58 ILE A H    1  
ATOM   863   H  HA   . ILE A 1 58 ? 3.501   -5.381  5.901   1.00 0.00 ? 58 ILE A HA   1  
ATOM   864   H  HB   . ILE A 1 58 ? 0.958   -4.883  7.450   1.00 0.00 ? 58 ILE A HB   1  
ATOM   865   H  HG12 . ILE A 1 58 ? 2.673   -3.230  8.077   1.00 0.00 ? 58 ILE A HG12 1  
ATOM   866   H  HG13 . ILE A 1 58 ? 2.381   -4.378  9.380   1.00 0.00 ? 58 ILE A HG13 1  
ATOM   867   H  HG21 . ILE A 1 58 ? 1.511   -6.792  8.711   1.00 0.00 ? 58 ILE A HG21 1  
ATOM   868   H  HG22 . ILE A 1 58 ? 3.147   -6.852  8.057   1.00 0.00 ? 58 ILE A HG22 1  
ATOM   869   H  HG23 . ILE A 1 58 ? 1.771   -7.251  7.028   1.00 0.00 ? 58 ILE A HG23 1  
ATOM   870   H  HD11 . ILE A 1 58 ? 4.686   -4.505  7.448   1.00 0.00 ? 58 ILE A HD11 1  
ATOM   871   H  HD12 . ILE A 1 58 ? 4.410   -5.566  8.829   1.00 0.00 ? 58 ILE A HD12 1  
ATOM   872   H  HD13 . ILE A 1 58 ? 4.758   -3.856  9.086   1.00 0.00 ? 58 ILE A HD13 1  
ATOM   873   N  N    . TYR A 1 59 ? 2.028   -6.887  4.570   1.00 0.00 ? 59 TYR A N    1  
ATOM   874   C  CA   . TYR A 1 59 ? 1.248   -7.697  3.636   1.00 0.00 ? 59 TYR A CA   1  
ATOM   875   C  C    . TYR A 1 59 ? 1.657   -9.168  3.708   1.00 0.00 ? 59 TYR A C    1  
ATOM   876   O  O    . TYR A 1 59 ? 2.577   -9.533  4.446   1.00 0.00 ? 59 TYR A O    1  
ATOM   877   C  CB   . TYR A 1 59 ? 1.445   -7.176  2.206   1.00 0.00 ? 59 TYR A CB   1  
ATOM   878   C  CG   . TYR A 1 59 ? 2.897   -6.962  1.846   1.00 0.00 ? 59 TYR A CG   1  
ATOM   879   C  CD1  . TYR A 1 59 ? 3.537   -5.773  2.163   1.00 0.00 ? 59 TYR A CD1  1  
ATOM   880   C  CD2  . TYR A 1 59 ? 3.632   -7.952  1.205   1.00 0.00 ? 59 TYR A CD2  1  
ATOM   881   C  CE1  . TYR A 1 59 ? 4.864   -5.573  1.853   1.00 0.00 ? 59 TYR A CE1  1  
ATOM   882   C  CE2  . TYR A 1 59 ? 4.962   -7.761  0.895   1.00 0.00 ? 59 TYR A CE2  1  
ATOM   883   C  CZ   . TYR A 1 59 ? 5.575   -6.567  1.222   1.00 0.00 ? 59 TYR A CZ   1  
ATOM   884   O  OH   . TYR A 1 59 ? 6.904   -6.364  0.922   1.00 0.00 ? 59 TYR A OH   1  
ATOM   885   H  H    . TYR A 1 59 ? 2.904   -7.212  4.866   1.00 0.00 ? 59 TYR A H    1  
ATOM   886   H  HA   . TYR A 1 59 ? 0.206   -7.608  3.904   1.00 0.00 ? 59 TYR A HA   1  
ATOM   887   H  HB2  . TYR A 1 59 ? 1.030   -7.886  1.508   1.00 0.00 ? 59 TYR A HB2  1  
ATOM   888   H  HB3  . TYR A 1 59 ? 0.932   -6.230  2.100   1.00 0.00 ? 59 TYR A HB3  1  
ATOM   889   H  HD1  . TYR A 1 59 ? 2.979   -4.992  2.661   1.00 0.00 ? 59 TYR A HD1  1  
ATOM   890   H  HD2  . TYR A 1 59 ? 3.151   -8.884  0.950   1.00 0.00 ? 59 TYR A HD2  1  
ATOM   891   H  HE1  . TYR A 1 59 ? 5.338   -4.640  2.107   1.00 0.00 ? 59 TYR A HE1  1  
ATOM   892   H  HE2  . TYR A 1 59 ? 5.517   -8.544  0.395   1.00 0.00 ? 59 TYR A HE2  1  
ATOM   893   H  HH   . TYR A 1 59 ? 7.366   -7.205  0.916   1.00 0.00 ? 59 TYR A HH   1  
ATOM   894   N  N    . ASP A 1 60 ? 0.979   -10.008 2.927   1.00 0.00 ? 60 ASP A N    1  
ATOM   895   C  CA   . ASP A 1 60 ? 1.282   -11.432 2.891   1.00 0.00 ? 60 ASP A CA   1  
ATOM   896   C  C    . ASP A 1 60 ? 2.316   -11.732 1.808   1.00 0.00 ? 60 ASP A C    1  
ATOM   897   O  O    . ASP A 1 60 ? 1.994   -11.750 0.618   1.00 0.00 ? 60 ASP A O    1  
ATOM   898   C  CB   . ASP A 1 60 ? 0.009   -12.247 2.640   1.00 0.00 ? 60 ASP A CB   1  
ATOM   899   C  CG   . ASP A 1 60 ? 0.112   -13.664 3.173   1.00 0.00 ? 60 ASP A CG   1  
ATOM   900   O  OD1  . ASP A 1 60 ? 1.091   -14.360 2.828   1.00 0.00 ? 60 ASP A OD1  1  
ATOM   901   O  OD2  . ASP A 1 60 ? -0.788  -14.081 3.931   1.00 0.00 ? 60 ASP A OD2  1  
ATOM   902   H  H    . ASP A 1 60 ? 0.264   -9.657  2.354   1.00 0.00 ? 60 ASP A H    1  
ATOM   903   H  HA   . ASP A 1 60 ? 1.693   -11.708 3.851   1.00 0.00 ? 60 ASP A HA   1  
ATOM   904   H  HB2  . ASP A 1 60 ? -0.824  -11.762 3.126   1.00 0.00 ? 60 ASP A HB2  1  
ATOM   905   H  HB3  . ASP A 1 60 ? -0.179  -12.294 1.577   1.00 0.00 ? 60 ASP A HB3  1  
ATOM   906   N  N    . LYS A 1 61 ? 3.560   -11.974 2.226   1.00 0.00 ? 61 LYS A N    1  
ATOM   907   C  CA   . LYS A 1 61 ? 4.641   -12.282 1.288   1.00 0.00 ? 61 LYS A CA   1  
ATOM   908   C  C    . LYS A 1 61 ? 4.323   -13.546 0.490   1.00 0.00 ? 61 LYS A C    1  
ATOM   909   O  O    . LYS A 1 61 ? 4.712   -13.665 -0.671  1.00 0.00 ? 61 LYS A O    1  
ATOM   910   C  CB   . LYS A 1 61 ? 5.968   -12.458 2.029   1.00 0.00 ? 61 LYS A CB   1  
ATOM   911   C  CG   . LYS A 1 61 ? 6.511   -11.169 2.623   1.00 0.00 ? 61 LYS A CG   1  
ATOM   912   C  CD   . LYS A 1 61 ? 7.543   -10.522 1.708   1.00 0.00 ? 61 LYS A CD   1  
ATOM   913   C  CE   . LYS A 1 61 ? 8.654   -9.847  2.502   1.00 0.00 ? 61 LYS A CE   1  
ATOM   914   N  NZ   . LYS A 1 61 ? 9.346   -10.799 3.418   1.00 0.00 ? 61 LYS A NZ   1  
ATOM   915   H  H    . LYS A 1 61 ? 3.754   -11.949 3.188   1.00 0.00 ? 61 LYS A H    1  
ATOM   916   H  HA   . LYS A 1 61 ? 4.728   -11.452 0.603   1.00 0.00 ? 61 LYS A HA   1  
ATOM   917   H  HB2  . LYS A 1 61 ? 5.829   -13.167 2.829   1.00 0.00 ? 61 LYS A HB2  1  
ATOM   918   H  HB3  . LYS A 1 61 ? 6.702   -12.847 1.337   1.00 0.00 ? 61 LYS A HB3  1  
ATOM   919   H  HG2  . LYS A 1 61 ? 5.694   -10.478 2.771   1.00 0.00 ? 61 LYS A HG2  1  
ATOM   920   H  HG3  . LYS A 1 61 ? 6.973   -11.391 3.574   1.00 0.00 ? 61 LYS A HG3  1  
ATOM   921   H  HD2  . LYS A 1 61 ? 7.978   -11.282 1.077   1.00 0.00 ? 61 LYS A HD2  1  
ATOM   922   H  HD3  . LYS A 1 61 ? 7.051   -9.780  1.094   1.00 0.00 ? 61 LYS A HD3  1  
ATOM   923   H  HE2  . LYS A 1 61 ? 9.376   -9.440  1.809   1.00 0.00 ? 61 LYS A HE2  1  
ATOM   924   H  HE3  . LYS A 1 61 ? 8.225   -9.045  3.085   1.00 0.00 ? 61 LYS A HE3  1  
ATOM   925   H  HZ1  . LYS A 1 61 ? 8.852   -10.838 4.332   1.00 0.00 ? 61 LYS A HZ1  1  
ATOM   926   H  HZ2  . LYS A 1 61 ? 10.327  -10.490 3.580   1.00 0.00 ? 61 LYS A HZ2  1  
ATOM   927   H  HZ3  . LYS A 1 61 ? 9.360   -11.752 3.003   1.00 0.00 ? 61 LYS A HZ3  1  
ATOM   928   N  N    . ASP A 1 62 ? 3.605   -14.481 1.116   1.00 0.00 ? 62 ASP A N    1  
ATOM   929   C  CA   . ASP A 1 62 ? 3.225   -15.730 0.456   1.00 0.00 ? 62 ASP A CA   1  
ATOM   930   C  C    . ASP A 1 62 ? 2.276   -15.456 -0.713  1.00 0.00 ? 62 ASP A C    1  
ATOM   931   O  O    . ASP A 1 62 ? 2.333   -16.134 -1.740  1.00 0.00 ? 62 ASP A O    1  
ATOM   932   C  CB   . ASP A 1 62 ? 2.563   -16.682 1.455   1.00 0.00 ? 62 ASP A CB   1  
ATOM   933   C  CG   . ASP A 1 62 ? 2.871   -18.137 1.160   1.00 0.00 ? 62 ASP A CG   1  
ATOM   934   O  OD1  . ASP A 1 62 ? 4.019   -18.564 1.412   1.00 0.00 ? 62 ASP A OD1  1  
ATOM   935   O  OD2  . ASP A 1 62 ? 1.967   -18.850 0.678   1.00 0.00 ? 62 ASP A OD2  1  
ATOM   936   H  H    . ASP A 1 62 ? 3.317   -14.325 2.041   1.00 0.00 ? 62 ASP A H    1  
ATOM   937   H  HA   . ASP A 1 62 ? 4.124   -16.190 0.074   1.00 0.00 ? 62 ASP A HA   1  
ATOM   938   H  HB2  . ASP A 1 62 ? 2.916   -16.455 2.450   1.00 0.00 ? 62 ASP A HB2  1  
ATOM   939   H  HB3  . ASP A 1 62 ? 1.492   -16.546 1.419   1.00 0.00 ? 62 ASP A HB3  1  
ATOM   940   N  N    . GLN A 1 63 ? 1.412   -14.451 -0.551  1.00 0.00 ? 63 GLN A N    1  
ATOM   941   C  CA   . GLN A 1 63 ? 0.457   -14.078 -1.591  1.00 0.00 ? 63 GLN A CA   1  
ATOM   942   C  C    . GLN A 1 63 ? 1.129   -13.231 -2.673  1.00 0.00 ? 63 GLN A C    1  
ATOM   943   O  O    . GLN A 1 63 ? 0.949   -13.479 -3.866  1.00 0.00 ? 63 GLN A O    1  
ATOM   944   C  CB   . GLN A 1 63 ? -0.718  -13.307 -0.984  1.00 0.00 ? 63 GLN A CB   1  
ATOM   945   C  CG   . GLN A 1 63 ? -1.686  -14.177 -0.195  1.00 0.00 ? 63 GLN A CG   1  
ATOM   946   C  CD   . GLN A 1 63 ? -2.948  -14.506 -0.973  1.00 0.00 ? 63 GLN A CD   1  
ATOM   947   O  OE1  . GLN A 1 63 ? -3.094  -15.609 -1.500  1.00 0.00 ? 63 GLN A OE1  1  
ATOM   948   N  NE2  . GLN A 1 63 ? -3.867  -13.549 -1.051  1.00 0.00 ? 63 GLN A NE2  1  
ATOM   949   H  H    . GLN A 1 63 ? 1.422   -13.946 0.291   1.00 0.00 ? 63 GLN A H    1  
ATOM   950   H  HA   . GLN A 1 63 ? 0.086   -14.987 -2.040  1.00 0.00 ? 63 GLN A HA   1  
ATOM   951   H  HB2  . GLN A 1 63 ? -0.330  -12.548 -0.321  1.00 0.00 ? 63 GLN A HB2  1  
ATOM   952   H  HB3  . GLN A 1 63 ? -1.266  -12.829 -1.783  1.00 0.00 ? 63 GLN A HB3  1  
ATOM   953   H  HG2  . GLN A 1 63 ? -1.191  -15.100 0.066   1.00 0.00 ? 63 GLN A HG2  1  
ATOM   954   H  HG3  . GLN A 1 63 ? -1.965  -13.653 0.707   1.00 0.00 ? 63 GLN A HG3  1  
ATOM   955   H  HE21 . GLN A 1 63 ? -3.688  -12.694 -0.608  1.00 0.00 ? 63 GLN A HE21 1  
ATOM   956   H  HE22 . GLN A 1 63 ? -4.690  -13.739 -1.550  1.00 0.00 ? 63 GLN A HE22 1  
ATOM   957   N  N    . PHE A 1 64 ? 1.899   -12.225 -2.247  1.00 0.00 ? 64 PHE A N    1  
ATOM   958   C  CA   . PHE A 1 64 ? 2.596   -11.335 -3.179  1.00 0.00 ? 64 PHE A CA   1  
ATOM   959   C  C    . PHE A 1 64 ? 3.628   -12.098 -4.011  1.00 0.00 ? 64 PHE A C    1  
ATOM   960   O  O    . PHE A 1 64 ? 3.735   -11.887 -5.219  1.00 0.00 ? 64 PHE A O    1  
ATOM   961   C  CB   . PHE A 1 64 ? 3.277   -10.193 -2.420  1.00 0.00 ? 64 PHE A CB   1  
ATOM   962   C  CG   . PHE A 1 64 ? 2.363   -9.030  -2.151  1.00 0.00 ? 64 PHE A CG   1  
ATOM   963   C  CD1  . PHE A 1 64 ? 1.364   -9.122  -1.195  1.00 0.00 ? 64 PHE A CD1  1  
ATOM   964   C  CD2  . PHE A 1 64 ? 2.498   -7.845  -2.859  1.00 0.00 ? 64 PHE A CD2  1  
ATOM   965   C  CE1  . PHE A 1 64 ? 0.519   -8.058  -0.950  1.00 0.00 ? 64 PHE A CE1  1  
ATOM   966   C  CE2  . PHE A 1 64 ? 1.655   -6.778  -2.618  1.00 0.00 ? 64 PHE A CE2  1  
ATOM   967   C  CZ   . PHE A 1 64 ? 0.664   -6.884  -1.662  1.00 0.00 ? 64 PHE A CZ   1  
ATOM   968   H  H    . PHE A 1 64 ? 1.997   -12.076 -1.283  1.00 0.00 ? 64 PHE A H    1  
ATOM   969   H  HA   . PHE A 1 64 ? 1.855   -10.916 -3.847  1.00 0.00 ? 64 PHE A HA   1  
ATOM   970   H  HB2  . PHE A 1 64 ? 3.636   -10.563 -1.471  1.00 0.00 ? 64 PHE A HB2  1  
ATOM   971   H  HB3  . PHE A 1 64 ? 4.114   -9.835  -3.001  1.00 0.00 ? 64 PHE A HB3  1  
ATOM   972   H  HD1  . PHE A 1 64 ? 1.248   -10.039 -0.637  1.00 0.00 ? 64 PHE A HD1  1  
ATOM   973   H  HD2  . PHE A 1 64 ? 3.273   -7.761  -3.607  1.00 0.00 ? 64 PHE A HD2  1  
ATOM   974   H  HE1  . PHE A 1 64 ? -0.256  -8.144  -0.201  1.00 0.00 ? 64 PHE A HE1  1  
ATOM   975   H  HE2  . PHE A 1 64 ? 1.772   -5.862  -3.176  1.00 0.00 ? 64 PHE A HE2  1  
ATOM   976   H  HZ   . PHE A 1 64 ? 0.004   -6.052  -1.472  1.00 0.00 ? 64 PHE A HZ   1  
ATOM   977   N  N    . VAL A 1 65 ? 4.377   -12.989 -3.361  1.00 0.00 ? 65 VAL A N    1  
ATOM   978   C  CA   . VAL A 1 65 ? 5.390   -13.791 -4.045  1.00 0.00 ? 65 VAL A CA   1  
ATOM   979   C  C    . VAL A 1 65 ? 4.750   -15.028 -4.670  1.00 0.00 ? 65 VAL A C    1  
ATOM   980   O  O    . VAL A 1 65 ? 4.765   -16.113 -4.085  1.00 0.00 ? 65 VAL A O    1  
ATOM   981   C  CB   . VAL A 1 65 ? 6.520   -14.226 -3.085  1.00 0.00 ? 65 VAL A CB   1  
ATOM   982   C  CG1  . VAL A 1 65 ? 7.634   -14.930 -3.848  1.00 0.00 ? 65 VAL A CG1  1  
ATOM   983   C  CG2  . VAL A 1 65 ? 7.066   -13.030 -2.317  1.00 0.00 ? 65 VAL A CG2  1  
ATOM   984   H  H    . VAL A 1 65 ? 4.237   -13.120 -2.398  1.00 0.00 ? 65 VAL A H    1  
ATOM   985   H  HA   . VAL A 1 65 ? 5.822   -13.186 -4.830  1.00 0.00 ? 65 VAL A HA   1  
ATOM   986   H  HB   . VAL A 1 65 ? 6.108   -14.926 -2.371  1.00 0.00 ? 65 VAL A HB   1  
ATOM   987   H  HG11 . VAL A 1 65 ? 8.438   -14.235 -4.037  1.00 0.00 ? 65 VAL A HG11 1  
ATOM   988   H  HG12 . VAL A 1 65 ? 7.249   -15.297 -4.787  1.00 0.00 ? 65 VAL A HG12 1  
ATOM   989   H  HG13 . VAL A 1 65 ? 8.004   -15.759 -3.264  1.00 0.00 ? 65 VAL A HG13 1  
ATOM   990   H  HG21 . VAL A 1 65 ? 6.248   -12.399 -2.003  1.00 0.00 ? 65 VAL A HG21 1  
ATOM   991   H  HG22 . VAL A 1 65 ? 7.731   -12.465 -2.954  1.00 0.00 ? 65 VAL A HG22 1  
ATOM   992   H  HG23 . VAL A 1 65 ? 7.608   -13.374 -1.448  1.00 0.00 ? 65 VAL A HG23 1  
ATOM   993   N  N    . SER A 1 66 ? 4.181   -14.853 -5.859  1.00 0.00 ? 66 SER A N    1  
ATOM   994   C  CA   . SER A 1 66 ? 3.527   -15.948 -6.566  1.00 0.00 ? 66 SER A CA   1  
ATOM   995   C  C    . SER A 1 66 ? 4.286   -16.302 -7.843  1.00 0.00 ? 66 SER A C    1  
ATOM   996   O  O    . SER A 1 66 ? 4.060   -15.700 -8.895  1.00 0.00 ? 66 SER A O    1  
ATOM   997   C  CB   . SER A 1 66 ? 2.084   -15.568 -6.900  1.00 0.00 ? 66 SER A CB   1  
ATOM   998   O  OG   . SER A 1 66 ? 1.207   -15.926 -5.847  1.00 0.00 ? 66 SER A OG   1  
ATOM   999   H  H    . SER A 1 66 ? 4.199   -13.962 -6.272  1.00 0.00 ? 66 SER A H    1  
ATOM   1000  H  HA   . SER A 1 66 ? 3.522   -16.809 -5.912  1.00 0.00 ? 66 SER A HA   1  
ATOM   1001  H  HB2  . SER A 1 66 ? 2.022   -14.502 -7.057  1.00 0.00 ? 66 SER A HB2  1  
ATOM   1002  H  HB3  . SER A 1 66 ? 1.779   -16.082 -7.798  1.00 0.00 ? 66 SER A HB3  1  
ATOM   1003  H  HG   . SER A 1 66 ? 0.404   -15.402 -5.905  1.00 0.00 ? 66 SER A HG   1  
ATOM   1004  N  N    . GLY A 1 67 ? 5.186   -17.281 -7.744  1.00 0.00 ? 67 GLY A N    1  
ATOM   1005  C  CA   . GLY A 1 67 ? 5.966   -17.698 -8.899  1.00 0.00 ? 67 GLY A CA   1  
ATOM   1006  C  C    . GLY A 1 67 ? 5.138   -18.443 -9.931  1.00 0.00 ? 67 GLY A C    1  
ATOM   1007  O  O    . GLY A 1 67 ? 5.007   -17.992 -11.070 1.00 0.00 ? 67 GLY A O    1  
ATOM   1008  H  H    . GLY A 1 67 ? 5.323   -17.723 -6.879  1.00 0.00 ? 67 GLY A H    1  
ATOM   1009  H  HA2  . GLY A 1 67 ? 6.392   -16.821 -9.364  1.00 0.00 ? 67 GLY A HA2  1  
ATOM   1010  H  HA3  . GLY A 1 67 ? 6.766   -18.340 -8.565  1.00 0.00 ? 67 GLY A HA3  1  
ATOM   1011  N  N    . GLU A 1 68 ? 4.581   -19.586 -9.532  1.00 0.00 ? 68 GLU A N    1  
ATOM   1012  C  CA   . GLU A 1 68 ? 3.763   -20.398 -10.432 1.00 0.00 ? 68 GLU A CA   1  
ATOM   1013  C  C    . GLU A 1 68 ? 2.374   -20.661 -9.839  1.00 0.00 ? 68 GLU A C    1  
ATOM   1014  O  O    . GLU A 1 68 ? 1.801   -21.737 -10.028 1.00 0.00 ? 68 GLU A O    1  
ATOM   1015  C  CB   . GLU A 1 68 ? 4.473   -21.721 -10.729 1.00 0.00 ? 68 GLU A CB   1  
ATOM   1016  C  CG   . GLU A 1 68 ? 5.439   -21.642 -11.901 1.00 0.00 ? 68 GLU A CG   1  
ATOM   1017  C  CD   . GLU A 1 68 ? 6.414   -22.805 -11.945 1.00 0.00 ? 68 GLU A CD   1  
ATOM   1018  O  OE1  . GLU A 1 68 ? 5.999   -23.948 -11.653 1.00 0.00 ? 68 GLU A OE1  1  
ATOM   1019  O  OE2  . GLU A 1 68 ? 7.595   -22.573 -12.277 1.00 0.00 ? 68 GLU A OE2  1  
ATOM   1020  H  H    . GLU A 1 68 ? 4.724   -19.892 -8.612  1.00 0.00 ? 68 GLU A H    1  
ATOM   1021  H  HA   . GLU A 1 68 ? 3.645   -19.850 -11.355 1.00 0.00 ? 68 GLU A HA   1  
ATOM   1022  H  HB2  . GLU A 1 68 ? 5.025   -22.027 -9.851  1.00 0.00 ? 68 GLU A HB2  1  
ATOM   1023  H  HB3  . GLU A 1 68 ? 3.731   -22.472 -10.954 1.00 0.00 ? 68 GLU A HB3  1  
ATOM   1024  H  HG2  . GLU A 1 68 ? 4.871   -21.634 -12.819 1.00 0.00 ? 68 GLU A HG2  1  
ATOM   1025  H  HG3  . GLU A 1 68 ? 6.003   -20.723 -11.822 1.00 0.00 ? 68 GLU A HG3  1  
ATOM   1026  N  N    . THR A 1 69 ? 1.837   -19.670 -9.123  1.00 0.00 ? 69 THR A N    1  
ATOM   1027  C  CA   . THR A 1 69 ? 0.518   -19.790 -8.506  1.00 0.00 ? 69 THR A CA   1  
ATOM   1028  C  C    . THR A 1 69 ? -0.259  -18.480 -8.630  1.00 0.00 ? 69 THR A C    1  
ATOM   1029  O  O    . THR A 1 69 ? 0.005   -17.525 -7.901  1.00 0.00 ? 69 THR A O    1  
ATOM   1030  C  CB   . THR A 1 69 ? 0.659   -20.180 -7.028  1.00 0.00 ? 69 THR A CB   1  
ATOM   1031  O  OG1  . THR A 1 69 ? 1.461   -21.341 -6.883  1.00 0.00 ? 69 THR A OG1  1  
ATOM   1032  C  CG2  . THR A 1 69 ? -0.667  -20.452 -6.348  1.00 0.00 ? 69 THR A CG2  1  
ATOM   1033  H  H    . THR A 1 69 ? 2.341   -18.837 -9.009  1.00 0.00 ? 69 THR A H    1  
ATOM   1034  H  HA   . THR A 1 69 ? -0.021  -20.568 -9.025  1.00 0.00 ? 69 THR A HA   1  
ATOM   1035  H  HB   . THR A 1 69 ? 1.139   -19.369 -6.499  1.00 0.00 ? 69 THR A HB   1  
ATOM   1036  H  HG1  . THR A 1 69 ? 1.153   -22.024 -7.486  1.00 0.00 ? 69 THR A HG1  1  
ATOM   1037  H  HG21 . THR A 1 69 ? -0.563  -21.293 -5.679  1.00 0.00 ? 69 THR A HG21 1  
ATOM   1038  H  HG22 . THR A 1 69 ? -1.416  -20.675 -7.093  1.00 0.00 ? 69 THR A HG22 1  
ATOM   1039  H  HG23 . THR A 1 69 ? -0.968  -19.580 -5.785  1.00 0.00 ? 69 THR A HG23 1  
ATOM   1040  N  N    . VAL A 1 70 ? -1.215  -18.440 -9.557  1.00 0.00 ? 70 VAL A N    1  
ATOM   1041  C  CA   . VAL A 1 70 ? -2.025  -17.242 -9.768  1.00 0.00 ? 70 VAL A CA   1  
ATOM   1042  C  C    . VAL A 1 70 ? -3.230  -17.217 -8.823  1.00 0.00 ? 70 VAL A C    1  
ATOM   1043  O  O    . VAL A 1 70 ? -4.104  -18.083 -8.896  1.00 0.00 ? 70 VAL A O    1  
ATOM   1044  C  CB   . VAL A 1 70 ? -2.507  -17.132 -11.233 1.00 0.00 ? 70 VAL A CB   1  
ATOM   1045  C  CG1  . VAL A 1 70 ? -3.386  -18.317 -11.614 1.00 0.00 ? 70 VAL A CG1  1  
ATOM   1046  C  CG2  . VAL A 1 70 ? -3.243  -15.819 -11.459 1.00 0.00 ? 70 VAL A CG2  1  
ATOM   1047  H  H    . VAL A 1 70 ? -1.381  -19.233 -10.109 1.00 0.00 ? 70 VAL A H    1  
ATOM   1048  H  HA   . VAL A 1 70 ? -1.402  -16.384 -9.556  1.00 0.00 ? 70 VAL A HA   1  
ATOM   1049  H  HB   . VAL A 1 70 ? -1.636  -17.144 -11.873 1.00 0.00 ? 70 VAL A HB   1  
ATOM   1050  H  HG11 . VAL A 1 70 ? -3.145  -18.637 -12.616 1.00 0.00 ? 70 VAL A HG11 1  
ATOM   1051  H  HG12 . VAL A 1 70 ? -4.424  -18.021 -11.571 1.00 0.00 ? 70 VAL A HG12 1  
ATOM   1052  H  HG13 . VAL A 1 70 ? -3.216  -19.130 -10.925 1.00 0.00 ? 70 VAL A HG13 1  
ATOM   1053  H  HG21 . VAL A 1 70 ? -3.568  -15.420 -10.511 1.00 0.00 ? 70 VAL A HG21 1  
ATOM   1054  H  HG22 . VAL A 1 70 ? -4.102  -15.992 -12.091 1.00 0.00 ? 70 VAL A HG22 1  
ATOM   1055  H  HG23 . VAL A 1 70 ? -2.580  -15.113 -11.938 1.00 0.00 ? 70 VAL A HG23 1  
ATOM   1056  N  N    . PRO A 1 71 ? -3.286  -16.222 -7.913  1.00 0.00 ? 71 PRO A N    1  
ATOM   1057  C  CA   . PRO A 1 71 ? -4.384  -16.084 -6.942  1.00 0.00 ? 71 PRO A CA   1  
ATOM   1058  C  C    . PRO A 1 71 ? -5.752  -15.915 -7.612  1.00 0.00 ? 71 PRO A C    1  
ATOM   1059  O  O    . PRO A 1 71 ? -5.848  -15.817 -8.839  1.00 0.00 ? 71 PRO A O    1  
ATOM   1060  C  CB   . PRO A 1 71 ? -4.013  -14.821 -6.150  1.00 0.00 ? 71 PRO A CB   1  
ATOM   1061  C  CG   . PRO A 1 71 ? -2.550  -14.643 -6.368  1.00 0.00 ? 71 PRO A CG   1  
ATOM   1062  C  CD   . PRO A 1 71 ? -2.279  -15.156 -7.751  1.00 0.00 ? 71 PRO A CD   1  
ATOM   1063  H  HA   . PRO A 1 71 ? -4.420  -16.930 -6.272  1.00 0.00 ? 71 PRO A HA   1  
ATOM   1064  H  HB2  . PRO A 1 71 ? -4.573  -13.978 -6.529  1.00 0.00 ? 71 PRO A HB2  1  
ATOM   1065  H  HB3  . PRO A 1 71 ? -4.240  -14.968 -5.105  1.00 0.00 ? 71 PRO A HB3  1  
ATOM   1066  H  HG2  . PRO A 1 71 ? -2.293  -13.596 -6.301  1.00 0.00 ? 71 PRO A HG2  1  
ATOM   1067  H  HG3  . PRO A 1 71 ? -1.995  -15.215 -5.639  1.00 0.00 ? 71 PRO A HG3  1  
ATOM   1068  H  HD2  . PRO A 1 71 ? -2.423  -14.373 -8.481  1.00 0.00 ? 71 PRO A HD2  1  
ATOM   1069  H  HD3  . PRO A 1 71 ? -1.279  -15.559 -7.817  1.00 0.00 ? 71 PRO A HD3  1  
ATOM   1070  N  N    . ALA A 1 72 ? -6.811  -15.891 -6.797  1.00 0.00 ? 72 ALA A N    1  
ATOM   1071  C  CA   . ALA A 1 72 ? -8.173  -15.746 -7.310  1.00 0.00 ? 72 ALA A CA   1  
ATOM   1072  C  C    . ALA A 1 72 ? -8.888  -14.532 -6.708  1.00 0.00 ? 72 ALA A C    1  
ATOM   1073  O  O    . ALA A 1 72 ? -8.546  -14.073 -5.615  1.00 0.00 ? 72 ALA A O    1  
ATOM   1074  C  CB   . ALA A 1 72 ? -8.967  -17.018 -7.044  1.00 0.00 ? 72 ALA A CB   1  
ATOM   1075  H  H    . ALA A 1 72 ? -6.672  -15.978 -5.832  1.00 0.00 ? 72 ALA A H    1  
ATOM   1076  H  HA   . ALA A 1 72 ? -8.109  -15.613 -8.379  1.00 0.00 ? 72 ALA A HA   1  
ATOM   1077  H  HB1  . ALA A 1 72 ? -9.596  -17.231 -7.896  1.00 0.00 ? 72 ALA A HB1  1  
ATOM   1078  H  HB2  . ALA A 1 72 ? -9.584  -16.884 -6.167  1.00 0.00 ? 72 ALA A HB2  1  
ATOM   1079  H  HB3  . ALA A 1 72 ? -8.288  -17.842 -6.884  1.00 0.00 ? 72 ALA A HB3  1  
ATOM   1080  N  N    . PRO A 1 73 ? -9.903  -14.001 -7.429  1.00 0.00 ? 73 PRO A N    1  
ATOM   1081  C  CA   . PRO A 1 73 ? -10.686 -12.835 -6.984  1.00 0.00 ? 73 PRO A CA   1  
ATOM   1082  C  C    . PRO A 1 73 ? -11.610 -13.154 -5.812  1.00 0.00 ? 73 PRO A C    1  
ATOM   1083  O  O    . PRO A 1 73 ? -12.024 -14.301 -5.630  1.00 0.00 ? 73 PRO A O    1  
ATOM   1084  C  CB   . PRO A 1 73 ? -11.513 -12.473 -8.221  1.00 0.00 ? 73 PRO A CB   1  
ATOM   1085  C  CG   . PRO A 1 73 ? -11.647 -13.752 -8.970  1.00 0.00 ? 73 PRO A CG   1  
ATOM   1086  C  CD   . PRO A 1 73 ? -10.365 -14.501 -8.739  1.00 0.00 ? 73 PRO A CD   1  
ATOM   1087  H  HA   . PRO A 1 73 ? -10.045 -12.006 -6.722  1.00 0.00 ? 73 PRO A HA   1  
ATOM   1088  H  HB2  . PRO A 1 73 ? -12.476 -12.092 -7.913  1.00 0.00 ? 73 PRO A HB2  1  
ATOM   1089  H  HB3  . PRO A 1 73 ? -10.992 -11.728 -8.802  1.00 0.00 ? 73 PRO A HB3  1  
ATOM   1090  H  HG2  . PRO A 1 73 ? -12.485 -14.317 -8.587  1.00 0.00 ? 73 PRO A HG2  1  
ATOM   1091  H  HG3  . PRO A 1 73 ? -11.778 -13.550 -10.022 1.00 0.00 ? 73 PRO A HG3  1  
ATOM   1092  H  HD2  . PRO A 1 73 ? -10.550 -15.565 -8.702  1.00 0.00 ? 73 PRO A HD2  1  
ATOM   1093  H  HD3  . PRO A 1 73 ? -9.648  -14.269 -9.514  1.00 0.00 ? 73 PRO A HD3  1  
ATOM   1094  N  N    . SER A 1 74 ? -11.934 -12.128 -5.023  1.00 0.00 ? 74 SER A N    1  
ATOM   1095  C  CA   . SER A 1 74 ? -12.811 -12.298 -3.868  1.00 0.00 ? 74 SER A CA   1  
ATOM   1096  C  C    . SER A 1 74 ? -13.636 -11.036 -3.613  1.00 0.00 ? 74 SER A C    1  
ATOM   1097  O  O    . SER A 1 74 ? -13.206 -10.140 -2.883  1.00 0.00 ? 74 SER A O    1  
ATOM   1098  C  CB   . SER A 1 74 ? -11.984 -12.650 -2.627  1.00 0.00 ? 74 SER A CB   1  
ATOM   1099  O  OG   . SER A 1 74 ? -11.135 -13.760 -2.868  1.00 0.00 ? 74 SER A OG   1  
ATOM   1100  H  H    . SER A 1 74 ? -11.575 -11.237 -5.221  1.00 0.00 ? 74 SER A H    1  
ATOM   1101  H  HA   . SER A 1 74 ? -13.484 -13.112 -4.083  1.00 0.00 ? 74 SER A HA   1  
ATOM   1102  H  HB2  . SER A 1 74 ? -11.374 -11.802 -2.352  1.00 0.00 ? 74 SER A HB2  1  
ATOM   1103  H  HB3  . SER A 1 74 ? -12.648 -12.893 -1.812  1.00 0.00 ? 74 SER A HB3  1  
ATOM   1104  H  HG   . SER A 1 74 ? -10.231 -13.531 -2.636  1.00 0.00 ? 74 SER A HG   1  
ATOM   1105  N  N    . ALA A 1 75 ? -14.826 -10.979 -4.222  1.00 0.00 ? 75 ALA A N    1  
ATOM   1106  C  CA   . ALA A 1 75 ? -15.729 -9.832  -4.071  1.00 0.00 ? 75 ALA A CA   1  
ATOM   1107  C  C    . ALA A 1 75 ? -15.101 -8.544  -4.612  1.00 0.00 ? 75 ALA A C    1  
ATOM   1108  O  O    . ALA A 1 75 ? -13.971 -8.551  -5.108  1.00 0.00 ? 75 ALA A O    1  
ATOM   1109  C  CB   . ALA A 1 75 ? -16.131 -9.664  -2.609  1.00 0.00 ? 75 ALA A CB   1  
ATOM   1110  H  H    . ALA A 1 75 ? -15.104 -11.728 -4.789  1.00 0.00 ? 75 ALA A H    1  
ATOM   1111  H  HA   . ALA A 1 75 ? -16.625 -10.045 -4.639  1.00 0.00 ? 75 ALA A HA   1  
ATOM   1112  H  HB1  . ALA A 1 75 ? -16.545 -8.678  -2.460  1.00 0.00 ? 75 ALA A HB1  1  
ATOM   1113  H  HB2  . ALA A 1 75 ? -15.264 -9.788  -1.979  1.00 0.00 ? 75 ALA A HB2  1  
ATOM   1114  H  HB3  . ALA A 1 75 ? -16.872 -10.406 -2.350  1.00 0.00 ? 75 ALA A HB3  1  
ATOM   1115  N  N    . ASN A 1 76 ? -15.842 -7.438  -4.516  1.00 0.00 ? 76 ASN A N    1  
ATOM   1116  C  CA   . ASN A 1 76 ? -15.359 -6.142  -4.996  1.00 0.00 ? 76 ASN A CA   1  
ATOM   1117  C  C    . ASN A 1 76 ? -15.613 -5.043  -3.964  1.00 0.00 ? 76 ASN A C    1  
ATOM   1118  O  O    . ASN A 1 76 ? -16.519 -5.154  -3.134  1.00 0.00 ? 76 ASN A O    1  
ATOM   1119  C  CB   . ASN A 1 76 ? -16.020 -5.779  -6.332  1.00 0.00 ? 76 ASN A CB   1  
ATOM   1120  C  CG   . ASN A 1 76 ? -17.534 -5.635  -6.238  1.00 0.00 ? 76 ASN A CG   1  
ATOM   1121  O  OD1  . ASN A 1 76 ? -18.176 -6.199  -5.351  1.00 0.00 ? 76 ASN A OD1  1  
ATOM   1122  N  ND2  . ASN A 1 76 ? -18.115 -4.879  -7.165  1.00 0.00 ? 76 ASN A ND2  1  
ATOM   1123  H  H    . ASN A 1 76 ? -16.735 -7.492  -4.116  1.00 0.00 ? 76 ASN A H    1  
ATOM   1124  H  HA   . ASN A 1 76 ? -14.294 -6.228  -5.149  1.00 0.00 ? 76 ASN A HA   1  
ATOM   1125  H  HB2  . ASN A 1 76 ? -15.613 -4.842  -6.681  1.00 0.00 ? 76 ASN A HB2  1  
ATOM   1126  H  HB3  . ASN A 1 76 ? -15.796 -6.552  -7.053  1.00 0.00 ? 76 ASN A HB3  1  
ATOM   1127  H  HD21 . ASN A 1 76 ? -17.549 -4.461  -7.848  1.00 0.00 ? 76 ASN A HD21 1  
ATOM   1128  H  HD22 . ASN A 1 76 ? -19.088 -4.770  -7.128  1.00 0.00 ? 76 ASN A HD22 1  
ATOM   1129  N  N    . LYS A 1 77 ? -14.804 -3.985  -4.022  1.00 0.00 ? 77 LYS A N    1  
ATOM   1130  C  CA   . LYS A 1 77 ? -14.934 -2.864  -3.092  1.00 0.00 ? 77 LYS A CA   1  
ATOM   1131  C  C    . LYS A 1 77 ? -14.933 -1.531  -3.834  1.00 0.00 ? 77 LYS A C    1  
ATOM   1132  O  O    . LYS A 1 77 ? -14.029 -1.253  -4.625  1.00 0.00 ? 77 LYS A O    1  
ATOM   1133  C  CB   . LYS A 1 77 ? -13.797 -2.886  -2.064  1.00 0.00 ? 77 LYS A CB   1  
ATOM   1134  C  CG   . LYS A 1 77 ? -12.419 -3.126  -2.671  1.00 0.00 ? 77 LYS A CG   1  
ATOM   1135  C  CD   . LYS A 1 77 ? -11.339 -2.349  -1.934  1.00 0.00 ? 77 LYS A CD   1  
ATOM   1136  C  CE   . LYS A 1 77 ? -11.017 -1.035  -2.633  1.00 0.00 ? 77 LYS A CE   1  
ATOM   1137  N  NZ   . LYS A 1 77 ? -10.169 -0.146  -1.790  1.00 0.00 ? 77 LYS A NZ   1  
ATOM   1138  H  H    . LYS A 1 77 ? -14.100 -3.958  -4.704  1.00 0.00 ? 77 LYS A H    1  
ATOM   1139  H  HA   . LYS A 1 77 ? -15.875 -2.973  -2.573  1.00 0.00 ? 77 LYS A HA   1  
ATOM   1140  H  HB2  . LYS A 1 77 ? -13.777 -1.937  -1.550  1.00 0.00 ? 77 LYS A HB2  1  
ATOM   1141  H  HB3  . LYS A 1 77 ? -13.992 -3.669  -1.346  1.00 0.00 ? 77 LYS A HB3  1  
ATOM   1142  H  HG2  . LYS A 1 77 ? -12.191 -4.181  -2.612  1.00 0.00 ? 77 LYS A HG2  1  
ATOM   1143  H  HG3  . LYS A 1 77 ? -12.432 -2.816  -3.706  1.00 0.00 ? 77 LYS A HG3  1  
ATOM   1144  H  HD2  . LYS A 1 77 ? -11.681 -2.137  -0.932  1.00 0.00 ? 77 LYS A HD2  1  
ATOM   1145  H  HD3  . LYS A 1 77 ? -10.443 -2.951  -1.891  1.00 0.00 ? 77 LYS A HD3  1  
ATOM   1146  H  HE2  . LYS A 1 77 ? -10.494 -1.252  -3.553  1.00 0.00 ? 77 LYS A HE2  1  
ATOM   1147  H  HE3  . LYS A 1 77 ? -11.943 -0.526  -2.860  1.00 0.00 ? 77 LYS A HE3  1  
ATOM   1148  H  HZ1  . LYS A 1 77 ? -9.624  0.504   -2.393  1.00 0.00 ? 77 LYS A HZ1  1  
ATOM   1149  H  HZ2  . LYS A 1 77 ? -9.506  -0.713  -1.223  1.00 0.00 ? 77 LYS A HZ2  1  
ATOM   1150  H  HZ3  . LYS A 1 77 ? -10.764 0.414   -1.149  1.00 0.00 ? 77 LYS A HZ3  1  
ATOM   1151  N  N    . GLU A 1 78 ? -15.947 -0.708  -3.568  1.00 0.00 ? 78 GLU A N    1  
ATOM   1152  C  CA   . GLU A 1 78 ? -16.062 0.599   -4.205  1.00 0.00 ? 78 GLU A CA   1  
ATOM   1153  C  C    . GLU A 1 78 ? -16.370 1.684   -3.173  1.00 0.00 ? 78 GLU A C    1  
ATOM   1154  O  O    . GLU A 1 78 ? -17.530 2.038   -2.955  1.00 0.00 ? 78 GLU A O    1  
ATOM   1155  C  CB   . GLU A 1 78 ? -17.147 0.573   -5.285  1.00 0.00 ? 78 GLU A CB   1  
ATOM   1156  C  CG   . GLU A 1 78 ? -16.837 1.458   -6.482  1.00 0.00 ? 78 GLU A CG   1  
ATOM   1157  C  CD   . GLU A 1 78 ? -17.615 1.059   -7.721  1.00 0.00 ? 78 GLU A CD   1  
ATOM   1158  O  OE1  . GLU A 1 78 ? -18.857 1.196   -7.714  1.00 0.00 ? 78 GLU A OE1  1  
ATOM   1159  O  OE2  . GLU A 1 78 ? -16.982 0.609   -8.699  1.00 0.00 ? 78 GLU A OE2  1  
ATOM   1160  H  H    . GLU A 1 78 ? -16.633 -0.986  -2.924  1.00 0.00 ? 78 GLU A H    1  
ATOM   1161  H  HA   . GLU A 1 78 ? -15.111 0.823   -4.670  1.00 0.00 ? 78 GLU A HA   1  
ATOM   1162  H  HB2  . GLU A 1 78 ? -17.268 -0.442  -5.634  1.00 0.00 ? 78 GLU A HB2  1  
ATOM   1163  H  HB3  . GLU A 1 78 ? -18.078 0.907   -4.851  1.00 0.00 ? 78 GLU A HB3  1  
ATOM   1164  H  HG2  . GLU A 1 78 ? -17.086 2.478   -6.233  1.00 0.00 ? 78 GLU A HG2  1  
ATOM   1165  H  HG3  . GLU A 1 78 ? -15.781 1.390   -6.700  1.00 0.00 ? 78 GLU A HG3  1  
ATOM   1166  N  N    . LEU A 1 79 ? -15.322 2.211   -2.541  1.00 0.00 ? 79 LEU A N    1  
ATOM   1167  C  CA   . LEU A 1 79 ? -15.479 3.261   -1.533  1.00 0.00 ? 79 LEU A CA   1  
ATOM   1168  C  C    . LEU A 1 79 ? -14.494 4.407   -1.777  1.00 0.00 ? 79 LEU A C    1  
ATOM   1169  O  O    . LEU A 1 79 ? -14.009 5.035   -0.831  1.00 0.00 ? 79 LEU A O    1  
ATOM   1170  C  CB   . LEU A 1 79 ? -15.281 2.684   -0.126  1.00 0.00 ? 79 LEU A CB   1  
ATOM   1171  C  CG   . LEU A 1 79 ? -13.907 2.061   0.138   1.00 0.00 ? 79 LEU A CG   1  
ATOM   1172  C  CD1  . LEU A 1 79 ? -13.508 2.248   1.594   1.00 0.00 ? 79 LEU A CD1  1  
ATOM   1173  C  CD2  . LEU A 1 79 ? -13.909 0.585   -0.233  1.00 0.00 ? 79 LEU A CD2  1  
ATOM   1174  H  H    . LEU A 1 79 ? -14.421 1.890   -2.758  1.00 0.00 ? 79 LEU A H    1  
ATOM   1175  H  HA   . LEU A 1 79 ? -16.484 3.648   -1.614  1.00 0.00 ? 79 LEU A HA   1  
ATOM   1176  H  HB2  . LEU A 1 79 ? -15.436 3.479   0.588   1.00 0.00 ? 79 LEU A HB2  1  
ATOM   1177  H  HB3  . LEU A 1 79 ? -16.033 1.926   0.038   1.00 0.00 ? 79 LEU A HB3  1  
ATOM   1178  H  HG   . LEU A 1 79 ? -13.170 2.561   -0.475  1.00 0.00 ? 79 LEU A HG   1  
ATOM   1179  H  HD11 . LEU A 1 79 ? -12.431 2.247   1.677   1.00 0.00 ? 79 LEU A HD11 1  
ATOM   1180  H  HD12 . LEU A 1 79 ? -13.917 1.443   2.186   1.00 0.00 ? 79 LEU A HD12 1  
ATOM   1181  H  HD13 . LEU A 1 79 ? -13.895 3.191   1.955   1.00 0.00 ? 79 LEU A HD13 1  
ATOM   1182  H  HD21 . LEU A 1 79 ? -12.909 0.280   -0.501  1.00 0.00 ? 79 LEU A HD21 1  
ATOM   1183  H  HD22 . LEU A 1 79 ? -14.570 0.425   -1.071  1.00 0.00 ? 79 LEU A HD22 1  
ATOM   1184  H  HD23 . LEU A 1 79 ? -14.248 0.002   0.610   1.00 0.00 ? 79 LEU A HD23 1  
ATOM   1185  N  N    . VAL A 1 80 ? -14.202 4.676   -3.050  1.00 0.00 ? 80 VAL A N    1  
ATOM   1186  C  CA   . VAL A 1 80 ? -13.278 5.741   -3.415  1.00 0.00 ? 80 VAL A CA   1  
ATOM   1187  C  C    . VAL A 1 80 ? -13.986 7.098   -3.434  1.00 0.00 ? 80 VAL A C    1  
ATOM   1188  O  O    . VAL A 1 80 ? -14.403 7.580   -4.490  1.00 0.00 ? 80 VAL A O    1  
ATOM   1189  C  CB   . VAL A 1 80 ? -12.626 5.478   -4.791  1.00 0.00 ? 80 VAL A CB   1  
ATOM   1190  C  CG1  . VAL A 1 80 ? -11.521 6.489   -5.063  1.00 0.00 ? 80 VAL A CG1  1  
ATOM   1191  C  CG2  . VAL A 1 80 ? -12.087 4.054   -4.866  1.00 0.00 ? 80 VAL A CG2  1  
ATOM   1192  H  H    . VAL A 1 80 ? -14.620 4.144   -3.759  1.00 0.00 ? 80 VAL A H    1  
ATOM   1193  H  HA   . VAL A 1 80 ? -12.494 5.768   -2.670  1.00 0.00 ? 80 VAL A HA   1  
ATOM   1194  H  HB   . VAL A 1 80 ? -13.384 5.592   -5.552  1.00 0.00 ? 80 VAL A HB   1  
ATOM   1195  H  HG11 . VAL A 1 80 ? -11.063 6.782   -4.130  1.00 0.00 ? 80 VAL A HG11 1  
ATOM   1196  H  HG12 . VAL A 1 80 ? -11.942 7.358   -5.547  1.00 0.00 ? 80 VAL A HG12 1  
ATOM   1197  H  HG13 . VAL A 1 80 ? -10.776 6.044   -5.706  1.00 0.00 ? 80 VAL A HG13 1  
ATOM   1198  H  HG21 . VAL A 1 80 ? -12.840 3.407   -5.291  1.00 0.00 ? 80 VAL A HG21 1  
ATOM   1199  H  HG22 . VAL A 1 80 ? -11.835 3.711   -3.873  1.00 0.00 ? 80 VAL A HG22 1  
ATOM   1200  H  HG23 . VAL A 1 80 ? -11.204 4.035   -5.487  1.00 0.00 ? 80 VAL A HG23 1  
ATOM   1201  N  N    . LYS A 1 81 ? -14.117 7.704   -2.255  1.00 0.00 ? 81 LYS A N    1  
ATOM   1202  C  CA   . LYS A 1 81 ? -14.772 9.005   -2.122  1.00 0.00 ? 81 LYS A CA   1  
ATOM   1203  C  C    . LYS A 1 81 ? -14.057 9.876   -1.083  1.00 0.00 ? 81 LYS A C    1  
ATOM   1204  O  O    . LYS A 1 81 ? -14.693 10.649  -0.361  1.00 0.00 ? 81 LYS A O    1  
ATOM   1205  C  CB   . LYS A 1 81 ? -16.243 8.817   -1.733  1.00 0.00 ? 81 LYS A CB   1  
ATOM   1206  C  CG   . LYS A 1 81 ? -17.174 8.621   -2.920  1.00 0.00 ? 81 LYS A CG   1  
ATOM   1207  C  CD   . LYS A 1 81 ? -18.618 8.927   -2.546  1.00 0.00 ? 81 LYS A CD   1  
ATOM   1208  C  CE   . LYS A 1 81 ? -19.410 9.450   -3.736  1.00 0.00 ? 81 LYS A CE   1  
ATOM   1209  N  NZ   . LYS A 1 81 ? -20.132 8.359   -4.450  1.00 0.00 ? 81 LYS A NZ   1  
ATOM   1210  H  H    . LYS A 1 81 ? -13.766 7.265   -1.451  1.00 0.00 ? 81 LYS A H    1  
ATOM   1211  H  HA   . LYS A 1 81 ? -14.723 9.500   -3.082  1.00 0.00 ? 81 LYS A HA   1  
ATOM   1212  H  HB2  . LYS A 1 81 ? -16.325 7.951   -1.093  1.00 0.00 ? 81 LYS A HB2  1  
ATOM   1213  H  HB3  . LYS A 1 81 ? -16.572 9.687   -1.186  1.00 0.00 ? 81 LYS A HB3  1  
ATOM   1214  H  HG2  . LYS A 1 81 ? -16.870 9.282   -3.718  1.00 0.00 ? 81 LYS A HG2  1  
ATOM   1215  H  HG3  . LYS A 1 81 ? -17.107 7.595   -3.252  1.00 0.00 ? 81 LYS A HG3  1  
ATOM   1216  H  HD2  . LYS A 1 81 ? -19.085 8.022   -2.186  1.00 0.00 ? 81 LYS A HD2  1  
ATOM   1217  H  HD3  . LYS A 1 81 ? -18.627 9.672   -1.764  1.00 0.00 ? 81 LYS A HD3  1  
ATOM   1218  H  HE2  . LYS A 1 81 ? -20.131 10.172  -3.381  1.00 0.00 ? 81 LYS A HE2  1  
ATOM   1219  H  HE3  . LYS A 1 81 ? -18.729 9.931   -4.423  1.00 0.00 ? 81 LYS A HE3  1  
ATOM   1220  H  HZ1  . LYS A 1 81 ? -19.548 7.497   -4.475  1.00 0.00 ? 81 LYS A HZ1  1  
ATOM   1221  H  HZ2  . LYS A 1 81 ? -20.343 8.649   -5.427  1.00 0.00 ? 81 LYS A HZ2  1  
ATOM   1222  H  HZ3  . LYS A 1 81 ? -21.026 8.144   -3.965  1.00 0.00 ? 81 LYS A HZ3  1  
ATOM   1223  N  N    . LEU A 1 82 ? -12.729 9.748   -1.016  1.00 0.00 ? 82 LEU A N    1  
ATOM   1224  C  CA   . LEU A 1 82 ? -11.925 10.521  -0.071  1.00 0.00 ? 82 LEU A CA   1  
ATOM   1225  C  C    . LEU A 1 82 ? -11.423 11.812  -0.713  1.00 0.00 ? 82 LEU A C    1  
ATOM   1226  O  O    . LEU A 1 82 ? -10.434 11.807  -1.451  1.00 0.00 ? 82 LEU A O    1  
ATOM   1227  C  CB   . LEU A 1 82 ? -10.739 9.689   0.426   1.00 0.00 ? 82 LEU A CB   1  
ATOM   1228  C  CG   . LEU A 1 82 ? -10.200 10.081  1.806   1.00 0.00 ? 82 LEU A CG   1  
ATOM   1229  C  CD1  . LEU A 1 82 ? -9.632  8.863   2.518   1.00 0.00 ? 82 LEU A CD1  1  
ATOM   1230  C  CD2  . LEU A 1 82 ? -9.143  11.170  1.679   1.00 0.00 ? 82 LEU A CD2  1  
ATOM   1231  H  H    . LEU A 1 82 ? -12.277 9.121   -1.618  1.00 0.00 ? 82 LEU A H    1  
ATOM   1232  H  HA   . LEU A 1 82 ? -12.554 10.772  0.770   1.00 0.00 ? 82 LEU A HA   1  
ATOM   1233  H  HB2  . LEU A 1 82 ? -11.043 8.653   0.462   1.00 0.00 ? 82 LEU A HB2  1  
ATOM   1234  H  HB3  . LEU A 1 82 ? -9.935  9.785   -0.289  1.00 0.00 ? 82 LEU A HB3  1  
ATOM   1235  H  HG   . LEU A 1 82 ? -11.011 10.469  2.406   1.00 0.00 ? 82 LEU A HG   1  
ATOM   1236  H  HD11 . LEU A 1 82 ? -10.416 8.376   3.078   1.00 0.00 ? 82 LEU A HD11 1  
ATOM   1237  H  HD12 . LEU A 1 82 ? -8.847  9.172   3.193   1.00 0.00 ? 82 LEU A HD12 1  
ATOM   1238  H  HD13 . LEU A 1 82 ? -9.229  8.175   1.789   1.00 0.00 ? 82 LEU A HD13 1  
ATOM   1239  H  HD21 . LEU A 1 82 ? -9.596  12.067  1.282   1.00 0.00 ? 82 LEU A HD21 1  
ATOM   1240  H  HD22 . LEU A 1 82 ? -8.360  10.837  1.014   1.00 0.00 ? 82 LEU A HD22 1  
ATOM   1241  H  HD23 . LEU A 1 82 ? -8.724  11.380  2.652   1.00 0.00 ? 82 LEU A HD23 1  
ATOM   1242  N  N    . GLU A 1 83 ? -12.111 12.916  -0.425  1.00 0.00 ? 83 GLU A N    1  
ATOM   1243  C  CA   . GLU A 1 83 ? -11.737 14.218  -0.971  1.00 0.00 ? 83 GLU A CA   1  
ATOM   1244  C  C    . GLU A 1 83 ? -11.044 15.073  0.085   1.00 0.00 ? 83 GLU A C    1  
ATOM   1245  O  O    . GLU A 1 83 ? -11.429 15.063  1.257   1.00 0.00 ? 83 GLU A O    1  
ATOM   1246  C  CB   . GLU A 1 83 ? -12.970 14.949  -1.504  1.00 0.00 ? 83 GLU A CB   1  
ATOM   1247  C  CG   . GLU A 1 83 ? -12.704 15.742  -2.777  1.00 0.00 ? 83 GLU A CG   1  
ATOM   1248  C  CD   . GLU A 1 83 ? -13.838 15.650  -3.783  1.00 0.00 ? 83 GLU A CD   1  
ATOM   1249  O  OE1  . GLU A 1 83 ? -14.402 14.547  -3.955  1.00 0.00 ? 83 GLU A OE1  1  
ATOM   1250  O  OE2  . GLU A 1 83 ? -14.163 16.685  -4.403  1.00 0.00 ? 83 GLU A OE2  1  
ATOM   1251  H  H    . GLU A 1 83 ? -12.888 12.854  0.170   1.00 0.00 ? 83 GLU A H    1  
ATOM   1252  H  HA   . GLU A 1 83 ? -11.050 14.049  -1.787  1.00 0.00 ? 83 GLU A HA   1  
ATOM   1253  H  HB2  . GLU A 1 83 ? -13.741 14.223  -1.710  1.00 0.00 ? 83 GLU A HB2  1  
ATOM   1254  H  HB3  . GLU A 1 83 ? -13.327 15.634  -0.749  1.00 0.00 ? 83 GLU A HB3  1  
ATOM   1255  H  HG2  . GLU A 1 83 ? -12.561 16.780  -2.516  1.00 0.00 ? 83 GLU A HG2  1  
ATOM   1256  H  HG3  . GLU A 1 83 ? -11.802 15.363  -3.239  1.00 0.00 ? 83 GLU A HG3  1  
ATOM   1257  N  N    . HIS A 1 84 ? -10.025 15.814  -0.342  1.00 0.00 ? 84 HIS A N    1  
ATOM   1258  C  CA   . HIS A 1 84 ? -9.272  16.685  0.559   1.00 0.00 ? 84 HIS A CA   1  
ATOM   1259  C  C    . HIS A 1 84 ? -9.603  18.152  0.301   1.00 0.00 ? 84 HIS A C    1  
ATOM   1260  O  O    . HIS A 1 84 ? -10.664 18.637  0.693   1.00 0.00 ? 84 HIS A O    1  
ATOM   1261  C  CB   . HIS A 1 84 ? -7.764  16.450  0.403   1.00 0.00 ? 84 HIS A CB   1  
ATOM   1262  C  CG   . HIS A 1 84 ? -7.266  16.620  -1.001  1.00 0.00 ? 84 HIS A CG   1  
ATOM   1263  N  ND1  . HIS A 1 84 ? -6.793  17.819  -1.493  1.00 0.00 ? 84 HIS A ND1  1  
ATOM   1264  C  CD2  . HIS A 1 84 ? -7.171  15.734  -2.021  1.00 0.00 ? 84 HIS A CD2  1  
ATOM   1265  C  CE1  . HIS A 1 84 ? -6.431  17.663  -2.754  1.00 0.00 ? 84 HIS A CE1  1  
ATOM   1266  N  NE2  . HIS A 1 84 ? -6.650  16.408  -3.098  1.00 0.00 ? 84 HIS A NE2  1  
ATOM   1267  H  H    . HIS A 1 84 ? -9.774  15.779  -1.288  1.00 0.00 ? 84 HIS A H    1  
ATOM   1268  H  HA   . HIS A 1 84 ? -9.561  16.439  1.572   1.00 0.00 ? 84 HIS A HA   1  
ATOM   1269  H  HB2  . HIS A 1 84 ? -7.233  17.149  1.029   1.00 0.00 ? 84 HIS A HB2  1  
ATOM   1270  H  HB3  . HIS A 1 84 ? -7.530  15.444  0.720   1.00 0.00 ? 84 HIS A HB3  1  
ATOM   1271  H  HD1  . HIS A 1 84 ? -6.733  18.659  -0.992  1.00 0.00 ? 84 HIS A HD1  1  
ATOM   1272  H  HD2  . HIS A 1 84 ? -7.454  14.690  -1.993  1.00 0.00 ? 84 HIS A HD2  1  
ATOM   1273  H  HE1  . HIS A 1 84 ? -6.021  18.431  -3.394  1.00 0.00 ? 84 HIS A HE1  1  
ATOM   1274  H  HE2  . HIS A 1 84 ? -6.565  16.047  -4.006  1.00 0.00 ? 84 HIS A HE2  1  
HETATM 1275  ZN ZN   . ZN  B 2 .  ? 2.554   12.928  3.713   1.00 0.00 ? 85 ZN  A ZN   1  
ATOM   1276  N  N    . MET A 1 1  ? 13.445  10.854  8.750   1.00 0.00 ? 1  MET A N    2  
ATOM   1277  C  CA   . MET A 1 1  ? 14.626  10.717  7.850   1.00 0.00 ? 1  MET A CA   2  
ATOM   1278  C  C    . MET A 1 1  ? 15.131  9.272   7.796   1.00 0.00 ? 1  MET A C    2  
ATOM   1279  O  O    . MET A 1 1  ? 15.541  8.795   6.736   1.00 0.00 ? 1  MET A O    2  
ATOM   1280  C  CB   . MET A 1 1  ? 15.736  11.652  8.347   1.00 0.00 ? 1  MET A CB   2  
ATOM   1281  C  CG   . MET A 1 1  ? 16.672  12.129  7.244   1.00 0.00 ? 1  MET A CG   2  
ATOM   1282  S  SD   . MET A 1 1  ? 18.213  11.192  7.178   1.00 0.00 ? 1  MET A SD   2  
ATOM   1283  C  CE   . MET A 1 1  ? 19.077  12.049  5.862   1.00 0.00 ? 1  MET A CE   2  
ATOM   1284  H  H1   . MET A 1 1  ? 12.962  11.741  8.504   1.00 0.00 ? 1  MET A H1   2  
ATOM   1285  H  H2   . MET A 1 1  ? 13.791  10.875  9.731   1.00 0.00 ? 1  MET A H2   2  
ATOM   1286  H  H3   . MET A 1 1  ? 12.824  10.035  8.589   1.00 0.00 ? 1  MET A H3   2  
ATOM   1287  H  HA   . MET A 1 1  ? 14.330  11.019  6.856   1.00 0.00 ? 1  MET A HA   2  
ATOM   1288  H  HB2  . MET A 1 1  ? 15.281  12.520  8.801   1.00 0.00 ? 1  MET A HB2  2  
ATOM   1289  H  HB3  . MET A 1 1  ? 16.324  11.133  9.089   1.00 0.00 ? 1  MET A HB3  2  
ATOM   1290  H  HG2  . MET A 1 1  ? 16.168  12.029  6.294   1.00 0.00 ? 1  MET A HG2  2  
ATOM   1291  H  HG3  . MET A 1 1  ? 16.907  13.170  7.416   1.00 0.00 ? 1  MET A HG3  2  
ATOM   1292  H  HE1  . MET A 1 1  ? 20.133  11.837  5.926   1.00 0.00 ? 1  MET A HE1  2  
ATOM   1293  H  HE2  . MET A 1 1  ? 18.918  13.113  5.959   1.00 0.00 ? 1  MET A HE2  2  
ATOM   1294  H  HE3  . MET A 1 1  ? 18.700  11.715  4.906   1.00 0.00 ? 1  MET A HE3  2  
ATOM   1295  N  N    . ALA A 1 2  ? 15.105  8.581   8.940   1.00 0.00 ? 2  ALA A N    2  
ATOM   1296  C  CA   . ALA A 1 2  ? 15.564  7.194   9.011   1.00 0.00 ? 2  ALA A CA   2  
ATOM   1297  C  C    . ALA A 1 2  ? 14.508  6.285   9.645   1.00 0.00 ? 2  ALA A C    2  
ATOM   1298  O  O    . ALA A 1 2  ? 14.061  5.320   9.026   1.00 0.00 ? 2  ALA A O    2  
ATOM   1299  C  CB   . ALA A 1 2  ? 16.875  7.114   9.782   1.00 0.00 ? 2  ALA A CB   2  
ATOM   1300  H  H    . ALA A 1 2  ? 14.770  9.013   9.752   1.00 0.00 ? 2  ALA A H    2  
ATOM   1301  H  HA   . ALA A 1 2  ? 15.750  6.857   8.002   1.00 0.00 ? 2  ALA A HA   2  
ATOM   1302  H  HB1  . ALA A 1 2  ? 16.871  7.844   10.578  1.00 0.00 ? 2  ALA A HB1  2  
ATOM   1303  H  HB2  . ALA A 1 2  ? 17.699  7.315   9.113   1.00 0.00 ? 2  ALA A HB2  2  
ATOM   1304  H  HB3  . ALA A 1 2  ? 16.985  6.125   10.202  1.00 0.00 ? 2  ALA A HB3  2  
ATOM   1305  N  N    . VAL A 1 3  ? 14.115  6.597   10.882  1.00 0.00 ? 3  VAL A N    2  
ATOM   1306  C  CA   . VAL A 1 3  ? 13.112  5.804   11.596  1.00 0.00 ? 3  VAL A CA   2  
ATOM   1307  C  C    . VAL A 1 3  ? 11.754  5.862   10.897  1.00 0.00 ? 3  VAL A C    2  
ATOM   1308  O  O    . VAL A 1 3  ? 11.340  6.917   10.409  1.00 0.00 ? 3  VAL A O    2  
ATOM   1309  C  CB   . VAL A 1 3  ? 12.945  6.271   13.060  1.00 0.00 ? 3  VAL A CB   2  
ATOM   1310  C  CG1  . VAL A 1 3  ? 14.181  5.918   13.875  1.00 0.00 ? 3  VAL A CG1  2  
ATOM   1311  C  CG2  . VAL A 1 3  ? 12.659  7.768   13.129  1.00 0.00 ? 3  VAL A CG2  2  
ATOM   1312  H  H    . VAL A 1 3  ? 14.511  7.378   11.326  1.00 0.00 ? 3  VAL A H    2  
ATOM   1313  H  HA   . VAL A 1 3  ? 13.452  4.778   11.608  1.00 0.00 ? 3  VAL A HA   2  
ATOM   1314  H  HB   . VAL A 1 3  ? 12.102  5.746   13.488  1.00 0.00 ? 3  VAL A HB   2  
ATOM   1315  H  HG11 . VAL A 1 3  ? 14.245  6.569   14.734  1.00 0.00 ? 3  VAL A HG11 2  
ATOM   1316  H  HG12 . VAL A 1 3  ? 15.062  6.041   13.263  1.00 0.00 ? 3  VAL A HG12 2  
ATOM   1317  H  HG13 . VAL A 1 3  ? 14.113  4.891   14.205  1.00 0.00 ? 3  VAL A HG13 2  
ATOM   1318  H  HG21 . VAL A 1 3  ? 12.056  7.979   14.000  1.00 0.00 ? 3  VAL A HG21 2  
ATOM   1319  H  HG22 . VAL A 1 3  ? 12.127  8.075   12.241  1.00 0.00 ? 3  VAL A HG22 2  
ATOM   1320  H  HG23 . VAL A 1 3  ? 13.590  8.311   13.197  1.00 0.00 ? 3  VAL A HG23 2  
ATOM   1321  N  N    . PHE A 1 4  ? 11.065  4.723   10.854  1.00 0.00 ? 4  PHE A N    2  
ATOM   1322  C  CA   . PHE A 1 4  ? 9.753   4.643   10.217  1.00 0.00 ? 4  PHE A CA   2  
ATOM   1323  C  C    . PHE A 1 4  ? 8.679   5.260   11.107  1.00 0.00 ? 4  PHE A C    2  
ATOM   1324  O  O    . PHE A 1 4  ? 8.692   5.078   12.326  1.00 0.00 ? 4  PHE A O    2  
ATOM   1325  C  CB   . PHE A 1 4  ? 9.397   3.186   9.904   1.00 0.00 ? 4  PHE A CB   2  
ATOM   1326  C  CG   . PHE A 1 4  ? 9.804   2.744   8.525   1.00 0.00 ? 4  PHE A CG   2  
ATOM   1327  C  CD1  . PHE A 1 4  ? 11.141  2.706   8.158   1.00 0.00 ? 4  PHE A CD1  2  
ATOM   1328  C  CD2  . PHE A 1 4  ? 8.848   2.364   7.596   1.00 0.00 ? 4  PHE A CD2  2  
ATOM   1329  C  CE1  . PHE A 1 4  ? 11.515  2.297   6.892   1.00 0.00 ? 4  PHE A CE1  2  
ATOM   1330  C  CE2  . PHE A 1 4  ? 9.217   1.954   6.328   1.00 0.00 ? 4  PHE A CE2  2  
ATOM   1331  C  CZ   . PHE A 1 4  ? 10.552  1.921   5.976   1.00 0.00 ? 4  PHE A CZ   2  
ATOM   1332  H  H    . PHE A 1 4  ? 11.447  3.918   11.261  1.00 0.00 ? 4  PHE A H    2  
ATOM   1333  H  HA   . PHE A 1 4  ? 9.800   5.200   9.292   1.00 0.00 ? 4  PHE A HA   2  
ATOM   1334  H  HB2  . PHE A 1 4  ? 9.890   2.541   10.617  1.00 0.00 ? 4  PHE A HB2  2  
ATOM   1335  H  HB3  . PHE A 1 4  ? 8.328   3.058   9.992   1.00 0.00 ? 4  PHE A HB3  2  
ATOM   1336  H  HD1  . PHE A 1 4  ? 11.895  3.000   8.872   1.00 0.00 ? 4  PHE A HD1  2  
ATOM   1337  H  HD2  . PHE A 1 4  ? 7.804   2.390   7.869   1.00 0.00 ? 4  PHE A HD2  2  
ATOM   1338  H  HE1  . PHE A 1 4  ? 12.560  2.272   6.619   1.00 0.00 ? 4  PHE A HE1  2  
ATOM   1339  H  HE2  . PHE A 1 4  ? 8.463   1.659   5.614   1.00 0.00 ? 4  PHE A HE2  2  
ATOM   1340  H  HZ   . PHE A 1 4  ? 10.842  1.599   4.986   1.00 0.00 ? 4  PHE A HZ   2  
ATOM   1341  N  N    . HIS A 1 5  ? 7.752   5.989   10.491  1.00 0.00 ? 5  HIS A N    2  
ATOM   1342  C  CA   . HIS A 1 5  ? 6.666   6.632   11.229  1.00 0.00 ? 5  HIS A CA   2  
ATOM   1343  C  C    . HIS A 1 5  ? 5.781   5.586   11.910  1.00 0.00 ? 5  HIS A C    2  
ATOM   1344  O  O    . HIS A 1 5  ? 5.760   5.487   13.137  1.00 0.00 ? 5  HIS A O    2  
ATOM   1345  C  CB   . HIS A 1 5  ? 5.829   7.508   10.289  1.00 0.00 ? 5  HIS A CB   2  
ATOM   1346  C  CG   . HIS A 1 5  ? 4.804   8.339   10.995  1.00 0.00 ? 5  HIS A CG   2  
ATOM   1347  N  ND1  . HIS A 1 5  ? 5.054   9.614   11.454  1.00 0.00 ? 5  HIS A ND1  2  
ATOM   1348  C  CD2  . HIS A 1 5  ? 3.515   8.071   11.318  1.00 0.00 ? 5  HIS A CD2  2  
ATOM   1349  C  CE1  . HIS A 1 5  ? 3.967   10.094  12.031  1.00 0.00 ? 5  HIS A CE1  2  
ATOM   1350  N  NE2  . HIS A 1 5  ? 3.018   9.178   11.959  1.00 0.00 ? 5  HIS A NE2  2  
ATOM   1351  H  H    . HIS A 1 5  ? 7.796   6.096   9.517   1.00 0.00 ? 5  HIS A H    2  
ATOM   1352  H  HA   . HIS A 1 5  ? 7.110   7.258   11.990  1.00 0.00 ? 5  HIS A HA   2  
ATOM   1353  H  HB2  . HIS A 1 5  ? 6.484   8.177   9.753   1.00 0.00 ? 5  HIS A HB2  2  
ATOM   1354  H  HB3  . HIS A 1 5  ? 5.314   6.873   9.583   1.00 0.00 ? 5  HIS A HB3  2  
ATOM   1355  H  HD1  . HIS A 1 5  ? 5.904   10.094  11.371  1.00 0.00 ? 5  HIS A HD1  2  
ATOM   1356  H  HD2  . HIS A 1 5  ? 2.978   7.158   11.108  1.00 0.00 ? 5  HIS A HD2  2  
ATOM   1357  H  HE1  . HIS A 1 5  ? 3.871   11.071  12.480  1.00 0.00 ? 5  HIS A HE1  2  
ATOM   1358  H  HE2  . HIS A 1 5  ? 2.154   9.226   12.421  1.00 0.00 ? 5  HIS A HE2  2  
ATOM   1359  N  N    . ASP A 1 6  ? 5.062   4.805   11.101  1.00 0.00 ? 6  ASP A N    2  
ATOM   1360  C  CA   . ASP A 1 6  ? 4.181   3.761   11.619  1.00 0.00 ? 6  ASP A CA   2  
ATOM   1361  C  C    . ASP A 1 6  ? 3.848   2.745   10.528  1.00 0.00 ? 6  ASP A C    2  
ATOM   1362  O  O    . ASP A 1 6  ? 3.647   3.112   9.368   1.00 0.00 ? 6  ASP A O    2  
ATOM   1363  C  CB   . ASP A 1 6  ? 2.889   4.373   12.174  1.00 0.00 ? 6  ASP A CB   2  
ATOM   1364  C  CG   . ASP A 1 6  ? 2.991   4.725   13.648  1.00 0.00 ? 6  ASP A CG   2  
ATOM   1365  O  OD1  . ASP A 1 6  ? 3.168   3.801   14.471  1.00 0.00 ? 6  ASP A OD1  2  
ATOM   1366  O  OD2  . ASP A 1 6  ? 2.892   5.925   13.977  1.00 0.00 ? 6  ASP A OD2  2  
ATOM   1367  H  H    . ASP A 1 6  ? 5.129   4.932   10.132  1.00 0.00 ? 6  ASP A H    2  
ATOM   1368  H  HA   . ASP A 1 6  ? 4.704   3.254   12.418  1.00 0.00 ? 6  ASP A HA   2  
ATOM   1369  H  HB2  . ASP A 1 6  ? 2.661   5.274   11.626  1.00 0.00 ? 6  ASP A HB2  2  
ATOM   1370  H  HB3  . ASP A 1 6  ? 2.082   3.666   12.047  1.00 0.00 ? 6  ASP A HB3  2  
ATOM   1371  N  N    . GLU A 1 7  ? 3.789   1.468   10.907  1.00 0.00 ? 7  GLU A N    2  
ATOM   1372  C  CA   . GLU A 1 7  ? 3.474   0.400   9.960   1.00 0.00 ? 7  GLU A CA   2  
ATOM   1373  C  C    . GLU A 1 7  ? 1.965   0.201   9.859   1.00 0.00 ? 7  GLU A C    2  
ATOM   1374  O  O    . GLU A 1 7  ? 1.265   0.176   10.873  1.00 0.00 ? 7  GLU A O    2  
ATOM   1375  C  CB   . GLU A 1 7  ? 4.147   -0.913  10.378  1.00 0.00 ? 7  GLU A CB   2  
ATOM   1376  C  CG   . GLU A 1 7  ? 5.618   -0.760  10.749  1.00 0.00 ? 7  GLU A CG   2  
ATOM   1377  C  CD   . GLU A 1 7  ? 5.857   -0.724  12.249  1.00 0.00 ? 7  GLU A CD   2  
ATOM   1378  O  OE1  . GLU A 1 7  ? 5.006   -0.169  12.979  1.00 0.00 ? 7  GLU A OE1  2  
ATOM   1379  O  OE2  . GLU A 1 7  ? 6.899   -1.248  12.693  1.00 0.00 ? 7  GLU A OE2  2  
ATOM   1380  H  H    . GLU A 1 7  ? 3.956   1.239   11.845  1.00 0.00 ? 7  GLU A H    2  
ATOM   1381  H  HA   . GLU A 1 7  ? 3.852   0.696   8.991   1.00 0.00 ? 7  GLU A HA   2  
ATOM   1382  H  HB2  . GLU A 1 7  ? 3.624   -1.317  11.231  1.00 0.00 ? 7  GLU A HB2  2  
ATOM   1383  H  HB3  . GLU A 1 7  ? 4.076   -1.616  9.560   1.00 0.00 ? 7  GLU A HB3  2  
ATOM   1384  H  HG2  . GLU A 1 7  ? 6.166   -1.595  10.338  1.00 0.00 ? 7  GLU A HG2  2  
ATOM   1385  H  HG3  . GLU A 1 7  ? 5.989   0.158   10.318  1.00 0.00 ? 7  GLU A HG3  2  
ATOM   1386  N  N    . VAL A 1 8  ? 1.467   0.069   8.631   1.00 0.00 ? 8  VAL A N    2  
ATOM   1387  C  CA   . VAL A 1 8  ? 0.039   -0.118  8.400   1.00 0.00 ? 8  VAL A CA   2  
ATOM   1388  C  C    . VAL A 1 8  ? -0.222  -1.303  7.475   1.00 0.00 ? 8  VAL A C    2  
ATOM   1389  O  O    . VAL A 1 8  ? 0.516   -1.527  6.514   1.00 0.00 ? 8  VAL A O    2  
ATOM   1390  C  CB   . VAL A 1 8  ? -0.606  1.147   7.795   1.00 0.00 ? 8  VAL A CB   2  
ATOM   1391  C  CG1  . VAL A 1 8  ? -2.120  1.009   7.755   1.00 0.00 ? 8  VAL A CG1  2  
ATOM   1392  C  CG2  . VAL A 1 8  ? -0.202  2.390   8.578   1.00 0.00 ? 8  VAL A CG2  2  
ATOM   1393  H  H    . VAL A 1 8  ? 2.075   0.102   7.862   1.00 0.00 ? 8  VAL A H    2  
ATOM   1394  H  HA   . VAL A 1 8  ? -0.430  -0.311  9.356   1.00 0.00 ? 8  VAL A HA   2  
ATOM   1395  H  HB   . VAL A 1 8  ? -0.250  1.258   6.780   1.00 0.00 ? 8  VAL A HB   2  
ATOM   1396  H  HG11 . VAL A 1 8  ? -2.384  0.006   7.452   1.00 0.00 ? 8  VAL A HG11 2  
ATOM   1397  H  HG12 . VAL A 1 8  ? -2.527  1.715   7.048   1.00 0.00 ? 8  VAL A HG12 2  
ATOM   1398  H  HG13 . VAL A 1 8  ? -2.525  1.207   8.736   1.00 0.00 ? 8  VAL A HG13 2  
ATOM   1399  H  HG21 . VAL A 1 8  ? -0.753  2.425   9.506   1.00 0.00 ? 8  VAL A HG21 2  
ATOM   1400  H  HG22 . VAL A 1 8  ? -0.423  3.270   7.994   1.00 0.00 ? 8  VAL A HG22 2  
ATOM   1401  H  HG23 . VAL A 1 8  ? 0.856   2.355   8.790   1.00 0.00 ? 8  VAL A HG23 2  
ATOM   1402  N  N    . GLU A 1 9  ? -1.281  -2.055  7.773   1.00 0.00 ? 9  GLU A N    2  
ATOM   1403  C  CA   . GLU A 1 9  ? -1.652  -3.218  6.973   1.00 0.00 ? 9  GLU A CA   2  
ATOM   1404  C  C    . GLU A 1 9  ? -2.107  -2.799  5.577   1.00 0.00 ? 9  GLU A C    2  
ATOM   1405  O  O    . GLU A 1 9  ? -2.809  -1.800  5.415   1.00 0.00 ? 9  GLU A O    2  
ATOM   1406  C  CB   . GLU A 1 9  ? -2.764  -4.014  7.664   1.00 0.00 ? 9  GLU A CB   2  
ATOM   1407  C  CG   . GLU A 1 9  ? -2.265  -4.924  8.778   1.00 0.00 ? 9  GLU A CG   2  
ATOM   1408  C  CD   . GLU A 1 9  ? -3.374  -5.755  9.399   1.00 0.00 ? 9  GLU A CD   2  
ATOM   1409  O  OE1  . GLU A 1 9  ? -4.310  -5.162  9.976   1.00 0.00 ? 9  GLU A OE1  2  
ATOM   1410  O  OE2  . GLU A 1 9  ? -3.303  -6.998  9.311   1.00 0.00 ? 9  GLU A OE2  2  
ATOM   1411  H  H    . GLU A 1 9  ? -1.828  -1.818  8.552   1.00 0.00 ? 9  GLU A H    2  
ATOM   1412  H  HA   . GLU A 1 9  ? -0.777  -3.846  6.879   1.00 0.00 ? 9  GLU A HA   2  
ATOM   1413  H  HB2  . GLU A 1 9  ? -3.477  -3.322  8.086   1.00 0.00 ? 9  GLU A HB2  2  
ATOM   1414  H  HB3  . GLU A 1 9  ? -3.263  -4.624  6.927   1.00 0.00 ? 9  GLU A HB3  2  
ATOM   1415  H  HG2  . GLU A 1 9  ? -1.520  -5.593  8.373   1.00 0.00 ? 9  GLU A HG2  2  
ATOM   1416  H  HG3  . GLU A 1 9  ? -1.817  -4.314  9.549   1.00 0.00 ? 9  GLU A HG3  2  
ATOM   1417  N  N    . ILE A 1 10 ? -1.700  -3.574  4.574   1.00 0.00 ? 10 ILE A N    2  
ATOM   1418  C  CA   . ILE A 1 10 ? -2.061  -3.300  3.185   1.00 0.00 ? 10 ILE A CA   2  
ATOM   1419  C  C    . ILE A 1 10 ? -3.580  -3.241  3.002   1.00 0.00 ? 10 ILE A C    2  
ATOM   1420  O  O    . ILE A 1 10 ? -4.075  -2.542  2.116   1.00 0.00 ? 10 ILE A O    2  
ATOM   1421  C  CB   . ILE A 1 10 ? -1.460  -4.358  2.229   1.00 0.00 ? 10 ILE A CB   2  
ATOM   1422  C  CG1  . ILE A 1 10 ? -1.683  -3.954  0.769   1.00 0.00 ? 10 ILE A CG1  2  
ATOM   1423  C  CG2  . ILE A 1 10 ? -2.052  -5.735  2.501   1.00 0.00 ? 10 ILE A CG2  2  
ATOM   1424  C  CD1  . ILE A 1 10 ? -0.838  -2.777  0.330   1.00 0.00 ? 10 ILE A CD1  2  
ATOM   1425  H  H    . ILE A 1 10 ? -1.143  -4.356  4.775   1.00 0.00 ? 10 ILE A H    2  
ATOM   1426  H  HA   . ILE A 1 10 ? -1.645  -2.338  2.922   1.00 0.00 ? 10 ILE A HA   2  
ATOM   1427  H  HB   . ILE A 1 10 ? -0.398  -4.410  2.418   1.00 0.00 ? 10 ILE A HB   2  
ATOM   1428  H  HG12 . ILE A 1 10 ? -1.439  -4.789  0.132   1.00 0.00 ? 10 ILE A HG12 2  
ATOM   1429  H  HG13 . ILE A 1 10 ? -2.720  -3.689  0.628   1.00 0.00 ? 10 ILE A HG13 2  
ATOM   1430  H  HG21 . ILE A 1 10 ? -3.128  -5.685  2.438   1.00 0.00 ? 10 ILE A HG21 2  
ATOM   1431  H  HG22 . ILE A 1 10 ? -1.764  -6.061  3.489   1.00 0.00 ? 10 ILE A HG22 2  
ATOM   1432  H  HG23 . ILE A 1 10 ? -1.679  -6.436  1.768   1.00 0.00 ? 10 ILE A HG23 2  
ATOM   1433  H  HD11 . ILE A 1 10 ? -0.022  -2.639  1.025   1.00 0.00 ? 10 ILE A HD11 2  
ATOM   1434  H  HD12 . ILE A 1 10 ? -1.446  -1.885  0.309   1.00 0.00 ? 10 ILE A HD12 2  
ATOM   1435  H  HD13 . ILE A 1 10 ? -0.443  -2.966  -0.656  1.00 0.00 ? 10 ILE A HD13 2  
ATOM   1436  N  N    . GLU A 1 11 ? -4.316  -3.969  3.848   1.00 0.00 ? 11 GLU A N    2  
ATOM   1437  C  CA   . GLU A 1 11 ? -5.777  -3.981  3.779   1.00 0.00 ? 11 GLU A CA   2  
ATOM   1438  C  C    . GLU A 1 11 ? -6.340  -2.567  3.937   1.00 0.00 ? 11 GLU A C    2  
ATOM   1439  O  O    . GLU A 1 11 ? -7.357  -2.226  3.333   1.00 0.00 ? 11 GLU A O    2  
ATOM   1440  C  CB   . GLU A 1 11 ? -6.357  -4.899  4.857   1.00 0.00 ? 11 GLU A CB   2  
ATOM   1441  C  CG   . GLU A 1 11 ? -6.430  -6.361  4.443   1.00 0.00 ? 11 GLU A CG   2  
ATOM   1442  C  CD   . GLU A 1 11 ? -7.819  -6.771  3.992   1.00 0.00 ? 11 GLU A CD   2  
ATOM   1443  O  OE1  . GLU A 1 11 ? -8.232  -6.354  2.889   1.00 0.00 ? 11 GLU A OE1  2  
ATOM   1444  O  OE2  . GLU A 1 11 ? -8.494  -7.509  4.740   1.00 0.00 ? 11 GLU A OE2  2  
ATOM   1445  H  H    . GLU A 1 11 ? -3.867  -4.502  4.537   1.00 0.00 ? 11 GLU A H    2  
ATOM   1446  H  HA   . GLU A 1 11 ? -6.059  -4.359  2.807   1.00 0.00 ? 11 GLU A HA   2  
ATOM   1447  H  HB2  . GLU A 1 11 ? -5.743  -4.829  5.743   1.00 0.00 ? 11 GLU A HB2  2  
ATOM   1448  H  HB3  . GLU A 1 11 ? -7.356  -4.565  5.096   1.00 0.00 ? 11 GLU A HB3  2  
ATOM   1449  H  HG2  . GLU A 1 11 ? -5.741  -6.528  3.629   1.00 0.00 ? 11 GLU A HG2  2  
ATOM   1450  H  HG3  . GLU A 1 11 ? -6.146  -6.974  5.286   1.00 0.00 ? 11 GLU A HG3  2  
ATOM   1451  N  N    . ASP A 1 12 ? -5.666  -1.746  4.745   1.00 0.00 ? 12 ASP A N    2  
ATOM   1452  C  CA   . ASP A 1 12 ? -6.094  -0.367  4.973   1.00 0.00 ? 12 ASP A CA   2  
ATOM   1453  C  C    . ASP A 1 12 ? -5.801  0.509   3.751   1.00 0.00 ? 12 ASP A C    2  
ATOM   1454  O  O    . ASP A 1 12 ? -6.510  1.482   3.493   1.00 0.00 ? 12 ASP A O    2  
ATOM   1455  C  CB   . ASP A 1 12 ? -5.395  0.211   6.208   1.00 0.00 ? 12 ASP A CB   2  
ATOM   1456  C  CG   . ASP A 1 12 ? -6.113  -0.143  7.496   1.00 0.00 ? 12 ASP A CG   2  
ATOM   1457  O  OD1  . ASP A 1 12 ? -5.857  -1.239  8.036   1.00 0.00 ? 12 ASP A OD1  2  
ATOM   1458  O  OD2  . ASP A 1 12 ? -6.929  0.679   7.966   1.00 0.00 ? 12 ASP A OD2  2  
ATOM   1459  H  H    . ASP A 1 12 ? -4.858  -2.075  5.196   1.00 0.00 ? 12 ASP A H    2  
ATOM   1460  H  HA   . ASP A 1 12 ? -7.160  -0.375  5.147   1.00 0.00 ? 12 ASP A HA   2  
ATOM   1461  H  HB2  . ASP A 1 12 ? -4.389  -0.181  6.261   1.00 0.00 ? 12 ASP A HB2  2  
ATOM   1462  H  HB3  . ASP A 1 12 ? -5.354  1.286   6.122   1.00 0.00 ? 12 ASP A HB3  2  
ATOM   1463  N  N    . PHE A 1 13 ? -4.752  0.155   3.003   1.00 0.00 ? 13 PHE A N    2  
ATOM   1464  C  CA   . PHE A 1 13 ? -4.365  0.905   1.808   1.00 0.00 ? 13 PHE A CA   2  
ATOM   1465  C  C    . PHE A 1 13 ? -5.452  0.832   0.733   1.00 0.00 ? 13 PHE A C    2  
ATOM   1466  O  O    . PHE A 1 13 ? -6.440  0.108   0.882   1.00 0.00 ? 13 PHE A O    2  
ATOM   1467  C  CB   . PHE A 1 13 ? -3.050  0.358   1.241   1.00 0.00 ? 13 PHE A CB   2  
ATOM   1468  C  CG   . PHE A 1 13 ? -1.816  0.895   1.916   1.00 0.00 ? 13 PHE A CG   2  
ATOM   1469  C  CD1  . PHE A 1 13 ? -1.545  0.597   3.242   1.00 0.00 ? 13 PHE A CD1  2  
ATOM   1470  C  CD2  . PHE A 1 13 ? -0.922  1.691   1.216   1.00 0.00 ? 13 PHE A CD2  2  
ATOM   1471  C  CE1  . PHE A 1 13 ? -0.406  1.085   3.859   1.00 0.00 ? 13 PHE A CE1  2  
ATOM   1472  C  CE2  . PHE A 1 13 ? 0.216   2.182   1.827   1.00 0.00 ? 13 PHE A CE2  2  
ATOM   1473  C  CZ   . PHE A 1 13 ? 0.475   1.878   3.149   1.00 0.00 ? 13 PHE A CZ   2  
ATOM   1474  H  H    . PHE A 1 13 ? -4.226  -0.631  3.261   1.00 0.00 ? 13 PHE A H    2  
ATOM   1475  H  HA   . PHE A 1 13 ? -4.224  1.937   2.093   1.00 0.00 ? 13 PHE A HA   2  
ATOM   1476  H  HB2  . PHE A 1 13 ? -3.042  -0.716  1.345   1.00 0.00 ? 13 PHE A HB2  2  
ATOM   1477  H  HB3  . PHE A 1 13 ? -2.991  0.611   0.192   1.00 0.00 ? 13 PHE A HB3  2  
ATOM   1478  H  HD1  . PHE A 1 13 ? -2.232  -0.023  3.798   1.00 0.00 ? 13 PHE A HD1  2  
ATOM   1479  H  HD2  . PHE A 1 13 ? -1.122  1.931   0.183   1.00 0.00 ? 13 PHE A HD2  2  
ATOM   1480  H  HE1  . PHE A 1 13 ? -0.206  0.846   4.892   1.00 0.00 ? 13 PHE A HE1  2  
ATOM   1481  H  HE2  . PHE A 1 13 ? 0.904   2.802   1.270   1.00 0.00 ? 13 PHE A HE2  2  
ATOM   1482  H  HZ   . PHE A 1 13 ? 1.364   2.259   3.629   1.00 0.00 ? 13 PHE A HZ   2  
ATOM   1483  N  N    . GLN A 1 14 ? -5.259  1.583   -0.352  1.00 0.00 ? 14 GLN A N    2  
ATOM   1484  C  CA   . GLN A 1 14 ? -6.216  1.604   -1.456  1.00 0.00 ? 14 GLN A CA   2  
ATOM   1485  C  C    . GLN A 1 14 ? -5.583  1.050   -2.733  1.00 0.00 ? 14 GLN A C    2  
ATOM   1486  O  O    . GLN A 1 14 ? -4.685  1.670   -3.308  1.00 0.00 ? 14 GLN A O    2  
ATOM   1487  C  CB   . GLN A 1 14 ? -6.712  3.033   -1.699  1.00 0.00 ? 14 GLN A CB   2  
ATOM   1488  C  CG   . GLN A 1 14 ? -7.975  3.107   -2.546  1.00 0.00 ? 14 GLN A CG   2  
ATOM   1489  C  CD   . GLN A 1 14 ? -8.986  4.104   -2.004  1.00 0.00 ? 14 GLN A CD   2  
ATOM   1490  O  OE1  . GLN A 1 14 ? -8.751  5.312   -2.019  1.00 0.00 ? 14 GLN A OE1  2  
ATOM   1491  N  NE2  . GLN A 1 14 ? -10.117 3.602   -1.521  1.00 0.00 ? 14 GLN A NE2  2  
ATOM   1492  H  H    . GLN A 1 14 ? -4.451  2.134   -0.413  1.00 0.00 ? 14 GLN A H    2  
ATOM   1493  H  HA   . GLN A 1 14 ? -7.054  0.981   -1.183  1.00 0.00 ? 14 GLN A HA   2  
ATOM   1494  H  HB2  . GLN A 1 14 ? -6.914  3.498   -0.746  1.00 0.00 ? 14 GLN A HB2  2  
ATOM   1495  H  HB3  . GLN A 1 14 ? -5.936  3.590   -2.203  1.00 0.00 ? 14 GLN A HB3  2  
ATOM   1496  H  HG2  . GLN A 1 14 ? -7.705  3.404   -3.548  1.00 0.00 ? 14 GLN A HG2  2  
ATOM   1497  H  HG3  . GLN A 1 14 ? -8.435  2.130   -2.573  1.00 0.00 ? 14 GLN A HG3  2  
ATOM   1498  H  HE21 . GLN A 1 14 ? -10.237 2.629   -1.540  1.00 0.00 ? 14 GLN A HE21 2  
ATOM   1499  H  HE22 . GLN A 1 14 ? -10.785 4.225   -1.165  1.00 0.00 ? 14 GLN A HE22 2  
ATOM   1500  N  N    . TYR A 1 15 ? -6.056  -0.117  -3.175  1.00 0.00 ? 15 TYR A N    2  
ATOM   1501  C  CA   . TYR A 1 15 ? -5.532  -0.741  -4.388  1.00 0.00 ? 15 TYR A CA   2  
ATOM   1502  C  C    . TYR A 1 15 ? -5.858  0.108   -5.614  1.00 0.00 ? 15 TYR A C    2  
ATOM   1503  O  O    . TYR A 1 15 ? -7.024  0.392   -5.894  1.00 0.00 ? 15 TYR A O    2  
ATOM   1504  C  CB   . TYR A 1 15 ? -6.099  -2.156  -4.565  1.00 0.00 ? 15 TYR A CB   2  
ATOM   1505  C  CG   . TYR A 1 15 ? -5.579  -2.870  -5.797  1.00 0.00 ? 15 TYR A CG   2  
ATOM   1506  C  CD1  . TYR A 1 15 ? -4.270  -3.336  -5.852  1.00 0.00 ? 15 TYR A CD1  2  
ATOM   1507  C  CD2  . TYR A 1 15 ? -6.394  -3.077  -6.904  1.00 0.00 ? 15 TYR A CD2  2  
ATOM   1508  C  CE1  . TYR A 1 15 ? -3.790  -3.989  -6.971  1.00 0.00 ? 15 TYR A CE1  2  
ATOM   1509  C  CE2  . TYR A 1 15 ? -5.921  -3.730  -8.026  1.00 0.00 ? 15 TYR A CE2  2  
ATOM   1510  C  CZ   . TYR A 1 15 ? -4.618  -4.183  -8.056  1.00 0.00 ? 15 TYR A CZ   2  
ATOM   1511  O  OH   . TYR A 1 15 ? -4.144  -4.833  -9.174  1.00 0.00 ? 15 TYR A OH   2  
ATOM   1512  H  H    . TYR A 1 15 ? -6.774  -0.564  -2.677  1.00 0.00 ? 15 TYR A H    2  
ATOM   1513  H  HA   . TYR A 1 15 ? -4.459  -0.806  -4.286  1.00 0.00 ? 15 TYR A HA   2  
ATOM   1514  H  HB2  . TYR A 1 15 ? -5.838  -2.751  -3.704  1.00 0.00 ? 15 TYR A HB2  2  
ATOM   1515  H  HB3  . TYR A 1 15 ? -7.175  -2.099  -4.644  1.00 0.00 ? 15 TYR A HB3  2  
ATOM   1516  H  HD1  . TYR A 1 15 ? -3.623  -3.183  -5.002  1.00 0.00 ? 15 TYR A HD1  2  
ATOM   1517  H  HD2  . TYR A 1 15 ? -7.414  -2.721  -6.878  1.00 0.00 ? 15 TYR A HD2  2  
ATOM   1518  H  HE1  . TYR A 1 15 ? -2.770  -4.343  -6.993  1.00 0.00 ? 15 TYR A HE1  2  
ATOM   1519  H  HE2  . TYR A 1 15 ? -6.572  -3.880  -8.877  1.00 0.00 ? 15 TYR A HE2  2  
ATOM   1520  H  HH   . TYR A 1 15 ? -3.901  -5.733  -8.943  1.00 0.00 ? 15 TYR A HH   2  
ATOM   1521  N  N    . ASP A 1 16 ? -4.816  0.513   -6.336  1.00 0.00 ? 16 ASP A N    2  
ATOM   1522  C  CA   . ASP A 1 16 ? -4.978  1.334   -7.531  1.00 0.00 ? 16 ASP A CA   2  
ATOM   1523  C  C    . ASP A 1 16 ? -4.881  0.483   -8.795  1.00 0.00 ? 16 ASP A C    2  
ATOM   1524  O  O    . ASP A 1 16 ? -3.792  0.265   -9.325  1.00 0.00 ? 16 ASP A O    2  
ATOM   1525  C  CB   . ASP A 1 16 ? -3.919  2.442   -7.561  1.00 0.00 ? 16 ASP A CB   2  
ATOM   1526  C  CG   . ASP A 1 16 ? -4.355  3.643   -8.378  1.00 0.00 ? 16 ASP A CG   2  
ATOM   1527  O  OD1  . ASP A 1 16 ? -5.390  4.254   -8.036  1.00 0.00 ? 16 ASP A OD1  2  
ATOM   1528  O  OD2  . ASP A 1 16 ? -3.661  3.972   -9.362  1.00 0.00 ? 16 ASP A OD2  2  
ATOM   1529  H  H    . ASP A 1 16 ? -3.913  0.254   -6.057  1.00 0.00 ? 16 ASP A H    2  
ATOM   1530  H  HA   . ASP A 1 16 ? -5.958  1.790   -7.490  1.00 0.00 ? 16 ASP A HA   2  
ATOM   1531  H  HB2  . ASP A 1 16 ? -3.720  2.769   -6.552  1.00 0.00 ? 16 ASP A HB2  2  
ATOM   1532  H  HB3  . ASP A 1 16 ? -3.009  2.049   -7.992  1.00 0.00 ? 16 ASP A HB3  2  
ATOM   1533  N  N    . GLU A 1 17 ? -6.031  0.006   -9.273  1.00 0.00 ? 17 GLU A N    2  
ATOM   1534  C  CA   . GLU A 1 17 ? -6.084  -0.823  -10.480 1.00 0.00 ? 17 GLU A CA   2  
ATOM   1535  C  C    . GLU A 1 17 ? -5.447  -0.117  -11.679 1.00 0.00 ? 17 GLU A C    2  
ATOM   1536  O  O    . GLU A 1 17 ? -4.954  -0.772  -12.599 1.00 0.00 ? 17 GLU A O    2  
ATOM   1537  C  CB   . GLU A 1 17 ? -7.533  -1.194  -10.812 1.00 0.00 ? 17 GLU A CB   2  
ATOM   1538  C  CG   . GLU A 1 17 ? -8.500  -0.015  -10.769 1.00 0.00 ? 17 GLU A CG   2  
ATOM   1539  C  CD   . GLU A 1 17 ? -9.835  -0.321  -11.425 1.00 0.00 ? 17 GLU A CD   2  
ATOM   1540  O  OE1  . GLU A 1 17 ? -9.845  -0.999  -12.475 1.00 0.00 ? 17 GLU A OE1  2  
ATOM   1541  O  OE2  . GLU A 1 17 ? -10.872 0.122   -10.888 1.00 0.00 ? 17 GLU A OE2  2  
ATOM   1542  H  H    . GLU A 1 17 ? -6.864  0.217   -8.803  1.00 0.00 ? 17 GLU A H    2  
ATOM   1543  H  HA   . GLU A 1 17 ? -5.532  -1.730  -10.281 1.00 0.00 ? 17 GLU A HA   2  
ATOM   1544  H  HB2  . GLU A 1 17 ? -7.563  -1.616  -11.803 1.00 0.00 ? 17 GLU A HB2  2  
ATOM   1545  H  HB3  . GLU A 1 17 ? -7.874  -1.935  -10.104 1.00 0.00 ? 17 GLU A HB3  2  
ATOM   1546  H  HG2  . GLU A 1 17 ? -8.680  0.249   -9.737  1.00 0.00 ? 17 GLU A HG2  2  
ATOM   1547  H  HG3  . GLU A 1 17 ? -8.049  0.824   -11.279 1.00 0.00 ? 17 GLU A HG3  2  
ATOM   1548  N  N    . ASP A 1 18 ? -5.469  1.218   -11.661 1.00 0.00 ? 18 ASP A N    2  
ATOM   1549  C  CA   . ASP A 1 18 ? -4.903  2.026   -12.744 1.00 0.00 ? 18 ASP A CA   2  
ATOM   1550  C  C    . ASP A 1 18 ? -3.511  1.537   -13.138 1.00 0.00 ? 18 ASP A C    2  
ATOM   1551  O  O    . ASP A 1 18 ? -3.245  1.293   -14.316 1.00 0.00 ? 18 ASP A O    2  
ATOM   1552  C  CB   . ASP A 1 18 ? -4.829  3.504   -12.336 1.00 0.00 ? 18 ASP A CB   2  
ATOM   1553  C  CG   . ASP A 1 18 ? -6.156  4.051   -11.844 1.00 0.00 ? 18 ASP A CG   2  
ATOM   1554  O  OD1  . ASP A 1 18 ? -6.607  3.627   -10.760 1.00 0.00 ? 18 ASP A OD1  2  
ATOM   1555  O  OD2  . ASP A 1 18 ? -6.742  4.903   -12.543 1.00 0.00 ? 18 ASP A OD2  2  
ATOM   1556  H  H    . ASP A 1 18 ? -5.886  1.673   -10.900 1.00 0.00 ? 18 ASP A H    2  
ATOM   1557  H  HA   . ASP A 1 18 ? -5.558  1.933   -13.598 1.00 0.00 ? 18 ASP A HA   2  
ATOM   1558  H  HB2  . ASP A 1 18 ? -4.102  3.616   -11.549 1.00 0.00 ? 18 ASP A HB2  2  
ATOM   1559  H  HB3  . ASP A 1 18 ? -4.517  4.087   -13.190 1.00 0.00 ? 18 ASP A HB3  2  
ATOM   1560  N  N    . SER A 1 19 ? -2.624  1.402   -12.150 1.00 0.00 ? 19 SER A N    2  
ATOM   1561  C  CA   . SER A 1 19 ? -1.257  0.949   -12.406 1.00 0.00 ? 19 SER A CA   2  
ATOM   1562  C  C    . SER A 1 19 ? -0.741  0.037   -11.282 1.00 0.00 ? 19 SER A C    2  
ATOM   1563  O  O    . SER A 1 19 ? 0.465   -0.037  -11.042 1.00 0.00 ? 19 SER A O    2  
ATOM   1564  C  CB   . SER A 1 19 ? -0.331  2.159   -12.571 1.00 0.00 ? 19 SER A CB   2  
ATOM   1565  O  OG   . SER A 1 19 ? -0.669  2.914   -13.725 1.00 0.00 ? 19 SER A OG   2  
ATOM   1566  H  H    . SER A 1 19 ? -2.893  1.619   -11.232 1.00 0.00 ? 19 SER A H    2  
ATOM   1567  H  HA   . SER A 1 19 ? -1.264  0.388   -13.330 1.00 0.00 ? 19 SER A HA   2  
ATOM   1568  H  HB2  . SER A 1 19 ? -0.419  2.796   -11.703 1.00 0.00 ? 19 SER A HB2  2  
ATOM   1569  H  HB3  . SER A 1 19 ? 0.690   1.820   -12.664 1.00 0.00 ? 19 SER A HB3  2  
ATOM   1570  H  HG   . SER A 1 19 ? -0.704  3.847   -13.497 1.00 0.00 ? 19 SER A HG   2  
ATOM   1571  N  N    . GLU A 1 20 ? -1.660  -0.662  -10.604 1.00 0.00 ? 20 GLU A N    2  
ATOM   1572  C  CA   . GLU A 1 20 ? -1.301  -1.571  -9.512  1.00 0.00 ? 20 GLU A CA   2  
ATOM   1573  C  C    . GLU A 1 20 ? -0.421  -0.874  -8.468  1.00 0.00 ? 20 GLU A C    2  
ATOM   1574  O  O    . GLU A 1 20 ? 0.757   -1.203  -8.312  1.00 0.00 ? 20 GLU A O    2  
ATOM   1575  C  CB   . GLU A 1 20 ? -0.580  -2.806  -10.062 1.00 0.00 ? 20 GLU A CB   2  
ATOM   1576  C  CG   . GLU A 1 20 ? -1.313  -3.489  -11.209 1.00 0.00 ? 20 GLU A CG   2  
ATOM   1577  C  CD   . GLU A 1 20 ? -0.378  -3.958  -12.307 1.00 0.00 ? 20 GLU A CD   2  
ATOM   1578  O  OE1  . GLU A 1 20 ? 0.620   -4.640  -11.989 1.00 0.00 ? 20 GLU A OE1  2  
ATOM   1579  O  OE2  . GLU A 1 20 ? -0.647  -3.648  -13.487 1.00 0.00 ? 20 GLU A OE2  2  
ATOM   1580  H  H    . GLU A 1 20 ? -2.605  -0.568  -10.846 1.00 0.00 ? 20 GLU A H    2  
ATOM   1581  H  HA   . GLU A 1 20 ? -2.216  -1.889  -9.034  1.00 0.00 ? 20 GLU A HA   2  
ATOM   1582  H  HB2  . GLU A 1 20 ? 0.396   -2.508  -10.416 1.00 0.00 ? 20 GLU A HB2  2  
ATOM   1583  H  HB3  . GLU A 1 20 ? -0.460  -3.523  -9.263  1.00 0.00 ? 20 GLU A HB3  2  
ATOM   1584  H  HG2  . GLU A 1 20 ? -1.844  -4.346  -10.821 1.00 0.00 ? 20 GLU A HG2  2  
ATOM   1585  H  HG3  . GLU A 1 20 ? -2.021  -2.791  -11.633 1.00 0.00 ? 20 GLU A HG3  2  
ATOM   1586  N  N    . THR A 1 21 ? -1.006  0.085   -7.753  1.00 0.00 ? 21 THR A N    2  
ATOM   1587  C  CA   . THR A 1 21 ? -0.283  0.828   -6.719  1.00 0.00 ? 21 THR A CA   2  
ATOM   1588  C  C    . THR A 1 21 ? -1.163  1.024   -5.484  1.00 0.00 ? 21 THR A C    2  
ATOM   1589  O  O    . THR A 1 21 ? -2.384  1.108   -5.593  1.00 0.00 ? 21 THR A O    2  
ATOM   1590  C  CB   . THR A 1 21 ? 0.176   2.189   -7.261  1.00 0.00 ? 21 THR A CB   2  
ATOM   1591  O  OG1  . THR A 1 21 ? 0.791   2.045   -8.529  1.00 0.00 ? 21 THR A OG1  2  
ATOM   1592  C  CG2  . THR A 1 21 ? 1.164   2.896   -6.354  1.00 0.00 ? 21 THR A CG2  2  
ATOM   1593  H  H    . THR A 1 21 ? -1.948  0.297   -7.921  1.00 0.00 ? 21 THR A H    2  
ATOM   1594  H  HA   . THR A 1 21 ? 0.584   0.249   -6.441  1.00 0.00 ? 21 THR A HA   2  
ATOM   1595  H  HB   . THR A 1 21 ? -0.687  2.831   -7.374  1.00 0.00 ? 21 THR A HB   2  
ATOM   1596  H  HG1  . THR A 1 21 ? 0.794   2.890   -8.984  1.00 0.00 ? 21 THR A HG1  2  
ATOM   1597  H  HG21 . THR A 1 21 ? 2.151   2.488   -6.510  1.00 0.00 ? 21 THR A HG21 2  
ATOM   1598  H  HG22 . THR A 1 21 ? 0.875   2.753   -5.323  1.00 0.00 ? 21 THR A HG22 2  
ATOM   1599  H  HG23 . THR A 1 21 ? 1.172   3.952   -6.581  1.00 0.00 ? 21 THR A HG23 2  
ATOM   1600  N  N    . TYR A 1 22 ? -0.538  1.099   -4.310  1.00 0.00 ? 22 TYR A N    2  
ATOM   1601  C  CA   . TYR A 1 22 ? -1.275  1.286   -3.060  1.00 0.00 ? 22 TYR A CA   2  
ATOM   1602  C  C    . TYR A 1 22 ? -0.939  2.636   -2.434  1.00 0.00 ? 22 TYR A C    2  
ATOM   1603  O  O    . TYR A 1 22 ? 0.216   3.064   -2.448  1.00 0.00 ? 22 TYR A O    2  
ATOM   1604  C  CB   . TYR A 1 22 ? -0.969  0.152   -2.076  1.00 0.00 ? 22 TYR A CB   2  
ATOM   1605  C  CG   . TYR A 1 22 ? -1.171  -1.229  -2.659  1.00 0.00 ? 22 TYR A CG   2  
ATOM   1606  C  CD1  . TYR A 1 22 ? -0.252  -1.769  -3.551  1.00 0.00 ? 22 TYR A CD1  2  
ATOM   1607  C  CD2  . TYR A 1 22 ? -2.281  -1.994  -2.320  1.00 0.00 ? 22 TYR A CD2  2  
ATOM   1608  C  CE1  . TYR A 1 22 ? -0.432  -3.028  -4.087  1.00 0.00 ? 22 TYR A CE1  2  
ATOM   1609  C  CE2  . TYR A 1 22 ? -2.467  -3.255  -2.851  1.00 0.00 ? 22 TYR A CE2  2  
ATOM   1610  C  CZ   . TYR A 1 22 ? -1.540  -3.767  -3.735  1.00 0.00 ? 22 TYR A CZ   2  
ATOM   1611  O  OH   . TYR A 1 22 ? -1.721  -5.022  -4.268  1.00 0.00 ? 22 TYR A OH   2  
ATOM   1612  H  H    . TYR A 1 22 ? 0.439   1.024   -4.282  1.00 0.00 ? 22 TYR A H    2  
ATOM   1613  H  HA   . TYR A 1 22 ? -2.330  1.267   -3.294  1.00 0.00 ? 22 TYR A HA   2  
ATOM   1614  H  HB2  . TYR A 1 22 ? 0.059   0.231   -1.756  1.00 0.00 ? 22 TYR A HB2  2  
ATOM   1615  H  HB3  . TYR A 1 22 ? -1.615  0.247   -1.217  1.00 0.00 ? 22 TYR A HB3  2  
ATOM   1616  H  HD1  . TYR A 1 22 ? 0.617   -1.188  -3.827  1.00 0.00 ? 22 TYR A HD1  2  
ATOM   1617  H  HD2  . TYR A 1 22 ? -3.005  -1.591  -1.628  1.00 0.00 ? 22 TYR A HD2  2  
ATOM   1618  H  HE1  . TYR A 1 22 ? 0.294   -3.427  -4.779  1.00 0.00 ? 22 TYR A HE1  2  
ATOM   1619  H  HE2  . TYR A 1 22 ? -3.335  -3.834  -2.576  1.00 0.00 ? 22 TYR A HE2  2  
ATOM   1620  H  HH   . TYR A 1 22 ? -1.499  -5.684  -3.610  1.00 0.00 ? 22 TYR A HH   2  
ATOM   1621  N  N    . PHE A 1 23 ? -1.956  3.312   -1.898  1.00 0.00 ? 23 PHE A N    2  
ATOM   1622  C  CA   . PHE A 1 23 ? -1.764  4.624   -1.282  1.00 0.00 ? 23 PHE A CA   2  
ATOM   1623  C  C    . PHE A 1 23 ? -2.321  4.663   0.142   1.00 0.00 ? 23 PHE A C    2  
ATOM   1624  O  O    . PHE A 1 23 ? -3.236  3.912   0.482   1.00 0.00 ? 23 PHE A O    2  
ATOM   1625  C  CB   . PHE A 1 23 ? -2.435  5.711   -2.131  1.00 0.00 ? 23 PHE A CB   2  
ATOM   1626  C  CG   . PHE A 1 23 ? -1.953  5.754   -3.557  1.00 0.00 ? 23 PHE A CG   2  
ATOM   1627  C  CD1  . PHE A 1 23 ? -2.272  4.736   -4.442  1.00 0.00 ? 23 PHE A CD1  2  
ATOM   1628  C  CD2  . PHE A 1 23 ? -1.181  6.812   -4.011  1.00 0.00 ? 23 PHE A CD2  2  
ATOM   1629  C  CE1  . PHE A 1 23 ? -1.832  4.772   -5.750  1.00 0.00 ? 23 PHE A CE1  2  
ATOM   1630  C  CE2  . PHE A 1 23 ? -0.738  6.855   -5.319  1.00 0.00 ? 23 PHE A CE2  2  
ATOM   1631  C  CZ   . PHE A 1 23 ? -1.063  5.832   -6.190  1.00 0.00 ? 23 PHE A CZ   2  
ATOM   1632  H  H    . PHE A 1 23 ? -2.857  2.925   -1.928  1.00 0.00 ? 23 PHE A H    2  
ATOM   1633  H  HA   . PHE A 1 23 ? -0.704  4.818   -1.244  1.00 0.00 ? 23 PHE A HA   2  
ATOM   1634  H  HB2  . PHE A 1 23 ? -3.501  5.538   -2.147  1.00 0.00 ? 23 PHE A HB2  2  
ATOM   1635  H  HB3  . PHE A 1 23 ? -2.241  6.676   -1.684  1.00 0.00 ? 23 PHE A HB3  2  
ATOM   1636  H  HD1  . PHE A 1 23 ? -2.874  3.907   -4.102  1.00 0.00 ? 23 PHE A HD1  2  
ATOM   1637  H  HD2  . PHE A 1 23 ? -0.927  7.613   -3.332  1.00 0.00 ? 23 PHE A HD2  2  
ATOM   1638  H  HE1  . PHE A 1 23 ? -2.088  3.972   -6.429  1.00 0.00 ? 23 PHE A HE1  2  
ATOM   1639  H  HE2  . PHE A 1 23 ? -0.138  7.684   -5.659  1.00 0.00 ? 23 PHE A HE2  2  
ATOM   1640  H  HZ   . PHE A 1 23 ? -0.717  5.863   -7.212  1.00 0.00 ? 23 PHE A HZ   2  
ATOM   1641  N  N    . TYR A 1 24 ? -1.760  5.551   0.968   1.00 0.00 ? 24 TYR A N    2  
ATOM   1642  C  CA   . TYR A 1 24 ? -2.196  5.698   2.356   1.00 0.00 ? 24 TYR A CA   2  
ATOM   1643  C  C    . TYR A 1 24 ? -2.418  7.171   2.709   1.00 0.00 ? 24 TYR A C    2  
ATOM   1644  O  O    . TYR A 1 24 ? -1.562  8.013   2.439   1.00 0.00 ? 24 TYR A O    2  
ATOM   1645  C  CB   . TYR A 1 24 ? -1.165  5.089   3.310   1.00 0.00 ? 24 TYR A CB   2  
ATOM   1646  C  CG   . TYR A 1 24 ? -1.684  4.894   4.719   1.00 0.00 ? 24 TYR A CG   2  
ATOM   1647  C  CD1  . TYR A 1 24 ? -2.793  4.093   4.967   1.00 0.00 ? 24 TYR A CD1  2  
ATOM   1648  C  CD2  . TYR A 1 24 ? -1.068  5.514   5.801   1.00 0.00 ? 24 TYR A CD2  2  
ATOM   1649  C  CE1  . TYR A 1 24 ? -3.272  3.915   6.250   1.00 0.00 ? 24 TYR A CE1  2  
ATOM   1650  C  CE2  . TYR A 1 24 ? -1.542  5.339   7.088   1.00 0.00 ? 24 TYR A CE2  2  
ATOM   1651  C  CZ   . TYR A 1 24 ? -2.644  4.538   7.307   1.00 0.00 ? 24 TYR A CZ   2  
ATOM   1652  O  OH   . TYR A 1 24 ? -3.118  4.363   8.587   1.00 0.00 ? 24 TYR A OH   2  
ATOM   1653  H  H    . TYR A 1 24 ? -1.035  6.121   0.633   1.00 0.00 ? 24 TYR A H    2  
ATOM   1654  H  HA   . TYR A 1 24 ? -3.130  5.170   2.466   1.00 0.00 ? 24 TYR A HA   2  
ATOM   1655  H  HB2  . TYR A 1 24 ? -0.862  4.126   2.932   1.00 0.00 ? 24 TYR A HB2  2  
ATOM   1656  H  HB3  . TYR A 1 24 ? -0.303  5.740   3.360   1.00 0.00 ? 24 TYR A HB3  2  
ATOM   1657  H  HD1  . TYR A 1 24 ? -3.284  3.605   4.138   1.00 0.00 ? 24 TYR A HD1  2  
ATOM   1658  H  HD2  . TYR A 1 24 ? -0.205  6.140   5.626   1.00 0.00 ? 24 TYR A HD2  2  
ATOM   1659  H  HE1  . TYR A 1 24 ? -4.136  3.288   6.421   1.00 0.00 ? 24 TYR A HE1  2  
ATOM   1660  H  HE2  . TYR A 1 24 ? -1.050  5.829   7.915   1.00 0.00 ? 24 TYR A HE2  2  
ATOM   1661  H  HH   . TYR A 1 24 ? -3.053  3.436   8.831   1.00 0.00 ? 24 TYR A HH   2  
ATOM   1662  N  N    . PRO A 1 25 ? -3.572  7.500   3.327   1.00 0.00 ? 25 PRO A N    2  
ATOM   1663  C  CA   . PRO A 1 25 ? -3.900  8.879   3.719   1.00 0.00 ? 25 PRO A CA   2  
ATOM   1664  C  C    . PRO A 1 25 ? -2.871  9.475   4.677   1.00 0.00 ? 25 PRO A C    2  
ATOM   1665  O  O    . PRO A 1 25 ? -2.595  8.909   5.738   1.00 0.00 ? 25 PRO A O    2  
ATOM   1666  C  CB   . PRO A 1 25 ? -5.259  8.748   4.417   1.00 0.00 ? 25 PRO A CB   2  
ATOM   1667  C  CG   . PRO A 1 25 ? -5.824  7.463   3.920   1.00 0.00 ? 25 PRO A CG   2  
ATOM   1668  C  CD   . PRO A 1 25 ? -4.649  6.559   3.688   1.00 0.00 ? 25 PRO A CD   2  
ATOM   1669  H  HA   . PRO A 1 25 ? -3.998  9.521   2.858   1.00 0.00 ? 25 PRO A HA   2  
ATOM   1670  H  HB2  . PRO A 1 25 ? -5.116  8.728   5.488   1.00 0.00 ? 25 PRO A HB2  2  
ATOM   1671  H  HB3  . PRO A 1 25 ? -5.885  9.585   4.149   1.00 0.00 ? 25 PRO A HB3  2  
ATOM   1672  H  HG2  . PRO A 1 25 ? -6.485  7.039   4.662   1.00 0.00 ? 25 PRO A HG2  2  
ATOM   1673  H  HG3  . PRO A 1 25 ? -6.356  7.630   2.995   1.00 0.00 ? 25 PRO A HG3  2  
ATOM   1674  H  HD2  . PRO A 1 25 ? -4.405  6.018   4.591   1.00 0.00 ? 25 PRO A HD2  2  
ATOM   1675  H  HD3  . PRO A 1 25 ? -4.853  5.875   2.878   1.00 0.00 ? 25 PRO A HD3  2  
ATOM   1676  N  N    . CYS A 1 26 ? -2.308  10.622  4.297   1.00 0.00 ? 26 CYS A N    2  
ATOM   1677  C  CA   . CYS A 1 26 ? -1.311  11.298  5.119   1.00 0.00 ? 26 CYS A CA   2  
ATOM   1678  C  C    . CYS A 1 26 ? -1.902  12.544  5.777   1.00 0.00 ? 26 CYS A C    2  
ATOM   1679  O  O    . CYS A 1 26 ? -2.686  13.269  5.159   1.00 0.00 ? 26 CYS A O    2  
ATOM   1680  C  CB   . CYS A 1 26 ? -0.095  11.682  4.273   1.00 0.00 ? 26 CYS A CB   2  
ATOM   1681  S  SG   . CYS A 1 26 ? 1.503   11.232  5.022   1.00 0.00 ? 26 CYS A SG   2  
ATOM   1682  H  H    . CYS A 1 26 ? -2.571  11.024  3.443   1.00 0.00 ? 26 CYS A H    2  
ATOM   1683  H  HA   . CYS A 1 26 ? -0.999  10.612  5.891   1.00 0.00 ? 26 CYS A HA   2  
ATOM   1684  H  HB2  . CYS A 1 26 ? -0.159  11.186  3.317   1.00 0.00 ? 26 CYS A HB2  2  
ATOM   1685  H  HB3  . CYS A 1 26 ? -0.096  12.751  4.120   1.00 0.00 ? 26 CYS A HB3  2  
ATOM   1686  N  N    . PRO A 1 27 ? -1.529  12.815  7.044   1.00 0.00 ? 27 PRO A N    2  
ATOM   1687  C  CA   . PRO A 1 27 ? -2.022  13.985  7.783   1.00 0.00 ? 27 PRO A CA   2  
ATOM   1688  C  C    . PRO A 1 27 ? -1.523  15.311  7.202   1.00 0.00 ? 27 PRO A C    2  
ATOM   1689  O  O    . PRO A 1 27 ? -2.087  16.368  7.489   1.00 0.00 ? 27 PRO A O    2  
ATOM   1690  C  CB   . PRO A 1 27 ? -1.465  13.781  9.195   1.00 0.00 ? 27 PRO A CB   2  
ATOM   1691  C  CG   . PRO A 1 27 ? -0.276  12.902  9.015   1.00 0.00 ? 27 PRO A CG   2  
ATOM   1692  C  CD   . PRO A 1 27 ? -0.595  12.006  7.852   1.00 0.00 ? 27 PRO A CD   2  
ATOM   1693  H  HA   . PRO A 1 27 ? -3.102  13.997  7.820   1.00 0.00 ? 27 PRO A HA   2  
ATOM   1694  H  HB2  . PRO A 1 27 ? -1.190  14.737  9.615   1.00 0.00 ? 27 PRO A HB2  2  
ATOM   1695  H  HB3  . PRO A 1 27 ? -2.213  13.311  9.815   1.00 0.00 ? 27 PRO A HB3  2  
ATOM   1696  H  HG2  . PRO A 1 27 ? 0.595   13.502  8.798   1.00 0.00 ? 27 PRO A HG2  2  
ATOM   1697  H  HG3  . PRO A 1 27 ? -0.116  12.315  9.906   1.00 0.00 ? 27 PRO A HG3  2  
ATOM   1698  H  HD2  . PRO A 1 27 ? 0.303   11.776  7.295   1.00 0.00 ? 27 PRO A HD2  2  
ATOM   1699  H  HD3  . PRO A 1 27 ? -1.072  11.099  8.194   1.00 0.00 ? 27 PRO A HD3  2  
ATOM   1700  N  N    . CYS A 1 28 ? -0.469  15.252  6.389   1.00 0.00 ? 28 CYS A N    2  
ATOM   1701  C  CA   . CYS A 1 28 ? 0.095   16.452  5.774   1.00 0.00 ? 28 CYS A CA   2  
ATOM   1702  C  C    . CYS A 1 28 ? -0.860  17.037  4.727   1.00 0.00 ? 28 CYS A C    2  
ATOM   1703  O  O    . CYS A 1 28 ? -0.908  18.254  4.533   1.00 0.00 ? 28 CYS A O    2  
ATOM   1704  C  CB   . CYS A 1 28 ? 1.444   16.131  5.128   1.00 0.00 ? 28 CYS A CB   2  
ATOM   1705  S  SG   . CYS A 1 28 ? 1.344   14.932  3.758   1.00 0.00 ? 28 CYS A SG   2  
ATOM   1706  H  H    . CYS A 1 28 ? -0.060  14.381  6.195   1.00 0.00 ? 28 CYS A H    2  
ATOM   1707  H  HA   . CYS A 1 28 ? 0.245   17.183  6.557   1.00 0.00 ? 28 CYS A HA   2  
ATOM   1708  H  HB2  . CYS A 1 28 ? 1.874   17.041  4.739   1.00 0.00 ? 28 CYS A HB2  2  
ATOM   1709  H  HB3  . CYS A 1 28 ? 2.105   15.719  5.878   1.00 0.00 ? 28 CYS A HB3  2  
ATOM   1710  N  N    . GLY A 1 29 ? -1.608  16.161  4.052   1.00 0.00 ? 29 GLY A N    2  
ATOM   1711  C  CA   . GLY A 1 29 ? -2.543  16.597  3.028   1.00 0.00 ? 29 GLY A CA   2  
ATOM   1712  C  C    . GLY A 1 29 ? -2.618  15.625  1.862   1.00 0.00 ? 29 GLY A C    2  
ATOM   1713  O  O    . GLY A 1 29 ? -3.702  15.339  1.352   1.00 0.00 ? 29 GLY A O    2  
ATOM   1714  H  H    . GLY A 1 29 ? -1.520  15.204  4.249   1.00 0.00 ? 29 GLY A H    2  
ATOM   1715  H  HA2  . GLY A 1 29 ? -3.525  16.688  3.469   1.00 0.00 ? 29 GLY A HA2  2  
ATOM   1716  H  HA3  . GLY A 1 29 ? -2.235  17.564  2.659   1.00 0.00 ? 29 GLY A HA3  2  
ATOM   1717  N  N    . ASP A 1 30 ? -1.458  15.116  1.444   1.00 0.00 ? 30 ASP A N    2  
ATOM   1718  C  CA   . ASP A 1 30 ? -1.384  14.165  0.336   1.00 0.00 ? 30 ASP A CA   2  
ATOM   1719  C  C    . ASP A 1 30 ? -1.555  12.727  0.839   1.00 0.00 ? 30 ASP A C    2  
ATOM   1720  O  O    . ASP A 1 30 ? -1.972  12.503  1.979   1.00 0.00 ? 30 ASP A O    2  
ATOM   1721  C  CB   . ASP A 1 30 ? -0.042  14.319  -0.391  1.00 0.00 ? 30 ASP A CB   2  
ATOM   1722  C  CG   . ASP A 1 30 ? -0.175  14.243  -1.901  1.00 0.00 ? 30 ASP A CG   2  
ATOM   1723  O  OD1  . ASP A 1 30 ? -0.865  13.327  -2.397  1.00 0.00 ? 30 ASP A OD1  2  
ATOM   1724  O  OD2  . ASP A 1 30 ? 0.414   15.103  -2.590  1.00 0.00 ? 30 ASP A OD2  2  
ATOM   1725  H  H    . ASP A 1 30 ? -0.631  15.383  1.894   1.00 0.00 ? 30 ASP A H    2  
ATOM   1726  H  HA   . ASP A 1 30 ? -2.187  14.391  -0.351  1.00 0.00 ? 30 ASP A HA   2  
ATOM   1727  H  HB2  . ASP A 1 30 ? 0.386   15.276  -0.138  1.00 0.00 ? 30 ASP A HB2  2  
ATOM   1728  H  HB3  . ASP A 1 30 ? 0.627   13.535  -0.066  1.00 0.00 ? 30 ASP A HB3  2  
ATOM   1729  N  N    . ASN A 1 31 ? -1.232  11.755  -0.016  1.00 0.00 ? 31 ASN A N    2  
ATOM   1730  C  CA   . ASN A 1 31 ? -1.347  10.345  0.339   1.00 0.00 ? 31 ASN A CA   2  
ATOM   1731  C  C    . ASN A 1 31 ? -0.127  9.567   -0.148  1.00 0.00 ? 31 ASN A C    2  
ATOM   1732  O  O    . ASN A 1 31 ? 0.346   9.779   -1.267  1.00 0.00 ? 31 ASN A O    2  
ATOM   1733  C  CB   . ASN A 1 31 ? -2.620  9.742   -0.264  1.00 0.00 ? 31 ASN A CB   2  
ATOM   1734  C  CG   . ASN A 1 31 ? -3.865  10.564  0.031   1.00 0.00 ? 31 ASN A CG   2  
ATOM   1735  O  OD1  . ASN A 1 31 ? -4.653  10.225  0.914   1.00 0.00 ? 31 ASN A OD1  2  
ATOM   1736  N  ND2  . ASN A 1 31 ? -4.054  11.649  -0.714  1.00 0.00 ? 31 ASN A ND2  2  
ATOM   1737  H  H    . ASN A 1 31 ? -0.905  11.994  -0.910  1.00 0.00 ? 31 ASN A H    2  
ATOM   1738  H  HA   . ASN A 1 31 ? -1.398  10.277  1.417   1.00 0.00 ? 31 ASN A HA   2  
ATOM   1739  H  HB2  . ASN A 1 31 ? -2.505  9.674   -1.335  1.00 0.00 ? 31 ASN A HB2  2  
ATOM   1740  H  HB3  . ASN A 1 31 ? -2.765  8.751   0.140   1.00 0.00 ? 31 ASN A HB3  2  
ATOM   1741  H  HD21 . ASN A 1 31 ? -3.389  11.862  -1.403  1.00 0.00 ? 31 ASN A HD21 2  
ATOM   1742  H  HD22 . ASN A 1 31 ? -4.853  12.192  -0.546  1.00 0.00 ? 31 ASN A HD22 2  
ATOM   1743  N  N    . PHE A 1 32 ? 0.373   8.665   0.696   1.00 0.00 ? 32 PHE A N    2  
ATOM   1744  C  CA   . PHE A 1 32 ? 1.539   7.845   0.360   1.00 0.00 ? 32 PHE A CA   2  
ATOM   1745  C  C    . PHE A 1 32 ? 1.271   6.995   -0.883  1.00 0.00 ? 32 PHE A C    2  
ATOM   1746  O  O    . PHE A 1 32 ? 0.126   6.851   -1.309  1.00 0.00 ? 32 PHE A O    2  
ATOM   1747  C  CB   . PHE A 1 32 ? 1.902   6.939   1.537   1.00 0.00 ? 32 PHE A CB   2  
ATOM   1748  C  CG   . PHE A 1 32 ? 2.802   7.593   2.550   1.00 0.00 ? 32 PHE A CG   2  
ATOM   1749  C  CD1  . PHE A 1 32 ? 4.143   7.801   2.270   1.00 0.00 ? 32 PHE A CD1  2  
ATOM   1750  C  CD2  . PHE A 1 32 ? 2.309   7.994   3.783   1.00 0.00 ? 32 PHE A CD2  2  
ATOM   1751  C  CE1  . PHE A 1 32 ? 4.975   8.394   3.198   1.00 0.00 ? 32 PHE A CE1  2  
ATOM   1752  C  CE2  . PHE A 1 32 ? 3.139   8.590   4.714   1.00 0.00 ? 32 PHE A CE2  2  
ATOM   1753  C  CZ   . PHE A 1 32 ? 4.473   8.790   4.422   1.00 0.00 ? 32 PHE A CZ   2  
ATOM   1754  H  H    . PHE A 1 32 ? -0.056  8.545   1.571   1.00 0.00 ? 32 PHE A H    2  
ATOM   1755  H  HA   . PHE A 1 32 ? 2.365   8.508   0.157   1.00 0.00 ? 32 PHE A HA   2  
ATOM   1756  H  HB2  . PHE A 1 32 ? 0.997   6.638   2.042   1.00 0.00 ? 32 PHE A HB2  2  
ATOM   1757  H  HB3  . PHE A 1 32 ? 2.407   6.060   1.162   1.00 0.00 ? 32 PHE A HB3  2  
ATOM   1758  H  HD1  . PHE A 1 32 ? 4.537   7.494   1.312   1.00 0.00 ? 32 PHE A HD1  2  
ATOM   1759  H  HD2  . PHE A 1 32 ? 1.266   7.840   4.013   1.00 0.00 ? 32 PHE A HD2  2  
ATOM   1760  H  HE1  . PHE A 1 32 ? 6.019   8.550   2.967   1.00 0.00 ? 32 PHE A HE1  2  
ATOM   1761  H  HE2  . PHE A 1 32 ? 2.744   8.899   5.672   1.00 0.00 ? 32 PHE A HE2  2  
ATOM   1762  H  HZ   . PHE A 1 32 ? 5.124   9.254   5.149   1.00 0.00 ? 32 PHE A HZ   2  
ATOM   1763  N  N    . SER A 1 33 ? 2.335   6.436   -1.464  1.00 0.00 ? 33 SER A N    2  
ATOM   1764  C  CA   . SER A 1 33 ? 2.205   5.606   -2.661  1.00 0.00 ? 33 SER A CA   2  
ATOM   1765  C  C    . SER A 1 33 ? 3.256   4.496   -2.696  1.00 0.00 ? 33 SER A C    2  
ATOM   1766  O  O    . SER A 1 33 ? 4.420   4.718   -2.356  1.00 0.00 ? 33 SER A O    2  
ATOM   1767  C  CB   . SER A 1 33 ? 2.324   6.474   -3.919  1.00 0.00 ? 33 SER A CB   2  
ATOM   1768  O  OG   . SER A 1 33 ? 3.492   7.277   -3.879  1.00 0.00 ? 33 SER A OG   2  
ATOM   1769  H  H    . SER A 1 33 ? 3.225   6.587   -1.082  1.00 0.00 ? 33 SER A H    2  
ATOM   1770  H  HA   . SER A 1 33 ? 1.225   5.153   -2.645  1.00 0.00 ? 33 SER A HA   2  
ATOM   1771  H  HB2  . SER A 1 33 ? 2.371   5.838   -4.789  1.00 0.00 ? 33 SER A HB2  2  
ATOM   1772  H  HB3  . SER A 1 33 ? 1.461   7.119   -3.991  1.00 0.00 ? 33 SER A HB3  2  
ATOM   1773  H  HG   . SER A 1 33 ? 3.287   8.125   -3.475  1.00 0.00 ? 33 SER A HG   2  
ATOM   1774  N  N    . ILE A 1 34 ? 2.832   3.303   -3.113  1.00 0.00 ? 34 ILE A N    2  
ATOM   1775  C  CA   . ILE A 1 34 ? 3.723   2.148   -3.209  1.00 0.00 ? 34 ILE A CA   2  
ATOM   1776  C  C    . ILE A 1 34 ? 3.238   1.181   -4.293  1.00 0.00 ? 34 ILE A C    2  
ATOM   1777  O  O    . ILE A 1 34 ? 2.089   0.738   -4.270  1.00 0.00 ? 34 ILE A O    2  
ATOM   1778  C  CB   . ILE A 1 34 ? 3.833   1.401   -1.857  1.00 0.00 ? 34 ILE A CB   2  
ATOM   1779  C  CG1  . ILE A 1 34 ? 4.799   0.219   -1.967  1.00 0.00 ? 34 ILE A CG1  2  
ATOM   1780  C  CG2  . ILE A 1 34 ? 2.463   0.929   -1.390  1.00 0.00 ? 34 ILE A CG2  2  
ATOM   1781  C  CD1  . ILE A 1 34 ? 5.444   -0.148  -0.650  1.00 0.00 ? 34 ILE A CD1  2  
ATOM   1782  H  H    . ILE A 1 34 ? 1.892   3.198   -3.371  1.00 0.00 ? 34 ILE A H    2  
ATOM   1783  H  HA   . ILE A 1 34 ? 4.707   2.508   -3.478  1.00 0.00 ? 34 ILE A HA   2  
ATOM   1784  H  HB   . ILE A 1 34 ? 4.216   2.095   -1.121  1.00 0.00 ? 34 ILE A HB   2  
ATOM   1785  H  HG12 . ILE A 1 34 ? 4.263   -0.647  -2.327  1.00 0.00 ? 34 ILE A HG12 2  
ATOM   1786  H  HG13 . ILE A 1 34 ? 5.585   0.466   -2.666  1.00 0.00 ? 34 ILE A HG13 2  
ATOM   1787  H  HG21 . ILE A 1 34 ? 2.111   0.144   -2.043  1.00 0.00 ? 34 ILE A HG21 2  
ATOM   1788  H  HG22 . ILE A 1 34 ? 1.770   1.755   -1.416  1.00 0.00 ? 34 ILE A HG22 2  
ATOM   1789  H  HG23 . ILE A 1 34 ? 2.537   0.551   -0.381  1.00 0.00 ? 34 ILE A HG23 2  
ATOM   1790  H  HD11 . ILE A 1 34 ? 4.880   0.288   0.160   1.00 0.00 ? 34 ILE A HD11 2  
ATOM   1791  H  HD12 . ILE A 1 34 ? 6.456   0.228   -0.628  1.00 0.00 ? 34 ILE A HD12 2  
ATOM   1792  H  HD13 . ILE A 1 34 ? 5.458   -1.222  -0.543  1.00 0.00 ? 34 ILE A HD13 2  
ATOM   1793  N  N    . THR A 1 35 ? 4.113   0.861   -5.245  1.00 0.00 ? 35 THR A N    2  
ATOM   1794  C  CA   . THR A 1 35 ? 3.756   -0.049  -6.337  1.00 0.00 ? 35 THR A CA   2  
ATOM   1795  C  C    . THR A 1 35 ? 3.634   -1.490  -5.840  1.00 0.00 ? 35 THR A C    2  
ATOM   1796  O  O    . THR A 1 35 ? 4.323   -1.896  -4.901  1.00 0.00 ? 35 THR A O    2  
ATOM   1797  C  CB   . THR A 1 35 ? 4.792   0.023   -7.466  1.00 0.00 ? 35 THR A CB   2  
ATOM   1798  O  OG1  . THR A 1 35 ? 6.069   -0.398  -7.011  1.00 0.00 ? 35 THR A OG1  2  
ATOM   1799  C  CG2  . THR A 1 35 ? 4.947   1.410   -8.060  1.00 0.00 ? 35 THR A CG2  2  
ATOM   1800  H  H    . THR A 1 35 ? 5.013   1.248   -5.217  1.00 0.00 ? 35 THR A H    2  
ATOM   1801  H  HA   . THR A 1 35 ? 2.797   0.262   -6.723  1.00 0.00 ? 35 THR A HA   2  
ATOM   1802  H  HB   . THR A 1 35 ? 4.483   -0.642  -8.261  1.00 0.00 ? 35 THR A HB   2  
ATOM   1803  H  HG1  . THR A 1 35 ? 6.445   0.274   -6.438  1.00 0.00 ? 35 THR A HG1  2  
ATOM   1804  H  HG21 . THR A 1 35 ? 4.861   1.351   -9.135  1.00 0.00 ? 35 THR A HG21 2  
ATOM   1805  H  HG22 . THR A 1 35 ? 5.917   1.807   -7.796  1.00 0.00 ? 35 THR A HG22 2  
ATOM   1806  H  HG23 . THR A 1 35 ? 4.175   2.057   -7.674  1.00 0.00 ? 35 THR A HG23 2  
ATOM   1807  N  N    . LYS A 1 36 ? 2.753   -2.258  -6.481  1.00 0.00 ? 36 LYS A N    2  
ATOM   1808  C  CA   . LYS A 1 36 ? 2.539   -3.658  -6.114  1.00 0.00 ? 36 LYS A CA   2  
ATOM   1809  C  C    . LYS A 1 36 ? 3.809   -4.482  -6.328  1.00 0.00 ? 36 LYS A C    2  
ATOM   1810  O  O    . LYS A 1 36 ? 4.111   -5.385  -5.546  1.00 0.00 ? 36 LYS A O    2  
ATOM   1811  C  CB   . LYS A 1 36 ? 1.388   -4.256  -6.930  1.00 0.00 ? 36 LYS A CB   2  
ATOM   1812  C  CG   . LYS A 1 36 ? 0.869   -5.575  -6.377  1.00 0.00 ? 36 LYS A CG   2  
ATOM   1813  C  CD   . LYS A 1 36 ? 1.668   -6.756  -6.910  1.00 0.00 ? 36 LYS A CD   2  
ATOM   1814  C  CE   . LYS A 1 36 ? 0.873   -7.560  -7.928  1.00 0.00 ? 36 LYS A CE   2  
ATOM   1815  N  NZ   . LYS A 1 36 ? 0.512   -6.746  -9.126  1.00 0.00 ? 36 LYS A NZ   2  
ATOM   1816  H  H    . LYS A 1 36 ? 2.237   -1.875  -7.222  1.00 0.00 ? 36 LYS A H    2  
ATOM   1817  H  HA   . LYS A 1 36 ? 2.279   -3.690  -5.065  1.00 0.00 ? 36 LYS A HA   2  
ATOM   1818  H  HB2  . LYS A 1 36 ? 0.570   -3.551  -6.948  1.00 0.00 ? 36 LYS A HB2  2  
ATOM   1819  H  HB3  . LYS A 1 36 ? 1.729   -4.423  -7.941  1.00 0.00 ? 36 LYS A HB3  2  
ATOM   1820  H  HG2  . LYS A 1 36 ? 0.946   -5.557  -5.299  1.00 0.00 ? 36 LYS A HG2  2  
ATOM   1821  H  HG3  . LYS A 1 36 ? -0.167  -5.691  -6.662  1.00 0.00 ? 36 LYS A HG3  2  
ATOM   1822  H  HD2  . LYS A 1 36 ? 2.566   -6.389  -7.382  1.00 0.00 ? 36 LYS A HD2  2  
ATOM   1823  H  HD3  . LYS A 1 36 ? 1.933   -7.401  -6.084  1.00 0.00 ? 36 LYS A HD3  2  
ATOM   1824  H  HE2  . LYS A 1 36 ? 1.468   -8.403  -8.243  1.00 0.00 ? 36 LYS A HE2  2  
ATOM   1825  H  HE3  . LYS A 1 36 ? -0.032  -7.914  -7.459  1.00 0.00 ? 36 LYS A HE3  2  
ATOM   1826  H  HZ1  . LYS A 1 36 ? -0.199  -7.246  -9.698  1.00 0.00 ? 36 LYS A HZ1  2  
ATOM   1827  H  HZ2  . LYS A 1 36 ? 1.354   -6.577  -9.712  1.00 0.00 ? 36 LYS A HZ2  2  
ATOM   1828  H  HZ3  . LYS A 1 36 ? 0.119   -5.829  -8.832  1.00 0.00 ? 36 LYS A HZ3  2  
ATOM   1829  N  N    . GLU A 1 37 ? 4.553   -4.158  -7.389  1.00 0.00 ? 37 GLU A N    2  
ATOM   1830  C  CA   . GLU A 1 37 ? 5.796   -4.864  -7.704  1.00 0.00 ? 37 GLU A CA   2  
ATOM   1831  C  C    . GLU A 1 37 ? 6.808   -4.716  -6.567  1.00 0.00 ? 37 GLU A C    2  
ATOM   1832  O  O    . GLU A 1 37 ? 7.531   -5.660  -6.245  1.00 0.00 ? 37 GLU A O    2  
ATOM   1833  C  CB   . GLU A 1 37 ? 6.400   -4.332  -9.005  1.00 0.00 ? 37 GLU A CB   2  
ATOM   1834  C  CG   . GLU A 1 37 ? 7.378   -5.298  -9.661  1.00 0.00 ? 37 GLU A CG   2  
ATOM   1835  C  CD   . GLU A 1 37 ? 8.612   -4.608  -10.217 1.00 0.00 ? 37 GLU A CD   2  
ATOM   1836  O  OE1  . GLU A 1 37 ? 8.462   -3.556  -10.877 1.00 0.00 ? 37 GLU A OE1  2  
ATOM   1837  O  OE2  . GLU A 1 37 ? 9.728   -5.124  -9.998  1.00 0.00 ? 37 GLU A OE2  2  
ATOM   1838  H  H    . GLU A 1 37 ? 4.260   -3.428  -7.973  1.00 0.00 ? 37 GLU A H    2  
ATOM   1839  H  HA   . GLU A 1 37 ? 5.560   -5.912  -7.829  1.00 0.00 ? 37 GLU A HA   2  
ATOM   1840  H  HB2  . GLU A 1 37 ? 5.602   -4.131  -9.704  1.00 0.00 ? 37 GLU A HB2  2  
ATOM   1841  H  HB3  . GLU A 1 37 ? 6.923   -3.410  -8.793  1.00 0.00 ? 37 GLU A HB3  2  
ATOM   1842  H  HG2  . GLU A 1 37 ? 7.696   -6.021  -8.924  1.00 0.00 ? 37 GLU A HG2  2  
ATOM   1843  H  HG3  . GLU A 1 37 ? 6.873   -5.807  -10.468 1.00 0.00 ? 37 GLU A HG3  2  
ATOM   1844  N  N    . ASP A 1 38 ? 6.846   -3.526  -5.959  1.00 0.00 ? 38 ASP A N    2  
ATOM   1845  C  CA   . ASP A 1 38 ? 7.760   -3.253  -4.850  1.00 0.00 ? 38 ASP A CA   2  
ATOM   1846  C  C    . ASP A 1 38 ? 7.546   -4.258  -3.726  1.00 0.00 ? 38 ASP A C    2  
ATOM   1847  O  O    . ASP A 1 38 ? 8.505   -4.759  -3.138  1.00 0.00 ? 38 ASP A O    2  
ATOM   1848  C  CB   . ASP A 1 38 ? 7.545   -1.829  -4.315  1.00 0.00 ? 38 ASP A CB   2  
ATOM   1849  C  CG   . ASP A 1 38 ? 8.451   -0.798  -4.966  1.00 0.00 ? 38 ASP A CG   2  
ATOM   1850  O  OD1  . ASP A 1 38 ? 8.895   -1.025  -6.112  1.00 0.00 ? 38 ASP A OD1  2  
ATOM   1851  O  OD2  . ASP A 1 38 ? 8.714   0.243   -4.328  1.00 0.00 ? 38 ASP A OD2  2  
ATOM   1852  H  H    . ASP A 1 38 ? 6.240   -2.816  -6.263  1.00 0.00 ? 38 ASP A H    2  
ATOM   1853  H  HA   . ASP A 1 38 ? 8.772   -3.346  -5.217  1.00 0.00 ? 38 ASP A HA   2  
ATOM   1854  H  HB2  . ASP A 1 38 ? 6.522   -1.537  -4.490  1.00 0.00 ? 38 ASP A HB2  2  
ATOM   1855  H  HB3  . ASP A 1 38 ? 7.735   -1.825  -3.250  1.00 0.00 ? 38 ASP A HB3  2  
ATOM   1856  N  N    . LEU A 1 39 ? 6.280   -4.550  -3.436  1.00 0.00 ? 39 LEU A N    2  
ATOM   1857  C  CA   . LEU A 1 39 ? 5.933   -5.497  -2.384  1.00 0.00 ? 39 LEU A CA   2  
ATOM   1858  C  C    . LEU A 1 39 ? 6.498   -6.885  -2.695  1.00 0.00 ? 39 LEU A C    2  
ATOM   1859  O  O    . LEU A 1 39 ? 7.102   -7.523  -1.834  1.00 0.00 ? 39 LEU A O    2  
ATOM   1860  C  CB   . LEU A 1 39 ? 4.411   -5.566  -2.209  1.00 0.00 ? 39 LEU A CB   2  
ATOM   1861  C  CG   . LEU A 1 39 ? 3.706   -4.213  -2.059  1.00 0.00 ? 39 LEU A CG   2  
ATOM   1862  C  CD1  . LEU A 1 39 ? 2.199   -4.383  -2.166  1.00 0.00 ? 39 LEU A CD1  2  
ATOM   1863  C  CD2  . LEU A 1 39 ? 4.078   -3.552  -0.738  1.00 0.00 ? 39 LEU A CD2  2  
ATOM   1864  H  H    . LEU A 1 39 ? 5.563   -4.115  -3.945  1.00 0.00 ? 39 LEU A H    2  
ATOM   1865  H  HA   . LEU A 1 39 ? 6.374   -5.143  -1.463  1.00 0.00 ? 39 LEU A HA   2  
ATOM   1866  H  HB2  . LEU A 1 39 ? 3.997   -6.070  -3.069  1.00 0.00 ? 39 LEU A HB2  2  
ATOM   1867  H  HB3  . LEU A 1 39 ? 4.198   -6.156  -1.331  1.00 0.00 ? 39 LEU A HB3  2  
ATOM   1868  H  HG   . LEU A 1 39 ? 4.024   -3.559  -2.858  1.00 0.00 ? 39 LEU A HG   2  
ATOM   1869  H  HD11 . LEU A 1 39 ? 1.930   -4.566  -3.196  1.00 0.00 ? 39 LEU A HD11 2  
ATOM   1870  H  HD12 . LEU A 1 39 ? 1.708   -3.486  -1.819  1.00 0.00 ? 39 LEU A HD12 2  
ATOM   1871  H  HD13 . LEU A 1 39 ? 1.887   -5.221  -1.560  1.00 0.00 ? 39 LEU A HD13 2  
ATOM   1872  H  HD21 . LEU A 1 39 ? 4.026   -2.478  -0.845  1.00 0.00 ? 39 LEU A HD21 2  
ATOM   1873  H  HD22 . LEU A 1 39 ? 5.082   -3.836  -0.462  1.00 0.00 ? 39 LEU A HD22 2  
ATOM   1874  H  HD23 . LEU A 1 39 ? 3.390   -3.869  0.031   1.00 0.00 ? 39 LEU A HD23 2  
ATOM   1875  N  N    . GLU A 1 40 ? 6.312   -7.349  -3.931  1.00 0.00 ? 40 GLU A N    2  
ATOM   1876  C  CA   . GLU A 1 40 ? 6.819   -8.662  -4.335  1.00 0.00 ? 40 GLU A CA   2  
ATOM   1877  C  C    . GLU A 1 40 ? 8.340   -8.757  -4.167  1.00 0.00 ? 40 GLU A C    2  
ATOM   1878  O  O    . GLU A 1 40 ? 8.878   -9.849  -3.987  1.00 0.00 ? 40 GLU A O    2  
ATOM   1879  C  CB   . GLU A 1 40 ? 6.437   -8.964  -5.786  1.00 0.00 ? 40 GLU A CB   2  
ATOM   1880  C  CG   . GLU A 1 40 ? 4.937   -9.076  -6.008  1.00 0.00 ? 40 GLU A CG   2  
ATOM   1881  C  CD   . GLU A 1 40 ? 4.588   -9.515  -7.417  1.00 0.00 ? 40 GLU A CD   2  
ATOM   1882  O  OE1  . GLU A 1 40 ? 4.665   -8.675  -8.337  1.00 0.00 ? 40 GLU A OE1  2  
ATOM   1883  O  OE2  . GLU A 1 40 ? 4.237   -10.699 -7.600  1.00 0.00 ? 40 GLU A OE2  2  
ATOM   1884  H  H    . GLU A 1 40 ? 5.828   -6.797  -4.585  1.00 0.00 ? 40 GLU A H    2  
ATOM   1885  H  HA   . GLU A 1 40 ? 6.358   -9.400  -3.696  1.00 0.00 ? 40 GLU A HA   2  
ATOM   1886  H  HB2  . GLU A 1 40 ? 6.817   -8.175  -6.418  1.00 0.00 ? 40 GLU A HB2  2  
ATOM   1887  H  HB3  . GLU A 1 40 ? 6.894   -9.899  -6.076  1.00 0.00 ? 40 GLU A HB3  2  
ATOM   1888  H  HG2  . GLU A 1 40 ? 4.537   -9.800  -5.313  1.00 0.00 ? 40 GLU A HG2  2  
ATOM   1889  H  HG3  . GLU A 1 40 ? 4.487   -8.113  -5.825  1.00 0.00 ? 40 GLU A HG3  2  
ATOM   1890  N  N    . ASN A 1 41 ? 9.027   -7.613  -4.225  1.00 0.00 ? 41 ASN A N    2  
ATOM   1891  C  CA   . ASN A 1 41 ? 10.482  -7.581  -4.078  1.00 0.00 ? 41 ASN A CA   2  
ATOM   1892  C  C    . ASN A 1 41 ? 10.899  -7.393  -2.616  1.00 0.00 ? 41 ASN A C    2  
ATOM   1893  O  O    . ASN A 1 41 ? 11.893  -7.968  -2.171  1.00 0.00 ? 41 ASN A O    2  
ATOM   1894  C  CB   . ASN A 1 41 ? 11.078  -6.455  -4.929  1.00 0.00 ? 41 ASN A CB   2  
ATOM   1895  C  CG   . ASN A 1 41 ? 11.436  -6.913  -6.329  1.00 0.00 ? 41 ASN A CG   2  
ATOM   1896  O  OD1  . ASN A 1 41 ? 10.560  -7.122  -7.170  1.00 0.00 ? 41 ASN A OD1  2  
ATOM   1897  N  ND2  . ASN A 1 41 ? 12.728  -7.072  -6.587  1.00 0.00 ? 41 ASN A ND2  2  
ATOM   1898  H  H    . ASN A 1 41 ? 8.546   -6.771  -4.373  1.00 0.00 ? 41 ASN A H    2  
ATOM   1899  H  HA   . ASN A 1 41 ? 10.871  -8.525  -4.430  1.00 0.00 ? 41 ASN A HA   2  
ATOM   1900  H  HB2  . ASN A 1 41 ? 10.363  -5.650  -5.006  1.00 0.00 ? 41 ASN A HB2  2  
ATOM   1901  H  HB3  . ASN A 1 41 ? 11.975  -6.089  -4.452  1.00 0.00 ? 41 ASN A HB3  2  
ATOM   1902  H  HD21 . ASN A 1 41 ? 13.370  -6.890  -5.869  1.00 0.00 ? 41 ASN A HD21 2  
ATOM   1903  H  HD22 . ASN A 1 41 ? 12.988  -7.364  -7.485  1.00 0.00 ? 41 ASN A HD22 2  
ATOM   1904  N  N    . GLY A 1 42 ? 10.142  -6.578  -1.880  1.00 0.00 ? 42 GLY A N    2  
ATOM   1905  C  CA   . GLY A 1 42 ? 10.453  -6.315  -0.483  1.00 0.00 ? 42 GLY A CA   2  
ATOM   1906  C  C    . GLY A 1 42 ? 10.372  -4.835  -0.121  1.00 0.00 ? 42 GLY A C    2  
ATOM   1907  O  O    . GLY A 1 42 ? 10.563  -4.469  1.041   1.00 0.00 ? 42 GLY A O    2  
ATOM   1908  H  H    . GLY A 1 42 ? 9.367   -6.142  -2.292  1.00 0.00 ? 42 GLY A H    2  
ATOM   1909  H  HA2  . GLY A 1 42 ? 9.754   -6.861  0.133   1.00 0.00 ? 42 GLY A HA2  2  
ATOM   1910  H  HA3  . GLY A 1 42 ? 11.454  -6.670  -0.272  1.00 0.00 ? 42 GLY A HA3  2  
ATOM   1911  N  N    . GLU A 1 43 ? 10.075  -3.985  -1.110  1.00 0.00 ? 43 GLU A N    2  
ATOM   1912  C  CA   . GLU A 1 43 ? 9.956   -2.550  -0.885  1.00 0.00 ? 43 GLU A CA   2  
ATOM   1913  C  C    . GLU A 1 43 ? 8.641   -2.221  -0.184  1.00 0.00 ? 43 GLU A C    2  
ATOM   1914  O  O    . GLU A 1 43 ? 7.693   -1.744  -0.804  1.00 0.00 ? 43 GLU A O    2  
ATOM   1915  C  CB   . GLU A 1 43 ? 10.051  -1.790  -2.212  1.00 0.00 ? 43 GLU A CB   2  
ATOM   1916  C  CG   . GLU A 1 43 ? 11.476  -1.523  -2.657  1.00 0.00 ? 43 GLU A CG   2  
ATOM   1917  C  CD   . GLU A 1 43 ? 12.235  -0.659  -1.671  1.00 0.00 ? 43 GLU A CD   2  
ATOM   1918  O  OE1  . GLU A 1 43 ? 12.091  0.580   -1.735  1.00 0.00 ? 43 GLU A OE1  2  
ATOM   1919  O  OE2  . GLU A 1 43 ? 12.965  -1.221  -0.829  1.00 0.00 ? 43 GLU A OE2  2  
ATOM   1920  H  H    . GLU A 1 43 ? 9.923   -4.332  -2.011  1.00 0.00 ? 43 GLU A H    2  
ATOM   1921  H  HA   . GLU A 1 43 ? 10.774  -2.246  -0.249  1.00 0.00 ? 43 GLU A HA   2  
ATOM   1922  H  HB2  . GLU A 1 43 ? 9.557   -2.366  -2.980  1.00 0.00 ? 43 GLU A HB2  2  
ATOM   1923  H  HB3  . GLU A 1 43 ? 9.546   -0.841  -2.108  1.00 0.00 ? 43 GLU A HB3  2  
ATOM   1924  H  HG2  . GLU A 1 43 ? 11.990  -2.468  -2.758  1.00 0.00 ? 43 GLU A HG2  2  
ATOM   1925  H  HG3  . GLU A 1 43 ? 11.453  -1.021  -3.614  1.00 0.00 ? 43 GLU A HG3  2  
ATOM   1926  N  N    . ASP A 1 44 ? 8.602   -2.484  1.117   1.00 0.00 ? 44 ASP A N    2  
ATOM   1927  C  CA   . ASP A 1 44 ? 7.418   -2.227  1.937   1.00 0.00 ? 44 ASP A CA   2  
ATOM   1928  C  C    . ASP A 1 44 ? 7.463   -0.807  2.512   1.00 0.00 ? 44 ASP A C    2  
ATOM   1929  O  O    . ASP A 1 44 ? 7.044   -0.580  3.649   1.00 0.00 ? 44 ASP A O    2  
ATOM   1930  C  CB   . ASP A 1 44 ? 7.343   -3.238  3.094   1.00 0.00 ? 44 ASP A CB   2  
ATOM   1931  C  CG   . ASP A 1 44 ? 7.303   -4.692  2.641   1.00 0.00 ? 44 ASP A CG   2  
ATOM   1932  O  OD1  . ASP A 1 44 ? 7.823   -5.003  1.548   1.00 0.00 ? 44 ASP A OD1  2  
ATOM   1933  O  OD2  . ASP A 1 44 ? 6.755   -5.526  3.390   1.00 0.00 ? 44 ASP A OD2  2  
ATOM   1934  H  H    . ASP A 1 44 ? 9.394   -2.866  1.540   1.00 0.00 ? 44 ASP A H    2  
ATOM   1935  H  HA   . ASP A 1 44 ? 6.539   -2.336  1.315   1.00 0.00 ? 44 ASP A HA   2  
ATOM   1936  H  HB2  . ASP A 1 44 ? 8.207   -3.107  3.725   1.00 0.00 ? 44 ASP A HB2  2  
ATOM   1937  H  HB3  . ASP A 1 44 ? 6.452   -3.037  3.672   1.00 0.00 ? 44 ASP A HB3  2  
ATOM   1938  N  N    . VAL A 1 45 ? 7.988   0.143   1.734   1.00 0.00 ? 45 VAL A N    2  
ATOM   1939  C  CA   . VAL A 1 45 ? 8.097   1.529   2.192   1.00 0.00 ? 45 VAL A CA   2  
ATOM   1940  C  C    . VAL A 1 45 ? 7.446   2.506   1.214   1.00 0.00 ? 45 VAL A C    2  
ATOM   1941  O  O    . VAL A 1 45 ? 7.671   2.440   0.004   1.00 0.00 ? 45 VAL A O    2  
ATOM   1942  C  CB   . VAL A 1 45 ? 9.575   1.942   2.417   1.00 0.00 ? 45 VAL A CB   2  
ATOM   1943  C  CG1  . VAL A 1 45 ? 10.373  1.856   1.122   1.00 0.00 ? 45 VAL A CG1  2  
ATOM   1944  C  CG2  . VAL A 1 45 ? 9.666   3.345   3.013   1.00 0.00 ? 45 VAL A CG2  2  
ATOM   1945  H  H    . VAL A 1 45 ? 8.317   -0.093  0.842   1.00 0.00 ? 45 VAL A H    2  
ATOM   1946  H  HA   . VAL A 1 45 ? 7.584   1.597   3.139   1.00 0.00 ? 45 VAL A HA   2  
ATOM   1947  H  HB   . VAL A 1 45 ? 10.013  1.251   3.123   1.00 0.00 ? 45 VAL A HB   2  
ATOM   1948  H  HG11 . VAL A 1 45 ? 9.952   1.090   0.488   1.00 0.00 ? 45 VAL A HG11 2  
ATOM   1949  H  HG12 . VAL A 1 45 ? 11.402  1.614   1.346   1.00 0.00 ? 45 VAL A HG12 2  
ATOM   1950  H  HG13 . VAL A 1 45 ? 10.333  2.807   0.611   1.00 0.00 ? 45 VAL A HG13 2  
ATOM   1951  H  HG21 . VAL A 1 45 ? 9.797   4.067   2.221   1.00 0.00 ? 45 VAL A HG21 2  
ATOM   1952  H  HG22 . VAL A 1 45 ? 10.510  3.396   3.688   1.00 0.00 ? 45 VAL A HG22 2  
ATOM   1953  H  HG23 . VAL A 1 45 ? 8.759   3.568   3.556   1.00 0.00 ? 45 VAL A HG23 2  
ATOM   1954  N  N    . ALA A 1 46 ? 6.646   3.422   1.756   1.00 0.00 ? 46 ALA A N    2  
ATOM   1955  C  CA   . ALA A 1 46 ? 5.970   4.428   0.947   1.00 0.00 ? 46 ALA A CA   2  
ATOM   1956  C  C    . ALA A 1 46 ? 6.517   5.818   1.255   1.00 0.00 ? 46 ALA A C    2  
ATOM   1957  O  O    . ALA A 1 46 ? 6.795   6.141   2.412   1.00 0.00 ? 46 ALA A O    2  
ATOM   1958  C  CB   . ALA A 1 46 ? 4.468   4.380   1.185   1.00 0.00 ? 46 ALA A CB   2  
ATOM   1959  H  H    . ALA A 1 46 ? 6.514   3.426   2.727   1.00 0.00 ? 46 ALA A H    2  
ATOM   1960  H  HA   . ALA A 1 46 ? 6.155   4.200   -0.094  1.00 0.00 ? 46 ALA A HA   2  
ATOM   1961  H  HB1  . ALA A 1 46 ? 4.173   5.228   1.785   1.00 0.00 ? 46 ALA A HB1  2  
ATOM   1962  H  HB2  . ALA A 1 46 ? 4.215   3.468   1.702   1.00 0.00 ? 46 ALA A HB2  2  
ATOM   1963  H  HB3  . ALA A 1 46 ? 3.953   4.412   0.237   1.00 0.00 ? 46 ALA A HB3  2  
ATOM   1964  N  N    . THR A 1 47 ? 6.673   6.636   0.217   1.00 0.00 ? 47 THR A N    2  
ATOM   1965  C  CA   . THR A 1 47 ? 7.192   7.989   0.382   1.00 0.00 ? 47 THR A CA   2  
ATOM   1966  C  C    . THR A 1 47 ? 6.197   9.019   -0.147  1.00 0.00 ? 47 THR A C    2  
ATOM   1967  O  O    . THR A 1 47 ? 5.671   8.876   -1.252  1.00 0.00 ? 47 THR A O    2  
ATOM   1968  C  CB   . THR A 1 47 ? 8.540   8.131   -0.334  1.00 0.00 ? 47 THR A CB   2  
ATOM   1969  O  OG1  . THR A 1 47 ? 9.341   6.976   -0.134  1.00 0.00 ? 47 THR A OG1  2  
ATOM   1970  C  CG2  . THR A 1 47 ? 9.345   9.331   0.121   1.00 0.00 ? 47 THR A CG2  2  
ATOM   1971  H  H    . THR A 1 47 ? 6.436   6.322   -0.682  1.00 0.00 ? 47 THR A H    2  
ATOM   1972  H  HA   . THR A 1 47 ? 7.337   8.160   1.439   1.00 0.00 ? 47 THR A HA   2  
ATOM   1973  H  HB   . THR A 1 47 ? 8.361   8.237   -1.395  1.00 0.00 ? 47 THR A HB   2  
ATOM   1974  H  HG1  . THR A 1 47 ? 9.374   6.762   0.802   1.00 0.00 ? 47 THR A HG1  2  
ATOM   1975  H  HG21 . THR A 1 47 ? 9.914   9.070   1.001   1.00 0.00 ? 47 THR A HG21 2  
ATOM   1976  H  HG22 . THR A 1 47 ? 8.679   10.148  0.353   1.00 0.00 ? 47 THR A HG22 2  
ATOM   1977  H  HG23 . THR A 1 47 ? 10.020  9.630   -0.667  1.00 0.00 ? 47 THR A HG23 2  
ATOM   1978  N  N    . CYS A 1 48 ? 5.945   10.054  0.653   1.00 0.00 ? 48 CYS A N    2  
ATOM   1979  C  CA   . CYS A 1 48 ? 5.016   11.110  0.269   1.00 0.00 ? 48 CYS A CA   2  
ATOM   1980  C  C    . CYS A 1 48 ? 5.734   12.189  -0.538  1.00 0.00 ? 48 CYS A C    2  
ATOM   1981  O  O    . CYS A 1 48 ? 6.851   12.584  -0.203  1.00 0.00 ? 48 CYS A O    2  
ATOM   1982  C  CB   . CYS A 1 48 ? 4.365   11.730  1.508   1.00 0.00 ? 48 CYS A CB   2  
ATOM   1983  S  SG   . CYS A 1 48 ? 2.585   12.075  1.322   1.00 0.00 ? 48 CYS A SG   2  
ATOM   1984  H  H    . CYS A 1 48 ? 6.397   10.108  1.522   1.00 0.00 ? 48 CYS A H    2  
ATOM   1985  H  HA   . CYS A 1 48 ? 4.248   10.664  -0.345  1.00 0.00 ? 48 CYS A HA   2  
ATOM   1986  H  HB2  . CYS A 1 48 ? 4.480   11.056  2.343   1.00 0.00 ? 48 CYS A HB2  2  
ATOM   1987  H  HB3  . CYS A 1 48 ? 4.858   12.664  1.735   1.00 0.00 ? 48 CYS A HB3  2  
ATOM   1988  N  N    . PRO A 1 49 ? 5.097   12.687  -1.616  1.00 0.00 ? 49 PRO A N    2  
ATOM   1989  C  CA   . PRO A 1 49 ? 5.680   13.730  -2.468  1.00 0.00 ? 49 PRO A CA   2  
ATOM   1990  C  C    . PRO A 1 49 ? 5.648   15.122  -1.824  1.00 0.00 ? 49 PRO A C    2  
ATOM   1991  O  O    . PRO A 1 49 ? 6.179   16.081  -2.388  1.00 0.00 ? 49 PRO A O    2  
ATOM   1992  C  CB   . PRO A 1 49 ? 4.792   13.696  -3.712  1.00 0.00 ? 49 PRO A CB   2  
ATOM   1993  C  CG   . PRO A 1 49 ? 3.470   13.219  -3.217  1.00 0.00 ? 49 PRO A CG   2  
ATOM   1994  C  CD   . PRO A 1 49 ? 3.759   12.272  -2.084  1.00 0.00 ? 49 PRO A CD   2  
ATOM   1995  H  HA   . PRO A 1 49 ? 6.696   13.489  -2.745  1.00 0.00 ? 49 PRO A HA   2  
ATOM   1996  H  HB2  . PRO A 1 49 ? 4.722   14.689  -4.134  1.00 0.00 ? 49 PRO A HB2  2  
ATOM   1997  H  HB3  . PRO A 1 49 ? 5.210   13.016  -4.439  1.00 0.00 ? 49 PRO A HB3  2  
ATOM   1998  H  HG2  . PRO A 1 49 ? 2.886   14.055  -2.865  1.00 0.00 ? 49 PRO A HG2  2  
ATOM   1999  H  HG3  . PRO A 1 49 ? 2.946   12.704  -4.009  1.00 0.00 ? 49 PRO A HG3  2  
ATOM   2000  H  HD2  . PRO A 1 49 ? 3.023   12.386  -1.301  1.00 0.00 ? 49 PRO A HD2  2  
ATOM   2001  H  HD3  . PRO A 1 49 ? 3.778   11.253  -2.439  1.00 0.00 ? 49 PRO A HD3  2  
ATOM   2002  N  N    . SER A 1 50 ? 5.022   15.231  -0.648  1.00 0.00 ? 50 SER A N    2  
ATOM   2003  C  CA   . SER A 1 50 ? 4.925   16.507  0.055   1.00 0.00 ? 50 SER A CA   2  
ATOM   2004  C  C    . SER A 1 50 ? 5.781   16.506  1.324   1.00 0.00 ? 50 SER A C    2  
ATOM   2005  O  O    . SER A 1 50 ? 6.792   17.207  1.395   1.00 0.00 ? 50 SER A O    2  
ATOM   2006  C  CB   . SER A 1 50 ? 3.464   16.814  0.397   1.00 0.00 ? 50 SER A CB   2  
ATOM   2007  O  OG   . SER A 1 50 ? 2.899   15.791  1.201   1.00 0.00 ? 50 SER A OG   2  
ATOM   2008  H  H    . SER A 1 50 ? 4.612   14.438  -0.247  1.00 0.00 ? 50 SER A H    2  
ATOM   2009  H  HA   . SER A 1 50 ? 5.296   17.275  -0.609  1.00 0.00 ? 50 SER A HA   2  
ATOM   2010  H  HB2  . SER A 1 50 ? 3.411   17.747  0.936   1.00 0.00 ? 50 SER A HB2  2  
ATOM   2011  H  HB3  . SER A 1 50 ? 2.893   16.893  -0.517  1.00 0.00 ? 50 SER A HB3  2  
ATOM   2012  H  HG   . SER A 1 50 ? 2.604   15.067  0.643   1.00 0.00 ? 50 SER A HG   2  
ATOM   2013  N  N    . CYS A 1 51 ? 5.373   15.719  2.320   1.00 0.00 ? 51 CYS A N    2  
ATOM   2014  C  CA   . CYS A 1 51 ? 6.108   15.637  3.583   1.00 0.00 ? 51 CYS A CA   2  
ATOM   2015  C  C    . CYS A 1 51 ? 7.424   14.871  3.424   1.00 0.00 ? 51 CYS A C    2  
ATOM   2016  O  O    . CYS A 1 51 ? 8.380   15.109  4.167   1.00 0.00 ? 51 CYS A O    2  
ATOM   2017  C  CB   . CYS A 1 51 ? 5.248   14.974  4.664   1.00 0.00 ? 51 CYS A CB   2  
ATOM   2018  S  SG   . CYS A 1 51 ? 4.838   13.227  4.334   1.00 0.00 ? 51 CYS A SG   2  
ATOM   2019  H  H    . CYS A 1 51 ? 4.558   15.184  2.204   1.00 0.00 ? 51 CYS A H    2  
ATOM   2020  H  HA   . CYS A 1 51 ? 6.335   16.647  3.893   1.00 0.00 ? 51 CYS A HA   2  
ATOM   2021  H  HB2  . CYS A 1 51 ? 5.776   15.014  5.605   1.00 0.00 ? 51 CYS A HB2  2  
ATOM   2022  H  HB3  . CYS A 1 51 ? 4.318   15.517  4.758   1.00 0.00 ? 51 CYS A HB3  2  
ATOM   2023  N  N    . SER A 1 52 ? 7.468   13.947  2.460   1.00 0.00 ? 52 SER A N    2  
ATOM   2024  C  CA   . SER A 1 52 ? 8.664   13.140  2.212   1.00 0.00 ? 52 SER A CA   2  
ATOM   2025  C  C    . SER A 1 52 ? 8.980   12.252  3.417   1.00 0.00 ? 52 SER A C    2  
ATOM   2026  O  O    . SER A 1 52 ? 10.138  12.112  3.819   1.00 0.00 ? 52 SER A O    2  
ATOM   2027  C  CB   . SER A 1 52 ? 9.859   14.043  1.883   1.00 0.00 ? 52 SER A CB   2  
ATOM   2028  O  OG   . SER A 1 52 ? 10.915  13.303  1.296   1.00 0.00 ? 52 SER A OG   2  
ATOM   2029  H  H    . SER A 1 52 ? 6.675   13.797  1.906   1.00 0.00 ? 52 SER A H    2  
ATOM   2030  H  HA   . SER A 1 52 ? 8.461   12.507  1.362   1.00 0.00 ? 52 SER A HA   2  
ATOM   2031  H  HB2  . SER A 1 52 ? 9.547   14.810  1.192   1.00 0.00 ? 52 SER A HB2  2  
ATOM   2032  H  HB3  . SER A 1 52 ? 10.218  14.504  2.792   1.00 0.00 ? 52 SER A HB3  2  
ATOM   2033  H  HG   . SER A 1 52 ? 11.136  13.683  0.444   1.00 0.00 ? 52 SER A HG   2  
ATOM   2034  N  N    . LEU A 1 53 ? 7.938   11.649  3.986   1.00 0.00 ? 53 LEU A N    2  
ATOM   2035  C  CA   . LEU A 1 53 ? 8.090   10.768  5.139   1.00 0.00 ? 53 LEU A CA   2  
ATOM   2036  C  C    . LEU A 1 53 ? 8.163   9.309   4.694   1.00 0.00 ? 53 LEU A C    2  
ATOM   2037  O  O    . LEU A 1 53 ? 8.132   9.015   3.498   1.00 0.00 ? 53 LEU A O    2  
ATOM   2038  C  CB   . LEU A 1 53 ? 6.919   10.966  6.111   1.00 0.00 ? 53 LEU A CB   2  
ATOM   2039  C  CG   . LEU A 1 53 ? 7.117   12.069  7.155   1.00 0.00 ? 53 LEU A CG   2  
ATOM   2040  C  CD1  . LEU A 1 53 ? 5.773   12.643  7.579   1.00 0.00 ? 53 LEU A CD1  2  
ATOM   2041  C  CD2  . LEU A 1 53 ? 7.878   11.537  8.362   1.00 0.00 ? 53 LEU A CD2  2  
ATOM   2042  H  H    . LEU A 1 53 ? 7.041   11.796  3.616   1.00 0.00 ? 53 LEU A H    2  
ATOM   2043  H  HA   . LEU A 1 53 ? 9.011   11.028  5.638   1.00 0.00 ? 53 LEU A HA   2  
ATOM   2044  H  HB2  . LEU A 1 53 ? 6.036   11.201  5.534   1.00 0.00 ? 53 LEU A HB2  2  
ATOM   2045  H  HB3  . LEU A 1 53 ? 6.748   10.035  6.632   1.00 0.00 ? 53 LEU A HB3  2  
ATOM   2046  H  HG   . LEU A 1 53 ? 7.696   12.868  6.718   1.00 0.00 ? 53 LEU A HG   2  
ATOM   2047  H  HD11 . LEU A 1 53 ? 5.831   12.977  8.605   1.00 0.00 ? 53 LEU A HD11 2  
ATOM   2048  H  HD12 . LEU A 1 53 ? 5.012   11.880  7.492   1.00 0.00 ? 53 LEU A HD12 2  
ATOM   2049  H  HD13 . LEU A 1 53 ? 5.521   13.477  6.943   1.00 0.00 ? 53 LEU A HD13 2  
ATOM   2050  H  HD21 . LEU A 1 53 ? 8.940   11.619  8.183   1.00 0.00 ? 53 LEU A HD21 2  
ATOM   2051  H  HD22 . LEU A 1 53 ? 7.618   10.502  8.526   1.00 0.00 ? 53 LEU A HD22 2  
ATOM   2052  H  HD23 . LEU A 1 53 ? 7.615   12.116  9.236   1.00 0.00 ? 53 LEU A HD23 2  
ATOM   2053  N  N    . ILE A 1 54 ? 8.262   8.397   5.662   1.00 0.00 ? 54 ILE A N    2  
ATOM   2054  C  CA   . ILE A 1 54 ? 8.337   6.971   5.361   1.00 0.00 ? 54 ILE A CA   2  
ATOM   2055  C  C    . ILE A 1 54 ? 7.311   6.180   6.172   1.00 0.00 ? 54 ILE A C    2  
ATOM   2056  O  O    . ILE A 1 54 ? 7.046   6.495   7.336   1.00 0.00 ? 54 ILE A O    2  
ATOM   2057  C  CB   . ILE A 1 54 ? 9.748   6.403   5.640   1.00 0.00 ? 54 ILE A CB   2  
ATOM   2058  C  CG1  . ILE A 1 54 ? 10.192  6.735   7.069   1.00 0.00 ? 54 ILE A CG1  2  
ATOM   2059  C  CG2  . ILE A 1 54 ? 10.752  6.945   4.628   1.00 0.00 ? 54 ILE A CG2  2  
ATOM   2060  C  CD1  . ILE A 1 54 ? 11.529  6.133   7.446   1.00 0.00 ? 54 ILE A CD1  2  
ATOM   2061  H  H    . ILE A 1 54 ? 8.282   8.690   6.597   1.00 0.00 ? 54 ILE A H    2  
ATOM   2062  H  HA   . ILE A 1 54 ? 8.123   6.840   4.309   1.00 0.00 ? 54 ILE A HA   2  
ATOM   2063  H  HB   . ILE A 1 54 ? 9.707   5.331   5.525   1.00 0.00 ? 54 ILE A HB   2  
ATOM   2064  H  HG12 . ILE A 1 54 ? 10.271  7.806   7.177   1.00 0.00 ? 54 ILE A HG12 2  
ATOM   2065  H  HG13 . ILE A 1 54 ? 9.454   6.362   7.764   1.00 0.00 ? 54 ILE A HG13 2  
ATOM   2066  H  HG21 . ILE A 1 54 ? 11.495  6.188   4.418   1.00 0.00 ? 54 ILE A HG21 2  
ATOM   2067  H  HG22 . ILE A 1 54 ? 11.237  7.821   5.032   1.00 0.00 ? 54 ILE A HG22 2  
ATOM   2068  H  HG23 . ILE A 1 54 ? 10.240  7.205   3.714   1.00 0.00 ? 54 ILE A HG23 2  
ATOM   2069  H  HD11 . ILE A 1 54 ? 12.096  5.924   6.551   1.00 0.00 ? 54 ILE A HD11 2  
ATOM   2070  H  HD12 . ILE A 1 54 ? 11.371  5.215   7.993   1.00 0.00 ? 54 ILE A HD12 2  
ATOM   2071  H  HD13 . ILE A 1 54 ? 12.077  6.829   8.065   1.00 0.00 ? 54 ILE A HD13 2  
ATOM   2072  N  N    . ILE A 1 55 ? 6.743   5.146   5.550   1.00 0.00 ? 55 ILE A N    2  
ATOM   2073  C  CA   . ILE A 1 55 ? 5.750   4.296   6.207   1.00 0.00 ? 55 ILE A CA   2  
ATOM   2074  C  C    . ILE A 1 55 ? 5.927   2.835   5.797   1.00 0.00 ? 55 ILE A C    2  
ATOM   2075  O  O    . ILE A 1 55 ? 6.280   2.542   4.654   1.00 0.00 ? 55 ILE A O    2  
ATOM   2076  C  CB   . ILE A 1 55 ? 4.304   4.735   5.884   1.00 0.00 ? 55 ILE A CB   2  
ATOM   2077  C  CG1  . ILE A 1 55 ? 4.080   4.802   4.370   1.00 0.00 ? 55 ILE A CG1  2  
ATOM   2078  C  CG2  . ILE A 1 55 ? 3.997   6.080   6.529   1.00 0.00 ? 55 ILE A CG2  2  
ATOM   2079  C  CD1  . ILE A 1 55 ? 2.685   4.397   3.946   1.00 0.00 ? 55 ILE A CD1  2  
ATOM   2080  H  H    . ILE A 1 55 ? 7.002   4.946   4.625   1.00 0.00 ? 55 ILE A H    2  
ATOM   2081  H  HA   . ILE A 1 55 ? 5.899   4.378   7.274   1.00 0.00 ? 55 ILE A HA   2  
ATOM   2082  H  HB   . ILE A 1 55 ? 3.630   4.004   6.306   1.00 0.00 ? 55 ILE A HB   2  
ATOM   2083  H  HG12 . ILE A 1 55 ? 4.247   5.814   4.032   1.00 0.00 ? 55 ILE A HG12 2  
ATOM   2084  H  HG13 . ILE A 1 55 ? 4.780   4.144   3.879   1.00 0.00 ? 55 ILE A HG13 2  
ATOM   2085  H  HG21 . ILE A 1 55 ? 4.698   6.819   6.173   1.00 0.00 ? 55 ILE A HG21 2  
ATOM   2086  H  HG22 . ILE A 1 55 ? 4.078   5.991   7.601   1.00 0.00 ? 55 ILE A HG22 2  
ATOM   2087  H  HG23 . ILE A 1 55 ? 2.993   6.382   6.267   1.00 0.00 ? 55 ILE A HG23 2  
ATOM   2088  H  HD11 . ILE A 1 55 ? 2.744   3.565   3.260   1.00 0.00 ? 55 ILE A HD11 2  
ATOM   2089  H  HD12 . ILE A 1 55 ? 2.200   5.230   3.461   1.00 0.00 ? 55 ILE A HD12 2  
ATOM   2090  H  HD13 . ILE A 1 55 ? 2.113   4.105   4.815   1.00 0.00 ? 55 ILE A HD13 2  
ATOM   2091  N  N    . LYS A 1 56 ? 5.684   1.922   6.737   1.00 0.00 ? 56 LYS A N    2  
ATOM   2092  C  CA   . LYS A 1 56 ? 5.824   0.493   6.467   1.00 0.00 ? 56 LYS A CA   2  
ATOM   2093  C  C    . LYS A 1 56 ? 4.504   -0.120  6.030   1.00 0.00 ? 56 LYS A C    2  
ATOM   2094  O  O    . LYS A 1 56 ? 3.452   0.143   6.616   1.00 0.00 ? 56 LYS A O    2  
ATOM   2095  C  CB   . LYS A 1 56 ? 6.363   -0.239  7.698   1.00 0.00 ? 56 LYS A CB   2  
ATOM   2096  C  CG   . LYS A 1 56 ? 7.370   -1.330  7.370   1.00 0.00 ? 56 LYS A CG   2  
ATOM   2097  C  CD   . LYS A 1 56 ? 6.686   -2.604  6.897   1.00 0.00 ? 56 LYS A CD   2  
ATOM   2098  C  CE   . LYS A 1 56 ? 7.683   -3.739  6.707   1.00 0.00 ? 56 LYS A CE   2  
ATOM   2099  N  NZ   . LYS A 1 56 ? 7.107   -5.057  7.095   1.00 0.00 ? 56 LYS A NZ   2  
ATOM   2100  H  H    . LYS A 1 56 ? 5.408   2.215   7.631   1.00 0.00 ? 56 LYS A H    2  
ATOM   2101  H  HA   . LYS A 1 56 ? 6.524   0.380   5.656   1.00 0.00 ? 56 LYS A HA   2  
ATOM   2102  H  HB2  . LYS A 1 56 ? 6.842   0.480   8.348   1.00 0.00 ? 56 LYS A HB2  2  
ATOM   2103  H  HB3  . LYS A 1 56 ? 5.536   -0.690  8.225   1.00 0.00 ? 56 LYS A HB3  2  
ATOM   2104  H  HG2  . LYS A 1 56 ? 8.027   -0.976  6.589   1.00 0.00 ? 56 LYS A HG2  2  
ATOM   2105  H  HG3  . LYS A 1 56 ? 7.947   -1.549  8.256   1.00 0.00 ? 56 LYS A HG3  2  
ATOM   2106  H  HD2  . LYS A 1 56 ? 5.954   -2.902  7.631   1.00 0.00 ? 56 LYS A HD2  2  
ATOM   2107  H  HD3  . LYS A 1 56 ? 6.194   -2.410  5.955   1.00 0.00 ? 56 LYS A HD3  2  
ATOM   2108  H  HE2  . LYS A 1 56 ? 7.974   -3.776  5.667   1.00 0.00 ? 56 LYS A HE2  2  
ATOM   2109  H  HE3  . LYS A 1 56 ? 8.554   -3.542  7.316   1.00 0.00 ? 56 LYS A HE3  2  
ATOM   2110  H  HZ1  . LYS A 1 56 ? 7.826   -5.803  6.997   1.00 0.00 ? 56 LYS A HZ1  2  
ATOM   2111  H  HZ2  . LYS A 1 56 ? 6.298   -5.289  6.482   1.00 0.00 ? 56 LYS A HZ2  2  
ATOM   2112  H  HZ3  . LYS A 1 56 ? 6.783   -5.031  8.082   1.00 0.00 ? 56 LYS A HZ3  2  
ATOM   2113  N  N    . VAL A 1 57 ? 4.578   -0.938  4.987   1.00 0.00 ? 57 VAL A N    2  
ATOM   2114  C  CA   . VAL A 1 57 ? 3.406   -1.595  4.442   1.00 0.00 ? 57 VAL A CA   2  
ATOM   2115  C  C    . VAL A 1 57 ? 3.410   -3.089  4.764   1.00 0.00 ? 57 VAL A C    2  
ATOM   2116  O  O    . VAL A 1 57 ? 4.259   -3.836  4.277   1.00 0.00 ? 57 VAL A O    2  
ATOM   2117  C  CB   . VAL A 1 57 ? 3.313   -1.397  2.912   1.00 0.00 ? 57 VAL A CB   2  
ATOM   2118  C  CG1  . VAL A 1 57 ? 1.863   -1.270  2.497   1.00 0.00 ? 57 VAL A CG1  2  
ATOM   2119  C  CG2  . VAL A 1 57 ? 4.099   -0.169  2.462   1.00 0.00 ? 57 VAL A CG2  2  
ATOM   2120  H  H    . VAL A 1 57 ? 5.451   -1.097  4.566   1.00 0.00 ? 57 VAL A H    2  
ATOM   2121  H  HA   . VAL A 1 57 ? 2.534   -1.143  4.893   1.00 0.00 ? 57 VAL A HA   2  
ATOM   2122  H  HB   . VAL A 1 57 ? 3.732   -2.266  2.426   1.00 0.00 ? 57 VAL A HB   2  
ATOM   2123  H  HG11 . VAL A 1 57 ? 1.403   -0.478  3.067   1.00 0.00 ? 57 VAL A HG11 2  
ATOM   2124  H  HG12 . VAL A 1 57 ? 1.353   -2.200  2.689   1.00 0.00 ? 57 VAL A HG12 2  
ATOM   2125  H  HG13 . VAL A 1 57 ? 1.810   -1.035  1.446   1.00 0.00 ? 57 VAL A HG13 2  
ATOM   2126  H  HG21 . VAL A 1 57 ? 4.161   0.541   3.274   1.00 0.00 ? 57 VAL A HG21 2  
ATOM   2127  H  HG22 . VAL A 1 57 ? 3.601   0.289   1.620   1.00 0.00 ? 57 VAL A HG22 2  
ATOM   2128  H  HG23 . VAL A 1 57 ? 5.095   -0.467  2.170   1.00 0.00 ? 57 VAL A HG23 2  
ATOM   2129  N  N    . ILE A 1 58 ? 2.455   -3.515  5.591   1.00 0.00 ? 58 ILE A N    2  
ATOM   2130  C  CA   . ILE A 1 58 ? 2.346   -4.919  5.984   1.00 0.00 ? 58 ILE A CA   2  
ATOM   2131  C  C    . ILE A 1 58 ? 1.371   -5.667  5.077   1.00 0.00 ? 58 ILE A C    2  
ATOM   2132  O  O    . ILE A 1 58 ? 0.288   -5.170  4.774   1.00 0.00 ? 58 ILE A O    2  
ATOM   2133  C  CB   . ILE A 1 58 ? 1.883   -5.067  7.451   1.00 0.00 ? 58 ILE A CB   2  
ATOM   2134  C  CG1  . ILE A 1 58 ? 2.697   -4.153  8.374   1.00 0.00 ? 58 ILE A CG1  2  
ATOM   2135  C  CG2  . ILE A 1 58 ? 1.993   -6.519  7.903   1.00 0.00 ? 58 ILE A CG2  2  
ATOM   2136  C  CD1  . ILE A 1 58 ? 4.173   -4.491  8.427   1.00 0.00 ? 58 ILE A CD1  2  
ATOM   2137  H  H    . ILE A 1 58 ? 1.807   -2.868  5.947   1.00 0.00 ? 58 ILE A H    2  
ATOM   2138  H  HA   . ILE A 1 58 ? 3.325   -5.365  5.890   1.00 0.00 ? 58 ILE A HA   2  
ATOM   2139  H  HB   . ILE A 1 58 ? 0.843   -4.781  7.504   1.00 0.00 ? 58 ILE A HB   2  
ATOM   2140  H  HG12 . ILE A 1 58 ? 2.605   -3.133  8.032   1.00 0.00 ? 58 ILE A HG12 2  
ATOM   2141  H  HG13 . ILE A 1 58 ? 2.304   -4.227  9.377   1.00 0.00 ? 58 ILE A HG13 2  
ATOM   2142  H  HG21 . ILE A 1 58 ? 1.650   -7.169  7.113   1.00 0.00 ? 58 ILE A HG21 2  
ATOM   2143  H  HG22 . ILE A 1 58 ? 1.384   -6.669  8.782   1.00 0.00 ? 58 ILE A HG22 2  
ATOM   2144  H  HG23 . ILE A 1 58 ? 3.022   -6.748  8.136   1.00 0.00 ? 58 ILE A HG23 2  
ATOM   2145  H  HD11 . ILE A 1 58 ? 4.670   -3.825  9.116   1.00 0.00 ? 58 ILE A HD11 2  
ATOM   2146  H  HD12 . ILE A 1 58 ? 4.604   -4.377  7.443   1.00 0.00 ? 58 ILE A HD12 2  
ATOM   2147  H  HD13 . ILE A 1 58 ? 4.298   -5.511  8.759   1.00 0.00 ? 58 ILE A HD13 2  
ATOM   2148  N  N    . TYR A 1 59 ? 1.763   -6.863  4.646   1.00 0.00 ? 59 TYR A N    2  
ATOM   2149  C  CA   . TYR A 1 59 ? 0.925   -7.685  3.771   1.00 0.00 ? 59 TYR A CA   2  
ATOM   2150  C  C    . TYR A 1 59 ? 1.351   -9.155  3.843   1.00 0.00 ? 59 TYR A C    2  
ATOM   2151  O  O    . TYR A 1 59 ? 2.258   -9.507  4.601   1.00 0.00 ? 59 TYR A O    2  
ATOM   2152  C  CB   . TYR A 1 59 ? 1.023   -7.176  2.326   1.00 0.00 ? 59 TYR A CB   2  
ATOM   2153  C  CG   . TYR A 1 59 ? 2.443   -7.128  1.817   1.00 0.00 ? 59 TYR A CG   2  
ATOM   2154  C  CD1  . TYR A 1 59 ? 3.067   -8.276  1.352   1.00 0.00 ? 59 TYR A CD1  2  
ATOM   2155  C  CD2  . TYR A 1 59 ? 3.168   -5.941  1.826   1.00 0.00 ? 59 TYR A CD2  2  
ATOM   2156  C  CE1  . TYR A 1 59 ? 4.371   -8.245  0.907   1.00 0.00 ? 59 TYR A CE1  2  
ATOM   2157  C  CE2  . TYR A 1 59 ? 4.474   -5.904  1.385   1.00 0.00 ? 59 TYR A CE2  2  
ATOM   2158  C  CZ   . TYR A 1 59 ? 5.070   -7.060  0.926   1.00 0.00 ? 59 TYR A CZ   2  
ATOM   2159  O  OH   . TYR A 1 59 ? 6.371   -7.036  0.489   1.00 0.00 ? 59 TYR A OH   2  
ATOM   2160  H  H    . TYR A 1 59 ? 2.640   -7.205  4.921   1.00 0.00 ? 59 TYR A H    2  
ATOM   2161  H  HA   . TYR A 1 59 ? -0.097  -7.599  4.109   1.00 0.00 ? 59 TYR A HA   2  
ATOM   2162  H  HB2  . TYR A 1 59 ? 0.456   -7.830  1.679   1.00 0.00 ? 59 TYR A HB2  2  
ATOM   2163  H  HB3  . TYR A 1 59 ? 0.615   -6.177  2.273   1.00 0.00 ? 59 TYR A HB3  2  
ATOM   2164  H  HD1  . TYR A 1 59 ? 2.516   -9.205  1.336   1.00 0.00 ? 59 TYR A HD1  2  
ATOM   2165  H  HD2  . TYR A 1 59 ? 2.697   -5.039  2.185   1.00 0.00 ? 59 TYR A HD2  2  
ATOM   2166  H  HE1  . TYR A 1 59 ? 4.839   -9.149  0.547   1.00 0.00 ? 59 TYR A HE1  2  
ATOM   2167  H  HE2  . TYR A 1 59 ? 5.023   -4.971  1.401   1.00 0.00 ? 59 TYR A HE2  2  
ATOM   2168  H  HH   . TYR A 1 59 ? 6.902   -6.496  1.076   1.00 0.00 ? 59 TYR A HH   2  
ATOM   2169  N  N    . ASP A 1 60 ? 0.704   -10.010 3.050   1.00 0.00 ? 60 ASP A N    2  
ATOM   2170  C  CA   . ASP A 1 60 ? 1.030   -11.430 3.032   1.00 0.00 ? 60 ASP A CA   2  
ATOM   2171  C  C    . ASP A 1 60 ? 2.144   -11.716 2.030   1.00 0.00 ? 60 ASP A C    2  
ATOM   2172  O  O    . ASP A 1 60 ? 1.888   -11.913 0.840   1.00 0.00 ? 60 ASP A O    2  
ATOM   2173  C  CB   . ASP A 1 60 ? -0.211  -12.263 2.697   1.00 0.00 ? 60 ASP A CB   2  
ATOM   2174  C  CG   . ASP A 1 60 ? -0.075  -13.710 3.131   1.00 0.00 ? 60 ASP A CG   2  
ATOM   2175  O  OD1  . ASP A 1 60 ? -0.253  -13.988 4.336   1.00 0.00 ? 60 ASP A OD1  2  
ATOM   2176  O  OD2  . ASP A 1 60 ? 0.211   -14.563 2.267   1.00 0.00 ? 60 ASP A OD2  2  
ATOM   2177  H  H    . ASP A 1 60 ? -0.005  -9.678  2.460   1.00 0.00 ? 60 ASP A H    2  
ATOM   2178  H  HA   . ASP A 1 60 ? 1.376   -11.700 4.020   1.00 0.00 ? 60 ASP A HA   2  
ATOM   2179  H  HB2  . ASP A 1 60 ? -1.067  -11.837 3.196   1.00 0.00 ? 60 ASP A HB2  2  
