data_2K0G
# 
_entry.id   2K0G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2K0G         pdb_00002k0g 10.2210/pdb2k0g/pdb 
RCSB  RCSB100519   ?            ?                   
WWPDB D_1000100519 ?            ?                   
# 
_pdbx_database_related.db_id          15249 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Entry containing resonance assignment data for this molecular system.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K0G 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-02-02 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schunke, S.'  1 
'Stoldt, M.'   2 
'Willbold, D.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of the Mesorhizobium loti K1 channel cyclic nucleotide-binding domain in complex with cAMP.' 
_citation.journal_abbrev            'Embo Rep.' 
_citation.journal_volume            10 
_citation.page_first                729 
_citation.page_last                 735 
_citation.year                      2009 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1469-221X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19465888 
_citation.pdbx_database_id_DOI      10.1038/embor.2009.68 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schunke, S.'  1 ? 
primary 'Stoldt, M.'   2 ? 
primary 'Novak, K.'    3 ? 
primary 'Kaupp, U.B.'  4 ? 
primary 'Willbold, D.' 5 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mll3241 protein'                      14983.222 1 ? ? 'Cyclic Nucleotide Binding Domain, residues 216-355' ? 
2 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 329.206   1 ? ? ?                                                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPG
AFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSQEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPG
AFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLN n 
1 4   GLU n 
1 5   VAL n 
1 6   ARG n 
1 7   ARG n 
1 8   GLY n 
1 9   ASP n 
1 10  PHE n 
1 11  VAL n 
1 12  ARG n 
1 13  ASN n 
1 14  TRP n 
1 15  GLN n 
1 16  LEU n 
1 17  VAL n 
1 18  ALA n 
1 19  ALA n 
1 20  VAL n 
1 21  PRO n 
1 22  LEU n 
1 23  PHE n 
1 24  GLN n 
1 25  LYS n 
1 26  LEU n 
1 27  GLY n 
1 28  PRO n 
1 29  ALA n 
1 30  VAL n 
1 31  LEU n 
1 32  VAL n 
1 33  GLU n 
1 34  ILE n 
1 35  VAL n 
1 36  ARG n 
1 37  ALA n 
1 38  LEU n 
1 39  ARG n 
1 40  ALA n 
1 41  ARG n 
1 42  THR n 
1 43  VAL n 
1 44  PRO n 
1 45  ALA n 
1 46  GLY n 
1 47  ALA n 
1 48  VAL n 
1 49  ILE n 
1 50  CYS n 
1 51  ARG n 
1 52  ILE n 
1 53  GLY n 
1 54  GLU n 
1 55  PRO n 
1 56  GLY n 
1 57  ASP n 
1 58  ARG n 
1 59  MET n 
1 60  PHE n 
1 61  PHE n 
1 62  VAL n 
1 63  VAL n 
1 64  GLU n 
1 65  GLY n 
1 66  SER n 
1 67  VAL n 
1 68  SER n 
1 69  VAL n 
1 70  ALA n 
1 71  THR n 
1 72  PRO n 
1 73  ASN n 
1 74  PRO n 
1 75  VAL n 
1 76  GLU n 
1 77  LEU n 
1 78  GLY n 
1 79  PRO n 
1 80  GLY n 
1 81  ALA n 
1 82  PHE n 
1 83  PHE n 
1 84  GLY n 
1 85  GLU n 
1 86  MET n 
1 87  ALA n 
1 88  LEU n 
1 89  ILE n 
1 90  SER n 
1 91  GLY n 
1 92  GLU n 
1 93  PRO n 
1 94  ARG n 
1 95  SER n 
1 96  ALA n 
1 97  THR n 
1 98  VAL n 
1 99  SER n 
1 100 ALA n 
1 101 ALA n 
1 102 THR n 
1 103 THR n 
1 104 VAL n 
1 105 SER n 
1 106 LEU n 
1 107 LEU n 
1 108 SER n 
1 109 LEU n 
1 110 HIS n 
1 111 SER n 
1 112 ALA n 
1 113 ASP n 
1 114 PHE n 
1 115 GLN n 
1 116 MET n 
1 117 LEU n 
1 118 CYS n 
1 119 SER n 
1 120 SER n 
1 121 SER n 
1 122 PRO n 
1 123 GLU n 
1 124 ILE n 
1 125 ALA n 
1 126 GLU n 
1 127 ILE n 
1 128 PHE n 
1 129 ARG n 
1 130 LYS n 
1 131 THR n 
1 132 ALA n 
1 133 LEU n 
1 134 GLU n 
1 135 ARG n 
1 136 ARG n 
1 137 GLY n 
1 138 ALA n 
1 139 ALA n 
1 140 ALA n 
1 141 SER n 
1 142 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Mesorhizobium loti' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rhizobium loti' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-2T 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q98GN8_RHILO 
_struct_ref.pdbx_db_accession          Q98GN8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;QEVRRGDFVRNWQLVAAVPLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVELGPGAF
FGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSPEIAEIFRKTALERRGAAASA
;
_struct_ref.pdbx_align_begin           216 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2K0G 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 142 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q98GN8 
_struct_ref_seq.db_align_beg                  216 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  355 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       216 
_struct_ref_seq.pdbx_auth_seq_align_end       355 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2K0G GLY A 1 ? UNP Q98GN8 ? ? 'expression tag' 214 1 
1 2K0G SER A 2 ? UNP Q98GN8 ? ? 'expression tag' 215 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
1 2 1 3D_13C-separated_NOESY 
1 3 2 3D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '100 mM KCl' 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.5 mM [U-100% 13C; U-100% 15N] MlCNBD Protein, 0.5 mM [U-100% 13C; U-100% 15N] ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE, 95% H2O, 5% D2O
;
1 '95% H2O/5% D2O' 
;0.5 mM [U-100% 13C; U-100% 15N] MlCNBD Protein, 0.5 mM [U-100% 13C; U-100% 15N] ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE, 100 % D2O
;
2 '100% D2O'       
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             'Unity INOVA with cryogenic triple resonance probe' 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'VARIAN Unity INOVA with cryogenic triple resonance probe' 
# 
_pdbx_nmr_refine.entry_id           2K0G 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            'The NMR structure ensemble is based on total of 2388 NOE-derived distance constraints.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  '15 structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K0G 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K0G 
_pdbx_nmr_representative.selection_criteria   'lowest energy and fewest violations' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Varian                                              processing                  VnmrJ        1.1d  1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe      3.0   2 
'Keller and Wuthrich'                               'data analysis'             CARA         1.8.4 3 
'Keller and Wuthrich'                               'chemical shift assignment' CARA         1.8.4 4 
'Keller and Wuthrich'                               'peak picking'              CARA         1.8.4 5 
'Herrmann, Guntert and Wuthrich'                    'structure solution'        ATNOS/CANDID 1.1   6 
'Herrmann, Guntert and Wuthrich'                    refinement                  ATNOS/CANDID 1.1   7 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA        1.1   8 
'Guntert, Mumenthaler and Wuthrich'                 refinement                  CYANA        1.1   9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K0G 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K0G 
_struct.title                     
'Solution Structure of a Bacterial Cyclic Nucleotide-Activated K+ Channel Binding Domain in Complex with cAMP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K0G 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            
;Membrane Protein, Ion Channel, helical bundle beta barrel core, Phosphate Binding Cassette with cAMP bound, Cyclic Nucleotide Binding Domain, Solution Structure
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 8   ? ALA A 18  ? GLY A 221 ALA A 231 1 ? 11 
HELX_P HELX_P2 2 PRO A 21  ? LYS A 25  ? PRO A 234 LYS A 238 5 ? 5  
HELX_P HELX_P3 3 PRO A 28  ? LEU A 38  ? PRO A 241 LEU A 251 1 ? 11 
HELX_P HELX_P4 4 MET A 86  ? ILE A 89  ? MET A 299 ILE A 302 1 ? 4  
HELX_P HELX_P5 5 SER A 111 ? SER A 120 ? SER A 324 SER A 333 1 ? 10 
HELX_P HELX_P6 6 PRO A 122 ? ARG A 136 ? PRO A 335 ARG A 349 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 39  ? VAL A 43  ? ARG A 252 VAL A 256 
A 2 VAL A 104 ? HIS A 110 ? VAL A 317 HIS A 323 
A 3 ARG A 58  ? GLU A 64  ? ARG A 271 GLU A 277 
A 4 ALA A 81  ? PHE A 83  ? ALA A 294 PHE A 296 
B 1 VAL A 98  ? ALA A 100 ? VAL A 311 ALA A 313 
B 2 VAL A 67  ? VAL A 69  ? VAL A 280 VAL A 282 
B 3 VAL A 75  ? LEU A 77  ? VAL A 288 LEU A 290 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 43  ? N VAL A 256 O VAL A 104 ? O VAL A 317 
A 2 3 O SER A 105 ? O SER A 318 N VAL A 63  ? N VAL A 276 
A 3 4 N PHE A 60  ? N PHE A 273 O PHE A 83  ? O PHE A 296 
B 1 2 O SER A 99  ? O SER A 312 N SER A 68  ? N SER A 281 
B 2 3 N VAL A 69  ? N VAL A 282 O VAL A 75  ? O VAL A 288 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    CMP 
_struct_site.pdbx_auth_seq_id     370 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    7 
_struct_site.details              'BINDING SITE FOR RESIDUE CMP A 370' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 7 ILE A 52  ? ILE A 265 . ? 1_555 ? 
2 AC1 7 ASN A 73  ? ASN A 286 . ? 1_555 ? 
3 AC1 7 PRO A 74  ? PRO A 287 . ? 1_555 ? 
4 AC1 7 LEU A 77  ? LEU A 290 . ? 1_555 ? 
5 AC1 7 GLU A 85  ? GLU A 298 . ? 1_555 ? 
6 AC1 7 MET A 86  ? MET A 299 . ? 1_555 ? 
7 AC1 7 ARG A 135 ? ARG A 348 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2K0G 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N      . GLY A 1 1   ? 3.759  0.880   -12.316 1.00 0.00 ? 214 GLY A N      1  
ATOM   2     C CA     . GLY A 1 1   ? 3.955  0.959   -10.879 1.00 0.00 ? 214 GLY A CA     1  
ATOM   3     C C      . GLY A 1 1   ? 3.086  -0.069  -10.150 1.00 0.00 ? 214 GLY A C      1  
ATOM   4     O O      . GLY A 1 1   ? 1.864  0.058   -10.117 1.00 0.00 ? 214 GLY A O      1  
ATOM   5     H H1     . GLY A 1 1   ? 4.589  0.996   -12.862 1.00 0.00 ? 214 GLY A H1     1  
ATOM   6     H HA2    . GLY A 1 1   ? 5.004  0.788   -10.641 1.00 0.00 ? 214 GLY A HA2    1  
ATOM   7     H HA3    . GLY A 1 1   ? 3.709  1.961   -10.528 1.00 0.00 ? 214 GLY A HA3    1  
ATOM   8     N N      . SER A 1 2   ? 3.753  -1.065  -9.584  1.00 0.00 ? 215 SER A N      1  
ATOM   9     C CA     . SER A 1 2   ? 3.058  -2.114  -8.858  1.00 0.00 ? 215 SER A CA     1  
ATOM   10    C C      . SER A 1 2   ? 3.142  -1.853  -7.353  1.00 0.00 ? 215 SER A C      1  
ATOM   11    O O      . SER A 1 2   ? 4.031  -1.139  -6.893  1.00 0.00 ? 215 SER A O      1  
ATOM   12    C CB     . SER A 1 2   ? 3.636  -3.491  -9.192  1.00 0.00 ? 215 SER A CB     1  
ATOM   13    O OG     . SER A 1 2   ? 4.914  -3.693  -8.594  1.00 0.00 ? 215 SER A OG     1  
ATOM   14    H H      . SER A 1 2   ? 4.749  -1.161  -9.616  1.00 0.00 ? 215 SER A H      1  
ATOM   15    H HA     . SER A 1 2   ? 2.024  -2.063  -9.198  1.00 0.00 ? 215 SER A HA     1  
ATOM   16    H HB2    . SER A 1 2   ? 2.950  -4.265  -8.849  1.00 0.00 ? 215 SER A HB2    1  
ATOM   17    H HB3    . SER A 1 2   ? 3.721  -3.596  -10.274 1.00 0.00 ? 215 SER A HB3    1  
ATOM   18    H HG     . SER A 1 2   ? 4.817  -3.793  -7.604  1.00 0.00 ? 215 SER A HG     1  
ATOM   19    N N      . GLN A 1 3   ? 2.206  -2.447  -6.629  1.00 0.00 ? 216 GLN A N      1  
ATOM   20    C CA     . GLN A 1 3   ? 2.163  -2.289  -5.185  1.00 0.00 ? 216 GLN A CA     1  
ATOM   21    C C      . GLN A 1 3   ? 2.147  -0.804  -4.814  1.00 0.00 ? 216 GLN A C      1  
ATOM   22    O O      . GLN A 1 3   ? 3.186  -0.147  -4.828  1.00 0.00 ? 216 GLN A O      1  
ATOM   23    C CB     . GLN A 1 3   ? 3.338  -3.007  -4.519  1.00 0.00 ? 216 GLN A CB     1  
ATOM   24    C CG     . GLN A 1 3   ? 3.184  -4.526  -4.625  1.00 0.00 ? 216 GLN A CG     1  
ATOM   25    C CD     . GLN A 1 3   ? 4.466  -5.239  -4.191  1.00 0.00 ? 216 GLN A CD     1  
ATOM   26    O OE1    . GLN A 1 3   ? 4.874  -5.195  -3.042  1.00 0.00 ? 216 GLN A OE1    1  
ATOM   27    N NE2    . GLN A 1 3   ? 5.078  -5.896  -5.173  1.00 0.00 ? 216 GLN A NE2    1  
ATOM   28    H H      . GLN A 1 3   ? 1.487  -3.027  -7.011  1.00 0.00 ? 216 GLN A H      1  
ATOM   29    H HA     . GLN A 1 3   ? 1.232  -2.759  -4.869  1.00 0.00 ? 216 GLN A HA     1  
ATOM   30    H HB2    . GLN A 1 3   ? 4.272  -2.699  -4.991  1.00 0.00 ? 216 GLN A HB2    1  
ATOM   31    H HB3    . GLN A 1 3   ? 3.401  -2.716  -3.471  1.00 0.00 ? 216 GLN A HB3    1  
ATOM   32    H HG2    . GLN A 1 3   ? 2.352  -4.854  -4.001  1.00 0.00 ? 216 GLN A HG2    1  
ATOM   33    H HG3    . GLN A 1 3   ? 2.941  -4.799  -5.651  1.00 0.00 ? 216 GLN A HG3    1  
ATOM   34    H HE21   . GLN A 1 3   ? 4.689  -5.893  -6.094  1.00 0.00 ? 216 GLN A HE21   1  
ATOM   35    H HE22   . GLN A 1 3   ? 5.924  -6.395  -4.988  1.00 0.00 ? 216 GLN A HE22   1  
ATOM   36    N N      . GLU A 1 4   ? 0.956  -0.320  -4.493  1.00 0.00 ? 217 GLU A N      1  
ATOM   37    C CA     . GLU A 1 4   ? 0.791  1.074   -4.119  1.00 0.00 ? 217 GLU A CA     1  
ATOM   38    C C      . GLU A 1 4   ? -0.361 1.223   -3.123  1.00 0.00 ? 217 GLU A C      1  
ATOM   39    O O      . GLU A 1 4   ? -1.345 1.905   -3.406  1.00 0.00 ? 217 GLU A O      1  
ATOM   40    C CB     . GLU A 1 4   ? 0.567  1.949   -5.353  1.00 0.00 ? 217 GLU A CB     1  
ATOM   41    C CG     . GLU A 1 4   ? 1.860  2.651   -5.771  1.00 0.00 ? 217 GLU A CG     1  
ATOM   42    C CD     . GLU A 1 4   ? 2.195  3.798   -4.815  1.00 0.00 ? 217 GLU A CD     1  
ATOM   43    O OE1    . GLU A 1 4   ? 2.949  3.602   -3.850  1.00 0.00 ? 217 GLU A OE1    1  
ATOM   44    O OE2    . GLU A 1 4   ? 1.642  4.928   -5.104  1.00 0.00 ? 217 GLU A OE2    1  
ATOM   45    H H      . GLU A 1 4   ? 0.115  -0.863  -4.484  1.00 0.00 ? 217 GLU A H      1  
ATOM   46    H HA     . GLU A 1 4   ? 1.730  1.360   -3.644  1.00 0.00 ? 217 GLU A HA     1  
ATOM   47    H HB2    . GLU A 1 4   ? 0.199  1.336   -6.176  1.00 0.00 ? 217 GLU A HB2    1  
ATOM   48    H HB3    . GLU A 1 4   ? -0.202 2.693   -5.142  1.00 0.00 ? 217 GLU A HB3    1  
ATOM   49    H HG2    . GLU A 1 4   ? 2.681  1.933   -5.783  1.00 0.00 ? 217 GLU A HG2    1  
ATOM   50    H HG3    . GLU A 1 4   ? 1.759  3.036   -6.785  1.00 0.00 ? 217 GLU A HG3    1  
ATOM   51    H HE2    . GLU A 1 4   ? 1.587  5.037   -6.096  1.00 0.00 ? 217 GLU A HE2    1  
ATOM   52    N N      . VAL A 1 5   ? -0.201 0.575   -1.979  1.00 0.00 ? 218 VAL A N      1  
ATOM   53    C CA     . VAL A 1 5   ? -1.215 0.628   -0.941  1.00 0.00 ? 218 VAL A CA     1  
ATOM   54    C C      . VAL A 1 5   ? -1.174 1.999   -0.263  1.00 0.00 ? 218 VAL A C      1  
ATOM   55    O O      . VAL A 1 5   ? -2.216 2.572   0.050   1.00 0.00 ? 218 VAL A O      1  
ATOM   56    C CB     . VAL A 1 5   ? -1.019 -0.530  0.041   1.00 0.00 ? 218 VAL A CB     1  
ATOM   57    C CG1    . VAL A 1 5   ? 0.251  -0.338  0.870   1.00 0.00 ? 218 VAL A CG1    1  
ATOM   58    C CG2    . VAL A 1 5   ? -2.244 -0.695  0.944   1.00 0.00 ? 218 VAL A CG2    1  
ATOM   59    H H      . VAL A 1 5   ? 0.603  0.023   -1.758  1.00 0.00 ? 218 VAL A H      1  
ATOM   60    H HA     . VAL A 1 5   ? -2.185 0.504   -1.421  1.00 0.00 ? 218 VAL A HA     1  
ATOM   61    H HB     . VAL A 1 5   ? -0.906 -1.445  -0.540  1.00 0.00 ? 218 VAL A HB     1  
ATOM   62    H HG11   . VAL A 1 5   ? 0.229  0.640   1.350   1.00 0.00 ? 218 VAL A HG11   1  
ATOM   63    H HG12   . VAL A 1 5   ? 0.309  -1.116  1.632   1.00 0.00 ? 218 VAL A HG12   1  
ATOM   64    H HG13   . VAL A 1 5   ? 1.123  -0.402  0.218   1.00 0.00 ? 218 VAL A HG13   1  
ATOM   65    H HG21   . VAL A 1 5   ? -2.608 0.287   1.246   1.00 0.00 ? 218 VAL A HG21   1  
ATOM   66    H HG22   . VAL A 1 5   ? -3.028 -1.222  0.400   1.00 0.00 ? 218 VAL A HG22   1  
ATOM   67    H HG23   . VAL A 1 5   ? -1.968 -1.268  1.829   1.00 0.00 ? 218 VAL A HG23   1  
ATOM   68    N N      . ARG A 1 6   ? 0.041  2.485   -0.054  1.00 0.00 ? 219 ARG A N      1  
ATOM   69    C CA     . ARG A 1 6   ? 0.232  3.778   0.581   1.00 0.00 ? 219 ARG A CA     1  
ATOM   70    C C      . ARG A 1 6   ? 1.722  4.122   0.646   1.00 0.00 ? 219 ARG A C      1  
ATOM   71    O O      . ARG A 1 6   ? 2.237  4.464   1.710   1.00 0.00 ? 219 ARG A O      1  
ATOM   72    C CB     . ARG A 1 6   ? -0.350 3.787   1.996   1.00 0.00 ? 219 ARG A CB     1  
ATOM   73    C CG     . ARG A 1 6   ? -0.850 5.182   2.373   1.00 0.00 ? 219 ARG A CG     1  
ATOM   74    C CD     . ARG A 1 6   ? -2.369 5.282   2.213   1.00 0.00 ? 219 ARG A CD     1  
ATOM   75    N NE     . ARG A 1 6   ? -2.912 6.291   3.149   1.00 0.00 ? 219 ARG A NE     1  
ATOM   76    C CZ     . ARG A 1 6   ? -4.198 6.356   3.522   1.00 0.00 ? 219 ARG A CZ     1  
ATOM   77    N NH1    . ARG A 1 6   ? -5.080 5.470   3.041   1.00 0.00 ? 219 ARG A NH1    1  
ATOM   78    N NH2    . ARG A 1 6   ? -4.600 7.307   4.376   1.00 0.00 ? 219 ARG A NH2    1  
ATOM   79    H H      . ARG A 1 6   ? 0.884  2.012   -0.311  1.00 0.00 ? 219 ARG A H      1  
ATOM   80    H HA     . ARG A 1 6   ? -0.306 4.482   -0.054  1.00 0.00 ? 219 ARG A HA     1  
ATOM   81    H HB2    . ARG A 1 6   ? -1.169 3.072   2.062   1.00 0.00 ? 219 ARG A HB2    1  
ATOM   82    H HB3    . ARG A 1 6   ? 0.411  3.465   2.707   1.00 0.00 ? 219 ARG A HB3    1  
ATOM   83    H HG2    . ARG A 1 6   ? -0.575 5.405   3.404   1.00 0.00 ? 219 ARG A HG2    1  
ATOM   84    H HG3    . ARG A 1 6   ? -0.365 5.930   1.745   1.00 0.00 ? 219 ARG A HG3    1  
ATOM   85    H HD2    . ARG A 1 6   ? -2.618 5.553   1.188   1.00 0.00 ? 219 ARG A HD2    1  
ATOM   86    H HD3    . ARG A 1 6   ? -2.827 4.311   2.407   1.00 0.00 ? 219 ARG A HD3    1  
ATOM   87    H HE     . ARG A 1 6   ? -2.280 6.968   3.527   1.00 0.00 ? 219 ARG A HE     1  