ATOM   2180  H  HB3  . ASP A 1 60 ? -0.374  -12.241 1.627   1.00 0.00 ? 60 ASP A HB3  2  
ATOM   2181  N  N    . LYS A 1 61 ? 3.384   -11.740 2.518   1.00 0.00 ? 61 LYS A N    2  
ATOM   2182  C  CA   . LYS A 1 61 ? 4.540   -12.008 1.664   1.00 0.00 ? 61 LYS A CA   2  
ATOM   2183  C  C    . LYS A 1 61 ? 4.412   -13.366 0.977   1.00 0.00 ? 61 LYS A C    2  
ATOM   2184  O  O    . LYS A 1 61 ? 4.922   -13.555 -0.126  1.00 0.00 ? 61 LYS A O    2  
ATOM   2185  C  CB   . LYS A 1 61 ? 5.835   -11.955 2.476   1.00 0.00 ? 61 LYS A CB   2  
ATOM   2186  C  CG   . LYS A 1 61 ? 6.258   -10.543 2.849   1.00 0.00 ? 61 LYS A CG   2  
ATOM   2187  C  CD   . LYS A 1 61 ? 7.764   -10.362 2.746   1.00 0.00 ? 61 LYS A CD   2  
ATOM   2188  C  CE   . LYS A 1 61 ? 8.154   -9.603  1.484   1.00 0.00 ? 61 LYS A CE   2  
ATOM   2189  N  NZ   . LYS A 1 61 ? 7.644   -10.267 0.251   1.00 0.00 ? 61 LYS A NZ   2  
ATOM   2190  H  H    . LYS A 1 61 ? 3.523   -11.576 3.475   1.00 0.00 ? 61 LYS A H    2  
ATOM   2191  H  HA   . LYS A 1 61 ? 4.573   -11.240 0.906   1.00 0.00 ? 61 LYS A HA   2  
ATOM   2192  H  HB2  . LYS A 1 61 ? 5.699   -12.521 3.387   1.00 0.00 ? 61 LYS A HB2  2  
ATOM   2193  H  HB3  . LYS A 1 61 ? 6.627   -12.403 1.897   1.00 0.00 ? 61 LYS A HB3  2  
ATOM   2194  H  HG2  . LYS A 1 61 ? 5.776   -9.845  2.179   1.00 0.00 ? 61 LYS A HG2  2  
ATOM   2195  H  HG3  . LYS A 1 61 ? 5.947   -10.341 3.864   1.00 0.00 ? 61 LYS A HG3  2  
ATOM   2196  H  HD2  . LYS A 1 61 ? 8.109   -9.809  3.607   1.00 0.00 ? 61 LYS A HD2  2  
ATOM   2197  H  HD3  . LYS A 1 61 ? 8.234   -11.334 2.729   1.00 0.00 ? 61 LYS A HD3  2  
ATOM   2198  H  HE2  . LYS A 1 61 ? 7.745   -8.605  1.539   1.00 0.00 ? 61 LYS A HE2  2  
ATOM   2199  H  HE3  . LYS A 1 61 ? 9.232   -9.544  1.433   1.00 0.00 ? 61 LYS A HE3  2  
ATOM   2200  H  HZ1  . LYS A 1 61 ? 8.256   -10.034 -0.559  1.00 0.00 ? 61 LYS A HZ1  2  
ATOM   2201  H  HZ2  . LYS A 1 61 ? 6.678   -9.945  0.044   1.00 0.00 ? 61 LYS A HZ2  2  
ATOM   2202  H  HZ3  . LYS A 1 61 ? 7.634   -11.297 0.377   1.00 0.00 ? 61 LYS A HZ3  2  
ATOM   2203  N  N    . ASP A 1 62 ? 3.722   -14.305 1.629   1.00 0.00 ? 62 ASP A N    2  
ATOM   2204  C  CA   . ASP A 1 62 ? 3.525   -15.636 1.062   1.00 0.00 ? 62 ASP A CA   2  
ATOM   2205  C  C    . ASP A 1 62 ? 2.682   -15.561 -0.210  1.00 0.00 ? 62 ASP A C    2  
ATOM   2206  O  O    . ASP A 1 62 ? 2.920   -16.301 -1.164  1.00 0.00 ? 62 ASP A O    2  
ATOM   2207  C  CB   . ASP A 1 62 ? 2.854   -16.561 2.080   1.00 0.00 ? 62 ASP A CB   2  
ATOM   2208  C  CG   . ASP A 1 62 ? 3.263   -18.010 1.898   1.00 0.00 ? 62 ASP A CG   2  
ATOM   2209  O  OD1  . ASP A 1 62 ? 3.042   -18.557 0.798   1.00 0.00 ? 62 ASP A OD1  2  
ATOM   2210  O  OD2  . ASP A 1 62 ? 3.804   -18.598 2.858   1.00 0.00 ? 62 ASP A OD2  2  
ATOM   2211  H  H    . ASP A 1 62 ? 3.332   -14.096 2.505   1.00 0.00 ? 62 ASP A H    2  
ATOM   2212  H  HA   . ASP A 1 62 ? 4.498   -16.034 0.813   1.00 0.00 ? 62 ASP A HA   2  
ATOM   2213  H  HB2  . ASP A 1 62 ? 3.126   -16.252 3.078   1.00 0.00 ? 62 ASP A HB2  2  
ATOM   2214  H  HB3  . ASP A 1 62 ? 1.781   -16.492 1.967   1.00 0.00 ? 62 ASP A HB3  2  
ATOM   2215  N  N    . GLN A 1 63 ? 1.698   -14.659 -0.215  1.00 0.00 ? 63 GLN A N    2  
ATOM   2216  C  CA   . GLN A 1 63 ? 0.823   -14.487 -1.372  1.00 0.00 ? 63 GLN A CA   2  
ATOM   2217  C  C    . GLN A 1 63 ? 1.504   -13.661 -2.467  1.00 0.00 ? 63 GLN A C    2  
ATOM   2218  O  O    . GLN A 1 63 ? 1.295   -13.905 -3.656  1.00 0.00 ? 63 GLN A O    2  
ATOM   2219  C  CB   . GLN A 1 63 ? -0.487  -13.817 -0.952  1.00 0.00 ? 63 GLN A CB   2  
ATOM   2220  C  CG   . GLN A 1 63 ? -1.551  -14.796 -0.480  1.00 0.00 ? 63 GLN A CG   2  
ATOM   2221  C  CD   . GLN A 1 63 ? -2.624  -15.037 -1.524  1.00 0.00 ? 63 GLN A CD   2  
ATOM   2222  O  OE1  . GLN A 1 63 ? -2.484  -15.903 -2.386  1.00 0.00 ? 63 GLN A OE1  2  
ATOM   2223  N  NE2  . GLN A 1 63 ? -3.705  -14.267 -1.452  1.00 0.00 ? 63 GLN A NE2  2  
ATOM   2224  H  H    . GLN A 1 63 ? 1.558   -14.095 0.579   1.00 0.00 ? 63 GLN A H    2  
ATOM   2225  H  HA   . GLN A 1 63 ? 0.601   -15.469 -1.766  1.00 0.00 ? 63 GLN A HA   2  
ATOM   2226  H  HB2  . GLN A 1 63 ? -0.283  -13.126 -0.147  1.00 0.00 ? 63 GLN A HB2  2  
ATOM   2227  H  HB3  . GLN A 1 63 ? -0.882  -13.268 -1.793  1.00 0.00 ? 63 GLN A HB3  2  
ATOM   2228  H  HG2  . GLN A 1 63 ? -1.078  -15.738 -0.248  1.00 0.00 ? 63 GLN A HG2  2  
ATOM   2229  H  HG3  . GLN A 1 63 ? -2.016  -14.400 0.411   1.00 0.00 ? 63 GLN A HG3  2  
ATOM   2230  H  HE21 . GLN A 1 63 ? -3.751  -13.596 -0.739  1.00 0.00 ? 63 GLN A HE21 2  
ATOM   2231  H  HE22 . GLN A 1 63 ? -4.413  -14.400 -2.116  1.00 0.00 ? 63 GLN A HE22 2  
ATOM   2232  N  N    . PHE A 1 64 ? 2.313   -12.683 -2.060  1.00 0.00 ? 64 PHE A N    2  
ATOM   2233  C  CA   . PHE A 1 64 ? 3.016   -11.821 -3.010  1.00 0.00 ? 64 PHE A CA   2  
ATOM   2234  C  C    . PHE A 1 64 ? 4.192   -12.545 -3.666  1.00 0.00 ? 64 PHE A C    2  
ATOM   2235  O  O    . PHE A 1 64 ? 4.392   -12.442 -4.877  1.00 0.00 ? 64 PHE A O    2  
ATOM   2236  C  CB   . PHE A 1 64 ? 3.513   -10.551 -2.313  1.00 0.00 ? 64 PHE A CB   2  
ATOM   2237  C  CG   . PHE A 1 64 ? 2.488   -9.454  -2.263  1.00 0.00 ? 64 PHE A CG   2  
ATOM   2238  C  CD1  . PHE A 1 64 ? 1.453   -9.492  -1.342  1.00 0.00 ? 64 PHE A CD1  2  
ATOM   2239  C  CD2  . PHE A 1 64 ? 2.557   -8.385  -3.143  1.00 0.00 ? 64 PHE A CD2  2  
ATOM   2240  C  CE1  . PHE A 1 64 ? 0.508   -8.485  -1.298  1.00 0.00 ? 64 PHE A CE1  2  
ATOM   2241  C  CE2  . PHE A 1 64 ? 1.616   -7.376  -3.104  1.00 0.00 ? 64 PHE A CE2  2  
ATOM   2242  C  CZ   . PHE A 1 64 ? 0.589   -7.426  -2.181  1.00 0.00 ? 64 PHE A CZ   2  
ATOM   2243  H  H    . PHE A 1 64 ? 2.436   -12.534 -1.099  1.00 0.00 ? 64 PHE A H    2  
ATOM   2244  H  HA   . PHE A 1 64 ? 2.311   -11.541 -3.779  1.00 0.00 ? 64 PHE A HA   2  
ATOM   2245  H  HB2  . PHE A 1 64 ? 3.795   -10.791 -1.298  1.00 0.00 ? 64 PHE A HB2  2  
ATOM   2246  H  HB3  . PHE A 1 64 ? 4.379   -10.177 -2.841  1.00 0.00 ? 64 PHE A HB3  2  
ATOM   2247  H  HD1  . PHE A 1 64 ? 1.388   -10.321 -0.653  1.00 0.00 ? 64 PHE A HD1  2  
ATOM   2248  H  HD2  . PHE A 1 64 ? 3.359   -8.345  -3.865  1.00 0.00 ? 64 PHE A HD2  2  
ATOM   2249  H  HE1  . PHE A 1 64 ? -0.294  -8.527  -0.576  1.00 0.00 ? 64 PHE A HE1  2  
ATOM   2250  H  HE2  . PHE A 1 64 ? 1.683   -6.549  -3.795  1.00 0.00 ? 64 PHE A HE2  2  
ATOM   2251  H  HZ   . PHE A 1 64 ? -0.148  -6.637  -2.149  1.00 0.00 ? 64 PHE A HZ   2  
ATOM   2252  N  N    . VAL A 1 65 ? 4.970   -13.272 -2.862  1.00 0.00 ? 65 VAL A N    2  
ATOM   2253  C  CA   . VAL A 1 65 ? 6.128   -14.004 -3.373  1.00 0.00 ? 65 VAL A CA   2  
ATOM   2254  C  C    . VAL A 1 65 ? 5.703   -15.324 -4.011  1.00 0.00 ? 65 VAL A C    2  
ATOM   2255  O  O    . VAL A 1 65 ? 5.788   -16.387 -3.392  1.00 0.00 ? 65 VAL A O    2  
ATOM   2256  C  CB   . VAL A 1 65 ? 7.170   -14.284 -2.265  1.00 0.00 ? 65 VAL A CB   2  
ATOM   2257  C  CG1  . VAL A 1 65 ? 8.427   -14.915 -2.850  1.00 0.00 ? 65 VAL A CG1  2  
ATOM   2258  C  CG2  . VAL A 1 65 ? 7.514   -13.005 -1.517  1.00 0.00 ? 65 VAL A CG2  2  
ATOM   2259  H  H    . VAL A 1 65 ? 4.762   -13.315 -1.904  1.00 0.00 ? 65 VAL A H    2  
ATOM   2260  H  HA   . VAL A 1 65 ? 6.597   -13.391 -4.129  1.00 0.00 ? 65 VAL A HA   2  
ATOM   2261  H  HB   . VAL A 1 65 ? 6.738   -14.982 -1.561  1.00 0.00 ? 65 VAL A HB   2  
ATOM   2262  H  HG11 . VAL A 1 65 ? 8.774   -14.323 -3.685  1.00 0.00 ? 65 VAL A HG11 2  
ATOM   2263  H  HG12 . VAL A 1 65 ? 8.203   -15.917 -3.187  1.00 0.00 ? 65 VAL A HG12 2  
ATOM   2264  H  HG13 . VAL A 1 65 ? 9.196   -14.954 -2.092  1.00 0.00 ? 65 VAL A HG13 2  
ATOM   2265  H  HG21 . VAL A 1 65 ? 6.612   -12.439 -1.336  1.00 0.00 ? 65 VAL A HG21 2  
ATOM   2266  H  HG22 . VAL A 1 65 ? 8.199   -12.414 -2.107  1.00 0.00 ? 65 VAL A HG22 2  
ATOM   2267  H  HG23 . VAL A 1 65 ? 7.975   -13.255 -0.573  1.00 0.00 ? 65 VAL A HG23 2  
ATOM   2268  N  N    . SER A 1 66 ? 5.245   -15.244 -5.257  1.00 0.00 ? 66 SER A N    2  
ATOM   2269  C  CA   . SER A 1 66 ? 4.805   -16.425 -5.996  1.00 0.00 ? 66 SER A CA   2  
ATOM   2270  C  C    . SER A 1 66 ? 5.451   -16.481 -7.383  1.00 0.00 ? 66 SER A C    2  
ATOM   2271  O  O    . SER A 1 66 ? 4.862   -17.007 -8.330  1.00 0.00 ? 66 SER A O    2  
ATOM   2272  C  CB   . SER A 1 66 ? 3.281   -16.422 -6.126  1.00 0.00 ? 66 SER A CB   2  
ATOM   2273  O  OG   . SER A 1 66 ? 2.809   -17.660 -6.633  1.00 0.00 ? 66 SER A OG   2  
ATOM   2274  H  H    . SER A 1 66 ? 5.202   -14.367 -5.694  1.00 0.00 ? 66 SER A H    2  
ATOM   2275  H  HA   . SER A 1 66 ? 5.108   -17.297 -5.435  1.00 0.00 ? 66 SER A HA   2  
ATOM   2276  H  HB2  . SER A 1 66 ? 2.839   -16.253 -5.156  1.00 0.00 ? 66 SER A HB2  2  
ATOM   2277  H  HB3  . SER A 1 66 ? 2.982   -15.633 -6.801  1.00 0.00 ? 66 SER A HB3  2  
ATOM   2278  H  HG   . SER A 1 66 ? 2.570   -18.234 -5.904  1.00 0.00 ? 66 SER A HG   2  
ATOM   2279  N  N    . GLY A 1 67 ? 6.668   -15.943 -7.497  1.00 0.00 ? 67 GLY A N    2  
ATOM   2280  C  CA   . GLY A 1 67 ? 7.371   -15.950 -8.771  1.00 0.00 ? 67 GLY A CA   2  
ATOM   2281  C  C    . GLY A 1 67 ? 7.843   -17.338 -9.166  1.00 0.00 ? 67 GLY A C    2  
ATOM   2282  O  O    . GLY A 1 67 ? 7.741   -17.724 -10.332 1.00 0.00 ? 67 GLY A O    2  
ATOM   2283  H  H    . GLY A 1 67 ? 7.093   -15.543 -6.710  1.00 0.00 ? 67 GLY A H    2  
ATOM   2284  H  HA2  . GLY A 1 67 ? 6.709   -15.573 -9.536  1.00 0.00 ? 67 GLY A HA2  2  
ATOM   2285  H  HA3  . GLY A 1 67 ? 8.230   -15.299 -8.699  1.00 0.00 ? 67 GLY A HA3  2  
ATOM   2286  N  N    . GLU A 1 68 ? 8.355   -18.088 -8.192  1.00 0.00 ? 68 GLU A N    2  
ATOM   2287  C  CA   . GLU A 1 68 ? 8.843   -19.444 -8.433  1.00 0.00 ? 68 GLU A CA   2  
ATOM   2288  C  C    . GLU A 1 68 ? 7.806   -20.490 -8.009  1.00 0.00 ? 68 GLU A C    2  
ATOM   2289  O  O    . GLU A 1 68 ? 8.159   -21.593 -7.579  1.00 0.00 ? 68 GLU A O    2  
ATOM   2290  C  CB   . GLU A 1 68 ? 10.161  -19.666 -7.684  1.00 0.00 ? 68 GLU A CB   2  
ATOM   2291  C  CG   . GLU A 1 68 ? 11.102  -20.630 -8.388  1.00 0.00 ? 68 GLU A CG   2  
ATOM   2292  C  CD   . GLU A 1 68 ? 12.566  -20.308 -8.148  1.00 0.00 ? 68 GLU A CD   2  
ATOM   2293  O  OE1  . GLU A 1 68 ? 12.930  -19.113 -8.193  1.00 0.00 ? 68 GLU A OE1  2  
ATOM   2294  O  OE2  . GLU A 1 68 ? 13.348  -21.252 -7.914  1.00 0.00 ? 68 GLU A OE2  2  
ATOM   2295  H  H    . GLU A 1 68 ? 8.405   -17.720 -7.284  1.00 0.00 ? 68 GLU A H    2  
ATOM   2296  H  HA   . GLU A 1 68 ? 9.022   -19.548 -9.493  1.00 0.00 ? 68 GLU A HA   2  
ATOM   2297  H  HB2  . GLU A 1 68 ? 10.663  -18.716 -7.582  1.00 0.00 ? 68 GLU A HB2  2  
ATOM   2298  H  HB3  . GLU A 1 68 ? 9.946   -20.057 -6.701  1.00 0.00 ? 68 GLU A HB3  2  
ATOM   2299  H  HG2  . GLU A 1 68 ? 10.905  -21.629 -8.028  1.00 0.00 ? 68 GLU A HG2  2  
ATOM   2300  H  HG3  . GLU A 1 68 ? 10.908  -20.587 -9.450  1.00 0.00 ? 68 GLU A HG3  2  
ATOM   2301  N  N    . THR A 1 69 ? 6.523   -20.141 -8.134  1.00 0.00 ? 69 THR A N    2  
ATOM   2302  C  CA   . THR A 1 69 ? 5.437   -21.044 -7.768  1.00 0.00 ? 69 THR A CA   2  
ATOM   2303  C  C    . THR A 1 69 ? 4.297   -20.960 -8.783  1.00 0.00 ? 69 THR A C    2  
ATOM   2304  O  O    . THR A 1 69 ? 3.527   -19.999 -8.783  1.00 0.00 ? 69 THR A O    2  
ATOM   2305  C  CB   . THR A 1 69 ? 4.919   -20.711 -6.364  1.00 0.00 ? 69 THR A CB   2  
ATOM   2306  O  OG1  . THR A 1 69 ? 5.987   -20.642 -5.434  1.00 0.00 ? 69 THR A OG1  2  
ATOM   2307  C  CG2  . THR A 1 69 ? 3.919   -21.716 -5.836  1.00 0.00 ? 69 THR A CG2  2  
ATOM   2308  H  H    . THR A 1 69 ? 6.299   -19.253 -8.483  1.00 0.00 ? 69 THR A H    2  
ATOM   2309  H  HA   . THR A 1 69 ? 5.830   -22.050 -7.768  1.00 0.00 ? 69 THR A HA   2  
ATOM   2310  H  HB   . THR A 1 69 ? 4.432   -19.746 -6.394  1.00 0.00 ? 69 THR A HB   2  
ATOM   2311  H  HG1  . THR A 1 69 ? 6.298   -19.736 -5.367  1.00 0.00 ? 69 THR A HG1  2  
ATOM   2312  H  HG21 . THR A 1 69 ? 4.185   -21.991 -4.827  1.00 0.00 ? 69 THR A HG21 2  
ATOM   2313  H  HG22 . THR A 1 69 ? 3.924   -22.595 -6.464  1.00 0.00 ? 69 THR A HG22 2  
ATOM   2314  H  HG23 . THR A 1 69 ? 2.933   -21.277 -5.841  1.00 0.00 ? 69 THR A HG23 2  
ATOM   2315  N  N    . VAL A 1 70 ? 4.197   -21.982 -9.640  1.00 0.00 ? 70 VAL A N    2  
ATOM   2316  C  CA   . VAL A 1 70 ? 3.155   -22.051 -10.667 1.00 0.00 ? 70 VAL A CA   2  
ATOM   2317  C  C    . VAL A 1 70 ? 3.342   -20.969 -11.741 1.00 0.00 ? 70 VAL A C    2  
ATOM   2318  O  O    . VAL A 1 70 ? 3.730   -19.839 -11.438 1.00 0.00 ? 70 VAL A O    2  
ATOM   2319  C  CB   . VAL A 1 70 ? 1.755   -21.922 -10.034 1.00 0.00 ? 70 VAL A CB   2  
ATOM   2320  C  CG1  . VAL A 1 70 ? 0.663   -21.965 -11.094 1.00 0.00 ? 70 VAL A CG1  2  
ATOM   2321  C  CG2  . VAL A 1 70 ? 1.534   -23.013 -8.994  1.00 0.00 ? 70 VAL A CG2  2  
ATOM   2322  H  H    . VAL A 1 70 ? 4.837   -22.714 -9.577  1.00 0.00 ? 70 VAL A H    2  
ATOM   2323  H  HA   . VAL A 1 70 ? 3.221   -23.022 -11.136 1.00 0.00 ? 70 VAL A HA   2  
ATOM   2324  H  HB   . VAL A 1 70 ? 1.705   -20.970 -9.533  1.00 0.00 ? 70 VAL A HB   2  
ATOM   2325  H  HG11 . VAL A 1 70 ? 0.866   -21.221 -11.850 1.00 0.00 ? 70 VAL A HG11 2  
ATOM   2326  H  HG12 . VAL A 1 70 ? -0.293  -21.758 -10.635 1.00 0.00 ? 70 VAL A HG12 2  
ATOM   2327  H  HG13 . VAL A 1 70 ? 0.639   -22.945 -11.548 1.00 0.00 ? 70 VAL A HG13 2  
ATOM   2328  H  HG21 . VAL A 1 70 ? 0.475   -23.136 -8.820  1.00 0.00 ? 70 VAL A HG21 2  
ATOM   2329  H  HG22 . VAL A 1 70 ? 2.022   -22.735 -8.073  1.00 0.00 ? 70 VAL A HG22 2  
ATOM   2330  H  HG23 . VAL A 1 70 ? 1.948   -23.944 -9.355  1.00 0.00 ? 70 VAL A HG23 2  
ATOM   2331  N  N    . PRO A 1 71 ? 3.070   -21.305 -13.021 1.00 0.00 ? 71 PRO A N    2  
ATOM   2332  C  CA   . PRO A 1 71 ? 3.210   -20.361 -14.144 1.00 0.00 ? 71 PRO A CA   2  
ATOM   2333  C  C    . PRO A 1 71 ? 2.361   -19.102 -13.967 1.00 0.00 ? 71 PRO A C    2  
ATOM   2334  O  O    . PRO A 1 71 ? 1.349   -19.121 -13.264 1.00 0.00 ? 71 PRO A O    2  
ATOM   2335  C  CB   . PRO A 1 71 ? 2.722   -21.162 -15.355 1.00 0.00 ? 71 PRO A CB   2  
ATOM   2336  C  CG   . PRO A 1 71 ? 2.861   -22.590 -14.954 1.00 0.00 ? 71 PRO A CG   2  
ATOM   2337  C  CD   . PRO A 1 71 ? 2.606   -22.629 -13.477 1.00 0.00 ? 71 PRO A CD   2  
ATOM   2338  H  HA   . PRO A 1 71 ? 4.243   -20.078 -14.291 1.00 0.00 ? 71 PRO A HA   2  
ATOM   2339  H  HB2  . PRO A 1 71 ? 1.692   -20.910 -15.566 1.00 0.00 ? 71 PRO A HB2  2  
ATOM   2340  H  HB3  . PRO A 1 71 ? 3.336   -20.933 -16.213 1.00 0.00 ? 71 PRO A HB3  2  
ATOM   2341  H  HG2  . PRO A 1 71 ? 2.132   -23.192 -15.477 1.00 0.00 ? 71 PRO A HG2  2  
ATOM   2342  H  HG3  . PRO A 1 71 ? 3.860   -22.937 -15.172 1.00 0.00 ? 71 PRO A HG3  2  
ATOM   2343  H  HD2  . PRO A 1 71 ? 1.552   -22.758 -13.280 1.00 0.00 ? 71 PRO A HD2  2  
ATOM   2344  H  HD3  . PRO A 1 71 ? 3.178   -23.419 -13.015 1.00 0.00 ? 71 PRO A HD3  2  
ATOM   2345  N  N    . ALA A 1 72 ? 2.781   -18.009 -14.609 1.00 0.00 ? 72 ALA A N    2  
ATOM   2346  C  CA   . ALA A 1 72 ? 2.062   -16.739 -14.521 1.00 0.00 ? 72 ALA A CA   2  
ATOM   2347  C  C    . ALA A 1 72 ? 2.457   -15.787 -15.653 1.00 0.00 ? 72 ALA A C    2  
ATOM   2348  O  O    . ALA A 1 72 ? 3.582   -15.838 -16.152 1.00 0.00 ? 72 ALA A O    2  
ATOM   2349  C  CB   . ALA A 1 72 ? 2.321   -16.086 -13.170 1.00 0.00 ? 72 ALA A CB   2  
ATOM   2350  H  H    . ALA A 1 72 ? 3.595   -18.058 -15.155 1.00 0.00 ? 72 ALA A H    2  
ATOM   2351  H  HA   . ALA A 1 72 ? 1.005   -16.952 -14.594 1.00 0.00 ? 72 ALA A HA   2  
ATOM   2352  H  HB1  . ALA A 1 72 ? 1.885   -16.691 -12.388 1.00 0.00 ? 72 ALA A HB1  2  
ATOM   2353  H  HB2  . ALA A 1 72 ? 1.878   -15.102 -13.154 1.00 0.00 ? 72 ALA A HB2  2  
ATOM   2354  H  HB3  . ALA A 1 72 ? 3.386   -16.004 -13.009 1.00 0.00 ? 72 ALA A HB3  2  
ATOM   2355  N  N    . PRO A 1 73 ? 1.533   -14.896 -16.066 1.00 0.00 ? 73 PRO A N    2  
ATOM   2356  C  CA   . PRO A 1 73 ? 1.790   -13.924 -17.137 1.00 0.00 ? 73 PRO A CA   2  
ATOM   2357  C  C    . PRO A 1 73 ? 2.785   -12.845 -16.715 1.00 0.00 ? 73 PRO A C    2  
ATOM   2358  O  O    . PRO A 1 73 ? 2.986   -12.606 -15.523 1.00 0.00 ? 73 PRO A O    2  
ATOM   2359  C  CB   . PRO A 1 73 ? 0.414   -13.304 -17.399 1.00 0.00 ? 73 PRO A CB   2  
ATOM   2360  C  CG   . PRO A 1 73 ? -0.333  -13.481 -16.123 1.00 0.00 ? 73 PRO A CG   2  
ATOM   2361  C  CD   . PRO A 1 73 ? 0.167   -14.765 -15.520 1.00 0.00 ? 73 PRO A CD   2  
ATOM   2362  H  HA   . PRO A 1 73 ? 2.148   -14.409 -18.033 1.00 0.00 ? 73 PRO A HA   2  
ATOM   2363  H  HB2  . PRO A 1 73 ? 0.530   -12.258 -17.648 1.00 0.00 ? 73 PRO A HB2  2  
ATOM   2364  H  HB3  . PRO A 1 73 ? -0.069  -13.822 -18.214 1.00 0.00 ? 73 PRO A HB3  2  
ATOM   2365  H  HG2  . PRO A 1 73 ? -0.128  -12.652 -15.460 1.00 0.00 ? 73 PRO A HG2  2  
ATOM   2366  H  HG3  . PRO A 1 73 ? -1.391  -13.548 -16.324 1.00 0.00 ? 73 PRO A HG3  2  
ATOM   2367  H  HD2  . PRO A 1 73 ? 0.190   -14.692 -14.443 1.00 0.00 ? 73 PRO A HD2  2  
ATOM   2368  H  HD3  . PRO A 1 73 ? -0.453  -15.593 -15.830 1.00 0.00 ? 73 PRO A HD3  2  
ATOM   2369  N  N    . SER A 1 74 ? 3.403   -12.195 -17.700 1.00 0.00 ? 74 SER A N    2  
ATOM   2370  C  CA   . SER A 1 74 ? 4.376   -11.140 -17.432 1.00 0.00 ? 74 SER A CA   2  
ATOM   2371  C  C    . SER A 1 74 ? 3.735   -9.761  -17.558 1.00 0.00 ? 74 SER A C    2  
ATOM   2372  O  O    . SER A 1 74 ? 3.977   -9.036  -18.527 1.00 0.00 ? 74 SER A O    2  
ATOM   2373  C  CB   . SER A 1 74 ? 5.567   -11.264 -18.387 1.00 0.00 ? 74 SER A CB   2  
ATOM   2374  O  OG   . SER A 1 74 ? 6.353   -12.402 -18.080 1.00 0.00 ? 74 SER A OG   2  
ATOM   2375  H  H    . SER A 1 74 ? 3.200   -12.430 -18.630 1.00 0.00 ? 74 SER A H    2  
ATOM   2376  H  HA   . SER A 1 74 ? 4.727   -11.266 -16.418 1.00 0.00 ? 74 SER A HA   2  
ATOM   2377  H  HB2  . SER A 1 74 ? 5.204   -11.357 -19.400 1.00 0.00 ? 74 SER A HB2  2  
ATOM   2378  H  HB3  . SER A 1 74 ? 6.185   -10.382 -18.305 1.00 0.00 ? 74 SER A HB3  2  
ATOM   2379  H  HG   . SER A 1 74 ? 6.017   -13.164 -18.560 1.00 0.00 ? 74 SER A HG   2  
ATOM   2380  N  N    . ALA A 1 75 ? 2.914   -9.405  -16.568 1.00 0.00 ? 75 ALA A N    2  
ATOM   2381  C  CA   . ALA A 1 75 ? 2.228   -8.113  -16.550 1.00 0.00 ? 75 ALA A CA   2  
ATOM   2382  C  C    . ALA A 1 75 ? 1.185   -8.011  -17.663 1.00 0.00 ? 75 ALA A C    2  
ATOM   2383  O  O    . ALA A 1 75 ? 1.227   -8.759  -18.643 1.00 0.00 ? 75 ALA A O    2  
ATOM   2384  C  CB   . ALA A 1 75 ? 3.236   -6.973  -16.654 1.00 0.00 ? 75 ALA A CB   2  
ATOM   2385  H  H    . ALA A 1 75 ? 2.765   -10.030 -15.827 1.00 0.00 ? 75 ALA A H    2  
ATOM   2386  H  HA   . ALA A 1 75 ? 1.725   -8.022  -15.598 1.00 0.00 ? 75 ALA A HA   2  
ATOM   2387  H  HB1  . ALA A 1 75 ? 4.190   -7.297  -16.267 1.00 0.00 ? 75 ALA A HB1  2  
ATOM   2388  H  HB2  . ALA A 1 75 ? 2.883   -6.128  -16.080 1.00 0.00 ? 75 ALA A HB2  2  
ATOM   2389  H  HB3  . ALA A 1 75 ? 3.347   -6.684  -17.688 1.00 0.00 ? 75 ALA A HB3  2  
ATOM   2390  N  N    . ASN A 1 76 ? 0.243   -7.082  -17.498 1.00 0.00 ? 76 ASN A N    2  
ATOM   2391  C  CA   . ASN A 1 76 ? -0.819  -6.876  -18.478 1.00 0.00 ? 76 ASN A CA   2  
ATOM   2392  C  C    . ASN A 1 76 ? -0.710  -5.500  -19.130 1.00 0.00 ? 76 ASN A C    2  
ATOM   2393  O  O    . ASN A 1 76 ? -0.288  -4.533  -18.494 1.00 0.00 ? 76 ASN A O    2  
ATOM   2394  C  CB   . ASN A 1 76 ? -2.189  -7.033  -17.817 1.00 0.00 ? 76 ASN A CB   2  
ATOM   2395  C  CG   . ASN A 1 76 ? -2.706  -8.458  -17.886 1.00 0.00 ? 76 ASN A CG   2  
ATOM   2396  O  OD1  . ASN A 1 76 ? -2.273  -9.323  -17.124 1.00 0.00 ? 76 ASN A OD1  2  
ATOM   2397  N  ND2  . ASN A 1 76 ? -3.636  -8.712  -18.800 1.00 0.00 ? 76 ASN A ND2  2  
ATOM   2398  H  H    . ASN A 1 76 ? 0.262   -6.521  -16.695 1.00 0.00 ? 76 ASN A H    2  
ATOM   2399  H  HA   . ASN A 1 76 ? -0.713  -7.631  -19.243 1.00 0.00 ? 76 ASN A HA   2  
ATOM   2400  H  HB2  . ASN A 1 76 ? -2.116  -6.747  -16.777 1.00 0.00 ? 76 ASN A HB2  2  
ATOM   2401  H  HB3  . ASN A 1 76 ? -2.899  -6.387  -18.314 1.00 0.00 ? 76 ASN A HB3  2  
ATOM   2402  H  HD21 . ASN A 1 76 ? -3.937  -7.977  -19.373 1.00 0.00 ? 76 ASN A HD21 2  
ATOM   2403  H  HD22 . ASN A 1 76 ? -3.981  -9.627  -18.867 1.00 0.00 ? 76 ASN A HD22 2  
ATOM   2404  N  N    . LYS A 1 77 ? -1.097  -5.424  -20.403 1.00 0.00 ? 77 LYS A N    2  
ATOM   2405  C  CA   . LYS A 1 77 ? -1.048  -4.172  -21.151 1.00 0.00 ? 77 LYS A CA   2  
ATOM   2406  C  C    . LYS A 1 77 ? -2.396  -3.871  -21.805 1.00 0.00 ? 77 LYS A C    2  
ATOM   2407  O  O    . LYS A 1 77 ? -2.647  -4.268  -22.944 1.00 0.00 ? 77 LYS A O    2  
ATOM   2408  C  CB   . LYS A 1 77 ? 0.053   -4.235  -22.218 1.00 0.00 ? 77 LYS A CB   2  
ATOM   2409  C  CG   . LYS A 1 77 ? 0.780   -2.915  -22.428 1.00 0.00 ? 77 LYS A CG   2  
ATOM   2410  C  CD   . LYS A 1 77 ? -0.183  -1.790  -22.781 1.00 0.00 ? 77 LYS A CD   2  
ATOM   2411  C  CE   . LYS A 1 77 ? 0.452   -0.790  -23.734 1.00 0.00 ? 77 LYS A CE   2  
ATOM   2412  N  NZ   . LYS A 1 77 ? 0.110   -1.078  -25.157 1.00 0.00 ? 77 LYS A NZ   2  
ATOM   2413  H  H    . LYS A 1 77 ? -1.424  -6.233  -20.851 1.00 0.00 ? 77 LYS A H    2  
ATOM   2414  H  HA   . LYS A 1 77 ? -0.815  -3.380  -20.455 1.00 0.00 ? 77 LYS A HA   2  
ATOM   2415  H  HB2  . LYS A 1 77 ? 0.780   -4.978  -21.924 1.00 0.00 ? 77 LYS A HB2  2  
ATOM   2416  H  HB3  . LYS A 1 77 ? -0.389  -4.532  -23.159 1.00 0.00 ? 77 LYS A HB3  2  
ATOM   2417  H  HG2  . LYS A 1 77 ? 1.303   -2.654  -21.520 1.00 0.00 ? 77 LYS A HG2  2  
ATOM   2418  H  HG3  . LYS A 1 77 ? 1.491   -3.033  -23.234 1.00 0.00 ? 77 LYS A HG3  2  
ATOM   2419  H  HD2  . LYS A 1 77 ? -1.059  -2.214  -23.251 1.00 0.00 ? 77 LYS A HD2  2  
ATOM   2420  H  HD3  . LYS A 1 77 ? -0.470  -1.278  -21.874 1.00 0.00 ? 77 LYS A HD3  2  
ATOM   2421  H  HE2  . LYS A 1 77 ? 0.101   0.200   -23.482 1.00 0.00 ? 77 LYS A HE2  2  
ATOM   2422  H  HE3  . LYS A 1 77 ? 1.525   -0.831  -23.615 1.00 0.00 ? 77 LYS A HE3  2  
ATOM   2423  H  HZ1  . LYS A 1 77 ? 0.717   -1.838  -25.523 1.00 0.00 ? 77 LYS A HZ1  2  
ATOM   2424  H  HZ2  . LYS A 1 77 ? 0.252   -0.226  -25.738 1.00 0.00 ? 77 LYS A HZ2  2  
ATOM   2425  H  HZ3  . LYS A 1 77 ? -0.884  -1.374  -25.234 1.00 0.00 ? 77 LYS A HZ3  2  
ATOM   2426  N  N    . GLU A 1 78 ? -3.259  -3.161  -21.080 1.00 0.00 ? 78 GLU A N    2  
ATOM   2427  C  CA   . GLU A 1 78 ? -4.579  -2.804  -21.597 1.00 0.00 ? 78 GLU A CA   2  
ATOM   2428  C  C    . GLU A 1 78 ? -5.065  -1.490  -20.991 1.00 0.00 ? 78 GLU A C    2  
ATOM   2429  O  O    . GLU A 1 78 ? -5.264  -1.391  -19.780 1.00 0.00 ? 78 GLU A O    2  
ATOM   2430  C  CB   . GLU A 1 78 ? -5.591  -3.916  -21.308 1.00 0.00 ? 78 GLU A CB   2  
ATOM   2431  C  CG   . GLU A 1 78 ? -6.671  -4.045  -22.370 1.00 0.00 ? 78 GLU A CG   2  
ATOM   2432  C  CD   . GLU A 1 78 ? -7.720  -5.078  -22.012 1.00 0.00 ? 78 GLU A CD   2  
ATOM   2433  O  OE1  . GLU A 1 78 ? -7.454  -6.284  -22.202 1.00 0.00 ? 78 GLU A OE1  2  
ATOM   2434  O  OE2  . GLU A 1 78 ? -8.806  -4.684  -21.538 1.00 0.00 ? 78 GLU A OE2  2  
ATOM   2435  H  H    . GLU A 1 78 ? -3.003  -2.869  -20.179 1.00 0.00 ? 78 GLU A H    2  
ATOM   2436  H  HA   . GLU A 1 78 ? -4.489  -2.681  -22.665 1.00 0.00 ? 78 GLU A HA   2  
ATOM   2437  H  HB2  . GLU A 1 78 ? -5.065  -4.858  -21.243 1.00 0.00 ? 78 GLU A HB2  2  
ATOM   2438  H  HB3  . GLU A 1 78 ? -6.069  -3.715  -20.360 1.00 0.00 ? 78 GLU A HB3  2  
ATOM   2439  H  HG2  . GLU A 1 78 ? -7.157  -3.087  -22.489 1.00 0.00 ? 78 GLU A HG2  2  
ATOM   2440  H  HG3  . GLU A 1 78 ? -6.208  -4.331  -23.304 1.00 0.00 ? 78 GLU A HG3  2  
ATOM   2441  N  N    . LEU A 1 79 ? -5.253  -0.484  -21.843 1.00 0.00 ? 79 LEU A N    2  
ATOM   2442  C  CA   . LEU A 1 79 ? -5.717  0.827   -21.392 1.00 0.00 ? 79 LEU A CA   2  
ATOM   2443  C  C    . LEU A 1 79 ? -6.516  1.537   -22.490 1.00 0.00 ? 79 LEU A C    2  
ATOM   2444  O  O    . LEU A 1 79 ? -6.460  2.762   -22.619 1.00 0.00 ? 79 LEU A O    2  
ATOM   2445  C  CB   . LEU A 1 79 ? -4.525  1.692   -20.957 1.00 0.00 ? 79 LEU A CB   2  
ATOM   2446  C  CG   . LEU A 1 79 ? -3.423  1.867   -22.008 1.00 0.00 ? 79 LEU A CG   2  
ATOM   2447  C  CD1  . LEU A 1 79 ? -2.768  3.231   -21.867 1.00 0.00 ? 79 LEU A CD1  2  
ATOM   2448  C  CD2  . LEU A 1 79 ? -2.384  0.759   -21.887 1.00 0.00 ? 79 LEU A CD2  2  
ATOM   2449  H  H    . LEU A 1 79 ? -5.075  -0.624  -22.797 1.00 0.00 ? 79 LEU A H    2  
ATOM   2450  H  HA   . LEU A 1 79 ? -6.365  0.672   -20.543 1.00 0.00 ? 79 LEU A HA   2  
ATOM   2451  H  HB2  . LEU A 1 79 ? -4.899  2.672   -20.693 1.00 0.00 ? 79 LEU A HB2  2  
ATOM   2452  H  HB3  . LEU A 1 79 ? -4.087  1.244   -20.078 1.00 0.00 ? 79 LEU A HB3  2  
ATOM   2453  H  HG   . LEU A 1 79 ? -3.862  1.808   -22.994 1.00 0.00 ? 79 LEU A HG   2  
ATOM   2454  H  HD11 . LEU A 1 79 ? -3.477  3.931   -21.450 1.00 0.00 ? 79 LEU A HD11 2  
ATOM   2455  H  HD12 . LEU A 1 79 ? -2.447  3.579   -22.838 1.00 0.00 ? 79 LEU A HD12 2  
ATOM   2456  H  HD13 . LEU A 1 79 ? -1.911  3.154   -21.212 1.00 0.00 ? 79 LEU A HD13 2  
ATOM   2457  H  HD21 . LEU A 1 79 ? -1.596  1.078   -21.219 1.00 0.00 ? 79 LEU A HD21 2  
ATOM   2458  H  HD22 . LEU A 1 79 ? -1.968  0.548   -22.860 1.00 0.00 ? 79 LEU A HD22 2  
ATOM   2459  H  HD23 . LEU A 1 79 ? -2.850  -0.131  -21.493 1.00 0.00 ? 79 LEU A HD23 2  
ATOM   2460  N  N    . VAL A 1 80 ? -7.261  0.759   -23.277 1.00 0.00 ? 80 VAL A N    2  
ATOM   2461  C  CA   . VAL A 1 80 ? -8.069  1.311   -24.358 1.00 0.00 ? 80 VAL A CA   2  
ATOM   2462  C  C    . VAL A 1 80 ? -9.561  1.222   -24.034 1.00 0.00 ? 80 VAL A C    2  
ATOM   2463  O  O    . VAL A 1 80 ? -10.064 0.154   -23.678 1.00 0.00 ? 80 VAL A O    2  
ATOM   2464  C  CB   . VAL A 1 80 ? -7.781  0.593   -25.697 1.00 0.00 ? 80 VAL A CB   2  
ATOM   2465  C  CG1  . VAL A 1 80 ? -8.129  -0.889  -25.613 1.00 0.00 ? 80 VAL A CG1  2  
ATOM   2466  C  CG2  . VAL A 1 80 ? -8.533  1.265   -26.838 1.00 0.00 ? 80 VAL A CG2  2  
ATOM   2467  H  H    . VAL A 1 80 ? -7.270  -0.209  -23.125 1.00 0.00 ? 80 VAL A H    2  
ATOM   2468  H  HA   . VAL A 1 80 ? -7.801  2.352   -24.470 1.00 0.00 ? 80 VAL A HA   2  
ATOM   2469  H  HB   . VAL A 1 80 ? -6.722  0.676   -25.900 1.00 0.00 ? 80 VAL A HB   2  
ATOM   2470  H  HG11 . VAL A 1 80 ? -7.620  -1.333  -24.771 1.00 0.00 ? 80 VAL A HG11 2  
ATOM   2471  H  HG12 . VAL A 1 80 ? -7.818  -1.384  -26.522 1.00 0.00 ? 80 VAL A HG12 2  
ATOM   2472  H  HG13 . VAL A 1 80 ? -9.195  -1.003  -25.489 1.00 0.00 ? 80 VAL A HG13 2  
ATOM   2473  H  HG21 . VAL A 1 80 ? -9.542  0.881   -26.880 1.00 0.00 ? 80 VAL A HG21 2  
ATOM   2474  H  HG22 . VAL A 1 80 ? -8.030  1.059   -27.771 1.00 0.00 ? 80 VAL A HG22 2  
ATOM   2475  H  HG23 . VAL A 1 80 ? -8.561  2.332   -26.672 1.00 0.00 ? 80 VAL A HG23 2  
ATOM   2476  N  N    . LYS A 1 81 ? -10.259 2.356   -24.157 1.00 0.00 ? 81 LYS A N    2  
ATOM   2477  C  CA   . LYS A 1 81 ? -11.696 2.427   -23.876 1.00 0.00 ? 81 LYS A CA   2  
ATOM   2478  C  C    . LYS A 1 81 ? -11.993 2.031   -22.429 1.00 0.00 ? 81 LYS A C    2  
ATOM   2479  O  O    . LYS A 1 81 ? -12.303 0.874   -22.141 1.00 0.00 ? 81 LYS A O    2  
ATOM   2480  C  CB   . LYS A 1 81 ? -12.483 1.529   -24.840 1.00 0.00 ? 81 LYS A CB   2  
ATOM   2481  C  CG   . LYS A 1 81 ? -12.345 1.929   -26.303 1.00 0.00 ? 81 LYS A CG   2  
ATOM   2482  C  CD   . LYS A 1 81 ? -13.465 2.864   -26.741 1.00 0.00 ? 81 LYS A CD   2  
ATOM   2483  C  CE   . LYS A 1 81 ? -13.775 2.716   -28.227 1.00 0.00 ? 81 LYS A CE   2  
ATOM   2484  N  NZ   . LYS A 1 81 ? -14.057 1.302   -28.606 1.00 0.00 ? 81 LYS A NZ   2  
ATOM   2485  H  H    . LYS A 1 81 ? -9.794  3.169   -24.441 1.00 0.00 ? 81 LYS A H    2  
ATOM   2486  H  HA   . LYS A 1 81 ? -12.007 3.451   -24.022 1.00 0.00 ? 81 LYS A HA   2  
ATOM   2487  H  HB2  . LYS A 1 81 ? -12.132 0.514   -24.734 1.00 0.00 ? 81 LYS A HB2  2  
ATOM   2488  H  HB3  . LYS A 1 81 ? -13.529 1.569   -24.575 1.00 0.00 ? 81 LYS A HB3  2  
ATOM   2489  H  HG2  . LYS A 1 81 ? -11.397 2.430   -26.440 1.00 0.00 ? 81 LYS A HG2  2  
ATOM   2490  H  HG3  . LYS A 1 81 ? -12.372 1.037   -26.911 1.00 0.00 ? 81 LYS A HG3  2  
ATOM   2491  H  HD2  . LYS A 1 81 ? -14.356 2.636   -26.175 1.00 0.00 ? 81 LYS A HD2  2  
ATOM   2492  H  HD3  . LYS A 1 81 ? -13.166 3.884   -26.546 1.00 0.00 ? 81 LYS A HD3  2  
ATOM   2493  H  HE2  . LYS A 1 81 ? -14.639 3.319   -28.461 1.00 0.00 ? 81 LYS A HE2  2  
ATOM   2494  H  HE3  . LYS A 1 81 ? -12.927 3.071   -28.794 1.00 0.00 ? 81 LYS A HE3  2  
ATOM   2495  H  HZ1  . LYS A 1 81 ? -14.472 0.789   -27.802 1.00 0.00 ? 81 LYS A HZ1  2  
ATOM   2496  H  HZ2  . LYS A 1 81 ? -13.176 0.825   -28.889 1.00 0.00 ? 81 LYS A HZ2  2  
ATOM   2497  H  HZ3  . LYS A 1 81 ? -14.724 1.272   -29.403 1.00 0.00 ? 81 LYS A HZ3  2  
ATOM   2498  N  N    . LEU A 1 82 ? -11.892 3.003   -21.523 1.00 0.00 ? 82 LEU A N    2  
ATOM   2499  C  CA   . LEU A 1 82 ? -12.145 2.761   -20.104 1.00 0.00 ? 82 LEU A CA   2  
ATOM   2500  C  C    . LEU A 1 82 ? -13.582 3.127   -19.732 1.00 0.00 ? 82 LEU A C    2  
ATOM   2501  O  O    . LEU A 1 82 ? -14.042 4.235   -20.012 1.00 0.00 ? 82 LEU A O    2  
ATOM   2502  C  CB   . LEU A 1 82 ? -11.165 3.566   -19.244 1.00 0.00 ? 82 LEU A CB   2  
ATOM   2503  C  CG   . LEU A 1 82 ? -9.826  2.878   -18.957 1.00 0.00 ? 82 LEU A CG   2  
ATOM   2504  C  CD1  . LEU A 1 82 ? -10.028 1.663   -18.061 1.00 0.00 ? 82 LEU A CD1  2  
ATOM   2505  C  CD2  . LEU A 1 82 ? -9.138  2.479   -20.258 1.00 0.00 ? 82 LEU A CD2  2  
ATOM   2506  H  H    . LEU A 1 82 ? -11.639 3.904   -21.814 1.00 0.00 ? 82 LEU A H    2  
ATOM   2507  H  HA   . LEU A 1 82 ? -11.995 1.709   -19.915 1.00 0.00 ? 82 LEU A HA   2  
ATOM   2508  H  HB2  . LEU A 1 82 ? -10.964 4.502   -19.746 1.00 0.00 ? 82 LEU A HB2  2  
ATOM   2509  H  HB3  . LEU A 1 82 ? -11.641 3.780   -18.300 1.00 0.00 ? 82 LEU A HB3  2  
ATOM   2510  H  HG   . LEU A 1 82 ? -9.179  3.571   -18.437 1.00 0.00 ? 82 LEU A HG   2  
ATOM   2511  H  HD11 . LEU A 1 82 ? -9.920  1.958   -17.028 1.00 0.00 ? 82 LEU A HD11 2  
ATOM   2512  H  HD12 . LEU A 1 82 ? -9.290  0.912   -18.300 1.00 0.00 ? 82 LEU A HD12 2  
ATOM   2513  H  HD13 . LEU A 1 82 ? -11.017 1.260   -18.219 1.00 0.00 ? 82 LEU A HD13 2  
ATOM   2514  H  HD21 . LEU A 1 82 ? -9.304  3.242   -21.002 1.00 0.00 ? 82 LEU A HD21 2  
ATOM   2515  H  HD22 . LEU A 1 82 ? -9.545  1.541   -20.607 1.00 0.00 ? 82 LEU A HD22 2  
ATOM   2516  H  HD23 . LEU A 1 82 ? -8.077  2.368   -20.086 1.00 0.00 ? 82 LEU A HD23 2  
ATOM   2517  N  N    . GLU A 1 83 ? -14.285 2.186   -19.099 1.00 0.00 ? 83 GLU A N    2  
ATOM   2518  C  CA   . GLU A 1 83 ? -15.670 2.402   -18.683 1.00 0.00 ? 83 GLU A CA   2  
ATOM   2519  C  C    . GLU A 1 83 ? -15.762 2.635   -17.174 1.00 0.00 ? 83 GLU A C    2  
ATOM   2520  O  O    . GLU A 1 83 ? -14.784 2.455   -16.446 1.00 0.00 ? 83 GLU A O    2  
ATOM   2521  C  CB   . GLU A 1 83 ? -16.539 1.202   -19.084 1.00 0.00 ? 83 GLU A CB   2  
ATOM   2522  C  CG   . GLU A 1 83 ? -16.135 -0.103  -18.411 1.00 0.00 ? 83 GLU A CG   2  
ATOM   2523  C  CD   . GLU A 1 83 ? -16.765 -1.324  -19.057 1.00 0.00 ? 83 GLU A CD   2  
ATOM   2524  O  OE1  . GLU A 1 83 ? -16.676 -1.456  -20.297 1.00 0.00 ? 83 GLU A OE1  2  
ATOM   2525  O  OE2  . GLU A 1 83 ? -17.344 -2.151  -18.321 1.00 0.00 ? 83 GLU A OE2  2  
ATOM   2526  H  H    . GLU A 1 83 ? -13.859 1.325   -18.905 1.00 0.00 ? 83 GLU A H    2  
ATOM   2527  H  HA   . GLU A 1 83 ? -16.033 3.283   -19.193 1.00 0.00 ? 83 GLU A HA   2  
ATOM   2528  H  HB2  . GLU A 1 83 ? -17.567 1.414   -18.822 1.00 0.00 ? 83 GLU A HB2  2  
ATOM   2529  H  HB3  . GLU A 1 83 ? -16.472 1.067   -20.154 1.00 0.00 ? 83 GLU A HB3  2  
ATOM   2530  H  HG2  . GLU A 1 83 ? -15.062 -0.203  -18.465 1.00 0.00 ? 83 GLU A HG2  2  
ATOM   2531  H  HG3  . GLU A 1 83 ? -16.438 -0.066  -17.374 1.00 0.00 ? 83 GLU A HG3  2  
ATOM   2532  N  N    . HIS A 1 84 ? -16.948 3.037   -16.710 1.00 0.00 ? 84 HIS A N    2  
ATOM   2533  C  CA   . HIS A 1 84 ? -17.177 3.294   -15.289 1.00 0.00 ? 84 HIS A CA   2  
ATOM   2534  C  C    . HIS A 1 84 ? -18.575 2.842   -14.869 1.00 0.00 ? 84 HIS A C    2  
ATOM   2535  O  O    . HIS A 1 84 ? -19.422 2.537   -15.710 1.00 0.00 ? 84 HIS A O    2  
ATOM   2536  C  CB   . HIS A 1 84 ? -16.991 4.783   -14.982 1.00 0.00 ? 84 HIS A CB   2  
ATOM   2537  C  CG   . HIS A 1 84 ? -16.586 5.057   -13.566 1.00 0.00 ? 84 HIS A CG   2  
ATOM   2538  N  ND1  . HIS A 1 84 ? -17.486 5.385   -12.574 1.00 0.00 ? 84 HIS A ND1  2  
ATOM   2539  C  CD2  . HIS A 1 84 ? -15.366 5.045   -12.976 1.00 0.00 ? 84 HIS A CD2  2  
ATOM   2540  C  CE1  . HIS A 1 84 ? -16.838 5.569   -11.437 1.00 0.00 ? 84 HIS A CE1  2  
ATOM   2541  N  NE2  . HIS A 1 84 ? -15.551 5.367   -11.655 1.00 0.00 ? 84 HIS A NE2  2  
ATOM   2542  H  H    . HIS A 1 84 ? -17.689 3.160   -17.341 1.00 0.00 ? 84 HIS A H    2  
ATOM   2543  H  HA   . HIS A 1 84 ? -16.447 2.727   -14.729 1.00 0.00 ? 84 HIS A HA   2  
ATOM   2544  H  HB2  . HIS A 1 84 ? -16.224 5.183   -15.628 1.00 0.00 ? 84 HIS A HB2  2  
ATOM   2545  H  HB3  . HIS A 1 84 ? -17.920 5.303   -15.169 1.00 0.00 ? 84 HIS A HB3  2  
ATOM   2546  H  HD1  . HIS A 1 84 ? -18.456 5.472   -12.686 1.00 0.00 ? 84 HIS A HD1  2  
ATOM   2547  H  HD2  . HIS A 1 84 ? -14.424 4.824   -13.457 1.00 0.00 ? 84 HIS A HD2  2  
ATOM   2548  H  HE1  . HIS A 1 84 ? -17.284 5.837   -10.491 1.00 0.00 ? 84 HIS A HE1  2  
ATOM   2549  H  HE2  . HIS A 1 84 ? -14.859 5.342   -10.961 1.00 0.00 ? 84 HIS A HE2  2  
HETATM 2550  ZN ZN   . ZN  B 2 .  ? 2.566   12.857  3.593   1.00 0.00 ? 85 ZN  A ZN   2  
ATOM   2551  N  N    . MET A 1 1  ? 13.172  9.942   15.240  1.00 0.00 ? 1  MET A N    3  
ATOM   2552  C  CA   . MET A 1 1  ? 14.270  10.438  14.363  1.00 0.00 ? 1  MET A CA   3  
ATOM   2553  C  C    . MET A 1 1  ? 14.850  9.310   13.513  1.00 0.00 ? 1  MET A C    3  
ATOM   2554  O  O    . MET A 1 1  ? 15.291  8.287   14.039  1.00 0.00 ? 1  MET A O    3  
ATOM   2555  C  CB   . MET A 1 1  ? 15.360  11.061  15.243  1.00 0.00 ? 1  MET A CB   3  
ATOM   2556  C  CG   . MET A 1 1  ? 15.082  12.509  15.616  1.00 0.00 ? 1  MET A CG   3  
ATOM   2557  S  SD   . MET A 1 1  ? 16.356  13.209  16.684  1.00 0.00 ? 1  MET A SD   3  
ATOM   2558  C  CE   . MET A 1 1  ? 17.398  14.019  15.475  1.00 0.00 ? 1  MET A CE   3  
ATOM   2559  H  H1   . MET A 1 1  ? 12.897  10.718  15.876  1.00 0.00 ? 1  MET A H1   3  
ATOM   2560  H  H2   . MET A 1 1  ? 13.537  9.129   15.778  1.00 0.00 ? 1  MET A H2   3  
ATOM   2561  H  H3   . MET A 1 1  ? 12.380  9.662   14.628  1.00 0.00 ? 1  MET A H3   3  
ATOM   2562  H  HA   . MET A 1 1  ? 13.867  11.196  13.709  1.00 0.00 ? 1  MET A HA   3  
ATOM   2563  H  HB2  . MET A 1 1  ? 15.445  10.485  16.153  1.00 0.00 ? 1  MET A HB2  3  
ATOM   2564  H  HB3  . MET A 1 1  ? 16.301  11.022  14.713  1.00 0.00 ? 1  MET A HB3  3  
ATOM   2565  H  HG2  . MET A 1 1  ? 15.032  13.096  14.711  1.00 0.00 ? 1  MET A HG2  3  
ATOM   2566  H  HG3  . MET A 1 1  ? 14.133  12.559  16.129  1.00 0.00 ? 1  MET A HG3  3  
ATOM   2567  H  HE1  . MET A 1 1  ? 17.196  15.080  15.479  1.00 0.00 ? 1  MET A HE1  3  
ATOM   2568  H  HE2  . MET A 1 1  ? 17.191  13.617  14.494  1.00 0.00 ? 1  MET A HE2  3  
ATOM   2569  H  HE3  . MET A 1 1  ? 18.436  13.849  15.721  1.00 0.00 ? 1  MET A HE3  3  
ATOM   2570  N  N    . ALA A 1 2  ? 14.839  9.507   12.191  1.00 0.00 ? 2  ALA A N    3  
ATOM   2571  C  CA   . ALA A 1 2  ? 15.357  8.514   11.250  1.00 0.00 ? 2  ALA A CA   3  
ATOM   2572  C  C    . ALA A 1 2  ? 14.691  7.148   11.453  1.00 0.00 ? 2  ALA A C    3  
ATOM   2573  O  O    . ALA A 1 2  ? 15.334  6.105   11.320  1.00 0.00 ? 2  ALA A O    3  
ATOM   2574  C  CB   . ALA A 1 2  ? 16.872  8.403   11.378  1.00 0.00 ? 2  ALA A CB   3  
ATOM   2575  H  H    . ALA A 1 2  ? 14.470  10.344  11.838  1.00 0.00 ? 2  ALA A H    3  
ATOM   2576  H  HA   . ALA A 1 2  ? 15.133  8.861   10.250  1.00 0.00 ? 2  ALA A HA   3  
ATOM   2577  H  HB1  . ALA A 1 2  ? 17.150  8.467   12.419  1.00 0.00 ? 2  ALA A HB1  3  
ATOM   2578  H  HB2  . ALA A 1 2  ? 17.339  9.208   10.830  1.00 0.00 ? 2  ALA A HB2  3  
ATOM   2579  H  HB3  . ALA A 1 2  ? 17.201  7.456   10.974  1.00 0.00 ? 2  ALA A HB3  3  
ATOM   2580  N  N    . VAL A 1 3  ? 13.395  7.165   11.769  1.00 0.00 ? 3  VAL A N    3  
ATOM   2581  C  CA   . VAL A 1 3  ? 12.638  5.933   11.984  1.00 0.00 ? 3  VAL A CA   3  
ATOM   2582  C  C    . VAL A 1 3  ? 11.314  5.971   11.222  1.00 0.00 ? 3  VAL A C    3  
ATOM   2583  O  O    . VAL A 1 3  ? 10.786  7.047   10.937  1.00 0.00 ? 3  VAL A O    3  
ATOM   2584  C  CB   . VAL A 1 3  ? 12.348  5.687   13.481  1.00 0.00 ? 3  VAL A CB   3  
ATOM   2585  C  CG1  . VAL A 1 3  ? 13.632  5.399   14.243  1.00 0.00 ? 3  VAL A CG1  3  
ATOM   2586  C  CG2  . VAL A 1 3  ? 11.613  6.872   14.092  1.00 0.00 ? 3  VAL A CG2  3  
ATOM   2587  H  H    . VAL A 1 3  ? 12.934  8.026   11.853  1.00 0.00 ? 3  VAL A H    3  
ATOM   2588  H  HA   . VAL A 1 3  ? 13.232  5.110   11.611  1.00 0.00 ? 3  VAL A HA   3  
ATOM   2589  H  HB   . VAL A 1 3  ? 11.710  4.818   13.562  1.00 0.00 ? 3  VAL A HB   3  
ATOM   2590  H  HG11 . VAL A 1 3  ? 14.384  5.036   13.558  1.00 0.00 ? 3  VAL A HG11 3  
ATOM   2591  H  HG12 . VAL A 1 3  ? 13.443  4.650   14.998  1.00 0.00 ? 3  VAL A HG12 3  
ATOM   2592  H  HG13 . VAL A 1 3  ? 13.983  6.305   14.716  1.00 0.00 ? 3  VAL A HG13 3  
ATOM   2593  H  HG21 . VAL A 1 3  ? 11.710  6.842   15.168  1.00 0.00 ? 3  VAL A HG21 3  
ATOM   2594  H  HG22 . VAL A 1 3  ? 10.568  6.823   13.824  1.00 0.00 ? 3  VAL A HG22 3  
ATOM   2595  H  HG23 . VAL A 1 3  ? 12.037  7.791   13.718  1.00 0.00 ? 3  VAL A HG23 3  
ATOM   2596  N  N    . PHE A 1 4  ? 10.783  4.793   10.897  1.00 0.00 ? 4  PHE A N    3  
ATOM   2597  C  CA   . PHE A 1 4  ? 9.518   4.692   10.168  1.00 0.00 ? 4  PHE A CA   3  
ATOM   2598  C  C    . PHE A 1 4  ? 8.371   5.303   10.975  1.00 0.00 ? 4  PHE A C    3  
ATOM   2599  O  O    . PHE A 1 4  ? 8.288   5.115   12.189  1.00 0.00 ? 4  PHE A O    3  
ATOM   2600  C  CB   . PHE A 1 4  ? 9.201   3.227   9.848   1.00 0.00 ? 4  PHE A CB   3  
ATOM   2601  C  CG   . PHE A 1 4  ? 9.742   2.753   8.525   1.00 0.00 ? 4  PHE A CG   3  
ATOM   2602  C  CD1  . PHE A 1 4  ? 11.080  2.920   8.198   1.00 0.00 ? 4  PHE A CD1  3  
ATOM   2603  C  CD2  . PHE A 1 4  ? 8.908   2.128   7.612   1.00 0.00 ? 4  PHE A CD2  3  
ATOM   2604  C  CE1  . PHE A 1 4  ? 11.572  2.472   6.986   1.00 0.00 ? 4  PHE A CE1  3  
ATOM   2605  C  CE2  . PHE A 1 4  ? 9.393   1.680   6.399   1.00 0.00 ? 4  PHE A CE2  3  
ATOM   2606  C  CZ   . PHE A 1 4  ? 10.727  1.852   6.085   1.00 0.00 ? 4  PHE A CZ   3  
ATOM   2607  H  H    . PHE A 1 4  ? 11.251  3.971   11.154  1.00 0.00 ? 4  PHE A H    3  
ATOM   2608  H  HA   . PHE A 1 4  ? 9.623   5.241   9.243   1.00 0.00 ? 4  PHE A HA   3  
ATOM   2609  H  HB2  . PHE A 1 4  ? 9.622   2.600   10.619  1.00 0.00 ? 4  PHE A HB2  3  
ATOM   2610  H  HB3  . PHE A 1 4  ? 8.129   3.096   9.833   1.00 0.00 ? 4  PHE A HB3  3  
ATOM   2611  H  HD1  . PHE A 1 4  ? 11.741  3.406   8.899   1.00 0.00 ? 4  PHE A HD1  3  
ATOM   2612  H  HD2  . PHE A 1 4  ? 7.865   1.993   7.856   1.00 0.00 ? 4  PHE A HD2  3  
ATOM   2613  H  HE1  . PHE A 1 4  ? 12.616  2.608   6.742   1.00 0.00 ? 4  PHE A HE1  3  
ATOM   2614  H  HE2  . PHE A 1 4  ? 8.730   1.194   5.699   1.00 0.00 ? 4  PHE A HE2  3  
ATOM   2615  H  HZ   . PHE A 1 4  ? 11.108  1.500   5.137   1.00 0.00 ? 4  PHE A HZ   3  
ATOM   2616  N  N    . HIS A 1 5  ? 7.490   6.035   10.292  1.00 0.00 ? 5  HIS A N    3  
ATOM   2617  C  CA   . HIS A 1 5  ? 6.346   6.676   10.945  1.00 0.00 ? 5  HIS A CA   3  
ATOM   2618  C  C    . HIS A 1 5  ? 5.467   5.642   11.647  1.00 0.00 ? 5  HIS A C    3  
ATOM   2619  O  O    . HIS A 1 5  ? 5.339   5.651   12.874  1.00 0.00 ? 5  HIS A O    3  
ATOM   2620  C  CB   . HIS A 1 5  ? 5.521   7.463   9.918   1.00 0.00 ? 5  HIS A CB   3  
ATOM   2621  C  CG   . HIS A 1 5  ? 4.423   8.280   10.523  1.00 0.00 ? 5  HIS A CG   3  
ATOM   2622  N  ND1  . HIS A 1 5  ? 4.616   9.128   11.594  1.00 0.00 ? 5  HIS A ND1  3  
ATOM   2623  C  CD2  . HIS A 1 5  ? 3.112   8.379   10.200  1.00 0.00 ? 5  HIS A CD2  3  
ATOM   2624  C  CE1  . HIS A 1 5  ? 3.474   9.712   11.902  1.00 0.00 ? 5  HIS A CE1  3  
ATOM   2625  N  NE2  . HIS A 1 5  ? 2.544   9.275   11.072  1.00 0.00 ? 5  HIS A NE2  3  
ATOM   2626  H  H    . HIS A 1 5  ? 7.613   6.149   9.325   1.00 0.00 ? 5  HIS A H    3  
ATOM   2627  H  HA   . HIS A 1 5  ? 6.730   7.364   11.685  1.00 0.00 ? 5  HIS A HA   3  
ATOM   2628  H  HB2  . HIS A 1 5  ? 6.174   8.135   9.382   1.00 0.00 ? 5  HIS A HB2  3  
ATOM   2629  H  HB3  . HIS A 1 5  ? 5.075   6.769   9.219   1.00 0.00 ? 5  HIS A HB3  3  
ATOM   2630  H  HD1  . HIS A 1 5  ? 5.467   9.280   12.057  1.00 0.00 ? 5  HIS A HD1  3  
ATOM   2631  H  HD2  . HIS A 1 5  ? 2.606   7.852   9.404   1.00 0.00 ? 5  HIS A HD2  3  
ATOM   2632  H  HE1  . HIS A 1 5  ? 3.324   10.425  12.700  1.00 0.00 ? 5  HIS A HE1  3  
ATOM   2633  H  HE2  . HIS A 1 5  ? 1.623   9.605   11.030  1.00 0.00 ? 5  HIS A HE2  3  
ATOM   2634  N  N    . ASP A 1 6  ? 4.865   4.750   10.861  1.00 0.00 ? 6  ASP A N    3  
ATOM   2635  C  CA   . ASP A 1 6  ? 4.003   3.705   11.404  1.00 0.00 ? 6  ASP A CA   3  
ATOM   2636  C  C    . ASP A 1 6  ? 3.802   2.581   10.387  1.00 0.00 ? 6  ASP A C    3  
ATOM   2637  O  O    . ASP A 1 6  ? 4.010   2.772   9.186   1.00 0.00 ? 6  ASP A O    3  
ATOM   2638  C  CB   . ASP A 1 6  ? 2.648   4.288   11.815  1.00 0.00 ? 6  ASP A CB   3  
ATOM   2639  C  CG   . ASP A 1 6  ? 2.598   4.663   13.285  1.00 0.00 ? 6  ASP A CG   3  
ATOM   2640  O  OD1  . ASP A 1 6  ? 2.768   3.764   14.136  1.00 0.00 ? 6  ASP A OD1  3  
ATOM   2641  O  OD2  . ASP A 1 6  ? 2.391   5.858   13.584  1.00 0.00 ? 6  ASP A OD2  3  
ATOM   2642  H  H    . ASP A 1 6  ? 5.008   4.795   9.892   1.00 0.00 ? 6  ASP A H    3  
ATOM   2643  H  HA   . ASP A 1 6  ? 4.492   3.299   12.279  1.00 0.00 ? 6  ASP A HA   3  
ATOM   2644  H  HB2  . ASP A 1 6  ? 2.452   5.176   11.232  1.00 0.00 ? 6  ASP A HB2  3  
ATOM   2645  H  HB3  . ASP A 1 6  ? 1.875   3.559   11.622  1.00 0.00 ? 6  ASP A HB3  3  
ATOM   2646  N  N    . GLU A 1 7  ? 3.391   1.412   10.876  1.00 0.00 ? 7  GLU A N    3  
ATOM   2647  C  CA   . GLU A 1 7  ? 3.152   0.256   10.014  1.00 0.00 ? 7  GLU A CA   3  
ATOM   2648  C  C    . GLU A 1 7  ? 1.655   0.034   9.825   1.00 0.00 ? 7  GLU A C    3  
ATOM   2649  O  O    . GLU A 1 7  ? 0.890   0.073   10.790  1.00 0.00 ? 7  GLU A O    3  
ATOM   2650  C  CB   . GLU A 1 7  ? 3.784   -1.007  10.608  1.00 0.00 ? 7  GLU A CB   3  
ATOM   2651  C  CG   . GLU A 1 7  ? 5.252   -0.853  10.967  1.00 0.00 ? 7  GLU A CG   3  
ATOM   2652  C  CD   . GLU A 1 7  ? 5.610   -1.554  12.264  1.00 0.00 ? 7  GLU A CD   3  
ATOM   2653  O  OE1  . GLU A 1 7  ? 5.543   -2.800  12.303  1.00 0.00 ? 7  GLU A OE1  3  
ATOM   2654  O  OE2  . GLU A 1 7  ? 5.956   -0.854  13.239  1.00 0.00 ? 7  GLU A OE2  3  
ATOM   2655  H  H    . GLU A 1 7  ? 3.241   1.324   11.841  1.00 0.00 ? 7  GLU A H    3  
ATOM   2656  H  HA   . GLU A 1 7  ? 3.602   0.457   9.052   1.00 0.00 ? 7  GLU A HA   3  
ATOM   2657  H  HB2  . GLU A 1 7  ? 3.244   -1.277  11.503  1.00 0.00 ? 7  GLU A HB2  3  
ATOM   2658  H  HB3  . GLU A 1 7  ? 3.693   -1.810  9.890   1.00 0.00 ? 7  GLU A HB3  3  
ATOM   2659  H  HG2  . GLU A 1 7  ? 5.849   -1.275  10.173  1.00 0.00 ? 7  GLU A HG2  3  
ATOM   2660  H  HG3  . GLU A 1 7  ? 5.478   0.198   11.067  1.00 0.00 ? 7  GLU A HG3  3  
ATOM   2661  N  N    . VAL A 1 8  ? 1.241   -0.197  8.580   1.00 0.00 ? 8  VAL A N    3  
ATOM   2662  C  CA   . VAL A 1 8  ? -0.169  -0.423  8.275   1.00 0.00 ? 8  VAL A CA   3  
ATOM   2663  C  C    . VAL A 1 8  ? -0.343  -1.545  7.256   1.00 0.00 ? 8  VAL A C    3  
ATOM   2664  O  O    . VAL A 1 8  ? 0.439   -1.667  6.311   1.00 0.00 ? 8  VAL A O    3  
ATOM   2665  C  CB   . VAL A 1 8  ? -0.849  0.854   7.735   1.00 0.00 ? 8  VAL A CB   3  
ATOM   2666  C  CG1  . VAL A 1 8  ? -2.355  0.657   7.637   1.00 0.00 ? 8  VAL A CG1  3  
ATOM   2667  C  CG2  . VAL A 1 8  ? -0.520  2.054   8.612   1.00 0.00 ? 8  VAL A CG2  3  
ATOM   2668  H  H    . VAL A 1 8  ? 1.897   -0.215  7.851   1.00 0.00 ? 8  VAL A H    3  
ATOM   2669  H  HA   . VAL A 1 8  ? -0.665  -0.707  9.192   1.00 0.00 ? 8  VAL A HA   3  
ATOM   2670  H  HB   . VAL A 1 8  ? -0.468  1.046   6.742   1.00 0.00 ? 8  VAL A HB   3  
ATOM   2671  H  HG11 . VAL A 1 8  ? -2.764  1.367   6.933   1.00 0.00 ? 8  VAL A HG11 3  
ATOM   2672  H  HG12 . VAL A 1 8  ? -2.802  0.813   8.607   1.00 0.00 ? 8  VAL A HG12 3  
ATOM   2673  H  HG13 . VAL A 1 8  ? -2.567  -0.346  7.300   1.00 0.00 ? 8  VAL A HG13 3  
ATOM   2674  H  HG21 . VAL A 1 8  ? -0.949  1.911   9.593   1.00 0.00 ? 8  VAL A HG21 3  
ATOM   2675  H  HG22 . VAL A 1 8  ? -0.930  2.947   8.166   1.00 0.00 ? 8  VAL A HG22 3  
ATOM   2676  H  HG23 . VAL A 1 8  ? 0.551   2.155   8.700   1.00 0.00 ? 8  VAL A HG23 3  
ATOM   2677  N  N    . GLU A 1 9  ? -1.380  -2.358  7.455   1.00 0.00 ? 9  GLU A N    3  
ATOM   2678  C  CA   . GLU A 1 9  ? -1.675  -3.473  6.556   1.00 0.00 ? 9  GLU A CA   3  
ATOM   2679  C  C    . GLU A 1 9  ? -2.094  -2.967  5.179   1.00 0.00 ? 9  GLU A C    3  
ATOM   2680  O  O    . GLU A 1 9  ? -2.829  -1.984  5.062   1.00 0.00 ? 9  GLU A O    3  
ATOM   2681  C  CB   . GLU A 1 9  ? -2.780  -4.359  7.138   1.00 0.00 ? 9  GLU A CB   3  
ATOM   2682  C  CG   . GLU A 1 9  ? -2.326  -5.223  8.306   1.00 0.00 ? 9  GLU A CG   3  
ATOM   2683  C  CD   . GLU A 1 9  ? -3.471  -5.981  8.957   1.00 0.00 ? 9  GLU A CD   3  
ATOM   2684  O  OE1  . GLU A 1 9  ? -4.468  -5.335  9.345   1.00 0.00 ? 9  GLU A OE1  3  
ATOM   2685  O  OE2  . GLU A 1 9  ? -3.369  -7.219  9.080   1.00 0.00 ? 9  GLU A OE2  3  
ATOM   2686  H  H    . GLU A 1 9  ? -1.967  -2.202  8.224   1.00 0.00 ? 9  GLU A H    3  
ATOM   2687  H  HA   . GLU A 1 9  ? -0.774  -4.058  6.452   1.00 0.00 ? 9  GLU A HA   3  
ATOM   2688  H  HB2  . GLU A 1 9  ? -3.589  -3.727  7.479   1.00 0.00 ? 9  GLU A HB2  3  
ATOM   2689  H  HB3  . GLU A 1 9  ? -3.150  -5.009  6.359   1.00 0.00 ? 9  GLU A HB3  3  
ATOM   2690  H  HG2  . GLU A 1 9  ? -1.602  -5.939  7.947   1.00 0.00 ? 9  GLU A HG2  3  
ATOM   2691  H  HG3  . GLU A 1 9  ? -1.866  -4.590  9.049   1.00 0.00 ? 9  GLU A HG3  3  
ATOM   2692  N  N    . ILE A 1 10 ? -1.619  -3.649  4.142   1.00 0.00 ? 10 ILE A N    3  
ATOM   2693  C  CA   . ILE A 1 10 ? -1.932  -3.288  2.764   1.00 0.00 ? 10 ILE A CA   3  
ATOM   2694  C  C    . ILE A 1 10 ? -3.445  -3.227  2.521   1.00 0.00 ? 10 ILE A C    3  
ATOM   2695  O  O    . ILE A 1 10 ? -3.912  -2.453  1.684   1.00 0.00 ? 10 ILE A O    3  
ATOM   2696  C  CB   . ILE A 1 10 ? -1.285  -4.277  1.769   1.00 0.00 ? 10 ILE A CB   3  
ATOM   2697  C  CG1  . ILE A 1 10 ? -1.425  -3.766  0.335   1.00 0.00 ? 10 ILE A CG1  3  
ATOM   2698  C  CG2  . ILE A 1 10 ? -1.897  -5.666  1.906   1.00 0.00 ? 10 ILE A CG2  3  
ATOM   2699  C  CD1  . ILE A 1 10 ? -0.184  -3.076  -0.184  1.00 0.00 ? 10 ILE A CD1  3  
ATOM   2700  H  H    . ILE A 1 10 ? -1.038  -4.423  4.310   1.00 0.00 ? 10 ILE A H    3  
ATOM   2701  H  HA   . ILE A 1 10 ? -1.515  -2.309  2.579   1.00 0.00 ? 10 ILE A HA   3  
ATOM   2702  H  HB   . ILE A 1 10 ? -0.235  -4.352  2.013   1.00 0.00 ? 10 ILE A HB   3  
ATOM   2703  H  HG12 . ILE A 1 10 ? -1.637  -4.598  -0.318  1.00 0.00 ? 10 ILE A HG12 3  
ATOM   2704  H  HG13 . ILE A 1 10 ? -2.240  -3.060  0.288   1.00 0.00 ? 10 ILE A HG13 3  
ATOM   2705  H  HG21 . ILE A 1 10 ? -2.848  -5.694  1.396   1.00 0.00 ? 10 ILE A HG21 3  
ATOM   2706  H  HG22 . ILE A 1 10 ? -2.042  -5.896  2.952   1.00 0.00 ? 10 ILE A HG22 3  
ATOM   2707  H  HG23 . ILE A 1 10 ? -1.232  -6.396  1.466   1.00 0.00 ? 10 ILE A HG23 3  
ATOM   2708  H  HD11 . ILE A 1 10 ? -0.038  -3.334  -1.220  1.00 0.00 ? 10 ILE A HD11 3  
ATOM   2709  H  HD12 . ILE A 1 10 ? 0.673   -3.394  0.392   1.00 0.00 ? 10 ILE A HD12 3  
ATOM   2710  H  HD13 . ILE A 1 10 ? -0.302  -2.005  -0.092  1.00 0.00 ? 10 ILE A HD13 3  
ATOM   2711  N  N    . GLU A 1 11 ? -4.206  -4.040  3.260   1.00 0.00 ? 11 GLU A N    3  
ATOM   2712  C  CA   . GLU A 1 11 ? -5.663  -4.060  3.125   1.00 0.00 ? 11 GLU A CA   3  
ATOM   2713  C  C    . GLU A 1 11 ? -6.254  -2.677  3.411   1.00 0.00 ? 11 GLU A C    3  
ATOM   2714  O  O    . GLU A 1 11 ? -7.253  -2.286  2.808   1.00 0.00 ? 11 GLU A O    3  
ATOM   2715  C  CB   . GLU A 1 11 ? -6.270  -5.099  4.070   1.00 0.00 ? 11 GLU A CB   3  
ATOM   2716  C  CG   . GLU A 1 11 ? -5.955  -6.535  3.676   1.00 0.00 ? 11 GLU A CG   3  
ATOM   2717  C  CD   . GLU A 1 11 ? -7.074  -7.499  4.023   1.00 0.00 ? 11 GLU A CD   3  
ATOM   2718  O  OE1  . GLU A 1 11 ? -7.170  -7.900  5.202   1.00 0.00 ? 11 GLU A OE1  3  
ATOM   2719  O  OE2  . GLU A 1 11 ? -7.853  -7.856  3.113   1.00 0.00 ? 11 GLU A OE2  3  
ATOM   2720  H  H    . GLU A 1 11 ? -3.779  -4.632  3.915   1.00 0.00 ? 11 GLU A H    3  
ATOM   2721  H  HA   . GLU A 1 11 ? -5.896  -4.333  2.107   1.00 0.00 ? 11 GLU A HA   3  
ATOM   2722  H  HB2  . GLU A 1 11 ? -5.889  -4.931  5.066   1.00 0.00 ? 11 GLU A HB2  3  
ATOM   2723  H  HB3  . GLU A 1 11 ? -7.342  -4.978  4.079   1.00 0.00 ? 11 GLU A HB3  3  
ATOM   2724  H  HG2  . GLU A 1 11 ? -5.786  -6.575  2.611   1.00 0.00 ? 11 GLU A HG2  3  
ATOM   2725  H  HG3  . GLU A 1 11 ? -5.059  -6.847  4.194   1.00 0.00 ? 11 GLU A HG3  3  
ATOM   2726  N  N    . ASP A 1 12 ? -5.623  -1.941  4.326   1.00 0.00 ? 12 ASP A N    3  
ATOM   2727  C  CA   . ASP A 1 12 ? -6.076  -0.598  4.684   1.00 0.00 ? 12 ASP A CA   3  
ATOM   2728  C  C    . ASP A 1 12 ? -5.793  0.396   3.554   1.00 0.00 ? 12 ASP A C    3  
ATOM   2729  O  O    . ASP A 1 12 ? -6.526  1.371   3.376   1.00 0.00 ? 12 ASP A O    3  
ATOM   2730  C  CB   . ASP A 1 12 ? -5.391  -0.133  5.973   1.00 0.00 ? 12 ASP A CB   3  
ATOM   2731  C  CG   . ASP A 1 12 ? -6.326  0.647   6.877   1.00 0.00 ? 12 ASP A CG   3  
ATOM   2732  O  OD1  . ASP A 1 12 ? -6.862  1.682   6.430   1.00 0.00 ? 12 ASP A OD1  3  
ATOM   2733  O  OD2  . ASP A 1 12 ? -6.522  0.220   8.035   1.00 0.00 ? 12 ASP A OD2  3  
ATOM   2734  H  H    . ASP A 1 12 ? -4.827  -2.308  4.769   1.00 0.00 ? 12 ASP A H    3  
ATOM   2735  H  HA   . ASP A 1 12 ? -7.142  -0.642  4.850   1.00 0.00 ? 12 ASP A HA   3  
ATOM   2736  H  HB2  . ASP A 1 12 ? -5.033  -0.996  6.515   1.00 0.00 ? 12 ASP A HB2  3  
ATOM   2737  H  HB3  . ASP A 1 12 ? -4.554  0.501   5.720   1.00 0.00 ? 12 ASP A HB3  3  
ATOM   2738  N  N    . PHE A 1 13 ? -4.723  0.144   2.794   1.00 0.00 ? 13 PHE A N    3  
ATOM   2739  C  CA   . PHE A 1 13 ? -4.338  1.012   1.680   1.00 0.00 ? 13 PHE A CA   3  
ATOM   2740  C  C    . PHE A 1 13 ? -5.395  0.994   0.573   1.00 0.00 ? 13 PHE A C    3  
ATOM   2741  O  O    . PHE A 1 13 ? -6.332  0.193   0.606   1.00 0.00 ? 13 PHE A O    3  
ATOM   2742  C  CB   . PHE A 1 13 ? -2.989  0.566   1.102   1.00 0.00 ? 13 PHE A CB   3  
ATOM   2743  C  CG   . PHE A 1 13 ? -1.791  1.030   1.887   1.00 0.00 ? 13 PHE A CG   3  
ATOM   2744  C  CD1  . PHE A 1 13 ? -1.560  0.566   3.174   1.00 0.00 ? 13 PHE A CD1  3  
ATOM   2745  C  CD2  . PHE A 1 13 ? -0.888  1.922   1.330   1.00 0.00 ? 13 PHE A CD2  3  
ATOM   2746  C  CE1  . PHE A 1 13 ? -0.453  0.986   3.889   1.00 0.00 ? 13 PHE A CE1  3  
ATOM   2747  C  CE2  . PHE A 1 13 ? 0.219   2.346   2.040   1.00 0.00 ? 13 PHE A CE2  3  
ATOM   2748  C  CZ   . PHE A 1 13 ? 0.436   1.877   3.321   1.00 0.00 ? 13 PHE A CZ   3  
ATOM   2749  H  H    . PHE A 1 13 ? -4.180  -0.647  2.988   1.00 0.00 ? 13 PHE A H    3  
ATOM   2750  H  HA   . PHE A 1 13 ? -4.245  2.019   2.059   1.00 0.00 ? 13 PHE A HA   3  
ATOM   2751  H  HB2  . PHE A 1 13 ? -2.962  -0.512  1.066   1.00 0.00 ? 13 PHE A HB2  3  
ATOM   2752  H  HB3  . PHE A 1 13 ? -2.897  0.953   0.097   1.00 0.00 ? 13 PHE A HB3  3  
ATOM   2753  H  HD1  . PHE A 1 13 ? -2.255  -0.130  3.620   1.00 0.00 ? 13 PHE A HD1  3  
ATOM   2754  H  HD2  . PHE A 1 13 ? -1.055  2.291   0.329   1.00 0.00 ? 13 PHE A HD2  3  
ATOM   2755  H  HE1  . PHE A 1 13 ? -0.285  0.617   4.890   1.00 0.00 ? 13 PHE A HE1  3  
ATOM   2756  H  HE2  . PHE A 1 13 ? 0.913   3.042   1.595   1.00 0.00 ? 13 PHE A HE2  3  
ATOM   2757  H  HZ   . PHE A 1 13 ? 1.302   2.206   3.878   1.00 0.00 ? 13 PHE A HZ   3  
ATOM   2758  N  N    . GLN A 1 14 ? -5.230  1.880   -0.411  1.00 0.00 ? 14 GLN A N    3  
ATOM   2759  C  CA   . GLN A 1 14 ? -6.160  1.966   -1.535  1.00 0.00 ? 14 GLN A CA   3  
ATOM   2760  C  C    . GLN A 1 14 ? -5.555  1.340   -2.790  1.00 0.00 ? 14 GLN A C    3  
ATOM   2761  O  O    . GLN A 1 14 ? -4.686  1.932   -3.432  1.00 0.00 ? 14 GLN A O    3  
ATOM   2762  C  CB   . GLN A 1 14 ? -6.535  3.428   -1.807  1.00 0.00 ? 14 GLN A CB   3  
ATOM   2763  C  CG   . GLN A 1 14 ? -7.996  3.626   -2.187  1.00 0.00 ? 14 GLN A CG   3  
ATOM   2764  C  CD   . GLN A 1 14 ? -8.859  4.029   -1.005  1.00 0.00 ? 14 GLN A CD   3  
ATOM   2765  O  OE1  . GLN A 1 14 ? -9.504  5.076   -1.022  1.00 0.00 ? 14 GLN A OE1  3  
ATOM   2766  N  NE2  . GLN A 1 14 ? -8.874  3.196   0.032   1.00 0.00 ? 14 GLN A NE2  3  
ATOM   2767  H  H    . GLN A 1 14 ? -4.461  2.486   -0.382  1.00 0.00 ? 14 GLN A H    3  
ATOM   2768  H  HA   . GLN A 1 14 ? -7.052  1.417   -1.269  1.00 0.00 ? 14 GLN A HA   3  
ATOM   2769  H  HB2  . GLN A 1 14 ? -6.335  4.009   -0.918  1.00 0.00 ? 14 GLN A HB2  3  
ATOM   2770  H  HB3  . GLN A 1 14 ? -5.922  3.799   -2.614  1.00 0.00 ? 14 GLN A HB3  3  
ATOM   2771  H  HG2  . GLN A 1 14 ? -8.056  4.402   -2.936  1.00 0.00 ? 14 GLN A HG2  3  
ATOM   2772  H  HG3  . GLN A 1 14 ? -8.379  2.702   -2.596  1.00 0.00 ? 14 GLN A HG3  3  
ATOM   2773  H  HE21 . GLN A 1 14 ? -8.334  2.380   -0.021  1.00 0.00 ? 14 GLN A HE21 3  
ATOM   2774  H  HE22 . GLN A 1 14 ? -9.422  3.434   0.808   1.00 0.00 ? 14 GLN A HE22 3  
ATOM   2775  N  N    . TYR A 1 15 ? -6.020  0.139   -3.132  1.00 0.00 ? 15 TYR A N    3  
ATOM   2776  C  CA   . TYR A 1 15 ? -5.530  -0.570  -4.313  1.00 0.00 ? 15 TYR A CA   3  
ATOM   2777  C  C    . TYR A 1 15 ? -5.927  0.169   -5.591  1.00 0.00 ? 15 TYR A C    3  
ATOM   2778  O  O    . TYR A 1 15 ? -6.957  0.842   -5.635  1.00 0.00 ? 15 TYR A O    3  
ATOM   2779  C  CB   . TYR A 1 15 ? -6.079  -2.000  -4.338  1.00 0.00 ? 15 TYR A CB   3  
ATOM   2780  C  CG   . TYR A 1 15 ? -5.692  -2.784  -5.573  1.00 0.00 ? 15 TYR A CG   3  
ATOM   2781  C  CD1  . TYR A 1 15 ? -4.483  -3.462  -5.637  1.00 0.00 ? 15 TYR A CD1  3  
ATOM   2782  C  CD2  . TYR A 1 15 ? -6.536  -2.843  -6.675  1.00 0.00 ? 15 TYR A CD2  3  
ATOM   2783  C  CE1  . TYR A 1 15 ? -4.123  -4.176  -6.762  1.00 0.00 ? 15 TYR A CE1  3  
ATOM   2784  C  CE2  . TYR A 1 15 ? -6.185  -3.556  -7.806  1.00 0.00 ? 15 TYR A CE2  3  
ATOM   2785  C  CZ   . TYR A 1 15 ? -4.977  -4.220  -7.844  1.00 0.00 ? 15 TYR A CZ   3  
ATOM   2786  O  OH   . TYR A 1 15 ? -4.622  -4.933  -8.968  1.00 0.00 ? 15 TYR A OH   3  
ATOM   2787  H  H    . TYR A 1 15 ? -6.713  -0.279  -2.578  1.00 0.00 ? 15 TYR A H    3  
ATOM   2788  H  HA   . TYR A 1 15 ? -4.453  -0.606  -4.252  1.00 0.00 ? 15 TYR A HA   3  
ATOM   2789  H  HB2  . TYR A 1 15 ? -5.707  -2.536  -3.478  1.00 0.00 ? 15 TYR A HB2  3  
ATOM   2790  H  HB3  . TYR A 1 15 ? -7.158  -1.964  -4.292  1.00 0.00 ? 15 TYR A HB3  3  
ATOM   2791  H  HD1  . TYR A 1 15 ? -3.816  -3.426  -4.790  1.00 0.00 ? 15 TYR A HD1  3  
ATOM   2792  H  HD2  . TYR A 1 15 ? -7.480  -2.320  -6.642  1.00 0.00 ? 15 TYR A HD2  3  
ATOM   2793  H  HE1  . TYR A 1 15 ? -3.176  -4.696  -6.791  1.00 0.00 ? 15 TYR A HE1  3  
ATOM   2794  H  HE2  . TYR A 1 15 ? -6.855  -3.586  -8.653  1.00 0.00 ? 15 TYR A HE2  3  
ATOM   2795  H  HH   . TYR A 1 15 ? -4.318  -5.807  -8.712  1.00 0.00 ? 15 TYR A HH   3  
ATOM   2796  N  N    . ASP A 1 16 ? -5.100  0.038   -6.629  1.00 0.00 ? 16 ASP A N    3  
ATOM   2797  C  CA   . ASP A 1 16 ? -5.366  0.694   -7.908  1.00 0.00 ? 16 ASP A CA   3  
ATOM   2798  C  C    . ASP A 1 16 ? -5.366  -0.310  -9.058  1.00 0.00 ? 16 ASP A C    3  
ATOM   2799  O  O    . ASP A 1 16 ? -4.597  -1.271  -9.056  1.00 0.00 ? 16 ASP A O    3  
ATOM   2800  C  CB   . ASP A 1 16 ? -4.328  1.789   -8.171  1.00 0.00 ? 16 ASP A CB   3  
ATOM   2801  C  CG   . ASP A 1 16 ? -4.906  2.976   -8.919  1.00 0.00 ? 16 ASP A CG   3  
ATOM   2802  O  OD1  . ASP A 1 16 ? -6.033  3.402   -8.586  1.00 0.00 ? 16 ASP A OD1  3  
ATOM   2803  O  OD2  . ASP A 1 16 ? -4.227  3.482   -9.837  1.00 0.00 ? 16 ASP A OD2  3  
ATOM   2804  H  H    . ASP A 1 16 ? -4.293  -0.513  -6.534  1.00 0.00 ? 16 ASP A H    3  
ATOM   2805  H  HA   . ASP A 1 16 ? -6.343  1.148   -7.847  1.00 0.00 ? 16 ASP A HA   3  
ATOM   2806  H  HB2  . ASP A 1 16 ? -3.937  2.140   -7.228  1.00 0.00 ? 16 ASP A HB2  3  
ATOM   2807  H  HB3  . ASP A 1 16 ? -3.520  1.377   -8.758  1.00 0.00 ? 16 ASP A HB3  3  
ATOM   2808  N  N    . GLU A 1 17 ? -6.236  -0.072  -10.040 1.00 0.00 ? 17 GLU A N    3  
ATOM   2809  C  CA   . GLU A 1 17 ? -6.344  -0.947  -11.210 1.00 0.00 ? 17 GLU A CA   3  
ATOM   2810  C  C    . GLU A 1 17 ? -5.519  -0.412  -12.381 1.00 0.00 ? 17 GLU A C    3  
ATOM   2811  O  O    . GLU A 1 17 ? -5.050  -1.185  -13.218 1.00 0.00 ? 17 GLU A O    3  
ATOM   2812  C  CB   . GLU A 1 17 ? -7.808  -1.116  -11.643 1.00 0.00 ? 17 GLU A CB   3  
ATOM   2813  C  CG   . GLU A 1 17 ? -8.637  0.159   -11.561 1.00 0.00 ? 17 GLU A CG   3  
ATOM   2814  C  CD   . GLU A 1 17 ? -9.719  0.226   -12.625 1.00 0.00 ? 17 GLU A CD   3  
ATOM   2815  O  OE1  . GLU A 1 17 ? -9.382  0.139   -13.825 1.00 0.00 ? 17 GLU A OE1  3  
ATOM   2816  O  OE2  . GLU A 1 17 ? -10.903 0.368   -12.255 1.00 0.00 ? 17 GLU A OE2  3  
ATOM   2817  H  H    . GLU A 1 17 ? -6.816  0.716   -9.979  1.00 0.00 ? 17 GLU A H    3  
ATOM   2818  H  HA   . GLU A 1 17 ? -5.951  -1.914  -10.931 1.00 0.00 ? 17 GLU A HA   3  
ATOM   2819  H  HB2  . GLU A 1 17 ? -7.827  -1.462  -12.667 1.00 0.00 ? 17 GLU A HB2  3  
ATOM   2820  H  HB3  . GLU A 1 17 ? -8.272  -1.861  -11.015 1.00 0.00 ? 17 GLU A HB3  3  
ATOM   2821  H  HG2  . GLU A 1 17 ? -9.106  0.204   -10.589 1.00 0.00 ? 17 GLU A HG2  3  
ATOM   2822  H  HG3  . GLU A 1 17 ? -7.980  1.008   -11.680 1.00 0.00 ? 17 GLU A HG3  3  
ATOM   2823  N  N    . ASP A 1 18 ? -5.351  0.914   -12.441 1.00 0.00 ? 18 ASP A N    3  
ATOM   2824  C  CA   . ASP A 1 18 ? -4.588  1.548   -13.516 1.00 0.00 ? 18 ASP A CA   3  
ATOM   2825  C  C    . ASP A 1 18 ? -3.234  0.867   -13.712 1.00 0.00 ? 18 ASP A C    3  
ATOM   2826  O  O    . ASP A 1 18 ? -2.895  0.460   -14.824 1.00 0.00 ? 18 ASP A O    3  
ATOM   2827  C  CB   . ASP A 1 18 ? -4.387  3.040   -13.223 1.00 0.00 ? 18 ASP A CB   3  
ATOM   2828  C  CG   . ASP A 1 18 ? -4.429  3.889   -14.480 1.00 0.00 ? 18 ASP A CG   3  
ATOM   2829  O  OD1  . ASP A 1 18 ? -5.366  3.711   -15.289 1.00 0.00 ? 18 ASP A OD1  3  
ATOM   2830  O  OD2  . ASP A 1 18 ? -3.527  4.735   -14.656 1.00 0.00 ? 18 ASP A OD2  3  
ATOM   2831  H  H    . ASP A 1 18 ? -5.755  1.478   -11.749 1.00 0.00 ? 18 ASP A H    3  
ATOM   2832  H  HA   . ASP A 1 18 ? -5.159  1.447   -14.426 1.00 0.00 ? 18 ASP A HA   3  
ATOM   2833  H  HB2  . ASP A 1 18 ? -5.167  3.379   -12.557 1.00 0.00 ? 18 ASP A HB2  3  
ATOM   2834  H  HB3  . ASP A 1 18 ? -3.427  3.182   -12.746 1.00 0.00 ? 18 ASP A HB3  3  
ATOM   2835  N  N    . SER A 1 19 ? -2.466  0.742   -12.629 1.00 0.00 ? 19 SER A N    3  
ATOM   2836  C  CA   . SER A 1 19 ? -1.152  0.102   -12.694 1.00 0.00 ? 19 SER A CA   3  
ATOM   2837  C  C    . SER A 1 19 ? -0.802  -0.606  -11.379 1.00 0.00 ? 19 SER A C    3  
ATOM   2838  O  O    . SER A 1 19 ? 0.376   -0.749  -11.043 1.00 0.00 ? 19 SER A O    3  
ATOM   2839  C  CB   . SER A 1 19 ? -0.073  1.137   -13.038 1.00 0.00 ? 19 SER A CB   3  
ATOM   2840  O  OG   . SER A 1 19 ? -0.445  1.920   -14.161 1.00 0.00 ? 19 SER A OG   3  
ATOM   2841  H  H    . SER A 1 19 ? -2.790  1.084   -11.769 1.00 0.00 ? 19 SER A H    3  
ATOM   2842  H  HA   . SER A 1 19 ? -1.187  -0.637  -13.483 1.00 0.00 ? 19 SER A HA   3  
ATOM   2843  H  HB2  . SER A 1 19 ? 0.076   1.791   -12.193 1.00 0.00 ? 19 SER A HB2  3  
ATOM   2844  H  HB3  . SER A 1 19 ? 0.852   0.626   -13.262 1.00 0.00 ? 19 SER A HB3  3  
ATOM   2845  H  HG   . SER A 1 19 ? -0.754  2.780   -13.864 1.00 0.00 ? 19 SER A HG   3  
ATOM   2846  N  N    . GLU A 1 20 ? -1.826  -1.057  -10.643 1.00 0.00 ? 20 GLU A N    3  
ATOM   2847  C  CA   . GLU A 1 20 ? -1.621  -1.756  -9.369  1.00 0.00 ? 20 GLU A CA   3  
ATOM   2848  C  C    . GLU A 1 20 ? -0.751  -0.934  -8.417  1.00 0.00 ? 20 GLU A C    3  
ATOM   2849  O  O    . GLU A 1 20 ? 0.459   -1.154  -8.315  1.00 0.00 ? 20 GLU A O    3  
ATOM   2850  C  CB   . GLU A 1 20 ? -0.978  -3.125  -9.602  1.00 0.00 ? 20 GLU A CB   3  
ATOM   2851  C  CG   . GLU A 1 20 ? -1.704  -3.983  -10.628 1.00 0.00 ? 20 GLU A CG   3  
ATOM   2852  C  CD   . GLU A 1 20 ? -0.753  -4.726  -11.546 1.00 0.00 ? 20 GLU A CD   3  
ATOM   2853  O  OE1  . GLU A 1 20 ? 0.165   -5.400  -11.030 1.00 0.00 ? 20 GLU A OE1  3  
ATOM   2854  O  OE2  . GLU A 1 20 ? -0.926  -4.636  -12.779 1.00 0.00 ? 20 GLU A OE2  3  
ATOM   2855  H  H    . GLU A 1 20 ? -2.741  -0.923  -10.965 1.00 0.00 ? 20 GLU A H    3  
ATOM   2856  H  HA   . GLU A 1 20 ? -2.587  -1.901  -8.913  1.00 0.00 ? 20 GLU A HA   3  
ATOM   2857  H  HB2  . GLU A 1 20 ? 0.036   -2.977  -9.944  1.00 0.00 ? 20 GLU A HB2  3  
ATOM   2858  H  HB3  . GLU A 1 20 ? -0.957  -3.662  -8.666  1.00 0.00 ? 20 GLU A HB3  3  
ATOM   2859  H  HG2  . GLU A 1 20 ? -2.313  -4.705  -10.107 1.00 0.00 ? 20 GLU A HG2  3  
ATOM   2860  H  HG3  . GLU A 1 20 ? -2.338  -3.345  -11.228 1.00 0.00 ? 20 GLU A HG3  3  
ATOM   2861  N  N    . THR A 1 21 ? -1.376  0.014   -7.723  1.00 0.00 ? 21 THR A N    3  
ATOM   2862  C  CA   . THR A 1 21 ? -0.662  0.871   -6.778  1.00 0.00 ? 21 THR A CA   3  
ATOM   2863  C  C    . THR A 1 21 ? -1.470  1.061   -5.494  1.00 0.00 ? 21 THR A C    3  
ATOM   2864  O  O    . THR A 1 21 ? -2.696  1.156   -5.533  1.00 0.00 ? 21 THR A O    3  
ATOM   2865  C  CB   . THR A 1 21 ? -0.362  2.236   -7.412  1.00 0.00 ? 21 THR A CB   3  
ATOM   2866  O  OG1  . THR A 1 21 ? 0.084   2.090   -8.750  1.00 0.00 ? 21 THR A OG1  3  
ATOM   2867  C  CG2  . THR A 1 21 ? 0.693   3.026   -6.664  1.00 0.00 ? 21 THR A CG2  3  
ATOM   2868  H  H    . THR A 1 21 ? -2.338  0.140   -7.847  1.00 0.00 ? 21 THR A H    3  
ATOM   2869  H  HA   . THR A 1 21 ? 0.272   0.385   -6.534  1.00 0.00 ? 21 THR A HA   3  
ATOM   2870  H  HB   . THR A 1 21 ? -1.269  2.825   -7.421  1.00 0.00 ? 21 THR A HB   3  
ATOM   2871  H  HG1  . THR A 1 21 ? 0.730   1.380   -8.800  1.00 0.00 ? 21 THR A HG1  3  
ATOM   2872  H  HG21 . THR A 1 21 ? 0.635   4.065   -6.950  1.00 0.00 ? 21 THR A HG21 3  
ATOM   2873  H  HG22 . THR A 1 21 ? 1.671   2.640   -6.910  1.00 0.00 ? 21 THR A HG22 3  
ATOM   2874  H  HG23 . THR A 1 21 ? 0.526   2.933   -5.602  1.00 0.00 ? 21 THR A HG23 3  
ATOM   2875  N  N    . TYR A 1 22 ? -0.772  1.116   -4.360  1.00 0.00 ? 22 TYR A N    3  
ATOM   2876  C  CA   . TYR A 1 22 ? -1.425  1.302   -3.064  1.00 0.00 ? 22 TYR A CA   3  
ATOM   2877  C  C    . TYR A 1 22 ? -1.122  2.687   -2.495  1.00 0.00 ? 22 TYR A C    3  
ATOM   2878  O  O    . TYR A 1 22 ? 0.022   3.141   -2.524  1.00 0.00 ? 22 TYR A O    3  
ATOM   2879  C  CB   . TYR A 1 22 ? -0.975  0.221   -2.078  1.00 0.00 ? 22 TYR A CB   3  
ATOM   2880  C  CG   . TYR A 1 22 ? -1.288  -1.186  -2.537  1.00 0.00 ? 22 TYR A CG   3  
ATOM   2881  C  CD1  . TYR A 1 22 ? -0.418  -1.870  -3.377  1.00 0.00 ? 22 TYR A CD1  3  
ATOM   2882  C  CD2  . TYR A 1 22 ? -2.452  -1.827  -2.134  1.00 0.00 ? 22 TYR A CD2  3  
ATOM   2883  C  CE1  . TYR A 1 22 ? -0.698  -3.154  -3.800  1.00 0.00 ? 22 TYR A CE1  3  
ATOM   2884  C  CE2  . TYR A 1 22 ? -2.740  -3.111  -2.553  1.00 0.00 ? 22 TYR A CE2  3  
ATOM   2885  C  CZ   . TYR A 1 22 ? -1.860  -3.770  -3.385  1.00 0.00 ? 22 TYR A CZ   3  
ATOM   2886  O  OH   . TYR A 1 22 ? -2.143  -5.051  -3.803  1.00 0.00 ? 22 TYR A OH   3  
ATOM   2887  H  H    . TYR A 1 22 ? 0.206   1.035   -4.395  1.00 0.00 ? 22 TYR A H    3  
ATOM   2888  H  HA   . TYR A 1 22 ? -2.491  1.214   -3.217  1.00 0.00 ? 22 TYR A HA   3  
ATOM   2889  H  HB2  . TYR A 1 22 ? 0.093   0.293   -1.936  1.00 0.00 ? 22 TYR A HB2  3  
ATOM   2890  H  HB3  . TYR A 1 22 ? -1.470  0.379   -1.130  1.00 0.00 ? 22 TYR A HB3  3  
ATOM   2891  H  HD1  . TYR A 1 22 ? 0.490   -1.385  -3.699  1.00 0.00 ? 22 TYR A HD1  3  
ATOM   2892  H  HD2  . TYR A 1 22 ? -3.139  -1.307  -1.482  1.00 0.00 ? 22 TYR A HD2  3  
ATOM   2893  H  HE1  . TYR A 1 22 ? -0.010  -3.669  -4.452  1.00 0.00 ? 22 TYR A HE1  3  
ATOM   2894  H  HE2  . TYR A 1 22 ? -3.650  -3.594  -2.227  1.00 0.00 ? 22 TYR A HE2  3  
ATOM   2895  H  HH   . TYR A 1 22 ? -1.881  -5.674  -3.121  1.00 0.00 ? 22 TYR A HH   3  
ATOM   2896  N  N    . PHE A 1 23 ? -2.156  3.356   -1.985  1.00 0.00 ? 23 PHE A N    3  
ATOM   2897  C  CA   . PHE A 1 23 ? -2.001  4.695   -1.417  1.00 0.00 ? 23 PHE A CA   3  
ATOM   2898  C  C    . PHE A 1 23 ? -2.505  4.747   0.025   1.00 0.00 ? 23 PHE A C    3  
ATOM   2899  O  O    . PHE A 1 23 ? -3.289  3.897   0.449   1.00 0.00 ? 23 PHE A O    3  
ATOM   2900  C  CB   . PHE A 1 23 ? -2.751  5.727   -2.268  1.00 0.00 ? 23 PHE A CB   3  
ATOM   2901  C  CG   . PHE A 1 23 ? -2.397  5.680   -3.729  1.00 0.00 ? 23 PHE A CG   3  
ATOM   2902  C  CD1  . PHE A 1 23 ? -2.881  4.664   -4.540  1.00 0.00 ? 23 PHE A CD1  3  
ATOM   2903  C  CD2  . PHE A 1 23 ? -1.582  6.649   -4.292  1.00 0.00 ? 23 PHE A CD2  3  
ATOM   2904  C  CE1  . PHE A 1 23 ? -2.557  4.616   -5.881  1.00 0.00 ? 23 PHE A CE1  3  
ATOM   2905  C  CE2  . PHE A 1 23 ? -1.255  6.605   -5.635  1.00 0.00 ? 23 PHE A CE2  3  
ATOM   2906  C  CZ   . PHE A 1 23 ? -1.743  5.587   -6.431  1.00 0.00 ? 23 PHE A CZ   3  
ATOM   2907  H  H    . PHE A 1 23 ? -3.046  2.944   -1.996  1.00 0.00 ? 23 PHE A H    3  
ATOM   2908  H  HA   . PHE A 1 23 ? -0.949  4.936   -1.425  1.00 0.00 ? 23 PHE A HA   3  
ATOM   2909  H  HB2  . PHE A 1 23 ? -3.813  5.553   -2.178  1.00 0.00 ? 23 PHE A HB2  3  
ATOM   2910  H  HB3  . PHE A 1 23 ? -2.523  6.718   -1.901  1.00 0.00 ? 23 PHE A HB3  3  
ATOM   2911  H  HD1  . PHE A 1 23 ? -3.518  3.904   -4.114  1.00 0.00 ? 23 PHE A HD1  3  
ATOM   2912  H  HD2  . PHE A 1 23 ? -1.200  7.446   -3.672  1.00 0.00 ? 23 PHE A HD2  3  
ATOM   2913  H  HE1  . PHE A 1 23 ? -2.940  3.818   -6.502  1.00 0.00 ? 23 PHE A HE1  3  
ATOM   2914  H  HE2  . PHE A 1 23 ? -0.618  7.367   -6.061  1.00 0.00 ? 23 PHE A HE2  3  
ATOM   2915  H  HZ   . PHE A 1 23 ? -1.489  5.551   -7.479  1.00 0.00 ? 23 PHE A HZ   3  
ATOM   2916  N  N    . TYR A 1 24 ? -2.050  5.756   0.772   1.00 0.00 ? 24 TYR A N    3  
ATOM   2917  C  CA   . TYR A 1 24 ? -2.456  5.925   2.165   1.00 0.00 ? 24 TYR A CA   3  
ATOM   2918  C  C    . TYR A 1 24 ? -2.618  7.404   2.517   1.00 0.00 ? 24 TYR A C    3  
ATOM   2919  O  O    . TYR A 1 24 ? -1.815  8.237   2.100   1.00 0.00 ? 24 TYR A O    3  
ATOM   2920  C  CB   . TYR A 1 24 ? -1.432  5.279   3.103   1.00 0.00 ? 24 TYR A CB   3  
ATOM   2921  C  CG   . TYR A 1 24 ? -2.029  4.790   4.405   1.00 0.00 ? 24 TYR A CG   3  
ATOM   2922  C  CD1  . TYR A 1 24 ? -2.995  3.790   4.416   1.00 0.00 ? 24 TYR A CD1  3  
ATOM   2923  C  CD2  . TYR A 1 24 ? -1.635  5.335   5.622   1.00 0.00 ? 24 TYR A CD2  3  
ATOM   2924  C  CE1  . TYR A 1 24 ? -3.549  3.347   5.602   1.00 0.00 ? 24 TYR A CE1  3  
ATOM   2925  C  CE2  . TYR A 1 24 ? -2.186  4.896   6.811   1.00 0.00 ? 24 TYR A CE2  3  
ATOM   2926  C  CZ   . TYR A 1 24 ? -3.143  3.903   6.796   1.00 0.00 ? 24 TYR A CZ   3  
ATOM   2927  O  OH   . TYR A 1 24 ? -3.698  3.465   7.979   1.00 0.00 ? 24 TYR A OH   3  
ATOM   2928  H  H    . TYR A 1 24 ? -1.429  6.402   0.375   1.00 0.00 ? 24 TYR A H    3  
ATOM   2929  H  HA   . TYR A 1 24 ? -3.408  5.430   2.292   1.00 0.00 ? 24 TYR A HA   3  
ATOM   2930  H  HB2  . TYR A 1 24 ? -0.983  4.432   2.606   1.00 0.00 ? 24 TYR A HB2  3  
ATOM   2931  H  HB3  . TYR A 1 24 ? -0.665  6.001   3.339   1.00 0.00 ? 24 TYR A HB3  3  
ATOM   2932  H  HD1  . TYR A 1 24 ? -3.313  3.355   3.480   1.00 0.00 ? 24 TYR A HD1  3  
ATOM   2933  H  HD2  . TYR A 1 24 ? -0.886  6.112   5.631   1.00 0.00 ? 24 TYR A HD2  3  
ATOM   2934  H  HE1  . TYR A 1 24 ? -4.299  2.568   5.589   1.00 0.00 ? 24 TYR A HE1  3  
ATOM   2935  H  HE2  . TYR A 1 24 ? -1.867  5.332   7.746   1.00 0.00 ? 24 TYR A HE2  3  
ATOM   2936  H  HH   . TYR A 1 24 ? -3.001  3.202   8.584   1.00 0.00 ? 24 TYR A HH   3  
ATOM   2937  N  N    . PRO A 1 25 ? -3.665  7.752   3.293   1.00 0.00 ? 25 PRO A N    3  
ATOM   2938  C  CA   . PRO A 1 25 ? -3.923  9.139   3.697   1.00 0.00 ? 25 PRO A CA   3  
ATOM   2939  C  C    . PRO A 1 25 ? -2.881  9.664   4.683   1.00 0.00 ? 25 PRO A C    3  
ATOM   2940  O  O    . PRO A 1 25 ? -2.662  9.072   5.742   1.00 0.00 ? 25 PRO A O    3  
ATOM   2941  C  CB   . PRO A 1 25 ? -5.301  9.070   4.359   1.00 0.00 ? 25 PRO A CB   3  
ATOM   2942  C  CG   . PRO A 1 25 ? -5.429  7.663   4.831   1.00 0.00 ? 25 PRO A CG   3  
ATOM   2943  C  CD   . PRO A 1 25 ? -4.678  6.822   3.835   1.00 0.00 ? 25 PRO A CD   3  
ATOM   2944  H  HA   . PRO A 1 25 ? -3.967  9.794   2.841   1.00 0.00 ? 25 PRO A HA   3  
ATOM   2945  H  HB2  . PRO A 1 25 ? -5.343  9.769   5.183   1.00 0.00 ? 25 PRO A HB2  3  
ATOM   2946  H  HB3  . PRO A 1 25 ? -6.064  9.313   3.635   1.00 0.00 ? 25 PRO A HB3  3  
ATOM   2947  H  HG2  . PRO A 1 25 ? -4.989  7.563   5.812   1.00 0.00 ? 25 PRO A HG2  3  
ATOM   2948  H  HG3  . PRO A 1 25 ? -6.469  7.376   4.853   1.00 0.00 ? 25 PRO A HG3  3  
ATOM   2949  H  HD2  . PRO A 1 25 ? -4.207  5.986   4.330   1.00 0.00 ? 25 PRO A HD2  3  
ATOM   2950  H  HD3  . PRO A 1 25 ? -5.341  6.477   3.056   1.00 0.00 ? 25 PRO A HD3  3  
ATOM   2951  N  N    . CYS A 1 26 ? -2.243  10.778  4.327   1.00 0.00 ? 26 CYS A N    3  
ATOM   2952  C  CA   . CYS A 1 26 ? -1.227  11.386  5.177   1.00 0.00 ? 26 CYS A CA   3  
ATOM   2953  C  C    . CYS A 1 26 ? -1.816  12.538  5.991   1.00 0.00 ? 26 CYS A C    3  
ATOM   2954  O  O    . CYS A 1 26 ? -2.684  13.269  5.508   1.00 0.00 ? 26 CYS A O    3  
ATOM   2955  C  CB   . CYS A 1 26 ? -0.056  11.889  4.330   1.00 0.00 ? 26 CYS A CB   3  
ATOM   2956  S  SG   . CYS A 1 26 ? 1.581   11.365  4.933   1.00 0.00 ? 26 CYS A SG   3  
ATOM   2957  H  H    . CYS A 1 26 ? -2.462  11.204  3.472   1.00 0.00 ? 26 CYS A H    3  
ATOM   2958  H  HA   . CYS A 1 26 ? -0.868  10.628  5.857   1.00 0.00 ? 26 CYS A HA   3  
ATOM   2959  H  HB2  . CYS A 1 26 ? -0.165  11.518  3.321   1.00 0.00 ? 26 CYS A HB2  3  
ATOM   2960  H  HB3  . CYS A 1 26 ? -0.069  12.969  4.313   1.00 0.00 ? 26 CYS A HB3  3  
ATOM   2961  N  N    . PRO A 1 27 ? -1.348  12.717  7.241   1.00 0.00 ? 27 PRO A N    3  
ATOM   2962  C  CA   . PRO A 1 27 ? -1.829  13.789  8.121   1.00 0.00 ? 27 PRO A CA   3  
ATOM   2963  C  C    . PRO A 1 27 ? -1.444  15.186  7.625   1.00 0.00 ? 27 PRO A C    3  
ATOM   2964  O  O    . PRO A 1 27 ? -2.035  16.183  8.043   1.00 0.00 ? 27 PRO A O    3  
ATOM   2965  C  CB   . PRO A 1 27 ? -1.143  13.493  9.459   1.00 0.00 ? 27 PRO A CB   3  
ATOM   2966  C  CG   . PRO A 1 27 ? 0.065   12.698  9.102   1.00 0.00 ? 27 PRO A CG   3  
ATOM   2967  C  CD   . PRO A 1 27 ? -0.311  11.892  7.890   1.00 0.00 ? 27 PRO A CD   3  
ATOM   2968  H  HA   . PRO A 1 27 ? -2.901  13.741  8.248   1.00 0.00 ? 27 PRO A HA   3  
ATOM   2969  H  HB2  . PRO A 1 27 ? -0.877  14.421  9.943   1.00 0.00 ? 27 PRO A HB2  3  
ATOM   2970  H  HB3  . PRO A 1 27 ? -1.812  12.930  10.092  1.00 0.00 ? 27 PRO A HB3  3  
ATOM   2971  H  HG2  . PRO A 1 27 ? 0.887   13.360  8.871   1.00 0.00 ? 27 PRO A HG2  3  
ATOM   2972  H  HG3  . PRO A 1 27 ? 0.328   12.043  9.919   1.00 0.00 ? 27 PRO A HG3  3  
ATOM   2973  H  HD2  . PRO A 1 27 ? 0.544   11.763  7.243   1.00 0.00 ? 27 PRO A HD2  3  
ATOM   2974  H  HD3  . PRO A 1 27 ? -0.713  10.934  8.185   1.00 0.00 ? 27 PRO A HD3  3  
ATOM   2975  N  N    . CYS A 1 28 ? -0.453  15.255  6.734   1.00 0.00 ? 28 CYS A N    3  
ATOM   2976  C  CA   . CYS A 1 28 ? -0.003  16.534  6.192   1.00 0.00 ? 28 CYS A CA   3  
ATOM   2977  C  C    . CYS A 1 28 ? -0.980  17.063  5.138   1.00 0.00 ? 28 CYS A C    3  
ATOM   2978  O  O    . CYS A 1 28 ? -1.240  18.266  5.071   1.00 0.00 ? 28 CYS A O    3  
ATOM   2979  C  CB   . CYS A 1 28 ? 1.399   16.397  5.587   1.00 0.00 ? 28 CYS A CB   3  
ATOM   2980  S  SG   . CYS A 1 28 ? 1.505   15.220  4.198   1.00 0.00 ? 28 CYS A SG   3  
ATOM   2981  H  H    . CYS A 1 28 ? -0.016  14.429  6.433   1.00 0.00 ? 28 CYS A H    3  
ATOM   2982  H  HA   . CYS A 1 28 ? 0.037   17.239  7.010   1.00 0.00 ? 28 CYS A HA   3  
ATOM   2983  H  HB2  . CYS A 1 28 ? 1.722   17.362  5.225   1.00 0.00 ? 28 CYS A HB2  3  
ATOM   2984  H  HB3  . CYS A 1 28 ? 2.082   16.062  6.354   1.00 0.00 ? 28 CYS A HB3  3  
ATOM   2985  N  N    . GLY A 1 29 ? -1.517  16.154  4.317   1.00 0.00 ? 29 GLY A N    3  
ATOM   2986  C  CA   . GLY A 1 29 ? -2.456  16.544  3.275   1.00 0.00 ? 29 GLY A CA   3  
ATOM   2987  C  C    . GLY A 1 29 ? -2.395  15.632  2.060   1.00 0.00 ? 29 GLY A C    3  
ATOM   2988  O  O    . GLY A 1 29 ? -3.432  15.257  1.508   1.00 0.00 ? 29 GLY A O    3  
ATOM   2989  H  H    . GLY A 1 29 ? -1.270  15.211  4.419   1.00 0.00 ? 29 GLY A H    3  
ATOM   2990  H  HA2  . GLY A 1 29 ? -3.455  16.517  3.683   1.00 0.00 ? 29 GLY A HA2  3  
ATOM   2991  H  HA3  . GLY A 1 29 ? -2.233  17.555  2.965   1.00 0.00 ? 29 GLY A HA3  3  
ATOM   2992  N  N    . ASP A 1 30 ? -1.181  15.276  1.644   1.00 0.00 ? 30 ASP A N    3  
ATOM   2993  C  CA   . ASP A 1 30 ? -0.984  14.401  0.489   1.00 0.00 ? 30 ASP A CA   3  
ATOM   2994  C  C    . ASP A 1 30 ? -1.250  12.939  0.866   1.00 0.00 ? 30 ASP A C    3  
ATOM   2995  O  O    . ASP A 1 30 ? -1.644  12.646  1.997   1.00 0.00 ? 30 ASP A O    3  
ATOM   2996  C  CB   . ASP A 1 30 ? 0.444   14.561  -0.048  1.00 0.00 ? 30 ASP A CB   3  
ATOM   2997  C  CG   . ASP A 1 30 ? 0.505   15.364  -1.335  1.00 0.00 ? 30 ASP A CG   3  
ATOM   2998  O  OD1  . ASP A 1 30 ? -0.133  16.437  -1.401  1.00 0.00 ? 30 ASP A OD1  3  
ATOM   2999  O  OD2  . ASP A 1 30 ? 1.197   14.922  -2.276  1.00 0.00 ? 30 ASP A OD2  3  
ATOM   3000  H  H    . ASP A 1 30 ? -0.395  15.608  2.128   1.00 0.00 ? 30 ASP A H    3  
ATOM   3001  H  HA   . ASP A 1 30 ? -1.686  14.698  -0.278  1.00 0.00 ? 30 ASP A HA   3  
ATOM   3002  H  HB2  . ASP A 1 30 ? 1.043   15.069  0.695   1.00 0.00 ? 30 ASP A HB2  3  
ATOM   3003  H  HB3  . ASP A 1 30 ? 0.864   13.585  -0.234  1.00 0.00 ? 30 ASP A HB3  3  
ATOM   3004  N  N    . ASN A 1 31 ? -1.039  12.024  -0.084  1.00 0.00 ? 31 ASN A N    3  
ATOM   3005  C  CA   . ASN A 1 31 ? -1.260  10.600  0.165   1.00 0.00 ? 31 ASN A CA   3  
ATOM   3006  C  C    . ASN A 1 31 ? -0.056  9.767   -0.276  1.00 0.00 ? 31 ASN A C    3  
ATOM   3007  O  O    . ASN A 1 31 ? 0.486   9.968   -1.364  1.00 0.00 ? 31 ASN A O    3  
ATOM   3008  C  CB   . ASN A 1 31 ? -2.519  10.108  -0.563  1.00 0.00 ? 31 ASN A CB   3  
ATOM   3009  C  CG   . ASN A 1 31 ? -3.709  11.038  -0.394  1.00 0.00 ? 31 ASN A CG   3  
ATOM   3010  O  OD1  . ASN A 1 31 ? -4.360  11.408  -1.369  1.00 0.00 ? 31 ASN A OD1  3  
ATOM   3011  N  ND2  . ASN A 1 31 ? -3.997  11.421  0.845   1.00 0.00 ? 31 ASN A ND2  3  
ATOM   3012  H  H    . ASN A 1 31 ? -0.728  12.312  -0.969  1.00 0.00 ? 31 ASN A H    3  
ATOM   3013  H  HA   . ASN A 1 31 ? -1.398  10.470  1.228   1.00 0.00 ? 31 ASN A HA   3  
ATOM   3014  H  HB2  . ASN A 1 31 ? -2.304  10.021  -1.619  1.00 0.00 ? 31 ASN A HB2  3  
ATOM   3015  H  HB3  . ASN A 1 31 ? -2.790  9.138   -0.175  1.00 0.00 ? 31 ASN A HB3  3  
ATOM   3016  H  HD21 . ASN A 1 31 ? -3.434  11.092  1.575   1.00 0.00 ? 31 ASN A HD21 3  
ATOM   3017  H  HD22 . ASN A 1 31 ? -4.763  12.017  0.978   1.00 0.00 ? 31 ASN A HD22 3  
ATOM   3018  N  N    . PHE A 1 32 ? 0.349   8.821   0.576   1.00 0.00 ? 32 PHE A N    3  
ATOM   3019  C  CA   . PHE A 1 32 ? 1.483   7.941   0.278   1.00 0.00 ? 32 PHE A CA   3  
ATOM   3020  C  C    . PHE A 1 32 ? 1.188   7.073   -0.948  1.00 0.00 ? 32 PHE A C    3  
ATOM   3021  O  O    . PHE A 1 32 ? 0.035   6.949   -1.363  1.00 0.00 ? 32 PHE A O    3  
ATOM   3022  C  CB   . PHE A 1 32 ? 1.784   7.037   1.480   1.00 0.00 ? 32 PHE A CB   3  
ATOM   3023  C  CG   . PHE A 1 32 ? 2.680   7.662   2.517   1.00 0.00 ? 32 PHE A CG   3  
ATOM   3024  C  CD1  . PHE A 1 32 ? 4.023   7.878   2.253   1.00 0.00 ? 32 PHE A CD1  3  
ATOM   3025  C  CD2  . PHE A 1 32 ? 2.180   8.020   3.760   1.00 0.00 ? 32 PHE A CD2  3  
ATOM   3026  C  CE1  . PHE A 1 32 ? 4.848   8.441   3.209   1.00 0.00 ? 32 PHE A CE1  3  
ATOM   3027  C  CE2  . PHE A 1 32 ? 3.002   8.586   4.717   1.00 0.00 ? 32 PHE A CE2  3  
ATOM   3028  C  CZ   . PHE A 1 32 ? 4.338   8.795   4.440   1.00 0.00 ? 32 PHE A CZ   3  
ATOM   3029  H  H    . PHE A 1 32 ? -0.133  8.706   1.423   1.00 0.00 ? 32 PHE A H    3  
ATOM   3030  H  HA   . PHE A 1 32 ? 2.343   8.560   0.074   1.00 0.00 ? 32 PHE A HA   3  
ATOM   3031  H  HB2  . PHE A 1 32 ? 0.856   6.772   1.962   1.00 0.00 ? 32 PHE A HB2  3  
ATOM   3032  H  HB3  . PHE A 1 32 ? 2.266   6.136   1.126   1.00 0.00 ? 32 PHE A HB3  3  
ATOM   3033  H  HD1  . PHE A 1 32 ? 4.424   7.605   1.289   1.00 0.00 ? 32 PHE A HD1  3  
ATOM   3034  H  HD2  . PHE A 1 32 ? 1.134   7.858   3.979   1.00 0.00 ? 32 PHE A HD2  3  
ATOM   3035  H  HE1  . PHE A 1 32 ? 5.895   8.603   2.990   1.00 0.00 ? 32 PHE A HE1  3  
ATOM   3036  H  HE2  . PHE A 1 32 ? 2.600   8.862   5.681   1.00 0.00 ? 32 PHE A HE2  3  
ATOM   3037  H  HZ   . PHE A 1 32 ? 4.982   9.235   5.188   1.00 0.00 ? 32 PHE A HZ   3  
ATOM   3038  N  N    . SER A 1 33 ? 2.231   6.469   -1.520  1.00 0.00 ? 33 SER A N    3  
ATOM   3039  C  CA   . SER A 1 33 ? 2.071   5.611   -2.695  1.00 0.00 ? 33 SER A CA   3  
ATOM   3040  C  C    . SER A 1 33 ? 3.139   4.516   -2.742  1.00 0.00 ? 33 SER A C    3  
ATOM   3041  O  O    . SER A 1 33 ? 4.312   4.763   -2.451  1.00 0.00 ? 33 SER A O    3  
ATOM   3042  C  CB   . SER A 1 33 ? 2.126   6.444   -3.979  1.00 0.00 ? 33 SER A CB   3  
ATOM   3043  O  OG   . SER A 1 33 ? 3.229   7.337   -3.968  1.00 0.00 ? 33 SER A OG   3  
ATOM   3044  H  H    . SER A 1 33 ? 3.128   6.601   -1.144  1.00 0.00 ? 33 SER A H    3  
ATOM   3045  H  HA   . SER A 1 33 ? 1.102   5.140   -2.627  1.00 0.00 ? 33 SER A HA   3  
ATOM   3046  H  HB2  . SER A 1 33 ? 2.223   5.785   -4.829  1.00 0.00 ? 33 SER A HB2  3  
ATOM   3047  H  HB3  . SER A 1 33 ? 1.215   7.018   -4.073  1.00 0.00 ? 33 SER A HB3  3  
ATOM   3048  H  HG   . SER A 1 33 ? 3.752   7.209   -4.764  1.00 0.00 ? 33 SER A HG   3  
ATOM   3049  N  N    . ILE A 1 34 ? 2.721   3.307   -3.122  1.00 0.00 ? 34 ILE A N    3  
ATOM   3050  C  CA   . ILE A 1 34 ? 3.628   2.164   -3.227  1.00 0.00 ? 34 ILE A CA   3  
ATOM   3051  C  C    . ILE A 1 34 ? 3.130   1.173   -4.283  1.00 0.00 ? 34 ILE A C    3  
ATOM   3052  O  O    . ILE A 1 34 ? 1.986   0.716   -4.231  1.00 0.00 ? 34 ILE A O    3  
ATOM   3053  C  CB   . ILE A 1 34 ? 3.799   1.439   -1.871  1.00 0.00 ? 34 ILE A CB   3  
ATOM   3054  C  CG1  . ILE A 1 34 ? 4.801   0.287   -2.001  1.00 0.00 ? 34 ILE A CG1  3  
ATOM   3055  C  CG2  . ILE A 1 34 ? 2.459   0.928   -1.358  1.00 0.00 ? 34 ILE A CG2  3  
ATOM   3056  C  CD1  . ILE A 1 34 ? 5.705   0.136   -0.797  1.00 0.00 ? 34 ILE A CD1  3  
ATOM   3057  H  H    . ILE A 1 34 ? 1.773   3.182   -3.347  1.00 0.00 ? 34 ILE A H    3  
ATOM   3058  H  HA   . ILE A 1 34 ? 4.594   2.539   -3.534  1.00 0.00 ? 34 ILE A HA   3  
ATOM   3059  H  HB   . ILE A 1 34 ? 4.178   2.152   -1.154  1.00 0.00 ? 34 ILE A HB   3  
ATOM   3060  H  HG12 . ILE A 1 34 ? 4.262   -0.640  -2.127  1.00 0.00 ? 34 ILE A HG12 3  
ATOM   3061  H  HG13 . ILE A 1 34 ? 5.426   0.457   -2.866  1.00 0.00 ? 34 ILE A HG13 3  
ATOM   3062  H  HG21 . ILE A 1 34 ? 2.452   0.959   -0.279  1.00 0.00 ? 34 ILE A HG21 3  
ATOM   3063  H  HG22 . ILE A 1 34 ? 2.310   -0.089  -1.690  1.00 0.00 ? 34 ILE A HG22 3  
ATOM   3064  H  HG23 . ILE A 1 34 ? 1.666   1.552   -1.742  1.00 0.00 ? 34 ILE A HG23 3  
ATOM   3065  H  HD11 . ILE A 1 34 ? 5.618   -0.867  -0.404  1.00 0.00 ? 34 ILE A HD11 3  
ATOM   3066  H  HD12 . ILE A 1 34 ? 5.417   0.846   -0.037  1.00 0.00 ? 34 ILE A HD12 3  
ATOM   3067  H  HD13 . ILE A 1 34 ? 6.729   0.320   -1.090  1.00 0.00 ? 34 ILE A HD13 3  
ATOM   3068  N  N    . THR A 1 35 ? 3.996   0.853   -5.243  1.00 0.00 ? 35 THR A N    3  
ATOM   3069  C  CA   . THR A 1 35 ? 3.652   -0.072  -6.325  1.00 0.00 ? 35 THR A CA   3  
ATOM   3070  C  C    . THR A 1 35 ? 3.588   -1.517  -5.826  1.00 0.00 ? 35 THR A C    3  
ATOM   3071  O  O    . THR A 1 35 ? 4.315   -1.901  -4.909  1.00 0.00 ? 35 THR A O    3  
ATOM   3072  C  CB   . THR A 1 35 ? 4.674   0.043   -7.460  1.00 0.00 ? 35 THR A CB   3  
ATOM   3073  O  OG1  . THR A 1 35 ? 5.997   -0.022  -6.955  1.00 0.00 ? 35 THR A OG1  3  
ATOM   3074  C  CG2  . THR A 1 35 ? 4.550   1.331   -8.249  1.00 0.00 ? 35 THR A CG2  3  
ATOM   3075  H  H    . THR A 1 35 ? 4.889   1.258   -5.231  1.00 0.00 ? 35 THR A H    3  
ATOM   3076  H  HA   . THR A 1 35 ? 2.679   0.206   -6.702  1.00 0.00 ? 35 THR A HA   3  
ATOM   3077  H  HB   . THR A 1 35 ? 4.532   -0.780  -8.147  1.00 0.00 ? 35 THR A HB   3  
ATOM   3078  H  HG1  . THR A 1 35 ? 6.601   -0.264  -7.661  1.00 0.00 ? 35 THR A HG1  3  
ATOM   3079  H  HG21 . THR A 1 35 ? 4.946   1.184   -9.243  1.00 0.00 ? 35 THR A HG21 3  
ATOM   3080  H  HG22 . THR A 1 35 ? 5.106   2.112   -7.750  1.00 0.00 ? 35 THR A HG22 3  
ATOM   3081  H  HG23 . THR A 1 35 ? 3.510   1.614   -8.314  1.00 0.00 ? 35 THR A HG23 3  
ATOM   3082  N  N    . LYS A 1 36 ? 2.714   -2.316  -6.443  1.00 0.00 ? 36 LYS A N    3  
ATOM   3083  C  CA   . LYS A 1 36 ? 2.559   -3.725  -6.069  1.00 0.00 ? 36 LYS A CA   3  
ATOM   3084  C  C    . LYS A 1 36 ? 3.872   -4.487  -6.267  1.00 0.00 ? 36 LYS A C    3  
ATOM   3085  O  O    . LYS A 1 36 ? 4.220   -5.353  -5.463  1.00 0.00 ? 36 LYS A O    3  
ATOM   3086  C  CB   . LYS A 1 36 ? 1.441   -4.379  -6.891  1.00 0.00 ? 36 LYS A CB   3  
ATOM   3087  C  CG   . LYS A 1 36 ? 1.202   -5.845  -6.551  1.00 0.00 ? 36 LYS A CG   3  
ATOM   3088  C  CD   . LYS A 1 36 ? 0.077   -6.010  -5.540  1.00 0.00 ? 36 LYS A CD   3  
ATOM   3089  C  CE   . LYS A 1 36 ? -0.379  -7.460  -5.444  1.00 0.00 ? 36 LYS A CE   3  
ATOM   3090  N  NZ   . LYS A 1 36 ? -1.862  -7.573  -5.344  1.00 0.00 ? 36 LYS A NZ   3  
ATOM   3091  H  H    . LYS A 1 36 ? 2.165   -1.951  -7.169  1.00 0.00 ? 36 LYS A H    3  
ATOM   3092  H  HA   . LYS A 1 36 ? 2.292   -3.759  -5.023  1.00 0.00 ? 36 LYS A HA   3  
ATOM   3093  H  HB2  . LYS A 1 36 ? 0.522   -3.838  -6.719  1.00 0.00 ? 36 LYS A HB2  3  
ATOM   3094  H  HB3  . LYS A 1 36 ? 1.695   -4.312  -7.939  1.00 0.00 ? 36 LYS A HB3  3  
ATOM   3095  H  HG2  . LYS A 1 36 ? 0.939   -6.374  -7.455  1.00 0.00 ? 36 LYS A HG2  3  
ATOM   3096  H  HG3  . LYS A 1 36 ? 2.108   -6.263  -6.140  1.00 0.00 ? 36 LYS A HG3  3  
ATOM   3097  H  HD2  . LYS A 1 36 ? 0.428   -5.691  -4.571  1.00 0.00 ? 36 LYS A HD2  3  
ATOM   3098  H  HD3  . LYS A 1 36 ? -0.759  -5.399  -5.843  1.00 0.00 ? 36 LYS A HD3  3  
ATOM   3099  H  HE2  . LYS A 1 36 ? -0.046  -7.989  -6.324  1.00 0.00 ? 36 LYS A HE2  3  
ATOM   3100  H  HE3  . LYS A 1 36 ? 0.067   -7.906  -4.567  1.00 0.00 ? 36 LYS A HE3  3  
ATOM   3101  H  HZ1  . LYS A 1 36 ? -2.166  -7.452  -4.357  1.00 0.00 ? 36 LYS A HZ1  3  
ATOM   3102  H  HZ2  . LYS A 1 36 ? -2.171  -8.509  -5.678  1.00 0.00 ? 36 LYS A HZ2  3  
ATOM   3103  H  HZ3  . LYS A 1 36 ? -2.319  -6.844  -5.928  1.00 0.00 ? 36 LYS A HZ3  3  
ATOM   3104  N  N    . GLU A 1 37 ? 4.595   -4.153  -7.339  1.00 0.00 ? 37 GLU A N    3  
ATOM   3105  C  CA   . GLU A 1 37 ? 5.872   -4.801  -7.639  1.00 0.00 ? 37 GLU A CA   3  
ATOM   3106  C  C    . GLU A 1 37 ? 6.885   -4.571  -6.515  1.00 0.00 ? 37 GLU A C    3  
ATOM   3107  O  O    . GLU A 1 37 ? 7.669   -5.464  -6.188  1.00 0.00 ? 37 GLU A O    3  
ATOM   3108  C  CB   . GLU A 1 37 ? 6.440   -4.275  -8.960  1.00 0.00 ? 37 GLU A CB   3  
ATOM   3109  C  CG   . GLU A 1 37 ? 7.452   -5.212  -9.601  1.00 0.00 ? 37 GLU A CG   3  
ATOM   3110  C  CD   . GLU A 1 37 ? 6.866   -6.014  -10.747 1.00 0.00 ? 37 GLU A CD   3  
ATOM   3111  O  OE1  . GLU A 1 37 ? 6.220   -7.049  -10.478 1.00 0.00 ? 37 GLU A OE1  3  
ATOM   3112  O  OE2  . GLU A 1 37 ? 7.053   -5.608  -11.913 1.00 0.00 ? 37 GLU A OE2  3  
ATOM   3113  H  H    . GLU A 1 37 ? 4.264   -3.452  -7.939  1.00 0.00 ? 37 GLU A H    3  
ATOM   3114  H  HA   . GLU A 1 37 ? 5.690   -5.862  -7.734  1.00 0.00 ? 37 GLU A HA   3  
ATOM   3115  H  HB2  . GLU A 1 37 ? 5.627   -4.124  -9.655  1.00 0.00 ? 37 GLU A HB2  3  
ATOM   3116  H  HB3  . GLU A 1 37 ? 6.925   -3.328  -8.777  1.00 0.00 ? 37 GLU A HB3  3  
ATOM   3117  H  HG2  . GLU A 1 37 ? 8.277   -4.626  -9.977  1.00 0.00 ? 37 GLU A HG2  3  
ATOM   3118  H  HG3  . GLU A 1 37 ? 7.813   -5.899  -8.849  1.00 0.00 ? 37 GLU A HG3  3  
ATOM   3119  N  N    . ASP A 1 38 ? 6.859   -3.372  -5.926  1.00 0.00 ? 38 ASP A N    3  
ATOM   3120  C  CA   . ASP A 1 38 ? 7.771   -3.029  -4.835  1.00 0.00 ? 38 ASP A CA   3  
ATOM   3121  C  C    . ASP A 1 38 ? 7.631   -4.021  -3.686  1.00 0.00 ? 38 ASP A C    3  
ATOM   3122  O  O    . ASP A 1 38 ? 8.624   -4.527  -3.168  1.00 0.00 ? 38 ASP A O    3  
ATOM   3123  C  CB   . ASP A 1 38 ? 7.485   -1.610  -4.317  1.00 0.00 ? 38 ASP A CB   3  
ATOM   3124  C  CG   . ASP A 1 38 ? 8.302   -0.537  -5.017  1.00 0.00 ? 38 ASP A CG   3  
ATOM   3125  O  OD1  . ASP A 1 38 ? 8.794   -0.792  -6.138  1.00 0.00 ? 38 ASP A OD1  3  
ATOM   3126  O  OD2  . ASP A 1 38 ? 8.446   0.563   -4.443  1.00 0.00 ? 38 ASP A OD2  3  
ATOM   3127  H  H    . ASP A 1 38 ? 6.209   -2.705  -6.233  1.00 0.00 ? 38 ASP A H    3  
ATOM   3128  H  HA   . ASP A 1 38 ? 8.781   -3.070  -5.214  1.00 0.00 ? 38 ASP A HA   3  
ATOM   3129  H  HB2  . ASP A 1 38 ? 6.439   -1.386  -4.461  1.00 0.00 ? 38 ASP A HB2  3  
ATOM   3130  H  HB3  . ASP A 1 38 ? 7.711   -1.572  -3.260  1.00 0.00 ? 38 ASP A HB3  3  
ATOM   3131  N  N    . LEU A 1 39 ? 6.387   -4.293  -3.300  1.00 0.00 ? 39 LEU A N    3  
ATOM   3132  C  CA   . LEU A 1 39 ? 6.103   -5.226  -2.213  1.00 0.00 ? 39 LEU A CA   3  
ATOM   3133  C  C    . LEU A 1 39 ? 6.644   -6.616  -2.534  1.00 0.00 ? 39 LEU A C    3  
ATOM   3134  O  O    . LEU A 1 39 ? 7.279   -7.250  -1.693  1.00 0.00 ? 39 LEU A O    3  
ATOM   3135  C  CB   . LEU A 1 39 ? 4.598   -5.295  -1.954  1.00 0.00 ? 39 LEU A CB   3  
ATOM   3136  C  CG   . LEU A 1 39 ? 3.917   -3.944  -1.726  1.00 0.00 ? 39 LEU A CG   3  
ATOM   3137  C  CD1  . LEU A 1 39 ? 2.420   -4.064  -1.952  1.00 0.00 ? 39 LEU A CD1  3  
ATOM   3138  C  CD2  . LEU A 1 39 ? 4.213   -3.425  -0.327  1.00 0.00 ? 39 LEU A CD2  3  
ATOM   3139  H  H    . LEU A 1 39 ? 5.640   -3.854  -3.759  1.00 0.00 ? 39 LEU A H    3  
ATOM   3140  H  HA   . LEU A 1 39 ? 6.596   -4.856  -1.326  1.00 0.00 ? 39 LEU A HA   3  
ATOM   3141  H  HB2  . LEU A 1 39 ? 4.132   -5.772  -2.804  1.00 0.00 ? 39 LEU A HB2  3  
ATOM   3142  H  HB3  . LEU A 1 39 ? 4.432   -5.908  -1.082  1.00 0.00 ? 39 LEU A HB3  3  
ATOM   3143  H  HG   . LEU A 1 39 ? 4.303   -3.230  -2.439  1.00 0.00 ? 39 LEU A HG   3  
ATOM   3144  H  HD11 . LEU A 1 39 ? 1.935   -3.154  -1.633  1.00 0.00 ? 39 LEU A HD11 3  
ATOM   3145  H  HD12 . LEU A 1 39 ? 2.034   -4.897  -1.384  1.00 0.00 ? 39 LEU A HD12 3  
ATOM   3146  H  HD13 . LEU A 1 39 ? 2.227   -4.227  -3.003  1.00 0.00 ? 39 LEU A HD13 3  
ATOM   3147  H  HD21 . LEU A 1 39 ? 5.208   -3.727  -0.032  1.00 0.00 ? 39 LEU A HD21 3  
ATOM   3148  H  HD22 . LEU A 1 39 ? 3.493   -3.829  0.370   1.00 0.00 ? 39 LEU A HD22 3  
ATOM   3149  H  HD23 . LEU A 1 39 ? 4.152   -2.346  -0.323  1.00 0.00 ? 39 LEU A HD23 3  
ATOM   3150  N  N    . GLU A 1 40 ? 6.394   -7.081  -3.758  1.00 0.00 ? 40 GLU A N    3  
ATOM   3151  C  CA   . GLU A 1 40 ? 6.864   -8.397  -4.187  1.00 0.00 ? 40 GLU A CA   3  
ATOM   3152  C  C    . GLU A 1 40 ? 8.391   -8.488  -4.117  1.00 0.00 ? 40 GLU A C    3  
ATOM   3153  O  O    . GLU A 1 40 ? 8.940   -9.557  -3.853  1.00 0.00 ? 40 GLU A O    3  
ATOM   3154  C  CB   . GLU A 1 40 ? 6.392   -8.696  -5.612  1.00 0.00 ? 40 GLU A CB   3  
ATOM   3155  C  CG   . GLU A 1 40 ? 4.880   -8.666  -5.778  1.00 0.00 ? 40 GLU A CG   3  
ATOM   3156  C  CD   . GLU A 1 40 ? 4.449   -8.761  -7.229  1.00 0.00 ? 40 GLU A CD   3  
ATOM   3157  O  OE1  . GLU A 1 40 ? 4.846   -9.733  -7.907  1.00 0.00 ? 40 GLU A OE1  3  
ATOM   3158  O  OE2  . GLU A 1 40 ? 3.711   -7.863  -7.688  1.00 0.00 ? 40 GLU A OE2  3  
ATOM   3159  H  H    . GLU A 1 40 ? 5.884   -6.524  -4.386  1.00 0.00 ? 40 GLU A H    3  
ATOM   3160  H  HA   . GLU A 1 40 ? 6.442   -9.132  -3.517  1.00 0.00 ? 40 GLU A HA   3  
ATOM   3161  H  HB2  . GLU A 1 40 ? 6.820   -7.965  -6.281  1.00 0.00 ? 40 GLU A HB2  3  
ATOM   3162  H  HB3  . GLU A 1 40 ? 6.743   -9.678  -5.893  1.00 0.00 ? 40 GLU A HB3  3  
ATOM   3163  H  HG2  . GLU A 1 40 ? 4.455   -9.499  -5.239  1.00 0.00 ? 40 GLU A HG2  3  
ATOM   3164  H  HG3  . GLU A 1 40 ? 4.503   -7.741  -5.367  1.00 0.00 ? 40 GLU A HG3  3  
ATOM   3165  N  N    . ASN A 1 41 ? 9.067   -7.364  -4.358  1.00 0.00 ? 41 ASN A N    3  
ATOM   3166  C  CA   . ASN A 1 41 ? 10.527  -7.322  -4.325  1.00 0.00 ? 41 ASN A CA   3  
ATOM   3167  C  C    . ASN A 1 41 ? 11.056  -7.151  -2.899  1.00 0.00 ? 41 ASN A C    3  
ATOM   3168  O  O    . ASN A 1 41 ? 12.085  -7.728  -2.543  1.00 0.00 ? 41 ASN A O    3  
ATOM   3169  C  CB   . ASN A 1 41 ? 11.044  -6.179  -5.202  1.00 0.00 ? 41 ASN A CB   3  
ATOM   3170  C  CG   . ASN A 1 41 ? 11.326  -6.621  -6.624  1.00 0.00 ? 41 ASN A CG   3  
ATOM   3171  O  OD1  . ASN A 1 41 ? 10.404  -6.863  -7.404  1.00 0.00 ? 41 ASN A OD1  3  
ATOM   3172  N  ND2  . ASN A 1 41 ? 12.603  -6.730  -6.967  1.00 0.00 ? 41 ASN A ND2  3  
ATOM   3173  H  H    . ASN A 1 41 ? 8.572   -6.542  -4.569  1.00 0.00 ? 41 ASN A H    3  
ATOM   3174  H  HA   . ASN A 1 41 ? 10.893  -8.257  -4.721  1.00 0.00 ? 41 ASN A HA   3  
ATOM   3175  H  HB2  . ASN A 1 41 ? 10.307  -5.390  -5.230  1.00 0.00 ? 41 ASN A HB2  3  
ATOM   3176  H  HB3  . ASN A 1 41 ? 11.960  -5.795  -4.776  1.00 0.00 ? 41 ASN A HB3  3  
ATOM   3177  H  HD21 . ASN A 1 41 ? 13.284  -6.523  -6.294  1.00 0.00 ? 41 ASN A HD21 3  
ATOM   3178  H  HD22 . ASN A 1 41 ? 12.813  -7.015  -7.881  1.00 0.00 ? 41 ASN A HD22 3  
ATOM   3179  N  N    . GLY A 1 42 ? 10.358  -6.344  -2.096  1.00 0.00 ? 42 GLY A N    3  
ATOM   3180  C  CA   . GLY A 1 42 ? 10.781  -6.098  -0.728  1.00 0.00 ? 42 GLY A CA   3  
ATOM   3181  C  C    . GLY A 1 42 ? 10.579  -4.647  -0.305  1.00 0.00 ? 42 GLY A C    3  
ATOM   3182  O  O    . GLY A 1 42 ? 10.661  -4.330  0.882   1.00 0.00 ? 42 GLY A O    3  
ATOM   3183  H  H    . GLY A 1 42 ? 9.553   -5.903  -2.439  1.00 0.00 ? 42 GLY A H    3  
ATOM   3184  H  HA2  . GLY A 1 42 ? 10.214  -6.738  -0.068  1.00 0.00 ? 42 GLY A HA2  3  
ATOM   3185  H  HA3  . GLY A 1 42 ? 11.829  -6.344  -0.638  1.00 0.00 ? 42 GLY A HA3  3  
ATOM   3186  N  N    . GLU A 1 43 ? 10.315  -3.768  -1.280  1.00 0.00 ? 43 GLU A N    3  
ATOM   3187  C  CA   . GLU A 1 43 ? 10.101  -2.352  -1.008  1.00 0.00 ? 43 GLU A CA   3  
ATOM   3188  C  C    . GLU A 1 43 ? 8.772   -2.126  -0.285  1.00 0.00 ? 43 GLU A C    3  
ATOM   3189  O  O    . GLU A 1 43 ? 7.773   -1.753  -0.896  1.00 0.00 ? 43 GLU A O    3  
ATOM   3190  C  CB   . GLU A 1 43 ? 10.129  -1.550  -2.313  1.00 0.00 ? 43 GLU A CB   3  
ATOM   3191  C  CG   . GLU A 1 43 ? 11.528  -1.240  -2.817  1.00 0.00 ? 43 GLU A CG   3  
ATOM   3192  C  CD   . GLU A 1 43 ? 11.588  0.068   -3.579  1.00 0.00 ? 43 GLU A CD   3  
ATOM   3193  O  OE1  . GLU A 1 43 ? 11.471  1.134   -2.937  1.00 0.00 ? 43 GLU A OE1  3  
ATOM   3194  O  OE2  . GLU A 1 43 ? 11.745  0.029   -4.817  1.00 0.00 ? 43 GLU A OE2  3  
ATOM   3195  H  H    . GLU A 1 43 ? 10.262  -4.081  -2.204  1.00 0.00 ? 43 GLU A H    3  
ATOM   3196  H  HA   . GLU A 1 43 ? 10.904  -2.014  -0.372  1.00 0.00 ? 43 GLU A HA   3  
ATOM   3197  H  HB2  . GLU A 1 43 ? 9.612   -2.111  -3.078  1.00 0.00 ? 43 GLU A HB2  3  
ATOM   3198  H  HB3  . GLU A 1 43 ? 9.612   -0.615  -2.158  1.00 0.00 ? 43 GLU A HB3  3  
ATOM   3199  H  HG2  . GLU A 1 43 ? 12.198  -1.180  -1.973  1.00 0.00 ? 43 GLU A HG2  3  
ATOM   3200  H  HG3  . GLU A 1 43 ? 11.846  -2.038  -3.474  1.00 0.00 ? 43 GLU A HG3  3  
ATOM   3201  N  N    . ASP A 1 44 ? 8.777   -2.356  1.021   1.00 0.00 ? 44 ASP A N    3  
ATOM   3202  C  CA   . ASP A 1 44 ? 7.585   -2.176  1.845   1.00 0.00 ? 44 ASP A CA   3  
ATOM   3203  C  C    . ASP A 1 44 ? 7.610   -0.809  2.532   1.00 0.00 ? 44 ASP A C    3  
ATOM   3204  O  O    . ASP A 1 44 ? 7.266   -0.683  3.710   1.00 0.00 ? 44 ASP A O    3  
ATOM   3205  C  CB   . ASP A 1 44 ? 7.472   -3.303  2.882   1.00 0.00 ? 44 ASP A CB   3  
ATOM   3206  C  CG   . ASP A 1 44 ? 8.733   -3.503  3.711   1.00 0.00 ? 44 ASP A CG   3  
ATOM   3207  O  OD1  . ASP A 1 44 ? 9.476   -2.523  3.931   1.00 0.00 ? 44 ASP A OD1  3  
ATOM   3208  O  OD2  . ASP A 1 44 ? 8.971   -4.648  4.147   1.00 0.00 ? 44 ASP A OD2  3  
ATOM   3209  H  H    . ASP A 1 44 ? 9.605   -2.650  1.442   1.00 0.00 ? 44 ASP A H    3  
ATOM   3210  H  HA   . ASP A 1 44 ? 6.723   -2.218  1.193   1.00 0.00 ? 44 ASP A HA   3  
ATOM   3211  H  HB2  . ASP A 1 44 ? 6.657   -3.081  3.554   1.00 0.00 ? 44 ASP A HB2  3  
ATOM   3212  H  HB3  . ASP A 1 44 ? 7.259   -4.227  2.366   1.00 0.00 ? 44 ASP A HB3  3  
ATOM   3213  N  N    . VAL A 1 45 ? 8.018   0.211   1.781   1.00 0.00 ? 45 VAL A N    3  
ATOM   3214  C  CA   . VAL A 1 45 ? 8.091   1.571   2.303   1.00 0.00 ? 45 VAL A CA   3  
ATOM   3215  C  C    . VAL A 1 45 ? 7.444   2.565   1.343   1.00 0.00 ? 45 VAL A C    3  
ATOM   3216  O  O    . VAL A 1 45 ? 7.678   2.521   0.134   1.00 0.00 ? 45 VAL A O    3  
ATOM   3217  C  CB   . VAL A 1 45 ? 9.550   2.002   2.572   1.00 0.00 ? 45 VAL A CB   3  
ATOM   3218  C  CG1  . VAL A 1 45 ? 10.370  1.986   1.288   1.00 0.00 ? 45 VAL A CG1  3  
ATOM   3219  C  CG2  . VAL A 1 45 ? 9.586   3.379   3.222   1.00 0.00 ? 45 VAL A CG2  3  
ATOM   3220  H  H    . VAL A 1 45 ? 8.275   0.044   0.850   1.00 0.00 ? 45 VAL A H    3  
ATOM   3221  H  HA   . VAL A 1 45 ? 7.556   1.594   3.240   1.00 0.00 ? 45 VAL A HA   3  
ATOM   3222  H  HB   . VAL A 1 45 ? 9.990   1.295   3.260   1.00 0.00 ? 45 VAL A HB   3  
ATOM   3223  H  HG11 . VAL A 1 45 ? 10.343  2.965   0.830   1.00 0.00 ? 45 VAL A HG11 3  
ATOM   3224  H  HG12 . VAL A 1 45 ? 9.956   1.261   0.605   1.00 0.00 ? 45 VAL A HG12 3  
ATOM   3225  H  HG13 . VAL A 1 45 ? 11.393  1.725   1.515   1.00 0.00 ? 45 VAL A HG13 3  
ATOM   3226  H  HG21 . VAL A 1 45 ? 9.256   4.121   2.509   1.00 0.00 ? 45 VAL A HG21 3  
ATOM   3227  H  HG22 . VAL A 1 45 ? 10.595  3.604   3.535   1.00 0.00 ? 45 VAL A HG22 3  
ATOM   3228  H  HG23 . VAL A 1 45 ? 8.931   3.388   4.080   1.00 0.00 ? 45 VAL A HG23 3  
ATOM   3229  N  N    . ALA A 1 46 ? 6.640   3.467   1.894   1.00 0.00 ? 46 ALA A N    3  
ATOM   3230  C  CA   . ALA A 1 46 ? 5.970   4.479   1.091   1.00 0.00 ? 46 ALA A CA   3  
ATOM   3231  C  C    . ALA A 1 46 ? 6.510   5.865   1.421   1.00 0.00 ? 46 ALA A C    3  
ATOM   3232  O  O    . ALA A 1 46 ? 6.720   6.197   2.590   1.00 0.00 ? 46 ALA A O    3  
ATOM   3233  C  CB   . ALA A 1 46 ? 4.464   4.424   1.305   1.00 0.00 ? 46 ALA A CB   3  
ATOM   3234  H  H    . ALA A 1 46 ? 6.499   3.457   2.864   1.00 0.00 ? 46 ALA A H    3  
ATOM   3235  H  HA   . ALA A 1 46 ? 6.171   4.264   0.051   1.00 0.00 ? 46 ALA A HA   3  
ATOM   3236  H  HB1  . ALA A 1 46 ? 4.152   5.270   1.900   1.00 0.00 ? 46 ALA A HB1  3  
ATOM   3237  H  HB2  . ALA A 1 46 ? 4.204   3.509   1.818   1.00 0.00 ? 46 ALA A HB2  3  
ATOM   3238  H  HB3  . ALA A 1 46 ? 3.963   4.454   0.348   1.00 0.00 ? 46 ALA A HB3  3  
ATOM   3239  N  N    . THR A 1 47 ? 6.740   6.668   0.386   1.00 0.00 ? 47 THR A N    3  
ATOM   3240  C  CA   . THR A 1 47 ? 7.261   8.019   0.566   1.00 0.00 ? 47 THR A CA   3  
ATOM   3241  C  C    . THR A 1 47 ? 6.257   9.059   0.072   1.00 0.00 ? 47 THR A C    3  
ATOM   3242  O  O    . THR A 1 47 ? 5.716   8.940   -1.028  1.00 0.00 ? 47 THR A O    3  
ATOM   3243  C  CB   . THR A 1 47 ? 8.598   8.180   -0.169  1.00 0.00 ? 47 THR A CB   3  
ATOM   3244  O  OG1  . THR A 1 47 ? 9.420   7.037   0.019   1.00 0.00 ? 47 THR A OG1  3  
ATOM   3245  C  CG2  . THR A 1 47 ? 9.390   9.391   0.283   1.00 0.00 ? 47 THR A CG2  3  
ATOM   3246  H  H    . THR A 1 47 ? 6.557   6.344   -0.522  1.00 0.00 ? 47 THR A H    3  
ATOM   3247  H  HA   . THR A 1 47 ? 7.424   8.169   1.623   1.00 0.00 ? 47 THR A HA   3  
ATOM   3248  H  HB   . THR A 1 47 ? 8.407   8.289   -1.228  1.00 0.00 ? 47 THR A HB   3  
ATOM   3249  H  HG1  . THR A 1 47 ? 9.472   6.827   0.955   1.00 0.00 ? 47 THR A HG1  3  
ATOM   3250  H  HG21 . THR A 1 47 ? 8.712   10.158  0.627   1.00 0.00 ? 47 THR A HG21 3  
ATOM   3251  H  HG22 . THR A 1 47 ? 9.972   9.770   -0.543  1.00 0.00 ? 47 THR A HG22 3  
ATOM   3252  H  HG23 . THR A 1 47 ? 10.052  9.108   1.088   1.00 0.00 ? 47 THR A HG23 3  
ATOM   3253  N  N    . CYS A 1 48 ? 6.015   10.076  0.898   1.00 0.00 ? 48 CYS A N    3  
ATOM   3254  C  CA   . CYS A 1 48 ? 5.080   11.145  0.558   1.00 0.00 ? 48 CYS A CA   3  
ATOM   3255  C  C    . CYS A 1 48 ? 5.831   12.346  -0.021  1.00 0.00 ? 48 CYS A C    3  
ATOM   3256  O  O    . CYS A 1 48 ? 6.636   12.965  0.670   1.00 0.00 ? 48 CYS A O    3  
ATOM   3257  C  CB   . CYS A 1 48 ? 4.289   11.571  1.801   1.00 0.00 ? 48 CYS A CB   3  
ATOM   3258  S  SG   . CYS A 1 48 ? 2.925   12.732  1.467   1.00 0.00 ? 48 CYS A SG   3  
ATOM   3259  H  H    . CYS A 1 48 ? 6.480   10.110  1.761   1.00 0.00 ? 48 CYS A H    3  
ATOM   3260  H  HA   . CYS A 1 48 ? 4.391   10.763  -0.181  1.00 0.00 ? 48 CYS A HA   3  
ATOM   3261  H  HB2  . CYS A 1 48 ? 3.861   10.694  2.262   1.00 0.00 ? 48 CYS A HB2  3  
ATOM   3262  H  HB3  . CYS A 1 48 ? 4.961   12.047  2.500   1.00 0.00 ? 48 CYS A HB3  3  
ATOM   3263  N  N    . PRO A 1 49 ? 5.585   12.685  -1.301  1.00 0.00 ? 49 PRO A N    3  
ATOM   3264  C  CA   . PRO A 1 49 ? 6.254   13.816  -1.968  1.00 0.00 ? 49 PRO A CA   3  
ATOM   3265  C  C    . PRO A 1 49 ? 6.100   15.149  -1.226  1.00 0.00 ? 49 PRO A C    3  
ATOM   3266  O  O    . PRO A 1 49 ? 6.875   16.079  -1.455  1.00 0.00 ? 49 PRO A O    3  
ATOM   3267  C  CB   . PRO A 1 49 ? 5.556   13.889  -3.328  1.00 0.00 ? 49 PRO A CB   3  
ATOM   3268  C  CG   . PRO A 1 49 ? 5.028   12.517  -3.559  1.00 0.00 ? 49 PRO A CG   3  
ATOM   3269  C  CD   . PRO A 1 49 ? 4.649   11.991  -2.203  1.00 0.00 ? 49 PRO A CD   3  
ATOM   3270  H  HA   . PRO A 1 49 ? 7.303   13.615  -2.116  1.00 0.00 ? 49 PRO A HA   3  
ATOM   3271  H  HB2  . PRO A 1 49 ? 4.759   14.617  -3.288  1.00 0.00 ? 49 PRO A HB2  3  
ATOM   3272  H  HB3  . PRO A 1 49 ? 6.270   14.168  -4.088  1.00 0.00 ? 49 PRO A HB3  3  
ATOM   3273  H  HG2  . PRO A 1 49 ? 4.161   12.560  -4.200  1.00 0.00 ? 49 PRO A HG2  3  
ATOM   3274  H  HG3  . PRO A 1 49 ? 5.793   11.896  -4.000  1.00 0.00 ? 49 PRO A HG3  3  
ATOM   3275  H  HD2  . PRO A 1 49 ? 3.626   12.247  -1.970  1.00 0.00 ? 49 PRO A HD2  3  
ATOM   3276  H  HD3  . PRO A 1 49 ? 4.793   10.922  -2.156  1.00 0.00 ? 49 PRO A HD3  3  
ATOM   3277  N  N    . SER A 1 50 ? 5.098   15.244  -0.347  1.00 0.00 ? 50 SER A N    3  
ATOM   3278  C  CA   . SER A 1 50 ? 4.859   16.473  0.409   1.00 0.00 ? 50 SER A CA   3  
ATOM   3279  C  C    . SER A 1 50 ? 5.759   16.551  1.644   1.00 0.00 ? 50 SER A C    3  
ATOM   3280  O  O    . SER A 1 50 ? 6.733   17.304  1.661   1.00 0.00 ? 50 SER A O    3  
ATOM   3281  C  CB   . SER A 1 50 ? 3.387   16.568  0.817   1.00 0.00 ? 50 SER A CB   3  
ATOM   3282  O  OG   . SER A 1 50 ? 2.646   17.322  -0.129  1.00 0.00 ? 50 SER A OG   3  
ATOM   3283  H  H    . SER A 1 50 ? 4.505   14.477  -0.208  1.00 0.00 ? 50 SER A H    3  
ATOM   3284  H  HA   . SER A 1 50 ? 5.093   17.305  -0.239  1.00 0.00 ? 50 SER A HA   3  
ATOM   3285  H  HB2  . SER A 1 50 ? 2.964   15.575  0.876   1.00 0.00 ? 50 SER A HB2  3  
ATOM   3286  H  HB3  . SER A 1 50 ? 3.313   17.050  1.782   1.00 0.00 ? 50 SER A HB3  3  
ATOM   3287  H  HG   . SER A 1 50 ? 2.532   18.216  0.197   1.00 0.00 ? 50 SER A HG   3  
ATOM   3288  N  N    . CYS A 1 51 ? 5.426   15.776  2.679   1.00 0.00 ? 51 CYS A N    3  
ATOM   3289  C  CA   . CYS A 1 51 ? 6.208   15.772  3.918   1.00 0.00 ? 51 CYS A CA   3  
ATOM   3290  C  C    . CYS A 1 51 ? 7.536   15.027  3.760   1.00 0.00 ? 51 CYS A C    3  
ATOM   3291  O  O    . CYS A 1 51 ? 8.477   15.261  4.520   1.00 0.00 ? 51 CYS A O    3  
ATOM   3292  C  CB   . CYS A 1 51 ? 5.402   15.147  5.060   1.00 0.00 ? 51 CYS A CB   3  
ATOM   3293  S  SG   . CYS A 1 51 ? 4.943   13.403  4.787   1.00 0.00 ? 51 CYS A SG   3  
ATOM   3294  H  H    . CYS A 1 51 ? 4.636   15.197  2.610   1.00 0.00 ? 51 CYS A H    3  
ATOM   3295  H  HA   . CYS A 1 51 ? 6.421   16.799  4.171   1.00 0.00 ? 51 CYS A HA   3  
ATOM   3296  H  HB2  . CYS A 1 51 ? 5.987   15.194  5.966   1.00 0.00 ? 51 CYS A HB2  3  
ATOM   3297  H  HB3  . CYS A 1 51 ? 4.491   15.710  5.197   1.00 0.00 ? 51 CYS A HB3  3  
ATOM   3298  N  N    . SER A 1 52 ? 7.604   14.126  2.779   1.00 0.00 ? 52 SER A N    3  
ATOM   3299  C  CA   . SER A 1 52 ? 8.811   13.341  2.529   1.00 0.00 ? 52 SER A CA   3  
ATOM   3300  C  C    . SER A 1 52 ? 9.124   12.432  3.718   1.00 0.00 ? 52 SER A C    3  
ATOM   3301  O  O    . SER A 1 52 ? 10.271  12.342  4.167   1.00 0.00 ? 52 SER A O    3  
ATOM   3302  C  CB   . SER A 1 52 ? 9.997   14.262  2.226   1.00 0.00 ? 52 SER A CB   3  
ATOM   3303  O  OG   . SER A 1 52 ? 10.133  14.476  0.832   1.00 0.00 ? 52 SER A OG   3  
ATOM   3304  H  H    . SER A 1 52 ? 6.818   13.977  2.213   1.00 0.00 ? 52 SER A H    3  
ATOM   3305  H  HA   . SER A 1 52 ? 8.623   12.721  1.664   1.00 0.00 ? 52 SER A HA   3  
ATOM   3306  H  HB2  . SER A 1 52 ? 9.845   15.214  2.710   1.00 0.00 ? 52 SER A HB2  3  
ATOM   3307  H  HB3  . SER A 1 52 ? 10.906  13.811  2.597   1.00 0.00 ? 52 SER A HB3  3  
ATOM   3308  H  HG   . SER A 1 52 ? 10.340  15.399  0.668   1.00 0.00 ? 52 SER A HG   3  
ATOM   3309  N  N    . LEU A 1 53 ? 8.093   11.756  4.221   1.00 0.00 ? 53 LEU A N    3  
ATOM   3310  C  CA   . LEU A 1 53 ? 8.242   10.849  5.355   1.00 0.00 ? 53 LEU A CA   3  
ATOM   3311  C  C    . LEU A 1 53 ? 8.283   9.395   4.886   1.00 0.00 ? 53 LEU A C    3  
ATOM   3312  O  O    . LEU A 1 53 ? 8.188   9.116   3.688   1.00 0.00 ? 53 LEU A O    3  
ATOM   3313  C  CB   . LEU A 1 53 ? 7.095   11.048  6.350   1.00 0.00 ? 53 LEU A CB   3  
ATOM   3314  C  CG   . LEU A 1 53 ? 7.419   11.945  7.548   1.00 0.00 ? 53 LEU A CG   3  
ATOM   3315  C  CD1  . LEU A 1 53 ? 7.382   13.414  7.150   1.00 0.00 ? 53 LEU A CD1  3  
ATOM   3316  C  CD2  . LEU A 1 53 ? 6.447   11.675  8.688   1.00 0.00 ? 53 LEU A CD2  3  
ATOM   3317  H  H    . LEU A 1 53 ? 7.205   11.869  3.817   1.00 0.00 ? 53 LEU A H    3  
ATOM   3318  H  HA   . LEU A 1 53 ? 9.177   11.083  5.844   1.00 0.00 ? 53 LEU A HA   3  
ATOM   3319  H  HB2  . LEU A 1 53 ? 6.257   11.479  5.819   1.00 0.00 ? 53 LEU A HB2  3  
ATOM   3320  H  HB3  . LEU A 1 53 ? 6.799   10.080  6.724   1.00 0.00 ? 53 LEU A HB3  3  
ATOM   3321  H  HG   . LEU A 1 53 ? 8.416   11.720  7.898   1.00 0.00 ? 53 LEU A HG   3  
ATOM   3322  H  HD11 . LEU A 1 53 ? 7.515   13.502  6.082   1.00 0.00 ? 53 LEU A HD11 3  
ATOM   3323  H  HD12 . LEU A 1 53 ? 8.174   13.945  7.656   1.00 0.00 ? 53 LEU A HD12 3  
ATOM   3324  H  HD13 . LEU A 1 53 ? 6.429   13.840  7.430   1.00 0.00 ? 53 LEU A HD13 3  
ATOM   3325  H  HD21 . LEU A 1 53 ? 6.388   10.611  8.866   1.00 0.00 ? 53 LEU A HD21 3  
ATOM   3326  H  HD22 . LEU A 1 53 ? 5.470   12.052  8.424   1.00 0.00 ? 53 LEU A HD22 3  
ATOM   3327  H  HD23 . LEU A 1 53 ? 6.795   12.171  9.582   1.00 0.00 ? 53 LEU A HD23 3  
ATOM   3328  N  N    . ILE A 1 54 ? 8.426   8.473   5.837   1.00 0.00 ? 54 ILE A N    3  
ATOM   3329  C  CA   . ILE A 1 54 ? 8.482   7.047   5.522   1.00 0.00 ? 54 ILE A CA   3  
ATOM   3330  C  C    . ILE A 1 54 ? 7.459   6.256   6.338   1.00 0.00 ? 54 ILE A C    3  
ATOM   3331  O  O    . ILE A 1 54 ? 7.215   6.561   7.508   1.00 0.00 ? 54 ILE A O    3  
ATOM   3332  C  CB   . ILE A 1 54 ? 9.892   6.473   5.785   1.00 0.00 ? 54 ILE A CB   3  
ATOM   3333  C  CG1  . ILE A 1 54 ? 10.387  6.875   7.179   1.00 0.00 ? 54 ILE A CG1  3  
ATOM   3334  C  CG2  . ILE A 1 54 ? 10.869  6.945   4.715   1.00 0.00 ? 54 ILE A CG2  3  
ATOM   3335  C  CD1  . ILE A 1 54 ? 11.613  6.111   7.632   1.00 0.00 ? 54 ILE A CD1  3  
ATOM   3336  H  H    . ILE A 1 54 ? 8.497   8.757   6.772   1.00 0.00 ? 54 ILE A H    3  
ATOM   3337  H  HA   . ILE A 1 54 ? 8.258   6.927   4.471   1.00 0.00 ? 54 ILE A HA   3  
ATOM   3338  H  HB   . ILE A 1 54 ? 9.831   5.396   5.729   1.00 0.00 ? 54 ILE A HB   3  
ATOM   3339  H  HG12 . ILE A 1 54 ? 10.635  7.926   7.177   1.00 0.00 ? 54 ILE A HG12 3  
ATOM   3340  H  HG13 . ILE A 1 54 ? 9.601   6.697   7.899   1.00 0.00 ? 54 ILE A HG13 3  
ATOM   3341  H  HG21 . ILE A 1 54 ? 10.669  7.978   4.474   1.00 0.00 ? 54 ILE A HG21 3  
ATOM   3342  H  HG22 . ILE A 1 54 ? 10.753  6.340   3.828   1.00 0.00 ? 54 ILE A HG22 3  
ATOM   3343  H  HG23 . ILE A 1 54 ? 11.881  6.851   5.084   1.00 0.00 ? 54 ILE A HG23 3  
ATOM   3344  H  HD11 . ILE A 1 54 ? 11.699  5.198   7.062   1.00 0.00 ? 54 ILE A HD11 3  
ATOM   3345  H  HD12 . ILE A 1 54 ? 11.523  5.874   8.680   1.00 0.00 ? 54 ILE A HD12 3  
ATOM   3346  H  HD13 . ILE A 1 54 ? 12.493  6.717   7.473   1.00 0.00 ? 54 ILE A HD13 3  
ATOM   3347  N  N    . ILE A 1 55 ? 6.875   5.232   5.714   1.00 0.00 ? 55 ILE A N    3  
ATOM   3348  C  CA   . ILE A 1 55 ? 5.886   4.383   6.378   1.00 0.00 ? 55 ILE A CA   3  
ATOM   3349  C  C    . ILE A 1 55 ? 6.105   2.912   6.027   1.00 0.00 ? 55 ILE A C    3  
ATOM   3350  O  O    . ILE A 1 55 ? 6.724   2.596   5.009   1.00 0.00 ? 55 ILE A O    3  
ATOM   3351  C  CB   . ILE A 1 55 ? 4.438   4.775   6.007   1.00 0.00 ? 55 ILE A CB   3  
ATOM   3352  C  CG1  . ILE A 1 55 ? 4.233   4.728   4.490   1.00 0.00 ? 55 ILE A CG1  3  
ATOM   3353  C  CG2  . ILE A 1 55 ? 4.101   6.157   6.549   1.00 0.00 ? 55 ILE A CG2  3  
ATOM   3354  C  CD1  . ILE A 1 55 ? 2.807   4.422   4.082   1.00 0.00 ? 55 ILE A CD1  3  
ATOM   3355  H  H    . ILE A 1 55 ? 7.120   5.039   4.783   1.00 0.00 ? 55 ILE A H    3  
ATOM   3356  H  HA   . ILE A 1 55 ? 6.007   4.507   7.444   1.00 0.00 ? 55 ILE A HA   3  
ATOM   3357  H  HB   . ILE A 1 55 ? 3.771   4.065   6.472   1.00 0.00 ? 55 ILE A HB   3  
ATOM   3358  H  HG12 . ILE A 1 55 ? 4.499   5.685   4.066   1.00 0.00 ? 55 ILE A HG12 3  
ATOM   3359  H  HG13 . ILE A 1 55 ? 4.869   3.965   4.069   1.00 0.00 ? 55 ILE A HG13 3  
ATOM   3360  H  HG21 . ILE A 1 55 ? 4.824   6.872   6.189   1.00 0.00 ? 55 ILE A HG21 3  
ATOM   3361  H  HG22 . ILE A 1 55 ? 4.121   6.134   7.628   1.00 0.00 ? 55 ILE A HG22 3  
ATOM   3362  H  HG23 . ILE A 1 55 ? 3.114   6.443   6.213   1.00 0.00 ? 55 ILE A HG23 3  
ATOM   3363  H  HD11 . ILE A 1 55 ? 2.435   5.213   3.450   1.00 0.00 ? 55 ILE A HD11 3  
ATOM   3364  H  HD12 . ILE A 1 55 ? 2.188   4.346   4.964   1.00 0.00 ? 55 ILE A HD12 3  
ATOM   3365  H  HD13 . ILE A 1 55 ? 2.780   3.486   3.541   1.00 0.00 ? 55 ILE A HD13 3  
ATOM   3366  N  N    . LYS A 1 56 ? 5.598   2.018   6.874   1.00 0.00 ? 56 LYS A N    3  
ATOM   3367  C  CA   . LYS A 1 56 ? 5.746   0.582   6.647   1.00 0.00 ? 56 LYS A CA   3  
ATOM   3368  C  C    . LYS A 1 56 ? 4.466   -0.031  6.109   1.00 0.00 ? 56 LYS A C    3  
ATOM   3369  O  O    . LYS A 1 56 ? 3.374   0.205   6.629   1.00 0.00 ? 56 LYS A O    3  
ATOM   3370  C  CB   . LYS A 1 56 ? 6.167   -0.126  7.937   1.00 0.00 ? 56 LYS A CB   3  
ATOM   3371  C  CG   . LYS A 1 56 ? 7.218   -1.203  7.726   1.00 0.00 ? 56 LYS A CG   3  
ATOM   3372  C  CD   . LYS A 1 56 ? 6.621   -2.455  7.098   1.00 0.00 ? 56 LYS A CD   3  
ATOM   3373  C  CE   . LYS A 1 56 ? 7.606   -3.615  7.117   1.00 0.00 ? 56 LYS A CE   3  
ATOM   3374  N  NZ   . LYS A 1 56 ? 7.737   -4.213  8.476   1.00 0.00 ? 56 LYS A NZ   3  
ATOM   3375  H  H    . LYS A 1 56 ? 5.115   2.330   7.669   1.00 0.00 ? 56 LYS A H    3  
ATOM   3376  H  HA   . LYS A 1 56 ? 6.513   0.444   5.904   1.00 0.00 ? 56 LYS A HA   3  
ATOM   3377  H  HB2  . LYS A 1 56 ? 6.567   0.607   8.623   1.00 0.00 ? 56 LYS A HB2  3  
ATOM   3378  H  HB3  . LYS A 1 56 ? 5.297   -0.586  8.384   1.00 0.00 ? 56 LYS A HB3  3  
ATOM   3379  H  HG2  . LYS A 1 56 ? 7.988   -0.819  7.075   1.00 0.00 ? 56 LYS A HG2  3  
ATOM   3380  H  HG3  . LYS A 1 56 ? 7.648   -1.461  8.682   1.00 0.00 ? 56 LYS A HG3  3  
ATOM   3381  H  HD2  . LYS A 1 56 ? 5.738   -2.736  7.651   1.00 0.00 ? 56 LYS A HD2  3  
ATOM   3382  H  HD3  . LYS A 1 56 ? 6.354   -2.240  6.074   1.00 0.00 ? 56 LYS A HD3  3  
ATOM   3383  H  HE2  . LYS A 1 56 ? 7.260   -4.374  6.432   1.00 0.00 ? 56 LYS A HE2  3  
ATOM   3384  H  HE3  . LYS A 1 56 ? 8.573   -3.255  6.796   1.00 0.00 ? 56 LYS A HE3  3  
ATOM   3385  H  HZ1  . LYS A 1 56 ? 6.960   -4.882  8.649   1.00 0.00 ? 56 LYS A HZ1  3  
ATOM   3386  H  HZ2  . LYS A 1 56 ? 7.708   -3.469  9.201   1.00 0.00 ? 56 LYS A HZ2  3  
ATOM   3387  H  HZ3  . LYS A 1 56 ? 8.640   -4.723  8.557   1.00 0.00 ? 56 LYS A HZ3  3  
ATOM   3388  N  N    . VAL A 1 57 ? 4.622   -0.824  5.054   1.00 0.00 ? 57 VAL A N    3  
ATOM   3389  C  CA   . VAL A 1 57 ? 3.499   -1.485  4.414   1.00 0.00 ? 57 VAL A CA   3  
ATOM   3390  C  C    . VAL A 1 57 ? 3.523   -2.987  4.684   1.00 0.00 ? 57 VAL A C    3  
ATOM   3391  O  O    . VAL A 1 57 ? 4.418   -3.697  4.224   1.00 0.00 ? 57 VAL A O    3  
ATOM   3392  C  CB   . VAL A 1 57 ? 3.493   -1.237  2.889   1.00 0.00 ? 57 VAL A CB   3  
ATOM   3393  C  CG1  . VAL A 1 57 ? 2.068   -1.112  2.394   1.00 0.00 ? 57 VAL A CG1  3  
ATOM   3394  C  CG2  . VAL A 1 57 ? 4.287   0.014   2.524   1.00 0.00 ? 57 VAL A CG2  3  
ATOM   3395  H  H    . VAL A 1 57 ? 5.525   -0.964  4.694   1.00 0.00 ? 57 VAL A H    3  
ATOM   3396  H  HA   . VAL A 1 57 ? 2.590   -1.070  4.828   1.00 0.00 ? 57 VAL A HA   3  
ATOM   3397  H  HB   . VAL A 1 57 ? 3.952   -2.086  2.399   1.00 0.00 ? 57 VAL A HB   3  
ATOM   3398  H  HG11 . VAL A 1 57 ? 1.557   -0.368  2.984   1.00 0.00 ? 57 VAL A HG11 3  
ATOM   3399  H  HG12 . VAL A 1 57 ? 1.568   -2.062  2.498   1.00 0.00 ? 57 VAL A HG12 3  
ATOM   3400  H  HG13 . VAL A 1 57 ? 2.072   -0.813  1.358   1.00 0.00 ? 57 VAL A HG13 3  
ATOM   3401  H  HG21 . VAL A 1 57 ? 5.285   -0.062  2.925   1.00 0.00 ? 57 VAL A HG21 3  
ATOM   3402  H  HG22 . VAL A 1 57 ? 3.798   0.884   2.937   1.00 0.00 ? 57 VAL A HG22 3  
ATOM   3403  H  HG23 . VAL A 1 57 ? 4.338   0.106   1.450   1.00 0.00 ? 57 VAL A HG23 3  
ATOM   3404  N  N    . ILE A 1 58 ? 2.531   -3.466  5.436   1.00 0.00 ? 58 ILE A N    3  
ATOM   3405  C  CA   . ILE A 1 58 ? 2.435   -4.885  5.770   1.00 0.00 ? 58 ILE A CA   3  
ATOM   3406  C  C    . ILE A 1 58 ? 1.526   -5.617  4.786   1.00 0.00 ? 58 ILE A C    3  
ATOM   3407  O  O    . ILE A 1 58 ? 0.450   -5.131  4.443   1.00 0.00 ? 58 ILE A O    3  
ATOM   3408  C  CB   . ILE A 1 58 ? 1.905   -5.096  7.205   1.00 0.00 ? 58 ILE A CB   3  
ATOM   3409  C  CG1  . ILE A 1 58 ? 2.677   -4.221  8.198   1.00 0.00 ? 58 ILE A CG1  3  
ATOM   3410  C  CG2  . ILE A 1 58 ? 2.002   -6.565  7.596   1.00 0.00 ? 58 ILE A CG2  3  
ATOM   3411  C  CD1  . ILE A 1 58 ? 4.145   -4.576  8.316   1.00 0.00 ? 58 ILE A CD1  3  
ATOM   3412  H  H    . ILE A 1 58 ? 1.847   -2.848  5.775   1.00 0.00 ? 58 ILE A H    3  
ATOM   3413  H  HA   . ILE A 1 58 ? 3.429   -5.307  5.709   1.00 0.00 ? 58 ILE A HA   3  
ATOM   3414  H  HB   . ILE A 1 58 ? 0.863   -4.815  7.223   1.00 0.00 ? 58 ILE A HB   3  
ATOM   3415  H  HG12 . ILE A 1 58 ? 2.611   -3.189  7.887   1.00 0.00 ? 58 ILE A HG12 3  
ATOM   3416  H  HG13 . ILE A 1 58 ? 2.231   -4.324  9.177   1.00 0.00 ? 58 ILE A HG13 3  
ATOM   3417  H  HG21 . ILE A 1 58 ? 1.114   -7.085  7.267   1.00 0.00 ? 58 ILE A HG21 3  
ATOM   3418  H  HG22 . ILE A 1 58 ? 2.088   -6.648  8.670   1.00 0.00 ? 58 ILE A HG22 3  
ATOM   3419  H  HG23 . ILE A 1 58 ? 2.871   -7.007  7.131   1.00 0.00 ? 58 ILE A HG23 3  
ATOM   3420  H  HD11 . ILE A 1 58 ? 4.243   -5.589  8.676   1.00 0.00 ? 58 ILE A HD11 3  
ATOM   3421  H  HD12 . ILE A 1 58 ? 4.624   -3.900  9.008   1.00 0.00 ? 58 ILE A HD12 3  
ATOM   3422  H  HD13 . ILE A 1 58 ? 4.614   -4.491  7.347   1.00 0.00 ? 58 ILE A HD13 3  
ATOM   3423  N  N    . TYR A 1 59 ? 1.971   -6.785  4.331   1.00 0.00 ? 59 TYR A N    3  
ATOM   3424  C  CA   . TYR A 1 59 ? 1.208   -7.588  3.375   1.00 0.00 ? 59 TYR A CA   3  
ATOM   3425  C  C    . TYR A 1 59 ? 1.584   -9.065  3.496   1.00 0.00 ? 59 TYR A C    3  
ATOM   3426  O  O    . TYR A 1 59 ? 2.450   -9.429  4.293   1.00 0.00 ? 59 TYR A O    3  
ATOM   3427  C  CB   . TYR A 1 59 ? 1.472   -7.090  1.948   1.00 0.00 ? 59 TYR A CB   3  
ATOM   3428  C  CG   . TYR A 1 59 ? 2.945   -6.958  1.629   1.00 0.00 ? 59 TYR A CG   3  
ATOM   3429  C  CD1  . TYR A 1 59 ? 3.665   -5.846  2.049   1.00 0.00 ? 59 TYR A CD1  3  
ATOM   3430  C  CD2  . TYR A 1 59 ? 3.619   -7.949  0.925   1.00 0.00 ? 59 TYR A CD2  3  
ATOM   3431  C  CE1  . TYR A 1 59 ? 5.012   -5.724  1.777   1.00 0.00 ? 59 TYR A CE1  3  
ATOM   3432  C  CE2  . TYR A 1 59 ? 4.968   -7.836  0.654   1.00 0.00 ? 59 TYR A CE2  3  
ATOM   3433  C  CZ   . TYR A 1 59 ? 5.659   -6.720  1.081   1.00 0.00 ? 59 TYR A CZ   3  
ATOM   3434  O  OH   . TYR A 1 59 ? 7.003   -6.605  0.818   1.00 0.00 ? 59 TYR A OH   3  
ATOM   3435  H  H    . TYR A 1 59 ? 2.841   -7.115  4.640   1.00 0.00 ? 59 TYR A H    3  
ATOM   3436  H  HA   . TYR A 1 59 ? 0.158   -7.472  3.603   1.00 0.00 ? 59 TYR A HA   3  
ATOM   3437  H  HB2  . TYR A 1 59 ? 1.038   -7.783  1.243   1.00 0.00 ? 59 TYR A HB2  3  
ATOM   3438  H  HB3  . TYR A 1 59 ? 1.015   -6.119  1.821   1.00 0.00 ? 59 TYR A HB3  3  
ATOM   3439  H  HD1  . TYR A 1 59 ? 3.154   -5.066  2.595   1.00 0.00 ? 59 TYR A HD1  3  
ATOM   3440  H  HD2  . TYR A 1 59 ? 3.073   -8.820  0.590   1.00 0.00 ? 59 TYR A HD2  3  
ATOM   3441  H  HE1  . TYR A 1 59 ? 5.553   -4.851  2.110   1.00 0.00 ? 59 TYR A HE1  3  
ATOM   3442  H  HE2  . TYR A 1 59 ? 5.474   -8.618  0.104   1.00 0.00 ? 59 TYR A HE2  3  
ATOM   3443  H  HH   . TYR A 1 59 ? 7.501   -7.093  1.479   1.00 0.00 ? 59 TYR A HH   3  
ATOM   3444  N  N    . ASP A 1 60 ? 0.937   -9.916  2.697   1.00 0.00 ? 60 ASP A N    3  
ATOM   3445  C  CA   . ASP A 1 60 ? 1.224   -11.347 2.723   1.00 0.00 ? 60 ASP A CA   3  
ATOM   3446  C  C    . ASP A 1 60 ? 2.305   -11.705 1.708   1.00 0.00 ? 60 ASP A C    3  
ATOM   3447  O  O    . ASP A 1 60 ? 2.029   -11.846 0.515   1.00 0.00 ? 60 ASP A O    3  
ATOM   3448  C  CB   . ASP A 1 60 ? -0.044  -12.162 2.450   1.00 0.00 ? 60 ASP A CB   3  
ATOM   3449  C  CG   . ASP A 1 60 ? 0.028   -13.560 3.041   1.00 0.00 ? 60 ASP A CG   3  
ATOM   3450  O  OD1  . ASP A 1 60 ? 0.547   -13.706 4.168   1.00 0.00 ? 60 ASP A OD1  3  
ATOM   3451  O  OD2  . ASP A 1 60 ? -0.435  -14.508 2.376   1.00 0.00 ? 60 ASP A OD2  3  
ATOM   3452  H  H    . ASP A 1 60 ? 0.262   -9.575  2.073   1.00 0.00 ? 60 ASP A H    3  
ATOM   3453  H  HA   . ASP A 1 60 ? 1.587   -11.589 3.712   1.00 0.00 ? 60 ASP A HA   3  
ATOM   3454  H  HB2  . ASP A 1 60 ? -0.892  -11.653 2.881   1.00 0.00 ? 60 ASP A HB2  3  
ATOM   3455  H  HB3  . ASP A 1 60 ? -0.186  -12.251 1.383   1.00 0.00 ? 60 ASP A HB3  3  
ATOM   3456  N  N    . LYS A 1 61 ? 3.538   -11.853 2.193   1.00 0.00 ? 61 LYS A N    3  
ATOM   3457  C  CA   . LYS A 1 61 ? 4.667   -12.203 1.332   1.00 0.00 ? 61 LYS A CA   3  
ATOM   3458  C  C    . LYS A 1 61 ? 4.428   -13.533 0.619   1.00 0.00 ? 61 LYS A C    3  
ATOM   3459  O  O    . LYS A 1 61 ? 4.915   -13.745 -0.492  1.00 0.00 ? 61 LYS A O    3  
ATOM   3460  C  CB   . LYS A 1 61 ? 5.958   -12.274 2.152   1.00 0.00 ? 61 LYS A CB   3  
ATOM   3461  C  CG   . LYS A 1 61 ? 6.526   -10.911 2.514   1.00 0.00 ? 61 LYS A CG   3  
ATOM   3462  C  CD   . LYS A 1 61 ? 7.660   -10.511 1.582   1.00 0.00 ? 61 LYS A CD   3  
ATOM   3463  C  CE   . LYS A 1 61 ? 8.784   -9.816  2.336   1.00 0.00 ? 61 LYS A CE   3  
ATOM   3464  N  NZ   . LYS A 1 61 ? 10.125  -10.186 1.805   1.00 0.00 ? 61 LYS A NZ   3  
ATOM   3465  H  H    . LYS A 1 61 ? 3.690   -11.730 3.155   1.00 0.00 ? 61 LYS A H    3  
ATOM   3466  H  HA   . LYS A 1 61 ? 4.769   -11.426 0.590   1.00 0.00 ? 61 LYS A HA   3  
ATOM   3467  H  HB2  . LYS A 1 61 ? 5.761   -12.812 3.067   1.00 0.00 ? 61 LYS A HB2  3  
ATOM   3468  H  HB3  . LYS A 1 61 ? 6.704   -12.811 1.583   1.00 0.00 ? 61 LYS A HB3  3  
ATOM   3469  H  HG2  . LYS A 1 61 ? 5.741   -10.173 2.446   1.00 0.00 ? 61 LYS A HG2  3  
ATOM   3470  H  HG3  . LYS A 1 61 ? 6.902   -10.948 3.527   1.00 0.00 ? 61 LYS A HG3  3  
ATOM   3471  H  HD2  . LYS A 1 61 ? 8.053   -11.396 1.108   1.00 0.00 ? 61 LYS A HD2  3  
ATOM   3472  H  HD3  . LYS A 1 61 ? 7.274   -9.838  0.830   1.00 0.00 ? 61 LYS A HD3  3  
ATOM   3473  H  HE2  . LYS A 1 61 ? 8.653   -8.747  2.246   1.00 0.00 ? 61 LYS A HE2  3  
ATOM   3474  H  HE3  . LYS A 1 61 ? 8.727   -10.097 3.376   1.00 0.00 ? 61 LYS A HE3  3  
ATOM   3475  H  HZ1  . LYS A 1 61 ? 10.086  -10.297 0.771   1.00 0.00 ? 61 LYS A HZ1  3  
ATOM   3476  H  HZ2  . LYS A 1 61 ? 10.441  -11.083 2.227   1.00 0.00 ? 61 LYS A HZ2  3  
ATOM   3477  H  HZ3  . LYS A 1 61 ? 10.817  -9.445  2.036   1.00 0.00 ? 61 LYS A HZ3  3  
ATOM   3478  N  N    . ASP A 1 62 ? 3.672   -14.427 1.262   1.00 0.00 ? 62 ASP A N    3  
ATOM   3479  C  CA   . ASP A 1 62 ? 3.365   -15.733 0.683   1.00 0.00 ? 62 ASP A CA   3  
ATOM   3480  C  C    . ASP A 1 62 ? 2.502   -15.586 -0.570  1.00 0.00 ? 62 ASP A C    3  
ATOM   3481  O  O    . ASP A 1 62 ? 2.696   -16.304 -1.550  1.00 0.00 ? 62 ASP A O    3  
ATOM   3482  C  CB   . ASP A 1 62 ? 2.653   -16.619 1.712   1.00 0.00 ? 62 ASP A CB   3  
ATOM   3483  C  CG   . ASP A 1 62 ? 3.620   -17.432 2.555   1.00 0.00 ? 62 ASP A CG   3  
ATOM   3484  O  OD1  . ASP A 1 62 ? 4.706   -16.910 2.890   1.00 0.00 ? 62 ASP A OD1  3  
ATOM   3485  O  OD2  . ASP A 1 62 ? 3.291   -18.592 2.881   1.00 0.00 ? 62 ASP A OD2  3  
ATOM   3486  H  H    . ASP A 1 62 ? 3.310   -14.202 2.145   1.00 0.00 ? 62 ASP A H    3  
ATOM   3487  H  HA   . ASP A 1 62 ? 4.299   -16.199 0.407   1.00 0.00 ? 62 ASP A HA   3  
ATOM   3488  H  HB2  . ASP A 1 62 ? 2.069   -15.996 2.372   1.00 0.00 ? 62 ASP A HB2  3  
ATOM   3489  H  HB3  . ASP A 1 62 ? 1.996   -17.302 1.193   1.00 0.00 ? 62 ASP A HB3  3  
ATOM   3490  N  N    . GLN A 1 63 ? 1.555   -14.647 -0.533  1.00 0.00 ? 63 GLN A N    3  
ATOM   3491  C  CA   . GLN A 1 63 ? 0.673   -14.406 -1.672  1.00 0.00 ? 63 GLN A CA   3  
ATOM   3492  C  C    . GLN A 1 63 ? 1.417   -13.679 -2.791  1.00 0.00 ? 63 GLN A C    3  
ATOM   3493  O  O    . GLN A 1 63 ? 1.264   -14.010 -3.965  1.00 0.00 ? 63 GLN A O    3  
ATOM   3494  C  CB   . GLN A 1 63 ? -0.544  -13.585 -1.241  1.00 0.00 ? 63 GLN A CB   3  
ATOM   3495  C  CG   . GLN A 1 63 ? -1.555  -14.375 -0.425  1.00 0.00 ? 63 GLN A CG   3  
ATOM   3496  C  CD   . GLN A 1 63 ? -2.777  -14.772 -1.232  1.00 0.00 ? 63 GLN A CD   3  
ATOM   3497  O  OE1  . GLN A 1 63 ? -2.662  -15.266 -2.354  1.00 0.00 ? 63 GLN A OE1  3  