ATOM   88    H HH11   . ARG A 1 6   ? -4.779 4.761   2.403   1.00 0.00 ? 219 ARG A HH11   1  
ATOM   89    H HH12   . ARG A 1 6   ? -6.040 5.518   3.318   1.00 0.00 ? 219 ARG A HH12   1  
ATOM   90    H HH21   . ARG A 1 6   ? -3.942 7.968   4.735   1.00 0.00 ? 219 ARG A HH21   1  
ATOM   91    H HH22   . ARG A 1 6   ? -5.560 7.356   4.653   1.00 0.00 ? 219 ARG A HH22   1  
ATOM   92    N N      . ARG A 1 7   ? 2.371  4.022   -0.505  1.00 0.00 ? 220 ARG A N      1  
ATOM   93    C CA     . ARG A 1 7   ? 3.790  4.319   -0.592  1.00 0.00 ? 220 ARG A CA     1  
ATOM   94    C C      . ARG A 1 7   ? 4.531  3.730   0.611   1.00 0.00 ? 220 ARG A C      1  
ATOM   95    O O      . ARG A 1 7   ? 5.173  4.458   1.366   1.00 0.00 ? 220 ARG A O      1  
ATOM   96    C CB     . ARG A 1 7   ? 4.035  5.828   -0.644  1.00 0.00 ? 220 ARG A CB     1  
ATOM   97    C CG     . ARG A 1 7   ? 4.034  6.334   -2.088  1.00 0.00 ? 220 ARG A CG     1  
ATOM   98    C CD     . ARG A 1 7   ? 5.391  6.093   -2.752  1.00 0.00 ? 220 ARG A CD     1  
ATOM   99    N NE     . ARG A 1 7   ? 5.228  6.020   -4.222  1.00 0.00 ? 220 ARG A NE     1  
ATOM   100   C CZ     . ARG A 1 7   ? 5.019  7.084   -5.009  1.00 0.00 ? 220 ARG A CZ     1  
ATOM   101   N NH1    . ARG A 1 7   ? 4.947  8.310   -4.472  1.00 0.00 ? 220 ARG A NH1    1  
ATOM   102   N NH2    . ARG A 1 7   ? 4.883  6.922   -6.332  1.00 0.00 ? 220 ARG A NH2    1  
ATOM   103   H H      . ARG A 1 7   ? 1.943  3.744   -1.365  1.00 0.00 ? 220 ARG A H      1  
ATOM   104   H HA     . ARG A 1 7   ? 4.116  3.850   -1.521  1.00 0.00 ? 220 ARG A HA     1  
ATOM   105   H HB2    . ARG A 1 7   ? 3.263  6.345   -0.073  1.00 0.00 ? 220 ARG A HB2    1  
ATOM   106   H HB3    . ARG A 1 7   ? 4.990  6.062   -0.172  1.00 0.00 ? 220 ARG A HB3    1  
ATOM   107   H HG2    . ARG A 1 7   ? 3.252  5.828   -2.654  1.00 0.00 ? 220 ARG A HG2    1  
ATOM   108   H HG3    . ARG A 1 7   ? 3.801  7.398   -2.103  1.00 0.00 ? 220 ARG A HG3    1  
ATOM   109   H HD2    . ARG A 1 7   ? 6.080  6.898   -2.495  1.00 0.00 ? 220 ARG A HD2    1  
ATOM   110   H HD3    . ARG A 1 7   ? 5.830  5.168   -2.381  1.00 0.00 ? 220 ARG A HD3    1  
ATOM   111   H HE     . ARG A 1 7   ? 5.278  5.119   -4.654  1.00 0.00 ? 220 ARG A HE     1  
ATOM   112   H HH11   . ARG A 1 7   ? 5.047  8.431   -3.485  1.00 0.00 ? 220 ARG A HH11   1  
ATOM   113   H HH12   . ARG A 1 7   ? 4.790  9.104   -5.060  1.00 0.00 ? 220 ARG A HH12   1  
ATOM   114   H HH21   . ARG A 1 7   ? 4.938  6.007   -6.732  1.00 0.00 ? 220 ARG A HH21   1  
ATOM   115   H HH22   . ARG A 1 7   ? 4.727  7.716   -6.920  1.00 0.00 ? 220 ARG A HH22   1  
ATOM   116   N N      . GLY A 1 8   ? 4.415  2.418   0.753   1.00 0.00 ? 221 GLY A N      1  
ATOM   117   C CA     . GLY A 1 8   ? 5.065  1.724   1.851   1.00 0.00 ? 221 GLY A CA     1  
ATOM   118   C C      . GLY A 1 8   ? 6.561  1.552   1.581   1.00 0.00 ? 221 GLY A C      1  
ATOM   119   O O      . GLY A 1 8   ? 7.375  1.639   2.501   1.00 0.00 ? 221 GLY A O      1  
ATOM   120   H H      . GLY A 1 8   ? 3.889  1.833   0.134   1.00 0.00 ? 221 GLY A H      1  
ATOM   121   H HA2    . GLY A 1 8   ? 4.920  2.281   2.776   1.00 0.00 ? 221 GLY A HA2    1  
ATOM   122   H HA3    . GLY A 1 8   ? 4.603  0.746   1.992   1.00 0.00 ? 221 GLY A HA3    1  
ATOM   123   N N      . ASP A 1 9   ? 6.879  1.312   0.318   1.00 0.00 ? 222 ASP A N      1  
ATOM   124   C CA     . ASP A 1 9   ? 8.264  1.130   -0.083  1.00 0.00 ? 222 ASP A CA     1  
ATOM   125   C C      . ASP A 1 9   ? 8.996  2.470   -0.001  1.00 0.00 ? 222 ASP A C      1  
ATOM   126   O O      . ASP A 1 9   ? 10.146 2.528   0.431   1.00 0.00 ? 222 ASP A O      1  
ATOM   127   C CB     . ASP A 1 9   ? 8.357  0.626   -1.525  1.00 0.00 ? 222 ASP A CB     1  
ATOM   128   C CG     . ASP A 1 9   ? 9.189  -0.644  -1.715  1.00 0.00 ? 222 ASP A CG     1  
ATOM   129   O OD1    . ASP A 1 9   ? 10.404 -0.653  -1.472  1.00 0.00 ? 222 ASP A OD1    1  
ATOM   130   O OD2    . ASP A 1 9   ? 8.528  -1.670  -2.136  1.00 0.00 ? 222 ASP A OD2    1  
ATOM   131   H H      . ASP A 1 9   ? 6.212  1.244   -0.423  1.00 0.00 ? 222 ASP A H      1  
ATOM   132   H HA     . ASP A 1 9   ? 8.667  0.390   0.610   1.00 0.00 ? 222 ASP A HA     1  
ATOM   133   H HB2    . ASP A 1 9   ? 7.350  0.442   -1.895  1.00 0.00 ? 222 ASP A HB2    1  
ATOM   134   H HB3    . ASP A 1 9   ? 8.784  1.417   -2.142  1.00 0.00 ? 222 ASP A HB3    1  
ATOM   135   H HD2    . ASP A 1 9   ? 8.978  -2.511  -1.836  1.00 0.00 ? 222 ASP A HD2    1  
ATOM   136   N N      . PHE A 1 10  ? 8.301  3.515   -0.424  1.00 0.00 ? 223 PHE A N      1  
ATOM   137   C CA     . PHE A 1 10  ? 8.871  4.851   -0.404  1.00 0.00 ? 223 PHE A CA     1  
ATOM   138   C C      . PHE A 1 10  ? 9.075  5.339   1.031   1.00 0.00 ? 223 PHE A C      1  
ATOM   139   O O      . PHE A 1 10  ? 10.017 6.078   1.312   1.00 0.00 ? 223 PHE A O      1  
ATOM   140   C CB     . PHE A 1 10  ? 7.872  5.774   -1.107  1.00 0.00 ? 223 PHE A CB     1  
ATOM   141   C CG     . PHE A 1 10  ? 8.178  7.264   -0.940  1.00 0.00 ? 223 PHE A CG     1  
ATOM   142   C CD1    . PHE A 1 10  ? 7.805  7.911   0.196   1.00 0.00 ? 223 PHE A CD1    1  
ATOM   143   C CD2    . PHE A 1 10  ? 8.822  7.940   -1.928  1.00 0.00 ? 223 PHE A CD2    1  
ATOM   144   C CE1    . PHE A 1 10  ? 8.089  9.294   0.351   1.00 0.00 ? 223 PHE A CE1    1  
ATOM   145   C CE2    . PHE A 1 10  ? 9.106  9.323   -1.774  1.00 0.00 ? 223 PHE A CE2    1  
ATOM   146   C CZ     . PHE A 1 10  ? 8.733  9.970   -0.637  1.00 0.00 ? 223 PHE A CZ     1  
ATOM   147   H H      . PHE A 1 10  ? 7.366  3.459   -0.775  1.00 0.00 ? 223 PHE A H      1  
ATOM   148   H HA     . PHE A 1 10  ? 9.836  4.799   -0.909  1.00 0.00 ? 223 PHE A HA     1  
ATOM   149   H HB2    . PHE A 1 10  ? 7.857  5.534   -2.171  1.00 0.00 ? 223 PHE A HB2    1  
ATOM   150   H HB3    . PHE A 1 10  ? 6.873  5.573   -0.721  1.00 0.00 ? 223 PHE A HB3    1  
ATOM   151   H HD1    . PHE A 1 10  ? 7.289  7.369   0.988   1.00 0.00 ? 223 PHE A HD1    1  
ATOM   152   H HD2    . PHE A 1 10  ? 9.121  7.421   -2.839  1.00 0.00 ? 223 PHE A HD2    1  
ATOM   153   H HE1    . PHE A 1 10  ? 7.790  9.813   1.262   1.00 0.00 ? 223 PHE A HE1    1  
ATOM   154   H HE2    . PHE A 1 10  ? 9.622  9.866   -2.565  1.00 0.00 ? 223 PHE A HE2    1  
ATOM   155   H HZ     . PHE A 1 10  ? 8.951  11.032  -0.519  1.00 0.00 ? 223 PHE A HZ     1  
ATOM   156   N N      . VAL A 1 11  ? 8.175  4.907   1.903   1.00 0.00 ? 224 VAL A N      1  
ATOM   157   C CA     . VAL A 1 11  ? 8.243  5.290   3.302   1.00 0.00 ? 224 VAL A CA     1  
ATOM   158   C C      . VAL A 1 11  ? 9.400  4.548   3.974   1.00 0.00 ? 224 VAL A C      1  
ATOM   159   O O      . VAL A 1 11  ? 10.082 5.101   4.835   1.00 0.00 ? 224 VAL A O      1  
ATOM   160   C CB     . VAL A 1 11  ? 6.895  5.037   3.981   1.00 0.00 ? 224 VAL A CB     1  
ATOM   161   C CG1    . VAL A 1 11  ? 7.051  4.975   5.502   1.00 0.00 ? 224 VAL A CG1    1  
ATOM   162   C CG2    . VAL A 1 11  ? 5.870  6.099   3.578   1.00 0.00 ? 224 VAL A CG2    1  
ATOM   163   H H      . VAL A 1 11  ? 7.410  4.306   1.666   1.00 0.00 ? 224 VAL A H      1  
ATOM   164   H HA     . VAL A 1 11  ? 8.445  6.361   3.340   1.00 0.00 ? 224 VAL A HA     1  
ATOM   165   H HB     . VAL A 1 11  ? 6.526  4.069   3.643   1.00 0.00 ? 224 VAL A HB     1  
ATOM   166   H HG11   . VAL A 1 11  ? 7.647  4.103   5.772   1.00 0.00 ? 224 VAL A HG11   1  
ATOM   167   H HG12   . VAL A 1 11  ? 7.551  5.879   5.853   1.00 0.00 ? 224 VAL A HG12   1  
ATOM   168   H HG13   . VAL A 1 11  ? 6.067  4.901   5.965   1.00 0.00 ? 224 VAL A HG13   1  
ATOM   169   H HG21   . VAL A 1 11  ? 4.865  5.687   3.670   1.00 0.00 ? 224 VAL A HG21   1  
ATOM   170   H HG22   . VAL A 1 11  ? 5.969  6.966   4.231   1.00 0.00 ? 224 VAL A HG22   1  
ATOM   171   H HG23   . VAL A 1 11  ? 6.047  6.400   2.545   1.00 0.00 ? 224 VAL A HG23   1  
ATOM   172   N N      . ARG A 1 12  ? 9.585  3.304   3.554   1.00 0.00 ? 225 ARG A N      1  
ATOM   173   C CA     . ARG A 1 12  ? 10.648 2.479   4.104   1.00 0.00 ? 225 ARG A CA     1  
ATOM   174   C C      . ARG A 1 12  ? 12.013 2.991   3.639   1.00 0.00 ? 225 ARG A C      1  
ATOM   175   O O      . ARG A 1 12  ? 12.991 2.923   4.380   1.00 0.00 ? 225 ARG A O      1  
ATOM   176   C CB     . ARG A 1 12  ? 10.487 1.019   3.680   1.00 0.00 ? 225 ARG A CB     1  
ATOM   177   C CG     . ARG A 1 12  ? 10.465 0.093   4.897   1.00 0.00 ? 225 ARG A CG     1  
ATOM   178   C CD     . ARG A 1 12  ? 11.189 -1.223  4.599   1.00 0.00 ? 225 ARG A CD     1  
ATOM   179   N NE     . ARG A 1 12  ? 10.401 -2.027  3.640   1.00 0.00 ? 225 ARG A NE     1  
ATOM   180   C CZ     . ARG A 1 12  ? 10.688 -3.294  3.308   1.00 0.00 ? 225 ARG A CZ     1  
ATOM   181   N NH1    . ARG A 1 12  ? 11.746 -3.907  3.856   1.00 0.00 ? 225 ARG A NH1    1  
ATOM   182   N NH2    . ARG A 1 12  ? 9.916  -3.946  2.428   1.00 0.00 ? 225 ARG A NH2    1  
ATOM   183   H H      . ARG A 1 12  ? 9.026  2.861   2.854   1.00 0.00 ? 225 ARG A H      1  
ATOM   184   H HA     . ARG A 1 12  ? 10.542 2.573   5.185   1.00 0.00 ? 225 ARG A HA     1  
ATOM   185   H HB2    . ARG A 1 12  ? 9.564  0.901   3.112   1.00 0.00 ? 225 ARG A HB2    1  
ATOM   186   H HB3    . ARG A 1 12  ? 11.307 0.737   3.018   1.00 0.00 ? 225 ARG A HB3    1  
ATOM   187   H HG2    . ARG A 1 12  ? 10.939 0.589   5.744   1.00 0.00 ? 225 ARG A HG2    1  
ATOM   188   H HG3    . ARG A 1 12  ? 9.434  -0.112  5.184   1.00 0.00 ? 225 ARG A HG3    1  
ATOM   189   H HD2    . ARG A 1 12  ? 12.178 -1.017  4.188   1.00 0.00 ? 225 ARG A HD2    1  
ATOM   190   H HD3    . ARG A 1 12  ? 11.336 -1.783  5.522   1.00 0.00 ? 225 ARG A HD3    1  
ATOM   191   H HE     . ARG A 1 12  ? 9.604  -1.600  3.212   1.00 0.00 ? 225 ARG A HE     1  
ATOM   192   H HH11   . ARG A 1 12  ? 12.322 -3.419  4.512   1.00 0.00 ? 225 ARG A HH11   1  
ATOM   193   H HH12   . ARG A 1 12  ? 11.960 -4.851  3.608   1.00 0.00 ? 225 ARG A HH12   1  
ATOM   194   H HH21   . ARG A 1 12  ? 9.127  -3.490  2.018   1.00 0.00 ? 225 ARG A HH21   1  
ATOM   195   H HH22   . ARG A 1 12  ? 10.131 -4.892  2.180   1.00 0.00 ? 225 ARG A HH22   1  
ATOM   196   N N      . ASN A 1 13  ? 12.034 3.495   2.414   1.00 0.00 ? 226 ASN A N      1  
ATOM   197   C CA     . ASN A 1 13  ? 13.262 4.019   1.841   1.00 0.00 ? 226 ASN A CA     1  
ATOM   198   C C      . ASN A 1 13  ? 13.636 5.321   2.551   1.00 0.00 ? 226 ASN A C      1  
ATOM   199   O O      . ASN A 1 13  ? 14.815 5.650   2.674   1.00 0.00 ? 226 ASN A O      1  
ATOM   200   C CB     . ASN A 1 13  ? 13.089 4.325   0.352   1.00 0.00 ? 226 ASN A CB     1  
ATOM   201   C CG     . ASN A 1 13  ? 13.795 3.276   -0.510  1.00 0.00 ? 226 ASN A CG     1  
ATOM   202   O OD1    . ASN A 1 13  ? 14.928 2.894   -0.265  1.00 0.00 ? 226 ASN A OD1    1  
ATOM   203   N ND2    . ASN A 1 13  ? 13.064 2.831   -1.528  1.00 0.00 ? 226 ASN A ND2    1  
ATOM   204   H H      . ASN A 1 13  ? 11.233 3.547   1.817   1.00 0.00 ? 226 ASN A H      1  
ATOM   205   H HA     . ASN A 1 13  ? 14.005 3.235   1.990   1.00 0.00 ? 226 ASN A HA     1  
ATOM   206   H HB2    . ASN A 1 13  ? 12.027 4.350   0.103   1.00 0.00 ? 226 ASN A HB2    1  
ATOM   207   H HB3    . ASN A 1 13  ? 13.491 5.313   0.131   1.00 0.00 ? 226 ASN A HB3    1  
ATOM   208   H HD21   . ASN A 1 13  ? 12.140 3.186   -1.673  1.00 0.00 ? 226 ASN A HD21   1  
ATOM   209   H HD22   . ASN A 1 13  ? 13.440 2.144   -2.150  1.00 0.00 ? 226 ASN A HD22   1  
ATOM   210   N N      . TRP A 1 14  ? 12.610 6.030   2.999   1.00 0.00 ? 227 TRP A N      1  
ATOM   211   C CA     . TRP A 1 14  ? 12.815 7.289   3.694   1.00 0.00 ? 227 TRP A CA     1  
ATOM   212   C C      . TRP A 1 14  ? 13.563 6.994   4.996   1.00 0.00 ? 227 TRP A C      1  
ATOM   213   O O      . TRP A 1 14  ? 14.565 7.640   5.300   1.00 0.00 ? 227 TRP A O      1  
ATOM   214   C CB     . TRP A 1 14  ? 11.487 8.014   3.919   1.00 0.00 ? 227 TRP A CB     1  
ATOM   215   C CG     . TRP A 1 14  ? 11.337 9.303   3.108   1.00 0.00 ? 227 TRP A CG     1  
ATOM   216   C CD1    . TRP A 1 14  ? 10.250 9.752   2.466   1.00 0.00 ? 227 TRP A CD1    1  
ATOM   217   C CD2    . TRP A 1 14  ? 12.358 10.298  2.878   1.00 0.00 ? 227 TRP A CD2    1  
ATOM   218   N NE1    . TRP A 1 14  ? 10.494 10.959  1.841   1.00 0.00 ? 227 TRP A NE1    1  
ATOM   219   C CE2    . TRP A 1 14  ? 11.817 11.301  2.099   1.00 0.00 ? 227 TRP A CE2    1  
ATOM   220   C CE3    . TRP A 1 14  ? 13.694 10.348  3.312   1.00 0.00 ? 227 TRP A CE3    1  
ATOM   221   C CZ2    . TRP A 1 14  ? 12.540 12.426  1.689   1.00 0.00 ? 227 TRP A CZ2    1  
ATOM   222   C CZ3    . TRP A 1 14  ? 14.403 11.480  2.894   1.00 0.00 ? 227 TRP A CZ3    1  
ATOM   223   C CH2    . TRP A 1 14  ? 13.873 12.498  2.110   1.00 0.00 ? 227 TRP A CH2    1  
ATOM   224   H H      . TRP A 1 14  ? 11.653 5.756   2.896   1.00 0.00 ? 227 TRP A H      1  
ATOM   225   H HA     . TRP A 1 14  ? 13.421 7.928   3.052   1.00 0.00 ? 227 TRP A HA     1  
ATOM   226   H HB2    . TRP A 1 14  ? 10.670 7.341   3.665   1.00 0.00 ? 227 TRP A HB2    1  
ATOM   227   H HB3    . TRP A 1 14  ? 11.389 8.250   4.978   1.00 0.00 ? 227 TRP A HB3    1  
ATOM   228   H HD1    . TRP A 1 14  ? 9.293  9.231   2.440   1.00 0.00 ? 227 TRP A HD1    1  
ATOM   229   H HE1    . TRP A 1 14  ? 9.781  11.536  1.253   1.00 0.00 ? 227 TRP A HE1    1  
ATOM   230   H HE3    . TRP A 1 14  ? 14.145 9.569   3.927   1.00 0.00 ? 227 TRP A HE3    1  
ATOM   231   H HZ2    . TRP A 1 14  ? 12.089 13.205  1.074   1.00 0.00 ? 227 TRP A HZ2    1  
ATOM   232   H HZ3    . TRP A 1 14  ? 15.444 11.568  3.203   1.00 0.00 ? 227 TRP A HZ3    1  
ATOM   233   H HH2    . TRP A 1 14  ? 14.492 13.348  1.825   1.00 0.00 ? 227 TRP A HH2    1  
ATOM   234   N N      . GLN A 1 15  ? 13.049 6.018   5.729   1.00 0.00 ? 228 GLN A N      1  
ATOM   235   C CA     . GLN A 1 15  ? 13.655 5.631   6.991   1.00 0.00 ? 228 GLN A CA     1  
ATOM   236   C C      . GLN A 1 15  ? 15.016 4.974   6.746   1.00 0.00 ? 228 GLN A C      1  
ATOM   237   O O      . GLN A 1 15  ? 15.912 5.065   7.582   1.00 0.00 ? 228 GLN A O      1  
ATOM   238   C CB     . GLN A 1 15  ? 12.732 4.701   7.780   1.00 0.00 ? 228 GLN A CB     1  
ATOM   239   C CG     . GLN A 1 15  ? 12.638 3.326   7.114   1.00 0.00 ? 228 GLN A CG     1  
ATOM   240   C CD     . GLN A 1 15  ? 12.129 2.272   8.101   1.00 0.00 ? 228 GLN A CD     1  
ATOM   241   O OE1    . GLN A 1 15  ? 12.821 1.855   9.014   1.00 0.00 ? 228 GLN A OE1    1  
ATOM   242   N NE2    . GLN A 1 15  ? 10.884 1.868   7.866   1.00 0.00 ? 228 GLN A NE2    1  
ATOM   243   H H      . GLN A 1 15  ? 12.233 5.498   5.474   1.00 0.00 ? 228 GLN A H      1  
ATOM   244   H HA     . GLN A 1 15  ? 13.787 6.559   7.546   1.00 0.00 ? 228 GLN A HA     1  
ATOM   245   H HB2    . GLN A 1 15  ? 13.105 4.590   8.799   1.00 0.00 ? 228 GLN A HB2    1  
ATOM   246   H HB3    . GLN A 1 15  ? 11.738 5.143   7.851   1.00 0.00 ? 228 GLN A HB3    1  
ATOM   247   H HG2    . GLN A 1 15  ? 11.969 3.379   6.256   1.00 0.00 ? 228 GLN A HG2    1  
ATOM   248   H HG3    . GLN A 1 15  ? 13.618 3.033   6.737   1.00 0.00 ? 228 GLN A HG3    1  
ATOM   249   H HE21   . GLN A 1 15  ? 10.370 2.251   7.098   1.00 0.00 ? 228 GLN A HE21   1  
ATOM   250   H HE22   . GLN A 1 15  ? 10.462 1.180   8.456   1.00 0.00 ? 228 GLN A HE22   1  
ATOM   251   N N      . LEU A 1 16  ? 15.125 4.327   5.596   1.00 0.00 ? 229 LEU A N      1  
ATOM   252   C CA     . LEU A 1 16  ? 16.362 3.655   5.231   1.00 0.00 ? 229 LEU A CA     1  
ATOM   253   C C      . LEU A 1 16  ? 17.438 4.702   4.937   1.00 0.00 ? 229 LEU A C      1  
ATOM   254   O O      . LEU A 1 16  ? 18.600 4.522   5.300   1.00 0.00 ? 229 LEU A O      1  
ATOM   255   C CB     . LEU A 1 16  ? 16.121 2.681   4.075   1.00 0.00 ? 229 LEU A CB     1  
ATOM   256   C CG     . LEU A 1 16  ? 16.247 1.194   4.415   1.00 0.00 ? 229 LEU A CG     1  
ATOM   257   C CD1    . LEU A 1 16  ? 15.487 0.858   5.700   1.00 0.00 ? 229 LEU A CD1    1  
ATOM   258   C CD2    . LEU A 1 16  ? 15.800 0.323   3.239   1.00 0.00 ? 229 LEU A CD2    1  
ATOM   259   H H      . LEU A 1 16  ? 14.391 4.257   4.921   1.00 0.00 ? 229 LEU A H      1  
ATOM   260   H HA     . LEU A 1 16  ? 16.679 3.064   6.090   1.00 0.00 ? 229 LEU A HA     1  
ATOM   261   H HB2    . LEU A 1 16  ? 15.121 2.859   3.678   1.00 0.00 ? 229 LEU A HB2    1  
ATOM   262   H HB3    . LEU A 1 16  ? 16.826 2.912   3.277   1.00 0.00 ? 229 LEU A HB3    1  
ATOM   263   H HG     . LEU A 1 16  ? 17.299 0.974   4.596   1.00 0.00 ? 229 LEU A HG     1  
ATOM   264   H HD11   . LEU A 1 16  ? 16.168 0.396   6.414   1.00 0.00 ? 229 LEU A HD11   1  
ATOM   265   H HD12   . LEU A 1 16  ? 15.077 1.773   6.129   1.00 0.00 ? 229 LEU A HD12   1  
ATOM   266   H HD13   . LEU A 1 16  ? 14.676 0.168   5.471   1.00 0.00 ? 229 LEU A HD13   1  
ATOM   267   H HD21   . LEU A 1 16  ? 16.662 0.071   2.623   1.00 0.00 ? 229 LEU A HD21   1  
ATOM   268   H HD22   . LEU A 1 16  ? 15.345 -0.592  3.618   1.00 0.00 ? 229 LEU A HD22   1  
ATOM   269   H HD23   . LEU A 1 16  ? 15.071 0.869   2.639   1.00 0.00 ? 229 LEU A HD23   1  
ATOM   270   N N      . VAL A 1 17  ? 17.014 5.773   4.283   1.00 0.00 ? 230 VAL A N      1  
ATOM   271   C CA     . VAL A 1 17  ? 17.928 6.849   3.936   1.00 0.00 ? 230 VAL A CA     1  
ATOM   272   C C      . VAL A 1 17  ? 18.304 7.620   5.204   1.00 0.00 ? 230 VAL A C      1  
ATOM   273   O O      . VAL A 1 17  ? 19.374 8.222   5.273   1.00 0.00 ? 230 VAL A O      1  
ATOM   274   C CB     . VAL A 1 17  ? 17.304 7.738   2.859   1.00 0.00 ? 230 VAL A CB     1  