ATOM   3498  N  NE2  . GLN A 1 63 ? -3.958  -14.555 -0.665  1.00 0.00 ? 63 GLN A NE2  3  
ATOM   3499  H  H    . GLN A 1 63 ? 1.451   -14.102 0.277   1.00 0.00 ? 63 GLN A H    3  
ATOM   3500  H  HA   . GLN A 1 63 ? 0.337   -15.364 -2.041  1.00 0.00 ? 63 GLN A HA   3  
ATOM   3501  H  HB2  . GLN A 1 63 ? -0.209  -12.749 -0.646  1.00 0.00 ? 63 GLN A HB2  3  
ATOM   3502  H  HB3  . GLN A 1 63 ? -1.042  -13.211 -2.124  1.00 0.00 ? 63 GLN A HB3  3  
ATOM   3503  H  HG2  . GLN A 1 63 ? -1.080  -15.272 -0.057  1.00 0.00 ? 63 GLN A HG2  3  
ATOM   3504  H  HG3  . GLN A 1 63 ? -1.873  -13.770 0.411   1.00 0.00 ? 63 GLN A HG3  3  
ATOM   3505  H  HE21 . GLN A 1 63 ? -3.976  -14.156 0.231   1.00 0.00 ? 63 GLN A HE21 3  
ATOM   3506  H  HE22 . GLN A 1 63 ? -4.764  -14.805 -1.163  1.00 0.00 ? 63 GLN A HE22 3  
ATOM   3507  N  N    . PHE A 1 64 ? 2.223   -12.687 -2.413  1.00 0.00 ? 64 PHE A N    3  
ATOM   3508  C  CA   . PHE A 1 64 ? 2.995   -11.909 -3.381  1.00 0.00 ? 64 PHE A CA   3  
ATOM   3509  C  C    . PHE A 1 64 ? 4.080   -12.767 -4.035  1.00 0.00 ? 64 PHE A C    3  
ATOM   3510  O  O    . PHE A 1 64 ? 4.266   -12.723 -5.251  1.00 0.00 ? 64 PHE A O    3  
ATOM   3511  C  CB   . PHE A 1 64 ? 3.626   -10.686 -2.706  1.00 0.00 ? 64 PHE A CB   3  
ATOM   3512  C  CG   . PHE A 1 64 ? 2.659   -9.553  -2.481  1.00 0.00 ? 64 PHE A CG   3  
ATOM   3513  C  CD1  . PHE A 1 64 ? 1.497   -9.746  -1.748  1.00 0.00 ? 64 PHE A CD1  3  
ATOM   3514  C  CD2  . PHE A 1 64 ? 2.910   -8.294  -3.007  1.00 0.00 ? 64 PHE A CD2  3  
ATOM   3515  C  CE1  . PHE A 1 64 ? 0.609   -8.708  -1.544  1.00 0.00 ? 64 PHE A CE1  3  
ATOM   3516  C  CE2  . PHE A 1 64 ? 2.024   -7.253  -2.804  1.00 0.00 ? 64 PHE A CE2  3  
ATOM   3517  C  CZ   . PHE A 1 64 ? 0.872   -7.460  -2.072  1.00 0.00 ? 64 PHE A CZ   3  
ATOM   3518  H  H    . PHE A 1 64 ? 2.302   -12.472 -1.458  1.00 0.00 ? 64 PHE A H    3  
ATOM   3519  H  HA   . PHE A 1 64 ? 2.314   -11.572 -4.149  1.00 0.00 ? 64 PHE A HA   3  
ATOM   3520  H  HB2  . PHE A 1 64 ? 4.026   -10.978 -1.747  1.00 0.00 ? 64 PHE A HB2  3  
ATOM   3521  H  HB3  . PHE A 1 64 ? 4.430   -10.319 -3.329  1.00 0.00 ? 64 PHE A HB3  3  
ATOM   3522  H  HD1  . PHE A 1 64 ? 1.289   -10.720 -1.333  1.00 0.00 ? 64 PHE A HD1  3  
ATOM   3523  H  HD2  . PHE A 1 64 ? 3.811   -8.130  -3.579  1.00 0.00 ? 64 PHE A HD2  3  
ATOM   3524  H  HE1  . PHE A 1 64 ? -0.292  -8.873  -0.970  1.00 0.00 ? 64 PHE A HE1  3  
ATOM   3525  H  HE2  . PHE A 1 64 ? 2.234   -6.279  -3.220  1.00 0.00 ? 64 PHE A HE2  3  
ATOM   3526  H  HZ   . PHE A 1 64 ? 0.178   -6.647  -1.914  1.00 0.00 ? 64 PHE A HZ   3  
ATOM   3527  N  N    . VAL A 1 65 ? 4.790   -13.549 -3.221  1.00 0.00 ? 65 VAL A N    3  
ATOM   3528  C  CA   . VAL A 1 65 ? 5.851   -14.420 -3.718  1.00 0.00 ? 65 VAL A CA   3  
ATOM   3529  C  C    . VAL A 1 65 ? 5.358   -15.863 -3.829  1.00 0.00 ? 65 VAL A C    3  
ATOM   3530  O  O    . VAL A 1 65 ? 5.591   -16.680 -2.936  1.00 0.00 ? 65 VAL A O    3  
ATOM   3531  C  CB   . VAL A 1 65 ? 7.095   -14.375 -2.802  1.00 0.00 ? 65 VAL A CB   3  
ATOM   3532  C  CG1  . VAL A 1 65 ? 8.249   -15.161 -3.414  1.00 0.00 ? 65 VAL A CG1  3  
ATOM   3533  C  CG2  . VAL A 1 65 ? 7.510   -12.936 -2.524  1.00 0.00 ? 65 VAL A CG2  3  
ATOM   3534  H  H    . VAL A 1 65 ? 4.592   -13.542 -2.259  1.00 0.00 ? 65 VAL A H    3  
ATOM   3535  H  HA   . VAL A 1 65 ? 6.139   -14.070 -4.700  1.00 0.00 ? 65 VAL A HA   3  
ATOM   3536  H  HB   . VAL A 1 65 ? 6.838   -14.839 -1.861  1.00 0.00 ? 65 VAL A HB   3  
ATOM   3537  H  HG11 . VAL A 1 65 ? 8.927   -14.481 -3.908  1.00 0.00 ? 65 VAL A HG11 3  
ATOM   3538  H  HG12 . VAL A 1 65 ? 7.864   -15.869 -4.133  1.00 0.00 ? 65 VAL A HG12 3  
ATOM   3539  H  HG13 . VAL A 1 65 ? 8.775   -15.691 -2.634  1.00 0.00 ? 65 VAL A HG13 3  
ATOM   3540  H  HG21 . VAL A 1 65 ? 6.686   -12.273 -2.746  1.00 0.00 ? 65 VAL A HG21 3  
ATOM   3541  H  HG22 . VAL A 1 65 ? 8.355   -12.677 -3.143  1.00 0.00 ? 65 VAL A HG22 3  
ATOM   3542  H  HG23 . VAL A 1 65 ? 7.780   -12.836 -1.484  1.00 0.00 ? 65 VAL A HG23 3  
ATOM   3543  N  N    . SER A 1 66 ? 4.671   -16.170 -4.929  1.00 0.00 ? 66 SER A N    3  
ATOM   3544  C  CA   . SER A 1 66 ? 4.139   -17.511 -5.154  1.00 0.00 ? 66 SER A CA   3  
ATOM   3545  C  C    . SER A 1 66 ? 4.836   -18.190 -6.331  1.00 0.00 ? 66 SER A C    3  
ATOM   3546  O  O    . SER A 1 66 ? 4.411   -18.052 -7.479  1.00 0.00 ? 66 SER A O    3  
ATOM   3547  C  CB   . SER A 1 66 ? 2.631   -17.448 -5.409  1.00 0.00 ? 66 SER A CB   3  
ATOM   3548  O  OG   . SER A 1 66 ? 1.939   -16.948 -4.279  1.00 0.00 ? 66 SER A OG   3  
ATOM   3549  H  H    . SER A 1 66 ? 4.513   -15.475 -5.604  1.00 0.00 ? 66 SER A H    3  
ATOM   3550  H  HA   . SER A 1 66 ? 4.318   -18.093 -4.260  1.00 0.00 ? 66 SER A HA   3  
ATOM   3551  H  HB2  . SER A 1 66 ? 2.438   -16.798 -6.250  1.00 0.00 ? 66 SER A HB2  3  
ATOM   3552  H  HB3  . SER A 1 66 ? 2.264   -18.441 -5.630  1.00 0.00 ? 66 SER A HB3  3  
ATOM   3553  H  HG   . SER A 1 66 ? 1.058   -16.668 -4.540  1.00 0.00 ? 66 SER A HG   3  
ATOM   3554  N  N    . GLY A 1 67 ? 5.907   -18.927 -6.037  1.00 0.00 ? 67 GLY A N    3  
ATOM   3555  C  CA   . GLY A 1 67 ? 6.645   -19.619 -7.081  1.00 0.00 ? 67 GLY A CA   3  
ATOM   3556  C  C    . GLY A 1 67 ? 6.290   -21.093 -7.171  1.00 0.00 ? 67 GLY A C    3  
ATOM   3557  O  O    . GLY A 1 67 ? 6.055   -21.614 -8.262  1.00 0.00 ? 67 GLY A O    3  
ATOM   3558  H  H    . GLY A 1 67 ? 6.197   -19.003 -5.104  1.00 0.00 ? 67 GLY A H    3  
ATOM   3559  H  HA2  . GLY A 1 67 ? 6.428   -19.151 -8.030  1.00 0.00 ? 67 GLY A HA2  3  
ATOM   3560  H  HA3  . GLY A 1 67 ? 7.702   -19.529 -6.879  1.00 0.00 ? 67 GLY A HA3  3  
ATOM   3561  N  N    . GLU A 1 68 ? 6.256   -21.768 -6.021  1.00 0.00 ? 68 GLU A N    3  
ATOM   3562  C  CA   . GLU A 1 68 ? 5.933   -23.192 -5.977  1.00 0.00 ? 68 GLU A CA   3  
ATOM   3563  C  C    . GLU A 1 68 ? 4.516   -23.433 -5.444  1.00 0.00 ? 68 GLU A C    3  
ATOM   3564  O  O    . GLU A 1 68 ? 4.251   -24.448 -4.795  1.00 0.00 ? 68 GLU A O    3  
ATOM   3565  C  CB   . GLU A 1 68 ? 6.961   -23.937 -5.119  1.00 0.00 ? 68 GLU A CB   3  
ATOM   3566  C  CG   . GLU A 1 68 ? 8.224   -24.309 -5.879  1.00 0.00 ? 68 GLU A CG   3  
ATOM   3567  C  CD   . GLU A 1 68 ? 9.373   -23.355 -5.611  1.00 0.00 ? 68 GLU A CD   3  
ATOM   3568  O  OE1  . GLU A 1 68 ? 9.266   -22.170 -5.993  1.00 0.00 ? 68 GLU A OE1  3  
ATOM   3569  O  OE2  . GLU A 1 68 ? 10.383  -23.794 -5.021  1.00 0.00 ? 68 GLU A OE2  3  
ATOM   3570  H  H    . GLU A 1 68 ? 6.455   -21.298 -5.184  1.00 0.00 ? 68 GLU A H    3  
ATOM   3571  H  HA   . GLU A 1 68 ? 5.986   -23.571 -6.987  1.00 0.00 ? 68 GLU A HA   3  
ATOM   3572  H  HB2  . GLU A 1 68 ? 7.239   -23.310 -4.283  1.00 0.00 ? 68 GLU A HB2  3  
ATOM   3573  H  HB3  . GLU A 1 68 ? 6.512   -24.844 -4.743  1.00 0.00 ? 68 GLU A HB3  3  
ATOM   3574  H  HG2  . GLU A 1 68 ? 8.526   -25.303 -5.586  1.00 0.00 ? 68 GLU A HG2  3  
ATOM   3575  H  HG3  . GLU A 1 68 ? 8.008   -24.299 -6.937  1.00 0.00 ? 68 GLU A HG3  3  
ATOM   3576  N  N    . THR A 1 69 ? 3.605   -22.500 -5.731  1.00 0.00 ? 69 THR A N    3  
ATOM   3577  C  CA   . THR A 1 69 ? 2.216   -22.614 -5.288  1.00 0.00 ? 69 THR A CA   3  
ATOM   3578  C  C    . THR A 1 69 ? 1.276   -21.895 -6.254  1.00 0.00 ? 69 THR A C    3  
ATOM   3579  O  O    . THR A 1 69 ? 1.476   -20.719 -6.566  1.00 0.00 ? 69 THR A O    3  
ATOM   3580  C  CB   . THR A 1 69 ? 2.047   -22.037 -3.878  1.00 0.00 ? 69 THR A CB   3  
ATOM   3581  O  OG1  . THR A 1 69 ? 3.119   -22.424 -3.036  1.00 0.00 ? 69 THR A OG1  3  
ATOM   3582  C  CG2  . THR A 1 69 ? 0.760   -22.468 -3.206  1.00 0.00 ? 69 THR A CG2  3  
ATOM   3583  H  H    . THR A 1 69 ? 3.871   -21.718 -6.256  1.00 0.00 ? 69 THR A H    3  
ATOM   3584  H  HA   . THR A 1 69 ? 1.960   -23.664 -5.271  1.00 0.00 ? 69 THR A HA   3  
ATOM   3585  H  HB   . THR A 1 69 ? 2.037   -20.958 -3.942  1.00 0.00 ? 69 THR A HB   3  
ATOM   3586  H  HG1  . THR A 1 69 ? 3.259   -23.371 -3.106  1.00 0.00 ? 69 THR A HG1  3  
ATOM   3587  H  HG21 . THR A 1 69 ? -0.064  -21.896 -3.604  1.00 0.00 ? 69 THR A HG21 3  
ATOM   3588  H  HG22 . THR A 1 69 ? 0.837   -22.296 -2.142  1.00 0.00 ? 69 THR A HG22 3  
ATOM   3589  H  HG23 . THR A 1 69 ? 0.593   -23.519 -3.389  1.00 0.00 ? 69 THR A HG23 3  
ATOM   3590  N  N    . VAL A 1 70 ? 0.251   -22.607 -6.716  1.00 0.00 ? 70 VAL A N    3  
ATOM   3591  C  CA   . VAL A 1 70 ? -0.729  -22.039 -7.641  1.00 0.00 ? 70 VAL A CA   3  
ATOM   3592  C  C    . VAL A 1 70 ? -2.049  -21.761 -6.924  1.00 0.00 ? 70 VAL A C    3  
ATOM   3593  O  O    . VAL A 1 70 ? -2.506  -22.572 -6.117  1.00 0.00 ? 70 VAL A O    3  
ATOM   3594  C  CB   . VAL A 1 70 ? -1.001  -22.979 -8.836  1.00 0.00 ? 70 VAL A CB   3  
ATOM   3595  C  CG1  . VAL A 1 70 ? -1.720  -22.235 -9.954  1.00 0.00 ? 70 VAL A CG1  3  
ATOM   3596  C  CG2  . VAL A 1 70 ? 0.293   -23.598 -9.349  1.00 0.00 ? 70 VAL A CG2  3  
ATOM   3597  H  H    . VAL A 1 70 ? 0.145   -23.538 -6.424  1.00 0.00 ? 70 VAL A H    3  
ATOM   3598  H  HA   . VAL A 1 70 ? -0.330  -21.111 -8.021  1.00 0.00 ? 70 VAL A HA   3  
ATOM   3599  H  HB   . VAL A 1 70 ? -1.644  -23.775 -8.497  1.00 0.00 ? 70 VAL A HB   3  
ATOM   3600  H  HG11 . VAL A 1 70 ? -2.713  -21.965 -9.624  1.00 0.00 ? 70 VAL A HG11 3  
ATOM   3601  H  HG12 . VAL A 1 70 ? -1.790  -22.872 -10.824 1.00 0.00 ? 70 VAL A HG12 3  
ATOM   3602  H  HG13 . VAL A 1 70 ? -1.169  -21.342 -10.206 1.00 0.00 ? 70 VAL A HG13 3  
ATOM   3603  H  HG21 . VAL A 1 70 ? 0.774   -24.143 -8.551  1.00 0.00 ? 70 VAL A HG21 3  
ATOM   3604  H  HG22 . VAL A 1 70 ? 0.952   -22.816 -9.699  1.00 0.00 ? 70 VAL A HG22 3  
ATOM   3605  H  HG23 . VAL A 1 70 ? 0.072   -24.273 -10.163 1.00 0.00 ? 70 VAL A HG23 3  
ATOM   3606  N  N    . PRO A 1 71 ? -2.685  -20.609 -7.210  1.00 0.00 ? 71 PRO A N    3  
ATOM   3607  C  CA   . PRO A 1 71 ? -3.954  -20.229 -6.593  1.00 0.00 ? 71 PRO A CA   3  
ATOM   3608  C  C    . PRO A 1 71 ? -5.163  -20.810 -7.334  1.00 0.00 ? 71 PRO A C    3  
ATOM   3609  O  O    . PRO A 1 71 ? -6.094  -20.085 -7.689  1.00 0.00 ? 71 PRO A O    3  
ATOM   3610  C  CB   . PRO A 1 71 ? -3.925  -18.705 -6.698  1.00 0.00 ? 71 PRO A CB   3  
ATOM   3611  C  CG   . PRO A 1 71 ? -3.152  -18.419 -7.945  1.00 0.00 ? 71 PRO A CG   3  
ATOM   3612  C  CD   . PRO A 1 71 ? -2.214  -19.584 -8.161  1.00 0.00 ? 71 PRO A CD   3  
ATOM   3613  H  HA   . PRO A 1 71 ? -3.992  -20.523 -5.554  1.00 0.00 ? 71 PRO A HA   3  
ATOM   3614  H  HB2  . PRO A 1 71 ? -4.936  -18.326 -6.762  1.00 0.00 ? 71 PRO A HB2  3  
ATOM   3615  H  HB3  . PRO A 1 71 ? -3.435  -18.290 -5.829  1.00 0.00 ? 71 PRO A HB3  3  
ATOM   3616  H  HG2  . PRO A 1 71 ? -3.831  -18.330 -8.780  1.00 0.00 ? 71 PRO A HG2  3  
ATOM   3617  H  HG3  . PRO A 1 71 ? -2.589  -17.506 -7.824  1.00 0.00 ? 71 PRO A HG3  3  
ATOM   3618  H  HD2  . PRO A 1 71 ? -2.292  -19.940 -9.179  1.00 0.00 ? 71 PRO A HD2  3  
ATOM   3619  H  HD3  . PRO A 1 71 ? -1.199  -19.296 -7.942  1.00 0.00 ? 71 PRO A HD3  3  
ATOM   3620  N  N    . ALA A 1 72 ? -5.142  -22.125 -7.566  1.00 0.00 ? 72 ALA A N    3  
ATOM   3621  C  CA   . ALA A 1 72 ? -6.231  -22.800 -8.265  1.00 0.00 ? 72 ALA A CA   3  
ATOM   3622  C  C    . ALA A 1 72 ? -6.851  -23.896 -7.398  1.00 0.00 ? 72 ALA A C    3  
ATOM   3623  O  O    . ALA A 1 72 ? -6.160  -24.827 -6.978  1.00 0.00 ? 72 ALA A O    3  
ATOM   3624  C  CB   . ALA A 1 72 ? -5.729  -23.379 -9.580  1.00 0.00 ? 72 ALA A CB   3  
ATOM   3625  H  H    . ALA A 1 72 ? -4.375  -22.652 -7.261  1.00 0.00 ? 72 ALA A H    3  
ATOM   3626  H  HA   . ALA A 1 72 ? -6.987  -22.063 -8.492  1.00 0.00 ? 72 ALA A HA   3  
ATOM   3627  H  HB1  . ALA A 1 72 ? -6.571  -23.599 -10.221 1.00 0.00 ? 72 ALA A HB1  3  
ATOM   3628  H  HB2  . ALA A 1 72 ? -5.176  -24.287 -9.389  1.00 0.00 ? 72 ALA A HB2  3  
ATOM   3629  H  HB3  . ALA A 1 72 ? -5.085  -22.661 -10.066 1.00 0.00 ? 72 ALA A HB3  3  
ATOM   3630  N  N    . PRO A 1 73 ? -8.169  -23.796 -7.114  1.00 0.00 ? 73 PRO A N    3  
ATOM   3631  C  CA   . PRO A 1 73 ? -8.892  -24.777 -6.286  1.00 0.00 ? 73 PRO A CA   3  
ATOM   3632  C  C    . PRO A 1 73 ? -8.833  -26.196 -6.854  1.00 0.00 ? 73 PRO A C    3  
ATOM   3633  O  O    . PRO A 1 73 ? -8.351  -26.415 -7.966  1.00 0.00 ? 73 PRO A O    3  
ATOM   3634  C  CB   . PRO A 1 73 ? -10.340 -24.264 -6.292  1.00 0.00 ? 73 PRO A CB   3  
ATOM   3635  C  CG   . PRO A 1 73 ? -10.238 -22.822 -6.650  1.00 0.00 ? 73 PRO A CG   3  
ATOM   3636  C  CD   . PRO A 1 73 ? -9.060  -22.712 -7.573  1.00 0.00 ? 73 PRO A CD   3  
ATOM   3637  H  HA   . PRO A 1 73 ? -8.518  -24.784 -5.273  1.00 0.00 ? 73 PRO A HA   3  
ATOM   3638  H  HB2  . PRO A 1 73 ? -10.915 -24.811 -7.026  1.00 0.00 ? 73 PRO A HB2  3  
ATOM   3639  H  HB3  . PRO A 1 73 ? -10.779 -24.397 -5.314  1.00 0.00 ? 73 PRO A HB3  3  
ATOM   3640  H  HG2  . PRO A 1 73 ? -11.140 -22.505 -7.154  1.00 0.00 ? 73 PRO A HG2  3  
ATOM   3641  H  HG3  . PRO A 1 73 ? -10.076 -22.231 -5.761  1.00 0.00 ? 73 PRO A HG3  3  
ATOM   3642  H  HD2  . PRO A 1 73 ? -9.367  -22.870 -8.596  1.00 0.00 ? 73 PRO A HD2  3  
ATOM   3643  H  HD3  . PRO A 1 73 ? -8.583  -21.750 -7.462  1.00 0.00 ? 73 PRO A HD3  3  
ATOM   3644  N  N    . SER A 1 74 ? -9.332  -27.156 -6.072  1.00 0.00 ? 74 SER A N    3  
ATOM   3645  C  CA   . SER A 1 74 ? -9.346  -28.563 -6.477  1.00 0.00 ? 74 SER A CA   3  
ATOM   3646  C  C    . SER A 1 74 ? -10.346 -28.809 -7.610  1.00 0.00 ? 74 SER A C    3  
ATOM   3647  O  O    . SER A 1 74 ? -10.094 -29.627 -8.496  1.00 0.00 ? 74 SER A O    3  
ATOM   3648  C  CB   . SER A 1 74 ? -9.683  -29.458 -5.278  1.00 0.00 ? 74 SER A CB   3  
ATOM   3649  O  OG   . SER A 1 74 ? -9.156  -30.763 -5.450  1.00 0.00 ? 74 SER A OG   3  
ATOM   3650  H  H    . SER A 1 74 ? -9.703  -26.910 -5.198  1.00 0.00 ? 74 SER A H    3  
ATOM   3651  H  HA   . SER A 1 74 ? -8.356  -28.812 -6.829  1.00 0.00 ? 74 SER A HA   3  
ATOM   3652  H  HB2  . SER A 1 74 ? -9.261  -29.030 -4.381  1.00 0.00 ? 74 SER A HB2  3  
ATOM   3653  H  HB3  . SER A 1 74 ? -10.756 -29.527 -5.172  1.00 0.00 ? 74 SER A HB3  3  
ATOM   3654  H  HG   . SER A 1 74 ? -9.816  -31.325 -5.861  1.00 0.00 ? 74 SER A HG   3  
ATOM   3655  N  N    . ALA A 1 75 ? -11.479 -28.103 -7.577  1.00 0.00 ? 75 ALA A N    3  
ATOM   3656  C  CA   . ALA A 1 75 ? -12.508 -28.254 -8.603  1.00 0.00 ? 75 ALA A CA   3  
ATOM   3657  C  C    . ALA A 1 75 ? -12.911 -26.900 -9.183  1.00 0.00 ? 75 ALA A C    3  
ATOM   3658  O  O    . ALA A 1 75 ? -13.224 -25.967 -8.441  1.00 0.00 ? 75 ALA A O    3  
ATOM   3659  C  CB   . ALA A 1 75 ? -13.723 -28.970 -8.030  1.00 0.00 ? 75 ALA A CB   3  
ATOM   3660  H  H    . ALA A 1 75 ? -11.626 -27.469 -6.844  1.00 0.00 ? 75 ALA A H    3  
ATOM   3661  H  HA   . ALA A 1 75 ? -12.099 -28.866 -9.394  1.00 0.00 ? 75 ALA A HA   3  
ATOM   3662  H  HB1  . ALA A 1 75 ? -14.274 -29.440 -8.831  1.00 0.00 ? 75 ALA A HB1  3  
ATOM   3663  H  HB2  . ALA A 1 75 ? -14.358 -28.256 -7.527  1.00 0.00 ? 75 ALA A HB2  3  
ATOM   3664  H  HB3  . ALA A 1 75 ? -13.400 -29.722 -7.325  1.00 0.00 ? 75 ALA A HB3  3  
ATOM   3665  N  N    . ASN A 1 76 ? -12.896 -26.800 -10.512 1.00 0.00 ? 76 ASN A N    3  
ATOM   3666  C  CA   . ASN A 1 76 ? -13.259 -25.560 -11.200 1.00 0.00 ? 76 ASN A CA   3  
ATOM   3667  C  C    . ASN A 1 76 ? -14.743 -25.237 -11.011 1.00 0.00 ? 76 ASN A C    3  
ATOM   3668  O  O    . ASN A 1 76 ? -15.575 -26.140 -10.890 1.00 0.00 ? 76 ASN A O    3  
ATOM   3669  C  CB   . ASN A 1 76 ? -12.929 -25.662 -12.695 1.00 0.00 ? 76 ASN A CB   3  
ATOM   3670  C  CG   . ASN A 1 76 ? -11.535 -25.153 -13.026 1.00 0.00 ? 76 ASN A CG   3  
ATOM   3671  O  OD1  . ASN A 1 76 ? -10.880 -24.512 -12.203 1.00 0.00 ? 76 ASN A OD1  3  
ATOM   3672  N  ND2  . ASN A 1 76 ? -11.073 -25.437 -14.241 1.00 0.00 ? 76 ASN A ND2  3  
ATOM   3673  H  H    . ASN A 1 76 ? -12.635 -27.581 -11.046 1.00 0.00 ? 76 ASN A H    3  
ATOM   3674  H  HA   . ASN A 1 76 ? -12.675 -24.762 -10.765 1.00 0.00 ? 76 ASN A HA   3  
ATOM   3675  H  HB2  . ASN A 1 76 ? -12.994 -26.696 -13.000 1.00 0.00 ? 76 ASN A HB2  3  
ATOM   3676  H  HB3  . ASN A 1 76 ? -13.646 -25.081 -13.255 1.00 0.00 ? 76 ASN A HB3  3  
ATOM   3677  H  HD21 . ASN A 1 76 ? -11.647 -25.950 -14.847 1.00 0.00 ? 76 ASN A HD21 3  
ATOM   3678  H  HD22 . ASN A 1 76 ? -10.178 -25.120 -14.481 1.00 0.00 ? 76 ASN A HD22 3  
ATOM   3679  N  N    . LYS A 1 77 ? -15.066 -23.942 -10.984 1.00 0.00 ? 77 LYS A N    3  
ATOM   3680  C  CA   . LYS A 1 77 ? -16.449 -23.489 -10.804 1.00 0.00 ? 77 LYS A CA   3  
ATOM   3681  C  C    . LYS A 1 77 ? -17.032 -22.943 -12.107 1.00 0.00 ? 77 LYS A C    3  
ATOM   3682  O  O    . LYS A 1 77 ? -16.301 -22.445 -12.965 1.00 0.00 ? 77 LYS A O    3  
ATOM   3683  C  CB   . LYS A 1 77 ? -16.520 -22.414 -9.714  1.00 0.00 ? 77 LYS A CB   3  
ATOM   3684  C  CG   . LYS A 1 77 ? -15.475 -21.318 -9.863  1.00 0.00 ? 77 LYS A CG   3  
ATOM   3685  C  CD   . LYS A 1 77 ? -15.967 -19.994 -9.299  1.00 0.00 ? 77 LYS A CD   3  
ATOM   3686  C  CE   . LYS A 1 77 ? -14.902 -18.913 -9.404  1.00 0.00 ? 77 LYS A CE   3  
ATOM   3687  N  NZ   . LYS A 1 77 ? -15.489 -17.544 -9.385  1.00 0.00 ? 77 LYS A NZ   3  
ATOM   3688  H  H    . LYS A 1 77 ? -14.357 -23.274 -11.084 1.00 0.00 ? 77 LYS A H    3  
ATOM   3689  H  HA   . LYS A 1 77 ? -17.035 -24.341 -10.491 1.00 0.00 ? 77 LYS A HA   3  
ATOM   3690  H  HB2  . LYS A 1 77 ? -17.496 -21.955 -9.742  1.00 0.00 ? 77 LYS A HB2  3  
ATOM   3691  H  HB3  . LYS A 1 77 ? -16.382 -22.885 -8.751  1.00 0.00 ? 77 LYS A HB3  3  
ATOM   3692  H  HG2  . LYS A 1 77 ? -14.580 -21.612 -9.334  1.00 0.00 ? 77 LYS A HG2  3  
ATOM   3693  H  HG3  . LYS A 1 77 ? -15.249 -21.191 -10.912 1.00 0.00 ? 77 LYS A HG3  3  
ATOM   3694  H  HD2  . LYS A 1 77 ? -16.839 -19.680 -9.853  1.00 0.00 ? 77 LYS A HD2  3  
ATOM   3695  H  HD3  . LYS A 1 77 ? -16.228 -20.133 -8.261  1.00 0.00 ? 77 LYS A HD3  3  
ATOM   3696  H  HE2  . LYS A 1 77 ? -14.223 -19.015 -8.570  1.00 0.00 ? 77 LYS A HE2  3  
ATOM   3697  H  HE3  . LYS A 1 77 ? -14.356 -19.051 -10.327 1.00 0.00 ? 77 LYS A HE3  3  
ATOM   3698  H  HZ1  . LYS A 1 77 ? -16.328 -17.520 -8.772  1.00 0.00 ? 77 LYS A HZ1  3  
ATOM   3699  H  HZ2  . LYS A 1 77 ? -15.766 -17.260 -10.347 1.00 0.00 ? 77 LYS A HZ2  3  
ATOM   3700  H  HZ3  . LYS A 1 77 ? -14.791 -16.862 -9.024  1.00 0.00 ? 77 LYS A HZ3  3  
ATOM   3701  N  N    . GLU A 1 78 ? -18.357 -23.035 -12.243 1.00 0.00 ? 78 GLU A N    3  
ATOM   3702  C  CA   . GLU A 1 78 ? -19.047 -22.548 -13.436 1.00 0.00 ? 78 GLU A CA   3  
ATOM   3703  C  C    . GLU A 1 78 ? -20.438 -22.012 -13.091 1.00 0.00 ? 78 GLU A C    3  
ATOM   3704  O  O    . GLU A 1 78 ? -21.392 -22.782 -12.956 1.00 0.00 ? 78 GLU A O    3  
ATOM   3705  C  CB   . GLU A 1 78 ? -19.160 -23.665 -14.478 1.00 0.00 ? 78 GLU A CB   3  
ATOM   3706  C  CG   . GLU A 1 78 ? -17.981 -23.722 -15.439 1.00 0.00 ? 78 GLU A CG   3  
ATOM   3707  C  CD   . GLU A 1 78 ? -18.074 -24.876 -16.419 1.00 0.00 ? 78 GLU A CD   3  
ATOM   3708  O  OE1  . GLU A 1 78 ? -19.148 -25.056 -17.030 1.00 0.00 ? 78 GLU A OE1  3  
ATOM   3709  O  OE2  . GLU A 1 78 ? -17.068 -25.601 -16.576 1.00 0.00 ? 78 GLU A OE2  3  
ATOM   3710  H  H    . GLU A 1 78 ? -18.884 -23.441 -11.522 1.00 0.00 ? 78 GLU A H    3  
ATOM   3711  H  HA   . GLU A 1 78 ? -18.459 -21.741 -13.850 1.00 0.00 ? 78 GLU A HA   3  
ATOM   3712  H  HB2  . GLU A 1 78 ? -19.227 -24.616 -13.968 1.00 0.00 ? 78 GLU A HB2  3  
ATOM   3713  H  HB3  . GLU A 1 78 ? -20.059 -23.512 -15.057 1.00 0.00 ? 78 GLU A HB3  3  
ATOM   3714  H  HG2  . GLU A 1 78 ? -17.945 -22.799 -15.997 1.00 0.00 ? 78 GLU A HG2  3  
ATOM   3715  H  HG3  . GLU A 1 78 ? -17.073 -23.829 -14.863 1.00 0.00 ? 78 GLU A HG3  3  
ATOM   3716  N  N    . LEU A 1 79 ? -20.548 -20.687 -12.952 1.00 0.00 ? 79 LEU A N    3  
ATOM   3717  C  CA   . LEU A 1 79 ? -21.823 -20.044 -12.629 1.00 0.00 ? 79 LEU A CA   3  
ATOM   3718  C  C    . LEU A 1 79 ? -21.707 -18.521 -12.702 1.00 0.00 ? 79 LEU A C    3  
ATOM   3719  O  O    . LEU A 1 79 ? -20.812 -17.926 -12.096 1.00 0.00 ? 79 LEU A O    3  
ATOM   3720  C  CB   . LEU A 1 79 ? -22.310 -20.462 -11.234 1.00 0.00 ? 79 LEU A CB   3  
ATOM   3721  C  CG   . LEU A 1 79 ? -21.323 -20.216 -10.090 1.00 0.00 ? 79 LEU A CG   3  
ATOM   3722  C  CD1  . LEU A 1 79 ? -22.066 -20.007 -8.778  1.00 0.00 ? 79 LEU A CD1  3  
ATOM   3723  C  CD2  . LEU A 1 79 ? -20.340 -21.373 -9.974  1.00 0.00 ? 79 LEU A CD2  3  
ATOM   3724  H  H    . LEU A 1 79 ? -19.752 -20.127 -13.076 1.00 0.00 ? 79 LEU A H    3  
ATOM   3725  H  HA   . LEU A 1 79 ? -22.546 -20.369 -13.362 1.00 0.00 ? 79 LEU A HA   3  
ATOM   3726  H  HB2  . LEU A 1 79 ? -23.218 -19.918 -11.020 1.00 0.00 ? 79 LEU A HB2  3  
ATOM   3727  H  HB3  . LEU A 1 79 ? -22.542 -21.517 -11.259 1.00 0.00 ? 79 LEU A HB3  3  
ATOM   3728  H  HG   . LEU A 1 79 ? -20.759 -19.318 -10.297 1.00 0.00 ? 79 LEU A HG   3  
ATOM   3729  H  HD11 . LEU A 1 79 ? -22.256 -18.954 -8.634  1.00 0.00 ? 79 LEU A HD11 3  
ATOM   3730  H  HD12 . LEU A 1 79 ? -21.466 -20.381 -7.961  1.00 0.00 ? 79 LEU A HD12 3  
ATOM   3731  H  HD13 . LEU A 1 79 ? -23.005 -20.541 -8.806  1.00 0.00 ? 79 LEU A HD13 3  
ATOM   3732  H  HD21 . LEU A 1 79 ? -20.051 -21.499 -8.941  1.00 0.00 ? 79 LEU A HD21 3  
ATOM   3733  H  HD22 . LEU A 1 79 ? -19.465 -21.161 -10.570 1.00 0.00 ? 79 LEU A HD22 3  
ATOM   3734  H  HD23 . LEU A 1 79 ? -20.808 -22.279 -10.329 1.00 0.00 ? 79 LEU A HD23 3  
ATOM   3735  N  N    . VAL A 1 80 ? -22.622 -17.898 -13.443 1.00 0.00 ? 80 VAL A N    3  
ATOM   3736  C  CA   . VAL A 1 80 ? -22.634 -16.444 -13.594 1.00 0.00 ? 80 VAL A CA   3  
ATOM   3737  C  C    . VAL A 1 80 ? -23.859 -15.840 -12.908 1.00 0.00 ? 80 VAL A C    3  
ATOM   3738  O  O    . VAL A 1 80 ? -24.919 -15.696 -13.520 1.00 0.00 ? 80 VAL A O    3  
ATOM   3739  C  CB   . VAL A 1 80 ? -22.629 -16.027 -15.082 1.00 0.00 ? 80 VAL A CB   3  
ATOM   3740  C  CG1  . VAL A 1 80 ? -22.432 -14.522 -15.220 1.00 0.00 ? 80 VAL A CG1  3  
ATOM   3741  C  CG2  . VAL A 1 80 ? -21.555 -16.784 -15.852 1.00 0.00 ? 80 VAL A CG2  3  
ATOM   3742  H  H    . VAL A 1 80 ? -23.310 -18.429 -13.895 1.00 0.00 ? 80 VAL A H    3  
ATOM   3743  H  HA   . VAL A 1 80 ? -21.741 -16.051 -13.127 1.00 0.00 ? 80 VAL A HA   3  
ATOM   3744  H  HB   . VAL A 1 80 ? -23.590 -16.279 -15.508 1.00 0.00 ? 80 VAL A HB   3  
ATOM   3745  H  HG11 . VAL A 1 80 ? -22.944 -14.173 -16.104 1.00 0.00 ? 80 VAL A HG11 3  
ATOM   3746  H  HG12 . VAL A 1 80 ? -21.378 -14.303 -15.305 1.00 0.00 ? 80 VAL A HG12 3  
ATOM   3747  H  HG13 . VAL A 1 80 ? -22.835 -14.025 -14.351 1.00 0.00 ? 80 VAL A HG13 3  
ATOM   3748  H  HG21 . VAL A 1 80 ? -21.228 -16.190 -16.692 1.00 0.00 ? 80 VAL A HG21 3  
ATOM   3749  H  HG22 . VAL A 1 80 ? -21.961 -17.719 -16.209 1.00 0.00 ? 80 VAL A HG22 3  
ATOM   3750  H  HG23 . VAL A 1 80 ? -20.716 -16.981 -15.201 1.00 0.00 ? 80 VAL A HG23 3  
ATOM   3751  N  N    . LYS A 1 81 ? -23.707 -15.491 -11.631 1.00 0.00 ? 81 LYS A N    3  
ATOM   3752  C  CA   . LYS A 1 81 ? -24.801 -14.907 -10.860 1.00 0.00 ? 81 LYS A CA   3  
ATOM   3753  C  C    . LYS A 1 81 ? -24.556 -13.422 -10.600 1.00 0.00 ? 81 LYS A C    3  
ATOM   3754  O  O    . LYS A 1 81 ? -23.749 -13.057 -9.742  1.00 0.00 ? 81 LYS A O    3  
ATOM   3755  C  CB   . LYS A 1 81 ? -24.972 -15.653 -9.533  1.00 0.00 ? 81 LYS A CB   3  
ATOM   3756  C  CG   . LYS A 1 81 ? -25.933 -16.830 -9.613  1.00 0.00 ? 81 LYS A CG   3  
ATOM   3757  C  CD   . LYS A 1 81 ? -26.724 -16.992 -8.324  1.00 0.00 ? 81 LYS A CD   3  
ATOM   3758  C  CE   . LYS A 1 81 ? -26.112 -18.053 -7.422  1.00 0.00 ? 81 LYS A CE   3  
ATOM   3759  N  NZ   . LYS A 1 81 ? -27.133 -18.698 -6.549  1.00 0.00 ? 81 LYS A NZ   3  
ATOM   3760  H  H    . LYS A 1 81 ? -22.840 -15.632 -11.196 1.00 0.00 ? 81 LYS A H    3  
ATOM   3761  H  HA   . LYS A 1 81 ? -25.707 -15.012 -11.440 1.00 0.00 ? 81 LYS A HA   3  
ATOM   3762  H  HB2  . LYS A 1 81 ? -24.008 -16.025 -9.216  1.00 0.00 ? 81 LYS A HB2  3  
ATOM   3763  H  HB3  . LYS A 1 81 ? -25.342 -14.962 -8.790  1.00 0.00 ? 81 LYS A HB3  3  
ATOM   3764  H  HG2  . LYS A 1 81 ? -26.624 -16.666 -10.428 1.00 0.00 ? 81 LYS A HG2  3  
ATOM   3765  H  HG3  . LYS A 1 81 ? -25.366 -17.732 -9.794  1.00 0.00 ? 81 LYS A HG3  3  
ATOM   3766  H  HD2  . LYS A 1 81 ? -26.733 -16.049 -7.797  1.00 0.00 ? 81 LYS A HD2  3  
ATOM   3767  H  HD3  . LYS A 1 81 ? -27.736 -17.279 -8.569  1.00 0.00 ? 81 LYS A HD3  3  
ATOM   3768  H  HE2  . LYS A 1 81 ? -25.652 -18.810 -8.039  1.00 0.00 ? 81 LYS A HE2  3  
ATOM   3769  H  HE3  . LYS A 1 81 ? -25.359 -17.589 -6.801  1.00 0.00 ? 81 LYS A HE3  3  
ATOM   3770  H  HZ1  . LYS A 1 81 ? -27.875 -18.013 -6.297  1.00 0.00 ? 81 LYS A HZ1  3  
ATOM   3771  H  HZ2  . LYS A 1 81 ? -26.687 -19.047 -5.676  1.00 0.00 ? 81 LYS A HZ2  3  
ATOM   3772  H  HZ3  . LYS A 1 81 ? -27.572 -19.500 -7.044  1.00 0.00 ? 81 LYS A HZ3  3  
ATOM   3773  N  N    . LEU A 1 82 ? -25.259 -12.567 -11.345 1.00 0.00 ? 82 LEU A N    3  
ATOM   3774  C  CA   . LEU A 1 82 ? -25.120 -11.119 -11.195 1.00 0.00 ? 82 LEU A CA   3  
ATOM   3775  C  C    . LEU A 1 82 ? -26.488 -10.444 -11.047 1.00 0.00 ? 82 LEU A C    3  
ATOM   3776  O  O    . LEU A 1 82 ? -26.700 -9.334  -11.541 1.00 0.00 ? 82 LEU A O    3  
ATOM   3777  C  CB   . LEU A 1 82 ? -24.366 -10.534 -12.394 1.00 0.00 ? 82 LEU A CB   3  
ATOM   3778  C  CG   . LEU A 1 82 ? -22.845 -10.712 -12.355 1.00 0.00 ? 82 LEU A CG   3  
ATOM   3779  C  CD1  . LEU A 1 82 ? -22.286 -10.846 -13.764 1.00 0.00 ? 82 LEU A CD1  3  
ATOM   3780  C  CD2  . LEU A 1 82 ? -22.189 -9.545  -11.628 1.00 0.00 ? 82 LEU A CD2  3  
ATOM   3781  H  H    . LEU A 1 82 ? -25.887 -12.919 -12.011 1.00 0.00 ? 82 LEU A H    3  
ATOM   3782  H  HA   . LEU A 1 82 ? -24.546 -10.935 -10.299 1.00 0.00 ? 82 LEU A HA   3  
ATOM   3783  H  HB2  . LEU A 1 82 ? -24.741 -11.005 -13.292 1.00 0.00 ? 82 LEU A HB2  3  
ATOM   3784  H  HB3  . LEU A 1 82 ? -24.581 -9.477  -12.447 1.00 0.00 ? 82 LEU A HB3  3  
ATOM   3785  H  HG   . LEU A 1 82 ? -22.609 -11.617 -11.816 1.00 0.00 ? 82 LEU A HG   3  
ATOM   3786  H  HD11 . LEU A 1 82 ? -22.281 -9.879  -14.244 1.00 0.00 ? 82 LEU A HD11 3  
ATOM   3787  H  HD12 . LEU A 1 82 ? -22.903 -11.527 -14.333 1.00 0.00 ? 82 LEU A HD12 3  
ATOM   3788  H  HD13 . LEU A 1 82 ? -21.277 -11.229 -13.716 1.00 0.00 ? 82 LEU A HD13 3  
ATOM   3789  H  HD21 . LEU A 1 82 ? -21.126 -9.550  -11.823 1.00 0.00 ? 82 LEU A HD21 3  
ATOM   3790  H  HD22 . LEU A 1 82 ? -22.361 -9.641  -10.566 1.00 0.00 ? 82 LEU A HD22 3  
ATOM   3791  H  HD23 . LEU A 1 82 ? -22.615 -8.617  -11.978 1.00 0.00 ? 82 LEU A HD23 3  
ATOM   3792  N  N    . GLU A 1 83 ? -27.409 -11.120 -10.355 1.00 0.00 ? 83 GLU A N    3  
ATOM   3793  C  CA   . GLU A 1 83 ? -28.752 -10.587 -10.135 1.00 0.00 ? 83 GLU A CA   3  
ATOM   3794  C  C    . GLU A 1 83 ? -28.778 -9.648  -8.928  1.00 0.00 ? 83 GLU A C    3  
ATOM   3795  O  O    . GLU A 1 83 ? -27.774 -9.492  -8.228  1.00 0.00 ? 83 GLU A O    3  
ATOM   3796  C  CB   . GLU A 1 83 ? -29.748 -11.733 -9.926  1.00 0.00 ? 83 GLU A CB   3  
ATOM   3797  C  CG   . GLU A 1 83 ? -31.100 -11.500 -10.583 1.00 0.00 ? 83 GLU A CG   3  
ATOM   3798  C  CD   . GLU A 1 83 ? -31.272 -12.297 -11.863 1.00 0.00 ? 83 GLU A CD   3  
ATOM   3799  O  OE1  . GLU A 1 83 ? -30.743 -11.860 -12.908 1.00 0.00 ? 83 GLU A OE1  3  
ATOM   3800  O  OE2  . GLU A 1 83 ? -31.931 -13.355 -11.820 1.00 0.00 ? 83 GLU A OE2  3  
ATOM   3801  H  H    . GLU A 1 83 ? -27.178 -11.994 -9.982  1.00 0.00 ? 83 GLU A H    3  
ATOM   3802  H  HA   . GLU A 1 83 ? -29.036 -10.030 -11.015 1.00 0.00 ? 83 GLU A HA   3  
ATOM   3803  H  HB2  . GLU A 1 83 ? -29.326 -12.639 -10.334 1.00 0.00 ? 83 GLU A HB2  3  
ATOM   3804  H  HB3  . GLU A 1 83 ? -29.906 -11.868 -8.866  1.00 0.00 ? 83 GLU A HB3  3  
ATOM   3805  H  HG2  . GLU A 1 83 ? -31.878 -11.791 -9.892  1.00 0.00 ? 83 GLU A HG2  3  
ATOM   3806  H  HG3  . GLU A 1 83 ? -31.200 -10.450 -10.814 1.00 0.00 ? 83 GLU A HG3  3  
ATOM   3807  N  N    . HIS A 1 84 ? -29.933 -9.025  -8.688  1.00 0.00 ? 84 HIS A N    3  
ATOM   3808  C  CA   . HIS A 1 84 ? -30.094 -8.103  -7.565  1.00 0.00 ? 84 HIS A CA   3  
ATOM   3809  C  C    . HIS A 1 84 ? -31.324 -8.463  -6.734  1.00 0.00 ? 84 HIS A C    3  
ATOM   3810  O  O    . HIS A 1 84 ? -31.621 -9.639  -6.519  1.00 0.00 ? 84 HIS A O    3  
ATOM   3811  C  CB   . HIS A 1 84 ? -30.210 -6.661  -8.071  1.00 0.00 ? 84 HIS A CB   3  
ATOM   3812  C  CG   . HIS A 1 84 ? -31.323 -6.452  -9.052  1.00 0.00 ? 84 HIS A CG   3  
ATOM   3813  N  ND1  . HIS A 1 84 ? -31.189 -6.687  -10.404 1.00 0.00 ? 84 HIS A ND1  3  
ATOM   3814  C  CD2  . HIS A 1 84 ? -32.600 -6.038  -8.870  1.00 0.00 ? 84 HIS A CD2  3  
ATOM   3815  C  CE1  . HIS A 1 84 ? -32.333 -6.427  -11.010 1.00 0.00 ? 84 HIS A CE1  3  
ATOM   3816  N  NE2  . HIS A 1 84 ? -33.206 -6.032  -10.102 1.00 0.00 ? 84 HIS A NE2  3  
ATOM   3817  H  H    . HIS A 1 84 ? -30.697 -9.192  -9.279  1.00 0.00 ? 84 HIS A H    3  
ATOM   3818  H  HA   . HIS A 1 84 ? -29.217 -8.186  -6.941  1.00 0.00 ? 84 HIS A HA   3  
ATOM   3819  H  HB2  . HIS A 1 84 ? -30.382 -6.006  -7.231  1.00 0.00 ? 84 HIS A HB2  3  
ATOM   3820  H  HB3  . HIS A 1 84 ? -29.285 -6.381  -8.552  1.00 0.00 ? 84 HIS A HB3  3  
ATOM   3821  H  HD1  . HIS A 1 84 ? -30.375 -6.999  -10.853 1.00 0.00 ? 84 HIS A HD1  3  
ATOM   3822  H  HD2  . HIS A 1 84 ? -33.056 -5.761  -7.929  1.00 0.00 ? 84 HIS A HD2  3  
ATOM   3823  H  HE1  . HIS A 1 84 ? -32.523 -6.523  -12.069 1.00 0.00 ? 84 HIS A HE1  3  
ATOM   3824  H  HE2  . HIS A 1 84 ? -34.163 -5.892  -10.264 1.00 0.00 ? 84 HIS A HE2  3  
HETATM 3825  ZN ZN   . ZN  B 2 .  ? 2.730   13.181  3.831   1.00 0.00 ? 85 ZN  A ZN   3  
ATOM   3826  N  N    . MET A 1 1  ? 13.005  -2.113  12.495  1.00 0.00 ? 1  MET A N    4  
ATOM   3827  C  CA   . MET A 1 1  ? 12.580  -0.709  12.744  1.00 0.00 ? 1  MET A CA   4  
ATOM   3828  C  C    . MET A 1 1  ? 13.783  0.229   12.835  1.00 0.00 ? 1  MET A C    4  
ATOM   3829  O  O    . MET A 1 1  ? 14.779  -0.087  13.487  1.00 0.00 ? 1  MET A O    4  
ATOM   3830  C  CB   . MET A 1 1  ? 11.778  -0.659  14.049  1.00 0.00 ? 1  MET A CB   4  
ATOM   3831  C  CG   . MET A 1 1  ? 10.630  0.337   14.019  1.00 0.00 ? 1  MET A CG   4  
ATOM   3832  S  SD   . MET A 1 1  ? 11.198  2.049   14.023  1.00 0.00 ? 1  MET A SD   4  
ATOM   3833  C  CE   . MET A 1 1  ? 9.640   2.920   13.884  1.00 0.00 ? 1  MET A CE   4  
ATOM   3834  H  H1   . MET A 1 1  ? 12.154  -2.709  12.498  1.00 0.00 ? 1  MET A H1   4  
ATOM   3835  H  H2   . MET A 1 1  ? 13.661  -2.387  13.256  1.00 0.00 ? 1  MET A H2   4  
ATOM   3836  H  H3   . MET A 1 1  ? 13.476  -2.141  11.567  1.00 0.00 ? 1  MET A H3   4  
ATOM   3837  H  HA   . MET A 1 1  ? 11.949  -0.393  11.927  1.00 0.00 ? 1  MET A HA   4  
ATOM   3838  H  HB2  . MET A 1 1  ? 11.369  -1.640  14.247  1.00 0.00 ? 1  MET A HB2  4  
ATOM   3839  H  HB3  . MET A 1 1  ? 12.441  -0.387  14.857  1.00 0.00 ? 1  MET A HB3  4  
ATOM   3840  H  HG2  . MET A 1 1  ? 10.048  0.168   13.126  1.00 0.00 ? 1  MET A HG2  4  
ATOM   3841  H  HG3  . MET A 1 1  ? 10.008  0.176   14.887  1.00 0.00 ? 1  MET A HG3  4  
ATOM   3842  H  HE1  . MET A 1 1  ? 9.243   2.793   12.887  1.00 0.00 ? 1  MET A HE1  4  
ATOM   3843  H  HE2  . MET A 1 1  ? 9.796   3.970   14.078  1.00 0.00 ? 1  MET A HE2  4  
ATOM   3844  H  HE3  . MET A 1 1  ? 8.939   2.522   14.603  1.00 0.00 ? 1  MET A HE3  4  
ATOM   3845  N  N    . ALA A 1 2  ? 13.675  1.387   12.182  1.00 0.00 ? 2  ALA A N    4  
ATOM   3846  C  CA   . ALA A 1 2  ? 14.745  2.381   12.193  1.00 0.00 ? 2  ALA A CA   4  
ATOM   3847  C  C    . ALA A 1 2  ? 14.192  3.770   12.519  1.00 0.00 ? 2  ALA A C    4  
ATOM   3848  O  O    . ALA A 1 2  ? 14.435  4.300   13.603  1.00 0.00 ? 2  ALA A O    4  
ATOM   3849  C  CB   . ALA A 1 2  ? 15.479  2.392   10.857  1.00 0.00 ? 2  ALA A CB   4  
ATOM   3850  H  H    . ALA A 1 2  ? 12.852  1.579   11.686  1.00 0.00 ? 2  ALA A H    4  
ATOM   3851  H  HA   . ALA A 1 2  ? 15.451  2.099   12.961  1.00 0.00 ? 2  ALA A HA   4  
ATOM   3852  H  HB1  . ALA A 1 2  ? 15.842  3.389   10.653  1.00 0.00 ? 2  ALA A HB1  4  
ATOM   3853  H  HB2  . ALA A 1 2  ? 14.803  2.086   10.071  1.00 0.00 ? 2  ALA A HB2  4  
ATOM   3854  H  HB3  . ALA A 1 2  ? 16.314  1.708   10.899  1.00 0.00 ? 2  ALA A HB3  4  
ATOM   3855  N  N    . VAL A 1 3  ? 13.440  4.352   11.578  1.00 0.00 ? 3  VAL A N    4  
ATOM   3856  C  CA   . VAL A 1 3  ? 12.846  5.678   11.770  1.00 0.00 ? 3  VAL A CA   4  
ATOM   3857  C  C    . VAL A 1 3  ? 11.485  5.800   11.070  1.00 0.00 ? 3  VAL A C    4  
ATOM   3858  O  O    . VAL A 1 3  ? 11.069  6.900   10.701  1.00 0.00 ? 3  VAL A O    4  
ATOM   3859  C  CB   . VAL A 1 3  ? 13.778  6.796   11.250  1.00 0.00 ? 3  VAL A CB   4  
ATOM   3860  C  CG1  . VAL A 1 3  ? 15.022  6.904   12.116  1.00 0.00 ? 3  VAL A CG1  4  
ATOM   3861  C  CG2  . VAL A 1 3  ? 14.156  6.553   9.794   1.00 0.00 ? 3  VAL A CG2  4  
ATOM   3862  H  H    . VAL A 1 3  ? 13.280  3.877   10.735  1.00 0.00 ? 3  VAL A H    4  
ATOM   3863  H  HA   . VAL A 1 3  ? 12.704  5.825   12.832  1.00 0.00 ? 3  VAL A HA   4  
ATOM   3864  H  HB   . VAL A 1 3  ? 13.245  7.734   11.308  1.00 0.00 ? 3  VAL A HB   4  
ATOM   3865  H  HG11 . VAL A 1 3  ? 15.484  7.868   11.963  1.00 0.00 ? 3  VAL A HG11 4  
ATOM   3866  H  HG12 . VAL A 1 3  ? 15.718  6.125   11.844  1.00 0.00 ? 3  VAL A HG12 4  
ATOM   3867  H  HG13 . VAL A 1 3  ? 14.748  6.796   13.155  1.00 0.00 ? 3  VAL A HG13 4  
ATOM   3868  H  HG21 . VAL A 1 3  ? 13.402  5.941   9.322   1.00 0.00 ? 3  VAL A HG21 4  
ATOM   3869  H  HG22 . VAL A 1 3  ? 15.109  6.049   9.748   1.00 0.00 ? 3  VAL A HG22 4  
ATOM   3870  H  HG23 . VAL A 1 3  ? 14.224  7.500   9.277   1.00 0.00 ? 3  VAL A HG23 4  
ATOM   3871  N  N    . PHE A 1 4  ? 10.797  4.672   10.888  1.00 0.00 ? 4  PHE A N    4  
ATOM   3872  C  CA   . PHE A 1 4  ? 9.492   4.667   10.224  1.00 0.00 ? 4  PHE A CA   4  
ATOM   3873  C  C    . PHE A 1 4  ? 8.402   5.235   11.134  1.00 0.00 ? 4  PHE A C    4  
ATOM   3874  O  O    . PHE A 1 4  ? 8.436   5.047   12.349  1.00 0.00 ? 4  PHE A O    4  
ATOM   3875  C  CB   . PHE A 1 4  ? 9.118   3.245   9.792   1.00 0.00 ? 4  PHE A CB   4  
ATOM   3876  C  CG   . PHE A 1 4  ? 9.622   2.869   8.425   1.00 0.00 ? 4  PHE A CG   4  
ATOM   3877  C  CD1  . PHE A 1 4  ? 10.936  3.118   8.056   1.00 0.00 ? 4  PHE A CD1  4  
ATOM   3878  C  CD2  . PHE A 1 4  ? 8.780   2.258   7.512   1.00 0.00 ? 4  PHE A CD2  4  
ATOM   3879  C  CE1  . PHE A 1 4  ? 11.395  2.766   6.802   1.00 0.00 ? 4  PHE A CE1  4  
ATOM   3880  C  CE2  . PHE A 1 4  ? 9.234   1.903   6.257   1.00 0.00 ? 4  PHE A CE2  4  
ATOM   3881  C  CZ   . PHE A 1 4  ? 10.543  2.158   5.901   1.00 0.00 ? 4  PHE A CZ   4  
ATOM   3882  H  H    . PHE A 1 4  ? 11.174  3.825   11.200  1.00 0.00 ? 4  PHE A H    4  
ATOM   3883  H  HA   . PHE A 1 4  ? 9.567   5.291   9.346   1.00 0.00 ? 4  PHE A HA   4  
ATOM   3884  H  HB2  . PHE A 1 4  ? 9.530   2.542   10.501  1.00 0.00 ? 4  PHE A HB2  4  
ATOM   3885  H  HB3  . PHE A 1 4  ? 8.043   3.150   9.786   1.00 0.00 ? 4  PHE A HB3  4  
ATOM   3886  H  HD1  . PHE A 1 4  ? 11.604  3.594   8.760   1.00 0.00 ? 4  PHE A HD1  4  
ATOM   3887  H  HD2  . PHE A 1 4  ? 7.756   2.056   7.789   1.00 0.00 ? 4  PHE A HD2  4  
ATOM   3888  H  HE1  . PHE A 1 4  ? 12.420  2.967   6.527   1.00 0.00 ? 4  PHE A HE1  4  
ATOM   3889  H  HE2  . PHE A 1 4  ? 8.566   1.428   5.555   1.00 0.00 ? 4  PHE A HE2  4  
ATOM   3890  H  HZ   . PHE A 1 4  ? 10.901  1.882   4.920   1.00 0.00 ? 4  PHE A HZ   4  
ATOM   3891  N  N    . HIS A 1 5  ? 7.436   5.930   10.532  1.00 0.00 ? 5  HIS A N    4  
ATOM   3892  C  CA   . HIS A 1 5  ? 6.331   6.521   11.287  1.00 0.00 ? 5  HIS A CA   4  
ATOM   3893  C  C    . HIS A 1 5  ? 5.484   5.427   11.939  1.00 0.00 ? 5  HIS A C    4  
ATOM   3894  O  O    . HIS A 1 5  ? 5.415   5.332   13.166  1.00 0.00 ? 5  HIS A O    4  
ATOM   3895  C  CB   . HIS A 1 5  ? 5.460   7.392   10.373  1.00 0.00 ? 5  HIS A CB   4  
ATOM   3896  C  CG   . HIS A 1 5  ? 4.633   8.397   11.110  1.00 0.00 ? 5  HIS A CG   4  
ATOM   3897  N  ND1  . HIS A 1 5  ? 5.174   9.356   11.940  1.00 0.00 ? 5  HIS A ND1  4  
ATOM   3898  C  CD2  . HIS A 1 5  ? 3.294   8.595   11.132  1.00 0.00 ? 5  HIS A CD2  4  
ATOM   3899  C  CE1  . HIS A 1 5  ? 4.204   10.098  12.443  1.00 0.00 ? 5  HIS A CE1  4  
ATOM   3900  N  NE2  . HIS A 1 5  ? 3.054   9.656   11.968  1.00 0.00 ? 5  HIS A NE2  4  
ATOM   3901  H  H    . HIS A 1 5  ? 7.462   6.042   9.557   1.00 0.00 ? 5  HIS A H    4  
ATOM   3902  H  HA   . HIS A 1 5  ? 6.756   7.140   12.065  1.00 0.00 ? 5  HIS A HA   4  
ATOM   3903  H  HB2  . HIS A 1 5  ? 6.095   7.927   9.684   1.00 0.00 ? 5  HIS A HB2  4  
ATOM   3904  H  HB3  . HIS A 1 5  ? 4.789   6.755   9.814   1.00 0.00 ? 5  HIS A HB3  4  
ATOM   3905  H  HD1  . HIS A 1 5  ? 6.128   9.472   12.135  1.00 0.00 ? 5  HIS A HD1  4  
ATOM   3906  H  HD2  . HIS A 1 5  ? 2.553   8.021   10.593  1.00 0.00 ? 5  HIS A HD2  4  
ATOM   3907  H  HE1  . HIS A 1 5  ? 4.330   10.924  13.125  1.00 0.00 ? 5  HIS A HE1  4  
ATOM   3908  H  HE2  . HIS A 1 5  ? 2.178   10.064  12.134  1.00 0.00 ? 5  HIS A HE2  4  
ATOM   3909  N  N    . ASP A 1 6  ? 4.850   4.601   11.108  1.00 0.00 ? 6  ASP A N    4  
ATOM   3910  C  CA   . ASP A 1 6  ? 4.017   3.506   11.595  1.00 0.00 ? 6  ASP A CA   4  
ATOM   3911  C  C    . ASP A 1 6  ? 3.754   2.490   10.485  1.00 0.00 ? 6  ASP A C    4  
ATOM   3912  O  O    . ASP A 1 6  ? 3.626   2.858   9.314   1.00 0.00 ? 6  ASP A O    4  
ATOM   3913  C  CB   . ASP A 1 6  ? 2.688   4.044   12.137  1.00 0.00 ? 6  ASP A CB   4  
ATOM   3914  C  CG   . ASP A 1 6  ? 2.718   4.261   13.639  1.00 0.00 ? 6  ASP A CG   4  
ATOM   3915  O  OD1  . ASP A 1 6  ? 2.946   3.281   14.381  1.00 0.00 ? 6  ASP A OD1  4  
ATOM   3916  O  OD2  . ASP A 1 6  ? 2.514   5.414   14.074  1.00 0.00 ? 6  ASP A OD2  4  
ATOM   3917  H  H    . ASP A 1 6  ? 4.951   4.726   10.141  1.00 0.00 ? 6  ASP A H    4  
ATOM   3918  H  HA   . ASP A 1 6  ? 4.553   3.016   12.396  1.00 0.00 ? 6  ASP A HA   4  
ATOM   3919  H  HB2  . ASP A 1 6  ? 2.468   4.988   11.662  1.00 0.00 ? 6  ASP A HB2  4  
ATOM   3920  H  HB3  . ASP A 1 6  ? 1.901   3.340   11.909  1.00 0.00 ? 6  ASP A HB3  4  
ATOM   3921  N  N    . GLU A 1 7  ? 3.670   1.214   10.859  1.00 0.00 ? 7  GLU A N    4  
ATOM   3922  C  CA   . GLU A 1 7  ? 3.416   0.143   9.894   1.00 0.00 ? 7  GLU A CA   4  
ATOM   3923  C  C    . GLU A 1 7  ? 1.917   -0.124  9.777   1.00 0.00 ? 7  GLU A C    4  
ATOM   3924  O  O    . GLU A 1 7  ? 1.215   -0.212  10.785  1.00 0.00 ? 7  GLU A O    4  
ATOM   3925  C  CB   . GLU A 1 7  ? 4.141   -1.144  10.302  1.00 0.00 ? 7  GLU A CB   4  
ATOM   3926  C  CG   . GLU A 1 7  ? 5.600   -0.936  10.681  1.00 0.00 ? 7  GLU A CG   4  
ATOM   3927  C  CD   . GLU A 1 7  ? 5.820   -0.929  12.181  1.00 0.00 ? 7  GLU A CD   4  
ATOM   3928  O  OE1  . GLU A 1 7  ? 5.911   -2.024  12.774  1.00 0.00 ? 7  GLU A OE1  4  
ATOM   3929  O  OE2  . GLU A 1 7  ? 5.905   0.173   12.763  1.00 0.00 ? 7  GLU A OE2  4  
ATOM   3930  H  H    . GLU A 1 7  ? 3.779   0.985   11.805  1.00 0.00 ? 7  GLU A H    4  
ATOM   3931  H  HA   . GLU A 1 7  ? 3.789   0.467   8.933   1.00 0.00 ? 7  GLU A HA   4  
ATOM   3932  H  HB2  . GLU A 1 7  ? 3.632   -1.579  11.148  1.00 0.00 ? 7  GLU A HB2  4  
ATOM   3933  H  HB3  . GLU A 1 7  ? 4.104   -1.841  9.476   1.00 0.00 ? 7  GLU A HB3  4  
ATOM   3934  H  HG2  . GLU A 1 7  ? 6.186   -1.734  10.251  1.00 0.00 ? 7  GLU A HG2  4  
ATOM   3935  H  HG3  . GLU A 1 7  ? 5.930   0.009   10.279  1.00 0.00 ? 7  GLU A HG3  4  
ATOM   3936  N  N    . VAL A 1 8  ? 1.434   -0.248  8.542   1.00 0.00 ? 8  VAL A N    4  
ATOM   3937  C  CA   . VAL A 1 8  ? 0.017   -0.498  8.293   1.00 0.00 ? 8  VAL A CA   4  
ATOM   3938  C  C    . VAL A 1 8  ? -0.174  -1.621  7.276   1.00 0.00 ? 8  VAL A C    4  
ATOM   3939  O  O    . VAL A 1 8  ? 0.575   -1.726  6.302   1.00 0.00 ? 8  VAL A O    4  
ATOM   3940  C  CB   . VAL A 1 8  ? -0.701  0.770   7.786   1.00 0.00 ? 8  VAL A CB   4  
ATOM   3941  C  CG1  . VAL A 1 8  ? -2.207  0.550   7.739   1.00 0.00 ? 8  VAL A CG1  4  
ATOM   3942  C  CG2  . VAL A 1 8  ? -0.362  1.971   8.660   1.00 0.00 ? 8  VAL A CG2  4  
ATOM   3943  H  H    . VAL A 1 8  ? 2.045   -0.164  7.779   1.00 0.00 ? 8  VAL A H    4  
ATOM   3944  H  HA   . VAL A 1 8  ? -0.439  -0.794  9.228   1.00 0.00 ? 8  VAL A HA   4  
ATOM   3945  H  HB   . VAL A 1 8  ? -0.360  0.975   6.782   1.00 0.00 ? 8  VAL A HB   4  
ATOM   3946  H  HG11 . VAL A 1 8  ? -2.654  1.278   7.082   1.00 0.00 ? 8  VAL A HG11 4  
ATOM   3947  H  HG12 . VAL A 1 8  ? -2.617  0.660   8.731   1.00 0.00 ? 8  VAL A HG12 4  
ATOM   3948  H  HG13 . VAL A 1 8  ? -2.415  -0.444  7.372   1.00 0.00 ? 8  VAL A HG13 4  
ATOM   3949  H  HG21 . VAL A 1 8  ? -0.629  2.879   8.140   1.00 0.00 ? 8  VAL A HG21 4  
ATOM   3950  H  HG22 . VAL A 1 8  ? 0.696   1.977   8.871   1.00 0.00 ? 8  VAL A HG22 4  
ATOM   3951  H  HG23 . VAL A 1 8  ? -0.913  1.911   9.585   1.00 0.00 ? 8  VAL A HG23 4  
ATOM   3952  N  N    . GLU A 1 9  ? -1.187  -2.454  7.510   1.00 0.00 ? 9  GLU A N    4  
ATOM   3953  C  CA   . GLU A 1 9  ? -1.493  -3.573  6.622   1.00 0.00 ? 9  GLU A CA   4  
ATOM   3954  C  C    . GLU A 1 9  ? -1.973  -3.080  5.259   1.00 0.00 ? 9  GLU A C    4  
ATOM   3955  O  O    . GLU A 1 9  ? -2.732  -2.113  5.168   1.00 0.00 ? 9  GLU A O    4  
ATOM   3956  C  CB   . GLU A 1 9  ? -2.559  -4.483  7.243   1.00 0.00 ? 9  GLU A CB   4  
ATOM   3957  C  CG   . GLU A 1 9  ? -2.179  -5.044  8.606   1.00 0.00 ? 9  GLU A CG   4  
ATOM   3958  C  CD   . GLU A 1 9  ? -3.341  -5.739  9.293   1.00 0.00 ? 9  GLU A CD   4  
ATOM   3959  O  OE1  . GLU A 1 9  ? -4.219  -5.034  9.836   1.00 0.00 ? 9  GLU A OE1  4  
ATOM   3960  O  OE2  . GLU A 1 9  ? -3.371  -6.988  9.292   1.00 0.00 ? 9  GLU A OE2  4  
ATOM   3961  H  H    . GLU A 1 9  ? -1.746  -2.311  8.303   1.00 0.00 ? 9  GLU A H    4  
ATOM   3962  H  HA   . GLU A 1 9  ? -0.585  -4.142  6.484   1.00 0.00 ? 9  GLU A HA   4  
ATOM   3963  H  HB2  . GLU A 1 9  ? -3.474  -3.920  7.354   1.00 0.00 ? 9  GLU A HB2  4  
ATOM   3964  H  HB3  . GLU A 1 9  ? -2.738  -5.313  6.575   1.00 0.00 ? 9  GLU A HB3  4  
ATOM   3965  H  HG2  . GLU A 1 9  ? -1.377  -5.756  8.478   1.00 0.00 ? 9  GLU A HG2  4  
ATOM   3966  H  HG3  . GLU A 1 9  ? -1.841  -4.233  9.235   1.00 0.00 ? 9  GLU A HG3  4  
ATOM   3967  N  N    . ILE A 1 10 ? -1.529  -3.756  4.202   1.00 0.00 ? 10 ILE A N    4  
ATOM   3968  C  CA   . ILE A 1 10 ? -1.911  -3.402  2.836   1.00 0.00 ? 10 ILE A CA   4  
ATOM   3969  C  C    . ILE A 1 10 ? -3.434  -3.398  2.664   1.00 0.00 ? 10 ILE A C    4  
ATOM   3970  O  O    . ILE A 1 10 ? -3.966  -2.661  1.833   1.00 0.00 ? 10 ILE A O    4  
ATOM   3971  C  CB   . ILE A 1 10 ? -1.272  -4.360  1.805   1.00 0.00 ? 10 ILE A CB   4  
ATOM   3972  C  CG1  . ILE A 1 10 ? -1.508  -3.850  0.381   1.00 0.00 ? 10 ILE A CG1  4  
ATOM   3973  C  CG2  . ILE A 1 10 ? -1.817  -5.774  1.965   1.00 0.00 ? 10 ILE A CG2  4  
ATOM   3974  C  CD1  . ILE A 1 10 ? -0.315  -3.133  -0.211  1.00 0.00 ? 10 ILE A CD1  4  
ATOM   3975  H  H    . ILE A 1 10 ? -0.929  -4.520  4.345   1.00 0.00 ? 10 ILE A H    4  
ATOM   3976  H  HA   . ILE A 1 10 ? -1.541  -2.406  2.641   1.00 0.00 ? 10 ILE A HA   4  
ATOM   3977  H  HB   . ILE A 1 10 ? -0.209  -4.392  1.993   1.00 0.00 ? 10 ILE A HB   4  
ATOM   3978  H  HG12 . ILE A 1 10 ? -1.742  -4.685  -0.260  1.00 0.00 ? 10 ILE A HG12 4  
ATOM   3979  H  HG13 . ILE A 1 10 ? -2.340  -3.161  0.384   1.00 0.00 ? 10 ILE A HG13 4  
ATOM   3980  H  HG21 . ILE A 1 10 ? -1.274  -6.445  1.315   1.00 0.00 ? 10 ILE A HG21 4  
ATOM   3981  H  HG22 . ILE A 1 10 ? -2.865  -5.789  1.702   1.00 0.00 ? 10 ILE A HG22 4  
ATOM   3982  H  HG23 . ILE A 1 10 ? -1.699  -6.093  2.991   1.00 0.00 ? 10 ILE A HG23 4  
ATOM   3983  H  HD11 . ILE A 1 10 ? -0.145  -3.489  -1.215  1.00 0.00 ? 10 ILE A HD11 4  
ATOM   3984  H  HD12 . ILE A 1 10 ? 0.559   -3.324  0.394   1.00 0.00 ? 10 ILE A HD12 4  
ATOM   3985  H  HD13 . ILE A 1 10 ? -0.511  -2.071  -0.236  1.00 0.00 ? 10 ILE A HD13 4  
ATOM   3986  N  N    . GLU A 1 11 ? -4.133  -4.213  3.460   1.00 0.00 ? 11 GLU A N    4  
ATOM   3987  C  CA   . GLU A 1 11 ? -5.594  -4.283  3.392   1.00 0.00 ? 11 GLU A CA   4  
ATOM   3988  C  C    . GLU A 1 11 ? -6.219  -2.908  3.653   1.00 0.00 ? 11 GLU A C    4  
ATOM   3989  O  O    . GLU A 1 11 ? -7.265  -2.579  3.093   1.00 0.00 ? 11 GLU A O    4  
ATOM   3990  C  CB   . GLU A 1 11 ? -6.137  -5.306  4.396   1.00 0.00 ? 11 GLU A CB   4  
ATOM   3991  C  CG   . GLU A 1 11 ? -5.775  -5.007  5.847   1.00 0.00 ? 11 GLU A CG   4  
ATOM   3992  C  CD   . GLU A 1 11 ? -6.659  -5.743  6.837   1.00 0.00 ? 11 GLU A CD   4  
ATOM   3993  O  OE1  . GLU A 1 11 ? -6.580  -6.988  6.892   1.00 0.00 ? 11 GLU A OE1  4  
ATOM   3994  O  OE2  . GLU A 1 11 ? -7.432  -5.074  7.555   1.00 0.00 ? 11 GLU A OE2  4  
ATOM   3995  H  H    . GLU A 1 11 ? -3.659  -4.775  4.108   1.00 0.00 ? 11 GLU A H    4  
ATOM   3996  H  HA   . GLU A 1 11 ? -5.861  -4.598  2.395   1.00 0.00 ? 11 GLU A HA   4  
ATOM   3997  H  HB2  . GLU A 1 11 ? -7.214  -5.330  4.317   1.00 0.00 ? 11 GLU A HB2  4  
ATOM   3998  H  HB3  . GLU A 1 11 ? -5.747  -6.281  4.144   1.00 0.00 ? 11 GLU A HB3  4  
ATOM   3999  H  HG2  . GLU A 1 11 ? -4.751  -5.303  6.017   1.00 0.00 ? 11 GLU A HG2  4  
ATOM   4000  H  HG3  . GLU A 1 11 ? -5.874  -3.945  6.019   1.00 0.00 ? 11 GLU A HG3  4  
ATOM   4001  N  N    . ASP A 1 12 ? -5.567  -2.109  4.502   1.00 0.00 ? 12 ASP A N    4  
ATOM   4002  C  CA   . ASP A 1 12 ? -6.054  -0.771  4.828   1.00 0.00 ? 12 ASP A CA   4  
ATOM   4003  C  C    . ASP A 1 12 ? -5.788  0.208   3.682   1.00 0.00 ? 12 ASP A C    4  
ATOM   4004  O  O    . ASP A 1 12 ? -6.517  1.186   3.514   1.00 0.00 ? 12 ASP A O    4  
ATOM   4005  C  CB   . ASP A 1 12 ? -5.396  -0.262  6.116   1.00 0.00 ? 12 ASP A CB   4  
ATOM   4006  C  CG   . ASP A 1 12 ? -6.045  -0.832  7.363   1.00 0.00 ? 12 ASP A CG   4  
ATOM   4007  O  OD1  . ASP A 1 12 ? -7.204  -0.465  7.650   1.00 0.00 ? 12 ASP A OD1  4  
ATOM   4008  O  OD2  . ASP A 1 12 ? -5.392  -1.644  8.052   1.00 0.00 ? 12 ASP A OD2  4  
ATOM   4009  H  H    . ASP A 1 12 ? -4.736  -2.428  4.916   1.00 0.00 ? 12 ASP A H    4  
ATOM   4010  H  HA   . ASP A 1 12 ? -7.121  -0.839  4.986   1.00 0.00 ? 12 ASP A HA   4  
ATOM   4011  H  HB2  . ASP A 1 12 ? -4.354  -0.543  6.117   1.00 0.00 ? 12 ASP A HB2  4  
ATOM   4012  H  HB3  . ASP A 1 12 ? -5.476  0.814   6.152   1.00 0.00 ? 12 ASP A HB3  4  
ATOM   4013  N  N    . PHE A 1 13 ? -4.740  -0.060  2.897   1.00 0.00 ? 13 PHE A N    4  
ATOM   4014  C  CA   . PHE A 1 13 ? -4.381  0.798   1.766   1.00 0.00 ? 13 PHE A CA   4  
ATOM   4015  C  C    . PHE A 1 13 ? -5.465  0.772   0.686   1.00 0.00 ? 13 PHE A C    4  
ATOM   4016  O  O    . PHE A 1 13 ? -6.416  -0.009  0.764   1.00 0.00 ? 13 PHE A O    4  
ATOM   4017  C  CB   . PHE A 1 13 ? -3.047  0.352   1.157   1.00 0.00 ? 13 PHE A CB   4  
ATOM   4018  C  CG   . PHE A 1 13 ? -1.833  0.836   1.904   1.00 0.00 ? 13 PHE A CG   4  
ATOM   4019  C  CD1  . PHE A 1 13 ? -1.584  0.427   3.208   1.00 0.00 ? 13 PHE A CD1  4  
ATOM   4020  C  CD2  . PHE A 1 13 ? -0.933  1.696   1.295   1.00 0.00 ? 13 PHE A CD2  4  
ATOM   4021  C  CE1  . PHE A 1 13 ? -0.463  0.869   3.885   1.00 0.00 ? 13 PHE A CE1  4  
ATOM   4022  C  CE2  . PHE A 1 13 ? 0.188   2.141   1.967   1.00 0.00 ? 13 PHE A CE2  4  
ATOM   4023  C  CZ   . PHE A 1 13 ? 0.424   1.727   3.264   1.00 0.00 ? 13 PHE A CZ   4  
ATOM   4024  H  H    . PHE A 1 13 ? -4.197  -0.853  3.081   1.00 0.00 ? 13 PHE A H    4  
ATOM   4025  H  HA   . PHE A 1 13 ? -4.280  1.808   2.135   1.00 0.00 ? 13 PHE A HA   4  
ATOM   4026  H  HB2  . PHE A 1 13 ? -3.014  -0.726  1.134   1.00 0.00 ? 13 PHE A HB2  4  
ATOM   4027  H  HB3  . PHE A 1 13 ? -2.985  0.727   0.146   1.00 0.00 ? 13 PHE A HB3  4  
ATOM   4028  H  HD1  . PHE A 1 13 ? -2.278  -0.244  3.694   1.00 0.00 ? 13 PHE A HD1  4  
ATOM   4029  H  HD2  . PHE A 1 13 ? -1.115  2.022   0.282   1.00 0.00 ? 13 PHE A HD2  4  
ATOM   4030  H  HE1  . PHE A 1 13 ? -0.280  0.543   4.898   1.00 0.00 ? 13 PHE A HE1  4  
ATOM   4031  H  HE2  . PHE A 1 13 ? 0.879   2.811   1.480   1.00 0.00 ? 13 PHE A HE2  4  
ATOM   4032  H  HZ   . PHE A 1 13 ? 1.301   2.073   3.791   1.00 0.00 ? 13 PHE A HZ   4  
ATOM   4033  N  N    . GLN A 1 14 ? -5.310  1.629   -0.325  1.00 0.00 ? 14 GLN A N    4  
ATOM   4034  C  CA   . GLN A 1 14 ? -6.269  1.702   -1.424  1.00 0.00 ? 14 GLN A CA   4  
ATOM   4035  C  C    . GLN A 1 14 ? -5.648  1.192   -2.722  1.00 0.00 ? 14 GLN A C    4  
ATOM   4036  O  O    . GLN A 1 14 ? -4.722  1.804   -3.258  1.00 0.00 ? 14 GLN A O    4  
ATOM   4037  C  CB   . GLN A 1 14 ? -6.758  3.143   -1.611  1.00 0.00 ? 14 GLN A CB   4  
ATOM   4038  C  CG   . GLN A 1 14 ? -8.226  3.239   -2.001  1.00 0.00 ? 14 GLN A CG   4  
ATOM   4039  C  CD   . GLN A 1 14 ? -8.636  4.640   -2.427  1.00 0.00 ? 14 GLN A CD   4  
ATOM   4040  O  OE1  . GLN A 1 14 ? -7.800  5.533   -2.570  1.00 0.00 ? 14 GLN A OE1  4  
ATOM   4041  N  NE2  . GLN A 1 14 ? -9.935  4.840   -2.631  1.00 0.00 ? 14 GLN A NE2  4  
ATOM   4042  H  H    . GLN A 1 14 ? -4.530  2.223   -0.333  1.00 0.00 ? 14 GLN A H    4  
ATOM   4043  H  HA   . GLN A 1 14 ? -7.111  1.075   -1.171  1.00 0.00 ? 14 GLN A HA   4  
ATOM   4044  H  HB2  . GLN A 1 14 ? -6.616  3.682   -0.687  1.00 0.00 ? 14 GLN A HB2  4  
ATOM   4045  H  HB3  . GLN A 1 14 ? -6.170  3.612   -2.386  1.00 0.00 ? 14 GLN A HB3  4  
ATOM   4046  H  HG2  . GLN A 1 14 ? -8.412  2.563   -2.823  1.00 0.00 ? 14 GLN A HG2  4  
ATOM   4047  H  HG3  . GLN A 1 14 ? -8.828  2.946   -1.155  1.00 0.00 ? 14 GLN A HG3  4  
ATOM   4048  H  HE21 . GLN A 1 14 ? -10.548 4.086   -2.499  1.00 0.00 ? 14 GLN A HE21 4  
ATOM   4049  H  HE22 . GLN A 1 14 ? -10.227 5.735   -2.907  1.00 0.00 ? 14 GLN A HE22 4  
ATOM   4050  N  N    . TYR A 1 15 ? -6.165  0.069   -3.225  1.00 0.00 ? 15 TYR A N    4  
ATOM   4051  C  CA   . TYR A 1 15 ? -5.660  -0.515  -4.465  1.00 0.00 ? 15 TYR A CA   4  
ATOM   4052  C  C    . TYR A 1 15 ? -5.943  0.408   -5.646  1.00 0.00 ? 15 TYR A C    4  
ATOM   4053  O  O    . TYR A 1 15 ? -7.088  0.804   -5.877  1.00 0.00 ? 15 TYR A O    4  
ATOM   4054  C  CB   . TYR A 1 15 ? -6.291  -1.890  -4.712  1.00 0.00 ? 15 TYR A CB   4  
ATOM   4055  C  CG   . TYR A 1 15 ? -5.707  -2.625  -5.902  1.00 0.00 ? 15 TYR A CG   4  
ATOM   4056  C  CD1  . TYR A 1 15 ? -4.393  -3.077  -5.889  1.00 0.00 ? 15 TYR A CD1  4  
ATOM   4057  C  CD2  . TYR A 1 15 ? -6.472  -2.869  -7.036  1.00 0.00 ? 15 TYR A CD2  4  
ATOM   4058  C  CE1  . TYR A 1 15 ? -3.857  -3.750  -6.970  1.00 0.00 ? 15 TYR A CE1  4  
ATOM   4059  C  CE2  . TYR A 1 15 ? -5.945  -3.544  -8.121  1.00 0.00 ? 15 TYR A CE2  4  
ATOM   4060  C  CZ   . TYR A 1 15 ? -4.638  -3.982  -8.083  1.00 0.00 ? 15 TYR A CZ   4  
ATOM   4061  O  OH   . TYR A 1 15 ? -4.112  -4.657  -9.162  1.00 0.00 ? 15 TYR A OH   4  
ATOM   4062  H  H    . TYR A 1 15 ? -6.903  -0.371  -2.754  1.00 0.00 ? 15 TYR A H    4  
ATOM   4063  H  HA   . TYR A 1 15 ? -4.591  -0.632  -4.363  1.00 0.00 ? 15 TYR A HA   4  
ATOM   4064  H  HB2  . TYR A 1 15 ? -6.144  -2.508  -3.838  1.00 0.00 ? 15 TYR A HB2  4  
ATOM   4065  H  HB3  . TYR A 1 15 ? -7.350  -1.767  -4.884  1.00 0.00 ? 15 TYR A HB3  4  
ATOM   4066  H  HD1  . TYR A 1 15 ? -3.784  -2.894  -5.017  1.00 0.00 ? 15 TYR A HD1  4  
ATOM   4067  H  HD2  . TYR A 1 15 ? -7.496  -2.526  -7.062  1.00 0.00 ? 15 TYR A HD2  4  
ATOM   4068  H  HE1  . TYR A 1 15 ? -2.834  -4.092  -6.940  1.00 0.00 ? 15 TYR A HE1  4  
ATOM   4069  H  HE2  . TYR A 1 15 ? -6.558  -3.722  -8.993  1.00 0.00 ? 15 TYR A HE2  4  
ATOM   4070  H  HH   . TYR A 1 15 ? -3.283  -4.252  -9.423  1.00 0.00 ? 15 TYR A HH   4  
ATOM   4071  N  N    . ASP A 1 16 ? -4.892  0.746   -6.387  1.00 0.00 ? 16 ASP A N    4  
ATOM   4072  C  CA   . ASP A 1 16 ? -5.014  1.624   -7.544  1.00 0.00 ? 16 ASP A CA   4  
ATOM   4073  C  C    . ASP A 1 16 ? -4.920  0.822   -8.839  1.00 0.00 ? 16 ASP A C    4  
ATOM   4074  O  O    . ASP A 1 16 ? -3.830  0.621   -9.376  1.00 0.00 ? 16 ASP A O    4  
ATOM   4075  C  CB   . ASP A 1 16 ? -3.927  2.705   -7.506  1.00 0.00 ? 16 ASP A CB   4  
ATOM   4076  C  CG   . ASP A 1 16 ? -4.226  3.876   -8.423  1.00 0.00 ? 16 ASP A CG   4  
ATOM   4077  O  OD1  . ASP A 1 16 ? -5.383  4.351   -8.431  1.00 0.00 ? 16 ASP A OD1  4  
ATOM   4078  O  OD2  . ASP A 1 16 ? -3.301  4.323   -9.133  1.00 0.00 ? 16 ASP A OD2  4  
ATOM   4079  H  H    . ASP A 1 16 ? -4.007  0.396   -6.147  1.00 0.00 ? 16 ASP A H    4  
ATOM   4080  H  HA   . ASP A 1 16 ? -5.982  2.100   -7.498  1.00 0.00 ? 16 ASP A HA   4  
ATOM   4081  H  HB2  . ASP A 1 16 ? -3.835  3.078   -6.498  1.00 0.00 ? 16 ASP A HB2  4  
ATOM   4082  H  HB3  . ASP A 1 16 ? -2.985  2.269   -7.808  1.00 0.00 ? 16 ASP A HB3  4  
ATOM   4083  N  N    . GLU A 1 17 ? -6.073  0.366   -9.334  1.00 0.00 ? 17 GLU A N    4  
ATOM   4084  C  CA   . GLU A 1 17 ? -6.129  -0.416  -10.573 1.00 0.00 ? 17 GLU A CA   4  
ATOM   4085  C  C    . GLU A 1 17 ? -5.456  0.326   -11.731 1.00 0.00 ? 17 GLU A C    4  
ATOM   4086  O  O    . GLU A 1 17 ? -4.951  -0.302  -12.662 1.00 0.00 ? 17 GLU A O    4  
ATOM   4087  C  CB   . GLU A 1 17 ? -7.578  -0.748  -10.945 1.00 0.00 ? 17 GLU A CB   4  
ATOM   4088  C  CG   . GLU A 1 17 ? -8.545  0.419   -10.786 1.00 0.00 ? 17 GLU A CG   4  
ATOM   4089  C  CD   . GLU A 1 17 ? -9.663  0.402   -11.815 1.00 0.00 ? 17 GLU A CD   4  
ATOM   4090  O  OE1  . GLU A 1 17 ? -9.359  0.391   -13.027 1.00 0.00 ? 17 GLU A OE1  4  
ATOM   4091  O  OE2  . GLU A 1 17 ? -10.842 0.404   -11.406 1.00 0.00 ? 17 GLU A OE2  4  
ATOM   4092  H  H    . GLU A 1 17 ? -6.907  0.561   -8.855  1.00 0.00 ? 17 GLU A H    4  
ATOM   4093  H  HA   . GLU A 1 17 ? -5.594  -1.339  -10.401 1.00 0.00 ? 17 GLU A HA   4  
ATOM   4094  H  HB2  . GLU A 1 17 ? -7.604  -1.068  -11.977 1.00 0.00 ? 17 GLU A HB2  4  
ATOM   4095  H  HB3  . GLU A 1 17 ? -7.920  -1.560  -10.320 1.00 0.00 ? 17 GLU A HB3  4  
ATOM   4096  H  HG2  . GLU A 1 17 ? -8.986  0.370   -9.801  1.00 0.00 ? 17 GLU A HG2  4  
ATOM   4097  H  HG3  . GLU A 1 17 ? -7.994  1.343   -10.887 1.00 0.00 ? 17 GLU A HG3  4  
ATOM   4098  N  N    . ASP A 1 18 ? -5.459  1.662   -11.661 1.00 0.00 ? 18 ASP A N    4  
ATOM   4099  C  CA   . ASP A 1 18 ? -4.854  2.505   -12.693 1.00 0.00 ? 18 ASP A CA   4  
ATOM   4100  C  C    . ASP A 1 18 ? -3.484  1.973   -13.118 1.00 0.00 ? 18 ASP A C    4  
ATOM   4101  O  O    . ASP A 1 18 ? -3.212  1.832   -14.310 1.00 0.00 ? 18 ASP A O    4  
ATOM   4102  C  CB   . ASP A 1 18 ? -4.718  3.947   -12.189 1.00 0.00 ? 18 ASP A CB   4  
ATOM   4103  C  CG   . ASP A 1 18 ? -4.965  4.969   -13.283 1.00 0.00 ? 18 ASP A CG   4  
ATOM   4104  O  OD1  . ASP A 1 18 ? -6.136  5.136   -13.686 1.00 0.00 ? 18 ASP A OD1  4  
ATOM   4105  O  OD2  . ASP A 1 18 ? -3.989  5.604   -13.735 1.00 0.00 ? 18 ASP A OD2  4  
ATOM   4106  H  H    . ASP A 1 18 ? -5.882  2.094   -10.891 1.00 0.00 ? 18 ASP A H    4  
ATOM   4107  H  HA   . ASP A 1 18 ? -5.511  2.496   -13.551 1.00 0.00 ? 18 ASP A HA   4  
ATOM   4108  H  HB2  . ASP A 1 18 ? -5.431  4.116   -11.396 1.00 0.00 ? 18 ASP A HB2  4  
ATOM   4109  H  HB3  . ASP A 1 18 ? -3.719  4.093   -11.804 1.00 0.00 ? 18 ASP A HB3  4  
ATOM   4110  N  N    . SER A 1 19 ? -2.627  1.675   -12.137 1.00 0.00 ? 19 SER A N    4  
ATOM   4111  C  CA   . SER A 1 19 ? -1.289  1.156   -12.423 1.00 0.00 ? 19 SER A CA   4  
ATOM   4112  C  C    . SER A 1 19 ? -0.776  0.263   -11.285 1.00 0.00 ? 19 SER A C    4  
ATOM   4113  O  O    . SER A 1 19 ? 0.427   0.211   -11.023 1.00 0.00 ? 19 SER A O    4  
ATOM   4114  C  CB   . SER A 1 19 ? -0.315  2.315   -12.670 1.00 0.00 ? 19 SER A CB   4  
ATOM   4115  O  OG   . SER A 1 19 ? -0.492  2.870   -13.965 1.00 0.00 ? 19 SER A OG   4  
ATOM   4116  H  H    . SER A 1 19 ? -2.902  1.808   -11.204 1.00 0.00 ? 19 SER A H    4  
ATOM   4117  H  HA   . SER A 1 19 ? -1.356  0.560   -13.322 1.00 0.00 ? 19 SER A HA   4  
ATOM   4118  H  HB2  . SER A 1 19 ? -0.485  3.087   -11.936 1.00 0.00 ? 19 SER A HB2  4  
ATOM   4119  H  HB3  . SER A 1 19 ? 0.699   1.955   -12.584 1.00 0.00 ? 19 SER A HB3  4  
ATOM   4120  H  HG   . SER A 1 19 ? -0.728  3.798   -13.886 1.00 0.00 ? 19 SER A HG   4  
ATOM   4121  N  N    . GLU A 1 20 ? -1.695  -0.446  -10.616 1.00 0.00 ? 20 GLU A N    4  
ATOM   4122  C  CA   . GLU A 1 20 ? -1.339  -1.343  -9.511  1.00 0.00 ? 20 GLU A CA   4  
ATOM   4123  C  C    . GLU A 1 20 ? -0.473  -0.632  -8.465  1.00 0.00 ? 20 GLU A C    4  
ATOM   4124  O  O    . GLU A 1 20 ? 0.721   -0.915  -8.332  1.00 0.00 ? 20 GLU A O    4  
ATOM   4125  C  CB   . GLU A 1 20 ? -0.605  -2.581  -10.038 1.00 0.00 ? 20 GLU A CB   4  
ATOM   4126  C  CG   . GLU A 1 20 ? -1.261  -3.222  -11.253 1.00 0.00 ? 20 GLU A CG   4  
ATOM   4127  C  CD   . GLU A 1 20 ? -0.329  -4.167  -11.985 1.00 0.00 ? 20 GLU A CD   4  
ATOM   4128  O  OE1  . GLU A 1 20 ? 0.667   -3.687  -12.569 1.00 0.00 ? 20 GLU A OE1  4  
ATOM   4129  O  OE2  . GLU A 1 20 ? -0.593  -5.387  -11.975 1.00 0.00 ? 20 GLU A OE2  4  
ATOM   4130  H  H    . GLU A 1 20 ? -2.636  -0.369  -10.876 1.00 0.00 ? 20 GLU A H    4  
ATOM   4131  H  HA   . GLU A 1 20 ? -2.257  -1.659  -9.038  1.00 0.00 ? 20 GLU A HA   4  
ATOM   4132  H  HB2  . GLU A 1 20 ? 0.400   -2.294  -10.310 1.00 0.00 ? 20 GLU A HB2  4  
ATOM   4133  H  HB3  . GLU A 1 20 ? -0.560  -3.317  -9.249  1.00 0.00 ? 20 GLU A HB3  4  
ATOM   4134  H  HG2  . GLU A 1 20 ? -2.128  -3.777  -10.929 1.00 0.00 ? 20 GLU A HG2  4  
ATOM   4135  H  HG3  . GLU A 1 20 ? -1.567  -2.442  -11.935 1.00 0.00 ? 20 GLU A HG3  4  
ATOM   4136  N  N    . THR A 1 21 ? -1.085  0.290   -7.726  1.00 0.00 ? 21 THR A N    4  
ATOM   4137  C  CA   . THR A 1 21 ? -0.378  1.043   -6.690  1.00 0.00 ? 21 THR A CA   4  
ATOM   4138  C  C    . THR A 1 21 ? -1.236  1.172   -5.431  1.00 0.00 ? 21 THR A C    4  
ATOM   4139  O  O    . THR A 1 21 ? -2.463  1.142   -5.505  1.00 0.00 ? 21 THR A O    4  
ATOM   4140  C  CB   . THR A 1 21 ? 0.004   2.436   -7.211  1.00 0.00 ? 21 THR A CB   4  
ATOM   4141  O  OG1  . THR A 1 21 ? 0.605   2.350   -8.493  1.00 0.00 ? 21 THR A OG1  4  
ATOM   4142  C  CG2  . THR A 1 21 ? 0.966   3.175   -6.304  1.00 0.00 ? 21 THR A CG2  4  
ATOM   4143  H  H    . THR A 1 21 ? -2.036  0.468   -7.878  1.00 0.00 ? 21 THR A H    4  
ATOM   4144  H  HA   . THR A 1 21 ? 0.525   0.502   -6.442  1.00 0.00 ? 21 THR A HA   4  
ATOM   4145  H  HB   . THR A 1 21 ? -0.893  3.034   -7.298  1.00 0.00 ? 21 THR A HB   4  
ATOM   4146  H  HG1  . THR A 1 21 ? 1.290   1.676   -8.485  1.00 0.00 ? 21 THR A HG1  4  
ATOM   4147  H  HG21 . THR A 1 21 ? 1.824   2.549   -6.106  1.00 0.00 ? 21 THR A HG21 4  
ATOM   4148  H  HG22 . THR A 1 21 ? 0.473   3.415   -5.375  1.00 0.00 ? 21 THR A HG22 4  
ATOM   4149  H  HG23 . THR A 1 21 ? 1.288   4.085   -6.788  1.00 0.00 ? 21 THR A HG23 4  
ATOM   4150  N  N    . TYR A 1 22 ? -0.586  1.317   -4.276  1.00 0.00 ? 22 TYR A N    4  
ATOM   4151  C  CA   . TYR A 1 22 ? -1.298  1.454   -3.005  1.00 0.00 ? 22 TYR A CA   4  
ATOM   4152  C  C    . TYR A 1 22 ? -0.949  2.777   -2.328  1.00 0.00 ? 22 TYR A C    4  
ATOM   4153  O  O    . TYR A 1 22 ? 0.225   3.129   -2.209  1.00 0.00 ? 22 TYR A O    4  
ATOM   4154  C  CB   . TYR A 1 22 ? -0.972  0.284   -2.072  1.00 0.00 ? 22 TYR A CB   4  
ATOM   4155  C  CG   . TYR A 1 22 ? -1.241  -1.076  -2.679  1.00 0.00 ? 22 TYR A CG   4  
ATOM   4156  C  CD1  . TYR A 1 22 ? -0.364  -1.630  -3.605  1.00 0.00 ? 22 TYR A CD1  4  
ATOM   4157  C  CD2  . TYR A 1 22 ? -2.368  -1.807  -2.326  1.00 0.00 ? 22 TYR A CD2  4  
ATOM   4158  C  CE1  . TYR A 1 22 ? -0.603  -2.871  -4.161  1.00 0.00 ? 22 TYR A CE1  4  
ATOM   4159  C  CE2  . TYR A 1 22 ? -2.613  -3.051  -2.876  1.00 0.00 ? 22 TYR A CE2  4  
ATOM   4160  C  CZ   . TYR A 1 22 ? -1.728  -3.577  -3.794  1.00 0.00 ? 22 TYR A CZ   4  
ATOM   4161  O  OH   . TYR A 1 22 ? -1.967  -4.815  -4.344  1.00 0.00 ? 22 TYR A OH   4  
ATOM   4162  H  H    . TYR A 1 22 ? 0.395   1.333   -4.279  1.00 0.00 ? 22 TYR A H    4  
ATOM   4163  H  HA   . TYR A 1 22 ? -2.357  1.445   -3.218  1.00 0.00 ? 22 TYR A HA   4  
ATOM   4164  H  HB2  . TYR A 1 22 ? 0.074   0.326   -1.805  1.00 0.00 ? 22 TYR A HB2  4  
ATOM   4165  H  HB3  . TYR A 1 22 ? -1.568  0.371   -1.176  1.00 0.00 ? 22 TYR A HB3  4  
ATOM   4166  H  HD1  . TYR A 1 22 ? 0.518   -1.074  -3.891  1.00 0.00 ? 22 TYR A HD1  4  
ATOM   4167  H  HD2  . TYR A 1 22 ? -3.060  -1.393  -1.608  1.00 0.00 ? 22 TYR A HD2  4  
ATOM   4168  H  HE1  . TYR A 1 22 ? 0.090   -3.282  -4.879  1.00 0.00 ? 22 TYR A HE1  4  
ATOM   4169  H  HE2  . TYR A 1 22 ? -3.495  -3.603  -2.590  1.00 0.00 ? 22 TYR A HE2  4  
ATOM   4170  H  HH   . TYR A 1 22 ? -1.875  -5.491  -3.668  1.00 0.00 ? 22 TYR A HH   4  
ATOM   4171  N  N    . PHE A 1 23 ? -1.974  3.509   -1.893  1.00 0.00 ? 23 PHE A N    4  
ATOM   4172  C  CA   . PHE A 1 23 ? -1.769  4.798   -1.235  1.00 0.00 ? 23 PHE A CA   4  
ATOM   4173  C  C    . PHE A 1 23 ? -2.311  4.787   0.193   1.00 0.00 ? 23 PHE A C    4  
ATOM   4174  O  O    . PHE A 1 23 ? -3.243  4.046   0.510   1.00 0.00 ? 23 PHE A O    4  
ATOM   4175  C  CB   . PHE A 1 23 ? -2.442  5.920   -2.035  1.00 0.00 ? 23 PHE A CB   4  
ATOM   4176  C  CG   . PHE A 1 23 ? -1.782  6.211   -3.357  1.00 0.00 ? 23 PHE A CG   4  
ATOM   4177  C  CD1  . PHE A 1 23 ? -1.782  5.266   -4.371  1.00 0.00 ? 23 PHE A CD1  4  
ATOM   4178  C  CD2  . PHE A 1 23 ? -1.165  7.431   -3.586  1.00 0.00 ? 23 PHE A CD2  4  
ATOM   4179  C  CE1  . PHE A 1 23 ? -1.180  5.531   -5.586  1.00 0.00 ? 23 PHE A CE1  4  
ATOM   4180  C  CE2  . PHE A 1 23 ? -0.561  7.702   -4.798  1.00 0.00 ? 23 PHE A CE2  4  
ATOM   4181  C  CZ   . PHE A 1 23 ? -0.568  6.751   -5.800  1.00 0.00 ? 23 PHE A CZ   4  
ATOM   4182  H  H    . PHE A 1 23 ? -2.888  3.176   -2.021  1.00 0.00 ? 23 PHE A H    4  
ATOM   4183  H  HA   . PHE A 1 23 ? -0.707  4.985   -1.200  1.00 0.00 ? 23 PHE A HA   4  
ATOM   4184  H  HB2  . PHE A 1 23 ? -3.468  5.647   -2.230  1.00 0.00 ? 23 PHE A HB2  4  
ATOM   4185  H  HB3  . PHE A 1 23 ? -2.424  6.828   -1.449  1.00 0.00 ? 23 PHE A HB3  4  
ATOM   4186  H  HD1  . PHE A 1 23 ? -2.261  4.311   -4.206  1.00 0.00 ? 23 PHE A HD1  4  
ATOM   4187  H  HD2  . PHE A 1 23 ? -1.157  8.176   -2.803  1.00 0.00 ? 23 PHE A HD2  4  
ATOM   4188  H  HE1  . PHE A 1 23 ? -1.188  4.786   -6.367  1.00 0.00 ? 23 PHE A HE1  4  
ATOM   4189  H  HE2  . PHE A 1 23 ? -0.085  8.657   -4.963  1.00 0.00 ? 23 PHE A HE2  4  
ATOM   4190  H  HZ   . PHE A 1 23 ? -0.096  6.961   -6.748  1.00 0.00 ? 23 PHE A HZ   4  
ATOM   4191  N  N    . TYR A 1 24 ? -1.722  5.624   1.049   1.00 0.00 ? 24 TYR A N    4  
ATOM   4192  C  CA   . TYR A 1 24 ? -2.143  5.726   2.446   1.00 0.00 ? 24 TYR A CA   4  
ATOM   4193  C  C    . TYR A 1 24 ? -2.406  7.180   2.833   1.00 0.00 ? 24 TYR A C    4  
ATOM   4194  O  O    . TYR A 1 24 ? -1.630  8.069   2.482   1.00 0.00 ? 24 TYR A O    4  
ATOM   4195  C  CB   . TYR A 1 24 ? -1.077  5.128   3.371   1.00 0.00 ? 24 TYR A CB   4  
ATOM   4196  C  CG   . TYR A 1 24 ? -1.592  4.796   4.754   1.00 0.00 ? 24 TYR A CG   4  
ATOM   4197  C  CD1  . TYR A 1 24 ? -2.556  3.813   4.940   1.00 0.00 ? 24 TYR A CD1  4  
ATOM   4198  C  CD2  . TYR A 1 24 ? -1.117  5.469   5.874   1.00 0.00 ? 24 TYR A CD2  4  
ATOM   4199  C  CE1  . TYR A 1 24 ? -3.030  3.509   6.199   1.00 0.00 ? 24 TYR A CE1  4  
ATOM   4200  C  CE2  . TYR A 1 24 ? -1.586  5.169   7.138   1.00 0.00 ? 24 TYR A CE2  4  
ATOM   4201  C  CZ   . TYR A 1 24 ? -2.544  4.189   7.296   1.00 0.00 ? 24 TYR A CZ   4  
ATOM   4202  O  OH   . TYR A 1 24 ? -3.013  3.887   8.555   1.00 0.00 ? 24 TYR A OH   4  
ATOM   4203  H  H    . TYR A 1 24 ? -0.987  6.192   0.731   1.00 0.00 ? 24 TYR A H    4  
ATOM   4204  H  HA   . TYR A 1 24 ? -3.057  5.163   2.557   1.00 0.00 ? 24 TYR A HA   4  
ATOM   4205  H  HB2  . TYR A 1 24 ? -0.699  4.218   2.931   1.00 0.00 ? 24 TYR A HB2  4  
ATOM   4206  H  HB3  . TYR A 1 24 ? -0.266  5.835   3.478   1.00 0.00 ? 24 TYR A HB3  4  
ATOM   4207  H  HD1  . TYR A 1 24 ? -2.937  3.280   4.081   1.00 0.00 ? 24 TYR A HD1  4  
ATOM   4208  H  HD2  . TYR A 1 24 ? -0.367  6.237   5.747   1.00 0.00 ? 24 TYR A HD2  4  
ATOM   4209  H  HE1  . TYR A 1 24 ? -3.780  2.741   6.322   1.00 0.00 ? 24 TYR A HE1  4  
ATOM   4210  H  HE2  . TYR A 1 24 ? -1.204  5.702   7.996   1.00 0.00 ? 24 TYR A HE2  4  
ATOM   4211  H  HH   . TYR A 1 24 ? -3.974  3.916   8.557   1.00 0.00 ? 24 TYR A HH   4  
ATOM   4212  N  N    . PRO A 1 25 ? -3.508  7.444   3.566   1.00 0.00 ? 25 PRO A N    4  
ATOM   4213  C  CA   . PRO A 1 25 ? -3.865  8.803   3.998   1.00 0.00 ? 25 PRO A CA   4  
ATOM   4214  C  C    . PRO A 1 25 ? -2.770  9.455   4.841   1.00 0.00 ? 25 PRO A C    4  
ATOM   4215  O  O    . PRO A 1 25 ? -2.356  8.911   5.867   1.00 0.00 ? 25 PRO A O    4  
ATOM   4216  C  CB   . PRO A 1 25 ? -5.130  8.601   4.838   1.00 0.00 ? 25 PRO A CB   4  
ATOM   4217  C  CG   . PRO A 1 25 ? -5.678  7.287   4.400   1.00 0.00 ? 25 PRO A CG   4  
ATOM   4218  C  CD   . PRO A 1 25 ? -4.490  6.447   4.028   1.00 0.00 ? 25 PRO A CD   4  
ATOM   4219  H  HA   . PRO A 1 25 ? -4.088  9.439   3.153   1.00 0.00 ? 25 PRO A HA   4  
ATOM   4220  H  HB2  . PRO A 1 25 ? -4.872  8.591   5.888   1.00 0.00 ? 25 PRO A HB2  4  
ATOM   4221  H  HB3  . PRO A 1 25 ? -5.826  9.403   4.643   1.00 0.00 ? 25 PRO A HB3  4  
ATOM   4222  H  HG2  . PRO A 1 25 ? -6.224  6.828   5.212   1.00 0.00 ? 25 PRO A HG2  4  
ATOM   4223  H  HG3  . PRO A 1 25 ? -6.322  7.425   3.545   1.00 0.00 ? 25 PRO A HG3  4  
ATOM   4224  H  HD2  . PRO A 1 25 ? -4.121  5.910   4.891   1.00 0.00 ? 25 PRO A HD2  4  
ATOM   4225  H  HD3  . PRO A 1 25 ? -4.747  5.761   3.235   1.00 0.00 ? 25 PRO A HD3  4  
ATOM   4226  N  N    . CYS A 1 26 ? -2.307  10.624  4.400   1.00 0.00 ? 26 CYS A N    4  
ATOM   4227  C  CA   . CYS A 1 26 ? -1.264  11.358  5.112   1.00 0.00 ? 26 CYS A CA   4  
ATOM   4228  C  C    . CYS A 1 26 ? -1.809  12.670  5.677   1.00 0.00 ? 26 CYS A C    4  
ATOM   4229  O  O    . CYS A 1 26 ? -2.692  13.290  5.079   1.00 0.00 ? 26 CYS A O    4  
ATOM   4230  C  CB   . CYS A 1 26 ? -0.085  11.643  4.180   1.00 0.00 ? 26 CYS A CB   4  
ATOM   4231  S  SG   . CYS A 1 26 ? 1.547   11.427  4.960   1.00 0.00 ? 26 CYS A SG   4  
ATOM   4232  H  H    . CYS A 1 26 ? -2.679  11.005  3.577   1.00 0.00 ? 26 CYS A H    4  
ATOM   4233  H  HA   . CYS A 1 26 ? -0.923  10.742  5.928   1.00 0.00 ? 26 CYS A HA   4  
ATOM   4234  H  HB2  . CYS A 1 26 ? -0.134  10.973  3.333   1.00 0.00 ? 26 CYS A HB2  4  
ATOM   4235  H  HB3  . CYS A 1 26 ? -0.149  12.663  3.830   1.00 0.00 ? 26 CYS A HB3  4  
ATOM   4236  N  N    . PRO A 1 27 ? -1.285  13.111  6.839   1.00 0.00 ? 27 PRO A N    4  
ATOM   4237  C  CA   . PRO A 1 27 ? -1.718  14.357  7.489   1.00 0.00 ? 27 PRO A CA   4  
ATOM   4238  C  C    . PRO A 1 27 ? -1.628  15.572  6.564   1.00 0.00 ? 27 PRO A C    4  
ATOM   4239  O  O    . PRO A 1 27 ? -2.411  16.513  6.692   1.00 0.00 ? 27 PRO A O    4  
ATOM   4240  C  CB   . PRO A 1 27 ? -0.742  14.511  8.660   1.00 0.00 ? 27 PRO A CB   4  
ATOM   4241  C  CG   . PRO A 1 27 ? -0.261  13.132  8.940   1.00 0.00 ? 27 PRO A CG   4  
ATOM   4242  C  CD   . PRO A 1 27 ? -0.229  12.429  7.612   1.00 0.00 ? 27 PRO A CD   4  
ATOM   4243  H  HA   . PRO A 1 27 ? -2.725  14.270  7.866   1.00 0.00 ? 27 PRO A HA   4  
ATOM   4244  H  HB2  . PRO A 1 27 ? 0.071   15.163  8.370   1.00 0.00 ? 27 PRO A HB2  4  
ATOM   4245  H  HB3  . PRO A 1 27 ? -1.259  14.930  9.510   1.00 0.00 ? 27 PRO A HB3  4  
ATOM   4246  H  HG2  . PRO A 1 27 ? 0.729   13.170  9.369   1.00 0.00 ? 27 PRO A HG2  4  
ATOM   4247  H  HG3  . PRO A 1 27 ? -0.944  12.634  9.611   1.00 0.00 ? 27 PRO A HG3  4  
ATOM   4248  H  HD2  . PRO A 1 27 ? 0.737   12.553  7.142   1.00 0.00 ? 27 PRO A HD2  4  
ATOM   4249  H  HD3  . PRO A 1 27 ? -0.459  11.381  7.734   1.00 0.00 ? 27 PRO A HD3  4  
ATOM   4250  N  N    . CYS A 1 28 ? -0.669  15.550  5.637   1.00 0.00 ? 28 CYS A N    4  
ATOM   4251  C  CA   . CYS A 1 28 ? -0.485  16.657  4.700   1.00 0.00 ? 28 CYS A CA   4  
ATOM   4252  C  C    . CYS A 1 28 ? -1.590  16.678  3.641   1.00 0.00 ? 28 CYS A C    4  
ATOM   4253  O  O    . CYS A 1 28 ? -2.107  17.744  3.297   1.00 0.00 ? 28 CYS A O    4  
ATOM   4254  C  CB   . CYS A 1 28 ? 0.888   16.567  4.026   1.00 0.00 ? 28 CYS A CB   4  
ATOM   4255  S  SG   . CYS A 1 28 ? 1.243   14.947  3.271   1.00 0.00 ? 28 CYS A SG   4  
ATOM   4256  H  H    . CYS A 1 28 ? -0.071  14.774  5.583   1.00 0.00 ? 28 CYS A H    4  
ATOM   4257  H  HA   . CYS A 1 28 ? -0.533  17.575  5.267   1.00 0.00 ? 28 CYS A HA   4  
ATOM   4258  H  HB2  . CYS A 1 28 ? 0.945   17.312  3.246   1.00 0.00 ? 28 CYS A HB2  4  
ATOM   4259  H  HB3  . CYS A 1 28 ? 1.655   16.763  4.759   1.00 0.00 ? 28 CYS A HB3  4  
ATOM   4260  N  N    . GLY A 1 29 ? -1.942  15.498  3.124   1.00 0.00 ? 29 GLY A N    4  
ATOM   4261  C  CA   . GLY A 1 29 ? -2.980  15.402  2.106   1.00 0.00 ? 29 GLY A CA   4  
ATOM   4262  C  C    . GLY A 1 29 ? -2.509  14.719  0.829   1.00 0.00 ? 29 GLY A C    4  
ATOM   4263  O  O    . GLY A 1 29 ? -3.327  14.199  0.066   1.00 0.00 ? 29 GLY A O    4  
ATOM   4264  H  H    . GLY A 1 29 ? -1.492  14.684  3.436   1.00 0.00 ? 29 GLY A H    4  
ATOM   4265  H  HA2  . GLY A 1 29 ? -3.808  14.842  2.512   1.00 0.00 ? 29 GLY A HA2  4  
ATOM   4266  H  HA3  . GLY A 1 29 ? -3.321  16.398  1.861   1.00 0.00 ? 29 GLY A HA3  4  
ATOM   4267  N  N    . ASP A 1 30 ? -1.195  14.717  0.594   1.00 0.00 ? 30 ASP A N    4  
ATOM   4268  C  CA   . ASP A 1 30 ? -0.625  14.092  -0.602  1.00 0.00 ? 30 ASP A CA   4  
ATOM   4269  C  C    . ASP A 1 30 ? -0.875  12.583  -0.613  1.00 0.00 ? 30 ASP A C    4  
ATOM   4270  O  O    . ASP A 1 30 ? -1.099  11.994  -1.672  1.00 0.00 ? 30 ASP A O    4  
ATOM   4271  C  CB   . ASP A 1 30 ? 0.880   14.370  -0.691  1.00 0.00 ? 30 ASP A CB   4  
ATOM   4272  C  CG   . ASP A 1 30 ? 1.196   15.625  -1.484  1.00 0.00 ? 30 ASP A CG   4  
ATOM   4273  O  OD1  . ASP A 1 30 ? 0.797   16.724  -1.044  1.00 0.00 ? 30 ASP A OD1  4  
ATOM   4274  O  OD2  . ASP A 1 30 ? 1.846   15.508  -2.544  1.00 0.00 ? 30 ASP A OD2  4  
ATOM   4275  H  H    . ASP A 1 30 ? -0.594  15.145  1.238   1.00 0.00 ? 30 ASP A H    4  
ATOM   4276  H  HA   . ASP A 1 30 ? -1.112  14.527  -1.462  1.00 0.00 ? 30 ASP A HA   4  
ATOM   4277  H  HB2  . ASP A 1 30 ? 1.279   14.487  0.305   1.00 0.00 ? 30 ASP A HB2  4  
ATOM   4278  H  HB3  . ASP A 1 30 ? 1.365   13.533  -1.170  1.00 0.00 ? 30 ASP A HB3  4  
ATOM   4279  N  N    . ASN A 1 31 ? -0.837  11.970  0.574   1.00 0.00 ? 31 ASN A N    4  
ATOM   4280  C  CA   . ASN A 1 31 ? -1.064  10.531  0.726   1.00 0.00 ? 31 ASN A CA   4  
ATOM   4281  C  C    . ASN A 1 31 ? 0.125   9.714   0.224   1.00 0.00 ? 31 ASN A C    4  
ATOM   4282  O  O    . ASN A 1 31 ? 0.626   9.931   -0.882  1.00 0.00 ? 31 ASN A O    4  
ATOM   4283  C  CB   . ASN A 1 31 ? -2.334  10.095  -0.010  1.00 0.00 ? 31 ASN A CB   4  
ATOM   4284  C  CG   . ASN A 1 31 ? -3.572  10.842  0.454   1.00 0.00 ? 31 ASN A CG   4  
ATOM   4285  O  OD1  . ASN A 1 31 ? -3.636  11.318  1.589   1.00 0.00 ? 31 ASN A OD1  4  
ATOM   4286  N  ND2  . ASN A 1 31 ? -4.563  10.955  -0.425  1.00 0.00 ? 31 ASN A ND2  4  
ATOM   4287  H  H    . ASN A 1 31 ? -0.654  12.505  1.375   1.00 0.00 ? 31 ASN A H    4  
ATOM   4288  H  HA   . ASN A 1 31 ? -1.191  10.336  1.780   1.00 0.00 ? 31 ASN A HA   4  
ATOM   4289  H  HB2  . ASN A 1 31 ? -2.206  10.273  -1.067  1.00 0.00 ? 31 ASN A HB2  4  
ATOM   4290  H  HB3  . ASN A 1 31 ? -2.492  9.040   0.156   1.00 0.00 ? 31 ASN A HB3  4  
ATOM   4291  H  HD21 . ASN A 1 31 ? -4.444  10.559  -1.314  1.00 0.00 ? 31 ASN A HD21 4  
ATOM   4292  H  HD22 . ASN A 1 31 ? -5.376  11.424  -0.145  1.00 0.00 ? 31 ASN A HD22 4  
ATOM   4293  N  N    . PHE A 1 32 ? 0.559   8.763   1.050   1.00 0.00 ? 32 PHE A N    4  
ATOM   4294  C  CA   . PHE A 1 32 ? 1.680   7.885   0.711   1.00 0.00 ? 32 PHE A CA   4  
ATOM   4295  C  C    . PHE A 1 32 ? 1.372   7.066   -0.542  1.00 0.00 ? 32 PHE A C    4  
ATOM   4296  O  O    . PHE A 1 32 ? 0.214   6.956   -0.948  1.00 0.00 ? 32 PHE A O    4  
ATOM   4297  C  CB   . PHE A 1 32 ? 1.977   6.937   1.875   1.00 0.00 ? 32 PHE A CB   4  
ATOM   4298  C  CG   . PHE A 1 32 ? 2.632   7.602   3.051   1.00 0.00 ? 32 PHE A CG   4  
ATOM   4299  C  CD1  . PHE A 1 32 ? 3.959   7.992   2.992   1.00 0.00 ? 32 PHE A CD1  4  
ATOM   4300  C  CD2  . PHE A 1 32 ? 1.920   7.833   4.218   1.00 0.00 ? 32 PHE A CD2  4  
ATOM   4301  C  CE1  . PHE A 1 32 ? 4.564   8.600   4.072   1.00 0.00 ? 32 PHE A CE1  4  
ATOM   4302  C  CE2  . PHE A 1 32 ? 2.522   8.440   5.303   1.00 0.00 ? 32 PHE A CE2  4  
ATOM   4303  C  CZ   . PHE A 1 32 ? 3.846   8.824   5.230   1.00 0.00 ? 32 PHE A CZ   4  
ATOM   4304  H  H    . PHE A 1 32 ? 0.105   8.641   1.912   1.00 0.00 ? 32 PHE A H    4  
ATOM   4305  H  HA   . PHE A 1 32 ? 2.545   8.503   0.526   1.00 0.00 ? 32 PHE A HA   4  
ATOM   4306  H  HB2  . PHE A 1 32 ? 1.051   6.500   2.217   1.00 0.00 ? 32 PHE A HB2  4  
ATOM   4307  H  HB3  . PHE A 1 32 ? 2.632   6.152   1.530   1.00 0.00 ? 32 PHE A HB3  4  
ATOM   4308  H  HD1  . PHE A 1 32 ? 4.522   7.818   2.086   1.00 0.00 ? 32 PHE A HD1  4  
ATOM   4309  H  HD2  . PHE A 1 32 ? 0.884   7.533   4.276   1.00 0.00 ? 32 PHE A HD2  4  
ATOM   4310  H  HE1  . PHE A 1 32 ? 5.600   8.900   4.011   1.00 0.00 ? 32 PHE A HE1  4  
ATOM   4311  H  HE2  . PHE A 1 32 ? 1.957   8.615   6.207   1.00 0.00 ? 32 PHE A HE2  4  
ATOM   4312  H  HZ   . PHE A 1 32 ? 4.319   9.299   6.076   1.00 0.00 ? 32 PHE A HZ   4  
ATOM   4313  N  N    . SER A 1 33 ? 2.412   6.488   -1.150  1.00 0.00 ? 33 SER A N    4  
ATOM   4314  C  CA   . SER A 1 33 ? 2.241   5.676   -2.356  1.00 0.00 ? 33 SER A CA   4  
ATOM   4315  C  C    . SER A 1 33 ? 3.277   4.552   -2.423  1.00 0.00 ? 33 SER A C    4  
ATOM   4316  O  O    . SER A 1 33 ? 4.451   4.758   -2.109  1.00 0.00 ? 33 SER A O    4  
ATOM   4317  C  CB   . SER A 1 33 ? 2.348   6.555   -3.608  1.00 0.00 ? 33 SER A CB   4  
ATOM   4318  O  OG   . SER A 1 33 ? 3.618   7.185   -3.689  1.00 0.00 ? 33 SER A OG   4  
ATOM   4319  H  H    . SER A 1 33 ? 3.312   6.608   -0.778  1.00 0.00 ? 33 SER A H    4  
ATOM   4320  H  HA   . SER A 1 33 ? 1.256   5.237   -2.323  1.00 0.00 ? 33 SER A HA   4  
ATOM   4321  H  HB2  . SER A 1 33 ? 2.207   5.945   -4.487  1.00 0.00 ? 33 SER A HB2  4  
ATOM   4322  H  HB3  . SER A 1 33 ? 1.584   7.317   -3.574  1.00 0.00 ? 33 SER A HB3  4  
ATOM   4323  H  HG   . SER A 1 33 ? 4.291   6.530   -3.889  1.00 0.00 ? 33 SER A HG   4  
ATOM   4324  N  N    . ILE A 1 34 ? 2.833   3.368   -2.848  1.00 0.00 ? 34 ILE A N    4  
ATOM   4325  C  CA   . ILE A 1 34 ? 3.712   2.207   -2.976  1.00 0.00 ? 34 ILE A CA   4  
ATOM   4326  C  C    . ILE A 1 34 ? 3.220   1.280   -4.088  1.00 0.00 ? 34 ILE A C    4  
ATOM   4327  O  O    . ILE A 1 34 ? 2.068   0.840   -4.080  1.00 0.00 ? 34 ILE A O    4  
ATOM   4328  C  CB   . ILE A 1 34 ? 3.820   1.416   -1.649  1.00 0.00 ? 34 ILE A CB   4  
ATOM   4329  C  CG1  . ILE A 1 34 ? 4.819   0.262   -1.790  1.00 0.00 ? 34 ILE A CG1  4  
ATOM   4330  C  CG2  . ILE A 1 34 ? 2.457   0.893   -1.215  1.00 0.00 ? 34 ILE A CG2  4  
ATOM   4331  C  CD1  . ILE A 1 34 ? 5.521   -0.098  -0.498  1.00 0.00 ? 34 ILE A CD1  4  
ATOM   4332  H  H    . ILE A 1 34 ? 1.887   3.275   -3.089  1.00 0.00 ? 34 ILE A H    4  
ATOM   4333  H  HA   . ILE A 1 34 ? 4.698   2.567   -3.235  1.00 0.00 ? 34 ILE A HA   4  
ATOM   4334  H  HB   . ILE A 1 34 ? 4.174   2.093   -0.884  1.00 0.00 ? 34 ILE A HB   4  
ATOM   4335  H  HG12 . ILE A 1 34 ? 4.298   -0.617  -2.138  1.00 0.00 ? 34 ILE A HG12 4  
ATOM   4336  H  HG13 . ILE A 1 34 ? 5.575   0.535   -2.513  1.00 0.00 ? 34 ILE A HG13 4  
ATOM   4337  H  HG21 . ILE A 1 34 ? 1.687   1.563   -1.565  1.00 0.00 ? 34 ILE A HG21 4  
ATOM   4338  H  HG22 . ILE A 1 34 ? 2.420   0.831   -0.139  1.00 0.00 ? 34 ILE A HG22 4  
ATOM   4339  H  HG23 . ILE A 1 34 ? 2.298   -0.089  -1.638  1.00 0.00 ? 34 ILE A HG23 4  
ATOM   4340  H  HD11 . ILE A 1 34 ? 6.565   0.168   -0.569  1.00 0.00 ? 34 ILE A HD11 4  
ATOM   4341  H  HD12 . ILE A 1 34 ? 5.431   -1.160  -0.324  1.00 0.00 ? 34 ILE A HD12 4  
ATOM   4342  H  HD13 . ILE A 1 34 ? 5.067   0.441   0.320   1.00 0.00 ? 34 ILE A HD13 4  
ATOM   4343  N  N    . THR A 1 35 ? 4.095   0.994   -5.050  1.00 0.00 ? 35 THR A N    4  
ATOM   4344  C  CA   . THR A 1 35 ? 3.746   0.128   -6.177  1.00 0.00 ? 35 THR A CA   4  
ATOM   4345  C  C    . THR A 1 35 ? 3.624   -1.330  -5.736  1.00 0.00 ? 35 THR A C    4  
ATOM   4346  O  O    . THR A 1 35 ? 4.318   -1.772  -4.817  1.00 0.00 ? 35 THR A O    4  
ATOM   4347  C  CB   . THR A 1 35 ? 4.796   0.253   -7.288  1.00 0.00 ? 35 THR A CB   4  
ATOM   4348  O  OG1  . THR A 1 35 ? 6.067   0.568   -6.747  1.00 0.00 ? 35 THR A OG1  4  
ATOM   4349  C  CG2  . THR A 1 35 ? 4.463   1.314   -8.317  1.00 0.00 ? 35 THR A CG2  4  
ATOM   4350  H  H    . THR A 1 35 ? 4.996   1.379   -5.008  1.00 0.00 ? 35 THR A H    4  
ATOM   4351  H  HA   . THR A 1 35 ? 2.792   0.451   -6.562  1.00 0.00 ? 35 THR A HA   4  
ATOM   4352  H  HB   . THR A 1 35 ? 4.876   -0.694  -7.804  1.00 0.00 ? 35 THR A HB   4  
ATOM   4353  H  HG1  . THR A 1 35 ? 6.448   -0.215  -6.342  1.00 0.00 ? 35 THR A HG1  4  
ATOM   4354  H  HG21 . THR A 1 35 ? 4.230   0.841   -9.259  1.00 0.00 ? 35 THR A HG21 4  
ATOM   4355  H  HG22 . THR A 1 35 ? 5.310   1.972   -8.445  1.00 0.00 ? 35 THR A HG22 4  
ATOM   4356  H  HG23 . THR A 1 35 ? 3.610   1.887   -7.983  1.00 0.00 ? 35 THR A HG23 4  
ATOM   4357  N  N    . LYS A 1 36 ? 2.736   -2.072  -6.398  1.00 0.00 ? 36 LYS A N    4  
ATOM   4358  C  CA   . LYS A 1 36 ? 2.519   -3.484  -6.081  1.00 0.00 ? 36 LYS A CA   4  
ATOM   4359  C  C    . LYS A 1 36 ? 3.799   -4.293  -6.279  1.00 0.00 ? 36 LYS A C    4  
ATOM   4360  O  O    . LYS A 1 36 ? 4.096   -5.196  -5.495  1.00 0.00 ? 36 LYS A O    4  
ATOM   4361  C  CB   . LYS A 1 36 ? 1.396   -4.063  -6.949  1.00 0.00 ? 36 LYS A CB   4  
ATOM   4362  C  CG   . LYS A 1 36 ? 0.892   -5.417  -6.471  1.00 0.00 ? 36 LYS A CG   4  
ATOM   4363  C  CD   . LYS A 1 36 ? 1.684   -6.562  -7.089  1.00 0.00 ? 36 LYS A CD   4  
ATOM   4364  C  CE   . LYS A 1 36 ? 0.792   -7.748  -7.428  1.00 0.00 ? 36 LYS A CE   4  
ATOM   4365  N  NZ   . LYS A 1 36 ? -0.083  -8.141  -6.287  1.00 0.00 ? 36 LYS A NZ   4  
ATOM   4366  H  H    . LYS A 1 36 ? 2.215   -1.659  -7.121  1.00 0.00 ? 36 LYS A H    4  
ATOM   4367  H  HA   . LYS A 1 36 ? 2.225   -3.545  -5.043  1.00 0.00 ? 36 LYS A HA   4  
ATOM   4368  H  HB2  . LYS A 1 36 ? 0.565   -3.374  -6.949  1.00 0.00 ? 36 LYS A HB2  4  
ATOM   4369  H  HB3  . LYS A 1 36 ? 1.759   -4.174  -7.961  1.00 0.00 ? 36 LYS A HB3  4  
ATOM   4370  H  HG2  . LYS A 1 36 ? 0.989   -5.467  -5.397  1.00 0.00 ? 36 LYS A HG2  4  
ATOM   4371  H  HG3  . LYS A 1 36 ? -0.147  -5.520  -6.746  1.00 0.00 ? 36 LYS A HG3  4  
ATOM   4372  H  HD2  . LYS A 1 36 ? 2.159   -6.213  -7.994  1.00 0.00 ? 36 LYS A HD2  4  
ATOM   4373  H  HD3  . LYS A 1 36 ? 2.441   -6.883  -6.387  1.00 0.00 ? 36 LYS A HD3  4  
ATOM   4374  H  HE2  . LYS A 1 36 ? 0.170   -7.483  -8.271  1.00 0.00 ? 36 LYS A HE2  4  
ATOM   4375  H  HE3  . LYS A 1 36 ? 1.419   -8.586  -7.696  1.00 0.00 ? 36 LYS A HE3  4  
ATOM   4376  H  HZ1  . LYS A 1 36 ? -0.984  -7.623  -6.333  1.00 0.00 ? 36 LYS A HZ1  4  
ATOM   4377  H  HZ2  . LYS A 1 36 ? 0.386   -7.924  -5.384  1.00 0.00 ? 36 LYS A HZ2  4  
ATOM   4378  H  HZ3  . LYS A 1 36 ? -0.282  -9.161  -6.324  1.00 0.00 ? 36 LYS A HZ3  4  
ATOM   4379  N  N    . GLU A 1 37 ? 4.554   -3.960  -7.327  1.00 0.00 ? 37 GLU A N    4  
ATOM   4380  C  CA   . GLU A 1 37 ? 5.806   -4.653  -7.628  1.00 0.00 ? 37 GLU A CA   4  
ATOM   4381  C  C    . GLU A 1 37 ? 6.807   -4.505  -6.481  1.00 0.00 ? 37 GLU A C    4  
ATOM   4382  O  O    . GLU A 1 37 ? 7.528   -5.450  -6.156  1.00 0.00 ? 37 GLU A O    4  
ATOM   4383  C  CB   . GLU A 1 37 ? 6.416   -4.109  -8.922  1.00 0.00 ? 37 GLU A CB   4  
ATOM   4384  C  CG   . GLU A 1 37 ? 7.395   -5.072  -9.581  1.00 0.00 ? 37 GLU A CG   4  
ATOM   4385  C  CD   . GLU A 1 37 ? 8.555   -4.369  -10.264 1.00 0.00 ? 37 GLU A CD   4  
ATOM   4386  O  OE1  . GLU A 1 37 ? 9.157   -3.467  -9.643  1.00 0.00 ? 37 GLU A OE1  4  
ATOM   4387  O  OE2  . GLU A 1 37 ? 8.864   -4.727  -11.419 1.00 0.00 ? 37 GLU A OE2  4  
ATOM   4388  H  H    . GLU A 1 37 ? 4.262   -3.229  -7.912  1.00 0.00 ? 37 GLU A H    4  
ATOM   4389  H  HA   . GLU A 1 37 ? 5.580   -5.700  -7.761  1.00 0.00 ? 37 GLU A HA   4  
ATOM   4390  H  HB2  . GLU A 1 37 ? 5.619   -3.900  -9.623  1.00 0.00 ? 37 GLU A HB2  4  
ATOM   4391  H  HB3  . GLU A 1 37 ? 6.939   -3.190  -8.702  1.00 0.00 ? 37 GLU A HB3  4  
ATOM   4392  H  HG2  . GLU A 1 37 ? 7.792   -5.731  -8.824  1.00 0.00 ? 37 GLU A HG2  4  
ATOM   4393  H  HG3  . GLU A 1 37 ? 6.862   -5.656  -10.319 1.00 0.00 ? 37 GLU A HG3  4  
ATOM   4394  N  N    . ASP A 1 38 ? 6.842   -3.318  -5.870  1.00 0.00 ? 38 ASP A N    4  
ATOM   4395  C  CA   . ASP A 1 38 ? 7.749   -3.049  -4.754  1.00 0.00 ? 38 ASP A CA   4  
ATOM   4396  C  C    . ASP A 1 38 ? 7.530   -4.053  -3.628  1.00 0.00 ? 38 ASP A C    4  
ATOM   4397  O  O    . ASP A 1 38 ? 8.483   -4.627  -3.102  1.00 0.00 ? 38 ASP A O    4  
ATOM   4398  C  CB   . ASP A 1 38 ? 7.538   -1.626  -4.217  1.00 0.00 ? 38 ASP A CB   4  
ATOM   4399  C  CG   . ASP A 1 38 ? 8.455   -0.602  -4.863  1.00 0.00 ? 38 ASP A CG   4  
ATOM   4400  O  OD1  . ASP A 1 38 ? 8.731   -0.728  -6.075  1.00 0.00 ? 38 ASP A OD1  4  
ATOM   4401  O  OD2  . ASP A 1 38 ? 8.890   0.332   -4.157  1.00 0.00 ? 38 ASP A OD2  4  
ATOM   4402  H  H    . ASP A 1 38 ? 6.239   -2.608  -6.174  1.00 0.00 ? 38 ASP A H    4  
ATOM   4403  H  HA   . ASP A 1 38 ? 8.762   -3.145  -5.115  1.00 0.00 ? 38 ASP A HA   4  
ATOM   4404  H  HB2  . ASP A 1 38 ? 6.516   -1.328  -4.398  1.00 0.00 ? 38 ASP A HB2  4  
ATOM   4405  H  HB3  . ASP A 1 38 ? 7.722   -1.623  -3.151  1.00 0.00 ? 38 ASP A HB3  4  
ATOM   4406  N  N    . LEU A 1 39 ? 6.266   -4.261  -3.269  1.00 0.00 ? 39 LEU A N    4  
ATOM   4407  C  CA   . LEU A 1 39 ? 5.914   -5.198  -2.206  1.00 0.00 ? 39 LEU A CA   4  
ATOM   4408  C  C    . LEU A 1 39 ? 6.359   -6.617  -2.558  1.00 0.00 ? 39 LEU A C    4  
ATOM   4409  O  O    . LEU A 1 39 ? 6.887   -7.336  -1.709  1.00 0.00 ? 39 LEU A O    4  
ATOM   4410  C  CB   . LEU A 1 39 ? 4.407   -5.174  -1.948  1.00 0.00 ? 39 LEU A CB   4  
ATOM   4411  C  CG   . LEU A 1 39 ? 3.803   -3.784  -1.728  1.00 0.00 ? 39 LEU A CG   4  
ATOM   4412  C  CD1  . LEU A 1 39 ? 2.364   -3.750  -2.219  1.00 0.00 ? 39 LEU A CD1  4  
ATOM   4413  C  CD2  . LEU A 1 39 ? 3.881   -3.394  -0.259  1.00 0.00 ? 39 LEU A CD2  4  
ATOM   4414  H  H    . LEU A 1 39 ? 5.552   -3.773  -3.732  1.00 0.00 ? 39 LEU A H    4  
ATOM   4415  H  HA   . LEU A 1 39 ? 6.428   -4.886  -1.308  1.00 0.00 ? 39 LEU A HA   4  
ATOM   4416  H  HB2  . LEU A 1 39 ? 3.914   -5.629  -2.795  1.00 0.00 ? 39 LEU A HB2  4  
ATOM   4417  H  HB3  . LEU A 1 39 ? 4.205   -5.771  -1.073  1.00 0.00 ? 39 LEU A HB3  4  
ATOM   4418  H  HG   . LEU A 1 39 ? 4.366   -3.058  -2.298  1.00 0.00 ? 39 LEU A HG   4  
ATOM   4419  H  HD11 . LEU A 1 39 ? 2.296   -4.265  -3.166  1.00 0.00 ? 39 LEU A HD11 4  
ATOM   4420  H  HD12 . LEU A 1 39 ? 2.050   -2.725  -2.344  1.00 0.00 ? 39 LEU A HD12 4  
ATOM   4421  H  HD13 . LEU A 1 39 ? 1.726   -4.238  -1.497  1.00 0.00 ? 39 LEU A HD13 4  
ATOM   4422  H  HD21 . LEU A 1 39 ? 3.646   -2.346  -0.150  1.00 0.00 ? 39 LEU A HD21 4  
ATOM   4423  H  HD22 . LEU A 1 39 ? 4.879   -3.578  0.111   1.00 0.00 ? 39 LEU A HD22 4  
ATOM   4424  H  HD23 . LEU A 1 39 ? 3.174   -3.981  0.309   1.00 0.00 ? 39 LEU A HD23 4  
ATOM   4425  N  N    . GLU A 1 40 ? 6.147   -7.013  -3.815  1.00 0.00 ? 40 GLU A N    4  
ATOM   4426  C  CA   . GLU A 1 40 ? 6.533   -8.347  -4.276  1.00 0.00 ? 40 GLU A CA   4  
ATOM   4427  C  C    . GLU A 1 40 ? 8.039   -8.573  -4.128  1.00 0.00 ? 40 GLU A C    4  
ATOM   4428  O  O    . GLU A 1 40 ? 8.482   -9.697  -3.898  1.00 0.00 ? 40 GLU A O    4  
ATOM   4429  C  CB   . GLU A 1 40 ? 6.120   -8.552  -5.733  1.00 0.00 ? 40 GLU A CB   4  
ATOM   4430  C  CG   . GLU A 1 40 ? 4.626   -8.399  -5.973  1.00 0.00 ? 40 GLU A CG   4  
ATOM   4431  C  CD   . GLU A 1 40 ? 4.159   -9.113  -7.227  1.00 0.00 ? 40 GLU A CD   4  
ATOM   4432  O  OE1  . GLU A 1 40 ? 3.967   -10.345 -7.170  1.00 0.00 ? 40 GLU A OE1  4  
ATOM   4433  O  OE2  . GLU A 1 40 ? 3.983   -8.439  -8.264  1.00 0.00 ? 40 GLU A OE2  4  
ATOM   4434  H  H    . GLU A 1 40 ? 5.723   -6.393  -4.447  1.00 0.00 ? 40 GLU A H    4  
ATOM   4435  H  HA   . GLU A 1 40 ? 6.013   -9.070  -3.662  1.00 0.00 ? 40 GLU A HA   4  
ATOM   4436  H  HB2  . GLU A 1 40 ? 6.636   -7.829  -6.347  1.00 0.00 ? 40 GLU A HB2  4  
ATOM   4437  H  HB3  . GLU A 1 40 ? 6.411   -9.545  -6.041  1.00 0.00 ? 40 GLU A HB3  4  
ATOM   4438  H  HG2  . GLU A 1 40 ? 4.095   -8.807  -5.127  1.00 0.00 ? 40 GLU A HG2  4  
ATOM   4439  H  HG3  . GLU A 1 40 ? 4.398   -7.348  -6.069  1.00 0.00 ? 40 GLU A HG3  4  
ATOM   4440  N  N    . ASN A 1 41 ? 8.822   -7.501  -4.265  1.00 0.00 ? 41 ASN A N    4  
ATOM   4441  C  CA   . ASN A 1 41 ? 10.276  -7.593  -4.150  1.00 0.00 ? 41 ASN A CA   4  
ATOM   4442  C  C    . ASN A 1 41 ? 10.738  -7.459  -2.698  1.00 0.00 ? 41 ASN A C    4  
ATOM   4443  O  O    . ASN A 1 41 ? 11.700  -8.112  -2.286  1.00 0.00 ? 41 ASN A O    4  
ATOM   4444  C  CB   . ASN A 1 41 ? 10.946  -6.513  -5.002  1.00 0.00 ? 41 ASN A CB   4  
ATOM   4445  C  CG   . ASN A 1 41 ? 11.262  -6.991  -6.409  1.00 0.00 ? 41 ASN A CG   4  
ATOM   4446  O  OD1  . ASN A 1 41 ? 11.062  -8.159  -6.743  1.00 0.00 ? 41 ASN A OD1  4  
ATOM   4447  N  ND2  . ASN A 1 41 ? 11.762  -6.087  -7.243  1.00 0.00 ? 41 ASN A ND2  4  
ATOM   4448  H  H    . ASN A 1 41 ? 8.413   -6.629  -4.455  1.00 0.00 ? 41 ASN A H    4  
ATOM   4449  H  HA   . ASN A 1 41 ? 10.574  -8.562  -4.520  1.00 0.00 ? 41 ASN A HA   4  
ATOM   4450  H  HB2  . ASN A 1 41 ? 10.290  -5.658  -5.074  1.00 0.00 ? 41 ASN A HB2  4  
ATOM   4451  H  HB3  . ASN A 1 41 ? 11.870  -6.211  -4.529  1.00 0.00 ? 41 ASN A HB3  4  
ATOM   4452  H  HD21 . ASN A 1 41 ? 11.899  -5.174  -6.913  1.00 0.00 ? 41 ASN A HD21 4  
ATOM   4453  H  HD22 . ASN A 1 41 ? 11.976  -6.370  -8.157  1.00 0.00 ? 41 ASN A HD22 4  
ATOM   4454  N  N    . GLY A 1 42 ? 10.063  -6.599  -1.933  1.00 0.00 ? 42 GLY A N    4  
ATOM   4455  C  CA   . GLY A 1 42 ? 10.430  -6.380  -0.546  1.00 0.00 ? 42 GLY A CA   4  
ATOM   4456  C  C    . GLY A 1 42 ? 10.291  -4.921  -0.128  1.00 0.00 ? 42 GLY A C    4  
ATOM   4457  O  O    . GLY A 1 42 ? 10.306  -4.613  1.064   1.00 0.00 ? 42 GLY A O    4  
ATOM   4458  H  H    . GLY A 1 42 ? 9.314   -6.097  -2.319  1.00 0.00 ? 42 GLY A H    4  
ATOM   4459  H  HA2  . GLY A 1 42 ? 9.792   -6.988  0.080   1.00 0.00 ? 42 GLY A HA2  4  
ATOM   4460  H  HA3  . GLY A 1 42 ? 11.456  -6.687  -0.401  1.00 0.00 ? 42 GLY A HA3  4  
ATOM   4461  N  N    . GLU A 1 43 ? 10.151  -4.024  -1.114  1.00 0.00 ? 43 GLU A N    4  
ATOM   4462  C  CA   . GLU A 1 43 ? 10.003  -2.595  -0.854  1.00 0.00 ? 43 GLU A CA   4  
ATOM   4463  C  C    . GLU A 1 43 ? 8.665   -2.293  -0.177  1.00 0.00 ? 43 GLU A C    4  
ATOM   4464  O  O    . GLU A 1 43 ? 7.708   -1.869  -0.824  1.00 0.00 ? 43 GLU A O    4  
ATOM   4465  C  CB   . GLU A 1 43 ? 10.112  -1.796  -2.162  1.00 0.00 ? 43 GLU A CB   4  
ATOM   4466  C  CG   . GLU A 1 43 ? 11.539  -1.593  -2.641  1.00 0.00 ? 43 GLU A CG   4  
ATOM   4467  C  CD   . GLU A 1 43 ? 12.408  -0.891  -1.614  1.00 0.00 ? 43 GLU A CD   4  
ATOM   4468  O  OE1  . GLU A 1 43 ? 12.075  0.252   -1.232  1.00 0.00 ? 43 GLU A OE1  4  
ATOM   4469  O  OE2  . GLU A 1 43 ? 13.422  -1.484  -1.191  1.00 0.00 ? 43 GLU A OE2  4  
ATOM   4470  H  H    . GLU A 1 43 ? 10.144  -4.334  -2.042  1.00 0.00 ? 43 GLU A H    4  
ATOM   4471  H  HA   . GLU A 1 43 ? 10.802  -2.295  -0.193  1.00 0.00 ? 43 GLU A HA   4  
ATOM   4472  H  HB2  . GLU A 1 43 ? 9.568   -2.317  -2.934  1.00 0.00 ? 43 GLU A HB2  4  
ATOM   4473  H  HB3  . GLU A 1 43 ? 9.665   -0.824  -2.013  1.00 0.00 ? 43 GLU A HB3  4  
ATOM   4474  H  HG2  . GLU A 1 43 ? 11.973  -2.557  -2.858  1.00 0.00 ? 43 GLU A HG2  4  
ATOM   4475  H  HG3  . GLU A 1 43 ? 11.520  -0.998  -3.542  1.00 0.00 ? 43 GLU A HG3  4  
ATOM   4476  N  N    . ASP A 1 44 ? 8.611   -2.515  1.130   1.00 0.00 ? 44 ASP A N    4  
ATOM   4477  C  CA   . ASP A 1 44 ? 7.397   -2.265  1.908   1.00 0.00 ? 44 ASP A CA   4  
ATOM   4478  C  C    . ASP A 1 44 ? 7.438   -0.874  2.546   1.00 0.00 ? 44 ASP A C    4  
ATOM   4479  O  O    . ASP A 1 44 ? 6.998   -0.686  3.681   1.00 0.00 ? 44 ASP A O    4  
ATOM   4480  C  CB   . ASP A 1 44 ? 7.215   -3.345  2.985   1.00 0.00 ? 44 ASP A CB   4  
ATOM   4481  C  CG   . ASP A 1 44 ? 8.480   -3.629  3.774   1.00 0.00 ? 44 ASP A CG   4  
ATOM   4482  O  OD1  . ASP A 1 44 ? 9.075   -2.675  4.317   1.00 0.00 ? 44 ASP A OD1  4  
ATOM   4483  O  OD2  . ASP A 1 44 ? 8.872   -4.811  3.852   1.00 0.00 ? 44 ASP A OD2  4  
ATOM   4484  H  H    . ASP A 1 44 ? 9.407   -2.853  1.582   1.00 0.00 ? 44 ASP A H    4  
ATOM   4485  H  HA   . ASP A 1 44 ? 6.556   -2.306  1.230   1.00 0.00 ? 44 ASP A HA   4  
ATOM   4486  H  HB2  . ASP A 1 44 ? 6.449   -3.027  3.676   1.00 0.00 ? 44 ASP A HB2  4  
ATOM   4487  H  HB3  . ASP A 1 44 ? 6.902   -4.261  2.506   1.00 0.00 ? 44 ASP A HB3  4  
ATOM   4488  N  N    . VAL A 1 45 ? 7.962   0.101   1.801   1.00 0.00 ? 45 VAL A N    4  
ATOM   4489  C  CA   . VAL A 1 45 ? 8.054   1.473   2.287   1.00 0.00 ? 45 VAL A CA   4  
ATOM   4490  C  C    . VAL A 1 45 ? 7.423   2.453   1.300   1.00 0.00 ? 45 VAL A C    4  
ATOM   4491  O  O    . VAL A 1 45 ? 7.703   2.411   0.100   1.00 0.00 ? 45 VAL A O    4  
ATOM   4492  C  CB   . VAL A 1 45 ? 9.518   1.889   2.552   1.00 0.00 ? 45 VAL A CB   4  
ATOM   4493  C  CG1  . VAL A 1 45 ? 10.362  1.764   1.291   1.00 0.00 ? 45 VAL A CG1  4  
ATOM   4494  C  CG2  . VAL A 1 45 ? 9.577   3.309   3.104   1.00 0.00 ? 45 VAL A CG2  4  
ATOM   4495  H  H    . VAL A 1 45 ? 8.291   -0.109  0.903   1.00 0.00 ? 45 VAL A H    4  
ATOM   4496  H  HA   . VAL A 1 45 ? 7.515   1.527   3.220   1.00 0.00 ? 45 VAL A HA   4  
ATOM   4497  H  HB   . VAL A 1 45 ? 9.927   1.222   3.296   1.00 0.00 ? 45 VAL A HB   4  
ATOM   4498  H  HG11 . VAL A 1 45 ? 11.337  1.371   1.546   1.00 0.00 ? 45 VAL A HG11 4  
ATOM   4499  H  HG12 . VAL A 1 45 ? 10.476  2.735   0.833   1.00 0.00 ? 45 VAL A HG12 4  
ATOM   4500  H  HG13 . VAL A 1 45 ? 9.877   1.094   0.596   1.00 0.00 ? 45 VAL A HG13 4  
ATOM   4501  H  HG21 . VAL A 1 45 ? 8.869   3.409   3.913   1.00 0.00 ? 45 VAL A HG21 4  
ATOM   4502  H  HG22 . VAL A 1 45 ? 9.331   4.010   2.320   1.00 0.00 ? 45 VAL A HG22 4  
ATOM   4503  H  HG23 . VAL A 1 45 ? 10.572  3.513   3.470   1.00 0.00 ? 45 VAL A HG23 4  
ATOM   4504  N  N    . ALA A 1 46 ? 6.575   3.340   1.817   1.00 0.00 ? 46 ALA A N    4  
ATOM   4505  C  CA   . ALA A 1 46 ? 5.911   4.336   0.989   1.00 0.00 ? 46 ALA A CA   4  
ATOM   4506  C  C    . ALA A 1 46 ? 6.395   5.740   1.331   1.00 0.00 ? 46 ALA A C    4  
ATOM   4507  O  O    . ALA A 1 46 ? 6.375   6.146   2.495   1.00 0.00 ? 46 ALA A O    4  
ATOM   4508  C  CB   . ALA A 1 46 ? 4.401   4.239   1.150   1.00 0.00 ? 46 ALA A CB   4  
ATOM   4509  H  H    . ALA A 1 46 ? 6.398   3.325   2.782   1.00 0.00 ? 46 ALA A H    4  
ATOM   4510  H  HA   . ALA A 1 46 ? 6.153   4.124   -0.044  1.00 0.00 ? 46 ALA A HA   4  
ATOM   4511  H  HB1  . ALA A 1 46 ? 4.133   3.238   1.454   1.00 0.00 ? 46 ALA A HB1  4  
ATOM   4512  H  HB2  . ALA A 1 46 ? 3.923   4.467   0.209   1.00 0.00 ? 46 ALA A HB2  4  
ATOM   4513  H  HB3  . ALA A 1 46 ? 4.072   4.942   1.899   1.00 0.00 ? 46 ALA A HB3  4  
ATOM   4514  N  N    . THR A 1 47 ? 6.833   6.477   0.311   1.00 0.00 ? 47 THR A N    4  
ATOM   4515  C  CA   . THR A 1 47 ? 7.325   7.839   0.501   1.00 0.00 ? 47 THR A CA   4  
ATOM   4516  C  C    . THR A 1 47 ? 6.374   8.853   -0.134  1.00 0.00 ? 47 THR A C    4  
ATOM   4517  O  O    . THR A 1 47 ? 6.093   8.785   -1.333  1.00 0.00 ? 47 THR A O    4  
ATOM   4518  C  CB   . THR A 1 47 ? 8.733   7.987   -0.091  1.00 0.00 ? 47 THR A CB   4  
ATOM   4519  O  OG1  . THR A 1 47 ? 9.548   6.885   0.271   1.00 0.00 ? 47 THR A OG1  4  
ATOM   4520  C  CG2  . THR A 1 47 ? 9.446   9.248   0.355   1.00 0.00 ? 47 THR A CG2  4  
ATOM   4521  H  H    . THR A 1 47 ? 6.825   6.095   -0.592  1.00 0.00 ? 47 THR A H    4  
ATOM   4522  H  HA   . THR A 1 47 ? 7.370   8.027   1.563   1.00 0.00 ? 47 THR A HA   4  
ATOM   4523  H  HB   . THR A 1 47 ? 8.658   8.014   -1.170  1.00 0.00 ? 47 THR A HB   4  
ATOM   4524  H  HG1  . THR A 1 47 ? 10.133  6.664   -0.458  1.00 0.00 ? 47 THR A HG1  4  
ATOM   4525  H  HG21 . THR A 1 47 ? 10.195  8.997   1.091   1.00 0.00 ? 47 THR A HG21 4  
ATOM   4526  H  HG22 . THR A 1 47 ? 8.732   9.933   0.789   1.00 0.00 ? 47 THR A HG22 4  
ATOM   4527  H  HG23 . THR A 1 47 ? 9.919   9.715   -0.496  1.00 0.00 ? 47 THR A HG23 4  
ATOM   4528  N  N    . CYS A 1 48 ? 5.883   9.790   0.677   1.00 0.00 ? 48 CYS A N    4  
ATOM   4529  C  CA   . CYS A 1 48 ? 4.963   10.820  0.198   1.00 0.00 ? 48 CYS A CA   4  
ATOM   4530  C  C    . CYS A 1 48 ? 5.690   11.819  -0.703  1.00 0.00 ? 48 CYS A C    4  
ATOM   4531  O  O    . CYS A 1 48 ? 6.838   12.183  -0.439  1.00 0.00 ? 48 CYS A O    4  
ATOM   4532  C  CB   . CYS A 1 48 ? 4.321   11.551  1.378   1.00 0.00 ? 48 CYS A CB   4  
ATOM   4533  S  SG   . CYS A 1 48 ? 2.540   11.871  1.174   1.00 0.00 ? 48 CYS A SG   4  
ATOM   4534  H  H    . CYS A 1 48 ? 6.145   9.790   1.622   1.00 0.00 ? 48 CYS A H    4  
ATOM   4535  H  HA   . CYS A 1 48 ? 4.191   10.330  -0.375  1.00 0.00 ? 48 CYS A HA   4  
ATOM   4536  H  HB2  . CYS A 1 48 ? 4.444   10.958  2.272   1.00 0.00 ? 48 CYS A HB2  4  
ATOM   4537  H  HB3  . CYS A 1 48 ? 4.813   12.502  1.513   1.00 0.00 ? 48 CYS A HB3  4  
ATOM   4538  N  N    . PRO A 1 49 ? 5.030   12.274  -1.787  1.00 0.00 ? 49 PRO A N    4  
ATOM   4539  C  CA   . PRO A 1 49 ? 5.615   13.225  -2.735  1.00 0.00 ? 49 PRO A CA   4  
ATOM   4540  C  C    . PRO A 1 49 ? 5.463   14.692  -2.302  1.00 0.00 ? 49 PRO A C    4  
ATOM   4541  O  O    . PRO A 1 49 ? 5.266   15.577  -3.139  1.00 0.00 ? 49 PRO A O    4  
ATOM   4542  C  CB   . PRO A 1 49 ? 4.820   12.949  -4.008  1.00 0.00 ? 49 PRO A CB   4  
ATOM   4543  C  CG   . PRO A 1 49 ? 3.469   12.533  -3.530  1.00 0.00 ? 49 PRO A CG   4  
ATOM   4544  C  CD   . PRO A 1 49 ? 3.662   11.881  -2.181  1.00 0.00 ? 49 PRO A CD   4  
ATOM   4545  H  HA   . PRO A 1 49 ? 6.659   13.015  -2.910  1.00 0.00 ? 49 PRO A HA   4  
ATOM   4546  H  HB2  . PRO A 1 49 ? 4.770   13.847  -4.608  1.00 0.00 ? 49 PRO A HB2  4  
ATOM   4547  H  HB3  . PRO A 1 49 ? 5.299   12.160  -4.570  1.00 0.00 ? 49 PRO A HB3  4  
ATOM   4548  H  HG2  . PRO A 1 49 ? 2.833   13.399  -3.436  1.00 0.00 ? 49 PRO A HG2  4  
ATOM   4549  H  HG3  . PRO A 1 49 ? 3.037   11.828  -4.225  1.00 0.00 ? 49 PRO A HG3  4  
ATOM   4550  H  HD2  . PRO A 1 49 ? 2.936   12.259  -1.476  1.00 0.00 ? 49 PRO A HD2  4  
ATOM   4551  H  HD3  . PRO A 1 49 ? 3.581   10.808  -2.266  1.00 0.00 ? 49 PRO A HD3  4  
ATOM   4552  N  N    . SER A 1 50 ? 5.567   14.944  -0.996  1.00 0.00 ? 50 SER A N    4  
ATOM   4553  C  CA   . SER A 1 50 ? 5.452   16.298  -0.457  1.00 0.00 ? 50 SER A CA   4  
ATOM   4554  C  C    . SER A 1 50 ? 6.179   16.405  0.883   1.00 0.00 ? 50 SER A C    4  
ATOM   4555  O  O    . SER A 1 50 ? 7.165   17.135  1.008   1.00 0.00 ? 50 SER A O    4  
ATOM   4556  C  CB   . SER A 1 50 ? 3.980   16.689  -0.296  1.00 0.00 ? 50 SER A CB   4  
ATOM   4557  O  OG   . SER A 1 50 ? 3.844   17.905  0.421   1.00 0.00 ? 50 SER A OG   4  
ATOM   4558  H  H    . SER A 1 50 ? 5.729   14.204  -0.380  1.00 0.00 ? 50 SER A H    4  
ATOM   4559  H  HA   . SER A 1 50 ? 5.920   16.973  -1.158  1.00 0.00 ? 50 SER A HA   4  
ATOM   4560  H  HB2  . SER A 1 50 ? 3.535   16.813  -1.272  1.00 0.00 ? 50 SER A HB2  4  
ATOM   4561  H  HB3  . SER A 1 50 ? 3.458   15.909  0.240   1.00 0.00 ? 50 SER A HB3  4  
ATOM   4562  H  HG   . SER A 1 50 ? 3.224   18.478  -0.035  1.00 0.00 ? 50 SER A HG   4  
ATOM   4563  N  N    . CYS A 1 51 ? 5.695   15.664  1.879   1.00 0.00 ? 51 CYS A N    4  
ATOM   4564  C  CA   . CYS A 1 51 ? 6.307   15.671  3.206   1.00 0.00 ? 51 CYS A CA   4  
ATOM   4565  C  C    . CYS A 1 51 ? 7.589   14.831  3.234   1.00 0.00 ? 51 CYS A C    4  
ATOM   4566  O  O    . CYS A 1 51 ? 8.463   15.056  4.073   1.00 0.00 ? 51 CYS A O    4  
ATOM   4567  C  CB   . CYS A 1 51 ? 5.321   15.151  4.254   1.00 0.00 ? 51 CYS A CB   4  
ATOM   4568  S  SG   . CYS A 1 51 ? 4.796   13.425  3.991   1.00 0.00 ? 51 CYS A SG   4  
ATOM   4569  H  H    . CYS A 1 51 ? 4.911   15.097  1.717   1.00 0.00 ? 51 CYS A H    4  
ATOM   4570  H  HA   . CYS A 1 51 ? 6.559   16.694  3.444   1.00 0.00 ? 51 CYS A HA   4  
ATOM   4571  H  HB2  . CYS A 1 51 ? 5.782   15.208  5.229   1.00 0.00 ? 51 CYS A HB2  4  
ATOM   4572  H  HB3  . CYS A 1 51 ? 4.436   15.768  4.243   1.00 0.00 ? 51 CYS A HB3  4  
ATOM   4573  N  N    . SER A 1 52 ? 7.690   13.860  2.319   1.00 0.00 ? 52 SER A N    4  
ATOM   4574  C  CA   . SER A 1 52 ? 8.860   12.981  2.241   1.00 0.00 ? 52 SER A CA   4  
ATOM   4575  C  C    . SER A 1 52 ? 8.962   12.100  3.489   1.00 0.00 ? 52 SER A C    4  
ATOM   4576  O  O    . SER A 1 52 ? 10.050  11.885  4.026   1.00 0.00 ? 52 SER A O    4  
ATOM   4577  C  CB   . SER A 1 52 ? 10.142  13.804  2.064   1.00 0.00 ? 52 SER A CB   4  
ATOM   4578  O  OG   . SER A 1 52 ? 9.994   14.766  1.035   1.00 0.00 ? 52 SER A OG   4  
ATOM   4579  H  H    . SER A 1 52 ? 6.957   13.727  1.683   1.00 0.00 ? 52 SER A H    4  
ATOM   4580  H  HA   . SER A 1 52 ? 8.732   12.343  1.378   1.00 0.00 ? 52 SER A HA   4  
ATOM   4581  H  HB2  . SER A 1 52 ? 10.367  14.317  2.988   1.00 0.00 ? 52 SER A HB2  4  
ATOM   4582  H  HB3  . SER A 1 52 ? 10.960  13.145  1.810   1.00 0.00 ? 52 SER A HB3  4  
ATOM   4583  H  HG   . SER A 1 52 ? 10.809  14.829  0.532   1.00 0.00 ? 52 SER A HG   4  
ATOM   4584  N  N    . LEU A 1 53 ? 7.815   11.589  3.940   1.00 0.00 ? 53 LEU A N    4  
ATOM   4585  C  CA   . LEU A 1 53 ? 7.762   10.728  5.118   1.00 0.00 ? 53 LEU A CA   4  
ATOM   4586  C  C    . LEU A 1 53 ? 7.952   9.263   4.731   1.00 0.00 ? 53 LEU A C    4  
ATOM   4587  O  O    . LEU A 1 53 ? 8.127   8.941   3.553   1.00 0.00 ? 53 LEU A O    4  
ATOM   4588  C  CB   . LEU A 1 53 ? 6.423   10.906  5.842   1.00 0.00 ? 53 LEU A CB   4  
ATOM   4589  C  CG   . LEU A 1 53 ? 6.430   11.910  6.997   1.00 0.00 ? 53 LEU A CG   4  
ATOM   4590  C  CD1  . LEU A 1 53 ? 5.037   12.487  7.207   1.00 0.00 ? 53 LEU A CD1  4  
ATOM   4591  C  CD2  . LEU A 1 53 ? 6.936   11.254  8.275   1.00 0.00 ? 53 LEU A CD2  4  
ATOM   4592  H  H    . LEU A 1 53 ? 6.982   11.795  3.464   1.00 0.00 ? 53 LEU A H    4  
ATOM   4593  H  HA   . LEU A 1 53 ? 8.563   11.022  5.780   1.00 0.00 ? 53 LEU A HA   4  
ATOM   4594  H  HB2  . LEU A 1 53 ? 5.688   11.230  5.118   1.00 0.00 ? 53 LEU A HB2  4  
ATOM   4595  H  HB3  . LEU A 1 53 ? 6.118   9.947   6.232   1.00 0.00 ? 53 LEU A HB3  4  
ATOM   4596  H  HG   . LEU A 1 53 ? 7.094   12.725  6.753   1.00 0.00 ? 53 LEU A HG   4  
ATOM   4597  H  HD11 . LEU A 1 53 ? 4.300   11.791  6.832   1.00 0.00 ? 53 LEU A HD11 4  
ATOM   4598  H  HD12 . LEU A 1 53 ? 4.953   13.422  6.674   1.00 0.00 ? 53 LEU A HD12 4  
ATOM   4599  H  HD13 . LEU A 1 53 ? 4.871   12.655  8.260   1.00 0.00 ? 53 LEU A HD13 4  
ATOM   4600  H  HD21 . LEU A 1 53 ? 7.111   12.012  9.023   1.00 0.00 ? 53 LEU A HD21 4  
ATOM   4601  H  HD22 . LEU A 1 53 ? 7.860   10.731  8.070   1.00 0.00 ? 53 LEU A HD22 4  
ATOM   4602  H  HD23 . LEU A 1 53 ? 6.199   10.553  8.637   1.00 0.00 ? 53 LEU A HD23 4  
ATOM   4603  N  N    . ILE A 1 54 ? 7.914   8.378   5.727   1.00 0.00 ? 54 ILE A N    4  
ATOM   4604  C  CA   . ILE A 1 54 ? 8.079   6.947   5.486   1.00 0.00 ? 54 ILE A CA   4  
ATOM   4605  C  C    . ILE A 1 54 ? 7.060   6.127   6.277   1.00 0.00 ? 54 ILE A C    4  
ATOM   4606  O  O    . ILE A 1 54 ? 6.725   6.462   7.416   1.00 0.00 ? 54 ILE A O    4  
ATOM   4607  C  CB   . ILE A 1 54 ? 9.503   6.470   5.860   1.00 0.00 ? 54 ILE A CB   4  
ATOM   4608  C  CG1  . ILE A 1 54 ? 9.899   6.991   7.247   1.00 0.00 ? 54 ILE A CG1  4  
ATOM   4609  C  CG2  . ILE A 1 54 ? 10.511  6.920   4.809   1.00 0.00 ? 54 ILE A CG2  4  
ATOM   4610  C  CD1  . ILE A 1 54 ? 11.287  6.568   7.684   1.00 0.00 ? 54 ILE A CD1  4  
ATOM   4611  H  H    . ILE A 1 54 ? 7.770   8.693   6.644   1.00 0.00 ? 54 ILE A H    4  
ATOM   4612  H  HA   . ILE A 1 54 ? 7.929   6.768   4.431   1.00 0.00 ? 54 ILE A HA   4  
ATOM   4613  H  HB   . ILE A 1 54 ? 9.501   5.390   5.877   1.00 0.00 ? 54 ILE A HB   4  
ATOM   4614  H  HG12 . ILE A 1 54 ? 9.870   8.070   7.242   1.00 0.00 ? 54 ILE A HG12 4  
ATOM   4615  H  HG13 . ILE A 1 54 ? 9.195   6.621   7.978   1.00 0.00 ? 54 ILE A HG13 4  
ATOM   4616  H  HG21 . ILE A 1 54 ? 10.009  7.069   3.866   1.00 0.00 ? 54 ILE A HG21 4  
ATOM   4617  H  HG22 . ILE A 1 54 ? 11.273  6.162   4.694   1.00 0.00 ? 54 ILE A HG22 4  
ATOM   4618  H  HG23 . ILE A 1 54 ? 10.971  7.846   5.123   1.00 0.00 ? 54 ILE A HG23 4  
ATOM   4619  H  HD11 . ILE A 1 54 ? 11.228  5.629   8.212   1.00 0.00 ? 54 ILE A HD11 4  
ATOM   4620  H  HD12 . ILE A 1 54 ? 11.703  7.322   8.337   1.00 0.00 ? 54 ILE A HD12 4  
ATOM   4621  H  HD13 . ILE A 1 54 ? 11.919  6.455   6.817   1.00 0.00 ? 54 ILE A HD13 4  
ATOM   4622  N  N    . ILE A 1 55 ? 6.582   5.041   5.666   1.00 0.00 ? 55 ILE A N    4  
ATOM   4623  C  CA   . ILE A 1 55 ? 5.611   4.150   6.303   1.00 0.00 ? 55 ILE A CA   4  
ATOM   4624  C  C    . ILE A 1 55 ? 5.833   2.705   5.867   1.00 0.00 ? 55 ILE A C    4  
ATOM   4625  O  O    . ILE A 1 55 ? 6.200   2.444   4.720   1.00 0.00 ? 55 ILE A O    4  
ATOM   4626  C  CB   . ILE A 1 55 ? 4.153   4.543   5.977   1.00 0.00 ? 55 ILE A CB   4  
ATOM   4627  C  CG1  . ILE A 1 55 ? 3.964   4.729   4.468   1.00 0.00 ? 55 ILE A CG1  4  
ATOM   4628  C  CG2  . ILE A 1 55 ? 3.753   5.802   6.729   1.00 0.00 ? 55 ILE A CG2  4  
ATOM   4629  C  CD1  . ILE A 1 55 ? 2.596   4.305   3.974   1.00 0.00 ? 55 ILE A CD1  4  
ATOM   4630  H  H    . ILE A 1 55 ? 6.898   4.828   4.762   1.00 0.00 ? 55 ILE A H    4  
ATOM   4631  H  HA   . ILE A 1 55 ? 5.751   4.218   7.373   1.00 0.00 ? 55 ILE A HA   4  
ATOM   4632  H  HB   . ILE A 1 55 ? 3.511   3.740   6.312   1.00 0.00 ? 55 ILE A HB   4  
ATOM   4633  H  HG12 . ILE A 1 55 ? 4.096   5.772   4.221   1.00 0.00 ? 55 ILE A HG12 4  
ATOM   4634  H  HG13 . ILE A 1 55 ? 4.702   4.144   3.943   1.00 0.00 ? 55 ILE A HG13 4  
ATOM   4635  H  HG21 . ILE A 1 55 ? 3.825   5.625   7.792   1.00 0.00 ? 55 ILE A HG21 4  
ATOM   4636  H  HG22 . ILE A 1 55 ? 2.735   6.063   6.477   1.00 0.00 ? 55 ILE A HG22 4  
ATOM   4637  H  HG23 . ILE A 1 55 ? 4.411   6.612   6.453   1.00 0.00 ? 55 ILE A HG23 4  
ATOM   4638  H  HD11 . ILE A 1 55 ? 1.997   5.180   3.776   1.00 0.00 ? 55 ILE A HD11 4  
ATOM   4639  H  HD12 . ILE A 1 55 ? 2.112   3.701   4.729   1.00 0.00 ? 55 ILE A HD12 4  
ATOM   4640  H  HD13 . ILE A 1 55 ? 2.702   3.729   3.068   1.00 0.00 ? 55 ILE A HD13 4  
ATOM   4641  N  N    . LYS A 1 56 ? 5.607   1.768   6.786   1.00 0.00 ? 56 LYS A N    4  
ATOM   4642  C  CA   . LYS A 1 56 ? 5.783   0.350   6.489   1.00 0.00 ? 56 LYS A CA   4  
ATOM   4643  C  C    . LYS A 1 56 ? 4.478   -0.282  6.040   1.00 0.00 ? 56 LYS A C    4  
ATOM   4644  O  O    . LYS A 1 56 ? 3.416   -0.036  6.616   1.00 0.00 ? 56 LYS A O    4  
ATOM   4645  C  CB   . LYS A 1 56 ? 6.338   -0.393  7.706   1.00 0.00 ? 56 LYS A CB   4  
ATOM   4646  C  CG   . LYS A 1 56 ? 7.481   -1.339  7.378   1.00 0.00 ? 56 LYS A CG   4  
ATOM   4647  C  CD   . LYS A 1 56 ? 6.975   -2.668  6.838   1.00 0.00 ? 56 LYS A CD   4  
ATOM   4648  C  CE   . LYS A 1 56 ? 7.961   -3.795  7.115   1.00 0.00 ? 56 LYS A CE   4  
ATOM   4649  N  NZ   . LYS A 1 56 ? 7.277   -5.109  7.273   1.00 0.00 ? 56 LYS A NZ   4  
ATOM   4650  H  H    . LYS A 1 56 ? 5.313   2.036   7.682   1.00 0.00 ? 56 LYS A H    4  
ATOM   4651  H  HA   . LYS A 1 56 ? 6.486   0.269   5.677   1.00 0.00 ? 56 LYS A HA   4  
ATOM   4652  H  HB2  . LYS A 1 56 ? 6.694   0.332   8.423   1.00 0.00 ? 56 LYS A HB2  4  
ATOM   4653  H  HB3  . LYS A 1 56 ? 5.542   -0.968  8.157   1.00 0.00 ? 56 LYS A HB3  4  
ATOM   4654  H  HG2  . LYS A 1 56 ? 8.115   -0.879  6.635   1.00 0.00 ? 56 LYS A HG2  4  
ATOM   4655  H  HG3  . LYS A 1 56 ? 8.051   -1.519  8.278   1.00 0.00 ? 56 LYS A HG3  4  
ATOM   4656  H  HD2  . LYS A 1 56 ? 6.033   -2.904  7.312   1.00 0.00 ? 56 LYS A HD2  4  
ATOM   4657  H  HD3  . LYS A 1 56 ? 6.832   -2.582  5.771   1.00 0.00 ? 56 LYS A HD3  4  
ATOM   4658  H  HE2  . LYS A 1 56 ? 8.655   -3.861  6.291   1.00 0.00 ? 56 LYS A HE2  4  
ATOM   4659  H  HE3  . LYS A 1 56 ? 8.502   -3.570  8.023   1.00 0.00 ? 56 LYS A HE3  4  
ATOM   4660  H  HZ1  . LYS A 1 56 ? 6.527   -5.212  6.559   1.00 0.00 ? 56 LYS A HZ1  4  
ATOM   4661  H  HZ2  . LYS A 1 56 ? 6.850   -5.179  8.219   1.00 0.00 ? 56 LYS A HZ2  4  
ATOM   4662  H  HZ3  . LYS A 1 56 ? 7.960   -5.885  7.156   1.00 0.00 ? 56 LYS A HZ3  4  
ATOM   4663  N  N    . VAL A 1 57 ? 4.575   -1.095  4.996   1.00 0.00 ? 57 VAL A N    4  
ATOM   4664  C  CA   . VAL A 1 57 ? 3.419   -1.770  4.437   1.00 0.00 ? 57 VAL A CA   4  
ATOM   4665  C  C    . VAL A 1 57 ? 3.465   -3.266  4.731   1.00 0.00 ? 57 VAL A C    4  
ATOM   4666  O  O    . VAL A 1 57 ? 4.347   -3.977  4.247   1.00 0.00 ? 57 VAL A O    4  
ATOM   4667  C  CB   . VAL A 1 57 ? 3.316   -1.545  2.911   1.00 0.00 ? 57 VAL A CB   4  
ATOM   4668  C  CG1  . VAL A 1 57 ? 1.862   -1.438  2.502   1.00 0.00 ? 57 VAL A CG1  4  
ATOM   4669  C  CG2  . VAL A 1 57 ? 4.075   -0.293  2.483   1.00 0.00 ? 57 VAL A CG2  4  
ATOM   4670  H  H    . VAL A 1 57 ? 5.454   -1.239  4.584   1.00 0.00 ? 57 VAL A H    4  
ATOM   4671  H  HA   . VAL A 1 57 ? 2.537   -1.351  4.900   1.00 0.00 ? 57 VAL A HA   4  
ATOM   4672  H  HB   . VAL A 1 57 ? 3.753   -2.396  2.406   1.00 0.00 ? 57 VAL A HB   4  
ATOM   4673  H  HG11 . VAL A 1 57 ? 1.800   -1.213  1.450   1.00 0.00 ? 57 VAL A HG11 4  
ATOM   4674  H  HG12 . VAL A 1 57 ? 1.395   -0.647  3.070   1.00 0.00 ? 57 VAL A HG12 4  
ATOM   4675  H  HG13 . VAL A 1 57 ? 1.361   -2.371  2.704   1.00 0.00 ? 57 VAL A HG13 4  
ATOM   4676  H  HG21 . VAL A 1 57 ? 3.573   0.162   1.643   1.00 0.00 ? 57 VAL A HG21 4  
ATOM   4677  H  HG22 . VAL A 1 57 ? 5.080   -0.563  2.198   1.00 0.00 ? 57 VAL A HG22 4  
ATOM   4678  H  HG23 . VAL A 1 57 ? 4.110   0.408   3.304   1.00 0.00 ? 57 VAL A HG23 4  
ATOM   4679  N  N    . ILE A 1 58 ? 2.508   -3.738  5.530   1.00 0.00 ? 58 ILE A N    4  
ATOM   4680  C  CA   . ILE A 1 58 ? 2.437   -5.151  5.891   1.00 0.00 ? 58 ILE A CA   4  
ATOM   4681  C  C    . ILE A 1 58 ? 1.520   -5.908  4.934   1.00 0.00 ? 58 ILE A C    4  
ATOM   4682  O  O    . ILE A 1 58 ? 0.430   -5.441  4.610   1.00 0.00 ? 58 ILE A O    4  
ATOM   4683  C  CB   . ILE A 1 58 ? 1.933   -5.348  7.336   1.00 0.00 ? 58 ILE A CB   4  
ATOM   4684  C  CG1  . ILE A 1 58 ? 2.691   -4.429  8.300   1.00 0.00 ? 58 ILE A CG1  4  
ATOM   4685  C  CG2  . ILE A 1 58 ? 2.074   -6.805  7.758   1.00 0.00 ? 58 ILE A CG2  4  
ATOM   4686  C  CD1  . ILE A 1 58 ? 4.177   -4.707  8.361   1.00 0.00 ? 58 ILE A CD1  4  
ATOM   4687  H  H    . ILE A 1 58 ? 1.834   -3.119  5.886   1.00 0.00 ? 58 ILE A H    4  
ATOM   4688  H  HA   . ILE A 1 58 ? 3.435   -5.563  5.821   1.00 0.00 ? 58 ILE A HA   4  
ATOM   4689  H  HB   . ILE A 1 58 ? 0.883   -5.094  7.360   1.00 0.00 ? 58 ILE A HB   4  
ATOM   4690  H  HG12 . ILE A 1 58 ? 2.559   -3.404  7.987   1.00 0.00 ? 58 ILE A HG12 4  
ATOM   4691  H  HG13 . ILE A 1 58 ? 2.288   -4.552  9.294   1.00 0.00 ? 58 ILE A HG13 4  
ATOM   4692  H  HG21 . ILE A 1 58 ? 1.507   -6.974  8.660   1.00 0.00 ? 58 ILE A HG21 4  
ATOM   4693  H  HG22 . ILE A 1 58 ? 3.115   -7.030  7.939   1.00 0.00 ? 58 ILE A HG22 4  
ATOM   4694  H  HG23 . ILE A 1 58 ? 1.700   -7.446  6.972   1.00 0.00 ? 58 ILE A HG23 4  
ATOM   4695  H  HD11 . ILE A 1 58 ? 4.611   -4.164  9.187   1.00 0.00 ? 58 ILE A HD11 4  
ATOM   4696  H  HD12 . ILE A 1 58 ? 4.642   -4.390  7.439   1.00 0.00 ? 58 ILE A HD12 4  
ATOM   4697  H  HD13 . ILE A 1 58 ? 4.340   -5.765  8.501   1.00 0.00 ? 58 ILE A HD13 4  
ATOM   4698  N  N    . TYR A 1 59 ? 1.975   -7.074  4.479   1.00 0.00 ? 59 TYR A N    4  
ATOM   4699  C  CA   . TYR A 1 59 ? 1.200   -7.894  3.547   1.00 0.00 ? 59 TYR A CA   4  
ATOM   4700  C  C    . TYR A 1 59 ? 1.628   -9.361  3.619   1.00 0.00 ? 59 TYR A C    4  
ATOM   4701  O  O    . TYR A 1 59 ? 2.552   -9.712  4.358   1.00 0.00 ? 59 TYR A O    4  
ATOM   4702  C  CB   . TYR A 1 59 ? 1.380   -7.365  2.118   1.00 0.00 ? 59 TYR A CB   4  
ATOM   4703  C  CG   . TYR A 1 59 ? 2.827   -7.131  1.746   1.00 0.00 ? 59 TYR A CG   4  
ATOM   4704  C  CD1  . TYR A 1 59 ? 3.463   -5.943  2.082   1.00 0.00 ? 59 TYR A CD1  4  
ATOM   4705  C  CD2  . TYR A 1 59 ? 3.559   -8.101  1.075   1.00 0.00 ? 59 TYR A CD2  4  
ATOM   4706  C  CE1  . TYR A 1 59 ? 4.785   -5.728  1.757   1.00 0.00 ? 59 TYR A CE1  4  
ATOM   4707  C  CE2  . TYR A 1 59 ? 4.885   -7.895  0.749   1.00 0.00 ? 59 TYR A CE2  4  
ATOM   4708  C  CZ   . TYR A 1 59 ? 5.495   -6.705  1.093   1.00 0.00 ? 59 TYR A CZ   4  
ATOM   4709  O  OH   . TYR A 1 59 ? 6.820   -6.493  0.780   1.00 0.00 ? 59 TYR A OH   4  
ATOM   4710  H  H    . TYR A 1 59 ? 2.856   -7.388  4.770   1.00 0.00 ? 59 TYR A H    4  
ATOM   4711  H  HA   . TYR A 1 59 ? 0.160   -7.818  3.821   1.00 0.00 ? 59 TYR A HA   4  
ATOM   4712  H  HB2  . TYR A 1 59 ? 0.969   -8.078  1.420   1.00 0.00 ? 59 TYR A HB2  4  
ATOM   4713  H  HB3  . TYR A 1 59 ? 0.855   -6.425  2.018   1.00 0.00 ? 59 TYR A HB3  4  
ATOM   4714  H  HD1  . TYR A 1 59 ? 2.907   -5.179  2.603   1.00 0.00 ? 59 TYR A HD1  4  
ATOM   4715  H  HD2  . TYR A 1 59 ? 3.078   -9.029  0.806   1.00 0.00 ? 59 TYR A HD2  4  
ATOM   4716  H  HE1  . TYR A 1 59 ? 5.258   -4.797  2.027   1.00 0.00 ? 59 TYR A HE1  4  
ATOM   4717  H  HE2  . TYR A 1 59 ? 5.438   -8.661  0.228   1.00 0.00 ? 59 TYR A HE2  4  
ATOM   4718  H  HH   . TYR A 1 59 ? 6.981   -6.747  -0.131  1.00 0.00 ? 59 TYR A HH   4  
ATOM   4719  N  N    . ASP A 1 60 ? 0.963   -10.211 2.834   1.00 0.00 ? 60 ASP A N    4  
ATOM   4720  C  CA   . ASP A 1 60 ? 1.278   -11.631 2.795   1.00 0.00 ? 60 ASP A CA   4  
ATOM   4721  C  C    . ASP A 1 60 ? 2.358   -11.904 1.752   1.00 0.00 ? 60 ASP A C    4  
ATOM   4722  O  O    . ASP A 1 60 ? 2.053   -12.140 0.583   1.00 0.00 ? 60 ASP A O    4  
ATOM   4723  C  CB   . ASP A 1 60 ? 0.019   -12.444 2.468   1.00 0.00 ? 60 ASP A CB   4  
ATOM   4724  C  CG   . ASP A 1 60 ? 0.167   -13.922 2.789   1.00 0.00 ? 60 ASP A CG   4  
ATOM   4725  O  OD1  . ASP A 1 60 ? 1.311   -14.422 2.797   1.00 0.00 ? 60 ASP A OD1  4  
ATOM   4726  O  OD2  . ASP A 1 60 ? -0.867  -14.581 3.026   1.00 0.00 ? 60 ASP A OD2  4  
ATOM   4727  H  H    . ASP A 1 60 ? 0.248   -9.871  2.258   1.00 0.00 ? 60 ASP A H    4  
ATOM   4728  H  HA   . ASP A 1 60 ? 1.644   -11.920 3.770   1.00 0.00 ? 60 ASP A HA   4  
ATOM   4729  H  HB2  . ASP A 1 60 ? -0.810  -12.054 3.039   1.00 0.00 ? 60 ASP A HB2  4  
ATOM   4730  H  HB3  . ASP A 1 60 ? -0.199  -12.345 1.415   1.00 0.00 ? 60 ASP A HB3  4  
ATOM   4731  N  N    . LYS A 1 61 ? 3.618   -11.872 2.182   1.00 0.00 ? 61 LYS A N    4  
ATOM   4732  C  CA   . LYS A 1 61 ? 4.741   -12.121 1.278   1.00 0.00 ? 61 LYS A CA   4  
ATOM   4733  C  C    . LYS A 1 61 ? 4.625   -13.501 0.631   1.00 0.00 ? 61 LYS A C    4  
ATOM   4734  O  O    . LYS A 1 61 ? 5.002   -13.680 -0.528  1.00 0.00 ? 61 LYS A O    4  
ATOM   4735  C  CB   . LYS A 1 61 ? 6.075   -12.000 2.020   1.00 0.00 ? 61 LYS A CB   4  
ATOM   4736  C  CG   . LYS A 1 61 ? 6.278   -10.652 2.699   1.00 0.00 ? 61 LYS A CG   4  
ATOM   4737  C  CD   . LYS A 1 61 ? 7.745   -10.247 2.721   1.00 0.00 ? 61 LYS A CD   4  
ATOM   4738  C  CE   . LYS A 1 61 ? 8.038   -9.158  1.701   1.00 0.00 ? 61 LYS A CE   4  
ATOM   4739  N  NZ   . LYS A 1 61 ? 8.937   -8.101  2.246   1.00 0.00 ? 61 LYS A NZ   4  
ATOM   4740  H  H    . LYS A 1 61 ? 3.796   -11.679 3.128   1.00 0.00 ? 61 LYS A H    4  
ATOM   4741  H  HA   . LYS A 1 61 ? 4.706   -11.374 0.501   1.00 0.00 ? 61 LYS A HA   4  
ATOM   4742  H  HB2  . LYS A 1 61 ? 6.126   -12.770 2.774   1.00 0.00 ? 61 LYS A HB2  4  
ATOM   4743  H  HB3  . LYS A 1 61 ? 6.880   -12.148 1.313   1.00 0.00 ? 61 LYS A HB3  4  
ATOM   4744  H  HG2  . LYS A 1 61 ? 5.717   -9.903  2.162   1.00 0.00 ? 61 LYS A HG2  4  
ATOM   4745  H  HG3  . LYS A 1 61 ? 5.915   -10.716 3.714   1.00 0.00 ? 61 LYS A HG3  4  
ATOM   4746  H  HD2  . LYS A 1 61 ? 7.991   -9.879  3.706   1.00 0.00 ? 61 LYS A HD2  4  
ATOM   4747  H  HD3  . LYS A 1 61 ? 8.355   -11.112 2.498   1.00 0.00 ? 61 LYS A HD3  4  
ATOM   4748  H  HE2  . LYS A 1 61 ? 8.507   -9.607  0.838   1.00 0.00 ? 61 LYS A HE2  4  
ATOM   4749  H  HE3  . LYS A 1 61 ? 7.105   -8.705  1.403   1.00 0.00 ? 61 LYS A HE3  4  
ATOM   4750  H  HZ1  . LYS A 1 61 ? 8.648   -7.167  1.887   1.00 0.00 ? 61 LYS A HZ1  4  
ATOM   4751  H  HZ2  . LYS A 1 61 ? 9.918   -8.283  1.955   1.00 0.00 ? 61 LYS A HZ2  4  
ATOM   4752  H  HZ3  . LYS A 1 61 ? 8.891   -8.089  3.284   1.00 0.00 ? 61 LYS A HZ3  4  
ATOM   4753  N  N    . ASP A 1 62 ? 4.094   -14.469 1.382   1.00 0.00 ? 62 ASP A N    4  
ATOM   4754  C  CA   . ASP A 1 62 ? 3.921   -15.828 0.872   1.00 0.00 ? 62 ASP A CA   4  
ATOM   4755  C  C    . ASP A 1 62 ? 2.914   -15.852 -0.277  1.00 0.00 ? 62 ASP A C    4  
ATOM   4756  O  O    . ASP A 1 62 ? 3.057   -16.635 -1.218  1.00 0.00 ? 62 ASP A O    4  
ATOM   4757  C  CB   . ASP A 1 62 ? 3.464   -16.777 1.985   1.00 0.00 ? 62 ASP A CB   4  
ATOM   4758  C  CG   . ASP A 1 62 ? 4.624   -17.369 2.764   1.00 0.00 ? 62 ASP A CG   4  
ATOM   4759  O  OD1  . ASP A 1 62 ? 5.524   -17.964 2.135   1.00 0.00 ? 62 ASP A OD1  4  
ATOM   4760  O  OD2  . ASP A 1 62 ? 4.629   -17.241 4.008   1.00 0.00 ? 62 ASP A OD2  4  
ATOM   4761  H  H    . ASP A 1 62 ? 3.806   -14.261 2.297   1.00 0.00 ? 62 ASP A H    4  
ATOM   4762  H  HA   . ASP A 1 62 ? 4.878   -16.162 0.498   1.00 0.00 ? 62 ASP A HA   4  
ATOM   4763  H  HB2  . ASP A 1 62 ? 2.831   -16.237 2.675   1.00 0.00 ? 62 ASP A HB2  4  
ATOM   4764  H  HB3  . ASP A 1 62 ? 2.900   -17.587 1.547   1.00 0.00 ? 62 ASP A HB3  4  
ATOM   4765  N  N    . GLN A 1 63 ? 1.898   -14.990 -0.202  1.00 0.00 ? 63 GLN A N    4  
ATOM   4766  C  CA   . GLN A 1 63 ? 0.882   -14.923 -1.248  1.00 0.00 ? 63 GLN A CA   4  
ATOM   4767  C  C    . GLN A 1 63 ? 1.323   -13.996 -2.382  1.00 0.00 ? 63 GLN A C    4  
ATOM   4768  O  O    . GLN A 1 63 ? 1.026   -14.250 -3.549  1.00 0.00 ? 63 GLN A O    4  
ATOM   4769  C  CB   . GLN A 1 63 ? -0.450  -14.449 -0.665  1.00 0.00 ? 63 GLN A CB   4  
ATOM   4770  C  CG   . GLN A 1 63 ? -1.337  -15.585 -0.178  1.00 0.00 ? 63 GLN A CG   4  
ATOM   4771  C  CD   . GLN A 1 63 ? -2.451  -15.927 -1.153  1.00 0.00 ? 63 GLN A CD   4  
ATOM   4772  O  OE1  . GLN A 1 63 ? -2.541  -15.356 -2.241  1.00 0.00 ? 63 GLN A OE1  4  
ATOM   4773  N  NE2  . GLN A 1 63 ? -3.308  -16.864 -0.766  1.00 0.00 ? 63 GLN A NE2  4  
ATOM   4774  H  H    . GLN A 1 63 ? 1.832   -14.382 0.570   1.00 0.00 ? 63 GLN A H    4  
ATOM   4775  H  HA   . GLN A 1 63 ? 0.753   -15.919 -1.646  1.00 0.00 ? 63 GLN A HA   4  
ATOM   4776  H  HB2  . GLN A 1 63 ? -0.252  -13.794 0.171   1.00 0.00 ? 63 GLN A HB2  4  
ATOM   4777  H  HB3  . GLN A 1 63 ? -0.988  -13.900 -1.423  1.00 0.00 ? 63 GLN A HB3  4  
ATOM   4778  H  HG2  . GLN A 1 63 ? -0.728  -16.464 -0.034  1.00 0.00 ? 63 GLN A HG2  4  
ATOM   4779  H  HG3  . GLN A 1 63 ? -1.779  -15.297 0.765   1.00 0.00 ? 63 GLN A HG3  4  
ATOM   4780  H  HE21 . GLN A 1 63 ? -3.177  -17.278 0.113   1.00 0.00 ? 63 GLN A HE21 4  
ATOM   4781  H  HE22 . GLN A 1 63 ? -4.035  -17.105 -1.376  1.00 0.00 ? 63 GLN A HE22 4  
ATOM   4782  N  N    . PHE A 1 64 ? 2.031   -12.920 -2.029  1.00 0.00 ? 64 PHE A N    4  
ATOM   4783  C  CA   . PHE A 1 64 ? 2.509   -11.952 -3.017  1.00 0.00 ? 64 PHE A CA   4  
ATOM   4784  C  C    . PHE A 1 64 ? 3.433   -12.609 -4.043  1.00 0.00 ? 64 PHE A C    4  
ATOM   4785  O  O    . PHE A 1 64 ? 3.191   -12.520 -5.247  1.00 0.00 ? 64 PHE A O    4  
ATOM   4786  C  CB   . PHE A 1 64 ? 3.239   -10.791 -2.329  1.00 0.00 ? 64 PHE A CB   4  
ATOM   4787  C  CG   . PHE A 1 64 ? 2.335   -9.644  -1.955  1.00 0.00 ? 64 PHE A CG   4  
ATOM   4788  C  CD1  . PHE A 1 64 ? 1.167   -9.863  -1.240  1.00 0.00 ? 64 PHE A CD1  4  
ATOM   4789  C  CD2  . PHE A 1 64 ? 2.658   -8.345  -2.319  1.00 0.00 ? 64 PHE A CD2  4  
ATOM   4790  C  CE1  . PHE A 1 64 ? 0.338   -8.811  -0.898  1.00 0.00 ? 64 PHE A CE1  4  
ATOM   4791  C  CE2  . PHE A 1 64 ? 1.832   -7.290  -1.979  1.00 0.00 ? 64 PHE A CE2  4  
ATOM   4792  C  CZ   . PHE A 1 64 ? 0.672   -7.523  -1.267  1.00 0.00 ? 64 PHE A CZ   4  
ATOM   4793  H  H    . PHE A 1 64 ? 2.233   -12.770 -1.080  1.00 0.00 ? 64 PHE A H    4  
ATOM   4794  H  HA   . PHE A 1 64 ? 1.646   -11.561 -3.533  1.00 0.00 ? 64 PHE A HA   4  
ATOM   4795  H  HB2  . PHE A 1 64 ? 3.709   -11.153 -1.426  1.00 0.00 ? 64 PHE A HB2  4  
ATOM   4796  H  HB3  . PHE A 1 64 ? 4.000   -10.412 -2.996  1.00 0.00 ? 64 PHE A HB3  4  
ATOM   4797  H  HD1  . PHE A 1 64 ? 0.904   -10.870 -0.951  1.00 0.00 ? 64 PHE A HD1  4  
ATOM   4798  H  HD2  . PHE A 1 64 ? 3.564   -8.159  -2.877  1.00 0.00 ? 64 PHE A HD2  4  
ATOM   4799  H  HE1  . PHE A 1 64 ? -0.569  -8.996  -0.341  1.00 0.00 ? 64 PHE A HE1  4  
ATOM   4800  H  HE2  . PHE A 1 64 ? 2.094   -6.284  -2.268  1.00 0.00 ? 64 PHE A HE2  4  
ATOM   4801  H  HZ   . PHE A 1 64 ? 0.027   -6.698  -1.000  1.00 0.00 ? 64 PHE A HZ   4  
ATOM   4802  N  N    . VAL A 1 65 ? 4.488   -13.270 -3.565  1.00 0.00 ? 65 VAL A N    4  
ATOM   4803  C  CA   . VAL A 1 65 ? 5.438   -13.936 -4.454  1.00 0.00 ? 65 VAL A CA   4  
ATOM   4804  C  C    . VAL A 1 65 ? 5.189   -15.446 -4.494  1.00 0.00 ? 65 VAL A C    4  
ATOM   4805  O  O    . VAL A 1 65 ? 5.737   -16.207 -3.695  1.00 0.00 ? 65 VAL A O    4  
ATOM   4806  C  CB   . VAL A 1 65 ? 6.905   -13.648 -4.047  1.00 0.00 ? 65 VAL A CB   4  
ATOM   4807  C  CG1  . VAL A 1 65 ? 7.177   -14.083 -2.613  1.00 0.00 ? 65 VAL A CG1  4  
ATOM   4808  C  CG2  . VAL A 1 65 ? 7.875   -14.318 -5.013  1.00 0.00 ? 65 VAL A CG2  4  
ATOM   4809  H  H    . VAL A 1 65 ? 4.630   -13.311 -2.594  1.00 0.00 ? 65 VAL A H    4  
ATOM   4810  H  HA   . VAL A 1 65 ? 5.284   -13.539 -5.448  1.00 0.00 ? 65 VAL A HA   4  
ATOM   4811  H  HB   . VAL A 1 65 ? 7.061   -12.580 -4.106  1.00 0.00 ? 65 VAL A HB   4  
ATOM   4812  H  HG11 . VAL A 1 65 ? 7.423   -13.218 -2.014  1.00 0.00 ? 65 VAL A HG11 4  
ATOM   4813  H  HG12 . VAL A 1 65 ? 8.001   -14.779 -2.597  1.00 0.00 ? 65 VAL A HG12 4  
ATOM   4814  H  HG13 . VAL A 1 65 ? 6.296   -14.560 -2.207  1.00 0.00 ? 65 VAL A HG13 4  
ATOM   4815  H  HG21 . VAL A 1 65 ? 7.638   -15.369 -5.092  1.00 0.00 ? 65 VAL A HG21 4  
ATOM   4816  H  HG22 . VAL A 1 65 ? 8.884   -14.203 -4.647  1.00 0.00 ? 65 VAL A HG22 4  
ATOM   4817  H  HG23 . VAL A 1 65 ? 7.791   -13.857 -5.987  1.00 0.00 ? 65 VAL A HG23 4  
ATOM   4818  N  N    . SER A 1 66 ? 4.347   -15.868 -5.433  1.00 0.00 ? 66 SER A N    4  
ATOM   4819  C  CA   . SER A 1 66 ? 4.010   -17.282 -5.587  1.00 0.00 ? 66 SER A CA   4  
ATOM   4820  C  C    . SER A 1 66 ? 3.891   -17.672 -7.064  1.00 0.00 ? 66 SER A C    4  
ATOM   4821  O  O    . SER A 1 66 ? 3.150   -18.596 -7.409  1.00 0.00 ? 66 SER A O    4  
ATOM   4822  C  CB   . SER A 1 66 ? 2.699   -17.584 -4.859  1.00 0.00 ? 66 SER A CB   4  
ATOM   4823  O  OG   . SER A 1 66 ? 1.591   -17.020 -5.544  1.00 0.00 ? 66 SER A OG   4  
ATOM   4824  H  H    . SER A 1 66 ? 3.938   -15.213 -6.035  1.00 0.00 ? 66 SER A H    4  
ATOM   4825  H  HA   . SER A 1 66 ? 4.803   -17.863 -5.138  1.00 0.00 ? 66 SER A HA   4  
ATOM   4826  H  HB2  . SER A 1 66 ? 2.563   -18.653 -4.799  1.00 0.00 ? 66 SER A HB2  4  
ATOM   4827  H  HB3  . SER A 1 66 ? 2.742   -17.169 -3.864  1.00 0.00 ? 66 SER A HB3  4  
ATOM   4828  H  HG   . SER A 1 66 ? 1.197   -16.329 -5.006  1.00 0.00 ? 66 SER A HG   4  
ATOM   4829  N  N    . GLY A 1 67 ? 4.623   -16.970 -7.932  1.00 0.00 ? 67 GLY A N    4  
ATOM   4830  C  CA   . GLY A 1 67 ? 4.577   -17.268 -9.353  1.00 0.00 ? 67 GLY A CA   4  
ATOM   4831  C  C    . GLY A 1 67 ? 5.803   -18.022 -9.824  1.00 0.00 ? 67 GLY A C    4  
ATOM   4832  O  O    . GLY A 1 67 ? 5.756   -19.240 -10.007 1.00 0.00 ? 67 GLY A O    4  
ATOM   4833  H  H    . GLY A 1 67 ? 5.200   -16.248 -7.605  1.00 0.00 ? 67 GLY A H    4  
ATOM   4834  H  HA2  . GLY A 1 67 ? 3.701   -17.866 -9.556  1.00 0.00 ? 67 GLY A HA2  4  
ATOM   4835  H  HA3  . GLY A 1 67 ? 4.501   -16.340 -9.902  1.00 0.00 ? 67 GLY A HA3  4  
ATOM   4836  N  N    . GLU A 1 68 ? 6.904   -17.301 -10.018 1.00 0.00 ? 68 GLU A N    4  
ATOM   4837  C  CA   . GLU A 1 68 ? 8.147   -17.917 -10.468 1.00 0.00 ? 68 GLU A CA   4  
ATOM   4838  C  C    . GLU A 1 68 ? 8.960   -18.423 -9.277  1.00 0.00 ? 68 GLU A C    4  
ATOM   4839  O  O    . GLU A 1 68 ? 9.906   -17.768 -8.834  1.00 0.00 ? 68 GLU A O    4  
ATOM   4840  C  CB   . GLU A 1 68 ? 8.973   -16.921 -11.284 1.00 0.00 ? 68 GLU A CB   4  
ATOM   4841  C  CG   . GLU A 1 68 ? 8.638   -16.920 -12.767 1.00 0.00 ? 68 GLU A CG   4  
ATOM   4842  C  CD   . GLU A 1 68 ? 9.871   -16.803 -13.640 1.00 0.00 ? 68 GLU A CD   4  
ATOM   4843  O  OE1  . GLU A 1 68 ? 10.297  -15.662 -13.917 1.00 0.00 ? 68 GLU A OE1  4  
ATOM   4844  O  OE2  . GLU A 1 68 ? 10.413  -17.853 -14.044 1.00 0.00 ? 68 GLU A OE2  4  
ATOM   4845  H  H    . GLU A 1 68 ? 6.880   -16.335 -9.854  1.00 0.00 ? 68 GLU A H    4  
ATOM   4846  H  HA   . GLU A 1 68 ? 7.892   -18.758 -11.095 1.00 0.00 ? 68 GLU A HA   4  
ATOM   4847  H  HB2  . GLU A 1 68 ? 8.804   -15.927 -10.899 1.00 0.00 ? 68 GLU A HB2  4  
ATOM   4848  H  HB3  . GLU A 1 68 ? 10.020  -17.166 -11.176 1.00 0.00 ? 68 GLU A HB3  4  
ATOM   4849  H  HG2  . GLU A 1 68 ? 8.127   -17.840 -13.010 1.00 0.00 ? 68 GLU A HG2  4  
ATOM   4850  H  HG3  . GLU A 1 68 ? 7.987   -16.083 -12.974 1.00 0.00 ? 68 GLU A HG3  4  
ATOM   4851  N  N    . THR A 1 69 ? 8.583   -19.592 -8.764  1.00 0.00 ? 69 THR A N    4  
ATOM   4852  C  CA   . THR A 1 69 ? 9.276   -20.190 -7.626  1.00 0.00 ? 69 THR A CA   4  
ATOM   4853  C  C    . THR A 1 69 ? 9.597   -21.661 -7.901  1.00 0.00 ? 69 THR A C    4  
ATOM   4854  O  O    . THR A 1 69 ? 8.722   -22.526 -7.828  1.00 0.00 ? 69 THR A O    4  
ATOM   4855  C  CB   . THR A 1 69 ? 8.439   -20.044 -6.348  1.00 0.00 ? 69 THR A CB   4  
ATOM   4856  O  OG1  . THR A 1 69 ? 9.081   -20.670 -5.251  1.00 0.00 ? 69 THR A OG1  4  
ATOM   4857  C  CG2  . THR A 1 69 ? 7.043   -20.629 -6.458  1.00 0.00 ? 69 THR A CG2  4  
ATOM   4858  H  H    . THR A 1 69 ? 7.821   -20.065 -9.160  1.00 0.00 ? 69 THR A H    4  
ATOM   4859  H  HA   . THR A 1 69 ? 10.206  -19.655 -7.494  1.00 0.00 ? 69 THR A HA   4  
ATOM   4860  H  HB   . THR A 1 69 ? 8.336   -18.992 -6.120  1.00 0.00 ? 69 THR A HB   4  
ATOM   4861  H  HG1  . THR A 1 69 ? 9.859   -20.165 -5.003  1.00 0.00 ? 69 THR A HG1  4  
ATOM   4862  H  HG21 . THR A 1 69 ? 6.955   -21.479 -5.797  1.00 0.00 ? 69 THR A HG21 4  
ATOM   4863  H  HG22 . THR A 1 69 ? 6.864   -20.944 -7.475  1.00 0.00 ? 69 THR A HG22 4  
ATOM   4864  H  HG23 . THR A 1 69 ? 6.316   -19.880 -6.179  1.00 0.00 ? 69 THR A HG23 4  
ATOM   4865  N  N    . VAL A 1 70 ? 10.861  -21.932 -8.234  1.00 0.00 ? 70 VAL A N    4  
ATOM   4866  C  CA   . VAL A 1 70 ? 11.309  -23.292 -8.538  1.00 0.00 ? 70 VAL A CA   4  
ATOM   4867  C  C    . VAL A 1 70 ? 12.613  -23.621 -7.803  1.00 0.00 ? 70 VAL A C    4  
ATOM   4868  O  O    . VAL A 1 70 ? 13.500  -22.770 -7.701  1.00 0.00 ? 70 VAL A O    4  
ATOM   4869  C  CB   . VAL A 1 70 ? 11.527  -23.476 -10.055 1.00 0.00 ? 70 VAL A CB   4  
ATOM   4870  C  CG1  . VAL A 1 70 ? 11.775  -24.938 -10.394 1.00 0.00 ? 70 VAL A CG1  4  
ATOM   4871  C  CG2  . VAL A 1 70 ? 10.341  -22.935 -10.844 1.00 0.00 ? 70 VAL A CG2  4  
ATOM   4872  H  H    . VAL A 1 70 ? 11.507  -21.198 -8.286  1.00 0.00 ? 70 VAL A H    4  
ATOM   4873  H  HA   . VAL A 1 70 ? 10.539  -23.978 -8.217  1.00 0.00 ? 70 VAL A HA   4  
ATOM   4874  H  HB   . VAL A 1 70 ? 12.403  -22.912 -10.340 1.00 0.00 ? 70 VAL A HB   4  
ATOM   4875  H  HG11 . VAL A 1 70 ? 10.908  -25.523 -10.124 1.00 0.00 ? 70 VAL A HG11 4  
ATOM   4876  H  HG12 . VAL A 1 70 ? 12.635  -25.293 -9.845  1.00 0.00 ? 70 VAL A HG12 4  
ATOM   4877  H  HG13 . VAL A 1 70 ? 11.959  -25.035 -11.454 1.00 0.00 ? 70 VAL A HG13 4  
ATOM   4878  H  HG21 . VAL A 1 70 ? 9.422   -23.209 -10.347 1.00 0.00 ? 70 VAL A HG21 4  
ATOM   4879  H  HG22 . VAL A 1 70 ? 10.350  -23.354 -11.839 1.00 0.00 ? 70 VAL A HG22 4  
ATOM   4880  H  HG23 . VAL A 1 70 ? 10.410  -21.858 -10.905 1.00 0.00 ? 70 VAL A HG23 4  
ATOM   4881  N  N    . PRO A 1 71 ? 12.748  -24.863 -7.282  1.00 0.00 ? 71 PRO A N    4  
ATOM   4882  C  CA   . PRO A 1 71 ? 13.954  -25.301 -6.555  1.00 0.00 ? 71 PRO A CA   4  
ATOM   4883  C  C    . PRO A 1 71 ? 15.231  -25.180 -7.391  1.00 0.00 ? 71 PRO A C    4  
ATOM   4884  O  O    . PRO A 1 71 ? 15.177  -24.885 -8.587  1.00 0.00 ? 71 PRO A O    4  
ATOM   4885  C  CB   . PRO A 1 71 ? 13.668  -26.775 -6.233  1.00 0.00 ? 71 PRO A CB   4  
ATOM   4886  C  CG   . PRO A 1 71 ? 12.186  -26.906 -6.301  1.00 0.00 ? 71 PRO A CG   4  
ATOM   4887  C  CD   . PRO A 1 71 ? 11.735  -25.935 -7.354  1.00 0.00 ? 71 PRO A CD   4  
ATOM   4888  H  HA   . PRO A 1 71 ? 14.078  -24.749 -5.635  1.00 0.00 ? 71 PRO A HA   4  
ATOM   4889  H  HB2  . PRO A 1 71 ? 14.153  -27.406 -6.962  1.00 0.00 ? 71 PRO A HB2  4  
ATOM   4890  H  HB3  . PRO A 1 71 ? 14.038  -27.008 -5.245  1.00 0.00 ? 71 PRO A HB3  4  
ATOM   4891  H  HG2  . PRO A 1 71 ? 11.920  -27.915 -6.581  1.00 0.00 ? 71 PRO A HG2  4  
ATOM   4892  H  HG3  . PRO A 1 71 ? 11.749  -26.653 -5.345  1.00 0.00 ? 71 PRO A HG3  4  
ATOM   4893  H  HD2  . PRO A 1 71 ? 11.739  -26.407 -8.326  1.00 0.00 ? 71 PRO A HD2  4  
ATOM   4894  H  HD3  . PRO A 1 71 ? 10.753  -25.553 -7.121  1.00 0.00 ? 71 PRO A HD3  4  
ATOM   4895  N  N    . ALA A 1 72 ? 16.381  -25.406 -6.751  1.00 0.00 ? 72 ALA A N    4  
ATOM   4896  C  CA   . ALA A 1 72 ? 17.674  -25.314 -7.430  1.00 0.00 ? 72 ALA A CA   4  
ATOM   4897  C  C    . ALA A 1 72 ? 18.535  -26.556 -7.193  1.00 0.00 ? 72 ALA A C    4  
ATOM   4898  O  O    . ALA A 1 72 ? 18.437  -27.203 -6.148  1.00 0.00 ? 72 ALA A O    4  
ATOM   4899  C  CB   . ALA A 1 72 ? 18.420  -24.068 -6.972  1.00 0.00 ? 72 ALA A CB   4  
ATOM   4900  H  H    . ALA A 1 72 ? 16.361  -25.634 -5.797  1.00 0.00 ? 72 ALA A H    4  
ATOM   4901  H  HA   . ALA A 1 72 ? 17.485  -25.217 -8.488  1.00 0.00 ? 72 ALA A HA   4  
ATOM   4902  H  HB1  . ALA A 1 72 ? 17.712  -23.329 -6.624  1.00 0.00 ? 72 ALA A HB1  4  
ATOM   4903  H  HB2  . ALA A 1 72 ? 18.984  -23.664 -7.797  1.00 0.00 ? 72 ALA A HB2  4  
ATOM   4904  H  HB3  . ALA A 1 72 ? 19.095  -24.327 -6.168  1.00 0.00 ? 72 ALA A HB3  4  
ATOM   4905  N  N    . PRO A 1 73 ? 19.400  -26.901 -8.171  1.00 0.00 ? 73 PRO A N    4  
ATOM   4906  C  CA   . PRO A 1 73 ? 20.295  -28.066 -8.078  1.00 0.00 ? 73 PRO A CA   4  
ATOM   4907  C  C    . PRO A 1 73 ? 21.419  -27.867 -7.059  1.00 0.00 ? 73 PRO A C    4  
ATOM   4908  O  O    . PRO A 1 73 ? 21.479  -26.842 -6.376  1.00 0.00 ? 73 PRO A O    4  
ATOM   4909  C  CB   . PRO A 1 73 ? 20.866  -28.185 -9.495  1.00 0.00 ? 73 PRO A CB   4  
ATOM   4910  C  CG   . PRO A 1 73 ? 20.811  -26.800 -10.038 1.00 0.00 ? 73 PRO A CG   4  
ATOM   4911  C  CD   . PRO A 1 73 ? 19.579  -26.175 -9.445  1.00 0.00 ? 73 PRO A CD   4  
ATOM   4912  H  HA   . PRO A 1 73 ? 19.747  -28.964 -7.832  1.00 0.00 ? 73 PRO A HA   4  
ATOM   4913  H  HB2  . PRO A 1 73 ? 21.881  -28.553 -9.450  1.00 0.00 ? 73 PRO A HB2  4  
ATOM   4914  H  HB3  . PRO A 1 73 ? 20.257  -28.861 -10.076 1.00 0.00 ? 73 PRO A HB3  4  
ATOM   4915  H  HG2  . PRO A 1 73 ? 21.692  -26.253 -9.737  1.00 0.00 ? 73 PRO A HG2  4  
ATOM   4916  H  HG3  . PRO A 1 73 ? 20.735  -26.831 -11.115 1.00 0.00 ? 73 PRO A HG3  4  
ATOM   4917  H  HD2  . PRO A 1 73 ? 19.738  -25.121 -9.270  1.00 0.00 ? 73 PRO A HD2  4  
ATOM   4918  H  HD3  . PRO A 1 73 ? 18.729  -26.326 -10.095 1.00 0.00 ? 73 PRO A HD3  4  
ATOM   4919  N  N    . SER A 1 74 ? 22.306  -28.859 -6.957  1.00 0.00 ? 74 SER A N    4  
ATOM   4920  C  CA   . SER A 1 74 ? 23.422  -28.798 -6.017  1.00 0.00 ? 74 SER A CA   4  
ATOM   4921  C  C    . SER A 1 74 ? 24.562  -27.934 -6.556  1.00 0.00 ? 74 SER A C    4  
ATOM   4922  O  O    . SER A 1 74 ? 25.088  -28.190 -7.641  1.00 0.00 ? 74 SER A O    4  
ATOM   4923  C  CB   . SER A 1 74 ? 23.939  -30.207 -5.708  1.00 0.00 ? 74 SER A CB   4  
ATOM   4924  O  OG   . SER A 1 74 ? 23.256  -30.765 -4.598  1.00 0.00 ? 74 SER A OG   4  
ATOM   4925  H  H    . SER A 1 74 ? 22.203  -29.651 -7.525  1.00 0.00 ? 74 SER A H    4  
ATOM   4926  H  HA   . SER A 1 74 ? 23.056  -28.354 -5.104  1.00 0.00 ? 74 SER A HA   4  
ATOM   4927  H  HB2  . SER A 1 74 ? 23.784  -30.844 -6.567  1.00 0.00 ? 74 SER A HB2  4  
ATOM   4928  H  HB3  . SER A 1 74 ? 24.994  -30.159 -5.481  1.00 0.00 ? 74 SER A HB3  4  
ATOM   4929  H  HG   . SER A 1 74 ? 23.892  -31.011 -3.923  1.00 0.00 ? 74 SER A HG   4  
ATOM   4930  N  N    . ALA A 1 75 ? 24.935  -26.912 -5.782  1.00 0.00 ? 75 ALA A N    4  
ATOM   4931  C  CA   . ALA A 1 75 ? 26.013  -25.994 -6.155  1.00 0.00 ? 75 ALA A CA   4  
ATOM   4932  C  C    . ALA A 1 75 ? 25.640  -25.158 -7.380  1.00 0.00 ? 75 ALA A C    4  
ATOM   4933  O  O    . ALA A 1 75 ? 25.723  -25.630 -8.514  1.00 0.00 ? 75 ALA A O    4  
ATOM   4934  C  CB   . ALA A 1 75 ? 27.307  -26.758 -6.409  1.00 0.00 ? 75 ALA A CB   4  
ATOM   4935  H  H    . ALA A 1 75 ? 24.471  -26.770 -4.931  1.00 0.00 ? 75 ALA A H    4  
ATOM   4936  H  HA   . ALA A 1 75 ? 26.180  -25.328 -5.320  1.00 0.00 ? 75 ALA A HA   4  
ATOM   4937  H  HB1  . ALA A 1 75 ? 27.315  -27.662 -5.818  1.00 0.00 ? 75 ALA A HB1  4  
ATOM   4938  H  HB2  . ALA A 1 75 ? 28.148  -26.141 -6.132  1.00 0.00 ? 75 ALA A HB2  4  
ATOM   4939  H  HB3  . ALA A 1 75 ? 27.375  -27.012 -7.456  1.00 0.00 ? 75 ALA A HB3  4  
ATOM   4940  N  N    . ASN A 1 76 ? 25.236  -23.912 -7.139  1.00 0.00 ? 76 ASN A N    4  
ATOM   4941  C  CA   . ASN A 1 76 ? 24.855  -23.003 -8.222  1.00 0.00 ? 76 ASN A CA   4  
ATOM   4942  C  C    . ASN A 1 76 ? 26.033  -22.115 -8.641  1.00 0.00 ? 76 ASN A C    4  
ATOM   4943  O  O    . ASN A 1 76 ? 25.855  -20.932 -8.942  1.00 0.00 ? 76 ASN A O    4  
ATOM   4944  C  CB   . ASN A 1 76 ? 23.661  -22.136 -7.800  1.00 0.00 ? 76 ASN A CB   4  
ATOM   4945  C  CG   . ASN A 1 76 ? 23.940  -21.303 -6.558  1.00 0.00 ? 76 ASN A CG   4  
ATOM   4946  O  OD1  . ASN A 1 76 ? 24.650  -21.737 -5.650  1.00 0.00 ? 76 ASN A OD1  4  
ATOM   4947  N  ND2  . ASN A 1 76 ? 23.378  -20.100 -6.510  1.00 0.00 ? 76 ASN A ND2  4  
ATOM   4948  H  H    . ASN A 1 76 ? 25.196  -23.592 -6.212  1.00 0.00 ? 76 ASN A H    4  
ATOM   4949  H  HA   . ASN A 1 76 ? 24.563  -23.609 -9.068  1.00 0.00 ? 76 ASN A HA   4  
ATOM   4950  H  HB2  . ASN A 1 76 ? 23.412  -21.464 -8.608  1.00 0.00 ? 76 ASN A HB2  4  
ATOM   4951  H  HB3  . ASN A 1 76 ? 22.815  -22.775 -7.599  1.00 0.00 ? 76 ASN A HB3  4  
ATOM   4952  H  HD21 . ASN A 1 76 ? 22.822  -19.814 -7.265  1.00 0.00 ? 76 ASN A HD21 4  
ATOM   4953  H  HD22 . ASN A 1 76 ? 23.542  -19.546 -5.718  1.00 0.00 ? 76 ASN A HD22 4  
ATOM   4954  N  N    . LYS A 1 77 ? 27.237  -22.694 -8.666  1.00 0.00 ? 77 LYS A N    4  
ATOM   4955  C  CA   . LYS A 1 77 ? 28.439  -21.959 -9.054  1.00 0.00 ? 77 LYS A CA   4  
ATOM   4956  C  C    . LYS A 1 77 ? 29.390  -22.851 -9.847  1.00 0.00 ? 77 LYS A C    4  
ATOM   4957  O  O    . LYS A 1 77 ? 30.064  -23.711 -9.279  1.00 0.00 ? 77 LYS A O    4  
ATOM   4958  C  CB   . LYS A 1 77 ? 29.160  -21.414 -7.816  1.00 0.00 ? 77 LYS A CB   4  
ATOM   4959  C  CG   . LYS A 1 77 ? 28.699  -20.027 -7.395  1.00 0.00 ? 77 LYS A CG   4  
ATOM   4960  C  CD   . LYS A 1 77 ? 29.493  -18.934 -8.097  1.00 0.00 ? 77 LYS A CD   4  
ATOM   4961  C  CE   . LYS A 1 77 ? 28.749  -18.389 -9.308  1.00 0.00 ? 77 LYS A CE   4  
ATOM   4962  N  NZ   . LYS A 1 77 ? 28.009  -17.135 -8.993  1.00 0.00 ? 77 LYS A NZ   4  
ATOM   4963  H  H    . LYS A 1 77 ? 27.318  -23.640 -8.424  1.00 0.00 ? 77 LYS A H    4  
ATOM   4964  H  HA   . LYS A 1 77 ? 28.135  -21.132 -9.678  1.00 0.00 ? 77 LYS A HA   4  
ATOM   4965  H  HB2  . LYS A 1 77 ? 28.994  -22.091 -6.990  1.00 0.00 ? 77 LYS A HB2  4  
ATOM   4966  H  HB3  . LYS A 1 77 ? 30.218  -21.369 -8.024  1.00 0.00 ? 77 LYS A HB3  4  
ATOM   4967  H  HG2  . LYS A 1 77 ? 27.654  -19.914 -7.642  1.00 0.00 ? 77 LYS A HG2  4  
ATOM   4968  H  HG3  . LYS A 1 77 ? 28.831  -19.925 -6.328  1.00 0.00 ? 77 LYS A HG3  4  
ATOM   4969  H  HD2  . LYS A 1 77 ? 29.664  -18.126 -7.401  1.00 0.00 ? 77 LYS A HD2  4  
ATOM   4970  H  HD3  . LYS A 1 77 ? 30.441  -19.338 -8.419  1.00 0.00 ? 77 LYS A HD3  4  
ATOM   4971  H  HE2  . LYS A 1 77 ? 29.465  -18.186 -10.092 1.00 0.00 ? 77 LYS A HE2  4  
ATOM   4972  H  HE3  . LYS A 1 77 ? 28.047  -19.136 -9.648  1.00 0.00 ? 77 LYS A HE3  4  
ATOM   4973  H  HZ1  . LYS A 1 77 ? 27.503  -17.235 -8.089  1.00 0.00 ? 77 LYS A HZ1  4  
ATOM   4974  H  HZ2  . LYS A 1 77 ? 27.319  -16.930 -9.744  1.00 0.00 ? 77 LYS A HZ2  4  
ATOM   4975  H  HZ3  . LYS A 1 77 ? 28.672  -16.337 -8.920  1.00 0.00 ? 77 LYS A HZ3  4  
ATOM   4976  N  N    . GLU A 1 78 ? 29.447  -22.638 -11.161 1.00 0.00 ? 78 GLU A N    4  
ATOM   4977  C  CA   . GLU A 1 78 ? 30.326  -23.422 -12.024 1.00 0.00 ? 78 GLU A CA   4  
ATOM   4978  C  C    . GLU A 1 78 ? 31.633  -22.679 -12.280 1.00 0.00 ? 78 GLU A C    4  
ATOM   4979  O  O    . GLU A 1 78 ? 31.640  -21.621 -12.911 1.00 0.00 ? 78 GLU A O    4  
ATOM   4980  C  CB   . GLU A 1 78 ? 29.636  -23.733 -13.355 1.00 0.00 ? 78 GLU A CB   4  
ATOM   4981  C  CG   . GLU A 1 78 ? 29.981  -25.103 -13.913 1.00 0.00 ? 78 GLU A CG   4  
ATOM   4982  C  CD   . GLU A 1 78 ? 31.151  -25.066 -14.878 1.00 0.00 ? 78 GLU A CD   4  
ATOM   4983  O  OE1  . GLU A 1 78 ? 32.291  -24.832 -14.423 1.00 0.00 ? 78 GLU A OE1  4  
ATOM   4984  O  OE2  . GLU A 1 78 ? 30.926  -25.276 -16.089 1.00 0.00 ? 78 GLU A OE2  4  
ATOM   4985  H  H    . GLU A 1 78 ? 28.891  -21.934 -11.558 1.00 0.00 ? 78 GLU A H    4  
ATOM   4986  H  HA   . GLU A 1 78 ? 30.546  -24.349 -11.517 1.00 0.00 ? 78 GLU A HA   4  
ATOM   4987  H  HB2  . GLU A 1 78 ? 28.566  -23.684 -13.214 1.00 0.00 ? 78 GLU A HB2  4  
ATOM   4988  H  HB3  . GLU A 1 78 ? 29.928  -22.987 -14.082 1.00 0.00 ? 78 GLU A HB3  4  
ATOM   4989  H  HG2  . GLU A 1 78 ? 30.235  -25.759 -13.093 1.00 0.00 ? 78 GLU A HG2  4  
ATOM   4990  H  HG3  . GLU A 1 78 ? 29.118  -25.494 -14.430 1.00 0.00 ? 78 GLU A HG3  4  
ATOM   4991  N  N    . LEU A 1 79 ? 32.741  -23.233 -11.784 1.00 0.00 ? 79 LEU A N    4  
ATOM   4992  C  CA   . LEU A 1 79 ? 34.049  -22.609 -11.963 1.00 0.00 ? 79 LEU A CA   4  
ATOM   4993  C  C    . LEU A 1 79 ? 35.178  -23.644 -11.889 1.00 0.00 ? 79 LEU A C    4  
ATOM   4994  O  O    . LEU A 1 79 ? 36.025  -23.592 -10.993 1.00 0.00 ? 79 LEU A O    4  
ATOM   4995  C  CB   . LEU A 1 79 ? 34.256  -21.503 -10.916 1.00 0.00 ? 79 LEU A CB   4  
ATOM   4996  C  CG   . LEU A 1 79 ? 34.066  -21.927 -9.454  1.00 0.00 ? 79 LEU A CG   4  
ATOM   4997  C  CD1  . LEU A 1 79 ? 35.027  -21.170 -8.550  1.00 0.00 ? 79 LEU A CD1  4  
ATOM   4998  C  CD2  . LEU A 1 79 ? 32.626  -21.700 -9.011  1.00 0.00 ? 79 LEU A CD2  4  
ATOM   4999  H  H    . LEU A 1 79 ? 32.676  -24.076 -11.286 1.00 0.00 ? 79 LEU A H    4  
ATOM   5000  H  HA   . LEU A 1 79 ? 34.062  -22.163 -12.946 1.00 0.00 ? 79 LEU A HA   4  
ATOM   5001  H  HB2  . LEU A 1 79 ? 35.260  -21.118 -11.028 1.00 0.00 ? 79 LEU A HB2  4  
ATOM   5002  H  HB3  . LEU A 1 79 ? 33.561  -20.706 -11.128 1.00 0.00 ? 79 LEU A HB3  4  
ATOM   5003  H  HG   . LEU A 1 79 ? 34.282  -22.982 -9.362  1.00 0.00 ? 79 LEU A HG   4  
ATOM   5004  H  HD11 . LEU A 1 79 ? 35.233  -20.200 -8.976  1.00 0.00 ? 79 LEU A HD11 4  
ATOM   5005  H  HD12 . LEU A 1 79 ? 35.947  -21.727 -8.458  1.00 0.00 ? 79 LEU A HD12 4  
ATOM   5006  H  HD13 . LEU A 1 79 ? 34.582  -21.047 -7.573  1.00 0.00 ? 79 LEU A HD13 4  
ATOM   5007  H  HD21 . LEU A 1 79 ? 32.573  -21.719 -7.933  1.00 0.00 ? 79 LEU A HD21 4  
ATOM   5008  H  HD22 . LEU A 1 79 ? 31.998  -22.480 -9.416  1.00 0.00 ? 79 LEU A HD22 4  
ATOM   5009  H  HD23 . LEU A 1 79 ? 32.284  -20.741 -9.372  1.00 0.00 ? 79 LEU A HD23 4  
ATOM   5010  N  N    . VAL A 1 80 ? 35.185  -24.582 -12.840 1.00 0.00 ? 80 VAL A N    4  
ATOM   5011  C  CA   . VAL A 1 80 ? 36.211  -25.627 -12.883 1.00 0.00 ? 80 VAL A CA   4  
ATOM   5012  C  C    . VAL A 1 80 ? 36.640  -25.928 -14.322 1.00 0.00 ? 80 VAL A C    4  
ATOM   5013  O  O    . VAL A 1 80 ? 35.811  -26.285 -15.159 1.00 0.00 ? 80 VAL A O    4  
ATOM   5014  C  CB   . VAL A 1 80 ? 35.713  -26.933 -12.223 1.00 0.00 ? 80 VAL A CB   4  
ATOM   5015  C  CG1  . VAL A 1 80 ? 36.851  -27.934 -12.066 1.00 0.00 ? 80 VAL A CG1  4  
ATOM   5016  C  CG2  . VAL A 1 80 ? 35.065  -26.640 -10.877 1.00 0.00 ? 80 VAL A CG2  4  
ATOM   5017  H  H    . VAL A 1 80 ? 34.486  -24.574 -13.527 1.00 0.00 ? 80 VAL A H    4  
ATOM   5018  H  HA   . VAL A 1 80 ? 37.069  -25.272 -12.329 1.00 0.00 ? 80 VAL A HA   4  
ATOM   5019  H  HB   . VAL A 1 80 ? 34.965  -27.372 -12.867 1.00 0.00 ? 80 VAL A HB   4  
ATOM   5020  H  HG11 . VAL A 1 80 ? 37.263  -27.858 -11.070 1.00 0.00 ? 80 VAL A HG11 4  
ATOM   5021  H  HG12 . VAL A 1 80 ? 37.623  -27.723 -12.792 1.00 0.00 ? 80 VAL A HG12 4  
ATOM   5022  H  HG13 . VAL A 1 80 ? 36.473  -28.934 -12.223 1.00 0.00 ? 80 VAL A HG13 4  
ATOM   5023  H  HG21 . VAL A 1 80 ? 35.734  -26.037 -10.280 1.00 0.00 ? 80 VAL A HG21 4  
ATOM   5024  H  HG22 . VAL A 1 80 ? 34.864  -27.570 -10.366 1.00 0.00 ? 80 VAL A HG22 4  
ATOM   5025  H  HG23 . VAL A 1 80 ? 34.139  -26.106 -11.032 1.00 0.00 ? 80 VAL A HG23 4  
ATOM   5026  N  N    . LYS A 1 81 ? 37.944  -25.786 -14.593 1.00 0.00 ? 81 LYS A N    4  
ATOM   5027  C  CA   . LYS A 1 81 ? 38.508  -26.044 -15.924 1.00 0.00 ? 81 LYS A CA   4  
ATOM   5028  C  C    . LYS A 1 81 ? 37.893  -25.120 -16.979 1.00 0.00 ? 81 LYS A C    4  
ATOM   5029  O  O    . LYS A 1 81 ? 36.854  -25.430 -17.564 1.00 0.00 ? 81 LYS A O    4  
ATOM   5030  C  CB   . LYS A 1 81 ? 38.311  -27.514 -16.324 1.00 0.00 ? 81 LYS A CB   4  
ATOM   5031  C  CG   . LYS A 1 81 ? 39.436  -28.428 -15.859 1.00 0.00 ? 81 LYS A CG   4  
ATOM   5032  C  CD   . LYS A 1 81 ? 39.547  -29.670 -16.735 1.00 0.00 ? 81 LYS A CD   4  
ATOM   5033  C  CE   . LYS A 1 81 ? 40.655  -30.601 -16.259 1.00 0.00 ? 81 LYS A CE   4  
ATOM   5034  N  NZ   . LYS A 1 81 ? 41.957  -30.312 -16.928 1.00 0.00 ? 81 LYS A NZ   4  
ATOM   5035  H  H    . LYS A 1 81 ? 38.548  -25.503 -13.874 1.00 0.00 ? 81 LYS A H    4  
ATOM   5036  H  HA   . LYS A 1 81 ? 39.568  -25.842 -15.872 1.00 0.00 ? 81 LYS A HA   4  
ATOM   5037  H  HB2  . LYS A 1 81 ? 37.386  -27.871 -15.897 1.00 0.00 ? 81 LYS A HB2  4  
ATOM   5038  H  HB3  . LYS A 1 81 ? 38.247  -27.576 -17.401 1.00 0.00 ? 81 LYS A HB3  4  
ATOM   5039  H  HG2  . LYS A 1 81 ? 40.369  -27.887 -15.903 1.00 0.00 ? 81 LYS A HG2  4  
ATOM   5040  H  HG3  . LYS A 1 81 ? 39.242  -28.733 -14.841 1.00 0.00 ? 81 LYS A HG3  4  
ATOM   5041  H  HD2  . LYS A 1 81 ? 38.609  -30.203 -16.705 1.00 0.00 ? 81 LYS A HD2  4  
ATOM   5042  H  HD3  . LYS A 1 81 ? 39.757  -29.364 -17.749 1.00 0.00 ? 81 LYS A HD3  4  
ATOM   5043  H  HE2  . LYS A 1 81 ? 40.776  -30.484 -15.192 1.00 0.00 ? 81 LYS A HE2  4  
ATOM   5044  H  HE3  . LYS A 1 81 ? 40.368  -31.619 -16.477 1.00 0.00 ? 81 LYS A HE3  4  
ATOM   5045  H  HZ1  . LYS A 1 81 ? 42.002  -29.312 -17.210 1.00 0.00 ? 81 LYS A HZ1  4  
ATOM   5046  H  HZ2  . LYS A 1 81 ? 42.062  -30.905 -17.777 1.00 0.00 ? 81 LYS A HZ2  4  
ATOM   5047  H  HZ3  . LYS A 1 81 ? 42.746  -30.513 -16.280 1.00 0.00 ? 81 LYS A HZ3  4  
ATOM   5048  N  N    . LEU A 1 82 ? 38.546  -23.980 -17.214 1.00 0.00 ? 82 LEU A N    4  
ATOM   5049  C  CA   . LEU A 1 82 ? 38.069  -23.005 -18.194 1.00 0.00 ? 82 LEU A CA   4  
ATOM   5050  C  C    . LEU A 1 82 ? 38.604  -23.321 -19.592 1.00 0.00 ? 82 LEU A C    4  
ATOM   5051  O  O    . LEU A 1 82 ? 39.771  -23.067 -19.893 1.00 0.00 ? 82 LEU A O    4  
ATOM   5052  C  CB   . LEU A 1 82 ? 38.486  -21.588 -17.783 1.00 0.00 ? 82 LEU A CB   4  
ATOM   5053  C  CG   . LEU A 1 82 ? 37.890  -21.088 -16.463 1.00 0.00 ? 82 LEU A CG   4  
ATOM   5054  C  CD1  . LEU A 1 82 ? 38.784  -20.022 -15.847 1.00 0.00 ? 82 LEU A CD1  4  
ATOM   5055  C  CD2  . LEU A 1 82 ? 36.482  -20.552 -16.682 1.00 0.00 ? 82 LEU A CD2  4  
ATOM   5056  H  H    . LEU A 1 82 ? 39.370  -23.790 -16.716 1.00 0.00 ? 82 LEU A H    4  
ATOM   5057  H  HA   . LEU A 1 82 ? 36.991  -23.059 -18.215 1.00 0.00 ? 82 LEU A HA   4  
ATOM   5058  H  HB2  . LEU A 1 82 ? 39.563  -21.562 -17.700 1.00 0.00 ? 82 LEU A HB2  4  
ATOM   5059  H  HB3  . LEU A 1 82 ? 38.188  -20.907 -18.566 1.00 0.00 ? 82 LEU A HB3  4  
ATOM   5060  H  HG   . LEU A 1 82 ? 37.830  -21.915 -15.769 1.00 0.00 ? 82 LEU A HG   4  
ATOM   5061  H  HD11 . LEU A 1 82 ? 38.559  -19.063 -16.292 1.00 0.00 ? 82 LEU A HD11 4  
ATOM   5062  H  HD12 . LEU A 1 82 ? 39.818  -20.270 -16.030 1.00 0.00 ? 82 LEU A HD12 4  
ATOM   5063  H  HD13 . LEU A 1 82 ? 38.608  -19.975 -14.782 1.00 0.00 ? 82 LEU A HD13 4  
ATOM   5064  H  HD21 . LEU A 1 82 ? 35.872  -20.780 -15.820 1.00 0.00 ? 82 LEU A HD21 4  
ATOM   5065  H  HD22 . LEU A 1 82 ? 36.052  -21.012 -17.558 1.00 0.00 ? 82 LEU A HD22 4  
ATOM   5066  H  HD23 . LEU A 1 82 ? 36.522  -19.481 -16.821 1.00 0.00 ? 82 LEU A HD23 4  
ATOM   5067  N  N    . GLU A 1 83 ? 37.737  -23.874 -20.440 1.00 0.00 ? 83 GLU A N    4  
ATOM   5068  C  CA   . GLU A 1 83 ? 38.108  -24.229 -21.809 1.00 0.00 ? 83 GLU A CA   4  
ATOM   5069  C  C    . GLU A 1 83 ? 37.619  -23.178 -22.808 1.00 0.00 ? 83 GLU A C    4  
ATOM   5070  O  O    . GLU A 1 83 ? 38.286  -22.904 -23.807 1.00 0.00 ? 83 GLU A O    4  
ATOM   5071  C  CB   . GLU A 1 83 ? 37.533  -25.599 -22.176 1.00 0.00 ? 83 GLU A CB   4  
ATOM   5072  C  CG   . GLU A 1 83 ? 38.437  -26.420 -23.083 1.00 0.00 ? 83 GLU A CG   4  
ATOM   5073  C  CD   . GLU A 1 83 ? 38.034  -26.335 -24.543 1.00 0.00 ? 83 GLU A CD   4  
ATOM   5074  O  OE1  . GLU A 1 83 ? 37.015  -26.953 -24.915 1.00 0.00 ? 83 GLU A OE1  4  
ATOM   5075  O  OE2  . GLU A 1 83 ? 38.739  -25.650 -25.314 1.00 0.00 ? 83 GLU A OE2  4  
ATOM   5076  H  H    . GLU A 1 83 ? 36.821  -24.050 -20.136 1.00 0.00 ? 83 GLU A H    4  
ATOM   5077  H  HA   . GLU A 1 83 ? 39.187  -24.278 -21.858 1.00 0.00 ? 83 GLU A HA   4  
ATOM   5078  H  HB2  . GLU A 1 83 ? 37.364  -26.161 -21.270 1.00 0.00 ? 83 GLU A HB2  4  
ATOM   5079  H  HB3  . GLU A 1 83 ? 36.588  -25.456 -22.681 1.00 0.00 ? 83 GLU A HB3  4  
ATOM   5080  H  HG2  . GLU A 1 83 ? 39.450  -26.059 -22.983 1.00 0.00 ? 83 GLU A HG2  4  
ATOM   5081  H  HG3  . GLU A 1 83 ? 38.394  -27.454 -22.772 1.00 0.00 ? 83 GLU A HG3  4  
ATOM   5082  N  N    . HIS A 1 84 ? 36.445  -22.601 -22.534 1.00 0.00 ? 84 HIS A N    4  
ATOM   5083  C  CA   . HIS A 1 84 ? 35.851  -21.588 -23.407 1.00 0.00 ? 84 HIS A CA   4  
ATOM   5084  C  C    . HIS A 1 84 ? 35.577  -22.161 -24.795 1.00 0.00 ? 84 HIS A C    4  
ATOM   5085  O  O    . HIS A 1 84 ? 34.858  -23.150 -24.934 1.00 0.00 ? 84 HIS A O    4  
ATOM   5086  C  CB   . HIS A 1 84 ? 36.760  -20.359 -23.521 1.00 0.00 ? 84 HIS A CB   4  
ATOM   5087  C  CG   . HIS A 1 84 ? 36.913  -19.595 -22.243 1.00 0.00 ? 84 HIS A CG   4  
ATOM   5088  N  ND1  . HIS A 1 84 ? 38.060  -19.628 -21.478 1.00 0.00 ? 84 HIS A ND1  4  
ATOM   5089  C  CD2  . HIS A 1 84 ? 36.059  -18.762 -21.603 1.00 0.00 ? 84 HIS A CD2  4  
ATOM   5090  C  CE1  . HIS A 1 84 ? 37.905  -18.846 -20.424 1.00 0.00 ? 84 HIS A CE1  4  
ATOM   5091  N  NE2  . HIS A 1 84 ? 36.700  -18.309 -20.477 1.00 0.00 ? 84 HIS A NE2  4  
ATOM   5092  H  H    . HIS A 1 84 ? 35.959  -22.869 -21.727 1.00 0.00 ? 84 HIS A H    4  
ATOM   5093  H  HA   . HIS A 1 84 ? 34.910  -21.287 -22.968 1.00 0.00 ? 84 HIS A HA   4  
ATOM   5094  H  HB2  . HIS A 1 84 ? 37.744  -20.675 -23.835 1.00 0.00 ? 84 HIS A HB2  4  
ATOM   5095  H  HB3  . HIS A 1 84 ? 36.352  -19.688 -24.263 1.00 0.00 ? 84 HIS A HB3  4  
ATOM   5096  H  HD1  . HIS A 1 84 ? 38.866  -20.150 -21.676 1.00 0.00 ? 84 HIS A HD1  4  
ATOM   5097  H  HD2  . HIS A 1 84 ? 35.059  -18.503 -21.920 1.00 0.00 ? 84 HIS A HD2  4  
ATOM   5098  H  HE1  . HIS A 1 84 ? 38.641  -18.675 -19.652 1.00 0.00 ? 84 HIS A HE1  4  
ATOM   5099  H  HE2  . HIS A 1 84 ? 36.370  -17.605 -19.880 1.00 0.00 ? 84 HIS A HE2  4  
HETATM 5100  ZN ZN   . ZN  B 2 .  ? 2.532   12.914  3.340   1.00 0.00 ? 85 ZN  A ZN   4  
ATOM   5101  N  N    . MET A 1 1  ? 13.256  10.737  12.343  1.00 0.00 ? 1  MET A N    5  
ATOM   5102  C  CA   . MET A 1 1  ? 14.216  11.192  11.300  1.00 0.00 ? 1  MET A CA   5  
ATOM   5103  C  C    . MET A 1 1  ? 14.575  10.056  10.343  1.00 0.00 ? 1  MET A C    5  
ATOM   5104  O  O    . MET A 1 1  ? 14.245  10.107  9.157   1.00 0.00 ? 1  MET A O    5  
ATOM   5105  C  CB   . MET A 1 1  ? 15.477  11.725  11.989  1.00 0.00 ? 1  MET A CB   5  
ATOM   5106  C  CG   . MET A 1 1  ? 15.215  12.907  12.911  1.00 0.00 ? 1  MET A CG   5  
ATOM   5107  S  SD   . MET A 1 1  ? 16.671  13.946  13.140  1.00 0.00 ? 1  MET A SD   5  
ATOM   5108  C  CE   . MET A 1 1  ? 17.814  12.775  13.868  1.00 0.00 ? 1  MET A CE   5  
ATOM   5109  H  H1   . MET A 1 1  ? 12.449  10.293  11.860  1.00 0.00 ? 1  MET A H1   5  
ATOM   5110  H  H2   . MET A 1 1  ? 12.954  11.574  12.883  1.00 0.00 ? 1  MET A H2   5  
ATOM   5111  H  H3   . MET A 1 1  ? 13.746  10.054  12.954  1.00 0.00 ? 1  MET A H3   5  
ATOM   5112  H  HA   . MET A 1 1  ? 13.757  11.991  10.737  1.00 0.00 ? 1  MET A HA   5  
ATOM   5113  H  HB2  . MET A 1 1  ? 15.917  10.931  12.575  1.00 0.00 ? 1  MET A HB2  5  
ATOM   5114  H  HB3  . MET A 1 1  ? 16.183  12.036  11.233  1.00 0.00 ? 1  MET A HB3  5  
ATOM   5115  H  HG2  . MET A 1 1  ? 14.425  13.508  12.487  1.00 0.00 ? 1  MET A HG2  5  
ATOM   5116  H  HG3  . MET A 1 1  ? 14.902  12.531  13.874  1.00 0.00 ? 1  MET A HG3  5  
ATOM   5117  H  HE1  . MET A 1 1  ? 17.551  11.775  13.559  1.00 0.00 ? 1  MET A HE1  5  
ATOM   5118  H  HE2  . MET A 1 1  ? 17.764  12.845  14.944  1.00 0.00 ? 1  MET A HE2  5  
ATOM   5119  H  HE3  . MET A 1 1  ? 18.818  13.001  13.540  1.00 0.00 ? 1  MET A HE3  5  
ATOM   5120  N  N    . ALA A 1 2  ? 15.251  9.033   10.864  1.00 0.00 ? 2  ALA A N    5  
ATOM   5121  C  CA   . ALA A 1 2  ? 15.653  7.885   10.058  1.00 0.00 ? 2  ALA A CA   5  
ATOM   5122  C  C    . ALA A 1 2  ? 14.681  6.719   10.228  1.00 0.00 ? 2  ALA A C    5  
ATOM   5123  O  O    . ALA A 1 2  ? 14.299  6.075   9.251   1.00 0.00 ? 2  ALA A O    5  
ATOM   5124  C  CB   . ALA A 1 2  ? 17.069  7.459   10.422  1.00 0.00 ? 2  ALA A CB   5  
ATOM   5125  H  H    . ALA A 1 2  ? 15.484  9.052   11.816  1.00 0.00 ? 2  ALA A H    5  
ATOM   5126  H  HA   . ALA A 1 2  ? 15.653  8.191   9.022   1.00 0.00 ? 2  ALA A HA   5  
ATOM   5127  H  HB1  . ALA A 1 2  ? 17.775  7.989   9.799   1.00 0.00 ? 2  ALA A HB1  5  
ATOM   5128  H  HB2  . ALA A 1 2  ? 17.177  6.396   10.264  1.00 0.00 ? 2  ALA A HB2  5  
ATOM   5129  H  HB3  . ALA A 1 2  ? 17.260  7.692   11.459  1.00 0.00 ? 2  ALA A HB3  5  
ATOM   5130  N  N    . VAL A 1 3  ? 14.282  6.452   11.474  1.00 0.00 ? 3  VAL A N    5  
ATOM   5131  C  CA   . VAL A 1 3  ? 13.352  5.362   11.768  1.00 0.00 ? 3  VAL A CA   5  
ATOM   5132  C  C    . VAL A 1 3  ? 11.979  5.616   11.147  1.00 0.00 ? 3  VAL A C    5  
ATOM   5133  O  O    . VAL A 1 3  ? 11.630  6.754   10.825  1.00 0.00 ? 3  VAL A O    5  
ATOM   5134  C  CB   . VAL A 1 3  ? 13.186  5.146   13.290  1.00 0.00 ? 3  VAL A CB   5  
ATOM   5135  C  CG1  . VAL A 1 3  ? 14.485  4.642   13.902  1.00 0.00 ? 3  VAL A CG1  5  
ATOM   5136  C  CG2  . VAL A 1 3  ? 12.724  6.429   13.972  1.00 0.00 ? 3  VAL A CG2  5  
ATOM   5137  H  H    . VAL A 1 3  ? 14.623  6.999   12.211  1.00 0.00 ? 3  VAL A H    5  
ATOM   5138  H  HA   . VAL A 1 3  ? 13.761  4.456   11.343  1.00 0.00 ? 3  VAL A HA   5  
ATOM   5139  H  HB   . VAL A 1 3  ? 12.429  4.391   13.442  1.00 0.00 ? 3  VAL A HB   5  
ATOM   5140  H  HG11 . VAL A 1 3  ? 15.051  5.477   14.286  1.00 0.00 ? 3  VAL A HG11 5  
ATOM   5141  H  HG12 . VAL A 1 3  ? 15.065  4.131   13.147  1.00 0.00 ? 3  VAL A HG12 5  
ATOM   5142  H  HG13 . VAL A 1 3  ? 14.262  3.958   14.708  1.00 0.00 ? 3  VAL A HG13 5  
ATOM   5143  H  HG21 . VAL A 1 3  ? 13.581  6.957   14.364  1.00 0.00 ? 3  VAL A HG21 5  
ATOM   5144  H  HG22 . VAL A 1 3  ? 12.050  6.185   14.780  1.00 0.00 ? 3  VAL A HG22 5  
ATOM   5145  H  HG23 . VAL A 1 3  ? 12.213  7.056   13.256  1.00 0.00 ? 3  VAL A HG23 5  
ATOM   5146  N  N    . PHE A 1 4  ? 11.203  4.545   10.983  1.00 0.00 ? 4  PHE A N    5  
ATOM   5147  C  CA   . PHE A 1 4  ? 9.865   4.640   10.403  1.00 0.00 ? 4  PHE A CA   5  
ATOM   5148  C  C    . PHE A 1 4  ? 8.887   5.302   11.373  1.00 0.00 ? 4  PHE A C    5  
ATOM   5149  O  O    . PHE A 1 4  ? 9.158   5.401   12.570  1.00 0.00 ? 4  PHE A O    5  
ATOM   5150  C  CB   . PHE A 1 4  ? 9.352   3.249   10.021  1.00 0.00 ? 4  PHE A CB   5  
ATOM   5151  C  CG   . PHE A 1 4  ? 9.769   2.805   8.646   1.00 0.00 ? 4  PHE A CG   5  
ATOM   5152  C  CD1  . PHE A 1 4  ? 11.108  2.631   8.333   1.00 0.00 ? 4  PHE A CD1  5  
ATOM   5153  C  CD2  . PHE A 1 4  ? 8.818   2.560   7.669   1.00 0.00 ? 4  PHE A CD2  5  
ATOM   5154  C  CE1  . PHE A 1 4  ? 11.490  2.219   7.070   1.00 0.00 ? 4  PHE A CE1  5  
ATOM   5155  C  CE2  . PHE A 1 4  ? 9.195   2.148   6.405   1.00 0.00 ? 4  PHE A CE2  5  
ATOM   5156  C  CZ   . PHE A 1 4  ? 10.532  1.978   6.105   1.00 0.00 ? 4  PHE A CZ   5  
ATOM   5157  H  H    . PHE A 1 4  ? 11.538  3.667   11.262  1.00 0.00 ? 4  PHE A H    5  
ATOM   5158  H  HA   . PHE A 1 4  ? 9.934   5.246   9.511   1.00 0.00 ? 4  PHE A HA   5  
ATOM   5159  H  HB2  . PHE A 1 4  ? 9.728   2.527   10.729  1.00 0.00 ? 4  PHE A HB2  5  
ATOM   5160  H  HB3  . PHE A 1 4  ? 8.272   3.250   10.056  1.00 0.00 ? 4  PHE A HB3  5  
ATOM   5161  H  HD1  . PHE A 1 4  ? 11.859  2.819   9.086   1.00 0.00 ? 4  PHE A HD1  5  
ATOM   5162  H  HD2  . PHE A 1 4  ? 7.773   2.694   7.902   1.00 0.00 ? 4  PHE A HD2  5  
ATOM   5163  H  HE1  . PHE A 1 4  ? 12.535  2.085   6.838   1.00 0.00 ? 4  PHE A HE1  5  
ATOM   5164  H  HE2  . PHE A 1 4  ? 8.443   1.960   5.653   1.00 0.00 ? 4  PHE A HE2  5  
ATOM   5165  H  HZ   . PHE A 1 4  ? 10.827  1.655   5.118   1.00 0.00 ? 4  PHE A HZ   5  
ATOM   5166  N  N    . HIS A 1 5  ? 7.748   5.750   10.846  1.00 0.00 ? 5  HIS A N    5  
ATOM   5167  C  CA   . HIS A 1 5  ? 6.729   6.399   11.667  1.00 0.00 ? 5  HIS A CA   5  
ATOM   5168  C  C    . HIS A 1 5  ? 5.735   5.378   12.223  1.00 0.00 ? 5  HIS A C    5  
ATOM   5169  O  O    . HIS A 1 5  ? 5.693   5.142   13.432  1.00 0.00 ? 5  HIS A O    5  
ATOM   5170  C  CB   . HIS A 1 5  ? 5.990   7.469   10.855  1.00 0.00 ? 5  HIS A CB   5  
ATOM   5171  C  CG   . HIS A 1 5  ? 5.524   8.631   11.677  1.00 0.00 ? 5  HIS A CG   5  
ATOM   5172  N  ND1  . HIS A 1 5  ? 4.548   8.525   12.647  1.00 0.00 ? 5  HIS A ND1  5  
ATOM   5173  C  CD2  . HIS A 1 5  ? 5.902   9.930   11.667  1.00 0.00 ? 5  HIS A CD2  5  
ATOM   5174  C  CE1  . HIS A 1 5  ? 4.347   9.709   13.197  1.00 0.00 ? 5  HIS A CE1  5  
ATOM   5175  N  NE2  . HIS A 1 5  ? 5.156   10.580  12.620  1.00 0.00 ? 5  HIS A NE2  5  
ATOM   5176  H  H    . HIS A 1 5  ? 7.588   5.639   9.886   1.00 0.00 ? 5  HIS A H    5  
ATOM   5177  H  HA   . HIS A 1 5  ? 7.233   6.877   12.495  1.00 0.00 ? 5  HIS A HA   5  
ATOM   5178  H  HB2  . HIS A 1 5  ? 6.647   7.849   10.088  1.00 0.00 ? 5  HIS A HB2  5  
ATOM   5179  H  HB3  . HIS A 1 5  ? 5.124   7.022   10.391  1.00 0.00 ? 5  HIS A HB3  5  
ATOM   5180  H  HD1  . HIS A 1 5  ? 4.071   7.703   12.896  1.00 0.00 ? 5  HIS A HD1  5  
ATOM   5181  H  HD2  . HIS A 1 5  ? 6.652   10.375  11.028  1.00 0.00 ? 5  HIS A HD2  5  
ATOM   5182  H  HE1  . HIS A 1 5  ? 3.643   9.928   13.986  1.00 0.00 ? 5  HIS A HE1  5  
ATOM   5183  H  HE2  . HIS A 1 5  ? 5.132   11.550  12.759  1.00 0.00 ? 5  HIS A HE2  5  
ATOM   5184  N  N    . ASP A 1 6  ? 4.938   4.776   11.336  1.00 0.00 ? 6  ASP A N    5  
ATOM   5185  C  CA   . ASP A 1 6  ? 3.945   3.783   11.741  1.00 0.00 ? 6  ASP A CA   5  
ATOM   5186  C  C    . ASP A 1 6  ? 3.779   2.697   10.676  1.00 0.00 ? 6  ASP A C    5  
ATOM   5187  O  O    . ASP A 1 6  ? 4.178   2.878   9.522   1.00 0.00 ? 6  ASP A O    5  
ATOM   5188  C  CB   . ASP A 1 6  ? 2.597   4.459   12.009  1.00 0.00 ? 6  ASP A CB   5  
ATOM   5189  C  CG   . ASP A 1 6  ? 2.530   5.101   13.381  1.00 0.00 ? 6  ASP A CG   5  
ATOM   5190  O  OD1  . ASP A 1 6  ? 2.191   4.393   14.353  1.00 0.00 ? 6  ASP A OD1  5  
ATOM   5191  O  OD2  . ASP A 1 6  ? 2.818   6.313   13.484  1.00 0.00 ? 6  ASP A OD2  5  
ATOM   5192  H  H    . ASP A 1 6  ? 5.020   5.007   10.387  1.00 0.00 ? 6  ASP A H    5  
ATOM   5193  H  HA   . ASP A 1 6  ? 4.293   3.321   12.654  1.00 0.00 ? 6  ASP A HA   5  
ATOM   5194  H  HB2  . ASP A 1 6  ? 2.432   5.226   11.266  1.00 0.00 ? 6  ASP A HB2  5  
ATOM   5195  H  HB3  . ASP A 1 6  ? 1.811   3.721   11.938  1.00 0.00 ? 6  ASP A HB3  5  
ATOM   5196  N  N    . GLU A 1 7  ? 3.184   1.570   11.073  1.00 0.00 ? 7  GLU A N    5  
ATOM   5197  C  CA   . GLU A 1 7  ? 2.959   0.450   10.160  1.00 0.00 ? 7  GLU A CA   5  
ATOM   5198  C  C    . GLU A 1 7  ? 1.465   0.230   9.925   1.00 0.00 ? 7  GLU A C    5  
ATOM   5199  O  O    . GLU A 1 7  ? 0.675   0.225   10.870  1.00 0.00 ? 7  GLU A O    5  
ATOM   5200  C  CB   . GLU A 1 7  ? 3.590   -0.829  10.721  1.00 0.00 ? 7  GLU A CB   5  
ATOM   5201  C  CG   . GLU A 1 7  ? 5.039   -0.655  11.148  1.00 0.00 ? 7  GLU A CG   5  
ATOM   5202  C  CD   . GLU A 1 7  ? 5.203   -0.572  12.654  1.00 0.00 ? 7  GLU A CD   5  
ATOM   5203  O  OE1  . GLU A 1 7  ? 4.894   0.494   13.227  1.00 0.00 ? 7  GLU A OE1  5  
ATOM   5204  O  OE2  . GLU A 1 7  ? 5.644   -1.573  13.257  1.00 0.00 ? 7  GLU A OE2  5  
ATOM   5205  H  H    . GLU A 1 7  ? 2.889   1.489   12.004  1.00 0.00 ? 7  GLU A H    5  
ATOM   5206  H  HA   . GLU A 1 7  ? 3.429   0.688   9.216   1.00 0.00 ? 7  GLU A HA   5  
ATOM   5207  H  HB2  . GLU A 1 7  ? 3.017   -1.153  11.578  1.00 0.00 ? 7  GLU A HB2  5  
ATOM   5208  H  HB3  . GLU A 1 7  ? 3.550   -1.598  9.963   1.00 0.00 ? 7  GLU A HB3  5  
ATOM   5209  H  HG2  . GLU A 1 7  ? 5.612   -1.495  10.786  1.00 0.00 ? 7  GLU A HG2  5  
ATOM   5210  H  HG3  . GLU A 1 7  ? 5.422   0.256   10.710  1.00 0.00 ? 7  GLU A HG3  5  
ATOM   5211  N  N    . VAL A 1 8  ? 1.084   0.049   8.660   1.00 0.00 ? 8  VAL A N    5  
ATOM   5212  C  CA   . VAL A 1 8  ? -0.317  -0.167  8.305   1.00 0.00 ? 8  VAL A CA   5  
ATOM   5213  C  C    . VAL A 1 8  ? -0.468  -1.348  7.345   1.00 0.00 ? 8  VAL A C    5  
ATOM   5214  O  O    . VAL A 1 8  ? 0.349   -1.533  6.441   1.00 0.00 ? 8  VAL A O    5  
ATOM   5215  C  CB   . VAL A 1 8  ? -0.937  1.090   7.659   1.00 0.00 ? 8  VAL A CB   5  
ATOM   5216  C  CG1  . VAL A 1 8  ? -2.444  0.934   7.517   1.00 0.00 ? 8  VAL A CG1  5  
ATOM   5217  C  CG2  . VAL A 1 8  ? -0.599  2.336   8.467   1.00 0.00 ? 8  VAL A CG2  5  
ATOM   5218  H  H    . VAL A 1 8  ? 1.759   0.066   7.948   1.00 0.00 ? 8  VAL A H    5  
ATOM   5219  H  HA   . VAL A 1 8  ? -0.860  -0.384  9.213   1.00 0.00 ? 8  VAL A HA   5  
ATOM   5220  H  HB   . VAL A 1 8  ? -0.517  1.206   6.671   1.00 0.00 ? 8  VAL A HB   5  
ATOM   5221  H  HG11 . VAL A 1 8  ? -2.754  1.303   6.552   1.00 0.00 ? 8  VAL A HG11 5  
ATOM   5222  H  HG12 . VAL A 1 8  ? -2.940  1.497   8.295   1.00 0.00 ? 8  VAL A HG12 5  
ATOM   5223  H  HG13 . VAL A 1 8  ? -2.709  -0.110  7.604   1.00 0.00 ? 8  VAL A HG13 5  
ATOM   5224  H  HG21 . VAL A 1 8  ? -1.410  3.044   8.390   1.00 0.00 ? 8  VAL A HG21 5  
ATOM   5225  H  HG22 . VAL A 1 8  ? 0.305   2.781   8.083   1.00 0.00 ? 8  VAL A HG22 5  
ATOM   5226  H  HG23 . VAL A 1 8  ? -0.456  2.066   9.503   1.00 0.00 ? 8  VAL A HG23 5  
ATOM   5227  N  N    . GLU A 1 9  ? -1.522  -2.140  7.550   1.00 0.00 ? 9  GLU A N    5  
ATOM   5228  C  CA   . GLU A 1 9  ? -1.788  -3.302  6.705   1.00 0.00 ? 9  GLU A CA   5  
ATOM   5229  C  C    . GLU A 1 9  ? -2.145  -2.875  5.283   1.00 0.00 ? 9  GLU A C    5  
ATOM   5230  O  O    . GLU A 1 9  ? -2.869  -1.899  5.076   1.00 0.00 ? 9  GLU A O    5  
ATOM   5231  C  CB   . GLU A 1 9  ? -2.924  -4.146  7.293   1.00 0.00 ? 9  GLU A CB   5  
ATOM   5232  C  CG   . GLU A 1 9  ? -2.513  -4.968  8.507   1.00 0.00 ? 9  GLU A CG   5  
ATOM   5233  C  CD   . GLU A 1 9  ? -3.701  -5.554  9.247   1.00 0.00 ? 9  GLU A CD   5  
ATOM   5234  O  OE1  . GLU A 1 9  ? -4.490  -4.774  9.821   1.00 0.00 ? 9  GLU A OE1  5  
ATOM   5235  O  OE2  . GLU A 1 9  ? -3.841  -6.796  9.255   1.00 0.00 ? 9  GLU A OE2  5  
ATOM   5236  H  H    . GLU A 1 9  ? -2.135  -1.937  8.286   1.00 0.00 ? 9  GLU A H    5  
ATOM   5237  H  HA   . GLU A 1 9  ? -0.889  -3.899  6.671   1.00 0.00 ? 9  GLU A HA   5  
ATOM   5238  H  HB2  . GLU A 1 9  ? -3.730  -3.489  7.588   1.00 0.00 ? 9  GLU A HB2  5  
ATOM   5239  H  HB3  . GLU A 1 9  ? -3.286  -4.823  6.533   1.00 0.00 ? 9  GLU A HB3  5  
ATOM   5240  H  HG2  . GLU A 1 9  ? -1.878  -5.777  8.180   1.00 0.00 ? 9  GLU A HG2  5  
ATOM   5241  H  HG3  . GLU A 1 9  ? -1.964  -4.332  9.185   1.00 0.00 ? 9  GLU A HG3  5  
ATOM   5242  N  N    . ILE A 1 10 ? -1.627  -3.617  4.309   1.00 0.00 ? 10 ILE A N    5  
ATOM   5243  C  CA   . ILE A 1 10 ? -1.875  -3.337  2.899   1.00 0.00 ? 10 ILE A CA   5  
ATOM   5244  C  C    . ILE A 1 10 ? -3.374  -3.329  2.579   1.00 0.00 ? 10 ILE A C    5  
ATOM   5245  O  O    . ILE A 1 10 ? -3.816  -2.606  1.686   1.00 0.00 ? 10 ILE A O    5  
ATOM   5246  C  CB   . ILE A 1 10 ? -1.151  -4.359  1.993   1.00 0.00 ? 10 ILE A CB   5  
ATOM   5247  C  CG1  . ILE A 1 10 ? -1.204  -3.912  0.534   1.00 0.00 ? 10 ILE A CG1  5  
ATOM   5248  C  CG2  . ILE A 1 10 ? -1.747  -5.753  2.152   1.00 0.00 ? 10 ILE A CG2  5  
ATOM   5249  C  CD1  . ILE A 1 10 ? -0.199  -2.834  0.199   1.00 0.00 ? 10 ILE A CD1  5  
ATOM   5250  H  H    . ILE A 1 10 ? -1.057  -4.381  4.547   1.00 0.00 ? 10 ILE A H    5  
ATOM   5251  H  HA   . ILE A 1 10 ? -1.472  -2.358  2.683   1.00 0.00 ? 10 ILE A HA   5  
ATOM   5252  H  HB   . ILE A 1 10 ? -0.118  -4.404  2.306   1.00 0.00 ? 10 ILE A HB   5  
ATOM   5253  H  HG12 . ILE A 1 10 ? -1.003  -4.761  -0.102  1.00 0.00 ? 10 ILE A HG12 5  
ATOM   5254  H  HG13 . ILE A 1 10 ? -2.189  -3.529  0.315   1.00 0.00 ? 10 ILE A HG13 5  
ATOM   5255  H  HG21 . ILE A 1 10 ? -2.816  -5.708  2.010   1.00 0.00 ? 10 ILE A HG21 5  
ATOM   5256  H  HG22 . ILE A 1 10 ? -1.530  -6.127  3.141   1.00 0.00 ? 10 ILE A HG22 5  
ATOM   5257  H  HG23 . ILE A 1 10 ? -1.313  -6.414  1.415   1.00 0.00 ? 10 ILE A HG23 5  
ATOM   5258  H  HD11 . ILE A 1 10 ? 0.142   -2.965  -0.816  1.00 0.00 ? 10 ILE A HD11 5  
ATOM   5259  H  HD12 . ILE A 1 10 ? 0.641   -2.902  0.874   1.00 0.00 ? 10 ILE A HD12 5  
ATOM   5260  H  HD13 . ILE A 1 10 ? -0.664  -1.864  0.299   1.00 0.00 ? 10 ILE A HD13 5  
ATOM   5261  N  N    . GLU A 1 11 ? -4.149  -4.127  3.317   1.00 0.00 ? 11 GLU A N    5  
ATOM   5262  C  CA   . GLU A 1 11 ? -5.596  -4.195  3.114   1.00 0.00 ? 11 GLU A CA   5  
ATOM   5263  C  C    . GLU A 1 11 ? -6.242  -2.826  3.342   1.00 0.00 ? 11 GLU A C    5  
ATOM   5264  O  O    . GLU A 1 11 ? -7.238  -2.487  2.702   1.00 0.00 ? 11 GLU A O    5  
ATOM   5265  C  CB   . GLU A 1 11 ? -6.221  -5.228  4.060   1.00 0.00 ? 11 GLU A CB   5  
ATOM   5266  C  CG   . GLU A 1 11 ? -7.343  -6.040  3.426   1.00 0.00 ? 11 GLU A CG   5  
ATOM   5267  C  CD   . GLU A 1 11 ? -7.656  -7.310  4.195   1.00 0.00 ? 11 GLU A CD   5  
ATOM   5268  O  OE1  . GLU A 1 11 ? -6.735  -8.132  4.388   1.00 0.00 ? 11 GLU A OE1  5  
ATOM   5269  O  OE2  . GLU A 1 11 ? -8.823  -7.485  4.603   1.00 0.00 ? 11 GLU A OE2  5  
ATOM   5270  H  H    . GLU A 1 11 ? -3.740  -4.677  4.018   1.00 0.00 ? 11 GLU A H    5  
ATOM   5271  H  HA   . GLU A 1 11 ? -5.775  -4.501  2.092   1.00 0.00 ? 11 GLU A HA   5  
ATOM   5272  H  HB2  . GLU A 1 11 ? -5.451  -5.911  4.386   1.00 0.00 ? 11 GLU A HB2  5  
ATOM   5273  H  HB3  . GLU A 1 11 ? -6.621  -4.712  4.920   1.00 0.00 ? 11 GLU A HB3  5  
ATOM   5274  H  HG2  . GLU A 1 11 ? -8.234  -5.430  3.394   1.00 0.00 ? 11 GLU A HG2  5  
ATOM   5275  H  HG3  . GLU A 1 11 ? -7.054  -6.307  2.421   1.00 0.00 ? 11 GLU A HG3  5  
ATOM   5276  N  N    . ASP A 1 12 ? -5.663  -2.045  4.255   1.00 0.00 ? 12 ASP A N    5  
ATOM   5277  C  CA   . ASP A 1 12 ? -6.175  -0.712  4.568   1.00 0.00 ? 12 ASP A CA   5  
ATOM   5278  C  C    . ASP A 1 12 ? -5.876  0.277   3.442   1.00 0.00 ? 12 ASP A C    5  
ATOM   5279  O  O    . ASP A 1 12 ? -6.619  1.238   3.239   1.00 0.00 ? 12 ASP A O    5  
ATOM   5280  C  CB   . ASP A 1 12 ? -5.570  -0.206  5.880   1.00 0.00 ? 12 ASP A CB   5  
ATOM   5281  C  CG   . ASP A 1 12 ? -6.541  0.645   6.674   1.00 0.00 ? 12 ASP A CG   5  
ATOM   5282  O  OD1  . ASP A 1 12 ? -7.596  0.116   7.087   1.00 0.00 ? 12 ASP A OD1  5  
ATOM   5283  O  OD2  . ASP A 1 12 ? -6.248  1.840   6.884   1.00 0.00 ? 12 ASP A OD2  5  
ATOM   5284  H  H    . ASP A 1 12 ? -4.871  -2.373  4.731   1.00 0.00 ? 12 ASP A H    5  
ATOM   5285  H  HA   . ASP A 1 12 ? -7.246  -0.790  4.687   1.00 0.00 ? 12 ASP A HA   5  
ATOM   5286  H  HB2  . ASP A 1 12 ? -5.281  -1.052  6.488   1.00 0.00 ? 12 ASP A HB2  5  
ATOM   5287  H  HB3  . ASP A 1 12 ? -4.696  0.389   5.659   1.00 0.00 ? 12 ASP A HB3  5  
ATOM   5288  N  N    . PHE A 1 13 ? -4.785  0.038   2.715   1.00 0.00 ? 13 PHE A N    5  
ATOM   5289  C  CA   . PHE A 1 13 ? -4.387  0.907   1.608   1.00 0.00 ? 13 PHE A CA   5  
ATOM   5290  C  C    . PHE A 1 13 ? -5.447  0.908   0.503   1.00 0.00 ? 13 PHE A C    5  
ATOM   5291  O  O    . PHE A 1 13 ? -6.274  -0.002  0.422   1.00 0.00 ? 13 PHE A O    5  
ATOM   5292  C  CB   . PHE A 1 13 ? -3.042  0.454   1.031   1.00 0.00 ? 13 PHE A CB   5  
ATOM   5293  C  CG   . PHE A 1 13 ? -1.845  0.916   1.822   1.00 0.00 ? 13 PHE A CG   5  
ATOM   5294  C  CD1  . PHE A 1 13 ? -1.646  0.487   3.127   1.00 0.00 ? 13 PHE A CD1  5  
ATOM   5295  C  CD2  . PHE A 1 13 ? -0.919  1.779   1.257   1.00 0.00 ? 13 PHE A CD2  5  
ATOM   5296  C  CE1  . PHE A 1 13 ? -0.546  0.909   3.850   1.00 0.00 ? 13 PHE A CE1  5  
ATOM   5297  C  CE2  . PHE A 1 13 ? 0.182   2.203   1.976   1.00 0.00 ? 13 PHE A CE2  5  
ATOM   5298  C  CZ   . PHE A 1 13 ? 0.368   1.770   3.275   1.00 0.00 ? 13 PHE A CZ   5  
ATOM   5299  H  H    . PHE A 1 13 ? -4.232  -0.743  2.926   1.00 0.00 ? 13 PHE A H    5  
ATOM   5300  H  HA   . PHE A 1 13 ? -4.286  1.910   1.993   1.00 0.00 ? 13 PHE A HA   5  
ATOM   5301  H  HB2  . PHE A 1 13 ? -3.018  -0.625  0.998   1.00 0.00 ? 13 PHE A HB2  5  
ATOM   5302  H  HB3  . PHE A 1 13 ? -2.944  0.839   0.026   1.00 0.00 ? 13 PHE A HB3  5  
ATOM   5303  H  HD1  . PHE A 1 13 ? -2.359  -0.186  3.578   1.00 0.00 ? 13 PHE A HD1  5  
ATOM   5304  H  HD2  . PHE A 1 13 ? -1.062  2.122   0.243   1.00 0.00 ? 13 PHE A HD2  5  
ATOM   5305  H  HE1  . PHE A 1 13 ? -0.403  0.568   4.864   1.00 0.00 ? 13 PHE A HE1  5  
ATOM   5306  H  HE2  . PHE A 1 13 ? 0.896   2.876   1.523   1.00 0.00 ? 13 PHE A HE2  5  
ATOM   5307  H  HZ   . PHE A 1 13 ? 1.228   2.102   3.838   1.00 0.00 ? 13 PHE A HZ   5  
ATOM   5308  N  N    . GLN A 1 14 ? -5.410  1.933   -0.347  1.00 0.00 ? 14 GLN A N    5  
ATOM   5309  C  CA   . GLN A 1 14 ? -6.360  2.049   -1.449  1.00 0.00 ? 14 GLN A CA   5  
ATOM   5310  C  C    . GLN A 1 14 ? -5.756  1.500   -2.738  1.00 0.00 ? 14 GLN A C    5  
ATOM   5311  O  O    . GLN A 1 14 ? -5.238  2.254   -3.565  1.00 0.00 ? 14 GLN A O    5  
ATOM   5312  C  CB   . GLN A 1 14 ? -6.779  3.511   -1.643  1.00 0.00 ? 14 GLN A CB   5  
ATOM   5313  C  CG   . GLN A 1 14 ? -8.116  3.678   -2.354  1.00 0.00 ? 14 GLN A CG   5  
ATOM   5314  C  CD   . GLN A 1 14 ? -8.123  4.838   -3.334  1.00 0.00 ? 14 GLN A CD   5  
ATOM   5315  O  OE1  . GLN A 1 14 ? -7.258  5.713   -3.287  1.00 0.00 ? 14 GLN A OE1  5  
ATOM   5316  N  NE2  . GLN A 1 14 ? -9.107  4.853   -4.226  1.00 0.00 ? 14 GLN A NE2  5  
ATOM   5317  H  H    . GLN A 1 14 ? -4.722  2.621   -0.234  1.00 0.00 ? 14 GLN A H    5  
ATOM   5318  H  HA   . GLN A 1 14 ? -7.233  1.465   -1.198  1.00 0.00 ? 14 GLN A HA   5  
ATOM   5319  H  HB2  . GLN A 1 14 ? -6.849  3.985   -0.677  1.00 0.00 ? 14 GLN A HB2  5  
ATOM   5320  H  HB3  . GLN A 1 14 ? -6.022  4.016   -2.227  1.00 0.00 ? 14 GLN A HB3  5  
ATOM   5321  H  HG2  . GLN A 1 14 ? -8.337  2.770   -2.897  1.00 0.00 ? 14 GLN A HG2  5  
ATOM   5322  H  HG3  . GLN A 1 14 ? -8.883  3.847   -1.613  1.00 0.00 ? 14 GLN A HG3  5  
ATOM   5323  H  HE21 . GLN A 1 14 ? -9.764  4.125   -4.204  1.00 0.00 ? 14 GLN A HE21 5  
ATOM   5324  H  HE22 . GLN A 1 14 ? -9.137  5.591   -4.869  1.00 0.00 ? 14 GLN A HE22 5  
ATOM   5325  N  N    . TYR A 1 15 ? -5.821  0.181   -2.902  1.00 0.00 ? 15 TYR A N    5  
ATOM   5326  C  CA   . TYR A 1 15 ? -5.277  -0.466  -4.089  1.00 0.00 ? 15 TYR A CA   5  
ATOM   5327  C  C    . TYR A 1 15 ? -6.089  -0.107  -5.331  1.00 0.00 ? 15 TYR A C    5  
ATOM   5328  O  O    . TYR A 1 15 ? -7.280  0.198   -5.241  1.00 0.00 ? 15 TYR A O    5  
ATOM   5329  C  CB   . TYR A 1 15 ? -5.248  -1.988  -3.915  1.00 0.00 ? 15 TYR A CB   5  
ATOM   5330  C  CG   . TYR A 1 15 ? -4.689  -2.722  -5.117  1.00 0.00 ? 15 TYR A CG   5  
ATOM   5331  C  CD1  . TYR A 1 15 ? -3.326  -2.710  -5.387  1.00 0.00 ? 15 TYR A CD1  5  
ATOM   5332  C  CD2  . TYR A 1 15 ? -5.523  -3.420  -5.980  1.00 0.00 ? 15 TYR A CD2  5  
ATOM   5333  C  CE1  . TYR A 1 15 ? -2.810  -3.373  -6.482  1.00 0.00 ? 15 TYR A CE1  5  
ATOM   5334  C  CE2  . TYR A 1 15 ? -5.015  -4.087  -7.079  1.00 0.00 ? 15 TYR A CE2  5  
ATOM   5335  C  CZ   . TYR A 1 15 ? -3.657  -4.063  -7.324  1.00 0.00 ? 15 TYR A CZ   5  
ATOM   5336  O  OH   . TYR A 1 15 ? -3.144  -4.727  -8.412  1.00 0.00 ? 15 TYR A OH   5  
ATOM   5337  H  H    . TYR A 1 15 ? -6.242  -0.369  -2.206  1.00 0.00 ? 15 TYR A H    5  
ATOM   5338  H  HA   . TYR A 1 15 ? -4.266  -0.111  -4.222  1.00 0.00 ? 15 TYR A HA   5  
ATOM   5339  H  HB2  . TYR A 1 15 ? -4.634  -2.233  -3.061  1.00 0.00 ? 15 TYR A HB2  5  
ATOM   5340  H  HB3  . TYR A 1 15 ? -6.253  -2.343  -3.744  1.00 0.00 ? 15 TYR A HB3  5  
ATOM   5341  H  HD1  . TYR A 1 15 ? -2.665  -2.170  -4.725  1.00 0.00 ? 15 TYR A HD1  5  
ATOM   5342  H  HD2  . TYR A 1 15 ? -6.586  -3.438  -5.786  1.00 0.00 ? 15 TYR A HD2  5  
ATOM   5343  H  HE1  . TYR A 1 15 ? -1.748  -3.352  -6.673  1.00 0.00 ? 15 TYR A HE1  5  
ATOM   5344  H  HE2  . TYR A 1 15 ? -5.680  -4.622  -7.742  1.00 0.00 ? 15 TYR A HE2  5  
ATOM   5345  H  HH   . TYR A 1 15 ? -3.462  -4.316  -9.219  1.00 0.00 ? 15 TYR A HH   5  
ATOM   5346  N  N    . ASP A 1 16 ? -5.431  -0.153  -6.486  1.00 0.00 ? 16 ASP A N    5  
ATOM   5347  C  CA   . ASP A 1 16 ? -6.078  0.158   -7.755  1.00 0.00 ? 16 ASP A CA   5  
ATOM   5348  C  C    . ASP A 1 16 ? -5.526  -0.726  -8.868  1.00 0.00 ? 16 ASP A C    5  
ATOM   5349  O  O    . ASP A 1 16 ? -4.322  -0.734  -9.118  1.00 0.00 ? 16 ASP A O    5  
ATOM   5350  C  CB   . ASP A 1 16 ? -5.871  1.635   -8.107  1.00 0.00 ? 16 ASP A CB   5  
ATOM   5351  C  CG   . ASP A 1 16 ? -6.976  2.189   -8.988  1.00 0.00 ? 16 ASP A CG   5  
ATOM   5352  O  OD1  . ASP A 1 16 ? -8.122  1.694   -8.899  1.00 0.00 ? 16 ASP A OD1  5  
ATOM   5353  O  OD2  . ASP A 1 16 ? -6.696  3.120   -9.771  1.00 0.00 ? 16 ASP A OD2  5  
ATOM   5354  H  H    . ASP A 1 16 ? -4.485  -0.409  -6.486  1.00 0.00 ? 16 ASP A H    5  
ATOM   5355  H  HA   . ASP A 1 16 ? -7.134  -0.035  -7.646  1.00 0.00 ? 16 ASP A HA   5  
ATOM   5356  H  HB2  . ASP A 1 16 ? -5.841  2.213   -7.195  1.00 0.00 ? 16 ASP A HB2  5  
ATOM   5357  H  HB3  . ASP A 1 16 ? -4.932  1.746   -8.629  1.00 0.00 ? 16 ASP A HB3  5  
ATOM   5358  N  N    . GLU A 1 17 ? -6.410  -1.467  -9.537  1.00 0.00 ? 17 GLU A N    5  
ATOM   5359  C  CA   . GLU A 1 17 ? -6.000  -2.350  -10.630 1.00 0.00 ? 17 GLU A CA   5  
ATOM   5360  C  C    . GLU A 1 17 ? -5.464  -1.546  -11.816 1.00 0.00 ? 17 GLU A C    5  
ATOM   5361  O  O    . GLU A 1 17 ? -4.629  -2.034  -12.578 1.00 0.00 ? 17 GLU A O    5  
ATOM   5362  C  CB   . GLU A 1 17 ? -7.169  -3.231  -11.083 1.00 0.00 ? 17 GLU A CB   5  
ATOM   5363  C  CG   . GLU A 1 17 ? -8.466  -2.468  -11.326 1.00 0.00 ? 17 GLU A CG   5  
ATOM   5364  C  CD   . GLU A 1 17 ? -9.467  -3.250  -12.160 1.00 0.00 ? 17 GLU A CD   5  
ATOM   5365  O  OE1  . GLU A 1 17 ? -9.040  -4.017  -13.050 1.00 0.00 ? 17 GLU A OE1  5  
ATOM   5366  O  OE2  . GLU A 1 17 ? -10.684 -3.094  -11.923 1.00 0.00 ? 17 GLU A OE2  5  
ATOM   5367  H  H    . GLU A 1 17 ? -7.358  -1.416  -9.291  1.00 0.00 ? 17 GLU A H    5  
ATOM   5368  H  HA   . GLU A 1 17 ? -5.208  -2.986  -10.259 1.00 0.00 ? 17 GLU A HA   5  
ATOM   5369  H  HB2  . GLU A 1 17 ? -6.893  -3.726  -12.002 1.00 0.00 ? 17 GLU A HB2  5  
ATOM   5370  H  HB3  . GLU A 1 17 ? -7.354  -3.978  -10.325 1.00 0.00 ? 17 GLU A HB3  5  
ATOM   5371  H  HG2  . GLU A 1 17 ? -8.917  -2.244  -10.372 1.00 0.00 ? 17 GLU A HG2  5  
ATOM   5372  H  HG3  . GLU A 1 17 ? -8.235  -1.546  -11.839 1.00 0.00 ? 17 GLU A HG3  5  
ATOM   5373  N  N    . ASP A 1 18 ? -5.960  -0.318  -11.968 1.00 0.00 ? 18 ASP A N    5  
ATOM   5374  C  CA   . ASP A 1 18 ? -5.547  0.560   -13.063 1.00 0.00 ? 18 ASP A CA   5  
ATOM   5375  C  C    . ASP A 1 18 ? -4.037  0.800   -13.055 1.00 0.00 ? 18 ASP A C    5  
ATOM   5376  O  O    . ASP A 1 18 ? -3.346  0.474   -14.018 1.00 0.00 ? 18 ASP A O    5  
ATOM   5377  C  CB   . ASP A 1 18 ? -6.287  1.899   -12.978 1.00 0.00 ? 18 ASP A CB   5  
ATOM   5378  C  CG   . ASP A 1 18 ? -7.661  1.841   -13.618 1.00 0.00 ? 18 ASP A CG   5  
ATOM   5379  O  OD1  . ASP A 1 18 ? -8.556  1.185   -13.044 1.00 0.00 ? 18 ASP A OD1  5  
ATOM   5380  O  OD2  . ASP A 1 18 ? -7.842  2.450   -14.693 1.00 0.00 ? 18 ASP A OD2  5  
ATOM   5381  H  H    . ASP A 1 18 ? -6.632  0.005   -11.330 1.00 0.00 ? 18 ASP A H    5  
ATOM   5382  H  HA   . ASP A 1 18 ? -5.815  0.074   -13.990 1.00 0.00 ? 18 ASP A HA   5  
ATOM   5383  H  HB2  . ASP A 1 18 ? -6.406  2.173   -11.940 1.00 0.00 ? 18 ASP A HB2  5  
ATOM   5384  H  HB3  . ASP A 1 18 ? -5.706  2.656   -13.482 1.00 0.00 ? 18 ASP A HB3  5  
ATOM   5385  N  N    . SER A 1 19 ? -3.535  1.384   -11.967 1.00 0.00 ? 19 SER A N    5  
ATOM   5386  C  CA   . SER A 1 19 ? -2.107  1.680   -11.841 1.00 0.00 ? 19 SER A CA   5  
ATOM   5387  C  C    . SER A 1 19 ? -1.355  0.562   -11.112 1.00 0.00 ? 19 SER A C    5  
ATOM   5388  O  O    . SER A 1 19 ? -0.134  0.448   -11.239 1.00 0.00 ? 19 SER A O    5  
ATOM   5389  C  CB   . SER A 1 19 ? -1.908  3.006   -11.103 1.00 0.00 ? 19 SER A CB   5  
ATOM   5390  O  OG   . SER A 1 19 ? -2.266  4.105   -11.923 1.00 0.00 ? 19 SER A OG   5  
ATOM   5391  H  H    . SER A 1 19 ? -4.139  1.628   -11.234 1.00 0.00 ? 19 SER A H    5  
ATOM   5392  H  HA   . SER A 1 19 ? -1.702  1.774   -12.839 1.00 0.00 ? 19 SER A HA   5  
ATOM   5393  H  HB2  . SER A 1 19 ? -2.525  3.020   -10.217 1.00 0.00 ? 19 SER A HB2  5  
ATOM   5394  H  HB3  . SER A 1 19 ? -0.871  3.107   -10.820 1.00 0.00 ? 19 SER A HB3  5  
ATOM   5395  H  HG   . SER A 1 19 ? -1.476  4.488   -12.311 1.00 0.00 ? 19 SER A HG   5  
ATOM   5396  N  N    . GLU A 1 20 ? -2.085  -0.256  -10.349 1.00 0.00 ? 20 GLU A N    5  
ATOM   5397  C  CA   . GLU A 1 20 ? -1.484  -1.358  -9.598  1.00 0.00 ? 20 GLU A CA   5  
ATOM   5398  C  C    . GLU A 1 20 ? -0.536  -0.827  -8.520  1.00 0.00 ? 20 GLU A C    5  
ATOM   5399  O  O    . GLU A 1 20 ? 0.597   -1.298  -8.381  1.00 0.00 ? 20 GLU A O    5  
ATOM   5400  C  CB   . GLU A 1 20 ? -0.742  -2.311  -10.543 1.00 0.00 ? 20 GLU A CB   5  
ATOM   5401  C  CG   . GLU A 1 20 ? -1.547  -2.698  -11.775 1.00 0.00 ? 20 GLU A CG   5  
ATOM   5402  C  CD   . GLU A 1 20 ? -0.780  -3.604  -12.721 1.00 0.00 ? 20 GLU A CD   5  
ATOM   5403  O  OE1  . GLU A 1 20 ? -0.044  -4.491  -12.235 1.00 0.00 ? 20 GLU A OE1  5  
ATOM   5404  O  OE2  . GLU A 1 20 ? -0.917  -3.427  -13.951 1.00 0.00 ? 20 GLU A OE2  5  
ATOM   5405  H  H    . GLU A 1 20 ? -3.052  -0.113  -10.284 1.00 0.00 ? 20 GLU A H    5  
ATOM   5406  H  HA   . GLU A 1 20 ? -2.286  -1.899  -9.115  1.00 0.00 ? 20 GLU A HA   5  
ATOM   5407  H  HB2  . GLU A 1 20 ? 0.169   -1.834  -10.869 1.00 0.00 ? 20 GLU A HB2  5  
ATOM   5408  H  HB3  . GLU A 1 20 ? -0.492  -3.212  -10.004 1.00 0.00 ? 20 GLU A HB3  5  
ATOM   5409  H  HG2  . GLU A 1 20 ? -2.441  -3.212  -11.460 1.00 0.00 ? 20 GLU A HG2  5  
ATOM   5410  H  HG3  . GLU A 1 20 ? -1.820  -1.798  -12.307 1.00 0.00 ? 20 GLU A HG3  5  
ATOM   5411  N  N    . THR A 1 21 ? -1.012  0.161   -7.763  1.00 0.00 ? 21 THR A N    5  
ATOM   5412  C  CA   . THR A 1 21 ? -0.225  0.770   -6.693  1.00 0.00 ? 21 THR A CA   5  
ATOM   5413  C  C    . THR A 1 21 ? -1.103  1.041   -5.470  1.00 0.00 ? 21 THR A C    5  
ATOM   5414  O  O    . THR A 1 21 ? -2.283  1.363   -5.607  1.00 0.00 ? 21 THR A O    5  
ATOM   5415  C  CB   . THR A 1 21 ? 0.411   2.079   -7.183  1.00 0.00 ? 21 THR A CB   5  
ATOM   5416  O  OG1  . THR A 1 21 ? 1.217   1.849   -8.325  1.00 0.00 ? 21 THR A OG1  5  
ATOM   5417  C  CG2  . THR A 1 21 ? 1.281   2.762   -6.145  1.00 0.00 ? 21 THR A CG2  5  
ATOM   5418  H  H    . THR A 1 21 ? -1.922  0.488   -7.926  1.00 0.00 ? 21 THR A H    5  
ATOM   5419  H  HA   . THR A 1 21 ? 0.557   0.077   -6.420  1.00 0.00 ? 21 THR A HA   5  
ATOM   5420  H  HB   . THR A 1 21 ? -0.375  2.768   -7.458  1.00 0.00 ? 21 THR A HB   5  
ATOM   5421  H  HG1  . THR A 1 21 ? 1.310   2.665   -8.823  1.00 0.00 ? 21 THR A HG1  5  
ATOM   5422  H  HG21 . THR A 1 21 ? 1.280   3.827   -6.318  1.00 0.00 ? 21 THR A HG21 5  
ATOM   5423  H  HG22 . THR A 1 21 ? 2.291   2.388   -6.218  1.00 0.00 ? 21 THR A HG22 5  
ATOM   5424  H  HG23 . THR A 1 21 ? 0.894   2.558   -5.157  1.00 0.00 ? 21 THR A HG23 5  
ATOM   5425  N  N    . TYR A 1 22 ? -0.519  0.912   -4.279  1.00 0.00 ? 22 TYR A N    5  
ATOM   5426  C  CA   . TYR A 1 22 ? -1.249  1.149   -3.033  1.00 0.00 ? 22 TYR A CA   5  
ATOM   5427  C  C    . TYR A 1 22 ? -0.972  2.556   -2.502  1.00 0.00 ? 22 TYR A C    5  
ATOM   5428  O  O    . TYR A 1 22 ? 0.157   3.042   -2.581  1.00 0.00 ? 22 TYR A O    5  
ATOM   5429  C  CB   . TYR A 1 22 ? -0.861  0.112   -1.975  1.00 0.00 ? 22 TYR A CB   5  
ATOM   5430  C  CG   . TYR A 1 22 ? -1.127  -1.320  -2.385  1.00 0.00 ? 22 TYR A CG   5  
ATOM   5431  C  CD1  . TYR A 1 22 ? -0.209  -2.026  -3.154  1.00 0.00 ? 22 TYR A CD1  5  
ATOM   5432  C  CD2  . TYR A 1 22 ? -2.292  -1.969  -1.996  1.00 0.00 ? 22 TYR A CD2  5  
ATOM   5433  C  CE1  . TYR A 1 22 ? -0.446  -3.335  -3.525  1.00 0.00 ? 22 TYR A CE1  5  
ATOM   5434  C  CE2  . TYR A 1 22 ? -2.536  -3.280  -2.363  1.00 0.00 ? 22 TYR A CE2  5  
ATOM   5435  C  CZ   . TYR A 1 22 ? -1.610  -3.959  -3.126  1.00 0.00 ? 22 TYR A CZ   5  
ATOM   5436  O  OH   . TYR A 1 22 ? -1.850  -5.264  -3.493  1.00 0.00 ? 22 TYR A OH   5  
ATOM   5437  H  H    . TYR A 1 22 ? 0.427   0.655   -4.235  1.00 0.00 ? 22 TYR A H    5  
ATOM   5438  H  HA   . TYR A 1 22 ? -2.305  1.057   -3.245  1.00 0.00 ? 22 TYR A HA   5  
ATOM   5439  H  HB2  . TYR A 1 22 ? 0.193   0.204   -1.761  1.00 0.00 ? 22 TYR A HB2  5  
ATOM   5440  H  HB3  . TYR A 1 22 ? -1.421  0.308   -1.071  1.00 0.00 ? 22 TYR A HB3  5  
ATOM   5441  H  HD1  . TYR A 1 22 ? 0.701   -1.536  -3.465  1.00 0.00 ? 22 TYR A HD1  5  
ATOM   5442  H  HD2  . TYR A 1 22 ? -3.018  -1.434  -1.399  1.00 0.00 ? 22 TYR A HD2  5  
ATOM   5443  H  HE1  . TYR A 1 22 ? 0.280   -3.866  -4.123  1.00 0.00 ? 22 TYR A HE1  5  
ATOM   5444  H  HE2  . TYR A 1 22 ? -3.447  -3.767  -2.050  1.00 0.00 ? 22 TYR A HE2  5  
ATOM   5445  H  HH   . TYR A 1 22 ? -1.080  -5.802  -3.293  1.00 0.00 ? 22 TYR A HH   5  
ATOM   5446  N  N    . PHE A 1 23 ? -2.005  3.206   -1.964  1.00 0.00 ? 23 PHE A N    5  
ATOM   5447  C  CA   . PHE A 1 23 ? -1.862  4.561   -1.426  1.00 0.00 ? 23 PHE A CA   5  
ATOM   5448  C  C    . PHE A 1 23 ? -2.384  4.655   0.008   1.00 0.00 ? 23 PHE A C    5  
ATOM   5449  O  O    . PHE A 1 23 ? -3.212  3.846   0.432   1.00 0.00 ? 23 PHE A O    5  
ATOM   5450  C  CB   . PHE A 1 23 ? -2.600  5.569   -2.313  1.00 0.00 ? 23 PHE A CB   5  
ATOM   5451  C  CG   . PHE A 1 23 ? -2.237  5.471   -3.769  1.00 0.00 ? 23 PHE A CG   5  
ATOM   5452  C  CD1  . PHE A 1 23 ? -2.825  4.513   -4.579  1.00 0.00 ? 23 PHE A CD1  5  
ATOM   5453  C  CD2  . PHE A 1 23 ? -1.310  6.337   -4.325  1.00 0.00 ? 23 PHE A CD2  5  
ATOM   5454  C  CE1  . PHE A 1 23 ? -2.492  4.420   -5.917  1.00 0.00 ? 23 PHE A CE1  5  
ATOM   5455  C  CE2  . PHE A 1 23 ? -0.974  6.249   -5.662  1.00 0.00 ? 23 PHE A CE2  5  
ATOM   5456  C  CZ   . PHE A 1 23 ? -1.567  5.289   -6.459  1.00 0.00 ? 23 PHE A CZ   5  
ATOM   5457  H  H    . PHE A 1 23 ? -2.883  2.769   -1.930  1.00 0.00 ? 23 PHE A H    5  
ATOM   5458  H  HA   . PHE A 1 23 ? -0.810  4.804   -1.426  1.00 0.00 ? 23 PHE A HA   5  
ATOM   5459  H  HB2  . PHE A 1 23 ? -3.664  5.404   -2.223  1.00 0.00 ? 23 PHE A HB2  5  
ATOM   5460  H  HB3  . PHE A 1 23 ? -2.368  6.569   -1.977  1.00 0.00 ? 23 PHE A HB3  5  
ATOM   5461  H  HD1  . PHE A 1 23 ? -3.548  3.832   -4.157  1.00 0.00 ? 23 PHE A HD1  5  
ATOM   5462  H  HD2  . PHE A 1 23 ? -0.845  7.088   -3.702  1.00 0.00 ? 23 PHE A HD2  5  
ATOM   5463  H  HE1  . PHE A 1 23 ? -2.958  3.668   -6.538  1.00 0.00 ? 23 PHE A HE1  5  
ATOM   5464  H  HE2  . PHE A 1 23 ? -0.250  6.931   -6.084  1.00 0.00 ? 23 PHE A HE2  5  
ATOM   5465  H  HZ   . PHE A 1 23 ? -1.307  5.218   -7.506  1.00 0.00 ? 23 PHE A HZ   5  
ATOM   5466  N  N    . TYR A 1 24 ? -1.894  5.654   0.750   1.00 0.00 ? 24 TYR A N    5  
ATOM   5467  C  CA   . TYR A 1 24 ? -2.306  5.866   2.138   1.00 0.00 ? 24 TYR A CA   5  
ATOM   5468  C  C    . TYR A 1 24 ? -2.472  7.357   2.442   1.00 0.00 ? 24 TYR A C    5  
ATOM   5469  O  O    . TYR A 1 24 ? -1.643  8.171   2.043   1.00 0.00 ? 24 TYR A O    5  
ATOM   5470  C  CB   . TYR A 1 24 ? -1.278  5.257   3.097   1.00 0.00 ? 24 TYR A CB   5  
ATOM   5471  C  CG   . TYR A 1 24 ? -1.806  5.057   4.499   1.00 0.00 ? 24 TYR A CG   5  
ATOM   5472  C  CD1  . TYR A 1 24 ? -2.665  4.006   4.795   1.00 0.00 ? 24 TYR A CD1  5  
ATOM   5473  C  CD2  . TYR A 1 24 ? -1.453  5.926   5.526   1.00 0.00 ? 24 TYR A CD2  5  
ATOM   5474  C  CE1  . TYR A 1 24 ? -3.158  3.825   6.072   1.00 0.00 ? 24 TYR A CE1  5  
ATOM   5475  C  CE2  . TYR A 1 24 ? -1.940  5.750   6.807   1.00 0.00 ? 24 TYR A CE2  5  
ATOM   5476  C  CZ   . TYR A 1 24 ? -2.793  4.699   7.076   1.00 0.00 ? 24 TYR A CZ   5  
ATOM   5477  O  OH   . TYR A 1 24 ? -3.285  4.523   8.351   1.00 0.00 ? 24 TYR A OH   5  
ATOM   5478  H  H    . TYR A 1 24 ? -1.238  6.266   0.350   1.00 0.00 ? 24 TYR A H    5  
ATOM   5479  H  HA   . TYR A 1 24 ? -3.254  5.371   2.280   1.00 0.00 ? 24 TYR A HA   5  
ATOM   5480  H  HB2  . TYR A 1 24 ? -0.968  4.295   2.718   1.00 0.00 ? 24 TYR A HB2  5  
ATOM   5481  H  HB3  . TYR A 1 24 ? -0.418  5.909   3.154   1.00 0.00 ? 24 TYR A HB3  5  
ATOM   5482  H  HD1  . TYR A 1 24 ? -2.949  3.321   4.008   1.00 0.00 ? 24 TYR A HD1  5  
ATOM   5483  H  HD2  . TYR A 1 24 ? -0.786  6.747   5.314   1.00 0.00 ? 24 TYR A HD2  5  
ATOM   5484  H  HE1  . TYR A 1 24 ? -3.825  3.001   6.280   1.00 0.00 ? 24 TYR A HE1  5  
ATOM   5485  H  HE2  . TYR A 1 24 ? -1.654  6.434   7.592   1.00 0.00 ? 24 TYR A HE2  5  
ATOM   5486  H  HH   . TYR A 1 24 ? -2.566  4.565   8.984   1.00 0.00 ? 24 TYR A HH   5  
ATOM   5487  N  N    . PRO A 1 25 ? -3.551  7.737   3.159   1.00 0.00 ? 25 PRO A N    5  
ATOM   5488  C  CA   . PRO A 1 25 ? -3.814  9.139   3.515   1.00 0.00 ? 25 PRO A CA   5  
ATOM   5489  C  C    . PRO A 1 25 ? -2.784  9.700   4.492   1.00 0.00 ? 25 PRO A C    5  
ATOM   5490  O  O    . PRO A 1 25 ? -2.566  9.144   5.570   1.00 0.00 ? 25 PRO A O    5  
ATOM   5491  C  CB   . PRO A 1 25 ? -5.199  9.092   4.165   1.00 0.00 ? 25 PRO A CB   5  
ATOM   5492  C  CG   . PRO A 1 25 ? -5.344  7.692   4.654   1.00 0.00 ? 25 PRO A CG   5  
ATOM   5493  C  CD   . PRO A 1 25 ? -4.595  6.832   3.676   1.00 0.00 ? 25 PRO A CD   5  
ATOM   5494  H  HA   . PRO A 1 25 ? -3.849  9.767   2.637   1.00 0.00 ? 25 PRO A HA   5  
ATOM   5495  H  HB2  . PRO A 1 25 ? -5.241  9.802   4.979   1.00 0.00 ? 25 PRO A HB2  5  
ATOM   5496  H  HB3  . PRO A 1 25 ? -5.952  9.333   3.430   1.00 0.00 ? 25 PRO A HB3  5  
ATOM   5497  H  HG2  . PRO A 1 25 ? -4.915  7.600   5.641   1.00 0.00 ? 25 PRO A HG2  5  
ATOM   5498  H  HG3  . PRO A 1 25 ? -6.388  7.416   4.671   1.00 0.00 ? 25 PRO A HG3  5  
ATOM   5499  H  HD2  . PRO A 1 25 ? -4.157  5.983   4.179   1.00 0.00 ? 25 PRO A HD2  5  
ATOM   5500  H  HD3  . PRO A 1 25 ? -5.249  6.505   2.882   1.00 0.00 ? 25 PRO A HD3  5  
ATOM   5501  N  N    . CYS A 1 26 ? -2.154  10.810  4.108   1.00 0.00 ? 26 CYS A N    5  
ATOM   5502  C  CA   . CYS A 1 26 ? -1.150  11.454  4.948   1.00 0.00 ? 26 CYS A CA   5  
ATOM   5503  C  C    . CYS A 1 26 ? -1.761  12.608  5.740   1.00 0.00 ? 26 CYS A C    5  
ATOM   5504  O  O    . CYS A 1 26 ? -2.636  13.319  5.240   1.00 0.00 ? 26 CYS A O    5  
ATOM   5505  C  CB   . CYS A 1 26 ? 0.010   11.964  4.089   1.00 0.00 ? 26 CYS A CB   5  
ATOM   5506  S  SG   . CYS A 1 26 ? 1.656   11.494  4.710   1.00 0.00 ? 26 CYS A SG   5  
ATOM   5507  H  H    . CYS A 1 26 ? -2.371  11.210  3.240   1.00 0.00 ? 26 CYS A H    5  
ATOM   5508  H  HA   . CYS A 1 26 ? -0.774  10.715  5.638   1.00 0.00 ? 26 CYS A HA   5  
ATOM   5509  H  HB2  . CYS A 1 26 ? -0.089  11.566  3.090   1.00 0.00 ? 26 CYS A HB2  5  
ATOM   5510  H  HB3  . CYS A 1 26 ? -0.030  13.044  4.046   1.00 0.00 ? 26 CYS A HB3  5  
ATOM   5511  N  N    . PRO A 1 27 ? -1.304  12.814  6.990   1.00 0.00 ? 27 PRO A N    5  
ATOM   5512  C  CA   . PRO A 1 27 ? -1.808  13.891  7.852   1.00 0.00 ? 27 PRO A CA   5  
ATOM   5513  C  C    . PRO A 1 27 ? -1.382  15.284  7.378   1.00 0.00 ? 27 PRO A C    5  
ATOM   5514  O  O    . PRO A 1 27 ? -1.942  16.289  7.817   1.00 0.00 ? 27 PRO A O    5  
ATOM   5515  C  CB   . PRO A 1 27 ? -1.183  13.580  9.214   1.00 0.00 ? 27 PRO A CB   5  
ATOM   5516  C  CG   . PRO A 1 27 ? 0.049   12.805  8.901   1.00 0.00 ? 27 PRO A CG   5  
ATOM   5517  C  CD   . PRO A 1 27 ? -0.261  12.012  7.661   1.00 0.00 ? 27 PRO A CD   5  
ATOM   5518  H  HA   . PRO A 1 27 ? -2.884  13.857  7.933   1.00 0.00 ? 27 PRO A HA   5  
ATOM   5519  H  HB2  . PRO A 1 27 ? -0.952  14.504  9.725   1.00 0.00 ? 27 PRO A HB2  5  
ATOM   5520  H  HB3  . PRO A 1 27 ? -1.876  13.000  9.805   1.00 0.00 ? 27 PRO A HB3  5  
ATOM   5521  H  HG2  . PRO A 1 27 ? 0.871   13.479  8.718   1.00 0.00 ? 27 PRO A HG2  5  
ATOM   5522  H  HG3  . PRO A 1 27 ? 0.282   12.141  9.720   1.00 0.00 ? 27 PRO A HG3  5  
ATOM   5523  H  HD2  . PRO A 1 27 ? 0.621   11.925  7.040   1.00 0.00 ? 27 PRO A HD2  5  
ATOM   5524  H  HD3  . PRO A 1 27 ? -0.637  11.035  7.923   1.00 0.00 ? 27 PRO A HD3  5  
ATOM   5525  N  N    . CYS A 1 28 ? -0.392  15.341  6.485   1.00 0.00 ? 28 CYS A N    5  
ATOM   5526  C  CA   . CYS A 1 28 ? 0.093   16.619  5.966   1.00 0.00 ? 28 CYS A CA   5  
ATOM   5527  C  C    . CYS A 1 28 ? -0.857  17.178  4.903   1.00 0.00 ? 28 CYS A C    5  
ATOM   5528  O  O    . CYS A 1 28 ? -1.093  18.387  4.848   1.00 0.00 ? 28 CYS A O    5  
ATOM   5529  C  CB   . CYS A 1 28 ? 1.502   16.462  5.386   1.00 0.00 ? 28 CYS A CB   5  
ATOM   5530  S  SG   . CYS A 1 28 ? 1.601   15.343  3.950   1.00 0.00 ? 28 CYS A SG   5  
ATOM   5531  H  H    . CYS A 1 28 ? 0.021   14.511  6.168   1.00 0.00 ? 28 CYS A H    5  
ATOM   5532  H  HA   . CYS A 1 28 ? 0.131   17.313  6.793   1.00 0.00 ? 28 CYS A HA   5  
ATOM   5533  H  HB2  . CYS A 1 28 ? 1.864   17.431  5.073   1.00 0.00 ? 28 CYS A HB2  5  
ATOM   5534  H  HB3  . CYS A 1 28 ? 2.157   16.073  6.152   1.00 0.00 ? 28 CYS A HB3  5  
ATOM   5535  N  N    . GLY A 1 29 ? -1.397  16.291  4.060   1.00 0.00 ? 29 GLY A N    5  
ATOM   5536  C  CA   . GLY A 1 29 ? -2.311  16.715  3.009   1.00 0.00 ? 29 GLY A CA   5  
ATOM   5537  C  C    . GLY A 1 29 ? -2.376  15.730  1.852   1.00 0.00 ? 29 GLY A C    5  
ATOM   5538  O  O    . GLY A 1 29 ? -3.461  15.345  1.418   1.00 0.00 ? 29 GLY A O    5  
ATOM   5539  H  H    . GLY A 1 29 ? -1.171  15.343  4.153   1.00 0.00 ? 29 GLY A H    5  
ATOM   5540  H  HA2  . GLY A 1 29 ? -3.298  16.824  3.430   1.00 0.00 ? 29 GLY A HA2  5  
ATOM   5541  H  HA3  . GLY A 1 29 ? -1.987  17.674  2.631   1.00 0.00 ? 29 GLY A HA3  5  
ATOM   5542  N  N    . ASP A 1 30 ? -1.208  15.326  1.354   1.00 0.00 ? 30 ASP A N    5  
ATOM   5543  C  CA   . ASP A 1 30 ? -1.123  14.381  0.239   1.00 0.00 ? 30 ASP A CA   5  
ATOM   5544  C  C    . ASP A 1 30 ? -1.338  12.941  0.720   1.00 0.00 ? 30 ASP A C    5  
ATOM   5545  O  O    . ASP A 1 30 ? -1.782  12.717  1.848   1.00 0.00 ? 30 ASP A O    5  
ATOM   5546  C  CB   . ASP A 1 30 ? 0.239   14.520  -0.449  1.00 0.00 ? 30 ASP A CB   5  
ATOM   5547  C  CG   . ASP A 1 30 ? 0.158   14.373  -1.957  1.00 0.00 ? 30 ASP A CG   5  
ATOM   5548  O  OD1  . ASP A 1 30 ? -0.335  15.309  -2.619  1.00 0.00 ? 30 ASP A OD1  5  
ATOM   5549  O  OD2  . ASP A 1 30 ? 0.589   13.320  -2.473  1.00 0.00 ? 30 ASP A OD2  5  
ATOM   5550  H  H    . ASP A 1 30 ? -0.379  15.672  1.745   1.00 0.00 ? 30 ASP A H    5  
ATOM   5551  H  HA   . ASP A 1 30 ? -1.902  14.632  -0.468  1.00 0.00 ? 30 ASP A HA   5  
ATOM   5552  H  HB2  . ASP A 1 30 ? 0.647   15.494  -0.226  1.00 0.00 ? 30 ASP A HB2  5  
ATOM   5553  H  HB3  . ASP A 1 30 ? 0.906   13.760  -0.065  1.00 0.00 ? 30 ASP A HB3  5  
ATOM   5554  N  N    . ASN A 1 31 ? -1.028  11.968  -0.141  1.00 0.00 ? 31 ASN A N    5  
ATOM   5555  C  CA   . ASN A 1 31 ? -1.193  10.557  0.203   1.00 0.00 ? 31 ASN A CA   5  
ATOM   5556  C  C    . ASN A 1 31 ? 0.026   9.739   -0.229  1.00 0.00 ? 31 ASN A C    5  
ATOM   5557  O  O    . ASN A 1 31 ? 0.578   9.957   -1.310  1.00 0.00 ? 31 ASN A O    5  
ATOM   5558  C  CB   . ASN A 1 31 ? -2.454  9.984   -0.457  1.00 0.00 ? 31 ASN A CB   5  
ATOM   5559  C  CG   . ASN A 1 31 ? -3.701  10.809  -0.183  1.00 0.00 ? 31 ASN A CG   5  
ATOM   5560  O  OD1  . ASN A 1 31 ? -3.803  11.961  -0.610  1.00 0.00 ? 31 ASN A OD1  5  
ATOM   5561  N  ND2  . ASN A 1 31 ? -4.663  10.221  0.523   1.00 0.00 ? 31 ASN A ND2  5  
ATOM   5562  H  H    . ASN A 1 31 ? -0.682  12.202  -1.028  1.00 0.00 ? 31 ASN A H    5  
ATOM   5563  H  HA   . ASN A 1 31 ? -1.295  10.486  1.276   1.00 0.00 ? 31 ASN A HA   5  
ATOM   5564  H  HB2  . ASN A 1 31 ? -2.305  9.946   -1.526  1.00 0.00 ? 31 ASN A HB2  5  
ATOM   5565  H  HB3  . ASN A 1 31 ? -2.619  8.983   -0.088  1.00 0.00 ? 31 ASN A HB3  5  
ATOM   5566  H  HD21 . ASN A 1 31 ? -4.519  9.301   0.828   1.00 0.00 ? 31 ASN A HD21 5  
ATOM   5567  H  HD22 . ASN A 1 31 ? -5.482  10.730  0.703   1.00 0.00 ? 31 ASN A HD22 5  
ATOM   5568  N  N    . PHE A 1 32 ? 0.432   8.789   0.618   1.00 0.00 ? 32 PHE A N    5  
ATOM   5569  C  CA   . PHE A 1 32 ? 1.578   7.923   0.327   1.00 0.00 ? 32 PHE A CA   5  
ATOM   5570  C  C    . PHE A 1 32 ? 1.308   7.060   -0.906  1.00 0.00 ? 32 PHE A C    5  
ATOM   5571  O  O    . PHE A 1 32 ? 0.164   6.937   -1.347  1.00 0.00 ? 32 PHE A O    5  
ATOM   5572  C  CB   . PHE A 1 32 ? 1.881   7.010   1.521   1.00 0.00 ? 32 PHE A CB   5  
ATOM   5573  C  CG   . PHE A 1 32 ? 2.553   7.698   2.679   1.00 0.00 ? 32 PHE A CG   5  
ATOM   5574  C  CD1  . PHE A 1 32 ? 3.850   8.174   2.565   1.00 0.00 ? 32 PHE A CD1  5  
ATOM   5575  C  CD2  . PHE A 1 32 ? 1.892   7.851   3.887   1.00 0.00 ? 32 PHE A CD2  5  
ATOM   5576  C  CE1  . PHE A 1 32 ? 4.472   8.794   3.632   1.00 0.00 ? 32 PHE A CE1  5  
ATOM   5577  C  CE2  . PHE A 1 32 ? 2.509   8.473   4.957   1.00 0.00 ? 32 PHE A CE2  5  
ATOM   5578  C  CZ   . PHE A 1 32 ? 3.800   8.942   4.830   1.00 0.00 ? 32 PHE A CZ   5  
ATOM   5579  H  H    . PHE A 1 32 ? -0.058  8.663   1.459   1.00 0.00 ? 32 PHE A H    5  
ATOM   5580  H  HA   . PHE A 1 32 ? 2.435   8.553   0.136   1.00 0.00 ? 32 PHE A HA   5  
ATOM   5581  H  HB2  . PHE A 1 32 ? 0.955   6.588   1.881   1.00 0.00 ? 32 PHE A HB2  5  
ATOM   5582  H  HB3  . PHE A 1 32 ? 2.527   6.209   1.190   1.00 0.00 ? 32 PHE A HB3  5  
ATOM   5583  H  HD1  . PHE A 1 32 ? 4.376   8.061   1.628   1.00 0.00 ? 32 PHE A HD1  5  
ATOM   5584  H  HD2  . PHE A 1 32 ? 0.881   7.486   3.989   1.00 0.00 ? 32 PHE A HD2  5  
ATOM   5585  H  HE1  . PHE A 1 32 ? 5.482   9.161   3.531   1.00 0.00 ? 32 PHE A HE1  5  
ATOM   5586  H  HE2  . PHE A 1 32 ? 1.982   8.588   5.893   1.00 0.00 ? 32 PHE A HE2  5  
ATOM   5587  H  HZ   . PHE A 1 32 ? 4.285   9.426   5.665   1.00 0.00 ? 32 PHE A HZ   5  
ATOM   5588  N  N    . SER A 1 33 ? 2.365   6.459   -1.453  1.00 0.00 ? 33 SER A N    5  
ATOM   5589  C  CA   . SER A 1 33 ? 2.236   5.605   -2.632  1.00 0.00 ? 33 SER A CA   5  
ATOM   5590  C  C    . SER A 1 33 ? 3.303   4.511   -2.649  1.00 0.00 ? 33 SER A C    5  
ATOM   5591  O  O    . SER A 1 33 ? 4.466   4.759   -2.324  1.00 0.00 ? 33 SER A O    5  
ATOM   5592  C  CB   . SER A 1 33 ? 2.336   6.444   -3.910  1.00 0.00 ? 33 SER A CB   5  
ATOM   5593  O  OG   . SER A 1 33 ? 3.463   7.306   -3.872  1.00 0.00 ? 33 SER A OG   5  
ATOM   5594  H  H    . SER A 1 33 ? 3.252   6.591   -1.056  1.00 0.00 ? 33 SER A H    5  
ATOM   5595  H  HA   . SER A 1 33 ? 1.263   5.138   -2.596  1.00 0.00 ? 33 SER A HA   5  
ATOM   5596  H  HB2  . SER A 1 33 ? 2.431   5.788   -4.762  1.00 0.00 ? 33 SER A HB2  5  
ATOM   5597  H  HB3  . SER A 1 33 ? 1.444   7.043   -4.015  1.00 0.00 ? 33 SER A HB3  5  
ATOM   5598  H  HG   . SER A 1 33 ? 4.258   6.791   -3.701  1.00 0.00 ? 33 SER A HG   5  
ATOM   5599  N  N    . ILE A 1 34 ? 2.895   3.304   -3.040  1.00 0.00 ? 34 ILE A N    5  
ATOM   5600  C  CA   . ILE A 1 34 ? 3.801   2.160   -3.123  1.00 0.00 ? 34 ILE A CA   5  
ATOM   5601  C  C    . ILE A 1 34 ? 3.317   1.173   -4.187  1.00 0.00 ? 34 ILE A C    5  
ATOM   5602  O  O    . ILE A 1 34 ? 2.172   0.720   -4.150  1.00 0.00 ? 34 ILE A O    5  
ATOM   5603  C  CB   . ILE A 1 34 ? 3.940   1.436   -1.762  1.00 0.00 ? 34 ILE A CB   5  
ATOM   5604  C  CG1  . ILE A 1 34 ? 4.958   0.295   -1.860  1.00 0.00 ? 34 ILE A CG1  5  
ATOM   5605  C  CG2  . ILE A 1 34 ? 2.592   0.913   -1.283  1.00 0.00 ? 34 ILE A CG2  5  
ATOM   5606  C  CD1  . ILE A 1 34 ? 5.834   0.161   -0.634  1.00 0.00 ? 34 ILE A CD1  5  
ATOM   5607  H  H    . ILE A 1 34 ? 1.954   3.180   -3.293  1.00 0.00 ? 34 ILE A H    5  
ATOM   5608  H  HA   . ILE A 1 34 ? 4.775   2.531   -3.410  1.00 0.00 ? 34 ILE A HA   5  
ATOM   5609  H  HB   . ILE A 1 34 ? 4.291   2.156   -1.037  1.00 0.00 ? 34 ILE A HB   5  
ATOM   5610  H  HG12 . ILE A 1 34 ? 4.434   -0.639  -1.995  1.00 0.00 ? 34 ILE A HG12 5  
ATOM   5611  H  HG13 . ILE A 1 34 ? 5.603   0.467   -2.711  1.00 0.00 ? 34 ILE A HG13 5  
ATOM   5612  H  HG21 . ILE A 1 34 ? 2.498   -0.133  -1.542  1.00 0.00 ? 34 ILE A HG21 5  
ATOM   5613  H  HG22 . ILE A 1 34 ? 1.799   1.472   -1.756  1.00 0.00 ? 34 ILE A HG22 5  
ATOM   5614  H  HG23 . ILE A 1 34 ? 2.522   1.024   -0.212  1.00 0.00 ? 34 ILE A HG23 5  
ATOM   5615  H  HD11 . ILE A 1 34 ? 5.741   -0.837  -0.233  1.00 0.00 ? 34 ILE A HD11 5  
ATOM   5616  H  HD12 . ILE A 1 34 ? 5.525   0.879   0.110   1.00 0.00 ? 34 ILE A HD12 5  
ATOM   5617  H  HD13 . ILE A 1 34 ? 6.863   0.345   -0.905  1.00 0.00 ? 34 ILE A HD13 5  
ATOM   5618  N  N    . THR A 1 35 ? 4.191   0.856   -5.141  1.00 0.00 ? 35 THR A N    5  
ATOM   5619  C  CA   . THR A 1 35 ? 3.841   -0.064  -6.223  1.00 0.00 ? 35 THR A CA   5  
ATOM   5620  C  C    . THR A 1 35 ? 3.728   -1.500  -5.719  1.00 0.00 ? 35 THR A C    5  
ATOM   5621  O  O    . THR A 1 35 ? 4.421   -1.898  -4.781  1.00 0.00 ? 35 THR A O    5  
ATOM   5622  C  CB   . THR A 1 35 ? 4.880   0.016   -7.349  1.00 0.00 ? 35 THR A CB   5  
ATOM   5623  O  OG1  . THR A 1 35 ? 6.196   0.025   -6.820  1.00 0.00 ? 35 THR A OG1  5  
ATOM   5624  C  CG2  . THR A 1 35 ? 4.727   1.245   -8.220  1.00 0.00 ? 35 THR A CG2  5  
ATOM   5625  H  H    . THR A 1 35 ? 5.086   1.255   -5.123  1.00 0.00 ? 35 THR A H    5  
ATOM   5626  H  HA   . THR A 1 35 ? 2.882   0.239   -6.616  1.00 0.00 ? 35 THR A HA   5  
ATOM   5627  H  HB   . THR A 1 35 ? 4.776   -0.852  -7.982  1.00 0.00 ? 35 THR A HB   5  
ATOM   5628  H  HG1  . THR A 1 35 ? 6.823   -0.183  -7.517  1.00 0.00 ? 35 THR A HG1  5  
ATOM   5629  H  HG21 . THR A 1 35 ? 3.719   1.623   -8.138  1.00 0.00 ? 35 THR A HG21 5  
ATOM   5630  H  HG22 . THR A 1 35 ? 4.927   0.986   -9.247  1.00 0.00 ? 35 THR A HG22 5  
ATOM   5631  H  HG23 . THR A 1 35 ? 5.425   2.006   -7.896  1.00 0.00 ? 35 THR A HG23 5  
ATOM   5632  N  N    . LYS A 1 36 ? 2.847   -2.275  -6.353  1.00 0.00 ? 36 LYS A N    5  
ATOM   5633  C  CA   . LYS A 1 36 ? 2.635   -3.672  -5.976  1.00 0.00 ? 36 LYS A CA   5  
ATOM   5634  C  C    . LYS A 1 36 ? 3.916   -4.486  -6.158  1.00 0.00 ? 36 LYS A C    5  
ATOM   5635  O  O    . LYS A 1 36 ? 4.226   -5.360  -5.345  1.00 0.00 ? 36 LYS A O    5  
ATOM   5636  C  CB   . LYS A 1 36 ? 1.501   -4.277  -6.811  1.00 0.00 ? 36 LYS A CB   5  
ATOM   5637  C  CG   . LYS A 1 36 ? 1.177   -5.720  -6.455  1.00 0.00 ? 36 LYS A CG   5  
ATOM   5638  C  CD   . LYS A 1 36 ? 2.111   -6.694  -7.158  1.00 0.00 ? 36 LYS A CD   5  
ATOM   5639  C  CE   . LYS A 1 36 ? 1.365   -7.574  -8.147  1.00 0.00 ? 36 LYS A CE   5  
ATOM   5640  N  NZ   . LYS A 1 36 ? 1.222   -6.923  -9.481  1.00 0.00 ? 36 LYS A NZ   5  
ATOM   5641  H  H    . LYS A 1 36 ? 2.327   -1.897  -7.093  1.00 0.00 ? 36 LYS A H    5  
ATOM   5642  H  HA   . LYS A 1 36 ? 2.354   -3.695  -4.934  1.00 0.00 ? 36 LYS A HA   5  
ATOM   5643  H  HB2  . LYS A 1 36 ? 0.610   -3.687  -6.667  1.00 0.00 ? 36 LYS A HB2  5  
ATOM   5644  H  HB3  . LYS A 1 36 ? 1.780   -4.241  -7.855  1.00 0.00 ? 36 LYS A HB3  5  
ATOM   5645  H  HG2  . LYS A 1 36 ? 1.276   -5.849  -5.388  1.00 0.00 ? 36 LYS A HG2  5  
ATOM   5646  H  HG3  . LYS A 1 36 ? 0.159   -5.933  -6.751  1.00 0.00 ? 36 LYS A HG3  5  
ATOM   5647  H  HD2  . LYS A 1 36 ? 2.866   -6.135  -7.690  1.00 0.00 ? 36 LYS A HD2  5  
ATOM   5648  H  HD3  . LYS A 1 36 ? 2.583   -7.323  -6.417  1.00 0.00 ? 36 LYS A HD3  5  
ATOM   5649  H  HE2  . LYS A 1 36 ? 1.912   -8.499  -8.265  1.00 0.00 ? 36 LYS A HE2  5  
ATOM   5650  H  HE3  . LYS A 1 36 ? 0.383   -7.786  -7.751  1.00 0.00 ? 36 LYS A HE3  5  
ATOM   5651  H  HZ1  . LYS A 1 36 ? 0.351   -7.248  -9.947  1.00 0.00 ? 36 LYS A HZ1  5  
ATOM   5652  H  HZ2  . LYS A 1 36 ? 2.035   -7.161  -10.085 1.00 0.00 ? 36 LYS A HZ2  5  
ATOM   5653  H  HZ3  . LYS A 1 36 ? 1.177   -5.889  -9.373  1.00 0.00 ? 36 LYS A HZ3  5  
ATOM   5654  N  N    . GLU A 1 37 ? 4.660   -4.189  -7.225  1.00 0.00 ? 37 GLU A N    5  
ATOM   5655  C  CA   . GLU A 1 37 ? 5.909   -4.888  -7.512  1.00 0.00 ? 37 GLU A CA   5  
ATOM   5656  C  C    . GLU A 1 37 ? 6.921   -4.688  -6.381  1.00 0.00 ? 37 GLU A C    5  
ATOM   5657  O  O    . GLU A 1 37 ? 7.656   -5.612  -6.030  1.00 0.00 ? 37 GLU A O    5  
ATOM   5658  C  CB   . GLU A 1 37 ? 6.504   -4.398  -8.834  1.00 0.00 ? 37 GLU A CB   5  
ATOM   5659  C  CG   . GLU A 1 37 ? 7.451   -5.396  -9.481  1.00 0.00 ? 37 GLU A CG   5  
ATOM   5660  C  CD   . GLU A 1 37 ? 8.515   -4.729  -10.331 1.00 0.00 ? 37 GLU A CD   5  
ATOM   5661  O  OE1  . GLU A 1 37 ? 8.160   -4.146  -11.378 1.00 0.00 ? 37 GLU A OE1  5  
ATOM   5662  O  OE2  . GLU A 1 37 ? 9.703   -4.791  -9.951  1.00 0.00 ? 37 GLU A OE2  5  
ATOM   5663  H  H    . GLU A 1 37 ? 4.359   -3.480  -7.833  1.00 0.00 ? 37 GLU A H    5  
ATOM   5664  H  HA   . GLU A 1 37 ? 5.686   -5.942  -7.599  1.00 0.00 ? 37 GLU A HA   5  
ATOM   5665  H  HB2  . GLU A 1 37 ? 5.699   -4.197  -9.526  1.00 0.00 ? 37 GLU A HB2  5  
ATOM   5666  H  HB3  . GLU A 1 37 ? 7.048   -3.482  -8.653  1.00 0.00 ? 37 GLU A HB3  5  
ATOM   5667  H  HG2  . GLU A 1 37 ? 7.938   -5.964  -8.704  1.00 0.00 ? 37 GLU A HG2  5  
ATOM   5668  H  HG3  . GLU A 1 37 ? 6.876   -6.063  -10.107 1.00 0.00 ? 37 GLU A HG3  5  
ATOM   5669  N  N    . ASP A 1 38 ? 6.946   -3.479  -5.814  1.00 0.00 ? 38 ASP A N    5  
ATOM   5670  C  CA   . ASP A 1 38 ? 7.860   -3.159  -4.718  1.00 0.00 ? 38 ASP A CA   5  
ATOM   5671  C  C    . ASP A 1 38 ? 7.665   -4.129  -3.559  1.00 0.00 ? 38 ASP A C    5  
ATOM   5672  O  O    . ASP A 1 38 ? 8.630   -4.661  -3.013  1.00 0.00 ? 38 ASP A O    5  
ATOM   5673  C  CB   . ASP A 1 38 ? 7.638   -1.722  -4.226  1.00 0.00 ? 38 ASP A CB   5  
ATOM   5674  C  CG   . ASP A 1 38 ? 8.543   -0.701  -4.901  1.00 0.00 ? 38 ASP A CG   5  
ATOM   5675  O  OD1  . ASP A 1 38 ? 9.450   -1.105  -5.661  1.00 0.00 ? 38 ASP A OD1  5  
ATOM   5676  O  OD2  . ASP A 1 38 ? 8.338   0.508   -4.668  1.00 0.00 ? 38 ASP A OD2  5  
ATOM   5677  H  H    . ASP A 1 38 ? 6.330   -2.788  -6.138  1.00 0.00 ? 38 ASP A H    5  
ATOM   5678  H  HA   . ASP A 1 38 ? 8.870   -3.256  -5.088  1.00 0.00 ? 38 ASP A HA   5  
ATOM   5679  H  HB2  . ASP A 1 38 ? 6.613   -1.439  -4.414  1.00 0.00 ? 38 ASP A HB2  5  
ATOM   5680  H  HB3  . ASP A 1 38 ? 7.822   -1.685  -3.161  1.00 0.00 ? 38 ASP A HB3  5  
ATOM   5681  N  N    . LEU A 1 39 ? 6.406   -4.351  -3.192  1.00 0.00 ? 39 LEU A N    5  
ATOM   5682  C  CA   . LEU A 1 39 ? 6.075   -5.255  -2.097  1.00 0.00 ? 39 LEU A CA   5  
ATOM   5683  C  C    . LEU A 1 39 ? 6.578   -6.668  -2.384  1.00 0.00 ? 39 LEU A C    5  
ATOM   5684  O  O    . LEU A 1 39 ? 7.173   -7.307  -1.515  1.00 0.00 ? 39 LEU A O    5  
ATOM   5685  C  CB   . LEU A 1 39 ? 4.564   -5.271  -1.851  1.00 0.00 ? 39 LEU A CB   5  
ATOM   5686  C  CG   . LEU A 1 39 ? 3.909   -3.893  -1.715  1.00 0.00 ? 39 LEU A CG   5  
ATOM   5687  C  CD1  . LEU A 1 39 ? 2.434   -4.043  -1.389  1.00 0.00 ? 39 LEU A CD1  5  
ATOM   5688  C  CD2  . LEU A 1 39 ? 4.609   -3.062  -0.647  1.00 0.00 ? 39 LEU A CD2  5  
ATOM   5689  H  H    . LEU A 1 39 ? 5.682   -3.895  -3.673  1.00 0.00 ? 39 LEU A H    5  
ATOM   5690  H  HA   . LEU A 1 39 ? 6.568   -4.887  -1.209  1.00 0.00 ? 39 LEU A HA   5  
ATOM   5691  H  HB2  . LEU A 1 39 ? 4.094   -5.789  -2.675  1.00 0.00 ? 39 LEU A HB2  5  
ATOM   5692  H  HB3  . LEU A 1 39 ? 4.375   -5.825  -0.945  1.00 0.00 ? 39 LEU A HB3  5  
ATOM   5693  H  HG   . LEU A 1 39 ? 3.990   -3.368  -2.656  1.00 0.00 ? 39 LEU A HG   5  
ATOM   5694  H  HD11 . LEU A 1 39 ? 1.871   -4.138  -2.305  1.00 0.00 ? 39 LEU A HD11 5  
ATOM   5695  H  HD12 . LEU A 1 39 ? 2.096   -3.171  -0.849  1.00 0.00 ? 39 LEU A HD12 5  
ATOM   5696  H  HD13 . LEU A 1 39 ? 2.286   -4.922  -0.781  1.00 0.00 ? 39 LEU A HD13 5  
ATOM   5697  H  HD21 . LEU A 1 39 ? 5.661   -2.990  -0.879  1.00 0.00 ? 39 LEU A HD21 5  
ATOM   5698  H  HD22 . LEU A 1 39 ? 4.484   -3.531  0.317   1.00 0.00 ? 39 LEU A HD22 5  
ATOM   5699  H  HD23 . LEU A 1 39 ? 4.179   -2.072  -0.622  1.00 0.00 ? 39 LEU A HD23 5  
ATOM   5700  N  N    . GLU A 1 40 ? 6.346   -7.151  -3.608  1.00 0.00 ? 40 GLU A N    5  
ATOM   5701  C  CA   . GLU A 1 40 ? 6.793   -8.488  -3.996  1.00 0.00 ? 40 GLU A CA   5  
ATOM   5702  C  C    . GLU A 1 40 ? 8.314   -8.618  -3.868  1.00 0.00 ? 40 GLU A C    5  
ATOM   5703  O  O    . GLU A 1 40 ? 8.823   -9.691  -3.548  1.00 0.00 ? 40 GLU A O    5  
ATOM   5704  C  CB   . GLU A 1 40 ? 6.367   -8.806  -5.431  1.00 0.00 ? 40 GLU A CB   5  
ATOM   5705  C  CG   . GLU A 1 40 ? 4.863   -8.769  -5.648  1.00 0.00 ? 40 GLU A CG   5  
ATOM   5706  C  CD   . GLU A 1 40 ? 4.470   -9.056  -7.085  1.00 0.00 ? 40 GLU A CD   5  
ATOM   5707  O  OE1  . GLU A 1 40 ? 4.805   -8.238  -7.969  1.00 0.00 ? 40 GLU A OE1  5  
ATOM   5708  O  OE2  . GLU A 1 40 ? 3.823   -10.095 -7.327  1.00 0.00 ? 40 GLU A OE2  5  
ATOM   5709  H  H    . GLU A 1 40 ? 5.870   -6.595  -4.263  1.00 0.00 ? 40 GLU A H    5  
ATOM   5710  H  HA   . GLU A 1 40 ? 6.327   -9.197  -3.328  1.00 0.00 ? 40 GLU A HA   5  
ATOM   5711  H  HB2  . GLU A 1 40 ? 6.822   -8.087  -6.097  1.00 0.00 ? 40 GLU A HB2  5  
ATOM   5712  H  HB3  . GLU A 1 40 ? 6.721   -9.793  -5.687  1.00 0.00 ? 40 GLU A HB3  5  
ATOM   5713  H  HG2  . GLU A 1 40 ? 4.400   -9.508  -5.011  1.00 0.00 ? 40 GLU A HG2  5  
ATOM   5714  H  HG3  . GLU A 1 40 ? 4.498   -7.787  -5.381  1.00 0.00 ? 40 GLU A HG3  5  
ATOM   5715  N  N    . ASN A 1 41 ? 9.032   -7.523  -4.126  1.00 0.00 ? 41 ASN A N    5  
ATOM   5716  C  CA   . ASN A 1 41 ? 10.491  -7.517  -4.044  1.00 0.00 ? 41 ASN A CA   5  
ATOM   5717  C  C    . ASN A 1 41 ? 10.984  -7.332  -2.607  1.00 0.00 ? 41 ASN A C    5  
ATOM   5718  O  O    . ASN A 1 41 ? 11.985  -7.932  -2.209  1.00 0.00 ? 41 ASN A O    5  
ATOM   5719  C  CB   . ASN A 1 41 ? 11.065  -6.408  -4.930  1.00 0.00 ? 41 ASN A CB   5  
ATOM   5720  C  CG   . ASN A 1 41 ? 11.355  -6.887  -6.337  1.00 0.00 ? 41 ASN A CG   5  
ATOM   5721  O  OD1  . ASN A 1 41 ? 10.464  -6.932  -7.186  1.00 0.00 ? 41 ASN A OD1  5  
ATOM   5722  N  ND2  . ASN A 1 41 ? 12.606  -7.252  -6.590  1.00 0.00 ? 41 ASN A ND2  5  
ATOM   5723  H  H    . ASN A 1 41 ? 8.568   -6.695  -4.384  1.00 0.00 ? 41 ASN A H    5  
ATOM   5724  H  HA   . ASN A 1 41 ? 10.845  -8.470  -4.411  1.00 0.00 ? 41 ASN A HA   5  
ATOM   5725  H  HB2  . ASN A 1 41 ? 10.358  -5.595  -4.984  1.00 0.00 ? 41 ASN A HB2  5  
ATOM   5726  H  HB3  . ASN A 1 41 ? 11.987  -6.051  -4.494  1.00 0.00 ? 41 ASN A HB3  5  
ATOM   5727  H  HD21 . ASN A 1 41 ? 13.263  -7.192  -5.866  1.00 0.00 ? 41 ASN A HD21 5  
ATOM   5728  H  HD22 . ASN A 1 41 ? 12.821  -7.567  -7.493  1.00 0.00 ? 41 ASN A HD22 5  
ATOM   5729  N  N    . GLY A 1 42 ? 10.293  -6.487  -1.839  1.00 0.00 ? 42 GLY A N    5  
ATOM   5730  C  CA   . GLY A 1 42 ? 10.689  -6.226  -0.467  1.00 0.00 ? 42 GLY A CA   5  
ATOM   5731  C  C    . GLY A 1 42 ? 10.531  -4.759  -0.081  1.00 0.00 ? 42 GLY A C    5  
ATOM   5732  O  O    . GLY A 1 42 ? 10.601  -4.415  1.099   1.00 0.00 ? 42 GLY A O    5  
ATOM   5733  H  H    . GLY A 1 42 ? 9.512   -6.027  -2.212  1.00 0.00 ? 42 GLY A H    5  
ATOM   5734  H  HA2  . GLY A 1 42 ? 10.085  -6.831  0.192   1.00 0.00 ? 42 GLY A HA2  5  
ATOM   5735  H  HA3  . GLY A 1 42 ? 11.726  -6.506  -0.344  1.00 0.00 ? 42 GLY A HA3  5  
ATOM   5736  N  N    . GLU A 1 43 ? 10.314  -3.896  -1.081  1.00 0.00 ? 43 GLU A N    5  
ATOM   5737  C  CA   . GLU A 1 43 ? 10.144  -2.466  -0.853  1.00 0.00 ? 43 GLU A CA   5  
ATOM   5738  C  C    . GLU A 1 43 ? 8.815   -2.176  -0.156  1.00 0.00 ? 43 GLU A C    5  
ATOM   5739  O  O    . GLU A 1 43 ? 7.836   -1.787  -0.790  1.00 0.00 ? 43 GLU A O    5  
ATOM   5740  C  CB   . GLU A 1 43 ? 10.213  -1.708  -2.184  1.00 0.00 ? 43 GLU A CB   5  
ATOM   5741  C  CG   . GLU A 1 43 ? 11.631  -1.425  -2.657  1.00 0.00 ? 43 GLU A CG   5  
ATOM   5742  C  CD   . GLU A 1 43 ? 11.742  -0.118  -3.419  1.00 0.00 ? 43 GLU A CD   5  
ATOM   5743  O  OE1  . GLU A 1 43 ? 11.126  0.880   -2.987  1.00 0.00 ? 43 GLU A OE1  5  
ATOM   5744  O  OE2  . GLU A 1 43 ? 12.449  -0.092  -4.449  1.00 0.00 ? 43 GLU A OE2  5  
ATOM   5745  H  H    . GLU A 1 43 ? 10.267  -4.232  -1.998  1.00 0.00 ? 43 GLU A H    5  
ATOM   5746  H  HA   . GLU A 1 43 ? 10.950  -2.134  -0.217  1.00 0.00 ? 43 GLU A HA   5  
ATOM   5747  H  HB2  . GLU A 1 43 ? 9.716   -2.292  -2.946  1.00 0.00 ? 43 GLU A HB2  5  
ATOM   5748  H  HB3  . GLU A 1 43 ? 9.699   -0.764  -2.075  1.00 0.00 ? 43 GLU A HB3  5  
ATOM   5749  H  HG2  . GLU A 1 43 ? 12.281  -1.380  -1.798  1.00 0.00 ? 43 GLU A HG2  5  
ATOM   5750  H  HG3  . GLU A 1 43 ? 11.949  -2.231  -3.305  1.00 0.00 ? 43 GLU A HG3  5  
ATOM   5751  N  N    . ASP A 1 44 ? 8.795   -2.366  1.156   1.00 0.00 ? 44 ASP A N    5  
ATOM   5752  C  CA   . ASP A 1 44 ? 7.597   -2.124  1.956   1.00 0.00 ? 44 ASP A CA   5  
ATOM   5753  C  C    . ASP A 1 44 ? 7.659   -0.741  2.608   1.00 0.00 ? 44 ASP A C    5  
ATOM   5754  O  O    . ASP A 1 44 ? 7.301   -0.572  3.776   1.00 0.00 ? 44 ASP A O    5  
ATOM   5755  C  CB   . ASP A 1 44 ? 7.429   -3.221  3.019   1.00 0.00 ? 44 ASP A CB   5  
ATOM   5756  C  CG   . ASP A 1 44 ? 8.660   -3.428  3.892   1.00 0.00 ? 44 ASP A CG   5  
ATOM   5757  O  OD1  . ASP A 1 44 ? 9.514   -2.519  3.969   1.00 0.00 ? 44 ASP A OD1  5  
ATOM   5758  O  OD2  . ASP A 1 44 ? 8.768   -4.511  4.505   1.00 0.00 ? 44 ASP A OD2  5  
ATOM   5759  H  H    . ASP A 1 44 ? 9.607   -2.676  1.598   1.00 0.00 ? 44 ASP A H    5  
ATOM   5760  H  HA   . ASP A 1 44 ? 6.745   -2.151  1.291   1.00 0.00 ? 44 ASP A HA   5  
ATOM   5761  H  HB2  . ASP A 1 44 ? 6.602   -2.962  3.660   1.00 0.00 ? 44 ASP A HB2  5  
ATOM   5762  H  HB3  . ASP A 1 44 ? 7.208   -4.154  2.520   1.00 0.00 ? 44 ASP A HB3  5  
ATOM   5763  N  N    . VAL A 1 45 ? 8.117   0.246   1.838   1.00 0.00 ? 45 VAL A N    5  
ATOM   5764  C  CA   . VAL A 1 45 ? 8.229   1.618   2.325   1.00 0.00 ? 45 VAL A CA   5  
ATOM   5765  C  C    . VAL A 1 45 ? 7.562   2.604   1.367   1.00 0.00 ? 45 VAL A C    5  
ATOM   5766  O  O    . VAL A 1 45 ? 7.786   2.557   0.155   1.00 0.00 ? 45 VAL A O    5  
ATOM   5767  C  CB   . VAL A 1 45 ? 9.706   2.026   2.530   1.00 0.00 ? 45 VAL A CB   5  
ATOM   5768  C  CG1  . VAL A 1 45 ? 10.478  1.959   1.217   1.00 0.00 ? 45 VAL A CG1  5  
ATOM   5769  C  CG2  . VAL A 1 45 ? 9.795   3.419   3.138   1.00 0.00 ? 45 VAL A CG2  5  
ATOM   5770  H  H    . VAL A 1 45 ? 8.385   0.044   0.917   1.00 0.00 ? 45 VAL A H    5  
ATOM   5771  H  HA   . VAL A 1 45 ? 7.730   1.670   3.281   1.00 0.00 ? 45 VAL A HA   5  
ATOM   5772  H  HB   . VAL A 1 45 ? 10.156  1.328   3.219   1.00 0.00 ? 45 VAL A HB   5  
ATOM   5773  H  HG11 . VAL A 1 45 ? 11.519  1.759   1.420   1.00 0.00 ? 45 VAL A HG11 5  
ATOM   5774  H  HG12 . VAL A 1 45 ? 10.388  2.901   0.697   1.00 0.00 ? 45 VAL A HG12 5  
ATOM   5775  H  HG13 . VAL A 1 45 ? 10.073  1.169   0.602   1.00 0.00 ? 45 VAL A HG13 5  
ATOM   5776  H  HG21 . VAL A 1 45 ? 9.168   3.468   4.017   1.00 0.00 ? 45 VAL A HG21 5  
ATOM   5777  H  HG22 . VAL A 1 45 ? 9.461   4.150   2.416   1.00 0.00 ? 45 VAL A HG22 5  
ATOM   5778  H  HG23 . VAL A 1 45 ? 10.818  3.628   3.414   1.00 0.00 ? 45 VAL A HG23 5  
ATOM   5779  N  N    . ALA A 1 46 ? 6.746   3.501   1.918   1.00 0.00 ? 46 ALA A N    5  
ATOM   5780  C  CA   . ALA A 1 46 ? 6.053   4.500   1.114   1.00 0.00 ? 46 ALA A CA   5  
ATOM   5781  C  C    . ALA A 1 46 ? 6.571   5.901   1.427   1.00 0.00 ? 46 ALA A C    5  
ATOM   5782  O  O    . ALA A 1 46 ? 6.745   6.262   2.594   1.00 0.00 ? 46 ALA A O    5  
ATOM   5783  C  CB   . ALA A 1 46 ? 4.549   4.420   1.339   1.00 0.00 ? 46 ALA A CB   5  
ATOM   5784  H  H    . ALA A 1 46 ? 6.610   3.491   2.889   1.00 0.00 ? 46 ALA A H    5  
ATOM   5785  H  HA   . ALA A 1 46 ? 6.249   4.281   0.073   1.00 0.00 ? 46 ALA A HA   5  
ATOM   5786  H  HB1  . ALA A 1 46 ? 4.048   4.320   0.387   1.00 0.00 ? 46 ALA A HB1  5  
ATOM   5787  H  HB2  . ALA A 1 46 ? 4.208   5.319   1.831   1.00 0.00 ? 46 ALA A HB2  5  
ATOM   5788  H  HB3  . ALA A 1 46 ? 4.321   3.564   1.957   1.00 0.00 ? 46 ALA A HB3  5  
ATOM   5789  N  N    . THR A 1 47 ? 6.823   6.683   0.378   1.00 0.00 ? 47 THR A N    5  
ATOM   5790  C  CA   . THR A 1 47 ? 7.331   8.044   0.539   1.00 0.00 ? 47 THR A CA   5  
ATOM   5791  C  C    . THR A 1 47 ? 6.333   9.071   0.005   1.00 0.00 ? 47 THR A C    5  
ATOM   5792  O  O    . THR A 1 47 ? 5.813   8.926   -1.103  1.00 0.00 ? 47 THR A O    5  
ATOM   5793  C  CB   . THR A 1 47 ? 8.681   8.199   -0.177  1.00 0.00 ? 47 THR A CB   5  
ATOM   5794  O  OG1  . THR A 1 47 ? 9.492   7.052   0.023   1.00 0.00 ? 47 THR A OG1  5  
ATOM   5795  C  CG2  . THR A 1 47 ? 9.477   9.404   0.281   1.00 0.00 ? 47 THR A CG2  5  
ATOM   5796  H  H    . THR A 1 47 ? 6.670   6.336   -0.526  1.00 0.00 ? 47 THR A H    5  
ATOM   5797  H  HA   . THR A 1 47 ? 7.475   8.220   1.594   1.00 0.00 ? 47 THR A HA   5  
ATOM   5798  H  HB   . THR A 1 47 ? 8.504   8.304   -1.239  1.00 0.00 ? 47 THR A HB   5  
ATOM   5799  H  HG1  . THR A 1 47 ? 9.515   6.831   0.959   1.00 0.00 ? 47 THR A HG1  5  
ATOM   5800  H  HG21 . THR A 1 47 ? 8.824   10.094  0.795   1.00 0.00 ? 47 THR A HG21 5  
ATOM   5801  H  HG22 . THR A 1 47 ? 9.913   9.895   -0.577  1.00 0.00 ? 47 THR A HG22 5  
ATOM   5802  H  HG23 . THR A 1 47 ? 10.261  9.084   0.950   1.00 0.00 ? 47 THR A HG23 5  
ATOM   5803  N  N    . CYS A 1 48 ? 6.079   10.110  0.800   1.00 0.00 ? 48 CYS A N    5  
ATOM   5804  C  CA   . CYS A 1 48 ? 5.151   11.171  0.413   1.00 0.00 ? 48 CYS A CA   5  
ATOM   5805  C  C    . CYS A 1 48 ? 5.895   12.300  -0.300  1.00 0.00 ? 48 CYS A C    5  
ATOM   5806  O  O    . CYS A 1 48 ? 6.949   12.740  0.159   1.00 0.00 ? 48 CYS A O    5  
ATOM   5807  C  CB   . CYS A 1 48 ? 4.426   11.722  1.646   1.00 0.00 ? 48 CYS A CB   5  
ATOM   5808  S  SG   . CYS A 1 48 ? 3.038   12.840  1.266   1.00 0.00 ? 48 CYS A SG   5  
ATOM   5809  H  H    . CYS A 1 48 ? 6.531   10.168  1.669   1.00 0.00 ? 48 CYS A H    5  
ATOM   5810  H  HA   . CYS A 1 48 ? 4.424   10.745  -0.262  1.00 0.00 ? 48 CYS A HA   5  
ATOM   5811  H  HB2  . CYS A 1 48 ? 4.030   10.899  2.220   1.00 0.00 ? 48 CYS A HB2  5  
ATOM   5812  H  HB3  . CYS A 1 48 ? 5.131   12.271  2.253   1.00 0.00 ? 48 CYS A HB3  5  
ATOM   5813  N  N    . PRO A 1 49 ? 5.357   12.790  -1.434  1.00 0.00 ? 49 PRO A N    5  
ATOM   5814  C  CA   . PRO A 1 49 ? 5.979   13.875  -2.198  1.00 0.00 ? 49 PRO A CA   5  
ATOM   5815  C  C    . PRO A 1 49 ? 5.724   15.263  -1.596  1.00 0.00 ? 49 PRO A C    5  
ATOM   5816  O  O    . PRO A 1 49 ? 6.162   16.273  -2.152  1.00 0.00 ? 49 PRO A O    5  
ATOM   5817  C  CB   . PRO A 1 49 ? 5.313   13.753  -3.568  1.00 0.00 ? 49 PRO A CB   5  
ATOM   5818  C  CG   . PRO A 1 49 ? 3.961   13.189  -3.286  1.00 0.00 ? 49 PRO A CG   5  
ATOM   5819  C  CD   . PRO A 1 49 ? 4.100   12.326  -2.056  1.00 0.00 ? 49 PRO A CD   5  
ATOM   5820  H  HA   . PRO A 1 49 ? 7.043   13.723  -2.301  1.00 0.00 ? 49 PRO A HA   5  
ATOM   5821  H  HB2  . PRO A 1 49 ? 5.248   14.730  -4.027  1.00 0.00 ? 49 PRO A HB2  5  
ATOM   5822  H  HB3  . PRO A 1 49 ? 5.894   13.093  -4.195  1.00 0.00 ? 49 PRO A HB3  5  
ATOM   5823  H  HG2  . PRO A 1 49 ? 3.263   13.991  -3.101  1.00 0.00 ? 49 PRO A HG2  5  
ATOM   5824  H  HG3  . PRO A 1 49 ? 3.633   12.593  -4.124  1.00 0.00 ? 49 PRO A HG3  5  
ATOM   5825  H  HD2  . PRO A 1 49 ? 3.261   12.483  -1.393  1.00 0.00 ? 49 PRO A HD2  5  
ATOM   5826  H  HD3  . PRO A 1 49 ? 4.171   11.285  -2.333  1.00 0.00 ? 49 PRO A HD3  5  
ATOM   5827  N  N    . SER A 1 50 ? 5.019   15.312  -0.462  1.00 0.00 ? 50 SER A N    5  
ATOM   5828  C  CA   . SER A 1 50 ? 4.718   16.578  0.200   1.00 0.00 ? 50 SER A CA   5  
ATOM   5829  C  C    . SER A 1 50 ? 5.568   16.754  1.459   1.00 0.00 ? 50 SER A C    5  
ATOM   5830  O  O    . SER A 1 50 ? 6.211   17.788  1.642   1.00 0.00 ? 50 SER A O    5  
ATOM   5831  C  CB   . SER A 1 50 ? 3.232   16.653  0.558   1.00 0.00 ? 50 SER A CB   5  
ATOM   5832  O  OG   . SER A 1 50 ? 2.763   17.989  0.495   1.00 0.00 ? 50 SER A OG   5  
ATOM   5833  H  H    . SER A 1 50 ? 4.692   14.481  -0.062  1.00 0.00 ? 50 SER A H    5  
ATOM   5834  H  HA   . SER A 1 50 ? 4.953   17.375  -0.489  1.00 0.00 ? 50 SER A HA   5  
ATOM   5835  H  HB2  . SER A 1 50 ? 2.665   16.053  -0.139  1.00 0.00 ? 50 SER A HB2  5  
ATOM   5836  H  HB3  . SER A 1 50 ? 3.085   16.278  1.560   1.00 0.00 ? 50 SER A HB3  5  
ATOM   5837  H  HG   . SER A 1 50 ? 2.542   18.209  -0.412  1.00 0.00 ? 50 SER A HG   5  
ATOM   5838  N  N    . CYS A 1 51 ? 5.560   15.741  2.327   1.00 0.00 ? 51 CYS A N    5  
ATOM   5839  C  CA   . CYS A 1 51 ? 6.324   15.790  3.575   1.00 0.00 ? 51 CYS A CA   5  
ATOM   5840  C  C    . CYS A 1 51 ? 7.623   14.980  3.488   1.00 0.00 ? 51 CYS A C    5  
ATOM   5841  O  O    . CYS A 1 51 ? 8.571   15.244  4.232   1.00 0.00 ? 51 CYS A O    5  
ATOM   5842  C  CB   . CYS A 1 51 ? 5.471   15.278  4.738   1.00 0.00 ? 51 CYS A CB   5  
ATOM   5843  S  SG   . CYS A 1 51 ? 5.019   13.516  4.616   1.00 0.00 ? 51 CYS A SG   5  
ATOM   5844  H  H    . CYS A 1 51 ? 5.021   14.944  2.128   1.00 0.00 ? 51 CYS A H    5  
ATOM   5845  H  HA   . CYS A 1 51 ? 6.577   16.823  3.761   1.00 0.00 ? 51 CYS A HA   5  
ATOM   5846  H  HB2  . CYS A 1 51 ? 6.016   15.416  5.661   1.00 0.00 ? 51 CYS A HB2  5  
ATOM   5847  H  HB3  . CYS A 1 51 ? 4.554   15.850  4.782   1.00 0.00 ? 51 CYS A HB3  5  
ATOM   5848  N  N    . SER A 1 52 ? 7.661   13.991  2.589   1.00 0.00 ? 52 SER A N    5  
ATOM   5849  C  CA   . SER A 1 52 ? 8.841   13.141  2.420   1.00 0.00 ? 52 SER A CA   5  
ATOM   5850  C  C    . SER A 1 52 ? 9.041   12.233  3.637   1.00 0.00 ? 52 SER A C    5  
ATOM   5851  O  O    . SER A 1 52 ? 10.166  12.023  4.096   1.00 0.00 ? 52 SER A O    5  
ATOM   5852  C  CB   . SER A 1 52 ? 10.089  14.000  2.185   1.00 0.00 ? 52 SER A CB   5  
ATOM   5853  O  OG   . SER A 1 52 ? 11.023  13.331  1.356   1.00 0.00 ? 52 SER A OG   5  
ATOM   5854  H  H    . SER A 1 52 ? 6.874   13.823  2.031   1.00 0.00 ? 52 SER A H    5  
ATOM   5855  H  HA   . SER A 1 52 ? 8.676   12.520  1.551   1.00 0.00 ? 52 SER A HA   5  
ATOM   5856  H  HB2  . SER A 1 52 ? 9.801   14.924  1.706   1.00 0.00 ? 52 SER A HB2  5  
ATOM   5857  H  HB3  . SER A 1 52 ? 10.557  14.216  3.133   1.00 0.00 ? 52 SER A HB3  5  
ATOM   5858  H  HG   . SER A 1 52 ? 10.846  13.544  0.438   1.00 0.00 ? 52 SER A HG   5  
ATOM   5859  N  N    . LEU A 1 53 ? 7.937   11.691  4.149   1.00 0.00 ? 53 LEU A N    5  
ATOM   5860  C  CA   . LEU A 1 53 ? 7.976   10.804  5.307   1.00 0.00 ? 53 LEU A CA   5  
ATOM   5861  C  C    . LEU A 1 53 ? 8.012   9.341   4.869   1.00 0.00 ? 53 LEU A C    5  
ATOM   5862  O  O    . LEU A 1 53 ? 7.705   9.021   3.720   1.00 0.00 ? 53 LEU A O    5  
ATOM   5863  C  CB   . LEU A 1 53 ? 6.756   11.058  6.200   1.00 0.00 ? 53 LEU A CB   5  
ATOM   5864  C  CG   . LEU A 1 53 ? 6.857   10.512  7.628   1.00 0.00 ? 53 LEU A CG   5  
ATOM   5865  C  CD1  . LEU A 1 53 ? 8.109   11.033  8.321   1.00 0.00 ? 53 LEU A CD1  5  
ATOM   5866  C  CD2  . LEU A 1 53 ? 5.612   10.880  8.420   1.00 0.00 ? 53 LEU A CD2  5  
ATOM   5867  H  H    . LEU A 1 53 ? 7.071   11.893  3.736   1.00 0.00 ? 53 LEU A H    5  
ATOM   5868  H  HA   . LEU A 1 53 ? 8.874   11.024  5.865   1.00 0.00 ? 53 LEU A HA   5  
ATOM   5869  H  HB2  . LEU A 1 53 ? 6.598   12.125  6.257   1.00 0.00 ? 53 LEU A HB2  5  
ATOM   5870  H  HB3  . LEU A 1 53 ? 5.895   10.609  5.729   1.00 0.00 ? 53 LEU A HB3  5  
ATOM   5871  H  HG   . LEU A 1 53 ? 6.922   9.434   7.590   1.00 0.00 ? 53 LEU A HG   5  
ATOM   5872  H  HD11 . LEU A 1 53 ? 8.970   10.482  7.970   1.00 0.00 ? 53 LEU A HD11 5  
ATOM   5873  H  HD12 . LEU A 1 53 ? 8.009   10.902  9.388   1.00 0.00 ? 53 LEU A HD12 5  
ATOM   5874  H  HD13 . LEU A 1 53 ? 8.236   12.081  8.097   1.00 0.00 ? 53 LEU A HD13 5  
ATOM   5875  H  HD21 . LEU A 1 53 ? 5.791   11.791  8.973   1.00 0.00 ? 53 LEU A HD21 5  
ATOM   5876  H  HD22 . LEU A 1 53 ? 5.374   10.083  9.107   1.00 0.00 ? 53 LEU A HD22 5  
ATOM   5877  H  HD23 . LEU A 1 53 ? 4.785   11.029  7.742   1.00 0.00 ? 53 LEU A HD23 5  
ATOM   5878  N  N    . ILE A 1 54 ? 8.391   8.455   5.792   1.00 0.00 ? 54 ILE A N    5  
ATOM   5879  C  CA   . ILE A 1 54 ? 8.465   7.029   5.498   1.00 0.00 ? 54 ILE A CA   5  
ATOM   5880  C  C    . ILE A 1 54 ? 7.421   6.246   6.295   1.00 0.00 ? 54 ILE A C    5  
ATOM   5881  O  O    . ILE A 1 54 ? 7.145   6.566   7.454   1.00 0.00 ? 54 ILE A O    5  
ATOM   5882  C  CB   . ILE A 1 54 ? 9.872   6.455   5.807   1.00 0.00 ? 54 ILE A CB   5  
ATOM   5883  C  CG1  . ILE A 1 54 ? 10.269  6.751   7.260   1.00 0.00 ? 54 ILE A CG1  5  
ATOM   5884  C  CG2  . ILE A 1 54 ? 10.908  7.020   4.842   1.00 0.00 ? 54 ILE A CG2  5  
ATOM   5885  C  CD1  . ILE A 1 54 ? 11.607  6.162   7.657   1.00 0.00 ? 54 ILE A CD1  5  
ATOM   5886  H  H    . ILE A 1 54 ? 8.623   8.770   6.691   1.00 0.00 ? 54 ILE A H    5  
ATOM   5887  H  HA   . ILE A 1 54 ? 8.269   6.895   4.442   1.00 0.00 ? 54 ILE A HA   5  
ATOM   5888  H  HB   . ILE A 1 54 ? 9.835   5.385   5.665   1.00 0.00 ? 54 ILE A HB   5  
ATOM   5889  H  HG12 . ILE A 1 54 ? 10.324  7.820   7.401   1.00 0.00 ? 54 ILE A HG12 5  
ATOM   5890  H  HG13 . ILE A 1 54 ? 9.518   6.344   7.920   1.00 0.00 ? 54 ILE A HG13 5  
ATOM   5891  H  HG21 . ILE A 1 54 ? 10.495  7.050   3.844   1.00 0.00 ? 54 ILE A HG21 5  
ATOM   5892  H  HG22 . ILE A 1 54 ? 11.786  6.390   4.848   1.00 0.00 ? 54 ILE A HG22 5  
ATOM   5893  H  HG23 . ILE A 1 54 ? 11.182  8.019   5.149   1.00 0.00 ? 54 ILE A HG23 5  
ATOM   5894  H  HD11 . ILE A 1 54 ? 12.218  6.030   6.776   1.00 0.00 ? 54 ILE A HD11 5  
ATOM   5895  H  HD12 . ILE A 1 54 ? 11.452  5.206   8.134   1.00 0.00 ? 54 ILE A HD12 5  
ATOM   5896  H  HD13 . ILE A 1 54 ? 12.104  6.831   8.344   1.00 0.00 ? 54 ILE A HD13 5  
ATOM   5897  N  N    . ILE A 1 55 ? 6.854   5.215   5.670   1.00 0.00 ? 55 ILE A N    5  
ATOM   5898  C  CA   . ILE A 1 55 ? 5.849   4.374   6.321   1.00 0.00 ? 55 ILE A CA   5  
ATOM   5899  C  C    . ILE A 1 55 ? 6.016   2.909   5.920   1.00 0.00 ? 55 ILE A C    5  
ATOM   5900  O  O    . ILE A 1 55 ? 6.380   2.608   4.781   1.00 0.00 ? 55 ILE A O    5  
ATOM   5901  C  CB   . ILE A 1 55 ? 4.407   4.826   5.993   1.00 0.00 ? 55 ILE A CB   5  
ATOM   5902  C  CG1  . ILE A 1 55 ? 4.193   4.930   4.480   1.00 0.00 ? 55 ILE A CG1  5  
ATOM   5903  C  CG2  . ILE A 1 55 ? 4.099   6.156   6.666   1.00 0.00 ? 55 ILE A CG2  5  
ATOM   5904  C  CD1  . ILE A 1 55 ? 2.797   4.538   4.041   1.00 0.00 ? 55 ILE A CD1  5  
ATOM   5905  H  H    . ILE A 1 55 ? 7.122   5.007   4.749   1.00 0.00 ? 55 ILE A H    5  
ATOM   5906  H  HA   . ILE A 1 55 ? 5.994   4.458   7.389   1.00 0.00 ? 55 ILE A HA   5  
ATOM   5907  H  HB   . ILE A 1 55 ? 3.727   4.089   6.394   1.00 0.00 ? 55 ILE A HB   5  
ATOM   5908  H  HG12 . ILE A 1 55 ? 4.365   5.948   4.167   1.00 0.00 ? 55 ILE A HG12 5  
ATOM   5909  H  HG13 . ILE A 1 55 ? 4.894   4.280   3.978   1.00 0.00 ? 55 ILE A HG13 5  
ATOM   5910  H  HG21 . ILE A 1 55 ? 3.063   6.410   6.503   1.00 0.00 ? 55 ILE A HG21 5  
ATOM   5911  H  HG22 . ILE A 1 55 ? 4.728   6.926   6.246   1.00 0.00 ? 55 ILE A HG22 5  
ATOM   5912  H  HG23 . ILE A 1 55 ? 4.287   6.076   7.726   1.00 0.00 ? 55 ILE A HG23 5  
ATOM   5913  H  HD11 . ILE A 1 55 ? 2.782   3.490   3.781   1.00 0.00 ? 55 ILE A HD11 5  
ATOM   5914  H  HD12 . ILE A 1 55 ? 2.514   5.125   3.180   1.00 0.00 ? 55 ILE A HD12 5  
ATOM   5915  H  HD13 . ILE A 1 55 ? 2.101   4.721   4.846   1.00 0.00 ? 55 ILE A HD13 5  
ATOM   5916  N  N    . LYS A 1 56 ? 5.755   2.002   6.862   1.00 0.00 ? 56 LYS A N    5  
ATOM   5917  C  CA   . LYS A 1 56 ? 5.886   0.568   6.606   1.00 0.00 ? 56 LYS A CA   5  
ATOM   5918  C  C    . LYS A 1 56 ? 4.581   -0.036  6.118   1.00 0.00 ? 56 LYS A C    5  
ATOM   5919  O  O    . LYS A 1 56 ? 3.507   0.231   6.667   1.00 0.00 ? 56 LYS A O    5  
ATOM   5920  C  CB   . LYS A 1 56 ? 6.368   -0.159  7.864   1.00 0.00 ? 56 LYS A CB   5  
ATOM   5921  C  CG   . LYS A 1 56 ? 6.655   -1.640  7.650   1.00 0.00 ? 56 LYS A CG   5  
ATOM   5922  C  CD   . LYS A 1 56 ? 8.010   -1.861  6.993   1.00 0.00 ? 56 LYS A CD   5  
ATOM   5923  C  CE   . LYS A 1 56 ? 8.700   -3.110  7.527   1.00 0.00 ? 56 LYS A CE   5  
ATOM   5924  N  NZ   . LYS A 1 56 ? 7.793   -4.293  7.536   1.00 0.00 ? 56 LYS A NZ   5  
ATOM   5925  H  H    . LYS A 1 56 ? 5.473   2.304   7.752   1.00 0.00 ? 56 LYS A H    5  
ATOM   5926  H  HA   . LYS A 1 56 ? 6.619   0.440   5.823   1.00 0.00 ? 56 LYS A HA   5  
ATOM   5927  H  HB2  . LYS A 1 56 ? 7.276   0.312   8.214   1.00 0.00 ? 56 LYS A HB2  5  
ATOM   5928  H  HB3  . LYS A 1 56 ? 5.611   -0.070  8.629   1.00 0.00 ? 56 LYS A HB3  5  
ATOM   5929  H  HG2  . LYS A 1 56 ? 6.645   -2.139  8.607   1.00 0.00 ? 56 LYS A HG2  5  
ATOM   5930  H  HG3  . LYS A 1 56 ? 5.886   -2.057  7.018   1.00 0.00 ? 56 LYS A HG3  5  
ATOM   5931  H  HD2  . LYS A 1 56 ? 7.869   -1.971  5.928   1.00 0.00 ? 56 LYS A HD2  5  
ATOM   5932  H  HD3  . LYS A 1 56 ? 8.638   -1.004  7.188   1.00 0.00 ? 56 LYS A HD3  5  
ATOM   5933  H  HE2  . LYS A 1 56 ? 9.553   -3.329  6.902   1.00 0.00 ? 56 LYS A HE2  5  
ATOM   5934  H  HE3  . LYS A 1 56 ? 9.034   -2.916  8.536   1.00 0.00 ? 56 LYS A HE3  5  
ATOM   5935  H  HZ1  . LYS A 1 56 ? 7.158   -4.253  8.360   1.00 0.00 ? 56 LYS A HZ1  5  
ATOM   5936  H  HZ2  . LYS A 1 56 ? 8.350   -5.170  7.583   1.00 0.00 ? 56 LYS A HZ2  5  
ATOM   5937  H  HZ3  . LYS A 1 56 ? 7.217   -4.310  6.669   1.00 0.00 ? 56 LYS A HZ3  5  
ATOM   5938  N  N    . VAL A 1 57 ? 4.693   -0.852  5.076   1.00 0.00 ? 57 VAL A N    5  
ATOM   5939  C  CA   . VAL A 1 57 ? 3.542   -1.507  4.483   1.00 0.00 ? 57 VAL A CA   5  
ATOM   5940  C  C    . VAL A 1 57 ? 3.536   -2.999  4.804   1.00 0.00 ? 57 VAL A C    5  
ATOM   5941  O  O    . VAL A 1 57 ? 4.403   -3.746  4.346   1.00 0.00 ? 57 VAL A O    5  
ATOM   5942  C  CB   . VAL A 1 57 ? 3.508   -1.311  2.950   1.00 0.00 ? 57 VAL A CB   5  
ATOM   5943  C  CG1  . VAL A 1 57 ? 2.075   -1.188  2.480   1.00 0.00 ? 57 VAL A CG1  5  
ATOM   5944  C  CG2  . VAL A 1 57 ? 4.305   -0.082  2.527   1.00 0.00 ? 57 VAL A CG2  5  
ATOM   5945  H  H    . VAL A 1 57 ? 5.581   -1.014  4.692   1.00 0.00 ? 57 VAL A H    5  
ATOM   5946  H  HA   . VAL A 1 57 ? 2.652   -1.057  4.901   1.00 0.00 ? 57 VAL A HA   5  
ATOM   5947  H  HB   . VAL A 1 57 ? 3.951   -2.181  2.480   1.00 0.00 ? 57 VAL A HB   5  
ATOM   5948  H  HG11 . VAL A 1 57 ? 1.592   -0.399  3.035   1.00 0.00 ? 57 VAL A HG11 5  
ATOM   5949  H  HG12 . VAL A 1 57 ? 1.559   -2.119  2.654   1.00 0.00 ? 57 VAL A HG12 5  
ATOM   5950  H  HG13 . VAL A 1 57 ? 2.060   -0.954  1.429   1.00 0.00 ? 57 VAL A HG13 5  
ATOM   5951  H  HG21 . VAL A 1 57 ? 4.325   -0.020  1.450   1.00 0.00 ? 57 VAL A HG21 5  
ATOM   5952  H  HG22 . VAL A 1 57 ? 5.313   -0.159  2.901   1.00 0.00 ? 57 VAL A HG22 5  
ATOM   5953  H  HG23 . VAL A 1 57 ? 3.839   0.806   2.930   1.00 0.00 ? 57 VAL A HG23 5  
ATOM   5954  N  N    . ILE A 1 58 ? 2.552   -3.427  5.594   1.00 0.00 ? 58 ILE A N    5  
ATOM   5955  C  CA   . ILE A 1 58 ? 2.431   -4.832  5.978   1.00 0.00 ? 58 ILE A CA   5  
ATOM   5956  C  C    . ILE A 1 58 ? 1.512   -5.586  5.018   1.00 0.00 ? 58 ILE A C    5  
ATOM   5957  O  O    . ILE A 1 58 ? 0.436   -5.104  4.672   1.00 0.00 ? 58 ILE A O    5  
ATOM   5958  C  CB   . ILE A 1 58 ? 1.893   -4.983  7.417   1.00 0.00 ? 58 ILE A CB   5  
ATOM   5959  C  CG1  . ILE A 1 58 ? 2.677   -4.085  8.383   1.00 0.00 ? 58 ILE A CG1  5  
ATOM   5960  C  CG2  . ILE A 1 58 ? 1.962   -6.439  7.861   1.00 0.00 ? 58 ILE A CG2  5  
ATOM   5961  C  CD1  . ILE A 1 58 ? 4.163   -4.382  8.429   1.00 0.00 ? 58 ILE A CD1  5  
ATOM   5962  H  H    . ILE A 1 58 ? 1.891   -2.783  5.927   1.00 0.00 ? 58 ILE A H    5  
ATOM   5963  H  HA   . ILE A 1 58 ? 3.417   -5.274  5.937   1.00 0.00 ? 58 ILE A HA   5  
ATOM   5964  H  HB   . ILE A 1 58 ? 0.855   -4.682  7.421   1.00 0.00 ? 58 ILE A HB   5  
ATOM   5965  H  HG12 . ILE A 1 58 ? 2.557   -3.055  8.082   1.00 0.00 ? 58 ILE A HG12 5  
ATOM   5966  H  HG13 . ILE A 1 58 ? 2.281   -4.211  9.380   1.00 0.00 ? 58 ILE A HG13 5  
ATOM   5967  H  HG21 . ILE A 1 58 ? 1.024   -6.925  7.643   1.00 0.00 ? 58 ILE A HG21 5  
ATOM   5968  H  HG22 . ILE A 1 58 ? 2.152   -6.483  8.923   1.00 0.00 ? 58 ILE A HG22 5  
ATOM   5969  H  HG23 . ILE A 1 58 ? 2.760   -6.940  7.332   1.00 0.00 ? 58 ILE A HG23 5  
ATOM   5970  H  HD11 . ILE A 1 58 ? 4.561   -4.078  9.386   1.00 0.00 ? 58 ILE A HD11 5  
ATOM   5971  H  HD12 . ILE A 1 58 ? 4.664   -3.838  7.641   1.00 0.00 ? 58 ILE A HD12 5  
ATOM   5972  H  HD13 . ILE A 1 58 ? 4.323   -5.441  8.293   1.00 0.00 ? 58 ILE A HD13 5  
ATOM   5973  N  N    . TYR A 1 59 ? 1.951   -6.767  4.589   1.00 0.00 ? 59 TYR A N    5  
ATOM   5974  C  CA   . TYR A 1 59 ? 1.176   -7.587  3.660   1.00 0.00 ? 59 TYR A CA   5  
ATOM   5975  C  C    . TYR A 1 59 ? 1.571   -9.062  3.776   1.00 0.00 ? 59 TYR A C    5  
ATOM   5976  O  O    . TYR A 1 59 ? 2.481   -9.410  4.532   1.00 0.00 ? 59 TYR A O    5  
ATOM   5977  C  CB   . TYR A 1 59 ? 1.399   -7.099  2.222   1.00 0.00 ? 59 TYR A CB   5  
ATOM   5978  C  CG   . TYR A 1 59 ? 2.860   -6.928  1.872   1.00 0.00 ? 59 TYR A CG   5  
ATOM   5979  C  CD1  . TYR A 1 59 ? 3.511   -5.722  2.098   1.00 0.00 ? 59 TYR A CD1  5  
ATOM   5980  C  CD2  . TYR A 1 59 ? 3.592   -7.977  1.331   1.00 0.00 ? 59 TYR A CD2  5  
ATOM   5981  C  CE1  . TYR A 1 59 ? 4.851   -5.568  1.800   1.00 0.00 ? 59 TYR A CE1  5  
ATOM   5982  C  CE2  . TYR A 1 59 ? 4.930   -7.830  1.027   1.00 0.00 ? 59 TYR A CE2  5  
ATOM   5983  C  CZ   . TYR A 1 59 ? 5.556   -6.622  1.262   1.00 0.00 ? 59 TYR A CZ   5  
ATOM   5984  O  OH   . TYR A 1 59 ? 6.895   -6.472  0.974   1.00 0.00 ? 59 TYR A OH   5  
ATOM   5985  H  H    . TYR A 1 59 ? 2.822   -7.093  4.899   1.00 0.00 ? 59 TYR A H    5  
ATOM   5986  H  HA   . TYR A 1 59 ? 0.131   -7.483  3.910   1.00 0.00 ? 59 TYR A HA   5  
ATOM   5987  H  HB2  . TYR A 1 59 ? 0.972   -7.815  1.535   1.00 0.00 ? 59 TYR A HB2  5  
ATOM   5988  H  HB3  . TYR A 1 59 ? 0.909   -6.146  2.092   1.00 0.00 ? 59 TYR A HB3  5  
ATOM   5989  H  HD1  . TYR A 1 59 ? 2.956   -4.895  2.518   1.00 0.00 ? 59 TYR A HD1  5  
ATOM   5990  H  HD2  . TYR A 1 59 ? 3.099   -8.920  1.146   1.00 0.00 ? 59 TYR A HD2  5  
ATOM   5991  H  HE1  . TYR A 1 59 ? 5.339   -4.623  1.986   1.00 0.00 ? 59 TYR A HE1  5  
ATOM   5992  H  HE2  . TYR A 1 59 ? 5.481   -8.657  0.605   1.00 0.00 ? 59 TYR A HE2  5  
ATOM   5993  H  HH   . TYR A 1 59 ? 7.074   -6.796  0.089   1.00 0.00 ? 59 TYR A HH   5  
ATOM   5994  N  N    . ASP A 1 60 ? 0.890   -9.921  3.019   1.00 0.00 ? 60 ASP A N    5  
ATOM   5995  C  CA   . ASP A 1 60 ? 1.182   -11.351 3.040   1.00 0.00 ? 60 ASP A CA   5  
ATOM   5996  C  C    . ASP A 1 60 ? 2.232   -11.708 1.991   1.00 0.00 ? 60 ASP A C    5  
ATOM   5997  O  O    . ASP A 1 60 ? 1.937   -11.767 0.796   1.00 0.00 ? 60 ASP A O    5  
ATOM   5998  C  CB   . ASP A 1 60 ? -0.093  -12.170 2.805   1.00 0.00 ? 60 ASP A CB   5  
ATOM   5999  C  CG   . ASP A 1 60 ? 0.087   -13.636 3.156   1.00 0.00 ? 60 ASP A CG   5  
ATOM   6000  O  OD1  . ASP A 1 60 ? 0.547   -13.928 4.280   1.00 0.00 ? 60 ASP A OD1  5  
ATOM   6001  O  OD2  . ASP A 1 60 ? -0.228  -14.491 2.303   1.00 0.00 ? 60 ASP A OD2  5  
ATOM   6002  H  H    . ASP A 1 60 ? 0.179   -9.586  2.432   1.00 0.00 ? 60 ASP A H    5  
ATOM   6003  H  HA   . ASP A 1 60 ? 1.576   -11.592 4.016   1.00 0.00 ? 60 ASP A HA   5  
ATOM   6004  H  HB2  . ASP A 1 60 ? -0.887  -11.769 3.414   1.00 0.00 ? 60 ASP A HB2  5  
ATOM   6005  H  HB3  . ASP A 1 60 ? -0.371  -12.100 1.762   1.00 0.00 ? 60 ASP A HB3  5  
ATOM   6006  N  N    . LYS A 1 61 ? 3.458   -11.950 2.450   1.00 0.00 ? 61 LYS A N    5  
ATOM   6007  C  CA   . LYS A 1 61 ? 4.558   -12.310 1.558   1.00 0.00 ? 61 LYS A CA   5  
ATOM   6008  C  C    . LYS A 1 61 ? 4.252   -13.601 0.802   1.00 0.00 ? 61 LYS A C    5  
ATOM   6009  O  O    . LYS A 1 61 ? 4.704   -13.783 -0.328  1.00 0.00 ? 61 LYS A O    5  
ATOM   6010  C  CB   . LYS A 1 61 ? 5.859   -12.466 2.345   1.00 0.00 ? 61 LYS A CB   5  
ATOM   6011  C  CG   . LYS A 1 61 ? 6.647   -11.175 2.476   1.00 0.00 ? 61 LYS A CG   5  
ATOM   6012  C  CD   . LYS A 1 61 ? 7.753   -11.091 1.435   1.00 0.00 ? 61 LYS A CD   5  
ATOM   6013  C  CE   . LYS A 1 61 ? 7.325   -10.266 0.230   1.00 0.00 ? 61 LYS A CE   5  
ATOM   6014  N  NZ   . LYS A 1 61 ? 8.243   -10.450 -0.929  1.00 0.00 ? 61 LYS A NZ   5  
ATOM   6015  H  H    . LYS A 1 61 ? 3.627   -11.890 3.415   1.00 0.00 ? 61 LYS A H    5  
ATOM   6016  H  HA   . LYS A 1 61 ? 4.677   -11.510 0.842   1.00 0.00 ? 61 LYS A HA   5  
ATOM   6017  H  HB2  . LYS A 1 61 ? 5.627   -12.825 3.337   1.00 0.00 ? 61 LYS A HB2  5  
ATOM   6018  H  HB3  . LYS A 1 61 ? 6.483   -13.194 1.845   1.00 0.00 ? 61 LYS A HB3  5  
ATOM   6019  H  HG2  . LYS A 1 61 ? 5.975   -10.339 2.343   1.00 0.00 ? 61 LYS A HG2  5  
ATOM   6020  H  HG3  . LYS A 1 61 ? 7.087   -11.132 3.461   1.00 0.00 ? 61 LYS A HG3  5  
ATOM   6021  H  HD2  . LYS A 1 61 ? 8.620   -10.631 1.885   1.00 0.00 ? 61 LYS A HD2  5  
ATOM   6022  H  HD3  . LYS A 1 61 ? 8.001   -12.091 1.108   1.00 0.00 ? 61 LYS A HD3  5  
ATOM   6023  H  HE2  . LYS A 1 61 ? 6.330   -10.567 -0.061  1.00 0.00 ? 61 LYS A HE2  5  
ATOM   6024  H  HE3  . LYS A 1 61 ? 7.318   -9.224  0.509   1.00 0.00 ? 61 LYS A HE3  5  
ATOM   6025  H  HZ1  . LYS A 1 61 ? 8.740   -11.362 -0.855  1.00 0.00 ? 61 LYS A HZ1  5  
ATOM   6026  H  HZ2  . LYS A 1 61 ? 8.948   -9.685  -0.951  1.00 0.00 ? 61 LYS A HZ2  5  
ATOM   6027  H  HZ3  . LYS A 1 61 ? 7.705   -10.435 -1.819  1.00 0.00 ? 61 LYS A HZ3  5  
ATOM   6028  N  N    . ASP A 1 62 ? 3.481   -14.492 1.428   1.00 0.00 ? 62 ASP A N    5  
ATOM   6029  C  CA   . ASP A 1 62 ? 3.118   -15.758 0.801   1.00 0.00 ? 62 ASP A CA   5  
ATOM   6030  C  C    . ASP A 1 62 ? 2.248   -15.519 -0.432  1.00 0.00 ? 62 ASP A C    5  
ATOM   6031  O  O    . ASP A 1 62 ? 2.398   -16.198 -1.448  1.00 0.00 ? 62 ASP A O    5  
ATOM   6032  C  CB   . ASP A 1 62 ? 2.379   -16.657 1.796   1.00 0.00 ? 62 ASP A CB   5  
ATOM   6033  C  CG   . ASP A 1 62 ? 2.578   -18.128 1.495   1.00 0.00 ? 62 ASP A CG   5  
ATOM   6034  O  OD1  . ASP A 1 62 ? 2.047   -18.602 0.470   1.00 0.00 ? 62 ASP A OD1  5  
ATOM   6035  O  OD2  . ASP A 1 62 ? 3.268   -18.808 2.286   1.00 0.00 ? 62 ASP A OD2  5  
ATOM   6036  H  H    . ASP A 1 62 ? 3.147   -14.290 2.328   1.00 0.00 ? 62 ASP A H    5  
ATOM   6037  H  HA   . ASP A 1 62 ? 4.030   -16.249 0.495   1.00 0.00 ? 62 ASP A HA   5  
ATOM   6038  H  HB2  . ASP A 1 62 ? 2.745   -16.460 2.793   1.00 0.00 ? 62 ASP A HB2  5  
ATOM   6039  H  HB3  . ASP A 1 62 ? 1.322   -16.440 1.755   1.00 0.00 ? 62 ASP A HB3  5  
ATOM   6040  N  N    . GLN A 1 63 ? 1.341   -14.547 -0.332  1.00 0.00 ? 63 GLN A N    5  
ATOM   6041  C  CA   . GLN A 1 63 ? 0.448   -14.213 -1.439  1.00 0.00 ? 63 GLN A CA   5  
ATOM   6042  C  C    . GLN A 1 63 ? 1.175   -13.400 -2.511  1.00 0.00 ? 63 GLN A C    5  
ATOM   6043  O  O    . GLN A 1 63 ? 1.078   -13.706 -3.700  1.00 0.00 ? 63 GLN A O    5  
ATOM   6044  C  CB   . GLN A 1 63 ? -0.765  -13.433 -0.927  1.00 0.00 ? 63 GLN A CB   5  
ATOM   6045  C  CG   . GLN A 1 63 ? -1.901  -14.322 -0.447  1.00 0.00 ? 63 GLN A CG   5  
ATOM   6046  C  CD   . GLN A 1 63 ? -3.011  -14.459 -1.474  1.00 0.00 ? 63 GLN A CD   5  
ATOM   6047  O  OE1  . GLN A 1 63 ? -4.159  -14.100 -1.214  1.00 0.00 ? 63 GLN A OE1  5  
ATOM   6048  N  NE2  . GLN A 1 63 ? -2.674  -14.980 -2.649  1.00 0.00 ? 63 GLN A NE2  5  
ATOM   6049  H  H    . GLN A 1 63 ? 1.273   -14.043 0.506   1.00 0.00 ? 63 GLN A H    5  
ATOM   6050  H  HA   . GLN A 1 63 ? 0.110   -15.140 -1.879  1.00 0.00 ? 63 GLN A HA   5  
ATOM   6051  H  HB2  . GLN A 1 63 ? -0.455  -12.807 -0.105  1.00 0.00 ? 63 GLN A HB2  5  
ATOM   6052  H  HB3  . GLN A 1 63 ? -1.138  -12.809 -1.725  1.00 0.00 ? 63 GLN A HB3  5  
ATOM   6053  H  HG2  . GLN A 1 63 ? -1.508  -15.304 -0.232  1.00 0.00 ? 63 GLN A HG2  5  
ATOM   6054  H  HG3  . GLN A 1 63 ? -2.317  -13.896 0.455   1.00 0.00 ? 63 GLN A HG3  5  
ATOM   6055  H  HE21 . GLN A 1 63 ? -1.740  -15.244 -2.791  1.00 0.00 ? 63 GLN A HE21 5  
ATOM   6056  H  HE22 . GLN A 1 63 ? -3.374  -15.080 -3.328  1.00 0.00 ? 63 GLN A HE22 5  
ATOM   6057  N  N    . PHE A 1 64 ? 1.901   -12.365 -2.082  1.00 0.00 ? 64 PHE A N    5  
ATOM   6058  C  CA   . PHE A 1 64 ? 2.642   -11.509 -3.009  1.00 0.00 ? 64 PHE A CA   5  
ATOM   6059  C  C    . PHE A 1 64 ? 3.674   -12.314 -3.800  1.00 0.00 ? 64 PHE A C    5  
ATOM   6060  O  O    . PHE A 1 64 ? 3.806   -12.140 -5.011  1.00 0.00 ? 64 PHE A O    5  
ATOM   6061  C  CB   . PHE A 1 64 ? 3.329   -10.367 -2.253  1.00 0.00 ? 64 PHE A CB   5  
ATOM   6062  C  CG   . PHE A 1 64 ? 2.446   -9.163  -2.071  1.00 0.00 ? 64 PHE A CG   5  
ATOM   6063  C  CD1  . PHE A 1 64 ? 1.442   -9.161  -1.115  1.00 0.00 ? 64 PHE A CD1  5  
ATOM   6064  C  CD2  . PHE A 1 64 ? 2.617   -8.035  -2.860  1.00 0.00 ? 64 PHE A CD2  5  
ATOM   6065  C  CE1  . PHE A 1 64 ? 0.624   -8.058  -0.951  1.00 0.00 ? 64 PHE A CE1  5  
ATOM   6066  C  CE2  . PHE A 1 64 ? 1.802   -6.931  -2.700  1.00 0.00 ? 64 PHE A CE2  5  
ATOM   6067  C  CZ   . PHE A 1 64 ? 0.806   -6.942  -1.743  1.00 0.00 ? 64 PHE A CZ   5  
ATOM   6068  H  H    . PHE A 1 64 ? 1.937   -12.175 -1.121  1.00 0.00 ? 64 PHE A H    5  
ATOM   6069  H  HA   . PHE A 1 64 ? 1.930   -11.087 -3.703  1.00 0.00 ? 64 PHE A HA   5  
ATOM   6070  H  HB2  . PHE A 1 64 ? 3.625   -10.717 -1.275  1.00 0.00 ? 64 PHE A HB2  5  
ATOM   6071  H  HB3  . PHE A 1 64 ? 4.207   -10.058 -2.802  1.00 0.00 ? 64 PHE A HB3  5  
ATOM   6072  H  HD1  . PHE A 1 64 ? 1.299   -10.032 -0.494  1.00 0.00 ? 64 PHE A HD1  5  
ATOM   6073  H  HD2  . PHE A 1 64 ? 3.395   -8.025  -3.608  1.00 0.00 ? 64 PHE A HD2  5  
ATOM   6074  H  HE1  . PHE A 1 64 ? -0.155  -8.070  -0.204  1.00 0.00 ? 64 PHE A HE1  5  
ATOM   6075  H  HE2  . PHE A 1 64 ? 1.946   -6.059  -3.320  1.00 0.00 ? 64 PHE A HE2  5  
ATOM   6076  H  HZ   . PHE A 1 64 ? 0.168   -6.080  -1.616  1.00 0.00 ? 64 PHE A HZ   5  
ATOM   6077  N  N    . VAL A 1 65 ? 4.395   -13.200 -3.110  1.00 0.00 ? 65 VAL A N    5  
ATOM   6078  C  CA   . VAL A 1 65 ? 5.405   -14.036 -3.758  1.00 0.00 ? 65 VAL A CA   5  
ATOM   6079  C  C    . VAL A 1 65 ? 4.779   -15.333 -4.270  1.00 0.00 ? 65 VAL A C    5  
ATOM   6080  O  O    . VAL A 1 65 ? 4.822   -16.364 -3.595  1.00 0.00 ? 65 VAL A O    5  
ATOM   6081  C  CB   . VAL A 1 65 ? 6.571   -14.376 -2.800  1.00 0.00 ? 65 VAL A CB   5  
ATOM   6082  C  CG1  . VAL A 1 65 ? 7.700   -15.072 -3.549  1.00 0.00 ? 65 VAL A CG1  5  
ATOM   6083  C  CG2  . VAL A 1 65 ? 7.081   -13.122 -2.103  1.00 0.00 ? 65 VAL A CG2  5  
ATOM   6084  H  H    . VAL A 1 65 ? 4.240   -13.299 -2.146  1.00 0.00 ? 65 VAL A H    5  
ATOM   6085  H  HA   . VAL A 1 65 ? 5.804   -13.485 -4.597  1.00 0.00 ? 65 VAL A HA   5  
ATOM   6086  H  HB   . VAL A 1 65 ? 6.200   -15.056 -2.045  1.00 0.00 ? 65 VAL A HB   5  
ATOM   6087  H  HG11 . VAL A 1 65 ? 8.146   -15.820 -2.910  1.00 0.00 ? 65 VAL A HG11 5  
ATOM   6088  H  HG12 . VAL A 1 65 ? 8.448   -14.346 -3.829  1.00 0.00 ? 65 VAL A HG12 5  
ATOM   6089  H  HG13 . VAL A 1 65 ? 7.308   -15.544 -4.437  1.00 0.00 ? 65 VAL A HG13 5  
ATOM   6090  H  HG21 . VAL A 1 65 ? 7.633   -12.519 -2.807  1.00 0.00 ? 65 VAL A HG21 5  
ATOM   6091  H  HG22 . VAL A 1 65 ? 7.726   -13.404 -1.285  1.00 0.00 ? 65 VAL A HG22 5  
ATOM   6092  H  HG23 . VAL A 1 65 ? 6.243   -12.556 -1.722  1.00 0.00 ? 65 VAL A HG23 5  
ATOM   6093  N  N    . SER A 1 66 ? 4.190   -15.272 -5.464  1.00 0.00 ? 66 SER A N    5  
ATOM   6094  C  CA   . SER A 1 66 ? 3.548   -16.437 -6.063  1.00 0.00 ? 66 SER A CA   5  
ATOM   6095  C  C    . SER A 1 66 ? 4.025   -16.652 -7.499  1.00 0.00 ? 66 SER A C    5  
ATOM   6096  O  O    . SER A 1 66 ? 3.426   -16.138 -8.446  1.00 0.00 ? 66 SER A O    5  
ATOM   6097  C  CB   . SER A 1 66 ? 2.027   -16.268 -6.037  1.00 0.00 ? 66 SER A CB   5  
ATOM   6098  O  OG   . SER A 1 66 ? 1.459   -16.899 -4.903  1.00 0.00 ? 66 SER A OG   5  
ATOM   6099  H  H    . SER A 1 66 ? 4.184   -14.421 -5.951  1.00 0.00 ? 66 SER A H    5  
ATOM   6100  H  HA   . SER A 1 66 ? 3.814   -17.304 -5.474  1.00 0.00 ? 66 SER A HA   5  
ATOM   6101  H  HB2  . SER A 1 66 ? 1.786   -15.216 -6.004  1.00 0.00 ? 66 SER A HB2  5  
ATOM   6102  H  HB3  . SER A 1 66 ? 1.602   -16.706 -6.927  1.00 0.00 ? 66 SER A HB3  5  
ATOM   6103  H  HG   . SER A 1 66 ? 0.734   -16.366 -4.567  1.00 0.00 ? 66 SER A HG   5  
ATOM   6104  N  N    . GLY A 1 67 ? 5.104   -17.421 -7.656  1.00 0.00 ? 67 GLY A N    5  
ATOM   6105  C  CA   . GLY A 1 67 ? 5.641   -17.698 -8.981  1.00 0.00 ? 67 GLY A CA   5  
ATOM   6106  C  C    . GLY A 1 67 ? 5.020   -18.931 -9.617  1.00 0.00 ? 67 GLY A C    5  
ATOM   6107  O  O    . GLY A 1 67 ? 4.775   -18.956 -10.823 1.00 0.00 ? 67 GLY A O    5  
ATOM   6108  H  H    . GLY A 1 67 ? 5.537   -17.807 -6.867  1.00 0.00 ? 67 GLY A H    5  
ATOM   6109  H  HA2  . GLY A 1 67 ? 5.452   -16.845 -9.618  1.00 0.00 ? 67 GLY A HA2  5  
ATOM   6110  H  HA3  . GLY A 1 67 ? 6.707   -17.847 -8.903  1.00 0.00 ? 67 GLY A HA3  5  
ATOM   6111  N  N    . GLU A 1 68 ? 4.765   -19.956 -8.801  1.00 0.00 ? 68 GLU A N    5  
ATOM   6112  C  CA   . GLU A 1 68 ? 4.169   -21.200 -9.288  1.00 0.00 ? 68 GLU A CA   5  
ATOM   6113  C  C    . GLU A 1 68 ? 2.673   -21.270 -8.951  1.00 0.00 ? 68 GLU A C    5  
ATOM   6114  O  O    . GLU A 1 68 ? 2.149   -22.339 -8.625  1.00 0.00 ? 68 GLU A O    5  
ATOM   6115  C  CB   . GLU A 1 68 ? 4.906   -22.399 -8.681  1.00 0.00 ? 68 GLU A CB   5  
ATOM   6116  C  CG   . GLU A 1 68 ? 4.931   -23.627 -9.579  1.00 0.00 ? 68 GLU A CG   5  
ATOM   6117  C  CD   . GLU A 1 68 ? 5.991   -24.630 -9.163  1.00 0.00 ? 68 GLU A CD   5  
ATOM   6118  O  OE1  . GLU A 1 68 ? 5.901   -25.156 -8.033  1.00 0.00 ? 68 GLU A OE1  5  
ATOM   6119  O  OE2  . GLU A 1 68 ? 6.911   -24.888 -9.967  1.00 0.00 ? 68 GLU A OE2  5  
ATOM   6120  H  H    . GLU A 1 68 ? 4.982   -19.874 -7.850  1.00 0.00 ? 68 GLU A H    5  
ATOM   6121  H  HA   . GLU A 1 68 ? 4.284   -21.224 -10.361 1.00 0.00 ? 68 GLU A HA   5  
ATOM   6122  H  HB2  . GLU A 1 68 ? 5.927   -22.111 -8.476  1.00 0.00 ? 68 GLU A HB2  5  
ATOM   6123  H  HB3  . GLU A 1 68 ? 4.426   -22.670 -7.752  1.00 0.00 ? 68 GLU A HB3  5  
ATOM   6124  H  HG2  . GLU A 1 68 ? 3.965   -24.108 -9.536  1.00 0.00 ? 68 GLU A HG2  5  
ATOM   6125  H  HG3  . GLU A 1 68 ? 5.131   -23.313 -10.593 1.00 0.00 ? 68 GLU A HG3  5  
ATOM   6126  N  N    . THR A 1 69 ? 1.991   -20.128 -9.038  1.00 0.00 ? 69 THR A N    5  
ATOM   6127  C  CA   . THR A 1 69 ? 0.559   -20.059 -8.748  1.00 0.00 ? 69 THR A CA   5  
ATOM   6128  C  C    . THR A 1 69 ? -0.270  -20.285 -10.014 1.00 0.00 ? 69 THR A C    5  
ATOM   6129  O  O    . THR A 1 69 ? 0.271   -20.335 -11.120 1.00 0.00 ? 69 THR A O    5  
ATOM   6130  C  CB   . THR A 1 69 ? 0.212   -18.707 -8.115  1.00 0.00 ? 69 THR A CB   5  
ATOM   6131  O  OG1  . THR A 1 69 ? -1.148  -18.670 -7.718  1.00 0.00 ? 69 THR A OG1  5  