ATOM   275   C CG1    . VAL A 1 17  ? 18.001 9.099   2.801   1.00 0.00 ? 230 VAL A CG1    1  
ATOM   276   C CG2    . VAL A 1 17  ? 17.334 7.047   1.494   1.00 0.00 ? 230 VAL A CG2    1  
ATOM   277   H H      . VAL A 1 17  ? 16.067 5.912   3.991   1.00 0.00 ? 230 VAL A H      1  
ATOM   278   H HA     . VAL A 1 17  ? 18.828 6.396   3.522   1.00 0.00 ? 230 VAL A HA     1  
ATOM   279   H HB     . VAL A 1 17  ? 16.261 7.907   3.125   1.00 0.00 ? 230 VAL A HB     1  
ATOM   280   H HG11   . VAL A 1 17  ? 19.022 9.001   3.171   1.00 0.00 ? 230 VAL A HG11   1  
ATOM   281   H HG12   . VAL A 1 17  ? 18.021 9.453   1.769   1.00 0.00 ? 230 VAL A HG12   1  
ATOM   282   H HG13   . VAL A 1 17  ? 17.457 9.812   3.420   1.00 0.00 ? 230 VAL A HG13   1  
ATOM   283   H HG21   . VAL A 1 17  ? 16.743 6.132   1.536   1.00 0.00 ? 230 VAL A HG21   1  
ATOM   284   H HG22   . VAL A 1 17  ? 16.917 7.715   0.740   1.00 0.00 ? 230 VAL A HG22   1  
ATOM   285   H HG23   . VAL A 1 17  ? 18.364 6.804   1.233   1.00 0.00 ? 230 VAL A HG23   1  
ATOM   286   N N      . ALA A 1 18  ? 17.403 7.576   6.174   1.00 0.00 ? 231 ALA A N      1  
ATOM   287   C CA     . ALA A 1 18  ? 17.627 8.262   7.435   1.00 0.00 ? 231 ALA A CA     1  
ATOM   288   C C      . ALA A 1 18  ? 18.753 7.563   8.198   1.00 0.00 ? 231 ALA A C      1  
ATOM   289   O O      . ALA A 1 18  ? 19.399 8.170   9.052   1.00 0.00 ? 231 ALA A O      1  
ATOM   290   C CB     . ALA A 1 18  ? 16.322 8.307   8.232   1.00 0.00 ? 231 ALA A CB     1  
ATOM   291   H H      . ALA A 1 18  ? 16.535 7.084   6.110   1.00 0.00 ? 231 ALA A H      1  
ATOM   292   H HA     . ALA A 1 18  ? 17.933 9.284   7.207   1.00 0.00 ? 231 ALA A HA     1  
ATOM   293   H HB1    . ALA A 1 18  ? 16.501 8.781   9.197   1.00 0.00 ? 231 ALA A HB1    1  
ATOM   294   H HB2    . ALA A 1 18  ? 15.577 8.880   7.678   1.00 0.00 ? 231 ALA A HB2    1  
ATOM   295   H HB3    . ALA A 1 18  ? 15.958 7.292   8.388   1.00 0.00 ? 231 ALA A HB3    1  
ATOM   296   N N      . ALA A 1 19  ? 18.954 6.297   7.864   1.00 0.00 ? 232 ALA A N      1  
ATOM   297   C CA     . ALA A 1 19  ? 19.992 5.509   8.508   1.00 0.00 ? 232 ALA A CA     1  
ATOM   298   C C      . ALA A 1 19  ? 21.351 5.880   7.912   1.00 0.00 ? 232 ALA A C      1  
ATOM   299   O O      . ALA A 1 19  ? 22.392 5.504   8.451   1.00 0.00 ? 232 ALA A O      1  
ATOM   300   C CB     . ALA A 1 19  ? 19.673 4.021   8.352   1.00 0.00 ? 232 ALA A CB     1  
ATOM   301   H H      . ALA A 1 19  ? 18.424 5.812   7.169   1.00 0.00 ? 232 ALA A H      1  
ATOM   302   H HA     . ALA A 1 19  ? 19.988 5.760   9.569   1.00 0.00 ? 232 ALA A HA     1  
ATOM   303   H HB1    . ALA A 1 19  ? 20.323 3.587   7.593   1.00 0.00 ? 232 ALA A HB1    1  
ATOM   304   H HB2    . ALA A 1 19  ? 19.835 3.513   9.303   1.00 0.00 ? 232 ALA A HB2    1  
ATOM   305   H HB3    . ALA A 1 19  ? 18.632 3.902   8.049   1.00 0.00 ? 232 ALA A HB3    1  
ATOM   306   N N      . VAL A 1 20  ? 21.298 6.612   6.809   1.00 0.00 ? 233 VAL A N      1  
ATOM   307   C CA     . VAL A 1 20  ? 22.513 7.037   6.134   1.00 0.00 ? 233 VAL A CA     1  
ATOM   308   C C      . VAL A 1 20  ? 22.592 8.565   6.151   1.00 0.00 ? 233 VAL A C      1  
ATOM   309   O O      . VAL A 1 20  ? 21.765 9.239   5.538   1.00 0.00 ? 233 VAL A O      1  
ATOM   310   C CB     . VAL A 1 20  ? 22.560 6.450   4.722   1.00 0.00 ? 233 VAL A CB     1  
ATOM   311   C CG1    . VAL A 1 20  ? 23.925 6.694   4.073   1.00 0.00 ? 233 VAL A CG1    1  
ATOM   312   C CG2    . VAL A 1 20  ? 22.217 4.960   4.736   1.00 0.00 ? 233 VAL A CG2    1  
ATOM   313   H H      . VAL A 1 20  ? 20.448 6.913   6.377   1.00 0.00 ? 233 VAL A H      1  
ATOM   314   H HA     . VAL A 1 20  ? 23.358 6.637   6.695   1.00 0.00 ? 233 VAL A HA     1  
ATOM   315   H HB     . VAL A 1 20  ? 21.808 6.961   4.122   1.00 0.00 ? 233 VAL A HB     1  
ATOM   316   H HG11   . VAL A 1 20  ? 24.615 7.091   4.817   1.00 0.00 ? 233 VAL A HG11   1  
ATOM   317   H HG12   . VAL A 1 20  ? 24.313 5.753   3.682   1.00 0.00 ? 233 VAL A HG12   1  
ATOM   318   H HG13   . VAL A 1 20  ? 23.817 7.409   3.258   1.00 0.00 ? 233 VAL A HG13   1  
ATOM   319   H HG21   . VAL A 1 20  ? 21.167 4.826   4.476   1.00 0.00 ? 233 VAL A HG21   1  
ATOM   320   H HG22   . VAL A 1 20  ? 22.840 4.436   4.011   1.00 0.00 ? 233 VAL A HG22   1  
ATOM   321   H HG23   . VAL A 1 20  ? 22.400 4.553   5.731   1.00 0.00 ? 233 VAL A HG23   1  
ATOM   322   N N      . PRO A 1 21  ? 23.621 9.080   6.875   1.00 0.00 ? 234 PRO A N      1  
ATOM   323   C CA     . PRO A 1 21  ? 23.818 10.516  6.979   1.00 0.00 ? 234 PRO A CA     1  
ATOM   324   C C      . PRO A 1 21  ? 24.401 11.084  5.684   1.00 0.00 ? 234 PRO A C      1  
ATOM   325   O O      . PRO A 1 21  ? 24.243 12.269  5.395   1.00 0.00 ? 234 PRO A O      1  
ATOM   326   C CB     . PRO A 1 21  ? 24.736 10.702  8.176   1.00 0.00 ? 234 PRO A CB     1  
ATOM   327   C CG     . PRO A 1 21  ? 25.390 9.350   8.413   1.00 0.00 ? 234 PRO A CG     1  
ATOM   328   C CD     . PRO A 1 21  ? 24.619 8.312   7.613   1.00 0.00 ? 234 PRO A CD     1  
ATOM   329   H HA     . PRO A 1 21  ? 22.940 10.978  7.110   1.00 0.00 ? 234 PRO A HA     1  
ATOM   330   H HB2    . PRO A 1 21  ? 25.485 11.469  7.978   1.00 0.00 ? 234 PRO A HB2    1  
ATOM   331   H HB3    . PRO A 1 21  ? 24.175 11.023  9.053   1.00 0.00 ? 234 PRO A HB3    1  
ATOM   332   H HG2    . PRO A 1 21  ? 26.435 9.372   8.102   1.00 0.00 ? 234 PRO A HG2    1  
ATOM   333   H HG3    . PRO A 1 21  ? 25.378 9.101   9.474   1.00 0.00 ? 234 PRO A HG3    1  
ATOM   334   H HD2    . PRO A 1 21  ? 25.275 7.764   6.938   1.00 0.00 ? 234 PRO A HD2    1  
ATOM   335   H HD3    . PRO A 1 21  ? 24.149 7.577   8.268   1.00 0.00 ? 234 PRO A HD3    1  
ATOM   336   N N      . LEU A 1 22  ? 25.062 10.211  4.937   1.00 0.00 ? 235 LEU A N      1  
ATOM   337   C CA     . LEU A 1 22  ? 25.670 10.611  3.680   1.00 0.00 ? 235 LEU A CA     1  
ATOM   338   C C      . LEU A 1 22  ? 24.599 11.221  2.772   1.00 0.00 ? 235 LEU A C      1  
ATOM   339   O O      . LEU A 1 22  ? 24.869 12.175  2.044   1.00 0.00 ? 235 LEU A O      1  
ATOM   340   C CB     . LEU A 1 22  ? 26.415 9.434   3.046   1.00 0.00 ? 235 LEU A CB     1  
ATOM   341   C CG     . LEU A 1 22  ? 26.692 9.545   1.546   1.00 0.00 ? 235 LEU A CG     1  
ATOM   342   C CD1    . LEU A 1 22  ? 28.195 9.608   1.270   1.00 0.00 ? 235 LEU A CD1    1  
ATOM   343   C CD2    . LEU A 1 22  ? 26.015 8.408   0.778   1.00 0.00 ? 235 LEU A CD2    1  
ATOM   344   H H      . LEU A 1 22  ? 25.186 9.249   5.180   1.00 0.00 ? 235 LEU A H      1  
ATOM   345   H HA     . LEU A 1 22  ? 26.411 11.378  3.904   1.00 0.00 ? 235 LEU A HA     1  
ATOM   346   H HB2    . LEU A 1 22  ? 27.366 9.311   3.564   1.00 0.00 ? 235 LEU A HB2    1  
ATOM   347   H HB3    . LEU A 1 22  ? 25.837 8.527   3.222   1.00 0.00 ? 235 LEU A HB3    1  
ATOM   348   H HG     . LEU A 1 22  ? 26.260 10.479  1.187   1.00 0.00 ? 235 LEU A HG     1  
ATOM   349   H HD11   . LEU A 1 22  ? 28.673 8.706   1.654   1.00 0.00 ? 235 LEU A HD11   1  
ATOM   350   H HD12   . LEU A 1 22  ? 28.365 9.679   0.195   1.00 0.00 ? 235 LEU A HD12   1  
ATOM   351   H HD13   . LEU A 1 22  ? 28.619 10.482  1.763   1.00 0.00 ? 235 LEU A HD13   1  
ATOM   352   H HD21   . LEU A 1 22  ? 26.040 7.499   1.378   1.00 0.00 ? 235 LEU A HD21   1  
ATOM   353   H HD22   . LEU A 1 22  ? 24.979 8.678   0.568   1.00 0.00 ? 235 LEU A HD22   1  
ATOM   354   H HD23   . LEU A 1 22  ? 26.544 8.240   -0.161  1.00 0.00 ? 235 LEU A HD23   1  
ATOM   355   N N      . PHE A 1 23  ? 23.408 10.646  2.847   1.00 0.00 ? 236 PHE A N      1  
ATOM   356   C CA     . PHE A 1 23  ? 22.296 11.121  2.041   1.00 0.00 ? 236 PHE A CA     1  
ATOM   357   C C      . PHE A 1 23  ? 21.639 12.346  2.682   1.00 0.00 ? 236 PHE A C      1  
ATOM   358   O O      . PHE A 1 23  ? 20.855 13.042  2.039   1.00 0.00 ? 236 PHE A O      1  
ATOM   359   C CB     . PHE A 1 23  ? 21.274 9.985   1.974   1.00 0.00 ? 236 PHE A CB     1  
ATOM   360   C CG     . PHE A 1 23  ? 21.786 8.729   1.267   1.00 0.00 ? 236 PHE A CG     1  
ATOM   361   C CD1    . PHE A 1 23  ? 22.644 8.842   0.218   1.00 0.00 ? 236 PHE A CD1    1  
ATOM   362   C CD2    . PHE A 1 23  ? 21.384 7.500   1.688   1.00 0.00 ? 236 PHE A CD2    1  
ATOM   363   C CE1    . PHE A 1 23  ? 23.119 7.675   -0.439  1.00 0.00 ? 236 PHE A CE1    1  
ATOM   364   C CE2    . PHE A 1 23  ? 21.859 6.333   1.031   1.00 0.00 ? 236 PHE A CE2    1  
ATOM   365   C CZ     . PHE A 1 23  ? 22.716 6.446   -0.018  1.00 0.00 ? 236 PHE A CZ     1  
ATOM   366   H H      . PHE A 1 23  ? 23.198 9.871   3.442   1.00 0.00 ? 236 PHE A H      1  
ATOM   367   H HA     . PHE A 1 23  ? 22.698 11.396  1.066   1.00 0.00 ? 236 PHE A HA     1  
ATOM   368   H HB2    . PHE A 1 23  ? 20.972 9.722   2.988   1.00 0.00 ? 236 PHE A HB2    1  
ATOM   369   H HB3    . PHE A 1 23  ? 20.383 10.342  1.459   1.00 0.00 ? 236 PHE A HB3    1  
ATOM   370   H HD1    . PHE A 1 23  ? 22.967 9.826   -0.120  1.00 0.00 ? 236 PHE A HD1    1  
ATOM   371   H HD2    . PHE A 1 23  ? 20.696 7.409   2.529   1.00 0.00 ? 236 PHE A HD2    1  
ATOM   372   H HE1    . PHE A 1 23  ? 23.807 7.765   -1.280  1.00 0.00 ? 236 PHE A HE1    1  
ATOM   373   H HE2    . PHE A 1 23  ? 21.536 5.349   1.368   1.00 0.00 ? 236 PHE A HE2    1  
ATOM   374   H HZ     . PHE A 1 23  ? 23.082 5.551   -0.522  1.00 0.00 ? 236 PHE A HZ     1  
ATOM   375   N N      . GLN A 1 24  ? 21.982 12.570  3.943   1.00 0.00 ? 237 GLN A N      1  
ATOM   376   C CA     . GLN A 1 24  ? 21.435 13.698  4.676   1.00 0.00 ? 237 GLN A CA     1  
ATOM   377   C C      . GLN A 1 24  ? 22.129 14.994  4.253   1.00 0.00 ? 237 GLN A C      1  
ATOM   378   O O      . GLN A 1 24  ? 21.624 16.086  4.513   1.00 0.00 ? 237 GLN A O      1  
ATOM   379   C CB     . GLN A 1 24  ? 21.555 13.480  6.187   1.00 0.00 ? 237 GLN A CB     1  
ATOM   380   C CG     . GLN A 1 24  ? 20.665 12.324  6.646   1.00 0.00 ? 237 GLN A CG     1  
ATOM   381   C CD     . GLN A 1 24  ? 19.186 12.647  6.417   1.00 0.00 ? 237 GLN A CD     1  
ATOM   382   O OE1    . GLN A 1 24  ? 18.633 13.577  6.978   1.00 0.00 ? 237 GLN A OE1    1  
ATOM   383   N NE2    . GLN A 1 24  ? 18.580 11.827  5.562   1.00 0.00 ? 237 GLN A NE2    1  
ATOM   384   H H      . GLN A 1 24  ? 22.620 11.999  4.458   1.00 0.00 ? 237 GLN A H      1  
ATOM   385   H HA     . GLN A 1 24  ? 20.380 13.737  4.404   1.00 0.00 ? 237 GLN A HA     1  
ATOM   386   H HB2    . GLN A 1 24  ? 22.593 13.268  6.445   1.00 0.00 ? 237 GLN A HB2    1  
ATOM   387   H HB3    . GLN A 1 24  ? 21.275 14.391  6.714   1.00 0.00 ? 237 GLN A HB3    1  
ATOM   388   H HG2    . GLN A 1 24  ? 20.931 11.417  6.103   1.00 0.00 ? 237 GLN A HG2    1  
ATOM   389   H HG3    . GLN A 1 24  ? 20.837 12.125  7.704   1.00 0.00 ? 237 GLN A HG3    1  
ATOM   390   H HE21   . GLN A 1 24  ? 19.092 11.082  5.135   1.00 0.00 ? 237 GLN A HE21   1  
ATOM   391   H HE22   . GLN A 1 24  ? 17.612 11.956  5.346   1.00 0.00 ? 237 GLN A HE22   1  
ATOM   392   N N      . LYS A 1 25  ? 23.274 14.832  3.609   1.00 0.00 ? 238 LYS A N      1  
ATOM   393   C CA     . LYS A 1 25  ? 24.043 15.975  3.147   1.00 0.00 ? 238 LYS A CA     1  
ATOM   394   C C      . LYS A 1 25  ? 23.427 16.508  1.852   1.00 0.00 ? 238 LYS A C      1  
ATOM   395   O O      . LYS A 1 25  ? 23.933 17.465  1.268   1.00 0.00 ? 238 LYS A O      1  
ATOM   396   C CB     . LYS A 1 25  ? 25.523 15.611  3.020   1.00 0.00 ? 238 LYS A CB     1  
ATOM   397   C CG     . LYS A 1 25  ? 26.201 15.580  4.392   1.00 0.00 ? 238 LYS A CG     1  
ATOM   398   C CD     . LYS A 1 25  ? 27.088 14.342  4.537   1.00 0.00 ? 238 LYS A CD     1  
ATOM   399   C CE     . LYS A 1 25  ? 27.923 14.414  5.818   1.00 0.00 ? 238 LYS A CE     1  
ATOM   400   N NZ     . LYS A 1 25  ? 28.475 13.082  6.152   1.00 0.00 ? 238 LYS A NZ     1  
ATOM   401   H H      . LYS A 1 25  ? 23.678 13.941  3.402   1.00 0.00 ? 238 LYS A H      1  
ATOM   402   H HA     . LYS A 1 25  ? 23.966 16.750  3.911   1.00 0.00 ? 238 LYS A HA     1  
ATOM   403   H HB2    . LYS A 1 25  ? 25.622 14.637  2.540   1.00 0.00 ? 238 LYS A HB2    1  
ATOM   404   H HB3    . LYS A 1 25  ? 26.026 16.334  2.378   1.00 0.00 ? 238 LYS A HB3    1  
ATOM   405   H HG2    . LYS A 1 25  ? 26.800 16.480  4.525   1.00 0.00 ? 238 LYS A HG2    1  
ATOM   406   H HG3    . LYS A 1 25  ? 25.443 15.582  5.176   1.00 0.00 ? 238 LYS A HG3    1  
ATOM   407   H HD2    . LYS A 1 25  ? 26.469 13.445  4.552   1.00 0.00 ? 238 LYS A HD2    1  
ATOM   408   H HD3    . LYS A 1 25  ? 27.748 14.260  3.673   1.00 0.00 ? 238 LYS A HD3    1  
ATOM   409   H HE2    . LYS A 1 25  ? 28.735 15.130  5.690   1.00 0.00 ? 238 LYS A HE2    1  
ATOM   410   H HE3    . LYS A 1 25  ? 27.306 14.775  6.641   1.00 0.00 ? 238 LYS A HE3    1  
ATOM   411   H HZ1    . LYS A 1 25  ? 28.961 13.132  7.024   1.00 0.00 ? 238 LYS A HZ1    1  
ATOM   412   H HZ2    . LYS A 1 25  ? 27.730 12.420  6.223   1.00 0.00 ? 238 LYS A HZ2    1  
ATOM   413   H HZ3    . LYS A 1 25  ? 29.109 12.795  5.433   1.00 0.00 ? 238 LYS A HZ3    1  
ATOM   414   N N      . LEU A 1 26  ? 22.345 15.864  1.440   1.00 0.00 ? 239 LEU A N      1  
ATOM   415   C CA     . LEU A 1 26  ? 21.655 16.262  0.225   1.00 0.00 ? 239 LEU A CA     1  
ATOM   416   C C      . LEU A 1 26  ? 20.445 17.125  0.588   1.00 0.00 ? 239 LEU A C      1  
ATOM   417   O O      . LEU A 1 26  ? 19.780 16.876  1.592   1.00 0.00 ? 239 LEU A O      1  
ATOM   418   C CB     . LEU A 1 26  ? 21.303 15.034  -0.617  1.00 0.00 ? 239 LEU A CB     1  
ATOM   419   C CG     . LEU A 1 26  ? 22.487 14.216  -1.138  1.00 0.00 ? 239 LEU A CG     1  
ATOM   420   C CD1    . LEU A 1 26  ? 22.101 12.747  -1.321  1.00 0.00 ? 239 LEU A CD1    1  
ATOM   421   C CD2    . LEU A 1 26  ? 23.050 14.825  -2.424  1.00 0.00 ? 239 LEU A CD2    1  
ATOM   422   H H      . LEU A 1 26  ? 21.940 15.087  1.920   1.00 0.00 ? 239 LEU A H      1  
ATOM   423   H HA     . LEU A 1 26  ? 22.347 16.867  -0.361  1.00 0.00 ? 239 LEU A HA     1  
ATOM   424   H HB2    . LEU A 1 26  ? 20.669 14.379  -0.021  1.00 0.00 ? 239 LEU A HB2    1  
ATOM   425   H HB3    . LEU A 1 26  ? 20.710 15.361  -1.471  1.00 0.00 ? 239 LEU A HB3    1  
ATOM   426   H HG     . LEU A 1 26  ? 23.280 14.250  -0.392  1.00 0.00 ? 239 LEU A HG     1  
ATOM   427   H HD11   . LEU A 1 26  ? 21.102 12.581  -0.916  1.00 0.00 ? 239 LEU A HD11   1  
ATOM   428   H HD12   . LEU A 1 26  ? 22.109 12.498  -2.382  1.00 0.00 ? 239 LEU A HD12   1  
ATOM   429   H HD13   . LEU A 1 26  ? 22.816 12.115  -0.793  1.00 0.00 ? 239 LEU A HD13   1  
ATOM   430   H HD21   . LEU A 1 26  ? 24.022 14.380  -2.641  1.00 0.00 ? 239 LEU A HD21   1  
ATOM   431   H HD22   . LEU A 1 26  ? 22.367 14.626  -3.249  1.00 0.00 ? 239 LEU A HD22   1  
ATOM   432   H HD23   . LEU A 1 26  ? 23.164 15.901  -2.297  1.00 0.00 ? 239 LEU A HD23   1  
ATOM   433   N N      . GLY A 1 27  ? 20.197 18.122  -0.248  1.00 0.00 ? 240 GLY A N      1  
ATOM   434   C CA     . GLY A 1 27  ? 19.079 19.024  -0.027  1.00 0.00 ? 240 GLY A CA     1  
ATOM   435   C C      . GLY A 1 27  ? 17.768 18.247  0.112   1.00 0.00 ? 240 GLY A C      1  
ATOM   436   O O      . GLY A 1 27  ? 17.767 17.017  0.105   1.00 0.00 ? 240 GLY A O      1  
ATOM   437   H H      . GLY A 1 27  ? 20.744 18.318  -1.062  1.00 0.00 ? 240 GLY A H      1  
ATOM   438   H HA2    . GLY A 1 27  ? 19.255 19.612  0.874   1.00 0.00 ? 240 GLY A HA2    1  
ATOM   439   H HA3    . GLY A 1 27  ? 19.004 19.726  -0.857  1.00 0.00 ? 240 GLY A HA3    1  
ATOM   440   N N      . PRO A 1 28  ? 16.655 19.018  0.240   1.00 0.00 ? 241 PRO A N      1  
ATOM   441   C CA     . PRO A 1 28  ? 15.340 18.416  0.381   1.00 0.00 ? 241 PRO A CA     1  
ATOM   442   C C      . PRO A 1 28  ? 14.845 17.861  -0.956  1.00 0.00 ? 241 PRO A C      1  
ATOM   443   O O      . PRO A 1 28  ? 14.279 16.770  -1.009  1.00 0.00 ? 241 PRO A O      1  
ATOM   444   C CB     . PRO A 1 28  ? 14.456 19.525  0.927   1.00 0.00 ? 241 PRO A CB     1  
ATOM   445   C CG     . PRO A 1 28  ? 15.189 20.824  0.635   1.00 0.00 ? 241 PRO A CG     1  
ATOM   446   C CD     . PRO A 1 28  ? 16.618 20.478  0.253   1.00 0.00 ? 241 PRO A CD     1  
ATOM   447   H HA     . PRO A 1 28  ? 15.381 17.634  1.003   1.00 0.00 ? 241 PRO A HA     1  
ATOM   448   H HB2    . PRO A 1 28  ? 13.475 19.513  0.450   1.00 0.00 ? 241 PRO A HB2    1  
ATOM   449   H HB3    . PRO A 1 28  ? 14.291 19.402  1.997   1.00 0.00 ? 241 PRO A HB3    1  
ATOM   450   H HG2    . PRO A 1 28  ? 14.698 21.365  -0.174  1.00 0.00 ? 241 PRO A HG2    1  
ATOM   451   H HG3    . PRO A 1 28  ? 15.174 21.475  1.508   1.00 0.00 ? 241 PRO A HG3    1  
ATOM   452   H HD2    . PRO A 1 28  ? 16.878 20.889  -0.722  1.00 0.00 ? 241 PRO A HD2    1  
ATOM   453   H HD3    . PRO A 1 28  ? 17.330 20.885  0.971   1.00 0.00 ? 241 PRO A HD3    1  
ATOM   454   N N      . ALA A 1 29  ? 15.077 18.637  -2.005  1.00 0.00 ? 242 ALA A N      1  
ATOM   455   C CA     . ALA A 1 29  ? 14.662 18.236  -3.339  1.00 0.00 ? 242 ALA A CA     1  
ATOM   456   C C      . ALA A 1 29  ? 15.657 17.214  -3.892  1.00 0.00 ? 242 ALA A C      1  
ATOM   457   O O      . ALA A 1 29  ? 15.306 16.403  -4.748  1.00 0.00 ? 242 ALA A O      1  
ATOM   458   C CB     . ALA A 1 29  ? 14.543 19.475  -4.230  1.00 0.00 ? 242 ALA A CB     1  
ATOM   459   H H      . ALA A 1 29  ? 15.538 19.523  -1.954  1.00 0.00 ? 242 ALA A H      1  
ATOM   460   H HA     . ALA A 1 29  ? 13.681 17.768  -3.255  1.00 0.00 ? 242 ALA A HA     1  