ATOM   6132  C  CG2  . THR A 1 69 ? 0.457   -17.526 -9.035  1.00 0.00 ? 69 THR A CG2  5  
ATOM   6133  H  H    . THR A 1 69 ? 2.460   -19.311 -9.307  1.00 0.00 ? 69 THR A H    5  
ATOM   6134  H  HA   . THR A 1 69 ? 0.330   -20.845 -8.042  1.00 0.00 ? 69 THR A HA   5  
ATOM   6135  H  HB   . THR A 1 69 ? 0.824   -18.570 -7.235  1.00 0.00 ? 69 THR A HB   5  
ATOM   6136  H  HG1  . THR A 1 69 ? -1.270  -17.994 -7.047  1.00 0.00 ? 69 THR A HG1  5  
ATOM   6137  H  HG21 . THR A 1 69 ? 1.517   -17.406 -9.193  1.00 0.00 ? 69 THR A HG21 5  
ATOM   6138  H  HG22 . THR A 1 69 ? 0.056   -16.629 -8.585  1.00 0.00 ? 69 THR A HG22 5  
ATOM   6139  H  HG23 . THR A 1 69 ? -0.031  -17.700 -9.984  1.00 0.00 ? 69 THR A HG23 5  
ATOM   6140  N  N    . VAL A 1 70 ? -1.586  -20.423 -9.841  1.00 0.00 ? 70 VAL A N    5  
ATOM   6141  C  CA   . VAL A 1 70 ? -2.492  -20.647 -10.963 1.00 0.00 ? 70 VAL A CA   5  
ATOM   6142  C  C    . VAL A 1 70 ? -3.694  -19.697 -10.912 1.00 0.00 ? 70 VAL A C    5  
ATOM   6143  O  O    . VAL A 1 70 ? -4.288  -19.492 -9.852  1.00 0.00 ? 70 VAL A O    5  
ATOM   6144  C  CB   . VAL A 1 70 ? -2.990  -22.109 -10.995 1.00 0.00 ? 70 VAL A CB   5  
ATOM   6145  C  CG1  . VAL A 1 70 ? -3.754  -22.456 -9.723  1.00 0.00 ? 70 VAL A CG1  5  
ATOM   6146  C  CG2  . VAL A 1 70 ? -3.850  -22.362 -12.225 1.00 0.00 ? 70 VAL A CG2  5  
ATOM   6147  H  H    . VAL A 1 70 ? -1.954  -20.376 -8.933  1.00 0.00 ? 70 VAL A H    5  
ATOM   6148  H  HA   . VAL A 1 70 ? -1.940  -20.460 -11.873 1.00 0.00 ? 70 VAL A HA   5  
ATOM   6149  H  HB   . VAL A 1 70 ? -2.126  -22.755 -11.051 1.00 0.00 ? 70 VAL A HB   5  
ATOM   6150  H  HG11 . VAL A 1 70 ? -3.136  -22.242 -8.863  1.00 0.00 ? 70 VAL A HG11 5  
ATOM   6151  H  HG12 . VAL A 1 70 ? -4.007  -23.506 -9.731  1.00 0.00 ? 70 VAL A HG12 5  
ATOM   6152  H  HG13 . VAL A 1 70 ? -4.658  -21.869 -9.674  1.00 0.00 ? 70 VAL A HG13 5  
ATOM   6153  H  HG21 . VAL A 1 70 ? -4.271  -23.354 -12.173 1.00 0.00 ? 70 VAL A HG21 5  
ATOM   6154  H  HG22 . VAL A 1 70 ? -3.240  -22.276 -13.113 1.00 0.00 ? 70 VAL A HG22 5  
ATOM   6155  H  HG23 . VAL A 1 70 ? -4.646  -21.634 -12.266 1.00 0.00 ? 70 VAL A HG23 5  
ATOM   6156  N  N    . PRO A 1 71 ? -4.068  -19.106 -12.066 1.00 0.00 ? 71 PRO A N    5  
ATOM   6157  C  CA   . PRO A 1 71 ? -5.204  -18.179 -12.153 1.00 0.00 ? 71 PRO A CA   5  
ATOM   6158  C  C    . PRO A 1 71 ? -6.553  -18.902 -12.117 1.00 0.00 ? 71 PRO A C    5  
ATOM   6159  O  O    . PRO A 1 71 ? -6.611  -20.120 -11.934 1.00 0.00 ? 71 PRO A O    5  
ATOM   6160  C  CB   . PRO A 1 71 ? -4.993  -17.499 -13.507 1.00 0.00 ? 71 PRO A CB   5  
ATOM   6161  C  CG   . PRO A 1 71 ? -4.279  -18.516 -14.330 1.00 0.00 ? 71 PRO A CG   5  
ATOM   6162  C  CD   . PRO A 1 71 ? -3.412  -19.295 -13.377 1.00 0.00 ? 71 PRO A CD   5  
ATOM   6163  H  HA   . PRO A 1 71 ? -5.173  -17.440 -11.365 1.00 0.00 ? 71 PRO A HA   5  
ATOM   6164  H  HB2  . PRO A 1 71 ? -5.950  -17.242 -13.938 1.00 0.00 ? 71 PRO A HB2  5  
ATOM   6165  H  HB3  . PRO A 1 71 ? -4.397  -16.608 -13.377 1.00 0.00 ? 71 PRO A HB3  5  
ATOM   6166  H  HG2  . PRO A 1 71 ? -4.995  -19.172 -14.804 1.00 0.00 ? 71 PRO A HG2  5  
ATOM   6167  H  HG3  . PRO A 1 71 ? -3.670  -18.024 -15.074 1.00 0.00 ? 71 PRO A HG3  5  
ATOM   6168  H  HD2  . PRO A 1 71 ? -3.397  -20.339 -13.653 1.00 0.00 ? 71 PRO A HD2  5  
ATOM   6169  H  HD3  . PRO A 1 71 ? -2.409  -18.894 -13.366 1.00 0.00 ? 71 PRO A HD3  5  
ATOM   6170  N  N    . ALA A 1 72 ? -7.638  -18.143 -12.291 1.00 0.00 ? 72 ALA A N    5  
ATOM   6171  C  CA   . ALA A 1 72 ? -8.985  -18.711 -12.274 1.00 0.00 ? 72 ALA A CA   5  
ATOM   6172  C  C    . ALA A 1 72 ? -9.899  -18.027 -13.293 1.00 0.00 ? 72 ALA A C    5  
ATOM   6173  O  O    . ALA A 1 72 ? -9.701  -16.857 -13.627 1.00 0.00 ? 72 ALA A O    5  
ATOM   6174  C  CB   . ALA A 1 72 ? -9.576  -18.601 -10.877 1.00 0.00 ? 72 ALA A CB   5  
ATOM   6175  H  H    . ALA A 1 72 ? -7.531  -17.179 -12.430 1.00 0.00 ? 72 ALA A H    5  
ATOM   6176  H  HA   . ALA A 1 72 ? -8.906  -19.759 -12.522 1.00 0.00 ? 72 ALA A HA   5  
ATOM   6177  H  HB1  . ALA A 1 72 ? -9.562  -17.568 -10.560 1.00 0.00 ? 72 ALA A HB1  5  
ATOM   6178  H  HB2  . ALA A 1 72 ? -8.991  -19.196 -10.192 1.00 0.00 ? 72 ALA A HB2  5  
ATOM   6179  H  HB3  . ALA A 1 72 ? -10.594 -18.961 -10.886 1.00 0.00 ? 72 ALA A HB3  5  
ATOM   6180  N  N    . PRO A 1 73 ? -10.916 -18.758 -13.800 1.00 0.00 ? 73 PRO A N    5  
ATOM   6181  C  CA   . PRO A 1 73 ? -11.870 -18.232 -14.789 1.00 0.00 ? 73 PRO A CA   5  
ATOM   6182  C  C    . PRO A 1 73 ? -12.531 -16.930 -14.337 1.00 0.00 ? 73 PRO A C    5  
ATOM   6183  O  O    . PRO A 1 73 ? -12.843 -16.758 -13.156 1.00 0.00 ? 73 PRO A O    5  
ATOM   6184  C  CB   . PRO A 1 73 ? -12.916 -19.345 -14.908 1.00 0.00 ? 73 PRO A CB   5  
ATOM   6185  C  CG   . PRO A 1 73 ? -12.203 -20.585 -14.493 1.00 0.00 ? 73 PRO A CG   5  
ATOM   6186  C  CD   . PRO A 1 73 ? -11.209 -20.162 -13.449 1.00 0.00 ? 73 PRO A CD   5  
ATOM   6187  H  HA   . PRO A 1 73 ? -11.397 -18.076 -15.748 1.00 0.00 ? 73 PRO A HA   5  
ATOM   6188  H  HB2  . PRO A 1 73 ? -13.749 -19.132 -14.254 1.00 0.00 ? 73 PRO A HB2  5  
ATOM   6189  H  HB3  . PRO A 1 73 ? -13.261 -19.412 -15.928 1.00 0.00 ? 73 PRO A HB3  5  
ATOM   6190  H  HG2  . PRO A 1 73 ? -12.907 -21.291 -14.077 1.00 0.00 ? 73 PRO A HG2  5  
ATOM   6191  H  HG3  . PRO A 1 73 ? -11.694 -21.017 -15.342 1.00 0.00 ? 73 PRO A HG3  5  
ATOM   6192  H  HD2  . PRO A 1 73 ? -11.645 -20.232 -12.463 1.00 0.00 ? 73 PRO A HD2  5  
ATOM   6193  H  HD3  . PRO A 1 73 ? -10.317 -20.769 -13.512 1.00 0.00 ? 73 PRO A HD3  5  
ATOM   6194  N  N    . SER A 1 74 ? -12.742 -16.017 -15.287 1.00 0.00 ? 74 SER A N    5  
ATOM   6195  C  CA   . SER A 1 74 ? -13.365 -14.728 -14.996 1.00 0.00 ? 74 SER A CA   5  
ATOM   6196  C  C    . SER A 1 74 ? -13.934 -14.095 -16.266 1.00 0.00 ? 74 SER A C    5  
ATOM   6197  O  O    . SER A 1 74 ? -13.281 -14.084 -17.311 1.00 0.00 ? 74 SER A O    5  
ATOM   6198  C  CB   . SER A 1 74 ? -12.349 -13.782 -14.347 1.00 0.00 ? 74 SER A CB   5  
ATOM   6199  O  OG   . SER A 1 74 ? -12.965 -12.972 -13.359 1.00 0.00 ? 74 SER A OG   5  
ATOM   6200  H  H    . SER A 1 74 ? -12.471 -16.217 -16.207 1.00 0.00 ? 74 SER A H    5  
ATOM   6201  H  HA   . SER A 1 74 ? -14.173 -14.902 -14.303 1.00 0.00 ? 74 SER A HA   5  
ATOM   6202  H  HB2  . SER A 1 74 ? -11.566 -14.363 -13.880 1.00 0.00 ? 74 SER A HB2  5  
ATOM   6203  H  HB3  . SER A 1 74 ? -11.919 -13.143 -15.104 1.00 0.00 ? 74 SER A HB3  5  
ATOM   6204  H  HG   . SER A 1 74 ? -13.174 -13.507 -12.589 1.00 0.00 ? 74 SER A HG   5  
ATOM   6205  N  N    . ALA A 1 75 ? -15.156 -13.570 -16.164 1.00 0.00 ? 75 ALA A N    5  
ATOM   6206  C  CA   . ALA A 1 75 ? -15.823 -12.932 -17.297 1.00 0.00 ? 75 ALA A CA   5  
ATOM   6207  C  C    . ALA A 1 75 ? -15.847 -11.415 -17.133 1.00 0.00 ? 75 ALA A C    5  
ATOM   6208  O  O    . ALA A 1 75 ? -16.502 -10.892 -16.231 1.00 0.00 ? 75 ALA A O    5  
ATOM   6209  C  CB   . ALA A 1 75 ? -17.241 -13.469 -17.441 1.00 0.00 ? 75 ALA A CB   5  
ATOM   6210  H  H    . ALA A 1 75 ? -15.620 -13.612 -15.301 1.00 0.00 ? 75 ALA A H    5  
ATOM   6211  H  HA   . ALA A 1 75 ? -15.275 -13.182 -18.194 1.00 0.00 ? 75 ALA A HA   5  
ATOM   6212  H  HB1  . ALA A 1 75 ? -17.613 -13.766 -16.472 1.00 0.00 ? 75 ALA A HB1  5  
ATOM   6213  H  HB2  . ALA A 1 75 ? -17.237 -14.322 -18.103 1.00 0.00 ? 75 ALA A HB2  5  
ATOM   6214  H  HB3  . ALA A 1 75 ? -17.877 -12.698 -17.851 1.00 0.00 ? 75 ALA A HB3  5  
ATOM   6215  N  N    . ASN A 1 76 ? -15.132 -10.712 -18.013 1.00 0.00 ? 76 ASN A N    5  
ATOM   6216  C  CA   . ASN A 1 76 ? -15.080 -9.251  -17.958 1.00 0.00 ? 76 ASN A CA   5  
ATOM   6217  C  C    . ASN A 1 76 ? -16.287 -8.637  -18.668 1.00 0.00 ? 76 ASN A C    5  
ATOM   6218  O  O    . ASN A 1 76 ? -16.361 -8.629  -19.897 1.00 0.00 ? 76 ASN A O    5  
ATOM   6219  C  CB   . ASN A 1 76 ? -13.773 -8.721  -18.568 1.00 0.00 ? 76 ASN A CB   5  
ATOM   6220  C  CG   . ASN A 1 76 ? -13.490 -9.281  -19.951 1.00 0.00 ? 76 ASN A CG   5  
ATOM   6221  O  OD1  . ASN A 1 76 ? -13.033 -10.415 -20.089 1.00 0.00 ? 76 ASN A OD1  5  
ATOM   6222  N  ND2  . ASN A 1 76 ? -13.760 -8.489  -20.984 1.00 0.00 ? 76 ASN A ND2  5  
ATOM   6223  H  H    . ASN A 1 76 ? -14.633 -11.185 -18.712 1.00 0.00 ? 76 ASN A H    5  
ATOM   6224  H  HA   . ASN A 1 76 ? -15.115 -8.966  -16.916 1.00 0.00 ? 76 ASN A HA   5  
ATOM   6225  H  HB2  . ASN A 1 76 ? -13.830 -7.645  -18.644 1.00 0.00 ? 76 ASN A HB2  5  
ATOM   6226  H  HB3  . ASN A 1 76 ? -12.950 -8.984  -17.920 1.00 0.00 ? 76 ASN A HB3  5  
ATOM   6227  H  HD21 . ASN A 1 76 ? -14.125 -7.598  -20.803 1.00 0.00 ? 76 ASN A HD21 5  
ATOM   6228  H  HD22 . ASN A 1 76 ? -13.581 -8.830  -21.886 1.00 0.00 ? 76 ASN A HD22 5  
ATOM   6229  N  N    . LYS A 1 77 ? -17.234 -8.129  -17.880 1.00 0.00 ? 77 LYS A N    5  
ATOM   6230  C  CA   . LYS A 1 77 ? -18.444 -7.517  -18.427 1.00 0.00 ? 77 LYS A CA   5  
ATOM   6231  C  C    . LYS A 1 77 ? -18.119 -6.230  -19.184 1.00 0.00 ? 77 LYS A C    5  
ATOM   6232  O  O    . LYS A 1 77 ? -17.256 -5.455  -18.767 1.00 0.00 ? 77 LYS A O    5  
ATOM   6233  C  CB   . LYS A 1 77 ? -19.450 -7.225  -17.309 1.00 0.00 ? 77 LYS A CB   5  
ATOM   6234  C  CG   . LYS A 1 77 ? -18.952 -6.226  -16.272 1.00 0.00 ? 77 LYS A CG   5  
ATOM   6235  C  CD   . LYS A 1 77 ? -20.103 -5.457  -15.642 1.00 0.00 ? 77 LYS A CD   5  
ATOM   6236  C  CE   . LYS A 1 77 ? -19.745 -3.996  -15.401 1.00 0.00 ? 77 LYS A CE   5  
ATOM   6237  N  NZ   . LYS A 1 77 ? -20.157 -3.121  -16.536 1.00 0.00 ? 77 LYS A NZ   5  
ATOM   6238  H  H    . LYS A 1 77 ? -17.120 -8.171  -16.907 1.00 0.00 ? 77 LYS A H    5  
ATOM   6239  H  HA   . LYS A 1 77 ? -18.885 -8.222  -19.117 1.00 0.00 ? 77 LYS A HA   5  
ATOM   6240  H  HB2  . LYS A 1 77 ? -20.353 -6.831  -17.750 1.00 0.00 ? 77 LYS A HB2  5  
ATOM   6241  H  HB3  . LYS A 1 77 ? -19.683 -8.150  -16.802 1.00 0.00 ? 77 LYS A HB3  5  
ATOM   6242  H  HG2  . LYS A 1 77 ? -18.423 -6.760  -15.497 1.00 0.00 ? 77 LYS A HG2  5  
ATOM   6243  H  HG3  . LYS A 1 77 ? -18.281 -5.527  -16.749 1.00 0.00 ? 77 LYS A HG3  5  
ATOM   6244  H  HD2  . LYS A 1 77 ? -20.957 -5.503  -16.302 1.00 0.00 ? 77 LYS A HD2  5  
ATOM   6245  H  HD3  . LYS A 1 77 ? -20.355 -5.917  -14.698 1.00 0.00 ? 77 LYS A HD3  5  
ATOM   6246  H  HE2  . LYS A 1 77 ? -20.242 -3.662  -14.503 1.00 0.00 ? 77 LYS A HE2  5  
ATOM   6247  H  HE3  . LYS A 1 77 ? -18.675 -3.919  -15.269 1.00 0.00 ? 77 LYS A HE3  5  
ATOM   6248  H  HZ1  . LYS A 1 77 ? -19.434 -3.139  -17.284 1.00 0.00 ? 77 LYS A HZ1  5  
ATOM   6249  H  HZ2  . LYS A 1 77 ? -20.277 -2.142  -16.207 1.00 0.00 ? 77 LYS A HZ2  5  
ATOM   6250  H  HZ3  . LYS A 1 77 ? -21.059 -3.452  -16.936 1.00 0.00 ? 77 LYS A HZ3  5  
ATOM   6251  N  N    . GLU A 1 78 ? -18.818 -6.008  -20.296 1.00 0.00 ? 78 GLU A N    5  
ATOM   6252  C  CA   . GLU A 1 78 ? -18.601 -4.813  -21.105 1.00 0.00 ? 78 GLU A CA   5  
ATOM   6253  C  C    . GLU A 1 78 ? -19.839 -4.471  -21.932 1.00 0.00 ? 78 GLU A C    5  
ATOM   6254  O  O    . GLU A 1 78 ? -20.101 -5.091  -22.966 1.00 0.00 ? 78 GLU A O    5  
ATOM   6255  C  CB   . GLU A 1 78 ? -17.392 -5.006  -22.023 1.00 0.00 ? 78 GLU A CB   5  
ATOM   6256  C  CG   . GLU A 1 78 ? -16.577 -3.739  -22.218 1.00 0.00 ? 78 GLU A CG   5  
ATOM   6257  C  CD   . GLU A 1 78 ? -15.722 -3.783  -23.468 1.00 0.00 ? 78 GLU A CD   5  
ATOM   6258  O  OE1  . GLU A 1 78 ? -16.262 -3.524  -24.565 1.00 0.00 ? 78 GLU A OE1  5  
ATOM   6259  O  OE2  . GLU A 1 78 ? -14.515 -4.078  -23.351 1.00 0.00 ? 78 GLU A OE2  5  
ATOM   6260  H  H    . GLU A 1 78 ? -19.493 -6.661  -20.577 1.00 0.00 ? 78 GLU A H    5  
ATOM   6261  H  HA   . GLU A 1 78 ? -18.401 -3.994  -20.432 1.00 0.00 ? 78 GLU A HA   5  
ATOM   6262  H  HB2  . GLU A 1 78 ? -16.747 -5.761  -21.597 1.00 0.00 ? 78 GLU A HB2  5  
ATOM   6263  H  HB3  . GLU A 1 78 ? -17.736 -5.340  -22.991 1.00 0.00 ? 78 GLU A HB3  5  
ATOM   6264  H  HG2  . GLU A 1 78 ? -17.251 -2.899  -22.291 1.00 0.00 ? 78 GLU A HG2  5  
ATOM   6265  H  HG3  . GLU A 1 78 ? -15.931 -3.607  -21.362 1.00 0.00 ? 78 GLU A HG3  5  
ATOM   6266  N  N    . LEU A 1 79 ? -20.597 -3.477  -21.469 1.00 0.00 ? 79 LEU A N    5  
ATOM   6267  C  CA   . LEU A 1 79 ? -21.810 -3.041  -22.161 1.00 0.00 ? 79 LEU A CA   5  
ATOM   6268  C  C    . LEU A 1 79 ? -22.254 -1.659  -21.672 1.00 0.00 ? 79 LEU A C    5  
ATOM   6269  O  O    . LEU A 1 79 ? -23.447 -1.406  -21.490 1.00 0.00 ? 79 LEU A O    5  
ATOM   6270  C  CB   . LEU A 1 79 ? -22.940 -4.062  -21.966 1.00 0.00 ? 79 LEU A CB   5  
ATOM   6271  C  CG   . LEU A 1 79 ? -23.182 -4.509  -20.521 1.00 0.00 ? 79 LEU A CG   5  
ATOM   6272  C  CD1  . LEU A 1 79 ? -24.633 -4.926  -20.330 1.00 0.00 ? 79 LEU A CD1  5  
ATOM   6273  C  CD2  . LEU A 1 79 ? -22.246 -5.648  -20.147 1.00 0.00 ? 79 LEU A CD2  5  
ATOM   6274  H  H    . LEU A 1 79 ? -20.333 -3.025  -20.641 1.00 0.00 ? 79 LEU A H    5  
ATOM   6275  H  HA   . LEU A 1 79 ? -21.579 -2.974  -23.214 1.00 0.00 ? 79 LEU A HA   5  
ATOM   6276  H  HB2  . LEU A 1 79 ? -23.854 -3.625  -22.342 1.00 0.00 ? 79 LEU A HB2  5  
ATOM   6277  H  HB3  . LEU A 1 79 ? -22.710 -4.937  -22.557 1.00 0.00 ? 79 LEU A HB3  5  
ATOM   6278  H  HG   . LEU A 1 79 ? -22.984 -3.680  -19.856 1.00 0.00 ? 79 LEU A HG   5  
ATOM   6279  H  HD11 . LEU A 1 79 ? -24.717 -5.551  -19.453 1.00 0.00 ? 79 LEU A HD11 5  
ATOM   6280  H  HD12 . LEU A 1 79 ? -24.967 -5.477  -21.197 1.00 0.00 ? 79 LEU A HD12 5  
ATOM   6281  H  HD13 . LEU A 1 79 ? -25.247 -4.046  -20.204 1.00 0.00 ? 79 LEU A HD13 5  
ATOM   6282  H  HD21 . LEU A 1 79 ? -22.003 -6.220  -21.030 1.00 0.00 ? 79 LEU A HD21 5  
ATOM   6283  H  HD22 . LEU A 1 79 ? -22.730 -6.291  -19.425 1.00 0.00 ? 79 LEU A HD22 5  
ATOM   6284  H  HD23 . LEU A 1 79 ? -21.341 -5.245  -19.720 1.00 0.00 ? 79 LEU A HD23 5  
ATOM   6285  N  N    . VAL A 1 80 ? -21.286 -0.765  -21.463 1.00 0.00 ? 80 VAL A N    5  
ATOM   6286  C  CA   . VAL A 1 80 ? -21.579 0.589   -20.996 1.00 0.00 ? 80 VAL A CA   5  
ATOM   6287  C  C    . VAL A 1 80 ? -22.110 1.462   -22.134 1.00 0.00 ? 80 VAL A C    5  
ATOM   6288  O  O    . VAL A 1 80 ? -21.410 1.705   -23.119 1.00 0.00 ? 80 VAL A O    5  
ATOM   6289  C  CB   . VAL A 1 80 ? -20.333 1.265   -20.380 1.00 0.00 ? 80 VAL A CB   5  
ATOM   6290  C  CG1  . VAL A 1 80 ? -20.709 2.591   -19.736 1.00 0.00 ? 80 VAL A CG1  5  
ATOM   6291  C  CG2  . VAL A 1 80 ? -19.662 0.343   -19.368 1.00 0.00 ? 80 VAL A CG2  5  
ATOM   6292  H  H    . VAL A 1 80 ? -20.353 -1.021  -21.627 1.00 0.00 ? 80 VAL A H    5  
ATOM   6293  H  HA   . VAL A 1 80 ? -22.338 0.516   -20.230 1.00 0.00 ? 80 VAL A HA   5  
ATOM   6294  H  HB   . VAL A 1 80 ? -19.628 1.464   -21.174 1.00 0.00 ? 80 VAL A HB   5  
ATOM   6295  H  HG11 . VAL A 1 80 ? -21.717 2.533   -19.351 1.00 0.00 ? 80 VAL A HG11 5  
ATOM   6296  H  HG12 . VAL A 1 80 ? -20.651 3.379   -20.474 1.00 0.00 ? 80 VAL A HG12 5  
ATOM   6297  H  HG13 . VAL A 1 80 ? -20.027 2.806   -18.927 1.00 0.00 ? 80 VAL A HG13 5  
ATOM   6298  H  HG21 . VAL A 1 80 ? -19.193 0.936   -18.596 1.00 0.00 ? 80 VAL A HG21 5  
ATOM   6299  H  HG22 . VAL A 1 80 ? -18.913 -0.255  -19.866 1.00 0.00 ? 80 VAL A HG22 5  
ATOM   6300  H  HG23 . VAL A 1 80 ? -20.402 -0.305  -18.922 1.00 0.00 ? 80 VAL A HG23 5  
ATOM   6301  N  N    . LYS A 1 81 ? -23.353 1.928   -21.993 1.00 0.00 ? 81 LYS A N    5  
ATOM   6302  C  CA   . LYS A 1 81 ? -23.980 2.776   -23.010 1.00 0.00 ? 81 LYS A CA   5  
ATOM   6303  C  C    . LYS A 1 81 ? -24.914 3.819   -22.378 1.00 0.00 ? 81 LYS A C    5  
ATOM   6304  O  O    . LYS A 1 81 ? -25.853 4.285   -23.025 1.00 0.00 ? 81 LYS A O    5  
ATOM   6305  C  CB   . LYS A 1 81 ? -24.765 1.911   -24.007 1.00 0.00 ? 81 LYS A CB   5  
ATOM   6306  C  CG   . LYS A 1 81 ? -23.935 1.406   -25.178 1.00 0.00 ? 81 LYS A CG   5  
ATOM   6307  C  CD   . LYS A 1 81 ? -24.768 1.296   -26.449 1.00 0.00 ? 81 LYS A CD   5  
ATOM   6308  C  CE   . LYS A 1 81 ? -25.272 -0.123  -26.672 1.00 0.00 ? 81 LYS A CE   5  
ATOM   6309  N  NZ   . LYS A 1 81 ? -26.171 -0.216  -27.857 1.00 0.00 ? 81 LYS A NZ   5  
ATOM   6310  H  H    . LYS A 1 81 ? -23.860 1.696   -21.186 1.00 0.00 ? 81 LYS A H    5  
ATOM   6311  H  HA   . LYS A 1 81 ? -23.193 3.291   -23.540 1.00 0.00 ? 81 LYS A HA   5  
ATOM   6312  H  HB2  . LYS A 1 81 ? -25.166 1.054   -23.484 1.00 0.00 ? 81 LYS A HB2  5  
ATOM   6313  H  HB3  . LYS A 1 81 ? -25.585 2.494   -24.401 1.00 0.00 ? 81 LYS A HB3  5  
ATOM   6314  H  HG2  . LYS A 1 81 ? -23.119 2.093   -25.352 1.00 0.00 ? 81 LYS A HG2  5  
ATOM   6315  H  HG3  . LYS A 1 81 ? -23.539 0.431   -24.932 1.00 0.00 ? 81 LYS A HG3  5  
ATOM   6316  H  HD2  . LYS A 1 81 ? -25.615 1.960   -26.371 1.00 0.00 ? 81 LYS A HD2  5  
ATOM   6317  H  HD3  . LYS A 1 81 ? -24.158 1.588   -27.292 1.00 0.00 ? 81 LYS A HD3  5  
ATOM   6318  H  HE2  . LYS A 1 81 ? -24.423 -0.773  -26.824 1.00 0.00 ? 81 LYS A HE2  5  
ATOM   6319  H  HE3  . LYS A 1 81 ? -25.814 -0.441  -25.794 1.00 0.00 ? 81 LYS A HE3  5  
ATOM   6320  H  HZ1  . LYS A 1 81 ? -25.631 -0.042  -28.731 1.00 0.00 ? 81 LYS A HZ1  5  
ATOM   6321  H  HZ2  . LYS A 1 81 ? -26.932 0.491   -27.786 1.00 0.00 ? 81 LYS A HZ2  5  
ATOM   6322  H  HZ3  . LYS A 1 81 ? -26.597 -1.162  -27.910 1.00 0.00 ? 81 LYS A HZ3  5  
ATOM   6323  N  N    . LEU A 1 82 ? -24.649 4.184   -21.116 1.00 0.00 ? 82 LEU A N    5  
ATOM   6324  C  CA   . LEU A 1 82 ? -25.466 5.172   -20.397 1.00 0.00 ? 82 LEU A CA   5  
ATOM   6325  C  C    . LEU A 1 82 ? -26.862 4.622   -20.088 1.00 0.00 ? 82 LEU A C    5  
ATOM   6326  O  O    . LEU A 1 82 ? -27.376 3.762   -20.807 1.00 0.00 ? 82 LEU A O    5  
ATOM   6327  C  CB   . LEU A 1 82 ? -25.583 6.471   -21.206 1.00 0.00 ? 82 LEU A CB   5  
ATOM   6328  C  CG   . LEU A 1 82 ? -25.680 7.754   -20.372 1.00 0.00 ? 82 LEU A CG   5  
ATOM   6329  C  CD1  . LEU A 1 82 ? -24.981 8.908   -21.078 1.00 0.00 ? 82 LEU A CD1  5  
ATOM   6330  C  CD2  . LEU A 1 82 ? -27.135 8.104   -20.089 1.00 0.00 ? 82 LEU A CD2  5  
ATOM   6331  H  H    . LEU A 1 82 ? -23.886 3.779   -20.654 1.00 0.00 ? 82 LEU A H    5  
ATOM   6332  H  HA   . LEU A 1 82 ? -24.968 5.389   -19.464 1.00 0.00 ? 82 LEU A HA   5  
ATOM   6333  H  HB2  . LEU A 1 82 ? -24.717 6.548   -21.849 1.00 0.00 ? 82 LEU A HB2  5  
ATOM   6334  H  HB3  . LEU A 1 82 ? -26.464 6.403   -21.825 1.00 0.00 ? 82 LEU A HB3  5  
ATOM   6335  H  HG   . LEU A 1 82 ? -25.184 7.597   -19.426 1.00 0.00 ? 82 LEU A HG   5  
ATOM   6336  H  HD11 . LEU A 1 82 ? -23.917 8.842   -20.911 1.00 0.00 ? 82 LEU A HD11 5  
ATOM   6337  H  HD12 . LEU A 1 82 ? -25.350 9.846   -20.688 1.00 0.00 ? 82 LEU A HD12 5  
ATOM   6338  H  HD13 . LEU A 1 82 ? -25.184 8.857   -22.139 1.00 0.00 ? 82 LEU A HD13 5  
ATOM   6339  H  HD21 . LEU A 1 82 ? -27.766 7.670   -20.850 1.00 0.00 ? 82 LEU A HD21 5  
ATOM   6340  H  HD22 . LEU A 1 82 ? -27.254 9.178   -20.092 1.00 0.00 ? 82 LEU A HD22 5  
ATOM   6341  H  HD23 . LEU A 1 82 ? -27.417 7.714   -19.123 1.00 0.00 ? 82 LEU A HD23 5  
ATOM   6342  N  N    . GLU A 1 83 ? -27.470 5.126   -19.010 1.00 0.00 ? 83 GLU A N    5  
ATOM   6343  C  CA   . GLU A 1 83 ? -28.803 4.689   -18.602 1.00 0.00 ? 83 GLU A CA   5  
ATOM   6344  C  C    . GLU A 1 83 ? -29.859 5.127   -19.614 1.00 0.00 ? 83 GLU A C    5  
ATOM   6345  O  O    . GLU A 1 83 ? -29.735 6.181   -20.239 1.00 0.00 ? 83 GLU A O    5  
ATOM   6346  C  CB   . GLU A 1 83 ? -29.152 5.242   -17.217 1.00 0.00 ? 83 GLU A CB   5  
ATOM   6347  C  CG   . GLU A 1 83 ? -28.547 4.443   -16.074 1.00 0.00 ? 83 GLU A CG   5  
ATOM   6348  C  CD   . GLU A 1 83 ? -28.040 5.326   -14.951 1.00 0.00 ? 83 GLU A CD   5  
ATOM   6349  O  OE1  . GLU A 1 83 ? -27.087 6.100   -15.186 1.00 0.00 ? 83 GLU A OE1  5  
ATOM   6350  O  OE2  . GLU A 1 83 ? -28.595 5.244   -13.835 1.00 0.00 ? 83 GLU A OE2  5  
ATOM   6351  H  H    . GLU A 1 83 ? -27.008 5.807   -18.477 1.00 0.00 ? 83 GLU A H    5  
ATOM   6352  H  HA   . GLU A 1 83 ? -28.795 3.610   -18.556 1.00 0.00 ? 83 GLU A HA   5  
ATOM   6353  H  HB2  . GLU A 1 83 ? -28.792 6.259   -17.147 1.00 0.00 ? 83 GLU A HB2  5  
ATOM   6354  H  HB3  . GLU A 1 83 ? -30.225 5.240   -17.101 1.00 0.00 ? 83 GLU A HB3  5  
ATOM   6355  H  HG2  . GLU A 1 83 ? -29.301 3.779   -15.676 1.00 0.00 ? 83 GLU A HG2  5  
ATOM   6356  H  HG3  . GLU A 1 83 ? -27.721 3.861   -16.456 1.00 0.00 ? 83 GLU A HG3  5  
ATOM   6357  N  N    . HIS A 1 84 ? -30.897 4.307   -19.770 1.00 0.00 ? 84 HIS A N    5  
ATOM   6358  C  CA   . HIS A 1 84 ? -31.977 4.603   -20.706 1.00 0.00 ? 84 HIS A CA   5  
ATOM   6359  C  C    . HIS A 1 84 ? -33.320 4.112   -20.168 1.00 0.00 ? 84 HIS A C    5  
ATOM   6360  O  O    . HIS A 1 84 ? -33.374 3.253   -19.287 1.00 0.00 ? 84 HIS A O    5  
ATOM   6361  C  CB   . HIS A 1 84 ? -31.683 3.958   -22.064 1.00 0.00 ? 84 HIS A CB   5  
ATOM   6362  C  CG   . HIS A 1 84 ? -32.102 4.794   -23.234 1.00 0.00 ? 84 HIS A CG   5  
ATOM   6363  N  ND1  . HIS A 1 84 ? -33.405 5.193   -23.450 1.00 0.00 ? 84 HIS A ND1  5  
ATOM   6364  C  CD2  . HIS A 1 84 ? -31.380 5.305   -24.259 1.00 0.00 ? 84 HIS A CD2  5  
ATOM   6365  C  CE1  . HIS A 1 84 ? -33.465 5.912   -24.557 1.00 0.00 ? 84 HIS A CE1  5  
ATOM   6366  N  NE2  . HIS A 1 84 ? -32.251 5.996   -25.065 1.00 0.00 ? 84 HIS A NE2  5  
ATOM   6367  H  H    . HIS A 1 84 ? -30.937 3.482   -19.241 1.00 0.00 ? 84 HIS A H    5  
ATOM   6368  H  HA   . HIS A 1 84 ? -32.023 5.674   -20.829 1.00 0.00 ? 84 HIS A HA   5  
ATOM   6369  H  HB2  . HIS A 1 84 ? -30.621 3.783   -22.148 1.00 0.00 ? 84 HIS A HB2  5  
ATOM   6370  H  HB3  . HIS A 1 84 ? -32.203 3.012   -22.128 1.00 0.00 ? 84 HIS A HB3  5  
ATOM   6371  H  HD1  . HIS A 1 84 ? -34.171 4.982   -22.876 1.00 0.00 ? 84 HIS A HD1  5  
ATOM   6372  H  HD2  . HIS A 1 84 ? -30.316 5.191   -24.413 1.00 0.00 ? 84 HIS A HD2  5  
ATOM   6373  H  HE1  . HIS A 1 84 ? -34.357 6.354   -24.975 1.00 0.00 ? 84 HIS A HE1  5  
ATOM   6374  H  HE2  . HIS A 1 84 ? -32.025 6.406   -25.926 1.00 0.00 ? 84 HIS A HE2  5  
HETATM 6375  ZN ZN   . ZN  B 2 .  ? 2.827   13.303  3.624   1.00 0.00 ? 85 ZN  A ZN   5  
ATOM   6376  N  N    . MET A 1 1  ? 14.774  9.795   8.345   1.00 0.00 ? 1  MET A N    6  
ATOM   6377  C  CA   . MET A 1 1  ? 14.746  8.339   8.655   1.00 0.00 ? 1  MET A CA   6  
ATOM   6378  C  C    . MET A 1 1  ? 15.368  8.051   10.021  1.00 0.00 ? 1  MET A C    6  
ATOM   6379  O  O    . MET A 1 1  ? 16.386  8.640   10.383  1.00 0.00 ? 1  MET A O    6  
ATOM   6380  C  CB   . MET A 1 1  ? 15.511  7.589   7.560   1.00 0.00 ? 1  MET A CB   6  
ATOM   6381  C  CG   . MET A 1 1  ? 15.256  6.089   7.548   1.00 0.00 ? 1  MET A CG   6  
ATOM   6382  S  SD   . MET A 1 1  ? 15.340  5.382   5.891   1.00 0.00 ? 1  MET A SD   6  
ATOM   6383  C  CE   . MET A 1 1  ? 17.058  5.684   5.478   1.00 0.00 ? 1  MET A CE   6  
ATOM   6384  H  H1   . MET A 1 1  ? 14.299  10.296  9.123   1.00 0.00 ? 1  MET A H1   6  
ATOM   6385  H  H2   . MET A 1 1  ? 14.270  9.938   7.445   1.00 0.00 ? 1  MET A H2   6  
ATOM   6386  H  H3   . MET A 1 1  ? 15.770  10.086  8.268   1.00 0.00 ? 1  MET A H3   6  
ATOM   6387  H  HA   . MET A 1 1  ? 13.717  8.010   8.659   1.00 0.00 ? 1  MET A HA   6  
ATOM   6388  H  HB2  . MET A 1 1  ? 15.225  7.989   6.598   1.00 0.00 ? 1  MET A HB2  6  
ATOM   6389  H  HB3  . MET A 1 1  ? 16.570  7.750   7.704   1.00 0.00 ? 1  MET A HB3  6  
ATOM   6390  H  HG2  . MET A 1 1  ? 15.998  5.606   8.167   1.00 0.00 ? 1  MET A HG2  6  
ATOM   6391  H  HG3  . MET A 1 1  ? 14.273  5.901   7.956   1.00 0.00 ? 1  MET A HG3  6  
ATOM   6392  H  HE1  . MET A 1 1  ? 17.158  5.785   4.407   1.00 0.00 ? 1  MET A HE1  6  
ATOM   6393  H  HE2  . MET A 1 1  ? 17.662  4.857   5.820   1.00 0.00 ? 1  MET A HE2  6  
ATOM   6394  H  HE3  . MET A 1 1  ? 17.389  6.594   5.957   1.00 0.00 ? 1  MET A HE3  6  
ATOM   6395  N  N    . ALA A 1 2  ? 14.747  7.136   10.768  1.00 0.00 ? 2  ALA A N    6  
ATOM   6396  C  CA   . ALA A 1 2  ? 15.236  6.757   12.095  1.00 0.00 ? 2  ALA A CA   6  
ATOM   6397  C  C    . ALA A 1 2  ? 14.510  5.512   12.609  1.00 0.00 ? 2  ALA A C    6  
ATOM   6398  O  O    . ALA A 1 2  ? 15.118  4.454   12.770  1.00 0.00 ? 2  ALA A O    6  
ATOM   6399  C  CB   . ALA A 1 2  ? 15.076  7.911   13.077  1.00 0.00 ? 2  ALA A CB   6  
ATOM   6400  H  H    . ALA A 1 2  ? 13.943  6.700   10.417  1.00 0.00 ? 2  ALA A H    6  
ATOM   6401  H  HA   . ALA A 1 2  ? 16.290  6.534   12.008  1.00 0.00 ? 2  ALA A HA   6  
ATOM   6402  H  HB1  . ALA A 1 2  ? 14.129  7.821   13.589  1.00 0.00 ? 2  ALA A HB1  6  
ATOM   6403  H  HB2  . ALA A 1 2  ? 15.106  8.848   12.541  1.00 0.00 ? 2  ALA A HB2  6  
ATOM   6404  H  HB3  . ALA A 1 2  ? 15.879  7.883   13.799  1.00 0.00 ? 2  ALA A HB3  6  
ATOM   6405  N  N    . VAL A 1 3  ? 13.204  5.649   12.860  1.00 0.00 ? 3  VAL A N    6  
ATOM   6406  C  CA   . VAL A 1 3  ? 12.386  4.538   13.352  1.00 0.00 ? 3  VAL A CA   6  
ATOM   6407  C  C    . VAL A 1 3  ? 11.051  4.449   12.599  1.00 0.00 ? 3  VAL A C    6  
ATOM   6408  O  O    . VAL A 1 3  ? 10.073  3.916   13.129  1.00 0.00 ? 3  VAL A O    6  
ATOM   6409  C  CB   . VAL A 1 3  ? 12.101  4.670   14.867  1.00 0.00 ? 3  VAL A CB   6  
ATOM   6410  C  CG1  . VAL A 1 3  ? 13.348  4.363   15.684  1.00 0.00 ? 3  VAL A CG1  6  
ATOM   6411  C  CG2  . VAL A 1 3  ? 11.566  6.059   15.198  1.00 0.00 ? 3  VAL A CG2  6  
ATOM   6412  H  H    . VAL A 1 3  ? 12.780  6.521   12.710  1.00 0.00 ? 3  VAL A H    6  
ATOM   6413  H  HA   . VAL A 1 3  ? 12.938  3.622   13.190  1.00 0.00 ? 3  VAL A HA   6  
ATOM   6414  H  HB   . VAL A 1 3  ? 11.342  3.947   15.131  1.00 0.00 ? 3  VAL A HB   6  
ATOM   6415  H  HG11 . VAL A 1 3  ? 14.012  3.736   15.108  1.00 0.00 ? 3  VAL A HG11 6  
ATOM   6416  H  HG12 . VAL A 1 3  ? 13.065  3.850   16.591  1.00 0.00 ? 3  VAL A HG12 6  
ATOM   6417  H  HG13 . VAL A 1 3  ? 13.850  5.286   15.935  1.00 0.00 ? 3  VAL A HG13 6  
ATOM   6418  H  HG21 . VAL A 1 3  ? 12.388  6.712   15.451  1.00 0.00 ? 3  VAL A HG21 6  
ATOM   6419  H  HG22 . VAL A 1 3  ? 10.887  5.994   16.035  1.00 0.00 ? 3  VAL A HG22 6  
ATOM   6420  H  HG23 . VAL A 1 3  ? 11.042  6.458   14.341  1.00 0.00 ? 3  VAL A HG23 6  
ATOM   6421  N  N    . PHE A 1 4  ? 11.019  4.969   11.364  1.00 0.00 ? 4  PHE A N    6  
ATOM   6422  C  CA   . PHE A 1 4  ? 9.809   4.950   10.540  1.00 0.00 ? 4  PHE A CA   6  
ATOM   6423  C  C    . PHE A 1 4  ? 8.664   5.711   11.218  1.00 0.00 ? 4  PHE A C    6  
ATOM   6424  O  O    . PHE A 1 4  ? 8.824   6.247   12.318  1.00 0.00 ? 4  PHE A O    6  
ATOM   6425  C  CB   . PHE A 1 4  ? 9.400   3.504   10.254  1.00 0.00 ? 4  PHE A CB   6  
ATOM   6426  C  CG   . PHE A 1 4  ? 9.716   3.043   8.856   1.00 0.00 ? 4  PHE A CG   6  
ATOM   6427  C  CD1  . PHE A 1 4  ? 11.013  3.092   8.369   1.00 0.00 ? 4  PHE A CD1  6  
ATOM   6428  C  CD2  . PHE A 1 4  ? 8.714   2.557   8.032   1.00 0.00 ? 4  PHE A CD2  6  
ATOM   6429  C  CE1  . PHE A 1 4  ? 11.303  2.665   7.087   1.00 0.00 ? 4  PHE A CE1  6  
ATOM   6430  C  CE2  . PHE A 1 4  ? 9.000   2.129   6.750   1.00 0.00 ? 4  PHE A CE2  6  
ATOM   6431  C  CZ   . PHE A 1 4  ? 10.295  2.183   6.277   1.00 0.00 ? 4  PHE A CZ   6  
ATOM   6432  H  H    . PHE A 1 4  ? 11.826  5.369   10.996  1.00 0.00 ? 4  PHE A H    6  
ATOM   6433  H  HA   . PHE A 1 4  ? 10.039  5.438   9.606   1.00 0.00 ? 4  PHE A HA   6  
ATOM   6434  H  HB2  . PHE A 1 4  ? 9.917   2.852   10.938  1.00 0.00 ? 4  PHE A HB2  6  
ATOM   6435  H  HB3  . PHE A 1 4  ? 8.338   3.405   10.406  1.00 0.00 ? 4  PHE A HB3  6  
ATOM   6436  H  HD1  . PHE A 1 4  ? 11.804  3.467   9.003   1.00 0.00 ? 4  PHE A HD1  6  
ATOM   6437  H  HD2  . PHE A 1 4  ? 7.700   2.514   8.400   1.00 0.00 ? 4  PHE A HD2  6  
ATOM   6438  H  HE1  . PHE A 1 4  ? 12.318  2.707   6.720   1.00 0.00 ? 4  PHE A HE1  6  
ATOM   6439  H  HE2  . PHE A 1 4  ? 8.211   1.753   6.117   1.00 0.00 ? 4  PHE A HE2  6  
ATOM   6440  H  HZ   . PHE A 1 4  ? 10.520  1.848   5.275   1.00 0.00 ? 4  PHE A HZ   6  
ATOM   6441  N  N    . HIS A 1 5  ? 7.508   5.759   10.557  1.00 0.00 ? 5  HIS A N    6  
ATOM   6442  C  CA   . HIS A 1 5  ? 6.347   6.454   11.106  1.00 0.00 ? 5  HIS A CA   6  
ATOM   6443  C  C    . HIS A 1 5  ? 5.407   5.471   11.800  1.00 0.00 ? 5  HIS A C    6  
ATOM   6444  O  O    . HIS A 1 5  ? 5.174   5.573   13.004  1.00 0.00 ? 5  HIS A O    6  
ATOM   6445  C  CB   . HIS A 1 5  ? 5.597   7.207   10.003  1.00 0.00 ? 5  HIS A CB   6  
ATOM   6446  C  CG   . HIS A 1 5  ? 4.614   8.209   10.525  1.00 0.00 ? 5  HIS A CG   6  
ATOM   6447  N  ND1  . HIS A 1 5  ? 4.989   9.414   11.077  1.00 0.00 ? 5  HIS A ND1  6  
ATOM   6448  C  CD2  . HIS A 1 5  ? 3.260   8.176   10.578  1.00 0.00 ? 5  HIS A CD2  6  
ATOM   6449  C  CE1  . HIS A 1 5  ? 3.911   10.080  11.450  1.00 0.00 ? 5  HIS A CE1  6  
ATOM   6450  N  NE2  . HIS A 1 5  ? 2.850   9.350   11.158  1.00 0.00 ? 5  HIS A NE2  6  
ATOM   6451  H  H    . HIS A 1 5  ? 7.435   5.318   9.685   1.00 0.00 ? 5  HIS A H    6  
ATOM   6452  H  HA   . HIS A 1 5  ? 6.703   7.165   11.836  1.00 0.00 ? 5  HIS A HA   6  
ATOM   6453  H  HB2  . HIS A 1 5  ? 6.311   7.735   9.387   1.00 0.00 ? 5  HIS A HB2  6  
ATOM   6454  H  HB3  . HIS A 1 5  ? 5.059   6.498   9.392   1.00 0.00 ? 5  HIS A HB3  6  
ATOM   6455  H  HD1  . HIS A 1 5  ? 5.910   9.734   11.181  1.00 0.00 ? 5  HIS A HD1  6  
ATOM   6456  H  HD2  . HIS A 1 5  ? 2.624   7.375   10.230  1.00 0.00 ? 5  HIS A HD2  6  
ATOM   6457  H  HE1  . HIS A 1 5  ? 3.900   11.053  11.917  1.00 0.00 ? 5  HIS A HE1  6  
ATOM   6458  H  HE2  . HIS A 1 5  ? 1.919   9.647   11.245  1.00 0.00 ? 5  HIS A HE2  6  
ATOM   6459  N  N    . ASP A 1 6  ? 4.880   4.518   11.029  1.00 0.00 ? 6  ASP A N    6  
ATOM   6460  C  CA   . ASP A 1 6  ? 3.969   3.503   11.558  1.00 0.00 ? 6  ASP A CA   6  
ATOM   6461  C  C    . ASP A 1 6  ? 3.804   2.352   10.564  1.00 0.00 ? 6  ASP A C    6  
ATOM   6462  O  O    . ASP A 1 6  ? 4.076   2.510   9.370   1.00 0.00 ? 6  ASP A O    6  
ATOM   6463  C  CB   . ASP A 1 6  ? 2.594   4.114   11.866  1.00 0.00 ? 6  ASP A CB   6  
ATOM   6464  C  CG   . ASP A 1 6  ? 2.471   4.598   13.299  1.00 0.00 ? 6  ASP A CG   6  
ATOM   6465  O  OD1  . ASP A 1 6  ? 2.638   3.774   14.223  1.00 0.00 ? 6  ASP A OD1  6  
ATOM   6466  O  OD2  . ASP A 1 6  ? 2.204   5.804   13.496  1.00 0.00 ? 6  ASP A OD2  6  
ATOM   6467  H  H    . ASP A 1 6  ? 5.118   4.492   10.078  1.00 0.00 ? 6  ASP A H    6  
ATOM   6468  H  HA   . ASP A 1 6  ? 4.396   3.119   12.472  1.00 0.00 ? 6  ASP A HA   6  
ATOM   6469  H  HB2  . ASP A 1 6  ? 2.422   4.953   11.208  1.00 0.00 ? 6  ASP A HB2  6  
ATOM   6470  H  HB3  . ASP A 1 6  ? 1.831   3.368   11.692  1.00 0.00 ? 6  ASP A HB3  6  
ATOM   6471  N  N    . GLU A 1 7  ? 3.351   1.201   11.061  1.00 0.00 ? 7  GLU A N    6  
ATOM   6472  C  CA   . GLU A 1 7  ? 3.138   0.026   10.216  1.00 0.00 ? 7  GLU A CA   6  
ATOM   6473  C  C    . GLU A 1 7  ? 1.644   -0.220  10.010  1.00 0.00 ? 7  GLU A C    6  
ATOM   6474  O  O    . GLU A 1 7  ? 0.904   -0.422  10.975  1.00 0.00 ? 7  GLU A O    6  
ATOM   6475  C  CB   . GLU A 1 7  ? 3.784   -1.216  10.839  1.00 0.00 ? 7  GLU A CB   6  
ATOM   6476  C  CG   . GLU A 1 7  ? 5.241   -1.022  11.231  1.00 0.00 ? 7  GLU A CG   6  
ATOM   6477  C  CD   . GLU A 1 7  ? 5.588   -1.704  12.541  1.00 0.00 ? 7  GLU A CD   6  
ATOM   6478  O  OE1  . GLU A 1 7  ? 5.020   -1.314  13.584  1.00 0.00 ? 7  GLU A OE1  6  
ATOM   6479  O  OE2  . GLU A 1 7  ? 6.430   -2.627  12.523  1.00 0.00 ? 7  GLU A OE2  6  
ATOM   6480  H  H    . GLU A 1 7  ? 3.148   1.142   12.019  1.00 0.00 ? 7  GLU A H    6  
ATOM   6481  H  HA   . GLU A 1 7  ? 3.597   0.219   9.257   1.00 0.00 ? 7  GLU A HA   6  
ATOM   6482  H  HB2  . GLU A 1 7  ? 3.229   -1.491  11.725  1.00 0.00 ? 7  GLU A HB2  6  
ATOM   6483  H  HB3  . GLU A 1 7  ? 3.730   -2.028  10.128  1.00 0.00 ? 7  GLU A HB3  6  
ATOM   6484  H  HG2  . GLU A 1 7  ? 5.868   -1.433  10.453  1.00 0.00 ? 7  GLU A HG2  6  
ATOM   6485  H  HG3  . GLU A 1 7  ? 5.437   0.035   11.329  1.00 0.00 ? 7  GLU A HG3  6  
ATOM   6486  N  N    . VAL A 1 8  ? 1.205   -0.198  8.752   1.00 0.00 ? 8  VAL A N    6  
ATOM   6487  C  CA   . VAL A 1 8  ? -0.204  -0.417  8.424   1.00 0.00 ? 8  VAL A CA   6  
ATOM   6488  C  C    . VAL A 1 8  ? -0.364  -1.544  7.405   1.00 0.00 ? 8  VAL A C    6  
ATOM   6489  O  O    . VAL A 1 8  ? 0.439   -1.675  6.477   1.00 0.00 ? 8  VAL A O    6  
ATOM   6490  C  CB   . VAL A 1 8  ? -0.866  0.865   7.869   1.00 0.00 ? 8  VAL A CB   6  
ATOM   6491  C  CG1  . VAL A 1 8  ? -2.368  0.672   7.718   1.00 0.00 ? 8  VAL A CG1  6  
ATOM   6492  C  CG2  . VAL A 1 8  ? -0.568  2.061   8.763   1.00 0.00 ? 8  VAL A CG2  6  
ATOM   6493  H  H    . VAL A 1 8  ? 1.841   -0.031  8.025   1.00 0.00 ? 8  VAL A H    6  
ATOM   6494  H  HA   . VAL A 1 8  ? -0.717  -0.695  9.334   1.00 0.00 ? 8  VAL A HA   6  
ATOM   6495  H  HB   . VAL A 1 8  ? -0.453  1.063   6.891   1.00 0.00 ? 8  VAL A HB   6  
ATOM   6496  H  HG11 . VAL A 1 8  ? -2.835  0.701   8.692   1.00 0.00 ? 8  VAL A HG11 6  
ATOM   6497  H  HG12 . VAL A 1 8  ? -2.567  -0.283  7.255   1.00 0.00 ? 8  VAL A HG12 6  
ATOM   6498  H  HG13 . VAL A 1 8  ? -2.772  1.461   7.103   1.00 0.00 ? 8  VAL A HG13 6  
ATOM   6499  H  HG21 . VAL A 1 8  ? 0.492   2.107   8.965   1.00 0.00 ? 8  VAL A HG21 6  
ATOM   6500  H  HG22 . VAL A 1 8  ? -1.108  1.958   9.693   1.00 0.00 ? 8  VAL A HG22 6  
ATOM   6501  H  HG23 . VAL A 1 8  ? -0.879  2.967   8.265   1.00 0.00 ? 8  VAL A HG23 6  
ATOM   6502  N  N    . GLU A 1 9  ? -1.408  -2.354  7.585   1.00 0.00 ? 9  GLU A N    6  
ATOM   6503  C  CA   . GLU A 1 9  ? -1.686  -3.473  6.685   1.00 0.00 ? 9  GLU A CA   6  
ATOM   6504  C  C    . GLU A 1 9  ? -2.069  -2.975  5.291   1.00 0.00 ? 9  GLU A C    6  
ATOM   6505  O  O    . GLU A 1 9  ? -2.796  -1.991  5.150   1.00 0.00 ? 9  GLU A O    6  
ATOM   6506  C  CB   . GLU A 1 9  ? -2.804  -4.356  7.250   1.00 0.00 ? 9  GLU A CB   6  
ATOM   6507  C  CG   . GLU A 1 9  ? -2.440  -5.047  8.558   1.00 0.00 ? 9  GLU A CG   6  
ATOM   6508  C  CD   . GLU A 1 9  ? -3.660  -5.496  9.341   1.00 0.00 ? 9  GLU A CD   6  
ATOM   6509  O  OE1  . GLU A 1 9  ? -4.218  -6.565  9.012   1.00 0.00 ? 9  GLU A OE1  6  
ATOM   6510  O  OE2  . GLU A 1 9  ? -4.055  -4.782  10.286  1.00 0.00 ? 9  GLU A OE2  6  
ATOM   6511  H  H    . GLU A 1 9  ? -2.011  -2.194  8.342   1.00 0.00 ? 9  GLU A H    6  
ATOM   6512  H  HA   . GLU A 1 9  ? -0.783  -4.061  6.605   1.00 0.00 ? 9  GLU A HA   6  
ATOM   6513  H  HB2  . GLU A 1 9  ? -3.677  -3.745  7.423   1.00 0.00 ? 9  GLU A HB2  6  
ATOM   6514  H  HB3  . GLU A 1 9  ? -3.047  -5.117  6.522   1.00 0.00 ? 9  GLU A HB3  6  
ATOM   6515  H  HG2  . GLU A 1 9  ? -1.835  -5.914  8.337   1.00 0.00 ? 9  GLU A HG2  6  
ATOM   6516  H  HG3  . GLU A 1 9  ? -1.871  -4.361  9.168   1.00 0.00 ? 9  GLU A HG3  6  
ATOM   6517  N  N    . ILE A 1 10 ? -1.570  -3.665  4.266   1.00 0.00 ? 10 ILE A N    6  
ATOM   6518  C  CA   . ILE A 1 10 ? -1.849  -3.308  2.876   1.00 0.00 ? 10 ILE A CA   6  
ATOM   6519  C  C    . ILE A 1 10 ? -3.357  -3.284  2.595   1.00 0.00 ? 10 ILE A C    6  
ATOM   6520  O  O    . ILE A 1 10 ? -3.821  -2.526  1.742   1.00 0.00 ? 10 ILE A O    6  
ATOM   6521  C  CB   . ILE A 1 10 ? -1.137  -4.275  1.896   1.00 0.00 ? 10 ILE A CB   6  
ATOM   6522  C  CG1  . ILE A 1 10 ? -1.251  -3.770  0.456   1.00 0.00 ? 10 ILE A CG1  6  
ATOM   6523  C  CG2  . ILE A 1 10 ? -1.692  -5.689  2.017   1.00 0.00 ? 10 ILE A CG2  6  
ATOM   6524  C  CD1  . ILE A 1 10 ? -0.371  -2.573  0.162   1.00 0.00 ? 10 ILE A CD1  6  
ATOM   6525  H  H    . ILE A 1 10 ? -0.996  -4.440  4.450   1.00 0.00 ? 10 ILE A H    6  
ATOM   6526  H  HA   . ILE A 1 10 ? -1.455  -2.315  2.710   1.00 0.00 ? 10 ILE A HA   6  
ATOM   6527  H  HB   . ILE A 1 10 ? -0.093  -4.307  2.170   1.00 0.00 ? 10 ILE A HB   6  
ATOM   6528  H  HG12 . ILE A 1 10 ? -0.964  -4.563  -0.218  1.00 0.00 ? 10 ILE A HG12 6  
ATOM   6529  H  HG13 . ILE A 1 10 ? -2.274  -3.488  0.257   1.00 0.00 ? 10 ILE A HG13 6  
ATOM   6530  H  HG21 . ILE A 1 10 ? -1.257  -6.311  1.248   1.00 0.00 ? 10 ILE A HG21 6  
ATOM   6531  H  HG22 . ILE A 1 10 ? -2.765  -5.669  1.899   1.00 0.00 ? 10 ILE A HG22 6  
ATOM   6532  H  HG23 . ILE A 1 10 ? -1.443  -6.092  2.988   1.00 0.00 ? 10 ILE A HG23 6  
ATOM   6533  H  HD11 . ILE A 1 10 ? 0.478   -2.578  0.830   1.00 0.00 ? 10 ILE A HD11 6  
ATOM   6534  H  HD12 . ILE A 1 10 ? -0.939  -1.666  0.309   1.00 0.00 ? 10 ILE A HD12 6  
ATOM   6535  H  HD13 . ILE A 1 10 ? -0.027  -2.622  -0.860  1.00 0.00 ? 10 ILE A HD13 6  
ATOM   6536  N  N    . GLU A 1 11 ? -4.117  -4.102  3.330   1.00 0.00 ? 11 GLU A N    6  
ATOM   6537  C  CA   . GLU A 1 11 ? -5.572  -4.157  3.175   1.00 0.00 ? 11 GLU A CA   6  
ATOM   6538  C  C    . GLU A 1 11 ? -6.196  -2.777  3.415   1.00 0.00 ? 11 GLU A C    6  
ATOM   6539  O  O    . GLU A 1 11 ? -7.166  -2.405  2.754   1.00 0.00 ? 11 GLU A O    6  
ATOM   6540  C  CB   . GLU A 1 11 ? -6.160  -5.183  4.150   1.00 0.00 ? 11 GLU A CB   6  
ATOM   6541  C  CG   . GLU A 1 11 ? -7.647  -5.448  3.958   1.00 0.00 ? 11 GLU A CG   6  
ATOM   6542  C  CD   . GLU A 1 11 ? -8.364  -5.710  5.269   1.00 0.00 ? 11 GLU A CD   6  
ATOM   6543  O  OE1  . GLU A 1 11 ? -8.265  -6.844  5.785   1.00 0.00 ? 11 GLU A OE1  6  
ATOM   6544  O  OE2  . GLU A 1 11 ? -9.024  -4.781  5.783   1.00 0.00 ? 11 GLU A OE2  6  
ATOM   6545  H  H    . GLU A 1 11 ? -3.690  -4.673  4.002   1.00 0.00 ? 11 GLU A H    6  
ATOM   6546  H  HA   . GLU A 1 11 ? -5.786  -4.468  2.163   1.00 0.00 ? 11 GLU A HA   6  
ATOM   6547  H  HB2  . GLU A 1 11 ? -5.634  -6.119  4.025   1.00 0.00 ? 11 GLU A HB2  6  
ATOM   6548  H  HB3  . GLU A 1 11 ? -6.007  -4.828  5.159   1.00 0.00 ? 11 GLU A HB3  6  
ATOM   6549  H  HG2  . GLU A 1 11 ? -8.097  -4.589  3.484   1.00 0.00 ? 11 GLU A HG2  6  
ATOM   6550  H  HG3  . GLU A 1 11 ? -7.767  -6.313  3.321   1.00 0.00 ? 11 GLU A HG3  6  
ATOM   6551  N  N    . ASP A 1 12 ? -5.623  -2.020  4.358   1.00 0.00 ? 12 ASP A N    6  
ATOM   6552  C  CA   . ASP A 1 12 ? -6.114  -0.679  4.681   1.00 0.00 ? 12 ASP A CA   6  
ATOM   6553  C  C    . ASP A 1 12 ? -5.777  0.319   3.570   1.00 0.00 ? 12 ASP A C    6  
ATOM   6554  O  O    . ASP A 1 12 ? -6.495  1.299   3.369   1.00 0.00 ? 12 ASP A O    6  
ATOM   6555  C  CB   . ASP A 1 12 ? -5.514  -0.196  6.005   1.00 0.00 ? 12 ASP A CB   6  
ATOM   6556  C  CG   . ASP A 1 12 ? -6.319  -0.641  7.210   1.00 0.00 ? 12 ASP A CG   6  
ATOM   6557  O  OD1  . ASP A 1 12 ? -7.375  -0.029  7.480   1.00 0.00 ? 12 ASP A OD1  6  
ATOM   6558  O  OD2  . ASP A 1 12 ? -5.892  -1.600  7.887   1.00 0.00 ? 12 ASP A OD2  6  
ATOM   6559  H  H    . ASP A 1 12 ? -4.848  -2.371  4.845   1.00 0.00 ? 12 ASP A H    6  
ATOM   6560  H  HA   . ASP A 1 12 ? -7.188  -0.735  4.783   1.00 0.00 ? 12 ASP A HA   6  
ATOM   6561  H  HB2  . ASP A 1 12 ? -4.513  -0.586  6.103   1.00 0.00 ? 12 ASP A HB2  6  
ATOM   6562  H  HB3  . ASP A 1 12 ? -5.474  0.885   6.001   1.00 0.00 ? 12 ASP A HB3  6  
ATOM   6563  N  N    . PHE A 1 13 ? -4.676  0.065   2.852   1.00 0.00 ? 13 PHE A N    6  
ATOM   6564  C  CA   . PHE A 1 13 ? -4.244  0.943   1.764   1.00 0.00 ? 13 PHE A CA   6  
ATOM   6565  C  C    . PHE A 1 13 ? -5.268  0.967   0.630   1.00 0.00 ? 13 PHE A C    6  
ATOM   6566  O  O    . PHE A 1 13 ? -6.111  0.072   0.518   1.00 0.00 ? 13 PHE A O    6  
ATOM   6567  C  CB   . PHE A 1 13 ? -2.889  0.487   1.213   1.00 0.00 ? 13 PHE A CB   6  
ATOM   6568  C  CG   . PHE A 1 13 ? -1.704  0.958   2.013   1.00 0.00 ? 13 PHE A CG   6  
ATOM   6569  C  CD1  . PHE A 1 13 ? -1.486  0.494   3.301   1.00 0.00 ? 13 PHE A CD1  6  
ATOM   6570  C  CD2  . PHE A 1 13 ? -0.803  1.859   1.467   1.00 0.00 ? 13 PHE A CD2  6  
ATOM   6571  C  CE1  . PHE A 1 13 ? -0.392  0.923   4.030   1.00 0.00 ? 13 PHE A CE1  6  
ATOM   6572  C  CE2  . PHE A 1 13 ? 0.293   2.289   2.190   1.00 0.00 ? 13 PHE A CE2  6  
ATOM   6573  C  CZ   . PHE A 1 13 ? 0.499   1.822   3.474   1.00 0.00 ? 13 PHE A CZ   6  
ATOM   6574  H  H    . PHE A 1 13 ? -4.145  -0.729  3.062   1.00 0.00 ? 13 PHE A H    6  
ATOM   6575  H  HA   . PHE A 1 13 ? -4.144  1.941   2.164   1.00 0.00 ? 13 PHE A HA   6  
ATOM   6576  H  HB2  . PHE A 1 13 ? -2.863  -0.591  1.190   1.00 0.00 ? 13 PHE A HB2  6  
ATOM   6577  H  HB3  . PHE A 1 13 ? -2.779  0.862   0.206   1.00 0.00 ? 13 PHE A HB3  6  
ATOM   6578  H  HD1  . PHE A 1 13 ? -2.180  -0.207  3.737   1.00 0.00 ? 13 PHE A HD1  6  
ATOM   6579  H  HD2  . PHE A 1 13 ? -0.962  2.228   0.465   1.00 0.00 ? 13 PHE A HD2  6  
ATOM   6580  H  HE1  . PHE A 1 13 ? -0.234  0.555   5.033   1.00 0.00 ? 13 PHE A HE1  6  
ATOM   6581  H  HE2  . PHE A 1 13 ? 0.987   2.992   1.750   1.00 0.00 ? 13 PHE A HE2  6  
ATOM   6582  H  HZ   . PHE A 1 13 ? 1.355   2.155   4.042   1.00 0.00 ? 13 PHE A HZ   6  
ATOM   6583  N  N    . GLN A 1 14 ? -5.180  1.993   -0.213  1.00 0.00 ? 14 GLN A N    6  
ATOM   6584  C  CA   . GLN A 1 14 ? -6.087  2.140   -1.347  1.00 0.00 ? 14 GLN A CA   6  
ATOM   6585  C  C    . GLN A 1 14 ? -5.462  1.555   -2.613  1.00 0.00 ? 14 GLN A C    6  
ATOM   6586  O  O    . GLN A 1 14 ? -4.639  2.204   -3.263  1.00 0.00 ? 14 GLN A O    6  
ATOM   6587  C  CB   . GLN A 1 14 ? -6.431  3.618   -1.562  1.00 0.00 ? 14 GLN A CB   6  
ATOM   6588  C  CG   . GLN A 1 14 ? -7.620  3.848   -2.484  1.00 0.00 ? 14 GLN A CG   6  
ATOM   6589  C  CD   . GLN A 1 14 ? -7.208  4.300   -3.873  1.00 0.00 ? 14 GLN A CD   6  
ATOM   6590  O  OE1  . GLN A 1 14 ? -7.419  3.591   -4.856  1.00 0.00 ? 14 GLN A OE1  6  
ATOM   6591  N  NE2  . GLN A 1 14 ? -6.617  5.487   -3.962  1.00 0.00 ? 14 GLN A NE2  6  
ATOM   6592  H  H    . GLN A 1 14 ? -4.482  2.668   -0.073  1.00 0.00 ? 14 GLN A H    6  
ATOM   6593  H  HA   . GLN A 1 14 ? -6.993  1.596   -1.121  1.00 0.00 ? 14 GLN A HA   6  
ATOM   6594  H  HB2  . GLN A 1 14 ? -6.657  4.064   -0.603  1.00 0.00 ? 14 GLN A HB2  6  
ATOM   6595  H  HB3  . GLN A 1 14 ? -5.571  4.118   -1.986  1.00 0.00 ? 14 GLN A HB3  6  
ATOM   6596  H  HG2  . GLN A 1 14 ? -8.176  2.926   -2.572  1.00 0.00 ? 14 GLN A HG2  6  
ATOM   6597  H  HG3  . GLN A 1 14 ? -8.253  4.608   -2.049  1.00 0.00 ? 14 GLN A HG3  6  
ATOM   6598  H  HE21 . GLN A 1 14 ? -6.480  6.001   -3.139  1.00 0.00 ? 14 GLN A HE21 6  
ATOM   6599  H  HE22 . GLN A 1 14 ? -6.341  5.801   -4.849  1.00 0.00 ? 14 GLN A HE22 6  
ATOM   6600  N  N    . TYR A 1 15 ? -5.851  0.326   -2.956  1.00 0.00 ? 15 TYR A N    6  
ATOM   6601  C  CA   . TYR A 1 15 ? -5.323  -0.339  -4.145  1.00 0.00 ? 15 TYR A CA   6  
ATOM   6602  C  C    . TYR A 1 15 ? -5.817  0.350   -5.414  1.00 0.00 ? 15 TYR A C    6  
ATOM   6603  O  O    . TYR A 1 15 ? -6.992  0.704   -5.526  1.00 0.00 ? 15 TYR A O    6  
ATOM   6604  C  CB   . TYR A 1 15 ? -5.721  -1.820  -4.164  1.00 0.00 ? 15 TYR A CB   6  
ATOM   6605  C  CG   . TYR A 1 15 ? -5.226  -2.570  -5.388  1.00 0.00 ? 15 TYR A CG   6  
ATOM   6606  C  CD1  . TYR A 1 15 ? -3.866  -2.713  -5.639  1.00 0.00 ? 15 TYR A CD1  6  
ATOM   6607  C  CD2  . TYR A 1 15 ? -6.121  -3.130  -6.292  1.00 0.00 ? 15 TYR A CD2  6  
ATOM   6608  C  CE1  . TYR A 1 15 ? -3.413  -3.397  -6.751  1.00 0.00 ? 15 TYR A CE1  6  
ATOM   6609  C  CE2  . TYR A 1 15 ? -5.675  -3.814  -7.407  1.00 0.00 ? 15 TYR A CE2  6  
ATOM   6610  C  CZ   . TYR A 1 15 ? -4.321  -3.943  -7.633  1.00 0.00 ? 15 TYR A CZ   6  
ATOM   6611  O  OH   . TYR A 1 15 ? -3.874  -4.626  -8.741  1.00 0.00 ? 15 TYR A OH   6  
ATOM   6612  H  H    . TYR A 1 15 ? -6.508  -0.141  -2.396  1.00 0.00 ? 15 TYR A H    6  
ATOM   6613  H  HA   . TYR A 1 15 ? -4.247  -0.266  -4.108  1.00 0.00 ? 15 TYR A HA   6  
ATOM   6614  H  HB2  . TYR A 1 15 ? -5.311  -2.306  -3.291  1.00 0.00 ? 15 TYR A HB2  6  
ATOM   6615  H  HB3  . TYR A 1 15 ? -6.798  -1.897  -4.140  1.00 0.00 ? 15 TYR A HB3  6  
ATOM   6616  H  HD1  . TYR A 1 15 ? -3.156  -2.285  -4.947  1.00 0.00 ? 15 TYR A HD1  6  
ATOM   6617  H  HD2  . TYR A 1 15 ? -7.180  -3.025  -6.114  1.00 0.00 ? 15 TYR A HD2  6  
ATOM   6618  H  HE1  . TYR A 1 15 ? -2.352  -3.499  -6.927  1.00 0.00 ? 15 TYR A HE1  6  
ATOM   6619  H  HE2  . TYR A 1 15 ? -6.386  -4.242  -8.097  1.00 0.00 ? 15 TYR A HE2  6  
ATOM   6620  H  HH   . TYR A 1 15 ? -3.957  -4.067  -9.518  1.00 0.00 ? 15 TYR A HH   6  
ATOM   6621  N  N    . ASP A 1 16 ? -4.905  0.535   -6.363  1.00 0.00 ? 16 ASP A N    6  
ATOM   6622  C  CA   . ASP A 1 16 ? -5.230  1.180   -7.627  1.00 0.00 ? 16 ASP A CA   6  
ATOM   6623  C  C    . ASP A 1 16 ? -4.971  0.231   -8.794  1.00 0.00 ? 16 ASP A C    6  
ATOM   6624  O  O    . ASP A 1 16 ? -3.871  0.203   -9.346  1.00 0.00 ? 16 ASP A O    6  
ATOM   6625  C  CB   . ASP A 1 16 ? -4.407  2.464   -7.788  1.00 0.00 ? 16 ASP A CB   6  
ATOM   6626  C  CG   . ASP A 1 16 ? -4.721  3.207   -9.074  1.00 0.00 ? 16 ASP A CG   6  
ATOM   6627  O  OD1  . ASP A 1 16 ? -5.890  3.607   -9.261  1.00 0.00 ? 16 ASP A OD1  6  
ATOM   6628  O  OD2  . ASP A 1 16 ? -3.796  3.388   -9.893  1.00 0.00 ? 16 ASP A OD2  6  
ATOM   6629  H  H    . ASP A 1 16 ? -3.986  0.230   -6.209  1.00 0.00 ? 16 ASP A H    6  
ATOM   6630  H  HA   . ASP A 1 16 ? -6.279  1.435   -7.612  1.00 0.00 ? 16 ASP A HA   6  
ATOM   6631  H  HB2  . ASP A 1 16 ? -4.613  3.121   -6.957  1.00 0.00 ? 16 ASP A HB2  6  
ATOM   6632  H  HB3  . ASP A 1 16 ? -3.356  2.212   -7.788  1.00 0.00 ? 16 ASP A HB3  6  
ATOM   6633  N  N    . GLU A 1 17 ? -5.994  -0.542  -9.163  1.00 0.00 ? 17 GLU A N    6  
ATOM   6634  C  CA   . GLU A 1 17 ? -5.880  -1.494  -10.273 1.00 0.00 ? 17 GLU A CA   6  
ATOM   6635  C  C    . GLU A 1 17 ? -5.436  -0.791  -11.557 1.00 0.00 ? 17 GLU A C    6  
ATOM   6636  O  O    . GLU A 1 17 ? -4.779  -1.397  -12.406 1.00 0.00 ? 17 GLU A O    6  
ATOM   6637  C  CB   . GLU A 1 17 ? -7.208  -2.225  -10.509 1.00 0.00 ? 17 GLU A CB   6  
ATOM   6638  C  CG   . GLU A 1 17 ? -8.435  -1.319  -10.486 1.00 0.00 ? 17 GLU A CG   6  
ATOM   6639  C  CD   . GLU A 1 17 ? -9.615  -1.909  -11.238 1.00 0.00 ? 17 GLU A CD   6  
ATOM   6640  O  OE1  . GLU A 1 17 ? -9.439  -2.313  -12.407 1.00 0.00 ? 17 GLU A OE1  6  
ATOM   6641  O  OE2  . GLU A 1 17 ? -10.719 -1.965  -10.655 1.00 0.00 ? 17 GLU A OE2  6  
ATOM   6642  H  H    . GLU A 1 17 ? -6.844  -0.470  -8.681  1.00 0.00 ? 17 GLU A H    6  
ATOM   6643  H  HA   . GLU A 1 17 ? -5.128  -2.220  -10.005 1.00 0.00 ? 17 GLU A HA   6  
ATOM   6644  H  HB2  . GLU A 1 17 ? -7.167  -2.710  -11.472 1.00 0.00 ? 17 GLU A HB2  6  
ATOM   6645  H  HB3  . GLU A 1 17 ? -7.329  -2.977  -9.744  1.00 0.00 ? 17 GLU A HB3  6  
ATOM   6646  H  HG2  . GLU A 1 17 ? -8.728  -1.160  -9.459  1.00 0.00 ? 17 GLU A HG2  6  
ATOM   6647  H  HG3  . GLU A 1 17 ? -8.177  -0.372  -10.937 1.00 0.00 ? 17 GLU A HG3  6  
ATOM   6648  N  N    . ASP A 1 18 ? -5.796  0.491   -11.684 1.00 0.00 ? 18 ASP A N    6  
ATOM   6649  C  CA   . ASP A 1 18 ? -5.435  1.292   -12.854 1.00 0.00 ? 18 ASP A CA   6  
ATOM   6650  C  C    . ASP A 1 18 ? -3.952  1.129   -13.204 1.00 0.00 ? 18 ASP A C    6  
ATOM   6651  O  O    . ASP A 1 18 ? -3.603  0.972   -14.374 1.00 0.00 ? 18 ASP A O    6  
ATOM   6652  C  CB   . ASP A 1 18 ? -5.751  2.770   -12.598 1.00 0.00 ? 18 ASP A CB   6  
ATOM   6653  C  CG   . ASP A 1 18 ? -6.250  3.485   -13.840 1.00 0.00 ? 18 ASP A CG   6  
ATOM   6654  O  OD1  . ASP A 1 18 ? -7.419  3.264   -14.223 1.00 0.00 ? 18 ASP A OD1  6  
ATOM   6655  O  OD2  . ASP A 1 18 ? -5.475  4.269   -14.425 1.00 0.00 ? 18 ASP A OD2  6  
ATOM   6656  H  H    . ASP A 1 18 ? -6.316  0.911   -10.970 1.00 0.00 ? 18 ASP A H    6  
ATOM   6657  H  HA   . ASP A 1 18 ? -6.030  0.947   -13.686 1.00 0.00 ? 18 ASP A HA   6  
ATOM   6658  H  HB2  . ASP A 1 18 ? -6.512  2.843   -11.835 1.00 0.00 ? 18 ASP A HB2  6  
ATOM   6659  H  HB3  . ASP A 1 18 ? -4.856  3.269   -12.254 1.00 0.00 ? 18 ASP A HB3  6  
ATOM   6660  N  N    . SER A 1 19 ? -3.086  1.168   -12.184 1.00 0.00 ? 19 SER A N    6  
ATOM   6661  C  CA   . SER A 1 19 ? -1.644  1.024   -12.397 1.00 0.00 ? 19 SER A CA   6  
ATOM   6662  C  C    . SER A 1 19 ? -0.985  0.136   -11.327 1.00 0.00 ? 19 SER A C    6  
ATOM   6663  O  O    . SER A 1 19 ? 0.215   0.253   -11.077 1.00 0.00 ? 19 SER A O    6  
ATOM   6664  C  CB   . SER A 1 19 ? -0.980  2.404   -12.408 1.00 0.00 ? 19 SER A CB   6  
ATOM   6665  O  OG   . SER A 1 19 ? -1.235  3.087   -13.623 1.00 0.00 ? 19 SER A OG   6  
ATOM   6666  H  H    . SER A 1 19 ? -3.424  1.299   -11.272 1.00 0.00 ? 19 SER A H    6  
ATOM   6667  H  HA   . SER A 1 19 ? -1.499  0.562   -13.362 1.00 0.00 ? 19 SER A HA   6  
ATOM   6668  H  HB2  . SER A 1 19 ? -1.367  2.993   -11.590 1.00 0.00 ? 19 SER A HB2  6  
ATOM   6669  H  HB3  . SER A 1 19 ? 0.088   2.287   -12.293 1.00 0.00 ? 19 SER A HB3  6  
ATOM   6670  H  HG   . SER A 1 19 ? -1.545  3.976   -13.432 1.00 0.00 ? 19 SER A HG   6  
ATOM   6671  N  N    . GLU A 1 20 ? -1.773  -0.753  -10.705 1.00 0.00 ? 20 GLU A N    6  
ATOM   6672  C  CA   . GLU A 1 20 ? -1.269  -1.662  -9.667  1.00 0.00 ? 20 GLU A CA   6  
ATOM   6673  C  C    . GLU A 1 20 ? -0.409  -0.922  -8.629  1.00 0.00 ? 20 GLU A C    6  
ATOM   6674  O  O    . GLU A 1 20 ? 0.769   -1.234  -8.440  1.00 0.00 ? 20 GLU A O    6  
ATOM   6675  C  CB   . GLU A 1 20 ? -0.472  -2.807  -10.305 1.00 0.00 ? 20 GLU A CB   6  
ATOM   6676  C  CG   . GLU A 1 20 ? -0.689  -4.151  -9.621  1.00 0.00 ? 20 GLU A CG   6  
ATOM   6677  C  CD   . GLU A 1 20 ? 0.002   -5.308  -10.326 1.00 0.00 ? 20 GLU A CD   6  
ATOM   6678  O  OE1  . GLU A 1 20 ? 0.288   -5.194  -11.538 1.00 0.00 ? 20 GLU A OE1  6  
ATOM   6679  O  OE2  . GLU A 1 20 ? 0.252   -6.337  -9.663  1.00 0.00 ? 20 GLU A OE2  6  
ATOM   6680  H  H    . GLU A 1 20 ? -2.720  -0.804  -10.951 1.00 0.00 ? 20 GLU A H    6  
ATOM   6681  H  HA   . GLU A 1 20 ? -2.127  -2.079  -9.161  1.00 0.00 ? 20 GLU A HA   6  
ATOM   6682  H  HB2  . GLU A 1 20 ? -0.769  -2.903  -11.338 1.00 0.00 ? 20 GLU A HB2  6  
ATOM   6683  H  HB3  . GLU A 1 20 ? 0.580   -2.569  -10.261 1.00 0.00 ? 20 GLU A HB3  6  
ATOM   6684  H  HG2  . GLU A 1 20 ? -0.306  -4.091  -8.614  1.00 0.00 ? 20 GLU A HG2  6  
ATOM   6685  H  HG3  . GLU A 1 20 ? -1.747  -4.355  -9.588  1.00 0.00 ? 20 GLU A HG3  6  
ATOM   6686  N  N    . THR A 1 21 ? -1.013  0.062   -7.959  1.00 0.00 ? 21 THR A N    6  
ATOM   6687  C  CA   . THR A 1 21 ? -0.314  0.852   -6.941  1.00 0.00 ? 21 THR A CA   6  
ATOM   6688  C  C    . THR A 1 21 ? -1.210  1.092   -5.722  1.00 0.00 ? 21 THR A C    6  
ATOM   6689  O  O    . THR A 1 21 ? -2.417  1.275   -5.860  1.00 0.00 ? 21 THR A O    6  
ATOM   6690  C  CB   . THR A 1 21 ? 0.132   2.196   -7.533  1.00 0.00 ? 21 THR A CB   6  
ATOM   6691  O  OG1  . THR A 1 21 ? 0.831   2.003   -8.751  1.00 0.00 ? 21 THR A OG1  6  
ATOM   6692  C  CG2  . THR A 1 21 ? 1.035   2.991   -6.612  1.00 0.00 ? 21 THR A CG2  6  
ATOM   6693  H  H    . THR A 1 21 ? -1.953  0.263   -8.155  1.00 0.00 ? 21 THR A H    6  
ATOM   6694  H  HA   . THR A 1 21 ? 0.559   0.296   -6.630  1.00 0.00 ? 21 THR A HA   6  
ATOM   6695  H  HB   . THR A 1 21 ? -0.743  2.796   -7.736  1.00 0.00 ? 21 THR A HB   6  
ATOM   6696  H  HG1  . THR A 1 21 ? 0.206   1.795   -9.451  1.00 0.00 ? 21 THR A HG1  6  
ATOM   6697  H  HG21 . THR A 1 21 ? 0.756   4.034   -6.647  1.00 0.00 ? 21 THR A HG21 6  
ATOM   6698  H  HG22 . THR A 1 21 ? 2.062   2.884   -6.931  1.00 0.00 ? 21 THR A HG22 6  
ATOM   6699  H  HG23 . THR A 1 21 ? 0.933   2.625   -5.602  1.00 0.00 ? 21 THR A HG23 6  
ATOM   6700  N  N    . TYR A 1 22 ? -0.609  1.096   -4.530  1.00 0.00 ? 22 TYR A N    6  
ATOM   6701  C  CA   . TYR A 1 22 ? -1.355  1.321   -3.289  1.00 0.00 ? 22 TYR A CA   6  
ATOM   6702  C  C    . TYR A 1 22 ? -1.080  2.717   -2.732  1.00 0.00 ? 22 TYR A C    6  
ATOM   6703  O  O    . TYR A 1 22 ? 0.049   3.203   -2.790  1.00 0.00 ? 22 TYR A O    6  
ATOM   6704  C  CB   . TYR A 1 22 ? -0.995  0.264   -2.238  1.00 0.00 ? 22 TYR A CB   6  
ATOM   6705  C  CG   . TYR A 1 22 ? -1.252  -1.159  -2.683  1.00 0.00 ? 22 TYR A CG   6  
ATOM   6706  C  CD1  . TYR A 1 22 ? -0.385  -1.799  -3.561  1.00 0.00 ? 22 TYR A CD1  6  
ATOM   6707  C  CD2  . TYR A 1 22 ? -2.356  -1.864  -2.222  1.00 0.00 ? 22 TYR A CD2  6  
ATOM   6708  C  CE1  . TYR A 1 22 ? -0.612  -3.099  -3.969  1.00 0.00 ? 22 TYR A CE1  6  
ATOM   6709  C  CE2  . TYR A 1 22 ? -2.591  -3.165  -2.623  1.00 0.00 ? 22 TYR A CE2  6  
ATOM   6710  C  CZ   . TYR A 1 22 ? -1.715  -3.779  -3.497  1.00 0.00 ? 22 TYR A CZ   6  
ATOM   6711  O  OH   . TYR A 1 22 ? -1.945  -5.074  -3.900  1.00 0.00 ? 22 TYR A OH   6  
ATOM   6712  H  H    . TYR A 1 22 ? 0.362   0.948   -4.483  1.00 0.00 ? 22 TYR A H    6  
ATOM   6713  H  HA   . TYR A 1 22 ? -2.408  1.242   -3.519  1.00 0.00 ? 22 TYR A HA   6  
ATOM   6714  H  HB2  . TYR A 1 22 ? 0.054   0.351   -1.997  1.00 0.00 ? 22 TYR A HB2  6  
ATOM   6715  H  HB3  . TYR A 1 22 ? -1.578  0.443   -1.346  1.00 0.00 ? 22 TYR A HB3  6  
ATOM   6716  H  HD1  . TYR A 1 22 ? 0.479   -1.265  -3.929  1.00 0.00 ? 22 TYR A HD1  6  
ATOM   6717  H  HD2  . TYR A 1 22 ? -3.041  -1.382  -1.538  1.00 0.00 ? 22 TYR A HD2  6  
ATOM   6718  H  HE1  . TYR A 1 22 ? 0.073   -3.576  -4.652  1.00 0.00 ? 22 TYR A HE1  6  
ATOM   6719  H  HE2  . TYR A 1 22 ? -3.455  -3.697  -2.254  1.00 0.00 ? 22 TYR A HE2  6  
ATOM   6720  H  HH   . TYR A 1 22 ? -2.122  -5.623  -3.133  1.00 0.00 ? 22 TYR A HH   6  
ATOM   6721  N  N    . PHE A 1 23 ? -2.121  3.359   -2.197  1.00 0.00 ? 23 PHE A N    6  
ATOM   6722  C  CA   . PHE A 1 23 ? -1.992  4.704   -1.633  1.00 0.00 ? 23 PHE A CA   6  
ATOM   6723  C  C    . PHE A 1 23 ? -2.468  4.746   -0.179  1.00 0.00 ? 23 PHE A C    6  
ATOM   6724  O  O    . PHE A 1 23 ? -3.197  3.860   0.270   1.00 0.00 ? 23 PHE A O    6  
ATOM   6725  C  CB   . PHE A 1 23 ? -2.782  5.713   -2.473  1.00 0.00 ? 23 PHE A CB   6  
ATOM   6726  C  CG   . PHE A 1 23 ? -2.353  5.765   -3.914  1.00 0.00 ? 23 PHE A CG   6  
ATOM   6727  C  CD1  . PHE A 1 23 ? -2.875  4.874   -4.839  1.00 0.00 ? 23 PHE A CD1  6  
ATOM   6728  C  CD2  . PHE A 1 23 ? -1.427  6.703   -4.343  1.00 0.00 ? 23 PHE A CD2  6  
ATOM   6729  C  CE1  . PHE A 1 23 ? -2.481  4.918   -6.163  1.00 0.00 ? 23 PHE A CE1  6  
ATOM   6730  C  CE2  . PHE A 1 23 ? -1.028  6.751   -5.666  1.00 0.00 ? 23 PHE A CE2  6  
ATOM   6731  C  CZ   . PHE A 1 23 ? -1.556  5.856   -6.577  1.00 0.00 ? 23 PHE A CZ   6  
ATOM   6732  H  H    . PHE A 1 23 ? -2.999  2.919   -2.183  1.00 0.00 ? 23 PHE A H    6  
ATOM   6733  H  HA   . PHE A 1 23 ? -0.946  4.970   -1.660  1.00 0.00 ? 23 PHE A HA   6  
ATOM   6734  H  HB2  . PHE A 1 23 ? -3.830  5.451   -2.448  1.00 0.00 ? 23 PHE A HB2  6  
ATOM   6735  H  HB3  . PHE A 1 23 ? -2.655  6.700   -2.051  1.00 0.00 ? 23 PHE A HB3  6  
ATOM   6736  H  HD1  . PHE A 1 23 ? -3.599  4.139   -4.518  1.00 0.00 ? 23 PHE A HD1  6  
ATOM   6737  H  HD2  . PHE A 1 23 ? -1.013  7.404   -3.632  1.00 0.00 ? 23 PHE A HD2  6  
ATOM   6738  H  HE1  . PHE A 1 23 ? -2.895  4.217   -6.872  1.00 0.00 ? 23 PHE A HE1  6  
ATOM   6739  H  HE2  . PHE A 1 23 ? -0.307  7.487   -5.987  1.00 0.00 ? 23 PHE A HE2  6  
ATOM   6740  H  HZ   . PHE A 1 23 ? -1.247  5.892   -7.611  1.00 0.00 ? 23 PHE A HZ   6  
ATOM   6741  N  N    . TYR A 1 24 ? -2.049  5.783   0.553   1.00 0.00 ? 24 TYR A N    6  
ATOM   6742  C  CA   . TYR A 1 24 ? -2.429  5.941   1.957   1.00 0.00 ? 24 TYR A CA   6  
ATOM   6743  C  C    . TYR A 1 24 ? -2.528  7.421   2.340   1.00 0.00 ? 24 TYR A C    6  
ATOM   6744  O  O    . TYR A 1 24 ? -1.679  8.220   1.955   1.00 0.00 ? 24 TYR A O    6  
ATOM   6745  C  CB   . TYR A 1 24 ? -1.413  5.234   2.859   1.00 0.00 ? 24 TYR A CB   6  
ATOM   6746  C  CG   . TYR A 1 24 ? -1.976  4.801   4.194   1.00 0.00 ? 24 TYR A CG   6  
ATOM   6747  C  CD1  . TYR A 1 24 ? -2.926  3.788   4.276   1.00 0.00 ? 24 TYR A CD1  6  
ATOM   6748  C  CD2  . TYR A 1 24 ? -1.559  5.404   5.374   1.00 0.00 ? 24 TYR A CD2  6  
ATOM   6749  C  CE1  . TYR A 1 24 ? -3.444  3.394   5.494   1.00 0.00 ? 24 TYR A CE1  6  
ATOM   6750  C  CE2  . TYR A 1 24 ? -2.072  5.015   6.595   1.00 0.00 ? 24 TYR A CE2  6  
ATOM   6751  C  CZ   . TYR A 1 24 ? -3.013  4.010   6.649   1.00 0.00 ? 24 TYR A CZ   6  
ATOM   6752  O  OH   . TYR A 1 24 ? -3.528  3.622   7.866   1.00 0.00 ? 24 TYR A OH   6  
ATOM   6753  H  H    . TYR A 1 24 ? -1.467  6.456   0.137   1.00 0.00 ? 24 TYR A H    6  
ATOM   6754  H  HA   . TYR A 1 24 ? -3.397  5.480   2.090   1.00 0.00 ? 24 TYR A HA   6  
ATOM   6755  H  HB2  . TYR A 1 24 ? -1.047  4.354   2.353   1.00 0.00 ? 24 TYR A HB2  6  
ATOM   6756  H  HB3  . TYR A 1 24 ? -0.584  5.903   3.048   1.00 0.00 ? 24 TYR A HB3  6  
ATOM   6757  H  HD1  . TYR A 1 24 ? -3.261  3.306   3.369   1.00 0.00 ? 24 TYR A HD1  6  
ATOM   6758  H  HD2  . TYR A 1 24 ? -0.821  6.192   5.327   1.00 0.00 ? 24 TYR A HD2  6  
ATOM   6759  H  HE1  . TYR A 1 24 ? -4.181  2.606   5.537   1.00 0.00 ? 24 TYR A HE1  6  
ATOM   6760  H  HE2  . TYR A 1 24 ? -1.735  5.498   7.500   1.00 0.00 ? 24 TYR A HE2  6  
ATOM   6761  H  HH   . TYR A 1 24 ? -4.116  4.304   8.199   1.00 0.00 ? 24 TYR A HH   6  
ATOM   6762  N  N    . PRO A 1 25 ? -3.570  7.807   3.106   1.00 0.00 ? 25 PRO A N    6  
ATOM   6763  C  CA   . PRO A 1 25 ? -3.763  9.201   3.531   1.00 0.00 ? 25 PRO A CA   6  
ATOM   6764  C  C    . PRO A 1 25 ? -2.725  9.654   4.556   1.00 0.00 ? 25 PRO A C    6  
ATOM   6765  O  O    . PRO A 1 25 ? -2.541  9.013   5.594   1.00 0.00 ? 25 PRO A O    6  
ATOM   6766  C  CB   . PRO A 1 25 ? -5.162  9.193   4.154   1.00 0.00 ? 25 PRO A CB   6  
ATOM   6767  C  CG   . PRO A 1 25 ? -5.369  7.788   4.604   1.00 0.00 ? 25 PRO A CG   6  
ATOM   6768  C  CD   . PRO A 1 25 ? -4.637  6.923   3.615   1.00 0.00 ? 25 PRO A CD   6  
ATOM   6769  H  HA   . PRO A 1 25 ? -3.748  9.875   2.688   1.00 0.00 ? 25 PRO A HA   6  
ATOM   6770  H  HB2  . PRO A 1 25 ? -5.194  9.884   4.985   1.00 0.00 ? 25 PRO A HB2  6  
ATOM   6771  H  HB3  . PRO A 1 25 ? -5.889  9.480   3.410   1.00 0.00 ? 25 PRO A HB3  6  
ATOM   6772  H  HG2  . PRO A 1 25 ? -4.958  7.655   5.594   1.00 0.00 ? 25 PRO A HG2  6  
ATOM   6773  H  HG3  . PRO A 1 25 ? -6.423  7.553   4.599   1.00 0.00 ? 25 PRO A HG3  6  
ATOM   6774  H  HD2  . PRO A 1 25 ? -4.218  6.058   4.110   1.00 0.00 ? 25 PRO A HD2  6  
ATOM   6775  H  HD3  . PRO A 1 25 ? -5.298  6.618   2.818   1.00 0.00 ? 25 PRO A HD3  6  
ATOM   6776  N  N    . CYS A 1 26 ? -2.053  10.766  4.260   1.00 0.00 ? 26 CYS A N    6  
ATOM   6777  C  CA   . CYS A 1 26 ? -1.037  11.310  5.156   1.00 0.00 ? 26 CYS A CA   6  
ATOM   6778  C  C    . CYS A 1 26 ? -1.587  12.496  5.948   1.00 0.00 ? 26 CYS A C    6  
ATOM   6779  O  O    . CYS A 1 26 ? -2.373  13.289  5.426   1.00 0.00 ? 26 CYS A O    6  
ATOM   6780  C  CB   . CYS A 1 26 ? 0.199   11.742  4.363   1.00 0.00 ? 26 CYS A CB   6  
ATOM   6781  S  SG   . CYS A 1 26 ? 1.765   11.576  5.279   1.00 0.00 ? 26 CYS A SG   6  
ATOM   6782  H  H    . CYS A 1 26 ? -2.246  11.236  3.419   1.00 0.00 ? 26 CYS A H    6  
ATOM   6783  H  HA   . CYS A 1 26 ? -0.755  10.530  5.844   1.00 0.00 ? 26 CYS A HA   6  
ATOM   6784  H  HB2  . CYS A 1 26 ? 0.275   11.137  3.470   1.00 0.00 ? 26 CYS A HB2  6  
ATOM   6785  H  HB3  . CYS A 1 26 ? 0.094   12.779  4.080   1.00 0.00 ? 26 CYS A HB3  6  
ATOM   6786  N  N    . PRO A 1 27 ? -1.174  12.632  7.226   1.00 0.00 ? 27 PRO A N    6  
ATOM   6787  C  CA   . PRO A 1 27 ? -1.622  13.728  8.098   1.00 0.00 ? 27 PRO A CA   6  
ATOM   6788  C  C    . PRO A 1 27 ? -1.343  15.114  7.510   1.00 0.00 ? 27 PRO A C    6  
ATOM   6789  O  O    . PRO A 1 27 ? -2.037  16.079  7.834   1.00 0.00 ? 27 PRO A O    6  
ATOM   6790  C  CB   . PRO A 1 27 ? -0.809  13.525  9.383   1.00 0.00 ? 27 PRO A CB   6  
ATOM   6791  C  CG   . PRO A 1 27 ? -0.421  12.088  9.367   1.00 0.00 ? 27 PRO A CG   6  
ATOM   6792  C  CD   . PRO A 1 27 ? -0.236  11.728  7.921   1.00 0.00 ? 27 PRO A CD   6  
ATOM   6793  H  HA   . PRO A 1 27 ? -2.674  13.643  8.321   1.00 0.00 ? 27 PRO A HA   6  
ATOM   6794  H  HB2  . PRO A 1 27 ? 0.059   14.169  9.368   1.00 0.00 ? 27 PRO A HB2  6  
ATOM   6795  H  HB3  . PRO A 1 27 ? -1.422  13.758  10.240  1.00 0.00 ? 27 PRO A HB3  6  
ATOM   6796  H  HG2  . PRO A 1 27 ? 0.503   11.952  9.909   1.00 0.00 ? 27 PRO A HG2  6  
ATOM   6797  H  HG3  . PRO A 1 27 ? -1.206  11.489  9.805   1.00 0.00 ? 27 PRO A HG3  6  
ATOM   6798  H  HD2  . PRO A 1 27 ? 0.783   11.912  7.612   1.00 0.00 ? 27 PRO A HD2  6  
ATOM   6799  H  HD3  . PRO A 1 27 ? -0.504  10.695  7.751   1.00 0.00 ? 27 PRO A HD3  6  
ATOM   6800  N  N    . CYS A 1 28 ? -0.326  15.211  6.649   1.00 0.00 ? 28 CYS A N    6  
ATOM   6801  C  CA   . CYS A 1 28 ? 0.033   16.484  6.025   1.00 0.00 ? 28 CYS A CA   6  
ATOM   6802  C  C    . CYS A 1 28 ? -1.036  16.940  5.026   1.00 0.00 ? 28 CYS A C    6  
ATOM   6803  O  O    . CYS A 1 28 ? -1.330  18.134  4.926   1.00 0.00 ? 28 CYS A O    6  
ATOM   6804  C  CB   . CYS A 1 28 ? 1.390   16.371  5.322   1.00 0.00 ? 28 CYS A CB   6  
ATOM   6805  S  SG   . CYS A 1 28 ? 1.407   15.229  3.901   1.00 0.00 ? 28 CYS A SG   6  
ATOM   6806  H  H    . CYS A 1 28 ? 0.194   14.409  6.427   1.00 0.00 ? 28 CYS A H    6  
ATOM   6807  H  HA   . CYS A 1 28 ? 0.109   17.222  6.811   1.00 0.00 ? 28 CYS A HA   6  
ATOM   6808  H  HB2  . CYS A 1 28 ? 1.683   17.346  4.963   1.00 0.00 ? 28 CYS A HB2  6  
ATOM   6809  H  HB3  . CYS A 1 28 ? 2.126   16.019  6.032   1.00 0.00 ? 28 CYS A HB3  6  
ATOM   6810  N  N    . GLY A 1 29 ? -1.605  15.985  4.286   1.00 0.00 ? 29 GLY A N    6  
ATOM   6811  C  CA   . GLY A 1 29 ? -2.627  16.305  3.300   1.00 0.00 ? 29 GLY A CA   6  
ATOM   6812  C  C    . GLY A 1 29 ? -2.543  15.419  2.068   1.00 0.00 ? 29 GLY A C    6  
ATOM   6813  O  O    . GLY A 1 29 ? -3.567  14.995  1.533   1.00 0.00 ? 29 GLY A O    6  
ATOM   6814  H  H    . GLY A 1 29 ? -1.325  15.053  4.408   1.00 0.00 ? 29 GLY A H    6  
ATOM   6815  H  HA2  . GLY A 1 29 ? -3.599  16.181  3.754   1.00 0.00 ? 29 GLY A HA2  6  
ATOM   6816  H  HA3  . GLY A 1 29 ? -2.511  17.335  2.998   1.00 0.00 ? 29 GLY A HA3  6  
ATOM   6817  N  N    . ASP A 1 30 ? -1.317  15.139  1.623   1.00 0.00 ? 30 ASP A N    6  
ATOM   6818  C  CA   . ASP A 1 30 ? -1.092  14.295  0.451   1.00 0.00 ? 30 ASP A CA   6  
ATOM   6819  C  C    . ASP A 1 30 ? -1.335  12.818  0.786   1.00 0.00 ? 30 ASP A C    6  
ATOM   6820  O  O    . ASP A 1 30 ? -1.748  12.485  1.899   1.00 0.00 ? 30 ASP A O    6  
ATOM   6821  C  CB   . ASP A 1 30 ? 0.339   14.494  -0.064  1.00 0.00 ? 30 ASP A CB   6  
ATOM   6822  C  CG   . ASP A 1 30 ? 0.417   14.527  -1.578  1.00 0.00 ? 30 ASP A CG   6  
ATOM   6823  O  OD1  . ASP A 1 30 ? 0.407   13.441  -2.199  1.00 0.00 ? 30 ASP A OD1  6  
ATOM   6824  O  OD2  . ASP A 1 30 ? 0.486   15.637  -2.145  1.00 0.00 ? 30 ASP A OD2  6  
ATOM   6825  H  H    . ASP A 1 30 ? -0.543  15.507  2.099   1.00 0.00 ? 30 ASP A H    6  
ATOM   6826  H  HA   . ASP A 1 30 ? -1.789  14.600  -0.315  1.00 0.00 ? 30 ASP A HA   6  
ATOM   6827  H  HB2  . ASP A 1 30 ? 0.721   15.430  0.315   1.00 0.00 ? 30 ASP A HB2  6  
ATOM   6828  H  HB3  . ASP A 1 30 ? 0.959   13.686  0.293   1.00 0.00 ? 30 ASP A HB3  6  
ATOM   6829  N  N    . ASN A 1 31 ? -1.086  11.935  -0.185  1.00 0.00 ? 31 ASN A N    6  
ATOM   6830  C  CA   . ASN A 1 31 ? -1.286  10.502  0.016   1.00 0.00 ? 31 ASN A CA   6  
ATOM   6831  C  C    . ASN A 1 31 ? -0.061  9.700   -0.425  1.00 0.00 ? 31 ASN A C    6  
ATOM   6832  O  O    . ASN A 1 31 ? 0.473   9.915   -1.516  1.00 0.00 ? 31 ASN A O    6  
ATOM   6833  C  CB   . ASN A 1 31 ? -2.520  10.019  -0.754  1.00 0.00 ? 31 ASN A CB   6  
ATOM   6834  C  CG   . ASN A 1 31 ? -3.802  10.696  -0.302  1.00 0.00 ? 31 ASN A CG   6  
ATOM   6835  O  OD1  . ASN A 1 31 ? -4.041  11.866  -0.604  1.00 0.00 ? 31 ASN A OD1  6  
ATOM   6836  N  ND2  . ASN A 1 31 ? -4.641  9.961   0.424   1.00 0.00 ? 31 ASN A ND2  6  
ATOM   6837  H  H    . ASN A 1 31 ? -0.761  12.253  -1.054  1.00 0.00 ? 31 ASN A H    6  
ATOM   6838  H  HA   . ASN A 1 31 ? -1.446  10.337  1.071   1.00 0.00 ? 31 ASN A HA   6  
ATOM   6839  H  HB2  . ASN A 1 31 ? -2.382  10.225  -1.806  1.00 0.00 ? 31 ASN A HB2  6  
ATOM   6840  H  HB3  . ASN A 1 31 ? -2.628  8.955   -0.613  1.00 0.00 ? 31 ASN A HB3  6  
ATOM   6841  H  HD21 . ASN A 1 31 ? -4.391  9.036   0.627   1.00 0.00 ? 31 ASN A HD21 6  
ATOM   6842  H  HD22 . ASN A 1 31 ? -5.479  10.375  0.721   1.00 0.00 ? 31 ASN A HD22 6  
ATOM   6843  N  N    . PHE A 1 32 ? 0.367   8.763   0.427   1.00 0.00 ? 32 PHE A N    6  
ATOM   6844  C  CA   . PHE A 1 32 ? 1.519   7.907   0.132   1.00 0.00 ? 32 PHE A CA   6  
ATOM   6845  C  C    . PHE A 1 32 ? 1.246   7.037   -1.096  1.00 0.00 ? 32 PHE A C    6  
ATOM   6846  O  O    . PHE A 1 32 ? 0.094   6.863   -1.496  1.00 0.00 ? 32 PHE A O    6  
ATOM   6847  C  CB   . PHE A 1 32 ? 1.828   6.996   1.326   1.00 0.00 ? 32 PHE A CB   6  
ATOM   6848  C  CG   . PHE A 1 32 ? 2.474   7.693   2.492   1.00 0.00 ? 32 PHE A CG   6  
ATOM   6849  C  CD1  . PHE A 1 32 ? 3.734   8.256   2.373   1.00 0.00 ? 32 PHE A CD1  6  
ATOM   6850  C  CD2  . PHE A 1 32 ? 1.822   7.772   3.713   1.00 0.00 ? 32 PHE A CD2  6  
ATOM   6851  C  CE1  . PHE A 1 32 ? 4.332   8.883   3.449   1.00 0.00 ? 32 PHE A CE1  6  
ATOM   6852  C  CE2  . PHE A 1 32 ? 2.414   8.401   4.791   1.00 0.00 ? 32 PHE A CE2  6  
ATOM   6853  C  CZ   . PHE A 1 32 ? 3.672   8.957   4.659   1.00 0.00 ? 32 PHE A CZ   6  
ATOM   6854  H  H    . PHE A 1 32 ? -0.113  8.637   1.273   1.00 0.00 ? 32 PHE A H    6  
ATOM   6855  H  HA   . PHE A 1 32 ? 2.371   8.540   -0.063  1.00 0.00 ? 32 PHE A HA   6  
ATOM   6856  H  HB2  . PHE A 1 32 ? 0.908   6.554   1.675   1.00 0.00 ? 32 PHE A HB2  6  
ATOM   6857  H  HB3  . PHE A 1 32 ? 2.494   6.210   1.001   1.00 0.00 ? 32 PHE A HB3  6  
ATOM   6858  H  HD1  . PHE A 1 32 ? 4.252   8.203   1.427   1.00 0.00 ? 32 PHE A HD1  6  
ATOM   6859  H  HD2  . PHE A 1 32 ? 0.838   7.339   3.819   1.00 0.00 ? 32 PHE A HD2  6  
ATOM   6860  H  HE1  . PHE A 1 32 ? 5.314   9.318   3.344   1.00 0.00 ? 32 PHE A HE1  6  
ATOM   6861  H  HE2  . PHE A 1 32 ? 1.895   8.456   5.738   1.00 0.00 ? 32 PHE A HE2  6  
ATOM   6862  H  HZ   . PHE A 1 32 ? 4.138   9.447   5.502   1.00 0.00 ? 32 PHE A HZ   6  
ATOM   6863  N  N    . SER A 1 33 ? 2.308   6.482   -1.681  1.00 0.00 ? 33 SER A N    6  
ATOM   6864  C  CA   . SER A 1 33 ? 2.169   5.623   -2.858  1.00 0.00 ? 33 SER A CA   6  
ATOM   6865  C  C    . SER A 1 33 ? 3.227   4.519   -2.876  1.00 0.00 ? 33 SER A C    6  
ATOM   6866  O  O    . SER A 1 33 ? 4.393   4.756   -2.551  1.00 0.00 ? 33 SER A O    6  
ATOM   6867  C  CB   . SER A 1 33 ? 2.261   6.451   -4.145  1.00 0.00 ? 33 SER A CB   6  
ATOM   6868  O  OG   . SER A 1 33 ? 3.123   7.567   -3.987  1.00 0.00 ? 33 SER A OG   6  
ATOM   6869  H  H    . SER A 1 33 ? 3.202   6.649   -1.314  1.00 0.00 ? 33 SER A H    6  
ATOM   6870  H  HA   . SER A 1 33 ? 1.194   5.162   -2.807  1.00 0.00 ? 33 SER A HA   6  
ATOM   6871  H  HB2  . SER A 1 33 ? 2.643   5.830   -4.942  1.00 0.00 ? 33 SER A HB2  6  
ATOM   6872  H  HB3  . SER A 1 33 ? 1.277   6.808   -4.410  1.00 0.00 ? 33 SER A HB3  6  
ATOM   6873  H  HG   . SER A 1 33 ? 4.036   7.267   -3.970  1.00 0.00 ? 33 SER A HG   6  
ATOM   6874  N  N    . ILE A 1 34 ? 2.807   3.313   -3.267  1.00 0.00 ? 34 ILE A N    6  
ATOM   6875  C  CA   . ILE A 1 34 ? 3.706   2.162   -3.343  1.00 0.00 ? 34 ILE A CA   6  
ATOM   6876  C  C    . ILE A 1 34 ? 3.228   1.168   -4.410  1.00 0.00 ? 34 ILE A C    6  
ATOM   6877  O  O    . ILE A 1 34 ? 2.099   0.675   -4.351  1.00 0.00 ? 34 ILE A O    6  
ATOM   6878  C  CB   . ILE A 1 34 ? 3.831   1.443   -1.977  1.00 0.00 ? 34 ILE A CB   6  
ATOM   6879  C  CG1  . ILE A 1 34 ? 4.826   0.282   -2.067  1.00 0.00 ? 34 ILE A CG1  6  
ATOM   6880  C  CG2  . ILE A 1 34 ? 2.473   0.947   -1.496  1.00 0.00 ? 34 ILE A CG2  6  
ATOM   6881  C  CD1  . ILE A 1 34 ? 5.702   0.143   -0.841  1.00 0.00 ? 34 ILE A CD1  6  
ATOM   6882  H  H    . ILE A 1 34 ? 1.865   3.195   -3.516  1.00 0.00 ? 34 ILE A H    6  
ATOM   6883  H  HA   . ILE A 1 34 ? 4.685   2.526   -3.625  1.00 0.00 ? 34 ILE A HA   6  
ATOM   6884  H  HB   . ILE A 1 34 ? 4.197   2.159   -1.256  1.00 0.00 ? 34 ILE A HB   6  
ATOM   6885  H  HG12 . ILE A 1 34 ? 4.284   -0.643  -2.191  1.00 0.00 ? 34 ILE A HG12 6  
ATOM   6886  H  HG13 . ILE A 1 34 ? 5.472   0.432   -2.919  1.00 0.00 ? 34 ILE A HG13 6  
ATOM   6887  H  HG21 . ILE A 1 34 ? 1.691   1.511   -1.984  1.00 0.00 ? 34 ILE A HG21 6  
ATOM   6888  H  HG22 . ILE A 1 34 ? 2.399   1.080   -0.427  1.00 0.00 ? 34 ILE A HG22 6  
ATOM   6889  H  HG23 . ILE A 1 34 ? 2.365   -0.099  -1.738  1.00 0.00 ? 34 ILE A HG23 6  
ATOM   6890  H  HD11 . ILE A 1 34 ? 5.634   -0.866  -0.461  1.00 0.00 ? 34 ILE A HD11 6  
ATOM   6891  H  HD12 . ILE A 1 34 ? 5.371   0.836   -0.081  1.00 0.00 ? 34 ILE A HD12 6  
ATOM   6892  H  HD13 . ILE A 1 34 ? 6.726   0.361   -1.103  1.00 0.00 ? 34 ILE A HD13 6  
ATOM   6893  N  N    . THR A 1 35 ? 4.092   0.886   -5.388  1.00 0.00 ? 35 THR A N    6  
ATOM   6894  C  CA   . THR A 1 35 ? 3.755   -0.043  -6.471  1.00 0.00 ? 35 THR A CA   6  
ATOM   6895  C  C    . THR A 1 35 ? 3.726   -1.486  -5.969  1.00 0.00 ? 35 THR A C    6  
ATOM   6896  O  O    . THR A 1 35 ? 4.460   -1.848  -5.048  1.00 0.00 ? 35 THR A O    6  
ATOM   6897  C  CB   . THR A 1 35 ? 4.756   0.086   -7.629  1.00 0.00 ? 35 THR A CB   6  
ATOM   6898  O  OG1  . THR A 1 35 ? 6.058   -0.302  -7.219  1.00 0.00 ? 35 THR A OG1  6  
ATOM   6899  C  CG2  . THR A 1 35 ? 4.848   1.488   -8.198  1.00 0.00 ? 35 THR A CG2  6  
ATOM   6900  H  H    . THR A 1 35 ? 4.974   1.313   -5.383  1.00 0.00 ? 35 THR A H    6  
ATOM   6901  H  HA   . THR A 1 35 ? 2.771   0.215   -6.832  1.00 0.00 ? 35 THR A HA   6  
ATOM   6902  H  HB   . THR A 1 35 ? 4.447   -0.572  -8.428  1.00 0.00 ? 35 THR A HB   6  
ATOM   6903  H  HG1  . THR A 1 35 ? 6.455   0.393   -6.689  1.00 0.00 ? 35 THR A HG1  6  
ATOM   6904  H  HG21 . THR A 1 35 ? 3.854   1.876   -8.364  1.00 0.00 ? 35 THR A HG21 6  
ATOM   6905  H  HG22 . THR A 1 35 ? 5.385   1.461   -9.135  1.00 0.00 ? 35 THR A HG22 6  
ATOM   6906  H  HG23 . THR A 1 35 ? 5.372   2.126   -7.502  1.00 0.00 ? 35 THR A HG23 6  
ATOM   6907  N  N    . LYS A 1 36 ? 2.879   -2.308  -6.587  1.00 0.00 ? 36 LYS A N    6  
ATOM   6908  C  CA   . LYS A 1 36 ? 2.762   -3.717  -6.209  1.00 0.00 ? 36 LYS A CA   6  
ATOM   6909  C  C    . LYS A 1 36 ? 4.101   -4.438  -6.386  1.00 0.00 ? 36 LYS A C    6  
ATOM   6910  O  O    . LYS A 1 36 ? 4.459   -5.301  -5.581  1.00 0.00 ? 36 LYS A O    6  
ATOM   6911  C  CB   . LYS A 1 36 ? 1.677   -4.410  -7.037  1.00 0.00 ? 36 LYS A CB   6  
ATOM   6912  C  CG   . LYS A 1 36 ? 1.493   -5.882  -6.692  1.00 0.00 ? 36 LYS A CG   6  
ATOM   6913  C  CD   . LYS A 1 36 ? 0.377   -6.086  -5.681  1.00 0.00 ? 36 LYS A CD   6  
ATOM   6914  C  CE   . LYS A 1 36 ? 0.075   -7.562  -5.477  1.00 0.00 ? 36 LYS A CE   6  
ATOM   6915  N  NZ   . LYS A 1 36 ? -1.139  -7.772  -4.641  1.00 0.00 ? 36 LYS A NZ   6  
ATOM   6916  H  H    . LYS A 1 36 ? 2.323   -1.962  -7.319  1.00 0.00 ? 36 LYS A H    6  
ATOM   6917  H  HA   . LYS A 1 36 ? 2.485   -3.755  -5.165  1.00 0.00 ? 36 LYS A HA   6  
ATOM   6918  H  HB2  . LYS A 1 36 ? 0.737   -3.904  -6.872  1.00 0.00 ? 36 LYS A HB2  6  
ATOM   6919  H  HB3  . LYS A 1 36 ? 1.934   -4.337  -8.083  1.00 0.00 ? 36 LYS A HB3  6  
ATOM   6920  H  HG2  . LYS A 1 36 ? 1.254   -6.426  -7.592  1.00 0.00 ? 36 LYS A HG2  6  
ATOM   6921  H  HG3  . LYS A 1 36 ? 2.416   -6.262  -6.275  1.00 0.00 ? 36 LYS A HG3  6  
ATOM   6922  H  HD2  . LYS A 1 36 ? 0.676   -5.655  -4.738  1.00 0.00 ? 36 LYS A HD2  6  
ATOM   6923  H  HD3  . LYS A 1 36 ? -0.513  -5.591  -6.040  1.00 0.00 ? 36 LYS A HD3  6  
ATOM   6924  H  HE2  . LYS A 1 36 ? -0.081  -8.021  -6.443  1.00 0.00 ? 36 LYS A HE2  6  
ATOM   6925  H  HE3  . LYS A 1 36 ? 0.922   -8.025  -4.993  1.00 0.00 ? 36 LYS A HE3  6  
ATOM   6926  H  HZ1  . LYS A 1 36 ? -0.908  -7.638  -3.635  1.00 0.00 ? 36 LYS A HZ1  6  
ATOM   6927  H  HZ2  . LYS A 1 36 ? -1.502  -8.737  -4.776  1.00 0.00 ? 36 LYS A HZ2  6  
ATOM   6928  H  HZ3  . LYS A 1 36 ? -1.881  -7.094  -4.907  1.00 0.00 ? 36 LYS A HZ3  6  
ATOM   6929  N  N    . GLU A 1 37 ? 4.835   -4.071  -7.441  1.00 0.00 ? 37 GLU A N    6  
ATOM   6930  C  CA   . GLU A 1 37 ? 6.139   -4.669  -7.723  1.00 0.00 ? 37 GLU A CA   6  
ATOM   6931  C  C    . GLU A 1 37 ? 7.114   -4.422  -6.571  1.00 0.00 ? 37 GLU A C    6  
ATOM   6932  O  O    . GLU A 1 37 ? 7.906   -5.299  -6.222  1.00 0.00 ? 37 GLU A O    6  
ATOM   6933  C  CB   . GLU A 1 37 ? 6.713   -4.099  -9.023  1.00 0.00 ? 37 GLU A CB   6  
ATOM   6934  C  CG   . GLU A 1 37 ? 7.819   -4.951  -9.632  1.00 0.00 ? 37 GLU A CG   6  
ATOM   6935  C  CD   . GLU A 1 37 ? 8.699   -4.171  -10.594 1.00 0.00 ? 37 GLU A CD   6  
ATOM   6936  O  OE1  . GLU A 1 37 ? 9.250   -3.126  -10.186 1.00 0.00 ? 37 GLU A OE1  6  
ATOM   6937  O  OE2  . GLU A 1 37 ? 8.839   -4.609  -11.755 1.00 0.00 ? 37 GLU A OE2  6  
ATOM   6938  H  H    . GLU A 1 37 ? 4.495   -3.372  -8.037  1.00 0.00 ? 37 GLU A H    6  
ATOM   6939  H  HA   . GLU A 1 37 ? 5.997   -5.735  -7.838  1.00 0.00 ? 37 GLU A HA   6  
ATOM   6940  H  HB2  . GLU A 1 37 ? 5.917   -4.010  -9.747  1.00 0.00 ? 37 GLU A HB2  6  
ATOM   6941  H  HB3  . GLU A 1 37 ? 7.115   -3.116  -8.823  1.00 0.00 ? 37 GLU A HB3  6  
ATOM   6942  H  HG2  . GLU A 1 37 ? 8.439   -5.336  -8.836  1.00 0.00 ? 37 GLU A HG2  6  
ATOM   6943  H  HG3  . GLU A 1 37 ? 7.369   -5.775  -10.166 1.00 0.00 ? 37 GLU A HG3  6  
ATOM   6944  N  N    . ASP A 1 38 ? 7.046   -3.223  -5.979  1.00 0.00 ? 38 ASP A N    6  
ATOM   6945  C  CA   . ASP A 1 38 ? 7.916   -2.869  -4.858  1.00 0.00 ? 38 ASP A CA   6  
ATOM   6946  C  C    . ASP A 1 38 ? 7.765   -3.876  -3.722  1.00 0.00 ? 38 ASP A C    6  
ATOM   6947  O  O    . ASP A 1 38 ? 8.756   -4.361  -3.180  1.00 0.00 ? 38 ASP A O    6  
ATOM   6948  C  CB   . ASP A 1 38 ? 7.594   -1.458  -4.340  1.00 0.00 ? 38 ASP A CB   6  
ATOM   6949  C  CG   . ASP A 1 38 ? 8.388   -0.365  -5.041  1.00 0.00 ? 38 ASP A CG   6  
ATOM   6950  O  OD1  . ASP A 1 38 ? 8.835   -0.586  -6.188  1.00 0.00 ? 38 ASP A OD1  6  
ATOM   6951  O  OD2  . ASP A 1 38 ? 8.561   0.718   -4.440  1.00 0.00 ? 38 ASP A OD2  6  
ATOM   6952  H  H    . ASP A 1 38 ? 6.389   -2.569  -6.298  1.00 0.00 ? 38 ASP A H    6  
ATOM   6953  H  HA   . ASP A 1 38 ? 8.938   -2.891  -5.210  1.00 0.00 ? 38 ASP A HA   6  
ATOM   6954  H  HB2  . ASP A 1 38 ? 6.543   -1.260  -4.486  1.00 0.00 ? 38 ASP A HB2  6  
ATOM   6955  H  HB3  . ASP A 1 38 ? 7.817   -1.415  -3.282  1.00 0.00 ? 38 ASP A HB3  6  
ATOM   6956  N  N    . LEU A 1 39 ? 6.517   -4.191  -3.376  1.00 0.00 ? 39 LEU A N    6  
ATOM   6957  C  CA   . LEU A 1 39 ? 6.234   -5.144  -2.305  1.00 0.00 ? 39 LEU A CA   6  
ATOM   6958  C  C    . LEU A 1 39 ? 6.796   -6.528  -2.634  1.00 0.00 ? 39 LEU A C    6  
ATOM   6959  O  O    . LEU A 1 39 ? 7.436   -7.158  -1.793  1.00 0.00 ? 39 LEU A O    6  
ATOM   6960  C  CB   . LEU A 1 39 ? 4.726   -5.231  -2.047  1.00 0.00 ? 39 LEU A CB   6  
ATOM   6961  C  CG   . LEU A 1 39 ? 4.036   -3.889  -1.776  1.00 0.00 ? 39 LEU A CG   6  
ATOM   6962  C  CD1  . LEU A 1 39 ? 2.543   -3.986  -2.056  1.00 0.00 ? 39 LEU A CD1  6  
ATOM   6963  C  CD2  . LEU A 1 39 ? 4.286   -3.437  -0.345  1.00 0.00 ? 39 LEU A CD2  6  
ATOM   6964  H  H    . LEU A 1 39 ? 5.769   -3.770  -3.853  1.00 0.00 ? 39 LEU A H    6  
ATOM   6965  H  HA   . LEU A 1 39 ? 6.719   -4.783  -1.411  1.00 0.00 ? 39 LEU A HA   6  
ATOM   6966  H  HB2  . LEU A 1 39 ? 4.260   -5.686  -2.910  1.00 0.00 ? 39 LEU A HB2  6  
ATOM   6967  H  HB3  . LEU A 1 39 ? 4.565   -5.870  -1.193  1.00 0.00 ? 39 LEU A HB3  6  
ATOM   6968  H  HG   . LEU A 1 39 ? 4.447   -3.142  -2.440  1.00 0.00 ? 39 LEU A HG   6  
ATOM   6969  H  HD11 . LEU A 1 39 ? 2.121   -4.796  -1.478  1.00 0.00 ? 39 LEU A HD11 6  
ATOM   6970  H  HD12 . LEU A 1 39 ? 2.386   -4.175  -3.108  1.00 0.00 ? 39 LEU A HD12 6  
ATOM   6971  H  HD13 . LEU A 1 39 ? 2.064   -3.059  -1.782  1.00 0.00 ? 39 LEU A HD13 6  
ATOM   6972  H  HD21 . LEU A 1 39 ? 4.195   -2.363  -0.285  1.00 0.00 ? 39 LEU A HD21 6  
ATOM   6973  H  HD22 . LEU A 1 39 ? 5.281   -3.731  -0.044  1.00 0.00 ? 39 LEU A HD22 6  
ATOM   6974  H  HD23 . LEU A 1 39 ? 3.561   -3.898  0.311   1.00 0.00 ? 39 LEU A HD23 6  
ATOM   6975  N  N    . GLU A 1 40 ? 6.567   -6.995  -3.863  1.00 0.00 ? 40 GLU A N    6  
ATOM   6976  C  CA   . GLU A 1 40 ? 7.067   -8.303  -4.289  1.00 0.00 ? 40 GLU A CA   6  
ATOM   6977  C  C    . GLU A 1 40 ? 8.597   -8.366  -4.212  1.00 0.00 ? 40 GLU A C    6  
ATOM   6978  O  O    . GLU A 1 40 ? 9.166   -9.432  -3.970  1.00 0.00 ? 40 GLU A O    6  
ATOM   6979  C  CB   . GLU A 1 40 ? 6.598   -8.619  -5.711  1.00 0.00 ? 40 GLU A CB   6  
ATOM   6980  C  CG   . GLU A 1 40 ? 5.093   -8.818  -5.824  1.00 0.00 ? 40 GLU A CG   6  
ATOM   6981  C  CD   . GLU A 1 40 ? 4.654   -9.193  -7.225  1.00 0.00 ? 40 GLU A CD   6  
ATOM   6982  O  OE1  . GLU A 1 40 ? 4.394   -8.274  -8.031  1.00 0.00 ? 40 GLU A OE1  6  
ATOM   6983  O  OE2  . GLU A 1 40 ? 4.567   -10.405 -7.516  1.00 0.00 ? 40 GLU A OE2  6  
ATOM   6984  H  H    . GLU A 1 40 ? 6.056   -6.447  -4.497  1.00 0.00 ? 40 GLU A H    6  
ATOM   6985  H  HA   . GLU A 1 40 ? 6.660   -9.044  -3.616  1.00 0.00 ? 40 GLU A HA   6  
ATOM   6986  H  HB2  . GLU A 1 40 ? 6.882   -7.804  -6.361  1.00 0.00 ? 40 GLU A HB2  6  
ATOM   6987  H  HB3  . GLU A 1 40 ? 7.085   -9.523  -6.047  1.00 0.00 ? 40 GLU A HB3  6  
ATOM   6988  H  HG2  . GLU A 1 40 ? 4.797   -9.606  -5.149  1.00 0.00 ? 40 GLU A HG2  6  
ATOM   6989  H  HG3  . GLU A 1 40 ? 4.601   -7.899  -5.543  1.00 0.00 ? 40 GLU A HG3  6  
ATOM   6990  N  N    . ASN A 1 41 ? 9.256   -7.224  -4.422  1.00 0.00 ? 41 ASN A N    6  
ATOM   6991  C  CA   . ASN A 1 41 ? 10.716  -7.159  -4.376  1.00 0.00 ? 41 ASN A CA   6  
ATOM   6992  C  C    . ASN A 1 41 ? 11.238  -6.995  -2.944  1.00 0.00 ? 41 ASN A C    6  
ATOM   6993  O  O    . ASN A 1 41 ? 12.285  -7.545  -2.599  1.00 0.00 ? 41 ASN A O    6  
ATOM   6994  C  CB   . ASN A 1 41 ? 11.222  -6.004  -5.246  1.00 0.00 ? 41 ASN A CB   6  
ATOM   6995  C  CG   . ASN A 1 41 ? 11.513  -6.437  -6.670  1.00 0.00 ? 41 ASN A CG   6  
ATOM   6996  O  OD1  . ASN A 1 41 ? 10.597  -6.672  -7.459  1.00 0.00 ? 41 ASN A OD1  6  
ATOM   6997  N  ND2  . ASN A 1 41 ? 12.793  -6.549  -7.008  1.00 0.00 ? 41 ASN A ND2  6  
ATOM   6998  H  H    . ASN A 1 41 ? 8.749   -6.407  -4.614  1.00 0.00 ? 41 ASN A H    6  
ATOM   6999  H  HA   . ASN A 1 41 ? 11.097  -8.087  -4.777  1.00 0.00 ? 41 ASN A HA   6  
ATOM   7000  H  HB2  . ASN A 1 41 ? 10.477  -5.224  -5.272  1.00 0.00 ? 41 ASN A HB2  6  
ATOM   7001  H  HB3  . ASN A 1 41 ? 12.132  -5.610  -4.816  1.00 0.00 ? 41 ASN A HB3  6  
ATOM   7002  H  HD21 . ASN A 1 41 ? 13.472  -6.349  -6.329  1.00 0.00 ? 41 ASN A HD21 6  
ATOM   7003  H  HD22 . ASN A 1 41 ? 13.007  -6.830  -7.922  1.00 0.00 ? 41 ASN A HD22 6  
ATOM   7004  N  N    . GLY A 1 42 ? 10.515  -6.228  -2.121  1.00 0.00 ? 42 GLY A N    6  
ATOM   7005  C  CA   . GLY A 1 42 ? 10.933  -5.995  -0.747  1.00 0.00 ? 42 GLY A CA   6  
ATOM   7006  C  C    . GLY A 1 42 ? 10.712  -4.552  -0.300  1.00 0.00 ? 42 GLY A C    6  
ATOM   7007  O  O    . GLY A 1 42 ? 10.788  -4.255  0.893   1.00 0.00 ? 42 GLY A O    6  
ATOM   7008  H  H    . GLY A 1 42 ? 9.693   -5.805  -2.451  1.00 0.00 ? 42 GLY A H    6  
ATOM   7009  H  HA2  . GLY A 1 42 ? 10.371  -6.651  -0.097  1.00 0.00 ? 42 GLY A HA2  6  
ATOM   7010  H  HA3  . GLY A 1 42 ? 11.982  -6.232  -0.657  1.00 0.00 ? 42 GLY A HA3  6  
ATOM   7011  N  N    . GLU A 1 43 ? 10.433  -3.658  -1.263  1.00 0.00 ? 43 GLU A N    6  
ATOM   7012  C  CA   . GLU A 1 43 ? 10.193  -2.246  -0.972  1.00 0.00 ? 43 GLU A CA   6  
ATOM   7013  C  C    . GLU A 1 43 ? 8.844   -2.055  -0.279  1.00 0.00 ? 43 GLU A C    6  
ATOM   7014  O  O    . GLU A 1 43 ? 7.849   -1.703  -0.909  1.00 0.00 ? 43 GLU A O    6  
ATOM   7015  C  CB   . GLU A 1 43 ? 10.228  -1.416  -2.263  1.00 0.00 ? 43 GLU A CB   6  
ATOM   7016  C  CG   . GLU A 1 43 ? 11.626  -1.094  -2.761  1.00 0.00 ? 43 GLU A CG   6  
ATOM   7017  C  CD   . GLU A 1 43 ? 11.690  0.249   -3.464  1.00 0.00 ? 43 GLU A CD   6  
ATOM   7018  O  OE1  . GLU A 1 43 ? 11.784  1.281   -2.766  1.00 0.00 ? 43 GLU A OE1  6  
ATOM   7019  O  OE2  . GLU A 1 43 ? 11.645  0.269   -4.711  1.00 0.00 ? 43 GLU A OE2  6  
ATOM   7020  H  H    . GLU A 1 43 ? 10.382  -3.957  -2.192  1.00 0.00 ? 43 GLU A H    6  
ATOM   7021  H  HA   . GLU A 1 43 ? 10.977  -1.905  -0.313  1.00 0.00 ? 43 GLU A HA   6  
ATOM   7022  H  HB2  . GLU A 1 43 ? 9.711   -1.957  -3.041  1.00 0.00 ? 43 GLU A HB2  6  
ATOM   7023  H  HB3  . GLU A 1 43 ? 9.710   -0.483  -2.087  1.00 0.00 ? 43 GLU A HB3  6  
ATOM   7024  H  HG2  . GLU A 1 43 ? 12.302  -1.077  -1.919  1.00 0.00 ? 43 GLU A HG2  6  
ATOM   7025  H  HG3  . GLU A 1 43 ? 11.934  -1.864  -3.454  1.00 0.00 ? 43 GLU A HG3  6  
ATOM   7026  N  N    . ASP A 1 44 ? 8.825   -2.288  1.022   1.00 0.00 ? 44 ASP A N    6  
ATOM   7027  C  CA   . ASP A 1 44 ? 7.609   -2.141  1.822   1.00 0.00 ? 44 ASP A CA   6  
ATOM   7028  C  C    . ASP A 1 44 ? 7.586   -0.775  2.516   1.00 0.00 ? 44 ASP A C    6  
ATOM   7029  O  O    . ASP A 1 44 ? 7.220   -0.662  3.689   1.00 0.00 ? 44 ASP A O    6  
ATOM   7030  C  CB   . ASP A 1 44 ? 7.503   -3.277  2.851   1.00 0.00 ? 44 ASP A CB   6  
ATOM   7031  C  CG   . ASP A 1 44 ? 8.740   -3.437  3.728   1.00 0.00 ? 44 ASP A CG   6  
ATOM   7032  O  OD1  . ASP A 1 44 ? 9.527   -2.475  3.854   1.00 0.00 ? 44 ASP A OD1  6  
ATOM   7033  O  OD2  . ASP A 1 44 ? 8.918   -4.536  4.292   1.00 0.00 ? 44 ASP A OD2  6  
ATOM   7034  H  H    . ASP A 1 44 ? 9.649   -2.565  1.459   1.00 0.00 ? 44 ASP A H    6  
ATOM   7035  H  HA   . ASP A 1 44 ? 6.761   -2.204  1.152   1.00 0.00 ? 44 ASP A HA   6  
ATOM   7036  H  HB2  . ASP A 1 44 ? 6.656   -3.091  3.492   1.00 0.00 ? 44 ASP A HB2  6  
ATOM   7037  H  HB3  . ASP A 1 44 ? 7.345   -4.205  2.321   1.00 0.00 ? 44 ASP A HB3  6  
ATOM   7038  N  N    . VAL A 1 45 ? 7.989   0.264   1.779   1.00 0.00 ? 45 VAL A N    6  
ATOM   7039  C  CA   . VAL A 1 45 ? 8.025   1.625   2.313   1.00 0.00 ? 45 VAL A CA   6  
ATOM   7040  C  C    . VAL A 1 45 ? 7.369   2.622   1.355   1.00 0.00 ? 45 VAL A C    6  
ATOM   7041  O  O    . VAL A 1 45 ? 7.585   2.570   0.143   1.00 0.00 ? 45 VAL A O    6  
ATOM   7042  C  CB   . VAL A 1 45 ? 9.476   2.075   2.606   1.00 0.00 ? 45 VAL A CB   6  
ATOM   7043  C  CG1  . VAL A 1 45 ? 10.322  2.061   1.338   1.00 0.00 ? 45 VAL A CG1  6  
ATOM   7044  C  CG2  . VAL A 1 45 ? 9.494   3.456   3.249   1.00 0.00 ? 45 VAL A CG2  6  
ATOM   7045  H  H    . VAL A 1 45 ? 8.272   0.108   0.854   1.00 0.00 ? 45 VAL A H    6  
ATOM   7046  H  HA   . VAL A 1 45 ? 7.479   1.627   3.243   1.00 0.00 ? 45 VAL A HA   6  
ATOM   7047  H  HB   . VAL A 1 45 ? 9.911   1.374   3.304   1.00 0.00 ? 45 VAL A HB   6  
ATOM   7048  H  HG11 . VAL A 1 45 ? 10.125  2.955   0.764   1.00 0.00 ? 45 VAL A HG11 6  
ATOM   7049  H  HG12 . VAL A 1 45 ? 10.071  1.192   0.747   1.00 0.00 ? 45 VAL A HG12 6  
ATOM   7050  H  HG13 . VAL A 1 45 ? 11.368  2.026   1.603   1.00 0.00 ? 45 VAL A HG13 6  
ATOM   7051  H  HG21 . VAL A 1 45 ? 10.376  3.555   3.864   1.00 0.00 ? 45 VAL A HG21 6  
ATOM   7052  H  HG22 . VAL A 1 45 ? 8.613   3.580   3.862   1.00 0.00 ? 45 VAL A HG22 6  
ATOM   7053  H  HG23 . VAL A 1 45 ? 9.506   4.213   2.478   1.00 0.00 ? 45 VAL A HG23 6  
ATOM   7054  N  N    . ALA A 1 46 ? 6.573   3.536   1.912   1.00 0.00 ? 46 ALA A N    6  
ATOM   7055  C  CA   . ALA A 1 46 ? 5.894   4.552   1.113   1.00 0.00 ? 46 ALA A CA   6  
ATOM   7056  C  C    . ALA A 1 46 ? 6.444   5.942   1.423   1.00 0.00 ? 46 ALA A C    6  
ATOM   7057  O  O    . ALA A 1 46 ? 6.581   6.319   2.589   1.00 0.00 ? 46 ALA A O    6  
ATOM   7058  C  CB   . ALA A 1 46 ? 4.391   4.505   1.349   1.00 0.00 ? 46 ALA A CB   6  
ATOM   7059  H  H    . ALA A 1 46 ? 6.445   3.531   2.885   1.00 0.00 ? 46 ALA A H    6  
ATOM   7060  H  HA   . ALA A 1 46 ? 6.077   4.330   0.070   1.00 0.00 ? 46 ALA A HA   6  
ATOM   7061  H  HB1  . ALA A 1 46 ? 3.877   4.510   0.399   1.00 0.00 ? 46 ALA A HB1  6  
ATOM   7062  H  HB2  . ALA A 1 46 ? 4.087   5.367   1.925   1.00 0.00 ? 46 ALA A HB2  6  
ATOM   7063  H  HB3  . ALA A 1 46 ? 4.137   3.604   1.889   1.00 0.00 ? 46 ALA A HB3  6  
ATOM   7064  N  N    . THR A 1 47 ? 6.765   6.693   0.371   1.00 0.00 ? 47 THR A N    6  
ATOM   7065  C  CA   . THR A 1 47 ? 7.313   8.039   0.523   1.00 0.00 ? 47 THR A CA   6  
ATOM   7066  C  C    . THR A 1 47 ? 6.329   9.095   0.020   1.00 0.00 ? 47 THR A C    6  
ATOM   7067  O  O    . THR A 1 47 ? 5.777   8.971   -1.075  1.00 0.00 ? 47 THR A O    6  
ATOM   7068  C  CB   . THR A 1 47 ? 8.644   8.160   -0.233  1.00 0.00 ? 47 THR A CB   6  
ATOM   7069  O  OG1  . THR A 1 47 ? 9.401   6.966   -0.116  1.00 0.00 ? 47 THR A OG1  6  
ATOM   7070  C  CG2  . THR A 1 47 ? 9.516   9.298   0.257   1.00 0.00 ? 47 THR A CG2  6  
ATOM   7071  H  H    . THR A 1 47 ? 6.637   6.331   -0.532  1.00 0.00 ? 47 THR A H    6  
ATOM   7072  H  HA   . THR A 1 47 ? 7.492   8.206   1.574   1.00 0.00 ? 47 THR A HA   6  
ATOM   7073  H  HB   . THR A 1 47 ? 8.438   8.331   -1.280  1.00 0.00 ? 47 THR A HB   6  
ATOM   7074  H  HG1  . THR A 1 47 ? 9.374   6.485   -0.948  1.00 0.00 ? 47 THR A HG1  6  
ATOM   7075  H  HG21 . THR A 1 47 ? 9.181   10.224  -0.185  1.00 0.00 ? 47 THR A HG21 6  
ATOM   7076  H  HG22 . THR A 1 47 ? 10.541  9.114   -0.028  1.00 0.00 ? 47 THR A HG22 6  
ATOM   7077  H  HG23 . THR A 1 47 ? 9.448   9.367   1.333   1.00 0.00 ? 47 THR A HG23 6  
ATOM   7078  N  N    . CYS A 1 48 ? 6.120   10.137  0.827   1.00 0.00 ? 48 CYS A N    6  
ATOM   7079  C  CA   . CYS A 1 48 ? 5.208   11.220  0.465   1.00 0.00 ? 48 CYS A CA   6  
ATOM   7080  C  C    . CYS A 1 48 ? 5.915   12.252  -0.414  1.00 0.00 ? 48 CYS A C    6  
ATOM   7081  O  O    . CYS A 1 48 ? 7.067   12.606  -0.159  1.00 0.00 ? 48 CYS A O    6  
ATOM   7082  C  CB   . CYS A 1 48 ? 4.655   11.904  1.720   1.00 0.00 ? 48 CYS A CB   6  
ATOM   7083  S  SG   . CYS A 1 48 ? 2.901   12.384  1.600   1.00 0.00 ? 48 CYS A SG   6  
ATOM   7084  H  H    . CYS A 1 48 ? 6.594   10.179  1.686   1.00 0.00 ? 48 CYS A H    6  
ATOM   7085  H  HA   . CYS A 1 48 ? 4.387   10.789  -0.090  1.00 0.00 ? 48 CYS A HA   6  
ATOM   7086  H  HB2  . CYS A 1 48 ? 4.753   11.233  2.561   1.00 0.00 ? 48 CYS A HB2  6  
ATOM   7087  H  HB3  . CYS A 1 48 ? 5.226   12.800  1.914   1.00 0.00 ? 48 CYS A HB3  6  
ATOM   7088  N  N    . PRO A 1 49 ? 5.233   12.753  -1.463  1.00 0.00 ? 49 PRO A N    6  
ATOM   7089  C  CA   . PRO A 1 49 ? 5.806   13.749  -2.373  1.00 0.00 ? 49 PRO A CA   6  
ATOM   7090  C  C    . PRO A 1 49 ? 5.756   15.182  -1.820  1.00 0.00 ? 49 PRO A C    6  
ATOM   7091  O  O    . PRO A 1 49 ? 6.164   16.125  -2.502  1.00 0.00 ? 49 PRO A O    6  
ATOM   7092  C  CB   . PRO A 1 49 ? 4.922   13.622  -3.611  1.00 0.00 ? 49 PRO A CB   6  
ATOM   7093  C  CG   . PRO A 1 49 ? 3.590   13.208  -3.082  1.00 0.00 ? 49 PRO A CG   6  
ATOM   7094  C  CD   . PRO A 1 49 ? 3.852   12.389  -1.843  1.00 0.00 ? 49 PRO A CD   6  
ATOM   7095  H  HA   . PRO A 1 49 ? 6.825   13.505  -2.632  1.00 0.00 ? 49 PRO A HA   6  
ATOM   7096  H  HB2  . PRO A 1 49 ? 4.870   14.575  -4.119  1.00 0.00 ? 49 PRO A HB2  6  
ATOM   7097  H  HB3  . PRO A 1 49 ? 5.332   12.875  -4.274  1.00 0.00 ? 49 PRO A HB3  6  
ATOM   7098  H  HG2  . PRO A 1 49 ? 3.007   14.083  -2.834  1.00 0.00 ? 49 PRO A HG2  6  
ATOM   7099  H  HG3  . PRO A 1 49 ? 3.074   12.613  -3.820  1.00 0.00 ? 49 PRO A HG3  6  
ATOM   7100  H  HD2  . PRO A 1 49 ? 3.153   12.655  -1.062  1.00 0.00 ? 49 PRO A HD2  6  
ATOM   7101  H  HD3  . PRO A 1 49 ? 3.784   11.335  -2.068  1.00 0.00 ? 49 PRO A HD3  6  
ATOM   7102  N  N    . SER A 1 50 ? 5.258   15.342  -0.588  1.00 0.00 ? 50 SER A N    6  
ATOM   7103  C  CA   . SER A 1 50 ? 5.163   16.659  0.036   1.00 0.00 ? 50 SER A CA   6  
ATOM   7104  C  C    . SER A 1 50 ? 6.026   16.736  1.297   1.00 0.00 ? 50 SER A C    6  
ATOM   7105  O  O    . SER A 1 50 ? 6.985   17.507  1.351   1.00 0.00 ? 50 SER A O    6  
ATOM   7106  C  CB   . SER A 1 50 ? 3.704   16.988  0.365   1.00 0.00 ? 50 SER A CB   6  
ATOM   7107  O  OG   . SER A 1 50 ? 3.405   18.339  0.058   1.00 0.00 ? 50 SER A OG   6  
ATOM   7108  H  H    . SER A 1 50 ? 4.947   14.560  -0.090  1.00 0.00 ? 50 SER A H    6  
ATOM   7109  H  HA   . SER A 1 50 ? 5.531   17.385  -0.675  1.00 0.00 ? 50 SER A HA   6  
ATOM   7110  H  HB2  . SER A 1 50 ? 3.053   16.348  -0.212  1.00 0.00 ? 50 SER A HB2  6  
ATOM   7111  H  HB3  . SER A 1 50 ? 3.526   16.822  1.418   1.00 0.00 ? 50 SER A HB3  6  
ATOM   7112  H  HG   . SER A 1 50 ? 2.547   18.387  -0.371  1.00 0.00 ? 50 SER A HG   6  
ATOM   7113  N  N    . CYS A 1 51 ? 5.683   15.935  2.310   1.00 0.00 ? 51 CYS A N    6  
ATOM   7114  C  CA   . CYS A 1 51 ? 6.434   15.924  3.568   1.00 0.00 ? 51 CYS A CA   6  
ATOM   7115  C  C    . CYS A 1 51 ? 7.651   14.992  3.502   1.00 0.00 ? 51 CYS A C    6  
ATOM   7116  O  O    . CYS A 1 51 ? 8.584   15.131  4.296   1.00 0.00 ? 51 CYS A O    6  
ATOM   7117  C  CB   . CYS A 1 51 ? 5.529   15.506  4.730   1.00 0.00 ? 51 CYS A CB   6  
ATOM   7118  S  SG   . CYS A 1 51 ? 4.958   13.777  4.650   1.00 0.00 ? 51 CYS A SG   6  
ATOM   7119  H  H    . CYS A 1 51 ? 4.908   15.341  2.210   1.00 0.00 ? 51 CYS A H    6  
ATOM   7120  H  HA   . CYS A 1 51 ? 6.783   16.930  3.748   1.00 0.00 ? 51 CYS A HA   6  
ATOM   7121  H  HB2  . CYS A 1 51 ? 6.068   15.630  5.656   1.00 0.00 ? 51 CYS A HB2  6  
ATOM   7122  H  HB3  . CYS A 1 51 ? 4.654   16.141  4.740   1.00 0.00 ? 51 CYS A HB3  6  
ATOM   7123  N  N    . SER A 1 52 ? 7.632   14.041  2.561   1.00 0.00 ? 52 SER A N    6  
ATOM   7124  C  CA   . SER A 1 52 ? 8.729   13.081  2.397   1.00 0.00 ? 52 SER A CA   6  
ATOM   7125  C  C    . SER A 1 52 ? 8.845   12.161  3.617   1.00 0.00 ? 52 SER A C    6  
ATOM   7126  O  O    . SER A 1 52 ? 9.949   11.817  4.048   1.00 0.00 ? 52 SER A O    6  
ATOM   7127  C  CB   . SER A 1 52 ? 10.054  13.813  2.152   1.00 0.00 ? 52 SER A CB   6  
ATOM   7128  O  OG   . SER A 1 52 ? 9.902   14.842  1.190   1.00 0.00 ? 52 SER A OG   6  
ATOM   7129  H  H    . SER A 1 52 ? 6.859   13.978  1.964   1.00 0.00 ? 52 SER A H    6  
ATOM   7130  H  HA   . SER A 1 52 ? 8.503   12.475  1.532   1.00 0.00 ? 52 SER A HA   6  
ATOM   7131  H  HB2  . SER A 1 52 ? 10.398  14.251  3.077   1.00 0.00 ? 52 SER A HB2  6  
ATOM   7132  H  HB3  . SER A 1 52 ? 10.790  13.107  1.793   1.00 0.00 ? 52 SER A HB3  6  
ATOM   7133  H  HG   . SER A 1 52 ? 10.687  14.891  0.641   1.00 0.00 ? 52 SER A HG   6  
ATOM   7134  N  N    . LEU A 1 53 ? 7.695   11.764  4.162   1.00 0.00 ? 53 LEU A N    6  
ATOM   7135  C  CA   . LEU A 1 53 ? 7.652   10.881  5.325   1.00 0.00 ? 53 LEU A CA   6  
ATOM   7136  C  C    . LEU A 1 53 ? 7.765   9.418   4.898   1.00 0.00 ? 53 LEU A C    6  
ATOM   7137  O  O    . LEU A 1 53 ? 7.485   9.075   3.748   1.00 0.00 ? 53 LEU A O    6  
ATOM   7138  C  CB   . LEU A 1 53 ? 6.347   11.109  6.102   1.00 0.00 ? 53 LEU A CB   6  
ATOM   7139  C  CG   . LEU A 1 53 ? 6.170   10.275  7.377   1.00 0.00 ? 53 LEU A CG   6  
ATOM   7140  C  CD1  . LEU A 1 53 ? 7.227   10.633  8.413   1.00 0.00 ? 53 LEU A CD1  6  
ATOM   7141  C  CD2  . LEU A 1 53 ? 4.773   10.475  7.948   1.00 0.00 ? 53 LEU A CD2  6  
ATOM   7142  H  H    . LEU A 1 53 ? 6.851   12.068  3.769   1.00 0.00 ? 53 LEU A H    6  
ATOM   7143  H  HA   . LEU A 1 53 ? 8.490   11.126  5.961   1.00 0.00 ? 53 LEU A HA   6  
ATOM   7144  H  HB2  . LEU A 1 53 ? 6.296   12.153  6.374   1.00 0.00 ? 53 LEU A HB2  6  
ATOM   7145  H  HB3  . LEU A 1 53 ? 5.520   10.890  5.442   1.00 0.00 ? 53 LEU A HB3  6  
ATOM   7146  H  HG   . LEU A 1 53 ? 6.283   9.229   7.134   1.00 0.00 ? 53 LEU A HG   6  
ATOM   7147  H  HD11 . LEU A 1 53 ? 7.569   9.733   8.903   1.00 0.00 ? 53 LEU A HD11 6  
ATOM   7148  H  HD12 . LEU A 1 53 ? 6.802   11.302  9.147   1.00 0.00 ? 53 LEU A HD12 6  
ATOM   7149  H  HD13 . LEU A 1 53 ? 8.061   11.116  7.926   1.00 0.00 ? 53 LEU A HD13 6  
ATOM   7150  H  HD21 . LEU A 1 53 ? 4.809   11.210  8.739   1.00 0.00 ? 53 LEU A HD21 6  
ATOM   7151  H  HD22 . LEU A 1 53 ? 4.408   9.540   8.341   1.00 0.00 ? 53 LEU A HD22 6  
ATOM   7152  H  HD23 . LEU A 1 53 ? 4.111   10.820  7.166   1.00 0.00 ? 53 LEU A HD23 6  
ATOM   7153  N  N    . ILE A 1 54 ? 8.173   8.558   5.830   1.00 0.00 ? 54 ILE A N    6  
ATOM   7154  C  CA   . ILE A 1 54 ? 8.317   7.132   5.549   1.00 0.00 ? 54 ILE A CA   6  
ATOM   7155  C  C    . ILE A 1 54 ? 7.285   6.317   6.332   1.00 0.00 ? 54 ILE A C    6  
ATOM   7156  O  O    . ILE A 1 54 ? 6.978   6.635   7.482   1.00 0.00 ? 54 ILE A O    6  
ATOM   7157  C  CB   . ILE A 1 54 ? 9.739   6.626   5.903   1.00 0.00 ? 54 ILE A CB   6  
ATOM   7158  C  CG1  . ILE A 1 54 ? 10.114  7.022   7.338   1.00 0.00 ? 54 ILE A CG1  6  
ATOM   7159  C  CG2  . ILE A 1 54 ? 10.762  7.170   4.914   1.00 0.00 ? 54 ILE A CG2  6  
ATOM   7160  C  CD1  . ILE A 1 54 ? 11.480  6.532   7.771   1.00 0.00 ? 54 ILE A CD1  6  
ATOM   7161  H  H    . ILE A 1 54 ? 8.379   8.889   6.730   1.00 0.00 ? 54 ILE A H    6  
ATOM   7162  H  HA   . ILE A 1 54 ? 8.154   6.982   4.491   1.00 0.00 ? 54 ILE A HA   6  
ATOM   7163  H  HB   . ILE A 1 54 ? 9.740   5.549   5.823   1.00 0.00 ? 54 ILE A HB   6  
ATOM   7164  H  HG12 . ILE A 1 54 ? 10.109  8.098   7.420   1.00 0.00 ? 54 ILE A HG12 6  
ATOM   7165  H  HG13 . ILE A 1 54 ? 9.382   6.612   8.020   1.00 0.00 ? 54 ILE A HG13 6  
ATOM   7166  H  HG21 . ILE A 1 54 ? 11.685  6.617   5.010   1.00 0.00 ? 54 ILE A HG21 6  
ATOM   7167  H  HG22 . ILE A 1 54 ? 10.946  8.215   5.122   1.00 0.00 ? 54 ILE A HG22 6  
ATOM   7168  H  HG23 . ILE A 1 54 ? 10.384  7.065   3.907   1.00 0.00 ? 54 ILE A HG23 6  
ATOM   7169  H  HD11 . ILE A 1 54 ? 11.837  7.140   8.591   1.00 0.00 ? 54 ILE A HD11 6  
ATOM   7170  H  HD12 . ILE A 1 54 ? 12.170  6.607   6.943   1.00 0.00 ? 54 ILE A HD12 6  
ATOM   7171  H  HD13 . ILE A 1 54 ? 11.410  5.504   8.089   1.00 0.00 ? 54 ILE A HD13 6  
ATOM   7172  N  N    . ILE A 1 55 ? 6.763   5.258   5.709   1.00 0.00 ? 55 ILE A N    6  
ATOM   7173  C  CA   . ILE A 1 55 ? 5.773   4.392   6.355   1.00 0.00 ? 55 ILE A CA   6  
ATOM   7174  C  C    . ILE A 1 55 ? 5.960   2.934   5.932   1.00 0.00 ? 55 ILE A C    6  
ATOM   7175  O  O    . ILE A 1 55 ? 6.325   2.656   4.789   1.00 0.00 ? 55 ILE A O    6  
ATOM   7176  C  CB   . ILE A 1 55 ? 4.321   4.825   6.040   1.00 0.00 ? 55 ILE A CB   6  
ATOM   7177  C  CG1  . ILE A 1 55 ? 4.091   4.912   4.528   1.00 0.00 ? 55 ILE A CG1  6  
ATOM   7178  C  CG2  . ILE A 1 55 ? 4.000   6.157   6.704   1.00 0.00 ? 55 ILE A CG2  6  
ATOM   7179  C  CD1  . ILE A 1 55 ? 2.704   4.468   4.102   1.00 0.00 ? 55 ILE A CD1  6  
ATOM   7180  H  H    . ILE A 1 55 ? 7.051   5.051   4.794   1.00 0.00 ? 55 ILE A H    6  
ATOM   7181  H  HA   . ILE A 1 55 ? 5.922   4.462   7.423   1.00 0.00 ? 55 ILE A HA   6  
ATOM   7182  H  HB   . ILE A 1 55 ? 3.654   4.082   6.453   1.00 0.00 ? 55 ILE A HB   6  
ATOM   7183  H  HG12 . ILE A 1 55 ? 4.225   5.934   4.208   1.00 0.00 ? 55 ILE A HG12 6  
ATOM   7184  H  HG13 . ILE A 1 55 ? 4.809   4.284   4.023   1.00 0.00 ? 55 ILE A HG13 6  
ATOM   7185  H  HG21 . ILE A 1 55 ? 4.682   6.913   6.346   1.00 0.00 ? 55 ILE A HG21 6  
ATOM   7186  H  HG22 . ILE A 1 55 ? 4.100   6.059   7.775   1.00 0.00 ? 55 ILE A HG22 6  
ATOM   7187  H  HG23 . ILE A 1 55 ? 2.986   6.444   6.463   1.00 0.00 ? 55 ILE A HG23 6  
ATOM   7188  H  HD11 . ILE A 1 55 ? 2.061   4.412   4.967   1.00 0.00 ? 55 ILE A HD11 6  
ATOM   7189  H  HD12 . ILE A 1 55 ? 2.765   3.497   3.636   1.00 0.00 ? 55 ILE A HD12 6  
ATOM   7190  H  HD13 . ILE A 1 55 ? 2.299   5.180   3.398   1.00 0.00 ? 55 ILE A HD13 6  
ATOM   7191  N  N    . LYS A 1 56 ? 5.712   2.007   6.860   1.00 0.00 ? 56 LYS A N    6  
ATOM   7192  C  CA   . LYS A 1 56 ? 5.862   0.580   6.573   1.00 0.00 ? 56 LYS A CA   6  
ATOM   7193  C  C    . LYS A 1 56 ? 4.565   -0.029  6.073   1.00 0.00 ? 56 LYS A C    6  
ATOM   7194  O  O    . LYS A 1 56 ? 3.488   0.208   6.627   1.00 0.00 ? 56 LYS A O    6  
ATOM   7195  C  CB   . LYS A 1 56 ? 6.350   -0.174  7.816   1.00 0.00 ? 56 LYS A CB   6  
ATOM   7196  C  CG   . LYS A 1 56 ? 6.709   -1.630  7.550   1.00 0.00 ? 56 LYS A CG   6  
ATOM   7197  C  CD   . LYS A 1 56 ? 8.192   -1.798  7.256   1.00 0.00 ? 56 LYS A CD   6  
ATOM   7198  C  CE   . LYS A 1 56 ? 8.614   -3.260  7.324   1.00 0.00 ? 56 LYS A CE   6  
ATOM   7199  N  NZ   . LYS A 1 56 ? 8.932   -3.684  8.717   1.00 0.00 ? 56 LYS A NZ   6  
ATOM   7200  H  H    . LYS A 1 56 ? 5.428   2.288   7.757   1.00 0.00 ? 56 LYS A H    6  
ATOM   7201  H  HA   . LYS A 1 56 ? 6.595   0.478   5.789   1.00 0.00 ? 56 LYS A HA   6  
ATOM   7202  H  HB2  . LYS A 1 56 ? 7.226   0.325   8.204   1.00 0.00 ? 56 LYS A HB2  6  
ATOM   7203  H  HB3  . LYS A 1 56 ? 5.572   -0.148  8.565   1.00 0.00 ? 56 LYS A HB3  6  
ATOM   7204  H  HG2  . LYS A 1 56 ? 6.457   -2.217  8.421   1.00 0.00 ? 56 LYS A HG2  6  
ATOM   7205  H  HG3  . LYS A 1 56 ? 6.140   -1.983  6.702   1.00 0.00 ? 56 LYS A HG3  6  
ATOM   7206  H  HD2  . LYS A 1 56 ? 8.398   -1.422  6.265   1.00 0.00 ? 56 LYS A HD2  6  
ATOM   7207  H  HD3  . LYS A 1 56 ? 8.759   -1.235  7.982   1.00 0.00 ? 56 LYS A HD3  6  
ATOM   7208  H  HE2  . LYS A 1 56 ? 7.808   -3.872  6.945   1.00 0.00 ? 56 LYS A HE2  6  
ATOM   7209  H  HE3  . LYS A 1 56 ? 9.489   -3.396  6.705   1.00 0.00 ? 56 LYS A HE3  6  
ATOM   7210  H  HZ1  . LYS A 1 56 ? 9.291   -4.661  8.719   1.00 0.00 ? 56 LYS A HZ1  6  
ATOM   7211  H  HZ2  . LYS A 1 56 ? 8.076   -3.641  9.309   1.00 0.00 ? 56 LYS A HZ2  6  
ATOM   7212  H  HZ3  . LYS A 1 56 ? 9.655   -3.061  9.127   1.00 0.00 ? 56 LYS A HZ3  6  
ATOM   7213  N  N    . VAL A 1 57 ? 4.691   -0.818  5.012   1.00 0.00 ? 57 VAL A N    6  
ATOM   7214  C  CA   . VAL A 1 57 ? 3.553   -1.477  4.402   1.00 0.00 ? 57 VAL A CA   6  
ATOM   7215  C  C    . VAL A 1 57 ? 3.580   -2.978  4.687   1.00 0.00 ? 57 VAL A C    6  
ATOM   7216  O  O    . VAL A 1 57 ? 4.464   -3.692  4.214   1.00 0.00 ? 57 VAL A O    6  
ATOM   7217  C  CB   . VAL A 1 57 ? 3.516   -1.240  2.874   1.00 0.00 ? 57 VAL A CB   6  
ATOM   7218  C  CG1  . VAL A 1 57 ? 2.082   -1.147  2.403   1.00 0.00 ? 57 VAL A CG1  6  
ATOM   7219  C  CG2  . VAL A 1 57 ? 4.276   0.024   2.488   1.00 0.00 ? 57 VAL A CG2  6  
ATOM   7220  H  H    . VAL A 1 57 ? 5.582   -0.959  4.627   1.00 0.00 ? 57 VAL A H    6  
ATOM   7221  H  HA   . VAL A 1 57 ? 2.654   -1.056  4.833   1.00 0.00 ? 57 VAL A HA   6  
ATOM   7222  H  HB   . VAL A 1 57 ? 3.986   -2.083  2.381   1.00 0.00 ? 57 VAL A HB   6  
ATOM   7223  H  HG11 . VAL A 1 57 ? 2.062   -0.827  1.373   1.00 0.00 ? 57 VAL A HG11 6  
ATOM   7224  H  HG12 . VAL A 1 57 ? 1.558   -0.429  3.015   1.00 0.00 ? 57 VAL A HG12 6  
ATOM   7225  H  HG13 . VAL A 1 57 ? 1.609   -2.112  2.493   1.00 0.00 ? 57 VAL A HG13 6  
ATOM   7226  H  HG21 . VAL A 1 57 ? 5.279   -0.023  2.881   1.00 0.00 ? 57 VAL A HG21 6  
ATOM   7227  H  HG22 . VAL A 1 57 ? 3.769   0.887   2.895   1.00 0.00 ? 57 VAL A HG22 6  
ATOM   7228  H  HG23 . VAL A 1 57 ? 4.315   0.106   1.413   1.00 0.00 ? 57 VAL A HG23 6  
ATOM   7229  N  N    . ILE A 1 58 ? 2.606   -3.449  5.467   1.00 0.00 ? 58 ILE A N    6  
ATOM   7230  C  CA   . ILE A 1 58 ? 2.516   -4.864  5.820   1.00 0.00 ? 58 ILE A CA   6  
ATOM   7231  C  C    . ILE A 1 58 ? 1.604   -5.609  4.847   1.00 0.00 ? 58 ILE A C    6  
ATOM   7232  O  O    . ILE A 1 58 ? 0.526   -5.126  4.506   1.00 0.00 ? 58 ILE A O    6  
ATOM   7233  C  CB   . ILE A 1 58 ? 1.992   -5.060  7.260   1.00 0.00 ? 58 ILE A CB   6  
ATOM   7234  C  CG1  . ILE A 1 58 ? 2.756   -4.162  8.242   1.00 0.00 ? 58 ILE A CG1  6  
ATOM   7235  C  CG2  . ILE A 1 58 ? 2.098   -6.523  7.675   1.00 0.00 ? 58 ILE A CG2  6  
ATOM   7236  C  CD1  . ILE A 1 58 ? 4.233   -4.485  8.351   1.00 0.00 ? 58 ILE A CD1  6  
ATOM   7237  H  H    . ILE A 1 58 ? 1.930   -2.827  5.816   1.00 0.00 ? 58 ILE A H    6  
ATOM   7238  H  HA   . ILE A 1 58 ? 3.511   -5.285  5.760   1.00 0.00 ? 58 ILE A HA   6  
ATOM   7239  H  HB   . ILE A 1 58 ? 0.948   -4.786  7.275   1.00 0.00 ? 58 ILE A HB   6  
ATOM   7240  H  HG12 . ILE A 1 58 ? 2.666   -3.134  7.924   1.00 0.00 ? 58 ILE A HG12 6  
ATOM   7241  H  HG13 . ILE A 1 58 ? 2.320   -4.267  9.226   1.00 0.00 ? 58 ILE A HG13 6  
ATOM   7242  H  HG21 . ILE A 1 58 ? 2.141   -6.589  8.751   1.00 0.00 ? 58 ILE A HG21 6  
ATOM   7243  H  HG22 . ILE A 1 58 ? 2.993   -6.954  7.251   1.00 0.00 ? 58 ILE A HG22 6  
ATOM   7244  H  HG23 . ILE A 1 58 ? 1.234   -7.062  7.316   1.00 0.00 ? 58 ILE A HG23 6  
ATOM   7245  H  HD11 . ILE A 1 58 ? 4.732   -3.700  8.900   1.00 0.00 ? 58 ILE A HD11 6  
ATOM   7246  H  HD12 . ILE A 1 58 ? 4.659   -4.561  7.363   1.00 0.00 ? 58 ILE A HD12 6  
ATOM   7247  H  HD13 . ILE A 1 58 ? 4.358   -5.423  8.870   1.00 0.00 ? 58 ILE A HD13 6  
ATOM   7248  N  N    . TYR A 1 59 ? 2.047   -6.781  4.397   1.00 0.00 ? 59 TYR A N    6  
ATOM   7249  C  CA   . TYR A 1 59 ? 1.277   -7.588  3.449   1.00 0.00 ? 59 TYR A CA   6  
ATOM   7250  C  C    . TYR A 1 59 ? 1.668   -9.065  3.549   1.00 0.00 ? 59 TYR A C    6  
ATOM   7251  O  O    . TYR A 1 59 ? 2.671   -9.407  4.179   1.00 0.00 ? 59 TYR A O    6  
ATOM   7252  C  CB   . TYR A 1 59 ? 1.510   -7.080  2.020   1.00 0.00 ? 59 TYR A CB   6  
ATOM   7253  C  CG   . TYR A 1 59 ? 2.973   -6.957  1.660   1.00 0.00 ? 59 TYR A CG   6  
ATOM   7254  C  CD1  . TYR A 1 59 ? 3.719   -5.856  2.068   1.00 0.00 ? 59 TYR A CD1  6  
ATOM   7255  C  CD2  . TYR A 1 59 ? 3.615   -7.951  0.930   1.00 0.00 ? 59 TYR A CD2  6  
ATOM   7256  C  CE1  . TYR A 1 59 ? 5.059   -5.746  1.758   1.00 0.00 ? 59 TYR A CE1  6  
ATOM   7257  C  CE2  . TYR A 1 59 ? 4.954   -7.847  0.613   1.00 0.00 ? 59 TYR A CE2  6  
ATOM   7258  C  CZ   . TYR A 1 59 ? 5.672   -6.743  1.033   1.00 0.00 ? 59 TYR A CZ   6  
ATOM   7259  O  OH   . TYR A 1 59 ? 7.010   -6.638  0.731   1.00 0.00 ? 59 TYR A OH   6  
ATOM   7260  H  H    . TYR A 1 59 ? 2.920   -7.109  4.700   1.00 0.00 ? 59 TYR A H    6  
ATOM   7261  H  HA   . TYR A 1 59 ? 0.230   -7.486  3.695   1.00 0.00 ? 59 TYR A HA   6  
ATOM   7262  H  HB2  . TYR A 1 59 ? 1.050   -7.762  1.321   1.00 0.00 ? 59 TYR A HB2  6  
ATOM   7263  H  HB3  . TYR A 1 59 ? 1.058   -6.103  1.915   1.00 0.00 ? 59 TYR A HB3  6  
ATOM   7264  H  HD1  . TYR A 1 59 ? 3.233   -5.075  2.636   1.00 0.00 ? 59 TYR A HD1  6  
ATOM   7265  H  HD2  . TYR A 1 59 ? 3.049   -8.815  0.604   1.00 0.00 ? 59 TYR A HD2  6  
ATOM   7266  H  HE1  . TYR A 1 59 ? 5.621   -4.879  2.081   1.00 0.00 ? 59 TYR A HE1  6  
ATOM   7267  H  HE2  . TYR A 1 59 ? 5.434   -8.629  0.042   1.00 0.00 ? 59 TYR A HE2  6  
ATOM   7268  H  HH   . TYR A 1 59 ? 7.517   -7.202  1.323   1.00 0.00 ? 59 TYR A HH   6  
ATOM   7269  N  N    . ASP A 1 60 ? 0.877   -9.936  2.918   1.00 0.00 ? 60 ASP A N    6  
ATOM   7270  C  CA   . ASP A 1 60 ? 1.158   -11.368 2.937   1.00 0.00 ? 60 ASP A CA   6  
ATOM   7271  C  C    . ASP A 1 60 ? 2.136   -11.740 1.826   1.00 0.00 ? 60 ASP A C    6  
ATOM   7272  O  O    . ASP A 1 60 ? 1.741   -11.926 0.673   1.00 0.00 ? 60 ASP A O    6  
ATOM   7273  C  CB   . ASP A 1 60 ? -0.138  -12.179 2.800   1.00 0.00 ? 60 ASP A CB   6  
ATOM   7274  C  CG   . ASP A 1 60 ? 0.046   -13.648 3.152   1.00 0.00 ? 60 ASP A CG   6  
ATOM   7275  O  OD1  . ASP A 1 60 ? 1.025   -13.982 3.856   1.00 0.00 ? 60 ASP A OD1  6  
ATOM   7276  O  OD2  . ASP A 1 60 ? -0.792  -14.465 2.722   1.00 0.00 ? 60 ASP A OD2  6  
ATOM   7277  H  H    . ASP A 1 60 ? 0.095   -9.609  2.425   1.00 0.00 ? 60 ASP A H    6  
ATOM   7278  H  HA   . ASP A 1 60 ? 1.612   -11.600 3.889   1.00 0.00 ? 60 ASP A HA   6  
ATOM   7279  H  HB2  . ASP A 1 60 ? -0.885  -11.763 3.458   1.00 0.00 ? 60 ASP A HB2  6  
ATOM   7280  H  HB3  . ASP A 1 60 ? -0.490  -12.116 1.780   1.00 0.00 ? 60 ASP A HB3  6  
ATOM   7281  N  N    . LYS A 1 61 ? 3.416   -11.849 2.186   1.00 0.00 ? 61 LYS A N    6  
ATOM   7282  C  CA   . LYS A 1 61 ? 4.462   -12.205 1.227   1.00 0.00 ? 61 LYS A CA   6  
ATOM   7283  C  C    . LYS A 1 61 ? 4.174   -13.557 0.575   1.00 0.00 ? 61 LYS A C    6  
ATOM   7284  O  O    . LYS A 1 61 ? 4.549   -13.789 -0.575  1.00 0.00 ? 61 LYS A O    6  
ATOM   7285  C  CB   . LYS A 1 61 ? 5.830   -12.237 1.913   1.00 0.00 ? 61 LYS A CB   6  
ATOM   7286  C  CG   . LYS A 1 61 ? 6.460   -10.861 2.083   1.00 0.00 ? 61 LYS A CG   6  
ATOM   7287  C  CD   . LYS A 1 61 ? 7.395   -10.525 0.929   1.00 0.00 ? 61 LYS A CD   6  
ATOM   7288  C  CE   . LYS A 1 61 ? 8.829   -10.937 1.228   1.00 0.00 ? 61 LYS A CE   6  
ATOM   7289  N  NZ   . LYS A 1 61 ? 9.007   -12.417 1.207   1.00 0.00 ? 61 LYS A NZ   6  
ATOM   7290  H  H    . LYS A 1 61 ? 3.663   -11.690 3.121   1.00 0.00 ? 61 LYS A H    6  
ATOM   7291  H  HA   . LYS A 1 61 ? 4.475   -11.447 0.457   1.00 0.00 ? 61 LYS A HA   6  
ATOM   7292  H  HB2  . LYS A 1 61 ? 5.718   -12.680 2.891   1.00 0.00 ? 61 LYS A HB2  6  
ATOM   7293  H  HB3  . LYS A 1 61 ? 6.500   -12.846 1.325   1.00 0.00 ? 61 LYS A HB3  6  
ATOM   7294  H  HG2  . LYS A 1 61 ? 5.676   -10.119 2.125   1.00 0.00 ? 61 LYS A HG2  6  
ATOM   7295  H  HG3  . LYS A 1 61 ? 7.021   -10.846 3.006   1.00 0.00 ? 61 LYS A HG3  6  
ATOM   7296  H  HD2  . LYS A 1 61 ? 7.060   -11.047 0.044   1.00 0.00 ? 61 LYS A HD2  6  
ATOM   7297  H  HD3  . LYS A 1 61 ? 7.366   -9.460  0.752   1.00 0.00 ? 61 LYS A HD3  6  
ATOM   7298  H  HE2  . LYS A 1 61 ? 9.478   -10.496 0.486   1.00 0.00 ? 61 LYS A HE2  6  
ATOM   7299  H  HE3  . LYS A 1 61 ? 9.100   -10.564 2.206   1.00 0.00 ? 61 LYS A HE3  6  
ATOM   7300  H  HZ1  . LYS A 1 61 ? 8.681   -12.830 2.105   1.00 0.00 ? 61 LYS A HZ1  6  
ATOM   7301  H  HZ2  . LYS A 1 61 ? 10.012  -12.654 1.075   1.00 0.00 ? 61 LYS A HZ2  6  
ATOM   7302  H  HZ3  . LYS A 1 61 ? 8.461   -12.835 0.427   1.00 0.00 ? 61 LYS A HZ3  6  
ATOM   7303  N  N    . ASP A 1 62 ? 3.498   -14.443 1.313   1.00 0.00 ? 62 ASP A N    6  
ATOM   7304  C  CA   . ASP A 1 62 ? 3.152   -15.764 0.798   1.00 0.00 ? 62 ASP A CA   6  
ATOM   7305  C  C    . ASP A 1 62 ? 2.182   -15.644 -0.377  1.00 0.00 ? 62 ASP A C    6  
ATOM   7306  O  O    . ASP A 1 62 ? 2.268   -16.406 -1.340  1.00 0.00 ? 62 ASP A O    6  
ATOM   7307  C  CB   . ASP A 1 62 ? 2.530   -16.623 1.906   1.00 0.00 ? 62 ASP A CB   6  
ATOM   7308  C  CG   . ASP A 1 62 ? 2.712   -18.109 1.661   1.00 0.00 ? 62 ASP A CG   6  
ATOM   7309  O  OD1  . ASP A 1 62 ? 1.905   -18.691 0.906   1.00 0.00 ? 62 ASP A OD1  6  
ATOM   7310  O  OD2  . ASP A 1 62 ? 3.664   -18.692 2.224   1.00 0.00 ? 62 ASP A OD2  6  
ATOM   7311  H  H    . ASP A 1 62 ? 3.220   -14.198 2.221   1.00 0.00 ? 62 ASP A H    6  
ATOM   7312  H  HA   . ASP A 1 62 ? 4.060   -16.236 0.454   1.00 0.00 ? 62 ASP A HA   6  
ATOM   7313  H  HB2  . ASP A 1 62 ? 2.995   -16.375 2.849   1.00 0.00 ? 62 ASP A HB2  6  
ATOM   7314  H  HB3  . ASP A 1 62 ? 1.472   -16.414 1.965   1.00 0.00 ? 62 ASP A HB3  6  
ATOM   7315  N  N    . GLN A 1 63 ? 1.266   -14.675 -0.296  1.00 0.00 ? 63 GLN A N    6  
ATOM   7316  C  CA   . GLN A 1 63 ? 0.290   -14.451 -1.358  1.00 0.00 ? 63 GLN A CA   6  
ATOM   7317  C  C    . GLN A 1 63 ? 0.915   -13.683 -2.525  1.00 0.00 ? 63 GLN A C    6  
ATOM   7318  O  O    . GLN A 1 63 ? 0.613   -13.959 -3.686  1.00 0.00 ? 63 GLN A O    6  
ATOM   7319  C  CB   . GLN A 1 63 ? -0.924  -13.688 -0.818  1.00 0.00 ? 63 GLN A CB   6  
ATOM   7320  C  CG   . GLN A 1 63 ? -2.040  -14.590 -0.313  1.00 0.00 ? 63 GLN A CG   6  
ATOM   7321  C  CD   . GLN A 1 63 ? -3.421  -14.087 -0.697  1.00 0.00 ? 63 GLN A CD   6  
ATOM   7322  O  OE1  . GLN A 1 63 ? -4.187  -13.634 0.153   1.00 0.00 ? 63 GLN A OE1  6  
ATOM   7323  N  NE2  . GLN A 1 63 ? -3.745  -14.166 -1.983  1.00 0.00 ? 63 GLN A NE2  6  
ATOM   7324  H  H    . GLN A 1 63 ? 1.254   -14.089 0.495   1.00 0.00 ? 63 GLN A H    6  
ATOM   7325  H  HA   . GLN A 1 63 ? -0.035  -15.418 -1.716  1.00 0.00 ? 63 GLN A HA   6  
ATOM   7326  H  HB2  . GLN A 1 63 ? -0.603  -13.058 -0.003  1.00 0.00 ? 63 GLN A HB2  6  
ATOM   7327  H  HB3  . GLN A 1 63 ? -1.322  -13.065 -1.607  1.00 0.00 ? 63 GLN A HB3  6  
ATOM   7328  H  HG2  . GLN A 1 63 ? -1.907  -15.577 -0.728  1.00 0.00 ? 63 GLN A HG2  6  
ATOM   7329  H  HG3  . GLN A 1 63 ? -1.982  -14.644 0.763   1.00 0.00 ? 63 GLN A HG3  6  
ATOM   7330  H  HE21 . GLN A 1 63 ? -3.087  -14.538 -2.607  1.00 0.00 ? 63 GLN A HE21 6  
ATOM   7331  H  HE22 . GLN A 1 63 ? -4.631  -13.850 -2.256  1.00 0.00 ? 63 GLN A HE22 6  
ATOM   7332  N  N    . PHE A 1 64 ? 1.785   -12.718 -2.209  1.00 0.00 ? 64 PHE A N    6  
ATOM   7333  C  CA   . PHE A 1 64 ? 2.448   -11.913 -3.237  1.00 0.00 ? 64 PHE A CA   6  
ATOM   7334  C  C    . PHE A 1 64 ? 3.308   -12.786 -4.150  1.00 0.00 ? 64 PHE A C    6  
ATOM   7335  O  O    . PHE A 1 64 ? 3.079   -12.839 -5.360  1.00 0.00 ? 64 PHE A O    6  
ATOM   7336  C  CB   . PHE A 1 64 ? 3.303   -10.812 -2.599  1.00 0.00 ? 64 PHE A CB   6  
ATOM   7337  C  CG   . PHE A 1 64 ? 2.546   -9.534  -2.346  1.00 0.00 ? 64 PHE A CG   6  
ATOM   7338  C  CD1  . PHE A 1 64 ? 1.500   -9.500  -1.437  1.00 0.00 ? 64 PHE A CD1  6  
ATOM   7339  C  CD2  . PHE A 1 64 ? 2.878   -8.369  -3.020  1.00 0.00 ? 64 PHE A CD2  6  
ATOM   7340  C  CE1  . PHE A 1 64 ? 0.801   -8.331  -1.205  1.00 0.00 ? 64 PHE A CE1  6  
ATOM   7341  C  CE2  . PHE A 1 64 ? 2.181   -7.197  -2.793  1.00 0.00 ? 64 PHE A CE2  6  
ATOM   7342  C  CZ   . PHE A 1 64 ? 1.142   -7.178  -1.883  1.00 0.00 ? 64 PHE A CZ   6  
ATOM   7343  H  H    . PHE A 1 64 ? 1.984   -12.544 -1.264  1.00 0.00 ? 64 PHE A H    6  
ATOM   7344  H  HA   . PHE A 1 64 ? 1.676   -11.450 -3.832  1.00 0.00 ? 64 PHE A HA   6  
ATOM   7345  H  HB2  . PHE A 1 64 ? 3.689   -11.164 -1.652  1.00 0.00 ? 64 PHE A HB2  6  
ATOM   7346  H  HB3  . PHE A 1 64 ? 4.131   -10.584 -3.256  1.00 0.00 ? 64 PHE A HB3  6  
ATOM   7347  H  HD1  . PHE A 1 64 ? 1.231   -10.400 -0.904  1.00 0.00 ? 64 PHE A HD1  6  
ATOM   7348  H  HD2  . PHE A 1 64 ? 3.690   -8.381  -3.732  1.00 0.00 ? 64 PHE A HD2  6  
ATOM   7349  H  HE1  . PHE A 1 64 ? -0.011  -8.319  -0.493  1.00 0.00 ? 64 PHE A HE1  6  
ATOM   7350  H  HE2  . PHE A 1 64 ? 2.450   -6.297  -3.326  1.00 0.00 ? 64 PHE A HE2  6  
ATOM   7351  H  HZ   . PHE A 1 64 ? 0.596   -6.263  -1.704  1.00 0.00 ? 64 PHE A HZ   6  
ATOM   7352  N  N    . VAL A 1 65 ? 4.295   -13.472 -3.568  1.00 0.00 ? 65 VAL A N    6  
ATOM   7353  C  CA   . VAL A 1 65 ? 5.179   -14.343 -4.337  1.00 0.00 ? 65 VAL A CA   6  
ATOM   7354  C  C    . VAL A 1 65 ? 4.943   -15.816 -3.987  1.00 0.00 ? 65 VAL A C    6  
ATOM   7355  O  O    . VAL A 1 65 ? 5.494   -16.339 -3.015  1.00 0.00 ? 65 VAL A O    6  
ATOM   7356  C  CB   . VAL A 1 65 ? 6.668   -13.967 -4.127  1.00 0.00 ? 65 VAL A CB   6  
ATOM   7357  C  CG1  . VAL A 1 65 ? 7.069   -14.070 -2.660  1.00 0.00 ? 65 VAL A CG1  6  
ATOM   7358  C  CG2  . VAL A 1 65 ? 7.571   -14.832 -5.000  1.00 0.00 ? 65 VAL A CG2  6  
ATOM   7359  H  H    . VAL A 1 65 ? 4.429   -13.392 -2.600  1.00 0.00 ? 65 VAL A H    6  
ATOM   7360  H  HA   . VAL A 1 65 ? 4.945   -14.200 -5.384  1.00 0.00 ? 65 VAL A HA   6  
ATOM   7361  H  HB   . VAL A 1 65 ? 6.795   -12.939 -4.431  1.00 0.00 ? 65 VAL A HB   6  
ATOM   7362  H  HG11 . VAL A 1 65 ? 7.565   -13.161 -2.358  1.00 0.00 ? 65 VAL A HG11 6  
ATOM   7363  H  HG12 . VAL A 1 65 ? 7.738   -14.907 -2.528  1.00 0.00 ? 65 VAL A HG12 6  
ATOM   7364  H  HG13 . VAL A 1 65 ? 6.187   -14.217 -2.054  1.00 0.00 ? 65 VAL A HG13 6  
ATOM   7365  H  HG21 . VAL A 1 65 ? 8.460   -14.274 -5.260  1.00 0.00 ? 65 VAL A HG21 6  
ATOM   7366  H  HG22 . VAL A 1 65 ? 7.043   -15.108 -5.901  1.00 0.00 ? 65 VAL A HG22 6  
ATOM   7367  H  HG23 . VAL A 1 65 ? 7.850   -15.723 -4.458  1.00 0.00 ? 65 VAL A HG23 6  
ATOM   7368  N  N    . SER A 1 66 ? 4.106   -16.477 -4.789  1.00 0.00 ? 66 SER A N    6  
ATOM   7369  C  CA   . SER A 1 66 ? 3.778   -17.885 -4.577  1.00 0.00 ? 66 SER A CA   6  
ATOM   7370  C  C    . SER A 1 66 ? 4.654   -18.790 -5.443  1.00 0.00 ? 66 SER A C    6  
ATOM   7371  O  O    . SER A 1 66 ? 4.271   -19.163 -6.556  1.00 0.00 ? 66 SER A O    6  
ATOM   7372  C  CB   . SER A 1 66 ? 2.299   -18.134 -4.891  1.00 0.00 ? 66 SER A CB   6  
ATOM   7373  O  OG   . SER A 1 66 ? 1.501   -18.033 -3.725  1.00 0.00 ? 66 SER A OG   6  
ATOM   7374  H  H    . SER A 1 66 ? 3.695   -16.002 -5.542  1.00 0.00 ? 66 SER A H    6  
ATOM   7375  H  HA   . SER A 1 66 ? 3.959   -18.116 -3.537  1.00 0.00 ? 66 SER A HA   6  
ATOM   7376  H  HB2  . SER A 1 66 ? 1.958   -17.404 -5.609  1.00 0.00 ? 66 SER A HB2  6  
ATOM   7377  H  HB3  . SER A 1 66 ? 2.184   -19.125 -5.304  1.00 0.00 ? 66 SER A HB3  6  
ATOM   7378  H  HG   . SER A 1 66 ? 0.750   -17.462 -3.899  1.00 0.00 ? 66 SER A HG   6  
ATOM   7379  N  N    . GLY A 1 67 ? 5.832   -19.145 -4.925  1.00 0.00 ? 67 GLY A N    6  
ATOM   7380  C  CA   . GLY A 1 67 ? 6.744   -20.010 -5.661  1.00 0.00 ? 67 GLY A CA   6  
ATOM   7381  C  C    . GLY A 1 67 ? 6.183   -21.405 -5.874  1.00 0.00 ? 67 GLY A C    6  
ATOM   7382  O  O    . GLY A 1 67 ? 6.251   -21.942 -6.981  1.00 0.00 ? 67 GLY A O    6  
ATOM   7383  H  H    . GLY A 1 67 ? 6.083   -18.820 -4.035  1.00 0.00 ? 67 GLY A H    6  
ATOM   7384  H  HA2  . GLY A 1 67 ? 6.944   -19.563 -6.624  1.00 0.00 ? 67 GLY A HA2  6  
ATOM   7385  H  HA3  . GLY A 1 67 ? 7.671   -20.087 -5.113  1.00 0.00 ? 67 GLY A HA3  6  
ATOM   7386  N  N    . GLU A 1 68 ? 5.626   -21.989 -4.813  1.00 0.00 ? 68 GLU A N    6  
ATOM   7387  C  CA   . GLU A 1 68 ? 5.047   -23.327 -4.886  1.00 0.00 ? 68 GLU A CA   6  
ATOM   7388  C  C    . GLU A 1 68 ? 3.556   -23.295 -4.538  1.00 0.00 ? 68 GLU A C    6  
ATOM   7389  O  O    . GLU A 1 68 ? 3.166   -23.547 -3.396  1.00 0.00 ? 68 GLU A O    6  
ATOM   7390  C  CB   . GLU A 1 68 ? 5.797   -24.279 -3.947  1.00 0.00 ? 68 GLU A CB   6  
ATOM   7391  C  CG   . GLU A 1 68 ? 6.996   -24.954 -4.600  1.00 0.00 ? 68 GLU A CG   6  
ATOM   7392  C  CD   . GLU A 1 68 ? 7.172   -26.395 -4.161  1.00 0.00 ? 68 GLU A CD   6  
ATOM   7393  O  OE1  . GLU A 1 68 ? 6.288   -27.222 -4.469  1.00 0.00 ? 68 GLU A OE1  6  
ATOM   7394  O  OE2  . GLU A 1 68 ? 8.195   -26.696 -3.511  1.00 0.00 ? 68 GLU A OE2  6  
ATOM   7395  H  H    . GLU A 1 68 ? 5.602   -21.507 -3.960  1.00 0.00 ? 68 GLU A H    6  
ATOM   7396  H  HA   . GLU A 1 68 ? 5.156   -23.678 -5.902  1.00 0.00 ? 68 GLU A HA   6  
ATOM   7397  H  HB2  . GLU A 1 68 ? 6.147   -23.721 -3.091  1.00 0.00 ? 68 GLU A HB2  6  
ATOM   7398  H  HB3  . GLU A 1 68 ? 5.117   -25.048 -3.611  1.00 0.00 ? 68 GLU A HB3  6  
ATOM   7399  H  HG2  . GLU A 1 68 ? 6.865   -24.934 -5.671  1.00 0.00 ? 68 GLU A HG2  6  
ATOM   7400  H  HG3  . GLU A 1 68 ? 7.888   -24.401 -4.339  1.00 0.00 ? 68 GLU A HG3  6  
ATOM   7401  N  N    . THR A 1 69 ? 2.728   -22.973 -5.536  1.00 0.00 ? 69 THR A N    6  
ATOM   7402  C  CA   . THR A 1 69 ? 1.279   -22.897 -5.346  1.00 0.00 ? 69 THR A CA   6  
ATOM   7403  C  C    . THR A 1 69 ? 0.536   -23.731 -6.396  1.00 0.00 ? 69 THR A C    6  
ATOM   7404  O  O    . THR A 1 69 ? 1.096   -24.075 -7.439  1.00 0.00 ? 69 THR A O    6  
ATOM   7405  C  CB   . THR A 1 69 ? 0.819   -21.434 -5.399  1.00 0.00 ? 69 THR A CB   6  
ATOM   7406  O  OG1  . THR A 1 69 ? -0.560  -21.326 -5.087  1.00 0.00 ? 69 THR A OG1  6  
ATOM   7407  C  CG2  . THR A 1 69 ? 1.036   -20.777 -6.748  1.00 0.00 ? 69 THR A CG2  6  
ATOM   7408  H  H    . THR A 1 69 ? 3.101   -22.778 -6.420  1.00 0.00 ? 69 THR A H    6  
ATOM   7409  H  HA   . THR A 1 69 ? 1.054   -23.296 -4.368  1.00 0.00 ? 69 THR A HA   6  
ATOM   7410  H  HB   . THR A 1 69 ? 1.374   -20.870 -4.665  1.00 0.00 ? 69 THR A HB   6  
ATOM   7411  H  HG1  . THR A 1 69 ? -0.743  -20.450 -4.737  1.00 0.00 ? 69 THR A HG1  6  
ATOM   7412  H  HG21 . THR A 1 69 ? 2.094   -20.735 -6.962  1.00 0.00 ? 69 THR A HG21 6  
ATOM   7413  H  HG22 . THR A 1 69 ? 0.632   -19.774 -6.728  1.00 0.00 ? 69 THR A HG22 6  
ATOM   7414  H  HG23 . THR A 1 69 ? 0.535   -21.349 -7.515  1.00 0.00 ? 69 THR A HG23 6  
ATOM   7415  N  N    . VAL A 1 70 ? -0.726  -24.054 -6.108  1.00 0.00 ? 70 VAL A N    6  
ATOM   7416  C  CA   . VAL A 1 70 ? -1.548  -24.851 -7.018  1.00 0.00 ? 70 VAL A CA   6  
ATOM   7417  C  C    . VAL A 1 70 ? -2.617  -23.987 -7.696  1.00 0.00 ? 70 VAL A C    6  
ATOM   7418  O  O    . VAL A 1 70 ? -3.230  -23.131 -7.056  1.00 0.00 ? 70 VAL A O    6  
ATOM   7419  C  CB   . VAL A 1 70 ? -2.234  -26.020 -6.273  1.00 0.00 ? 70 VAL A CB   6  
ATOM   7420  C  CG1  . VAL A 1 70 ? -2.889  -26.983 -7.253  1.00 0.00 ? 70 VAL A CG1  6  
ATOM   7421  C  CG2  . VAL A 1 70 ? -1.232  -26.756 -5.390  1.00 0.00 ? 70 VAL A CG2  6  
ATOM   7422  H  H    . VAL A 1 70 ? -1.114  -23.752 -5.260  1.00 0.00 ? 70 VAL A H    6  
ATOM   7423  H  HA   . VAL A 1 70 ? -0.900  -25.265 -7.775  1.00 0.00 ? 70 VAL A HA   6  
ATOM   7424  H  HB   . VAL A 1 70 ? -3.005  -25.612 -5.638  1.00 0.00 ? 70 VAL A HB   6  
ATOM   7425  H  HG11 . VAL A 1 70 ? -2.150  -27.341 -7.954  1.00 0.00 ? 70 VAL A HG11 6  
ATOM   7426  H  HG12 . VAL A 1 70 ? -3.676  -26.472 -7.787  1.00 0.00 ? 70 VAL A HG12 6  
ATOM   7427  H  HG13 . VAL A 1 70 ? -3.306  -27.819 -6.711  1.00 0.00 ? 70 VAL A HG13 6  
ATOM   7428  H  HG21 . VAL A 1 70 ? -1.247  -26.329 -4.399  1.00 0.00 ? 70 VAL A HG21 6  
ATOM   7429  H  HG22 . VAL A 1 70 ? -0.243  -26.657 -5.810  1.00 0.00 ? 70 VAL A HG22 6  
ATOM   7430  H  HG23 . VAL A 1 70 ? -1.498  -27.801 -5.336  1.00 0.00 ? 70 VAL A HG23 6  
ATOM   7431  N  N    . PRO A 1 71 ? -2.848  -24.201 -9.010  1.00 0.00 ? 71 PRO A N    6  
ATOM   7432  C  CA   . PRO A 1 71 ? -3.843  -23.438 -9.784  1.00 0.00 ? 71 PRO A CA   6  
ATOM   7433  C  C    . PRO A 1 71 ? -5.247  -23.506 -9.177  1.00 0.00 ? 71 PRO A C    6  
ATOM   7434  O  O    . PRO A 1 71 ? -5.785  -24.594 -8.963  1.00 0.00 ? 71 PRO A O    6  
ATOM   7435  C  CB   . PRO A 1 71 ? -3.824  -24.112 -11.162 1.00 0.00 ? 71 PRO A CB   6  
ATOM   7436  C  CG   . PRO A 1 71 ? -2.493  -24.774 -11.247 1.00 0.00 ? 71 PRO A CG   6  
ATOM   7437  C  CD   . PRO A 1 71 ? -2.154  -25.198 -9.846  1.00 0.00 ? 71 PRO A CD   6  
ATOM   7438  H  HA   . PRO A 1 71 ? -3.551  -22.403 -9.885  1.00 0.00 ? 71 PRO A HA   6  
ATOM   7439  H  HB2  . PRO A 1 71 ? -4.628  -24.831 -11.226 1.00 0.00 ? 71 PRO A HB2  6  
ATOM   7440  H  HB3  . PRO A 1 71 ? -3.942  -23.364 -11.932 1.00 0.00 ? 71 PRO A HB3  6  
ATOM   7441  H  HG2  . PRO A 1 71 ? -2.551  -25.635 -11.897 1.00 0.00 ? 71 PRO A HG2  6  
ATOM   7442  H  HG3  . PRO A 1 71 ? -1.759  -24.074 -11.614 1.00 0.00 ? 71 PRO A HG3  6  
ATOM   7443  H  HD2  . PRO A 1 71 ? -2.526  -26.194 -9.653  1.00 0.00 ? 71 PRO A HD2  6  
ATOM   7444  H  HD3  . PRO A 1 71 ? -1.086  -25.156 -9.687  1.00 0.00 ? 71 PRO A HD3  6  
ATOM   7445  N  N    . ALA A 1 72 ? -5.828  -22.329 -8.908  1.00 0.00 ? 72 ALA A N    6  
ATOM   7446  C  CA   . ALA A 1 72 ? -7.171  -22.223 -8.326  1.00 0.00 ? 72 ALA A CA   6  
ATOM   7447  C  C    . ALA A 1 72 ? -7.183  -22.634 -6.849  1.00 0.00 ? 72 ALA A C    6  
ATOM   7448  O  O    . ALA A 1 72 ? -6.297  -23.358 -6.389  1.00 0.00 ? 72 ALA A O    6  
ATOM   7449  C  CB   . ALA A 1 72 ? -8.168  -23.056 -9.124  1.00 0.00 ? 72 ALA A CB   6  