ATOM   461   H HB1    . ALA A 1 29  ? 14.156 19.183  -5.207  1.00 0.00 ? 242 ALA A HB1    1  
ATOM   462   H HB2    . ALA A 1 29  ? 13.863 20.190  -3.768  1.00 0.00 ? 242 ALA A HB2    1  
ATOM   463   H HB3    . ALA A 1 29  ? 15.524 19.932  -4.350  1.00 0.00 ? 242 ALA A HB3    1  
ATOM   464   N N      . VAL A 1 30  ? 16.876 17.284  -3.381  1.00 0.00 ? 243 VAL A N      1  
ATOM   465   C CA     . VAL A 1 30  ? 17.924 16.375  -3.812  1.00 0.00 ? 243 VAL A CA     1  
ATOM   466   C C      . VAL A 1 30  ? 17.722 15.016  -3.139  1.00 0.00 ? 243 VAL A C      1  
ATOM   467   O O      . VAL A 1 30  ? 17.748 13.980  -3.803  1.00 0.00 ? 243 VAL A O      1  
ATOM   468   C CB     . VAL A 1 30  ? 19.297 16.985  -3.528  1.00 0.00 ? 243 VAL A CB     1  
ATOM   469   C CG1    . VAL A 1 30  ? 20.412 16.141  -4.149  1.00 0.00 ? 243 VAL A CG1    1  
ATOM   470   C CG2    . VAL A 1 30  ? 19.367 18.433  -4.021  1.00 0.00 ? 243 VAL A CG2    1  
ATOM   471   H H      . VAL A 1 30  ? 17.153 17.947  -2.684  1.00 0.00 ? 243 VAL A H      1  
ATOM   472   H HA     . VAL A 1 30  ? 17.826 16.251  -4.890  1.00 0.00 ? 243 VAL A HA     1  
ATOM   473   H HB     . VAL A 1 30  ? 19.444 16.993  -2.448  1.00 0.00 ? 243 VAL A HB     1  
ATOM   474   H HG11   . VAL A 1 30  ? 21.343 16.318  -3.612  1.00 0.00 ? 243 VAL A HG11   1  
ATOM   475   H HG12   . VAL A 1 30  ? 20.149 15.086  -4.081  1.00 0.00 ? 243 VAL A HG12   1  
ATOM   476   H HG13   . VAL A 1 30  ? 20.537 16.418  -5.195  1.00 0.00 ? 243 VAL A HG13   1  
ATOM   477   H HG21   . VAL A 1 30  ? 20.172 18.954  -3.502  1.00 0.00 ? 243 VAL A HG21   1  
ATOM   478   H HG22   . VAL A 1 30  ? 19.559 18.443  -5.094  1.00 0.00 ? 243 VAL A HG22   1  
ATOM   479   H HG23   . VAL A 1 30  ? 18.420 18.932  -3.816  1.00 0.00 ? 243 VAL A HG23   1  
ATOM   480   N N      . LEU A 1 31  ? 17.527 15.063  -1.830  1.00 0.00 ? 244 LEU A N      1  
ATOM   481   C CA     . LEU A 1 31  ? 17.321 13.848  -1.059  1.00 0.00 ? 244 LEU A CA     1  
ATOM   482   C C      . LEU A 1 31  ? 16.028 13.172  -1.516  1.00 0.00 ? 244 LEU A C      1  
ATOM   483   O O      . LEU A 1 31  ? 15.926 11.946  -1.503  1.00 0.00 ? 244 LEU A O      1  
ATOM   484   C CB     . LEU A 1 31  ? 17.360 14.152  0.440   1.00 0.00 ? 244 LEU A CB     1  
ATOM   485   C CG     . LEU A 1 31  ? 17.647 12.961  1.358   1.00 0.00 ? 244 LEU A CG     1  
ATOM   486   C CD1    . LEU A 1 31  ? 17.425 13.334  2.825   1.00 0.00 ? 244 LEU A CD1    1  
ATOM   487   C CD2    . LEU A 1 31  ? 16.824 11.740  0.945   1.00 0.00 ? 244 LEU A CD2    1  
ATOM   488   H H      . LEU A 1 31  ? 17.507 15.909  -1.297  1.00 0.00 ? 244 LEU A H      1  
ATOM   489   H HA     . LEU A 1 31  ? 18.156 13.180  -1.275  1.00 0.00 ? 244 LEU A HA     1  
ATOM   490   H HB2    . LEU A 1 31  ? 18.119 14.913  0.617   1.00 0.00 ? 244 LEU A HB2    1  
ATOM   491   H HB3    . LEU A 1 31  ? 16.402 14.584  0.728   1.00 0.00 ? 244 LEU A HB3    1  
ATOM   492   H HG     . LEU A 1 31  ? 18.699 12.693  1.250   1.00 0.00 ? 244 LEU A HG     1  
ATOM   493   H HD11   . LEU A 1 31  ? 17.853 14.318  3.019   1.00 0.00 ? 244 LEU A HD11   1  
ATOM   494   H HD12   . LEU A 1 31  ? 16.355 13.356  3.035   1.00 0.00 ? 244 LEU A HD12   1  
ATOM   495   H HD13   . LEU A 1 31  ? 17.906 12.596  3.465   1.00 0.00 ? 244 LEU A HD13   1  
ATOM   496   H HD21   . LEU A 1 31  ? 15.811 12.052  0.695   1.00 0.00 ? 244 LEU A HD21   1  
ATOM   497   H HD22   . LEU A 1 31  ? 17.284 11.268  0.076   1.00 0.00 ? 244 LEU A HD22   1  
ATOM   498   H HD23   . LEU A 1 31  ? 16.793 11.028  1.770   1.00 0.00 ? 244 LEU A HD23   1  
ATOM   499   N N      . VAL A 1 32  ? 15.072 14.000  -1.911  1.00 0.00 ? 245 VAL A N      1  
ATOM   500   C CA     . VAL A 1 32  ? 13.789 13.498  -2.372  1.00 0.00 ? 245 VAL A CA     1  
ATOM   501   C C      . VAL A 1 32  ? 13.952 12.904  -3.773  1.00 0.00 ? 245 VAL A C      1  
ATOM   502   O O      . VAL A 1 32  ? 13.302 11.916  -4.112  1.00 0.00 ? 245 VAL A O      1  
ATOM   503   C CB     . VAL A 1 32  ? 12.739 14.609  -2.313  1.00 0.00 ? 245 VAL A CB     1  
ATOM   504   C CG1    . VAL A 1 32  ? 11.476 14.211  -3.079  1.00 0.00 ? 245 VAL A CG1    1  
ATOM   505   C CG2    . VAL A 1 32  ? 12.409 14.973  -0.863  1.00 0.00 ? 245 VAL A CG2    1  
ATOM   506   H H      . VAL A 1 32  ? 15.163 14.996  -1.919  1.00 0.00 ? 245 VAL A H      1  
ATOM   507   H HA     . VAL A 1 32  ? 13.482 12.705  -1.689  1.00 0.00 ? 245 VAL A HA     1  
ATOM   508   H HB     . VAL A 1 32  ? 13.159 15.492  -2.793  1.00 0.00 ? 245 VAL A HB     1  
ATOM   509   H HG11   . VAL A 1 32  ? 10.972 13.402  -2.554  1.00 0.00 ? 245 VAL A HG11   1  
ATOM   510   H HG12   . VAL A 1 32  ? 10.809 15.071  -3.150  1.00 0.00 ? 245 VAL A HG12   1  
ATOM   511   H HG13   . VAL A 1 32  ? 11.749 13.881  -4.081  1.00 0.00 ? 245 VAL A HG13   1  
ATOM   512   H HG21   . VAL A 1 32  ? 13.255 14.722  -0.224  1.00 0.00 ? 245 VAL A HG21   1  
ATOM   513   H HG22   . VAL A 1 32  ? 12.206 16.042  -0.795  1.00 0.00 ? 245 VAL A HG22   1  
ATOM   514   H HG23   . VAL A 1 32  ? 11.531 14.416  -0.540  1.00 0.00 ? 245 VAL A HG23   1  
ATOM   515   N N      . GLU A 1 33  ? 14.825 13.531  -4.549  1.00 0.00 ? 246 GLU A N      1  
ATOM   516   C CA     . GLU A 1 33  ? 15.081 13.078  -5.905  1.00 0.00 ? 246 GLU A CA     1  
ATOM   517   C C      . GLU A 1 33  ? 16.002 11.856  -5.891  1.00 0.00 ? 246 GLU A C      1  
ATOM   518   O O      . GLU A 1 33  ? 15.937 11.015  -6.786  1.00 0.00 ? 246 GLU A O      1  
ATOM   519   C CB     . GLU A 1 33  ? 15.675 14.202  -6.756  1.00 0.00 ? 246 GLU A CB     1  
ATOM   520   C CG     . GLU A 1 33  ? 14.576 15.118  -7.299  1.00 0.00 ? 246 GLU A CG     1  
ATOM   521   C CD     . GLU A 1 33  ? 14.504 15.042  -8.825  1.00 0.00 ? 246 GLU A CD     1  
ATOM   522   O OE1    . GLU A 1 33  ? 15.490 15.352  -9.509  1.00 0.00 ? 246 GLU A OE1    1  
ATOM   523   O OE2    . GLU A 1 33  ? 13.371 14.642  -9.298  1.00 0.00 ? 246 GLU A OE2    1  
ATOM   524   H H      . GLU A 1 33  ? 15.349 14.334  -4.265  1.00 0.00 ? 246 GLU A H      1  
ATOM   525   H HA     . GLU A 1 33  ? 14.106 12.802  -6.308  1.00 0.00 ? 246 GLU A HA     1  
ATOM   526   H HB2    . GLU A 1 33  ? 16.376 14.784  -6.157  1.00 0.00 ? 246 GLU A HB2    1  
ATOM   527   H HB3    . GLU A 1 33  ? 16.241 13.776  -7.584  1.00 0.00 ? 246 GLU A HB3    1  
ATOM   528   H HG2    . GLU A 1 33  ? 13.615 14.832  -6.872  1.00 0.00 ? 246 GLU A HG2    1  
ATOM   529   H HG3    . GLU A 1 33  ? 14.769 16.146  -6.991  1.00 0.00 ? 246 GLU A HG3    1  
ATOM   530   H HE2    . GLU A 1 33  ? 12.779 15.428  -9.476  1.00 0.00 ? 246 GLU A HE2    1  
ATOM   531   N N      . ILE A 1 34  ? 16.838 11.797  -4.865  1.00 0.00 ? 247 ILE A N      1  
ATOM   532   C CA     . ILE A 1 34  ? 17.771 10.692  -4.722  1.00 0.00 ? 247 ILE A CA     1  
ATOM   533   C C      . ILE A 1 34  ? 17.025 9.466   -4.191  1.00 0.00 ? 247 ILE A C      1  
ATOM   534   O O      . ILE A 1 34  ? 17.399 8.332   -4.486  1.00 0.00 ? 247 ILE A O      1  
ATOM   535   C CB     . ILE A 1 34  ? 18.965 11.106  -3.860  1.00 0.00 ? 247 ILE A CB     1  
ATOM   536   C CG1    . ILE A 1 34  ? 20.284 10.683  -4.510  1.00 0.00 ? 247 ILE A CG1    1  
ATOM   537   C CG2    . ILE A 1 34  ? 18.828 10.565  -2.436  1.00 0.00 ? 247 ILE A CG2    1  
ATOM   538   C CD1    . ILE A 1 34  ? 20.590 11.541  -5.739  1.00 0.00 ? 247 ILE A CD1    1  
ATOM   539   H H      . ILE A 1 34  ? 16.884 12.485  -4.141  1.00 0.00 ? 247 ILE A H      1  
ATOM   540   H HA     . ILE A 1 34  ? 18.155 10.459  -5.715  1.00 0.00 ? 247 ILE A HA     1  
ATOM   541   H HB     . ILE A 1 34  ? 18.974 12.195  -3.791  1.00 0.00 ? 247 ILE A HB     1  
ATOM   542   H HG12   . ILE A 1 34  ? 21.094 10.773  -3.787  1.00 0.00 ? 247 ILE A HG12   1  
ATOM   543   H HG13   . ILE A 1 34  ? 20.230 9.633   -4.799  1.00 0.00 ? 247 ILE A HG13   1  
ATOM   544   H HG21   . ILE A 1 34  ? 17.862 10.864  -2.025  1.00 0.00 ? 247 ILE A HG21   1  
ATOM   545   H HG22   . ILE A 1 34  ? 18.894 9.477   -2.453  1.00 0.00 ? 247 ILE A HG22   1  
ATOM   546   H HG23   . ILE A 1 34  ? 19.627 10.968  -1.815  1.00 0.00 ? 247 ILE A HG23   1  
ATOM   547   H HD11   . ILE A 1 34  ? 19.679 11.685  -6.318  1.00 0.00 ? 247 ILE A HD11   1  
ATOM   548   H HD12   . ILE A 1 34  ? 20.973 12.510  -5.419  1.00 0.00 ? 247 ILE A HD12   1  
ATOM   549   H HD13   . ILE A 1 34  ? 21.337 11.040  -6.355  1.00 0.00 ? 247 ILE A HD13   1  
ATOM   550   N N      . VAL A 1 35  ? 15.984 9.735   -3.418  1.00 0.00 ? 248 VAL A N      1  
ATOM   551   C CA     . VAL A 1 35  ? 15.182 8.669   -2.843  1.00 0.00 ? 248 VAL A CA     1  
ATOM   552   C C      . VAL A 1 35  ? 14.328 8.030   -3.941  1.00 0.00 ? 248 VAL A C      1  
ATOM   553   O O      . VAL A 1 35  ? 14.122 6.817   -3.945  1.00 0.00 ? 248 VAL A O      1  
ATOM   554   C CB     . VAL A 1 35  ? 14.352 9.208   -1.676  1.00 0.00 ? 248 VAL A CB     1  
ATOM   555   C CG1    . VAL A 1 35  ? 13.302 8.187   -1.233  1.00 0.00 ? 248 VAL A CG1    1  
ATOM   556   C CG2    . VAL A 1 35  ? 15.250 9.614   -0.506  1.00 0.00 ? 248 VAL A CG2    1  
ATOM   557   H H      . VAL A 1 35  ? 15.686 10.661  -3.183  1.00 0.00 ? 248 VAL A H      1  
ATOM   558   H HA     . VAL A 1 35  ? 15.868 7.917   -2.450  1.00 0.00 ? 248 VAL A HA     1  
ATOM   559   H HB     . VAL A 1 35  ? 13.828 10.099  -2.022  1.00 0.00 ? 248 VAL A HB     1  
ATOM   560   H HG11   . VAL A 1 35  ? 13.671 7.179   -1.423  1.00 0.00 ? 248 VAL A HG11   1  
ATOM   561   H HG12   . VAL A 1 35  ? 13.105 8.308   -0.168  1.00 0.00 ? 248 VAL A HG12   1  
ATOM   562   H HG13   . VAL A 1 35  ? 12.381 8.347   -1.793  1.00 0.00 ? 248 VAL A HG13   1  
ATOM   563   H HG21   . VAL A 1 35  ? 16.243 9.861   -0.879  1.00 0.00 ? 248 VAL A HG21   1  
ATOM   564   H HG22   . VAL A 1 35  ? 14.823 10.484  -0.006  1.00 0.00 ? 248 VAL A HG22   1  
ATOM   565   H HG23   . VAL A 1 35  ? 15.322 8.787   0.201   1.00 0.00 ? 248 VAL A HG23   1  
ATOM   566   N N      . ARG A 1 36  ? 13.854 8.875   -4.844  1.00 0.00 ? 249 ARG A N      1  
ATOM   567   C CA     . ARG A 1 36  ? 13.026 8.409   -5.943  1.00 0.00 ? 249 ARG A CA     1  
ATOM   568   C C      . ARG A 1 36  ? 13.895 7.756   -7.020  1.00 0.00 ? 249 ARG A C      1  
ATOM   569   O O      . ARG A 1 36  ? 13.377 7.124   -7.940  1.00 0.00 ? 249 ARG A O      1  
ATOM   570   C CB     . ARG A 1 36  ? 12.237 9.562   -6.566  1.00 0.00 ? 249 ARG A CB     1  
ATOM   571   C CG     . ARG A 1 36  ? 10.867 9.711   -5.900  1.00 0.00 ? 249 ARG A CG     1  
ATOM   572   C CD     . ARG A 1 36  ? 9.878  10.413  -6.833  1.00 0.00 ? 249 ARG A CD     1  
ATOM   573   N NE     . ARG A 1 36  ? 8.979  11.289  -6.050  1.00 0.00 ? 249 ARG A NE     1  
ATOM   574   C CZ     . ARG A 1 36  ? 8.105  12.147  -6.593  1.00 0.00 ? 249 ARG A CZ     1  
ATOM   575   N NH1    . ARG A 1 36  ? 8.009  12.250  -7.926  1.00 0.00 ? 249 ARG A NH1    1  
ATOM   576   N NH2    . ARG A 1 36  ? 7.330  12.904  -5.805  1.00 0.00 ? 249 ARG A NH2    1  
ATOM   577   H H      . ARG A 1 36  ? 14.027 9.861   -4.833  1.00 0.00 ? 249 ARG A H      1  
ATOM   578   H HA     . ARG A 1 36  ? 12.348 7.686   -5.494  1.00 0.00 ? 249 ARG A HA     1  
ATOM   579   H HB2    . ARG A 1 36  ? 12.798 10.491  -6.460  1.00 0.00 ? 249 ARG A HB2    1  
ATOM   580   H HB3    . ARG A 1 36  ? 12.110 9.386   -7.633  1.00 0.00 ? 249 ARG A HB3    1  
ATOM   581   H HG2    . ARG A 1 36  ? 10.482 8.727   -5.631  1.00 0.00 ? 249 ARG A HG2    1  
ATOM   582   H HG3    . ARG A 1 36  ? 10.968 10.279  -4.976  1.00 0.00 ? 249 ARG A HG3    1  
ATOM   583   H HD2    . ARG A 1 36  ? 10.418 11.001  -7.574  1.00 0.00 ? 249 ARG A HD2    1  
ATOM   584   H HD3    . ARG A 1 36  ? 9.293  9.673   -7.379  1.00 0.00 ? 249 ARG A HD3    1  
ATOM   585   H HE     . ARG A 1 36  ? 9.026  11.237  -5.052  1.00 0.00 ? 249 ARG A HE     1  
ATOM   586   H HH11   . ARG A 1 36  ? 8.588  11.687  -8.515  1.00 0.00 ? 249 ARG A HH11   1  
ATOM   587   H HH12   . ARG A 1 36  ? 7.357  12.891  -8.332  1.00 0.00 ? 249 ARG A HH12   1  
ATOM   588   H HH21   . ARG A 1 36  ? 7.402  12.826  -4.811  1.00 0.00 ? 249 ARG A HH21   1  
ATOM   589   H HH22   . ARG A 1 36  ? 6.677  13.545  -6.211  1.00 0.00 ? 249 ARG A HH22   1  
ATOM   590   N N      . ALA A 1 37  ? 15.200 7.930   -6.870  1.00 0.00 ? 250 ALA A N      1  
ATOM   591   C CA     . ALA A 1 37  ? 16.144 7.364   -7.818  1.00 0.00 ? 250 ALA A CA     1  
ATOM   592   C C      . ALA A 1 37  ? 16.734 6.077   -7.239  1.00 0.00 ? 250 ALA A C      1  
ATOM   593   O O      . ALA A 1 37  ? 17.042 5.143   -7.978  1.00 0.00 ? 250 ALA A O      1  
ATOM   594   C CB     . ALA A 1 37  ? 17.220 8.401   -8.148  1.00 0.00 ? 250 ALA A CB     1  
ATOM   595   H H      . ALA A 1 37  ? 15.612 8.445   -6.118  1.00 0.00 ? 250 ALA A H      1  
ATOM   596   H HA     . ALA A 1 37  ? 15.597 7.125   -8.730  1.00 0.00 ? 250 ALA A HA     1  
ATOM   597   H HB1    . ALA A 1 37  ? 16.956 8.918   -9.071  1.00 0.00 ? 250 ALA A HB1    1  
ATOM   598   H HB2    . ALA A 1 37  ? 17.290 9.123   -7.334  1.00 0.00 ? 250 ALA A HB2    1  
ATOM   599   H HB3    . ALA A 1 37  ? 18.180 7.902   -8.273  1.00 0.00 ? 250 ALA A HB3    1  
ATOM   600   N N      . LEU A 1 38  ? 16.873 6.068   -5.921  1.00 0.00 ? 251 LEU A N      1  
ATOM   601   C CA     . LEU A 1 38  ? 17.420 4.911   -5.234  1.00 0.00 ? 251 LEU A CA     1  
ATOM   602   C C      . LEU A 1 38  ? 16.283 3.951   -4.876  1.00 0.00 ? 251 LEU A C      1  
ATOM   603   O O      . LEU A 1 38  ? 15.153 4.380   -4.649  1.00 0.00 ? 251 LEU A O      1  
ATOM   604   C CB     . LEU A 1 38  ? 18.257 5.349   -4.030  1.00 0.00 ? 251 LEU A CB     1  
ATOM   605   C CG     . LEU A 1 38  ? 17.496 5.533   -2.716  1.00 0.00 ? 251 LEU A CG     1  
ATOM   606   C CD1    . LEU A 1 38  ? 17.475 4.235   -1.907  1.00 0.00 ? 251 LEU A CD1    1  
ATOM   607   C CD2    . LEU A 1 38  ? 18.069 6.701   -1.910  1.00 0.00 ? 251 LEU A CD2    1  
ATOM   608   H H      . LEU A 1 38  ? 16.620 6.832   -5.327  1.00 0.00 ? 251 LEU A H      1  
ATOM   609   H HA     . LEU A 1 38  ? 18.092 4.406   -5.927  1.00 0.00 ? 251 LEU A HA     1  
ATOM   610   H HB2    . LEU A 1 38  ? 19.043 4.610   -3.871  1.00 0.00 ? 251 LEU A HB2    1  
ATOM   611   H HB3    . LEU A 1 38  ? 18.748 6.289   -4.277  1.00 0.00 ? 251 LEU A HB3    1  
ATOM   612   H HG     . LEU A 1 38  ? 16.462 5.783   -2.951  1.00 0.00 ? 251 LEU A HG     1  
ATOM   613   H HD11   . LEU A 1 38  ? 18.267 4.260   -1.158  1.00 0.00 ? 251 LEU A HD11   1  
ATOM   614   H HD12   . LEU A 1 38  ? 16.510 4.130   -1.411  1.00 0.00 ? 251 LEU A HD12   1  
ATOM   615   H HD13   . LEU A 1 38  ? 17.633 3.388   -2.576  1.00 0.00 ? 251 LEU A HD13   1  
ATOM   616   H HD21   . LEU A 1 38  ? 18.178 7.571   -2.558  1.00 0.00 ? 251 LEU A HD21   1  
ATOM   617   H HD22   . LEU A 1 38  ? 17.395 6.942   -1.089  1.00 0.00 ? 251 LEU A HD22   1  
ATOM   618   H HD23   . LEU A 1 38  ? 19.044 6.422   -1.509  1.00 0.00 ? 251 LEU A HD23   1  
ATOM   619   N N      . ARG A 1 39  ? 16.622 2.671   -4.836  1.00 0.00 ? 252 ARG A N      1  
ATOM   620   C CA     . ARG A 1 39  ? 15.644 1.648   -4.510  1.00 0.00 ? 252 ARG A CA     1  
ATOM   621   C C      . ARG A 1 39  ? 16.230 0.655   -3.505  1.00 0.00 ? 252 ARG A C      1  
ATOM   622   O O      . ARG A 1 39  ? 17.397 0.279   -3.606  1.00 0.00 ? 252 ARG A O      1  
ATOM   623   C CB     . ARG A 1 39  ? 15.199 0.892   -5.764  1.00 0.00 ? 252 ARG A CB     1  
ATOM   624   C CG     . ARG A 1 39  ? 13.684 0.679   -5.767  1.00 0.00 ? 252 ARG A CG     1  
ATOM   625   C CD     . ARG A 1 39  ? 13.307 -0.597  -5.013  1.00 0.00 ? 252 ARG A CD     1  
ATOM   626   N NE     . ARG A 1 39  ? 11.855 -0.851  -5.141  1.00 0.00 ? 252 ARG A NE     1  
ATOM   627   C CZ     . ARG A 1 39  ? 11.284 -2.053  -4.983  1.00 0.00 ? 252 ARG A CZ     1  
ATOM   628   N NH1    . ARG A 1 39  ? 12.041 -3.119  -4.689  1.00 0.00 ? 252 ARG A NH1    1  
ATOM   629   N NH2    . ARG A 1 39  ? 9.958  -2.189  -5.118  1.00 0.00 ? 252 ARG A NH2    1  
ATOM   630   H H      . ARG A 1 39  ? 17.544 2.331   -5.023  1.00 0.00 ? 252 ARG A H      1  
ATOM   631   H HA     . ARG A 1 39  ? 14.804 2.192   -4.079  1.00 0.00 ? 252 ARG A HA     1  
ATOM   632   H HB2    . ARG A 1 39  ? 15.494 1.449   -6.653  1.00 0.00 ? 252 ARG A HB2    1  
ATOM   633   H HB3    . ARG A 1 39  ? 15.704 -0.074  -5.809  1.00 0.00 ? 252 ARG A HB3    1  
ATOM   634   H HG2    . ARG A 1 39  ? 13.192 1.538   -5.307  1.00 0.00 ? 252 ARG A HG2    1  
ATOM   635   H HG3    . ARG A 1 39  ? 13.324 0.618   -6.795  1.00 0.00 ? 252 ARG A HG3    1  
ATOM   636   H HD2    . ARG A 1 39  ? 13.868 -1.443  -5.408  1.00 0.00 ? 252 ARG A HD2    1  
ATOM   637   H HD3    . ARG A 1 39  ? 13.576 -0.500  -3.961  1.00 0.00 ? 252 ARG A HD3    1  
ATOM   638   H HE     . ARG A 1 39  ? 11.261 -0.076  -5.359  1.00 0.00 ? 252 ARG A HE     1  
ATOM   639   H HH11   . ARG A 1 39  ? 13.031 -3.018  -4.588  1.00 0.00 ? 252 ARG A HH11   1  
ATOM   640   H HH12   . ARG A 1 39  ? 11.616 -4.017  -4.571  1.00 0.00 ? 252 ARG A HH12   1  
ATOM   641   H HH21   . ARG A 1 39  ? 9.394  -1.393  -5.337  1.00 0.00 ? 252 ARG A HH21   1  
ATOM   642   H HH22   . ARG A 1 39  ? 9.533  -3.086  -5.000  1.00 0.00 ? 252 ARG A HH22   1  
ATOM   643   N N      . ALA A 1 40  ? 15.394 0.258   -2.557  1.00 0.00 ? 253 ALA A N      1  
ATOM   644   C CA     . ALA A 1 40  ? 15.815 -0.685  -1.534  1.00 0.00 ? 253 ALA A CA     1  
ATOM   645   C C      . ALA A 1 40  ? 15.718 -2.108  -2.087  1.00 0.00 ? 253 ALA A C      1  
ATOM   646   O O      . ALA A 1 40  ? 14.665 -2.521  -2.570  1.00 0.00 ? 253 ALA A O      1  
ATOM   647   C CB     . ALA A 1 40  ? 14.964 -0.489  -0.278  1.00 0.00 ? 253 ALA A CB     1  
ATOM   648   H H      . ALA A 1 40  ? 14.446 0.568   -2.482  1.00 0.00 ? 253 ALA A H      1  
ATOM   649   H HA     . ALA A 1 40  ? 16.855 -0.469  -1.291  1.00 0.00 ? 253 ALA A HA     1  
ATOM   650   H HB1    . ALA A 1 40  ? 14.182 -1.248  -0.246  1.00 0.00 ? 253 ALA A HB1    1  
ATOM   651   H HB2    . ALA A 1 40  ? 15.595 -0.579  0.606   1.00 0.00 ? 253 ALA A HB2    1  
ATOM   652   H HB3    . ALA A 1 40  ? 14.508 0.501   -0.298  1.00 0.00 ? 253 ALA A HB3    1  
ATOM   653   N N      . ARG A 1 41  ? 16.833 -2.820  -1.999  1.00 0.00 ? 254 ARG A N      1  
ATOM   654   C CA     . ARG A 1 41  ? 16.887 -4.188  -2.485  1.00 0.00 ? 254 ARG A CA     1  
ATOM   655   C C      . ARG A 1 41  ? 17.693 -5.062  -1.522  1.00 0.00 ? 254 ARG A C      1  
ATOM   656   O O      . ARG A 1 41  ? 18.797 -4.694  -1.120  1.00 0.00 ? 254 ARG A O      1  
ATOM   657   C CB     . ARG A 1 41  ? 17.521 -4.254  -3.876  1.00 0.00 ? 254 ARG A CB     1  
ATOM   658   C CG     . ARG A 1 41  ? 17.080 -5.516  -4.620  1.00 0.00 ? 254 ARG A CG     1  
ATOM   659   C CD     . ARG A 1 41  ? 18.283 -6.254  -5.210  1.00 0.00 ? 254 ARG A CD     1  
ATOM   660   N NE     . ARG A 1 41  ? 18.057 -6.523  -6.648  1.00 0.00 ? 254 ARG A NE     1  
ATOM   661   C CZ     . ARG A 1 41  ? 18.187 -5.603  -7.613  1.00 0.00 ? 254 ARG A CZ     1  
ATOM   662   N NH1    . ARG A 1 41  ? 18.542 -4.349  -7.301  1.00 0.00 ? 254 ARG A NH1    1  
ATOM   663   N NH2    . ARG A 1 41  ? 17.961 -5.936  -8.892  1.00 0.00 ? 254 ARG A NH2    1  
ATOM   664   H H      . ARG A 1 41  ? 17.686 -2.477  -1.606  1.00 0.00 ? 254 ARG A H      1  
ATOM   665   H HA     . ARG A 1 41  ? 15.846 -4.511  -2.528  1.00 0.00 ? 254 ARG A HA     1  
ATOM   666   H HB2    . ARG A 1 41  ? 17.240 -3.372  -4.450  1.00 0.00 ? 254 ARG A HB2    1  
ATOM   667   H HB3    . ARG A 1 41  ? 18.608 -4.243  -3.785  1.00 0.00 ? 254 ARG A HB3    1  
ATOM   668   H HG2    . ARG A 1 41  ? 16.542 -6.176  -3.938  1.00 0.00 ? 254 ARG A HG2    1  
ATOM   669   H HG3    . ARG A 1 41  ? 16.386 -5.249  -5.417  1.00 0.00 ? 254 ARG A HG3    1  
ATOM   670   H HD2    . ARG A 1 41  ? 19.186 -5.657  -5.081  1.00 0.00 ? 254 ARG A HD2    1  
ATOM   671   H HD3    . ARG A 1 41  ? 18.443 -7.192  -4.677  1.00 0.00 ? 254 ARG A HD3    1  
ATOM   672   H HE     . ARG A 1 41  ? 17.791 -7.449  -6.916  1.00 0.00 ? 254 ARG A HE     1  
ATOM   673   H HH11   . ARG A 1 41  ? 18.710 -4.100  -6.347  1.00 0.00 ? 254 ARG A HH11   1  
ATOM   674   H HH12   . ARG A 1 41  ? 18.638 -3.663  -8.022  1.00 0.00 ? 254 ARG A HH12   1  
ATOM   675   H HH21   . ARG A 1 41  ? 17.697 -6.872  -9.124  1.00 0.00 ? 254 ARG A HH21   1  
ATOM   676   H HH22   . ARG A 1 41  ? 18.058 -5.250  -9.612  1.00 0.00 ? 254 ARG A HH22   1  
ATOM   677   N N      . THR A 1 42  ? 17.112 -6.202  -1.178  1.00 0.00 ? 255 THR A N      1  
ATOM   678   C CA     . THR A 1 42  ? 17.764 -7.130  -0.270  1.00 0.00 ? 255 THR A CA     1  
ATOM   679   C C      . THR A 1 42  ? 18.462 -8.243  -1.055  1.00 0.00 ? 255 THR A C      1  
ATOM   680   O O      . THR A 1 42  ? 17.919 -8.751  -2.035  1.00 0.00 ? 255 THR A O      1  
ATOM   681   C CB     . THR A 1 42  ? 16.710 -7.647  0.711   1.00 0.00 ? 255 THR A CB     1  
ATOM   682   O OG1    . THR A 1 42  ? 16.082 -6.467  1.201   1.00 0.00 ? 255 THR A OG1    1  
ATOM   683   C CG2    . THR A 1 42  ? 17.332 -8.283  1.957   1.00 0.00 ? 255 THR A CG2    1  
ATOM   684   H H      . THR A 1 42  ? 16.215 -6.493  -1.509  1.00 0.00 ? 255 THR A H      1  
ATOM   685   H HA     . THR A 1 42  ? 18.537 -6.591  0.277   1.00 0.00 ? 255 THR A HA     1  
ATOM   686   H HB     . THR A 1 42  ? 16.028 -8.342  0.220   1.00 0.00 ? 255 THR A HB     1  
ATOM   687   H HG1    . THR A 1 42  ? 15.779 -5.898  0.436   1.00 0.00 ? 255 THR A HG1    1  
ATOM   688   H HG21   . THR A 1 42  ? 17.003 -7.742  2.844   1.00 0.00 ? 255 THR A HG21   1  
ATOM   689   H HG22   . THR A 1 42  ? 17.018 -9.324  2.029   1.00 0.00 ? 255 THR A HG22   1  
ATOM   690   H HG23   . THR A 1 42  ? 18.419 -8.234  1.885   1.00 0.00 ? 255 THR A HG23   1  
ATOM   691   N N      . VAL A 1 43  ? 19.655 -8.588  -0.594  1.00 0.00 ? 256 VAL A N      1  
ATOM   692   C CA     . VAL A 1 43  ? 20.433 -9.630  -1.241  1.00 0.00 ? 256 VAL A CA     1  
ATOM   693   C C      . VAL A 1 43  ? 20.552 -10.831 -0.299  1.00 0.00 ? 256 VAL A C      1  
ATOM   694   O O      . VAL A 1 43  ? 20.971 -10.686 0.848   1.00 0.00 ? 256 VAL A O      1  
ATOM   695   C CB     . VAL A 1 43  ? 21.791 -9.076  -1.677  1.00 0.00 ? 256 VAL A CB     1  
ATOM   696   C CG1    . VAL A 1 43  ? 21.759 -8.635  -3.141  1.00 0.00 ? 256 VAL A CG1    1  
ATOM   697   C CG2    . VAL A 1 43  ? 22.231 -7.927  -0.767  1.00 0.00 ? 256 VAL A CG2    1  
ATOM   698   H H      . VAL A 1 43  ? 20.089 -8.169  0.203   1.00 0.00 ? 256 VAL A H      1  
ATOM   699   H HA     . VAL A 1 43  ? 19.892 -9.938  -2.136  1.00 0.00 ? 256 VAL A HA     1  
ATOM   700   H HB     . VAL A 1 43  ? 22.525 -9.876  -1.583  1.00 0.00 ? 256 VAL A HB     1  
ATOM   701   H HG11   . VAL A 1 43  ? 22.004 -9.483  -3.781  1.00 0.00 ? 256 VAL A HG11   1  
ATOM   702   H HG12   . VAL A 1 43  ? 20.763 -8.269  -3.389  1.00 0.00 ? 256 VAL A HG12   1  
ATOM   703   H HG13   . VAL A 1 43  ? 22.488 -7.840  -3.298  1.00 0.00 ? 256 VAL A HG13   1  
ATOM   704   H HG21   . VAL A 1 43  ? 23.284 -7.706  -0.944  1.00 0.00 ? 256 VAL A HG21   1  
ATOM   705   H HG22   . VAL A 1 43  ? 21.633 -7.042  -0.985  1.00 0.00 ? 256 VAL A HG22   1  
ATOM   706   H HG23   . VAL A 1 43  ? 22.090 -8.213  0.274   1.00 0.00 ? 256 VAL A HG23   1  
ATOM   707   N N      . PRO A 1 44  ? 20.165 -12.020 -0.833  1.00 0.00 ? 257 PRO A N      1  
ATOM   708   C CA     . PRO A 1 44  ? 20.223 -13.245 -0.053  1.00 0.00 ? 257 PRO A CA     1  
ATOM   709   C C      . PRO A 1 44  ? 21.665 -13.737 0.087   1.00 0.00 ? 257 PRO A C      1  
ATOM   710   O O      . PRO A 1 44  ? 22.502 -13.473 -0.776  1.00 0.00 ? 257 PRO A O      1  
ATOM   711   C CB     . PRO A 1 44  ? 19.330 -14.226 -0.793  1.00 0.00 ? 257 PRO A CB     1  
ATOM   712   C CG     . PRO A 1 44  ? 19.175 -13.670 -2.200  1.00 0.00 ? 257 PRO A CG     1  
ATOM   713   C CD     . PRO A 1 44  ? 19.663 -12.230 -2.188  1.00 0.00 ? 257 PRO A CD     1  
ATOM   714   H HA     . PRO A 1 44  ? 19.899 -13.079 0.879   1.00 0.00 ? 257 PRO A HA     1  
ATOM   715   H HB2    . PRO A 1 44  ? 19.775 -15.221 -0.813  1.00 0.00 ? 257 PRO A HB2    1  
ATOM   716   H HB3    . PRO A 1 44  ? 18.361 -14.320 -0.302  1.00 0.00 ? 257 PRO A HB3    1  
ATOM   717   H HG2    . PRO A 1 44  ? 19.752 -14.262 -2.910  1.00 0.00 ? 257 PRO A HG2    1  
ATOM   718   H HG3    . PRO A 1 44  ? 18.134 -13.718 -2.517  1.00 0.00 ? 257 PRO A HG3    1  
ATOM   719   H HD2    . PRO A 1 44  ? 20.446 -12.071 -2.929  1.00 0.00 ? 257 PRO A HD2    1  
ATOM   720   H HD3    . PRO A 1 44  ? 18.856 -11.537 -2.422  1.00 0.00 ? 257 PRO A HD3    1  
ATOM   721   N N      . ALA A 1 45  ? 21.911 -14.444 1.180   1.00 0.00 ? 258 ALA A N      1  
ATOM   722   C CA     . ALA A 1 45  ? 23.238 -14.977 1.444   1.00 0.00 ? 258 ALA A CA     1  
ATOM   723   C C      . ALA A 1 45  ? 23.737 -15.727 0.208   1.00 0.00 ? 258 ALA A C      1  
ATOM   724   O O      . ALA A 1 45  ? 23.008 -16.534 -0.368  1.00 0.00 ? 258 ALA A O      1  
ATOM   725   C CB     . ALA A 1 45  ? 23.193 -15.865 2.689   1.00 0.00 ? 258 ALA A CB     1  
ATOM   726   H H      . ALA A 1 45  ? 21.226 -14.655 1.877   1.00 0.00 ? 258 ALA A H      1  
ATOM   727   H HA     . ALA A 1 45  ? 23.901 -14.133 1.638   1.00 0.00 ? 258 ALA A HA     1  
ATOM   728   H HB1    . ALA A 1 45  ? 23.015 -16.899 2.391   1.00 0.00 ? 258 ALA A HB1    1  
ATOM   729   H HB2    . ALA A 1 45  ? 24.144 -15.798 3.217   1.00 0.00 ? 258 ALA A HB2    1  
ATOM   730   H HB3    . ALA A 1 45  ? 22.389 -15.532 3.344   1.00 0.00 ? 258 ALA A HB3    1  
ATOM   731   N N      . GLY A 1 46  ? 24.975 -15.436 -0.163  1.00 0.00 ? 259 GLY A N      1  
ATOM   732   C CA     . GLY A 1 46  ? 25.580 -16.074 -1.319  1.00 0.00 ? 259 GLY A CA     1  
ATOM   733   C C      . GLY A 1 46  ? 25.348 -15.247 -2.585  1.00 0.00 ? 259 GLY A C      1  
ATOM   734   O O      . GLY A 1 46  ? 25.889 -15.562 -3.644  1.00 0.00 ? 259 GLY A O      1  
ATOM   735   H H      . GLY A 1 46  ? 25.560 -14.779 0.312   1.00 0.00 ? 259 GLY A H      1  
ATOM   736   H HA2    . GLY A 1 46  ? 26.650 -16.198 -1.152  1.00 0.00 ? 259 GLY A HA2    1  
ATOM   737   H HA3    . GLY A 1 46  ? 25.159 -17.072 -1.450  1.00 0.00 ? 259 GLY A HA3    1  
ATOM   738   N N      . ALA A 1 47  ? 24.544 -14.204 -2.434  1.00 0.00 ? 260 ALA A N      1  
ATOM   739   C CA     . ALA A 1 47  ? 24.234 -13.330 -3.552  1.00 0.00 ? 260 ALA A CA     1  
ATOM   740   C C      . ALA A 1 47  ? 25.382 -12.338 -3.751  1.00 0.00 ? 260 ALA A C      1  
ATOM   741   O O      . ALA A 1 47  ? 25.689 -11.550 -2.858  1.00 0.00 ? 260 ALA A O      1  
ATOM   742   C CB     . ALA A 1 47  ? 22.898 -12.630 -3.298  1.00 0.00 ? 260 ALA A CB     1  
ATOM   743   H H      . ALA A 1 47  ? 24.108 -13.955 -1.569  1.00 0.00 ? 260 ALA A H      1  
ATOM   744   H HA     . ALA A 1 47  ? 24.142 -13.951 -4.443  1.00 0.00 ? 260 ALA A HA     1  
ATOM   745   H HB1    . ALA A 1 47  ? 22.642 -12.012 -4.157  1.00 0.00 ? 260 ALA A HB1    1  
ATOM   746   H HB2    . ALA A 1 47  ? 22.120 -13.378 -3.144  1.00 0.00 ? 260 ALA A HB2    1  
ATOM   747   H HB3    . ALA A 1 47  ? 22.979 -12.003 -2.410  1.00 0.00 ? 260 ALA A HB3    1  
ATOM   748   N N      . VAL A 1 48  ? 25.987 -12.412 -4.928  1.00 0.00 ? 261 VAL A N      1  
ATOM   749   C CA     . VAL A 1 48  ? 27.095 -11.530 -5.256  1.00 0.00 ? 261 VAL A CA     1  
ATOM   750   C C      . VAL A 1 48  ? 26.559 -10.123 -5.524  1.00 0.00 ? 261 VAL A C      1  
ATOM   751   O O      . VAL A 1 48  ? 25.675 -9.940  -6.359  1.00 0.00 ? 261 VAL A O      1  
ATOM   752   C CB     . VAL A 1 48  ? 27.888 -12.103 -6.433  1.00 0.00 ? 261 VAL A CB     1  
ATOM   753   C CG1    . VAL A 1 48  ? 28.959 -11.116 -6.904  1.00 0.00 ? 261 VAL A CG1    1  
ATOM   754   C CG2    . VAL A 1 48  ? 28.508 -13.454 -6.072  1.00 0.00 ? 261 VAL A CG2    1  
ATOM   755   H H      . VAL A 1 48  ? 25.731 -13.056 -5.649  1.00 0.00 ? 261 VAL A H      1  
ATOM   756   H HA     . VAL A 1 48  ? 27.756 -11.496 -4.390  1.00 0.00 ? 261 VAL A HA     1  
ATOM   757   H HB     . VAL A 1 48  ? 27.194 -12.262 -7.259  1.00 0.00 ? 261 VAL A HB     1  
ATOM   758   H HG11   . VAL A 1 48  ? 29.508 -10.737 -6.041  1.00 0.00 ? 261 VAL A HG11   1  
ATOM   759   H HG12   . VAL A 1 48  ? 29.648 -11.623 -7.579  1.00 0.00 ? 261 VAL A HG12   1  
ATOM   760   H HG13   . VAL A 1 48  ? 28.483 -10.285 -7.426  1.00 0.00 ? 261 VAL A HG13   1  
ATOM   761   H HG21   . VAL A 1 48  ? 28.833 -13.959 -6.981  1.00 0.00 ? 261 VAL A HG21   1  
ATOM   762   H HG22   . VAL A 1 48  ? 29.365 -13.296 -5.417  1.00 0.00 ? 261 VAL A HG22   1  
ATOM   763   H HG23   . VAL A 1 48  ? 27.767 -14.068 -5.560  1.00 0.00 ? 261 VAL A HG23   1  
ATOM   764   N N      . ILE A 1 49  ? 27.119 -9.163  -4.800  1.00 0.00 ? 262 ILE A N      1  
ATOM   765   C CA     . ILE A 1 49  ? 26.708 -7.778  -4.950  1.00 0.00 ? 262 ILE A CA     1  
ATOM   766   C C      . ILE A 1 49  ? 27.675 -7.063  -5.896  1.00 0.00 ? 262 ILE A C      1  
ATOM   767   O O      . ILE A 1 49  ? 27.259 -6.234  -6.704  1.00 0.00 ? 262 ILE A O      1  
ATOM   768   C CB     . ILE A 1 49  ? 26.579 -7.106  -3.581  1.00 0.00 ? 262 ILE A CB     1  
ATOM   769   C CG1    . ILE A 1 49  ? 25.882 -8.031  -2.581  1.00 0.00 ? 262 ILE A CG1    1  
ATOM   770   C CG2    . ILE A 1 49  ? 25.875 -5.754  -3.697  1.00 0.00 ? 262 ILE A CG2    1  
ATOM   771   C CD1    . ILE A 1 49  ? 26.026 -7.502  -1.153  1.00 0.00 ? 262 ILE A CD1    1  
ATOM   772   H H      . ILE A 1 49  ? 27.838 -9.320  -4.124  1.00 0.00 ? 262 ILE A H      1  
ATOM   773   H HA     . ILE A 1 49  ? 25.717 -7.778  -5.403  1.00 0.00 ? 262 ILE A HA     1  
ATOM   774   H HB     . ILE A 1 49  ? 27.582 -6.916  -3.198  1.00 0.00 ? 262 ILE A HB     1  
ATOM   775   H HG12   . ILE A 1 49  ? 24.826 -8.117  -2.835  1.00 0.00 ? 262 ILE A HG12   1  
ATOM   776   H HG13   . ILE A 1 49  ? 26.308 -9.032  -2.647  1.00 0.00 ? 262 ILE A HG13   1  
ATOM   777   H HG21   . ILE A 1 49  ? 24.865 -5.901  -4.077  1.00 0.00 ? 262 ILE A HG21   1  
ATOM   778   H HG22   . ILE A 1 49  ? 25.828 -5.282  -2.715  1.00 0.00 ? 262 ILE A HG22   1  
ATOM   779   H HG23   . ILE A 1 49  ? 26.430 -5.112  -4.382  1.00 0.00 ? 262 ILE A HG23   1  
ATOM   780   H HD11   . ILE A 1 49  ? 25.427 -8.113  -0.476  1.00 0.00 ? 262 ILE A HD11   1  
ATOM   781   H HD12   . ILE A 1 49  ? 27.074 -7.549  -0.851  1.00 0.00 ? 262 ILE A HD12   1  
ATOM   782   H HD13   . ILE A 1 49  ? 25.682 -6.468  -1.111  1.00 0.00 ? 262 ILE A HD13   1  
ATOM   783   N N      . CYS A 1 50  ? 28.946 -7.411  -5.765  1.00 0.00 ? 263 CYS A N      1  
ATOM   784   C CA     . CYS A 1 50  ? 29.975 -6.813  -6.599  1.00 0.00 ? 263 CYS A CA     1  
ATOM   785   C C      . CYS A 1 50  ? 30.958 -7.911  -7.012  1.00 0.00 ? 263 CYS A C      1  
ATOM   786   O O      . CYS A 1 50  ? 31.255 -8.811  -6.226  1.00 0.00 ? 263 CYS A O      1  
ATOM   787   C CB     . CYS A 1 50  ? 30.679 -5.657  -5.887  1.00 0.00 ? 263 CYS A CB     1  
ATOM   788   S SG     . CYS A 1 50  ? 29.501 -4.792  -4.785  1.00 0.00 ? 263 CYS A SG     1  
ATOM   789   H H      . CYS A 1 50  ? 29.276 -8.087  -5.107  1.00 0.00 ? 263 CYS A H      1  
ATOM   790   H HA     . CYS A 1 50  ? 29.470 -6.399  -7.471  1.00 0.00 ? 263 CYS A HA     1  
ATOM   791   H HB2    . CYS A 1 50  ? 31.522 -6.033  -5.308  1.00 0.00 ? 263 CYS A HB2    1  
ATOM   792   H HB3    . CYS A 1 50  ? 31.082 -4.958  -6.620  1.00 0.00 ? 263 CYS A HB3    1  
ATOM   793   H HG     . CYS A 1 50  ? 30.312 -4.738  -3.731  1.00 0.00 ? 263 CYS A HG     1  
ATOM   794   N N      . ARG A 1 51  ? 31.435 -7.802  -8.242  1.00 0.00 ? 264 ARG A N      1  
ATOM   795   C CA     . ARG A 1 51  ? 32.378 -8.775  -8.769  1.00 0.00 ? 264 ARG A CA     1  
ATOM   796   C C      . ARG A 1 51  ? 33.617 -8.067  -9.322  1.00 0.00 ? 264 ARG A C      1  
ATOM   797   O O      . ARG A 1 51  ? 33.509 -7.226  -10.213 1.00 0.00 ? 264 ARG A O      1  
ATOM   798   C CB     . ARG A 1 51  ? 31.741 -9.615  -9.877  1.00 0.00 ? 264 ARG A CB     1  
ATOM   799   C CG     . ARG A 1 51  ? 32.653 -10.777 -10.277 1.00 0.00 ? 264 ARG A CG     1  
ATOM   800   C CD     . ARG A 1 51  ? 32.941 -10.755 -11.780 1.00 0.00 ? 264 ARG A CD     1  
ATOM   801   N NE     . ARG A 1 51  ? 34.273 -11.340 -12.049 1.00 0.00 ? 264 ARG A NE     1  
ATOM   802   C CZ     . ARG A 1 51  ? 34.990 -11.104 -13.156 1.00 0.00 ? 264 ARG A CZ     1  
ATOM   803   N NH1    . ARG A 1 51  ? 34.505 -10.290 -14.105 1.00 0.00 ? 264 ARG A NH1    1  
ATOM   804   N NH2    . ARG A 1 51  ? 36.189 -11.678 -13.315 1.00 0.00 ? 264 ARG A NH2    1  
ATOM   805   H H      . ARG A 1 51  ? 31.189 -7.068  -8.875  1.00 0.00 ? 264 ARG A H      1  
ATOM   806   H HA     . ARG A 1 51  ? 32.634 -9.405  -7.916  1.00 0.00 ? 264 ARG A HA     1  
ATOM   807   H HB2    . ARG A 1 51  ? 30.781 -10.004 -9.538  1.00 0.00 ? 264 ARG A HB2    1  
ATOM   808   H HB3    . ARG A 1 51  ? 31.542 -8.988  -10.746 1.00 0.00 ? 264 ARG A HB3    1  
ATOM   809   H HG2    . ARG A 1 51  ? 33.590 -10.716 -9.723  1.00 0.00 ? 264 ARG A HG2    1  
ATOM   810   H HG3    . ARG A 1 51  ? 32.184 -11.723 -10.007 1.00 0.00 ? 264 ARG A HG3    1  
ATOM   811   H HD2    . ARG A 1 51  ? 32.174 -11.317 -12.314 1.00 0.00 ? 264 ARG A HD2    1  
ATOM   812   H HD3    . ARG A 1 51  ? 32.903 -9.731  -12.151 1.00 0.00 ? 264 ARG A HD3    1  
ATOM   813   H HE     . ARG A 1 51  ? 34.664 -11.952 -11.360 1.00 0.00 ? 264 ARG A HE     1  
ATOM   814   H HH11   . ARG A 1 51  ? 33.610 -9.862  -13.986 1.00 0.00 ? 264 ARG A HH11   1  
ATOM   815   H HH12   . ARG A 1 51  ? 35.039 -10.113 -14.932 1.00 0.00 ? 264 ARG A HH12   1  
ATOM   816   H HH21   . ARG A 1 51  ? 36.550 -12.285 -12.606 1.00 0.00 ? 264 ARG A HH21   1  
ATOM   817   H HH22   . ARG A 1 51  ? 36.723 -11.501 -14.141 1.00 0.00 ? 264 ARG A HH22   1  
ATOM   818   N N      . ILE A 1 52  ? 34.764 -8.436  -8.771  1.00 0.00 ? 265 ILE A N      1  
ATOM   819   C CA     . ILE A 1 52  ? 36.022 -7.847  -9.199  1.00 0.00 ? 265 ILE A CA     1  
ATOM   820   C C      . ILE A 1 52  ? 36.149 -7.972  -10.719 1.00 0.00 ? 265 ILE A C      1  
ATOM   821   O O      . ILE A 1 52  ? 35.949 -9.051  -11.275 1.00 0.00 ? 265 ILE A O      1  
ATOM   822   C CB     . ILE A 1 52  ? 37.191 -8.466  -8.431  1.00 0.00 ? 265 ILE A CB     1  
ATOM   823   C CG1    . ILE A 1 52  ? 38.531 -7.987  -8.993  1.00 0.00 ? 265 ILE A CG1    1  
ATOM   824   C CG2    . ILE A 1 52  ? 37.090 -9.993  -8.416  1.00 0.00 ? 265 ILE A CG2    1  
ATOM   825   C CD1    . ILE A 1 52  ? 39.585 -7.885  -7.887  1.00 0.00 ? 265 ILE A CD1    1  
ATOM   826   H H      . ILE A 1 52  ? 34.842 -9.121  -8.047  1.00 0.00 ? 265 ILE A H      1  
ATOM   827   H HA     . ILE A 1 52  ? 35.992 -6.788  -8.941  1.00 0.00 ? 265 ILE A HA     1  
ATOM   828   H HB     . ILE A 1 52  ? 37.137 -8.130  -7.396  1.00 0.00 ? 265 ILE A HB     1  
ATOM   829   H HG12   . ILE A 1 52  ? 38.875 -8.676  -9.764  1.00 0.00 ? 265 ILE A HG12   1  
ATOM   830   H HG13   . ILE A 1 52  ? 38.403 -7.015  -9.468  1.00 0.00 ? 265 ILE A HG13   1  
ATOM   831   H HG21   . ILE A 1 52  ? 38.015 -10.422 -8.802  1.00 0.00 ? 265 ILE A HG21   1  
ATOM   832   H HG22   . ILE A 1 52  ? 36.930 -10.336 -7.393  1.00 0.00 ? 265 ILE A HG22   1  
ATOM   833   H HG23   . ILE A 1 52  ? 36.254 -10.308 -9.039  1.00 0.00 ? 265 ILE A HG23   1  