ATOM   7450  H  H    . ALA A 1 72 ? -5.337  -21.505 -9.107  1.00 0.00 ? 72 ALA A H    6  
ATOM   7451  H  HA   . ALA A 1 72 ? -7.474  -21.188 -8.397  1.00 0.00 ? 72 ALA A HA   6  
ATOM   7452  H  HB1  . ALA A 1 72 ? -8.215  -24.053 -8.710  1.00 0.00 ? 72 ALA A HB1  6  
ATOM   7453  H  HB2  . ALA A 1 72 ? -7.851  -23.108 -10.155 1.00 0.00 ? 72 ALA A HB2  6  
ATOM   7454  H  HB3  . ALA A 1 72 ? -9.144  -22.597 -9.071  1.00 0.00 ? 72 ALA A HB3  6  
ATOM   7455  N  N    . PRO A 1 73 ? -8.195  -22.174 -6.080  1.00 0.00 ? 73 PRO A N    6  
ATOM   7456  C  CA   . PRO A 1 73 ? -8.315  -22.495 -4.652  1.00 0.00 ? 73 PRO A CA   6  
ATOM   7457  C  C    . PRO A 1 73 ? -8.745  -23.939 -4.405  1.00 0.00 ? 73 PRO A C    6  
ATOM   7458  O  O    . PRO A 1 73 ? -9.201  -24.630 -5.320  1.00 0.00 ? 73 PRO A O    6  
ATOM   7459  C  CB   . PRO A 1 73 ? -9.392  -21.528 -4.162  1.00 0.00 ? 73 PRO A CB   6  
ATOM   7460  C  CG   . PRO A 1 73 ? -10.235 -21.270 -5.362  1.00 0.00 ? 73 PRO A CG   6  
ATOM   7461  C  CD   . PRO A 1 73 ? -9.300  -21.307 -6.542  1.00 0.00 ? 73 PRO A CD   6  
ATOM   7462  H  HA   . PRO A 1 73 ? -7.391  -22.305 -4.126  1.00 0.00 ? 73 PRO A HA   6  
ATOM   7463  H  HB2  . PRO A 1 73 ? -9.962  -21.990 -3.368  1.00 0.00 ? 73 PRO A HB2  6  
ATOM   7464  H  HB3  . PRO A 1 73 ? -8.931  -20.621 -3.801  1.00 0.00 ? 73 PRO A HB3  6  
ATOM   7465  H  HG2  . PRO A 1 73 ? -10.987 -22.041 -5.454  1.00 0.00 ? 73 PRO A HG2  6  
ATOM   7466  H  HG3  . PRO A 1 73 ? -10.700 -20.299 -5.282  1.00 0.00 ? 73 PRO A HG3  6  
ATOM   7467  H  HD2  . PRO A 1 73 ? -9.795  -21.739 -7.399  1.00 0.00 ? 73 PRO A HD2  6  
ATOM   7468  H  HD3  . PRO A 1 73 ? -8.940  -20.316 -6.770  1.00 0.00 ? 73 PRO A HD3  6  
ATOM   7469  N  N    . SER A 1 74 ? -8.595  -24.386 -3.158  1.00 0.00 ? 74 SER A N    6  
ATOM   7470  C  CA   . SER A 1 74 ? -8.962  -25.747 -2.781  1.00 0.00 ? 74 SER A CA   6  
ATOM   7471  C  C    . SER A 1 74 ? -9.459  -25.804 -1.338  1.00 0.00 ? 74 SER A C    6  
ATOM   7472  O  O    . SER A 1 74 ? -10.592 -26.214 -1.081  1.00 0.00 ? 74 SER A O    6  
ATOM   7473  C  CB   . SER A 1 74 ? -7.766  -26.687 -2.961  1.00 0.00 ? 74 SER A CB   6  
ATOM   7474  O  OG   . SER A 1 74 ? -7.262  -26.628 -4.285  1.00 0.00 ? 74 SER A OG   6  
ATOM   7475  H  H    . SER A 1 74 ? -8.227  -23.785 -2.477  1.00 0.00 ? 74 SER A H    6  
ATOM   7476  H  HA   . SER A 1 74 ? -9.760  -26.066 -3.435  1.00 0.00 ? 74 SER A HA   6  
ATOM   7477  H  HB2  . SER A 1 74 ? -6.982  -26.400 -2.278  1.00 0.00 ? 74 SER A HB2  6  
ATOM   7478  H  HB3  . SER A 1 74 ? -8.073  -27.700 -2.749  1.00 0.00 ? 74 SER A HB3  6  
ATOM   7479  H  HG   . SER A 1 74 ? -7.992  -26.613 -4.907  1.00 0.00 ? 74 SER A HG   6  
ATOM   7480  N  N    . ALA A 1 75 ? -8.602  -25.393 -0.401  1.00 0.00 ? 75 ALA A N    6  
ATOM   7481  C  CA   . ALA A 1 75 ? -8.946  -25.397 1.020   1.00 0.00 ? 75 ALA A CA   6  
ATOM   7482  C  C    . ALA A 1 75 ? -9.393  -24.013 1.490   1.00 0.00 ? 75 ALA A C    6  
ATOM   7483  O  O    . ALA A 1 75 ? -9.281  -23.031 0.754   1.00 0.00 ? 75 ALA A O    6  
ATOM   7484  C  CB   . ALA A 1 75 ? -7.759  -25.876 1.848   1.00 0.00 ? 75 ALA A CB   6  
ATOM   7485  H  H    . ALA A 1 75 ? -7.714  -25.080 -0.672  1.00 0.00 ? 75 ALA A H    6  
ATOM   7486  H  HA   . ALA A 1 75 ? -9.759  -26.095 1.163   1.00 0.00 ? 75 ALA A HA   6  
ATOM   7487  H  HB1  . ALA A 1 75 ? -7.785  -25.405 2.819   1.00 0.00 ? 75 ALA A HB1  6  
ATOM   7488  H  HB2  . ALA A 1 75 ? -6.839  -25.613 1.346   1.00 0.00 ? 75 ALA A HB2  6  
ATOM   7489  H  HB3  . ALA A 1 75 ? -7.811  -26.948 1.966   1.00 0.00 ? 75 ALA A HB3  6  
ATOM   7490  N  N    . ASN A 1 76 ? -9.892  -23.946 2.725   1.00 0.00 ? 76 ASN A N    6  
ATOM   7491  C  CA   . ASN A 1 76 ? -10.350 -22.683 3.302   1.00 0.00 ? 76 ASN A CA   6  
ATOM   7492  C  C    . ASN A 1 76 ? -10.070 -22.630 4.809   1.00 0.00 ? 76 ASN A C    6  
ATOM   7493  O  O    . ASN A 1 76 ? -10.868 -22.093 5.582   1.00 0.00 ? 76 ASN A O    6  
ATOM   7494  C  CB   . ASN A 1 76 ? -11.846 -22.484 3.030   1.00 0.00 ? 76 ASN A CB   6  
ATOM   7495  C  CG   . ASN A 1 76 ? -12.108 -21.803 1.699   1.00 0.00 ? 76 ASN A CG   6  
ATOM   7496  O  OD1  . ASN A 1 76 ? -12.678 -22.400 0.787   1.00 0.00 ? 76 ASN A OD1  6  
ATOM   7497  N  ND2  . ASN A 1 76 ? -11.691 -20.547 1.582   1.00 0.00 ? 76 ASN A ND2  6  
ATOM   7498  H  H    . ASN A 1 76 ? -9.951  -24.764 3.263   1.00 0.00 ? 76 ASN A H    6  
ATOM   7499  H  HA   . ASN A 1 76 ? -9.799  -21.886 2.824   1.00 0.00 ? 76 ASN A HA   6  
ATOM   7500  H  HB2  . ASN A 1 76 ? -12.337 -23.446 3.024   1.00 0.00 ? 76 ASN A HB2  6  
ATOM   7501  H  HB3  . ASN A 1 76 ? -12.270 -21.873 3.814   1.00 0.00 ? 76 ASN A HB3  6  
ATOM   7502  H  HD21 . ASN A 1 76 ? -11.245 -20.131 2.350   1.00 0.00 ? 76 ASN A HD21 6  
ATOM   7503  H  HD22 . ASN A 1 76 ? -11.845 -20.086 0.731   1.00 0.00 ? 76 ASN A HD22 6  
ATOM   7504  N  N    . LYS A 1 77 ? -8.926  -23.183 5.220   1.00 0.00 ? 77 LYS A N    6  
ATOM   7505  C  CA   . LYS A 1 77 ? -8.535  -23.193 6.629   1.00 0.00 ? 77 LYS A CA   6  
ATOM   7506  C  C    . LYS A 1 77 ? -7.057  -22.823 6.798   1.00 0.00 ? 77 LYS A C    6  
ATOM   7507  O  O    . LYS A 1 77 ? -6.372  -23.355 7.675   1.00 0.00 ? 77 LYS A O    6  
ATOM   7508  C  CB   . LYS A 1 77 ? -8.804  -24.570 7.251   1.00 0.00 ? 77 LYS A CB   6  
ATOM   7509  C  CG   . LYS A 1 77 ? -10.270 -24.826 7.575   1.00 0.00 ? 77 LYS A CG   6  
ATOM   7510  C  CD   . LYS A 1 77 ? -10.615 -24.411 8.999   1.00 0.00 ? 77 LYS A CD   6  
ATOM   7511  C  CE   . LYS A 1 77 ? -10.987 -22.937 9.079   1.00 0.00 ? 77 LYS A CE   6  
ATOM   7512  N  NZ   . LYS A 1 77 ? -11.662 -22.595 10.364  1.00 0.00 ? 77 LYS A NZ   6  
ATOM   7513  H  H    . LYS A 1 77 ? -8.326  -23.591 4.560   1.00 0.00 ? 77 LYS A H    6  
ATOM   7514  H  HA   . LYS A 1 77 ? -9.134  -22.454 7.142   1.00 0.00 ? 77 LYS A HA   6  
ATOM   7515  H  HB2  . LYS A 1 77 ? -8.472  -25.334 6.564   1.00 0.00 ? 77 LYS A HB2  6  
ATOM   7516  H  HB3  . LYS A 1 77 ? -8.238  -24.654 8.166   1.00 0.00 ? 77 LYS A HB3  6  
ATOM   7517  H  HG2  . LYS A 1 77 ? -10.885 -24.266 6.887   1.00 0.00 ? 77 LYS A HG2  6  
ATOM   7518  H  HG3  . LYS A 1 77 ? -10.471 -25.882 7.461   1.00 0.00 ? 77 LYS A HG3  6  
ATOM   7519  H  HD2  . LYS A 1 77 ? -11.452 -25.001 9.342   1.00 0.00 ? 77 LYS A HD2  6  
ATOM   7520  H  HD3  . LYS A 1 77 ? -9.760  -24.592 9.634   1.00 0.00 ? 77 LYS A HD3  6  
ATOM   7521  H  HE2  . LYS A 1 77 ? -10.086 -22.347 8.988   1.00 0.00 ? 77 LYS A HE2  6  
ATOM   7522  H  HE3  . LYS A 1 77 ? -11.651 -22.702 8.259   1.00 0.00 ? 77 LYS A HE3  6  
ATOM   7523  H  HZ1  . LYS A 1 77 ? -12.165 -23.425 10.737  1.00 0.00 ? 77 LYS A HZ1  6  
ATOM   7524  H  HZ2  . LYS A 1 77 ? -12.346 -21.826 10.214  1.00 0.00 ? 77 LYS A HZ2  6  
ATOM   7525  H  HZ3  . LYS A 1 77 ? -10.960 -22.285 11.065  1.00 0.00 ? 77 LYS A HZ3  6  
ATOM   7526  N  N    . GLU A 1 78 ? -6.571  -21.903 5.960   1.00 0.00 ? 78 GLU A N    6  
ATOM   7527  C  CA   . GLU A 1 78 ? -5.176  -21.463 6.026   1.00 0.00 ? 78 GLU A CA   6  
ATOM   7528  C  C    . GLU A 1 78 ? -4.931  -20.656 7.305   1.00 0.00 ? 78 GLU A C    6  
ATOM   7529  O  O    . GLU A 1 78 ? -5.172  -19.448 7.347   1.00 0.00 ? 78 GLU A O    6  
ATOM   7530  C  CB   . GLU A 1 78 ? -4.818  -20.629 4.789   1.00 0.00 ? 78 GLU A CB   6  
ATOM   7531  C  CG   . GLU A 1 78 ? -3.404  -20.873 4.278   1.00 0.00 ? 78 GLU A CG   6  
ATOM   7532  C  CD   . GLU A 1 78 ? -3.321  -20.891 2.762   1.00 0.00 ? 78 GLU A CD   6  
ATOM   7533  O  OE1  . GLU A 1 78 ? -4.072  -21.666 2.132   1.00 0.00 ? 78 GLU A OE1  6  
ATOM   7534  O  OE2  . GLU A 1 78 ? -2.501  -20.130 2.203   1.00 0.00 ? 78 GLU A OE2  6  
ATOM   7535  H  H    . GLU A 1 78 ? -7.162  -21.509 5.285   1.00 0.00 ? 78 GLU A H    6  
ATOM   7536  H  HA   . GLU A 1 78 ? -4.556  -22.345 6.047   1.00 0.00 ? 78 GLU A HA   6  
ATOM   7537  H  HB2  . GLU A 1 78 ? -5.510  -20.869 3.996   1.00 0.00 ? 78 GLU A HB2  6  
ATOM   7538  H  HB3  . GLU A 1 78 ? -4.915  -19.582 5.033   1.00 0.00 ? 78 GLU A HB3  6  
ATOM   7539  H  HG2  . GLU A 1 78 ? -2.763  -20.084 4.646   1.00 0.00 ? 78 GLU A HG2  6  
ATOM   7540  H  HG3  . GLU A 1 78 ? -3.055  -21.823 4.656   1.00 0.00 ? 78 GLU A HG3  6  
ATOM   7541  N  N    . LEU A 1 79 ? -4.466  -21.343 8.351   1.00 0.00 ? 79 LEU A N    6  
ATOM   7542  C  CA   . LEU A 1 79 ? -4.200  -20.716 9.637   1.00 0.00 ? 79 LEU A CA   6  
ATOM   7543  C  C    . LEU A 1 79 ? -2.738  -20.933 10.047  1.00 0.00 ? 79 LEU A C    6  
ATOM   7544  O  O    . LEU A 1 79 ? -1.851  -20.986 9.193   1.00 0.00 ? 79 LEU A O    6  
ATOM   7545  C  CB   . LEU A 1 79 ? -5.166  -21.294 10.684  1.00 0.00 ? 79 LEU A CB   6  
ATOM   7546  C  CG   . LEU A 1 79 ? -5.732  -20.283 11.685  1.00 0.00 ? 79 LEU A CG   6  
ATOM   7547  C  CD1  . LEU A 1 79 ? -7.115  -19.814 11.251  1.00 0.00 ? 79 LEU A CD1  6  
ATOM   7548  C  CD2  . LEU A 1 79 ? -5.789  -20.894 13.078  1.00 0.00 ? 79 LEU A CD2  6  
ATOM   7549  H  H    . LEU A 1 79 ? -4.306  -22.303 8.257   1.00 0.00 ? 79 LEU A H    6  
ATOM   7550  H  HA   . LEU A 1 79 ? -4.382  -19.657 9.537   1.00 0.00 ? 79 LEU A HA   6  
ATOM   7551  H  HB2  . LEU A 1 79 ? -5.993  -21.751 10.161  1.00 0.00 ? 79 LEU A HB2  6  
ATOM   7552  H  HB3  . LEU A 1 79 ? -4.647  -22.064 11.235  1.00 0.00 ? 79 LEU A HB3  6  
ATOM   7553  H  HG   . LEU A 1 79 ? -5.083  -19.420 11.724  1.00 0.00 ? 79 LEU A HG   6  
ATOM   7554  H  HD11 . LEU A 1 79 ? -7.869  -20.335 11.821  1.00 0.00 ? 79 LEU A HD11 6  
ATOM   7555  H  HD12 . LEU A 1 79 ? -7.252  -20.019 10.200  1.00 0.00 ? 79 LEU A HD12 6  
ATOM   7556  H  HD13 . LEU A 1 79 ? -7.204  -18.751 11.425  1.00 0.00 ? 79 LEU A HD13 6  
ATOM   7557  H  HD21 . LEU A 1 79 ? -6.461  -20.320 13.697  1.00 0.00 ? 79 LEU A HD21 6  
ATOM   7558  H  HD22 . LEU A 1 79 ? -4.801  -20.885 13.515  1.00 0.00 ? 79 LEU A HD22 6  
ATOM   7559  H  HD23 . LEU A 1 79 ? -6.143  -21.912 13.011  1.00 0.00 ? 79 LEU A HD23 6  
ATOM   7560  N  N    . VAL A 1 80 ? -2.493  -21.058 11.351  1.00 0.00 ? 80 VAL A N    6  
ATOM   7561  C  CA   . VAL A 1 80 ? -1.141  -21.269 11.864  1.00 0.00 ? 80 VAL A CA   6  
ATOM   7562  C  C    . VAL A 1 80 ? -0.860  -22.761 12.061  1.00 0.00 ? 80 VAL A C    6  
ATOM   7563  O  O    . VAL A 1 80 ? -1.313  -23.363 13.036  1.00 0.00 ? 80 VAL A O    6  
ATOM   7564  C  CB   . VAL A 1 80 ? -0.917  -20.522 13.201  1.00 0.00 ? 80 VAL A CB   6  
ATOM   7565  C  CG1  . VAL A 1 80 ? 0.550   -20.571 13.610  1.00 0.00 ? 80 VAL A CG1  6  
ATOM   7566  C  CG2  . VAL A 1 80 ? -1.396  -19.079 13.102  1.00 0.00 ? 80 VAL A CG2  6  
ATOM   7567  H  H    . VAL A 1 80 ? -3.237  -21.009 11.981  1.00 0.00 ? 80 VAL A H    6  
ATOM   7568  H  HA   . VAL A 1 80 ? -0.446  -20.876 11.136  1.00 0.00 ? 80 VAL A HA   6  
ATOM   7569  H  HB   . VAL A 1 80 ? -1.495  -21.017 13.968  1.00 0.00 ? 80 VAL A HB   6  
ATOM   7570  H  HG11 . VAL A 1 80 ? 1.026   -21.426 13.154  1.00 0.00 ? 80 VAL A HG11 6  
ATOM   7571  H  HG12 . VAL A 1 80 ? 0.621   -20.651 14.685  1.00 0.00 ? 80 VAL A HG12 6  
ATOM   7572  H  HG13 . VAL A 1 80 ? 1.044   -19.667 13.285  1.00 0.00 ? 80 VAL A HG13 6  
ATOM   7573  H  HG21 . VAL A 1 80 ? -1.148  -18.682 12.128  1.00 0.00 ? 80 VAL A HG21 6  
ATOM   7574  H  HG22 . VAL A 1 80 ? -0.914  -18.486 13.866  1.00 0.00 ? 80 VAL A HG22 6  
ATOM   7575  H  HG23 . VAL A 1 80 ? -2.467  -19.044 13.242  1.00 0.00 ? 80 VAL A HG23 6  
ATOM   7576  N  N    . LYS A 1 81 ? -0.110  -23.350 11.121  1.00 0.00 ? 81 LYS A N    6  
ATOM   7577  C  CA   . LYS A 1 81 ? 0.243   -24.772 11.171  1.00 0.00 ? 81 LYS A CA   6  
ATOM   7578  C  C    . LYS A 1 81 ? -1.009  -25.659 11.132  1.00 0.00 ? 81 LYS A C    6  
ATOM   7579  O  O    . LYS A 1 81 ? -1.457  -26.166 12.163  1.00 0.00 ? 81 LYS A O    6  
ATOM   7580  C  CB   . LYS A 1 81 ? 1.082   -25.071 12.424  1.00 0.00 ? 81 LYS A CB   6  
ATOM   7581  C  CG   . LYS A 1 81 ? 1.871   -26.372 12.339  1.00 0.00 ? 81 LYS A CG   6  
ATOM   7582  C  CD   . LYS A 1 81 ? 3.098   -26.343 13.240  1.00 0.00 ? 81 LYS A CD   6  
ATOM   7583  C  CE   . LYS A 1 81 ? 3.977   -27.572 13.039  1.00 0.00 ? 81 LYS A CE   6  
ATOM   7584  N  NZ   . LYS A 1 81 ? 3.373   -28.799 13.632  1.00 0.00 ? 81 LYS A NZ   6  
ATOM   7585  H  H    . LYS A 1 81 ? 0.215   -22.810 10.370  1.00 0.00 ? 81 LYS A H    6  
ATOM   7586  H  HA   . LYS A 1 81 ? 0.841   -24.988 10.297  1.00 0.00 ? 81 LYS A HA   6  
ATOM   7587  H  HB2  . LYS A 1 81 ? 1.780   -24.262 12.576  1.00 0.00 ? 81 LYS A HB2  6  
ATOM   7588  H  HB3  . LYS A 1 81 ? 0.423   -25.130 13.278  1.00 0.00 ? 81 LYS A HB3  6  
ATOM   7589  H  HG2  . LYS A 1 81 ? 1.232   -27.188 12.644  1.00 0.00 ? 81 LYS A HG2  6  
ATOM   7590  H  HG3  . LYS A 1 81 ? 2.188   -26.523 11.318  1.00 0.00 ? 81 LYS A HG3  6  
ATOM   7591  H  HD2  . LYS A 1 81 ? 3.678   -25.461 13.013  1.00 0.00 ? 81 LYS A HD2  6  
ATOM   7592  H  HD3  . LYS A 1 81 ? 2.775   -26.307 14.270  1.00 0.00 ? 81 LYS A HD3  6  
ATOM   7593  H  HE2  . LYS A 1 81 ? 4.120   -27.728 11.979  1.00 0.00 ? 81 LYS A HE2  6  
ATOM   7594  H  HE3  . LYS A 1 81 ? 4.935   -27.392 13.506  1.00 0.00 ? 81 LYS A HE3  6  
ATOM   7595  H  HZ1  . LYS A 1 81 ? 2.412   -28.942 13.260  1.00 0.00 ? 81 LYS A HZ1  6  
ATOM   7596  H  HZ2  . LYS A 1 81 ? 3.321   -28.708 14.668  1.00 0.00 ? 81 LYS A HZ2  6  
ATOM   7597  H  HZ3  . LYS A 1 81 ? 3.950   -29.632 13.398  1.00 0.00 ? 81 LYS A HZ3  6  
ATOM   7598  N  N    . LEU A 1 82 ? -1.567  -25.842 9.931   1.00 0.00 ? 82 LEU A N    6  
ATOM   7599  C  CA   . LEU A 1 82 ? -2.764  -26.666 9.750   1.00 0.00 ? 82 LEU A CA   6  
ATOM   7600  C  C    . LEU A 1 82 ? -2.629  -27.573 8.522   1.00 0.00 ? 82 LEU A C    6  
ATOM   7601  O  O    . LEU A 1 82 ? -1.853  -27.284 7.609   1.00 0.00 ? 82 LEU A O    6  
ATOM   7602  C  CB   . LEU A 1 82 ? -4.005  -25.777 9.611   1.00 0.00 ? 82 LEU A CB   6  
ATOM   7603  C  CG   . LEU A 1 82 ? -5.282  -26.335 10.249  1.00 0.00 ? 82 LEU A CG   6  
ATOM   7604  C  CD1  . LEU A 1 82 ? -5.387  -25.910 11.706  1.00 0.00 ? 82 LEU A CD1  6  
ATOM   7605  C  CD2  . LEU A 1 82 ? -6.508  -25.880 9.472   1.00 0.00 ? 82 LEU A CD2  6  
ATOM   7606  H  H    . LEU A 1 82 ? -1.162  -25.412 9.146   1.00 0.00 ? 82 LEU A H    6  
ATOM   7607  H  HA   . LEU A 1 82 ? -2.873  -27.285 10.627  1.00 0.00 ? 82 LEU A HA   6  
ATOM   7608  H  HB2  . LEU A 1 82 ? -3.790  -24.821 10.065  1.00 0.00 ? 82 LEU A HB2  6  
ATOM   7609  H  HB3  . LEU A 1 82 ? -4.196  -25.620 8.559   1.00 0.00 ? 82 LEU A HB3  6  
ATOM   7610  H  HG   . LEU A 1 82 ? -5.250  -27.415 10.219  1.00 0.00 ? 82 LEU A HG   6  
ATOM   7611  H  HD11 . LEU A 1 82 ? -6.366  -26.160 12.085  1.00 0.00 ? 82 LEU A HD11 6  
ATOM   7612  H  HD12 . LEU A 1 82 ? -5.233  -24.843 11.782  1.00 0.00 ? 82 LEU A HD12 6  
ATOM   7613  H  HD13 . LEU A 1 82 ? -4.634  -26.423 12.286  1.00 0.00 ? 82 LEU A HD13 6  
ATOM   7614  H  HD21 . LEU A 1 82 ? -7.374  -26.431 9.809   1.00 0.00 ? 82 LEU A HD21 6  
ATOM   7615  H  HD22 . LEU A 1 82 ? -6.355  -26.062 8.418   1.00 0.00 ? 82 LEU A HD22 6  
ATOM   7616  H  HD23 . LEU A 1 82 ? -6.667  -24.825 9.637   1.00 0.00 ? 82 LEU A HD23 6  
ATOM   7617  N  N    . GLU A 1 83 ? -3.394  -28.674 8.517   1.00 0.00 ? 83 GLU A N    6  
ATOM   7618  C  CA   . GLU A 1 83 ? -3.383  -29.647 7.416   1.00 0.00 ? 83 GLU A CA   6  
ATOM   7619  C  C    . GLU A 1 83 ? -2.100  -30.484 7.426   1.00 0.00 ? 83 GLU A C    6  
ATOM   7620  O  O    . GLU A 1 83 ? -2.147  -31.698 7.633   1.00 0.00 ? 83 GLU A O    6  
ATOM   7621  C  CB   . GLU A 1 83 ? -3.554  -28.948 6.061   1.00 0.00 ? 83 GLU A CB   6  
ATOM   7622  C  CG   . GLU A 1 83 ? -4.423  -29.724 5.081   1.00 0.00 ? 83 GLU A CG   6  
ATOM   7623  C  CD   . GLU A 1 83 ? -4.633  -28.987 3.773   1.00 0.00 ? 83 GLU A CD   6  
ATOM   7624  O  OE1  . GLU A 1 83 ? -3.677  -28.912 2.972   1.00 0.00 ? 83 GLU A OE1  6  
ATOM   7625  O  OE2  . GLU A 1 83 ? -5.756  -28.488 3.547   1.00 0.00 ? 83 GLU A OE2  6  
ATOM   7626  H  H    . GLU A 1 83 ? -3.986  -28.839 9.281   1.00 0.00 ? 83 GLU A H    6  
ATOM   7627  H  HA   . GLU A 1 83 ? -4.221  -30.313 7.568   1.00 0.00 ? 83 GLU A HA   6  
ATOM   7628  H  HB2  . GLU A 1 83 ? -4.007  -27.981 6.223   1.00 0.00 ? 83 GLU A HB2  6  
ATOM   7629  H  HB3  . GLU A 1 83 ? -2.581  -28.810 5.614   1.00 0.00 ? 83 GLU A HB3  6  
ATOM   7630  H  HG2  . GLU A 1 83 ? -3.946  -30.670 4.869   1.00 0.00 ? 83 GLU A HG2  6  
ATOM   7631  H  HG3  . GLU A 1 83 ? -5.386  -29.902 5.536   1.00 0.00 ? 83 GLU A HG3  6  
ATOM   7632  N  N    . HIS A 1 84 ? -0.957  -29.830 7.204   1.00 0.00 ? 84 HIS A N    6  
ATOM   7633  C  CA   . HIS A 1 84 ? 0.337   -30.511 7.190   1.00 0.00 ? 84 HIS A CA   6  
ATOM   7634  C  C    . HIS A 1 84 ? 0.675   -31.057 8.575   1.00 0.00 ? 84 HIS A C    6  
ATOM   7635  O  O    . HIS A 1 84 ? 0.865   -32.261 8.750   1.00 0.00 ? 84 HIS A O    6  
ATOM   7636  C  CB   . HIS A 1 84 ? 1.433   -29.545 6.719   1.00 0.00 ? 84 HIS A CB   6  
ATOM   7637  C  CG   . HIS A 1 84 ? 2.790   -30.170 6.583   1.00 0.00 ? 84 HIS A CG   6  
ATOM   7638  N  ND1  . HIS A 1 84 ? 3.401   -30.386 5.364   1.00 0.00 ? 84 HIS A ND1  6  
ATOM   7639  C  CD2  . HIS A 1 84 ? 3.667   -30.603 7.521   1.00 0.00 ? 84 HIS A CD2  6  
ATOM   7640  C  CE1  . HIS A 1 84 ? 4.593   -30.925 5.560   1.00 0.00 ? 84 HIS A CE1  6  
ATOM   7641  N  NE2  . HIS A 1 84 ? 4.776   -31.067 6.859   1.00 0.00 ? 84 HIS A NE2  6  
ATOM   7642  H  H    . HIS A 1 84 ? -0.985  -28.862 7.048   1.00 0.00 ? 84 HIS A H    6  
ATOM   7643  H  HA   . HIS A 1 84 ? 0.271   -31.335 6.494   1.00 0.00 ? 84 HIS A HA   6  
ATOM   7644  H  HB2  . HIS A 1 84 ? 1.157   -29.146 5.756   1.00 0.00 ? 84 HIS A HB2  6  
ATOM   7645  H  HB3  . HIS A 1 84 ? 1.511   -28.733 7.427   1.00 0.00 ? 84 HIS A HB3  6  
ATOM   7646  H  HD1  . HIS A 1 84 ? 3.019   -30.179 4.486   1.00 0.00 ? 84 HIS A HD1  6  
ATOM   7647  H  HD2  . HIS A 1 84 ? 3.520   -30.587 8.592   1.00 0.00 ? 84 HIS A HD2  6  
ATOM   7648  H  HE1  . HIS A 1 84 ? 5.299   -31.196 4.788   1.00 0.00 ? 84 HIS A HE1  6  
ATOM   7649  H  HE2  . HIS A 1 84 ? 5.587   -31.419 7.281   1.00 0.00 ? 84 HIS A HE2  6  
HETATM 7650  ZN ZN   . ZN  B 2 .  ? 2.754   13.236  3.827   1.00 0.00 ? 85 ZN  A ZN   6  
ATOM   7651  N  N    . MET A 1 1  ? 15.203  1.469   16.848  1.00 0.00 ? 1  MET A N    7  
ATOM   7652  C  CA   . MET A 1 1  ? 15.623  0.520   15.778  1.00 0.00 ? 1  MET A CA   7  
ATOM   7653  C  C    . MET A 1 1  ? 15.363  1.091   14.381  1.00 0.00 ? 1  MET A C    7  
ATOM   7654  O  O    . MET A 1 1  ? 16.187  0.924   13.478  1.00 0.00 ? 1  MET A O    7  
ATOM   7655  C  CB   . MET A 1 1  ? 14.866  -0.801  15.964  1.00 0.00 ? 1  MET A CB   7  
ATOM   7656  C  CG   . MET A 1 1  ? 15.699  -2.035  15.644  1.00 0.00 ? 1  MET A CG   7  
ATOM   7657  S  SD   . MET A 1 1  ? 14.817  -3.573  15.973  1.00 0.00 ? 1  MET A SD   7  
ATOM   7658  C  CE   . MET A 1 1  ? 15.128  -3.782  17.724  1.00 0.00 ? 1  MET A CE   7  
ATOM   7659  H  H1   . MET A 1 1  ? 15.690  1.192   17.725  1.00 0.00 ? 1  MET A H1   7  
ATOM   7660  H  H2   . MET A 1 1  ? 14.171  1.395   16.955  1.00 0.00 ? 1  MET A H2   7  
ATOM   7661  H  H3   . MET A 1 1  ? 15.483  2.425   16.553  1.00 0.00 ? 1  MET A H3   7  
ATOM   7662  H  HA   . MET A 1 1  ? 16.683  0.335   15.887  1.00 0.00 ? 1  MET A HA   7  
ATOM   7663  H  HB2  . MET A 1 1  ? 14.537  -0.875  16.990  1.00 0.00 ? 1  MET A HB2  7  
ATOM   7664  H  HB3  . MET A 1 1  ? 14.000  -0.802  15.317  1.00 0.00 ? 1  MET A HB3  7  
ATOM   7665  H  HG2  . MET A 1 1  ? 15.968  -2.009  14.598  1.00 0.00 ? 1  MET A HG2  7  
ATOM   7666  H  HG3  . MET A 1 1  ? 16.597  -2.014  16.245  1.00 0.00 ? 1  MET A HG3  7  
ATOM   7667  H  HE1  . MET A 1 1  ? 14.510  -3.096  18.284  1.00 0.00 ? 1  MET A HE1  7  
ATOM   7668  H  HE2  . MET A 1 1  ? 16.169  -3.579  17.932  1.00 0.00 ? 1  MET A HE2  7  
ATOM   7669  H  HE3  . MET A 1 1  ? 14.896  -4.795  18.014  1.00 0.00 ? 1  MET A HE3  7  
ATOM   7670  N  N    . ALA A 1 2  ? 14.217  1.759   14.203  1.00 0.00 ? 2  ALA A N    7  
ATOM   7671  C  CA   . ALA A 1 2  ? 13.858  2.347   12.910  1.00 0.00 ? 2  ALA A CA   7  
ATOM   7672  C  C    . ALA A 1 2  ? 13.286  3.756   13.070  1.00 0.00 ? 2  ALA A C    7  
ATOM   7673  O  O    . ALA A 1 2  ? 12.701  4.083   14.104  1.00 0.00 ? 2  ALA A O    7  
ATOM   7674  C  CB   . ALA A 1 2  ? 12.860  1.452   12.184  1.00 0.00 ? 2  ALA A CB   7  
ATOM   7675  H  H    . ALA A 1 2  ? 13.598  1.858   14.957  1.00 0.00 ? 2  ALA A H    7  
ATOM   7676  H  HA   . ALA A 1 2  ? 14.755  2.402   12.311  1.00 0.00 ? 2  ALA A HA   7  
ATOM   7677  H  HB1  . ALA A 1 2  ? 12.951  0.439   12.548  1.00 0.00 ? 2  ALA A HB1  7  
ATOM   7678  H  HB2  . ALA A 1 2  ? 13.063  1.472   11.124  1.00 0.00 ? 2  ALA A HB2  7  
ATOM   7679  H  HB3  . ALA A 1 2  ? 11.855  1.809   12.363  1.00 0.00 ? 2  ALA A HB3  7  
ATOM   7680  N  N    . VAL A 1 3  ? 13.451  4.582   12.031  1.00 0.00 ? 3  VAL A N    7  
ATOM   7681  C  CA   . VAL A 1 3  ? 12.941  5.956   12.049  1.00 0.00 ? 3  VAL A CA   7  
ATOM   7682  C  C    . VAL A 1 3  ? 11.662  6.088   11.207  1.00 0.00 ? 3  VAL A C    7  
ATOM   7683  O  O    . VAL A 1 3  ? 11.389  7.147   10.637  1.00 0.00 ? 3  VAL A O    7  
ATOM   7684  C  CB   . VAL A 1 3  ? 13.998  6.970   11.545  1.00 0.00 ? 3  VAL A CB   7  
ATOM   7685  C  CG1  . VAL A 1 3  ? 15.135  7.100   12.547  1.00 0.00 ? 3  VAL A CG1  7  
ATOM   7686  C  CG2  . VAL A 1 3  ? 14.534  6.578   10.174  1.00 0.00 ? 3  VAL A CG2  7  
ATOM   7687  H  H    . VAL A 1 3  ? 13.920  4.258   11.233  1.00 0.00 ? 3  VAL A H    7  
ATOM   7688  H  HA   . VAL A 1 3  ? 12.704  6.202   13.074  1.00 0.00 ? 3  VAL A HA   7  
ATOM   7689  H  HB   . VAL A 1 3  ? 13.523  7.937   11.455  1.00 0.00 ? 3  VAL A HB   7  
ATOM   7690  H  HG11 . VAL A 1 3  ? 15.441  6.118   12.874  1.00 0.00 ? 3  VAL A HG11 7  
ATOM   7691  H  HG12 . VAL A 1 3  ? 14.802  7.676   13.397  1.00 0.00 ? 3  VAL A HG12 7  
ATOM   7692  H  HG13 . VAL A 1 3  ? 15.971  7.601   12.080  1.00 0.00 ? 3  VAL A HG13 7  
ATOM   7693  H  HG21 . VAL A 1 3  ? 15.147  7.378   9.785   1.00 0.00 ? 3  VAL A HG21 7  
ATOM   7694  H  HG22 . VAL A 1 3  ? 13.708  6.397   9.503   1.00 0.00 ? 3  VAL A HG22 7  
ATOM   7695  H  HG23 . VAL A 1 3  ? 15.130  5.681   10.264  1.00 0.00 ? 3  VAL A HG23 7  
ATOM   7696  N  N    . PHE A 1 4  ? 10.878  5.006   11.144  1.00 0.00 ? 4  PHE A N    7  
ATOM   7697  C  CA   . PHE A 1 4  ? 9.627   4.990   10.382  1.00 0.00 ? 4  PHE A CA   7  
ATOM   7698  C  C    . PHE A 1 4  ? 8.521   5.750   11.115  1.00 0.00 ? 4  PHE A C    7  
ATOM   7699  O  O    . PHE A 1 4  ? 8.693   6.169   12.261  1.00 0.00 ? 4  PHE A O    7  
ATOM   7700  C  CB   . PHE A 1 4  ? 9.173   3.545   10.140  1.00 0.00 ? 4  PHE A CB   7  
ATOM   7701  C  CG   . PHE A 1 4  ? 9.788   2.893   8.932   1.00 0.00 ? 4  PHE A CG   7  
ATOM   7702  C  CD1  . PHE A 1 4  ? 11.151  2.973   8.690   1.00 0.00 ? 4  PHE A CD1  7  
ATOM   7703  C  CD2  . PHE A 1 4  ? 8.996   2.185   8.041   1.00 0.00 ? 4  PHE A CD2  7  
ATOM   7704  C  CE1  . PHE A 1 4  ? 11.711  2.361   7.583   1.00 0.00 ? 4  PHE A CE1  7  
ATOM   7705  C  CE2  . PHE A 1 4  ? 9.550   1.571   6.936   1.00 0.00 ? 4  PHE A CE2  7  
ATOM   7706  C  CZ   . PHE A 1 4  ? 10.907  1.658   6.706   1.00 0.00 ? 4  PHE A CZ   7  
ATOM   7707  H  H    . PHE A 1 4  ? 11.146  4.196   11.625  1.00 0.00 ? 4  PHE A H    7  
ATOM   7708  H  HA   . PHE A 1 4  ? 9.807   5.467   9.433   1.00 0.00 ? 4  PHE A HA   7  
ATOM   7709  H  HB2  . PHE A 1 4  ? 9.432   2.947   11.001  1.00 0.00 ? 4  PHE A HB2  7  
ATOM   7710  H  HB3  . PHE A 1 4  ? 8.099   3.531   10.014  1.00 0.00 ? 4  PHE A HB3  7  
ATOM   7711  H  HD1  . PHE A 1 4  ? 11.780  3.523   9.375   1.00 0.00 ? 4  PHE A HD1  7  
ATOM   7712  H  HD2  . PHE A 1 4  ? 7.933   2.118   8.217   1.00 0.00 ? 4  PHE A HD2  7  
ATOM   7713  H  HE1  . PHE A 1 4  ? 12.774  2.431   7.405   1.00 0.00 ? 4  PHE A HE1  7  
ATOM   7714  H  HE2  . PHE A 1 4  ? 8.919   1.023   6.253   1.00 0.00 ? 4  PHE A HE2  7  
ATOM   7715  H  HZ   . PHE A 1 4  ? 11.342  1.176   5.841   1.00 0.00 ? 4  PHE A HZ   7  
ATOM   7716  N  N    . HIS A 1 5  ? 7.379   5.911   10.446  1.00 0.00 ? 5  HIS A N    7  
ATOM   7717  C  CA   . HIS A 1 5  ? 6.237   6.605   11.031  1.00 0.00 ? 5  HIS A CA   7  
ATOM   7718  C  C    . HIS A 1 5  ? 5.274   5.608   11.678  1.00 0.00 ? 5  HIS A C    7  
ATOM   7719  O  O    . HIS A 1 5  ? 5.101   5.606   12.897  1.00 0.00 ? 5  HIS A O    7  
ATOM   7720  C  CB   . HIS A 1 5  ? 5.505   7.429   9.963   1.00 0.00 ? 5  HIS A CB   7  
ATOM   7721  C  CG   . HIS A 1 5  ? 4.553   8.437   10.527  1.00 0.00 ? 5  HIS A CG   7  
ATOM   7722  N  ND1  . HIS A 1 5  ? 3.212   8.179   10.726  1.00 0.00 ? 5  HIS A ND1  7  
ATOM   7723  C  CD2  . HIS A 1 5  ? 4.752   9.714   10.930  1.00 0.00 ? 5  HIS A CD2  7  
ATOM   7724  C  CE1  . HIS A 1 5  ? 2.630   9.254   11.225  1.00 0.00 ? 5  HIS A CE1  7  
ATOM   7725  N  NE2  . HIS A 1 5  ? 3.543   10.199  11.361  1.00 0.00 ? 5  HIS A NE2  7  
ATOM   7726  H  H    . HIS A 1 5  ? 7.302   5.547   9.538   1.00 0.00 ? 5  HIS A H    7  
ATOM   7727  H  HA   . HIS A 1 5  ? 6.611   7.272   11.795  1.00 0.00 ? 5  HIS A HA   7  
ATOM   7728  H  HB2  . HIS A 1 5  ? 6.232   7.958   9.366   1.00 0.00 ? 5  HIS A HB2  7  
ATOM   7729  H  HB3  . HIS A 1 5  ? 4.944   6.761   9.328   1.00 0.00 ? 5  HIS A HB3  7  
ATOM   7730  H  HD1  . HIS A 1 5  ? 2.756   7.334   10.533  1.00 0.00 ? 5  HIS A HD1  7  
ATOM   7731  H  HD2  . HIS A 1 5  ? 5.689   10.251  10.916  1.00 0.00 ? 5  HIS A HD2  7  
ATOM   7732  H  HE1  . HIS A 1 5  ? 1.584   9.345   11.483  1.00 0.00 ? 5  HIS A HE1  7  
ATOM   7733  H  HE2  . HIS A 1 5  ? 3.407   11.050  11.825  1.00 0.00 ? 5  HIS A HE2  7  
ATOM   7734  N  N    . ASP A 1 6  ? 4.657   4.760   10.850  1.00 0.00 ? 6  ASP A N    7  
ATOM   7735  C  CA   . ASP A 1 6  ? 3.712   3.752   11.335  1.00 0.00 ? 6  ASP A CA   7  
ATOM   7736  C  C    . ASP A 1 6  ? 3.486   2.663   10.284  1.00 0.00 ? 6  ASP A C    7  
ATOM   7737  O  O    . ASP A 1 6  ? 3.355   2.958   9.093   1.00 0.00 ? 6  ASP A O    7  
ATOM   7738  C  CB   . ASP A 1 6  ? 2.370   4.402   11.697  1.00 0.00 ? 6  ASP A CB   7  
ATOM   7739  C  CG   . ASP A 1 6  ? 2.268   4.762   13.169  1.00 0.00 ? 6  ASP A CG   7  
ATOM   7740  O  OD1  . ASP A 1 6  ? 2.374   3.848   14.015  1.00 0.00 ? 6  ASP A OD1  7  
ATOM   7741  O  OD2  . ASP A 1 6  ? 2.078   5.958   13.472  1.00 0.00 ? 6  ASP A OD2  7  
ATOM   7742  H  H    . ASP A 1 6  ? 4.843   4.812   9.889   1.00 0.00 ? 6  ASP A H    7  
ATOM   7743  H  HA   . ASP A 1 6  ? 4.136   3.301   12.220  1.00 0.00 ? 6  ASP A HA   7  
ATOM   7744  H  HB2  . ASP A 1 6  ? 2.246   5.304   11.118  1.00 0.00 ? 6  ASP A HB2  7  
ATOM   7745  H  HB3  . ASP A 1 6  ? 1.570   3.715   11.458  1.00 0.00 ? 6  ASP A HB3  7  
ATOM   7746  N  N    . GLU A 1 7  ? 3.433   1.406   10.732  1.00 0.00 ? 7  GLU A N    7  
ATOM   7747  C  CA   . GLU A 1 7  ? 3.212   0.274   9.830   1.00 0.00 ? 7  GLU A CA   7  
ATOM   7748  C  C    . GLU A 1 7  ? 1.719   -0.016  9.690   1.00 0.00 ? 7  GLU A C    7  
ATOM   7749  O  O    . GLU A 1 7  ? 0.993   -0.055  10.685  1.00 0.00 ? 7  GLU A O    7  
ATOM   7750  C  CB   . GLU A 1 7  ? 3.938   -0.978  10.337  1.00 0.00 ? 7  GLU A CB   7  
ATOM   7751  C  CG   . GLU A 1 7  ? 5.380   -0.727  10.754  1.00 0.00 ? 7  GLU A CG   7  
ATOM   7752  C  CD   . GLU A 1 7  ? 5.564   -0.719  12.259  1.00 0.00 ? 7  GLU A CD   7  
ATOM   7753  O  OE1  . GLU A 1 7  ? 5.045   0.207   12.918  1.00 0.00 ? 7  GLU A OE1  7  
ATOM   7754  O  OE2  . GLU A 1 7  ? 6.230   -1.640  12.778  1.00 0.00 ? 7  GLU A OE2  7  
ATOM   7755  H  H    . GLU A 1 7  ? 3.541   1.236   11.691  1.00 0.00 ? 7  GLU A H    7  
ATOM   7756  H  HA   . GLU A 1 7  ? 3.609   0.541   8.859   1.00 0.00 ? 7  GLU A HA   7  
ATOM   7757  H  HB2  . GLU A 1 7  ? 3.404   -1.369  11.190  1.00 0.00 ? 7  GLU A HB2  7  
ATOM   7758  H  HB3  . GLU A 1 7  ? 3.936   -1.722  9.554   1.00 0.00 ? 7  GLU A HB3  7  
ATOM   7759  H  HG2  . GLU A 1 7  ? 6.002   -1.504  10.336  1.00 0.00 ? 7  GLU A HG2  7  
ATOM   7760  H  HG3  . GLU A 1 7  ? 5.693   0.231   10.363  1.00 0.00 ? 7  GLU A HG3  7  
ATOM   7761  N  N    . VAL A 1 8  ? 1.265   -0.209  8.451   1.00 0.00 ? 8  VAL A N    7  
ATOM   7762  C  CA   . VAL A 1 8  ? -0.146  -0.484  8.185   1.00 0.00 ? 8  VAL A CA   7  
ATOM   7763  C  C    . VAL A 1 8  ? -0.314  -1.599  7.156   1.00 0.00 ? 8  VAL A C    7  
ATOM   7764  O  O    . VAL A 1 8  ? 0.443   -1.683  6.185   1.00 0.00 ? 8  VAL A O    7  
ATOM   7765  C  CB   . VAL A 1 8  ? -0.885  0.775   7.684   1.00 0.00 ? 8  VAL A CB   7  
ATOM   7766  C  CG1  . VAL A 1 8  ? -2.386  0.527   7.628   1.00 0.00 ? 8  VAL A CG1  7  
ATOM   7767  C  CG2  . VAL A 1 8  ? -0.572  1.976   8.567   1.00 0.00 ? 8  VAL A CG2  7  
ATOM   7768  H  H    . VAL A 1 8  ? 1.891   -0.159  7.697   1.00 0.00 ? 8  VAL A H    7  
ATOM   7769  H  HA   . VAL A 1 8  ? -0.603  -0.797  9.114   1.00 0.00 ? 8  VAL A HA   7  
ATOM   7770  H  HB   . VAL A 1 8  ? -0.543  0.994   6.683   1.00 0.00 ? 8  VAL A HB   7  
ATOM   7771  H  HG11 . VAL A 1 8  ? -2.797  0.587   8.624   1.00 0.00 ? 8  VAL A HG11 7  
ATOM   7772  H  HG12 . VAL A 1 8  ? -2.575  -0.454  7.219   1.00 0.00 ? 8  VAL A HG12 7  
ATOM   7773  H  HG13 . VAL A 1 8  ? -2.850  1.273   7.002   1.00 0.00 ? 8  VAL A HG13 7  
ATOM   7774  H  HG21 . VAL A 1 8  ? -1.057  1.855   9.524   1.00 0.00 ? 8  VAL A HG21 7  
ATOM   7775  H  HG22 . VAL A 1 8  ? -0.935  2.875   8.092   1.00 0.00 ? 8  VAL A HG22 7  
ATOM   7776  H  HG23 . VAL A 1 8  ? 0.495   2.051   8.712   1.00 0.00 ? 8  VAL A HG23 7  
ATOM   7777  N  N    . GLU A 1 9  ? -1.318  -2.450  7.373   1.00 0.00 ? 9  GLU A N    7  
ATOM   7778  C  CA   . GLU A 1 9  ? -1.604  -3.561  6.468   1.00 0.00 ? 9  GLU A CA   7  
ATOM   7779  C  C    . GLU A 1 9  ? -2.081  -3.053  5.109   1.00 0.00 ? 9  GLU A C    7  
ATOM   7780  O  O    . GLU A 1 9  ? -2.850  -2.093  5.027   1.00 0.00 ? 9  GLU A O    7  
ATOM   7781  C  CB   . GLU A 1 9  ? -2.663  -4.491  7.068   1.00 0.00 ? 9  GLU A CB   7  
ATOM   7782  C  CG   . GLU A 1 9  ? -2.152  -5.345  8.221   1.00 0.00 ? 9  GLU A CG   7  
ATOM   7783  C  CD   . GLU A 1 9  ? -3.234  -5.661  9.236   1.00 0.00 ? 9  GLU A CD   7  
ATOM   7784  O  OE1  . GLU A 1 9  ? -4.039  -6.582  8.981   1.00 0.00 ? 9  GLU A OE1  7  
ATOM   7785  O  OE2  . GLU A 1 9  ? -3.276  -4.988  10.287  1.00 0.00 ? 9  GLU A OE2  7  
ATOM   7786  H  H    . GLU A 1 9  ? -1.886  -2.323  8.163   1.00 0.00 ? 9  GLU A H    7  
ATOM   7787  H  HA   . GLU A 1 9  ? -0.689  -4.117  6.329   1.00 0.00 ? 9  GLU A HA   7  
ATOM   7788  H  HB2  . GLU A 1 9  ? -3.487  -3.893  7.430   1.00 0.00 ? 9  GLU A HB2  7  
ATOM   7789  H  HB3  . GLU A 1 9  ? -3.023  -5.151  6.293   1.00 0.00 ? 9  GLU A HB3  7  
ATOM   7790  H  HG2  . GLU A 1 9  ? -1.774  -6.275  7.821   1.00 0.00 ? 9  GLU A HG2  7  
ATOM   7791  H  HG3  . GLU A 1 9  ? -1.354  -4.815  8.719   1.00 0.00 ? 9  GLU A HG3  7  
ATOM   7792  N  N    . ILE A 1 10 ? -1.619  -3.711  4.048   1.00 0.00 ? 10 ILE A N    7  
ATOM   7793  C  CA   . ILE A 1 10 ? -1.986  -3.348  2.682   1.00 0.00 ? 10 ILE A CA   7  
ATOM   7794  C  C    . ILE A 1 10 ? -3.507  -3.343  2.486   1.00 0.00 ? 10 ILE A C    7  
ATOM   7795  O  O    . ILE A 1 10 ? -4.026  -2.607  1.645   1.00 0.00 ? 10 ILE A O    7  
ATOM   7796  C  CB   . ILE A 1 10 ? -1.331  -4.301  1.658   1.00 0.00 ? 10 ILE A CB   7  
ATOM   7797  C  CG1  . ILE A 1 10 ? -1.532  -3.777  0.235   1.00 0.00 ? 10 ILE A CG1  7  
ATOM   7798  C  CG2  . ILE A 1 10 ? -1.883  -5.714  1.795   1.00 0.00 ? 10 ILE A CG2  7  
ATOM   7799  C  CD1  . ILE A 1 10 ? -0.316  -3.077  -0.326  1.00 0.00 ? 10 ILE A CD1  7  
ATOM   7800  H  H    . ILE A 1 10 ? -1.010  -4.469  4.190   1.00 0.00 ? 10 ILE A H    7  
ATOM   7801  H  HA   . ILE A 1 10 ? -1.614  -2.350  2.497   1.00 0.00 ? 10 ILE A HA   7  
ATOM   7802  H  HB   . ILE A 1 10 ? -0.272  -4.337  1.869   1.00 0.00 ? 10 ILE A HB   7  
ATOM   7803  H  HG12 . ILE A 1 10 ? -1.768  -4.604  -0.416  1.00 0.00 ? 10 ILE A HG12 7  
ATOM   7804  H  HG13 . ILE A 1 10 ? -2.352  -3.074  0.228   1.00 0.00 ? 10 ILE A HG13 7  
ATOM   7805  H  HG21 . ILE A 1 10 ? -2.960  -5.691  1.717   1.00 0.00 ? 10 ILE A HG21 7  
ATOM   7806  H  HG22 . ILE A 1 10 ? -1.599  -6.121  2.753   1.00 0.00 ? 10 ILE A HG22 7  
ATOM   7807  H  HG23 . ILE A 1 10 ? -1.480  -6.336  1.007   1.00 0.00 ? 10 ILE A HG23 7  
ATOM   7808  H  HD11 . ILE A 1 10 ? -0.217  -3.317  -1.374  1.00 0.00 ? 10 ILE A HD11 7  
ATOM   7809  H  HD12 . ILE A 1 10 ? 0.566   -3.405  0.204   1.00 0.00 ? 10 ILE A HD12 7  
ATOM   7810  H  HD13 . ILE A 1 10 ? -0.430  -2.009  -0.210  1.00 0.00 ? 10 ILE A HD13 7  
ATOM   7811  N  N    . GLU A 1 11 ? -4.217  -4.157  3.273   1.00 0.00 ? 11 GLU A N    7  
ATOM   7812  C  CA   . GLU A 1 11 ? -5.676  -4.228  3.190   1.00 0.00 ? 11 GLU A CA   7  
ATOM   7813  C  C    . GLU A 1 11 ? -6.301  -2.856  3.462   1.00 0.00 ? 11 GLU A C    7  
ATOM   7814  O  O    . GLU A 1 11 ? -7.336  -2.513  2.890   1.00 0.00 ? 11 GLU A O    7  
ATOM   7815  C  CB   . GLU A 1 11 ? -6.214  -5.257  4.187   1.00 0.00 ? 11 GLU A CB   7  
ATOM   7816  C  CG   . GLU A 1 11 ? -5.656  -6.657  3.981   1.00 0.00 ? 11 GLU A CG   7  
ATOM   7817  C  CD   . GLU A 1 11 ? -5.730  -7.510  5.232   1.00 0.00 ? 11 GLU A CD   7  
ATOM   7818  O  OE1  . GLU A 1 11 ? -6.848  -7.929  5.602   1.00 0.00 ? 11 GLU A OE1  7  
ATOM   7819  O  OE2  . GLU A 1 11 ? -4.669  -7.763  5.841   1.00 0.00 ? 11 GLU A OE2  7  
ATOM   7820  H  H    . GLU A 1 11 ? -3.750  -4.714  3.929   1.00 0.00 ? 11 GLU A H    7  
ATOM   7821  H  HA   . GLU A 1 11 ? -5.938  -4.537  2.189   1.00 0.00 ? 11 GLU A HA   7  
ATOM   7822  H  HB2  . GLU A 1 11 ? -5.965  -4.937  5.187   1.00 0.00 ? 11 GLU A HB2  7  
ATOM   7823  H  HB3  . GLU A 1 11 ? -7.289  -5.303  4.092   1.00 0.00 ? 11 GLU A HB3  7  
ATOM   7824  H  HG2  . GLU A 1 11 ? -6.219  -7.144  3.199   1.00 0.00 ? 11 GLU A HG2  7  
ATOM   7825  H  HG3  . GLU A 1 11 ? -4.621  -6.577  3.681   1.00 0.00 ? 11 GLU A HG3  7  
ATOM   7826  N  N    . ASP A 1 12 ? -5.655  -2.075  4.330   1.00 0.00 ? 12 ASP A N    7  
ATOM   7827  C  CA   . ASP A 1 12 ? -6.134  -0.738  4.671   1.00 0.00 ? 12 ASP A CA   7  
ATOM   7828  C  C    . ASP A 1 12 ? -5.880  0.249   3.525   1.00 0.00 ? 12 ASP A C    7  
ATOM   7829  O  O    . ASP A 1 12 ? -6.617  1.225   3.364   1.00 0.00 ? 12 ASP A O    7  
ATOM   7830  C  CB   . ASP A 1 12 ? -5.450  -0.239  5.948   1.00 0.00 ? 12 ASP A CB   7  
ATOM   7831  C  CG   . ASP A 1 12 ? -6.380  0.582   6.820   1.00 0.00 ? 12 ASP A CG   7  
ATOM   7832  O  OD1  . ASP A 1 12 ? -7.476  0.083   7.157   1.00 0.00 ? 12 ASP A OD1  7  
ATOM   7833  O  OD2  . ASP A 1 12 ? -6.013  1.725   7.164   1.00 0.00 ? 12 ASP A OD2  7  
ATOM   7834  H  H    . ASP A 1 12 ? -4.831  -2.406  4.749   1.00 0.00 ? 12 ASP A H    7  
ATOM   7835  H  HA   . ASP A 1 12 ? -7.198  -0.803  4.847   1.00 0.00 ? 12 ASP A HA   7  
ATOM   7836  H  HB2  . ASP A 1 12 ? -5.106  -1.088  6.522   1.00 0.00 ? 12 ASP A HB2  7  
ATOM   7837  H  HB3  . ASP A 1 12 ? -4.602  0.374   5.678   1.00 0.00 ? 12 ASP A HB3  7  
ATOM   7838  N  N    . PHE A 1 13 ? -4.833  -0.011  2.736   1.00 0.00 ? 13 PHE A N    7  
ATOM   7839  C  CA   . PHE A 1 13 ? -4.475  0.850   1.606   1.00 0.00 ? 13 PHE A CA   7  
ATOM   7840  C  C    . PHE A 1 13 ? -5.541  0.803   0.510   1.00 0.00 ? 13 PHE A C    7  
ATOM   7841  O  O    . PHE A 1 13 ? -6.456  -0.024  0.553   1.00 0.00 ? 13 PHE A O    7  
ATOM   7842  C  CB   . PHE A 1 13 ? -3.127  0.419   1.015   1.00 0.00 ? 13 PHE A CB   7  
ATOM   7843  C  CG   . PHE A 1 13 ? -1.926  0.931   1.764   1.00 0.00 ? 13 PHE A CG   7  
ATOM   7844  C  CD1  . PHE A 1 13 ? -1.700  0.566   3.084   1.00 0.00 ? 13 PHE A CD1  7  
ATOM   7845  C  CD2  . PHE A 1 13 ? -1.017  1.768   1.140   1.00 0.00 ? 13 PHE A CD2  7  
ATOM   7846  C  CE1  . PHE A 1 13 ? -0.590  1.031   3.764   1.00 0.00 ? 13 PHE A CE1  7  
ATOM   7847  C  CE2  . PHE A 1 13 ? 0.095   2.234   1.814   1.00 0.00 ? 13 PHE A CE2  7  
ATOM   7848  C  CZ   . PHE A 1 13 ? 0.309   1.865   3.127   1.00 0.00 ? 13 PHE A CZ   7  
ATOM   7849  H  H    . PHE A 1 13 ? -4.285  -0.801  2.920   1.00 0.00 ? 13 PHE A H    7  
ATOM   7850  H  HA   . PHE A 1 13 ? -4.392  1.863   1.972   1.00 0.00 ? 13 PHE A HA   7  
ATOM   7851  H  HB2  . PHE A 1 13 ? -3.076  -0.660  1.008   1.00 0.00 ? 13 PHE A HB2  7  
ATOM   7852  H  HB3  . PHE A 1 13 ? -3.063  0.780   -0.001  1.00 0.00 ? 13 PHE A HB3  7  
ATOM   7853  H  HD1  . PHE A 1 13 ? -2.401  -0.086  3.582   1.00 0.00 ? 13 PHE A HD1  7  
ATOM   7854  H  HD2  . PHE A 1 13 ? -1.182  2.059   0.114   1.00 0.00 ? 13 PHE A HD2  7  
ATOM   7855  H  HE1  . PHE A 1 13 ? -0.425  0.741   4.791   1.00 0.00 ? 13 PHE A HE1  7  
ATOM   7856  H  HE2  . PHE A 1 13 ? 0.795   2.886   1.313   1.00 0.00 ? 13 PHE A HE2  7  
ATOM   7857  H  HZ   . PHE A 1 13 ? 1.178   2.228   3.656   1.00 0.00 ? 13 PHE A HZ   7  
ATOM   7858  N  N    . GLN A 1 14 ? -5.412  1.690   -0.479  1.00 0.00 ? 14 GLN A N    7  
ATOM   7859  C  CA   . GLN A 1 14 ? -6.358  1.743   -1.591  1.00 0.00 ? 14 GLN A CA   7  
ATOM   7860  C  C    . GLN A 1 14 ? -5.742  1.151   -2.859  1.00 0.00 ? 14 GLN A C    7  
ATOM   7861  O  O    . GLN A 1 14 ? -4.844  1.746   -3.458  1.00 0.00 ? 14 GLN A O    7  
ATOM   7862  C  CB   . GLN A 1 14 ? -6.805  3.187   -1.849  1.00 0.00 ? 14 GLN A CB   7  
ATOM   7863  C  CG   . GLN A 1 14 ? -8.040  3.294   -2.734  1.00 0.00 ? 14 GLN A CG   7  
ATOM   7864  C  CD   . GLN A 1 14 ? -8.545  4.718   -2.874  1.00 0.00 ? 14 GLN A CD   7  
ATOM   7865  O  OE1  . GLN A 1 14 ? -8.003  5.508   -3.648  1.00 0.00 ? 14 GLN A OE1  7  
ATOM   7866  N  NE2  . GLN A 1 14 ? -9.590  5.056   -2.125  1.00 0.00 ? 14 GLN A NE2  7  
ATOM   7867  H  H    . GLN A 1 14 ? -4.660  2.319   -0.462  1.00 0.00 ? 14 GLN A H    7  
ATOM   7868  H  HA   . GLN A 1 14 ? -7.222  1.154   -1.316  1.00 0.00 ? 14 GLN A HA   7  
ATOM   7869  H  HB2  . GLN A 1 14 ? -7.022  3.660   -0.901  1.00 0.00 ? 14 GLN A HB2  7  
ATOM   7870  H  HB3  . GLN A 1 14 ? -5.998  3.721   -2.330  1.00 0.00 ? 14 GLN A HB3  7  
ATOM   7871  H  HG2  . GLN A 1 14 ? -7.796  2.917   -3.716  1.00 0.00 ? 14 GLN A HG2  7  
ATOM   7872  H  HG3  . GLN A 1 14 ? -8.826  2.689   -2.304  1.00 0.00 ? 14 GLN A HG3  7  
ATOM   7873  H  HE21 . GLN A 1 14 ? -9.973  4.378   -1.530  1.00 0.00 ? 14 GLN A HE21 7  
ATOM   7874  H  HE22 . GLN A 1 14 ? -9.938  5.969   -2.201  1.00 0.00 ? 14 GLN A HE22 7  
ATOM   7875  N  N    . TYR A 1 15 ? -6.232  -0.024  -3.263  1.00 0.00 ? 15 TYR A N    7  
ATOM   7876  C  CA   . TYR A 1 15 ? -5.730  -0.695  -4.463  1.00 0.00 ? 15 TYR A CA   7  
ATOM   7877  C  C    . TYR A 1 15 ? -6.081  0.106   -5.719  1.00 0.00 ? 15 TYR A C    7  
ATOM   7878  O  O    . TYR A 1 15 ? -7.250  0.202   -6.098  1.00 0.00 ? 15 TYR A O    7  
ATOM   7879  C  CB   . TYR A 1 15 ? -6.302  -2.116  -4.563  1.00 0.00 ? 15 TYR A CB   7  
ATOM   7880  C  CG   . TYR A 1 15 ? -5.832  -2.889  -5.779  1.00 0.00 ? 15 TYR A CG   7  
ATOM   7881  C  CD1  . TYR A 1 15 ? -4.543  -3.409  -5.843  1.00 0.00 ? 15 TYR A CD1  7  
ATOM   7882  C  CD2  . TYR A 1 15 ? -6.677  -3.103  -6.862  1.00 0.00 ? 15 TYR A CD2  7  
ATOM   7883  C  CE1  . TYR A 1 15 ? -4.112  -4.119  -6.948  1.00 0.00 ? 15 TYR A CE1  7  
ATOM   7884  C  CE2  . TYR A 1 15 ? -6.254  -3.813  -7.968  1.00 0.00 ? 15 TYR A CE2  7  
ATOM   7885  C  CZ   . TYR A 1 15 ? -4.973  -4.318  -8.007  1.00 0.00 ? 15 TYR A CZ   7  
ATOM   7886  O  OH   . TYR A 1 15 ? -4.554  -5.023  -9.114  1.00 0.00 ? 15 TYR A OH   7  
ATOM   7887  H  H    . TYR A 1 15 ? -6.948  -0.448  -2.743  1.00 0.00 ? 15 TYR A H    7  
ATOM   7888  H  HA   . TYR A 1 15 ? -4.655  -0.756  -4.379  1.00 0.00 ? 15 TYR A HA   7  
ATOM   7889  H  HB2  . TYR A 1 15 ? -6.011  -2.673  -3.687  1.00 0.00 ? 15 TYR A HB2  7  
ATOM   7890  H  HB3  . TYR A 1 15 ? -7.380  -2.058  -4.603  1.00 0.00 ? 15 TYR A HB3  7  
ATOM   7891  H  HD1  . TYR A 1 15 ? -3.872  -3.252  -5.015  1.00 0.00 ? 15 TYR A HD1  7  
ATOM   7892  H  HD2  . TYR A 1 15 ? -7.681  -2.706  -6.831  1.00 0.00 ? 15 TYR A HD2  7  
ATOM   7893  H  HE1  . TYR A 1 15 ? -3.107  -4.515  -6.977  1.00 0.00 ? 15 TYR A HE1  7  
ATOM   7894  H  HE2  . TYR A 1 15 ? -6.925  -3.970  -8.800  1.00 0.00 ? 15 TYR A HE2  7  
ATOM   7895  H  HH   . TYR A 1 15 ? -3.956  -5.725  -8.843  1.00 0.00 ? 15 TYR A HH   7  
ATOM   7896  N  N    . ASP A 1 16 ? -5.060  0.679   -6.353  1.00 0.00 ? 16 ASP A N    7  
ATOM   7897  C  CA   . ASP A 1 16 ? -5.249  1.474   -7.562  1.00 0.00 ? 16 ASP A CA   7  
ATOM   7898  C  C    . ASP A 1 16 ? -5.188  0.592   -8.807  1.00 0.00 ? 16 ASP A C    7  
ATOM   7899  O  O    . ASP A 1 16 ? -4.107  0.308   -9.325  1.00 0.00 ? 16 ASP A O    7  
ATOM   7900  C  CB   . ASP A 1 16 ? -4.187  2.582   -7.646  1.00 0.00 ? 16 ASP A CB   7  
ATOM   7901  C  CG   . ASP A 1 16 ? -4.639  3.789   -8.454  1.00 0.00 ? 16 ASP A CG   7  
ATOM   7902  O  OD1  . ASP A 1 16 ? -5.588  3.656   -9.257  1.00 0.00 ? 16 ASP A OD1  7  
ATOM   7903  O  OD2  . ASP A 1 16 ? -4.038  4.870   -8.284  1.00 0.00 ? 16 ASP A OD2  7  
ATOM   7904  H  H    . ASP A 1 16 ? -4.152  0.565   -5.997  1.00 0.00 ? 16 ASP A H    7  
ATOM   7905  H  HA   . ASP A 1 16 ? -6.227  1.933   -7.507  1.00 0.00 ? 16 ASP A HA   7  
ATOM   7906  H  HB2  . ASP A 1 16 ? -3.950  2.915   -6.647  1.00 0.00 ? 16 ASP A HB2  7  
ATOM   7907  H  HB3  . ASP A 1 16 ? -3.296  2.180   -8.104  1.00 0.00 ? 16 ASP A HB3  7  
ATOM   7908  N  N    . GLU A 1 17 ? -6.359  0.167   -9.282  1.00 0.00 ? 17 GLU A N    7  
ATOM   7909  C  CA   . GLU A 1 17 ? -6.450  -0.681  -10.476 1.00 0.00 ? 17 GLU A CA   7  
ATOM   7910  C  C    . GLU A 1 17 ? -5.838  0.004   -11.700 1.00 0.00 ? 17 GLU A C    7  
ATOM   7911  O  O    . GLU A 1 17 ? -5.403  -0.666  -12.638 1.00 0.00 ? 17 GLU A O    7  
ATOM   7912  C  CB   . GLU A 1 17 ? -7.908  -1.050  -10.776 1.00 0.00 ? 17 GLU A CB   7  
ATOM   7913  C  CG   . GLU A 1 17 ? -8.890  0.105   -10.613 1.00 0.00 ? 17 GLU A CG   7  
ATOM   7914  C  CD   . GLU A 1 17 ? -9.953  0.134   -11.697 1.00 0.00 ? 17 GLU A CD   7  
ATOM   7915  O  OE1  . GLU A 1 17 ? -10.571 -0.921  -11.957 1.00 0.00 ? 17 GLU A OE1  7  
ATOM   7916  O  OE2  . GLU A 1 17 ? -10.172 1.216   -12.284 1.00 0.00 ? 17 GLU A OE2  7  
ATOM   7917  H  H    . GLU A 1 17 ? -7.183  0.434   -8.822  1.00 0.00 ? 17 GLU A H    7  
ATOM   7918  H  HA   . GLU A 1 17 ? -5.898  -1.587  -10.276 1.00 0.00 ? 17 GLU A HA   7  
ATOM   7919  H  HB2  . GLU A 1 17 ? -7.969  -1.401  -11.797 1.00 0.00 ? 17 GLU A HB2  7  
ATOM   7920  H  HB3  . GLU A 1 17 ? -8.209  -1.847  -10.114 1.00 0.00 ? 17 GLU A HB3  7  
ATOM   7921  H  HG2  . GLU A 1 17 ? -9.380  0.010   -9.655  1.00 0.00 ? 17 GLU A HG2  7  
ATOM   7922  H  HG3  . GLU A 1 17 ? -8.339  1.035   -10.644 1.00 0.00 ? 17 GLU A HG3  7  
ATOM   7923  N  N    . ASP A 1 18 ? -5.818  1.341   -11.683 1.00 0.00 ? 18 ASP A N    7  
ATOM   7924  C  CA   . ASP A 1 18 ? -5.271  2.130   -12.789 1.00 0.00 ? 18 ASP A CA   7  
ATOM   7925  C  C    . ASP A 1 18 ? -3.886  1.632   -13.210 1.00 0.00 ? 18 ASP A C    7  
ATOM   7926  O  O    . ASP A 1 18 ? -3.646  1.382   -14.391 1.00 0.00 ? 18 ASP A O    7  
ATOM   7927  C  CB   . ASP A 1 18 ? -5.197  3.612   -12.400 1.00 0.00 ? 18 ASP A CB   7  
ATOM   7928  C  CG   . ASP A 1 18 ? -5.428  4.536   -13.581 1.00 0.00 ? 18 ASP A CG   7  
ATOM   7929  O  OD1  . ASP A 1 18 ? -6.527  4.479   -14.174 1.00 0.00 ? 18 ASP A OD1  7  
ATOM   7930  O  OD2  . ASP A 1 18 ? -4.512  5.317   -13.913 1.00 0.00 ? 18 ASP A OD2  7  
ATOM   7931  H  H    . ASP A 1 18 ? -6.190  1.809   -10.909 1.00 0.00 ? 18 ASP A H    7  
ATOM   7932  H  HA   . ASP A 1 18 ? -5.945  2.026   -13.627 1.00 0.00 ? 18 ASP A HA   7  
ATOM   7933  H  HB2  . ASP A 1 18 ? -5.949  3.821   -11.652 1.00 0.00 ? 18 ASP A HB2  7  
ATOM   7934  H  HB3  . ASP A 1 18 ? -4.220  3.820   -11.987 1.00 0.00 ? 18 ASP A HB3  7  
ATOM   7935  N  N    . SER A 1 19 ? -2.976  1.493   -12.242 1.00 0.00 ? 19 SER A N    7  
ATOM   7936  C  CA   . SER A 1 19 ? -1.617  1.028   -12.528 1.00 0.00 ? 19 SER A CA   7  
ATOM   7937  C  C    . SER A 1 19 ? -1.078  0.120   -11.411 1.00 0.00 ? 19 SER A C    7  
ATOM   7938  O  O    . SER A 1 19 ? 0.134   0.050   -11.193 1.00 0.00 ? 19 SER A O    7  
ATOM   7939  C  CB   . SER A 1 19 ? -0.681  2.228   -12.723 1.00 0.00 ? 19 SER A CB   7  
ATOM   7940  O  OG   . SER A 1 19 ? -1.213  3.152   -13.660 1.00 0.00 ? 19 SER A OG   7  
ATOM   7941  H  H    . SER A 1 19 ? -3.224  1.711   -11.317 1.00 0.00 ? 19 SER A H    7  
ATOM   7942  H  HA   . SER A 1 19 ? -1.650  0.461   -13.446 1.00 0.00 ? 19 SER A HA   7  
ATOM   7943  H  HB2  . SER A 1 19 ? -0.546  2.732   -11.778 1.00 0.00 ? 19 SER A HB2  7  
ATOM   7944  H  HB3  . SER A 1 19 ? 0.276   1.880   -13.084 1.00 0.00 ? 19 SER A HB3  7  
ATOM   7945  H  HG   . SER A 1 19 ? -1.427  3.975   -13.212 1.00 0.00 ? 19 SER A HG   7  
ATOM   7946  N  N    . GLU A 1 20 ? -1.983  -0.580  -10.715 1.00 0.00 ? 20 GLU A N    7  
ATOM   7947  C  CA   . GLU A 1 20 ? -1.603  -1.489  -9.626  1.00 0.00 ? 20 GLU A CA   7  
ATOM   7948  C  C    . GLU A 1 20 ? -0.699  -0.793  -8.601  1.00 0.00 ? 20 GLU A C    7  
ATOM   7949  O  O    . GLU A 1 20 ? 0.484   -1.121  -8.474  1.00 0.00 ? 20 GLU A O    7  
ATOM   7950  C  CB   . GLU A 1 20 ? -0.902  -2.733  -10.182 1.00 0.00 ? 20 GLU A CB   7  
ATOM   7951  C  CG   . GLU A 1 20 ? -1.590  -3.344  -11.398 1.00 0.00 ? 20 GLU A CG   7  
ATOM   7952  C  CD   . GLU A 1 20 ? -2.140  -4.741  -11.145 1.00 0.00 ? 20 GLU A CD   7  
ATOM   7953  O  OE1  . GLU A 1 20 ? -1.568  -5.474  -10.305 1.00 0.00 ? 20 GLU A OE1  7  
ATOM   7954  O  OE2  . GLU A 1 20 ? -3.144  -5.106  -11.793 1.00 0.00 ? 20 GLU A OE2  7  
ATOM   7955  H  H    . GLU A 1 20 ? -2.932  -0.487  -10.941 1.00 0.00 ? 20 GLU A H    7  
ATOM   7956  H  HA   . GLU A 1 20 ? -2.511  -1.797  -9.126  1.00 0.00 ? 20 GLU A HA   7  
ATOM   7957  H  HB2  . GLU A 1 20 ? 0.104   -2.463  -10.467 1.00 0.00 ? 20 GLU A HB2  7  
ATOM   7958  H  HB3  . GLU A 1 20 ? -0.858  -3.480  -9.405  1.00 0.00 ? 20 GLU A HB3  7  
ATOM   7959  H  HG2  . GLU A 1 20 ? -2.410  -2.704  -11.689 1.00 0.00 ? 20 GLU A HG2  7  
ATOM   7960  H  HG3  . GLU A 1 20 ? -0.874  -3.395  -12.206 1.00 0.00 ? 20 GLU A HG3  7  
ATOM   7961  N  N    . THR A 1 21 ? -1.266  0.167   -7.871  1.00 0.00 ? 21 THR A N    7  
ATOM   7962  C  CA   . THR A 1 21 ? -0.516  0.907   -6.856  1.00 0.00 ? 21 THR A CA   7  
ATOM   7963  C  C    . THR A 1 21 ? -1.359  1.097   -5.593  1.00 0.00 ? 21 THR A C    7  
ATOM   7964  O  O    . THR A 1 21 ? -2.582  1.179   -5.664  1.00 0.00 ? 21 THR A O    7  
ATOM   7965  C  CB   . THR A 1 21 ? -0.079  2.273   -7.407  1.00 0.00 ? 21 THR A CB   7  
ATOM   7966  O  OG1  . THR A 1 21 ? 0.559   2.132   -8.668  1.00 0.00 ? 21 THR A OG1  7  
ATOM   7967  C  CG2  . THR A 1 21 ? 0.878   3.011   -6.492  1.00 0.00 ? 21 THR A CG2  7  
ATOM   7968  H  H    . THR A 1 21 ? -2.212  0.381   -8.017  1.00 0.00 ? 21 THR A H    7  
ATOM   7969  H  HA   . THR A 1 21 ? 0.363   0.331   -6.607  1.00 0.00 ? 21 THR A HA   7  
ATOM   7970  H  HB   . THR A 1 21 ? -0.954  2.894   -7.539  1.00 0.00 ? 21 THR A HB   7  
ATOM   7971  H  HG1  . THR A 1 21 ? 1.161   1.384   -8.646  1.00 0.00 ? 21 THR A HG1  7  
ATOM   7972  H  HG21 . THR A 1 21 ? 1.857   2.562   -6.559  1.00 0.00 ? 21 THR A HG21 7  
ATOM   7973  H  HG22 . THR A 1 21 ? 0.522   2.951   -5.475  1.00 0.00 ? 21 THR A HG22 7  
ATOM   7974  H  HG23 . THR A 1 21 ? 0.936   4.047   -6.793  1.00 0.00 ? 21 THR A HG23 7  
ATOM   7975  N  N    . TYR A 1 22 ? -0.699  1.166   -4.436  1.00 0.00 ? 22 TYR A N    7  
ATOM   7976  C  CA   . TYR A 1 22 ? -1.398  1.349   -3.162  1.00 0.00 ? 22 TYR A CA   7  
ATOM   7977  C  C    . TYR A 1 22 ? -1.047  2.702   -2.544  1.00 0.00 ? 22 TYR A C    7  
ATOM   7978  O  O    . TYR A 1 22 ? 0.109   3.127   -2.586  1.00 0.00 ? 22 TYR A O    7  
ATOM   7979  C  CB   . TYR A 1 22 ? -1.055  0.218   -2.188  1.00 0.00 ? 22 TYR A CB   7  
ATOM   7980  C  CG   . TYR A 1 22 ? -1.304  -1.165  -2.751  1.00 0.00 ? 22 TYR A CG   7  
ATOM   7981  C  CD1  . TYR A 1 22 ? -0.397  -1.753  -3.624  1.00 0.00 ? 22 TYR A CD1  7  
ATOM   7982  C  CD2  . TYR A 1 22 ? -2.445  -1.881  -2.409  1.00 0.00 ? 22 TYR A CD2  7  
ATOM   7983  C  CE1  . TYR A 1 22 ? -0.620  -3.013  -4.141  1.00 0.00 ? 22 TYR A CE1  7  
ATOM   7984  C  CE2  . TYR A 1 22 ? -2.674  -3.143  -2.923  1.00 0.00 ? 22 TYR A CE2  7  
ATOM   7985  C  CZ   . TYR A 1 22 ? -1.759  -3.705  -3.788  1.00 0.00 ? 22 TYR A CZ   7  
ATOM   7986  O  OH   . TYR A 1 22 ? -1.983  -4.960  -4.302  1.00 0.00 ? 22 TYR A OH   7  
ATOM   7987  H  H    . TYR A 1 22 ? 0.280   1.095   -4.436  1.00 0.00 ? 22 TYR A H    7  
ATOM   7988  H  HA   . TYR A 1 22 ? -2.459  1.327   -3.364  1.00 0.00 ? 22 TYR A HA   7  
ATOM   7989  H  HB2  . TYR A 1 22 ? -0.011  0.284   -1.923  1.00 0.00 ? 22 TYR A HB2  7  
ATOM   7990  H  HB3  . TYR A 1 22 ? -1.654  0.326   -1.296  1.00 0.00 ? 22 TYR A HB3  7  
ATOM   7991  H  HD1  . TYR A 1 22 ? 0.494   -1.210  -3.899  1.00 0.00 ? 22 TYR A HD1  7  
ATOM   7992  H  HD2  . TYR A 1 22 ? -3.161  -1.440  -1.731  1.00 0.00 ? 22 TYR A HD2  7  
ATOM   7993  H  HE1  . TYR A 1 22 ? 0.096   -3.452  -4.819  1.00 0.00 ? 22 TYR A HE1  7  
ATOM   7994  H  HE2  . TYR A 1 22 ? -3.566  -3.685  -2.646  1.00 0.00 ? 22 TYR A HE2  7  
ATOM   7995  H  HH   . TYR A 1 22 ? -1.541  -5.614  -3.756  1.00 0.00 ? 22 TYR A HH   7  
ATOM   7996  N  N    . PHE A 1 23 ? -2.050  3.383   -1.985  1.00 0.00 ? 23 PHE A N    7  
ATOM   7997  C  CA   . PHE A 1 23 ? -1.840  4.699   -1.377  1.00 0.00 ? 23 PHE A CA   7  
ATOM   7998  C  C    . PHE A 1 23 ? -2.367  4.752   0.059   1.00 0.00 ? 23 PHE A C    7  
ATOM   7999  O  O    . PHE A 1 23 ? -3.240  3.969   0.440   1.00 0.00 ? 23 PHE A O    7  
ATOM   8000  C  CB   . PHE A 1 23 ? -2.522  5.785   -2.218  1.00 0.00 ? 23 PHE A CB   7  
ATOM   8001  C  CG   . PHE A 1 23 ? -2.073  5.815   -3.655  1.00 0.00 ? 23 PHE A CG   7  
ATOM   8002  C  CD1  . PHE A 1 23 ? -2.429  4.798   -4.527  1.00 0.00 ? 23 PHE A CD1  7  
ATOM   8003  C  CD2  . PHE A 1 23 ? -1.297  6.860   -4.131  1.00 0.00 ? 23 PHE A CD2  7  
ATOM   8004  C  CE1  . PHE A 1 23 ? -2.017  4.822   -5.845  1.00 0.00 ? 23 PHE A CE1  7  
ATOM   8005  C  CE2  . PHE A 1 23 ? -0.882  6.889   -5.449  1.00 0.00 ? 23 PHE A CE2  7  
ATOM   8006  C  CZ   . PHE A 1 23 ? -1.244  5.869   -6.307  1.00 0.00 ? 23 PHE A CZ   7  
ATOM   8007  H  H    . PHE A 1 23 ? -2.953  2.998   -1.994  1.00 0.00 ? 23 PHE A H    7  
ATOM   8008  H  HA   . PHE A 1 23 ? -0.778  4.889   -1.361  1.00 0.00 ? 23 PHE A HA   7  
ATOM   8009  H  HB2  . PHE A 1 23 ? -3.590  5.619   -2.208  1.00 0.00 ? 23 PHE A HB2  7  
ATOM   8010  H  HB3  . PHE A 1 23 ? -2.312  6.751   -1.782  1.00 0.00 ? 23 PHE A HB3  7  
ATOM   8011  H  HD1  . PHE A 1 23 ? -3.034  3.978   -4.169  1.00 0.00 ? 23 PHE A HD1  7  
ATOM   8012  H  HD2  . PHE A 1 23 ? -1.014  7.658   -3.460  1.00 0.00 ? 23 PHE A HD2  7  
ATOM   8013  H  HE1  . PHE A 1 23 ? -2.301  4.023   -6.514  1.00 0.00 ? 23 PHE A HE1  7  
ATOM   8014  H  HE2  . PHE A 1 23 ? -0.278  7.708   -5.807  1.00 0.00 ? 23 PHE A HE2  7  
ATOM   8015  H  HZ   . PHE A 1 23 ? -0.921  5.889   -7.338  1.00 0.00 ? 23 PHE A HZ   7  
ATOM   8016  N  N    . TYR A 1 24 ? -1.831  5.688   0.850   1.00 0.00 ? 24 TYR A N    7  
ATOM   8017  C  CA   . TYR A 1 24 ? -2.247  5.854   2.245   1.00 0.00 ? 24 TYR A CA   7  
ATOM   8018  C  C    . TYR A 1 24 ? -2.442  7.332   2.596   1.00 0.00 ? 24 TYR A C    7  
ATOM   8019  O  O    . TYR A 1 24 ? -1.627  8.175   2.226   1.00 0.00 ? 24 TYR A O    7  
ATOM   8020  C  CB   . TYR A 1 24 ? -1.214  5.235   3.193   1.00 0.00 ? 24 TYR A CB   7  
ATOM   8021  C  CG   . TYR A 1 24 ? -1.787  4.857   4.542   1.00 0.00 ? 24 TYR A CG   7  
ATOM   8022  C  CD1  . TYR A 1 24 ? -2.690  3.808   4.664   1.00 0.00 ? 24 TYR A CD1  7  
ATOM   8023  C  CD2  . TYR A 1 24 ? -1.432  5.555   5.691   1.00 0.00 ? 24 TYR A CD2  7  
ATOM   8024  C  CE1  . TYR A 1 24 ? -3.222  3.465   5.891   1.00 0.00 ? 24 TYR A CE1  7  
ATOM   8025  C  CE2  . TYR A 1 24 ? -1.961  5.218   6.922   1.00 0.00 ? 24 TYR A CE2  7  
ATOM   8026  C  CZ   . TYR A 1 24 ? -2.854  4.172   7.017   1.00 0.00 ? 24 TYR A CZ   7  
ATOM   8027  O  OH   . TYR A 1 24 ? -3.384  3.834   8.242   1.00 0.00 ? 24 TYR A OH   7  
ATOM   8028  H  H    . TYR A 1 24 ? -1.142  6.284   0.486   1.00 0.00 ? 24 TYR A H    7  
ATOM   8029  H  HA   . TYR A 1 24 ? -3.187  5.340   2.371   1.00 0.00 ? 24 TYR A HA   7  
ATOM   8030  H  HB2  . TYR A 1 24 ? -0.810  4.343   2.741   1.00 0.00 ? 24 TYR A HB2  7  
ATOM   8031  H  HB3  . TYR A 1 24 ? -0.414  5.945   3.357   1.00 0.00 ? 24 TYR A HB3  7  
ATOM   8032  H  HD1  . TYR A 1 24 ? -2.975  3.256   3.781   1.00 0.00 ? 24 TYR A HD1  7  
ATOM   8033  H  HD2  . TYR A 1 24 ? -0.733  6.375   5.614   1.00 0.00 ? 24 TYR A HD2  7  
ATOM   8034  H  HE1  . TYR A 1 24 ? -3.922  2.646   5.965   1.00 0.00 ? 24 TYR A HE1  7  
ATOM   8035  H  HE2  . TYR A 1 24 ? -1.674  5.772   7.804   1.00 0.00 ? 24 TYR A HE2  7  
ATOM   8036  H  HH   . TYR A 1 24 ? -3.167  2.922   8.447   1.00 0.00 ? 24 TYR A HH   7  
ATOM   8037  N  N    . PRO A 1 25 ? -3.529  7.665   3.320   1.00 0.00 ? 25 PRO A N    7  
ATOM   8038  C  CA   . PRO A 1 25 ? -3.825  9.047   3.722   1.00 0.00 ? 25 PRO A CA   7  
ATOM   8039  C  C    . PRO A 1 25 ? -2.795  9.608   4.703   1.00 0.00 ? 25 PRO A C    7  
ATOM   8040  O  O    . PRO A 1 25 ? -2.550  9.024   5.761   1.00 0.00 ? 25 PRO A O    7  
ATOM   8041  C  CB   . PRO A 1 25 ? -5.199  8.947   4.389   1.00 0.00 ? 25 PRO A CB   7  
ATOM   8042  C  CG   . PRO A 1 25 ? -5.309  7.527   4.826   1.00 0.00 ? 25 PRO A CG   7  
ATOM   8043  C  CD   . PRO A 1 25 ? -4.556  6.722   3.806   1.00 0.00 ? 25 PRO A CD   7  
ATOM   8044  H  HA   . PRO A 1 25 ? -3.888  9.699   2.864   1.00 0.00 ? 25 PRO A HA   7  
ATOM   8045  H  HB2  . PRO A 1 25 ? -5.244  9.623   5.231   1.00 0.00 ? 25 PRO A HB2  7  
ATOM   8046  H  HB3  . PRO A 1 25 ? -5.967  9.201   3.675   1.00 0.00 ? 25 PRO A HB3  7  
ATOM   8047  H  HG2  . PRO A 1 25 ? -4.864  7.406   5.803   1.00 0.00 ? 25 PRO A HG2  7  
ATOM   8048  H  HG3  . PRO A 1 25 ? -6.347  7.229   4.847   1.00 0.00 ? 25 PRO A HG3  7  
ATOM   8049  H  HD2  . PRO A 1 25 ? -4.100  5.859   4.268   1.00 0.00 ? 25 PRO A HD2  7  
ATOM   8050  H  HD3  . PRO A 1 25 ? -5.212  6.420   3.004   1.00 0.00 ? 25 PRO A HD3  7  
ATOM   8051  N  N    . CYS A 1 26 ? -2.203  10.746  4.345   1.00 0.00 ? 26 CYS A N    7  
ATOM   8052  C  CA   . CYS A 1 26 ? -1.203  11.391  5.190   1.00 0.00 ? 26 CYS A CA   7  
ATOM   8053  C  C    . CYS A 1 26 ? -1.816  12.557  5.966   1.00 0.00 ? 26 CYS A C    7  
ATOM   8054  O  O    . CYS A 1 26 ? -2.691  13.262  5.456   1.00 0.00 ? 26 CYS A O    7  
ATOM   8055  C  CB   . CYS A 1 26 ? -0.033  11.890  4.340   1.00 0.00 ? 26 CYS A CB   7  
ATOM   8056  S  SG   . CYS A 1 26 ? 1.602   11.367  4.946   1.00 0.00 ? 26 CYS A SG   7  
ATOM   8057  H  H    . CYS A 1 26 ? -2.442  11.164  3.490   1.00 0.00 ? 26 CYS A H    7  
ATOM   8058  H  HA   . CYS A 1 26 ? -0.839  10.658  5.891   1.00 0.00 ? 26 CYS A HA   7  
ATOM   8059  H  HB2  . CYS A 1 26 ? -0.144  11.514  3.332   1.00 0.00 ? 26 CYS A HB2  7  
ATOM   8060  H  HB3  . CYS A 1 26 ? -0.045  12.970  4.320   1.00 0.00 ? 26 CYS A HB3  7  
ATOM   8061  N  N    . PRO A 1 27 ? -1.356  12.780  7.213   1.00 0.00 ? 27 PRO A N    7  
ATOM   8062  C  CA   . PRO A 1 27 ? -1.857  13.871  8.059   1.00 0.00 ? 27 PRO A CA   7  
ATOM   8063  C  C    . PRO A 1 27 ? -1.463  15.258  7.539   1.00 0.00 ? 27 PRO A C    7  
ATOM   8064  O  O    . PRO A 1 27 ? -2.055  16.263  7.934   1.00 0.00 ? 27 PRO A O    7  
ATOM   8065  C  CB   . PRO A 1 27 ? -1.197  13.608  9.414   1.00 0.00 ? 27 PRO A CB   7  
ATOM   8066  C  CG   . PRO A 1 27 ? 0.029   12.820  9.097   1.00 0.00 ? 27 PRO A CG   7  
ATOM   8067  C  CD   . PRO A 1 27 ? -0.311  11.989  7.892   1.00 0.00 ? 27 PRO A CD   7  
ATOM   8068  H  HA   . PRO A 1 27 ? -2.930  13.823  8.166   1.00 0.00 ? 27 PRO A HA   7  
ATOM   8069  H  HB2  . PRO A 1 27 ? -0.951  14.548  9.886   1.00 0.00 ? 27 PRO A HB2  7  
ATOM   8070  H  HB3  . PRO A 1 27 ? -1.873  13.049  10.044  1.00 0.00 ? 27 PRO A HB3  7  
ATOM   8071  H  HG2  . PRO A 1 27 ? 0.847   13.489  8.873   1.00 0.00 ? 27 PRO A HG2  7  
ATOM   8072  H  HG3  . PRO A 1 27 ? 0.281   12.184  9.932   1.00 0.00 ? 27 PRO A HG3  7  
ATOM   8073  H  HD2  . PRO A 1 27 ? 0.559   11.869  7.260   1.00 0.00 ? 27 PRO A HD2  7  
ATOM   8074  H  HD3  . PRO A 1 27 ? -0.696  11.026  8.194   1.00 0.00 ? 27 PRO A HD3  7  
ATOM   8075  N  N    . CYS A 1 28 ? -0.463  15.308  6.655   1.00 0.00 ? 28 CYS A N    7  
ATOM   8076  C  CA   . CYS A 1 28 ? -0.003  16.575  6.092   1.00 0.00 ? 28 CYS A CA   7  
ATOM   8077  C  C    . CYS A 1 28 ? -0.976  17.093  5.029   1.00 0.00 ? 28 CYS A C    7  
ATOM   8078  O  O    . CYS A 1 28 ? -1.190  18.302  4.913   1.00 0.00 ? 28 CYS A O    7  
ATOM   8079  C  CB   . CYS A 1 28 ? 1.399   16.418  5.494   1.00 0.00 ? 28 CYS A CB   7  
ATOM   8080  S  SG   . CYS A 1 28 ? 1.503   15.207  4.135   1.00 0.00 ? 28 CYS A SG   7  
ATOM   8081  H  H    . CYS A 1 28 ? -0.026  14.475  6.376   1.00 0.00 ? 28 CYS A H    7  
ATOM   8082  H  HA   . CYS A 1 28 ? 0.042   17.292  6.899   1.00 0.00 ? 28 CYS A HA   7  
ATOM   8083  H  HB2  . CYS A 1 28 ? 1.725   17.372  5.109   1.00 0.00 ? 28 CYS A HB2  7  
ATOM   8084  H  HB3  . CYS A 1 28 ? 2.080   16.099  6.270   1.00 0.00 ? 28 CYS A HB3  7  
ATOM   8085  N  N    . GLY A 1 29 ? -1.561  16.173  4.255   1.00 0.00 ? 29 GLY A N    7  
ATOM   8086  C  CA   . GLY A 1 29 ? -2.500  16.557  3.213   1.00 0.00 ? 29 GLY A CA   7  
ATOM   8087  C  C    . GLY A 1 29 ? -2.517  15.582  2.049   1.00 0.00 ? 29 GLY A C    7  
ATOM   8088  O  O    . GLY A 1 29 ? -3.582  15.134  1.623   1.00 0.00 ? 29 GLY A O    7  
ATOM   8089  H  H    . GLY A 1 29 ? -1.351  15.226  4.394   1.00 0.00 ? 29 GLY A H    7  
ATOM   8090  H  HA2  . GLY A 1 29 ? -3.490  16.604  3.640   1.00 0.00 ? 29 GLY A HA2  7  
ATOM   8091  H  HA3  . GLY A 1 29 ? -2.232  17.536  2.844   1.00 0.00 ? 29 GLY A HA3  7  
ATOM   8092  N  N    . ASP A 1 30 ? -1.332  15.250  1.535   1.00 0.00 ? 30 ASP A N    7  
ATOM   8093  C  CA   . ASP A 1 30 ? -1.212  14.319  0.413   1.00 0.00 ? 30 ASP A CA   7  
ATOM   8094  C  C    . ASP A 1 30 ? -1.391  12.870  0.882   1.00 0.00 ? 30 ASP A C    7  
ATOM   8095  O  O    . ASP A 1 30 ? -1.826  12.626  2.011   1.00 0.00 ? 30 ASP A O    7  
ATOM   8096  C  CB   . ASP A 1 30 ? 0.149   14.501  -0.272  1.00 0.00 ? 30 ASP A CB   7  
ATOM   8097  C  CG   . ASP A 1 30 ? 0.079   14.331  -1.779  1.00 0.00 ? 30 ASP A CG   7  
ATOM   8098  O  OD1  . ASP A 1 30 ? -0.802  14.954  -2.412  1.00 0.00 ? 30 ASP A OD1  7  
ATOM   8099  O  OD2  . ASP A 1 30 ? 0.908   13.576  -2.330  1.00 0.00 ? 30 ASP A OD2  7  
ATOM   8100  H  H    . ASP A 1 30 ? -0.519  15.639  1.921   1.00 0.00 ? 30 ASP A H    7  
ATOM   8101  H  HA   . ASP A 1 30 ? -1.994  14.551  -0.294  1.00 0.00 ? 30 ASP A HA   7  
ATOM   8102  H  HB2  . ASP A 1 30 ? 0.519   15.493  -0.060  1.00 0.00 ? 30 ASP A HB2  7  
ATOM   8103  H  HB3  . ASP A 1 30 ? 0.843   13.773  0.123   1.00 0.00 ? 30 ASP A HB3  7  
ATOM   8104  N  N    . ASN A 1 31 ? -1.068  11.908  0.014   1.00 0.00 ? 31 ASN A N    7  
ATOM   8105  C  CA   . ASN A 1 31 ? -1.210  10.496  0.353   1.00 0.00 ? 31 ASN A CA   7  
ATOM   8106  C  C    . ASN A 1 31 ? -0.009  9.686   -0.133  1.00 0.00 ? 31 ASN A C    7  
ATOM   8107  O  O    . ASN A 1 31 ? 0.481   9.893   -1.245  1.00 0.00 ? 31 ASN A O    7  
ATOM   8108  C  CB   . ASN A 1 31 ? -2.496  9.928   -0.257  1.00 0.00 ? 31 ASN A CB   7  
ATOM   8109  C  CG   . ASN A 1 31 ? -3.721  10.779  0.041   1.00 0.00 ? 31 ASN A CG   7  
ATOM   8110  O  OD1  . ASN A 1 31 ? -4.488  10.483  0.956   1.00 0.00 ? 31 ASN A OD1  7  
ATOM   8111  N  ND2  . ASN A 1 31 ? -3.916  11.840  -0.737  1.00 0.00 ? 31 ASN A ND2  7  
ATOM   8112  H  H    . ASN A 1 31 ? -0.733  12.153  -0.873  1.00 0.00 ? 31 ASN A H    7  
ATOM   8113  H  HA   . ASN A 1 31 ? -1.269  10.419  1.429   1.00 0.00 ? 31 ASN A HA   7  
ATOM   8114  H  HB2  . ASN A 1 31 ? -2.379  9.865   -1.329  1.00 0.00 ? 31 ASN A HB2  7  
ATOM   8115  H  HB3  . ASN A 1 31 ? -2.665  8.938   0.138   1.00 0.00 ? 31 ASN A HB3  7  
ATOM   8116  H  HD21 . ASN A 1 31 ? -3.269  12.019  -1.452  1.00 0.00 ? 31 ASN A HD21 7  
ATOM   8117  H  HD22 . ASN A 1 31 ? -4.704  12.399  -0.565  1.00 0.00 ? 31 ASN A HD22 7  
ATOM   8118  N  N    . PHE A 1 32 ? 0.448   8.755   0.708   1.00 0.00 ? 32 PHE A N    7  
ATOM   8119  C  CA   . PHE A 1 32 ? 1.584   7.891   0.379   1.00 0.00 ? 32 PHE A CA   7  
ATOM   8120  C  C    . PHE A 1 32 ? 1.282   7.045   -0.860  1.00 0.00 ? 32 PHE A C    7  
ATOM   8121  O  O    . PHE A 1 32 ? 0.123   6.902   -1.251  1.00 0.00 ? 32 PHE A O    7  
ATOM   8122  C  CB   . PHE A 1 32 ? 1.907   6.970   1.561   1.00 0.00 ? 32 PHE A CB   7  
ATOM   8123  C  CG   . PHE A 1 32 ? 2.767   7.606   2.621   1.00 0.00 ? 32 PHE A CG   7  
ATOM   8124  C  CD1  . PHE A 1 32 ? 4.120   7.809   2.400   1.00 0.00 ? 32 PHE A CD1  7  
ATOM   8125  C  CD2  . PHE A 1 32 ? 2.227   7.990   3.839   1.00 0.00 ? 32 PHE A CD2  7  
ATOM   8126  C  CE1  . PHE A 1 32 ? 4.916   8.385   3.372   1.00 0.00 ? 32 PHE A CE1  7  
ATOM   8127  C  CE2  . PHE A 1 32 ? 3.019   8.565   4.814   1.00 0.00 ? 32 PHE A CE2  7  
ATOM   8128  C  CZ   . PHE A 1 32 ? 4.365   8.763   4.580   1.00 0.00 ? 32 PHE A CZ   7  
ATOM   8129  H  H    . PHE A 1 32 ? 0.002   8.639   1.575   1.00 0.00 ? 32 PHE A H    7  
ATOM   8130  H  HA   . PHE A 1 32 ? 2.438   8.521   0.175   1.00 0.00 ? 32 PHE A HA   7  
ATOM   8131  H  HB2  . PHE A 1 32 ? 0.984   6.661   2.028   1.00 0.00 ? 32 PHE A HB2  7  
ATOM   8132  H  HB3  . PHE A 1 32 ? 2.425   6.096   1.193   1.00 0.00 ? 32 PHE A HB3  7  
ATOM   8133  H  HD1  . PHE A 1 32 ? 4.552   7.515   1.455   1.00 0.00 ? 32 PHE A HD1  7  
ATOM   8134  H  HD2  . PHE A 1 32 ? 1.173   7.837   4.023   1.00 0.00 ? 32 PHE A HD2  7  
ATOM   8135  H  HE1  . PHE A 1 32 ? 5.968   8.538   3.187   1.00 0.00 ? 32 PHE A HE1  7  
ATOM   8136  H  HE2  . PHE A 1 32 ? 2.586   8.861   5.759   1.00 0.00 ? 32 PHE A HE2  7  
ATOM   8137  H  HZ   . PHE A 1 32 ? 4.988   9.212   5.341   1.00 0.00 ? 32 PHE A HZ   7  
ATOM   8138  N  N    . SER A 1 33 ? 2.326   6.480   -1.470  1.00 0.00 ? 33 SER A N    7  
ATOM   8139  C  CA   . SER A 1 33 ? 2.158   5.648   -2.662  1.00 0.00 ? 33 SER A CA   7  
ATOM   8140  C  C    . SER A 1 33 ? 3.198   4.528   -2.717  1.00 0.00 ? 33 SER A C    7  
ATOM   8141  O  O    . SER A 1 33 ? 4.372   4.739   -2.404  1.00 0.00 ? 33 SER A O    7  
ATOM   8142  C  CB   . SER A 1 33 ? 2.251   6.507   -3.928  1.00 0.00 ? 33 SER A CB   7  
ATOM   8143  O  OG   . SER A 1 33 ? 3.335   7.418   -3.854  1.00 0.00 ? 33 SER A OG   7  
ATOM   8144  H  H    . SER A 1 33 ? 3.228   6.627   -1.112  1.00 0.00 ? 33 SER A H    7  
ATOM   8145  H  HA   . SER A 1 33 ? 1.175   5.203   -2.615  1.00 0.00 ? 33 SER A HA   7  
ATOM   8146  H  HB2  . SER A 1 33 ? 2.396   5.865   -4.785  1.00 0.00 ? 33 SER A HB2  7  
ATOM   8147  H  HB3  . SER A 1 33 ? 1.335   7.065   -4.049  1.00 0.00 ? 33 SER A HB3  7  
ATOM   8148  H  HG   . SER A 1 33 ? 3.293   8.027   -4.596  1.00 0.00 ? 33 SER A HG   7  
ATOM   8149  N  N    . ILE A 1 34 ? 2.752   3.341   -3.125  1.00 0.00 ? 34 ILE A N    7  
ATOM   8150  C  CA   . ILE A 1 34 ? 3.627   2.175   -3.241  1.00 0.00 ? 34 ILE A CA   7  
ATOM   8151  C  C    . ILE A 1 34 ? 3.108   1.216   -4.317  1.00 0.00 ? 34 ILE A C    7  
ATOM   8152  O  O    . ILE A 1 34 ? 1.953   0.785   -4.273  1.00 0.00 ? 34 ILE A O    7  
ATOM   8153  C  CB   . ILE A 1 34 ? 3.764   1.426   -1.894  1.00 0.00 ? 34 ILE A CB   7  
ATOM   8154  C  CG1  . ILE A 1 34 ? 4.739   0.252   -2.028  1.00 0.00 ? 34 ILE A CG1  7  
ATOM   8155  C  CG2  . ILE A 1 34 ? 2.406   0.943   -1.401  1.00 0.00 ? 34 ILE A CG2  7  
ATOM   8156  C  CD1  . ILE A 1 34 ? 5.656   0.091   -0.836  1.00 0.00 ? 34 ILE A CD1  7  
ATOM   8157  H  H    . ILE A 1 34 ? 1.804   3.245   -3.364  1.00 0.00 ? 34 ILE A H    7  
ATOM   8158  H  HA   . ILE A 1 34 ? 4.606   2.527   -3.534  1.00 0.00 ? 34 ILE A HA   7  
ATOM   8159  H  HB   . ILE A 1 34 ? 4.153   2.121   -1.165  1.00 0.00 ? 34 ILE A HB   7  
ATOM   8160  H  HG12 . ILE A 1 34 ? 4.179   -0.665  -2.140  1.00 0.00 ? 34 ILE A HG12 7  
ATOM   8161  H  HG13 . ILE A 1 34 ? 5.355   0.401   -2.903  1.00 0.00 ? 34 ILE A HG13 7  
ATOM   8162  H  HG21 . ILE A 1 34 ? 1.626   1.534   -1.856  1.00 0.00 ? 34 ILE A HG21 7  
ATOM   8163  H  HG22 . ILE A 1 34 ? 2.355   1.048   -0.328  1.00 0.00 ? 34 ILE A HG22 7  
ATOM   8164  H  HG23 . ILE A 1 34 ? 2.274   -0.095  -1.668  1.00 0.00 ? 34 ILE A HG23 7  
ATOM   8165  H  HD11 . ILE A 1 34 ? 5.559   -0.909  -0.441  1.00 0.00 ? 34 ILE A HD11 7  
ATOM   8166  H  HD12 . ILE A 1 34 ? 5.387   0.807   -0.074  1.00 0.00 ? 34 ILE A HD12 7  
ATOM   8167  H  HD13 . ILE A 1 34 ? 6.678   0.260   -1.143  1.00 0.00 ? 34 ILE A HD13 7  
ATOM   8168  N  N    . THR A 1 35 ? 3.963   0.893   -5.286  1.00 0.00 ? 35 THR A N    7  
ATOM   8169  C  CA   . THR A 1 35 ? 3.587   -0.005  -6.380  1.00 0.00 ? 35 THR A CA   7  
ATOM   8170  C  C    . THR A 1 35 ? 3.463   -1.451  -5.895  1.00 0.00 ? 35 THR A C    7  
ATOM   8171  O  O    . THR A 1 35 ? 4.158   -1.868  -4.968  1.00 0.00 ? 35 THR A O    7  
ATOM   8172  C  CB   . THR A 1 35 ? 4.619   0.078   -7.510  1.00 0.00 ? 35 THR A CB   7  
ATOM   8173  O  OG1  . THR A 1 35 ? 5.925   -0.163  -7.014  1.00 0.00 ? 35 THR A OG1  7  
ATOM   8174  C  CG2  . THR A 1 35 ? 4.635   1.423   -8.209  1.00 0.00 ? 35 THR A CG2  7  
ATOM   8175  H  H    . THR A 1 35 ? 4.867   1.273   -5.271  1.00 0.00 ? 35 THR A H    7  
ATOM   8176  H  HA   . THR A 1 35 ? 2.628   0.317   -6.758  1.00 0.00 ? 35 THR A HA   7  
ATOM   8177  H  HB   . THR A 1 35 ? 4.391   -0.677  -8.250  1.00 0.00 ? 35 THR A HB   7  
ATOM   8178  H  HG1  . THR A 1 35 ? 6.513   -0.375  -7.743  1.00 0.00 ? 35 THR A HG1  7  
ATOM   8179  H  HG21 . THR A 1 35 ? 5.100   2.156   -7.566  1.00 0.00 ? 35 THR A HG21 7  
ATOM   8180  H  HG22 . THR A 1 35 ? 3.622   1.727   -8.428  1.00 0.00 ? 35 THR A HG22 7  
ATOM   8181  H  HG23 . THR A 1 35 ? 5.195   1.344   -9.128  1.00 0.00 ? 35 THR A HG23 7  
ATOM   8182  N  N    . LYS A 1 36 ? 2.571   -2.212  -6.534  1.00 0.00 ? 36 LYS A N    7  
ATOM   8183  C  CA   . LYS A 1 36 ? 2.356   -3.614  -6.173  1.00 0.00 ? 36 LYS A CA   7  
ATOM   8184  C  C    . LYS A 1 36 ? 3.635   -4.430  -6.366  1.00 0.00 ? 36 LYS A C    7  
ATOM   8185  O  O    . LYS A 1 36 ? 3.946   -5.308  -5.558  1.00 0.00 ? 36 LYS A O    7  
ATOM   8186  C  CB   . LYS A 1 36 ? 1.217   -4.214  -7.008  1.00 0.00 ? 36 LYS A CB   7  
ATOM   8187  C  CG   . LYS A 1 36 ? 0.811   -5.614  -6.574  1.00 0.00 ? 36 LYS A CG   7  
ATOM   8188  C  CD   . LYS A 1 36 ? 1.574   -6.682  -7.344  1.00 0.00 ? 36 LYS A CD   7  
ATOM   8189  C  CE   . LYS A 1 36 ? 0.677   -7.854  -7.717  1.00 0.00 ? 36 LYS A CE   7  
ATOM   8190  N  NZ   . LYS A 1 36 ? 0.115   -7.715  -9.091  1.00 0.00 ? 36 LYS A NZ   7  
ATOM   8191  H  H    . LYS A 1 36 ? 2.049   -1.822  -7.268  1.00 0.00 ? 36 LYS A H    7  
ATOM   8192  H  HA   . LYS A 1 36 ? 2.079   -3.646  -5.129  1.00 0.00 ? 36 LYS A HA   7  
ATOM   8193  H  HB2  . LYS A 1 36 ? 0.352   -3.571  -6.927  1.00 0.00 ? 36 LYS A HB2  7  
ATOM   8194  H  HB3  . LYS A 1 36 ? 1.528   -4.255  -8.042  1.00 0.00 ? 36 LYS A HB3  7  
ATOM   8195  H  HG2  . LYS A 1 36 ? 1.019   -5.729  -5.521  1.00 0.00 ? 36 LYS A HG2  7  
ATOM   8196  H  HG3  . LYS A 1 36 ? -0.247  -5.741  -6.750  1.00 0.00 ? 36 LYS A HG3  7  
ATOM   8197  H  HD2  . LYS A 1 36 ? 1.974   -6.246  -8.248  1.00 0.00 ? 36 LYS A HD2  7  
ATOM   8198  H  HD3  . LYS A 1 36 ? 2.385   -7.044  -6.729  1.00 0.00 ? 36 LYS A HD3  7  
ATOM   8199  H  HE2  . LYS A 1 36 ? 1.255   -8.764  -7.665  1.00 0.00 ? 36 LYS A HE2  7  
ATOM   8200  H  HE3  . LYS A 1 36 ? -0.136  -7.906  -7.008  1.00 0.00 ? 36 LYS A HE3  7  
ATOM   8201  H  HZ1  . LYS A 1 36 ? 0.860   -7.424  -9.755  1.00 0.00 ? 36 LYS A HZ1  7  
ATOM   8202  H  HZ2  . LYS A 1 36 ? -0.642  -6.998  -9.100  1.00 0.00 ? 36 LYS A HZ2  7  
ATOM   8203  H  HZ3  . LYS A 1 36 ? -0.282  -8.622  -9.409  1.00 0.00 ? 36 LYS A HZ3  7  
ATOM   8204  N  N    . GLU A 1 37 ? 4.376   -4.126  -7.434  1.00 0.00 ? 37 GLU A N    7  
ATOM   8205  C  CA   . GLU A 1 37 ? 5.626   -4.822  -7.727  1.00 0.00 ? 37 GLU A CA   7  
ATOM   8206  C  C    . GLU A 1 37 ? 6.643   -4.618  -6.600  1.00 0.00 ? 37 GLU A C    7  
ATOM   8207  O  O    . GLU A 1 37 ? 7.379   -5.540  -6.247  1.00 0.00 ? 37 GLU A O    7  
ATOM   8208  C  CB   . GLU A 1 37 ? 6.214   -4.332  -9.053  1.00 0.00 ? 37 GLU A CB   7  
ATOM   8209  C  CG   . GLU A 1 37 ? 7.097   -5.360  -9.745  1.00 0.00 ? 37 GLU A CG   7  
ATOM   8210  C  CD   . GLU A 1 37 ? 7.419   -4.992  -11.183 1.00 0.00 ? 37 GLU A CD   7  
ATOM   8211  O  OE1  . GLU A 1 37 ? 6.474   -4.743  -11.963 1.00 0.00 ? 37 GLU A OE1  7  
ATOM   8212  O  OE2  . GLU A 1 37 ? 8.618   -4.957  -11.531 1.00 0.00 ? 37 GLU A OE2  7  
ATOM   8213  H  H    . GLU A 1 37 ? 4.076   -3.411  -8.035  1.00 0.00 ? 37 GLU A H    7  
ATOM   8214  H  HA   . GLU A 1 37 ? 5.405   -5.877  -7.810  1.00 0.00 ? 37 GLU A HA   7  
ATOM   8215  H  HB2  . GLU A 1 37 ? 5.404   -4.076  -9.720  1.00 0.00 ? 37 GLU A HB2  7  
ATOM   8216  H  HB3  . GLU A 1 37 ? 6.806   -3.447  -8.866  1.00 0.00 ? 37 GLU A HB3  7  
ATOM   8217  H  HG2  . GLU A 1 37 ? 8.023   -5.445  -9.198  1.00 0.00 ? 37 GLU A HG2  7  
ATOM   8218  H  HG3  . GLU A 1 37 ? 6.588   -6.314  -9.739  1.00 0.00 ? 37 GLU A HG3  7  
ATOM   8219  N  N    . ASP A 1 38 ? 6.670   -3.405  -6.035  1.00 0.00 ? 38 ASP A N    7  
ATOM   8220  C  CA   . ASP A 1 38 ? 7.592   -3.085  -4.943  1.00 0.00 ? 38 ASP A CA   7  
ATOM   8221  C  C    . ASP A 1 38 ? 7.402   -4.052  -3.779  1.00 0.00 ? 38 ASP A C    7  
ATOM   8222  O  O    . ASP A 1 38 ? 8.368   -4.601  -3.257  1.00 0.00 ? 38 ASP A O    7  
ATOM   8223  C  CB   . ASP A 1 38 ? 7.373   -1.644  -4.454  1.00 0.00 ? 38 ASP A CB   7  
ATOM   8224  C  CG   . ASP A 1 38 ? 8.240   -0.622  -5.176  1.00 0.00 ? 38 ASP A CG   7  
ATOM   8225  O  OD1  . ASP A 1 38 ? 8.779   -0.944  -6.258  1.00 0.00 ? 38 ASP A OD1  7  
ATOM   8226  O  OD2  . ASP A 1 38 ? 8.379   0.505   -4.655  1.00 0.00 ? 38 ASP A OD2  7  
ATOM   8227  H  H    . ASP A 1 38 ? 6.057   -2.712  -6.359  1.00 0.00 ? 38 ASP A H    7  
ATOM   8228  H  HA   . ASP A 1 38 ? 8.601   -3.184  -5.318  1.00 0.00 ? 38 ASP A HA   7  
ATOM   8229  H  HB2  . ASP A 1 38 ? 6.340   -1.373  -4.604  1.00 0.00 ? 38 ASP A HB2  7  
ATOM   8230  H  HB3  . ASP A 1 38 ? 7.600   -1.596  -3.397  1.00 0.00 ? 38 ASP A HB3  7  
ATOM   8231  N  N    . LEU A 1 39 ? 6.146   -4.262  -3.388  1.00 0.00 ? 39 LEU A N    7  
ATOM   8232  C  CA   . LEU A 1 39 ? 5.827   -5.170  -2.289  1.00 0.00 ? 39 LEU A CA   7  
ATOM   8233  C  C    . LEU A 1 39 ? 6.255   -6.600  -2.622  1.00 0.00 ? 39 LEU A C    7  
ATOM   8234  O  O    . LEU A 1 39 ? 6.795   -7.305  -1.770  1.00 0.00 ? 39 LEU A O    7  
ATOM   8235  C  CB   . LEU A 1 39 ? 4.331   -5.126  -1.979  1.00 0.00 ? 39 LEU A CB   7  
ATOM   8236  C  CG   . LEU A 1 39 ? 3.758   -3.725  -1.754  1.00 0.00 ? 39 LEU A CG   7  
ATOM   8237  C  CD1  . LEU A 1 39 ? 2.280   -3.696  -2.102  1.00 0.00 ? 39 LEU A CD1  7  
ATOM   8238  C  CD2  . LEU A 1 39 ? 3.988   -3.275  -0.317  1.00 0.00 ? 39 LEU A CD2  7  
ATOM   8239  H  H    . LEU A 1 39 ? 5.418   -3.797  -3.851  1.00 0.00 ? 39 LEU A H    7  
ATOM   8240  H  HA   . LEU A 1 39 ? 6.374   -4.839  -1.419  1.00 0.00 ? 39 LEU A HA   7  
ATOM   8241  H  HB2  . LEU A 1 39 ? 3.802   -5.582  -2.804  1.00 0.00 ? 39 LEU A HB2  7  
ATOM   8242  H  HB3  . LEU A 1 39 ? 4.150   -5.711  -1.091  1.00 0.00 ? 39 LEU A HB3  7  
ATOM   8243  H  HG   . LEU A 1 39 ? 4.267   -3.029  -2.407  1.00 0.00 ? 39 LEU A HG   7  
ATOM   8244  H  HD11 . LEU A 1 39 ? 1.869   -2.731  -1.842  1.00 0.00 ? 39 LEU A HD11 7  
ATOM   8245  H  HD12 . LEU A 1 39 ? 1.766   -4.468  -1.551  1.00 0.00 ? 39 LEU A HD12 7  
ATOM   8246  H  HD13 . LEU A 1 39 ? 2.158   -3.865  -3.161  1.00 0.00 ? 39 LEU A HD13 7  
ATOM   8247  H  HD21 . LEU A 1 39 ? 3.280   -3.769  0.333   1.00 0.00 ? 39 LEU A HD21 7  
ATOM   8248  H  HD22 . LEU A 1 39 ? 3.855   -2.206  -0.249  1.00 0.00 ? 39 LEU A HD22 7  
ATOM   8249  H  HD23 . LEU A 1 39 ? 4.993   -3.533  -0.016  1.00 0.00 ? 39 LEU A HD23 7  
ATOM   8250  N  N    . GLU A 1 40 ? 6.022   -7.018  -3.867  1.00 0.00 ? 40 GLU A N    7  
ATOM   8251  C  CA   . GLU A 1 40 ? 6.396   -8.363  -4.311  1.00 0.00 ? 40 GLU A CA   7  
ATOM   8252  C  C    . GLU A 1 40 ? 7.911   -8.574  -4.243  1.00 0.00 ? 40 GLU A C    7  
ATOM   8253  O  O    . GLU A 1 40 ? 8.378   -9.692  -4.023  1.00 0.00 ? 40 GLU A O    7  
ATOM   8254  C  CB   . GLU A 1 40 ? 5.910   -8.608  -5.739  1.00 0.00 ? 40 GLU A CB   7  
ATOM   8255  C  CG   . GLU A 1 40 ? 4.434   -8.960  -5.835  1.00 0.00 ? 40 GLU A CG   7  
ATOM   8256  C  CD   . GLU A 1 40 ? 4.041   -9.438  -7.219  1.00 0.00 ? 40 GLU A CD   7  
ATOM   8257  O  OE1  . GLU A 1 40 ? 3.934   -8.592  -8.133  1.00 0.00 ? 40 GLU A OE1  7  
ATOM   8258  O  OE2  . GLU A 1 40 ? 3.840   -10.659 -7.391  1.00 0.00 ? 40 GLU A OE2  7  
ATOM   8259  H  H    . GLU A 1 40 ? 5.592   -6.407  -4.505  1.00 0.00 ? 40 GLU A H    7  
ATOM   8260  H  HA   . GLU A 1 40 ? 5.917   -9.072  -3.653  1.00 0.00 ? 40 GLU A HA   7  
ATOM   8261  H  HB2  . GLU A 1 40 ? 6.082   -7.716  -6.323  1.00 0.00 ? 40 GLU A HB2  7  
ATOM   8262  H  HB3  . GLU A 1 40 ? 6.479   -9.420  -6.165  1.00 0.00 ? 40 GLU A HB3  7  
ATOM   8263  H  HG2  . GLU A 1 40 ? 4.216   -9.743  -5.125  1.00 0.00 ? 40 GLU A HG2  7  
ATOM   8264  H  HG3  . GLU A 1 40 ? 3.851   -8.084  -5.595  1.00 0.00 ? 40 GLU A HG3  7  
ATOM   8265  N  N    . ASN A 1 41 ? 8.675   -7.497  -4.443  1.00 0.00 ? 41 ASN A N    7  
ATOM   8266  C  CA   . ASN A 1 41 ? 10.138  -7.571  -4.413  1.00 0.00 ? 41 ASN A CA   7  
ATOM   8267  C  C    . ASN A 1 41 ? 10.688  -7.413  -2.995  1.00 0.00 ? 41 ASN A C    7  
ATOM   8268  O  O    . ASN A 1 41 ? 11.687  -8.042  -2.639  1.00 0.00 ? 41 ASN A O    7  
ATOM   8269  C  CB   . ASN A 1 41 ? 10.740  -6.493  -5.315  1.00 0.00 ? 41 ASN A CB   7  
ATOM   8270  C  CG   . ASN A 1 41 ? 10.924  -6.974  -6.740  1.00 0.00 ? 41 ASN A CG   7  
ATOM   8271  O  OD1  . ASN A 1 41 ? 11.981  -7.494  -7.101  1.00 0.00 ? 41 ASN A OD1  7  
ATOM   8272  N  ND2  . ASN A 1 41 ? 9.891   -6.809  -7.557  1.00 0.00 ? 41 ASN A ND2  7  
ATOM   8273  H  H    . ASN A 1 41 ? 8.247   -6.633  -4.623  1.00 0.00 ? 41 ASN A H    7  
ATOM   8274  H  HA   . ASN A 1 41 ? 10.426  -8.540  -4.791  1.00 0.00 ? 41 ASN A HA   7  
ATOM   8275  H  HB2  . ASN A 1 41 ? 10.085  -5.633  -5.328  1.00 0.00 ? 41 ASN A HB2  7  
ATOM   8276  H  HB3  . ASN A 1 41 ? 11.703  -6.199  -4.926  1.00 0.00 ? 41 ASN A HB3  7  
ATOM   8277  H  HD21 . ASN A 1 41 ? 9.080   -6.390  -7.200  1.00 0.00 ? 41 ASN A HD21 7  
ATOM   8278  H  HD22 . ASN A 1 41 ? 9.981   -7.115  -8.483  1.00 0.00 ? 41 ASN A HD22 7  
ATOM   8279  N  N    . GLY A 1 42 ? 10.046  -6.558  -2.199  1.00 0.00 ? 42 GLY A N    7  
ATOM   8280  C  CA   . GLY A 1 42 ? 10.496  -6.316  -0.838  1.00 0.00 ? 42 GLY A CA   7  
ATOM   8281  C  C    . GLY A 1 42 ? 10.357  -4.856  -0.431  1.00 0.00 ? 42 GLY A C    7  
ATOM   8282  O  O    . GLY A 1 42 ? 10.421  -4.534  0.757   1.00 0.00 ? 42 GLY A O    7  
ATOM   8283  H  H    . GLY A 1 42 ? 9.265   -6.076  -2.541  1.00 0.00 ? 42 GLY A H    7  
ATOM   8284  H  HA2  . GLY A 1 42 ? 9.913   -6.926  -0.164  1.00 0.00 ? 42 GLY A HA2  7  
ATOM   8285  H  HA3  . GLY A 1 42 ? 11.535  -6.603  -0.757  1.00 0.00 ? 42 GLY A HA3  7  
ATOM   8286  N  N    . GLU A 1 43 ? 10.158  -3.971  -1.417  1.00 0.00 ? 43 GLU A N    7  
ATOM   8287  C  CA   . GLU A 1 43 ? 9.997   -2.547  -1.160  1.00 0.00 ? 43 GLU A CA   7  
ATOM   8288  C  C    . GLU A 1 43 ? 8.674   -2.277  -0.444  1.00 0.00 ? 43 GLU A C    7  
ATOM   8289  O  O    . GLU A 1 43 ? 7.683   -1.890  -1.061  1.00 0.00 ? 43 GLU A O    7  
ATOM   8290  C  CB   . GLU A 1 43 ? 10.057  -1.756  -2.473  1.00 0.00 ? 43 GLU A CB   7  
ATOM   8291  C  CG   . GLU A 1 43 ? 11.468  -1.535  -2.994  1.00 0.00 ? 43 GLU A CG   7  
ATOM   8292  C  CD   . GLU A 1 43 ? 11.608  -0.223  -3.742  1.00 0.00 ? 43 GLU A CD   7  
ATOM   8293  O  OE1  . GLU A 1 43 ? 11.510  0.843   -3.096  1.00 0.00 ? 43 GLU A OE1  7  
ATOM   8294  O  OE2  . GLU A 1 43 ? 11.815  -0.260  -4.972  1.00 0.00 ? 43 GLU A OE2  7  
ATOM   8295  H  H    . GLU A 1 43 ? 10.111  -4.288  -2.342  1.00 0.00 ? 43 GLU A H    7  
ATOM   8296  H  HA   . GLU A 1 43 ? 10.808  -2.232  -0.522  1.00 0.00 ? 43 GLU A HA   7  
ATOM   8297  H  HB2  . GLU A 1 43 ? 9.499   -2.290  -3.228  1.00 0.00 ? 43 GLU A HB2  7  
ATOM   8298  H  HB3  . GLU A 1 43 ? 9.599   -0.790  -2.318  1.00 0.00 ? 43 GLU A HB3  7  
ATOM   8299  H  HG2  . GLU A 1 43 ? 12.153  -1.532  -2.159  1.00 0.00 ? 43 GLU A HG2  7  
ATOM   8300  H  HG3  . GLU A 1 43 ? 11.722  -2.345  -3.665  1.00 0.00 ? 43 GLU A HG3  7  
ATOM   8301  N  N    . ASP A 1 44 ? 8.674   -2.490  0.863   1.00 0.00 ? 44 ASP A N    7  
ATOM   8302  C  CA   . ASP A 1 44 ? 7.492   -2.277  1.690   1.00 0.00 ? 44 ASP A CA   7  
ATOM   8303  C  C    . ASP A 1 44 ? 7.567   -0.915  2.381   1.00 0.00 ? 44 ASP A C    7  
ATOM   8304  O  O    . ASP A 1 44 ? 7.234   -0.779  3.561   1.00 0.00 ? 44 ASP A O    7  
ATOM   8305  C  CB   . ASP A 1 44 ? 7.354   -3.409  2.722   1.00 0.00 ? 44 ASP A CB   7  
ATOM   8306  C  CG   . ASP A 1 44 ? 8.544   -3.539  3.668   1.00 0.00 ? 44 ASP A CG   7  
ATOM   8307  O  OD1  . ASP A 1 44 ? 9.550   -2.817  3.487   1.00 0.00 ? 44 ASP A OD1  7  
ATOM   8308  O  OD2  . ASP A 1 44 ? 8.467   -4.371  4.594   1.00 0.00 ? 44 ASP A OD2  7  
ATOM   8309  H  H    . ASP A 1 44 ? 9.496   -2.801  1.286   1.00 0.00 ? 44 ASP A H    7  
ATOM   8310  H  HA   . ASP A 1 44 ? 6.625   -2.287  1.044   1.00 0.00 ? 44 ASP A HA   7  
ATOM   8311  H  HB2  . ASP A 1 44 ? 6.473   -3.234  3.317   1.00 0.00 ? 44 ASP A HB2  7  
ATOM   8312  H  HB3  . ASP A 1 44 ? 7.242   -4.344  2.193   1.00 0.00 ? 44 ASP A HB3  7  
ATOM   8313  N  N    . VAL A 1 45 ? 8.009   0.092   1.626   1.00 0.00 ? 45 VAL A N    7  
ATOM   8314  C  CA   . VAL A 1 45 ? 8.135   1.452   2.142   1.00 0.00 ? 45 VAL A CA   7  
ATOM   8315  C  C    . VAL A 1 45 ? 7.478   2.456   1.206   1.00 0.00 ? 45 VAL A C    7  
ATOM   8316  O  O    . VAL A 1 45 ? 7.718   2.440   -0.003  1.00 0.00 ? 45 VAL A O    7  
ATOM   8317  C  CB   . VAL A 1 45 ? 9.613   1.873   2.346   1.00 0.00 ? 45 VAL A CB   7  
ATOM   8318  C  CG1  . VAL A 1 45 ? 9.937   1.986   3.824   1.00 0.00 ? 45 VAL A CG1  7  
ATOM   8319  C  CG2  . VAL A 1 45 ? 10.573  0.909   1.663   1.00 0.00 ? 45 VAL A CG2  7  
ATOM   8320  H  H    . VAL A 1 45 ? 8.253   -0.085  0.693   1.00 0.00 ? 45 VAL A H    7  
ATOM   8321  H  HA   . VAL A 1 45 ? 7.637   1.490   3.100   1.00 0.00 ? 45 VAL A HA   7  
ATOM   8322  H  HB   . VAL A 1 45 ? 9.748   2.850   1.902   1.00 0.00 ? 45 VAL A HB   7  
ATOM   8323  H  HG11 . VAL A 1 45 ? 11.002  2.118   3.948   1.00 0.00 ? 45 VAL A HG11 7  
ATOM   8324  H  HG12 . VAL A 1 45 ? 9.624   1.084   4.329   1.00 0.00 ? 45 VAL A HG12 7  
ATOM   8325  H  HG13 . VAL A 1 45 ? 9.418   2.835   4.243   1.00 0.00 ? 45 VAL A HG13 7  
ATOM   8326  H  HG21 . VAL A 1 45 ? 10.653  0.007   2.249   1.00 0.00 ? 45 VAL A HG21 7  
ATOM   8327  H  HG22 . VAL A 1 45 ? 11.545  1.371   1.578   1.00 0.00 ? 45 VAL A HG22 7  
ATOM   8328  H  HG23 . VAL A 1 45 ? 10.202  0.668   0.677   1.00 0.00 ? 45 VAL A HG23 7  
ATOM   8329  N  N    . ALA A 1 46 ? 6.664   3.341   1.772   1.00 0.00 ? 46 ALA A N    7  
ATOM   8330  C  CA   . ALA A 1 46 ? 5.989   4.368   0.990   1.00 0.00 ? 46 ALA A CA   7  
ATOM   8331  C  C    . ALA A 1 46 ? 6.508   5.752   1.368   1.00 0.00 ? 46 ALA A C    7  
ATOM   8332  O  O    . ALA A 1 46 ? 6.697   6.051   2.549   1.00 0.00 ? 46 ALA A O    7  
ATOM   8333  C  CB   . ALA A 1 46 ? 4.479   4.292   1.184   1.00 0.00 ? 46 ALA A CB   7  
ATOM   8334  H  H    . ALA A 1 46 ? 6.524   3.311   2.743   1.00 0.00 ? 46 ALA A H    7  
ATOM   8335  H  HA   . ALA A 1 46 ? 6.205   4.184   -0.053  1.00 0.00 ? 46 ALA A HA   7  
ATOM   8336  H  HB1  . ALA A 1 46 ? 4.162   5.076   1.855   1.00 0.00 ? 46 ALA A HB1  7  
ATOM   8337  H  HB2  . ALA A 1 46 ? 4.215   3.332   1.601   1.00 0.00 ? 46 ALA A HB2  7  
ATOM   8338  H  HB3  . ALA A 1 46 ? 3.988   4.415   0.229   1.00 0.00 ? 46 ALA A HB3  7  
ATOM   8339  N  N    . THR A 1 47 ? 6.741   6.590   0.359   1.00 0.00 ? 47 THR A N    7  
ATOM   8340  C  CA   . THR A 1 47 ? 7.239   7.944   0.588   1.00 0.00 ? 47 THR A CA   7  
ATOM   8341  C  C    . THR A 1 47 ? 6.240   8.979   0.076   1.00 0.00 ? 47 THR A C    7  
ATOM   8342  O  O    . THR A 1 47 ? 5.747   8.877   -1.049  1.00 0.00 ? 47 THR A O    7  
ATOM   8343  C  CB   . THR A 1 47 ? 8.602   8.139   -0.088  1.00 0.00 ? 47 THR A CB   7  
ATOM   8344  O  OG1  . THR A 1 47 ? 9.492   7.091   0.265   1.00 0.00 ? 47 THR A OG1  7  
ATOM   8345  C  CG2  . THR A 1 47 ? 9.273   9.449   0.276   1.00 0.00 ? 47 THR A CG2  7  
ATOM   8346  H  H    . THR A 1 47 ? 6.573   6.292   -0.560  1.00 0.00 ? 47 THR A H    7  
ATOM   8347  H  HA   . THR A 1 47 ? 7.356   8.075   1.653   1.00 0.00 ? 47 THR A HA   7  
ATOM   8348  H  HB   . THR A 1 47 ? 8.468   8.122   -1.161  1.00 0.00 ? 47 THR A HB   7  
ATOM   8349  H  HG1  . THR A 1 47 ? 9.376   6.353   -0.339  1.00 0.00 ? 47 THR A HG1  7  
ATOM   8350  H  HG21 . THR A 1 47 ? 9.570   9.965   -0.626  1.00 0.00 ? 47 THR A HG21 7  
ATOM   8351  H  HG22 . THR A 1 47 ? 10.146  9.251   0.880   1.00 0.00 ? 47 THR A HG22 7  
ATOM   8352  H  HG23 . THR A 1 47 ? 8.584   10.066  0.832   1.00 0.00 ? 47 THR A HG23 7  
ATOM   8353  N  N    . CYS A 1 48 ? 5.946   9.971   0.913   1.00 0.00 ? 48 CYS A N    7  
ATOM   8354  C  CA   . CYS A 1 48 ? 5.008   11.028  0.555   1.00 0.00 ? 48 CYS A CA   7  
ATOM   8355  C  C    . CYS A 1 48 ? 5.749   12.210  -0.069  1.00 0.00 ? 48 CYS A C    7  
ATOM   8356  O  O    . CYS A 1 48 ? 6.580   12.837  0.582   1.00 0.00 ? 48 CYS A O    7  
ATOM   8357  C  CB   . CYS A 1 48 ? 4.229   11.488  1.793   1.00 0.00 ? 48 CYS A CB   7  
ATOM   8358  S  SG   . CYS A 1 48 ? 2.892   12.675  1.447   1.00 0.00 ? 48 CYS A SG   7  
ATOM   8359  H  H    . CYS A 1 48 ? 6.372   9.992   1.796   1.00 0.00 ? 48 CYS A H    7  
ATOM   8360  H  HA   . CYS A 1 48 ? 4.312   10.626  -0.165  1.00 0.00 ? 48 CYS A HA   7  
ATOM   8361  H  HB2  . CYS A 1 48 ? 3.783   10.627  2.267   1.00 0.00 ? 48 CYS A HB2  7  
ATOM   8362  H  HB3  . CYS A 1 48 ? 4.914   11.959  2.485   1.00 0.00 ? 48 CYS A HB3  7  
ATOM   8363  N  N    . PRO A 1 49 ? 5.461   12.528  -1.346  1.00 0.00 ? 49 PRO A N    7  
ATOM   8364  C  CA   . PRO A 1 49 ? 6.110   13.643  -2.055  1.00 0.00 ? 49 PRO A CA   7  
ATOM   8365  C  C    . PRO A 1 49 ? 5.966   14.990  -1.334  1.00 0.00 ? 49 PRO A C    7  
ATOM   8366  O  O    . PRO A 1 49 ? 6.722   15.923  -1.610  1.00 0.00 ? 49 PRO A O    7  
ATOM   8367  C  CB   . PRO A 1 49 ? 5.378   13.685  -3.400  1.00 0.00 ? 49 PRO A CB   7  
ATOM   8368  C  CG   . PRO A 1 49 ? 4.834   12.311  -3.580  1.00 0.00 ? 49 PRO A CG   7  
ATOM   8369  C  CD   . PRO A 1 49 ? 4.489   11.825  -2.202  1.00 0.00 ? 49 PRO A CD   7  
ATOM   8370  H  HA   . PRO A 1 49 ? 7.157   13.443  -2.222  1.00 0.00 ? 49 PRO A HA   7  
ATOM   8371  H  HB2  . PRO A 1 49 ? 4.589   14.420  -3.360  1.00 0.00 ? 49 PRO A HB2  7  
ATOM   8372  H  HB3  . PRO A 1 49 ? 6.075   13.939  -4.185  1.00 0.00 ? 49 PRO A HB3  7  
ATOM   8373  H  HG2  . PRO A 1 49 ? 3.950   12.345  -4.199  1.00 0.00 ? 49 PRO A HG2  7  
ATOM   8374  H  HG3  . PRO A 1 49 ? 5.583   11.674  -4.028  1.00 0.00 ? 49 PRO A HG3  7  
ATOM   8375  H  HD2  . PRO A 1 49 ? 3.476   12.098  -1.947  1.00 0.00 ? 49 PRO A HD2  7  
ATOM   8376  H  HD3  . PRO A 1 49 ? 4.623   10.754  -2.134  1.00 0.00 ? 49 PRO A HD3  7  
ATOM   8377  N  N    . SER A 1 50 ? 4.993   15.094  -0.423  1.00 0.00 ? 50 SER A N    7  
ATOM   8378  C  CA   . SER A 1 50 ? 4.765   16.335  0.313   1.00 0.00 ? 50 SER A CA   7  
ATOM   8379  C  C    . SER A 1 50 ? 5.703   16.450  1.520   1.00 0.00 ? 50 SER A C    7  
ATOM   8380  O  O    . SER A 1 50 ? 6.653   17.235  1.496   1.00 0.00 ? 50 SER A O    7  
ATOM   8381  C  CB   . SER A 1 50 ? 3.305   16.422  0.766   1.00 0.00 ? 50 SER A CB   7  
ATOM   8382  O  OG   . SER A 1 50 ? 2.445   16.688  -0.330  1.00 0.00 ? 50 SER A OG   7  
ATOM   8383  H  H    . SER A 1 50 ? 4.413   14.323  -0.248  1.00 0.00 ? 50 SER A H    7  
ATOM   8384  H  HA   . SER A 1 50 ? 4.968   17.155  -0.360  1.00 0.00 ? 50 SER A HA   7  
ATOM   8385  H  HB2  . SER A 1 50 ? 3.013   15.485  1.216   1.00 0.00 ? 50 SER A HB2  7  
ATOM   8386  H  HB3  . SER A 1 50 ? 3.204   17.216  1.491   1.00 0.00 ? 50 SER A HB3  7  
ATOM   8387  H  HG   . SER A 1 50 ? 2.753   17.467  -0.800  1.00 0.00 ? 50 SER A HG   7  
ATOM   8388  N  N    . CYS A 1 51 ? 5.433   15.674  2.571   1.00 0.00 ? 51 CYS A N    7  
ATOM   8389  C  CA   . CYS A 1 51 ? 6.261   15.708  3.782   1.00 0.00 ? 51 CYS A CA   7  
ATOM   8390  C  C    . CYS A 1 51 ? 7.581   14.954  3.595   1.00 0.00 ? 51 CYS A C    7  
ATOM   8391  O  O    . CYS A 1 51 ? 8.563   15.232  4.289   1.00 0.00 ? 51 CYS A O    7  
ATOM   8392  C  CB   . CYS A 1 51 ? 5.497   15.119  4.972   1.00 0.00 ? 51 CYS A CB   7  
ATOM   8393  S  SG   . CYS A 1 51 ? 4.947   13.398  4.731   1.00 0.00 ? 51 CYS A SG   7  
ATOM   8394  H  H    . CYS A 1 51 ? 4.661   15.069  2.535   1.00 0.00 ? 51 CYS A H    7  
ATOM   8395  H  HA   . CYS A 1 51 ? 6.484   16.743  3.994   1.00 0.00 ? 51 CYS A HA   7  
ATOM   8396  H  HB2  . CYS A 1 51 ? 6.137   15.140  5.844   1.00 0.00 ? 51 CYS A HB2  7  
ATOM   8397  H  HB3  . CYS A 1 51 ? 4.620   15.721  5.162   1.00 0.00 ? 51 CYS A HB3  7  
ATOM   8398  N  N    . SER A 1 52 ? 7.598   13.993  2.667   1.00 0.00 ? 52 SER A N    7  
ATOM   8399  C  CA   . SER A 1 52 ? 8.790   13.191  2.397   1.00 0.00 ? 52 SER A CA   7  
ATOM   8400  C  C    . SER A 1 52 ? 9.107   12.275  3.583   1.00 0.00 ? 52 SER A C    7  
ATOM   8401  O  O    . SER A 1 52 ? 10.272  12.067  3.933   1.00 0.00 ? 52 SER A O    7  
ATOM   8402  C  CB   . SER A 1 52 ? 9.985   14.095  2.080   1.00 0.00 ? 52 SER A CB   7  
ATOM   8403  O  OG   . SER A 1 52 ? 10.784  13.544  1.048   1.00 0.00 ? 52 SER A OG   7  
ATOM   8404  H  H    . SER A 1 52 ? 6.781   13.812  2.153   1.00 0.00 ? 52 SER A H    7  
ATOM   8405  H  HA   . SER A 1 52 ? 8.581   12.574  1.535   1.00 0.00 ? 52 SER A HA   7  
ATOM   8406  H  HB2  . SER A 1 52 ? 9.627   15.061  1.762   1.00 0.00 ? 52 SER A HB2  7  
ATOM   8407  H  HB3  . SER A 1 52 ? 10.592  14.209  2.965   1.00 0.00 ? 52 SER A HB3  7  
ATOM   8408  H  HG   . SER A 1 52 ? 11.210  12.741  1.364   1.00 0.00 ? 52 SER A HG   7  
ATOM   8409  N  N    . LEU A 1 53 ? 8.056   11.726  4.192   1.00 0.00 ? 53 LEU A N    7  
ATOM   8410  C  CA   . LEU A 1 53 ? 8.206   10.827  5.331   1.00 0.00 ? 53 LEU A CA   7  
ATOM   8411  C  C    . LEU A 1 53 ? 8.278   9.374   4.867   1.00 0.00 ? 53 LEU A C    7  
ATOM   8412  O  O    . LEU A 1 53 ? 8.176   9.091   3.670   1.00 0.00 ? 53 LEU A O    7  
ATOM   8413  C  CB   . LEU A 1 53 ? 7.034   11.009  6.303   1.00 0.00 ? 53 LEU A CB   7  
ATOM   8414  C  CG   . LEU A 1 53 ? 7.258   12.046  7.407   1.00 0.00 ? 53 LEU A CG   7  
ATOM   8415  C  CD1  . LEU A 1 53 ? 5.926   12.582  7.907   1.00 0.00 ? 53 LEU A CD1  7  
ATOM   8416  C  CD2  . LEU A 1 53 ? 8.059   11.445  8.554   1.00 0.00 ? 53 LEU A CD2  7  
ATOM   8417  H  H    . LEU A 1 53 ? 7.155   11.925  3.861   1.00 0.00 ? 53 LEU A H    7  
ATOM   8418  H  HA   . LEU A 1 53 ? 9.126   11.080  5.836   1.00 0.00 ? 53 LEU A HA   7  
ATOM   8419  H  HB2  . LEU A 1 53 ? 6.165   11.304  5.732   1.00 0.00 ? 53 LEU A HB2  7  
ATOM   8420  H  HB3  . LEU A 1 53 ? 6.829   10.057  6.770   1.00 0.00 ? 53 LEU A HB3  7  
ATOM   8421  H  HG   . LEU A 1 53 ? 7.820   12.875  7.003   1.00 0.00 ? 53 LEU A HG   7  
ATOM   8422  H  HD11 . LEU A 1 53 ? 5.655   13.459  7.338   1.00 0.00 ? 53 LEU A HD11 7  
ATOM   8423  H  HD12 . LEU A 1 53 ? 6.009   12.841  8.952   1.00 0.00 ? 53 LEU A HD12 7  
ATOM   8424  H  HD13 . LEU A 1 53 ? 5.164   11.827  7.784   1.00 0.00 ? 53 LEU A HD13 7  
ATOM   8425  H  HD21 . LEU A 1 53 ? 7.707   10.445  8.756   1.00 0.00 ? 53 LEU A HD21 7  
ATOM   8426  H  HD22 . LEU A 1 53 ? 7.936   12.055  9.437   1.00 0.00 ? 53 LEU A HD22 7  
ATOM   8427  H  HD23 . LEU A 1 53 ? 9.105   11.411  8.283   1.00 0.00 ? 53 LEU A HD23 7  
ATOM   8428  N  N    . ILE A 1 54 ? 8.456   8.456   5.816   1.00 0.00 ? 54 ILE A N    7  
ATOM   8429  C  CA   . ILE A 1 54 ? 8.540   7.034   5.498   1.00 0.00 ? 54 ILE A CA   7  
ATOM   8430  C  C    . ILE A 1 54 ? 7.527   6.221   6.305   1.00 0.00 ? 54 ILE A C    7  
ATOM   8431  O  O    . ILE A 1 54 ? 7.269   6.517   7.474   1.00 0.00 ? 54 ILE A O    7  
ATOM   8432  C  CB   . ILE A 1 54 ? 9.958   6.475   5.763   1.00 0.00 ? 54 ILE A CB   7  
ATOM   8433  C  CG1  . ILE A 1 54 ? 10.457  6.893   7.151   1.00 0.00 ? 54 ILE A CG1  7  
ATOM   8434  C  CG2  . ILE A 1 54 ? 10.929  6.939   4.685   1.00 0.00 ? 54 ILE A CG2  7  
ATOM   8435  C  CD1  . ILE A 1 54 ? 11.726  6.186   7.578   1.00 0.00 ? 54 ILE A CD1  7  
ATOM   8436  H  H    . ILE A 1 54 ? 8.530   8.740   6.752   1.00 0.00 ? 54 ILE A H    7  
ATOM   8437  H  HA   . ILE A 1 54 ? 8.323   6.916   4.446   1.00 0.00 ? 54 ILE A HA   7  
ATOM   8438  H  HB   . ILE A 1 54 ? 9.906   5.397   5.720   1.00 0.00 ? 54 ILE A HB   7  
ATOM   8439  H  HG12 . ILE A 1 54 ? 10.655  7.955   7.151   1.00 0.00 ? 54 ILE A HG12 7  
ATOM   8440  H  HG13 . ILE A 1 54 ? 9.693   6.674   7.884   1.00 0.00 ? 54 ILE A HG13 7  
ATOM   8441  H  HG21 . ILE A 1 54 ? 11.657  6.163   4.498   1.00 0.00 ? 54 ILE A HG21 7  
ATOM   8442  H  HG22 . ILE A 1 54 ? 11.437  7.834   5.015   1.00 0.00 ? 54 ILE A HG22 7  
ATOM   8443  H  HG23 . ILE A 1 54 ? 10.386  7.149   3.775   1.00 0.00 ? 54 ILE A HG23 7  
ATOM   8444  H  HD11 . ILE A 1 54 ? 12.577  6.821   7.376   1.00 0.00 ? 54 ILE A HD11 7  
ATOM   8445  H  HD12 . ILE A 1 54 ? 11.827  5.264   7.025   1.00 0.00 ? 54 ILE A HD12 7  
ATOM   8446  H  HD13 . ILE A 1 54 ? 11.681  5.970   8.634   1.00 0.00 ? 54 ILE A HD13 7  
ATOM   8447  N  N    . ILE A 1 55 ? 6.965   5.188   5.672   1.00 0.00 ? 55 ILE A N    7  
ATOM   8448  C  CA   . ILE A 1 55 ? 5.988   4.316   6.324   1.00 0.00 ? 55 ILE A CA   7  
ATOM   8449  C  C    . ILE A 1 55 ? 6.207   2.855   5.927   1.00 0.00 ? 55 ILE A C    7  
ATOM   8450  O  O    . ILE A 1 55 ? 6.829   2.569   4.902   1.00 0.00 ? 55 ILE A O    7  
ATOM   8451  C  CB   . ILE A 1 55 ? 4.531   4.711   5.985   1.00 0.00 ? 55 ILE A CB   7  
ATOM   8452  C  CG1  . ILE A 1 55 ? 4.298   4.693   4.471   1.00 0.00 ? 55 ILE A CG1  7  
ATOM   8453  C  CG2  . ILE A 1 55 ? 4.197   6.080   6.561   1.00 0.00 ? 55 ILE A CG2  7  
ATOM   8454  C  CD1  . ILE A 1 55 ? 2.902   4.258   4.080   1.00 0.00 ? 55 ILE A CD1  7  
ATOM   8455  H  H    . ILE A 1 55 ? 7.222   5.003   4.743   1.00 0.00 ? 55 ILE A H    7  
ATOM   8456  H  HA   . ILE A 1 55 ? 6.123   4.409   7.393   1.00 0.00 ? 55 ILE A HA   7  
ATOM   8457  H  HB   . ILE A 1 55 ? 3.874   3.989   6.448   1.00 0.00 ? 55 ILE A HB   7  
ATOM   8458  H  HG12 . ILE A 1 55 ? 4.459   5.685   4.076   1.00 0.00 ? 55 ILE A HG12 7  
ATOM   8459  H  HG13 . ILE A 1 55 ? 4.999   4.011   4.013   1.00 0.00 ? 55 ILE A HG13 7  
ATOM   8460  H  HG21 . ILE A 1 55 ? 3.190   6.353   6.277   1.00 0.00 ? 55 ILE A HG21 7  
ATOM   8461  H  HG22 . ILE A 1 55 ? 4.890   6.812   6.175   1.00 0.00 ? 55 ILE A HG22 7  
ATOM   8462  H  HG23 . ILE A 1 55 ? 4.271   6.046   7.637   1.00 0.00 ? 55 ILE A HG23 7  
ATOM   8463  H  HD11 . ILE A 1 55 ? 2.335   4.021   4.968   1.00 0.00 ? 55 ILE A HD11 7  
ATOM   8464  H  HD12 . ILE A 1 55 ? 2.960   3.386   3.447   1.00 0.00 ? 55 ILE A HD12 7  
ATOM   8465  H  HD13 . ILE A 1 55 ? 2.412   5.058   3.545   1.00 0.00 ? 55 ILE A HD13 7  
ATOM   8466  N  N    . LYS A 1 56 ? 5.695   1.936   6.747   1.00 0.00 ? 56 LYS A N    7  
ATOM   8467  C  CA   . LYS A 1 56 ? 5.836   0.506   6.480   1.00 0.00 ? 56 LYS A CA   7  
ATOM   8468  C  C    . LYS A 1 56 ? 4.534   -0.096  5.984   1.00 0.00 ? 56 LYS A C    7  
ATOM   8469  O  O    . LYS A 1 56 ? 3.460   0.155   6.538   1.00 0.00 ? 56 LYS A O    7  
ATOM   8470  C  CB   . LYS A 1 56 ? 6.311   -0.227  7.737   1.00 0.00 ? 56 LYS A CB   7  
ATOM   8471  C  CG   . LYS A 1 56 ? 7.329   -1.321  7.460   1.00 0.00 ? 56 LYS A CG   7  
ATOM   8472  C  CD   . LYS A 1 56 ? 6.674   -2.573  6.894   1.00 0.00 ? 56 LYS A CD   7  
ATOM   8473  C  CE   . LYS A 1 56 ? 7.310   -3.838  7.451   1.00 0.00 ? 56 LYS A CE   7  
ATOM   8474  N  NZ   . LYS A 1 56 ? 7.265   -3.880  8.941   1.00 0.00 ? 56 LYS A NZ   7  
ATOM   8475  H  H    . LYS A 1 56 ? 5.209   2.227   7.548   1.00 0.00 ? 56 LYS A H    7  
ATOM   8476  H  HA   . LYS A 1 56 ? 6.573   0.386   5.703   1.00 0.00 ? 56 LYS A HA   7  
ATOM   8477  H  HB2  . LYS A 1 56 ? 6.759   0.489   8.411   1.00 0.00 ? 56 LYS A HB2  7  
ATOM   8478  H  HB3  . LYS A 1 56 ? 5.456   -0.675  8.221   1.00 0.00 ? 56 LYS A HB3  7  
ATOM   8479  H  HG2  . LYS A 1 56 ? 8.055   -0.953  6.749   1.00 0.00 ? 56 LYS A HG2  7  
ATOM   8480  H  HG3  . LYS A 1 56 ? 7.826   -1.574  8.386   1.00 0.00 ? 56 LYS A HG3  7  
ATOM   8481  H  HD2  . LYS A 1 56 ? 5.625   -2.566  7.150   1.00 0.00 ? 56 LYS A HD2  7  
ATOM   8482  H  HD3  . LYS A 1 56 ? 6.783   -2.568  5.818   1.00 0.00 ? 56 LYS A HD3  7  
ATOM   8483  H  HE2  . LYS A 1 56 ? 6.780   -4.693  7.058   1.00 0.00 ? 56 LYS A HE2  7  
ATOM   8484  H  HE3  . LYS A 1 56 ? 8.341   -3.878  7.129   1.00 0.00 ? 56 LYS A HE3  7  
ATOM   8485  H  HZ1  . LYS A 1 56 ? 8.182   -3.587  9.335   1.00 0.00 ? 56 LYS A HZ1  7  
ATOM   8486  H  HZ2  . LYS A 1 56 ? 7.053   -4.846  9.265   1.00 0.00 ? 56 LYS A HZ2  7  
ATOM   8487  H  HZ3  . LYS A 1 56 ? 6.527   -3.240  9.296   1.00 0.00 ? 56 LYS A HZ3  7  
ATOM   8488  N  N    . VAL A 1 57 ? 4.645   -0.893  4.927   1.00 0.00 ? 57 VAL A N    7  
ATOM   8489  C  CA   . VAL A 1 57 ? 3.491   -1.540  4.328   1.00 0.00 ? 57 VAL A CA   7  
ATOM   8490  C  C    . VAL A 1 57 ? 3.509   -3.045  4.587   1.00 0.00 ? 57 VAL A C    7  
ATOM   8491  O  O    . VAL A 1 57 ? 4.378   -3.761  4.084   1.00 0.00 ? 57 VAL A O    7  
ATOM   8492  C  CB   . VAL A 1 57 ? 3.427   -1.279  2.805   1.00 0.00 ? 57 VAL A CB   7  
ATOM   8493  C  CG1  . VAL A 1 57 ? 1.986   -1.129  2.370   1.00 0.00 ? 57 VAL A CG1  7  
ATOM   8494  C  CG2  . VAL A 1 57 ? 4.223   -0.036  2.420   1.00 0.00 ? 57 VAL A CG2  7  
ATOM   8495  H  H    . VAL A 1 57 ? 5.532   -1.048  4.537   1.00 0.00 ? 57 VAL A H    7  
ATOM   8496  H  HA   . VAL A 1 57 ? 2.604   -1.119  4.780   1.00 0.00 ? 57 VAL A HA   7  
ATOM   8497  H  HB   . VAL A 1 57 ? 3.856   -2.129  2.290   1.00 0.00 ? 57 VAL A HB   7  
ATOM   8498  H  HG11 . VAL A 1 57 ? 1.950   -0.876  1.322   1.00 0.00 ? 57 VAL A HG11 7  
ATOM   8499  H  HG12 . VAL A 1 57 ? 1.525   -0.342  2.948   1.00 0.00 ? 57 VAL A HG12 7  
ATOM   8500  H  HG13 . VAL A 1 57 ? 1.459   -2.056  2.538   1.00 0.00 ? 57 VAL A HG13 7  
ATOM   8501  H  HG21 . VAL A 1 57 ? 3.782   0.833   2.887   1.00 0.00 ? 57 VAL A HG21 7  
ATOM   8502  H  HG22 . VAL A 1 57 ? 4.204   0.084   1.347   1.00 0.00 ? 57 VAL A HG22 7  
ATOM   8503  H  HG23 . VAL A 1 57 ? 5.243   -0.142  2.752   1.00 0.00 ? 57 VAL A HG23 7  
ATOM   8504  N  N    . ILE A 1 58 ? 2.544   -3.519  5.375   1.00 0.00 ? 58 ILE A N    7  
ATOM   8505  C  CA   . ILE A 1 58 ? 2.448   -4.942  5.700   1.00 0.00 ? 58 ILE A CA   7  
ATOM   8506  C  C    . ILE A 1 58 ? 1.530   -5.666  4.719   1.00 0.00 ? 58 ILE A C    7  
ATOM   8507  O  O    . ILE A 1 58 ? 0.456   -5.174  4.382   1.00 0.00 ? 58 ILE A O    7  
ATOM   8508  C  CB   . ILE A 1 58 ? 1.929   -5.166  7.137   1.00 0.00 ? 58 ILE A CB   7  
ATOM   8509  C  CG1  . ILE A 1 58 ? 2.697   -4.288  8.132   1.00 0.00 ? 58 ILE A CG1  7  
ATOM   8510  C  CG2  . ILE A 1 58 ? 2.043   -6.636  7.521   1.00 0.00 ? 58 ILE A CG2  7  
ATOM   8511  C  CD1  . ILE A 1 58 ? 4.180   -4.589  8.193   1.00 0.00 ? 58 ILE A CD1  7  
ATOM   8512  H  H    . ILE A 1 58 ? 1.880   -2.899  5.745   1.00 0.00 ? 58 ILE A H    7  
ATOM   8513  H  HA   . ILE A 1 58 ? 3.441   -5.364  5.629   1.00 0.00 ? 58 ILE A HA   7  
ATOM   8514  H  HB   . ILE A 1 58 ? 0.884   -4.895  7.164   1.00 0.00 ? 58 ILE A HB   7  
ATOM   8515  H  HG12 . ILE A 1 58 ? 2.582   -3.252  7.851   1.00 0.00 ? 58 ILE A HG12 7  
ATOM   8516  H  HG13 . ILE A 1 58 ? 2.287   -4.435  9.121   1.00 0.00 ? 58 ILE A HG13 7  
ATOM   8517  H  HG21 . ILE A 1 58 ? 2.210   -6.720  8.584   1.00 0.00 ? 58 ILE A HG21 7  
ATOM   8518  H  HG22 . ILE A 1 58 ? 2.870   -7.085  6.991   1.00 0.00 ? 58 ILE A HG22 7  
ATOM   8519  H  HG23 . ILE A 1 58 ? 1.128   -7.148  7.259   1.00 0.00 ? 58 ILE A HG23 7  
ATOM   8520  H  HD11 . ILE A 1 58 ? 4.626   -4.030  9.001   1.00 0.00 ? 58 ILE A HD11 7  
ATOM   8521  H  HD12 . ILE A 1 58 ? 4.642   -4.307  7.260   1.00 0.00 ? 58 ILE A HD12 7  
ATOM   8522  H  HD13 . ILE A 1 58 ? 4.325   -5.646  8.363   1.00 0.00 ? 58 ILE A HD13 7  
ATOM   8523  N  N    . TYR A 1 59 ? 1.968   -6.835  4.255   1.00 0.00 ? 59 TYR A N    7  
ATOM   8524  C  CA   . TYR A 1 59 ? 1.193   -7.627  3.301   1.00 0.00 ? 59 TYR A CA   7  
ATOM   8525  C  C    . TYR A 1 59 ? 1.499   -9.119  3.453   1.00 0.00 ? 59 TYR A C    7  
ATOM   8526  O  O    . TYR A 1 59 ? 2.339   -9.508  4.267   1.00 0.00 ? 59 TYR A O    7  
ATOM   8527  C  CB   . TYR A 1 59 ? 1.508   -7.171  1.871   1.00 0.00 ? 59 TYR A CB   7  
ATOM   8528  C  CG   . TYR A 1 59 ? 2.991   -7.098  1.583   1.00 0.00 ? 59 TYR A CG   7  
ATOM   8529  C  CD1  . TYR A 1 59 ? 3.687   -8.213  1.132   1.00 0.00 ? 59 TYR A CD1  7  
ATOM   8530  C  CD2  . TYR A 1 59 ? 3.698   -5.918  1.777   1.00 0.00 ? 59 TYR A CD2  7  
ATOM   8531  C  CE1  . TYR A 1 59 ? 5.044   -8.154  0.883   1.00 0.00 ? 59 TYR A CE1  7  
ATOM   8532  C  CE2  . TYR A 1 59 ? 5.054   -5.850  1.527   1.00 0.00 ? 59 TYR A CE2  7  
ATOM   8533  C  CZ   . TYR A 1 59 ? 5.724   -6.970  1.082   1.00 0.00 ? 59 TYR A CZ   7  
ATOM   8534  O  OH   . TYR A 1 59 ? 7.076   -6.907  0.839   1.00 0.00 ? 59 TYR A OH   7  
ATOM   8535  H  H    . TYR A 1 59 ? 2.838   -7.172  4.557   1.00 0.00 ? 59 TYR A H    7  
ATOM   8536  H  HA   . TYR A 1 59 ? 0.145   -7.462  3.501   1.00 0.00 ? 59 TYR A HA   7  
ATOM   8537  H  HB2  . TYR A 1 59 ? 1.067   -7.862  1.169   1.00 0.00 ? 59 TYR A HB2  7  
ATOM   8538  H  HB3  . TYR A 1 59 ? 1.090   -6.186  1.712   1.00 0.00 ? 59 TYR A HB3  7  
ATOM   8539  H  HD1  . TYR A 1 59 ? 3.152   -9.138  0.976   1.00 0.00 ? 59 TYR A HD1  7  
ATOM   8540  H  HD2  . TYR A 1 59 ? 3.172   -5.042  2.126   1.00 0.00 ? 59 TYR A HD2  7  
ATOM   8541  H  HE1  . TYR A 1 59 ? 5.567   -9.031  0.534   1.00 0.00 ? 59 TYR A HE1  7  
ATOM   8542  H  HE2  . TYR A 1 59 ? 5.584   -4.923  1.684   1.00 0.00 ? 59 TYR A HE2  7  
ATOM   8543  H  HH   . TYR A 1 59 ? 7.230   -6.863  -0.108  1.00 0.00 ? 59 TYR A HH   7  
ATOM   8544  N  N    . ASP A 1 60 ? 0.822   -9.950  2.658   1.00 0.00 ? 60 ASP A N    7  
ATOM   8545  C  CA   . ASP A 1 60 ? 1.034   -11.392 2.701   1.00 0.00 ? 60 ASP A CA   7  
ATOM   8546  C  C    . ASP A 1 60 ? 2.181   -11.795 1.776   1.00 0.00 ? 60 ASP A C    7  
ATOM   8547  O  O    . ASP A 1 60 ? 1.997   -11.915 0.563   1.00 0.00 ? 60 ASP A O    7  
ATOM   8548  C  CB   . ASP A 1 60 ? -0.248  -12.135 2.303   1.00 0.00 ? 60 ASP A CB   7  
ATOM   8549  C  CG   . ASP A 1 60 ? -0.291  -13.561 2.828   1.00 0.00 ? 60 ASP A CG   7  
ATOM   8550  O  OD1  . ASP A 1 60 ? 0.788   -14.168 3.004   1.00 0.00 ? 60 ASP A OD1  7  
ATOM   8551  O  OD2  . ASP A 1 60 ? -1.406  -14.072 3.058   1.00 0.00 ? 60 ASP A OD2  7  
ATOM   8552  H  H    . ASP A 1 60 ? 0.172   -9.585  2.021   1.00 0.00 ? 60 ASP A H    7  
ATOM   8553  H  HA   . ASP A 1 60 ? 1.293   -11.658 3.716   1.00 0.00 ? 60 ASP A HA   7  
ATOM   8554  H  HB2  . ASP A 1 60 ? -1.101  -11.603 2.696   1.00 0.00 ? 60 ASP A HB2  7  
ATOM   8555  H  HB3  . ASP A 1 60 ? -0.316  -12.167 1.225   1.00 0.00 ? 60 ASP A HB3  7  
ATOM   8556  N  N    . LYS A 1 61 ? 3.362   -12.007 2.357   1.00 0.00 ? 61 LYS A N    7  
ATOM   8557  C  CA   . LYS A 1 61 ? 4.537   -12.403 1.580   1.00 0.00 ? 61 LYS A CA   7  
ATOM   8558  C  C    . LYS A 1 61 ? 4.304   -13.741 0.877   1.00 0.00 ? 61 LYS A C    7  
ATOM   8559  O  O    . LYS A 1 61 ? 4.828   -13.971 -0.212  1.00 0.00 ? 61 LYS A O    7  
ATOM   8560  C  CB   . LYS A 1 61 ? 5.778   -12.489 2.473   1.00 0.00 ? 61 LYS A CB   7  
ATOM   8561  C  CG   . LYS A 1 61 ? 6.353   -11.131 2.855   1.00 0.00 ? 61 LYS A CG   7  
ATOM   8562  C  CD   . LYS A 1 61 ? 7.504   -10.730 1.943   1.00 0.00 ? 61 LYS A CD   7  
ATOM   8563  C  CE   . LYS A 1 61 ? 8.619   -10.048 2.722   1.00 0.00 ? 61 LYS A CE   7  
ATOM   8564  N  NZ   . LYS A 1 61 ? 9.964   -10.341 2.150   1.00 0.00 ? 61 LYS A NZ   7  
ATOM   8565  H  H    . LYS A 1 61 ? 3.445   -11.897 3.328   1.00 0.00 ? 61 LYS A H    7  
ATOM   8566  H  HA   . LYS A 1 61 ? 4.701   -11.646 0.829   1.00 0.00 ? 61 LYS A HA   7  
ATOM   8567  H  HB2  . LYS A 1 61 ? 5.519   -13.013 3.380   1.00 0.00 ? 61 LYS A HB2  7  
ATOM   8568  H  HB3  . LYS A 1 61 ? 6.544   -13.046 1.952   1.00 0.00 ? 61 LYS A HB3  7  
ATOM   8569  H  HG2  . LYS A 1 61 ? 5.573   -10.387 2.780   1.00 0.00 ? 61 LYS A HG2  7  
ATOM   8570  H  HG3  . LYS A 1 61 ? 6.710   -11.180 3.873   1.00 0.00 ? 61 LYS A HG3  7  
ATOM   8571  H  HD2  . LYS A 1 61 ? 7.901   -11.615 1.468   1.00 0.00 ? 61 LYS A HD2  7  
ATOM   8572  H  HD3  . LYS A 1 61 ? 7.135   -10.049 1.189   1.00 0.00 ? 61 LYS A HD3  7  
ATOM   8573  H  HE2  . LYS A 1 61 ? 8.454   -8.982  2.701   1.00 0.00 ? 61 LYS A HE2  7  
ATOM   8574  H  HE3  . LYS A 1 61 ? 8.590   -10.395 3.744   1.00 0.00 ? 61 LYS A HE3  7  
ATOM   8575  H  HZ1  . LYS A 1 61 ? 10.194  -9.652  1.404   1.00 0.00 ? 61 LYS A HZ1  7  
ATOM   8576  H  HZ2  . LYS A 1 61 ? 9.981   -11.297 1.742   1.00 0.00 ? 61 LYS A HZ2  7  
ATOM   8577  H  HZ3  . LYS A 1 61 ? 10.689  -10.281 2.893   1.00 0.00 ? 61 LYS A HZ3  7  
ATOM   8578  N  N    . ASP A 1 62 ? 3.512   -14.617 1.501   1.00 0.00 ? 62 ASP A N    7  
ATOM   8579  C  CA   . ASP A 1 62 ? 3.209   -15.923 0.919   1.00 0.00 ? 62 ASP A CA   7  
ATOM   8580  C  C    . ASP A 1 62 ? 2.404   -15.765 -0.371  1.00 0.00 ? 62 ASP A C    7  
ATOM   8581  O  O    . ASP A 1 62 ? 2.583   -16.533 -1.318  1.00 0.00 ? 62 ASP A O    7  
ATOM   8582  C  CB   . ASP A 1 62 ? 2.438   -16.796 1.916   1.00 0.00 ? 62 ASP A CB   7  
ATOM   8583  C  CG   . ASP A 1 62 ? 3.305   -17.268 3.071   1.00 0.00 ? 62 ASP A CG   7  
ATOM   8584  O  OD1  . ASP A 1 62 ? 3.844   -16.410 3.801   1.00 0.00 ? 62 ASP A OD1  7  
ATOM   8585  O  OD2  . ASP A 1 62 ? 3.443   -18.497 3.245   1.00 0.00 ? 62 ASP A OD2  7  
ATOM   8586  H  H    . ASP A 1 62 ? 3.118   -14.376 2.366   1.00 0.00 ? 62 ASP A H    7  
ATOM   8587  H  HA   . ASP A 1 62 ? 4.147   -16.405 0.684   1.00 0.00 ? 62 ASP A HA   7  
ATOM   8588  H  HB2  . ASP A 1 62 ? 1.614   -16.229 2.322   1.00 0.00 ? 62 ASP A HB2  7  
ATOM   8589  H  HB3  . ASP A 1 62 ? 2.053   -17.665 1.402   1.00 0.00 ? 62 ASP A HB3  7  
ATOM   8590  N  N    . GLN A 1 63 ? 1.529   -14.759 -0.409  1.00 0.00 ? 63 GLN A N    7  
ATOM   8591  C  CA   . GLN A 1 63 ? 0.711   -14.499 -1.591  1.00 0.00 ? 63 GLN A CA   7  
ATOM   8592  C  C    . GLN A 1 63 ? 1.504   -13.726 -2.645  1.00 0.00 ? 63 GLN A C    7  
ATOM   8593  O  O    . GLN A 1 63 ? 1.416   -14.021 -3.837  1.00 0.00 ? 63 GLN A O    7  
ATOM   8594  C  CB   . GLN A 1 63 ? -0.545  -13.716 -1.210  1.00 0.00 ? 63 GLN A CB   7  
ATOM   8595  C  CG   . GLN A 1 63 ? -1.585  -14.548 -0.474  1.00 0.00 ? 63 GLN A CG   7  
ATOM   8596  C  CD   . GLN A 1 63 ? -3.002  -14.239 -0.920  1.00 0.00 ? 63 GLN A CD   7  
ATOM   8597  O  OE1  . GLN A 1 63 ? -3.636  -15.039 -1.605  1.00 0.00 ? 63 GLN A OE1  7  
ATOM   8598  N  NE2  . GLN A 1 63 ? -3.505  -13.073 -0.530  1.00 0.00 ? 63 GLN A NE2  7  
ATOM   8599  H  H    . GLN A 1 63 ? 1.435   -14.172 0.376   1.00 0.00 ? 63 GLN A H    7  
ATOM   8600  H  HA   . GLN A 1 63 ? 0.417   -15.452 -2.006  1.00 0.00 ? 63 GLN A HA   7  
ATOM   8601  H  HB2  . GLN A 1 63 ? -0.261  -12.891 -0.572  1.00 0.00 ? 63 GLN A HB2  7  
ATOM   8602  H  HB3  . GLN A 1 63 ? -0.998  -13.325 -2.109  1.00 0.00 ? 63 GLN A HB3  7  
ATOM   8603  H  HG2  . GLN A 1 63 ? -1.387  -15.594 -0.657  1.00 0.00 ? 63 GLN A HG2  7  
ATOM   8604  H  HG3  . GLN A 1 63 ? -1.503  -14.347 0.584   1.00 0.00 ? 63 GLN A HG3  7  
ATOM   8605  H  HE21 . GLN A 1 63 ? -2.945  -12.483 0.016   1.00 0.00 ? 63 GLN A HE21 7  
ATOM   8606  H  HE22 . GLN A 1 63 ? -4.419  -12.850 -0.805  1.00 0.00 ? 63 GLN A HE22 7  
ATOM   8607  N  N    . PHE A 1 64 ? 2.273   -12.731 -2.197  1.00 0.00 ? 64 PHE A N    7  
ATOM   8608  C  CA   . PHE A 1 64 ? 3.078   -11.912 -3.103  1.00 0.00 ? 64 PHE A CA   7  
ATOM   8609  C  C    . PHE A 1 64 ? 4.278   -12.696 -3.643  1.00 0.00 ? 64 PHE A C    7  
ATOM   8610  O  O    . PHE A 1 64 ? 4.304   -13.066 -4.816  1.00 0.00 ? 64 PHE A O    7  
ATOM   8611  C  CB   . PHE A 1 64 ? 3.558   -10.638 -2.393  1.00 0.00 ? 64 PHE A CB   7  
ATOM   8612  C  CG   . PHE A 1 64 ? 2.524   -9.543  -2.336  1.00 0.00 ? 64 PHE A CG   7  
ATOM   8613  C  CD1  . PHE A 1 64 ? 1.337   -9.724  -1.641  1.00 0.00 ? 64 PHE A CD1  7  
ATOM   8614  C  CD2  . PHE A 1 64 ? 2.742   -8.332  -2.976  1.00 0.00 ? 64 PHE A CD2  7  
ATOM   8615  C  CE1  . PHE A 1 64 ? 0.390   -8.718  -1.586  1.00 0.00 ? 64 PHE A CE1  7  
ATOM   8616  C  CE2  . PHE A 1 64 ? 1.798   -7.324  -2.924  1.00 0.00 ? 64 PHE A CE2  7  
ATOM   8617  C  CZ   . PHE A 1 64 ? 0.620   -7.517  -2.229  1.00 0.00 ? 64 PHE A CZ   7  
ATOM   8618  H  H    . PHE A 1 64 ? 2.297   -12.541 -1.233  1.00 0.00 ? 64 PHE A H    7  
ATOM   8619  H  HA   . PHE A 1 64 ? 2.449   -11.631 -3.935  1.00 0.00 ? 64 PHE A HA   7  
ATOM   8620  H  HB2  . PHE A 1 64 ? 3.840   -10.882 -1.380  1.00 0.00 ? 64 PHE A HB2  7  
ATOM   8621  H  HB3  . PHE A 1 64 ? 4.422   -10.252 -2.917  1.00 0.00 ? 64 PHE A HB3  7  
ATOM   8622  H  HD1  . PHE A 1 64 ? 1.154   -10.660 -1.137  1.00 0.00 ? 64 PHE A HD1  7  
ATOM   8623  H  HD2  . PHE A 1 64 ? 3.662   -8.179  -3.520  1.00 0.00 ? 64 PHE A HD2  7  
ATOM   8624  H  HE1  . PHE A 1 64 ? -0.530  -8.872  -1.042  1.00 0.00 ? 64 PHE A HE1  7  
ATOM   8625  H  HE2  . PHE A 1 64 ? 1.981   -6.387  -3.428  1.00 0.00 ? 64 PHE A HE2  7  
ATOM   8626  H  HZ   . PHE A 1 64 ? -0.118  -6.730  -2.188  1.00 0.00 ? 64 PHE A HZ   7  
ATOM   8627  N  N    . VAL A 1 65 ? 5.272   -12.940 -2.783  1.00 0.00 ? 65 VAL A N    7  
ATOM   8628  C  CA   . VAL A 1 65 ? 6.473   -13.672 -3.183  1.00 0.00 ? 65 VAL A CA   7  
ATOM   8629  C  C    . VAL A 1 65 ? 6.591   -15.010 -2.447  1.00 0.00 ? 65 VAL A C    7  
ATOM   8630  O  O    . VAL A 1 65 ? 7.162   -15.093 -1.357  1.00 0.00 ? 65 VAL A O    7  
ATOM   8631  C  CB   . VAL A 1 65 ? 7.745   -12.827 -2.948  1.00 0.00 ? 65 VAL A CB   7  
ATOM   8632  C  CG1  . VAL A 1 65 ? 7.885   -12.432 -1.480  1.00 0.00 ? 65 VAL A CG1  7  
ATOM   8633  C  CG2  . VAL A 1 65 ? 8.985   -13.569 -3.431  1.00 0.00 ? 65 VAL A CG2  7  
ATOM   8634  H  H    . VAL A 1 65 ? 5.199   -12.617 -1.863  1.00 0.00 ? 65 VAL A H    7  
ATOM   8635  H  HA   . VAL A 1 65 ? 6.396   -13.869 -4.243  1.00 0.00 ? 65 VAL A HA   7  
ATOM   8636  H  HB   . VAL A 1 65 ? 7.651   -11.921 -3.525  1.00 0.00 ? 65 VAL A HB   7  
ATOM   8637  H  HG11 . VAL A 1 65 ? 6.957   -12.631 -0.964  1.00 0.00 ? 65 VAL A HG11 7  
ATOM   8638  H  HG12 . VAL A 1 65 ? 8.114   -11.379 -1.411  1.00 0.00 ? 65 VAL A HG12 7  
ATOM   8639  H  HG13 . VAL A 1 65 ? 8.679   -13.005 -1.028  1.00 0.00 ? 65 VAL A HG13 7  
ATOM   8640  H  HG21 . VAL A 1 65 ? 9.026   -14.544 -2.969  1.00 0.00 ? 65 VAL A HG21 7  
ATOM   8641  H  HG22 . VAL A 1 65 ? 9.870   -13.009 -3.165  1.00 0.00 ? 65 VAL A HG22 7  
ATOM   8642  H  HG23 . VAL A 1 65 ? 8.941   -13.682 -4.505  1.00 0.00 ? 65 VAL A HG23 7  
ATOM   8643  N  N    . SER A 1 66 ? 6.055   -16.061 -3.062  1.00 0.00 ? 66 SER A N    7  
ATOM   8644  C  CA   . SER A 1 66 ? 6.107   -17.399 -2.479  1.00 0.00 ? 66 SER A CA   7  
ATOM   8645  C  C    . SER A 1 66 ? 7.493   -18.017 -2.687  1.00 0.00 ? 66 SER A C    7  
ATOM   8646  O  O    . SER A 1 66 ? 7.735   -18.700 -3.684  1.00 0.00 ? 66 SER A O    7  
ATOM   8647  C  CB   . SER A 1 66 ? 5.025   -18.292 -3.098  1.00 0.00 ? 66 SER A CB   7  
ATOM   8648  O  OG   . SER A 1 66 ? 5.108   -18.296 -4.514  1.00 0.00 ? 66 SER A OG   7  
ATOM   8649  H  H    . SER A 1 66 ? 5.621   -15.935 -3.932  1.00 0.00 ? 66 SER A H    7  
ATOM   8650  H  HA   . SER A 1 66 ? 5.924   -17.307 -1.417  1.00 0.00 ? 66 SER A HA   7  
ATOM   8651  H  HB2  . SER A 1 66 ? 5.146   -19.303 -2.741  1.00 0.00 ? 66 SER A HB2  7  
ATOM   8652  H  HB3  . SER A 1 66 ? 4.050   -17.924 -2.808  1.00 0.00 ? 66 SER A HB3  7  
ATOM   8653  H  HG   . SER A 1 66 ? 4.312   -17.909 -4.884  1.00 0.00 ? 66 SER A HG   7  
ATOM   8654  N  N    . GLY A 1 67 ? 8.402   -17.764 -1.743  1.00 0.00 ? 67 GLY A N    7  
ATOM   8655  C  CA   . GLY A 1 67 ? 9.752   -18.297 -1.847  1.00 0.00 ? 67 GLY A CA   7  
ATOM   8656  C  C    . GLY A 1 67 ? 9.793   -19.801 -1.672  1.00 0.00 ? 67 GLY A C    7  
ATOM   8657  O  O    . GLY A 1 67 ? 9.501   -20.550 -2.607  1.00 0.00 ? 67 GLY A O    7  
ATOM   8658  H  H    . GLY A 1 67 ? 8.156   -17.207 -0.973  1.00 0.00 ? 67 GLY A H    7  
ATOM   8659  H  HA2  . GLY A 1 67 ? 10.153  -18.047 -2.818  1.00 0.00 ? 67 GLY A HA2  7  
ATOM   8660  H  HA3  . GLY A 1 67 ? 10.369  -17.839 -1.086  1.00 0.00 ? 67 GLY A HA3  7  
ATOM   8661  N  N    . GLU A 1 68 ? 10.146  -20.244 -0.469  1.00 0.00 ? 68 GLU A N    7  
ATOM   8662  C  CA   . GLU A 1 68 ? 10.217  -21.670 -0.162  1.00 0.00 ? 68 GLU A CA   7  
ATOM   8663  C  C    . GLU A 1 68 ? 9.046   -22.098 0.726   1.00 0.00 ? 68 GLU A C    7  
ATOM   8664  O  O    . GLU A 1 68 ? 9.177   -23.007 1.553   1.00 0.00 ? 68 GLU A O    7  
ATOM   8665  C  CB   . GLU A 1 68 ? 11.549  -21.989 0.518   1.00 0.00 ? 68 GLU A CB   7  
ATOM   8666  C  CG   . GLU A 1 68 ? 12.686  -22.226 -0.463  1.00 0.00 ? 68 GLU A CG   7  
ATOM   8667  C  CD   . GLU A 1 68 ? 13.996  -21.628 0.008   1.00 0.00 ? 68 GLU A CD   7  
ATOM   8668  O  OE1  . GLU A 1 68 ? 14.124  -20.384 -0.019  1.00 0.00 ? 68 GLU A OE1  7  
ATOM   8669  O  OE2  . GLU A 1 68 ? 14.891  -22.400 0.405   1.00 0.00 ? 68 GLU A OE2  7  
ATOM   8670  H  H    . GLU A 1 68 ? 10.359  -19.596 0.235   1.00 0.00 ? 68 GLU A H    7  
ATOM   8671  H  HA   . GLU A 1 68 ? 10.161  -22.213 -1.096  1.00 0.00 ? 68 GLU A HA   7  
ATOM   8672  H  HB2  . GLU A 1 68 ? 11.819  -21.162 1.158   1.00 0.00 ? 68 GLU A HB2  7  
ATOM   8673  H  HB3  . GLU A 1 68 ? 11.431  -22.877 1.121   1.00 0.00 ? 68 GLU A HB3  7  
ATOM   8674  H  HG2  . GLU A 1 68 ? 12.818  -23.290 -0.590  1.00 0.00 ? 68 GLU A HG2  7  
ATOM   8675  H  HG3  . GLU A 1 68 ? 12.424  -21.782 -1.413  1.00 0.00 ? 68 GLU A HG3  7  
ATOM   8676  N  N    . THR A 1 69 ? 7.897   -21.443 0.544   1.00 0.00 ? 69 THR A N    7  
ATOM   8677  C  CA   . THR A 1 69 ? 6.703   -21.756 1.317   1.00 0.00 ? 69 THR A CA   7  
ATOM   8678  C  C    . THR A 1 69 ? 5.980   -22.963 0.724   1.00 0.00 ? 69 THR A C    7  
ATOM   8679  O  O    . THR A 1 69 ? 5.651   -22.985 -0.464  1.00 0.00 ? 69 THR A O    7  
ATOM   8680  C  CB   . THR A 1 69 ? 5.764   -20.543 1.374   1.00 0.00 ? 69 THR A CB   7  
ATOM   8681  O  OG1  . THR A 1 69 ? 4.650   -20.813 2.208   1.00 0.00 ? 69 THR A OG1  7  
ATOM   8682  C  CG2  . THR A 1 69 ? 5.234   -20.120 0.020   1.00 0.00 ? 69 THR A CG2  7  
ATOM   8683  H  H    . THR A 1 69 ? 7.852   -20.738 -0.134  1.00 0.00 ? 69 THR A H    7  
ATOM   8684  H  HA   . THR A 1 69 ? 7.017   -22.001 2.321   1.00 0.00 ? 69 THR A HA   7  
ATOM   8685  H  HB   . THR A 1 69 ? 6.305   -19.705 1.791   1.00 0.00 ? 69 THR A HB   7  
ATOM   8686  H  HG1  . THR A 1 69 ? 4.490   -20.060 2.786   1.00 0.00 ? 69 THR A HG1  7  
ATOM   8687  H  HG21 . THR A 1 69 ? 5.807   -20.599 -0.759  1.00 0.00 ? 69 THR A HG21 7  
ATOM   8688  H  HG22 . THR A 1 69 ? 5.318   -19.048 -0.078  1.00 0.00 ? 69 THR A HG22 7  
ATOM   8689  H  HG23 . THR A 1 69 ? 4.196   -20.409 -0.067  1.00 0.00 ? 69 THR A HG23 7  
ATOM   8690  N  N    . VAL A 1 70 ? 5.740   -23.965 1.563   1.00 0.00 ? 70 VAL A N    7  
ATOM   8691  C  CA   . VAL A 1 70 ? 5.060   -25.181 1.138   1.00 0.00 ? 70 VAL A CA   7  
ATOM   8692  C  C    . VAL A 1 70 ? 3.574   -25.111 1.483   1.00 0.00 ? 70 VAL A C    7  
ATOM   8693  O  O    . VAL A 1 70 ? 3.210   -24.622 2.553   1.00 0.00 ? 70 VAL A O    7  
ATOM   8694  C  CB   . VAL A 1 70 ? 5.687   -26.427 1.805   1.00 0.00 ? 70 VAL A CB   7  
ATOM   8695  C  CG1  . VAL A 1 70 ? 5.129   -27.707 1.203   1.00 0.00 ? 70 VAL A CG1  7  
ATOM   8696  C  CG2  . VAL A 1 70 ? 7.205   -26.390 1.687   1.00 0.00 ? 70 VAL A CG2  7  
ATOM   8697  H  H    . VAL A 1 70 ? 6.029   -23.884 2.496   1.00 0.00 ? 70 VAL A H    7  
ATOM   8698  H  HA   . VAL A 1 70 ? 5.172   -25.274 0.068   1.00 0.00 ? 70 VAL A HA   7  
ATOM   8699  H  HB   . VAL A 1 70 ? 5.432   -26.413 2.855   1.00 0.00 ? 70 VAL A HB   7  
ATOM   8700  H  HG11 . VAL A 1 70 ? 4.063   -27.746 1.363   1.00 0.00 ? 70 VAL A HG11 7  
ATOM   8701  H  HG12 . VAL A 1 70 ? 5.596   -28.558 1.676   1.00 0.00 ? 70 VAL A HG12 7  
ATOM   8702  H  HG13 . VAL A 1 70 ? 5.335   -27.727 0.142   1.00 0.00 ? 70 VAL A HG13 7  
ATOM   8703  H  HG21 . VAL A 1 70 ? 7.621   -27.304 2.085   1.00 0.00 ? 70 VAL A HG21 7  
ATOM   8704  H  HG22 . VAL A 1 70 ? 7.591   -25.548 2.243   1.00 0.00 ? 70 VAL A HG22 7  
ATOM   8705  H  HG23 . VAL A 1 70 ? 7.485   -26.292 0.647   1.00 0.00 ? 70 VAL A HG23 7  
ATOM   8706  N  N    . PRO A 1 71 ? 2.696   -25.588 0.574   1.00 0.00 ? 71 PRO A N    7  
ATOM   8707  C  CA   . PRO A 1 71 ? 1.240   -25.569 0.786   1.00 0.00 ? 71 PRO A CA   7  
ATOM   8708  C  C    . PRO A 1 71 ? 0.825   -26.285 2.076   1.00 0.00 ? 71 PRO A C    7  
ATOM   8709  O  O    . PRO A 1 71 ? 0.514   -27.479 2.063   1.00 0.00 ? 71 PRO A O    7  
ATOM   8710  C  CB   . PRO A 1 71 ? 0.688   -26.304 -0.444  1.00 0.00 ? 71 PRO A CB   7  
ATOM   8711  C  CG   . PRO A 1 71 ? 1.748   -26.164 -1.482  1.00 0.00 ? 71 PRO A CG   7  
ATOM   8712  C  CD   . PRO A 1 71 ? 3.051   -26.173 -0.736  1.00 0.00 ? 71 PRO A CD   7  
ATOM   8713  H  HA   . PRO A 1 71 ? 0.861   -24.558 0.802   1.00 0.00 ? 71 PRO A HA   7  
ATOM   8714  H  HB2  . PRO A 1 71 ? 0.514   -27.342 -0.200  1.00 0.00 ? 71 PRO A HB2  7  
ATOM   8715  H  HB3  . PRO A 1 71 ? -0.234  -25.844 -0.759  1.00 0.00 ? 71 PRO A HB3  7  
ATOM   8716  H  HG2  . PRO A 1 71 ? 1.701   -26.996 -2.169  1.00 0.00 ? 71 PRO A HG2  7  
ATOM   8717  H  HG3  . PRO A 1 71 ? 1.625   -25.231 -2.011  1.00 0.00 ? 71 PRO A HG3  7  
ATOM   8718  H  HD2  . PRO A 1 71 ? 3.413   -27.186 -0.624  1.00 0.00 ? 71 PRO A HD2  7  
ATOM   8719  H  HD3  . PRO A 1 71 ? 3.782   -25.563 -1.245  1.00 0.00 ? 71 PRO A HD3  7  
ATOM   8720  N  N    . ALA A 1 72 ? 0.828   -25.545 3.189   1.00 0.00 ? 72 ALA A N    7  
ATOM   8721  C  CA   . ALA A 1 72 ? 0.460   -26.095 4.494   1.00 0.00 ? 72 ALA A CA   7  
ATOM   8722  C  C    . ALA A 1 72 ? 0.425   -24.999 5.567   1.00 0.00 ? 72 ALA A C    7  
ATOM   8723  O  O    . ALA A 1 72 ? 1.184   -24.028 5.496   1.00 0.00 ? 72 ALA A O    7  
ATOM   8724  C  CB   . ALA A 1 72 ? 1.425   -27.207 4.894   1.00 0.00 ? 72 ALA A CB   7  
ATOM   8725  H  H    . ALA A 1 72 ? 1.093   -24.603 3.131   1.00 0.00 ? 72 ALA A H    7  
ATOM   8726  H  HA   . ALA A 1 72 ? -0.527  -26.523 4.403   1.00 0.00 ? 72 ALA A HA   7  
ATOM   8727  H  HB1  . ALA A 1 72 ? 1.263   -27.473 5.927   1.00 0.00 ? 72 ALA A HB1  7  
ATOM   8728  H  HB2  . ALA A 1 72 ? 2.442   -26.865 4.765   1.00 0.00 ? 72 ALA A HB2  7  
ATOM   8729  H  HB3  . ALA A 1 72 ? 1.255   -28.071 4.268   1.00 0.00 ? 72 ALA A HB3  7  
ATOM   8730  N  N    . PRO A 1 73 ? -0.464  -25.140 6.574   1.00 0.00 ? 73 PRO A N    7  
ATOM   8731  C  CA   . PRO A 1 73 ? -0.603  -24.157 7.660   1.00 0.00 ? 73 PRO A CA   7  
ATOM   8732  C  C    . PRO A 1 73 ? 0.549   -24.212 8.660   1.00 0.00 ? 73 PRO A C    7  
ATOM   8733  O  O    . PRO A 1 73 ? 0.960   -25.292 9.090   1.00 0.00 ? 73 PRO A O    7  
ATOM   8734  C  CB   . PRO A 1 73 ? -1.909  -24.566 8.341   1.00 0.00 ? 73 PRO A CB   7  
ATOM   8735  C  CG   . PRO A 1 73 ? -2.021  -26.028 8.086   1.00 0.00 ? 73 PRO A CG   7  
ATOM   8736  C  CD   . PRO A 1 73 ? -1.410  -26.264 6.730   1.00 0.00 ? 73 PRO A CD   7  
ATOM   8737  H  HA   . PRO A 1 73 ? -0.696  -23.153 7.275   1.00 0.00 ? 73 PRO A HA   7  
ATOM   8738  H  HB2  . PRO A 1 73 ? -1.850  -24.351 9.398   1.00 0.00 ? 73 PRO A HB2  7  
ATOM   8739  H  HB3  . PRO A 1 73 ? -2.734  -24.025 7.902   1.00 0.00 ? 73 PRO A HB3  7  
ATOM   8740  H  HG2  . PRO A 1 73 ? -1.478  -26.575 8.843   1.00 0.00 ? 73 PRO A HG2  7  
ATOM   8741  H  HG3  . PRO A 1 73 ? -3.061  -26.322 8.084   1.00 0.00 ? 73 PRO A HG3  7  
ATOM   8742  H  HD2  . PRO A 1 73 ? -0.889  -27.208 6.711   1.00 0.00 ? 73 PRO A HD2  7  
ATOM   8743  H  HD3  . PRO A 1 73 ? -2.170  -26.235 5.963   1.00 0.00 ? 73 PRO A HD3  7  
ATOM   8744  N  N    . SER A 1 74 ? 1.057   -23.039 9.032   1.00 0.00 ? 74 SER A N    7  
ATOM   8745  C  CA   . SER A 1 74 ? 2.158   -22.945 9.989   1.00 0.00 ? 74 SER A CA   7  
ATOM   8746  C  C    . SER A 1 74 ? 2.290   -21.525 10.540  1.00 0.00 ? 74 SER A C    7  
ATOM   8747  O  O    . SER A 1 74 ? 2.275   -21.319 11.754  1.00 0.00 ? 74 SER A O    7  
ATOM   8748  C  CB   . SER A 1 74 ? 3.475   -23.369 9.329   1.00 0.00 ? 74 SER A CB   7  
ATOM   8749  O  OG   . SER A 1 74 ? 3.731   -24.752 9.522   1.00 0.00 ? 74 SER A OG   7  
ATOM   8750  H  H    . SER A 1 74 ? 0.680   -22.214 8.659   1.00 0.00 ? 74 SER A H    7  
ATOM   8751  H  HA   . SER A 1 74 ? 1.942   -23.616 10.807  1.00 0.00 ? 74 SER A HA   7  
ATOM   8752  H  HB2  . SER A 1 74 ? 3.422   -23.171 8.269   1.00 0.00 ? 74 SER A HB2  7  
ATOM   8753  H  HB3  . SER A 1 74 ? 4.289   -22.802 9.759   1.00 0.00 ? 74 SER A HB3  7  
ATOM   8754  H  HG   . SER A 1 74 ? 3.403   -25.024 10.381  1.00 0.00 ? 74 SER A HG   7  
ATOM   8755  N  N    . ALA A 1 75 ? 2.423   -20.554 9.635   1.00 0.00 ? 75 ALA A N    7  
ATOM   8756  C  CA   . ALA A 1 75 ? 2.564   -19.150 10.020  1.00 0.00 ? 75 ALA A CA   7  
ATOM   8757  C  C    . ALA A 1 75 ? 1.362   -18.660 10.828  1.00 0.00 ? 75 ALA A C    7  
ATOM   8758  O  O    . ALA A 1 75 ? 1.525   -17.947 11.820  1.00 0.00 ? 75 ALA A O    7  
ATOM   8759  C  CB   . ALA A 1 75 ? 2.765   -18.278 8.786   1.00 0.00 ? 75 ALA A CB   7  
ATOM   8760  H  H    . ALA A 1 75 ? 2.429   -20.790 8.684   1.00 0.00 ? 75 ALA A H    7  
ATOM   8761  H  HA   . ALA A 1 75 ? 3.451   -19.066 10.632  1.00 0.00 ? 75 ALA A HA   7  
ATOM   8762  H  HB1  . ALA A 1 75 ? 3.789   -18.356 8.453   1.00 0.00 ? 75 ALA A HB1  7  
ATOM   8763  H  HB2  . ALA A 1 75 ? 2.544   -17.250 9.032   1.00 0.00 ? 75 ALA A HB2  7  
ATOM   8764  H  HB3  . ALA A 1 75 ? 2.105   -18.608 7.997   1.00 0.00 ? 75 ALA A HB3  7  
ATOM   8765  N  N    . ASN A 1 76 ? 0.156   -19.038 10.398  1.00 0.00 ? 76 ASN A N    7  
ATOM   8766  C  CA   . ASN A 1 76 ? -1.070  -18.629 11.084  1.00 0.00 ? 76 ASN A CA   7  