ATOM   834   H HD11   . ILE A 1 52  ? 40.573 -8.065  -8.310  1.00 0.00 ? 265 ILE A HD11   1  
ATOM   835   H HD12   . ILE A 1 52  ? 39.554 -6.888  -7.446  1.00 0.00 ? 265 ILE A HD12   1  
ATOM   836   H HD13   . ILE A 1 52  ? 39.377 -8.629  -7.118  1.00 0.00 ? 265 ILE A HD13   1  
ATOM   837   N N      . GLY A 1 53  ? 36.479 -6.853  -11.347 1.00 0.00 ? 266 GLY A N      1  
ATOM   838   C CA     . GLY A 1 53  ? 36.634 -6.825  -12.791 1.00 0.00 ? 266 GLY A CA     1  
ATOM   839   C C      . GLY A 1 53  ? 35.455 -6.111  -13.455 1.00 0.00 ? 266 GLY A C      1  
ATOM   840   O O      . GLY A 1 53  ? 35.643 -5.325  -14.382 1.00 0.00 ? 266 GLY A O      1  
ATOM   841   H H      . GLY A 1 53  ? 36.639 -5.980  -10.887 1.00 0.00 ? 266 GLY A H      1  
ATOM   842   H HA2    . GLY A 1 53  ? 37.563 -6.318  -13.050 1.00 0.00 ? 266 GLY A HA2    1  
ATOM   843   H HA3    . GLY A 1 53  ? 36.709 -7.843  -13.173 1.00 0.00 ? 266 GLY A HA3    1  
ATOM   844   N N      . GLU A 1 54  ? 34.266 -6.410  -12.954 1.00 0.00 ? 267 GLU A N      1  
ATOM   845   C CA     . GLU A 1 54  ? 33.056 -5.807  -13.488 1.00 0.00 ? 267 GLU A CA     1  
ATOM   846   C C      . GLU A 1 54  ? 33.022 -4.311  -13.164 1.00 0.00 ? 267 GLU A C      1  
ATOM   847   O O      . GLU A 1 54  ? 33.422 -3.898  -12.078 1.00 0.00 ? 267 GLU A O      1  
ATOM   848   C CB     . GLU A 1 54  ? 31.809 -6.513  -12.951 1.00 0.00 ? 267 GLU A CB     1  
ATOM   849   C CG     . GLU A 1 54  ? 31.530 -6.107  -11.502 1.00 0.00 ? 267 GLU A CG     1  
ATOM   850   C CD     . GLU A 1 54  ? 30.278 -5.232  -11.410 1.00 0.00 ? 267 GLU A CD     1  
ATOM   851   O OE1    . GLU A 1 54  ? 29.994 -4.456  -12.334 1.00 0.00 ? 267 GLU A OE1    1  
ATOM   852   O OE2    . GLU A 1 54  ? 29.590 -5.378  -10.329 1.00 0.00 ? 267 GLU A OE2    1  
ATOM   853   H H      . GLU A 1 54  ? 34.122 -7.050  -12.199 1.00 0.00 ? 267 GLU A H      1  
ATOM   854   H HA     . GLU A 1 54  ? 33.112 -5.951  -14.566 1.00 0.00 ? 267 GLU A HA     1  
ATOM   855   H HB2    . GLU A 1 54  ? 30.949 -6.264  -13.574 1.00 0.00 ? 267 GLU A HB2    1  
ATOM   856   H HB3    . GLU A 1 54  ? 31.944 -7.592  -13.011 1.00 0.00 ? 267 GLU A HB3    1  
ATOM   857   H HG2    . GLU A 1 54  ? 31.401 -6.998  -10.890 1.00 0.00 ? 267 GLU A HG2    1  
ATOM   858   H HG3    . GLU A 1 54  ? 32.387 -5.566  -11.101 1.00 0.00 ? 267 GLU A HG3    1  
ATOM   859   H HE2    . GLU A 1 54  ? 29.391 -4.485  -9.926  1.00 0.00 ? 267 GLU A HE2    1  
ATOM   860   N N      . PRO A 1 55  ? 32.527 -3.521  -14.154 1.00 0.00 ? 268 PRO A N      1  
ATOM   861   C CA     . PRO A 1 55  ? 32.435 -2.080  -13.986 1.00 0.00 ? 268 PRO A CA     1  
ATOM   862   C C      . PRO A 1 55  ? 31.273 -1.710  -13.062 1.00 0.00 ? 268 PRO A C      1  
ATOM   863   O O      . PRO A 1 55  ? 30.165 -2.219  -13.218 1.00 0.00 ? 268 PRO A O      1  
ATOM   864   C CB     . PRO A 1 55  ? 32.274 -1.530  -15.393 1.00 0.00 ? 268 PRO A CB     1  
ATOM   865   C CG     . PRO A 1 55  ? 31.816 -2.700  -16.249 1.00 0.00 ? 268 PRO A CG     1  
ATOM   866   C CD     . PRO A 1 55  ? 32.044 -3.976  -15.455 1.00 0.00 ? 268 PRO A CD     1  
ATOM   867   H HA     . PRO A 1 55  ? 33.259 -1.730  -13.543 1.00 0.00 ? 268 PRO A HA     1  
ATOM   868   H HB2    . PRO A 1 55  ? 31.544 -0.721  -15.416 1.00 0.00 ? 268 PRO A HB2    1  
ATOM   869   H HB3    . PRO A 1 55  ? 33.214 -1.120  -15.763 1.00 0.00 ? 268 PRO A HB3    1  
ATOM   870   H HG2    . PRO A 1 55  ? 30.763 -2.594  -16.508 1.00 0.00 ? 268 PRO A HG2    1  
ATOM   871   H HG3    . PRO A 1 55  ? 32.373 -2.728  -17.186 1.00 0.00 ? 268 PRO A HG3    1  
ATOM   872   H HD2    . PRO A 1 55  ? 31.123 -4.551  -15.357 1.00 0.00 ? 268 PRO A HD2    1  
ATOM   873   H HD3    . PRO A 1 55  ? 32.773 -4.622  -15.945 1.00 0.00 ? 268 PRO A HD3    1  
ATOM   874   N N      . GLY A 1 56  ? 31.568 -0.825  -12.121 1.00 0.00 ? 269 GLY A N      1  
ATOM   875   C CA     . GLY A 1 56  ? 30.561 -0.379  -11.171 1.00 0.00 ? 269 GLY A CA     1  
ATOM   876   C C      . GLY A 1 56  ? 29.678 0.711   -11.780 1.00 0.00 ? 269 GLY A C      1  
ATOM   877   O O      . GLY A 1 56  ? 30.176 1.754   -12.202 1.00 0.00 ? 269 GLY A O      1  
ATOM   878   H H      . GLY A 1 56  ? 32.472 -0.416  -12.001 1.00 0.00 ? 269 GLY A H      1  
ATOM   879   H HA2    . GLY A 1 56  ? 29.943 -1.225  -10.868 1.00 0.00 ? 269 GLY A HA2    1  
ATOM   880   H HA3    . GLY A 1 56  ? 31.047 -0.000  -10.273 1.00 0.00 ? 269 GLY A HA3    1  
ATOM   881   N N      . ASP A 1 57  ? 28.383 0.434   -11.806 1.00 0.00 ? 270 ASP A N      1  
ATOM   882   C CA     . ASP A 1 57  ? 27.426 1.379   -12.357 1.00 0.00 ? 270 ASP A CA     1  
ATOM   883   C C      . ASP A 1 57  ? 26.291 1.592   -11.353 1.00 0.00 ? 270 ASP A C      1  
ATOM   884   O O      . ASP A 1 57  ? 25.175 1.938   -11.736 1.00 0.00 ? 270 ASP A O      1  
ATOM   885   C CB     . ASP A 1 57  ? 26.815 0.850   -13.656 1.00 0.00 ? 270 ASP A CB     1  
ATOM   886   C CG     . ASP A 1 57  ? 27.755 0.856   -14.862 1.00 0.00 ? 270 ASP A CG     1  
ATOM   887   O OD1    . ASP A 1 57  ? 28.364 -0.169  -15.204 1.00 0.00 ? 270 ASP A OD1    1  
ATOM   888   O OD2    . ASP A 1 57  ? 27.853 1.989   -15.472 1.00 0.00 ? 270 ASP A OD2    1  
ATOM   889   H H      . ASP A 1 57  ? 27.987 -0.417  -11.462 1.00 0.00 ? 270 ASP A H      1  
ATOM   890   H HA     . ASP A 1 57  ? 27.996 2.289   -12.542 1.00 0.00 ? 270 ASP A HA     1  
ATOM   891   H HB2    . ASP A 1 57  ? 26.470 -0.170  -13.488 1.00 0.00 ? 270 ASP A HB2    1  
ATOM   892   H HB3    . ASP A 1 57  ? 25.936 1.449   -13.896 1.00 0.00 ? 270 ASP A HB3    1  
ATOM   893   H HD2    . ASP A 1 57  ? 28.241 1.855   -16.384 1.00 0.00 ? 270 ASP A HD2    1  
ATOM   894   N N      . ARG A 1 58  ? 26.616 1.374   -10.087 1.00 0.00 ? 271 ARG A N      1  
ATOM   895   C CA     . ARG A 1 58  ? 25.638 1.539   -9.025  1.00 0.00 ? 271 ARG A CA     1  
ATOM   896   C C      . ARG A 1 58  ? 26.314 1.420   -7.657  1.00 0.00 ? 271 ARG A C      1  
ATOM   897   O O      . ARG A 1 58  ? 27.340 0.753   -7.524  1.00 0.00 ? 271 ARG A O      1  
ATOM   898   C CB     . ARG A 1 58  ? 24.529 0.490   -9.131  1.00 0.00 ? 271 ARG A CB     1  
ATOM   899   C CG     . ARG A 1 58  ? 25.115 -0.918  -9.251  1.00 0.00 ? 271 ARG A CG     1  
ATOM   900   C CD     . ARG A 1 58  ? 24.441 -1.698  -10.381 1.00 0.00 ? 271 ARG A CD     1  
ATOM   901   N NE     . ARG A 1 58  ? 25.377 -2.705  -10.929 1.00 0.00 ? 271 ARG A NE     1  
ATOM   902   C CZ     . ARG A 1 58  ? 25.014 -3.693  -11.759 1.00 0.00 ? 271 ARG A CZ     1  
ATOM   903   N NH1    . ARG A 1 58  ? 23.735 -3.814  -12.140 1.00 0.00 ? 271 ARG A NH1    1  
ATOM   904   N NH2    . ARG A 1 58  ? 25.931 -4.562  -12.207 1.00 0.00 ? 271 ARG A NH2    1  
ATOM   905   H H      . ARG A 1 58  ? 27.527 1.093   -9.783  1.00 0.00 ? 271 ARG A H      1  
ATOM   906   H HA     . ARG A 1 58  ? 25.229 2.538   -9.174  1.00 0.00 ? 271 ARG A HA     1  
ATOM   907   H HB2    . ARG A 1 58  ? 23.886 0.546   -8.253  1.00 0.00 ? 271 ARG A HB2    1  
ATOM   908   H HB3    . ARG A 1 58  ? 23.904 0.702   -9.998  1.00 0.00 ? 271 ARG A HB3    1  
ATOM   909   H HG2    . ARG A 1 58  ? 26.188 -0.855  -9.438  1.00 0.00 ? 271 ARG A HG2    1  
ATOM   910   H HG3    . ARG A 1 58  ? 24.987 -1.451  -8.309  1.00 0.00 ? 271 ARG A HG3    1  
ATOM   911   H HD2    . ARG A 1 58  ? 23.542 -2.189  -10.008 1.00 0.00 ? 271 ARG A HD2    1  
ATOM   912   H HD3    . ARG A 1 58  ? 24.128 -1.014  -11.170 1.00 0.00 ? 271 ARG A HD3    1  
ATOM   913   H HE     . ARG A 1 58  ? 26.339 -2.645  -10.665 1.00 0.00 ? 271 ARG A HE     1  
ATOM   914   H HH11   . ARG A 1 58  ? 23.051 -3.165  -11.807 1.00 0.00 ? 271 ARG A HH11   1  
ATOM   915   H HH12   . ARG A 1 58  ? 23.466 -4.551  -12.760 1.00 0.00 ? 271 ARG A HH12   1  
ATOM   916   H HH21   . ARG A 1 58  ? 26.886 -4.473  -11.922 1.00 0.00 ? 271 ARG A HH21   1  
ATOM   917   H HH22   . ARG A 1 58  ? 25.662 -5.300  -12.825 1.00 0.00 ? 271 ARG A HH22   1  
ATOM   918   N N      . MET A 1 59  ? 25.714 2.077   -6.677  1.00 0.00 ? 272 MET A N      1  
ATOM   919   C CA     . MET A 1 59  ? 26.245 2.053   -5.324  1.00 0.00 ? 272 MET A CA     1  
ATOM   920   C C      . MET A 1 59  ? 25.462 1.077   -4.444  1.00 0.00 ? 272 MET A C      1  
ATOM   921   O O      . MET A 1 59  ? 24.392 0.606   -4.831  1.00 0.00 ? 272 MET A O      1  
ATOM   922   C CB     . MET A 1 59  ? 26.170 3.457   -4.721  1.00 0.00 ? 272 MET A CB     1  
ATOM   923   C CG     . MET A 1 59  ? 27.564 4.074   -4.592  1.00 0.00 ? 272 MET A CG     1  
ATOM   924   S SD     . MET A 1 59  ? 28.614 3.009   -3.618  1.00 0.00 ? 272 MET A SD     1  
ATOM   925   C CE     . MET A 1 59  ? 28.237 3.614   -1.981  1.00 0.00 ? 272 MET A CE     1  
ATOM   926   H H      . MET A 1 59  ? 24.880 2.617   -6.793  1.00 0.00 ? 272 MET A H      1  
ATOM   927   H HA     . MET A 1 59  ? 27.278 1.717   -5.422  1.00 0.00 ? 272 MET A HA     1  
ATOM   928   H HB2    . MET A 1 59  ? 25.543 4.092   -5.348  1.00 0.00 ? 272 MET A HB2    1  
ATOM   929   H HB3    . MET A 1 59  ? 25.697 3.410   -3.740  1.00 0.00 ? 272 MET A HB3    1  
ATOM   930   H HG2    . MET A 1 59  ? 27.998 4.220   -5.581  1.00 0.00 ? 272 MET A HG2    1  
ATOM   931   H HG3    . MET A 1 59  ? 27.494 5.056   -4.126  1.00 0.00 ? 272 MET A HG3    1  
ATOM   932   H HE1    . MET A 1 59  ? 27.166 3.809   -1.904  1.00 0.00 ? 272 MET A HE1    1  
ATOM   933   H HE2    . MET A 1 59  ? 28.525 2.867   -1.242  1.00 0.00 ? 272 MET A HE2    1  
ATOM   934   H HE3    . MET A 1 59  ? 28.787 4.538   -1.800  1.00 0.00 ? 272 MET A HE3    1  
ATOM   935   N N      . PHE A 1 60  ? 26.024 0.800   -3.276  1.00 0.00 ? 273 PHE A N      1  
ATOM   936   C CA     . PHE A 1 60  ? 25.391 -0.112  -2.339  1.00 0.00 ? 273 PHE A CA     1  
ATOM   937   C C      . PHE A 1 60  ? 25.607 0.349   -0.895  1.00 0.00 ? 273 PHE A C      1  
ATOM   938   O O      . PHE A 1 60  ? 26.699 0.788   -0.538  1.00 0.00 ? 273 PHE A O      1  
ATOM   939   C CB     . PHE A 1 60  ? 26.052 -1.479  -2.529  1.00 0.00 ? 273 PHE A CB     1  
ATOM   940   C CG     . PHE A 1 60  ? 25.838 -2.084  -3.917  1.00 0.00 ? 273 PHE A CG     1  
ATOM   941   C CD1    . PHE A 1 60  ? 26.497 -1.574  -4.992  1.00 0.00 ? 273 PHE A CD1    1  
ATOM   942   C CD2    . PHE A 1 60  ? 24.989 -3.135  -4.078  1.00 0.00 ? 273 PHE A CD2    1  
ATOM   943   C CE1    . PHE A 1 60  ? 26.299 -2.136  -6.281  1.00 0.00 ? 273 PHE A CE1    1  
ATOM   944   C CE2    . PHE A 1 60  ? 24.791 -3.697  -5.366  1.00 0.00 ? 273 PHE A CE2    1  
ATOM   945   C CZ     . PHE A 1 60  ? 25.450 -3.187  -6.440  1.00 0.00 ? 273 PHE A CZ     1  
ATOM   946   H H      . PHE A 1 60  ? 26.894 1.187   -2.970  1.00 0.00 ? 273 PHE A H      1  
ATOM   947   H HA     . PHE A 1 60  ? 24.325 -0.116  -2.561  1.00 0.00 ? 273 PHE A HA     1  
ATOM   948   H HB2    . PHE A 1 60  ? 27.122 -1.382  -2.347  1.00 0.00 ? 273 PHE A HB2    1  
ATOM   949   H HB3    . PHE A 1 60  ? 25.662 -2.168  -1.780  1.00 0.00 ? 273 PHE A HB3    1  
ATOM   950   H HD1    . PHE A 1 60  ? 27.178 -0.732  -4.864  1.00 0.00 ? 273 PHE A HD1    1  
ATOM   951   H HD2    . PHE A 1 60  ? 24.461 -3.544  -3.217  1.00 0.00 ? 273 PHE A HD2    1  
ATOM   952   H HE1    . PHE A 1 60  ? 26.827 -1.727  -7.142  1.00 0.00 ? 273 PHE A HE1    1  
ATOM   953   H HE2    . PHE A 1 60  ? 24.110 -4.540  -5.495  1.00 0.00 ? 273 PHE A HE2    1  
ATOM   954   H HZ     . PHE A 1 60  ? 25.298 -3.619  -7.430  1.00 0.00 ? 273 PHE A HZ     1  
ATOM   955   N N      . PHE A 1 61  ? 24.549 0.233   -0.107  1.00 0.00 ? 274 PHE A N      1  
ATOM   956   C CA     . PHE A 1 61  ? 24.609 0.632   1.289   1.00 0.00 ? 274 PHE A CA     1  
ATOM   957   C C      . PHE A 1 61  ? 23.906 -0.392  2.182   1.00 0.00 ? 274 PHE A C      1  
ATOM   958   O O      . PHE A 1 61  ? 22.738 -0.711  1.967   1.00 0.00 ? 274 PHE A O      1  
ATOM   959   C CB     . PHE A 1 61  ? 23.883 1.974   1.402   1.00 0.00 ? 274 PHE A CB     1  
ATOM   960   C CG     . PHE A 1 61  ? 24.326 3.010   0.367   1.00 0.00 ? 274 PHE A CG     1  
ATOM   961   C CD1    . PHE A 1 61  ? 23.863 2.937   -0.910  1.00 0.00 ? 274 PHE A CD1    1  
ATOM   962   C CD2    . PHE A 1 61  ? 25.182 4.004   0.723   1.00 0.00 ? 274 PHE A CD2    1  
ATOM   963   C CE1    . PHE A 1 61  ? 24.273 3.898   -1.870  1.00 0.00 ? 274 PHE A CE1    1  
ATOM   964   C CE2    . PHE A 1 61  ? 25.593 4.966   -0.237  1.00 0.00 ? 274 PHE A CE2    1  
ATOM   965   C CZ     . PHE A 1 61  ? 25.130 4.893   -1.514  1.00 0.00 ? 274 PHE A CZ     1  
ATOM   966   H H      . PHE A 1 61  ? 23.666 -0.126  -0.406  1.00 0.00 ? 274 PHE A H      1  
ATOM   967   H HA     . PHE A 1 61  ? 25.662 0.689   1.564   1.00 0.00 ? 274 PHE A HA     1  
ATOM   968   H HB2    . PHE A 1 61  ? 22.812 1.805   1.297   1.00 0.00 ? 274 PHE A HB2    1  
ATOM   969   H HB3    . PHE A 1 61  ? 24.046 2.380   2.400   1.00 0.00 ? 274 PHE A HB3    1  
ATOM   970   H HD1    . PHE A 1 61  ? 23.177 2.139   -1.195  1.00 0.00 ? 274 PHE A HD1    1  
ATOM   971   H HD2    . PHE A 1 61  ? 25.553 4.063   1.746   1.00 0.00 ? 274 PHE A HD2    1  
ATOM   972   H HE1    . PHE A 1 61  ? 23.902 3.839   -2.894  1.00 0.00 ? 274 PHE A HE1    1  
ATOM   973   H HE2    . PHE A 1 61  ? 26.280 5.763   0.048   1.00 0.00 ? 274 PHE A HE2    1  
ATOM   974   H HZ     . PHE A 1 61  ? 25.446 5.631   -2.251  1.00 0.00 ? 274 PHE A HZ     1  
ATOM   975   N N      . VAL A 1 62  ? 24.647 -0.878  3.167   1.00 0.00 ? 275 VAL A N      1  
ATOM   976   C CA     . VAL A 1 62  ? 24.110 -1.859  4.095   1.00 0.00 ? 275 VAL A CA     1  
ATOM   977   C C      . VAL A 1 62  ? 23.183 -1.159  5.090   1.00 0.00 ? 275 VAL A C      1  
ATOM   978   O O      . VAL A 1 62  ? 23.559 -0.157  5.697   1.00 0.00 ? 275 VAL A O      1  
ATOM   979   C CB     . VAL A 1 62  ? 25.252 -2.618  4.774   1.00 0.00 ? 275 VAL A CB     1  
ATOM   980   C CG1    . VAL A 1 62  ? 24.717 -3.558  5.856   1.00 0.00 ? 275 VAL A CG1    1  
ATOM   981   C CG2    . VAL A 1 62  ? 26.088 -3.383  3.747   1.00 0.00 ? 275 VAL A CG2    1  
ATOM   982   H H      . VAL A 1 62  ? 25.597 -0.612  3.336   1.00 0.00 ? 275 VAL A H      1  
ATOM   983   H HA     . VAL A 1 62  ? 23.527 -2.574  3.515   1.00 0.00 ? 275 VAL A HA     1  
ATOM   984   H HB     . VAL A 1 62  ? 25.900 -1.886  5.256   1.00 0.00 ? 275 VAL A HB     1  
ATOM   985   H HG11   . VAL A 1 62  ? 25.496 -3.735  6.599   1.00 0.00 ? 275 VAL A HG11   1  
ATOM   986   H HG12   . VAL A 1 62  ? 23.852 -3.103  6.338   1.00 0.00 ? 275 VAL A HG12   1  
ATOM   987   H HG13   . VAL A 1 62  ? 24.426 -4.506  5.403   1.00 0.00 ? 275 VAL A HG13   1  
ATOM   988   H HG21   . VAL A 1 62  ? 27.043 -2.876  3.606   1.00 0.00 ? 275 VAL A HG21   1  
ATOM   989   H HG22   . VAL A 1 62  ? 26.265 -4.397  4.105   1.00 0.00 ? 275 VAL A HG22   1  
ATOM   990   H HG23   . VAL A 1 62  ? 25.554 -3.421  2.798   1.00 0.00 ? 275 VAL A HG23   1  
ATOM   991   N N      . VAL A 1 63  ? 21.987 -1.714  5.227   1.00 0.00 ? 276 VAL A N      1  
ATOM   992   C CA     . VAL A 1 63  ? 21.003 -1.155  6.139   1.00 0.00 ? 276 VAL A CA     1  
ATOM   993   C C      . VAL A 1 63  ? 20.915 -2.033  7.388   1.00 0.00 ? 276 VAL A C      1  
ATOM   994   O O      . VAL A 1 63  ? 20.915 -1.527  8.509   1.00 0.00 ? 276 VAL A O      1  
ATOM   995   C CB     . VAL A 1 63  ? 19.659 -0.996  5.423   1.00 0.00 ? 276 VAL A CB     1  
ATOM   996   C CG1    . VAL A 1 63  ? 18.595 -0.442  6.374   1.00 0.00 ? 276 VAL A CG1    1  
ATOM   997   C CG2    . VAL A 1 63  ? 19.799 -0.112  4.182   1.00 0.00 ? 276 VAL A CG2    1  
ATOM   998   H H      . VAL A 1 63  ? 21.688 -2.528  4.730   1.00 0.00 ? 276 VAL A H      1  
ATOM   999   H HA     . VAL A 1 63  ? 21.350 -0.164  6.429   1.00 0.00 ? 276 VAL A HA     1  
ATOM   1000  H HB     . VAL A 1 63  ? 19.334 -1.984  5.096   1.00 0.00 ? 276 VAL A HB     1  
ATOM   1001  H HG11   . VAL A 1 63  ? 17.655 -0.969  6.213   1.00 0.00 ? 276 VAL A HG11   1  
ATOM   1002  H HG12   . VAL A 1 63  ? 18.919 -0.583  7.405   1.00 0.00 ? 276 VAL A HG12   1  
ATOM   1003  H HG13   . VAL A 1 63  ? 18.453 0.621   6.180   1.00 0.00 ? 276 VAL A HG13   1  
ATOM   1004  H HG21   . VAL A 1 63  ? 18.924 -0.239  3.546   1.00 0.00 ? 276 VAL A HG21   1  
ATOM   1005  H HG22   . VAL A 1 63  ? 19.879 0.931   4.487   1.00 0.00 ? 276 VAL A HG22   1  
ATOM   1006  H HG23   . VAL A 1 63  ? 20.695 -0.400  3.631   1.00 0.00 ? 276 VAL A HG23   1  
ATOM   1007  N N      . GLU A 1 64  ? 20.841 -3.336  7.154   1.00 0.00 ? 277 GLU A N      1  
ATOM   1008  C CA     . GLU A 1 64  ? 20.754 -4.289  8.247   1.00 0.00 ? 277 GLU A CA     1  
ATOM   1009  C C      . GLU A 1 64  ? 21.447 -5.599  7.865   1.00 0.00 ? 277 GLU A C      1  
ATOM   1010  O O      . GLU A 1 64  ? 21.221 -6.132  6.780   1.00 0.00 ? 277 GLU A O      1  
ATOM   1011  C CB     . GLU A 1 64  ? 19.296 -4.534  8.643   1.00 0.00 ? 277 GLU A CB     1  
ATOM   1012  C CG     . GLU A 1 64  ? 19.210 -5.277  9.979   1.00 0.00 ? 277 GLU A CG     1  
ATOM   1013  C CD     . GLU A 1 64  ? 18.850 -4.319  11.116  1.00 0.00 ? 277 GLU A CD     1  
ATOM   1014  O OE1    . GLU A 1 64  ? 19.699 -3.525  11.550  1.00 0.00 ? 277 GLU A OE1    1  
ATOM   1015  O OE2    . GLU A 1 64  ? 17.640 -4.418  11.550  1.00 0.00 ? 277 GLU A OE2    1  
ATOM   1016  H H      . GLU A 1 64  ? 20.843 -3.739  6.239   1.00 0.00 ? 277 GLU A H      1  
ATOM   1017  H HA     . GLU A 1 64  ? 21.277 -3.822  9.081   1.00 0.00 ? 277 GLU A HA     1  
ATOM   1018  H HB2    . GLU A 1 64  ? 18.770 -3.583  8.717   1.00 0.00 ? 277 GLU A HB2    1  
ATOM   1019  H HB3    . GLU A 1 64  ? 18.797 -5.115  7.868   1.00 0.00 ? 277 GLU A HB3    1  