ATOM   8767  C  C    . ASN A 1 76 ? -2.228  -19.572 10.751  1.00 0.00 ? 76 ASN A C    7  
ATOM   8768  O  O    . ASN A 1 76 ? -2.164  -20.328 9.778   1.00 0.00 ? 76 ASN A O    7  
ATOM   8769  C  CB   . ASN A 1 76 ? -1.438  -17.191 10.704  1.00 0.00 ? 76 ASN A CB   7  
ATOM   8770  C  CG   . ASN A 1 76 ? -1.658  -17.022 9.212   1.00 0.00 ? 76 ASN A CG   7  
ATOM   8771  O  OD1  . ASN A 1 76 ? -2.786  -17.104 8.727   1.00 0.00 ? 76 ASN A OD1  7  
ATOM   8772  N  ND2  . ASN A 1 76 ? -0.576  -16.796 8.474   1.00 0.00 ? 76 ASN A ND2  7  
ATOM   8773  H  H    . ASN A 1 76 ? 0.089   -19.602 9.598   1.00 0.00 ? 76 ASN A H    7  
ATOM   8774  H  HA   . ASN A 1 76 ? -0.881  -18.674 12.146  1.00 0.00 ? 76 ASN A HA   7  
ATOM   8775  H  HB2  . ASN A 1 76 ? -2.347  -16.911 11.217  1.00 0.00 ? 76 ASN A HB2  7  
ATOM   8776  H  HB3  . ASN A 1 76 ? -0.641  -16.528 11.009  1.00 0.00 ? 76 ASN A HB3  7  
ATOM   8777  H  HD21 . ASN A 1 76 ? 0.293   -16.749 8.926   1.00 0.00 ? 76 ASN A HD21 7  
ATOM   8778  H  HD22 . ASN A 1 76 ? -0.692  -16.681 7.507   1.00 0.00 ? 76 ASN A HD22 7  
ATOM   8779  N  N    . LYS A 1 77 ? -3.285  -19.520 11.567  1.00 0.00 ? 77 LYS A N    7  
ATOM   8780  C  CA   . LYS A 1 77 ? -4.461  -20.368 11.366  1.00 0.00 ? 77 LYS A CA   7  
ATOM   8781  C  C    . LYS A 1 77 ? -5.741  -19.649 11.799  1.00 0.00 ? 77 LYS A C    7  
ATOM   8782  O  O    . LYS A 1 77 ? -6.251  -19.878 12.899  1.00 0.00 ? 77 LYS A O    7  
ATOM   8783  C  CB   . LYS A 1 77 ? -4.310  -21.676 12.153  1.00 0.00 ? 77 LYS A CB   7  
ATOM   8784  C  CG   . LYS A 1 77 ? -3.667  -22.802 11.358  1.00 0.00 ? 77 LYS A CG   7  
ATOM   8785  C  CD   . LYS A 1 77 ? -4.651  -23.439 10.386  1.00 0.00 ? 77 LYS A CD   7  
ATOM   8786  C  CE   . LYS A 1 77 ? -5.806  -24.112 11.113  1.00 0.00 ? 77 LYS A CE   7  
ATOM   8787  N  NZ   . LYS A 1 77 ? -6.542  -25.064 10.232  1.00 0.00 ? 77 LYS A NZ   7  
ATOM   8788  H  H    . LYS A 1 77 ? -3.272  -18.897 12.323  1.00 0.00 ? 77 LYS A H    7  
ATOM   8789  H  HA   . LYS A 1 77 ? -4.531  -20.598 10.313  1.00 0.00 ? 77 LYS A HA   7  
ATOM   8790  H  HB2  . LYS A 1 77 ? -3.700  -21.488 13.025  1.00 0.00 ? 77 LYS A HB2  7  
ATOM   8791  H  HB3  . LYS A 1 77 ? -5.288  -22.003 12.474  1.00 0.00 ? 77 LYS A HB3  7  
ATOM   8792  H  HG2  . LYS A 1 77 ? -2.833  -22.405 10.799  1.00 0.00 ? 77 LYS A HG2  7  
ATOM   8793  H  HG3  . LYS A 1 77 ? -3.315  -23.557 12.045  1.00 0.00 ? 77 LYS A HG3  7  
ATOM   8794  H  HD2  . LYS A 1 77 ? -5.047  -22.673 9.735   1.00 0.00 ? 77 LYS A HD2  7  
ATOM   8795  H  HD3  . LYS A 1 77 ? -4.128  -24.178 9.796   1.00 0.00 ? 77 LYS A HD3  7  
ATOM   8796  H  HE2  . LYS A 1 77 ? -5.415  -24.654 11.962  1.00 0.00 ? 77 LYS A HE2  7  
ATOM   8797  H  HE3  . LYS A 1 77 ? -6.491  -23.351 11.458  1.00 0.00 ? 77 LYS A HE3  7  
ATOM   8798  H  HZ1  . LYS A 1 77 ? -7.407  -25.393 10.707  1.00 0.00 ? 77 LYS A HZ1  7  
ATOM   8799  H  HZ2  . LYS A 1 77 ? -5.945  -25.886 10.014  1.00 0.00 ? 77 LYS A HZ2  7  
ATOM   8800  H  HZ3  . LYS A 1 77 ? -6.808  -24.596 9.341   1.00 0.00 ? 77 LYS A HZ3  7  
ATOM   8801  N  N    . GLU A 1 78 ? -6.258  -18.782 10.931  1.00 0.00 ? 78 GLU A N    7  
ATOM   8802  C  CA   . GLU A 1 78 ? -7.477  -18.036 11.230  1.00 0.00 ? 78 GLU A CA   7  
ATOM   8803  C  C    . GLU A 1 78 ? -8.434  -18.038 10.040  1.00 0.00 ? 78 GLU A C    7  
ATOM   8804  O  O    . GLU A 1 78 ? -8.312  -17.216 9.129   1.00 0.00 ? 78 GLU A O    7  
ATOM   8805  C  CB   . GLU A 1 78 ? -7.135  -16.597 11.628  1.00 0.00 ? 78 GLU A CB   7  
ATOM   8806  C  CG   . GLU A 1 78 ? -8.123  -15.988 12.611  1.00 0.00 ? 78 GLU A CG   7  
ATOM   8807  C  CD   . GLU A 1 78 ? -7.455  -15.071 13.617  1.00 0.00 ? 78 GLU A CD   7  
ATOM   8808  O  OE1  . GLU A 1 78 ? -6.837  -15.588 14.573  1.00 0.00 ? 78 GLU A OE1  7  
ATOM   8809  O  OE2  . GLU A 1 78 ? -7.547  -13.837 13.449  1.00 0.00 ? 78 GLU A OE2  7  
ATOM   8810  H  H    . GLU A 1 78 ? -5.810  -18.641 10.070  1.00 0.00 ? 78 GLU A H    7  
ATOM   8811  H  HA   . GLU A 1 78 ? -7.963  -18.522 12.064  1.00 0.00 ? 78 GLU A HA   7  
ATOM   8812  H  HB2  . GLU A 1 78 ? -6.154  -16.585 12.081  1.00 0.00 ? 78 GLU A HB2  7  
ATOM   8813  H  HB3  . GLU A 1 78 ? -7.118  -15.983 10.740  1.00 0.00 ? 78 GLU A HB3  7  
ATOM   8814  H  HG2  . GLU A 1 78 ? -8.854  -15.418 12.059  1.00 0.00 ? 78 GLU A HG2  7  
ATOM   8815  H  HG3  . GLU A 1 78 ? -8.618  -16.785 13.146  1.00 0.00 ? 78 GLU A HG3  7  
ATOM   8816  N  N    . LEU A 1 79 ? -9.388  -18.968 10.054  1.00 0.00 ? 79 LEU A N    7  
ATOM   8817  C  CA   . LEU A 1 79 ? -10.372 -19.075 8.976   1.00 0.00 ? 79 LEU A CA   7  
ATOM   8818  C  C    . LEU A 1 79 ? -11.704 -19.629 9.490   1.00 0.00 ? 79 LEU A C    7  
ATOM   8819  O  O    . LEU A 1 79 ? -12.426 -20.307 8.756   1.00 0.00 ? 79 LEU A O    7  
ATOM   8820  C  CB   . LEU A 1 79 ? -9.828  -19.964 7.845   1.00 0.00 ? 79 LEU A CB   7  
ATOM   8821  C  CG   . LEU A 1 79 ? -9.609  -21.436 8.210   1.00 0.00 ? 79 LEU A CG   7  
ATOM   8822  C  CD1  . LEU A 1 79 ? -9.812  -22.325 6.990   1.00 0.00 ? 79 LEU A CD1  7  
ATOM   8823  C  CD2  . LEU A 1 79 ? -8.218  -21.641 8.795   1.00 0.00 ? 79 LEU A CD2  7  
ATOM   8824  H  H    . LEU A 1 79 ? -9.435  -19.595 10.806  1.00 0.00 ? 79 LEU A H    7  
ATOM   8825  H  HA   . LEU A 1 79 ? -10.539 -18.082 8.586   1.00 0.00 ? 79 LEU A HA   7  
ATOM   8826  H  HB2  . LEU A 1 79 ? -10.526 -19.921 7.022   1.00 0.00 ? 79 LEU A HB2  7  
ATOM   8827  H  HB3  . LEU A 1 79 ? -8.885  -19.552 7.515   1.00 0.00 ? 79 LEU A HB3  7  
ATOM   8828  H  HG   . LEU A 1 79 ? -10.332 -21.728 8.957   1.00 0.00 ? 79 LEU A HG   7  
ATOM   8829  H  HD11 . LEU A 1 79 ? -8.903  -22.349 6.405   1.00 0.00 ? 79 LEU A HD11 7  
ATOM   8830  H  HD12 . LEU A 1 79 ? -10.616 -21.930 6.387   1.00 0.00 ? 79 LEU A HD12 7  
ATOM   8831  H  HD13 . LEU A 1 79 ? -10.061 -23.326 7.310   1.00 0.00 ? 79 LEU A HD13 7  
ATOM   8832  H  HD21 . LEU A 1 79 ? -8.212  -21.329 9.828   1.00 0.00 ? 79 LEU A HD21 7  
ATOM   8833  H  HD22 . LEU A 1 79 ? -7.502  -21.055 8.237   1.00 0.00 ? 79 LEU A HD22 7  
ATOM   8834  H  HD23 . LEU A 1 79 ? -7.951  -22.686 8.734   1.00 0.00 ? 79 LEU A HD23 7  
ATOM   8835  N  N    . VAL A 1 80 ? -12.028 -19.336 10.752  1.00 0.00 ? 80 VAL A N    7  
ATOM   8836  C  CA   . VAL A 1 80 ? -13.269 -19.812 11.354  1.00 0.00 ? 80 VAL A CA   7  
ATOM   8837  C  C    . VAL A 1 80 ? -14.241 -18.661 11.616  1.00 0.00 ? 80 VAL A C    7  
ATOM   8838  O  O    . VAL A 1 80 ? -13.983 -17.800 12.460  1.00 0.00 ? 80 VAL A O    7  
ATOM   8839  C  CB   . VAL A 1 80 ? -13.003 -20.562 12.677  1.00 0.00 ? 80 VAL A CB   7  
ATOM   8840  C  CG1  . VAL A 1 80 ? -14.276 -21.226 13.180  1.00 0.00 ? 80 VAL A CG1  7  
ATOM   8841  C  CG2  . VAL A 1 80 ? -11.890 -21.588 12.498  1.00 0.00 ? 80 VAL A CG2  7  
ATOM   8842  H  H    . VAL A 1 80 ? -11.418 -18.793 11.292  1.00 0.00 ? 80 VAL A H    7  
ATOM   8843  H  HA   . VAL A 1 80 ? -13.728 -20.505 10.661  1.00 0.00 ? 80 VAL A HA   7  
ATOM   8844  H  HB   . VAL A 1 80 ? -12.683 -19.842 13.417  1.00 0.00 ? 80 VAL A HB   7  
ATOM   8845  H  HG11 . VAL A 1 80 ? -14.817 -20.536 13.810  1.00 0.00 ? 80 VAL A HG11 7  
ATOM   8846  H  HG12 . VAL A 1 80 ? -14.022 -22.108 13.749  1.00 0.00 ? 80 VAL A HG12 7  
ATOM   8847  H  HG13 . VAL A 1 80 ? -14.894 -21.506 12.339  1.00 0.00 ? 80 VAL A HG13 7  
ATOM   8848  H  HG21 . VAL A 1 80 ? -11.896 -21.955 11.481  1.00 0.00 ? 80 VAL A HG21 7  
ATOM   8849  H  HG22 . VAL A 1 80 ? -12.047 -22.413 13.178  1.00 0.00 ? 80 VAL A HG22 7  
ATOM   8850  H  HG23 . VAL A 1 80 ? -10.937 -21.127 12.706  1.00 0.00 ? 80 VAL A HG23 7  
ATOM   8851  N  N    . LYS A 1 81 ? -15.361 -18.661 10.890  1.00 0.00 ? 81 LYS A N    7  
ATOM   8852  C  CA   . LYS A 1 81 ? -16.388 -17.627 11.039  1.00 0.00 ? 81 LYS A CA   7  
ATOM   8853  C  C    . LYS A 1 81 ? -17.653 -17.994 10.255  1.00 0.00 ? 81 LYS A C    7  
ATOM   8854  O  O    . LYS A 1 81 ? -17.704 -17.842 9.032   1.00 0.00 ? 81 LYS A O    7  
ATOM   8855  C  CB   . LYS A 1 81 ? -15.853 -16.261 10.580  1.00 0.00 ? 81 LYS A CB   7  
ATOM   8856  C  CG   . LYS A 1 81 ? -15.340 -16.247 9.148   1.00 0.00 ? 81 LYS A CG   7  
ATOM   8857  C  CD   . LYS A 1 81 ? -14.107 -15.370 9.004   1.00 0.00 ? 81 LYS A CD   7  
ATOM   8858  C  CE   . LYS A 1 81 ? -13.272 -15.776 7.800   1.00 0.00 ? 81 LYS A CE   7  
ATOM   8859  N  NZ   . LYS A 1 81 ? -11.873 -15.272 7.890   1.00 0.00 ? 81 LYS A NZ   7  
ATOM   8860  H  H    . LYS A 1 81 ? -15.505 -19.379 10.237  1.00 0.00 ? 81 LYS A H    7  
ATOM   8861  H  HA   . LYS A 1 81 ? -16.639 -17.567 12.088  1.00 0.00 ? 81 LYS A HA   7  
ATOM   8862  H  HB2  . LYS A 1 81 ? -16.648 -15.533 10.659  1.00 0.00 ? 81 LYS A HB2  7  
ATOM   8863  H  HB3  . LYS A 1 81 ? -15.044 -15.967 11.233  1.00 0.00 ? 81 LYS A HB3  7  
ATOM   8864  H  HG2  . LYS A 1 81 ? -15.087 -17.256 8.859   1.00 0.00 ? 81 LYS A HG2  7  
ATOM   8865  H  HG3  . LYS A 1 81 ? -16.118 -15.869 8.502   1.00 0.00 ? 81 LYS A HG3  7  
ATOM   8866  H  HD2  . LYS A 1 81 ? -14.419 -14.344 8.884   1.00 0.00 ? 81 LYS A HD2  7  
ATOM   8867  H  HD3  . LYS A 1 81 ? -13.505 -15.462 9.897   1.00 0.00 ? 81 LYS A HD3  7  
ATOM   8868  H  HE2  . LYS A 1 81 ? -13.252 -16.854 7.740   1.00 0.00 ? 81 LYS A HE2  7  
ATOM   8869  H  HE3  . LYS A 1 81 ? -13.733 -15.376 6.908   1.00 0.00 ? 81 LYS A HE3  7  
ATOM   8870  H  HZ1  . LYS A 1 81 ? -11.846 -14.384 8.434   1.00 0.00 ? 81 LYS A HZ1  7  
ATOM   8871  H  HZ2  . LYS A 1 81 ? -11.495 -15.094 6.938   1.00 0.00 ? 81 LYS A HZ2  7  
ATOM   8872  H  HZ3  . LYS A 1 81 ? -11.270 -15.973 8.365   1.00 0.00 ? 81 LYS A HZ3  7  
ATOM   8873  N  N    . LEU A 1 82 ? -18.669 -18.484 10.968  1.00 0.00 ? 82 LEU A N    7  
ATOM   8874  C  CA   . LEU A 1 82 ? -19.934 -18.878 10.341  1.00 0.00 ? 82 LEU A CA   7  
ATOM   8875  C  C    . LEU A 1 82 ? -20.787 -17.654 10.006  1.00 0.00 ? 82 LEU A C    7  
ATOM   8876  O  O    . LEU A 1 82 ? -20.680 -16.614 10.661  1.00 0.00 ? 82 LEU A O    7  
ATOM   8877  C  CB   . LEU A 1 82 ? -20.718 -19.823 11.261  1.00 0.00 ? 82 LEU A CB   7  
ATOM   8878  C  CG   . LEU A 1 82 ? -20.403 -21.316 11.102  1.00 0.00 ? 82 LEU A CG   7  
ATOM   8879  C  CD1  . LEU A 1 82 ? -20.831 -21.815 9.729   1.00 0.00 ? 82 LEU A CD1  7  
ATOM   8880  C  CD2  . LEU A 1 82 ? -18.921 -21.583 11.335  1.00 0.00 ? 82 LEU A CD2  7  
ATOM   8881  H  H    . LEU A 1 82 ? -18.566 -18.585 11.938  1.00 0.00 ? 82 LEU A H    7  
ATOM   8882  H  HA   . LEU A 1 82 ? -19.698 -19.398 9.424   1.00 0.00 ? 82 LEU A HA   7  
ATOM   8883  H  HB2  . LEU A 1 82 ? -20.517 -19.542 12.284  1.00 0.00 ? 82 LEU A HB2  7  
ATOM   8884  H  HB3  . LEU A 1 82 ? -21.772 -19.681 11.070  1.00 0.00 ? 82 LEU A HB3  7  
ATOM   8885  H  HG   . LEU A 1 82 ? -20.961 -21.872 11.843  1.00 0.00 ? 82 LEU A HG   7  
ATOM   8886  H  HD11 . LEU A 1 82 ? -21.622 -21.186 9.348   1.00 0.00 ? 82 LEU A HD11 7  
ATOM   8887  H  HD12 . LEU A 1 82 ? -21.188 -22.832 9.811   1.00 0.00 ? 82 LEU A HD12 7  
ATOM   8888  H  HD13 . LEU A 1 82 ? -19.988 -21.783 9.054   1.00 0.00 ? 82 LEU A HD13 7  
ATOM   8889  H  HD21 . LEU A 1 82 ? -18.379 -21.434 10.413  1.00 0.00 ? 82 LEU A HD21 7  
ATOM   8890  H  HD22 . LEU A 1 82 ? -18.787 -22.601 11.669  1.00 0.00 ? 82 LEU A HD22 7  
ATOM   8891  H  HD23 . LEU A 1 82 ? -18.546 -20.905 12.086  1.00 0.00 ? 82 LEU A HD23 7  
ATOM   8892  N  N    . GLU A 1 83 ? -21.631 -17.784 8.980   1.00 0.00 ? 83 GLU A N    7  
ATOM   8893  C  CA   . GLU A 1 83 ? -22.497 -16.686 8.555   1.00 0.00 ? 83 GLU A CA   7  
ATOM   8894  C  C    . GLU A 1 83 ? -23.769 -17.206 7.880   1.00 0.00 ? 83 GLU A C    7  
ATOM   8895  O  O    . GLU A 1 83 ? -23.861 -18.384 7.529   1.00 0.00 ? 83 GLU A O    7  
ATOM   8896  C  CB   . GLU A 1 83 ? -21.740 -15.766 7.594   1.00 0.00 ? 83 GLU A CB   7  
ATOM   8897  C  CG   . GLU A 1 83 ? -22.119 -14.297 7.721   1.00 0.00 ? 83 GLU A CG   7  
ATOM   8898  C  CD   . GLU A 1 83 ? -21.136 -13.370 7.028   1.00 0.00 ? 83 GLU A CD   7  
ATOM   8899  O  OE1  . GLU A 1 83 ? -19.911 -13.581 7.172   1.00 0.00 ? 83 GLU A OE1  7  
ATOM   8900  O  OE2  . GLU A 1 83 ? -21.590 -12.432 6.340   1.00 0.00 ? 83 GLU A OE2  7  
ATOM   8901  H  H    . GLU A 1 83 ? -21.669 -18.636 8.497   1.00 0.00 ? 83 GLU A H    7  
ATOM   8902  H  HA   . GLU A 1 83 ? -22.775 -16.123 9.434   1.00 0.00 ? 83 GLU A HA   7  
ATOM   8903  H  HB2  . GLU A 1 83 ? -20.682 -15.857 7.788   1.00 0.00 ? 83 GLU A HB2  7  
ATOM   8904  H  HB3  . GLU A 1 83 ? -21.938 -16.080 6.579   1.00 0.00 ? 83 GLU A HB3  7  
ATOM   8905  H  HG2  . GLU A 1 83 ? -23.093 -14.152 7.280   1.00 0.00 ? 83 GLU A HG2  7  
ATOM   8906  H  HG3  . GLU A 1 83 ? -22.158 -14.037 8.769   1.00 0.00 ? 83 GLU A HG3  7  
ATOM   8907  N  N    . HIS A 1 84 ? -24.741 -16.311 7.696   1.00 0.00 ? 84 HIS A N    7  
ATOM   8908  C  CA   . HIS A 1 84 ? -26.009 -16.661 7.058   1.00 0.00 ? 84 HIS A CA   7  
ATOM   8909  C  C    . HIS A 1 84 ? -26.356 -15.660 5.960   1.00 0.00 ? 84 HIS A C    7  
ATOM   8910  O  O    . HIS A 1 84 ? -25.648 -15.551 4.959   1.00 0.00 ? 84 HIS A O    7  
ATOM   8911  C  CB   . HIS A 1 84 ? -27.136 -16.708 8.091   1.00 0.00 ? 84 HIS A CB   7  
ATOM   8912  C  CG   . HIS A 1 84 ? -27.302 -18.050 8.734   1.00 0.00 ? 84 HIS A CG   7  
ATOM   8913  N  ND1  . HIS A 1 84 ? -26.460 -18.521 9.718   1.00 0.00 ? 84 HIS A ND1  7  
ATOM   8914  C  CD2  . HIS A 1 84 ? -28.222 -19.023 8.530   1.00 0.00 ? 84 HIS A CD2  7  
ATOM   8915  C  CE1  . HIS A 1 84 ? -26.853 -19.726 10.089  1.00 0.00 ? 84 HIS A CE1  7  
ATOM   8916  N  NE2  . HIS A 1 84 ? -27.921 -20.052 9.385   1.00 0.00 ? 84 HIS A NE2  7  
ATOM   8917  H  H    . HIS A 1 84 ? -24.600 -15.387 7.995   1.00 0.00 ? 84 HIS A H    7  
ATOM   8918  H  HA   . HIS A 1 84 ? -25.898 -17.638 6.613   1.00 0.00 ? 84 HIS A HA   7  
ATOM   8919  H  HB2  . HIS A 1 84 ? -26.933 -15.990 8.872   1.00 0.00 ? 84 HIS A HB2  7  
ATOM   8920  H  HB3  . HIS A 1 84 ? -28.069 -16.453 7.608   1.00 0.00 ? 84 HIS A HB3  7  
ATOM   8921  H  HD1  . HIS A 1 84 ? -25.686 -18.045 10.085  1.00 0.00 ? 84 HIS A HD1  7  
ATOM   8922  H  HD2  . HIS A 1 84 ? -29.041 -18.993 7.823   1.00 0.00 ? 84 HIS A HD2  7  
ATOM   8923  H  HE1  . HIS A 1 84 ? -26.383 -20.339 10.844  1.00 0.00 ? 84 HIS A HE1  7  
ATOM   8924  H  HE2  . HIS A 1 84 ? -28.455 -20.864 9.511   1.00 0.00 ? 84 HIS A HE2  7  
HETATM 8925  ZN ZN   . ZN  B 2 .  ? 2.734   13.174  3.801   1.00 0.00 ? 85 ZN  A ZN   7  
ATOM   8926  N  N    . MET A 1 1  ? 13.971  0.040   10.098  1.00 0.00 ? 1  MET A N    8  
ATOM   8927  C  CA   . MET A 1 1  ? 15.350  0.193   9.552   1.00 0.00 ? 1  MET A CA   8  
ATOM   8928  C  C    . MET A 1 1  ? 16.080  1.364   10.211  1.00 0.00 ? 1  MET A C    8  
ATOM   8929  O  O    . MET A 1 1  ? 17.152  1.185   10.790  1.00 0.00 ? 1  MET A O    8  
ATOM   8930  C  CB   . MET A 1 1  ? 15.265  0.397   8.036   1.00 0.00 ? 1  MET A CB   8  
ATOM   8931  C  CG   . MET A 1 1  ? 15.150  -0.901  7.253   1.00 0.00 ? 1  MET A CG   8  
ATOM   8932  S  SD   . MET A 1 1  ? 13.452  -1.500  7.147   1.00 0.00 ? 1  MET A SD   8  
ATOM   8933  C  CE   . MET A 1 1  ? 13.583  -2.673  5.801   1.00 0.00 ? 1  MET A CE   8  
ATOM   8934  H  H1   . MET A 1 1  ? 13.392  0.818   9.724   1.00 0.00 ? 1  MET A H1   8  
ATOM   8935  H  H2   . MET A 1 1  ? 14.035  0.085   11.135  1.00 0.00 ? 1  MET A H2   8  
ATOM   8936  H  H3   . MET A 1 1  ? 13.606  -0.881  9.785   1.00 0.00 ? 1  MET A H3   8  
ATOM   8937  H  HA   . MET A 1 1  ? 15.897  -0.716  9.757   1.00 0.00 ? 1  MET A HA   8  
ATOM   8938  H  HB2  . MET A 1 1  ? 14.402  1.005   7.812   1.00 0.00 ? 1  MET A HB2  8  
ATOM   8939  H  HB3  . MET A 1 1  ? 16.155  0.913   7.704   1.00 0.00 ? 1  MET A HB3  8  
ATOM   8940  H  HG2  . MET A 1 1  ? 15.521  -0.736  6.251   1.00 0.00 ? 1  MET A HG2  8  
ATOM   8941  H  HG3  . MET A 1 1  ? 15.753  -1.655  7.739   1.00 0.00 ? 1  MET A HG3  8  
ATOM   8942  H  HE1  . MET A 1 1  ? 12.638  -2.731  5.280   1.00 0.00 ? 1  MET A HE1  8  
ATOM   8943  H  HE2  . MET A 1 1  ? 13.837  -3.646  6.195   1.00 0.00 ? 1  MET A HE2  8  
ATOM   8944  H  HE3  . MET A 1 1  ? 14.352  -2.350  5.115   1.00 0.00 ? 1  MET A HE3  8  
ATOM   8945  N  N    . ALA A 1 2  ? 15.493  2.561   10.124  1.00 0.00 ? 2  ALA A N    8  
ATOM   8946  C  CA   . ALA A 1 2  ? 16.092  3.754   10.719  1.00 0.00 ? 2  ALA A CA   8  
ATOM   8947  C  C    . ALA A 1 2  ? 15.100  4.474   11.639  1.00 0.00 ? 2  ALA A C    8  
ATOM   8948  O  O    . ALA A 1 2  ? 15.245  4.436   12.861  1.00 0.00 ? 2  ALA A O    8  
ATOM   8949  C  CB   . ALA A 1 2  ? 16.606  4.691   9.633   1.00 0.00 ? 2  ALA A CB   8  
ATOM   8950  H  H    . ALA A 1 2  ? 14.637  2.642   9.653   1.00 0.00 ? 2  ALA A H    8  
ATOM   8951  H  HA   . ALA A 1 2  ? 16.938  3.433   11.311  1.00 0.00 ? 2  ALA A HA   8  
ATOM   8952  H  HB1  . ALA A 1 2  ? 16.752  4.136   8.718   1.00 0.00 ? 2  ALA A HB1  8  
ATOM   8953  H  HB2  . ALA A 1 2  ? 17.547  5.119   9.945   1.00 0.00 ? 2  ALA A HB2  8  
ATOM   8954  H  HB3  . ALA A 1 2  ? 15.890  5.481   9.467   1.00 0.00 ? 2  ALA A HB3  8  
ATOM   8955  N  N    . VAL A 1 3  ? 14.093  5.126   11.047  1.00 0.00 ? 3  VAL A N    8  
ATOM   8956  C  CA   . VAL A 1 3  ? 13.081  5.849   11.821  1.00 0.00 ? 3  VAL A CA   8  
ATOM   8957  C  C    . VAL A 1 3  ? 11.742  5.896   11.078  1.00 0.00 ? 3  VAL A C    8  
ATOM   8958  O  O    . VAL A 1 3  ? 11.373  6.922   10.503  1.00 0.00 ? 3  VAL A O    8  
ATOM   8959  C  CB   . VAL A 1 3  ? 13.530  7.293   12.150  1.00 0.00 ? 3  VAL A CB   8  
ATOM   8960  C  CG1  . VAL A 1 3  ? 14.595  7.293   13.236  1.00 0.00 ? 3  VAL A CG1  8  
ATOM   8961  C  CG2  . VAL A 1 3  ? 14.035  8.003   10.900  1.00 0.00 ? 3  VAL A CG2  8  
ATOM   8962  H  H    . VAL A 1 3  ? 14.028  5.118   10.069  1.00 0.00 ? 3  VAL A H    8  
ATOM   8963  H  HA   . VAL A 1 3  ? 12.940  5.321   12.754  1.00 0.00 ? 3  VAL A HA   8  
ATOM   8964  H  HB   . VAL A 1 3  ? 12.673  7.836   12.521  1.00 0.00 ? 3  VAL A HB   8  
ATOM   8965  H  HG11 . VAL A 1 3  ? 14.360  6.537   13.971  1.00 0.00 ? 3  VAL A HG11 8  
ATOM   8966  H  HG12 . VAL A 1 3  ? 14.624  8.261   13.712  1.00 0.00 ? 3  VAL A HG12 8  
ATOM   8967  H  HG13 . VAL A 1 3  ? 15.558  7.079   12.796  1.00 0.00 ? 3  VAL A HG13 8  
ATOM   8968  H  HG21 . VAL A 1 3  ? 15.113  7.946   10.864  1.00 0.00 ? 3  VAL A HG21 8  
ATOM   8969  H  HG22 . VAL A 1 3  ? 13.732  9.039   10.929  1.00 0.00 ? 3  VAL A HG22 8  
ATOM   8970  H  HG23 . VAL A 1 3  ? 13.619  7.531   10.024  1.00 0.00 ? 3  VAL A HG23 8  
ATOM   8971  N  N    . PHE A 1 4  ? 11.020  4.776   11.091  1.00 0.00 ? 4  PHE A N    8  
ATOM   8972  C  CA   . PHE A 1 4  ? 9.722   4.685   10.415  1.00 0.00 ? 4  PHE A CA   8  
ATOM   8973  C  C    . PHE A 1 4  ? 8.654   5.499   11.147  1.00 0.00 ? 4  PHE A C    8  
ATOM   8974  O  O    . PHE A 1 4  ? 8.820   5.853   12.315  1.00 0.00 ? 4  PHE A O    8  
ATOM   8975  C  CB   . PHE A 1 4  ? 9.266   3.227   10.317  1.00 0.00 ? 4  PHE A CB   8  
ATOM   8976  C  CG   . PHE A 1 4  ? 9.709   2.529   9.063   1.00 0.00 ? 4  PHE A CG   8  
ATOM   8977  C  CD1  . PHE A 1 4  ? 10.961  1.941   8.985   1.00 0.00 ? 4  PHE A CD1  8  
ATOM   8978  C  CD2  . PHE A 1 4  ? 8.869   2.455   7.964   1.00 0.00 ? 4  PHE A CD2  8  
ATOM   8979  C  CE1  . PHE A 1 4  ? 11.365  1.290   7.834   1.00 0.00 ? 4  PHE A CE1  8  
ATOM   8980  C  CE2  . PHE A 1 4  ? 9.268   1.808   6.811   1.00 0.00 ? 4  PHE A CE2  8  
ATOM   8981  C  CZ   . PHE A 1 4  ? 10.518  1.224   6.746   1.00 0.00 ? 4  PHE A CZ   8  
ATOM   8982  H  H    . PHE A 1 4  ? 11.367  3.992   11.564  1.00 0.00 ? 4  PHE A H    8  
ATOM   8983  H  HA   . PHE A 1 4  ? 9.841   5.083   9.419   1.00 0.00 ? 4  PHE A HA   8  
ATOM   8984  H  HB2  . PHE A 1 4  ? 9.660   2.676   11.156  1.00 0.00 ? 4  PHE A HB2  8  
ATOM   8985  H  HB3  . PHE A 1 4  ? 8.187   3.194   10.351  1.00 0.00 ? 4  PHE A HB3  8  
ATOM   8986  H  HD1  . PHE A 1 4  ? 11.625  1.993   9.835   1.00 0.00 ? 4  PHE A HD1  8  
ATOM   8987  H  HD2  . PHE A 1 4  ? 7.891   2.912   8.013   1.00 0.00 ? 4  PHE A HD2  8  
ATOM   8988  H  HE1  . PHE A 1 4  ? 12.344  0.835   7.786   1.00 0.00 ? 4  PHE A HE1  8  
ATOM   8989  H  HE2  . PHE A 1 4  ? 8.602   1.757   5.963   1.00 0.00 ? 4  PHE A HE2  8  
ATOM   8990  H  HZ   . PHE A 1 4  ? 10.832  0.716   5.844   1.00 0.00 ? 4  PHE A HZ   8  
ATOM   8991  N  N    . HIS A 1 5  ? 7.551   5.778   10.451  1.00 0.00 ? 5  HIS A N    8  
ATOM   8992  C  CA   . HIS A 1 5  ? 6.446   6.536   11.033  1.00 0.00 ? 5  HIS A CA   8  
ATOM   8993  C  C    . HIS A 1 5  ? 5.407   5.594   11.643  1.00 0.00 ? 5  HIS A C    8  
ATOM   8994  O  O    . HIS A 1 5  ? 5.194   5.597   12.856  1.00 0.00 ? 5  HIS A O    8  
ATOM   8995  C  CB   . HIS A 1 5  ? 5.796   7.429   9.970   1.00 0.00 ? 5  HIS A CB   8  
ATOM   8996  C  CG   . HIS A 1 5  ? 5.058   8.602   10.536  1.00 0.00 ? 5  HIS A CG   8  
ATOM   8997  N  ND1  . HIS A 1 5  ? 3.751   8.897   10.213  1.00 0.00 ? 5  HIS A ND1  8  
ATOM   8998  C  CD2  . HIS A 1 5  ? 5.452   9.559   11.409  1.00 0.00 ? 5  HIS A CD2  8  
ATOM   8999  C  CE1  . HIS A 1 5  ? 3.373   9.984   10.860  1.00 0.00 ? 5  HIS A CE1  8  
ATOM   9000  N  NE2  . HIS A 1 5  ? 4.386   10.405  11.595  1.00 0.00 ? 5  HIS A NE2  8  
ATOM   9001  H  H    . HIS A 1 5  ? 7.476   5.460   9.526   1.00 0.00 ? 5  HIS A H    8  
ATOM   9002  H  HA   . HIS A 1 5  ? 6.850   7.160   11.816  1.00 0.00 ? 5  HIS A HA   8  
ATOM   9003  H  HB2  . HIS A 1 5  ? 6.563   7.809   9.313   1.00 0.00 ? 5  HIS A HB2  8  
ATOM   9004  H  HB3  . HIS A 1 5  ? 5.095   6.842   9.394   1.00 0.00 ? 5  HIS A HB3  8  
ATOM   9005  H  HD1  . HIS A 1 5  ? 3.185   8.386   9.595   1.00 0.00 ? 5  HIS A HD1  8  
ATOM   9006  H  HD2  . HIS A 1 5  ? 6.425   9.643   11.873  1.00 0.00 ? 5  HIS A HD2  8  
ATOM   9007  H  HE1  . HIS A 1 5  ? 2.399   10.447  10.801  1.00 0.00 ? 5  HIS A HE1  8  
ATOM   9008  H  HE2  . HIS A 1 5  ? 4.335   11.114  12.269  1.00 0.00 ? 5  HIS A HE2  8  
ATOM   9009  N  N    . ASP A 1 6  ? 4.767   4.786   10.793  1.00 0.00 ? 6  ASP A N    8  
ATOM   9010  C  CA   . ASP A 1 6  ? 3.753   3.833   11.244  1.00 0.00 ? 6  ASP A CA   8  
ATOM   9011  C  C    . ASP A 1 6  ? 3.529   2.737   10.200  1.00 0.00 ? 6  ASP A C    8  
ATOM   9012  O  O    . ASP A 1 6  ? 3.438   3.021   9.004   1.00 0.00 ? 6  ASP A O    8  
ATOM   9013  C  CB   . ASP A 1 6  ? 2.429   4.553   11.528  1.00 0.00 ? 6  ASP A CB   8  
ATOM   9014  C  CG   . ASP A 1 6  ? 2.316   5.026   12.966  1.00 0.00 ? 6  ASP A CG   8  
ATOM   9015  O  OD1  . ASP A 1 6  ? 2.379   4.177   13.880  1.00 0.00 ? 6  ASP A OD1  8  
ATOM   9016  O  OD2  . ASP A 1 6  ? 2.160   6.248   13.176  1.00 0.00 ? 6  ASP A OD2  8  
ATOM   9017  H  H    . ASP A 1 6  ? 4.984   4.830   9.839   1.00 0.00 ? 6  ASP A H    8  
ATOM   9018  H  HA   . ASP A 1 6  ? 4.111   3.379   12.157  1.00 0.00 ? 6  ASP A HA   8  
ATOM   9019  H  HB2  . ASP A 1 6  ? 2.348   5.413   10.880  1.00 0.00 ? 6  ASP A HB2  8  
ATOM   9020  H  HB3  . ASP A 1 6  ? 1.610   3.878   11.325  1.00 0.00 ? 6  ASP A HB3  8  
ATOM   9021  N  N    . GLU A 1 7  ? 3.437   1.487   10.659  1.00 0.00 ? 7  GLU A N    8  
ATOM   9022  C  CA   . GLU A 1 7  ? 3.213   0.352   9.759   1.00 0.00 ? 7  GLU A CA   8  
ATOM   9023  C  C    . GLU A 1 7  ? 1.721   0.061   9.623   1.00 0.00 ? 7  GLU A C    8  
ATOM   9024  O  O    . GLU A 1 7  ? 0.995   0.032   10.619  1.00 0.00 ? 7  GLU A O    8  
ATOM   9025  C  CB   . GLU A 1 7  ? 3.936   -0.901  10.265  1.00 0.00 ? 7  GLU A CB   8  
ATOM   9026  C  CG   . GLU A 1 7  ? 5.371   -0.654  10.701  1.00 0.00 ? 7  GLU A CG   8  
ATOM   9027  C  CD   . GLU A 1 7  ? 5.561   -0.796  12.198  1.00 0.00 ? 7  GLU A CD   8  
ATOM   9028  O  OE1  . GLU A 1 7  ? 5.035   0.053   12.948  1.00 0.00 ? 7  GLU A OE1  8  
ATOM   9029  O  OE2  . GLU A 1 7  ? 6.234   -1.759  12.621  1.00 0.00 ? 7  GLU A OE2  8  
ATOM   9030  H  H    . GLU A 1 7  ? 3.513   1.322   11.623  1.00 0.00 ? 7  GLU A H    8  
ATOM   9031  H  HA   . GLU A 1 7  ? 3.607   0.618   8.789   1.00 0.00 ? 7  GLU A HA   8  
ATOM   9032  H  HB2  . GLU A 1 7  ? 3.391   -1.302  11.108  1.00 0.00 ? 7  GLU A HB2  8  
ATOM   9033  H  HB3  . GLU A 1 7  ? 3.945   -1.639  9.475   1.00 0.00 ? 7  GLU A HB3  8  
ATOM   9034  H  HG2  . GLU A 1 7  ? 6.012   -1.366  10.203  1.00 0.00 ? 7  GLU A HG2  8  
ATOM   9035  H  HG3  . GLU A 1 7  ? 5.655   0.348   10.410  1.00 0.00 ? 7  GLU A HG3  8  
ATOM   9036  N  N    . VAL A 1 8  ? 1.269   -0.152  8.388   1.00 0.00 ? 8  VAL A N    8  
ATOM   9037  C  CA   . VAL A 1 8  ? -0.140  -0.438  8.125   1.00 0.00 ? 8  VAL A CA   8  
ATOM   9038  C  C    . VAL A 1 8  ? -0.295  -1.564  7.106   1.00 0.00 ? 8  VAL A C    8  
ATOM   9039  O  O    . VAL A 1 8  ? 0.465   -1.650  6.138   1.00 0.00 ? 8  VAL A O    8  
ATOM   9040  C  CB   . VAL A 1 8  ? -0.889  0.812   7.613   1.00 0.00 ? 8  VAL A CB   8  
ATOM   9041  C  CG1  . VAL A 1 8  ? -2.388  0.552   7.552   1.00 0.00 ? 8  VAL A CG1  8  
ATOM   9042  C  CG2  . VAL A 1 8  ? -0.587  2.018   8.492   1.00 0.00 ? 8  VAL A CG2  8  
ATOM   9043  H  H    . VAL A 1 8  ? 1.897   -0.115  7.634   1.00 0.00 ? 8  VAL A H    8  
ATOM   9044  H  HA   . VAL A 1 8  ? -0.594  -0.746  9.056   1.00 0.00 ? 8  VAL A HA   8  
ATOM   9045  H  HB   . VAL A 1 8  ? -0.543  1.028   6.612   1.00 0.00 ? 8  VAL A HB   8  
ATOM   9046  H  HG11 . VAL A 1 8  ? -2.850  1.272   6.895   1.00 0.00 ? 8  VAL A HG11 8  
ATOM   9047  H  HG12 . VAL A 1 8  ? -2.809  0.646   8.541   1.00 0.00 ? 8  VAL A HG12 8  
ATOM   9048  H  HG13 . VAL A 1 8  ? -2.568  -0.445  7.178   1.00 0.00 ? 8  VAL A HG13 8  
ATOM   9049  H  HG21 . VAL A 1 8  ? -0.637  1.727   9.531   1.00 0.00 ? 8  VAL A HG21 8  
ATOM   9050  H  HG22 . VAL A 1 8  ? -1.314  2.793   8.300   1.00 0.00 ? 8  VAL A HG22 8  
ATOM   9051  H  HG23 . VAL A 1 8  ? 0.402   2.387   8.270   1.00 0.00 ? 8  VAL A HG23 8  
ATOM   9052  N  N    . GLU A 1 9  ? -1.289  -2.422  7.333   1.00 0.00 ? 9  GLU A N    8  
ATOM   9053  C  CA   . GLU A 1 9  ? -1.561  -3.547  6.442   1.00 0.00 ? 9  GLU A CA   8  
ATOM   9054  C  C    . GLU A 1 9  ? -2.045  -3.061  5.077   1.00 0.00 ? 9  GLU A C    8  
ATOM   9055  O  O    . GLU A 1 9  ? -2.826  -2.111  4.983   1.00 0.00 ? 9  GLU A O    8  
ATOM   9056  C  CB   . GLU A 1 9  ? -2.606  -4.481  7.059   1.00 0.00 ? 9  GLU A CB   8  
ATOM   9057  C  CG   . GLU A 1 9  ? -2.110  -5.236  8.285   1.00 0.00 ? 9  GLU A CG   8  
ATOM   9058  C  CD   . GLU A 1 9  ? -3.163  -6.159  8.875   1.00 0.00 ? 9  GLU A CD   8  
ATOM   9059  O  OE1  . GLU A 1 9  ? -3.770  -6.938  8.109   1.00 0.00 ? 9  GLU A OE1  8  
ATOM   9060  O  OE2  . GLU A 1 9  ? -3.377  -6.105  10.104  1.00 0.00 ? 9  GLU A OE2  8  
ATOM   9061  H  H    . GLU A 1 9  ? -1.858  -2.293  8.121   1.00 0.00 ? 9  GLU A H    8  
ATOM   9062  H  HA   . GLU A 1 9  ? -0.639  -4.091  6.308   1.00 0.00 ? 9  GLU A HA   8  
ATOM   9063  H  HB2  . GLU A 1 9  ? -3.469  -3.898  7.345   1.00 0.00 ? 9  GLU A HB2  8  
ATOM   9064  H  HB3  . GLU A 1 9  ? -2.905  -5.206  6.314   1.00 0.00 ? 9  GLU A HB3  8  
ATOM   9065  H  HG2  . GLU A 1 9  ? -1.252  -5.828  8.006   1.00 0.00 ? 9  GLU A HG2  8  
ATOM   9066  H  HG3  . GLU A 1 9  ? -1.820  -4.518  9.038   1.00 0.00 ? 9  GLU A HG3  8  
ATOM   9067  N  N    . ILE A 1 10 ? -1.573  -3.724  4.024   1.00 0.00 ? 10 ILE A N    8  
ATOM   9068  C  CA   . ILE A 1 10 ? -1.943  -3.377  2.654   1.00 0.00 ? 10 ILE A CA   8  
ATOM   9069  C  C    . ILE A 1 10 ? -3.464  -3.382  2.458   1.00 0.00 ? 10 ILE A C    8  
ATOM   9070  O  O    . ILE A 1 10 ? -3.986  -2.648  1.618   1.00 0.00 ? 10 ILE A O    8  
ATOM   9071  C  CB   . ILE A 1 10 ? -1.282  -4.337  1.637   1.00 0.00 ? 10 ILE A CB   8  
ATOM   9072  C  CG1  . ILE A 1 10 ? -1.486  -3.827  0.211   1.00 0.00 ? 10 ILE A CG1  8  
ATOM   9073  C  CG2  . ILE A 1 10 ? -1.830  -5.751  1.786   1.00 0.00 ? 10 ILE A CG2  8  
ATOM   9074  C  CD1  . ILE A 1 10 ? -0.304  -3.055  -0.325  1.00 0.00 ? 10 ILE A CD1  8  
ATOM   9075  H  H    . ILE A 1 10 ? -0.953  -4.470  4.173   1.00 0.00 ? 10 ILE A H    8  
ATOM   9076  H  HA   . ILE A 1 10 ? -1.575  -2.380  2.457   1.00 0.00 ? 10 ILE A HA   8  
ATOM   9077  H  HB   . ILE A 1 10 ? -0.224  -4.369  1.849   1.00 0.00 ? 10 ILE A HB   8  
ATOM   9078  H  HG12 . ILE A 1 10 ? -1.659  -4.667  -0.445  1.00 0.00 ? 10 ILE A HG12 8  
ATOM   9079  H  HG13 . ILE A 1 10 ? -2.346  -3.175  0.186   1.00 0.00 ? 10 ILE A HG13 8  
ATOM   9080  H  HG21 . ILE A 1 10 ? -2.906  -5.732  1.708   1.00 0.00 ? 10 ILE A HG21 8  
ATOM   9081  H  HG22 . ILE A 1 10 ? -1.545  -6.149  2.749   1.00 0.00 ? 10 ILE A HG22 8  
ATOM   9082  H  HG23 . ILE A 1 10 ? -1.424  -6.378  1.005   1.00 0.00 ? 10 ILE A HG23 8  
ATOM   9083  H  HD11 . ILE A 1 10 ? -0.140  -3.322  -1.357  1.00 0.00 ? 10 ILE A HD11 8  
ATOM   9084  H  HD12 . ILE A 1 10 ? 0.576   -3.294  0.253   1.00 0.00 ? 10 ILE A HD12 8  
ATOM   9085  H  HD13 . ILE A 1 10 ? -0.504  -1.996  -0.255  1.00 0.00 ? 10 ILE A HD13 8  
ATOM   9086  N  N    . GLU A 1 11 ? -4.171  -4.205  3.240   1.00 0.00 ? 11 GLU A N    8  
ATOM   9087  C  CA   . GLU A 1 11 ? -5.630  -4.285  3.148   1.00 0.00 ? 11 GLU A CA   8  
ATOM   9088  C  C    . GLU A 1 11 ? -6.272  -2.918  3.408   1.00 0.00 ? 11 GLU A C    8  
ATOM   9089  O  O    . GLU A 1 11 ? -7.324  -2.603  2.850   1.00 0.00 ? 11 GLU A O    8  
ATOM   9090  C  CB   . GLU A 1 11 ? -6.179  -5.318  4.138   1.00 0.00 ? 11 GLU A CB   8  
ATOM   9091  C  CG   . GLU A 1 11 ? -5.759  -5.075  5.583   1.00 0.00 ? 11 GLU A CG   8  
ATOM   9092  C  CD   . GLU A 1 11 ? -6.893  -5.299  6.566   1.00 0.00 ? 11 GLU A CD   8  
ATOM   9093  O  OE1  . GLU A 1 11 ? -7.730  -4.387  6.724   1.00 0.00 ? 11 GLU A OE1  8  
ATOM   9094  O  OE2  . GLU A 1 11 ? -6.941  -6.387  7.177   1.00 0.00 ? 11 GLU A OE2  8  
ATOM   9095  H  H    . GLU A 1 11 ? -3.701  -4.764  3.894   1.00 0.00 ? 11 GLU A H    8  
ATOM   9096  H  HA   . GLU A 1 11 ? -5.880  -4.597  2.144   1.00 0.00 ? 11 GLU A HA   8  
ATOM   9097  H  HB2  . GLU A 1 11 ? -7.258  -5.302  4.093   1.00 0.00 ? 11 GLU A HB2  8  
ATOM   9098  H  HB3  . GLU A 1 11 ? -5.831  -6.298  3.845   1.00 0.00 ? 11 GLU A HB3  8  
ATOM   9099  H  HG2  . GLU A 1 11 ? -4.952  -5.750  5.828   1.00 0.00 ? 11 GLU A HG2  8  
ATOM   9100  H  HG3  . GLU A 1 11 ? -5.415  -4.057  5.679   1.00 0.00 ? 11 GLU A HG3  8  
ATOM   9101  N  N    . ASP A 1 12 ? -5.626  -2.110  4.251   1.00 0.00 ? 12 ASP A N    8  
ATOM   9102  C  CA   . ASP A 1 12 ? -6.126  -0.776  4.576   1.00 0.00 ? 12 ASP A CA   8  
ATOM   9103  C  C    . ASP A 1 12 ? -5.873  0.200   3.423   1.00 0.00 ? 12 ASP A C    8  
ATOM   9104  O  O    . ASP A 1 12 ? -6.646  1.134   3.209   1.00 0.00 ? 12 ASP A O    8  
ATOM   9105  C  CB   . ASP A 1 12 ? -5.459  -0.256  5.854   1.00 0.00 ? 12 ASP A CB   8  
ATOM   9106  C  CG   . ASP A 1 12 ? -6.416  0.535   6.723   1.00 0.00 ? 12 ASP A CG   8  
ATOM   9107  O  OD1  . ASP A 1 12 ? -6.535  1.761   6.511   1.00 0.00 ? 12 ASP A OD1  8  
ATOM   9108  O  OD2  . ASP A 1 12 ? -7.048  -0.070  7.615   1.00 0.00 ? 12 ASP A OD2  8  
ATOM   9109  H  H    . ASP A 1 12 ? -4.790  -2.417  4.660   1.00 0.00 ? 12 ASP A H    8  
ATOM   9110  H  HA   . ASP A 1 12 ? -7.190  -0.851  4.742   1.00 0.00 ? 12 ASP A HA   8  
ATOM   9111  H  HB2  . ASP A 1 12 ? -5.091  -1.095  6.428   1.00 0.00 ? 12 ASP A HB2  8  
ATOM   9112  H  HB3  . ASP A 1 12 ? -4.631  0.383   5.588   1.00 0.00 ? 12 ASP A HB3  8  
ATOM   9113  N  N    . PHE A 1 13 ? -4.785  -0.029  2.682   1.00 0.00 ? 13 PHE A N    8  
ATOM   9114  C  CA   . PHE A 1 13 ? -4.426  0.821   1.546   1.00 0.00 ? 13 PHE A CA   8  
ATOM   9115  C  C    . PHE A 1 13 ? -5.488  0.751   0.447   1.00 0.00 ? 13 PHE A C    8  
ATOM   9116  O  O    . PHE A 1 13 ? -6.373  -0.106  0.479   1.00 0.00 ? 13 PHE A O    8  
ATOM   9117  C  CB   . PHE A 1 13 ? -3.071  0.392   0.970   1.00 0.00 ? 13 PHE A CB   8  
ATOM   9118  C  CG   . PHE A 1 13 ? -1.881  0.997   1.665   1.00 0.00 ? 13 PHE A CG   8  
ATOM   9119  C  CD1  . PHE A 1 13 ? -1.656  0.780   3.016   1.00 0.00 ? 13 PHE A CD1  8  
ATOM   9120  C  CD2  . PHE A 1 13 ? -0.979  1.776   0.957   1.00 0.00 ? 13 PHE A CD2  8  
ATOM   9121  C  CE1  . PHE A 1 13 ? -0.555  1.330   3.646   1.00 0.00 ? 13 PHE A CE1  8  
ATOM   9122  C  CE2  . PHE A 1 13 ? 0.123   2.326   1.582   1.00 0.00 ? 13 PHE A CE2  8  
ATOM   9123  C  CZ   . PHE A 1 13 ? 0.335   2.104   2.928   1.00 0.00 ? 13 PHE A CZ   8  
ATOM   9124  H  H    . PHE A 1 13 ? -4.211  -0.791  2.903   1.00 0.00 ? 13 PHE A H    8  
ATOM   9125  H  HA   . PHE A 1 13 ? -4.353  1.839   1.901   1.00 0.00 ? 13 PHE A HA   8  
ATOM   9126  H  HB2  . PHE A 1 13 ? -2.983  -0.682  1.044   1.00 0.00 ? 13 PHE A HB2  8  
ATOM   9127  H  HB3  . PHE A 1 13 ? -3.030  0.677   -0.071  1.00 0.00 ? 13 PHE A HB3  8  
ATOM   9128  H  HD1  . PHE A 1 13 ? -2.351  0.175   3.580   1.00 0.00 ? 13 PHE A HD1  8  
ATOM   9129  H  HD2  . PHE A 1 13 ? -1.143  1.953   -0.095  1.00 0.00 ? 13 PHE A HD2  8  
ATOM   9130  H  HE1  . PHE A 1 13 ? -0.391  1.154   4.698   1.00 0.00 ? 13 PHE A HE1  8  
ATOM   9131  H  HE2  . PHE A 1 13 ? 0.818   2.931   1.018   1.00 0.00 ? 13 PHE A HE2  8  
ATOM   9132  H  HZ   . PHE A 1 13 ? 1.196   2.533   3.418   1.00 0.00 ? 13 PHE A HZ   8  
ATOM   9133  N  N    . GLN A 1 14 ? -5.388  1.654   -0.527  1.00 0.00 ? 14 GLN A N    8  
ATOM   9134  C  CA   . GLN A 1 14 ? -6.333  1.694   -1.640  1.00 0.00 ? 14 GLN A CA   8  
ATOM   9135  C  C    . GLN A 1 14 ? -5.725  1.068   -2.895  1.00 0.00 ? 14 GLN A C    8  
ATOM   9136  O  O    . GLN A 1 14 ? -4.808  1.631   -3.494  1.00 0.00 ? 14 GLN A O    8  
ATOM   9137  C  CB   . GLN A 1 14 ? -6.751  3.138   -1.934  1.00 0.00 ? 14 GLN A CB   8  
ATOM   9138  C  CG   . GLN A 1 14 ? -8.010  3.575   -1.198  1.00 0.00 ? 14 GLN A CG   8  
ATOM   9139  C  CD   . GLN A 1 14 ? -7.722  4.154   0.177   1.00 0.00 ? 14 GLN A CD   8  
ATOM   9140  O  OE1  . GLN A 1 14 ? -6.571  4.417   0.528   1.00 0.00 ? 14 GLN A OE1  8  
ATOM   9141  N  NE2  . GLN A 1 14 ? -8.772  4.360   0.965   1.00 0.00 ? 14 GLN A NE2  8  
ATOM   9142  H  H    . GLN A 1 14 ? -4.658  2.309   -0.499  1.00 0.00 ? 14 GLN A H    8  
ATOM   9143  H  HA   . GLN A 1 14 ? -7.208  1.127   -1.355  1.00 0.00 ? 14 GLN A HA   8  
ATOM   9144  H  HB2  . GLN A 1 14 ? -5.944  3.798   -1.647  1.00 0.00 ? 14 GLN A HB2  8  
ATOM   9145  H  HB3  . GLN A 1 14 ? -6.926  3.240   -2.994  1.00 0.00 ? 14 GLN A HB3  8  
ATOM   9146  H  HG2  . GLN A 1 14 ? -8.510  4.327   -1.790  1.00 0.00 ? 14 GLN A HG2  8  
ATOM   9147  H  HG3  . GLN A 1 14 ? -8.659  2.719   -1.083  1.00 0.00 ? 14 GLN A HG3  8  
ATOM   9148  H  HE21 . GLN A 1 14 ? -9.662  4.131   0.622   1.00 0.00 ? 14 GLN A HE21 8  
ATOM   9149  H  HE22 . GLN A 1 14 ? -8.615  4.734   1.857   1.00 0.00 ? 14 GLN A HE22 8  
ATOM   9150  N  N    . TYR A 1 15 ? -6.243  -0.097  -3.289  1.00 0.00 ? 15 TYR A N    8  
ATOM   9151  C  CA   . TYR A 1 15 ? -5.750  -0.793  -4.476  1.00 0.00 ? 15 TYR A CA   8  
ATOM   9152  C  C    . TYR A 1 15 ? -6.047  0.013   -5.738  1.00 0.00 ? 15 TYR A C    8  
ATOM   9153  O  O    . TYR A 1 15 ? -7.191  0.406   -5.981  1.00 0.00 ? 15 TYR A O    8  
ATOM   9154  C  CB   . TYR A 1 15 ? -6.377  -2.187  -4.586  1.00 0.00 ? 15 TYR A CB   8  
ATOM   9155  C  CG   . TYR A 1 15 ? -5.918  -2.968  -5.798  1.00 0.00 ? 15 TYR A CG   8  
ATOM   9156  C  CD1  . TYR A 1 15 ? -4.609  -3.423  -5.901  1.00 0.00 ? 15 TYR A CD1  8  
ATOM   9157  C  CD2  . TYR A 1 15 ? -6.792  -3.250  -6.841  1.00 0.00 ? 15 TYR A CD2  8  
ATOM   9158  C  CE1  . TYR A 1 15 ? -4.183  -4.135  -7.006  1.00 0.00 ? 15 TYR A CE1  8  
ATOM   9159  C  CE2  . TYR A 1 15 ? -6.376  -3.963  -7.950  1.00 0.00 ? 15 TYR A CE2  8  
ATOM   9160  C  CZ   . TYR A 1 15 ? -5.070  -4.403  -8.028  1.00 0.00 ? 15 TYR A CZ   8  
ATOM   9161  O  OH   . TYR A 1 15 ? -4.651  -5.112  -9.130  1.00 0.00 ? 15 TYR A OH   8  
ATOM   9162  H  H    . TYR A 1 15 ? -6.974  -0.495  -2.771  1.00 0.00 ? 15 TYR A H    8  
ATOM   9163  H  HA   . TYR A 1 15 ? -4.680  -0.897  -4.375  1.00 0.00 ? 15 TYR A HA   8  
ATOM   9164  H  HB2  . TYR A 1 15 ? -6.121  -2.760  -3.707  1.00 0.00 ? 15 TYR A HB2  8  
ATOM   9165  H  HB3  . TYR A 1 15 ? -7.452  -2.087  -4.643  1.00 0.00 ? 15 TYR A HB3  8  
ATOM   9166  H  HD1  . TYR A 1 15 ? -3.916  -3.212  -5.100  1.00 0.00 ? 15 TYR A HD1  8  
ATOM   9167  H  HD2  . TYR A 1 15 ? -7.813  -2.904  -6.778  1.00 0.00 ? 15 TYR A HD2  8  
ATOM   9168  H  HE1  . TYR A 1 15 ? -3.161  -4.479  -7.066  1.00 0.00 ? 15 TYR A HE1  8  
ATOM   9169  H  HE2  . TYR A 1 15 ? -7.071  -4.171  -8.750  1.00 0.00 ? 15 TYR A HE2  8  
ATOM   9170  H  HH   . TYR A 1 15 ? -4.943  -6.024  -9.056  1.00 0.00 ? 15 TYR A HH   8  
ATOM   9171  N  N    . ASP A 1 16 ? -5.010  0.254   -6.537  1.00 0.00 ? 16 ASP A N    8  
ATOM   9172  C  CA   . ASP A 1 16 ? -5.152  1.010   -7.775  1.00 0.00 ? 16 ASP A CA   8  
ATOM   9173  C  C    . ASP A 1 16 ? -5.164  0.071   -8.978  1.00 0.00 ? 16 ASP A C    8  
ATOM   9174  O  O    . ASP A 1 16 ? -4.112  -0.351  -9.457  1.00 0.00 ? 16 ASP A O    8  
ATOM   9175  C  CB   . ASP A 1 16 ? -4.017  2.032   -7.913  1.00 0.00 ? 16 ASP A CB   8  
ATOM   9176  C  CG   . ASP A 1 16 ? -4.458  3.298   -8.628  1.00 0.00 ? 16 ASP A CG   8  
ATOM   9177  O  OD1  . ASP A 1 16 ? -5.041  3.188   -9.726  1.00 0.00 ? 16 ASP A OD1  8  
ATOM   9178  O  OD2  . ASP A 1 16 ? -4.214  4.398   -8.092  1.00 0.00 ? 16 ASP A OD2  8  
ATOM   9179  H  H    . ASP A 1 16 ? -4.126  -0.087  -6.287  1.00 0.00 ? 16 ASP A H    8  
ATOM   9180  H  HA   . ASP A 1 16 ? -6.095  1.536   -7.736  1.00 0.00 ? 16 ASP A HA   8  
ATOM   9181  H  HB2  . ASP A 1 16 ? -3.665  2.304   -6.929  1.00 0.00 ? 16 ASP A HB2  8  
ATOM   9182  H  HB3  . ASP A 1 16 ? -3.206  1.589   -8.471  1.00 0.00 ? 16 ASP A HB3  8  
ATOM   9183  N  N    . GLU A 1 17 ? -6.364  -0.252  -9.457  1.00 0.00 ? 17 GLU A N    8  
ATOM   9184  C  CA   . GLU A 1 17 ? -6.524  -1.144  -10.609 1.00 0.00 ? 17 GLU A CA   8  
ATOM   9185  C  C    . GLU A 1 17 ? -5.827  -0.586  -11.854 1.00 0.00 ? 17 GLU A C    8  
ATOM   9186  O  O    . GLU A 1 17 ? -5.443  -1.345  -12.744 1.00 0.00 ? 17 GLU A O    8  
ATOM   9187  C  CB   . GLU A 1 17 ? -8.009  -1.379  -10.914 1.00 0.00 ? 17 GLU A CB   8  
ATOM   9188  C  CG   . GLU A 1 17 ? -8.872  -0.127  -10.815 1.00 0.00 ? 17 GLU A CG   8  
ATOM   9189  C  CD   . GLU A 1 17 ? -10.085 -0.177  -11.724 1.00 0.00 ? 17 GLU A CD   8  
ATOM   9190  O  OE1  . GLU A 1 17 ? -10.921 -1.087  -11.549 1.00 0.00 ? 17 GLU A OE1  8  
ATOM   9191  O  OE2  . GLU A 1 17 ? -10.199 0.693   -12.613 1.00 0.00 ? 17 GLU A OE2  8  
ATOM   9192  H  H    . GLU A 1 17 ? -7.163  0.117   -9.024  1.00 0.00 ? 17 GLU A H    8  
ATOM   9193  H  HA   . GLU A 1 17 ? -6.068  -2.090  -10.355 1.00 0.00 ? 17 GLU A HA   8  
ATOM   9194  H  HB2  . GLU A 1 17 ? -8.095  -1.768  -11.918 1.00 0.00 ? 17 GLU A HB2  8  
ATOM   9195  H  HB3  . GLU A 1 17 ? -8.393  -2.112  -10.221 1.00 0.00 ? 17 GLU A HB3  8  
ATOM   9196  H  HG2  . GLU A 1 17 ? -9.211  -0.018  -9.796  1.00 0.00 ? 17 GLU A HG2  8  
ATOM   9197  H  HG3  . GLU A 1 17 ? -8.272  0.730   -11.085 1.00 0.00 ? 17 GLU A HG3  8  
ATOM   9198  N  N    . ASP A 1 18 ? -5.679  0.741   -11.909 1.00 0.00 ? 18 ASP A N    8  
ATOM   9199  C  CA   . ASP A 1 18 ? -5.040  1.409   -13.044 1.00 0.00 ? 18 ASP A CA   8  
ATOM   9200  C  C    . ASP A 1 18 ? -3.703  0.757   -13.406 1.00 0.00 ? 18 ASP A C    8  
ATOM   9201  O  O    . ASP A 1 18 ? -3.464  0.430   -14.569 1.00 0.00 ? 18 ASP A O    8  
ATOM   9202  C  CB   . ASP A 1 18 ? -4.826  2.895   -12.736 1.00 0.00 ? 18 ASP A CB   8  
ATOM   9203  C  CG   . ASP A 1 18 ? -4.777  3.747   -13.991 1.00 0.00 ? 18 ASP A CG   8  
ATOM   9204  O  OD1  . ASP A 1 18 ? -5.813  3.848   -14.681 1.00 0.00 ? 18 ASP A OD1  8  
ATOM   9205  O  OD2  . ASP A 1 18 ? -3.702  4.311   -14.284 1.00 0.00 ? 18 ASP A OD2  8  
ATOM   9206  H  H    . ASP A 1 18 ? -6.018  1.287   -11.169 1.00 0.00 ? 18 ASP A H    8  
ATOM   9207  H  HA   . ASP A 1 18 ? -5.706  1.323   -13.890 1.00 0.00 ? 18 ASP A HA   8  
ATOM   9208  H  HB2  . ASP A 1 18 ? -5.636  3.248   -12.116 1.00 0.00 ? 18 ASP A HB2  8  
ATOM   9209  H  HB3  . ASP A 1 18 ? -3.893  3.014   -12.205 1.00 0.00 ? 18 ASP A HB3  8  
ATOM   9210  N  N    . SER A 1 19 ? -2.834  0.575   -12.410 1.00 0.00 ? 19 SER A N    8  
ATOM   9211  C  CA   . SER A 1 19 ? -1.524  -0.036  -12.642 1.00 0.00 ? 19 SER A CA   8  
ATOM   9212  C  C    . SER A 1 19 ? -0.997  -0.738  -11.382 1.00 0.00 ? 19 SER A C    8  
ATOM   9213  O  O    . SER A 1 19 ? 0.210   -0.753  -11.131 1.00 0.00 ? 19 SER A O    8  
ATOM   9214  C  CB   . SER A 1 19 ? -0.527  1.028   -13.116 1.00 0.00 ? 19 SER A CB   8  
ATOM   9215  O  OG   . SER A 1 19 ? 0.574   0.441   -13.789 1.00 0.00 ? 19 SER A OG   8  
ATOM   9216  H  H    . SER A 1 19 ? -3.077  0.859   -11.502 1.00 0.00 ? 19 SER A H    8  
ATOM   9217  H  HA   . SER A 1 19 ? -1.641  -0.774  -13.423 1.00 0.00 ? 19 SER A HA   8  
ATOM   9218  H  HB2  . SER A 1 19 ? -1.025  1.706   -13.793 1.00 0.00 ? 19 SER A HB2  8  
ATOM   9219  H  HB3  . SER A 1 19 ? -0.160  1.579   -12.261 1.00 0.00 ? 19 SER A HB3  8  
ATOM   9220  H  HG   . SER A 1 19 ? 1.379   0.915   -13.559 1.00 0.00 ? 19 SER A HG   8  
ATOM   9221  N  N    . GLU A 1 20 ? -1.910  -1.325  -10.603 1.00 0.00 ? 20 GLU A N    8  
ATOM   9222  C  CA   . GLU A 1 20 ? -1.552  -2.038  -9.372  1.00 0.00 ? 20 GLU A CA   8  
ATOM   9223  C  C    . GLU A 1 20 ? -0.683  -1.178  -8.446  1.00 0.00 ? 20 GLU A C    8  
ATOM   9224  O  O    . GLU A 1 20 ? 0.532   -1.371  -8.358  1.00 0.00 ? 20 GLU A O    8  
ATOM   9225  C  CB   . GLU A 1 20 ? -0.825  -3.346  -9.704  1.00 0.00 ? 20 GLU A CB   8  
ATOM   9226  C  CG   . GLU A 1 20 ? -1.533  -4.196  -10.748 1.00 0.00 ? 20 GLU A CG   8  
ATOM   9227  C  CD   . GLU A 1 20 ? -0.570  -4.825  -11.733 1.00 0.00 ? 20 GLU A CD   8  
ATOM   9228  O  OE1  . GLU A 1 20 ? -0.138  -4.122  -12.672 1.00 0.00 ? 20 GLU A OE1  8  
ATOM   9229  O  OE2  . GLU A 1 20 ? -0.247  -6.020  -11.567 1.00 0.00 ? 20 GLU A OE2  8  
ATOM   9230  H  H    . GLU A 1 20 ? -2.853  -1.284  -10.864 1.00 0.00 ? 20 GLU A H    8  
ATOM   9231  H  HA   . GLU A 1 20 ? -2.470  -2.275  -8.856  1.00 0.00 ? 20 GLU A HA   8  
ATOM   9232  H  HB2  . GLU A 1 20 ? 0.160   -3.110  -10.074 1.00 0.00 ? 20 GLU A HB2  8  
ATOM   9233  H  HB3  . GLU A 1 20 ? -0.731  -3.928  -8.800  1.00 0.00 ? 20 GLU A HB3  8  
ATOM   9234  H  HG2  . GLU A 1 20 ? -2.075  -4.984  -10.246 1.00 0.00 ? 20 GLU A HG2  8  
ATOM   9235  H  HG3  . GLU A 1 20 ? -2.229  -3.574  -11.293 1.00 0.00 ? 20 GLU A HG3  8  
ATOM   9236  N  N    . THR A 1 21 ? -1.320  -0.236  -7.752  1.00 0.00 ? 21 THR A N    8  
ATOM   9237  C  CA   . THR A 1 21 ? -0.616  0.649   -6.824  1.00 0.00 ? 21 THR A CA   8  
ATOM   9238  C  C    . THR A 1 21 ? -1.423  0.835   -5.537  1.00 0.00 ? 21 THR A C    8  
ATOM   9239  O  O    . THR A 1 21 ? -2.648  0.750   -5.549  1.00 0.00 ? 21 THR A O    8  
ATOM   9240  C  CB   . THR A 1 21 ? -0.352  2.013   -7.476  1.00 0.00 ? 21 THR A CB   8  
ATOM   9241  O  OG1  . THR A 1 21 ? 0.256   1.856   -8.747  1.00 0.00 ? 21 THR A OG1  8  
ATOM   9242  C  CG2  . THR A 1 21 ? 0.548   2.908   -6.649  1.00 0.00 ? 21 THR A CG2  8  
ATOM   9243  H  H    . THR A 1 21 ? -2.290  -0.138  -7.862  1.00 0.00 ? 21 THR A H    8  
ATOM   9244  H  HA   . THR A 1 21 ? 0.329   0.187   -6.579  1.00 0.00 ? 21 THR A HA   8  
ATOM   9245  H  HB   . THR A 1 21 ? -1.294  2.525   -7.610  1.00 0.00 ? 21 THR A HB   8  
ATOM   9246  H  HG1  . THR A 1 21 ? -0.361  2.127   -9.431  1.00 0.00 ? 21 THR A HG1  8  
ATOM   9247  H  HG21 . THR A 1 21 ? 0.081   3.106   -5.695  1.00 0.00 ? 21 THR A HG21 8  
ATOM   9248  H  HG22 . THR A 1 21 ? 0.708   3.840   -7.170  1.00 0.00 ? 21 THR A HG22 8  
ATOM   9249  H  HG23 . THR A 1 21 ? 1.496   2.416   -6.489  1.00 0.00 ? 21 THR A HG23 8  
ATOM   9250  N  N    . TYR A 1 22 ? -0.728  1.087   -4.428  1.00 0.00 ? 22 TYR A N    8  
ATOM   9251  C  CA   . TYR A 1 22 ? -1.388  1.285   -3.136  1.00 0.00 ? 22 TYR A CA   8  
ATOM   9252  C  C    . TYR A 1 22 ? -1.035  2.652   -2.551  1.00 0.00 ? 22 TYR A C    8  
ATOM   9253  O  O    . TYR A 1 22 ? 0.109   3.098   -2.649  1.00 0.00 ? 22 TYR A O    8  
ATOM   9254  C  CB   . TYR A 1 22 ? -0.998  0.171   -2.163  1.00 0.00 ? 22 TYR A CB   8  
ATOM   9255  C  CG   . TYR A 1 22 ? -1.350  -1.214  -2.661  1.00 0.00 ? 22 TYR A CG   8  
ATOM   9256  C  CD1  . TYR A 1 22 ? -0.489  -1.910  -3.499  1.00 0.00 ? 22 TYR A CD1  8  
ATOM   9257  C  CD2  . TYR A 1 22 ? -2.544  -1.823  -2.293  1.00 0.00 ? 22 TYR A CD2  8  
ATOM   9258  C  CE1  . TYR A 1 22 ? -0.805  -3.174  -3.958  1.00 0.00 ? 22 TYR A CE1  8  
ATOM   9259  C  CE2  . TYR A 1 22 ? -2.868  -3.088  -2.748  1.00 0.00 ? 22 TYR A CE2  8  
ATOM   9260  C  CZ   . TYR A 1 22 ? -1.994  -3.758  -3.580  1.00 0.00 ? 22 TYR A CZ   8  
ATOM   9261  O  OH   . TYR A 1 22 ? -2.312  -5.018  -4.035  1.00 0.00 ? 22 TYR A OH   8  
ATOM   9262  H  H    . TYR A 1 22 ? 0.250   1.142   -4.477  1.00 0.00 ? 22 TYR A H    8  
ATOM   9263  H  HA   . TYR A 1 22 ? -2.455  1.245   -3.303  1.00 0.00 ? 22 TYR A HA   8  
ATOM   9264  H  HB2  . TYR A 1 22 ? 0.069   0.203   -1.999  1.00 0.00 ? 22 TYR A HB2  8  
ATOM   9265  H  HB3  . TYR A 1 22 ? -1.507  0.327   -1.224  1.00 0.00 ? 22 TYR A HB3  8  
ATOM   9266  H  HD1  . TYR A 1 22 ? 0.443   -1.450  -3.793  1.00 0.00 ? 22 TYR A HD1  8  
ATOM   9267  H  HD2  . TYR A 1 22 ? -3.227  -1.296  -1.642  1.00 0.00 ? 22 TYR A HD2  8  
ATOM   9268  H  HE1  . TYR A 1 22 ? -0.122  -3.697  -4.607  1.00 0.00 ? 22 TYR A HE1  8  
ATOM   9269  H  HE2  . TYR A 1 22 ? -3.800  -3.547  -2.451  1.00 0.00 ? 22 TYR A HE2  8  
ATOM   9270  H  HH   . TYR A 1 22 ? -2.409  -5.001  -4.990  1.00 0.00 ? 22 TYR A HH   8  
ATOM   9271  N  N    . PHE A 1 23 ? -2.026  3.317   -1.951  1.00 0.00 ? 23 PHE A N    8  
ATOM   9272  C  CA   . PHE A 1 23 ? -1.814  4.641   -1.362  1.00 0.00 ? 23 PHE A CA   8  
ATOM   9273  C  C    . PHE A 1 23 ? -2.359  4.717   0.064   1.00 0.00 ? 23 PHE A C    8  
ATOM   9274  O  O    . PHE A 1 23 ? -3.241  3.945   0.447   1.00 0.00 ? 23 PHE A O    8  
ATOM   9275  C  CB   . PHE A 1 23 ? -2.477  5.721   -2.225  1.00 0.00 ? 23 PHE A CB   8  
ATOM   9276  C  CG   . PHE A 1 23 ? -2.056  5.687   -3.668  1.00 0.00 ? 23 PHE A CG   8  
ATOM   9277  C  CD1  . PHE A 1 23 ? -2.533  4.703   -4.519  1.00 0.00 ? 23 PHE A CD1  8  
ATOM   9278  C  CD2  . PHE A 1 23 ? -1.183  6.637   -4.174  1.00 0.00 ? 23 PHE A CD2  8  
ATOM   9279  C  CE1  . PHE A 1 23 ? -2.149  4.666   -5.844  1.00 0.00 ? 23 PHE A CE1  8  
ATOM   9280  C  CE2  . PHE A 1 23 ? -0.796  6.607   -5.501  1.00 0.00 ? 23 PHE A CE2  8  
ATOM   9281  C  CZ   . PHE A 1 23 ? -1.279  5.619   -6.336  1.00 0.00 ? 23 PHE A CZ   8  
ATOM   9282  H  H    . PHE A 1 23 ? -2.919  2.913   -1.911  1.00 0.00 ? 23 PHE A H    8  
ATOM   9283  H  HA   . PHE A 1 23 ? -0.750  4.822   -1.334  1.00 0.00 ? 23 PHE A HA   8  
ATOM   9284  H  HB2  . PHE A 1 23 ? -3.548  5.592   -2.190  1.00 0.00 ? 23 PHE A HB2  8  
ATOM   9285  H  HB3  . PHE A 1 23 ? -2.224  6.693   -1.827  1.00 0.00 ? 23 PHE A HB3  8  
ATOM   9286  H  HD1  . PHE A 1 23 ? -3.214  3.956   -4.137  1.00 0.00 ? 23 PHE A HD1  8  
ATOM   9287  H  HD2  . PHE A 1 23 ? -0.804  7.411   -3.522  1.00 0.00 ? 23 PHE A HD2  8  
ATOM   9288  H  HE1  . PHE A 1 23 ? -2.528  3.892   -6.494  1.00 0.00 ? 23 PHE A HE1  8  
ATOM   9289  H  HE2  . PHE A 1 23 ? -0.115  7.353   -5.882  1.00 0.00 ? 23 PHE A HE2  8  
ATOM   9290  H  HZ   . PHE A 1 23 ? -0.977  5.592   -7.373  1.00 0.00 ? 23 PHE A HZ   8  
ATOM   9291  N  N    . TYR A 1 24 ? -1.829  5.664   0.845   1.00 0.00 ? 24 TYR A N    8  
ATOM   9292  C  CA   . TYR A 1 24 ? -2.262  5.856   2.230   1.00 0.00 ? 24 TYR A CA   8  
ATOM   9293  C  C    . TYR A 1 24 ? -2.457  7.340   2.549   1.00 0.00 ? 24 TYR A C    8  
ATOM   9294  O  O    . TYR A 1 24 ? -1.640  8.175   2.161   1.00 0.00 ? 24 TYR A O    8  
ATOM   9295  C  CB   . TYR A 1 24 ? -1.244  5.250   3.202   1.00 0.00 ? 24 TYR A CB   8  
ATOM   9296  C  CG   . TYR A 1 24 ? -1.847  4.854   4.532   1.00 0.00 ? 24 TYR A CG   8  
ATOM   9297  C  CD1  . TYR A 1 24 ? -2.778  3.826   4.613   1.00 0.00 ? 24 TYR A CD1  8  
ATOM   9298  C  CD2  . TYR A 1 24 ? -1.495  5.514   5.703   1.00 0.00 ? 24 TYR A CD2  8  
ATOM   9299  C  CE1  . TYR A 1 24 ? -3.339  3.465   5.822   1.00 0.00 ? 24 TYR A CE1  8  
ATOM   9300  C  CE2  . TYR A 1 24 ? -2.052  5.159   6.917   1.00 0.00 ? 24 TYR A CE2  8  
ATOM   9301  C  CZ   . TYR A 1 24 ? -2.974  4.135   6.972   1.00 0.00 ? 24 TYR A CZ   8  
ATOM   9302  O  OH   . TYR A 1 24 ? -3.532  3.782   8.181   1.00 0.00 ? 24 TYR A OH   8  
ATOM   9303  H  H    . TYR A 1 24 ? -1.133  6.251   0.479   1.00 0.00 ? 24 TYR A H    8  
ATOM   9304  H  HA   . TYR A 1 24 ? -3.206  5.348   2.352   1.00 0.00 ? 24 TYR A HA   8  
ATOM   9305  H  HB2  . TYR A 1 24 ? -0.813  4.368   2.756   1.00 0.00 ? 24 TYR A HB2  8  
ATOM   9306  H  HB3  . TYR A 1 24 ? -0.462  5.972   3.391   1.00 0.00 ? 24 TYR A HB3  8  
ATOM   9307  H  HD1  . TYR A 1 24 ? -3.063  3.302   3.713   1.00 0.00 ? 24 TYR A HD1  8  
ATOM   9308  H  HD2  . TYR A 1 24 ? -0.773  6.316   5.658   1.00 0.00 ? 24 TYR A HD2  8  
ATOM   9309  H  HE1  . TYR A 1 24 ? -4.061  2.663   5.864   1.00 0.00 ? 24 TYR A HE1  8  
ATOM   9310  H  HE2  . TYR A 1 24 ? -1.766  5.684   7.816   1.00 0.00 ? 24 TYR A HE2  8  
ATOM   9311  H  HH   . TYR A 1 24 ? -3.582  2.824   8.248   1.00 0.00 ? 24 TYR A HH   8  
ATOM   9312  N  N    . PRO A 1 25 ? -3.547  7.687   3.265   1.00 0.00 ? 25 PRO A N    8  
ATOM   9313  C  CA   . PRO A 1 25 ? -3.842  9.078   3.634   1.00 0.00 ? 25 PRO A CA   8  
ATOM   9314  C  C    . PRO A 1 25 ? -2.843  9.641   4.644   1.00 0.00 ? 25 PRO A C    8  
ATOM   9315  O  O    . PRO A 1 25 ? -2.641  9.069   5.717   1.00 0.00 ? 25 PRO A O    8  
ATOM   9316  C  CB   . PRO A 1 25 ? -5.239  8.997   4.254   1.00 0.00 ? 25 PRO A CB   8  
ATOM   9317  C  CG   . PRO A 1 25 ? -5.364  7.592   4.733   1.00 0.00 ? 25 PRO A CG   8  
ATOM   9318  C  CD   . PRO A 1 25 ? -4.575  6.754   3.767   1.00 0.00 ? 25 PRO A CD   8  
ATOM   9319  H  HA   . PRO A 1 25 ? -3.869  9.718   2.766   1.00 0.00 ? 25 PRO A HA   8  
ATOM   9320  H  HB2  . PRO A 1 25 ? -5.316  9.701   5.070   1.00 0.00 ? 25 PRO A HB2  8  
ATOM   9321  H  HB3  . PRO A 1 25 ? -5.982  9.225   3.504   1.00 0.00 ? 25 PRO A HB3  8  
ATOM   9322  H  HG2  . PRO A 1 25 ? -4.953  7.505   5.728   1.00 0.00 ? 25 PRO A HG2  8  
ATOM   9323  H  HG3  . PRO A 1 25 ? -6.402  7.293   4.727   1.00 0.00 ? 25 PRO A HG3  8  
ATOM   9324  H  HD2  . PRO A 1 25 ? -4.120  5.919   4.278   1.00 0.00 ? 25 PRO A HD2  8  
ATOM   9325  H  HD3  . PRO A 1 25 ? -5.208  6.408   2.964   1.00 0.00 ? 25 PRO A HD3  8  
ATOM   9326  N  N    . CYS A 1 26 ? -2.224  10.766  4.290   1.00 0.00 ? 26 CYS A N    8  
ATOM   9327  C  CA   . CYS A 1 26 ? -1.247  11.410  5.161   1.00 0.00 ? 26 CYS A CA   8  
ATOM   9328  C  C    . CYS A 1 26 ? -1.846  12.644  5.834   1.00 0.00 ? 26 CYS A C    8  
ATOM   9329  O  O    . CYS A 1 26 ? -2.625  13.379  5.221   1.00 0.00 ? 26 CYS A O    8  
ATOM   9330  C  CB   . CYS A 1 26 ? -0.003  11.803  4.361   1.00 0.00 ? 26 CYS A CB   8  
ATOM   9331  S  SG   . CYS A 1 26 ? 1.566   11.306  5.138   1.00 0.00 ? 26 CYS A SG   8  
ATOM   9332  H  H    . CYS A 1 26 ? -2.428  11.173  3.422   1.00 0.00 ? 26 CYS A H    8  
ATOM   9333  H  HA   . CYS A 1 26 ? -0.963  10.701  5.922   1.00 0.00 ? 26 CYS A HA   8  
ATOM   9334  H  HB2  . CYS A 1 26 ? -0.048  11.338  3.387   1.00 0.00 ? 26 CYS A HB2  8  
ATOM   9335  H  HB3  . CYS A 1 26 ? 0.015   12.877  4.241   1.00 0.00 ? 26 CYS A HB3  8  
ATOM   9336  N  N    . PRO A 1 27 ? -1.483  12.894  7.108   1.00 0.00 ? 27 PRO A N    8  
ATOM   9337  C  CA   . PRO A 1 27 ? -1.985  14.051  7.863   1.00 0.00 ? 27 PRO A CA   8  
ATOM   9338  C  C    . PRO A 1 27 ? -1.474  15.386  7.315   1.00 0.00 ? 27 PRO A C    8  
ATOM   9339  O  O    . PRO A 1 27 ? -2.040  16.440  7.610   1.00 0.00 ? 27 PRO A O    8  
ATOM   9340  C  CB   . PRO A 1 27 ? -1.448  13.819  9.278   1.00 0.00 ? 27 PRO A CB   8  
ATOM   9341  C  CG   . PRO A 1 27 ? -0.256  12.945  9.097   1.00 0.00 ? 27 PRO A CG   8  
ATOM   9342  C  CD   . PRO A 1 27 ? -0.555  12.073  7.910   1.00 0.00 ? 27 PRO A CD   8  
ATOM   9343  H  HA   . PRO A 1 27 ? -3.065  14.066  7.884   1.00 0.00 ? 27 PRO A HA   8  
ATOM   9344  H  HB2  . PRO A 1 27 ? -1.181  14.767  9.722   1.00 0.00 ? 27 PRO A HB2  8  
ATOM   9345  H  HB3  . PRO A 1 27 ? -2.204  13.335  9.876   1.00 0.00 ? 27 PRO A HB3  8  
ATOM   9346  H  HG2  . PRO A 1 27 ? 0.618   13.551  8.908   1.00 0.00 ? 27 PRO A HG2  8  
ATOM   9347  H  HG3  . PRO A 1 27 ? -0.108  12.339  9.978   1.00 0.00 ? 27 PRO A HG3  8  
ATOM   9348  H  HD2  . PRO A 1 27 ? 0.353   11.862  7.359   1.00 0.00 ? 27 PRO A HD2  8  
ATOM   9349  H  HD3  . PRO A 1 27 ? -1.030  11.156  8.225   1.00 0.00 ? 27 PRO A HD3  8  
ATOM   9350  N  N    . CYS A 1 28 ? -0.406  15.339  6.516   1.00 0.00 ? 28 CYS A N    8  
ATOM   9351  C  CA   . CYS A 1 28 ? 0.168   16.551  5.935   1.00 0.00 ? 28 CYS A CA   8  
ATOM   9352  C  C    . CYS A 1 28 ? -0.746  17.128  4.849   1.00 0.00 ? 28 CYS A C    8  
ATOM   9353  O  O    . CYS A 1 28 ? -0.790  18.343  4.647   1.00 0.00 ? 28 CYS A O    8  
ATOM   9354  C  CB   . CYS A 1 28 ? 1.555   16.257  5.352   1.00 0.00 ? 28 CYS A CB   8  
ATOM   9355  S  SG   . CYS A 1 28 ? 1.553   15.062  3.975   1.00 0.00 ? 28 CYS A SG   8  
ATOM   9356  H  H    . CYS A 1 28 ? 0.006   14.472  6.313   1.00 0.00 ? 28 CYS A H    8  
ATOM   9357  H  HA   . CYS A 1 28 ? 0.269   17.278  6.728   1.00 0.00 ? 28 CYS A HA   8  
ATOM   9358  H  HB2  . CYS A 1 28 ? 1.983   17.178  4.986   1.00 0.00 ? 28 CYS A HB2  8  
ATOM   9359  H  HB3  . CYS A 1 28 ? 2.188   15.859  6.132   1.00 0.00 ? 28 CYS A HB3  8  
ATOM   9360  N  N    . GLY A 1 29 ? -1.467  16.247  4.150   1.00 0.00 ? 29 GLY A N    8  
ATOM   9361  C  CA   . GLY A 1 29 ? -2.364  16.680  3.090   1.00 0.00 ? 29 GLY A CA   8  
ATOM   9362  C  C    . GLY A 1 29 ? -2.353  15.734  1.900   1.00 0.00 ? 29 GLY A C    8  
ATOM   9363  O  O    . GLY A 1 29 ? -3.402  15.450  1.317   1.00 0.00 ? 29 GLY A O    8  
ATOM   9364  H  H    . GLY A 1 29 ? -1.385  15.291  4.354   1.00 0.00 ? 29 GLY A H    8  
ATOM   9365  H  HA2  . GLY A 1 29 ? -3.367  16.734  3.485   1.00 0.00 ? 29 GLY A HA2  8  
ATOM   9366  H  HA3  . GLY A 1 29 ? -2.066  17.663  2.758   1.00 0.00 ? 29 GLY A HA3  8  
ATOM   9367  N  N    . ASP A 1 30 ? -1.166  15.245  1.544   1.00 0.00 ? 30 ASP A N    8  
ATOM   9368  C  CA   . ASP A 1 30 ? -1.013  14.322  0.421   1.00 0.00 ? 30 ASP A CA   8  
ATOM   9369  C  C    . ASP A 1 30 ? -1.262  12.876  0.864   1.00 0.00 ? 30 ASP A C    8  
ATOM   9370  O  O    . ASP A 1 30 ? -1.694  12.629  1.993   1.00 0.00 ? 30 ASP A O    8  
ATOM   9371  C  CB   . ASP A 1 30 ? 0.393   14.459  -0.175  1.00 0.00 ? 30 ASP A CB   8  
ATOM   9372  C  CG   . ASP A 1 30 ? 0.432   15.385  -1.376  1.00 0.00 ? 30 ASP A CG   8  
ATOM   9373  O  OD1  . ASP A 1 30 ? 0.039   16.561  -1.232  1.00 0.00 ? 30 ASP A OD1  8  
ATOM   9374  O  OD2  . ASP A 1 30 ? 0.857   14.933  -2.460  1.00 0.00 ? 30 ASP A OD2  8  
ATOM   9375  H  H    . ASP A 1 30 ? -0.372  15.509  2.052   1.00 0.00 ? 30 ASP A H    8  
ATOM   9376  H  HA   . ASP A 1 30 ? -1.742  14.586  -0.331  1.00 0.00 ? 30 ASP A HA   8  
ATOM   9377  H  HB2  . ASP A 1 30 ? 1.057   14.853  0.580   1.00 0.00 ? 30 ASP A HB2  8  
ATOM   9378  H  HB3  . ASP A 1 30 ? 0.745   13.485  -0.482  1.00 0.00 ? 30 ASP A HB3  8  
ATOM   9379  N  N    . ASN A 1 31 ? -0.991  11.923  -0.032  1.00 0.00 ? 31 ASN A N    8  
ATOM   9380  C  CA   . ASN A 1 31 ? -1.187  10.507  0.271   1.00 0.00 ? 31 ASN A CA   8  
ATOM   9381  C  C    . ASN A 1 31 ? -0.002  9.674   -0.220  1.00 0.00 ? 31 ASN A C    8  
ATOM   9382  O  O    . ASN A 1 31 ? 0.453   9.835   -1.354  1.00 0.00 ? 31 ASN A O    8  
ATOM   9383  C  CB   . ASN A 1 31 ? -2.481  9.997   -0.373  1.00 0.00 ? 31 ASN A CB   8  
ATOM   9384  C  CG   . ASN A 1 31 ? -3.688  10.853  -0.028  1.00 0.00 ? 31 ASN A CG   8  
ATOM   9385  O  OD1  . ASN A 1 31 ? -4.474  10.509  0.853   1.00 0.00 ? 31 ASN A OD1  8  
ATOM   9386  N  ND2  . ASN A 1 31 ? -3.845  11.973  -0.726  1.00 0.00 ? 31 ASN A ND2  8  
ATOM   9387  H  H    . ASN A 1 31 ? -0.651  12.178  -0.915  1.00 0.00 ? 31 ASN A H    8  
ATOM   9388  H  HA   . ASN A 1 31 ? -1.263  10.406  1.343   1.00 0.00 ? 31 ASN A HA   8  
ATOM   9389  H  HB2  . ASN A 1 31 ? -2.362  9.992   -1.446  1.00 0.00 ? 31 ASN A HB2  8  
ATOM   9390  H  HB3  . ASN A 1 31 ? -2.669  8.989   -0.033  1.00 0.00 ? 31 ASN A HB3  8  
ATOM   9391  H  HD21 . ASN A 1 31 ? -3.182  12.186  -1.417  1.00 0.00 ? 31 ASN A HD21 8  
ATOM   9392  H  HD22 . ASN A 1 31 ? -4.620  12.539  -0.524  1.00 0.00 ? 31 ASN A HD22 8  
ATOM   9393  N  N    . PHE A 1 32 ? 0.487   8.780   0.644   1.00 0.00 ? 32 PHE A N    8  
ATOM   9394  C  CA   . PHE A 1 32 ? 1.616   7.909   0.310   1.00 0.00 ? 32 PHE A CA   8  
ATOM   9395  C  C    . PHE A 1 32 ? 1.297   7.035   -0.905  1.00 0.00 ? 32 PHE A C    8  
ATOM   9396  O  O    . PHE A 1 32 ? 0.134   6.883   -1.279  1.00 0.00 ? 32 PHE A O    8  
ATOM   9397  C  CB   . PHE A 1 32 ? 1.966   7.019   1.506   1.00 0.00 ? 32 PHE A CB   8  
ATOM   9398  C  CG   . PHE A 1 32 ? 2.893   7.667   2.497   1.00 0.00 ? 32 PHE A CG   8  
ATOM   9399  C  CD1  . PHE A 1 32 ? 4.237   7.832   2.201   1.00 0.00 ? 32 PHE A CD1  8  
ATOM   9400  C  CD2  . PHE A 1 32 ? 2.425   8.103   3.726   1.00 0.00 ? 32 PHE A CD2  8  
ATOM   9401  C  CE1  . PHE A 1 32 ? 5.094   8.419   3.110   1.00 0.00 ? 32 PHE A CE1  8  
ATOM   9402  C  CE2  . PHE A 1 32 ? 3.280   8.690   4.641   1.00 0.00 ? 32 PHE A CE2  8  
ATOM   9403  C  CZ   . PHE A 1 32 ? 4.616   8.850   4.331   1.00 0.00 ? 32 PHE A CZ   8  
ATOM   9404  H  H    . PHE A 1 32 ? 0.072   8.703   1.530   1.00 0.00 ? 32 PHE A H    8  
ATOM   9405  H  HA   . PHE A 1 32 ? 2.464   8.537   0.077   1.00 0.00 ? 32 PHE A HA   8  
ATOM   9406  H  HB2  . PHE A 1 32 ? 1.058   6.755   2.026   1.00 0.00 ? 32 PHE A HB2  8  
ATOM   9407  H  HB3  . PHE A 1 32 ? 2.442   6.119   1.146   1.00 0.00 ? 32 PHE A HB3  8  
ATOM   9408  H  HD1  . PHE A 1 32 ? 4.613   7.498   1.246   1.00 0.00 ? 32 PHE A HD1  8  
ATOM   9409  H  HD2  . PHE A 1 32 ? 1.380   7.982   3.969   1.00 0.00 ? 32 PHE A HD2  8  
ATOM   9410  H  HE1  . PHE A 1 32 ? 6.139   8.542   2.866   1.00 0.00 ? 32 PHE A HE1  8  
ATOM   9411  H  HE2  . PHE A 1 32 ? 2.902   9.028   5.595   1.00 0.00 ? 32 PHE A HE2  8  
ATOM   9412  H  HZ   . PHE A 1 32 ? 5.286   9.309   5.044   1.00 0.00 ? 32 PHE A HZ   8  
ATOM   9413  N  N    . SER A 1 33 ? 2.336   6.462   -1.518  1.00 0.00 ? 33 SER A N    8  
ATOM   9414  C  CA   . SER A 1 33 ? 2.155   5.607   -2.691  1.00 0.00 ? 33 SER A CA   8  
ATOM   9415  C  C    . SER A 1 33 ? 3.204   4.494   -2.745  1.00 0.00 ? 33 SER A C    8  
ATOM   9416  O  O    . SER A 1 33 ? 4.382   4.721   -2.460  1.00 0.00 ? 33 SER A O    8  
ATOM   9417  C  CB   . SER A 1 33 ? 2.218   6.445   -3.973  1.00 0.00 ? 33 SER A CB   8  
ATOM   9418  O  OG   . SER A 1 33 ? 3.445   7.147   -4.070  1.00 0.00 ? 33 SER A OG   8  
ATOM   9419  H  H    . SER A 1 33 ? 3.242   6.619   -1.176  1.00 0.00 ? 33 SER A H    8  
ATOM   9420  H  HA   . SER A 1 33 ? 1.177   5.154   -2.620  1.00 0.00 ? 33 SER A HA   8  
ATOM   9421  H  HB2  . SER A 1 33 ? 2.122   5.794   -4.829  1.00 0.00 ? 33 SER A HB2  8  
ATOM   9422  H  HB3  . SER A 1 33 ? 1.408   7.159   -3.971  1.00 0.00 ? 33 SER A HB3  8  
ATOM   9423  H  HG   . SER A 1 33 ? 3.424   7.916   -3.497  1.00 0.00 ? 33 SER A HG   8  
ATOM   9424  N  N    . ILE A 1 34 ? 2.762   3.293   -3.123  1.00 0.00 ? 34 ILE A N    8  
ATOM   9425  C  CA   . ILE A 1 34 ? 3.650   2.135   -3.233  1.00 0.00 ? 34 ILE A CA   8  
ATOM   9426  C  C    . ILE A 1 34 ? 3.122   1.142   -4.274  1.00 0.00 ? 34 ILE A C    8  
ATOM   9427  O  O    . ILE A 1 34 ? 1.978   0.691   -4.189  1.00 0.00 ? 34 ILE A O    8  
ATOM   9428  C  CB   . ILE A 1 34 ? 3.823   1.421   -1.872  1.00 0.00 ? 34 ILE A CB   8  
ATOM   9429  C  CG1  . ILE A 1 34 ? 4.801   0.248   -1.998  1.00 0.00 ? 34 ILE A CG1  8  
ATOM   9430  C  CG2  . ILE A 1 34 ? 2.478   0.946   -1.340  1.00 0.00 ? 34 ILE A CG2  8  
ATOM   9431  C  CD1  . ILE A 1 34 ? 5.705   0.085   -0.796  1.00 0.00 ? 34 ILE A CD1  8  
ATOM   9432  H  H    . ILE A 1 34 ? 1.812   3.182   -3.341  1.00 0.00 ? 34 ILE A H    8  
ATOM   9433  H  HA   . ILE A 1 34 ? 4.619   2.492   -3.553  1.00 0.00 ? 34 ILE A HA   8  
ATOM   9434  H  HB   . ILE A 1 34 ? 4.225   2.136   -1.169  1.00 0.00 ? 34 ILE A HB   8  
ATOM   9435  H  HG12 . ILE A 1 34 ? 4.242   -0.669  -2.118  1.00 0.00 ? 34 ILE A HG12 8  
ATOM   9436  H  HG13 . ILE A 1 34 ? 5.427   0.399   -2.865  1.00 0.00 ? 34 ILE A HG13 8  
ATOM   9437  H  HG21 . ILE A 1 34 ? 1.687   1.520   -1.800  1.00 0.00 ? 34 ILE A HG21 8  
ATOM   9438  H  HG22 . ILE A 1 34 ? 2.445   1.084   -0.270  1.00 0.00 ? 34 ILE A HG22 8  
ATOM   9439  H  HG23 . ILE A 1 34 ? 2.346   -0.100  -1.573  1.00 0.00 ? 34 ILE A HG23 8  
ATOM   9440  H  HD11 . ILE A 1 34 ? 5.422   0.791   -0.031  1.00 0.00 ? 34 ILE A HD11 8  
ATOM   9441  H  HD12 . ILE A 1 34 ? 6.729   0.263   -1.089  1.00 0.00 ? 34 ILE A HD12 8  
ATOM   9442  H  HD13 . ILE A 1 34 ? 5.612   -0.921  -0.410  1.00 0.00 ? 34 ILE A HD13 8  
ATOM   9443  N  N    . THR A 1 35 ? 3.956   0.809   -5.258  1.00 0.00 ? 35 THR A N    8  
ATOM   9444  C  CA   . THR A 1 35 ? 3.564   -0.126  -6.316  1.00 0.00 ? 35 THR A CA   8  
ATOM   9445  C  C    . THR A 1 35 ? 3.478   -1.557  -5.787  1.00 0.00 ? 35 THR A C    8  
ATOM   9446  O  O    . THR A 1 35 ? 4.205   -1.934  -4.864  1.00 0.00 ? 35 THR A O    8  
ATOM   9447  C  CB   . THR A 1 35 ? 4.551   -0.064  -7.489  1.00 0.00 ? 35 THR A CB   8  
ATOM   9448  O  OG1  . THR A 1 35 ? 5.844   -0.495  -7.088  1.00 0.00 ? 35 THR A OG1  8  
ATOM   9449  C  CG2  . THR A 1 35 ? 4.690   1.321   -8.089  1.00 0.00 ? 35 THR A CG2  8  
ATOM   9450  H  H    . THR A 1 35 ? 4.854   1.203   -5.277  1.00 0.00 ? 35 THR A H    8  
ATOM   9451  H  HA   . THR A 1 35 ? 2.586   0.169   -6.668  1.00 0.00 ? 35 THR A HA   8  
ATOM   9452  H  HB   . THR A 1 35 ? 4.203   -0.728  -8.269  1.00 0.00 ? 35 THR A HB   8  
ATOM   9453  H  HG1  . THR A 1 35 ? 6.251   0.173   -6.532  1.00 0.00 ? 35 THR A HG1  8  
ATOM   9454  H  HG21 . THR A 1 35 ? 3.775   1.872   -7.938  1.00 0.00 ? 35 THR A HG21 8  
ATOM   9455  H  HG22 . THR A 1 35 ? 4.888   1.235   -9.147  1.00 0.00 ? 35 THR A HG22 8  
ATOM   9456  H  HG23 . THR A 1 35 ? 5.508   1.839   -7.609  1.00 0.00 ? 35 THR A HG23 8  
ATOM   9457  N  N    . LYS A 1 36 ? 2.588   -2.351  -6.382  1.00 0.00 ? 36 LYS A N    8  
ATOM   9458  C  CA   . LYS A 1 36 ? 2.408   -3.746  -5.979  1.00 0.00 ? 36 LYS A CA   8  
ATOM   9459  C  C    . LYS A 1 36 ? 3.695   -4.543  -6.189  1.00 0.00 ? 36 LYS A C    8  
ATOM   9460  O  O    . LYS A 1 36 ? 4.032   -5.413  -5.385  1.00 0.00 ? 36 LYS A O    8  
ATOM   9461  C  CB   . LYS A 1 36 ? 1.262   -4.388  -6.767  1.00 0.00 ? 36 LYS A CB   8  
ATOM   9462  C  CG   . LYS A 1 36 ? 0.682   -5.628  -6.100  1.00 0.00 ? 36 LYS A CG   8  
ATOM   9463  C  CD   . LYS A 1 36 ? 1.454   -6.883  -6.485  1.00 0.00 ? 36 LYS A CD   8  
ATOM   9464  C  CE   . LYS A 1 36 ? 0.754   -7.655  -7.594  1.00 0.00 ? 36 LYS A CE   8  
ATOM   9465  N  NZ   . LYS A 1 36 ? 0.642   -6.857  -8.849  1.00 0.00 ? 36 LYS A NZ   8  
ATOM   9466  H  H    . LYS A 1 36 ? 2.043   -1.992  -7.115  1.00 0.00 ? 36 LYS A H    8  
ATOM   9467  H  HA   . LYS A 1 36 ? 2.161   -3.756  -4.927  1.00 0.00 ? 36 LYS A HA   8  
ATOM   9468  H  HB2  . LYS A 1 36 ? 0.469   -3.664  -6.882  1.00 0.00 ? 36 LYS A HB2  8  
ATOM   9469  H  HB3  . LYS A 1 36 ? 1.625   -4.669  -7.744  1.00 0.00 ? 36 LYS A HB3  8  
ATOM   9470  H  HG2  . LYS A 1 36 ? 0.729   -5.505  -5.029  1.00 0.00 ? 36 LYS A HG2  8  
ATOM   9471  H  HG3  . LYS A 1 36 ? -0.347  -5.741  -6.407  1.00 0.00 ? 36 LYS A HG3  8  
ATOM   9472  H  HD2  . LYS A 1 36 ? 2.437   -6.599  -6.827  1.00 0.00 ? 36 LYS A HD2  8  
ATOM   9473  H  HD3  . LYS A 1 36 ? 1.543   -7.519  -5.617  1.00 0.00 ? 36 LYS A HD3  8  
ATOM   9474  H  HE2  . LYS A 1 36 ? 1.318   -8.553  -7.799  1.00 0.00 ? 36 LYS A HE2  8  
ATOM   9475  H  HE3  . LYS A 1 36 ? -0.237  -7.923  -7.257  1.00 0.00 ? 36 LYS A HE3  8  
ATOM   9476  H  HZ1  . LYS A 1 36 ? 0.464   -7.485  -9.659  1.00 0.00 ? 36 LYS A HZ1  8  
ATOM   9477  H  HZ2  . LYS A 1 36 ? 1.524   -6.331  -9.019  1.00 0.00 ? 36 LYS A HZ2  8  
ATOM   9478  H  HZ3  . LYS A 1 36 ? -0.143  -6.179  -8.773  1.00 0.00 ? 36 LYS A HZ3  8  
ATOM   9479  N  N    . GLU A 1 37 ? 4.411   -4.234  -7.272  1.00 0.00 ? 37 GLU A N    8  
ATOM   9480  C  CA   . GLU A 1 37 ? 5.665   -4.914  -7.586  1.00 0.00 ? 37 GLU A CA   8  
ATOM   9481  C  C    . GLU A 1 37 ? 6.692   -4.701  -6.472  1.00 0.00 ? 37 GLU A C    8  
ATOM   9482  O  O    . GLU A 1 37 ? 7.431   -5.621  -6.118  1.00 0.00 ? 37 GLU A O    8  
ATOM   9483  C  CB   . GLU A 1 37 ? 6.227   -4.410  -8.918  1.00 0.00 ? 37 GLU A CB   8  
ATOM   9484  C  CG   . GLU A 1 37 ? 7.210   -5.372  -9.568  1.00 0.00 ? 37 GLU A CG   8  
ATOM   9485  C  CD   . GLU A 1 37 ? 7.417   -5.093  -11.045 1.00 0.00 ? 37 GLU A CD   8  
ATOM   9486  O  OE1  . GLU A 1 37 ? 8.243   -4.215  -11.374 1.00 0.00 ? 37 GLU A OE1  8  
ATOM   9487  O  OE2  . GLU A 1 37 ? 6.754   -5.752  -11.872 1.00 0.00 ? 37 GLU A OE2  8  
ATOM   9488  H  H    . GLU A 1 37 ? 4.090   -3.527  -7.872  1.00 0.00 ? 37 GLU A H    8  
ATOM   9489  H  HA   . GLU A 1 37 ? 5.455   -5.971  -7.671  1.00 0.00 ? 37 GLU A HA   8  
ATOM   9490  H  HB2  . GLU A 1 37 ? 5.408   -4.249  -9.604  1.00 0.00 ? 37 GLU A HB2  8  
ATOM   9491  H  HB3  . GLU A 1 37 ? 6.733   -3.471  -8.749  1.00 0.00 ? 37 GLU A HB3  8  
ATOM   9492  H  HG2  . GLU A 1 37 ? 8.162   -5.286  -9.065  1.00 0.00 ? 37 GLU A HG2  8  
ATOM   9493  H  HG3  . GLU A 1 37 ? 6.835   -6.380  -9.456  1.00 0.00 ? 37 GLU A HG3  8  
ATOM   9494  N  N    . ASP A 1 38 ? 6.727   -3.485  -5.922  1.00 0.00 ? 38 ASP A N    8  
ATOM   9495  C  CA   . ASP A 1 38 ? 7.656   -3.153  -4.842  1.00 0.00 ? 38 ASP A CA   8  
ATOM   9496  C  C    . ASP A 1 38 ? 7.478   -4.108  -3.665  1.00 0.00 ? 38 ASP A C    8  
ATOM   9497  O  O    . ASP A 1 38 ? 8.451   -4.648  -3.143  1.00 0.00 ? 38 ASP A O    8  
ATOM   9498  C  CB   . ASP A 1 38 ? 7.435   -1.709  -4.366  1.00 0.00 ? 38 ASP A CB   8  
ATOM   9499  C  CG   . ASP A 1 38 ? 8.316   -0.696  -5.081  1.00 0.00 ? 38 ASP A CG   8  
ATOM   9500  O  OD1  . ASP A 1 38 ? 8.863   -1.024  -6.155  1.00 0.00 ? 38 ASP A OD1  8  
ATOM   9501  O  OD2  . ASP A 1 38 ? 8.456   0.432   -4.562  1.00 0.00 ? 38 ASP A OD2  8  
ATOM   9502  H  H    . ASP A 1 38 ? 6.108   -2.796  -6.245  1.00 0.00 ? 38 ASP A H    8  
ATOM   9503  H  HA   . ASP A 1 38 ? 8.663   -3.252  -5.224  1.00 0.00 ? 38 ASP A HA   8  
ATOM   9504  H  HB2  . ASP A 1 38 ? 6.404   -1.437  -4.534  1.00 0.00 ? 38 ASP A HB2  8  
ATOM   9505  H  HB3  . ASP A 1 38 ? 7.646   -1.655  -3.306  1.00 0.00 ? 38 ASP A HB3  8  
ATOM   9506  N  N    . LEU A 1 39 ? 6.228   -4.312  -3.261  1.00 0.00 ? 39 LEU A N    8  
ATOM   9507  C  CA   . LEU A 1 39 ? 5.915   -5.204  -2.147  1.00 0.00 ? 39 LEU A CA   8  
ATOM   9508  C  C    . LEU A 1 39 ? 6.344   -6.637  -2.454  1.00 0.00 ? 39 LEU A C    8  
ATOM   9509  O  O    . LEU A 1 39 ? 6.927   -7.312  -1.605  1.00 0.00 ? 39 LEU A O    8  
ATOM   9510  C  CB   . LEU A 1 39 ? 4.421   -5.159  -1.831  1.00 0.00 ? 39 LEU A CB   8  
ATOM   9511  C  CG   . LEU A 1 39 ? 3.841   -3.755  -1.648  1.00 0.00 ? 39 LEU A CG   8  
ATOM   9512  C  CD1  . LEU A 1 39 ? 2.348   -3.763  -1.916  1.00 0.00 ? 39 LEU A CD1  8  
ATOM   9513  C  CD2  . LEU A 1 39 ? 4.138   -3.230  -0.250  1.00 0.00 ? 39 LEU A CD2  8  
ATOM   9514  H  H    . LEU A 1 39 ? 5.496   -3.853  -3.726  1.00 0.00 ? 39 LEU A H    8  
ATOM   9515  H  HA   . LEU A 1 39 ? 6.466   -4.856  -1.285  1.00 0.00 ? 39 LEU A HA   8  
ATOM   9516  H  HB2  . LEU A 1 39 ? 3.891   -5.643  -2.639  1.00 0.00 ? 39 LEU A HB2  8  
ATOM   9517  H  HB3  . LEU A 1 39 ? 4.250   -5.717  -0.923  1.00 0.00 ? 39 LEU A HB3  8  
ATOM   9518  H  HG   . LEU A 1 39 ? 4.302   -3.087  -2.361  1.00 0.00 ? 39 LEU A HG   8  
ATOM   9519  H  HD11 . LEU A 1 39 ? 2.169   -4.010  -2.953  1.00 0.00 ? 39 LEU A HD11 8  
ATOM   9520  H  HD12 . LEU A 1 39 ? 1.939   -2.785  -1.705  1.00 0.00 ? 39 LEU A HD12 8  
ATOM   9521  H  HD13 . LEU A 1 39 ? 1.872   -4.498  -1.284  1.00 0.00 ? 39 LEU A HD13 8  
ATOM   9522  H  HD21 . LEU A 1 39 ? 5.145   -3.502  0.030   1.00 0.00 ? 39 LEU A HD21 8  
ATOM   9523  H  HD22 . LEU A 1 39 ? 3.441   -3.661  0.453   1.00 0.00 ? 39 LEU A HD22 8  
ATOM   9524  H  HD23 . LEU A 1 39 ? 4.040   -2.154  -0.242  1.00 0.00 ? 39 LEU A HD23 8  
ATOM   9525  N  N    . GLU A 1 40 ? 6.057   -7.097  -3.674  1.00 0.00 ? 40 GLU A N    8  
ATOM   9526  C  CA   . GLU A 1 40 ? 6.423   -8.452  -4.087  1.00 0.00 ? 40 GLU A CA   8  
ATOM   9527  C  C    . GLU A 1 40 ? 7.939   -8.661  -4.033  1.00 0.00 ? 40 GLU A C    8  
ATOM   9528  O  O    . GLU A 1 40 ? 8.406   -9.779  -3.821  1.00 0.00 ? 40 GLU A O    8  
ATOM   9529  C  CB   . GLU A 1 40 ? 5.905   -8.737  -5.498  1.00 0.00 ? 40 GLU A CB   8  
ATOM   9530  C  CG   . GLU A 1 40 ? 4.388   -8.799  -5.586  1.00 0.00 ? 40 GLU A CG   8  
ATOM   9531  C  CD   . GLU A 1 40 ? 3.891   -9.027  -7.001  1.00 0.00 ? 40 GLU A CD   8  
ATOM   9532  O  OE1  . GLU A 1 40 ? 4.122   -8.150  -7.862  1.00 0.00 ? 40 GLU A OE1  8  
ATOM   9533  O  OE2  . GLU A 1 40 ? 3.267   -10.080 -7.246  1.00 0.00 ? 40 GLU A OE2  8  
ATOM   9534  H  H    . GLU A 1 40 ? 5.592   -6.511  -4.311  1.00 0.00 ? 40 GLU A H    8  
ATOM   9535  H  HA   . GLU A 1 40 ? 5.957   -9.141  -3.399  1.00 0.00 ? 40 GLU A HA   8  
ATOM   9536  H  HB2  . GLU A 1 40 ? 6.251   -7.957  -6.159  1.00 0.00 ? 40 GLU A HB2  8  
ATOM   9537  H  HB3  . GLU A 1 40 ? 6.303   -9.684  -5.829  1.00 0.00 ? 40 GLU A HB3  8  
ATOM   9538  H  HG2  . GLU A 1 40 ? 4.038   -9.609  -4.964  1.00 0.00 ? 40 GLU A HG2  8  
ATOM   9539  H  HG3  . GLU A 1 40 ? 3.981   -7.867  -5.224  1.00 0.00 ? 40 GLU A HG3  8  
ATOM   9540  N  N    . ASN A 1 41 ? 8.701   -7.583  -4.228  1.00 0.00 ? 41 ASN A N    8  
ATOM   9541  C  CA   . ASN A 1 41 ? 10.160  -7.658  -4.198  1.00 0.00 ? 41 ASN A CA   8  
ATOM   9542  C  C    . ASN A 1 41 ? 10.705  -7.470  -2.783  1.00 0.00 ? 41 ASN A C    8  
ATOM   9543  O  O    . ASN A 1 41 ? 11.697  -8.098  -2.408  1.00 0.00 ? 41 ASN A O    8  
ATOM   9544  C  CB   . ASN A 1 41 ? 10.767  -6.596  -5.119  1.00 0.00 ? 41 ASN A CB   8  
ATOM   9545  C  CG   . ASN A 1 41 ? 10.998  -7.109  -6.527  1.00 0.00 ? 41 ASN A CG   8  
ATOM   9546  O  OD1  . ASN A 1 41 ? 11.221  -8.302  -6.741  1.00 0.00 ? 41 ASN A OD1  8  
ATOM   9547  N  ND2  . ASN A 1 41 ? 10.950  -6.206  -7.500  1.00 0.00 ? 41 ASN A ND2  8  
ATOM   9548  H  H    . ASN A 1 41 ? 8.272   -6.716  -4.396  1.00 0.00 ? 41 ASN A H    8  
ATOM   9549  H  HA   . ASN A 1 41 ? 10.448  -8.636  -4.556  1.00 0.00 ? 41 ASN A HA   8  
ATOM   9550  H  HB2  . ASN A 1 41 ? 10.101  -5.747  -5.168  1.00 0.00 ? 41 ASN A HB2  8  
ATOM   9551  H  HB3  . ASN A 1 41 ? 11.717  -6.278  -4.711  1.00 0.00 ? 41 ASN A HB3  8  
ATOM   9552  H  HD21 . ASN A 1 41 ? 10.772  -5.273  -7.259  1.00 0.00 ? 41 ASN A HD21 8  
ATOM   9553  H  HD22 . ASN A 1 41 ? 11.095  -6.511  -8.421  1.00 0.00 ? 41 ASN A HD22 8  
ATOM   9554  N  N    . GLY A 1 42 ? 10.066  -6.591  -2.010  1.00 0.00 ? 42 GLY A N    8  
ATOM   9555  C  CA   . GLY A 1 42 ? 10.511  -6.321  -0.654  1.00 0.00 ? 42 GLY A CA   8  
ATOM   9556  C  C    . GLY A 1 42 ? 10.371  -4.853  -0.272  1.00 0.00 ? 42 GLY A C    8  
ATOM   9557  O  O    . GLY A 1 42 ? 10.448  -4.508  0.908   1.00 0.00 ? 42 GLY A O    8  
ATOM   9558  H  H    . GLY A 1 42 ? 9.289   -6.110  -2.368  1.00 0.00 ? 42 GLY A H    8  
ATOM   9559  H  HA2  . GLY A 1 42 ? 9.926   -6.919  0.029   1.00 0.00 ? 42 GLY A HA2  8  
ATOM   9560  H  HA3  . GLY A 1 42 ? 11.549  -6.605  -0.565  1.00 0.00 ? 42 GLY A HA3  8  
ATOM   9561  N  N    . GLU A 1 43 ? 10.164  -3.988  -1.272  1.00 0.00 ? 43 GLU A N    8  
ATOM   9562  C  CA   . GLU A 1 43 ? 10.011  -2.557  -1.041  1.00 0.00 ? 43 GLU A CA   8  
ATOM   9563  C  C    . GLU A 1 43 ? 8.690   -2.251  -0.336  1.00 0.00 ? 43 GLU A C    8  
ATOM   9564  O  O    . GLU A 1 43 ? 7.710   -1.853  -0.964  1.00 0.00 ? 43 GLU A O    8  
ATOM   9565  C  CB   . GLU A 1 43 ? 10.085  -1.791  -2.366  1.00 0.00 ? 43 GLU A CB   8  
ATOM   9566  C  CG   . GLU A 1 43 ? 11.499  -1.596  -2.884  1.00 0.00 ? 43 GLU A CG   8  
ATOM   9567  C  CD   . GLU A 1 43 ? 11.647  -0.324  -3.696  1.00 0.00 ? 43 GLU A CD   8  
ATOM   9568  O  OE1  . GLU A 1 43 ? 11.462  0.772   -3.123  1.00 0.00 ? 43 GLU A OE1  8  
ATOM   9569  O  OE2  . GLU A 1 43 ? 11.943  -0.423  -4.905  1.00 0.00 ? 43 GLU A OE2  8  
ATOM   9570  H  H    . GLU A 1 43 ? 10.112  -4.323  -2.190  1.00 0.00 ? 43 GLU A H    8  
ATOM   9571  H  HA   . GLU A 1 43 ? 10.825  -2.238  -0.407  1.00 0.00 ? 43 GLU A HA   8  
ATOM   9572  H  HB2  . GLU A 1 43 ? 9.525   -2.333  -3.115  1.00 0.00 ? 43 GLU A HB2  8  
ATOM   9573  H  HB3  . GLU A 1 43 ? 9.639   -0.817  -2.231  1.00 0.00 ? 43 GLU A HB3  8  
ATOM   9574  H  HG2  . GLU A 1 43 ? 12.175  -1.548  -2.043  1.00 0.00 ? 43 GLU A HG2  8  
ATOM   9575  H  HG3  . GLU A 1 43 ? 11.760  -2.439  -3.509  1.00 0.00 ? 43 GLU A HG3  8  
ATOM   9576  N  N    . ASP A 1 44 ? 8.679   -2.440  0.976   1.00 0.00 ? 44 ASP A N    8  
ATOM   9577  C  CA   . ASP A 1 44 ? 7.494   -2.183  1.790   1.00 0.00 ? 44 ASP A CA   8  
ATOM   9578  C  C    . ASP A 1 44 ? 7.570   -0.792  2.423   1.00 0.00 ? 44 ASP A C    8  
ATOM   9579  O  O    . ASP A 1 44 ? 7.199   -0.605  3.585   1.00 0.00 ? 44 ASP A O    8  
ATOM   9580  C  CB   . ASP A 1 44 ? 7.344   -3.258  2.876   1.00 0.00 ? 44 ASP A CB   8  
ATOM   9581  C  CG   . ASP A 1 44 ? 8.613   -3.487  3.676   1.00 0.00 ? 44 ASP A CG   8  
ATOM   9582  O  OD1  . ASP A 1 44 ? 9.053   -2.557  4.381   1.00 0.00 ? 44 ASP A OD1  8  
ATOM   9583  O  OD2  . ASP A 1 44 ? 9.158   -4.607  3.605   1.00 0.00 ? 44 ASP A OD2  8  
ATOM   9584  H  H    . ASP A 1 44 ? 9.493   -2.757  1.409   1.00 0.00 ? 44 ASP A H    8  
ATOM   9585  H  HA   . ASP A 1 44 ? 6.629   -2.219  1.140   1.00 0.00 ? 44 ASP A HA   8  
ATOM   9586  H  HB2  . ASP A 1 44 ? 6.563   -2.963  3.561   1.00 0.00 ? 44 ASP A HB2  8  
ATOM   9587  H  HB3  . ASP A 1 44 ? 7.069   -4.190  2.405   1.00 0.00 ? 44 ASP A HB3  8  
ATOM   9588  N  N    . VAL A 1 45 ? 8.051   0.180   1.649   1.00 0.00 ? 45 VAL A N    8  
ATOM   9589  C  CA   . VAL A 1 45 ? 8.177   1.552   2.128   1.00 0.00 ? 45 VAL A CA   8  
ATOM   9590  C  C    . VAL A 1 45 ? 7.511   2.536   1.175   1.00 0.00 ? 45 VAL A C    8  
ATOM   9591  O  O    . VAL A 1 45 ? 7.708   2.468   -0.039  1.00 0.00 ? 45 VAL A O    8  
ATOM   9592  C  CB   . VAL A 1 45 ? 9.652   1.978   2.312   1.00 0.00 ? 45 VAL A CB   8  
ATOM   9593  C  CG1  . VAL A 1 45 ? 10.004  2.040   3.784   1.00 0.00 ? 45 VAL A CG1  8  
ATOM   9594  C  CG2  . VAL A 1 45 ? 10.601  1.042   1.576   1.00 0.00 ? 45 VAL A CG2  8  
ATOM   9595  H  H    . VAL A 1 45 ? 8.329   -0.028  0.735   1.00 0.00 ? 45 VAL A H    8  
ATOM   9596  H  HA   . VAL A 1 45 ? 7.686   1.613   3.089   1.00 0.00 ? 45 VAL A HA   8  
ATOM   9597  H  HB   . VAL A 1 45 ? 9.770   2.969   1.898   1.00 0.00 ? 45 VAL A HB   8  
ATOM   9598  H  HG11 . VAL A 1 45 ? 9.557   2.919   4.224   1.00 0.00 ? 45 VAL A HG11 8  
ATOM   9599  H  HG12 . VAL A 1 45 ? 11.077  2.087   3.896   1.00 0.00 ? 45 VAL A HG12 8  
ATOM   9600  H  HG13 . VAL A 1 45 ? 9.626   1.159   4.278   1.00 0.00 ? 45 VAL A HG13 8  
ATOM   9601  H  HG21 . VAL A 1 45 ? 10.207  0.830   0.592   1.00 0.00 ? 45 VAL A HG21 8  
ATOM   9602  H  HG22 . VAL A 1 45 ? 10.699  0.122   2.132   1.00 0.00 ? 45 VAL A HG22 8  
ATOM   9603  H  HG23 . VAL A 1 45 ? 11.569  1.512   1.483   1.00 0.00 ? 45 VAL A HG23 8  
ATOM   9604  N  N    . ALA A 1 46 ? 6.741   3.460   1.737   1.00 0.00 ? 46 ALA A N    8  
ATOM   9605  C  CA   . ALA A 1 46 ? 6.063   4.477   0.946   1.00 0.00 ? 46 ALA A CA   8  
ATOM   9606  C  C    . ALA A 1 46 ? 6.640   5.854   1.254   1.00 0.00 ? 46 ALA A C    8  
ATOM   9607  O  O    . ALA A 1 46 ? 6.935   6.168   2.410   1.00 0.00 ? 46 ALA A O    8  
ATOM   9608  C  CB   . ALA A 1 46 ? 4.561   4.448   1.201   1.00 0.00 ? 46 ALA A CB   8  
ATOM   9609  H  H    . ALA A 1 46 ? 6.637   3.468   2.712   1.00 0.00 ? 46 ALA A H    8  
ATOM   9610  H  HA   . ALA A 1 46 ? 6.233   4.254   -0.099  1.00 0.00 ? 46 ALA A HA   8  
ATOM   9611  H  HB1  . ALA A 1 46 ? 4.279   5.301   1.800   1.00 0.00 ? 46 ALA A HB1  8  
ATOM   9612  H  HB2  . ALA A 1 46 ? 4.300   3.539   1.725   1.00 0.00 ? 46 ALA A HB2  8  
ATOM   9613  H  HB3  . ALA A 1 46 ? 4.035   4.482   0.258   1.00 0.00 ? 46 ALA A HB3  8  
ATOM   9614  N  N    . THR A 1 47 ? 6.810   6.667   0.217   1.00 0.00 ? 47 THR A N    8  
ATOM   9615  C  CA   . THR A 1 47 ? 7.363   8.007   0.375   1.00 0.00 ? 47 THR A CA   8  
ATOM   9616  C  C    . THR A 1 47 ? 6.356   9.065   -0.076  1.00 0.00 ? 47 THR A C    8  
ATOM   9617  O  O    . THR A 1 47 ? 5.763   8.953   -1.151  1.00 0.00 ? 47 THR A O    8  
ATOM   9618  C  CB   . THR A 1 47 ? 8.668   8.144   -0.418  1.00 0.00 ? 47 THR A CB   8  
ATOM   9619  O  OG1  . THR A 1 47 ? 9.460   6.972   -0.293  1.00 0.00 ? 47 THR A OG1  8  
ATOM   9620  C  CG2  . THR A 1 47 ? 9.518   9.316   0.024   1.00 0.00 ? 47 THR A CG2  8  
ATOM   9621  H  H    . THR A 1 47 ? 6.563   6.356   -0.679  1.00 0.00 ? 47 THR A H    8  
ATOM   9622  H  HA   . THR A 1 47 ? 7.573   8.156   1.424   1.00 0.00 ? 47 THR A HA   8  
ATOM   9623  H  HB   . THR A 1 47 ? 8.432   8.283   -1.464  1.00 0.00 ? 47 THR A HB   8  
ATOM   9624  H  HG1  . THR A 1 47 ? 9.166   6.314   -0.929  1.00 0.00 ? 47 THR A HG1  8  
ATOM   9625  H  HG21 . THR A 1 47 ? 9.165   10.217  -0.454  1.00 0.00 ? 47 THR A HG21 8  
ATOM   9626  H  HG22 . THR A 1 47 ? 10.547  9.141   -0.254  1.00 0.00 ? 47 THR A HG22 8  
ATOM   9627  H  HG23 . THR A 1 47 ? 9.449   9.427   1.097   1.00 0.00 ? 47 THR A HG23 8  
ATOM   9628  N  N    . CYS A 1 48 ? 6.167   10.088  0.758   1.00 0.00 ? 48 CYS A N    8  
ATOM   9629  C  CA   . CYS A 1 48 ? 5.233   11.168  0.451   1.00 0.00 ? 48 CYS A CA   8  
ATOM   9630  C  C    . CYS A 1 48 ? 5.943   12.309  -0.274  1.00 0.00 ? 48 CYS A C    8  
ATOM   9631  O  O    . CYS A 1 48 ? 7.041   12.711  0.114   1.00 0.00 ? 48 CYS A O    8  
ATOM   9632  C  CB   . CYS A 1 48 ? 4.583   11.697  1.735   1.00 0.00 ? 48 CYS A CB   8  
ATOM   9633  S  SG   . CYS A 1 48 ? 2.857   12.242  1.529   1.00 0.00 ? 48 CYS A SG   8  
ATOM   9634  H  H    . CYS A 1 48 ? 6.668   10.116  1.600   1.00 0.00 ? 48 CYS A H    8  
ATOM   9635  H  HA   . CYS A 1 48 ? 4.464   10.767  -0.190  1.00 0.00 ? 48 CYS A HA   8  
ATOM   9636  H  HB2  . CYS A 1 48 ? 4.593   10.919  2.484   1.00 0.00 ? 48 CYS A HB2  8  
ATOM   9637  H  HB3  . CYS A 1 48 ? 5.152   12.542  2.095   1.00 0.00 ? 48 CYS A HB3  8  
ATOM   9638  N  N    . PRO A 1 49 ? 5.322   12.852  -1.339  1.00 0.00 ? 49 PRO A N    8  
ATOM   9639  C  CA   . PRO A 1 49 ? 5.902   13.955  -2.114  1.00 0.00 ? 49 PRO A CA   8  
ATOM   9640  C  C    . PRO A 1 49 ? 5.755   15.320  -1.428  1.00 0.00 ? 49 PRO A C    8  
ATOM   9641  O  O    . PRO A 1 49 ? 6.227   16.332  -1.952  1.00 0.00 ? 49 PRO A O    8  
ATOM   9642  C  CB   . PRO A 1 49 ? 5.097   13.920  -3.413  1.00 0.00 ? 49 PRO A CB   8  
ATOM   9643  C  CG   . PRO A 1 49 ? 3.764   13.379  -3.017  1.00 0.00 ? 49 PRO A CG   8  
ATOM   9644  C  CD   . PRO A 1 49 ? 4.009   12.433  -1.870  1.00 0.00 ? 49 PRO A CD   8  
ATOM   9645  H  HA   . PRO A 1 49 ? 6.943   13.777  -2.332  1.00 0.00 ? 49 PRO A HA   8  
ATOM   9646  H  HB2  . PRO A 1 49 ? 5.015   14.920  -3.814  1.00 0.00 ? 49 PRO A HB2  8  
ATOM   9647  H  HB3  . PRO A 1 49 ? 5.587   13.277  -4.127  1.00 0.00 ? 49 PRO A HB3  8  
ATOM   9648  H  HG2  . PRO A 1 49 ? 3.121   14.186  -2.703  1.00 0.00 ? 49 PRO A HG2  8  
ATOM   9649  H  HG3  . PRO A 1 49 ? 3.324   12.851  -3.849  1.00 0.00 ? 49 PRO A HG3  8  
ATOM   9650  H  HD2  . PRO A 1 49 ? 3.236   12.543  -1.123  1.00 0.00 ? 49 PRO A HD2  8  
ATOM   9651  H  HD3  . PRO A 1 49 ? 4.049   11.414  -2.225  1.00 0.00 ? 49 PRO A HD3  8  
ATOM   9652  N  N    . SER A 1 50 ? 5.099   15.349  -0.264  1.00 0.00 ? 50 SER A N    8  
ATOM   9653  C  CA   . SER A 1 50 ? 4.901   16.595  0.473   1.00 0.00 ? 50 SER A CA   8  
ATOM   9654  C  C    . SER A 1 50 ? 5.744   16.624  1.747   1.00 0.00 ? 50 SER A C    8  
ATOM   9655  O  O    . SER A 1 50 ? 6.656   17.443  1.874   1.00 0.00 ? 50 SER A O    8  
ATOM   9656  C  CB   . SER A 1 50 ? 3.419   16.780  0.815   1.00 0.00 ? 50 SER A CB   8  
ATOM   9657  O  OG   . SER A 1 50 ? 3.040   18.142  0.709   1.00 0.00 ? 50 SER A OG   8  
ATOM   9658  H  H    . SER A 1 50 ? 4.740   14.518  0.107   1.00 0.00 ? 50 SER A H    8  
ATOM   9659  H  HA   . SER A 1 50 ? 5.214   17.407  -0.167  1.00 0.00 ? 50 SER A HA   8  
ATOM   9660  H  HB2  . SER A 1 50 ? 2.818   16.198  0.132   1.00 0.00 ? 50 SER A HB2  8  
ATOM   9661  H  HB3  . SER A 1 50 ? 3.240   16.446  1.827   1.00 0.00 ? 50 SER A HB3  8  
ATOM   9662  H  HG   . SER A 1 50 ? 2.851   18.490  1.584   1.00 0.00 ? 50 SER A HG   8  
ATOM   9663  N  N    . CYS A 1 51 ? 5.436   15.732  2.689   1.00 0.00 ? 51 CYS A N    8  
ATOM   9664  C  CA   . CYS A 1 51 ? 6.172   15.668  3.953   1.00 0.00 ? 51 CYS A CA   8  
ATOM   9665  C  C    . CYS A 1 51 ? 7.504   14.928  3.802   1.00 0.00 ? 51 CYS A C    8  
ATOM   9666  O  O    . CYS A 1 51 ? 8.432   15.147  4.583   1.00 0.00 ? 51 CYS A O    8  
ATOM   9667  C  CB   . CYS A 1 51 ? 5.325   14.991  5.032   1.00 0.00 ? 51 CYS A CB   8  
ATOM   9668  S  SG   . CYS A 1 51 ? 4.959   13.236  4.704   1.00 0.00 ? 51 CYS A SG   8  
ATOM   9669  H  H    . CYS A 1 51 ? 4.697   15.105  2.533   1.00 0.00 ? 51 CYS A H    8  
ATOM   9670  H  HA   . CYS A 1 51 ? 6.376   16.683  4.262   1.00 0.00 ? 51 CYS A HA   8  
ATOM   9671  H  HB2  . CYS A 1 51 ? 5.849   15.048  5.975   1.00 0.00 ? 51 CYS A HB2  8  
ATOM   9672  H  HB3  . CYS A 1 51 ? 4.382   15.512  5.119   1.00 0.00 ? 51 CYS A HB3  8  
ATOM   9673  N  N    . SER A 1 52 ? 7.593   14.047  2.799   1.00 0.00 ? 52 SER A N    8  
ATOM   9674  C  CA   . SER A 1 52 ? 8.812   13.272  2.553   1.00 0.00 ? 52 SER A CA   8  
ATOM   9675  C  C    . SER A 1 52 ? 9.101   12.316  3.714   1.00 0.00 ? 52 SER A C    8  
ATOM   9676  O  O    . SER A 1 52 ? 10.255  12.130  4.109   1.00 0.00 ? 52 SER A O    8  
ATOM   9677  C  CB   . SER A 1 52 ? 10.007  14.211  2.325   1.00 0.00 ? 52 SER A CB   8  
ATOM   9678  O  OG   . SER A 1 52 ? 9.606   15.423  1.705   1.00 0.00 ? 52 SER A OG   8  
ATOM   9679  H  H    . SER A 1 52 ? 6.820   13.910  2.213   1.00 0.00 ? 52 SER A H    8  
ATOM   9680  H  HA   . SER A 1 52 ? 8.653   12.689  1.659   1.00 0.00 ? 52 SER A HA   8  
ATOM   9681  H  HB2  . SER A 1 52 ? 10.462  14.444  3.275   1.00 0.00 ? 52 SER A HB2  8  
ATOM   9682  H  HB3  . SER A 1 52 ? 10.731  13.720  1.691   1.00 0.00 ? 52 SER A HB3  8  
ATOM   9683  H  HG   . SER A 1 52 ? 9.288   15.241  0.817   1.00 0.00 ? 52 SER A HG   8  
ATOM   9684  N  N    . LEU A 1 53 ? 8.043   11.708  4.250   1.00 0.00 ? 53 LEU A N    8  
ATOM   9685  C  CA   . LEU A 1 53 ? 8.172   10.767  5.360   1.00 0.00 ? 53 LEU A CA   8  
ATOM   9686  C  C    . LEU A 1 53 ? 8.222   9.327   4.848   1.00 0.00 ? 53 LEU A C    8  
ATOM   9687  O  O    . LEU A 1 53 ? 8.155   9.088   3.641   1.00 0.00 ? 53 LEU A O    8  
ATOM   9688  C  CB   . LEU A 1 53 ? 6.999   10.934  6.334   1.00 0.00 ? 53 LEU A CB   8  
ATOM   9689  C  CG   . LEU A 1 53 ? 7.162   12.049  7.371   1.00 0.00 ? 53 LEU A CG   8  
ATOM   9690  C  CD1  . LEU A 1 53 ? 5.802   12.502  7.881   1.00 0.00 ? 53 LEU A CD1  8  
ATOM   9691  C  CD2  . LEU A 1 53 ? 8.042   11.588  8.525   1.00 0.00 ? 53 LEU A CD2  8  
ATOM   9692  H  H    . LEU A 1 53 ? 7.151   11.894  3.886   1.00 0.00 ? 53 LEU A H    8  
ATOM   9693  H  HA   . LEU A 1 53 ? 9.095   10.986  5.877   1.00 0.00 ? 53 LEU A HA   8  
ATOM   9694  H  HB2  . LEU A 1 53 ? 6.108   11.137  5.758   1.00 0.00 ? 53 LEU A HB2  8  
ATOM   9695  H  HB3  . LEU A 1 53 ? 6.860   10.003  6.861   1.00 0.00 ? 53 LEU A HB3  8  
ATOM   9696  H  HG   . LEU A 1 53 ? 7.641   12.898  6.903   1.00 0.00 ? 53 LEU A HG   8  
ATOM   9697  H  HD11 . LEU A 1 53 ? 5.872   12.743  8.932   1.00 0.00 ? 53 LEU A HD11 8  
ATOM   9698  H  HD12 . LEU A 1 53 ? 5.082   11.708  7.742   1.00 0.00 ? 53 LEU A HD12 8  
ATOM   9699  H  HD13 . LEU A 1 53 ? 5.484   13.375  7.333   1.00 0.00 ? 53 LEU A HD13 8  
ATOM   9700  H  HD21 . LEU A 1 53 ? 7.726   12.075  9.436   1.00 0.00 ? 53 LEU A HD21 8  
ATOM   9701  H  HD22 . LEU A 1 53 ? 9.072   11.843  8.318   1.00 0.00 ? 53 LEU A HD22 8  
ATOM   9702  H  HD23 . LEU A 1 53 ? 7.955   10.517  8.641   1.00 0.00 ? 53 LEU A HD23 8  
ATOM   9703  N  N    . ILE A 1 54 ? 8.331   8.370   5.773   1.00 0.00 ? 54 ILE A N    8  
ATOM   9704  C  CA   . ILE A 1 54 ? 8.379   6.955   5.405   1.00 0.00 ? 54 ILE A CA   8  
ATOM   9705  C  C    . ILE A 1 54 ? 7.358   6.141   6.201   1.00 0.00 ? 54 ILE A C    8  
ATOM   9706  O  O    . ILE A 1 54 ? 7.121   6.407   7.380   1.00 0.00 ? 54 ILE A O    8  
ATOM   9707  C  CB   . ILE A 1 54 ? 9.786   6.349   5.622   1.00 0.00 ? 54 ILE A CB   8  
ATOM   9708  C  CG1  . ILE A 1 54 ? 10.214  6.484   7.088   1.00 0.00 ? 54 ILE A CG1  8  
ATOM   9709  C  CG2  . ILE A 1 54 ? 10.803  7.010   4.701   1.00 0.00 ? 54 ILE A CG2  8  
ATOM   9710  C  CD1  . ILE A 1 54 ? 11.489  5.738   7.418   1.00 0.00 ? 54 ILE A CD1  8  
ATOM   9711  H  H    . ILE A 1 54 ? 8.376   8.619   6.720   1.00 0.00 ? 54 ILE A H    8  
ATOM   9712  H  HA   . ILE A 1 54 ? 8.138   6.880   4.354   1.00 0.00 ? 54 ILE A HA   8  
ATOM   9713  H  HB   . ILE A 1 54 ? 9.739   5.301   5.368   1.00 0.00 ? 54 ILE A HB   8  
ATOM   9714  H  HG12 . ILE A 1 54 ? 10.374  7.526   7.316   1.00 0.00 ? 54 ILE A HG12 8  
ATOM   9715  H  HG13 . ILE A 1 54 ? 9.430   6.099   7.723   1.00 0.00 ? 54 ILE A HG13 8  
ATOM   9716  H  HG21 . ILE A 1 54 ? 10.317  7.307   3.782   1.00 0.00 ? 54 ILE A HG21 8  
ATOM   9717  H  HG22 . ILE A 1 54 ? 11.595  6.310   4.480   1.00 0.00 ? 54 ILE A HG22 8  
ATOM   9718  H  HG23 . ILE A 1 54 ? 11.217  7.881   5.186   1.00 0.00 ? 54 ILE A HG23 8  
ATOM   9719  H  HD11 . ILE A 1 54 ? 11.602  5.674   8.490   1.00 0.00 ? 54 ILE A HD11 8  
ATOM   9720  H  HD12 . ILE A 1 54 ? 12.333  6.263   6.997   1.00 0.00 ? 54 ILE A HD12 8  
ATOM   9721  H  HD13 . ILE A 1 54 ? 11.441  4.742   7.000   1.00 0.00 ? 54 ILE A HD13 8  
ATOM   9722  N  N    . ILE A 1 55 ? 6.766   5.141   5.546   1.00 0.00 ? 55 ILE A N    8  
ATOM   9723  C  CA   . ILE A 1 55 ? 5.776   4.277   6.190   1.00 0.00 ? 55 ILE A CA   8  
ATOM   9724  C  C    . ILE A 1 55 ? 5.961   2.821   5.767   1.00 0.00 ? 55 ILE A C    8  
ATOM   9725  O  O    . ILE A 1 55 ? 6.305   2.539   4.618   1.00 0.00 ? 55 ILE A O    8  
ATOM   9726  C  CB   . ILE A 1 55 ? 4.330   4.714   5.867   1.00 0.00 ? 55 ILE A CB   8  
ATOM   9727  C  CG1  . ILE A 1 55 ? 4.106   4.777   4.352   1.00 0.00 ? 55 ILE A CG1  8  
ATOM   9728  C  CG2  . ILE A 1 55 ? 4.017   6.060   6.508   1.00 0.00 ? 55 ILE A CG2  8  
ATOM   9729  C  CD1  . ILE A 1 55 ? 2.678   4.487   3.940   1.00 0.00 ? 55 ILE A CD1  8  
ATOM   9730  H  H    . ILE A 1 55 ? 7.003   4.976   4.609   1.00 0.00 ? 55 ILE A H    8  
ATOM   9731  H  HA   . ILE A 1 55 ? 5.920   4.349   7.258   1.00 0.00 ? 55 ILE A HA   8  
ATOM   9732  H  HB   . ILE A 1 55 ? 3.657   3.982   6.290   1.00 0.00 ? 55 ILE A HB   8  
ATOM   9733  H  HG12 . ILE A 1 55 ? 4.360   5.764   3.998   1.00 0.00 ? 55 ILE A HG12 8  
ATOM   9734  H  HG13 . ILE A 1 55 ? 4.744   4.052   3.870   1.00 0.00 ? 55 ILE A HG13 8  
ATOM   9735  H  HG21 . ILE A 1 55 ? 4.727   6.797   6.164   1.00 0.00 ? 55 ILE A HG21 8  
ATOM   9736  H  HG22 . ILE A 1 55 ? 4.084   5.969   7.582   1.00 0.00 ? 55 ILE A HG22 8  
ATOM   9737  H  HG23 . ILE A 1 55 ? 3.019   6.365   6.233   1.00 0.00 ? 55 ILE A HG23 8  
ATOM   9738  H  HD11 . ILE A 1 55 ? 2.147   4.038   4.767   1.00 0.00 ? 55 ILE A HD11 8  
ATOM   9739  H  HD12 . ILE A 1 55 ? 2.676   3.810   3.100   1.00 0.00 ? 55 ILE A HD12 8  
ATOM   9740  H  HD13 . ILE A 1 55 ? 2.192   5.409   3.658   1.00 0.00 ? 55 ILE A HD13 8  
ATOM   9741  N  N    . LYS A 1 56 ? 5.732   1.899   6.703   1.00 0.00 ? 56 LYS A N    8  
ATOM   9742  C  CA   . LYS A 1 56 ? 5.875   0.471   6.423   1.00 0.00 ? 56 LYS A CA   8  
ATOM   9743  C  C    . LYS A 1 56 ? 4.563   -0.140  5.964   1.00 0.00 ? 56 LYS A C    8  
ATOM   9744  O  O    . LYS A 1 56 ? 3.510   0.075   6.567   1.00 0.00 ? 56 LYS A O    8  
ATOM   9745  C  CB   . LYS A 1 56 ? 6.397   -0.273  7.654   1.00 0.00 ? 56 LYS A CB   8  
ATOM   9746  C  CG   . LYS A 1 56 ? 7.298   -1.454  7.322   1.00 0.00 ? 56 LYS A CG   8  
ATOM   9747  C  CD   . LYS A 1 56 ? 6.538   -2.563  6.607   1.00 0.00 ? 56 LYS A CD   8  
ATOM   9748  C  CE   . LYS A 1 56 ? 7.131   -3.933  6.905   1.00 0.00 ? 56 LYS A CE   8  
ATOM   9749  N  NZ   . LYS A 1 56 ? 6.743   -4.947  5.882   1.00 0.00 ? 56 LYS A NZ   8  
ATOM   9750  H  H    . LYS A 1 56 ? 5.462   2.184   7.603   1.00 0.00 ? 56 LYS A H    8  
ATOM   9751  H  HA   . LYS A 1 56 ? 6.586   0.365   5.620   1.00 0.00 ? 56 LYS A HA   8  
ATOM   9752  H  HB2  . LYS A 1 56 ? 6.957   0.416   8.268   1.00 0.00 ? 56 LYS A HB2  8  
ATOM   9753  H  HB3  . LYS A 1 56 ? 5.553   -0.641  8.221   1.00 0.00 ? 56 LYS A HB3  8  
ATOM   9754  H  HG2  . LYS A 1 56 ? 8.100   -1.114  6.682   1.00 0.00 ? 56 LYS A HG2  8  
ATOM   9755  H  HG3  . LYS A 1 56 ? 7.712   -1.846  8.240   1.00 0.00 ? 56 LYS A HG3  8  
ATOM   9756  H  HD2  . LYS A 1 56 ? 5.509   -2.550  6.934   1.00 0.00 ? 56 LYS A HD2  8  
ATOM   9757  H  HD3  . LYS A 1 56 ? 6.583   -2.386  5.543   1.00 0.00 ? 56 LYS A HD3  8  
ATOM   9758  H  HE2  . LYS A 1 56 ? 8.207   -3.848  6.922   1.00 0.00 ? 56 LYS A HE2  8  
ATOM   9759  H  HE3  . LYS A 1 56 ? 6.780   -4.259  7.874   1.00 0.00 ? 56 LYS A HE3  8  
ATOM   9760  H  HZ1  . LYS A 1 56 ? 5.948   -4.596  5.308   1.00 0.00 ? 56 LYS A HZ1  8  
ATOM   9761  H  HZ2  . LYS A 1 56 ? 6.456   -5.832  6.348   1.00 0.00 ? 56 LYS A HZ2  8  
ATOM   9762  H  HZ3  . LYS A 1 56 ? 7.547   -5.147  5.252   1.00 0.00 ? 56 LYS A HZ3  8  
ATOM   9763  N  N    . VAL A 1 57 ? 4.648   -0.908  4.886   1.00 0.00 ? 57 VAL A N    8  
ATOM   9764  C  CA   . VAL A 1 57 ? 3.487   -1.568  4.319   1.00 0.00 ? 57 VAL A CA   8  
ATOM   9765  C  C    . VAL A 1 57 ? 3.520   -3.068  4.606   1.00 0.00 ? 57 VAL A C    8  
ATOM   9766  O  O    . VAL A 1 57 ? 4.416   -3.778  4.144   1.00 0.00 ? 57 VAL A O    8  
ATOM   9767  C  CB   . VAL A 1 57 ? 3.388   -1.338  2.794   1.00 0.00 ? 57 VAL A CB   8  
ATOM   9768  C  CG1  . VAL A 1 57 ? 1.936   -1.197  2.390   1.00 0.00 ? 57 VAL A CG1  8  
ATOM   9769  C  CG2  . VAL A 1 57 ? 4.173   -0.102  2.366   1.00 0.00 ? 57 VAL A CG2  8  
ATOM   9770  H  H    . VAL A 1 57 ? 5.522   -1.036  4.458   1.00 0.00 ? 57 VAL A H    8  
ATOM   9771  H  HA   . VAL A 1 57 ? 2.608   -1.142  4.782   1.00 0.00 ? 57 VAL A HA   8  
ATOM   9772  H  HB   . VAL A 1 57 ? 3.806   -2.197  2.286   1.00 0.00 ? 57 VAL A HB   8  
ATOM   9773  H  HG11 . VAL A 1 57 ? 1.422   -2.131  2.558   1.00 0.00 ? 57 VAL A HG11 8  
ATOM   9774  H  HG12 . VAL A 1 57 ? 1.877   -0.933  1.345   1.00 0.00 ? 57 VAL A HG12 8  
ATOM   9775  H  HG13 . VAL A 1 57 ? 1.478   -0.422  2.986   1.00 0.00 ? 57 VAL A HG13 8  
ATOM   9776  H  HG21 . VAL A 1 57 ? 3.739   0.775   2.822   1.00 0.00 ? 57 VAL A HG21 8  
ATOM   9777  H  HG22 . VAL A 1 57 ? 4.134   -0.007  1.292   1.00 0.00 ? 57 VAL A HG22 8  
ATOM   9778  H  HG23 . VAL A 1 57 ? 5.200   -0.200  2.681   1.00 0.00 ? 57 VAL A HG23 8  
ATOM   9779  N  N    . ILE A 1 58 ? 2.541   -3.545  5.374   1.00 0.00 ? 58 ILE A N    8  
ATOM   9780  C  CA   . ILE A 1 58 ? 2.460   -4.961  5.723   1.00 0.00 ? 58 ILE A CA   8  
ATOM   9781  C  C    . ILE A 1 58 ? 1.555   -5.708  4.748   1.00 0.00 ? 58 ILE A C    8  
ATOM   9782  O  O    . ILE A 1 58 ? 0.478   -5.229  4.398   1.00 0.00 ? 58 ILE A O    8  
ATOM   9783  C  CB   . ILE A 1 58 ? 1.940   -5.171  7.160   1.00 0.00 ? 58 ILE A CB   8  
ATOM   9784  C  CG1  . ILE A 1 58 ? 2.705   -4.279  8.145   1.00 0.00 ? 58 ILE A CG1  8  
ATOM   9785  C  CG2  . ILE A 1 58 ? 2.057   -6.637  7.560   1.00 0.00 ? 58 ILE A CG2  8  
ATOM   9786  C  CD1  . ILE A 1 58 ? 4.176   -4.619  8.260   1.00 0.00 ? 58 ILE A CD1  8  
ATOM   9787  H  H    . ILE A 1 58 ? 1.856   -2.929  5.715   1.00 0.00 ? 58 ILE A H    8  
ATOM   9788  H  HA   . ILE A 1 58 ? 3.457   -5.376  5.659   1.00 0.00 ? 58 ILE A HA   8  
ATOM   9789  H  HB   . ILE A 1 58 ? 0.894   -4.902  7.181   1.00 0.00 ? 58 ILE A HB   8  
ATOM   9790  H  HG12 . ILE A 1 58 ? 2.626   -3.252  7.826   1.00 0.00 ? 58 ILE A HG12 8  
ATOM   9791  H  HG13 . ILE A 1 58 ? 2.264   -4.381  9.126   1.00 0.00 ? 58 ILE A HG13 8  
ATOM   9792  H  HG21 . ILE A 1 58 ? 2.921   -7.073  7.080   1.00 0.00 ? 58 ILE A HG21 8  
ATOM   9793  H  HG22 . ILE A 1 58 ? 1.169   -7.166  7.250   1.00 0.00 ? 58 ILE A HG22 8  
ATOM   9794  H  HG23 . ILE A 1 58 ? 2.164   -6.711  8.631   1.00 0.00 ? 58 ILE A HG23 8  
ATOM   9795  H  HD11 . ILE A 1 58 ? 4.297   -5.485  8.893   1.00 0.00 ? 58 ILE A HD11 8  
ATOM   9796  H  HD12 . ILE A 1 58 ? 4.705   -3.782  8.691   1.00 0.00 ? 58 ILE A HD12 8  
ATOM   9797  H  HD13 . ILE A 1 58 ? 4.574   -4.830  7.279   1.00 0.00 ? 58 ILE A HD13 8  
ATOM   9798  N  N    . TYR A 1 59 ? 2.003   -6.880  4.305   1.00 0.00 ? 59 TYR A N    8  
ATOM   9799  C  CA   . TYR A 1 59 ? 1.240   -7.688  3.355   1.00 0.00 ? 59 TYR A CA   8  
ATOM   9800  C  C    . TYR A 1 59 ? 1.608   -9.166  3.477   1.00 0.00 ? 59 TYR A C    8  
ATOM   9801  O  O    . TYR A 1 59 ? 2.483   -9.534  4.264   1.00 0.00 ? 59 TYR A O    8  
ATOM   9802  C  CB   . TYR A 1 59 ? 1.512   -7.201  1.927   1.00 0.00 ? 59 TYR A CB   8  
ATOM   9803  C  CG   . TYR A 1 59 ? 2.981   -6.996  1.642   1.00 0.00 ? 59 TYR A CG   8  
ATOM   9804  C  CD1  . TYR A 1 59 ? 3.600   -5.796  1.958   1.00 0.00 ? 59 TYR A CD1  8  
ATOM   9805  C  CD2  . TYR A 1 59 ? 3.753   -8.007  1.082   1.00 0.00 ? 59 TYR A CD2  8  
ATOM   9806  C  CE1  . TYR A 1 59 ? 4.943   -5.604  1.721   1.00 0.00 ? 59 TYR A CE1  8  
ATOM   9807  C  CE2  . TYR A 1 59 ? 5.101   -7.824  0.845   1.00 0.00 ? 59 TYR A CE2  8  
ATOM   9808  C  CZ   . TYR A 1 59 ? 5.692   -6.618  1.166   1.00 0.00 ? 59 TYR A CZ   8  
ATOM   9809  O  OH   . TYR A 1 59 ? 7.037   -6.424  0.937   1.00 0.00 ? 59 TYR A OH   8  
ATOM   9810  H  H    . TYR A 1 59 ? 2.875   -7.205  4.615   1.00 0.00 ? 59 TYR A H    8  
ATOM   9811  H  HA   . TYR A 1 59 ? 0.191   -7.566  3.578   1.00 0.00 ? 59 TYR A HA   8  
ATOM   9812  H  HB2  . TYR A 1 59 ? 1.132   -7.926  1.222   1.00 0.00 ? 59 TYR A HB2  8  
ATOM   9813  H  HB3  . TYR A 1 59 ? 1.008   -6.257  1.772   1.00 0.00 ? 59 TYR A HB3  8  
ATOM   9814  H  HD1  . TYR A 1 59 ? 3.013   -5.001  2.393   1.00 0.00 ? 59 TYR A HD1  8  
ATOM   9815  H  HD2  . TYR A 1 59 ? 3.286   -8.946  0.830   1.00 0.00 ? 59 TYR A HD2  8  
ATOM   9816  H  HE1  . TYR A 1 59 ? 5.400   -4.661  1.971   1.00 0.00 ? 59 TYR A HE1  8  
ATOM   9817  H  HE2  . TYR A 1 59 ? 5.684   -8.622  0.409   1.00 0.00 ? 59 TYR A HE2  8  
ATOM   9818  H  HH   . TYR A 1 59 ? 7.489   -7.271  0.928   1.00 0.00 ? 59 TYR A HH   8  
ATOM   9819  N  N    . ASP A 1 60 ? 0.945   -10.008 2.686   1.00 0.00 ? 60 ASP A N    8  
ATOM   9820  C  CA   . ASP A 1 60 ? 1.216   -11.440 2.703   1.00 0.00 ? 60 ASP A CA   8  
ATOM   9821  C  C    . ASP A 1 60 ? 2.341   -11.784 1.732   1.00 0.00 ? 60 ASP A C    8  
ATOM   9822  O  O    . ASP A 1 60 ? 2.118   -11.894 0.524   1.00 0.00 ? 60 ASP A O    8  
ATOM   9823  C  CB   . ASP A 1 60 ? -0.044  -12.233 2.348   1.00 0.00 ? 60 ASP A CB   8  
ATOM   9824  C  CG   . ASP A 1 60 ? -0.130  -13.546 3.102   1.00 0.00 ? 60 ASP A CG   8  
ATOM   9825  O  OD1  . ASP A 1 60 ? -0.433  -13.515 4.313   1.00 0.00 ? 60 ASP A OD1  8  
ATOM   9826  O  OD2  . ASP A 1 60 ? 0.111   -14.602 2.482   1.00 0.00 ? 60 ASP A OD2  8  
ATOM   9827  H  H    . ASP A 1 60 ? 0.266   -9.658  2.073   1.00 0.00 ? 60 ASP A H    8  
ATOM   9828  H  HA   . ASP A 1 60 ? 1.528   -11.705 3.703   1.00 0.00 ? 60 ASP A HA   8  
ATOM   9829  H  HB2  . ASP A 1 60 ? -0.915  -11.642 2.591   1.00 0.00 ? 60 ASP A HB2  8  
ATOM   9830  H  HB3  . ASP A 1 60 ? -0.043  -12.447 1.289   1.00 0.00 ? 60 ASP A HB3  8  
ATOM   9831  N  N    . LYS A 1 61 ? 3.549   -11.953 2.267   1.00 0.00 ? 61 LYS A N    8  
ATOM   9832  C  CA   . LYS A 1 61 ? 4.712   -12.290 1.447   1.00 0.00 ? 61 LYS A CA   8  
ATOM   9833  C  C    . LYS A 1 61 ? 4.505   -13.620 0.719   1.00 0.00 ? 61 LYS A C    8  
ATOM   9834  O  O    . LYS A 1 61 ? 5.027   -13.819 -0.377  1.00 0.00 ? 61 LYS A O    8  
ATOM   9835  C  CB   . LYS A 1 61 ? 5.975   -12.356 2.305   1.00 0.00 ? 61 LYS A CB   8  
ATOM   9836  C  CG   . LYS A 1 61 ? 6.687   -11.019 2.445   1.00 0.00 ? 61 LYS A CG   8  
ATOM   9837  C  CD   . LYS A 1 61 ? 8.197   -11.193 2.524   1.00 0.00 ? 61 LYS A CD   8  
ATOM   9838  C  CE   . LYS A 1 61 ? 8.821   -10.242 3.536   1.00 0.00 ? 61 LYS A CE   8  
ATOM   9839  N  NZ   . LYS A 1 61 ? 8.382   -10.541 4.930   1.00 0.00 ? 61 LYS A NZ   8  
ATOM   9840  H  H    . LYS A 1 61 ? 3.661   -11.853 3.236   1.00 0.00 ? 61 LYS A H    8  
ATOM   9841  H  HA   . LYS A 1 61 ? 4.831   -11.508 0.710   1.00 0.00 ? 61 LYS A HA   8  
ATOM   9842  H  HB2  . LYS A 1 61 ? 5.709   -12.703 3.293   1.00 0.00 ? 61 LYS A HB2  8  
ATOM   9843  H  HB3  . LYS A 1 61 ? 6.663   -13.061 1.860   1.00 0.00 ? 61 LYS A HB3  8  
ATOM   9844  H  HG2  . LYS A 1 61 ? 6.451   -10.406 1.588   1.00 0.00 ? 61 LYS A HG2  8  
ATOM   9845  H  HG3  . LYS A 1 61 ? 6.340   -10.531 3.344   1.00 0.00 ? 61 LYS A HG3  8  
ATOM   9846  H  HD2  . LYS A 1 61 ? 8.419   -12.208 2.816   1.00 0.00 ? 61 LYS A HD2  8  
ATOM   9847  H  HD3  . LYS A 1 61 ? 8.623   -10.997 1.550   1.00 0.00 ? 61 LYS A HD3  8  
ATOM   9848  H  HE2  . LYS A 1 61 ? 9.896   -10.333 3.481   1.00 0.00 ? 61 LYS A HE2  8  
ATOM   9849  H  HE3  . LYS A 1 61 ? 8.534   -9.231  3.286   1.00 0.00 ? 61 LYS A HE3  8  
ATOM   9850  H  HZ1  . LYS A 1 61 ? 9.145   -10.314 5.601   1.00 0.00 ? 61 LYS A HZ1  8  
ATOM   9851  H  HZ2  . LYS A 1 61 ? 8.141   -11.549 5.022   1.00 0.00 ? 61 LYS A HZ2  8  
ATOM   9852  H  HZ3  . LYS A 1 61 ? 7.547   -9.972  5.170   1.00 0.00 ? 61 LYS A HZ3  8  
ATOM   9853  N  N    . ASP A 1 62 ? 3.737   -14.526 1.331   1.00 0.00 ? 62 ASP A N    8  
ATOM   9854  C  CA   . ASP A 1 62 ? 3.461   -15.830 0.729   1.00 0.00 ? 62 ASP A CA   8  
ATOM   9855  C  C    . ASP A 1 62 ? 2.645   -15.675 -0.555  1.00 0.00 ? 62 ASP A C    8  
ATOM   9856  O  O    . ASP A 1 62 ? 2.808   -16.447 -1.501  1.00 0.00 ? 62 ASP A O    8  
ATOM   9857  C  CB   . ASP A 1 62 ? 2.714   -16.730 1.717   1.00 0.00 ? 62 ASP A CB   8  
ATOM   9858  C  CG   . ASP A 1 62 ? 3.611   -17.239 2.829   1.00 0.00 ? 62 ASP A CG   8  
ATOM   9859  O  OD1  . ASP A 1 62 ? 4.511   -18.056 2.541   1.00 0.00 ? 62 ASP A OD1  8  
ATOM   9860  O  OD2  . ASP A 1 62 ? 3.412   -16.820 3.988   1.00 0.00 ? 62 ASP A OD2  8  
ATOM   9861  H  H    . ASP A 1 62 ? 3.345   -14.310 2.203   1.00 0.00 ? 62 ASP A H    8  
ATOM   9862  H  HA   . ASP A 1 62 ? 4.408   -16.288 0.484   1.00 0.00 ? 62 ASP A HA   8  
ATOM   9863  H  HB2  . ASP A 1 62 ? 1.905   -16.172 2.161   1.00 0.00 ? 62 ASP A HB2  8  
ATOM   9864  H  HB3  . ASP A 1 62 ? 2.311   -17.580 1.186   1.00 0.00 ? 62 ASP A HB3  8  
ATOM   9865  N  N    . GLN A 1 63 ? 1.768   -14.670 -0.584  1.00 0.00 ? 63 GLN A N    8  
ATOM   9866  C  CA   . GLN A 1 63 ? 0.933   -14.411 -1.752  1.00 0.00 ? 63 GLN A CA   8  
ATOM   9867  C  C    . GLN A 1 63 ? 1.637   -13.470 -2.732  1.00 0.00 ? 63 GLN A C    8  
ATOM   9868  O  O    . GLN A 1 63 ? 1.644   -13.714 -3.939  1.00 0.00 ? 63 GLN A O    8  
ATOM   9869  C  CB   . GLN A 1 63 ? -0.409  -13.813 -1.323  1.00 0.00 ? 63 GLN A CB   8  
ATOM   9870  C  CG   . GLN A 1 63 ? -1.318  -14.802 -0.609  1.00 0.00 ? 63 GLN A CG   8  
ATOM   9871  C  CD   . GLN A 1 63 ? -2.789  -14.461 -0.758  1.00 0.00 ? 63 GLN A CD   8  
ATOM   9872  O  OE1  . GLN A 1 63 ? -3.165  -13.290 -0.837  1.00 0.00 ? 63 GLN A OE1  8  
ATOM   9873  N  NE2  . GLN A 1 63 ? -3.635  -15.486 -0.795  1.00 0.00 ? 63 GLN A NE2  8  
ATOM   9874  H  H    . GLN A 1 63 ? 1.684   -14.087 0.202   1.00 0.00 ? 63 GLN A H    8  
ATOM   9875  H  HA   . GLN A 1 63 ? 0.753   -15.356 -2.245  1.00 0.00 ? 63 GLN A HA   8  
ATOM   9876  H  HB2  . GLN A 1 63 ? -0.223  -12.985 -0.655  1.00 0.00 ? 63 GLN A HB2  8  
ATOM   9877  H  HB3  . GLN A 1 63 ? -0.925  -13.448 -2.198  1.00 0.00 ? 63 GLN A HB3  8  
ATOM   9878  H  HG2  . GLN A 1 63 ? -1.150  -15.786 -1.019  1.00 0.00 ? 63 GLN A HG2  8  
ATOM   9879  H  HG3  . GLN A 1 63 ? -1.070  -14.804 0.442   1.00 0.00 ? 63 GLN A HG3  8  
ATOM   9880  H  HE21 . GLN A 1 63 ? -3.269  -16.392 -0.724  1.00 0.00 ? 63 GLN A HE21 8  
ATOM   9881  H  HE22 . GLN A 1 63 ? -4.590  -15.293 -0.890  1.00 0.00 ? 63 GLN A HE22 8  
ATOM   9882  N  N    . PHE A 1 64 ? 2.225   -12.396 -2.204  1.00 0.00 ? 64 PHE A N    8  
ATOM   9883  C  CA   . PHE A 1 64 ? 2.930   -11.415 -3.030  1.00 0.00 ? 64 PHE A CA   8  
ATOM   9884  C  C    . PHE A 1 64 ? 4.187   -12.019 -3.656  1.00 0.00 ? 64 PHE A C    8  
ATOM   9885  O  O    . PHE A 1 64 ? 4.351   -11.998 -4.876  1.00 0.00 ? 64 PHE A O    8  
ATOM   9886  C  CB   . PHE A 1 64 ? 3.306   -10.184 -2.196  1.00 0.00 ? 64 PHE A CB   8  
ATOM   9887  C  CG   . PHE A 1 64 ? 2.251   -9.113  -2.194  1.00 0.00 ? 64 PHE A CG   8  
ATOM   9888  C  CD1  . PHE A 1 64 ? 1.029   -9.324  -1.572  1.00 0.00 ? 64 PHE A CD1  8  
ATOM   9889  C  CD2  . PHE A 1 64 ? 2.479   -7.895  -2.815  1.00 0.00 ? 64 PHE A CD2  8  
ATOM   9890  C  CE1  . PHE A 1 64 ? 0.058   -8.340  -1.570  1.00 0.00 ? 64 PHE A CE1  8  
ATOM   9891  C  CE2  . PHE A 1 64 ? 1.512   -6.909  -2.817  1.00 0.00 ? 64 PHE A CE2  8  
ATOM   9892  C  CZ   . PHE A 1 64 ? 0.300   -7.132  -2.193  1.00 0.00 ? 64 PHE A CZ   8  
ATOM   9893  H  H    . PHE A 1 64 ? 2.181   -12.258 -1.233  1.00 0.00 ? 64 PHE A H    8  
ATOM   9894  H  HA   . PHE A 1 64 ? 2.263   -11.111 -3.822  1.00 0.00 ? 64 PHE A HA   8  
ATOM   9895  H  HB2  . PHE A 1 64 ? 3.475   -10.487 -1.174  1.00 0.00 ? 64 PHE A HB2  8  
ATOM   9896  H  HB3  . PHE A 1 64 ? 4.215   -9.756  -2.594  1.00 0.00 ? 64 PHE A HB3  8  
ATOM   9897  H  HD1  . PHE A 1 64 ? 0.839   -10.268 -1.084  1.00 0.00 ? 64 PHE A HD1  8  
ATOM   9898  H  HD2  . PHE A 1 64 ? 3.427   -7.720  -3.303  1.00 0.00 ? 64 PHE A HD2  8  
ATOM   9899  H  HE1  . PHE A 1 64 ? -0.890  -8.517  -1.083  1.00 0.00 ? 64 PHE A HE1  8  
ATOM   9900  H  HE2  . PHE A 1 64 ? 1.704   -5.966  -3.304  1.00 0.00 ? 64 PHE A HE2  8  
ATOM   9901  H  HZ   . PHE A 1 64 ? -0.458  -6.361  -2.194  1.00 0.00 ? 64 PHE A HZ   8  
ATOM   9902  N  N    . VAL A 1 65 ? 5.068   -12.559 -2.814  1.00 0.00 ? 65 VAL A N    8  
ATOM   9903  C  CA   . VAL A 1 65 ? 6.309   -13.170 -3.287  1.00 0.00 ? 65 VAL A CA   8  
ATOM   9904  C  C    . VAL A 1 65 ? 6.055   -14.593 -3.785  1.00 0.00 ? 65 VAL A C    8  
ATOM   9905  O  O    . VAL A 1 65 ? 6.259   -15.566 -3.055  1.00 0.00 ? 65 VAL A O    8  
ATOM   9906  C  CB   . VAL A 1 65 ? 7.387   -13.199 -2.180  1.00 0.00 ? 65 VAL A CB   8  
ATOM   9907  C  CG1  . VAL A 1 65 ? 8.734   -13.625 -2.749  1.00 0.00 ? 65 VAL A CG1  8  
ATOM   9908  C  CG2  . VAL A 1 65 ? 7.494   -11.842 -1.496  1.00 0.00 ? 65 VAL A CG2  8  
ATOM   9909  H  H    . VAL A 1 65 ? 4.879   -12.549 -1.851  1.00 0.00 ? 65 VAL A H    8  
ATOM   9910  H  HA   . VAL A 1 65 ? 6.680   -12.574 -4.108  1.00 0.00 ? 65 VAL A HA   8  
ATOM   9911  H  HB   . VAL A 1 65 ? 7.092   -13.927 -1.438  1.00 0.00 ? 65 VAL A HB   8  
ATOM   9912  H  HG11 . VAL A 1 65 ? 9.314   -12.749 -3.002  1.00 0.00 ? 65 VAL A HG11 8  
ATOM   9913  H  HG12 . VAL A 1 65 ? 8.580   -14.222 -3.637  1.00 0.00 ? 65 VAL A HG12 8  
ATOM   9914  H  HG13 . VAL A 1 65 ? 9.266   -14.209 -2.013  1.00 0.00 ? 65 VAL A HG13 8  
ATOM   9915  H  HG21 . VAL A 1 65 ? 6.845   -11.822 -0.634  1.00 0.00 ? 65 VAL A HG21 8  
ATOM   9916  H  HG22 . VAL A 1 65 ? 7.198   -11.065 -2.186  1.00 0.00 ? 65 VAL A HG22 8  
ATOM   9917  H  HG23 . VAL A 1 65 ? 8.514   -11.675 -1.183  1.00 0.00 ? 65 VAL A HG23 8  
ATOM   9918  N  N    . SER A 1 66 ? 5.602   -14.704 -5.032  1.00 0.00 ? 66 SER A N    8  
ATOM   9919  C  CA   . SER A 1 66 ? 5.312   -16.003 -5.635  1.00 0.00 ? 66 SER A CA   8  
ATOM   9920  C  C    . SER A 1 66 ? 6.497   -16.502 -6.462  1.00 0.00 ? 66 SER A C    8  
ATOM   9921  O  O    . SER A 1 66 ? 6.584   -16.242 -7.664  1.00 0.00 ? 66 SER A O    8  
ATOM   9922  C  CB   . SER A 1 66 ? 4.058   -15.908 -6.512  1.00 0.00 ? 66 SER A CB   8  
ATOM   9923  O  OG   . SER A 1 66 ? 4.027   -14.688 -7.236  1.00 0.00 ? 66 SER A OG   8  
ATOM   9924  H  H    . SER A 1 66 ? 5.456   -13.891 -5.562  1.00 0.00 ? 66 SER A H    8  
ATOM   9925  H  HA   . SER A 1 66 ? 5.125   -16.704 -4.834  1.00 0.00 ? 66 SER A HA   8  
ATOM   9926  H  HB2  . SER A 1 66 ? 4.050   -16.727 -7.215  1.00 0.00 ? 66 SER A HB2  8  
ATOM   9927  H  HB3  . SER A 1 66 ? 3.179   -15.963 -5.886  1.00 0.00 ? 66 SER A HB3  8  
ATOM   9928  H  HG   . SER A 1 66 ? 3.291   -14.153 -6.933  1.00 0.00 ? 66 SER A HG   8  
ATOM   9929  N  N    . GLY A 1 67 ? 7.411   -17.222 -5.809  1.00 0.00 ? 67 GLY A N    8  
ATOM   9930  C  CA   . GLY A 1 67 ? 8.580   -17.746 -6.497  1.00 0.00 ? 67 GLY A CA   8  
ATOM   9931  C  C    . GLY A 1 67 ? 8.414   -19.195 -6.918  1.00 0.00 ? 67 GLY A C    8  
ATOM   9932  O  O    . GLY A 1 67 ? 8.482   -19.512 -8.106  1.00 0.00 ? 67 GLY A O    8  
ATOM   9933  H  H    . GLY A 1 67 ? 7.291   -17.398 -4.852  1.00 0.00 ? 67 GLY A H    8  
ATOM   9934  H  HA2  . GLY A 1 67 ? 8.762   -17.147 -7.378  1.00 0.00 ? 67 GLY A HA2  8  
ATOM   9935  H  HA3  . GLY A 1 67 ? 9.434   -17.669 -5.842  1.00 0.00 ? 67 GLY A HA3  8  
ATOM   9936  N  N    . GLU A 1 68 ? 8.199   -20.076 -5.941  1.00 0.00 ? 68 GLU A N    8  
ATOM   9937  C  CA   . GLU A 1 68 ? 8.028   -21.502 -6.216  1.00 0.00 ? 68 GLU A CA   8  
ATOM   9938  C  C    . GLU A 1 68 ? 6.546   -21.903 -6.231  1.00 0.00 ? 68 GLU A C    8  
ATOM   9939  O  O    . GLU A 1 68 ? 6.211   -23.074 -6.040  1.00 0.00 ? 68 GLU A O    8  
ATOM   9940  C  CB   . GLU A 1 68 ? 8.792   -22.329 -5.174  1.00 0.00 ? 68 GLU A CB   8  
ATOM   9941  C  CG   . GLU A 1 68 ? 9.362   -23.629 -5.719  1.00 0.00 ? 68 GLU A CG   8  
ATOM   9942  C  CD   . GLU A 1 68 ? 10.840  -23.525 -6.045  1.00 0.00 ? 68 GLU A CD   8  
ATOM   9943  O  OE1  . GLU A 1 68 ? 11.666  -23.753 -5.138  1.00 0.00 ? 68 GLU A OE1  8  
ATOM   9944  O  OE2  . GLU A 1 68 ? 11.169  -23.210 -7.209  1.00 0.00 ? 68 GLU A OE2  8  
ATOM   9945  H  H    . GLU A 1 68 ? 8.158   -19.761 -5.014  1.00 0.00 ? 68 GLU A H    8  
ATOM   9946  H  HA   . GLU A 1 68 ? 8.445   -21.698 -7.191  1.00 0.00 ? 68 GLU A HA   8  
ATOM   9947  H  HB2  . GLU A 1 68 ? 9.611   -21.736 -4.794  1.00 0.00 ? 68 GLU A HB2  8  
ATOM   9948  H  HB3  . GLU A 1 68 ? 8.124   -22.567 -4.358  1.00 0.00 ? 68 GLU A HB3  8  
ATOM   9949  H  HG2  . GLU A 1 68 ? 9.227   -24.405 -4.979  1.00 0.00 ? 68 GLU A HG2  8  
ATOM   9950  H  HG3  . GLU A 1 68 ? 8.827   -23.894 -6.619  1.00 0.00 ? 68 GLU A HG3  8  
ATOM   9951  N  N    . THR A 1 69 ? 5.664   -20.930 -6.468  1.00 0.00 ? 69 THR A N    8  
ATOM   9952  C  CA   . THR A 1 69 ? 4.224   -21.188 -6.514  1.00 0.00 ? 69 THR A CA   8  
ATOM   9953  C  C    . THR A 1 69 ? 3.515   -20.170 -7.405  1.00 0.00 ? 69 THR A C    8  
ATOM   9954  O  O    . THR A 1 69 ? 3.531   -18.970 -7.124  1.00 0.00 ? 69 THR A O    8  
ATOM   9955  C  CB   . THR A 1 69 ? 3.624   -21.149 -5.101  1.00 0.00 ? 69 THR A CB   8  
ATOM   9956  O  OG1  . THR A 1 69 ? 4.339   -22.000 -4.219  1.00 0.00 ? 69 THR A OG1  8  
ATOM   9957  C  CG2  . THR A 1 69 ? 2.170   -21.566 -5.054  1.00 0.00 ? 69 THR A CG2  8  
ATOM   9958  H  H    . THR A 1 69 ? 5.986   -20.019 -6.620  1.00 0.00 ? 69 THR A H    8  
ATOM   9959  H  HA   . THR A 1 69 ? 4.078   -22.174 -6.929  1.00 0.00 ? 69 THR A HA   8  
ATOM   9960  H  HB   . THR A 1 69 ? 3.688   -20.139 -4.720  1.00 0.00 ? 69 THR A HB   8  
ATOM   9961  H  HG1  . THR A 1 69 ? 4.572   -22.814 -4.672  1.00 0.00 ? 69 THR A HG1  8  
ATOM   9962  H  HG21 . THR A 1 69 ? 1.955   -22.216 -5.889  1.00 0.00 ? 69 THR A HG21 8  
ATOM   9963  H  HG22 . THR A 1 69 ? 1.541   -20.690 -5.110  1.00 0.00 ? 69 THR A HG22 8  
ATOM   9964  H  HG23 . THR A 1 69 ? 1.976   -22.090 -4.130  1.00 0.00 ? 69 THR A HG23 8  
ATOM   9965  N  N    . VAL A 1 70 ? 2.891   -20.656 -8.479  1.00 0.00 ? 70 VAL A N    8  
ATOM   9966  C  CA   . VAL A 1 70 ? 2.174   -19.787 -9.411  1.00 0.00 ? 70 VAL A CA   8  
ATOM   9967  C  C    . VAL A 1 70 ? 0.800   -20.365 -9.771  1.00 0.00 ? 70 VAL A C    8  
ATOM   9968  O  O    . VAL A 1 70 ? 0.673   -21.562 -10.038 1.00 0.00 ? 70 VAL A O    8  
ATOM   9969  C  CB   . VAL A 1 70 ? 2.992   -19.549 -10.702 1.00 0.00 ? 70 VAL A CB   8  
ATOM   9970  C  CG1  . VAL A 1 70 ? 3.244   -20.857 -11.439 1.00 0.00 ? 70 VAL A CG1  8  
ATOM   9971  C  CG2  . VAL A 1 70 ? 2.293   -18.541 -11.608 1.00 0.00 ? 70 VAL A CG2  8  
ATOM   9972  H  H    . VAL A 1 70 ? 2.912   -21.621 -8.649  1.00 0.00 ? 70 VAL A H    8  
ATOM   9973  H  HA   . VAL A 1 70 ? 2.031   -18.834 -8.924  1.00 0.00 ? 70 VAL A HA   8  
ATOM   9974  H  HB   . VAL A 1 70 ? 3.949   -19.137 -10.420 1.00 0.00 ? 70 VAL A HB   8  
ATOM   9975  H  HG11 . VAL A 1 70 ? 2.486   -20.996 -12.196 1.00 0.00 ? 70 VAL A HG11 8  
ATOM   9976  H  HG12 . VAL A 1 70 ? 3.210   -21.678 -10.740 1.00 0.00 ? 70 VAL A HG12 8  
ATOM   9977  H  HG13 . VAL A 1 70 ? 4.218   -20.823 -11.907 1.00 0.00 ? 70 VAL A HG13 8  
ATOM   9978  H  HG21 . VAL A 1 70 ? 2.806   -18.494 -12.557 1.00 0.00 ? 70 VAL A HG21 8  
ATOM   9979  H  HG22 . VAL A 1 70 ? 2.310   -17.568 -11.141 1.00 0.00 ? 70 VAL A HG22 8  
ATOM   9980  H  HG23 . VAL A 1 70 ? 1.270   -18.847 -11.766 1.00 0.00 ? 70 VAL A HG23 8  
ATOM   9981  N  N    . PRO A 1 71 ? -0.248  -19.515 -9.779  1.00 0.00 ? 71 PRO A N    8  
ATOM   9982  C  CA   . PRO A 1 71 ? -1.619  -19.937 -10.102 1.00 0.00 ? 71 PRO A CA   8  
ATOM   9983  C  C    . PRO A 1 71 ? -1.834  -20.160 -11.602 1.00 0.00 ? 71 PRO A C    8  
ATOM   9984  O  O    . PRO A 1 71 ? -0.992  -19.788 -12.422 1.00 0.00 ? 71 PRO A O    8  
ATOM   9985  C  CB   . PRO A 1 71 ? -2.467  -18.764 -9.608  1.00 0.00 ? 71 PRO A CB   8  
ATOM   9986  C  CG   . PRO A 1 71 ? -1.574  -17.577 -9.723  1.00 0.00 ? 71 PRO A CG   8  
ATOM   9987  C  CD   . PRO A 1 71 ? -0.176  -18.073 -9.464  1.00 0.00 ? 71 PRO A CD   8  
ATOM   9988  H  HA   . PRO A 1 71 ? -1.892  -20.833 -9.566  1.00 0.00 ? 71 PRO A HA   8  
ATOM   9989  H  HB2  . PRO A 1 71 ? -3.344  -18.661 -10.232 1.00 0.00 ? 71 PRO A HB2  8  
ATOM   9990  H  HB3  . PRO A 1 71 ? -2.764  -18.936 -8.584  1.00 0.00 ? 71 PRO A HB3  8  
ATOM   9991  H  HG2  . PRO A 1 71 ? -1.644  -17.159 -10.716 1.00 0.00 ? 71 PRO A HG2  8  
ATOM   9992  H  HG3  . PRO A 1 71 ? -1.849  -16.838 -8.985  1.00 0.00 ? 71 PRO A HG3  8  
ATOM   9993  H  HD2  . PRO A 1 71 ? 0.525   -17.572 -10.115 1.00 0.00 ? 71 PRO A HD2  8  
ATOM   9994  H  HD3  . PRO A 1 71 ? 0.093   -17.919 -8.430  1.00 0.00 ? 71 PRO A HD3  8  
ATOM   9995  N  N    . ALA A 1 72 ? -2.971  -20.775 -11.954 1.00 0.00 ? 72 ALA A N    8  
ATOM   9996  C  CA   . ALA A 1 72 ? -3.297  -21.051 -13.353 1.00 0.00 ? 72 ALA A CA   8  
ATOM   9997  C  C    . ALA A 1 72 ? -4.809  -21.224 -13.561 1.00 0.00 ? 72 ALA A C    8  
ATOM   9998  O  O    . ALA A 1 72 ? -5.525  -21.649 -12.653 1.00 0.00 ? 72 ALA A O    8  
ATOM   9999  C  CB   . ALA A 1 72 ? -2.546  -22.286 -13.828 1.00 0.00 ? 72 ALA A CB   8  
ATOM   10000 H  H    . ALA A 1 72 ? -3.602  -21.048 -11.255 1.00 0.00 ? 72 ALA A H    8  
ATOM   10001 H  HA   . ALA A 1 72 ? -2.962  -20.210 -13.942 1.00 0.00 ? 72 ALA A HA   8  
ATOM   10002 H  HB1  . ALA A 1 72 ? -2.469  -22.996 -13.016 1.00 0.00 ? 72 ALA A HB1  8  
ATOM   10003 H  HB2  . ALA A 1 72 ? -1.556  -22.002 -14.150 1.00 0.00 ? 72 ALA A HB2  8  
ATOM   10004 H  HB3  . ALA A 1 72 ? -3.077  -22.740 -14.652 1.00 0.00 ? 72 ALA A HB3  8  
ATOM   10005 N  N    . PRO A 1 73 ? -5.306  -20.884 -14.771 1.00 0.00 ? 73 PRO A N    8  
ATOM   10006 C  CA   . PRO A 1 73 ? -6.738  -20.986 -15.122 1.00 0.00 ? 73 PRO A CA   8  
ATOM   10007 C  C    . PRO A 1 73 ? -7.315  -22.389 -14.915 1.00 0.00 ? 73 PRO A C    8  
ATOM   10008 O  O    . PRO A 1 73 ? -6.695  -23.386 -15.289 1.00 0.00 ? 73 PRO A O    8  
ATOM   10009 C  CB   . PRO A 1 73 ? -6.769  -20.621 -16.611 1.00 0.00 ? 73 PRO A CB   8  
ATOM   10010 C  CG   . PRO A 1 73 ? -5.539  -19.813 -16.837 1.00 0.00 ? 73 PRO A CG   8  
ATOM   10011 C  CD   . PRO A 1 73 ? -4.504  -20.363 -15.895 1.00 0.00 ? 73 PRO A CD   8  
ATOM   10012 H  HA   . PRO A 1 73 ? -7.328  -20.272 -14.566 1.00 0.00 ? 73 PRO A HA   8  
ATOM   10013 H  HB2  . PRO A 1 73 ? -6.763  -21.523 -17.207 1.00 0.00 ? 73 PRO A HB2  8  
ATOM   10014 H  HB3  . PRO A 1 73 ? -7.659  -20.048 -16.827 1.00 0.00 ? 73 PRO A HB3  8  
ATOM   10015 H  HG2  . PRO A 1 73 ? -5.210  -19.923 -17.860 1.00 0.00 ? 73 PRO A HG2  8  
ATOM   10016 H  HG3  . PRO A 1 73 ? -5.734  -18.775 -16.615 1.00 0.00 ? 73 PRO A HG3  8  
ATOM   10017 H  HD2  . PRO A 1 73 ? -3.943  -21.154 -16.370 1.00 0.00 ? 73 PRO A HD2  8  
ATOM   10018 H  HD3  . PRO A 1 73 ? -3.844  -19.575 -15.563 1.00 0.00 ? 73 PRO A HD3  8  
ATOM   10019 N  N    . SER A 1 74 ? -8.511  -22.454 -14.322 1.00 0.00 ? 74 SER A N    8  
ATOM   10020 C  CA   . SER A 1 74 ? -9.182  -23.730 -14.067 1.00 0.00 ? 74 SER A CA   8  
ATOM   10021 C  C    . SER A 1 74 ? -10.701 -23.578 -14.160 1.00 0.00 ? 74 SER A C    8  
ATOM   10022 O  O    . SER A 1 74 ? -11.373 -23.332 -13.154 1.00 0.00 ? 74 SER A O    8  
ATOM   10023 C  CB   . SER A 1 74 ? -8.790  -24.271 -12.685 1.00 0.00 ? 74 SER A CB   8  
ATOM   10024 O  OG   . SER A 1 74 ? -7.391  -24.181 -12.478 1.00 0.00 ? 74 SER A OG   8  
ATOM   10025 H  H    . SER A 1 74 ? -8.956  -21.624 -14.053 1.00 0.00 ? 74 SER A H    8  
ATOM   10026 H  HA   . SER A 1 74 ? -8.859  -24.431 -14.822 1.00 0.00 ? 74 SER A HA   8  
ATOM   10027 H  HB2  . SER A 1 74 ? -9.292  -23.698 -11.920 1.00 0.00 ? 74 SER A HB2  8  
ATOM   10028 H  HB3  . SER A 1 74 ? -9.085  -25.307 -12.611 1.00 0.00 ? 74 SER A HB3  8  
ATOM   10029 H  HG   . SER A 1 74 ? -7.198  -24.280 -11.542 1.00 0.00 ? 74 SER A HG   8  
ATOM   10030 N  N    . ALA A 1 75 ? -11.237 -23.724 -15.372 1.00 0.00 ? 75 ALA A N    8  
ATOM   10031 C  CA   . ALA A 1 75 ? -12.677 -23.604 -15.595 1.00 0.00 ? 75 ALA A CA   8  
ATOM   10032 C  C    . ALA A 1 75 ? -13.243 -24.856 -16.264 1.00 0.00 ? 75 ALA A C    8  
ATOM   10033 O  O    . ALA A 1 75 ? -12.522 -25.593 -16.937 1.00 0.00 ? 75 ALA A O    8  
ATOM   10034 C  CB   . ALA A 1 75 ? -12.983 -22.372 -16.433 1.00 0.00 ? 75 ALA A CB   8  
ATOM   10035 H  H    . ALA A 1 75 ? -10.652 -23.917 -16.133 1.00 0.00 ? 75 ALA A H    8  
ATOM   10036 H  HA   . ALA A 1 75 ? -13.150 -23.478 -14.631 1.00 0.00 ? 75 ALA A HA   8  
ATOM   10037 H  HB1  . ALA A 1 75 ? -12.428 -22.417 -17.359 1.00 0.00 ? 75 ALA A HB1  8  
ATOM   10038 H  HB2  . ALA A 1 75 ? -12.698 -21.483 -15.887 1.00 0.00 ? 75 ALA A HB2  8  
ATOM   10039 H  HB3  . ALA A 1 75 ? -14.040 -22.338 -16.649 1.00 0.00 ? 75 ALA A HB3  8  
ATOM   10040 N  N    . ASN A 1 76 ? -14.546 -25.086 -16.071 1.00 0.00 ? 76 ASN A N    8  
ATOM   10041 C  CA   . ASN A 1 76 ? -15.231 -26.247 -16.649 1.00 0.00 ? 76 ASN A CA   8  
ATOM   10042 C  C    . ASN A 1 76 ? -14.640 -27.567 -16.134 1.00 0.00 ? 76 ASN A C    8  
ATOM   10043 O  O    . ASN A 1 76 ? -14.744 -28.602 -16.797 1.00 0.00 ? 76 ASN A O    8  
ATOM   10044 C  CB   . ASN A 1 76 ? -15.161 -26.201 -18.182 1.00 0.00 ? 76 ASN A CB   8  
ATOM   10045 C  CG   . ASN A 1 76 ? -16.433 -26.710 -18.836 1.00 0.00 ? 76 ASN A CG   8  
ATOM   10046 O  OD1  . ASN A 1 76 ? -17.171 -25.948 -19.459 1.00 0.00 ? 76 ASN A OD1  8  
ATOM   10047 N  ND2  . ASN A 1 76 ? -16.697 -28.005 -18.696 1.00 0.00 ? 76 ASN A ND2  8  
ATOM   10048 H  H    . ASN A 1 76 ? -15.064 -24.458 -15.523 1.00 0.00 ? 76 ASN A H    8  
ATOM   10049 H  HA   . ASN A 1 76 ? -16.267 -26.198 -16.349 1.00 0.00 ? 76 ASN A HA   8  
ATOM   10050 H  HB2  . ASN A 1 76 ? -15.000 -25.181 -18.500 1.00 0.00 ? 76 ASN A HB2  8  
ATOM   10051 H  HB3  . ASN A 1 76 ? -14.336 -26.811 -18.518 1.00 0.00 ? 76 ASN A HB3  8  
ATOM   10052 H  HD21 . ASN A 1 76 ? -16.066 -28.556 -18.185 1.00 0.00 ? 76 ASN A HD21 8  
ATOM   10053 H  HD22 . ASN A 1 76 ? -17.514 -28.357 -19.107 1.00 0.00 ? 76 ASN A HD22 8  
ATOM   10054 N  N    . LYS A 1 77 ? -14.029 -27.530 -14.947 1.00 0.00 ? 77 LYS A N    8  
ATOM   10055 C  CA   . LYS A 1 77 ? -13.435 -28.725 -14.351 1.00 0.00 ? 77 LYS A CA   8  
ATOM   10056 C  C    . LYS A 1 77 ? -13.092 -28.495 -12.880 1.00 0.00 ? 77 LYS A C    8  
ATOM   10057 O  O    . LYS A 1 77 ? -11.923 -28.337 -12.521 1.00 0.00 ? 77 LYS A O    8  
ATOM   10058 C  CB   . LYS A 1 77 ? -12.173 -29.136 -15.121 1.00 0.00 ? 77 LYS A CB   8  
ATOM   10059 C  CG   . LYS A 1 77 ? -12.414 -30.213 -16.166 1.00 0.00 ? 77 LYS A CG   8  
ATOM   10060 C  CD   . LYS A 1 77 ? -11.227 -31.158 -16.279 1.00 0.00 ? 77 LYS A CD   8  
ATOM   10061 C  CE   . LYS A 1 77 ? -11.449 -32.434 -15.481 1.00 0.00 ? 77 LYS A CE   8  
ATOM   10062 N  NZ   . LYS A 1 77 ? -10.181 -32.956 -14.898 1.00 0.00 ? 77 LYS A NZ   8  
ATOM   10063 H  H    . LYS A 1 77 ? -13.983 -26.682 -14.458 1.00 0.00 ? 77 LYS A H    8  
ATOM   10064 H  HA   . LYS A 1 77 ? -14.160 -29.522 -14.417 1.00 0.00 ? 77 LYS A HA   8  
ATOM   10065 H  HB2  . LYS A 1 77 ? -11.770 -28.266 -15.620 1.00 0.00 ? 77 LYS A HB2  8  
ATOM   10066 H  HB3  . LYS A 1 77 ? -11.441 -29.506 -14.418 1.00 0.00 ? 77 LYS A HB3  8  
ATOM   10067 H  HG2  . LYS A 1 77 ? -13.290 -30.781 -15.887 1.00 0.00 ? 77 LYS A HG2  8  
ATOM   10068 H  HG3  . LYS A 1 77 ? -12.580 -29.742 -17.124 1.00 0.00 ? 77 LYS A HG3  8  
ATOM   10069 H  HD2  . LYS A 1 77 ? -11.084 -31.415 -17.318 1.00 0.00 ? 77 LYS A HD2  8  
ATOM   10070 H  HD3  . LYS A 1 77 ? -10.346 -30.658 -15.905 1.00 0.00 ? 77 LYS A HD3  8  
ATOM   10071 H  HE2  . LYS A 1 77 ? -12.142 -32.228 -14.680 1.00 0.00 ? 77 LYS A HE2  8  
ATOM   10072 H  HE3  . LYS A 1 77 ? -11.869 -33.184 -16.136 1.00 0.00 ? 77 LYS A HE3  8  
ATOM   10073 H  HZ1  . LYS A 1 77 ? -10.254 -33.982 -14.743 1.00 0.00 ? 77 LYS A HZ1  8  
ATOM   10074 H  HZ2  . LYS A 1 77 ? -9.988  -32.492 -13.988 1.00 0.00 ? 77 LYS A HZ2  8  
ATOM   10075 H  HZ3  . LYS A 1 77 ? -9.385  -32.771 -15.544 1.00 0.00 ? 77 LYS A HZ3  8  
ATOM   10076 N  N    . GLU A 1 78 ? -14.115 -28.477 -12.027 1.00 0.00 ? 78 GLU A N    8  
ATOM   10077 C  CA   . GLU A 1 78 ? -13.913 -28.269 -10.597 1.00 0.00 ? 78 GLU A CA   8  
ATOM   10078 C  C    . GLU A 1 78 ? -14.914 -29.079 -9.777  1.00 0.00 ? 78 GLU A C    8  
ATOM   10079 O  O    . GLU A 1 78 ? -15.984 -28.583 -9.418  1.00 0.00 ? 78 GLU A O    8  
ATOM   10080 C  CB   . GLU A 1 78 ? -14.029 -26.781 -10.250 1.00 0.00 ? 78 GLU A CB   8  
ATOM   10081 C  CG   . GLU A 1 78 ? -12.837 -25.951 -10.707 1.00 0.00 ? 78 GLU A CG   8  
ATOM   10082 C  CD   . GLU A 1 78 ? -12.423 -24.912 -9.683  1.00 0.00 ? 78 GLU A CD   8  
ATOM   10083 O  OE1  . GLU A 1 78 ? -13.160 -23.917 -9.515  1.00 0.00 ? 78 GLU A OE1  8  