ATOM   1020  H HG2    . GLU A 1 64  ? 18.461 -6.065  9.912   1.00 0.00 ? 277 GLU A HG2    1  
ATOM   1021  H HG3    . GLU A 1 64  ? 20.164 -5.760  10.193  1.00 0.00 ? 277 GLU A HG3    1  
ATOM   1022  H HE2    . GLU A 1 64  ? 17.550 -5.227  12.131  1.00 0.00 ? 277 GLU A HE2    1  
ATOM   1023  N N      . GLY A 1 65  ? 22.277 -6.079  8.780   1.00 0.00 ? 278 GLY A N      1  
ATOM   1024  C CA     . GLY A 1 65  ? 23.004 -7.316  8.553   1.00 0.00 ? 278 GLY A CA     1  
ATOM   1025  C C      . GLY A 1 65  ? 24.494 -7.044  8.329   1.00 0.00 ? 278 GLY A C      1  
ATOM   1026  O O      . GLY A 1 65  ? 24.963 -5.927  8.543   1.00 0.00 ? 278 GLY A O      1  
ATOM   1027  H H      . GLY A 1 65  ? 22.455 -5.639  9.659   1.00 0.00 ? 278 GLY A H      1  
ATOM   1028  H HA2    . GLY A 1 65  ? 22.877 -7.978  9.409   1.00 0.00 ? 278 GLY A HA2    1  
ATOM   1029  H HA3    . GLY A 1 65  ? 22.591 -7.832  7.686   1.00 0.00 ? 278 GLY A HA3    1  
ATOM   1030  N N      . SER A 1 66  ? 25.195 -8.083  7.900   1.00 0.00 ? 279 SER A N      1  
ATOM   1031  C CA     . SER A 1 66  ? 26.621 -7.970  7.644   1.00 0.00 ? 279 SER A CA     1  
ATOM   1032  C C      . SER A 1 66  ? 26.956 -8.566  6.275   1.00 0.00 ? 279 SER A C      1  
ATOM   1033  O O      . SER A 1 66  ? 26.183 -9.353  5.732   1.00 0.00 ? 279 SER A O      1  
ATOM   1034  C CB     . SER A 1 66  ? 27.433 -8.664  8.739   1.00 0.00 ? 279 SER A CB     1  
ATOM   1035  O OG     . SER A 1 66  ? 27.494 -7.886  9.932   1.00 0.00 ? 279 SER A OG     1  
ATOM   1036  H H      . SER A 1 66  ? 24.805 -8.987  7.727   1.00 0.00 ? 279 SER A H      1  
ATOM   1037  H HA     . SER A 1 66  ? 26.832 -6.900  7.658   1.00 0.00 ? 279 SER A HA     1  
ATOM   1038  H HB2    . SER A 1 66  ? 26.988 -9.633  8.961   1.00 0.00 ? 279 SER A HB2    1  
ATOM   1039  H HB3    . SER A 1 66  ? 28.443 -8.852  8.376   1.00 0.00 ? 279 SER A HB3    1  
ATOM   1040  H HG     . SER A 1 66  ? 26.969 -8.330  10.657  1.00 0.00 ? 279 SER A HG     1  
ATOM   1041  N N      . VAL A 1 67  ? 28.109 -8.167  5.758   1.00 0.00 ? 280 VAL A N      1  
ATOM   1042  C CA     . VAL A 1 67  ? 28.556 -8.652  4.464   1.00 0.00 ? 280 VAL A CA     1  
ATOM   1043  C C      . VAL A 1 67  ? 30.004 -9.131  4.576   1.00 0.00 ? 280 VAL A C      1  
ATOM   1044  O O      . VAL A 1 67  ? 30.731 -8.714  5.476   1.00 0.00 ? 280 VAL A O      1  
ATOM   1045  C CB     . VAL A 1 67  ? 28.365 -7.566  3.403   1.00 0.00 ? 280 VAL A CB     1  
ATOM   1046  C CG1    . VAL A 1 67  ? 29.213 -7.854  2.163   1.00 0.00 ? 280 VAL A CG1    1  
ATOM   1047  C CG2    . VAL A 1 67  ? 26.888 -7.413  3.034   1.00 0.00 ? 280 VAL A CG2    1  
ATOM   1048  H H      . VAL A 1 67  ? 28.731 -7.526  6.207   1.00 0.00 ? 280 VAL A H      1  
ATOM   1049  H HA     . VAL A 1 67  ? 27.926 -9.500  4.195   1.00 0.00 ? 280 VAL A HA     1  
ATOM   1050  H HB     . VAL A 1 67  ? 28.703 -6.620  3.828   1.00 0.00 ? 280 VAL A HB     1  
ATOM   1051  H HG11   . VAL A 1 67  ? 29.049 -7.074  1.421   1.00 0.00 ? 280 VAL A HG11   1  
ATOM   1052  H HG12   . VAL A 1 67  ? 30.268 -7.874  2.442   1.00 0.00 ? 280 VAL A HG12   1  
ATOM   1053  H HG13   . VAL A 1 67  ? 28.929 -8.819  1.746   1.00 0.00 ? 280 VAL A HG13   1  
ATOM   1054  H HG21   . VAL A 1 67  ? 26.806 -7.025  2.018   1.00 0.00 ? 280 VAL A HG21   1  
ATOM   1055  H HG22   . VAL A 1 67  ? 26.397 -8.385  3.092   1.00 0.00 ? 280 VAL A HG22   1  
ATOM   1056  H HG23   . VAL A 1 67  ? 26.409 -6.722  3.727   1.00 0.00 ? 280 VAL A HG23   1  
ATOM   1057  N N      . SER A 1 68  ? 30.380 -9.999  3.649   1.00 0.00 ? 281 SER A N      1  
ATOM   1058  C CA     . SER A 1 68  ? 31.729 -10.539 3.632   1.00 0.00 ? 281 SER A CA     1  
ATOM   1059  C C      . SER A 1 68  ? 32.361 -10.326 2.254   1.00 0.00 ? 281 SER A C      1  
ATOM   1060  O O      . SER A 1 68  ? 31.743 -10.617 1.232   1.00 0.00 ? 281 SER A O      1  
ATOM   1061  C CB     . SER A 1 68  ? 31.732 -12.026 3.992   1.00 0.00 ? 281 SER A CB     1  
ATOM   1062  O OG     . SER A 1 68  ? 32.029 -12.240 5.369   1.00 0.00 ? 281 SER A OG     1  
ATOM   1063  H H      . SER A 1 68  ? 29.782 -10.333 2.919   1.00 0.00 ? 281 SER A H      1  
ATOM   1064  H HA     . SER A 1 68  ? 32.274 -9.980  4.393   1.00 0.00 ? 281 SER A HA     1  
ATOM   1065  H HB2    . SER A 1 68  ? 30.758 -12.457 3.760   1.00 0.00 ? 281 SER A HB2    1  
ATOM   1066  H HB3    . SER A 1 68  ? 32.466 -12.546 3.377   1.00 0.00 ? 281 SER A HB3    1  
ATOM   1067  H HG     . SER A 1 68  ? 31.252 -12.676 5.823   1.00 0.00 ? 281 SER A HG     1  
ATOM   1068  N N      . VAL A 1 69  ? 33.586 -9.818  2.273   1.00 0.00 ? 282 VAL A N      1  
ATOM   1069  C CA     . VAL A 1 69  ? 34.307 -9.562  1.038   1.00 0.00 ? 282 VAL A CA     1  
ATOM   1070  C C      . VAL A 1 69  ? 34.894 -10.875 0.514   1.00 0.00 ? 282 VAL A C      1  
ATOM   1071  O O      . VAL A 1 69  ? 35.319 -11.724 1.295   1.00 0.00 ? 282 VAL A O      1  
ATOM   1072  C CB     . VAL A 1 69  ? 35.367 -8.483  1.266   1.00 0.00 ? 282 VAL A CB     1  
ATOM   1073  C CG1    . VAL A 1 69  ? 36.114 -8.164  -0.031  1.00 0.00 ? 282 VAL A CG1    1  
ATOM   1074  C CG2    . VAL A 1 69  ? 34.744 -7.221  1.865   1.00 0.00 ? 282 VAL A CG2    1  
ATOM   1075  H H      . VAL A 1 69  ? 34.081 -9.584  3.109   1.00 0.00 ? 282 VAL A H      1  
ATOM   1076  H HA     . VAL A 1 69  ? 33.591 -9.183  0.310   1.00 0.00 ? 282 VAL A HA     1  
ATOM   1077  H HB     . VAL A 1 69  ? 36.093 -8.871  1.982   1.00 0.00 ? 282 VAL A HB     1  
ATOM   1078  H HG11   . VAL A 1 69  ? 37.132 -7.856  0.202   1.00 0.00 ? 282 VAL A HG11   1  
ATOM   1079  H HG12   . VAL A 1 69  ? 36.137 -9.051  -0.664  1.00 0.00 ? 282 VAL A HG12   1  
ATOM   1080  H HG13   . VAL A 1 69  ? 35.601 -7.358  -0.556  1.00 0.00 ? 282 VAL A HG13   1  
ATOM   1081  H HG21   . VAL A 1 69  ? 33.710 -7.132  1.531   1.00 0.00 ? 282 VAL A HG21   1  
ATOM   1082  H HG22   . VAL A 1 69  ? 34.771 -7.283  2.953   1.00 0.00 ? 282 VAL A HG22   1  
ATOM   1083  H HG23   . VAL A 1 69  ? 35.308 -6.346  1.538   1.00 0.00 ? 282 VAL A HG23   1  
ATOM   1084  N N      . ALA A 1 70  ? 34.897 -10.999 -0.805  1.00 0.00 ? 283 ALA A N      1  
ATOM   1085  C CA     . ALA A 1 70  ? 35.425 -12.194 -1.442  1.00 0.00 ? 283 ALA A CA     1  
ATOM   1086  C C      . ALA A 1 70  ? 36.912 -11.994 -1.740  1.00 0.00 ? 283 ALA A C      1  
ATOM   1087  O O      . ALA A 1 70  ? 37.272 -11.428 -2.771  1.00 0.00 ? 283 ALA A O      1  
ATOM   1088  C CB     . ALA A 1 70  ? 34.614 -12.500 -2.703  1.00 0.00 ? 283 ALA A CB     1  
ATOM   1089  H H      . ALA A 1 70  ? 34.550 -10.303 -1.433  1.00 0.00 ? 283 ALA A H      1  
ATOM   1090  H HA     . ALA A 1 70  ? 35.311 -13.021 -0.742  1.00 0.00 ? 283 ALA A HA     1  
ATOM   1091  H HB1    . ALA A 1 70  ? 33.611 -12.820 -2.421  1.00 0.00 ? 283 ALA A HB1    1  
ATOM   1092  H HB2    . ALA A 1 70  ? 34.549 -11.604 -3.320  1.00 0.00 ? 283 ALA A HB2    1  
ATOM   1093  H HB3    . ALA A 1 70  ? 35.104 -13.294 -3.267  1.00 0.00 ? 283 ALA A HB3    1  
ATOM   1094  N N      . THR A 1 71  ? 37.736 -12.469 -0.818  1.00 0.00 ? 284 THR A N      1  
ATOM   1095  C CA     . THR A 1 71  ? 39.177 -12.350 -0.969  1.00 0.00 ? 284 THR A CA     1  
ATOM   1096  C C      . THR A 1 71  ? 39.896 -13.169 0.105   1.00 0.00 ? 284 THR A C      1  
ATOM   1097  O O      . THR A 1 71  ? 39.255 -13.752 0.979   1.00 0.00 ? 284 THR A O      1  
ATOM   1098  C CB     . THR A 1 71  ? 39.534 -10.862 -0.938  1.00 0.00 ? 284 THR A CB     1  
ATOM   1099  O OG1    . THR A 1 71  ? 40.346 -10.723 0.225   1.00 0.00 ? 284 THR A OG1    1  
ATOM   1100  C CG2    . THR A 1 71  ? 38.320 -9.974  -0.653  1.00 0.00 ? 284 THR A CG2    1  
ATOM   1101  H H      . THR A 1 71  ? 37.436 -12.928 0.017   1.00 0.00 ? 284 THR A H      1  
ATOM   1102  H HA     . THR A 1 71  ? 39.457 -12.771 -1.934  1.00 0.00 ? 284 THR A HA     1  
ATOM   1103  H HB     . THR A 1 71  ? 40.027 -10.561 -1.862  1.00 0.00 ? 284 THR A HB     1  
ATOM   1104  H HG1    . THR A 1 71  ? 40.824 -9.845  0.205   1.00 0.00 ? 284 THR A HG1    1  
ATOM   1105  H HG21   . THR A 1 71  ? 38.649 -9.054  -0.170  1.00 0.00 ? 284 THR A HG21   1  
ATOM   1106  H HG22   . THR A 1 71  ? 37.817 -9.735  -1.589  1.00 0.00 ? 284 THR A HG22   1  
ATOM   1107  H HG23   . THR A 1 71  ? 37.631 -10.503 0.006   1.00 0.00 ? 284 THR A HG23   1  
ATOM   1108  N N      . PRO A 1 72  ? 41.251 -13.187 0.003   1.00 0.00 ? 285 PRO A N      1  
ATOM   1109  C CA     . PRO A 1 72  ? 42.064 -13.924 0.955   1.00 0.00 ? 285 PRO A CA     1  
ATOM   1110  C C      . PRO A 1 72  ? 42.139 -13.191 2.296   1.00 0.00 ? 285 PRO A C      1  
ATOM   1111  O O      . PRO A 1 72  ? 42.344 -13.813 3.338   1.00 0.00 ? 285 PRO A O      1  
ATOM   1112  C CB     . PRO A 1 72  ? 43.419 -14.075 0.284   1.00 0.00 ? 285 PRO A CB     1  
ATOM   1113  C CG     . PRO A 1 72  ? 43.460 -13.021 -0.812  1.00 0.00 ? 285 PRO A CG     1  
ATOM   1114  C CD     . PRO A 1 72  ? 42.044 -12.507 -1.017  1.00 0.00 ? 285 PRO A CD     1  
ATOM   1115  H HA     . PRO A 1 72  ? 41.648 -14.812 1.153   1.00 0.00 ? 285 PRO A HA     1  
ATOM   1116  H HB2    . PRO A 1 72  ? 44.228 -13.925 0.998   1.00 0.00 ? 285 PRO A HB2    1  
ATOM   1117  H HB3    . PRO A 1 72  ? 43.541 -15.075 -0.132  1.00 0.00 ? 285 PRO A HB3    1  
ATOM   1118  H HG2    . PRO A 1 72  ? 44.126 -12.205 -0.532  1.00 0.00 ? 285 PRO A HG2    1  
ATOM   1119  H HG3    . PRO A 1 72  ? 43.848 -13.448 -1.737  1.00 0.00 ? 285 PRO A HG3    1  
ATOM   1120  H HD2    . PRO A 1 72  ? 41.996 -11.424 -0.900  1.00 0.00 ? 285 PRO A HD2    1  
ATOM   1121  H HD3    . PRO A 1 72  ? 41.681 -12.736 -2.018  1.00 0.00 ? 285 PRO A HD3    1  
ATOM   1122  N N      . ASN A 1 73  ? 41.971 -11.879 2.227   1.00 0.00 ? 286 ASN A N      1  
ATOM   1123  C CA     . ASN A 1 73  ? 42.018 -11.054 3.422   1.00 0.00 ? 286 ASN A CA     1  
ATOM   1124  C C      . ASN A 1 73  ? 40.855 -10.060 3.396   1.00 0.00 ? 286 ASN A C      1  
ATOM   1125  O O      . ASN A 1 73  ? 41.069 -8.848  3.403   1.00 0.00 ? 286 ASN A O      1  
ATOM   1126  C CB     . ASN A 1 73  ? 43.322 -10.255 3.490   1.00 0.00 ? 286 ASN A CB     1  
ATOM   1127  C CG     . ASN A 1 73  ? 44.403 -11.034 4.242   1.00 0.00 ? 286 ASN A CG     1  
ATOM   1128  O OD1    . ASN A 1 73  ? 45.281 -11.648 3.658   1.00 0.00 ? 286 ASN A OD1    1  
ATOM   1129  N ND2    . ASN A 1 73  ? 44.290 -10.975 5.565   1.00 0.00 ? 286 ASN A ND2    1  
ATOM   1130  H H      . ASN A 1 73  ? 41.805 -11.380 1.375   1.00 0.00 ? 286 ASN A H      1  
ATOM   1131  H HA     . ASN A 1 73  ? 41.950 -11.753 4.255   1.00 0.00 ? 286 ASN A HA     1  
ATOM   1132  H HB2    . ASN A 1 73  ? 43.666 -10.028 2.481   1.00 0.00 ? 286 ASN A HB2    1  
ATOM   1133  H HB3    . ASN A 1 73  ? 43.143 -9.302  3.987   1.00 0.00 ? 286 ASN A HB3    1  
ATOM   1134  H HD21   . ASN A 1 73  ? 43.545 -10.454 5.981   1.00 0.00 ? 286 ASN A HD21   1  
ATOM   1135  H HD22   . ASN A 1 73  ? 44.950 -11.453 6.145   1.00 0.00 ? 286 ASN A HD22   1  
ATOM   1136  N N      . PRO A 1 74  ? 39.618 -10.622 3.366   1.00 0.00 ? 287 PRO A N      1  
ATOM   1137  C CA     . PRO A 1 74  ? 38.421 -9.799  3.339   1.00 0.00 ? 287 PRO A CA     1  
ATOM   1138  C C      . PRO A 1 74  ? 38.146 -9.186  4.714   1.00 0.00 ? 287 PRO A C      1  
ATOM   1139  O O      . PRO A 1 74  ? 39.026 -9.159  5.572   1.00 0.00 ? 287 PRO A O      1  
ATOM   1140  C CB     . PRO A 1 74  ? 37.313 -10.730 2.872   1.00 0.00 ? 287 PRO A CB     1  
ATOM   1141  C CG     . PRO A 1 74  ? 37.830 -12.140 3.100   1.00 0.00 ? 287 PRO A CG     1  
ATOM   1142  C CD     . PRO A 1 74  ? 39.326 -12.054 3.357   1.00 0.00 ? 287 PRO A CD     1  
ATOM   1143  H HA     . PRO A 1 74  ? 38.545 -9.027  2.716   1.00 0.00 ? 287 PRO A HA     1  
ATOM   1144  H HB2    . PRO A 1 74  ? 36.395 -10.554 3.431   1.00 0.00 ? 287 PRO A HB2    1  
ATOM   1145  H HB3    . PRO A 1 74  ? 37.083 -10.564 1.819   1.00 0.00 ? 287 PRO A HB3    1  
ATOM   1146  H HG2    . PRO A 1 74  ? 37.324 -12.600 3.948   1.00 0.00 ? 287 PRO A HG2    1  
ATOM   1147  H HG3    . PRO A 1 74  ? 37.628 -12.767 2.231   1.00 0.00 ? 287 PRO A HG3    1  
ATOM   1148  H HD2    . PRO A 1 74  ? 39.593 -12.518 4.306   1.00 0.00 ? 287 PRO A HD2    1  
ATOM   1149  H HD3    . PRO A 1 74  ? 39.892 -12.568 2.580   1.00 0.00 ? 287 PRO A HD3    1  
ATOM   1150  N N      . VAL A 1 75  ? 36.921 -8.710  4.879   1.00 0.00 ? 288 VAL A N      1  
ATOM   1151  C CA     . VAL A 1 75  ? 36.520 -8.098  6.134   1.00 0.00 ? 288 VAL A CA     1  
ATOM   1152  C C      . VAL A 1 75  ? 35.006 -8.246  6.307   1.00 0.00 ? 288 VAL A C      1  
ATOM   1153  O O      . VAL A 1 75  ? 34.295 -8.545  5.350   1.00 0.00 ? 288 VAL A O      1  
ATOM   1154  C CB     . VAL A 1 75  ? 36.987 -6.642  6.181   1.00 0.00 ? 288 VAL A CB     1  
ATOM   1155  C CG1    . VAL A 1 75  ? 36.213 -5.851  7.238   1.00 0.00 ? 288 VAL A CG1    1  
ATOM   1156  C CG2    . VAL A 1 75  ? 38.494 -6.558  6.428   1.00 0.00 ? 288 VAL A CG2    1  
ATOM   1157  H H      . VAL A 1 75  ? 36.211 -8.735  4.176   1.00 0.00 ? 288 VAL A H      1  
ATOM   1158  H HA     . VAL A 1 75  ? 37.019 -8.639  6.938   1.00 0.00 ? 288 VAL A HA     1  
ATOM   1159  H HB     . VAL A 1 75  ? 36.781 -6.193  5.209   1.00 0.00 ? 288 VAL A HB     1  
ATOM   1160  H HG11   . VAL A 1 75  ? 36.382 -6.294  8.219   1.00 0.00 ? 288 VAL A HG11   1  
ATOM   1161  H HG12   . VAL A 1 75  ? 36.556 -4.817  7.241   1.00 0.00 ? 288 VAL A HG12   1  
ATOM   1162  H HG13   . VAL A 1 75  ? 35.147 -5.880  7.005   1.00 0.00 ? 288 VAL A HG13   1  
ATOM   1163  H HG21   . VAL A 1 75  ? 38.806 -7.389  7.059   1.00 0.00 ? 288 VAL A HG21   1  
ATOM   1164  H HG22   . VAL A 1 75  ? 39.022 -6.607  5.475   1.00 0.00 ? 288 VAL A HG22   1  
ATOM   1165  H HG23   . VAL A 1 75  ? 38.729 -5.616  6.925   1.00 0.00 ? 288 VAL A HG23   1  
ATOM   1166  N N      . GLU A 1 76  ? 34.560 -8.031  7.536   1.00 0.00 ? 289 GLU A N      1  
ATOM   1167  C CA     . GLU A 1 76  ? 33.144 -8.137  7.847   1.00 0.00 ? 289 GLU A CA     1  
ATOM   1168  C C      . GLU A 1 76  ? 32.496 -6.752  7.852   1.00 0.00 ? 289 GLU A C      1  
ATOM   1169  O O      . GLU A 1 76  ? 32.885 -5.883  8.632   1.00 0.00 ? 289 GLU A O      1  
ATOM   1170  C CB     . GLU A 1 76  ? 32.928 -8.848  9.185   1.00 0.00 ? 289 GLU A CB     1  
ATOM   1171  C CG     . GLU A 1 76  ? 31.510 -9.413  9.284   1.00 0.00 ? 289 GLU A CG     1  
ATOM   1172  C CD     . GLU A 1 76  ? 31.179 -9.816  10.722  1.00 0.00 ? 289 GLU A CD     1  
ATOM   1173  O OE1    . GLU A 1 76  ? 30.369 -9.150  11.382  1.00 0.00 ? 289 GLU A OE1    1  
ATOM   1174  O OE2    . GLU A 1 76  ? 31.797 -10.865 11.149  1.00 0.00 ? 289 GLU A OE2    1  
ATOM   1175  H H      . GLU A 1 76  ? 35.145 -7.790  8.310   1.00 0.00 ? 289 GLU A H      1  
ATOM   1176  H HA     . GLU A 1 76  ? 32.716 -8.744  7.048   1.00 0.00 ? 289 GLU A HA     1  
ATOM   1177  H HB2    . GLU A 1 76  ? 33.653 -9.655  9.293   1.00 0.00 ? 289 GLU A HB2    1  
ATOM   1178  H HB3    . GLU A 1 76  ? 33.104 -8.150  10.004  1.00 0.00 ? 289 GLU A HB3    1  
ATOM   1179  H HG2    . GLU A 1 76  ? 30.793 -8.668  8.937   1.00 0.00 ? 289 GLU A HG2    1  
ATOM   1180  H HG3    . GLU A 1 76  ? 31.413 -10.278 8.627   1.00 0.00 ? 289 GLU A HG3    1  
ATOM   1181  H HE2    . GLU A 1 76  ? 31.145 -11.501 11.565  1.00 0.00 ? 289 GLU A HE2    1  
ATOM   1182  N N      . LEU A 1 77  ? 31.520 -6.588  6.972   1.00 0.00 ? 290 LEU A N      1  
ATOM   1183  C CA     . LEU A 1 77  ? 30.814 -5.321  6.865   1.00 0.00 ? 290 LEU A CA     1  
ATOM   1184  C C      . LEU A 1 77  ? 29.525 -5.389  7.687   1.00 0.00 ? 290 LEU A C      1  
ATOM   1185  O O      . LEU A 1 77  ? 28.964 -6.467  7.882   1.00 0.00 ? 290 LEU A O      1  
ATOM   1186  C CB     . LEU A 1 77  ? 30.588 -4.957  5.396   1.00 0.00 ? 290 LEU A CB     1  
ATOM   1187  C CG     . LEU A 1 77  ? 31.802 -4.405  4.648   1.00 0.00 ? 290 LEU A CG     1  
ATOM   1188  C CD1    . LEU A 1 77  ? 31.546 -4.364  3.140   1.00 0.00 ? 290 LEU A CD1    1  
ATOM   1189  C CD2    . LEU A 1 77  ? 32.210 -3.037  5.197   1.00 0.00 ? 290 LEU A CD2    1  
ATOM   1190  H H      . LEU A 1 77  ? 31.209 -7.299  6.342   1.00 0.00 ? 290 LEU A H      1  
ATOM   1191  H HA     . LEU A 1 77  ? 31.457 -4.552  7.293   1.00 0.00 ? 290 LEU A HA     1  
ATOM   1192  H HB2    . LEU A 1 77  ? 30.235 -5.845  4.872   1.00 0.00 ? 290 LEU A HB2    1  
ATOM   1193  H HB3    . LEU A 1 77  ? 29.788 -4.218  5.345   1.00 0.00 ? 290 LEU A HB3    1  
ATOM   1194  H HG     . LEU A 1 77  ? 32.642 -5.082  4.812   1.00 0.00 ? 290 LEU A HG     1  
ATOM   1195  H HD11   . LEU A 1 77  ? 32.319 -4.933  2.624   1.00 0.00 ? 290 LEU A HD11   1  
ATOM   1196  H HD12   . LEU A 1 77  ? 30.569 -4.800  2.926   1.00 0.00 ? 290 LEU A HD12   1  
ATOM   1197  H HD13   . LEU A 1 77  ? 31.565 -3.330  2.796   1.00 0.00 ? 290 LEU A HD13   1  
ATOM   1198  H HD21   . LEU A 1 77  ? 33.287 -3.018  5.365   1.00 0.00 ? 290 LEU A HD21   1  
ATOM   1199  H HD22   . LEU A 1 77  ? 31.941 -2.262  4.478   1.00 0.00 ? 290 LEU A HD22   1  
ATOM   1200  H HD23   . LEU A 1 77  ? 31.693 -2.854  6.138   1.00 0.00 ? 290 LEU A HD23   1  
ATOM   1201  N N      . GLY A 1 78  ? 29.094 -4.224  8.147   1.00 0.00 ? 291 GLY A N      1  
ATOM   1202  C CA     . GLY A 1 78  ? 27.881 -4.139  8.944   1.00 0.00 ? 291 GLY A CA     1  
ATOM   1203  C C      . GLY A 1 78  ? 26.936 -3.070  8.391   1.00 0.00 ? 291 GLY A C      1  
ATOM   1204  O O      . GLY A 1 78  ? 27.177 -2.517  7.318   1.00 0.00 ? 291 GLY A O      1  
ATOM   1205  H H      . GLY A 1 78  ? 29.555 -3.353  7.985   1.00 0.00 ? 291 GLY A H      1  