ATOM   10084 O  OE2  . GLU A 1 78 ? -11.364 -25.093 -9.047  1.00 0.00 ? 78 GLU A OE2  8  
ATOM   10085 H  H    . GLU A 1 78 ? -15.026 -28.609 -12.367 1.00 0.00 ? 78 GLU A H    8  
ATOM   10086 H  HA   . GLU A 1 78 ? -12.915 -28.607 -10.353 1.00 0.00 ? 78 GLU A HA   8  
ATOM   10087 H  HB2  . GLU A 1 78 ? -14.917 -26.383 -10.716 1.00 0.00 ? 78 GLU A HB2  8  
ATOM   10088 H  HB3  . GLU A 1 78 ? -14.121 -26.679 -9.178  1.00 0.00 ? 78 GLU A HB3  8  
ATOM   10089 H  HG2  . GLU A 1 78 ? -12.002 -26.611 -10.885 1.00 0.00 ? 78 GLU A HG2  8  
ATOM   10090 H  HG3  . GLU A 1 78 ? -13.098 -25.447 -11.625 1.00 0.00 ? 78 GLU A HG3  8  
ATOM   10091 N  N    . LEU A 1 79 ? -14.556 -30.327 -9.483  1.00 0.00 ? 79 LEU A N    8  
ATOM   10092 C  CA   . LEU A 1 79 ? -15.418 -31.209 -8.700  1.00 0.00 ? 79 LEU A CA   8  
ATOM   10093 C  C    . LEU A 1 79 ? -14.625 -31.924 -7.604  1.00 0.00 ? 79 LEU A C    8  
ATOM   10094 O  O    . LEU A 1 79 ? -14.917 -33.071 -7.258  1.00 0.00 ? 79 LEU A O    8  
ATOM   10095 C  CB   . LEU A 1 79 ? -16.106 -32.236 -9.609  1.00 0.00 ? 79 LEU A CB   8  
ATOM   10096 C  CG   . LEU A 1 79 ? -15.171 -33.063 -10.497 1.00 0.00 ? 79 LEU A CG   8  
ATOM   10097 C  CD1  . LEU A 1 79 ? -15.800 -34.411 -10.823 1.00 0.00 ? 79 LEU A CD1  8  
ATOM   10098 C  CD2  . LEU A 1 79 ? -14.839 -32.303 -11.775 1.00 0.00 ? 79 LEU A CD2  8  
ATOM   10099 H  H    . LEU A 1 79 ? -13.689 -30.661 -9.794  1.00 0.00 ? 79 LEU A H    8  
ATOM   10100 H  HA   . LEU A 1 79 ? -16.175 -30.597 -8.231  1.00 0.00 ? 79 LEU A HA   8  
ATOM   10101 H  HB2  . LEU A 1 79 ? -16.664 -32.917 -8.983  1.00 0.00 ? 79 LEU A HB2  8  
ATOM   10102 H  HB3  . LEU A 1 79 ? -16.800 -31.711 -10.248 1.00 0.00 ? 79 LEU A HB3  8  
ATOM   10103 H  HG   . LEU A 1 79 ? -14.249 -33.246 -9.966  1.00 0.00 ? 79 LEU A HG   8  
ATOM   10104 H  HD11 . LEU A 1 79 ? -16.341 -34.342 -11.755 1.00 0.00 ? 79 LEU A HD11 8  
ATOM   10105 H  HD12 . LEU A 1 79 ? -16.481 -34.691 -10.031 1.00 0.00 ? 79 LEU A HD12 8  
ATOM   10106 H  HD13 . LEU A 1 79 ? -15.026 -35.159 -10.911 1.00 0.00 ? 79 LEU A HD13 8  
ATOM   10107 H  HD21 . LEU A 1 79 ? -15.650 -31.633 -12.017 1.00 0.00 ? 79 LEU A HD21 8  
ATOM   10108 H  HD22 . LEU A 1 79 ? -14.697 -33.003 -12.585 1.00 0.00 ? 79 LEU A HD22 8  
ATOM   10109 H  HD23 . LEU A 1 79 ? -13.933 -31.734 -11.629 1.00 0.00 ? 79 LEU A HD23 8  
ATOM   10110 N  N    . VAL A 1 80 ? -13.625 -31.234 -7.053  1.00 0.00 ? 80 VAL A N    8  
ATOM   10111 C  CA   . VAL A 1 80 ? -12.795 -31.799 -5.992  1.00 0.00 ? 80 VAL A CA   8  
ATOM   10112 C  C    . VAL A 1 80 ? -13.241 -31.303 -4.609  1.00 0.00 ? 80 VAL A C    8  
ATOM   10113 O  O    . VAL A 1 80 ? -12.459 -31.288 -3.656  1.00 0.00 ? 80 VAL A O    8  
ATOM   10114 C  CB   . VAL A 1 80 ? -11.302 -31.462 -6.218  1.00 0.00 ? 80 VAL A CB   8  
ATOM   10115 C  CG1  . VAL A 1 80 ? -11.049 -29.970 -6.047  1.00 0.00 ? 80 VAL A CG1  8  
ATOM   10116 C  CG2  . VAL A 1 80 ? -10.415 -32.280 -5.285  1.00 0.00 ? 80 VAL A CG2  8  
ATOM   10117 H  H    . VAL A 1 80 ? -13.443 -30.323 -7.364  1.00 0.00 ? 80 VAL A H    8  
ATOM   10118 H  HA   . VAL A 1 80 ? -12.904 -32.873 -6.026  1.00 0.00 ? 80 VAL A HA   8  
ATOM   10119 H  HB   . VAL A 1 80 ? -11.055 -31.725 -7.234  1.00 0.00 ? 80 VAL A HB   8  
ATOM   10120 H  HG11 . VAL A 1 80 ? -10.343 -29.636 -6.794  1.00 0.00 ? 80 VAL A HG11 8  
ATOM   10121 H  HG12 . VAL A 1 80 ? -10.648 -29.782 -5.062  1.00 0.00 ? 80 VAL A HG12 8  
ATOM   10122 H  HG13 . VAL A 1 80 ? -11.977 -29.432 -6.166  1.00 0.00 ? 80 VAL A HG13 8  
ATOM   10123 H  HG21 . VAL A 1 80 ? -10.898 -33.221 -5.062  1.00 0.00 ? 80 VAL A HG21 8  
ATOM   10124 H  HG22 . VAL A 1 80 ? -10.254 -31.734 -4.368  1.00 0.00 ? 80 VAL A HG22 8  
ATOM   10125 H  HG23 . VAL A 1 80 ? -9.465  -32.469 -5.764  1.00 0.00 ? 80 VAL A HG23 8  
ATOM   10126 N  N    . LYS A 1 81 ? -14.511 -30.908 -4.507  1.00 0.00 ? 81 LYS A N    8  
ATOM   10127 C  CA   . LYS A 1 81 ? -15.073 -30.422 -3.246  1.00 0.00 ? 81 LYS A CA   8  
ATOM   10128 C  C    . LYS A 1 81 ? -16.364 -31.172 -2.897  1.00 0.00 ? 81 LYS A C    8  
ATOM   10129 O  O    . LYS A 1 81 ? -17.267 -30.613 -2.268  1.00 0.00 ? 81 LYS A O    8  
ATOM   10130 C  CB   . LYS A 1 81 ? -15.347 -28.915 -3.333  1.00 0.00 ? 81 LYS A CB   8  
ATOM   10131 C  CG   . LYS A 1 81 ? -14.168 -28.048 -2.913  1.00 0.00 ? 81 LYS A CG   8  
ATOM   10132 C  CD   . LYS A 1 81 ? -13.147 -27.905 -4.032  1.00 0.00 ? 81 LYS A CD   8  
ATOM   10133 C  CE   . LYS A 1 81 ? -11.725 -27.876 -3.491  1.00 0.00 ? 81 LYS A CE   8  
ATOM   10134 N  NZ   . LYS A 1 81 ? -11.459 -26.657 -2.674  1.00 0.00 ? 81 LYS A NZ   8  
ATOM   10135 H  H    . LYS A 1 81 ? -15.088 -30.950 -5.296  1.00 0.00 ? 81 LYS A H    8  
ATOM   10136 H  HA   . LYS A 1 81 ? -14.346 -30.603 -2.469  1.00 0.00 ? 81 LYS A HA   8  
ATOM   10137 H  HB2  . LYS A 1 81 ? -15.605 -28.666 -4.352  1.00 0.00 ? 81 LYS A HB2  8  
ATOM   10138 H  HB3  . LYS A 1 81 ? -16.183 -28.677 -2.693  1.00 0.00 ? 81 LYS A HB3  8  
ATOM   10139 H  HG2  . LYS A 1 81 ? -14.533 -27.067 -2.649  1.00 0.00 ? 81 LYS A HG2  8  
ATOM   10140 H  HG3  . LYS A 1 81 ? -13.690 -28.499 -2.056  1.00 0.00 ? 81 LYS A HG3  8  
ATOM   10141 H  HD2  . LYS A 1 81 ? -13.245 -28.742 -4.707  1.00 0.00 ? 81 LYS A HD2  8  
ATOM   10142 H  HD3  . LYS A 1 81 ? -13.337 -26.986 -4.566  1.00 0.00 ? 81 LYS A HD3  8  
ATOM   10143 H  HE2  . LYS A 1 81 ? -11.568 -28.750 -2.876  1.00 0.00 ? 81 LYS A HE2  8  
ATOM   10144 H  HE3  . LYS A 1 81 ? -11.036 -27.898 -4.324  1.00 0.00 ? 81 LYS A HE3  8  
ATOM   10145 H  HZ1  . LYS A 1 81 ? -11.583 -25.804 -3.256  1.00 0.00 ? 81 LYS A HZ1  8  
ATOM   10146 H  HZ2  . LYS A 1 81 ? -10.485 -26.676 -2.310  1.00 0.00 ? 81 LYS A HZ2  8  
ATOM   10147 H  HZ3  . LYS A 1 81 ? -12.117 -26.614 -1.870  1.00 0.00 ? 81 LYS A HZ3  8  
ATOM   10148 N  N    . LEU A 1 82 ? -16.446 -32.442 -3.303  1.00 0.00 ? 82 LEU A N    8  
ATOM   10149 C  CA   . LEU A 1 82 ? -17.622 -33.268 -3.031  1.00 0.00 ? 82 LEU A CA   8  
ATOM   10150 C  C    . LEU A 1 82 ? -17.237 -34.532 -2.255  1.00 0.00 ? 82 LEU A C    8  
ATOM   10151 O  O    . LEU A 1 82 ? -17.862 -35.584 -2.413  1.00 0.00 ? 82 LEU A O    8  
ATOM   10152 C  CB   . LEU A 1 82 ? -18.318 -33.644 -4.346  1.00 0.00 ? 82 LEU A CB   8  
ATOM   10153 C  CG   . LEU A 1 82 ? -19.843 -33.764 -4.269  1.00 0.00 ? 82 LEU A CG   8  
ATOM   10154 C  CD1  . LEU A 1 82 ? -20.493 -32.388 -4.221  1.00 0.00 ? 82 LEU A CD1  8  
ATOM   10155 C  CD2  . LEU A 1 82 ? -20.373 -34.562 -5.453  1.00 0.00 ? 82 LEU A CD2  8  
ATOM   10156 H  H    . LEU A 1 82 ? -15.696 -32.834 -3.796  1.00 0.00 ? 82 LEU A H    8  
ATOM   10157 H  HA   . LEU A 1 82 ? -18.303 -32.685 -2.427  1.00 0.00 ? 82 LEU A HA   8  
ATOM   10158 H  HB2  . LEU A 1 82 ? -18.073 -32.895 -5.086  1.00 0.00 ? 82 LEU A HB2  8  
ATOM   10159 H  HB3  . LEU A 1 82 ? -17.923 -34.593 -4.679  1.00 0.00 ? 82 LEU A HB3  8  
ATOM   10160 H  HG   . LEU A 1 82 ? -20.110 -34.290 -3.365  1.00 0.00 ? 82 LEU A HG   8  
ATOM   10161 H  HD11 . LEU A 1 82 ? -21.381 -32.432 -3.610  1.00 0.00 ? 82 LEU A HD11 8  
ATOM   10162 H  HD12 . LEU A 1 82 ? -20.758 -32.080 -5.221  1.00 0.00 ? 82 LEU A HD12 8  
ATOM   10163 H  HD13 . LEU A 1 82 ? -19.800 -31.677 -3.797  1.00 0.00 ? 82 LEU A HD13 8  
ATOM   10164 H  HD21 . LEU A 1 82 ? -21.362 -34.211 -5.710  1.00 0.00 ? 82 LEU A HD21 8  
ATOM   10165 H  HD22 . LEU A 1 82 ? -20.422 -35.609 -5.188  1.00 0.00 ? 82 LEU A HD22 8  
ATOM   10166 H  HD23 . LEU A 1 82 ? -19.715 -34.435 -6.299  1.00 0.00 ? 82 LEU A HD23 8  
ATOM   10167 N  N    . GLU A 1 83 ? -16.208 -34.419 -1.414  1.00 0.00 ? 83 GLU A N    8  
ATOM   10168 C  CA   . GLU A 1 83 ? -15.737 -35.545 -0.608  1.00 0.00 ? 83 GLU A CA   8  
ATOM   10169 C  C    . GLU A 1 83 ? -16.478 -35.607 0.726   1.00 0.00 ? 83 GLU A C    8  
ATOM   10170 O  O    . GLU A 1 83 ? -17.086 -36.625 1.060   1.00 0.00 ? 83 GLU A O    8  
ATOM   10171 C  CB   . GLU A 1 83 ? -14.230 -35.426 -0.366  1.00 0.00 ? 83 GLU A CB   8  
ATOM   10172 C  CG   . GLU A 1 83 ? -13.568 -36.735 0.041   1.00 0.00 ? 83 GLU A CG   8  
ATOM   10173 C  CD   . GLU A 1 83 ? -12.557 -36.559 1.159   1.00 0.00 ? 83 GLU A CD   8  
ATOM   10174 O  OE1  . GLU A 1 83 ? -11.674 -35.683 1.030   1.00 0.00 ? 83 GLU A OE1  8  
ATOM   10175 O  OE2  . GLU A 1 83 ? -12.648 -37.295 2.162   1.00 0.00 ? 83 GLU A OE2  8  
ATOM   10176 H  H    . GLU A 1 83 ? -15.754 -33.556 -1.329  1.00 0.00 ? 83 GLU A H    8  
ATOM   10177 H  HA   . GLU A 1 83 ? -15.934 -36.453 -1.160  1.00 0.00 ? 83 GLU A HA   8  
ATOM   10178 H  HB2  . GLU A 1 83 ? -13.757 -35.077 -1.271  1.00 0.00 ? 83 GLU A HB2  8  
ATOM   10179 H  HB3  . GLU A 1 83 ? -14.059 -34.704 0.419   1.00 0.00 ? 83 GLU A HB3  8  
ATOM   10180 H  HG2  . GLU A 1 83 ? -14.331 -37.420 0.375   1.00 0.00 ? 83 GLU A HG2  8  
ATOM   10181 H  HG3  . GLU A 1 83 ? -13.062 -37.150 -0.818  1.00 0.00 ? 83 GLU A HG3  8  
ATOM   10182 N  N    . HIS A 1 84 ? -16.422 -34.508 1.483   1.00 0.00 ? 84 HIS A N    8  
ATOM   10183 C  CA   . HIS A 1 84 ? -17.085 -34.425 2.783   1.00 0.00 ? 84 HIS A CA   8  
ATOM   10184 C  C    . HIS A 1 84 ? -16.565 -35.502 3.734   1.00 0.00 ? 84 HIS A C    8  
ATOM   10185 O  O    . HIS A 1 84 ? -16.618 -35.345 4.954   1.00 0.00 ? 84 HIS A O    8  
ATOM   10186 C  CB   . HIS A 1 84 ? -18.603 -34.559 2.618   1.00 0.00 ? 84 HIS A CB   8  
ATOM   10187 C  CG   . HIS A 1 84 ? -19.384 -33.637 3.503   1.00 0.00 ? 84 HIS A CG   8  
ATOM   10188 N  ND1  . HIS A 1 84 ? -19.976 -32.477 3.048   1.00 0.00 ? 84 HIS A ND1  8  
ATOM   10189 C  CD2  . HIS A 1 84 ? -19.670 -33.711 4.824   1.00 0.00 ? 84 HIS A CD2  8  
ATOM   10190 C  CE1  . HIS A 1 84 ? -20.590 -31.877 4.053   1.00 0.00 ? 84 HIS A CE1  8  
ATOM   10191 N  NE2  . HIS A 1 84 ? -20.421 -32.605 5.141   1.00 0.00 ? 84 HIS A NE2  8  
ATOM   10192 H  H    . HIS A 1 84 ? -15.919 -33.732 1.158   1.00 0.00 ? 84 HIS A H    8  
ATOM   10193 H  HA   . HIS A 1 84 ? -16.862 -33.456 3.204   1.00 0.00 ? 84 HIS A HA   8  
ATOM   10194 H  HB2  . HIS A 1 84 ? -18.868 -34.339 1.594   1.00 0.00 ? 84 HIS A HB2  8  
ATOM   10195 H  HB3  . HIS A 1 84 ? -18.896 -35.572 2.849   1.00 0.00 ? 84 HIS A HB3  8  
ATOM   10196 H  HD1  . HIS A 1 84 ? -19.946 -32.141 2.129   1.00 0.00 ? 84 HIS A HD1  8  
ATOM   10197 H  HD2  . HIS A 1 84 ? -19.363 -34.494 5.503   1.00 0.00 ? 84 HIS A HD2  8  
ATOM   10198 H  HE1  . HIS A 1 84 ? -21.140 -30.949 3.992   1.00 0.00 ? 84 HIS A HE1  8  
ATOM   10199 H  HE2  . HIS A 1 84 ? -20.852 -32.440 6.004   1.00 0.00 ? 84 HIS A HE2  8  
HETATM 10200 ZN ZN   . ZN  B 2 .  ? 2.726   12.965  3.817   1.00 0.00 ? 85 ZN  A ZN   8  
ATOM   10201 N  N    . MET A 1 1  ? 19.843  2.739   8.490   1.00 0.00 ? 1  MET A N    9  
ATOM   10202 C  CA   . MET A 1 1  ? 18.357  2.622   8.412   1.00 0.00 ? 1  MET A CA   9  
ATOM   10203 C  C    . MET A 1 1  ? 17.672  3.849   9.019   1.00 0.00 ? 1  MET A C    9  
ATOM   10204 O  O    . MET A 1 1  ? 18.236  4.517   9.888   1.00 0.00 ? 1  MET A O    9  
ATOM   10205 C  CB   . MET A 1 1  ? 17.912  1.354   9.154   1.00 0.00 ? 1  MET A CB   9  
ATOM   10206 C  CG   . MET A 1 1  ? 18.361  0.059   8.492   1.00 0.00 ? 1  MET A CG   9  
ATOM   10207 S  SD   . MET A 1 1  ? 17.548  -1.396  9.183   1.00 0.00 ? 1  MET A SD   9  
ATOM   10208 C  CE   . MET A 1 1  ? 18.419  -2.709  8.331   1.00 0.00 ? 1  MET A CE   9  
ATOM   10209 H  H1   . MET A 1 1  ? 20.128  3.551   7.904   1.00 0.00 ? 1  MET A H1   9  
ATOM   10210 H  H2   . MET A 1 1  ? 20.253  1.854   8.126   1.00 0.00 ? 1  MET A H2   9  
ATOM   10211 H  H3   . MET A 1 1  ? 20.100  2.890   9.486   1.00 0.00 ? 1  MET A H3   9  
ATOM   10212 H  HA   . MET A 1 1  ? 18.074  2.542   7.372   1.00 0.00 ? 1  MET A HA   9  
ATOM   10213 H  HB2  . MET A 1 1  ? 18.313  1.377   10.157  1.00 0.00 ? 1  MET A HB2  9  
ATOM   10214 H  HB3  . MET A 1 1  ? 16.832  1.347   9.210   1.00 0.00 ? 1  MET A HB3  9  
ATOM   10215 H  HG2  . MET A 1 1  ? 18.135  0.112   7.438   1.00 0.00 ? 1  MET A HG2  9  
ATOM   10216 H  HG3  . MET A 1 1  ? 19.428  -0.046  8.626   1.00 0.00 ? 1  MET A HG3  9  
ATOM   10217 H  HE1  . MET A 1 1  ? 17.932  -3.653  8.530   1.00 0.00 ? 1  MET A HE1  9  
ATOM   10218 H  HE2  . MET A 1 1  ? 19.439  -2.752  8.682   1.00 0.00 ? 1  MET A HE2  9  
ATOM   10219 H  HE3  . MET A 1 1  ? 18.412  -2.518  7.269   1.00 0.00 ? 1  MET A HE3  9  
ATOM   10220 N  N    . ALA A 1 2  ? 16.454  4.137   8.555   1.00 0.00 ? 2  ALA A N    9  
ATOM   10221 C  CA   . ALA A 1 2  ? 15.689  5.282   9.049   1.00 0.00 ? 2  ALA A CA   9  
ATOM   10222 C  C    . ALA A 1 2  ? 14.535  4.834   9.946   1.00 0.00 ? 2  ALA A C    9  
ATOM   10223 O  O    . ALA A 1 2  ? 13.986  3.743   9.769   1.00 0.00 ? 2  ALA A O    9  
ATOM   10224 C  CB   . ALA A 1 2  ? 15.166  6.111   7.883   1.00 0.00 ? 2  ALA A CB   9  
ATOM   10225 H  H    . ALA A 1 2  ? 16.058  3.566   7.864   1.00 0.00 ? 2  ALA A H    9  
ATOM   10226 H  HA   . ALA A 1 2  ? 16.356  5.903   9.630   1.00 0.00 ? 2  ALA A HA   9  
ATOM   10227 H  HB1  . ALA A 1 2  ? 15.902  6.852   7.610   1.00 0.00 ? 2  ALA A HB1  9  
ATOM   10228 H  HB2  . ALA A 1 2  ? 14.248  6.605   8.172   1.00 0.00 ? 2  ALA A HB2  9  
ATOM   10229 H  HB3  . ALA A 1 2  ? 14.975  5.465   7.038   1.00 0.00 ? 2  ALA A HB3  9  
ATOM   10230 N  N    . VAL A 1 3  ? 14.170  5.686   10.905  1.00 0.00 ? 3  VAL A N    9  
ATOM   10231 C  CA   . VAL A 1 3  ? 13.077  5.383   11.829  1.00 0.00 ? 3  VAL A CA   9  
ATOM   10232 C  C    . VAL A 1 3  ? 11.724  5.519   11.133  1.00 0.00 ? 3  VAL A C    9  
ATOM   10233 O  O    . VAL A 1 3  ? 11.282  6.630   10.830  1.00 0.00 ? 3  VAL A O    9  
ATOM   10234 C  CB   . VAL A 1 3  ? 13.100  6.299   13.077  1.00 0.00 ? 3  VAL A CB   9  
ATOM   10235 C  CG1  . VAL A 1 3  ? 12.058  5.845   14.090  1.00 0.00 ? 3  VAL A CG1  9  
ATOM   10236 C  CG2  . VAL A 1 3  ? 14.486  6.325   13.708  1.00 0.00 ? 3  VAL A CG2  9  
ATOM   10237 H  H    . VAL A 1 3  ? 14.643  6.540   10.989  1.00 0.00 ? 3  VAL A H    9  
ATOM   10238 H  HA   . VAL A 1 3  ? 13.198  4.361   12.157  1.00 0.00 ? 3  VAL A HA   9  
ATOM   10239 H  HB   . VAL A 1 3  ? 12.851  7.305   12.765  1.00 0.00 ? 3  VAL A HB   9  
ATOM   10240 H  HG11 . VAL A 1 3  ? 11.109  6.309   13.864  1.00 0.00 ? 3  VAL A HG11 9  
ATOM   10241 H  HG12 . VAL A 1 3  ? 12.370  6.134   15.084  1.00 0.00 ? 3  VAL A HG12 9  
ATOM   10242 H  HG13 . VAL A 1 3  ? 11.954  4.771   14.044  1.00 0.00 ? 3  VAL A HG13 9  
ATOM   10243 H  HG21 . VAL A 1 3  ? 15.201  6.708   12.995  1.00 0.00 ? 3  VAL A HG21 9  
ATOM   10244 H  HG22 . VAL A 1 3  ? 14.768  5.325   13.999  1.00 0.00 ? 3  VAL A HG22 9  
ATOM   10245 H  HG23 . VAL A 1 3  ? 14.471  6.963   14.580  1.00 0.00 ? 3  VAL A HG23 9  
ATOM   10246 N  N    . PHE A 1 4  ? 11.074  4.384   10.879  1.00 0.00 ? 4  PHE A N    9  
ATOM   10247 C  CA   . PHE A 1 4  ? 9.769   4.370   10.215  1.00 0.00 ? 4  PHE A CA   9  
ATOM   10248 C  C    . PHE A 1 4  ? 8.714   5.073   11.065  1.00 0.00 ? 4  PHE A C    9  
ATOM   10249 O  O    . PHE A 1 4  ? 8.715   4.959   12.291  1.00 0.00 ? 4  PHE A O    9  
ATOM   10250 C  CB   . PHE A 1 4  ? 9.326   2.931   9.930   1.00 0.00 ? 4  PHE A CB   9  
ATOM   10251 C  CG   . PHE A 1 4  ? 9.723   2.431   8.568   1.00 0.00 ? 4  PHE A CG   9  
ATOM   10252 C  CD1  . PHE A 1 4  ? 10.968  1.863   8.358   1.00 0.00 ? 4  PHE A CD1  9  
ATOM   10253 C  CD2  . PHE A 1 4  ? 8.844   2.525   7.499   1.00 0.00 ? 4  PHE A CD2  9  
ATOM   10254 C  CE1  . PHE A 1 4  ? 11.332  1.397   7.109   1.00 0.00 ? 4  PHE A CE1  9  
ATOM   10255 C  CE2  . PHE A 1 4  ? 9.204   2.062   6.249   1.00 0.00 ? 4  PHE A CE2  9  
ATOM   10256 C  CZ   . PHE A 1 4  ? 10.447  1.496   6.053   1.00 0.00 ? 4  PHE A CZ   9  
ATOM   10257 H  H    . PHE A 1 4  ? 11.481  3.533   11.144  1.00 0.00 ? 4  PHE A H    9  
ATOM   10258 H  HA   . PHE A 1 4  ? 9.870   4.900   9.278   1.00 0.00 ? 4  PHE A HA   9  
ATOM   10259 H  HB2  . PHE A 1 4  ? 9.768   2.275   10.666  1.00 0.00 ? 4  PHE A HB2  9  
ATOM   10260 H  HB3  . PHE A 1 4  ? 8.249   2.873   10.005  1.00 0.00 ? 4  PHE A HB3  9  
ATOM   10261 H  HD1  . PHE A 1 4  ? 11.662  1.785   9.184   1.00 0.00 ? 4  PHE A HD1  9  
ATOM   10262 H  HD2  . PHE A 1 4  ? 7.871   2.968   7.650   1.00 0.00 ? 4  PHE A HD2  9  
ATOM   10263 H  HE1  . PHE A 1 4  ? 12.305  0.955   6.957   1.00 0.00 ? 4  PHE A HE1  9  
ATOM   10264 H  HE2  . PHE A 1 4  ? 8.510   2.141   5.424   1.00 0.00 ? 4  PHE A HE2  9  
ATOM   10265 H  HZ   . PHE A 1 4  ? 10.729  1.133   5.075   1.00 0.00 ? 4  PHE A HZ   9  
ATOM   10266 N  N    . HIS A 1 5  ? 7.810   5.797   10.404  1.00 0.00 ? 5  HIS A N    9  
ATOM   10267 C  CA   . HIS A 1 5  ? 6.744   6.513   11.100  1.00 0.00 ? 5  HIS A CA   9  
ATOM   10268 C  C    . HIS A 1 5  ? 5.755   5.525   11.718  1.00 0.00 ? 5  HIS A C    9  
ATOM   10269 O  O    . HIS A 1 5  ? 5.639   5.438   12.942  1.00 0.00 ? 5  HIS A O    9  
ATOM   10270 C  CB   . HIS A 1 5  ? 6.018   7.469   10.142  1.00 0.00 ? 5  HIS A CB   9  
ATOM   10271 C  CG   . HIS A 1 5  ? 5.399   8.654   10.819  1.00 0.00 ? 5  HIS A CG   9  
ATOM   10272 N  ND1  . HIS A 1 5  ? 6.057   9.411   11.766  1.00 0.00 ? 5  HIS A ND1  9  
ATOM   10273 C  CD2  . HIS A 1 5  ? 4.175   9.216   10.676  1.00 0.00 ? 5  HIS A CD2  9  
ATOM   10274 C  CE1  . HIS A 1 5  ? 5.266   10.386  12.176  1.00 0.00 ? 5  HIS A CE1  9  
ATOM   10275 N  NE2  . HIS A 1 5  ? 4.120   10.291  11.529  1.00 0.00 ? 5  HIS A NE2  9  
ATOM   10276 H  H    . HIS A 1 5  ? 7.860   5.846   9.426   1.00 0.00 ? 5  HIS A H    9  
ATOM   10277 H  HA   . HIS A 1 5  ? 7.200   7.087   11.895  1.00 0.00 ? 5  HIS A HA   9  
ATOM   10278 H  HB2  . HIS A 1 5  ? 6.722   7.839   9.413   1.00 0.00 ? 5  HIS A HB2  9  
ATOM   10279 H  HB3  . HIS A 1 5  ? 5.232   6.929   9.631   1.00 0.00 ? 5  HIS A HB3  9  
ATOM   10280 H  HD1  . HIS A 1 5  ? 6.970   9.256   12.091  1.00 0.00 ? 5  HIS A HD1  9  
ATOM   10281 H  HD2  . HIS A 1 5  ? 3.391   8.883   10.012  1.00 0.00 ? 5  HIS A HD2  9  
ATOM   10282 H  HE1  . HIS A 1 5  ? 5.516   11.134  12.913  1.00 0.00 ? 5  HIS A HE1  9  
ATOM   10283 H  HE2  . HIS A 1 5  ? 3.330   10.848  11.692  1.00 0.00 ? 5  HIS A HE2  9  
ATOM   10284 N  N    . ASP A 1 6  ? 5.053   4.778   10.863  1.00 0.00 ? 6  ASP A N    9  
ATOM   10285 C  CA   . ASP A 1 6  ? 4.078   3.788   11.321  1.00 0.00 ? 6  ASP A CA   9  
ATOM   10286 C  C    . ASP A 1 6  ? 3.849   2.714   10.255  1.00 0.00 ? 6  ASP A C    9  
ATOM   10287 O  O    . ASP A 1 6  ? 3.952   2.986   9.056   1.00 0.00 ? 6  ASP A O    9  
ATOM   10288 C  CB   . ASP A 1 6  ? 2.745   4.469   11.662  1.00 0.00 ? 6  ASP A CB   9  
ATOM   10289 C  CG   . ASP A 1 6  ? 2.667   4.935   13.106  1.00 0.00 ? 6  ASP A CG   9  
ATOM   10290 O  OD1  . ASP A 1 6  ? 2.660   4.074   14.012  1.00 0.00 ? 6  ASP A OD1  9  
ATOM   10291 O  OD2  . ASP A 1 6  ? 2.609   6.163   13.328  1.00 0.00 ? 6  ASP A OD2  9  
ATOM   10292 H  H    . ASP A 1 6  ? 5.198   4.891   9.900   1.00 0.00 ? 6  ASP A H    9  
ATOM   10293 H  HA   . ASP A 1 6  ? 4.474   3.318   12.211  1.00 0.00 ? 6  ASP A HA   9  
ATOM   10294 H  HB2  . ASP A 1 6  ? 2.616   5.329   11.023  1.00 0.00 ? 6  ASP A HB2  9  
ATOM   10295 H  HB3  . ASP A 1 6  ? 1.939   3.773   11.484  1.00 0.00 ? 6  ASP A HB3  9  
ATOM   10296 N  N    . GLU A 1 7  ? 3.534   1.496   10.698  1.00 0.00 ? 7  GLU A N    9  
ATOM   10297 C  CA   . GLU A 1 7  ? 3.279   0.381   9.785   1.00 0.00 ? 7  GLU A CA   9  
ATOM   10298 C  C    . GLU A 1 7  ? 1.779   0.144   9.639   1.00 0.00 ? 7  GLU A C    9  
ATOM   10299 O  O    . GLU A 1 7  ? 1.047   0.128   10.630  1.00 0.00 ? 7  GLU A O    9  
ATOM   10300 C  CB   . GLU A 1 7  ? 3.959   -0.900  10.283  1.00 0.00 ? 7  GLU A CB   9  
ATOM   10301 C  CG   . GLU A 1 7  ? 5.399   -0.704  10.730  1.00 0.00 ? 7  GLU A CG   9  
ATOM   10302 C  CD   . GLU A 1 7  ? 5.526   -0.487  12.227  1.00 0.00 ? 7  GLU A CD   9  
ATOM   10303 O  OE1  . GLU A 1 7  ? 5.205   -1.421  12.993  1.00 0.00 ? 7  GLU A OE1  9  
ATOM   10304 O  OE2  . GLU A 1 7  ? 5.949   0.616   12.631  1.00 0.00 ? 7  GLU A OE2  9  
ATOM   10305 H  H    . GLU A 1 7  ? 3.464   1.343   11.664  1.00 0.00 ? 7  GLU A H    9  
ATOM   10306 H  HA   . GLU A 1 7  ? 3.687   0.644   8.820   1.00 0.00 ? 7  GLU A HA   9  
ATOM   10307 H  HB2  . GLU A 1 7  ? 3.396   -1.291  11.119  1.00 0.00 ? 7  GLU A HB2  9  
ATOM   10308 H  HB3  . GLU A 1 7  ? 3.949   -1.628  9.485   1.00 0.00 ? 7  GLU A HB3  9  
ATOM   10309 H  HG2  . GLU A 1 7  ? 5.969   -1.581  10.461  1.00 0.00 ? 7  GLU A HG2  9  
ATOM   10310 H  HG3  . GLU A 1 7  ? 5.805   0.157   10.221  1.00 0.00 ? 7  GLU A HG3  9  
ATOM   10311 N  N    . VAL A 1 8  ? 1.327   -0.039  8.399   1.00 0.00 ? 8  VAL A N    9  
ATOM   10312 C  CA   . VAL A 1 8  ? -0.089  -0.273  8.125   1.00 0.00 ? 8  VAL A CA   9  
ATOM   10313 C  C    . VAL A 1 8  ? -0.276  -1.450  7.170   1.00 0.00 ? 8  VAL A C    9  
ATOM   10314 O  O    . VAL A 1 8  ? 0.499   -1.628  6.226   1.00 0.00 ? 8  VAL A O    9  
ATOM   10315 C  CB   . VAL A 1 8  ? -0.768  0.979   7.525   1.00 0.00 ? 8  VAL A CB   9  
ATOM   10316 C  CG1  . VAL A 1 8  ? -2.277  0.791   7.456   1.00 0.00 ? 8  VAL A CG1  9  
ATOM   10317 C  CG2  . VAL A 1 8  ? -0.420  2.223   8.332   1.00 0.00 ? 8  VAL A CG2  9  
ATOM   10318 H  H    . VAL A 1 8  ? 1.960   -0.014  7.650   1.00 0.00 ? 8  VAL A H    9  
ATOM   10319 H  HA   . VAL A 1 8  ? -0.575  -0.506  9.063   1.00 0.00 ? 8  VAL A HA   9  
ATOM   10320 H  HB   . VAL A 1 8  ? -0.399  1.115   6.518   1.00 0.00 ? 8  VAL A HB   9  
ATOM   10321 H  HG11 . VAL A 1 8  ? -2.503  -0.221  7.153   1.00 0.00 ? 8  VAL A HG11 9  
ATOM   10322 H  HG12 . VAL A 1 8  ? -2.692  1.481   6.737   1.00 0.00 ? 8  VAL A HG12 9  
ATOM   10323 H  HG13 . VAL A 1 8  ? -2.709  0.981   8.426   1.00 0.00 ? 8  VAL A HG13 9  
ATOM   10324 H  HG21 . VAL A 1 8  ? 0.649   2.372   8.322   1.00 0.00 ? 8  VAL A HG21 9  
ATOM   10325 H  HG22 . VAL A 1 8  ? -0.759  2.097   9.350   1.00 0.00 ? 8  VAL A HG22 9  
ATOM   10326 H  HG23 . VAL A 1 8  ? -0.907  3.082   7.894   1.00 0.00 ? 8  VAL A HG23 9  
ATOM   10327 N  N    . GLU A 1 9  ? -1.312  -2.249  7.422   1.00 0.00 ? 9  GLU A N    9  
ATOM   10328 C  CA   . GLU A 1 9  ? -1.617  -3.411  6.590   1.00 0.00 ? 9  GLU A CA   9  
ATOM   10329 C  C    . GLU A 1 9  ? -2.059  -2.983  5.192   1.00 0.00 ? 9  GLU A C    9  
ATOM   10330 O  O    . GLU A 1 9  ? -2.801  -2.010  5.035   1.00 0.00 ? 9  GLU A O    9  
ATOM   10331 C  CB   . GLU A 1 9  ? -2.711  -4.268  7.238   1.00 0.00 ? 9  GLU A CB   9  
ATOM   10332 C  CG   . GLU A 1 9  ? -2.337  -4.818  8.607   1.00 0.00 ? 9  GLU A CG   9  
ATOM   10333 C  CD   . GLU A 1 9  ? -3.547  -5.273  9.404   1.00 0.00 ? 9  GLU A CD   9  
ATOM   10334 O  OE1  . GLU A 1 9  ? -4.306  -4.402  9.881   1.00 0.00 ? 9  GLU A OE1  9  
ATOM   10335 O  OE2  . GLU A 1 9  ? -3.733  -6.499  9.552   1.00 0.00 ? 9  GLU A OE2  9  
ATOM   10336 H  H    . GLU A 1 9  ? -1.891  -2.048  8.188   1.00 0.00 ? 9  GLU A H    9  
ATOM   10337 H  HA   . GLU A 1 9  ? -0.715  -3.999  6.504   1.00 0.00 ? 9  GLU A HA   9  
ATOM   10338 H  HB2  . GLU A 1 9  ? -3.604  -3.669  7.346   1.00 0.00 ? 9  GLU A HB2  9  
ATOM   10339 H  HB3  . GLU A 1 9  ? -2.927  -5.103  6.587   1.00 0.00 ? 9  GLU A HB3  9  
ATOM   10340 H  HG2  . GLU A 1 9  ? -1.675  -5.661  8.475   1.00 0.00 ? 9  GLU A HG2  9  
ATOM   10341 H  HG3  . GLU A 1 9  ? -1.828  -4.045  9.165   1.00 0.00 ? 9  GLU A HG3  9  
ATOM   10342 N  N    . ILE A 1 10 ? -1.600  -3.720  4.183   1.00 0.00 ? 10 ILE A N    9  
ATOM   10343 C  CA   . ILE A 1 10 ? -1.942  -3.433  2.789   1.00 0.00 ? 10 ILE A CA   9  
ATOM   10344 C  C    . ILE A 1 10 ? -3.461  -3.418  2.574   1.00 0.00 ? 10 ILE A C    9  
ATOM   10345 O  O    . ILE A 1 10 ? -3.958  -2.696  1.710   1.00 0.00 ? 10 ILE A O    9  
ATOM   10346 C  CB   . ILE A 1 10 ? -1.282  -4.453  1.828   1.00 0.00 ? 10 ILE A CB   9  
ATOM   10347 C  CG1  . ILE A 1 10 ? -1.467  -4.018  0.371   1.00 0.00 ? 10 ILE A CG1  9  
ATOM   10348 C  CG2  . ILE A 1 10 ? -1.844  -5.852  2.046   1.00 0.00 ? 10 ILE A CG2  9  
ATOM   10349 C  CD1  . ILE A 1 10 ? -0.590  -2.851  -0.027  1.00 0.00 ? 10 ILE A CD1  9  
ATOM   10350 H  H    . ILE A 1 10 ? -1.012  -4.482  4.380   1.00 0.00 ? 10 ILE A H    9  
ATOM   10351 H  HA   . ILE A 1 10 ? -1.552  -2.453  2.553   1.00 0.00 ? 10 ILE A HA   9  
ATOM   10352 H  HB   . ILE A 1 10 ? -0.226  -4.483  2.050   1.00 0.00 ? 10 ILE A HB   9  
ATOM   10353 H  HG12 . ILE A 1 10 ? -1.229  -4.848  -0.276  1.00 0.00 ? 10 ILE A HG12 9  
ATOM   10354 H  HG13 . ILE A 1 10 ? -2.497  -3.729  0.215   1.00 0.00 ? 10 ILE A HG13 9  
ATOM   10355 H  HG21 . ILE A 1 10 ? -1.663  -6.158  3.065   1.00 0.00 ? 10 ILE A HG21 9  
ATOM   10356 H  HG22 . ILE A 1 10 ? -1.358  -6.543  1.372   1.00 0.00 ? 10 ILE A HG22 9  
ATOM   10357 H  HG23 . ILE A 1 10 ? -2.906  -5.849  1.853   1.00 0.00 ? 10 ILE A HG23 9  
ATOM   10358 H  HD11 . ILE A 1 10 ? -0.311  -2.951  -1.066  1.00 0.00 ? 10 ILE A HD11 9  
ATOM   10359 H  HD12 . ILE A 1 10 ? 0.299   -2.843  0.584   1.00 0.00 ? 10 ILE A HD12 9  
ATOM   10360 H  HD13 . ILE A 1 10 ? -1.133  -1.929  0.113   1.00 0.00 ? 10 ILE A HD13 9  
ATOM   10361 N  N    . GLU A 1 11 ? -4.191  -4.209  3.369   1.00 0.00 ? 11 GLU A N    9  
ATOM   10362 C  CA   . GLU A 1 11 ? -5.651  -4.267  3.268   1.00 0.00 ? 11 GLU A CA   9  
ATOM   10363 C  C    . GLU A 1 11 ? -6.269  -2.884  3.497   1.00 0.00 ? 11 GLU A C    9  
ATOM   10364 O  O    . GLU A 1 11 ? -7.285  -2.543  2.889   1.00 0.00 ? 11 GLU A O    9  
ATOM   10365 C  CB   . GLU A 1 11 ? -6.216  -5.271  4.276   1.00 0.00 ? 11 GLU A CB   9  
ATOM   10366 C  CG   . GLU A 1 11 ? -6.139  -6.716  3.806   1.00 0.00 ? 11 GLU A CG   9  
ATOM   10367 C  CD   . GLU A 1 11 ? -6.283  -7.711  4.942   1.00 0.00 ? 11 GLU A CD   9  
ATOM   10368 O  OE1  . GLU A 1 11 ? -7.434  -8.053  5.292   1.00 0.00 ? 11 GLU A OE1  9  
ATOM   10369 O  OE2  . GLU A 1 11 ? -5.246  -8.152  5.479   1.00 0.00 ? 11 GLU A OE2  9  
ATOM   10370 H  H    . GLU A 1 11 ? -3.739  -4.757  4.043   1.00 0.00 ? 11 GLU A H    9  
ATOM   10371 H  HA   . GLU A 1 11 ? -5.901  -4.596  2.269   1.00 0.00 ? 11 GLU A HA   9  
ATOM   10372 H  HB2  . GLU A 1 11 ? -5.663  -5.186  5.201   1.00 0.00 ? 11 GLU A HB2  9  
ATOM   10373 H  HB3  . GLU A 1 11 ? -7.253  -5.031  4.463   1.00 0.00 ? 11 GLU A HB3  9  
ATOM   10374 H  HG2  . GLU A 1 11 ? -6.931  -6.892  3.094   1.00 0.00 ? 11 GLU A HG2  9  
ATOM   10375 H  HG3  . GLU A 1 11 ? -5.184  -6.875  3.328   1.00 0.00 ? 11 GLU A HG3  9  
ATOM   10376 N  N    . ASP A 1 12 ? -5.644  -2.089  4.370   1.00 0.00 ? 12 ASP A N    9  
ATOM   10377 C  CA   . ASP A 1 12 ? -6.125  -0.739  4.671   1.00 0.00 ? 12 ASP A CA   9  
ATOM   10378 C  C    . ASP A 1 12 ? -5.839  0.221   3.511   1.00 0.00 ? 12 ASP A C    9  
ATOM   10379 O  O    . ASP A 1 12 ? -6.586  1.175   3.290   1.00 0.00 ? 12 ASP A O    9  
ATOM   10380 C  CB   . ASP A 1 12 ? -5.471  -0.216  5.954   1.00 0.00 ? 12 ASP A CB   9  
ATOM   10381 C  CG   . ASP A 1 12 ? -6.367  0.748   6.710   1.00 0.00 ? 12 ASP A CG   9  
ATOM   10382 O  OD1  . ASP A 1 12 ? -7.466  0.329   7.135   1.00 0.00 ? 12 ASP A OD1  9  
ATOM   10383 O  OD2  . ASP A 1 12 ? -5.970  1.919   6.878   1.00 0.00 ? 12 ASP A OD2  9  
ATOM   10384 H  H    . ASP A 1 12 ? -4.836  -2.416  4.820   1.00 0.00 ? 12 ASP A H    9  
ATOM   10385 H  HA   . ASP A 1 12 ? -7.194  -0.795  4.822   1.00 0.00 ? 12 ASP A HA   9  
ATOM   10386 H  HB2  . ASP A 1 12 ? -5.243  -1.049  6.602   1.00 0.00 ? 12 ASP A HB2  9  
ATOM   10387 H  HB3  . ASP A 1 12 ? -4.556  0.297   5.699   1.00 0.00 ? 12 ASP A HB3  9  
ATOM   10388 N  N    . PHE A 1 13 ? -4.753  -0.040  2.775   1.00 0.00 ? 13 PHE A N    9  
ATOM   10389 C  CA   . PHE A 1 13 ? -4.363  0.794   1.635   1.00 0.00 ? 13 PHE A CA   9  
ATOM   10390 C  C    . PHE A 1 13 ? -5.428  0.760   0.537   1.00 0.00 ? 13 PHE A C    9  
ATOM   10391 O  O    . PHE A 1 13 ? -6.299  -0.114  0.530   1.00 0.00 ? 13 PHE A O    9  
ATOM   10392 C  CB   . PHE A 1 13 ? -3.026  0.314   1.056   1.00 0.00 ? 13 PHE A CB   9  
ATOM   10393 C  CG   . PHE A 1 13 ? -1.815  0.973   1.659   1.00 0.00 ? 13 PHE A CG   9  
ATOM   10394 C  CD1  . PHE A 1 13 ? -1.500  0.794   2.998   1.00 0.00 ? 13 PHE A CD1  9  
ATOM   10395 C  CD2  . PHE A 1 13 ? -0.983  1.762   0.880   1.00 0.00 ? 13 PHE A CD2  9  
ATOM   10396 C  CE1  . PHE A 1 13 ? -0.381  1.393   3.546   1.00 0.00 ? 13 PHE A CE1  9  
ATOM   10397 C  CE2  . PHE A 1 13 ? 0.137   2.360   1.421   1.00 0.00 ? 13 PHE A CE2  9  
ATOM   10398 C  CZ   . PHE A 1 13 ? 0.439   2.176   2.757   1.00 0.00 ? 13 PHE A CZ   9  
ATOM   10399 H  H    . PHE A 1 13 ? -4.199  -0.815  3.004   1.00 0.00 ? 13 PHE A H    9  
ATOM   10400 H  HA   . PHE A 1 13 ? -4.252  1.810   1.986   1.00 0.00 ? 13 PHE A HA   9  
ATOM   10401 H  HB2  . PHE A 1 13 ? -2.934  -0.750  1.214   1.00 0.00 ? 13 PHE A HB2  9  
ATOM   10402 H  HB3  . PHE A 1 13 ? -3.016  0.511   -0.007  1.00 0.00 ? 13 PHE A HB3  9  
ATOM   10403 H  HD1  . PHE A 1 13 ? -2.140  0.182   3.616   1.00 0.00 ? 13 PHE A HD1  9  
ATOM   10404 H  HD2  . PHE A 1 13 ? -1.219  1.910   -0.164  1.00 0.00 ? 13 PHE A HD2  9  
ATOM   10405 H  HE1  . PHE A 1 13 ? -0.147  1.247   4.589   1.00 0.00 ? 13 PHE A HE1  9  
ATOM   10406 H  HE2  . PHE A 1 13 ? 0.776   2.972   0.802   1.00 0.00 ? 13 PHE A HE2  9  
ATOM   10407 H  HZ   . PHE A 1 13 ? 1.314   2.642   3.182   1.00 0.00 ? 13 PHE A HZ   9  
ATOM   10408 N  N    . GLN A 1 14 ? -5.346  1.710   -0.393  1.00 0.00 ? 14 GLN A N    9  
ATOM   10409 C  CA   . GLN A 1 14 ? -6.296  1.780   -1.499  1.00 0.00 ? 14 GLN A CA   9  
ATOM   10410 C  C    . GLN A 1 14 ? -5.699  1.162   -2.762  1.00 0.00 ? 14 GLN A C    9  
ATOM   10411 O  O    . GLN A 1 14 ? -4.767  1.718   -3.350  1.00 0.00 ? 14 GLN A O    9  
ATOM   10412 C  CB   . GLN A 1 14 ? -6.698  3.236   -1.768  1.00 0.00 ? 14 GLN A CB   9  
ATOM   10413 C  CG   . GLN A 1 14 ? -8.165  3.412   -2.133  1.00 0.00 ? 14 GLN A CG   9  
ATOM   10414 C  CD   . GLN A 1 14 ? -8.571  2.601   -3.352  1.00 0.00 ? 14 GLN A CD   9  
ATOM   10415 O  OE1  . GLN A 1 14 ? -8.302  2.990   -4.487  1.00 0.00 ? 14 GLN A OE1  9  
ATOM   10416 N  NE2  . GLN A 1 14 ? -9.224  1.465   -3.121  1.00 0.00 ? 14 GLN A NE2  9  
ATOM   10417 H  H    . GLN A 1 14 ? -4.627  2.374   -0.338  1.00 0.00 ? 14 GLN A H    9  
ATOM   10418 H  HA   . GLN A 1 14 ? -7.174  1.218   -1.219  1.00 0.00 ? 14 GLN A HA   9  
ATOM   10419 H  HB2  . GLN A 1 14 ? -6.497  3.822   -0.883  1.00 0.00 ? 14 GLN A HB2  9  
ATOM   10420 H  HB3  . GLN A 1 14 ? -6.099  3.619   -2.583  1.00 0.00 ? 14 GLN A HB3  9  
ATOM   10421 H  HG2  . GLN A 1 14 ? -8.771  3.102   -1.296  1.00 0.00 ? 14 GLN A HG2  9  
ATOM   10422 H  HG3  . GLN A 1 14 ? -8.348  4.456   -2.339  1.00 0.00 ? 14 GLN A HG3  9  
ATOM   10423 H  HE21 . GLN A 1 14 ? -9.407  1.216   -2.191  1.00 0.00 ? 14 GLN A HE21 9  
ATOM   10424 H  HE22 . GLN A 1 14 ? -9.494  0.923   -3.892  1.00 0.00 ? 14 GLN A HE22 9  
ATOM   10425 N  N    . TYR A 1 15 ? -6.237  0.013   -3.176  1.00 0.00 ? 15 TYR A N    9  
ATOM   10426 C  CA   . TYR A 1 15 ? -5.751  -0.670  -4.375  1.00 0.00 ? 15 TYR A CA   9  
ATOM   10427 C  C    . TYR A 1 15 ? -6.058  0.155   -5.622  1.00 0.00 ? 15 TYR A C    9  
ATOM   10428 O  O    . TYR A 1 15 ? -7.217  0.462   -5.904  1.00 0.00 ? 15 TYR A O    9  
ATOM   10429 C  CB   . TYR A 1 15 ? -6.377  -2.065  -4.505  1.00 0.00 ? 15 TYR A CB   9  
ATOM   10430 C  CG   . TYR A 1 15 ? -5.898  -2.830  -5.724  1.00 0.00 ? 15 TYR A CG   9  
ATOM   10431 C  CD1  . TYR A 1 15 ? -4.583  -3.270  -5.819  1.00 0.00 ? 15 TYR A CD1  9  
ATOM   10432 C  CD2  . TYR A 1 15 ? -6.759  -3.105  -6.780  1.00 0.00 ? 15 TYR A CD2  9  
ATOM   10433 C  CE1  . TYR A 1 15 ? -4.140  -3.962  -6.930  1.00 0.00 ? 15 TYR A CE1  9  
ATOM   10434 C  CE2  . TYR A 1 15 ? -6.323  -3.798  -7.894  1.00 0.00 ? 15 TYR A CE2  9  
ATOM   10435 C  CZ   . TYR A 1 15 ? -5.013  -4.224  -7.965  1.00 0.00 ? 15 TYR A CZ   9  
ATOM   10436 O  OH   . TYR A 1 15 ? -4.575  -4.912  -9.076  1.00 0.00 ? 15 TYR A OH   9  
ATOM   10437 H  H    . TYR A 1 15 ? -6.976  -0.380  -2.668  1.00 0.00 ? 15 TYR A H    9  
ATOM   10438 H  HA   . TYR A 1 15 ? -4.680  -0.774  -4.282  1.00 0.00 ? 15 TYR A HA   9  
ATOM   10439 H  HB2  . TYR A 1 15 ? -6.127  -2.646  -3.629  1.00 0.00 ? 15 TYR A HB2  9  
ATOM   10440 H  HB3  . TYR A 1 15 ? -7.451  -1.968  -4.572  1.00 0.00 ? 15 TYR A HB3  9  
ATOM   10441 H  HD1  . TYR A 1 15 ? -3.901  -3.065  -5.009  1.00 0.00 ? 15 TYR A HD1  9  
ATOM   10442 H  HD2  . TYR A 1 15 ? -7.784  -2.769  -6.724  1.00 0.00 ? 15 TYR A HD2  9  
ATOM   10443 H  HE1  . TYR A 1 15 ? -3.114  -4.294  -6.984  1.00 0.00 ? 15 TYR A HE1  9  
ATOM   10444 H  HE2  . TYR A 1 15 ? -7.008  -4.002  -8.704  1.00 0.00 ? 15 TYR A HE2  9  
ATOM   10445 H  HH   . TYR A 1 15 ? -4.158  -5.734  -8.804  1.00 0.00 ? 15 TYR A HH   9  
ATOM   10446 N  N    . ASP A 1 16 ? -5.010  0.511   -6.359  1.00 0.00 ? 16 ASP A N    9  
ATOM   10447 C  CA   . ASP A 1 16 ? -5.153  1.302   -7.577  1.00 0.00 ? 16 ASP A CA   9  
ATOM   10448 C  C    . ASP A 1 16 ? -5.034  0.413   -8.814  1.00 0.00 ? 16 ASP A C    9  
ATOM   10449 O  O    . ASP A 1 16 ? -3.956  0.280   -9.393  1.00 0.00 ? 16 ASP A O    9  
ATOM   10450 C  CB   . ASP A 1 16 ? -4.094  2.414   -7.615  1.00 0.00 ? 16 ASP A CB   9  
ATOM   10451 C  CG   . ASP A 1 16 ? -4.569  3.653   -8.352  1.00 0.00 ? 16 ASP A CG   9  
ATOM   10452 O  OD1  . ASP A 1 16 ? -5.049  3.520   -9.499  1.00 0.00 ? 16 ASP A OD1  9  
ATOM   10453 O  OD2  . ASP A 1 16 ? -4.461  4.758   -7.778  1.00 0.00 ? 16 ASP A OD2  9  
ATOM   10454 H  H    . ASP A 1 16 ? -4.113  0.234   -6.076  1.00 0.00 ? 16 ASP A H    9  
ATOM   10455 H  HA   . ASP A 1 16 ? -6.134  1.751   -7.568  1.00 0.00 ? 16 ASP A HA   9  
ATOM   10456 H  HB2  . ASP A 1 16 ? -3.838  2.697   -6.602  1.00 0.00 ? 16 ASP A HB2  9  
ATOM   10457 H  HB3  . ASP A 1 16 ? -3.211  2.040   -8.110  1.00 0.00 ? 16 ASP A HB3  9  
ATOM   10458 N  N    . GLU A 1 17 ? -6.154  -0.193  -9.211  1.00 0.00 ? 17 GLU A N    9  
ATOM   10459 C  CA   . GLU A 1 17 ? -6.187  -1.074  -10.384 1.00 0.00 ? 17 GLU A CA   9  
ATOM   10460 C  C    . GLU A 1 17 ? -5.676  -0.366  -11.642 1.00 0.00 ? 17 GLU A C    9  
ATOM   10461 O  O    . GLU A 1 17 ? -5.135  -1.011  -12.541 1.00 0.00 ? 17 GLU A O    9  
ATOM   10462 C  CB   . GLU A 1 17 ? -7.608  -1.595  -10.627 1.00 0.00 ? 17 GLU A CB   9  
ATOM   10463 C  CG   . GLU A 1 17 ? -8.678  -0.513  -10.580 1.00 0.00 ? 17 GLU A CG   9  
ATOM   10464 C  CD   . GLU A 1 17 ? -9.987  -0.970  -11.194 1.00 0.00 ? 17 GLU A CD   9  
ATOM   10465 O  OE1  . GLU A 1 17 ? -10.149 -0.820  -12.423 1.00 0.00 ? 17 GLU A OE1  9  
ATOM   10466 O  OE2  . GLU A 1 17 ? -10.845 -1.484  -10.446 1.00 0.00 ? 17 GLU A OE2  9  
ATOM   10467 H  H    . GLU A 1 17 ? -6.980  -0.043  -8.703  1.00 0.00 ? 17 GLU A H    9  
ATOM   10468 H  HA   . GLU A 1 17 ? -5.541  -1.914  -10.177 1.00 0.00 ? 17 GLU A HA   9  
ATOM   10469 H  HB2  . GLU A 1 17 ? -7.644  -2.062  -11.602 1.00 0.00 ? 17 GLU A HB2  9  
ATOM   10470 H  HB3  . GLU A 1 17 ? -7.842  -2.335  -9.877  1.00 0.00 ? 17 GLU A HB3  9  
ATOM   10471 H  HG2  . GLU A 1 17 ? -8.855  -0.245  -9.549  1.00 0.00 ? 17 GLU A HG2  9  
ATOM   10472 H  HG3  . GLU A 1 17 ? -8.322  0.353   -11.122 1.00 0.00 ? 17 GLU A HG3  9  
ATOM   10473 N  N    . ASP A 1 18 ? -5.858  0.960   -11.699 1.00 0.00 ? 18 ASP A N    9  
ATOM   10474 C  CA   . ASP A 1 18 ? -5.423  1.759   -12.849 1.00 0.00 ? 18 ASP A CA   9  
ATOM   10475 C  C    . ASP A 1 18 ? -3.990  1.407   -13.262 1.00 0.00 ? 18 ASP A C    9  
ATOM   10476 O  O    . ASP A 1 18 ? -3.693  1.306   -14.453 1.00 0.00 ? 18 ASP A O    9  
ATOM   10477 C  CB   . ASP A 1 18 ? -5.514  3.262   -12.543 1.00 0.00 ? 18 ASP A CB   9  
ATOM   10478 C  CG   . ASP A 1 18 ? -6.917  3.725   -12.180 1.00 0.00 ? 18 ASP A CG   9  
ATOM   10479 O  OD1  . ASP A 1 18 ? -7.544  3.106   -11.292 1.00 0.00 ? 18 ASP A OD1  9  
ATOM   10480 O  OD2  . ASP A 1 18 ? -7.383  4.724   -12.774 1.00 0.00 ? 18 ASP A OD2  9  
ATOM   10481 H  H    . ASP A 1 18 ? -6.304  1.410   -10.951 1.00 0.00 ? 18 ASP A H    9  
ATOM   10482 H  HA   . ASP A 1 18 ? -6.084  1.534   -13.674 1.00 0.00 ? 18 ASP A HA   9  
ATOM   10483 H  HB2  . ASP A 1 18 ? -4.859  3.496   -11.719 1.00 0.00 ? 18 ASP A HB2  9  
ATOM   10484 H  HB3  . ASP A 1 18 ? -5.194  3.809   -13.416 1.00 0.00 ? 18 ASP A HB3  9  
ATOM   10485 N  N    . SER A 1 19 ? -3.104  1.221   -12.274 1.00 0.00 ? 19 SER A N    9  
ATOM   10486 C  CA   . SER A 1 19 ? -1.708  0.882   -12.553 1.00 0.00 ? 19 SER A CA   9  
ATOM   10487 C  C    . SER A 1 19 ? -1.094  0.006   -11.445 1.00 0.00 ? 19 SER A C    9  
ATOM   10488 O  O    . SER A 1 19 ? 0.118   0.046   -11.216 1.00 0.00 ? 19 SER A O    9  
ATOM   10489 C  CB   . SER A 1 19 ? -0.889  2.165   -12.730 1.00 0.00 ? 19 SER A CB   9  
ATOM   10490 O  OG   . SER A 1 19 ? 0.065   2.027   -13.770 1.00 0.00 ? 19 SER A OG   9  
ATOM   10491 H  H    . SER A 1 19 ? -3.396  1.316   -11.343 1.00 0.00 ? 19 SER A H    9  
ATOM   10492 H  HA   . SER A 1 19 ? -1.686  0.327   -13.480 1.00 0.00 ? 19 SER A HA   9  
ATOM   10493 H  HB2  . SER A 1 19 ? -1.553  2.979   -12.978 1.00 0.00 ? 19 SER A HB2  9  
ATOM   10494 H  HB3  . SER A 1 19 ? -0.371  2.391   -11.809 1.00 0.00 ? 19 SER A HB3  9  
ATOM   10495 H  HG   . SER A 1 19 ? 0.560   2.844   -13.861 1.00 0.00 ? 19 SER A HG   9  
ATOM   10496 N  N    . GLU A 1 20 ? -1.935  -0.793  -10.772 1.00 0.00 ? 20 GLU A N    9  
ATOM   10497 C  CA   . GLU A 1 20 ? -1.483  -1.689  -9.698  1.00 0.00 ? 20 GLU A CA   9  
ATOM   10498 C  C    . GLU A 1 20 ? -0.584  -0.964  -8.688  1.00 0.00 ? 20 GLU A C    9  
ATOM   10499 O  O    . GLU A 1 20 ? 0.608   -1.260  -8.570  1.00 0.00 ? 20 GLU A O    9  
ATOM   10500 C  CB   . GLU A 1 20 ? -0.747  -2.897  -10.291 1.00 0.00 ? 20 GLU A CB   9  
ATOM   10501 C  CG   . GLU A 1 20 ? -1.506  -3.587  -11.415 1.00 0.00 ? 20 GLU A CG   9  
ATOM   10502 C  CD   . GLU A 1 20 ? -0.857  -4.888  -11.847 1.00 0.00 ? 20 GLU A CD   9  
ATOM   10503 O  OE1  . GLU A 1 20 ? -0.918  -5.868  -11.073 1.00 0.00 ? 20 GLU A OE1  9  
ATOM   10504 O  OE2  . GLU A 1 20 ? -0.288  -4.929  -12.958 1.00 0.00 ? 20 GLU A OE2  9  
ATOM   10505 H  H    . GLU A 1 20 ? -2.886  -0.787  -11.009 1.00 0.00 ? 20 GLU A H    9  
ATOM   10506 H  HA   . GLU A 1 20 ? -2.362  -2.043  -9.179  1.00 0.00 ? 20 GLU A HA   9  
ATOM   10507 H  HB2  . GLU A 1 20 ? 0.205   -2.567  -10.679 1.00 0.00 ? 20 GLU A HB2  9  
ATOM   10508 H  HB3  . GLU A 1 20 ? -0.575  -3.619  -9.506  1.00 0.00 ? 20 GLU A HB3  9  
ATOM   10509 H  HG2  . GLU A 1 20 ? -2.509  -3.800  -11.080 1.00 0.00 ? 20 GLU A HG2  9  
ATOM   10510 H  HG3  . GLU A 1 20 ? -1.544  -2.922  -12.265 1.00 0.00 ? 20 GLU A HG3  9  
ATOM   10511 N  N    . THR A 1 21 ? -1.170  -0.015  -7.958  1.00 0.00 ? 21 THR A N    9  
ATOM   10512 C  CA   . THR A 1 21 ? -0.435  0.755   -6.952  1.00 0.00 ? 21 THR A CA   9  
ATOM   10513 C  C    . THR A 1 21 ? -1.279  0.932   -5.687  1.00 0.00 ? 21 THR A C    9  
ATOM   10514 O  O    . THR A 1 21 ? -2.505  0.901   -5.746  1.00 0.00 ? 21 THR A O    9  
ATOM   10515 C  CB   . THR A 1 21 ? -0.040  2.129   -7.518  1.00 0.00 ? 21 THR A CB   9  
ATOM   10516 O  OG1  . THR A 1 21 ? 0.588   2.000   -8.784  1.00 0.00 ? 21 THR A OG1  9  
ATOM   10517 C  CG2  . THR A 1 21 ? 0.902   2.907   -6.620  1.00 0.00 ? 21 THR A CG2  9  
ATOM   10518 H  H    . THR A 1 21 ? -2.123  0.171   -8.096  1.00 0.00 ? 21 THR A H    9  
ATOM   10519 H  HA   . THR A 1 21 ? 0.462   0.206   -6.702  1.00 0.00 ? 21 THR A HA   9  
ATOM   10520 H  HB   . THR A 1 21 ? -0.936  2.722   -7.646  1.00 0.00 ? 21 THR A HB   9  
ATOM   10521 H  HG1  . THR A 1 21 ? 1.224   1.278   -8.759  1.00 0.00 ? 21 THR A HG1  9  
ATOM   10522 H  HG21 . THR A 1 21 ? 1.095   3.878   -7.056  1.00 0.00 ? 21 THR A HG21 9  
ATOM   10523 H  HG22 . THR A 1 21 ? 1.831   2.367   -6.517  1.00 0.00 ? 21 THR A HG22 9  
ATOM   10524 H  HG23 . THR A 1 21 ? 0.451   3.036   -5.648  1.00 0.00 ? 21 THR A HG23 9  
ATOM   10525 N  N    . TYR A 1 22 ? -0.618  1.119   -4.544  1.00 0.00 ? 22 TYR A N    9  
ATOM   10526 C  CA   . TYR A 1 22 ? -1.321  1.306   -3.273  1.00 0.00 ? 22 TYR A CA   9  
ATOM   10527 C  C    . TYR A 1 22 ? -0.991  2.671   -2.673  1.00 0.00 ? 22 TYR A C    9  
ATOM   10528 O  O    . TYR A 1 22 ? 0.156   3.116   -2.727  1.00 0.00 ? 22 TYR A O    9  
ATOM   10529 C  CB   . TYR A 1 22 ? -0.961  0.196   -2.283  1.00 0.00 ? 22 TYR A CB   9  
ATOM   10530 C  CG   . TYR A 1 22 ? -1.303  -1.194  -2.770  1.00 0.00 ? 22 TYR A CG   9  
ATOM   10531 C  CD1  . TYR A 1 22 ? -0.468  -1.865  -3.654  1.00 0.00 ? 22 TYR A CD1  9  
ATOM   10532 C  CD2  . TYR A 1 22 ? -2.459  -1.836  -2.342  1.00 0.00 ? 22 TYR A CD2  9  
ATOM   10533 C  CE1  . TYR A 1 22 ? -0.773  -3.137  -4.095  1.00 0.00 ? 22 TYR A CE1  9  
ATOM   10534 C  CE2  . TYR A 1 22 ? -2.771  -3.109  -2.780  1.00 0.00 ? 22 TYR A CE2  9  
ATOM   10535 C  CZ   . TYR A 1 22 ? -1.925  -3.754  -3.656  1.00 0.00 ? 22 TYR A CZ   9  
ATOM   10536 O  OH   . TYR A 1 22 ? -2.230  -5.024  -4.088  1.00 0.00 ? 22 TYR A OH   9  
ATOM   10537 H  H    . TYR A 1 22 ? 0.364   1.134   -4.554  1.00 0.00 ? 22 TYR A H    9  
ATOM   10538 H  HA   . TYR A 1 22 ? -2.382  1.264   -3.475  1.00 0.00 ? 22 TYR A HA   9  
ATOM   10539 H  HB2  . TYR A 1 22 ? 0.100   0.226   -2.090  1.00 0.00 ? 22 TYR A HB2  9  
ATOM   10540 H  HB3  . TYR A 1 22 ? -1.494  0.363   -1.358  1.00 0.00 ? 22 TYR A HB3  9  
ATOM   10541 H  HD1  . TYR A 1 22 ? 0.433   -1.379  -3.997  1.00 0.00 ? 22 TYR A HD1  9  
ATOM   10542 H  HD2  . TYR A 1 22 ? -3.120  -1.328  -1.656  1.00 0.00 ? 22 TYR A HD2  9  
ATOM   10543 H  HE1  . TYR A 1 22 ? -0.111  -3.641  -4.783  1.00 0.00 ? 22 TYR A HE1  9  
ATOM   10544 H  HE2  . TYR A 1 22 ? -3.673  -3.592  -2.436  1.00 0.00 ? 22 TYR A HE2  9  
ATOM   10545 H  HH   . TYR A 1 22 ? -1.977  -5.658  -3.413  1.00 0.00 ? 22 TYR A HH   9  
ATOM   10546 N  N    . PHE A 1 23 ? -2.003  3.337   -2.112  1.00 0.00 ? 23 PHE A N    9  
ATOM   10547 C  CA   . PHE A 1 23 ? -1.815  4.662   -1.516  1.00 0.00 ? 23 PHE A CA   9  
ATOM   10548 C  C    . PHE A 1 23 ? -2.377  4.723   -0.094  1.00 0.00 ? 23 PHE A C    9  
ATOM   10549 O  O    . PHE A 1 23 ? -3.255  3.938   0.273   1.00 0.00 ? 23 PHE A O    9  
ATOM   10550 C  CB   . PHE A 1 23 ? -2.481  5.737   -2.387  1.00 0.00 ? 23 PHE A CB   9  
ATOM   10551 C  CG   . PHE A 1 23 ? -2.026  5.726   -3.824  1.00 0.00 ? 23 PHE A CG   9  
ATOM   10552 C  CD1  . PHE A 1 23 ? -2.382  4.688   -4.671  1.00 0.00 ? 23 PHE A CD1  9  
ATOM   10553 C  CD2  . PHE A 1 23 ? -1.239  6.752   -4.326  1.00 0.00 ? 23 PHE A CD2  9  
ATOM   10554 C  CE1  . PHE A 1 23 ? -1.965  4.674   -5.988  1.00 0.00 ? 23 PHE A CE1  9  
ATOM   10555 C  CE2  . PHE A 1 23 ? -0.820  6.743   -5.642  1.00 0.00 ? 23 PHE A CE2  9  
ATOM   10556 C  CZ   . PHE A 1 23 ? -1.182  5.702   -6.473  1.00 0.00 ? 23 PHE A CZ   9  
ATOM   10557 H  H    . PHE A 1 23 ? -2.898  2.933   -2.107  1.00 0.00 ? 23 PHE A H    9  
ATOM   10558 H  HA   . PHE A 1 23 ? -0.754  4.856   -1.475  1.00 0.00 ? 23 PHE A HA   9  
ATOM   10559 H  HB2  . PHE A 1 23 ? -3.551  5.585   -2.379  1.00 0.00 ? 23 PHE A HB2  9  
ATOM   10560 H  HB3  . PHE A 1 23 ? -2.259  6.709   -1.975  1.00 0.00 ? 23 PHE A HB3  9  
ATOM   10561 H  HD1  . PHE A 1 23 ? -2.995  3.882   -4.295  1.00 0.00 ? 23 PHE A HD1  9  
ATOM   10562 H  HD2  . PHE A 1 23 ? -0.955  7.567   -3.676  1.00 0.00 ? 23 PHE A HD2  9  
ATOM   10563 H  HE1  . PHE A 1 23 ? -2.250  3.859   -6.636  1.00 0.00 ? 23 PHE A HE1  9  
ATOM   10564 H  HE2  . PHE A 1 23 ? -0.209  7.549   -6.021  1.00 0.00 ? 23 PHE A HE2  9  
ATOM   10565 H  HZ   . PHE A 1 23 ? -0.855  5.693   -7.503  1.00 0.00 ? 23 PHE A HZ   9  
ATOM   10566 N  N    . TYR A 1 24 ? -1.863  5.665   0.703   1.00 0.00 ? 24 TYR A N    9  
ATOM   10567 C  CA   . TYR A 1 24 ? -2.308  5.838   2.085   1.00 0.00 ? 24 TYR A CA   9  
ATOM   10568 C  C    . TYR A 1 24 ? -2.485  7.318   2.429   1.00 0.00 ? 24 TYR A C    9  
ATOM   10569 O  O    . TYR A 1 24 ? -1.640  8.143   2.084   1.00 0.00 ? 24 TYR A O    9  
ATOM   10570 C  CB   . TYR A 1 24 ? -1.303  5.204   3.050   1.00 0.00 ? 24 TYR A CB   9  
ATOM   10571 C  CG   . TYR A 1 24 ? -1.858  4.986   4.440   1.00 0.00 ? 24 TYR A CG   9  
ATOM   10572 C  CD1  . TYR A 1 24 ? -2.712  3.924   4.707   1.00 0.00 ? 24 TYR A CD1  9  
ATOM   10573 C  CD2  . TYR A 1 24 ? -1.530  5.843   5.483   1.00 0.00 ? 24 TYR A CD2  9  
ATOM   10574 C  CE1  . TYR A 1 24 ? -3.226  3.724   5.971   1.00 0.00 ? 24 TYR A CE1  9  
ATOM   10575 C  CE2  . TYR A 1 24 ? -2.040  5.648   6.752   1.00 0.00 ? 24 TYR A CE2  9  
ATOM   10576 C  CZ   . TYR A 1 24 ? -2.887  4.587   6.991   1.00 0.00 ? 24 TYR A CZ   9  
ATOM   10577 O  OH   . TYR A 1 24 ? -3.397  4.391   8.255   1.00 0.00 ? 24 TYR A OH   9  
ATOM   10578 H  H    . TYR A 1 24 ? -1.167  6.260   0.349   1.00 0.00 ? 24 TYR A H    9  
ATOM   10579 H  HA   . TYR A 1 24 ? -3.259  5.338   2.191   1.00 0.00 ? 24 TYR A HA   9  
ATOM   10580 H  HB2  . TYR A 1 24 ? -0.997  4.246   2.661   1.00 0.00 ? 24 TYR A HB2  9  
ATOM   10581 H  HB3  . TYR A 1 24 ? -0.439  5.846   3.134   1.00 0.00 ? 24 TYR A HB3  9  
ATOM   10582 H  HD1  . TYR A 1 24 ? -2.976  3.247   3.906   1.00 0.00 ? 24 TYR A HD1  9  
ATOM   10583 H  HD2  . TYR A 1 24 ? -0.867  6.673   5.292   1.00 0.00 ? 24 TYR A HD2  9  
ATOM   10584 H  HE1  . TYR A 1 24 ? -3.890  2.893   6.158   1.00 0.00 ? 24 TYR A HE1  9  
ATOM   10585 H  HE2  . TYR A 1 24 ? -1.774  6.326   7.550   1.00 0.00 ? 24 TYR A HE2  9  
ATOM   10586 H  HH   . TYR A 1 24 ? -4.356  4.442   8.227   1.00 0.00 ? 24 TYR A HH   9  
ATOM   10587 N  N    . PRO A 1 25 ? -3.588  7.672   3.120   1.00 0.00 ? 25 PRO A N    9  
ATOM   10588 C  CA   . PRO A 1 25 ? -3.863  9.063   3.508   1.00 0.00 ? 25 PRO A CA   9  
ATOM   10589 C  C    . PRO A 1 25 ? -2.861  9.597   4.531   1.00 0.00 ? 25 PRO A C    9  
ATOM   10590 O  O    . PRO A 1 25 ? -2.681  9.012   5.602   1.00 0.00 ? 25 PRO A O    9  
ATOM   10591 C  CB   . PRO A 1 25 ? -5.267  8.997   4.116   1.00 0.00 ? 25 PRO A CB   9  
ATOM   10592 C  CG   . PRO A 1 25 ? -5.427  7.584   4.560   1.00 0.00 ? 25 PRO A CG   9  
ATOM   10593 C  CD   . PRO A 1 25 ? -4.649  6.754   3.578   1.00 0.00 ? 25 PRO A CD   9  
ATOM   10594 H  HA   . PRO A 1 25 ? -3.873  9.713   2.649   1.00 0.00 ? 25 PRO A HA   9  
ATOM   10595 H  HB2  . PRO A 1 25 ? -5.335  9.683   4.949   1.00 0.00 ? 25 PRO A HB2  9  
ATOM   10596 H  HB3  . PRO A 1 25 ? -5.998  9.260   3.367   1.00 0.00 ? 25 PRO A HB3  9  
ATOM   10597 H  HG2  . PRO A 1 25 ? -5.024  7.463   5.556   1.00 0.00 ? 25 PRO A HG2  9  
ATOM   10598 H  HG3  . PRO A 1 25 ? -6.471  7.309   4.541   1.00 0.00 ? 25 PRO A HG3  9  
ATOM   10599 H  HD2  . PRO A 1 25 ? -4.227  5.889   4.068   1.00 0.00 ? 25 PRO A HD2  9  
ATOM   10600 H  HD3  . PRO A 1 25 ? -5.281  6.453   2.754   1.00 0.00 ? 25 PRO A HD3  9  
ATOM   10601 N  N    . CYS A 1 26 ? -2.212  10.712  4.194   1.00 0.00 ? 26 CYS A N    9  
ATOM   10602 C  CA   . CYS A 1 26 ? -1.232  11.329  5.082   1.00 0.00 ? 26 CYS A CA   9  
ATOM   10603 C  C    . CYS A 1 26 ? -1.856  12.487  5.860   1.00 0.00 ? 26 CYS A C    9  
ATOM   10604 O  O    . CYS A 1 26 ? -2.687  13.227  5.328   1.00 0.00 ? 26 CYS A O    9  
ATOM   10605 C  CB   . CYS A 1 26 ? -0.027  11.830  4.279   1.00 0.00 ? 26 CYS A CB   9  
ATOM   10606 S  SG   . CYS A 1 26 ? 1.583   11.341  4.972   1.00 0.00 ? 26 CYS A SG   9  
ATOM   10607 H  H    . CYS A 1 26 ? -2.400  11.133  3.328   1.00 0.00 ? 26 CYS A H    9  
ATOM   10608 H  HA   . CYS A 1 26 ? -0.899  10.578  5.780   1.00 0.00 ? 26 CYS A HA   9  
ATOM   10609 H  HB2  . CYS A 1 26 ? -0.083  11.435  3.275   1.00 0.00 ? 26 CYS A HB2  9  
ATOM   10610 H  HB3  . CYS A 1 26 ? -0.054  12.910  4.238   1.00 0.00 ? 26 CYS A HB3  9  
ATOM   10611 N  N    . PRO A 1 27 ? -1.457  12.662  7.135   1.00 0.00 ? 27 PRO A N    9  
ATOM   10612 C  CA   . PRO A 1 27 ? -1.977  13.740  7.989   1.00 0.00 ? 27 PRO A CA   9  
ATOM   10613 C  C    . PRO A 1 27 ? -1.548  15.134  7.515   1.00 0.00 ? 27 PRO A C    9  
ATOM   10614 O  O    . PRO A 1 27 ? -2.145  16.137  7.910   1.00 0.00 ? 27 PRO A O    9  
ATOM   10615 C  CB   . PRO A 1 27 ? -1.373  13.433  9.363   1.00 0.00 ? 27 PRO A CB   9  
ATOM   10616 C  CG   . PRO A 1 27 ? -0.154  12.626  9.076   1.00 0.00 ? 27 PRO A CG   9  
ATOM   10617 C  CD   . PRO A 1 27 ? -0.467  11.826  7.842   1.00 0.00 ? 27 PRO A CD   9  
ATOM   10618 H  HA   . PRO A 1 27 ? -3.053  13.703  8.052   1.00 0.00 ? 27 PRO A HA   9  
ATOM   10619 H  HB2  . PRO A 1 27 ? -1.126  14.358  9.865   1.00 0.00 ? 27 PRO A HB2  9  
ATOM   10620 H  HB3  . PRO A 1 27 ? -2.084  12.875  9.954   1.00 0.00 ? 27 PRO A HB3  9  
ATOM   10621 H  HG2  . PRO A 1 27 ? 0.687   13.280  8.896   1.00 0.00 ? 27 PRO A HG2  9  
ATOM   10622 H  HG3  . PRO A 1 27 ? 0.054   11.967  9.905   1.00 0.00 ? 27 PRO A HG3  9  
ATOM   10623 H  HD2  . PRO A 1 27 ? 0.424   11.691  7.245   1.00 0.00 ? 27 PRO A HD2  9  
ATOM   10624 H  HD3  . PRO A 1 27 ? -0.893  10.871  8.110   1.00 0.00 ? 27 PRO A HD3  9  
ATOM   10625 N  N    . CYS A 1 28 ? -0.513  15.193  6.670   1.00 0.00 ? 28 CYS A N    9  
ATOM   10626 C  CA   . CYS A 1 28 ? -0.018  16.467  6.152   1.00 0.00 ? 28 CYS A CA   9  
ATOM   10627 C  C    . CYS A 1 28 ? -0.961  17.034  5.084   1.00 0.00 ? 28 CYS A C    9  
ATOM   10628 O  O    . CYS A 1 28 ? -1.195  18.244  5.035   1.00 0.00 ? 28 CYS A O    9  
ATOM   10629 C  CB   . CYS A 1 28 ? 1.394   16.298  5.576   1.00 0.00 ? 28 CYS A CB   9  
ATOM   10630 S  SG   . CYS A 1 28 ? 1.493   15.168  4.150   1.00 0.00 ? 28 CYS A SG   9  
ATOM   10631 H  H    . CYS A 1 28 ? -0.076  14.362  6.386   1.00 0.00 ? 28 CYS A H    9  
ATOM   10632 H  HA   . CYS A 1 28 ? 0.024   17.161  6.979   1.00 0.00 ? 28 CYS A HA   9  
ATOM   10633 H  HB2  . CYS A 1 28 ? 1.761   17.262  5.255   1.00 0.00 ? 28 CYS A HB2  9  
ATOM   10634 H  HB3  . CYS A 1 28 ? 2.046   15.911  6.347   1.00 0.00 ? 28 CYS A HB3  9  
ATOM   10635 N  N    . GLY A 1 29 ? -1.496  16.153  4.233   1.00 0.00 ? 29 GLY A N    9  
ATOM   10636 C  CA   . GLY A 1 29 ? -2.401  16.582  3.177   1.00 0.00 ? 29 GLY A CA   9  
ATOM   10637 C  C    . GLY A 1 29 ? -2.409  15.628  1.993   1.00 0.00 ? 29 GLY A C    9  
ATOM   10638 O  O    . GLY A 1 29 ? -3.473  15.236  1.510   1.00 0.00 ? 29 GLY A O    9  
ATOM   10639 H  H    . GLY A 1 29 ? -1.270  15.203  4.321   1.00 0.00 ? 29 GLY A H    9  
ATOM   10640 H  HA2  . GLY A 1 29 ? -3.399  16.646  3.579   1.00 0.00 ? 29 GLY A HA2  9  
ATOM   10641 H  HA3  . GLY A 1 29 ? -2.099  17.561  2.833   1.00 0.00 ? 29 GLY A HA3  9  
ATOM   10642 N  N    . ASP A 1 30 ? -1.216  15.255  1.527   1.00 0.00 ? 30 ASP A N    9  
ATOM   10643 C  CA   . ASP A 1 30 ? -1.075  14.339  0.396   1.00 0.00 ? 30 ASP A CA   9  
ATOM   10644 C  C    . ASP A 1 30 ? -1.252  12.887  0.851   1.00 0.00 ? 30 ASP A C    9  
ATOM   10645 O  O    . ASP A 1 30 ? -1.590  12.631  2.009   1.00 0.00 ? 30 ASP A O    9  
ATOM   10646 C  CB   . ASP A 1 30 ? 0.300   14.529  -0.255  1.00 0.00 ? 30 ASP A CB   9  
ATOM   10647 C  CG   . ASP A 1 30 ? 0.260   14.418  -1.768  1.00 0.00 ? 30 ASP A CG   9  
ATOM   10648 O  OD1  . ASP A 1 30 ? -0.483  15.197  -2.404  1.00 0.00 ? 30 ASP A OD1  9  
ATOM   10649 O  OD2  . ASP A 1 30 ? 0.977   13.555  -2.319  1.00 0.00 ? 30 ASP A OD2  9  
ATOM   10650 H  H    . ASP A 1 30 ? -0.407  15.602  1.959   1.00 0.00 ? 30 ASP A H    9  
ATOM   10651 H  HA   . ASP A 1 30 ? -1.845  14.575  -0.325  1.00 0.00 ? 30 ASP A HA   9  
ATOM   10652 H  HB2  . ASP A 1 30 ? 0.677   15.507  0.002   1.00 0.00 ? 30 ASP A HB2  9  
ATOM   10653 H  HB3  . ASP A 1 30 ? 0.978   13.778  0.126   1.00 0.00 ? 30 ASP A HB3  9  
ATOM   10654 N  N    . ASN A 1 31 ? -1.025  11.940  -0.061  1.00 0.00 ? 31 ASN A N    9  
ATOM   10655 C  CA   . ASN A 1 31 ? -1.161  10.520  0.259   1.00 0.00 ? 31 ASN A CA   9  
ATOM   10656 C  C    . ASN A 1 31 ? 0.053   9.728   -0.227  1.00 0.00 ? 31 ASN A C    9  
ATOM   10657 O  O    . ASN A 1 31 ? 0.572   9.978   -1.317  1.00 0.00 ? 31 ASN A O    9  
ATOM   10658 C  CB   . ASN A 1 31 ? -2.438  9.943   -0.370  1.00 0.00 ? 31 ASN A CB   9  
ATOM   10659 C  CG   . ASN A 1 31 ? -3.690  10.738  -0.025  1.00 0.00 ? 31 ASN A CG   9  
ATOM   10660 O  OD1  . ASN A 1 31 ? -3.903  11.125  1.122   1.00 0.00 ? 31 ASN A OD1  9  
ATOM   10661 N  ND2  . ASN A 1 31 ? -4.533  10.983  -1.025  1.00 0.00 ? 31 ASN A ND2  9  
ATOM   10662 H  H    . ASN A 1 31 ? -0.759  12.199  -0.967  1.00 0.00 ? 31 ASN A H    9  
ATOM   10663 H  HA   . ASN A 1 31 ? -1.227  10.428  1.334   1.00 0.00 ? 31 ASN A HA   9  
ATOM   10664 H  HB2  . ASN A 1 31 ? -2.327  9.936   -1.443  1.00 0.00 ? 31 ASN A HB2  9  
ATOM   10665 H  HB3  . ASN A 1 31 ? -2.571  8.930   -0.022  1.00 0.00 ? 31 ASN A HB3  9  
ATOM   10666 H  HD21 . ASN A 1 31 ? -4.307  10.648  -1.918  1.00 0.00 ? 31 ASN A HD21 9  
ATOM   10667 H  HD22 . ASN A 1 31 ? -5.351  11.486  -0.827  1.00 0.00 ? 31 ASN A HD22 9  
ATOM   10668 N  N    . PHE A 1 32 ? 0.491   8.763   0.588   1.00 0.00 ? 32 PHE A N    9  
ATOM   10669 C  CA   . PHE A 1 32 ? 1.637   7.912   0.255   1.00 0.00 ? 32 PHE A CA   9  
ATOM   10670 C  C    . PHE A 1 32 ? 1.336   7.052   -0.977  1.00 0.00 ? 32 PHE A C    9  
ATOM   10671 O  O    . PHE A 1 32 ? 0.181   6.933   -1.391  1.00 0.00 ? 32 PHE A O    9  
ATOM   10672 C  CB   . PHE A 1 32 ? 1.980   7.003   1.440   1.00 0.00 ? 32 PHE A CB   9  
ATOM   10673 C  CG   . PHE A 1 32 ? 2.847   7.651   2.485   1.00 0.00 ? 32 PHE A CG   9  
ATOM   10674 C  CD1  . PHE A 1 32 ? 4.193   7.865   2.247   1.00 0.00 ? 32 PHE A CD1  9  
ATOM   10675 C  CD2  . PHE A 1 32 ? 2.318   8.033   3.708   1.00 0.00 ? 32 PHE A CD2  9  
ATOM   10676 C  CE1  . PHE A 1 32 ? 4.998   8.448   3.208   1.00 0.00 ? 32 PHE A CE1  9  
ATOM   10677 C  CE2  . PHE A 1 32 ? 3.118   8.619   4.672   1.00 0.00 ? 32 PHE A CE2  9  
ATOM   10678 C  CZ   . PHE A 1 32 ? 4.459   8.825   4.420   1.00 0.00 ? 32 PHE A CZ   9  
ATOM   10679 H  H    . PHE A 1 32 ? 0.023   8.616   1.438   1.00 0.00 ? 32 PHE A H    9  
ATOM   10680 H  HA   . PHE A 1 32 ? 2.481   8.553   0.040   1.00 0.00 ? 32 PHE A HA   9  
ATOM   10681 H  HB2  . PHE A 1 32 ? 1.065   6.689   1.919   1.00 0.00 ? 32 PHE A HB2  9  
ATOM   10682 H  HB3  . PHE A 1 32 ? 2.501   6.131   1.072   1.00 0.00 ? 32 PHE A HB3  9  
ATOM   10683 H  HD1  . PHE A 1 32 ? 4.616   7.573   1.298   1.00 0.00 ? 32 PHE A HD1  9  
ATOM   10684 H  HD2  . PHE A 1 32 ? 1.269   7.872   3.906   1.00 0.00 ? 32 PHE A HD2  9  
ATOM   10685 H  HE1  . PHE A 1 32 ? 6.046   8.608   3.008   1.00 0.00 ? 32 PHE A HE1  9  
ATOM   10686 H  HE2  . PHE A 1 32 ? 2.694   8.913   5.622   1.00 0.00 ? 32 PHE A HE2  9  
ATOM   10687 H  HZ   . PHE A 1 32 ? 5.086   9.282   5.172   1.00 0.00 ? 32 PHE A HZ   9  
ATOM   10688 N  N    . SER A 1 33 ? 2.379   6.447   -1.554  1.00 0.00 ? 33 SER A N    9  
ATOM   10689 C  CA   . SER A 1 33 ? 2.212   5.599   -2.736  1.00 0.00 ? 33 SER A CA   9  
ATOM   10690 C  C    . SER A 1 33 ? 3.261   4.487   -2.783  1.00 0.00 ? 33 SER A C    9  
ATOM   10691 O  O    . SER A 1 33 ? 4.434   4.710   -2.475  1.00 0.00 ? 33 SER A O    9  
ATOM   10692 C  CB   . SER A 1 33 ? 2.293   6.445   -4.014  1.00 0.00 ? 33 SER A CB   9  
ATOM   10693 O  OG   . SER A 1 33 ? 3.220   7.511   -3.872  1.00 0.00 ? 33 SER A OG   9  
ATOM   10694 H  H    . SER A 1 33 ? 3.277   6.574   -1.180  1.00 0.00 ? 33 SER A H    9  
ATOM   10695 H  HA   . SER A 1 33 ? 1.234   5.147   -2.681  1.00 0.00 ? 33 SER A HA   9  
ATOM   10696 H  HB2  . SER A 1 33 ? 2.607   5.820   -4.837  1.00 0.00 ? 33 SER A HB2  9  
ATOM   10697 H  HB3  . SER A 1 33 ? 1.319   6.858   -4.228  1.00 0.00 ? 33 SER A HB3  9  
ATOM   10698 H  HG   . SER A 1 33 ? 4.115   7.161   -3.879  1.00 0.00 ? 33 SER A HG   9  
ATOM   10699 N  N    . ILE A 1 34 ? 2.823   3.289   -3.180  1.00 0.00 ? 34 ILE A N    9  
ATOM   10700 C  CA   . ILE A 1 34 ? 3.706   2.128   -3.285  1.00 0.00 ? 34 ILE A CA   9  
ATOM   10701 C  C    . ILE A 1 34 ? 3.194   1.156   -4.353  1.00 0.00 ? 34 ILE A C    9  
ATOM   10702 O  O    . ILE A 1 34 ? 2.041   0.723   -4.310  1.00 0.00 ? 34 ILE A O    9  
ATOM   10703 C  CB   . ILE A 1 34 ? 3.846   1.387   -1.934  1.00 0.00 ? 34 ILE A CB   9  
ATOM   10704 C  CG1  . ILE A 1 34 ? 4.814   0.208   -2.071  1.00 0.00 ? 34 ILE A CG1  9  
ATOM   10705 C  CG2  . ILE A 1 34 ? 2.489   0.911   -1.428  1.00 0.00 ? 34 ILE A CG2  9  
ATOM   10706 C  CD1  . ILE A 1 34 ? 5.403   -0.247  -0.756  1.00 0.00 ? 34 ILE A CD1  9  
ATOM   10707 H  H    . ILE A 1 34 ? 1.875   3.184   -3.415  1.00 0.00 ? 34 ILE A H    9  
ATOM   10708 H  HA   . ILE A 1 34 ? 4.684   2.484   -3.581  1.00 0.00 ? 34 ILE A HA   9  
ATOM   10709 H  HB   . ILE A 1 34 ? 4.244   2.084   -1.211  1.00 0.00 ? 34 ILE A HB   9  
ATOM   10710 H  HG12 . ILE A 1 34 ? 4.293   -0.630  -2.507  1.00 0.00 ? 34 ILE A HG12 9  
ATOM   10711 H  HG13 . ILE A 1 34 ? 5.630   0.495   -2.719  1.00 0.00 ? 34 ILE A HG13 9  
ATOM   10712 H  HG21 . ILE A 1 34 ? 1.706   1.495   -1.888  1.00 0.00 ? 34 ILE A HG21 9  
ATOM   10713 H  HG22 . ILE A 1 34 ? 2.442   1.029   -0.355  1.00 0.00 ? 34 ILE A HG22 9  
ATOM   10714 H  HG23 . ILE A 1 34 ? 2.354   -0.131  -1.681  1.00 0.00 ? 34 ILE A HG23 9  
ATOM   10715 H  HD11 . ILE A 1 34 ? 6.402   0.150   -0.651  1.00 0.00 ? 34 ILE A HD11 9  
ATOM   10716 H  HD12 . ILE A 1 34 ? 5.443   -1.326  -0.734  1.00 0.00 ? 34 ILE A HD12 9  
ATOM   10717 H  HD13 . ILE A 1 34 ? 4.787   0.107   0.057   1.00 0.00 ? 34 ILE A HD13 9  
ATOM   10718 N  N    . THR A 1 35 ? 4.055   0.823   -5.312  1.00 0.00 ? 35 THR A N    9  
ATOM   10719 C  CA   . THR A 1 35 ? 3.688   -0.092  -6.397  1.00 0.00 ? 35 THR A CA   9  
ATOM   10720 C  C    . THR A 1 35 ? 3.584   -1.534  -5.899  1.00 0.00 ? 35 THR A C    9  
ATOM   10721 O  O    . THR A 1 35 ? 4.274   -1.926  -4.956  1.00 0.00 ? 35 THR A O    9  
ATOM   10722 C  CB   . THR A 1 35 ? 4.715   -0.008  -7.533  1.00 0.00 ? 35 THR A CB   9  
ATOM   10723 O  OG1  . THR A 1 35 ? 6.017   -0.301  -7.057  1.00 0.00 ? 35 THR A OG1  9  
ATOM   10724 C  CG2  . THR A 1 35 ? 4.764   1.351   -8.203  1.00 0.00 ? 35 THR A CG2  9  
ATOM   10725 H  H    . THR A 1 35 ? 4.958   1.206   -5.296  1.00 0.00 ? 35 THR A H    9  
ATOM   10726 H  HA   . THR A 1 35 ? 2.724   0.215   -6.775  1.00 0.00 ? 35 THR A HA   9  
ATOM   10727 H  HB   . THR A 1 35 ? 4.458   -0.738  -8.289  1.00 0.00 ? 35 THR A HB   9  
ATOM   10728 H  HG1  . THR A 1 35 ? 6.612   -0.433  -7.800  1.00 0.00 ? 35 THR A HG1  9  
ATOM   10729 H  HG21 . THR A 1 35 ? 5.308   1.275   -9.133  1.00 0.00 ? 35 THR A HG21 9  
ATOM   10730 H  HG22 . THR A 1 35 ? 5.263   2.055   -7.551  1.00 0.00 ? 35 THR A HG22 9  
ATOM   10731 H  HG23 . THR A 1 35 ? 3.760   1.694   -8.400  1.00 0.00 ? 35 THR A HG23 9  
ATOM   10732 N  N    . LYS A 1 36 ? 2.721   -2.322  -6.546  1.00 0.00 ? 36 LYS A N    9  
ATOM   10733 C  CA   . LYS A 1 36 ? 2.530   -3.728  -6.178  1.00 0.00 ? 36 LYS A CA   9  
ATOM   10734 C  C    . LYS A 1 36 ? 3.844   -4.503  -6.300  1.00 0.00 ? 36 LYS A C    9  
ATOM   10735 O  O    . LYS A 1 36 ? 4.144   -5.362  -5.469  1.00 0.00 ? 36 LYS A O    9  
ATOM   10736 C  CB   . LYS A 1 36 ? 1.458   -4.378  -7.063  1.00 0.00 ? 36 LYS A CB   9  
ATOM   10737 C  CG   . LYS A 1 36 ? 1.177   -5.837  -6.722  1.00 0.00 ? 36 LYS A CG   9  
ATOM   10738 C  CD   . LYS A 1 36 ? -0.007  -5.977  -5.780  1.00 0.00 ? 36 LYS A CD   9  
ATOM   10739 C  CE   . LYS A 1 36 ? -0.405  -7.433  -5.588  1.00 0.00 ? 36 LYS A CE   9  
ATOM   10740 N  NZ   . LYS A 1 36 ? -1.885  -7.613  -5.556  1.00 0.00 ? 36 LYS A NZ   9  
ATOM   10741 H  H    . LYS A 1 36 ? 2.203   -1.950  -7.292  1.00 0.00 ? 36 LYS A H    9  
ATOM   10742 H  HA   . LYS A 1 36 ? 2.203   -3.760  -5.149  1.00 0.00 ? 36 LYS A HA   9  
ATOM   10743 H  HB2  . LYS A 1 36 ? 0.538   -3.823  -6.960  1.00 0.00 ? 36 LYS A HB2  9  
ATOM   10744 H  HB3  . LYS A 1 36 ? 1.782   -4.330  -8.092  1.00 0.00 ? 36 LYS A HB3  9  
ATOM   10745 H  HG2  . LYS A 1 36 ? 0.962   -6.374  -7.634  1.00 0.00 ? 36 LYS A HG2  9  
ATOM   10746 H  HG3  . LYS A 1 36 ? 2.052   -6.263  -6.251  1.00 0.00 ? 36 LYS A HG3  9  
ATOM   10747 H  HD2  . LYS A 1 36 ? 0.259   -5.559  -4.820  1.00 0.00 ? 36 LYS A HD2  9  
ATOM   10748 H  HD3  . LYS A 1 36 ? -0.845  -5.434  -6.190  1.00 0.00 ? 36 LYS A HD3  9  
ATOM   10749 H  HE2  . LYS A 1 36 ? -0.001  -8.015  -6.403  1.00 0.00 ? 36 LYS A HE2  9  
ATOM   10750 H  HE3  . LYS A 1 36 ? 0.011   -7.787  -4.655  1.00 0.00 ? 36 LYS A HE3  9  
ATOM   10751 H  HZ1  . LYS A 1 36 ? -2.353  -6.715  -5.311  1.00 0.00 ? 36 LYS A HZ1  9  
ATOM   10752 H  HZ2  . LYS A 1 36 ? -2.144  -8.330  -4.847  1.00 0.00 ? 36 LYS A HZ2  9  
ATOM   10753 H  HZ3  . LYS A 1 36 ? -2.227  -7.924  -6.487  1.00 0.00 ? 36 LYS A HZ3  9  
ATOM   10754 N  N    . GLU A 1 37 ? 4.622   -4.188  -7.341  1.00 0.00 ? 37 GLU A N    9  
ATOM   10755 C  CA   . GLU A 1 37 ? 5.907   -4.849  -7.576  1.00 0.00 ? 37 GLU A CA   9  
ATOM   10756 C  C    . GLU A 1 37 ? 6.866   -4.623  -6.404  1.00 0.00 ? 37 GLU A C    9  
ATOM   10757 O  O    . GLU A 1 37 ? 7.608   -5.530  -6.021  1.00 0.00 ? 37 GLU A O    9  
ATOM   10758 C  CB   . GLU A 1 37 ? 6.538   -4.334  -8.874  1.00 0.00 ? 37 GLU A CB   9  
ATOM   10759 C  CG   . GLU A 1 37 ? 7.529   -5.306  -9.500  1.00 0.00 ? 37 GLU A CG   9  
ATOM   10760 C  CD   . GLU A 1 37 ? 7.682   -5.108  -10.997 1.00 0.00 ? 37 GLU A CD   9  
ATOM   10761 O  OE1  . GLU A 1 37 ? 6.745   -5.465  -11.744 1.00 0.00 ? 37 GLU A OE1  9  
ATOM   10762 O  OE2  . GLU A 1 37 ? 8.738   -4.596  -11.425 1.00 0.00 ? 37 GLU A OE2  9  
ATOM   10763 H  H    . GLU A 1 37 ? 4.324   -3.495  -7.965  1.00 0.00 ? 37 GLU A H    9  
ATOM   10764 H  HA   . GLU A 1 37 ? 5.720   -5.910  -7.674  1.00 0.00 ? 37 GLU A HA   9  
ATOM   10765 H  HB2  . GLU A 1 37 ? 5.753   -4.141  -9.591  1.00 0.00 ? 37 GLU A HB2  9  
ATOM   10766 H  HB3  . GLU A 1 37 ? 7.056   -3.409  -8.665  1.00 0.00 ? 37 GLU A HB3  9  
ATOM   10767 H  HG2  . GLU A 1 37 ? 8.493   -5.164  -9.035  1.00 0.00 ? 37 GLU A HG2  9  
ATOM   10768 H  HG3  . GLU A 1 37 ? 7.188   -6.316  -9.318  1.00 0.00 ? 37 GLU A HG3  9  
ATOM   10769 N  N    . ASP A 1 38 ? 6.837   -3.412  -5.831  1.00 0.00 ? 38 ASP A N    9  
ATOM   10770 C  CA   . ASP A 1 38 ? 7.701   -3.081  -4.696  1.00 0.00 ? 38 ASP A CA   9  
ATOM   10771 C  C    . ASP A 1 38 ? 7.452   -4.045  -3.540  1.00 0.00 ? 38 ASP A C    9  
ATOM   10772 O  O    . ASP A 1 38 ? 8.391   -4.595  -2.968  1.00 0.00 ? 38 ASP A O    9  
ATOM   10773 C  CB   . ASP A 1 38 ? 7.449   -1.638  -4.226  1.00 0.00 ? 38 ASP A CB   9  
ATOM   10774 C  CG   . ASP A 1 38 ? 8.317   -0.605  -4.932  1.00 0.00 ? 38 ASP A CG   9  
ATOM   10775 O  OD1  . ASP A 1 38 ? 9.411   -0.967  -5.419  1.00 0.00 ? 38 ASP A OD1  9  
ATOM   10776 O  OD2  . ASP A 1 38 ? 7.900   0.571   -4.994  1.00 0.00 ? 38 ASP A OD2  9  
ATOM   10777 H  H    . ASP A 1 38 ? 6.221   -2.735  -6.178  1.00 0.00 ? 38 ASP A H    9  
ATOM   10778 H  HA   . ASP A 1 38 ? 8.728   -3.177  -5.018  1.00 0.00 ? 38 ASP A HA   9  
ATOM   10779 H  HB2  . ASP A 1 38 ? 6.416   -1.385  -4.407  1.00 0.00 ? 38 ASP A HB2  9  
ATOM   10780 H  HB3  . ASP A 1 38 ? 7.647   -1.577  -3.166  1.00 0.00 ? 38 ASP A HB3  9  
ATOM   10781 N  N    . LEU A 1 39 ? 6.176   -4.255  -3.211  1.00 0.00 ? 39 LEU A N    9  
ATOM   10782 C  CA   . LEU A 1 39 ? 5.797   -5.163  -2.128  1.00 0.00 ? 39 LEU A CA   9  
ATOM   10783 C  C    . LEU A 1 39 ? 6.204   -6.602  -2.455  1.00 0.00 ? 39 LEU A C    9  
ATOM   10784 O  O    . LEU A 1 39 ? 6.646   -7.342  -1.576  1.00 0.00 ? 39 LEU A O    9  
ATOM   10785 C  CB   . LEU A 1 39 ? 4.288   -5.086  -1.870  1.00 0.00 ? 39 LEU A CB   9  
ATOM   10786 C  CG   . LEU A 1 39 ? 3.724   -3.670  -1.698  1.00 0.00 ? 39 LEU A CG   9  
ATOM   10787 C  CD1  . LEU A 1 39 ? 2.290   -3.604  -2.198  1.00 0.00 ? 39 LEU A CD1  9  
ATOM   10788 C  CD2  . LEU A 1 39 ? 3.804   -3.231  -0.242  1.00 0.00 ? 39 LEU A CD2  9  
ATOM   10789 H  H    . LEU A 1 39 ? 5.473   -3.790  -3.711  1.00 0.00 ? 39 LEU A H    9  
ATOM   10790 H  HA   . LEU A 1 39 ? 6.320   -4.849  -1.235  1.00 0.00 ? 39 LEU A HA   9  
ATOM   10791 H  HB2  . LEU A 1 39 ? 3.781   -5.553  -2.702  1.00 0.00 ? 39 LEU A HB2  9  
ATOM   10792 H  HB3  . LEU A 1 39 ? 4.068   -5.649  -0.975  1.00 0.00 ? 39 LEU A HB3  9  
ATOM   10793 H  HG   . LEU A 1 39 ? 4.312   -2.983  -2.286  1.00 0.00 ? 39 LEU A HG   9  
ATOM   10794 H  HD11 . LEU A 1 39 ? 1.647   -4.145  -1.520  1.00 0.00 ? 39 LEU A HD11 9  
ATOM   10795 H  HD12 . LEU A 1 39 ? 2.233   -4.049  -3.180  1.00 0.00 ? 39 LEU A HD12 9  
ATOM   10796 H  HD13 . LEU A 1 39 ? 1.973   -2.575  -2.249  1.00 0.00 ? 39 LEU A HD13 9  
ATOM   10797 H  HD21 . LEU A 1 39 ? 3.558   -2.181  -0.170  1.00 0.00 ? 39 LEU A HD21 9  
ATOM   10798 H  HD22 . LEU A 1 39 ? 4.806   -3.391  0.128   1.00 0.00 ? 39 LEU A HD22 9  
ATOM   10799 H  HD23 . LEU A 1 39 ? 3.106   -3.805  0.348   1.00 0.00 ? 39 LEU A HD23 9  
ATOM   10800 N  N    . GLU A 1 40 ? 6.062   -6.992  -3.723  1.00 0.00 ? 40 GLU A N    9  
ATOM   10801 C  CA   . GLU A 1 40 ? 6.426   -8.343  -4.156  1.00 0.00 ? 40 GLU A CA   9  
ATOM   10802 C  C    . GLU A 1 40 ? 7.933   -8.590  -4.019  1.00 0.00 ? 40 GLU A C    9  
ATOM   10803 O  O    . GLU A 1 40 ? 8.362   -9.727  -3.820  1.00 0.00 ? 40 GLU A O    9  
ATOM   10804 C  CB   . GLU A 1 40 ? 5.995   -8.573  -5.605  1.00 0.00 ? 40 GLU A CB   9  
ATOM   10805 C  CG   . GLU A 1 40 ? 4.489   -8.536  -5.811  1.00 0.00 ? 40 GLU A CG   9  
ATOM   10806 C  CD   . GLU A 1 40 ? 4.102   -8.553  -7.278  1.00 0.00 ? 40 GLU A CD   9  
ATOM   10807 O  OE1  . GLU A 1 40 ? 4.252   -9.614  -7.920  1.00 0.00 ? 40 GLU A OE1  9  
ATOM   10808 O  OE2  . GLU A 1 40 ? 3.649   -7.505  -7.784  1.00 0.00 ? 40 GLU A OE2  9  
ATOM   10809 H  H    . GLU A 1 40 ? 5.707   -6.357  -4.385  1.00 0.00 ? 40 GLU A H    9  
ATOM   10810 H  HA   . GLU A 1 40 ? 5.902   -9.044  -3.523  1.00 0.00 ? 40 GLU A HA   9  
ATOM   10811 H  HB2  . GLU A 1 40 ? 6.439   -7.810  -6.226  1.00 0.00 ? 40 GLU A HB2  9  
ATOM   10812 H  HB3  . GLU A 1 40 ? 6.357   -9.540  -5.926  1.00 0.00 ? 40 GLU A HB3  9  
ATOM   10813 H  HG2  . GLU A 1 40 ? 4.050   -9.398  -5.331  1.00 0.00 ? 40 GLU A HG2  9  
ATOM   10814 H  HG3  . GLU A 1 40 ? 4.098   -7.636  -5.361  1.00 0.00 ? 40 GLU A HG3  9  
ATOM   10815 N  N    . ASN A 1 41 ? 8.731   -7.525  -4.136  1.00 0.00 ? 41 ASN A N    9  
ATOM   10816 C  CA   . ASN A 1 41 ? 10.188  -7.633  -4.034  1.00 0.00 ? 41 ASN A CA   9  
ATOM   10817 C  C    . ASN A 1 41 ? 10.679  -7.454  -2.596  1.00 0.00 ? 41 ASN A C    9  
ATOM   10818 O  O    . ASN A 1 41 ? 11.639  -8.104  -2.180  1.00 0.00 ? 41 ASN A O    9  
ATOM   10819 C  CB   . ASN A 1 41 ? 10.859  -6.590  -4.932  1.00 0.00 ? 41 ASN A CB   9  
ATOM   10820 C  CG   . ASN A 1 41 ? 11.131  -7.117  -6.328  1.00 0.00 ? 41 ASN A CG   9  
ATOM   10821 O  OD1  . ASN A 1 41 ? 10.221  -7.577  -7.018  1.00 0.00 ? 41 ASN A OD1  9  
ATOM   10822 N  ND2  . ASN A 1 41 ? 12.388  -7.057  -6.753  1.00 0.00 ? 41 ASN A ND2  9  
ATOM   10823 H  H    . ASN A 1 41 ? 8.332   -6.644  -4.303  1.00 0.00 ? 41 ASN A H    9  
ATOM   10824 H  HA   . ASN A 1 41 ? 10.471  -8.618  -4.377  1.00 0.00 ? 41 ASN A HA   9  
ATOM   10825 H  HB2  . ASN A 1 41 ? 10.217  -5.725  -5.013  1.00 0.00 ? 41 ASN A HB2  9  
ATOM   10826 H  HB3  . ASN A 1 41 ? 11.799  -6.293  -4.490  1.00 0.00 ? 41 ASN A HB3  9  
ATOM   10827 H  HD21 . ASN A 1 41 ? 13.064  -6.678  -6.153  1.00 0.00 ? 41 ASN A HD21 9  
ATOM   10828 H  HD22 . ASN A 1 41 ? 12.588  -7.392  -7.651  1.00 0.00 ? 41 ASN A HD22 9  
ATOM   10829 N  N    . GLY A 1 42 ? 10.032  -6.557  -1.852  1.00 0.00 ? 42 GLY A N    9  
ATOM   10830 C  CA   . GLY A 1 42 ? 10.432  -6.292  -0.480  1.00 0.00 ? 42 GLY A CA   9  
ATOM   10831 C  C    . GLY A 1 42 ? 10.294  -4.822  -0.102  1.00 0.00 ? 42 GLY A C    9  
ATOM   10832 O  O    . GLY A 1 42 ? 10.317  -4.486  1.082   1.00 0.00 ? 42 GLY A O    9  
ATOM   10833 H  H    . GLY A 1 42 ? 9.283   -6.058  -2.241  1.00 0.00 ? 42 GLY A H    9  
ATOM   10834 H  HA2  . GLY A 1 42 ? 9.814   -6.883  0.181   1.00 0.00 ? 42 GLY A HA2  9  
ATOM   10835 H  HA3  . GLY A 1 42 ? 11.463  -6.590  -0.352  1.00 0.00 ? 42 GLY A HA3  9  
ATOM   10836 N  N    . GLU A 1 43 ? 10.146  -3.949  -1.109  1.00 0.00 ? 43 GLU A N    9  
ATOM   10837 C  CA   . GLU A 1 43 ? 9.993   -2.515  -0.876  1.00 0.00 ? 43 GLU A CA   9  
ATOM   10838 C  C    . GLU A 1 43 ? 8.653   -2.219  -0.204  1.00 0.00 ? 43 GLU A C    9  
ATOM   10839 O  O    . GLU A 1 43 ? 7.688   -1.823  -0.856  1.00 0.00 ? 43 GLU A O    9  
ATOM   10840 C  CB   . GLU A 1 43 ? 10.104  -1.737  -2.195  1.00 0.00 ? 43 GLU A CB   9  
ATOM   10841 C  CG   . GLU A 1 43 ? 11.526  -1.598  -2.712  1.00 0.00 ? 43 GLU A CG   9  
ATOM   10842 C  CD   . GLU A 1 43 ? 12.444  -0.896  -1.729  1.00 0.00 ? 43 GLU A CD   9  
ATOM   10843 O  OE1  . GLU A 1 43 ? 12.475  0.353   -1.731  1.00 0.00 ? 43 GLU A OE1  9  
ATOM   10844 O  OE2  . GLU A 1 43 ? 13.132  -1.596  -0.956  1.00 0.00 ? 43 GLU A OE2  9  
ATOM   10845 H  H    . GLU A 1 43 ? 10.131  -4.279  -2.030  1.00 0.00 ? 43 GLU A H    9  
ATOM   10846 H  HA   . GLU A 1 43 ? 10.790  -2.203  -0.217  1.00 0.00 ? 43 GLU A HA   9  
ATOM   10847 H  HB2  . GLU A 1 43 ? 9.520   -2.245  -2.949  1.00 0.00 ? 43 GLU A HB2  9  
ATOM   10848 H  HB3  . GLU A 1 43 ? 9.697   -0.746  -2.050  1.00 0.00 ? 43 GLU A HB3  9  
ATOM   10849 H  HG2  . GLU A 1 43 ? 11.920  -2.583  -2.909  1.00 0.00 ? 43 GLU A HG2  9  
ATOM   10850 H  HG3  . GLU A 1 43 ? 11.504  -1.029  -3.632  1.00 0.00 ? 43 GLU A HG3  9  
ATOM   10851 N  N    . ASP A 1 44 ? 8.613   -2.417  1.108   1.00 0.00 ? 44 ASP A N    9  
ATOM   10852 C  CA   . ASP A 1 44 ? 7.407   -2.177  1.900   1.00 0.00 ? 44 ASP A CA   9  
ATOM   10853 C  C    . ASP A 1 44 ? 7.458   -0.790  2.543   1.00 0.00 ? 44 ASP A C    9  
ATOM   10854 O  O    . ASP A 1 44 ? 7.045   -0.606  3.689   1.00 0.00 ? 44 ASP A O    9  
ATOM   10855 C  CB   . ASP A 1 44 ? 7.249   -3.261  2.978   1.00 0.00 ? 44 ASP A CB   9  
ATOM   10856 C  CG   . ASP A 1 44 ? 8.550   -3.601  3.690   1.00 0.00 ? 44 ASP A CG   9  
ATOM   10857 O  OD1  . ASP A 1 44 ? 9.182   -2.683  4.256   1.00 0.00 ? 44 ASP A OD1  9  
ATOM   10858 O  OD2  . ASP A 1 44 ? 8.930   -4.790  3.688   1.00 0.00 ? 44 ASP A OD2  9  
ATOM   10859 H  H    . ASP A 1 44 ? 9.419   -2.736  1.556   1.00 0.00 ? 44 ASP A H    9  
ATOM   10860 H  HA   . ASP A 1 44 ? 6.554   -2.219  1.236   1.00 0.00 ? 44 ASP A HA   9  
ATOM   10861 H  HB2  . ASP A 1 44 ? 6.538   -2.924  3.717   1.00 0.00 ? 44 ASP A HB2  9  
ATOM   10862 H  HB3  . ASP A 1 44 ? 6.874   -4.159  2.513   1.00 0.00 ? 44 ASP A HB3  9  
ATOM   10863 N  N    . VAL A 1 45 ? 7.971   0.185   1.792   1.00 0.00 ? 45 VAL A N    9  
ATOM   10864 C  CA   . VAL A 1 45 ? 8.081   1.551   2.282   1.00 0.00 ? 45 VAL A CA   9  
ATOM   10865 C  C    . VAL A 1 45 ? 7.439   2.538   1.315   1.00 0.00 ? 45 VAL A C    9  
ATOM   10866 O  O    . VAL A 1 45 ? 7.649   2.467   0.102   1.00 0.00 ? 45 VAL A O    9  
ATOM   10867 C  CB   . VAL A 1 45 ? 9.556   1.952   2.522   1.00 0.00 ? 45 VAL A CB   9  
ATOM   10868 C  CG1  . VAL A 1 45 ? 10.370  1.864   1.236   1.00 0.00 ? 45 VAL A CG1  9  
ATOM   10869 C  CG2  . VAL A 1 45 ? 9.640   3.348   3.124   1.00 0.00 ? 45 VAL A CG2  9  
ATOM   10870 H  H    . VAL A 1 45 ? 8.282   -0.021  0.887   1.00 0.00 ? 45 VAL A H    9  
ATOM   10871 H  HA   . VAL A 1 45 ? 7.562   1.606   3.228   1.00 0.00 ? 45 VAL A HA   9  
ATOM   10872 H  HB   . VAL A 1 45 ? 9.980   1.257   3.232   1.00 0.00 ? 45 VAL A HB   9  
ATOM   10873 H  HG11 . VAL A 1 45 ? 9.868   1.214   0.534   1.00 0.00 ? 45 VAL A HG11 9  
ATOM   10874 H  HG12 . VAL A 1 45 ? 11.350  1.464   1.455   1.00 0.00 ? 45 VAL A HG12 9  
ATOM   10875 H  HG13 . VAL A 1 45 ? 10.472  2.849   0.806   1.00 0.00 ? 45 VAL A HG13 9  
ATOM   10876 H  HG21 . VAL A 1 45 ? 9.423   4.081   2.362   1.00 0.00 ? 45 VAL A HG21 9  
ATOM   10877 H  HG22 . VAL A 1 45 ? 10.635  3.513   3.511   1.00 0.00 ? 45 VAL A HG22 9  
ATOM   10878 H  HG23 . VAL A 1 45 ? 8.923   3.436   3.925   1.00 0.00 ? 45 VAL A HG23 9  
ATOM   10879 N  N    . ALA A 1 46 ? 6.663   3.465   1.865   1.00 0.00 ? 46 ALA A N    9  
ATOM   10880 C  CA   . ALA A 1 46 ? 6.000   4.478   1.062   1.00 0.00 ? 46 ALA A CA   9  
ATOM   10881 C  C    . ALA A 1 46 ? 6.582   5.851   1.365   1.00 0.00 ? 46 ALA A C    9  
ATOM   10882 O  O    . ALA A 1 46 ? 6.848   6.179   2.523   1.00 0.00 ? 46 ALA A O    9  
ATOM   10883 C  CB   . ALA A 1 46 ? 4.497   4.461   1.313   1.00 0.00 ? 46 ALA A CB   9  
ATOM   10884 H  H    . ALA A 1 46 ? 6.542   3.471   2.837   1.00 0.00 ? 46 ALA A H    9  
ATOM   10885 H  HA   . ALA A 1 46 ? 6.172   4.243   0.020   1.00 0.00 ? 46 ALA A HA   9  
ATOM   10886 H  HB1  . ALA A 1 46 ? 4.224   3.541   1.809   1.00 0.00 ? 46 ALA A HB1  9  
ATOM   10887 H  HB2  . ALA A 1 46 ? 3.974   4.530   0.371   1.00 0.00 ? 46 ALA A HB2  9  
ATOM   10888 H  HB3  . ALA A 1 46 ? 4.226   5.301   1.936   1.00 0.00 ? 46 ALA A HB3  9  
ATOM   10889 N  N    . THR A 1 47 ? 6.783   6.647   0.318   1.00 0.00 ? 47 THR A N    9  
ATOM   10890 C  CA   . THR A 1 47 ? 7.337   7.987   0.470   1.00 0.00 ? 47 THR A CA   9  
ATOM   10891 C  C    . THR A 1 47 ? 6.330   9.040   0.016   1.00 0.00 ? 47 THR A C    9  
ATOM   10892 O  O    . THR A 1 47 ? 5.748   8.932   -1.066  1.00 0.00 ? 47 THR A O    9  
ATOM   10893 C  CB   . THR A 1 47 ? 8.646   8.123   -0.321  1.00 0.00 ? 47 THR A CB   9  
ATOM   10894 O  OG1  . THR A 1 47 ? 9.467   6.977   -0.145  1.00 0.00 ? 47 THR A OG1  9  
ATOM   10895 C  CG2  . THR A 1 47 ? 9.465   9.337   0.075   1.00 0.00 ? 47 THR A CG2  9  
ATOM   10896 H  H    . THR A 1 47 ? 6.553   6.325   -0.579  1.00 0.00 ? 47 THR A H    9  
ATOM   10897 H  HA   . THR A 1 47 ? 7.546   8.141   1.519   1.00 0.00 ? 47 THR A HA   9  
ATOM   10898 H  HB   . THR A 1 47 ? 8.413   8.211   -1.373  1.00 0.00 ? 47 THR A HB   9  
ATOM   10899 H  HG1  . THR A 1 47 ? 9.550   6.777   0.792   1.00 0.00 ? 47 THR A HG1  9  
ATOM   10900 H  HG21 . THR A 1 47 ? 9.303   9.556   1.119   1.00 0.00 ? 47 THR A HG21 9  
ATOM   10901 H  HG22 . THR A 1 47 ? 9.164   10.186  -0.522  1.00 0.00 ? 47 THR A HG22 9  
ATOM   10902 H  HG23 . THR A 1 47 ? 10.514  9.135   -0.092  1.00 0.00 ? 47 THR A HG23 9  
ATOM   10903 N  N    . CYS A 1 48 ? 6.129   10.054  0.856   1.00 0.00 ? 48 CYS A N    9  
ATOM   10904 C  CA   . CYS A 1 48 ? 5.194   11.134  0.560   1.00 0.00 ? 48 CYS A CA   9  
ATOM   10905 C  C    . CYS A 1 48 ? 5.946   12.355  0.030   1.00 0.00 ? 48 CYS A C    9  
ATOM   10906 O  O    . CYS A 1 48 ? 6.727   12.964  0.755   1.00 0.00 ? 48 CYS A O    9  
ATOM   10907 C  CB   . CYS A 1 48 ? 4.407   11.510  1.822   1.00 0.00 ? 48 CYS A CB   9  
ATOM   10908 S  SG   . CYS A 1 48 ? 3.023   12.659  1.532   1.00 0.00 ? 48 CYS A SG   9  
ATOM   10909 H  H    . CYS A 1 48 ? 6.623   10.076  1.701   1.00 0.00 ? 48 CYS A H    9  
ATOM   10910 H  HA   . CYS A 1 48 ? 4.502   10.783  -0.193  1.00 0.00 ? 48 CYS A HA   9  
ATOM   10911 H  HB2  . CYS A 1 48 ? 3.995   10.614  2.260   1.00 0.00 ? 48 CYS A HB2  9  
ATOM   10912 H  HB3  . CYS A 1 48 ? 5.078   11.976  2.530   1.00 0.00 ? 48 CYS A HB3  9  
ATOM   10913 N  N    . PRO A 1 49 ? 5.724   12.727  -1.245  1.00 0.00 ? 49 PRO A N    9  
ATOM   10914 C  CA   . PRO A 1 49 ? 6.392   13.884  -1.864  1.00 0.00 ? 49 PRO A CA   9  
ATOM   10915 C  C    . PRO A 1 49 ? 6.160   15.198  -1.105  1.00 0.00 ? 49 PRO A C    9  
ATOM   10916 O  O    . PRO A 1 49 ? 6.902   16.164  -1.295  1.00 0.00 ? 49 PRO A O    9  
ATOM   10917 C  CB   . PRO A 1 49 ? 5.759   13.958  -3.258  1.00 0.00 ? 49 PRO A CB   9  
ATOM   10918 C  CG   . PRO A 1 49 ? 5.255   12.582  -3.520  1.00 0.00 ? 49 PRO A CG   9  
ATOM   10919 C  CD   . PRO A 1 49 ? 4.816   12.048  -2.187  1.00 0.00 ? 49 PRO A CD   9  
ATOM   10920 H  HA   . PRO A 1 49 ? 7.453   13.717  -1.962  1.00 0.00 ? 49 PRO A HA   9  
ATOM   10921 H  HB2  . PRO A 1 49 ? 4.954   14.679  -3.252  1.00 0.00 ? 49 PRO A HB2  9  
ATOM   10922 H  HB3  . PRO A 1 49 ? 6.505   14.250  -3.981  1.00 0.00 ? 49 PRO A HB3  9  
ATOM   10923 H  HG2  . PRO A 1 49 ? 4.418   12.621  -4.204  1.00 0.00 ? 49 PRO A HG2  9  
ATOM   10924 H  HG3  . PRO A 1 49 ? 6.047   11.971  -3.927  1.00 0.00 ? 49 PRO A HG3  9  
ATOM   10925 H  HD2  . PRO A 1 49 ? 3.786   12.313  -1.994  1.00 0.00 ? 49 PRO A HD2  9  
ATOM   10926 H  HD3  . PRO A 1 49 ? 4.949   10.977  -2.144  1.00 0.00 ? 49 PRO A HD3  9  
ATOM   10927 N  N    . SER A 1 50 ? 5.127   15.237  -0.254  1.00 0.00 ? 50 SER A N    9  
ATOM   10928 C  CA   . SER A 1 50 ? 4.807   16.437  0.518   1.00 0.00 ? 50 SER A CA   9  
ATOM   10929 C  C    . SER A 1 50 ? 5.694   16.557  1.761   1.00 0.00 ? 50 SER A C    9  
ATOM   10930 O  O    . SER A 1 50 ? 6.596   17.395  1.804   1.00 0.00 ? 50 SER A O    9  
ATOM   10931 C  CB   . SER A 1 50 ? 3.328   16.429  0.919   1.00 0.00 ? 50 SER A CB   9  
ATOM   10932 O  OG   . SER A 1 50 ? 2.531   17.051  -0.072  1.00 0.00 ? 50 SER A OG   9  
ATOM   10933 H  H    . SER A 1 50 ? 4.565   14.441  -0.147  1.00 0.00 ? 50 SER A H    9  
ATOM   10934 H  HA   . SER A 1 50 ? 4.988   17.291  -0.119  1.00 0.00 ? 50 SER A HA   9  
ATOM   10935 H  HB2  . SER A 1 50 ? 2.995   15.409  1.040   1.00 0.00 ? 50 SER A HB2  9  
ATOM   10936 H  HB3  . SER A 1 50 ? 3.206   16.962  1.850   1.00 0.00 ? 50 SER A HB3  9  
ATOM   10937 H  HG   . SER A 1 50 ? 2.295   16.407  -0.745  1.00 0.00 ? 50 SER A HG   9  
ATOM   10938 N  N    . CYS A 1 51 ? 5.428   15.725  2.773   1.00 0.00 ? 51 CYS A N    9  
ATOM   10939 C  CA   . CYS A 1 51 ? 6.203   15.754  4.019   1.00 0.00 ? 51 CYS A CA   9  
ATOM   10940 C  C    . CYS A 1 51 ? 7.543   15.018  3.886   1.00 0.00 ? 51 CYS A C    9  
ATOM   10941 O  O    . CYS A 1 51 ? 8.482   15.298  4.634   1.00 0.00 ? 51 CYS A O    9  
ATOM   10942 C  CB   . CYS A 1 51 ? 5.393   15.143  5.167   1.00 0.00 ? 51 CYS A CB   9  
ATOM   10943 S  SG   . CYS A 1 51 ? 4.910   13.406  4.899   1.00 0.00 ? 51 CYS A SG   9  
ATOM   10944 H  H    . CYS A 1 51 ? 4.692   15.080  2.683   1.00 0.00 ? 51 CYS A H    9  
ATOM   10945 H  HA   . CYS A 1 51 ? 6.402   16.788  4.253   1.00 0.00 ? 51 CYS A HA   9  
ATOM   10946 H  HB2  . CYS A 1 51 ? 5.983   15.185  6.071   1.00 0.00 ? 51 CYS A HB2  9  
ATOM   10947 H  HB3  . CYS A 1 51 ? 4.491   15.719  5.308   1.00 0.00 ? 51 CYS A HB3  9  
ATOM   10948 N  N    . SER A 1 52 ? 7.622   14.076  2.942   1.00 0.00 ? 52 SER A N    9  
ATOM   10949 C  CA   . SER A 1 52 ? 8.840   13.292  2.713   1.00 0.00 ? 52 SER A CA   9  
ATOM   10950 C  C    . SER A 1 52 ? 9.104   12.334  3.878   1.00 0.00 ? 52 SER A C    9  
ATOM   10951 O  O    . SER A 1 52 ? 10.244  12.176  4.325   1.00 0.00 ? 52 SER A O    9  
ATOM   10952 C  CB   . SER A 1 52 ? 10.046  14.215  2.491   1.00 0.00 ? 52 SER A CB   9  
ATOM   10953 O  OG   . SER A 1 52 ? 9.725   15.283  1.612   1.00 0.00 ? 52 SER A OG   9  
ATOM   10954 H  H    . SER A 1 52 ? 6.836   13.895  2.385   1.00 0.00 ? 52 SER A H    9  
ATOM   10955 H  HA   . SER A 1 52 ? 8.684   12.705  1.819   1.00 0.00 ? 52 SER A HA   9  
ATOM   10956 H  HB2  . SER A 1 52 ? 10.358  14.628  3.437   1.00 0.00 ? 52 SER A HB2  9  
ATOM   10957 H  HB3  . SER A 1 52 ? 10.858  13.644  2.062   1.00 0.00 ? 52 SER A HB3  9  
ATOM   10958 H  HG   . SER A 1 52 ? 9.680   14.957  0.710   1.00 0.00 ? 52 SER A HG   9  
ATOM   10959 N  N    . LEU A 1 53 ? 8.040   11.690  4.360   1.00 0.00 ? 53 LEU A N    9  
ATOM   10960 C  CA   . LEU A 1 53 ? 8.142   10.742  5.466   1.00 0.00 ? 53 LEU A CA   9  
ATOM   10961 C  C    . LEU A 1 53 ? 8.186   9.303   4.949   1.00 0.00 ? 53 LEU A C    9  
ATOM   10962 O  O    . LEU A 1 53 ? 8.140   9.068   3.740   1.00 0.00 ? 53 LEU A O    9  
ATOM   10963 C  CB   . LEU A 1 53 ? 6.961   10.924  6.428   1.00 0.00 ? 53 LEU A CB   9  
ATOM   10964 C  CG   . LEU A 1 53 ? 7.239   11.814  7.644   1.00 0.00 ? 53 LEU A CG   9  
ATOM   10965 C  CD1  . LEU A 1 53 ? 7.254   13.284  7.246   1.00 0.00 ? 53 LEU A CD1  9  
ATOM   10966 C  CD2  . LEU A 1 53 ? 6.203   11.566  8.730   1.00 0.00 ? 53 LEU A CD2  9  
ATOM   10967 H  H    . LEU A 1 53 ? 7.161   11.855  3.955   1.00 0.00 ? 53 LEU A H    9  
ATOM   10968 H  HA   . LEU A 1 53 ? 9.061   10.949  5.996   1.00 0.00 ? 53 LEU A HA   9  
ATOM   10969 H  HB2  . LEU A 1 53 ? 6.135   11.350  5.875   1.00 0.00 ? 53 LEU A HB2  9  
ATOM   10970 H  HB3  . LEU A 1 53 ? 6.664   9.950   6.787   1.00 0.00 ? 53 LEU A HB3  9  
ATOM   10971 H  HG   . LEU A 1 53 ? 8.211   11.569  8.046   1.00 0.00 ? 53 LEU A HG   9  
ATOM   10972 H  HD11 . LEU A 1 53 ? 6.297   13.729  7.474   1.00 0.00 ? 53 LEU A HD11 9  
ATOM   10973 H  HD12 . LEU A 1 53 ? 7.447   13.369  6.187   1.00 0.00 ? 53 LEU A HD12 9  
ATOM   10974 H  HD13 . LEU A 1 53 ? 8.029   13.798  7.796   1.00 0.00 ? 53 LEU A HD13 9  
ATOM   10975 H  HD21 . LEU A 1 53 ? 6.100   10.504  8.892   1.00 0.00 ? 53 LEU A HD21 9  
ATOM   10976 H  HD22 . LEU A 1 53 ? 5.253   11.977  8.422   1.00 0.00 ? 53 LEU A HD22 9  
ATOM   10977 H  HD23 . LEU A 1 53 ? 6.521   12.041  9.646   1.00 0.00 ? 53 LEU A HD23 9  
ATOM   10978 N  N    . ILE A 1 54 ? 8.274   8.345   5.873   1.00 0.00 ? 54 ILE A N    9  
ATOM   10979 C  CA   . ILE A 1 54 ? 8.321   6.929   5.511   1.00 0.00 ? 54 ILE A CA   9  
ATOM   10980 C  C    . ILE A 1 54 ? 7.295   6.122   6.305   1.00 0.00 ? 54 ILE A C    9  
ATOM   10981 O  O    . ILE A 1 54 ? 7.057   6.391   7.485   1.00 0.00 ? 54 ILE A O    9  
ATOM   10982 C  CB   . ILE A 1 54 ? 9.729   6.330   5.746   1.00 0.00 ? 54 ILE A CB   9  
ATOM   10983 C  CG1  . ILE A 1 54 ? 10.180  6.550   7.196   1.00 0.00 ? 54 ILE A CG1  9  
ATOM   10984 C  CG2  . ILE A 1 54 ? 10.735  6.938   4.778   1.00 0.00 ? 54 ILE A CG2  9  
ATOM   10985 C  CD1  . ILE A 1 54 ? 11.468  5.834   7.544   1.00 0.00 ? 54 ILE A CD1  9  
ATOM   10986 H  H    . ILE A 1 54 ? 8.305   8.595   6.820   1.00 0.00 ? 54 ILE A H    9  
ATOM   10987 H  HA   . ILE A 1 54 ? 8.091   6.844   4.457   1.00 0.00 ? 54 ILE A HA   9  
ATOM   10988 H  HB   . ILE A 1 54 ? 9.678   5.269   5.552   1.00 0.00 ? 54 ILE A HB   9  
ATOM   10989 H  HG12 . ILE A 1 54 ? 10.333  7.605   7.364   1.00 0.00 ? 54 ILE A HG12 9  
ATOM   10990 H  HG13 . ILE A 1 54 ? 9.411   6.192   7.865   1.00 0.00 ? 54 ILE A HG13 9  
ATOM   10991 H  HG21 . ILE A 1 54 ? 10.425  6.741   3.763   1.00 0.00 ? 54 ILE A HG21 9  
ATOM   10992 H  HG22 . ILE A 1 54 ? 11.709  6.500   4.947   1.00 0.00 ? 54 ILE A HG22 9  
ATOM   10993 H  HG23 . ILE A 1 54 ? 10.789  8.005   4.937   1.00 0.00 ? 54 ILE A HG23 9  
ATOM   10994 H  HD11 . ILE A 1 54 ? 11.365  4.781   7.326   1.00 0.00 ? 54 ILE A HD11 9  
ATOM   10995 H  HD12 . ILE A 1 54 ? 11.681  5.965   8.595   1.00 0.00 ? 54 ILE A HD12 9  
ATOM   10996 H  HD13 . ILE A 1 54 ? 12.277  6.245   6.959   1.00 0.00 ? 54 ILE A HD13 9  
ATOM   10997 N  N    . ILE A 1 55 ? 6.698   5.124   5.651   1.00 0.00 ? 55 ILE A N    9  
ATOM   10998 C  CA   . ILE A 1 55 ? 5.705   4.264   6.294   1.00 0.00 ? 55 ILE A CA   9  
ATOM   10999 C  C    . ILE A 1 55 ? 5.887   2.812   5.863   1.00 0.00 ? 55 ILE A C    9  
ATOM   11000 O  O    . ILE A 1 55 ? 6.227   2.537   4.710   1.00 0.00 ? 55 ILE A O    9  
ATOM   11001 C  CB   . ILE A 1 55 ? 4.257   4.708   5.982   1.00 0.00 ? 55 ILE A CB   9  
ATOM   11002 C  CG1  . ILE A 1 55 ? 4.003   4.737   4.471   1.00 0.00 ? 55 ILE A CG1  9  
ATOM   11003 C  CG2  . ILE A 1 55 ? 3.970   6.071   6.598   1.00 0.00 ? 55 ILE A CG2  9  
ATOM   11004 C  CD1  . ILE A 1 55 ? 2.535   4.662   4.105   1.00 0.00 ? 55 ILE A CD1  9  
ATOM   11005 H  H    . ILE A 1 55 ? 6.939   4.957   4.715   1.00 0.00 ? 55 ILE A H    9  
ATOM   11006 H  HA   . ILE A 1 55 ? 5.856   4.328   7.362   1.00 0.00 ? 55 ILE A HA   9  
ATOM   11007 H  HB   . ILE A 1 55 ? 3.585   3.994   6.436   1.00 0.00 ? 55 ILE A HB   9  
ATOM   11008 H  HG12 . ILE A 1 55 ? 4.400   5.653   4.062   1.00 0.00 ? 55 ILE A HG12 9  
ATOM   11009 H  HG13 . ILE A 1 55 ? 4.501   3.897   4.011   1.00 0.00 ? 55 ILE A HG13 9  
ATOM   11010 H  HG21 . ILE A 1 55 ? 4.605   6.814   6.139   1.00 0.00 ? 55 ILE A HG21 9  
ATOM   11011 H  HG22 . ILE A 1 55 ? 4.166   6.035   7.658   1.00 0.00 ? 55 ILE A HG22 9  
ATOM   11012 H  HG23 . ILE A 1 55 ? 2.934   6.330   6.431   1.00 0.00 ? 55 ILE A HG23 9  
ATOM   11013 H  HD11 . ILE A 1 55 ? 2.080   3.823   4.609   1.00 0.00 ? 55 ILE A HD11 9  
ATOM   11014 H  HD12 . ILE A 1 55 ? 2.436   4.538   3.037   1.00 0.00 ? 55 ILE A HD12 9  
ATOM   11015 H  HD13 . ILE A 1 55 ? 2.042   5.573   4.410   1.00 0.00 ? 55 ILE A HD13 9  
ATOM   11016 N  N    . LYS A 1 56 ? 5.670   1.887   6.794   1.00 0.00 ? 56 LYS A N    9  
ATOM   11017 C  CA   . LYS A 1 56 ? 5.821   0.465   6.508   1.00 0.00 ? 56 LYS A CA   9  
ATOM   11018 C  C    . LYS A 1 56 ? 4.510   -0.152  6.057   1.00 0.00 ? 56 LYS A C    9  
ATOM   11019 O  O    . LYS A 1 56 ? 3.455   0.079   6.651   1.00 0.00 ? 56 LYS A O    9  
ATOM   11020 C  CB   . LYS A 1 56 ? 6.360   -0.279  7.732   1.00 0.00 ? 56 LYS A CB   9  
ATOM   11021 C  CG   . LYS A 1 56 ? 7.423   -1.314  7.403   1.00 0.00 ? 56 LYS A CG   9  
ATOM   11022 C  CD   . LYS A 1 56 ? 6.860   -2.450  6.563   1.00 0.00 ? 56 LYS A CD   9  
ATOM   11023 C  CE   . LYS A 1 56 ? 7.643   -3.738  6.767   1.00 0.00 ? 56 LYS A CE   9  
ATOM   11024 N  NZ   . LYS A 1 56 ? 7.009   -4.896  6.075   1.00 0.00 ? 56 LYS A NZ   9  
ATOM   11025 H  H    . LYS A 1 56 ? 5.407   2.168   7.697   1.00 0.00 ? 56 LYS A H    9  
ATOM   11026 H  HA   . LYS A 1 56 ? 6.526   0.366   5.699   1.00 0.00 ? 56 LYS A HA   9  
ATOM   11027 H  HB2  . LYS A 1 56 ? 6.788   0.440   8.414   1.00 0.00 ? 56 LYS A HB2  9  
ATOM   11028 H  HB3  . LYS A 1 56 ? 5.540   -0.782  8.223   1.00 0.00 ? 56 LYS A HB3  9  
ATOM   11029 H  HG2  . LYS A 1 56 ? 8.219   -0.835  6.853   1.00 0.00 ? 56 LYS A HG2  9  
ATOM   11030 H  HG3  . LYS A 1 56 ? 7.812   -1.719  8.326   1.00 0.00 ? 56 LYS A HG3  9  
ATOM   11031 H  HD2  . LYS A 1 56 ? 5.831   -2.618  6.841   1.00 0.00 ? 56 LYS A HD2  9  
ATOM   11032 H  HD3  . LYS A 1 56 ? 6.912   -2.172  5.520   1.00 0.00 ? 56 LYS A HD3  9  
ATOM   11033 H  HE2  . LYS A 1 56 ? 8.641   -3.600  6.377   1.00 0.00 ? 56 LYS A HE2  9  
ATOM   11034 H  HE3  . LYS A 1 56 ? 7.697   -3.945  7.826   1.00 0.00 ? 56 LYS A HE3  9  
ATOM   11035 H  HZ1  . LYS A 1 56 ? 6.327   -4.561  5.362   1.00 0.00 ? 56 LYS A HZ1  9  
ATOM   11036 H  HZ2  . LYS A 1 56 ? 6.509   -5.495  6.764   1.00 0.00 ? 56 LYS A HZ2  9  
ATOM   11037 H  HZ3  . LYS A 1 56 ? 7.734   -5.469  5.599   1.00 0.00 ? 56 LYS A HZ3  9  
ATOM   11038 N  N    . VAL A 1 57 ? 4.594   -0.940  4.994   1.00 0.00 ? 57 VAL A N    9  
ATOM   11039 C  CA   . VAL A 1 57 ? 3.432   -1.603  4.434   1.00 0.00 ? 57 VAL A CA   9  
ATOM   11040 C  C    . VAL A 1 57 ? 3.475   -3.105  4.715   1.00 0.00 ? 57 VAL A C    9  
ATOM   11041 O  O    . VAL A 1 57 ? 4.357   -3.813  4.226   1.00 0.00 ? 57 VAL A O    9  
ATOM   11042 C  CB   . VAL A 1 57 ? 3.323   -1.359  2.911   1.00 0.00 ? 57 VAL A CB   9  
ATOM   11043 C  CG1  . VAL A 1 57 ? 1.868   -1.215  2.520   1.00 0.00 ? 57 VAL A CG1  9  
ATOM   11044 C  CG2  . VAL A 1 57 ? 4.107   -0.121  2.487   1.00 0.00 ? 57 VAL A CG2  9  
ATOM   11045 H  H    . VAL A 1 57 ? 5.468   -1.077  4.570   1.00 0.00 ? 57 VAL A H    9  
ATOM   11046 H  HA   . VAL A 1 57 ? 2.554   -1.185  4.905   1.00 0.00 ? 57 VAL A HA   9  
ATOM   11047 H  HB   . VAL A 1 57 ? 3.736   -2.216  2.393   1.00 0.00 ? 57 VAL A HB   9  
ATOM   11048 H  HG11 . VAL A 1 57 ? 1.349   -2.141  2.717   1.00 0.00 ? 57 VAL A HG11 9  
ATOM   11049 H  HG12 . VAL A 1 57 ? 1.799   -0.976  1.471   1.00 0.00 ? 57 VAL A HG12 9  
ATOM   11050 H  HG13 . VAL A 1 57 ? 1.425   -0.422  3.102   1.00 0.00 ? 57 VAL A HG13 9  
ATOM   11051 H  HG21 . VAL A 1 57 ? 4.166   0.572   3.316   1.00 0.00 ? 57 VAL A HG21 9  
ATOM   11052 H  HG22 . VAL A 1 57 ? 3.608   0.355   1.657   1.00 0.00 ? 57 VAL A HG22 9  
ATOM   11053 H  HG23 . VAL A 1 57 ? 5.103   -0.409  2.189   1.00 0.00 ? 57 VAL A HG23 9  
ATOM   11054 N  N    . ILE A 1 58 ? 2.517   -3.581  5.511   1.00 0.00 ? 58 ILE A N    9  
ATOM   11055 C  CA   . ILE A 1 58 ? 2.441   -4.997  5.863   1.00 0.00 ? 58 ILE A CA   9  
ATOM   11056 C  C    . ILE A 1 58 ? 1.513   -5.742  4.905   1.00 0.00 ? 58 ILE A C    9  
ATOM   11057 O  O    . ILE A 1 58 ? 0.425   -5.265  4.589   1.00 0.00 ? 58 ILE A O    9  
ATOM   11058 C  CB   . ILE A 1 58 ? 1.945   -5.203  7.312   1.00 0.00 ? 58 ILE A CB   9  
ATOM   11059 C  CG1  . ILE A 1 58 ? 2.729   -4.311  8.284   1.00 0.00 ? 58 ILE A CG1  9  
ATOM   11060 C  CG2  . ILE A 1 58 ? 2.061   -6.670  7.717   1.00 0.00 ? 58 ILE A CG2  9  
ATOM   11061 C  CD1  . ILE A 1 58 ? 4.216   -4.601  8.321   1.00 0.00 ? 58 ILE A CD1  9  
ATOM   11062 H  H    . ILE A 1 58 ? 1.844   -2.963  5.872   1.00 0.00 ? 58 ILE A H    9  
ATOM   11063 H  HA   . ILE A 1 58 ? 3.435   -5.414  5.781   1.00 0.00 ? 58 ILE A HA   9  
ATOM   11064 H  HB   . ILE A 1 58 ? 0.900   -4.931  7.350   1.00 0.00 ? 58 ILE A HB   9  
ATOM   11065 H  HG12 . ILE A 1 58 ? 2.601   -3.279  7.996   1.00 0.00 ? 58 ILE A HG12 9  
ATOM   11066 H  HG13 . ILE A 1 58 ? 2.338   -4.452  9.282   1.00 0.00 ? 58 ILE A HG13 9  
ATOM   11067 H  HG21 . ILE A 1 58 ? 1.228   -6.935  8.350   1.00 0.00 ? 58 ILE A HG21 9  
ATOM   11068 H  HG22 . ILE A 1 58 ? 2.984   -6.824  8.255   1.00 0.00 ? 58 ILE A HG22 9  
ATOM   11069 H  HG23 . ILE A 1 58 ? 2.052   -7.290  6.833   1.00 0.00 ? 58 ILE A HG23 9  
ATOM   11070 H  HD11 . ILE A 1 58 ? 4.766   -3.675  8.234   1.00 0.00 ? 58 ILE A HD11 9  
ATOM   11071 H  HD12 . ILE A 1 58 ? 4.477   -5.253  7.501   1.00 0.00 ? 58 ILE A HD12 9  
ATOM   11072 H  HD13 . ILE A 1 58 ? 4.466   -5.081  9.256   1.00 0.00 ? 58 ILE A HD13 9  
ATOM   11073 N  N    . TYR A 1 59 ? 1.959   -6.904  4.436   1.00 0.00 ? 59 TYR A N    9  
ATOM   11074 C  CA   . TYR A 1 59 ? 1.175   -7.706  3.498   1.00 0.00 ? 59 TYR A CA   9  
ATOM   11075 C  C    . TYR A 1 59 ? 1.546   -9.188  3.592   1.00 0.00 ? 59 TYR A C    9  
ATOM   11076 O  O    . TYR A 1 59 ? 2.440   -9.567  4.350   1.00 0.00 ? 59 TYR A O    9  
ATOM   11077 C  CB   . TYR A 1 59 ? 1.405   -7.201  2.068   1.00 0.00 ? 59 TYR A CB   9  
ATOM   11078 C  CG   . TYR A 1 59 ? 2.866   -6.979  1.748   1.00 0.00 ? 59 TYR A CG   9  
ATOM   11079 C  CD1  . TYR A 1 59 ? 3.651   -8.004  1.236   1.00 0.00 ? 59 TYR A CD1  9  
ATOM   11080 C  CD2  . TYR A 1 59 ? 3.462   -5.749  1.981   1.00 0.00 ? 59 TYR A CD2  9  
ATOM   11081 C  CE1  . TYR A 1 59 ? 4.990   -7.806  0.964   1.00 0.00 ? 59 TYR A CE1  9  
ATOM   11082 C  CE2  . TYR A 1 59 ? 4.797   -5.543  1.715   1.00 0.00 ? 59 TYR A CE2  9  
ATOM   11083 C  CZ   . TYR A 1 59 ? 5.560   -6.572  1.207   1.00 0.00 ? 59 TYR A CZ   9  
ATOM   11084 O  OH   . TYR A 1 59 ? 6.895   -6.363  0.946   1.00 0.00 ? 59 TYR A OH   9  
ATOM   11085 H  H    . TYR A 1 59 ? 2.842   -7.227  4.717   1.00 0.00 ? 59 TYR A H    9  
ATOM   11086 H  HA   . TYR A 1 59 ? 0.131   -7.590  3.750   1.00 0.00 ? 59 TYR A HA   9  
ATOM   11087 H  HB2  . TYR A 1 59 ? 1.014   -7.924  1.366   1.00 0.00 ? 59 TYR A HB2  9  
ATOM   11088 H  HB3  . TYR A 1 59 ? 0.888   -6.261  1.936   1.00 0.00 ? 59 TYR A HB3  9  
ATOM   11089 H  HD1  . TYR A 1 59 ? 3.201   -8.967  1.045   1.00 0.00 ? 59 TYR A HD1  9  
ATOM   11090 H  HD2  . TYR A 1 59 ? 2.863   -4.942  2.378   1.00 0.00 ? 59 TYR A HD2  9  
ATOM   11091 H  HE1  . TYR A 1 59 ? 5.585   -8.617  0.565   1.00 0.00 ? 59 TYR A HE1  9  
ATOM   11092 H  HE2  . TYR A 1 59 ? 5.239   -4.578  1.902   1.00 0.00 ? 59 TYR A HE2  9  
ATOM   11093 H  HH   . TYR A 1 59 ? 7.420   -7.024  1.405   1.00 0.00 ? 59 TYR A HH   9  
ATOM   11094 N  N    . ASP A 1 60 ? 0.859   -10.016 2.807   1.00 0.00 ? 60 ASP A N    9  
ATOM   11095 C  CA   . ASP A 1 60 ? 1.120   -11.452 2.791   1.00 0.00 ? 60 ASP A CA   9  
ATOM   11096 C  C    . ASP A 1 60 ? 2.243   -11.780 1.806   1.00 0.00 ? 60 ASP A C    9  
ATOM   11097 O  O    . ASP A 1 60 ? 2.028   -11.806 0.594   1.00 0.00 ? 60 ASP A O    9  
ATOM   11098 C  CB   . ASP A 1 60 ? -0.153  -12.219 2.421   1.00 0.00 ? 60 ASP A CB   9  
ATOM   11099 C  CG   . ASP A 1 60 ? -0.066  -13.692 2.771   1.00 0.00 ? 60 ASP A CG   9  
ATOM   11100 O  OD1  . ASP A 1 60 ? -0.311  -14.039 3.945   1.00 0.00 ? 60 ASP A OD1  9  
ATOM   11101 O  OD2  . ASP A 1 60 ? 0.249   -14.496 1.872   1.00 0.00 ? 60 ASP A OD2  9  
ATOM   11102 H  H    . ASP A 1 60 ? 0.163   -9.654  2.219   1.00 0.00 ? 60 ASP A H    9  
ATOM   11103 H  HA   . ASP A 1 60 ? 1.432   -11.743 3.783   1.00 0.00 ? 60 ASP A HA   9  
ATOM   11104 H  HB2  . ASP A 1 60 ? -0.990  -11.793 2.953   1.00 0.00 ? 60 ASP A HB2  9  
ATOM   11105 H  HB3  . ASP A 1 60 ? -0.325  -12.129 1.356   1.00 0.00 ? 60 ASP A HB3  9  
ATOM   11106 N  N    . LYS A 1 61 ? 3.442   -12.024 2.339   1.00 0.00 ? 61 LYS A N    9  
ATOM   11107 C  CA   . LYS A 1 61 ? 4.602   -12.350 1.507   1.00 0.00 ? 61 LYS A CA   9  
ATOM   11108 C  C    . LYS A 1 61 ? 4.362   -13.625 0.693   1.00 0.00 ? 61 LYS A C    9  
ATOM   11109 O  O    . LYS A 1 61 ? 4.888   -13.764 -0.409  1.00 0.00 ? 61 LYS A O    9  
ATOM   11110 C  CB   . LYS A 1 61 ? 5.861   -12.514 2.365   1.00 0.00 ? 61 LYS A CB   9  
ATOM   11111 C  CG   . LYS A 1 61 ? 6.414   -11.200 2.899   1.00 0.00 ? 61 LYS A CG   9  
ATOM   11112 C  CD   . LYS A 1 61 ? 7.528   -10.656 2.015   1.00 0.00 ? 61 LYS A CD   9  
ATOM   11113 C  CE   . LYS A 1 61 ? 8.640   -10.025 2.843   1.00 0.00 ? 61 LYS A CE   9  
ATOM   11114 N  NZ   . LYS A 1 61 ? 9.924   -9.949  2.091   1.00 0.00 ? 61 LYS A NZ   9  
ATOM   11115 H  H    . LYS A 1 61 ? 3.549   -11.983 3.313   1.00 0.00 ? 61 LYS A H    9  
ATOM   11116 H  HA   . LYS A 1 61 ? 4.755   -11.529 0.821   1.00 0.00 ? 61 LYS A HA   9  
ATOM   11117 H  HB2  . LYS A 1 61 ? 5.629   -13.150 3.206   1.00 0.00 ? 61 LYS A HB2  9  
ATOM   11118 H  HB3  . LYS A 1 61 ? 6.628   -12.986 1.769   1.00 0.00 ? 61 LYS A HB3  9  
ATOM   11119 H  HG2  . LYS A 1 61 ? 5.615   -10.475 2.940   1.00 0.00 ? 61 LYS A HG2  9  
ATOM   11120 H  HG3  . LYS A 1 61 ? 6.803   -11.365 3.894   1.00 0.00 ? 61 LYS A HG3  9  
ATOM   11121 H  HD2  . LYS A 1 61 ? 7.942   -11.465 1.433   1.00 0.00 ? 61 LYS A HD2  9  
ATOM   11122 H  HD3  . LYS A 1 61 ? 7.116   -9.908  1.353   1.00 0.00 ? 61 LYS A HD3  9  
ATOM   11123 H  HE2  . LYS A 1 61 ? 8.339   -9.027  3.124   1.00 0.00 ? 61 LYS A HE2  9  
ATOM   11124 H  HE3  . LYS A 1 61 ? 8.788   -10.620 3.732   1.00 0.00 ? 61 LYS A HE3  9  
ATOM   11125 H  HZ1  . LYS A 1 61 ? 10.660  -9.518  2.686   1.00 0.00 ? 61 LYS A HZ1  9  
ATOM   11126 H  HZ2  . LYS A 1 61 ? 9.805   -9.371  1.234   1.00 0.00 ? 61 LYS A HZ2  9  
ATOM   11127 H  HZ3  . LYS A 1 61 ? 10.234  -10.901 1.813   1.00 0.00 ? 61 LYS A HZ3  9  
ATOM   11128 N  N    . ASP A 1 62 ? 3.565   -14.552 1.234   1.00 0.00 ? 62 ASP A N    9  
ATOM   11129 C  CA   . ASP A 1 62 ? 3.264   -15.804 0.536   1.00 0.00 ? 62 ASP A CA   9  
ATOM   11130 C  C    . ASP A 1 62 ? 2.474   -15.541 -0.748  1.00 0.00 ? 62 ASP A C    9  
ATOM   11131 O  O    . ASP A 1 62 ? 2.638   -16.251 -1.743  1.00 0.00 ? 62 ASP A O    9  
ATOM   11132 C  CB   . ASP A 1 62 ? 2.478   -16.753 1.448   1.00 0.00 ? 62 ASP A CB   9  
ATOM   11133 C  CG   . ASP A 1 62 ? 2.730   -18.213 1.122   1.00 0.00 ? 62 ASP A CG   9  
ATOM   11134 O  OD1  . ASP A 1 62 ? 3.892   -18.658 1.240   1.00 0.00 ? 62 ASP A OD1  9  
ATOM   11135 O  OD2  . ASP A 1 62 ? 1.765   -18.912 0.751   1.00 0.00 ? 62 ASP A OD2  9  
ATOM   11136 H  H    . ASP A 1 62 ? 3.170   -14.388 2.117   1.00 0.00 ? 62 ASP A H    9  
ATOM   11137 H  HA   . ASP A 1 62 ? 4.203   -16.271 0.277   1.00 0.00 ? 62 ASP A HA   9  
ATOM   11138 H  HB2  . ASP A 1 62 ? 2.764   -16.578 2.473   1.00 0.00 ? 62 ASP A HB2  9  
ATOM   11139 H  HB3  . ASP A 1 62 ? 1.423   -16.555 1.336   1.00 0.00 ? 62 ASP A HB3  9  
ATOM   11140 N  N    . GLN A 1 63 ? 1.622   -14.515 -0.721  1.00 0.00 ? 63 GLN A N    9  
ATOM   11141 C  CA   . GLN A 1 63 ? 0.810   -14.150 -1.880  1.00 0.00 ? 63 GLN A CA   9  
ATOM   11142 C  C    . GLN A 1 63 ? 1.570   -13.194 -2.803  1.00 0.00 ? 63 GLN A C    9  
ATOM   11143 O  O    . GLN A 1 63 ? 1.518   -13.330 -4.026  1.00 0.00 ? 63 GLN A O    9  
ATOM   11144 C  CB   . GLN A 1 63 ? -0.501  -13.508 -1.423  1.00 0.00 ? 63 GLN A CB   9  
ATOM   11145 C  CG   . GLN A 1 63 ? -1.559  -14.521 -1.009  1.00 0.00 ? 63 GLN A CG   9  
ATOM   11146 C  CD   . GLN A 1 63 ? -2.868  -13.875 -0.586  1.00 0.00 ? 63 GLN A CD   9  
ATOM   11147 O  OE1  . GLN A 1 63 ? -2.935  -12.667 -0.355  1.00 0.00 ? 63 GLN A OE1  9  
ATOM   11148 N  NE2  . GLN A 1 63 ? -3.918  -14.682 -0.478  1.00 0.00 ? 63 GLN A NE2  9  
ATOM   11149 H  H    . GLN A 1 63 ? 1.539   -13.986 0.102   1.00 0.00 ? 63 GLN A H    9  
ATOM   11150 H  HA   . GLN A 1 63 ? 0.586   -15.056 -2.426  1.00 0.00 ? 63 GLN A HA   9  
ATOM   11151 H  HB2  . GLN A 1 63 ? -0.297  -12.866 -0.579  1.00 0.00 ? 63 GLN A HB2  9  
ATOM   11152 H  HB3  . GLN A 1 63 ? -0.899  -12.912 -2.231  1.00 0.00 ? 63 GLN A HB3  9  
ATOM   11153 H  HG2  . GLN A 1 63 ? -1.755  -15.178 -1.843  1.00 0.00 ? 63 GLN A HG2  9  
ATOM   11154 H  HG3  . GLN A 1 63 ? -1.177  -15.100 -0.181  1.00 0.00 ? 63 GLN A HG3  9  
ATOM   11155 H  HE21 . GLN A 1 63 ? -3.793  -15.636 -0.675  1.00 0.00 ? 63 GLN A HE21 9  
ATOM   11156 H  HE22 . GLN A 1 63 ? -4.774  -14.293 -0.207  1.00 0.00 ? 63 GLN A HE22 9  
ATOM   11157 N  N    . PHE A 1 64 ? 2.275   -12.229 -2.208  1.00 0.00 ? 64 PHE A N    9  
ATOM   11158 C  CA   . PHE A 1 64 ? 3.048   -11.252 -2.978  1.00 0.00 ? 64 PHE A CA   9  
ATOM   11159 C  C    . PHE A 1 64 ? 4.288   -11.892 -3.609  1.00 0.00 ? 64 PHE A C    9  
ATOM   11160 O  O    . PHE A 1 64 ? 4.688   -11.522 -4.714  1.00 0.00 ? 64 PHE A O    9  
ATOM   11161 C  CB   . PHE A 1 64 ? 3.461   -10.075 -2.085  1.00 0.00 ? 64 PHE A CB   9  
ATOM   11162 C  CG   . PHE A 1 64 ? 2.429   -8.984  -2.014  1.00 0.00 ? 64 PHE A CG   9  
ATOM   11163 C  CD1  . PHE A 1 64 ? 1.345   -9.087  -1.156  1.00 0.00 ? 64 PHE A CD1  9  
ATOM   11164 C  CD2  . PHE A 1 64 ? 2.541   -7.854  -2.808  1.00 0.00 ? 64 PHE A CD2  9  
ATOM   11165 C  CE1  . PHE A 1 64 ? 0.395   -8.086  -1.091  1.00 0.00 ? 64 PHE A CE1  9  
ATOM   11166 C  CE2  . PHE A 1 64 ? 1.594   -6.850  -2.749  1.00 0.00 ? 64 PHE A CE2  9  
ATOM   11167 C  CZ   . PHE A 1 64 ? 0.520   -6.966  -1.889  1.00 0.00 ? 64 PHE A CZ   9  
ATOM   11168 H  H    . PHE A 1 64 ? 2.277   -12.174 -1.229  1.00 0.00 ? 64 PHE A H    9  
ATOM   11169 H  HA   . PHE A 1 64 ? 2.412   -10.881 -3.769  1.00 0.00 ? 64 PHE A HA   9  
ATOM   11170 H  HB2  . PHE A 1 64 ? 3.634   -10.436 -1.082  1.00 0.00 ? 64 PHE A HB2  9  
ATOM   11171 H  HB3  . PHE A 1 64 ? 4.375   -9.646  -2.470  1.00 0.00 ? 64 PHE A HB3  9  
ATOM   11172 H  HD1  . PHE A 1 64 ? 1.246   -9.962  -0.530  1.00 0.00 ? 64 PHE A HD1  9  
ATOM   11173 H  HD2  . PHE A 1 64 ? 3.381   -7.762  -3.482  1.00 0.00 ? 64 PHE A HD2  9  
ATOM   11174 H  HE1  . PHE A 1 64 ? -0.445  -8.180  -0.418  1.00 0.00 ? 64 PHE A HE1  9  
ATOM   11175 H  HE2  . PHE A 1 64 ? 1.694   -5.975  -3.374  1.00 0.00 ? 64 PHE A HE2  9  
ATOM   11176 H  HZ   . PHE A 1 64 ? -0.222  -6.181  -1.842  1.00 0.00 ? 64 PHE A HZ   9  
ATOM   11177 N  N    . VAL A 1 65 ? 4.891   -12.854 -2.907  1.00 0.00 ? 65 VAL A N    9  
ATOM   11178 C  CA   . VAL A 1 65 ? 6.080   -13.543 -3.404  1.00 0.00 ? 65 VAL A CA   9  
ATOM   11179 C  C    . VAL A 1 65 ? 5.712   -14.913 -3.973  1.00 0.00 ? 65 VAL A C    9  
ATOM   11180 O  O    . VAL A 1 65 ? 5.635   -15.902 -3.242  1.00 0.00 ? 65 VAL A O    9  
ATOM   11181 C  CB   . VAL A 1 65 ? 7.151   -13.713 -2.301  1.00 0.00 ? 65 VAL A CB   9  
ATOM   11182 C  CG1  . VAL A 1 65 ? 8.452   -14.246 -2.886  1.00 0.00 ? 65 VAL A CG1  9  
ATOM   11183 C  CG2  . VAL A 1 65 ? 7.387   -12.395 -1.574  1.00 0.00 ? 65 VAL A CG2  9  
ATOM   11184 H  H    . VAL A 1 65 ? 4.528   -13.111 -2.035  1.00 0.00 ? 65 VAL A H    9  
ATOM   11185 H  HA   . VAL A 1 65 ? 6.504   -12.940 -4.196  1.00 0.00 ? 65 VAL A HA   9  
ATOM   11186 H  HB   . VAL A 1 65 ? 6.785   -14.433 -1.583  1.00 0.00 ? 65 VAL A HB   9  
ATOM   11187 H  HG11 . VAL A 1 65 ? 8.231   -14.991 -3.636  1.00 0.00 ? 65 VAL A HG11 9  
ATOM   11188 H  HG12 . VAL A 1 65 ? 9.043   -14.692 -2.101  1.00 0.00 ? 65 VAL A HG12 9  
ATOM   11189 H  HG13 . VAL A 1 65 ? 9.005   -13.435 -3.336  1.00 0.00 ? 65 VAL A HG13 9  
ATOM   11190 H  HG21 . VAL A 1 65 ? 6.755   -12.349 -0.699  1.00 0.00 ? 65 VAL A HG21 9  
ATOM   11191 H  HG22 . VAL A 1 65 ? 7.151   -11.572 -2.232  1.00 0.00 ? 65 VAL A HG22 9  
ATOM   11192 H  HG23 . VAL A 1 65 ? 8.422   -12.330 -1.274  1.00 0.00 ? 65 VAL A HG23 9  
ATOM   11193 N  N    . SER A 1 66 ? 5.479   -14.953 -5.287  1.00 0.00 ? 66 SER A N    9  
ATOM   11194 C  CA   . SER A 1 66 ? 5.108   -16.185 -5.983  1.00 0.00 ? 66 SER A CA   9  
ATOM   11195 C  C    . SER A 1 66 ? 3.792   -16.743 -5.437  1.00 0.00 ? 66 SER A C    9  
ATOM   11196 O  O    . SER A 1 66 ? 3.777   -17.727 -4.694  1.00 0.00 ? 66 SER A O    9  
ATOM   11197 C  CB   . SER A 1 66 ? 6.224   -17.233 -5.872  1.00 0.00 ? 66 SER A CB   9  
ATOM   11198 O  OG   . SER A 1 66 ? 5.918   -18.390 -6.635  1.00 0.00 ? 66 SER A OG   9  
ATOM   11199 H  H    . SER A 1 66 ? 5.552   -14.123 -5.803  1.00 0.00 ? 66 SER A H    9  
ATOM   11200 H  HA   . SER A 1 66 ? 4.966   -15.939 -7.026  1.00 0.00 ? 66 SER A HA   9  
ATOM   11201 H  HB2  . SER A 1 66 ? 7.147   -16.810 -6.239  1.00 0.00 ? 66 SER A HB2  9  
ATOM   11202 H  HB3  . SER A 1 66 ? 6.346   -17.519 -4.838  1.00 0.00 ? 66 SER A HB3  9  
ATOM   11203 H  HG   . SER A 1 66 ? 5.398   -18.997 -6.101  1.00 0.00 ? 66 SER A HG   9  
ATOM   11204 N  N    . GLY A 1 67 ? 2.690   -16.098 -5.811  1.00 0.00 ? 67 GLY A N    9  
ATOM   11205 C  CA   . GLY A 1 67 ? 1.376   -16.524 -5.358  1.00 0.00 ? 67 GLY A CA   9  
ATOM   11206 C  C    . GLY A 1 67 ? 0.260   -15.920 -6.189  1.00 0.00 ? 67 GLY A C    9  
ATOM   11207 O  O    . GLY A 1 67 ? -0.575  -16.642 -6.735  1.00 0.00 ? 67 GLY A O    9  
ATOM   11208 H  H    . GLY A 1 67 ? 2.770   -15.319 -6.402  1.00 0.00 ? 67 GLY A H    9  
ATOM   11209 H  HA2  . GLY A 1 67 ? 1.317   -17.600 -5.419  1.00 0.00 ? 67 GLY A HA2  9  
ATOM   11210 H  HA3  . GLY A 1 67 ? 1.246   -16.223 -4.329  1.00 0.00 ? 67 GLY A HA3  9  
ATOM   11211 N  N    . GLU A 1 68 ? 0.252   -14.589 -6.284  1.00 0.00 ? 68 GLU A N    9  
ATOM   11212 C  CA   . GLU A 1 68 ? -0.763  -13.873 -7.055  1.00 0.00 ? 68 GLU A CA   9  
ATOM   11213 C  C    . GLU A 1 68 ? -0.129  -13.094 -8.216  1.00 0.00 ? 68 GLU A C    9  
ATOM   11214 O  O    . GLU A 1 68 ? -0.503  -11.950 -8.488  1.00 0.00 ? 68 GLU A O    9  
ATOM   11215 C  CB   . GLU A 1 68 ? -1.537  -12.922 -6.135  1.00 0.00 ? 68 GLU A CB   9  
ATOM   11216 C  CG   . GLU A 1 68 ? -2.945  -12.615 -6.617  1.00 0.00 ? 68 GLU A CG   9  
ATOM   11217 C  CD   . GLU A 1 68 ? -4.003  -13.414 -5.879  1.00 0.00 ? 68 GLU A CD   9  
ATOM   11218 O  OE1  . GLU A 1 68 ? -4.321  -13.055 -4.725  1.00 0.00 ? 68 GLU A OE1  9  
ATOM   11219 O  OE2  . GLU A 1 68 ? -4.510  -14.399 -6.455  1.00 0.00 ? 68 GLU A OE2  9  
ATOM   11220 H  H    . GLU A 1 68 ? 0.949   -14.074 -5.823  1.00 0.00 ? 68 GLU A H    9  
ATOM   11221 H  HA   . GLU A 1 68 ? -1.449  -14.604 -7.461  1.00 0.00 ? 68 GLU A HA   9  
ATOM   11222 H  HB2  . GLU A 1 68 ? -1.604  -13.367 -5.153  1.00 0.00 ? 68 GLU A HB2  9  
ATOM   11223 H  HB3  . GLU A 1 68 ? -0.994  -11.991 -6.060  1.00 0.00 ? 68 GLU A HB3  9  
ATOM   11224 H  HG2  . GLU A 1 68 ? -3.141  -11.564 -6.467  1.00 0.00 ? 68 GLU A HG2  9  
ATOM   11225 H  HG3  . GLU A 1 68 ? -3.009  -12.845 -7.670  1.00 0.00 ? 68 GLU A HG3  9  
ATOM   11226 N  N    . THR A 1 69 ? 0.837   -13.721 -8.895  1.00 0.00 ? 69 THR A N    9  
ATOM   11227 C  CA   . THR A 1 69 ? 1.526   -13.089 -10.023 1.00 0.00 ? 69 THR A CA   9  
ATOM   11228 C  C    . THR A 1 69 ? 0.579   -12.875 -11.211 1.00 0.00 ? 69 THR A C    9  
ATOM   11229 O  O    . THR A 1 69 ? -0.417  -13.587 -11.362 1.00 0.00 ? 69 THR A O    9  
ATOM   11230 C  CB   . THR A 1 69 ? 2.739   -13.929 -10.451 1.00 0.00 ? 69 THR A CB   9  
ATOM   11231 O  OG1  . THR A 1 69 ? 3.411   -13.327 -11.545 1.00 0.00 ? 69 THR A OG1  9  
ATOM   11232 C  CG2  . THR A 1 69 ? 2.388   -15.350 -10.854 1.00 0.00 ? 69 THR A CG2  9  
ATOM   11233 H  H    . THR A 1 69 ? 1.092   -14.629 -8.630  1.00 0.00 ? 69 THR A H    9  
ATOM   11234 H  HA   . THR A 1 69 ? 1.876   -12.123 -9.688  1.00 0.00 ? 69 THR A HA   9  
ATOM   11235 H  HB   . THR A 1 69 ? 3.431   -13.985 -9.622  1.00 0.00 ? 69 THR A HB   9  
ATOM   11236 H  HG1  . THR A 1 69 ? 4.318   -13.640 -11.581 1.00 0.00 ? 69 THR A HG1  9  
ATOM   11237 H  HG21 . THR A 1 69 ? 3.113   -16.032 -10.435 1.00 0.00 ? 69 THR A HG21 9  
ATOM   11238 H  HG22 . THR A 1 69 ? 2.398   -15.433 -11.931 1.00 0.00 ? 69 THR A HG22 9  
ATOM   11239 H  HG23 . THR A 1 69 ? 1.405   -15.597 -10.484 1.00 0.00 ? 69 THR A HG23 9  
ATOM   11240 N  N    . VAL A 1 70 ? 0.900   -11.884 -12.047 1.00 0.00 ? 70 VAL A N    9  
ATOM   11241 C  CA   . VAL A 1 70 ? 0.085   -11.562 -13.219 1.00 0.00 ? 70 VAL A CA   9  
ATOM   11242 C  C    . VAL A 1 70 ? 0.352   -12.537 -14.371 1.00 0.00 ? 70 VAL A C    9  
ATOM   11243 O  O    . VAL A 1 70 ? 1.502   -12.889 -14.644 1.00 0.00 ? 70 VAL A O    9  
ATOM   11244 C  CB   . VAL A 1 70 ? 0.333   -10.106 -13.695 1.00 0.00 ? 70 VAL A CB   9  
ATOM   11245 C  CG1  . VAL A 1 70 ? 1.774   -9.910  -14.149 1.00 0.00 ? 70 VAL A CG1  9  
ATOM   11246 C  CG2  . VAL A 1 70 ? -0.637  -9.721  -14.803 1.00 0.00 ? 70 VAL A CG2  9  
ATOM   11247 H  H    . VAL A 1 70 ? 1.705   -11.354 -11.868 1.00 0.00 ? 70 VAL A H    9  
ATOM   11248 H  HA   . VAL A 1 70 ? -0.951  -11.647 -12.929 1.00 0.00 ? 70 VAL A HA   9  
ATOM   11249 H  HB   . VAL A 1 70 ? 0.160   -9.446  -12.856 1.00 0.00 ? 70 VAL A HB   9  
ATOM   11250 H  HG11 . VAL A 1 70 ? 2.396   -10.680 -13.721 1.00 0.00 ? 70 VAL A HG11 9  
ATOM   11251 H  HG12 . VAL A 1 70 ? 2.126   -8.941  -13.823 1.00 0.00 ? 70 VAL A HG12 9  
ATOM   11252 H  HG13 . VAL A 1 70 ? 1.823   -9.965  -15.227 1.00 0.00 ? 70 VAL A HG13 9  
ATOM   11253 H  HG21 . VAL A 1 70 ? -0.543  -10.418 -15.624 1.00 0.00 ? 70 VAL A HG21 9  
ATOM   11254 H  HG22 . VAL A 1 70 ? -0.410  -8.724  -15.151 1.00 0.00 ? 70 VAL A HG22 9  
ATOM   11255 H  HG23 . VAL A 1 70 ? -1.647  -9.747  -14.422 1.00 0.00 ? 70 VAL A HG23 9  
ATOM   11256 N  N    . PRO A 1 71 ? -0.719  -12.991 -15.061 1.00 0.00 ? 71 PRO A N    9  
ATOM   11257 C  CA   . PRO A 1 71 ? -0.607  -13.930 -16.188 1.00 0.00 ? 71 PRO A CA   9  
ATOM   11258 C  C    . PRO A 1 71 ? 0.358   -13.439 -17.266 1.00 0.00 ? 71 PRO A C    9  
ATOM   11259 O  O    . PRO A 1 71 ? 0.236   -12.309 -17.746 1.00 0.00 ? 71 PRO A O    9  
ATOM   11260 C  CB   . PRO A 1 71 ? -2.032  -13.997 -16.746 1.00 0.00 ? 71 PRO A CB   9  
ATOM   11261 C  CG   . PRO A 1 71 ? -2.907  -13.618 -15.604 1.00 0.00 ? 71 PRO A CG   9  
ATOM   11262 C  CD   . PRO A 1 71 ? -2.124  -12.626 -14.791 1.00 0.00 ? 71 PRO A CD   9  
ATOM   11263 H  HA   . PRO A 1 71 ? -0.301  -14.912 -15.855 1.00 0.00 ? 71 PRO A HA   9  
ATOM   11264 H  HB2  . PRO A 1 71 ? -2.132  -13.302 -17.568 1.00 0.00 ? 71 PRO A HB2  9  
ATOM   11265 H  HB3  . PRO A 1 71 ? -2.242  -14.998 -17.089 1.00 0.00 ? 71 PRO A HB3  9  
ATOM   11266 H  HG2  . PRO A 1 71 ? -3.818  -13.167 -15.972 1.00 0.00 ? 71 PRO A HG2  9  
ATOM   11267 H  HG3  . PRO A 1 71 ? -3.135  -14.491 -15.011 1.00 0.00 ? 71 PRO A HG3  9  
ATOM   11268 H  HD2  . PRO A 1 71 ? -2.332  -11.619 -15.122 1.00 0.00 ? 71 PRO A HD2  9  
ATOM   11269 H  HD3  . PRO A 1 71 ? -2.353  -12.734 -13.741 1.00 0.00 ? 71 PRO A HD3  9  
ATOM   11270 N  N    . ALA A 1 72 ? 1.316   -14.297 -17.632 1.00 0.00 ? 72 ALA A N    9  
ATOM   11271 C  CA   . ALA A 1 72 ? 2.324   -13.975 -18.648 1.00 0.00 ? 72 ALA A CA   9  
ATOM   11272 C  C    . ALA A 1 72 ? 3.351   -12.972 -18.111 1.00 0.00 ? 72 ALA A C    9  
ATOM   11273 O  O    . ALA A 1 72 ? 3.049   -12.182 -17.215 1.00 0.00 ? 72 ALA A O    9  
ATOM   11274 C  CB   . ALA A 1 72 ? 1.667   -13.446 -19.920 1.00 0.00 ? 72 ALA A CB   9  
ATOM   11275 H  H    . ALA A 1 72 ? 1.352   -15.177 -17.201 1.00 0.00 ? 72 ALA A H    9  
ATOM   11276 H  HA   . ALA A 1 72 ? 2.838   -14.892 -18.898 1.00 0.00 ? 72 ALA A HA   9  
ATOM   11277 H  HB1  . ALA A 1 72 ? 2.225   -13.784 -20.781 1.00 0.00 ? 72 ALA A HB1  9  
ATOM   11278 H  HB2  . ALA A 1 72 ? 1.658   -12.367 -19.899 1.00 0.00 ? 72 ALA A HB2  9  
ATOM   11279 H  HB3  . ALA A 1 72 ? 0.652   -13.813 -19.982 1.00 0.00 ? 72 ALA A HB3  9  
ATOM   11280 N  N    . PRO A 1 73 ? 4.586   -12.988 -18.652 1.00 0.00 ? 73 PRO A N    9  
ATOM   11281 C  CA   . PRO A 1 73 ? 5.648   -12.072 -18.215 1.00 0.00 ? 73 PRO A CA   9  
ATOM   11282 C  C    . PRO A 1 73 ? 5.378   -10.630 -18.649 1.00 0.00 ? 73 PRO A C    9  
ATOM   11283 O  O    . PRO A 1 73 ? 5.910   -10.160 -19.657 1.00 0.00 ? 73 PRO A O    9  
ATOM   11284 C  CB   . PRO A 1 73 ? 6.901   -12.627 -18.900 1.00 0.00 ? 73 PRO A CB   9  
ATOM   11285 C  CG   . PRO A 1 73 ? 6.390   -13.342 -20.105 1.00 0.00 ? 73 PRO A CG   9  
ATOM   11286 C  CD   . PRO A 1 73 ? 5.041   -13.891 -19.729 1.00 0.00 ? 73 PRO A CD   9  
ATOM   11287 H  HA   . PRO A 1 73 ? 5.776   -12.104 -17.142 1.00 0.00 ? 73 PRO A HA   9  
ATOM   11288 H  HB2  . PRO A 1 73 ? 7.557   -11.814 -19.170 1.00 0.00 ? 73 PRO A HB2  9  
ATOM   11289 H  HB3  . PRO A 1 73 ? 7.412   -13.302 -18.229 1.00 0.00 ? 73 PRO A HB3  9  
ATOM   11290 H  HG2  . PRO A 1 73 ? 6.296   -12.649 -20.928 1.00 0.00 ? 73 PRO A HG2  9  
ATOM   11291 H  HG3  . PRO A 1 73 ? 7.062   -14.147 -20.367 1.00 0.00 ? 73 PRO A HG3  9  
ATOM   11292 H  HD2  . PRO A 1 73 ? 4.369   -13.850 -20.574 1.00 0.00 ? 73 PRO A HD2  9  
ATOM   11293 H  HD3  . PRO A 1 73 ? 5.132   -14.905 -19.366 1.00 0.00 ? 73 PRO A HD3  9  
ATOM   11294 N  N    . SER A 1 74 ? 4.533   -9.936  -17.886 1.00 0.00 ? 74 SER A N    9  
ATOM   11295 C  CA   . SER A 1 74 ? 4.179   -8.554  -18.194 1.00 0.00 ? 74 SER A CA   9  
ATOM   11296 C  C    . SER A 1 74 ? 4.742   -7.592  -17.149 1.00 0.00 ? 74 SER A C    9  
ATOM   11297 O  O    . SER A 1 74 ? 4.329   -7.612  -15.987 1.00 0.00 ? 74 SER A O    9  
ATOM   11298 C  CB   . SER A 1 74 ? 2.656   -8.404  -18.278 1.00 0.00 ? 74 SER A CB   9  
ATOM   11299 O  OG   . SER A 1 74 ? 2.284   -7.538  -19.339 1.00 0.00 ? 74 SER A OG   9  
ATOM   11300 H  H    . SER A 1 74 ? 4.133   -10.368 -17.100 1.00 0.00 ? 74 SER A H    9  
ATOM   11301 H  HA   . SER A 1 74 ? 4.607   -8.312  -19.155 1.00 0.00 ? 74 SER A HA   9  
ATOM   11302 H  HB2  . SER A 1 74 ? 2.210   -9.374  -18.451 1.00 0.00 ? 74 SER A HB2  9  
ATOM   11303 H  HB3  . SER A 1 74 ? 2.282   -7.998  -17.348 1.00 0.00 ? 74 SER A HB3  9  
ATOM   11304 H  HG   . SER A 1 74 ? 2.650   -6.663  -19.184 1.00 0.00 ? 74 SER A HG   9  
ATOM   11305 N  N    . ALA A 1 75 ? 5.682   -6.744  -17.574 1.00 0.00 ? 75 ALA A N    9  
ATOM   11306 C  CA   . ALA A 1 75 ? 6.300   -5.762  -16.682 1.00 0.00 ? 75 ALA A CA   9  
ATOM   11307 C  C    . ALA A 1 75 ? 6.863   -4.572  -17.466 1.00 0.00 ? 75 ALA A C    9  
ATOM   11308 O  O    . ALA A 1 75 ? 7.918   -4.032  -17.124 1.00 0.00 ? 75 ALA A O    9  
ATOM   11309 C  CB   . ALA A 1 75 ? 7.392   -6.421  -15.844 1.00 0.00 ? 75 ALA A CB   9  
ATOM   11310 H  H    . ALA A 1 75 ? 5.964   -6.778  -18.513 1.00 0.00 ? 75 ALA A H    9  
ATOM   11311 H  HA   . ALA A 1 75 ? 5.535   -5.400  -16.008 1.00 0.00 ? 75 ALA A HA   9  
ATOM   11312 H  HB1  . ALA A 1 75 ? 7.913   -7.152  -16.443 1.00 0.00 ? 75 ALA A HB1  9  
ATOM   11313 H  HB2  . ALA A 1 75 ? 6.944   -6.908  -14.990 1.00 0.00 ? 75 ALA A HB2  9  
ATOM   11314 H  HB3  . ALA A 1 75 ? 8.089   -5.669  -15.504 1.00 0.00 ? 75 ALA A HB3  9  
ATOM   11315 N  N    . ASN A 1 76 ? 6.151   -4.164  -18.521 1.00 0.00 ? 76 ASN A N    9  
ATOM   11316 C  CA   . ASN A 1 76 ? 6.578   -3.041  -19.349 1.00 0.00 ? 76 ASN A CA   9  
ATOM   11317 C  C    . ASN A 1 76 ? 5.761   -1.791  -19.029 1.00 0.00 ? 76 ASN A C    9  
ATOM   11318 O  O    . ASN A 1 76 ? 4.529   -1.821  -19.052 1.00 0.00 ? 76 ASN A O    9  
ATOM   11319 C  CB   . ASN A 1 76 ? 6.442   -3.391  -20.836 1.00 0.00 ? 76 ASN A CB   9  
ATOM   11320 C  CG   . ASN A 1 76 ? 7.700   -4.025  -21.398 1.00 0.00 ? 76 ASN A CG   9  
ATOM   11321 O  OD1  . ASN A 1 76 ? 7.696   -5.191  -21.794 1.00 0.00 ? 76 ASN A OD1  9  
ATOM   11322 N  ND2  . ASN A 1 76 ? 8.787   -3.261  -21.439 1.00 0.00 ? 76 ASN A ND2  9  
ATOM   11323 H  H    . ASN A 1 76 ? 5.318   -4.629  -18.744 1.00 0.00 ? 76 ASN A H    9  
ATOM   11324 H  HA   . ASN A 1 76 ? 7.616   -2.843  -19.130 1.00 0.00 ? 76 ASN A HA   9  
ATOM   11325 H  HB2  . ASN A 1 76 ? 5.624   -4.084  -20.965 1.00 0.00 ? 76 ASN A HB2  9  
ATOM   11326 H  HB3  . ASN A 1 76 ? 6.235   -2.489  -21.394 1.00 0.00 ? 76 ASN A HB3  9  
ATOM   11327 H  HD21 . ASN A 1 76 ? 8.721   -2.340  -21.107 1.00 0.00 ? 76 ASN A HD21 9  
ATOM   11328 H  HD22 . ASN A 1 76 ? 9.613   -3.651  -21.796 1.00 0.00 ? 76 ASN A HD22 9  
ATOM   11329 N  N    . LYS A 1 77 ? 6.457   -0.693  -18.730 1.00 0.00 ? 77 LYS A N    9  
ATOM   11330 C  CA   . LYS A 1 77 ? 5.796   0.570   -18.401 1.00 0.00 ? 77 LYS A CA   9  
ATOM   11331 C  C    . LYS A 1 77 ? 6.494   1.755   -19.075 1.00 0.00 ? 77 LYS A C    9  
ATOM   11332 O  O    . LYS A 1 77 ? 7.230   2.506   -18.432 1.00 0.00 ? 77 LYS A O    9  
ATOM   11333 C  CB   . LYS A 1 77 ? 5.751   0.769   -16.879 1.00 0.00 ? 77 LYS A CB   9  
ATOM   11334 C  CG   . LYS A 1 77 ? 7.073   0.495   -16.180 1.00 0.00 ? 77 LYS A CG   9  
ATOM   11335 C  CD   . LYS A 1 77 ? 6.969   0.732   -14.682 1.00 0.00 ? 77 LYS A CD   9  
ATOM   11336 C  CE   . LYS A 1 77 ? 8.321   1.091   -14.083 1.00 0.00 ? 77 LYS A CE   9  
ATOM   11337 N  NZ   . LYS A 1 77 ? 8.234   1.358   -12.619 1.00 0.00 ? 77 LYS A NZ   9  
ATOM   11338 H  H    . LYS A 1 77 ? 7.437   -0.733  -18.728 1.00 0.00 ? 77 LYS A H    9  
ATOM   11339 H  HA   . LYS A 1 77 ? 4.784   0.513   -18.773 1.00 0.00 ? 77 LYS A HA   9  
ATOM   11340 H  HB2  . LYS A 1 77 ? 5.465   1.790   -16.671 1.00 0.00 ? 77 LYS A HB2  9  
ATOM   11341 H  HB3  . LYS A 1 77 ? 5.006   0.104   -16.465 1.00 0.00 ? 77 LYS A HB3  9  
ATOM   11342 H  HG2  . LYS A 1 77 ? 7.354   -0.534  -16.351 1.00 0.00 ? 77 LYS A HG2  9  
ATOM   11343 H  HG3  . LYS A 1 77 ? 7.828   1.149   -16.589 1.00 0.00 ? 77 LYS A HG3  9  
ATOM   11344 H  HD2  . LYS A 1 77 ? 6.281   1.542   -14.502 1.00 0.00 ? 77 LYS A HD2  9  
ATOM   11345 H  HD3  . LYS A 1 77 ? 6.603   -0.167  -14.210 1.00 0.00 ? 77 LYS A HD3  9  
ATOM   11346 H  HE2  . LYS A 1 77 ? 9.002   0.270   -14.248 1.00 0.00 ? 77 LYS A HE2  9  
ATOM   11347 H  HE3  . LYS A 1 77 ? 8.696   1.974   -14.580 1.00 0.00 ? 77 LYS A HE3  9  
ATOM   11348 H  HZ1  . LYS A 1 77 ? 8.377   0.477   -12.085 1.00 0.00 ? 77 LYS A HZ1  9  
ATOM   11349 H  HZ2  . LYS A 1 77 ? 7.301   1.750   -12.379 1.00 0.00 ? 77 LYS A HZ2  9  
ATOM   11350 H  HZ3  . LYS A 1 77 ? 8.965   2.042   -12.337 1.00 0.00 ? 77 LYS A HZ3  9  
ATOM   11351 N  N    . GLU A 1 78 ? 6.248   1.918   -20.375 1.00 0.00 ? 78 GLU A N    9  
ATOM   11352 C  CA   . GLU A 1 78 ? 6.840   3.013   -21.143 1.00 0.00 ? 78 GLU A CA   9  
ATOM   11353 C  C    . GLU A 1 78 ? 5.787   4.081   -21.468 1.00 0.00 ? 78 GLU A C    9  
ATOM   11354 O  O    . GLU A 1 78 ? 5.783   4.650   -22.562 1.00 0.00 ? 78 GLU A O    9  
ATOM   11355 C  CB   . GLU A 1 78 ? 7.461   2.472   -22.436 1.00 0.00 ? 78 GLU A CB   9  
ATOM   11356 C  CG   . GLU A 1 78 ? 8.742   3.185   -22.847 1.00 0.00 ? 78 GLU A CG   9  
ATOM   11357 C  CD   . GLU A 1 78 ? 8.996   3.125   -24.343 1.00 0.00 ? 78 GLU A CD   9  
ATOM   11358 O  OE1  . GLU A 1 78 ? 8.987   2.009   -24.905 1.00 0.00 ? 78 GLU A OE1  9  
ATOM   11359 O  OE2  . GLU A 1 78 ? 9.204   4.196   -24.951 1.00 0.00 ? 78 GLU A OE2  9  
ATOM   11360 H  H    . GLU A 1 78 ? 5.649   1.288   -20.829 1.00 0.00 ? 78 GLU A H    9  
ATOM   11361 H  HA   . GLU A 1 78 ? 7.616   3.461   -20.540 1.00 0.00 ? 78 GLU A HA   9  
ATOM   11362 H  HB2  . GLU A 1 78 ? 7.686   1.425   -22.303 1.00 0.00 ? 78 GLU A HB2  9  
ATOM   11363 H  HB3  . GLU A 1 78 ? 6.744   2.577   -23.239 1.00 0.00 ? 78 GLU A HB3  9  
ATOM   11364 H  HG2  . GLU A 1 78 ? 8.672   4.220   -22.552 1.00 0.00 ? 78 GLU A HG2  9  
ATOM   11365 H  HG3  . GLU A 1 78 ? 9.575   2.722   -22.338 1.00 0.00 ? 78 GLU A HG3  9  
ATOM   11366 N  N    . LEU A 1 79 ? 4.895   4.345   -20.509 1.00 0.00 ? 79 LEU A N    9  
ATOM   11367 C  CA   . LEU A 1 79 ? 3.837   5.338   -20.692 1.00 0.00 ? 79 LEU A CA   9  
ATOM   11368 C  C    . LEU A 1 79 ? 4.355   6.752   -20.410 1.00 0.00 ? 79 LEU A C    9  
ATOM   11369 O  O    . LEU A 1 79 ? 4.002   7.371   -19.402 1.00 0.00 ? 79 LEU A O    9  
ATOM   11370 C  CB   . LEU A 1 79 ? 2.631   5.009   -19.793 1.00 0.00 ? 79 LEU A CB   9  
ATOM   11371 C  CG   . LEU A 1 79 ? 2.934   4.889   -18.294 1.00 0.00 ? 79 LEU A CG   9  
ATOM   11372 C  CD1  . LEU A 1 79 ? 1.832   5.545   -17.473 1.00 0.00 ? 79 LEU A CD1  9  
ATOM   11373 C  CD2  . LEU A 1 79 ? 3.103   3.428   -17.892 1.00 0.00 ? 79 LEU A CD2  9  
ATOM   11374 H  H    . LEU A 1 79 ? 4.950   3.859   -19.660 1.00 0.00 ? 79 LEU A H    9  
ATOM   11375 H  HA   . LEU A 1 79 ? 3.522   5.289   -21.724 1.00 0.00 ? 79 LEU A HA   9  
ATOM   11376 H  HB2  . LEU A 1 79 ? 1.891   5.784   -19.928 1.00 0.00 ? 79 LEU A HB2  9  
ATOM   11377 H  HB3  . LEU A 1 79 ? 2.209   4.072   -20.128 1.00 0.00 ? 79 LEU A HB3  9  
ATOM   11378 H  HG   . LEU A 1 79 ? 3.859   5.404   -18.081 1.00 0.00 ? 79 LEU A HG   9  
ATOM   11379 H  HD11 . LEU A 1 79 ? 2.264   6.018   -16.604 1.00 0.00 ? 79 LEU A HD11 9  
ATOM   11380 H  HD12 . LEU A 1 79 ? 1.123   4.794   -17.158 1.00 0.00 ? 79 LEU A HD12 9  
ATOM   11381 H  HD13 . LEU A 1 79 ? 1.329   6.287   -18.074 1.00 0.00 ? 79 LEU A HD13 9  
ATOM   11382 H  HD21 . LEU A 1 79 ? 2.607   2.795   -18.613 1.00 0.00 ? 79 LEU A HD21 9  
ATOM   11383 H  HD22 . LEU A 1 79 ? 2.668   3.269   -16.916 1.00 0.00 ? 79 LEU A HD22 9  
ATOM   11384 H  HD23 . LEU A 1 79 ? 4.154   3.182   -17.861 1.00 0.00 ? 79 LEU A HD23 9  
ATOM   11385 N  N    . VAL A 1 80 ? 5.201   7.256   -21.311 1.00 0.00 ? 80 VAL A N    9  
ATOM   11386 C  CA   . VAL A 1 80 ? 5.778   8.591   -21.169 1.00 0.00 ? 80 VAL A CA   9  
ATOM   11387 C  C    . VAL A 1 80 ? 5.590   9.409   -22.450 1.00 0.00 ? 80 VAL A C    9  
ATOM   11388 O  O    . VAL A 1 80 ? 6.235   9.144   -23.467 1.00 0.00 ? 80 VAL A O    9  
ATOM   11389 C  CB   . VAL A 1 80 ? 7.284   8.510   -20.824 1.00 0.00 ? 80 VAL A CB   9  
ATOM   11390 C  CG1  . VAL A 1 80 ? 7.832   9.879   -20.451 1.00 0.00 ? 80 VAL A CG1  9  
ATOM   11391 C  CG2  . VAL A 1 80 ? 7.524   7.513   -19.697 1.00 0.00 ? 80 VAL A CG2  9  
ATOM   11392 H  H    . VAL A 1 80 ? 5.447   6.713   -22.089 1.00 0.00 ? 80 VAL A H    9  
ATOM   11393 H  HA   . VAL A 1 80 ? 5.270   9.090   -20.357 1.00 0.00 ? 80 VAL A HA   9  
ATOM   11394 H  HB   . VAL A 1 80 ? 7.815   8.162   -21.698 1.00 0.00 ? 80 VAL A HB   9  
ATOM   11395 H  HG11 . VAL A 1 80 ? 8.869   9.944   -20.749 1.00 0.00 ? 80 VAL A HG11 9  
ATOM   11396 H  HG12 . VAL A 1 80 ? 7.755   10.020  -19.383 1.00 0.00 ? 80 VAL A HG12 9  
ATOM   11397 H  HG13 . VAL A 1 80 ? 7.265   10.646  -20.957 1.00 0.00 ? 80 VAL A HG13 9  
ATOM   11398 H  HG21 . VAL A 1 80 ? 7.640   6.522   -20.110 1.00 0.00 ? 80 VAL A HG21 9  
ATOM   11399 H  HG22 . VAL A 1 80 ? 6.683   7.524   -19.019 1.00 0.00 ? 80 VAL A HG22 9  
ATOM   11400 H  HG23 . VAL A 1 80 ? 8.420   7.784   -19.159 1.00 0.00 ? 80 VAL A HG23 9  
ATOM   11401 N  N    . LYS A 1 81 ? 4.700   10.405  -22.388 1.00 0.00