ATOM   1206  H HA2    . GLY A 1 78  ? 27.378 -5.105  8.953   1.00 0.00 ? 291 GLY A HA2    1  
ATOM   1207  H HA3    . GLY A 1 78  ? 28.136 -3.903  9.977   1.00 0.00 ? 291 GLY A HA3    1  
ATOM   1208  N N      . PRO A 1 79  ? 25.852 -2.805  9.166   1.00 0.00 ? 292 PRO A N      1  
ATOM   1209  C CA     . PRO A 1 79  ? 24.869 -1.812  8.765   1.00 0.00 ? 292 PRO A CA     1  
ATOM   1210  C C      . PRO A 1 79  ? 25.406 -0.394  8.969   1.00 0.00 ? 292 PRO A C      1  
ATOM   1211  O O      . PRO A 1 79  ? 26.088 -0.121  9.956   1.00 0.00 ? 292 PRO A O      1  
ATOM   1212  C CB     . PRO A 1 79  ? 23.640 -2.110  9.610   1.00 0.00 ? 292 PRO A CB     1  
ATOM   1213  C CG     . PRO A 1 79  ? 24.131 -2.953  10.776  1.00 0.00 ? 292 PRO A CG     1  
ATOM   1214  C CD     . PRO A 1 79  ? 25.532 -3.438  10.442  1.00 0.00 ? 292 PRO A CD     1  
ATOM   1215  H HA     . PRO A 1 79  ? 24.674 -1.893  7.787   1.00 0.00 ? 292 PRO A HA     1  
ATOM   1216  H HB2    . PRO A 1 79  ? 23.176 -1.189  9.962   1.00 0.00 ? 292 PRO A HB2    1  
ATOM   1217  H HB3    . PRO A 1 79  ? 22.888 -2.645  9.030   1.00 0.00 ? 292 PRO A HB3    1  
ATOM   1218  H HG2    . PRO A 1 79  ? 24.139 -2.367  11.694  1.00 0.00 ? 292 PRO A HG2    1  
ATOM   1219  H HG3    . PRO A 1 79  ? 23.464 -3.799  10.943  1.00 0.00 ? 292 PRO A HG3    1  
ATOM   1220  H HD2    . PRO A 1 79  ? 26.245 -3.153  11.215  1.00 0.00 ? 292 PRO A HD2    1  
ATOM   1221  H HD3    . PRO A 1 79  ? 25.567 -4.526  10.364  1.00 0.00 ? 292 PRO A HD3    1  
ATOM   1222  N N      . GLY A 1 80  ? 25.077 0.471   8.022   1.00 0.00 ? 293 GLY A N      1  
ATOM   1223  C CA     . GLY A 1 80  ? 25.518 1.854   8.086   1.00 0.00 ? 293 GLY A CA     1  
ATOM   1224  C C      . GLY A 1 80  ? 26.837 2.044   7.335   1.00 0.00 ? 293 GLY A C      1  
ATOM   1225  O O      . GLY A 1 80  ? 27.548 3.024   7.558   1.00 0.00 ? 293 GLY A O      1  
ATOM   1226  H H      . GLY A 1 80  ? 24.522 0.241   7.222   1.00 0.00 ? 293 GLY A H      1  
ATOM   1227  H HA2    . GLY A 1 80  ? 24.755 2.503   7.656   1.00 0.00 ? 293 GLY A HA2    1  
ATOM   1228  H HA3    . GLY A 1 80  ? 25.642 2.152   9.127   1.00 0.00 ? 293 GLY A HA3    1  
ATOM   1229  N N      . ALA A 1 81  ? 27.127 1.092   6.460   1.00 0.00 ? 294 ALA A N      1  
ATOM   1230  C CA     . ALA A 1 81  ? 28.348 1.143   5.675   1.00 0.00 ? 294 ALA A CA     1  
ATOM   1231  C C      . ALA A 1 81  ? 27.992 1.188   4.188   1.00 0.00 ? 294 ALA A C      1  
ATOM   1232  O O      . ALA A 1 81  ? 26.949 0.680   3.780   1.00 0.00 ? 294 ALA A O      1  
ATOM   1233  C CB     . ALA A 1 81  ? 29.230 -0.057  6.026   1.00 0.00 ? 294 ALA A CB     1  
ATOM   1234  H H      . ALA A 1 81  ? 26.544 0.298   6.284   1.00 0.00 ? 294 ALA A H      1  
ATOM   1235  H HA     . ALA A 1 81  ? 28.876 2.057   5.942   1.00 0.00 ? 294 ALA A HA     1  
ATOM   1236  H HB1    . ALA A 1 81  ? 29.488 -0.022  7.085   1.00 0.00 ? 294 ALA A HB1    1  
ATOM   1237  H HB2    . ALA A 1 81  ? 28.691 -0.981  5.815   1.00 0.00 ? 294 ALA A HB2    1  
ATOM   1238  H HB3    . ALA A 1 81  ? 30.143 -0.024  5.430   1.00 0.00 ? 294 ALA A HB3    1  
ATOM   1239  N N      . PHE A 1 82  ? 28.880 1.801   3.418   1.00 0.00 ? 295 PHE A N      1  
ATOM   1240  C CA     . PHE A 1 82  ? 28.673 1.919   1.985   1.00 0.00 ? 295 PHE A CA     1  
ATOM   1241  C C      . PHE A 1 82  ? 29.859 1.345   1.210   1.00 0.00 ? 295 PHE A C      1  
ATOM   1242  O O      . PHE A 1 82  ? 31.001 1.435   1.658   1.00 0.00 ? 295 PHE A O      1  
ATOM   1243  C CB     . PHE A 1 82  ? 28.548 3.412   1.673   1.00 0.00 ? 295 PHE A CB     1  
ATOM   1244  C CG     . PHE A 1 82  ? 29.446 4.304   2.533   1.00 0.00 ? 295 PHE A CG     1  
ATOM   1245  C CD1    . PHE A 1 82  ? 29.111 4.559   3.827   1.00 0.00 ? 295 PHE A CD1    1  
ATOM   1246  C CD2    . PHE A 1 82  ? 30.578 4.841   2.005   1.00 0.00 ? 295 PHE A CD2    1  
ATOM   1247  C CE1    . PHE A 1 82  ? 29.944 5.387   4.625   1.00 0.00 ? 295 PHE A CE1    1  
ATOM   1248  C CE2    . PHE A 1 82  ? 31.411 5.669   2.803   1.00 0.00 ? 295 PHE A CE2    1  
ATOM   1249  C CZ     . PHE A 1 82  ? 31.076 5.924   4.096   1.00 0.00 ? 295 PHE A CZ     1  
ATOM   1250  H H      . PHE A 1 82  ? 29.726 2.210   3.757   1.00 0.00 ? 295 PHE A H      1  
ATOM   1251  H HA     . PHE A 1 82  ? 27.773 1.353   1.741   1.00 0.00 ? 295 PHE A HA     1  
ATOM   1252  H HB2    . PHE A 1 82  ? 28.792 3.574   0.623   1.00 0.00 ? 295 PHE A HB2    1  
ATOM   1253  H HB3    . PHE A 1 82  ? 27.511 3.717   1.811   1.00 0.00 ? 295 PHE A HB3    1  
ATOM   1254  H HD1    . PHE A 1 82  ? 28.204 4.128   4.250   1.00 0.00 ? 295 PHE A HD1    1  
ATOM   1255  H HD2    . PHE A 1 82  ? 30.846 4.637   0.968   1.00 0.00 ? 295 PHE A HD2    1  
ATOM   1256  H HE1    . PHE A 1 82  ? 29.676 5.591   5.662   1.00 0.00 ? 295 PHE A HE1    1  
ATOM   1257  H HE2    . PHE A 1 82  ? 32.318 6.100   2.380   1.00 0.00 ? 295 PHE A HE2    1  
ATOM   1258  H HZ     . PHE A 1 82  ? 31.715 6.560   4.710   1.00 0.00 ? 295 PHE A HZ     1  
ATOM   1259  N N      . PHE A 1 83  ? 29.550 0.765   0.059   1.00 0.00 ? 296 PHE A N      1  
ATOM   1260  C CA     . PHE A 1 83  ? 30.577 0.176   -0.783  1.00 0.00 ? 296 PHE A CA     1  
ATOM   1261  C C      . PHE A 1 83  ? 30.184 0.251   -2.260  1.00 0.00 ? 296 PHE A C      1  
ATOM   1262  O O      . PHE A 1 83  ? 29.008 0.398   -2.587  1.00 0.00 ? 296 PHE A O      1  
ATOM   1263  C CB     . PHE A 1 83  ? 30.701 -1.294  -0.375  1.00 0.00 ? 296 PHE A CB     1  
ATOM   1264  C CG     . PHE A 1 83  ? 29.366 -2.037  -0.313  1.00 0.00 ? 296 PHE A CG     1  
ATOM   1265  C CD1    . PHE A 1 83  ? 28.475 -1.753  0.676   1.00 0.00 ? 296 PHE A CD1    1  
ATOM   1266  C CD2    . PHE A 1 83  ? 29.070 -2.983  -1.244  1.00 0.00 ? 296 PHE A CD2    1  
ATOM   1267  C CE1    . PHE A 1 83  ? 27.236 -2.444  0.734   1.00 0.00 ? 296 PHE A CE1    1  
ATOM   1268  C CE2    . PHE A 1 83  ? 27.830 -3.673  -1.185  1.00 0.00 ? 296 PHE A CE2    1  
ATOM   1269  C CZ     . PHE A 1 83  ? 26.939 -3.389  -0.198  1.00 0.00 ? 296 PHE A CZ     1  
ATOM   1270  H H      . PHE A 1 83  ? 28.618 0.695   -0.299  1.00 0.00 ? 296 PHE A H      1  
ATOM   1271  H HA     . PHE A 1 83  ? 31.492 0.746   -0.622  1.00 0.00 ? 296 PHE A HA     1  
ATOM   1272  H HB2    . PHE A 1 83  ? 31.357 -1.802  -1.083  1.00 0.00 ? 296 PHE A HB2    1  
ATOM   1273  H HB3    . PHE A 1 83  ? 31.182 -1.349  0.602   1.00 0.00 ? 296 PHE A HB3    1  
ATOM   1274  H HD1    . PHE A 1 83  ? 28.712 -0.995  1.421   1.00 0.00 ? 296 PHE A HD1    1  
ATOM   1275  H HD2    . PHE A 1 83  ? 29.784 -3.211  -2.035  1.00 0.00 ? 296 PHE A HD2    1  
ATOM   1276  H HE1    . PHE A 1 83  ? 26.521 -2.215  1.525   1.00 0.00 ? 296 PHE A HE1    1  
ATOM   1277  H HE2    . PHE A 1 83  ? 27.593 -4.431  -1.932  1.00 0.00 ? 296 PHE A HE2    1  
ATOM   1278  H HZ     . PHE A 1 83  ? 25.988 -3.918  -0.153  1.00 0.00 ? 296 PHE A HZ     1  
ATOM   1279  N N      . GLY A 1 84  ? 31.193 0.147   -3.113  1.00 0.00 ? 297 GLY A N      1  
ATOM   1280  C CA     . GLY A 1 84  ? 30.969 0.202   -4.548  1.00 0.00 ? 297 GLY A CA     1  
ATOM   1281  C C      . GLY A 1 84  ? 30.878 1.650   -5.034  1.00 0.00 ? 297 GLY A C      1  
ATOM   1282  O O      . GLY A 1 84  ? 30.139 1.948   -5.971  1.00 0.00 ? 297 GLY A O      1  
ATOM   1283  H H      . GLY A 1 84  ? 32.148 0.027   -2.839  1.00 0.00 ? 297 GLY A H      1  
ATOM   1284  H HA2    . GLY A 1 84  ? 31.779 -0.310  -5.066  1.00 0.00 ? 297 GLY A HA2    1  
ATOM   1285  H HA3    . GLY A 1 84  ? 30.048 -0.327  -4.796  1.00 0.00 ? 297 GLY A HA3    1  
ATOM   1286  N N      . GLU A 1 85  ? 31.641 2.510   -4.375  1.00 0.00 ? 298 GLU A N      1  
ATOM   1287  C CA     . GLU A 1 85  ? 31.656 3.919   -4.729  1.00 0.00 ? 298 GLU A CA     1  
ATOM   1288  C C      . GLU A 1 85  ? 32.931 4.257   -5.504  1.00 0.00 ? 298 GLU A C      1  
ATOM   1289  O O      . GLU A 1 85  ? 32.984 5.265   -6.209  1.00 0.00 ? 298 GLU A O      1  
ATOM   1290  C CB     . GLU A 1 85  ? 31.522 4.798   -3.483  1.00 0.00 ? 298 GLU A CB     1  
ATOM   1291  C CG     . GLU A 1 85  ? 32.694 4.574   -2.526  1.00 0.00 ? 298 GLU A CG     1  
ATOM   1292  C CD     . GLU A 1 85  ? 32.404 3.419   -1.565  1.00 0.00 ? 298 GLU A CD     1  
ATOM   1293  O OE1    . GLU A 1 85  ? 31.293 3.327   -1.022  1.00 0.00 ? 298 GLU A OE1    1  
ATOM   1294  O OE2    . GLU A 1 85  ? 33.382 2.596   -1.393  1.00 0.00 ? 298 GLU A OE2    1  
ATOM   1295  H H      . GLU A 1 85  ? 32.238 2.258   -3.614  1.00 0.00 ? 298 GLU A H      1  
ATOM   1296  H HA     . GLU A 1 85  ? 30.785 4.067   -5.366  1.00 0.00 ? 298 GLU A HA     1  
ATOM   1297  H HB2    . GLU A 1 85  ? 31.483 5.848   -3.777  1.00 0.00 ? 298 GLU A HB2    1  
ATOM   1298  H HB3    . GLU A 1 85  ? 30.585 4.574   -2.975  1.00 0.00 ? 298 GLU A HB3    1  
ATOM   1299  H HG2    . GLU A 1 85  ? 33.598 4.360   -3.095  1.00 0.00 ? 298 GLU A HG2    1  
ATOM   1300  H HG3    . GLU A 1 85  ? 32.883 5.485   -1.957  1.00 0.00 ? 298 GLU A HG3    1  
ATOM   1301  H HE2    . GLU A 1 85  ? 33.070 1.657   -1.543  1.00 0.00 ? 298 GLU A HE2    1  
ATOM   1302  N N      . MET A 1 86  ? 33.927 3.397   -5.349  1.00 0.00 ? 299 MET A N      1  
ATOM   1303  C CA     . MET A 1 86  ? 35.197 3.592   -6.026  1.00 0.00 ? 299 MET A CA     1  
ATOM   1304  C C      . MET A 1 86  ? 35.010 3.624   -7.544  1.00 0.00 ? 299 MET A C      1  
ATOM   1305  O O      . MET A 1 86  ? 35.679 4.387   -8.240  1.00 0.00 ? 299 MET A O      1  
ATOM   1306  C CB     . MET A 1 86  ? 36.154 2.459   -5.652  1.00 0.00 ? 299 MET A CB     1  
ATOM   1307  C CG     . MET A 1 86  ? 37.521 3.009   -5.239  1.00 0.00 ? 299 MET A CG     1  
ATOM   1308  S SD     . MET A 1 86  ? 38.283 3.850   -6.616  1.00 0.00 ? 299 MET A SD     1  
ATOM   1309  C CE     . MET A 1 86  ? 39.717 2.814   -6.856  1.00 0.00 ? 299 MET A CE     1  
ATOM   1310  H H      . MET A 1 86  ? 33.875 2.580   -4.774  1.00 0.00 ? 299 MET A H      1  
ATOM   1311  H HA     . MET A 1 86  ? 35.569 4.557   -5.679  1.00 0.00 ? 299 MET A HA     1  
ATOM   1312  H HB2    . MET A 1 86  ? 35.730 1.875   -4.835  1.00 0.00 ? 299 MET A HB2    1  
ATOM   1313  H HB3    . MET A 1 86  ? 36.271 1.783   -6.499  1.00 0.00 ? 299 MET A HB3    1  
ATOM   1314  H HG2    . MET A 1 86  ? 37.407 3.697   -4.400  1.00 0.00 ? 299 MET A HG2    1  
ATOM   1315  H HG3    . MET A 1 86  ? 38.162 2.196   -4.898  1.00 0.00 ? 299 MET A HG3    1  
ATOM   1316  H HE1    . MET A 1 86  ? 39.656 1.950   -6.195  1.00 0.00 ? 299 MET A HE1    1  
ATOM   1317  H HE2    . MET A 1 86  ? 39.755 2.478   -7.892  1.00 0.00 ? 299 MET A HE2    1  
ATOM   1318  H HE3    . MET A 1 86  ? 40.618 3.383   -6.626  1.00 0.00 ? 299 MET A HE3    1  
ATOM   1319  N N      . ALA A 1 87  ? 34.098 2.785   -8.014  1.00 0.00 ? 300 ALA A N      1  
ATOM   1320  C CA     . ALA A 1 87  ? 33.816 2.706   -9.437  1.00 0.00 ? 300 ALA A CA     1  
ATOM   1321  C C      . ALA A 1 87  ? 33.026 3.946   -9.864  1.00 0.00 ? 300 ALA A C      1  
ATOM   1322  O O      . ALA A 1 87  ? 33.333 4.559   -10.885 1.00 0.00 ? 300 ALA A O      1  
ATOM   1323  C CB     . ALA A 1 87  ? 33.068 1.406   -9.738  1.00 0.00 ? 300 ALA A CB     1  
ATOM   1324  H H      . ALA A 1 87  ? 33.559 2.168   -7.441  1.00 0.00 ? 300 ALA A H      1  
ATOM   1325  H HA     . ALA A 1 87  ? 34.770 2.693   -9.964  1.00 0.00 ? 300 ALA A HA     1  
ATOM   1326  H HB1    . ALA A 1 87  ? 32.390 1.562   -10.577 1.00 0.00 ? 300 ALA A HB1    1  
ATOM   1327  H HB2    . ALA A 1 87  ? 33.785 0.625   -9.991  1.00 0.00 ? 300 ALA A HB2    1  
ATOM   1328  H HB3    . ALA A 1 87  ? 32.496 1.105   -8.860  1.00 0.00 ? 300 ALA A HB3    1  
ATOM   1329  N N      . LEU A 1 88  ? 32.025 4.276   -9.062  1.00 0.00 ? 301 LEU A N      1  
ATOM   1330  C CA     . LEU A 1 88  ? 31.190 5.431   -9.344  1.00 0.00 ? 301 LEU A CA     1  
ATOM   1331  C C      . LEU A 1 88  ? 31.960 6.708   -9.005  1.00 0.00 ? 301 LEU A C      1  
ATOM   1332  O O      . LEU A 1 88  ? 31.521 7.809   -9.333  1.00 0.00 ? 301 LEU A O      1  
ATOM   1333  C CB     . LEU A 1 88  ? 29.847 5.312   -8.618  1.00 0.00 ? 301 LEU A CB     1  
ATOM   1334  C CG     . LEU A 1 88  ? 28.964 4.133   -9.031  1.00 0.00 ? 301 LEU A CG     1  
ATOM   1335  C CD1    . LEU A 1 88  ? 27.644 4.141   -8.258  1.00 0.00 ? 301 LEU A CD1    1  
ATOM   1336  C CD2    . LEU A 1 88  ? 28.743 4.117   -10.545 1.00 0.00 ? 301 LEU A CD2    1  
ATOM   1337  H H      . LEU A 1 88  ? 31.782 3.772   -8.233  1.00 0.00 ? 301 LEU A H      1  
ATOM   1338  H HA     . LEU A 1 88  ? 30.979 5.428   -10.414 1.00 0.00 ? 301 LEU A HA     1  
ATOM   1339  H HB2    . LEU A 1 88  ? 30.042 5.238   -7.548  1.00 0.00 ? 301 LEU A HB2    1  
ATOM   1340  H HB3    . LEU A 1 88  ? 29.288 6.233   -8.778  1.00 0.00 ? 301 LEU A HB3    1  
ATOM   1341  H HG     . LEU A 1 88  ? 29.484 3.210   -8.771  1.00 0.00 ? 301 LEU A HG     1  
ATOM   1342  H HD11   . LEU A 1 88  ? 26.827 3.882   -8.933  1.00 0.00 ? 301 LEU A HD11   1  
ATOM   1343  H HD12   . LEU A 1 88  ? 27.692 3.412   -7.449  1.00 0.00 ? 301 LEU A HD12   1  
ATOM   1344  H HD13   . LEU A 1 88  ? 27.472 5.134   -7.843  1.00 0.00 ? 301 LEU A HD13   1  
ATOM   1345  H HD21   . LEU A 1 88  ? 29.644 3.755   -11.040 1.00 0.00 ? 301 LEU A HD21   1  
ATOM   1346  H HD22   . LEU A 1 88  ? 27.908 3.458   -10.782 1.00 0.00 ? 301 LEU A HD22   1  
ATOM   1347  H HD23   . LEU A 1 88  ? 28.520 5.127   -10.889 1.00 0.00 ? 301 LEU A HD23   1  
ATOM   1348  N N      . ILE A 1 89  ? 33.098 6.519   -8.353  1.00 0.00 ? 302 ILE A N      1  
ATOM   1349  C CA     . ILE A 1 89  ? 33.935 7.643   -7.967  1.00 0.00 ? 302 ILE A CA     1  
ATOM   1350  C C      . ILE A 1 89  ? 34.856 8.011   -9.131  1.00 0.00 ? 302 ILE A C      1  
ATOM   1351  O O      . ILE A 1 89  ? 35.078 9.190   -9.403  1.00 0.00 ? 302 ILE A O      1  
ATOM   1352  C CB     . ILE A 1 89  ? 34.681 7.333   -6.667  1.00 0.00 ? 302 ILE A CB     1  
ATOM   1353  C CG1    . ILE A 1 89  ? 33.808 7.639   -5.448  1.00 0.00 ? 302 ILE A CG1    1  
ATOM   1354  C CG2    . ILE A 1 89  ? 36.020 8.071   -6.613  1.00 0.00 ? 302 ILE A CG2    1  
ATOM   1355  C CD1    . ILE A 1 89  ? 34.283 6.856   -4.223  1.00 0.00 ? 302 ILE A CD1    1  
ATOM   1356  H H      . ILE A 1 89  ? 33.450 5.620   -8.090  1.00 0.00 ? 302 ILE A H      1  
ATOM   1357  H HA     . ILE A 1 89  ? 33.276 8.487   -7.767  1.00 0.00 ? 302 ILE A HA     1  
ATOM   1358  H HB     . ILE A 1 89  ? 34.901 6.265   -6.645  1.00 0.00 ? 302 ILE A HB     1  
ATOM   1359  H HG12   . ILE A 1 89  ? 33.837 8.707   -5.234  1.00 0.00 ? 302 ILE A HG12   1  
ATOM   1360  H HG13   . ILE A 1 89  ? 32.771 7.385   -5.666  1.00 0.00 ? 302 ILE A HG13   1  
ATOM   1361  H HG21   . ILE A 1 89  ? 35.857 9.131   -6.810  1.00 0.00 ? 302 ILE A HG21   1  
ATOM   1362  H HG22   . ILE A 1 89  ? 36.463 7.950   -5.625  1.00 0.00 ? 302 ILE A HG22   1  
ATOM   1363  H HG23   . ILE A 1 89  ? 36.692 7.660   -7.367  1.00 0.00 ? 302 ILE A HG23   1  
ATOM   1364  H HD11   . ILE A 1 89  ? 35.222 7.279   -3.863  1.00 0.00 ? 302 ILE A HD11   1  
ATOM   1365  H HD12   . ILE A 1 89  ? 33.532 6.919   -3.436  1.00 0.00 ? 302 ILE A HD12   1  
ATOM   1366  H HD13   . ILE A 1 89  ? 34.437 5.812   -4.495  1.00 0.00 ? 302 ILE A HD13   1  
ATOM   1367  N N      . SER A 1 90  ? 35.369 6.980   -9.788  1.00 0.00 ? 303 SER A N      1  
ATOM   1368  C CA     . SER A 1 90  ? 36.261 7.181   -10.916 1.00 0.00 ? 303 SER A CA     1  
ATOM   1369  C C      . SER A 1 90  ? 35.715 6.461   -12.150 1.00 0.00 ? 303 SER A C      1  
ATOM   1370  O O      . SER A 1 90  ? 35.508 7.080   -13.194 1.00 0.00 ? 303 SER A O      1  
ATOM   1371  C CB     . SER A 1 90  ? 37.674 6.688   -10.596 1.00 0.00 ? 303 SER A CB     1  
ATOM   1372  O OG     . SER A 1 90  ? 38.652 7.705   -10.794 1.00 0.00 ? 303 SER A OG     1  
ATOM   1373  H H      . SER A 1 90  ? 35.184 6.025   -9.560  1.00 0.00 ? 303 SER A H      1  
ATOM   1374  H HA     . SER A 1 90  ? 36.282 8.258   -11.080 1.00 0.00 ? 303 SER A HA     1  
ATOM   1375  H HB2    . SER A 1 90  ? 37.712 6.343   -9.563  1.00 0.00 ? 303 SER A HB2    1  
ATOM   1376  H HB3    . SER A 1 90  ? 37.909 5.831   -11.227 1.00 0.00 ? 303 SER A HB3    1  
ATOM   1377  H HG     . SER A 1 90  ? 38.354 8.332   -11.513 1.00 0.00 ? 303 SER A HG     1  
ATOM   1378  N N      . GLY A 1 91  ? 35.495 5.164   -11.991 1.00 0.00 ? 304 GLY A N      1  
ATOM   1379  C CA     . GLY A 1 91  ? 34.975 4.354   -13.080 1.00 0.00 ? 304 GLY A CA     1  
ATOM   1380  C C      . GLY A 1 91  ? 35.677 2.995   -13.133 1.00 0.00 ? 304 GLY A C      1  
ATOM   1381  O O      . GLY A 1 91  ? 35.266 2.110   -13.882 1.00 0.00 ? 304 GLY A O      1  
ATOM   1382  H H      . GLY A 1 91  ? 35.665 4.669   -11.139 1.00 0.00 ? 304 GLY A H      1  
ATOM   1383  H HA2    . GLY A 1 91  ? 33.903 4.209   -12.950 1.00 0.00 ? 304 GLY A HA2    1  
ATOM   1384  H HA3    . GLY A 1 91  ? 35.115 4.877   -14.026 1.00 0.00 ? 304 GLY A HA3    1  
ATOM   1385  N N      . GLU A 1 92  ? 36.725 2.873   -12.331 1.00 0.00 ? 305 GLU A N      1  
ATOM   1386  C CA     . GLU A 1 92  ? 37.487 1.637   -12.279 1.00 0.00 ? 305 GLU A CA     1  
ATOM   1387  C C      . GLU A 1 92  ? 36.567 0.460   -11.949 1.00 0.00 ? 305 GLU A C      1  
ATOM   1388  O O      . GLU A 1 92  ? 35.478 0.651   -11.410 1.00 0.00 ? 305 GLU A O      1  
ATOM   1389  C CB     . GLU A 1 92  ? 38.630 1.741   -11.268 1.00 0.00 ? 305 GLU A CB     1  
ATOM   1390  C CG     . GLU A 1 92  ? 39.819 2.501   -11.859 1.00 0.00 ? 305 GLU A CG     1  
ATOM   1391  C CD     . GLU A 1 92  ? 41.029 1.580   -12.029 1.00 0.00 ? 305 GLU A CD     1  
ATOM   1392  O OE1    . GLU A 1 92  ? 40.947 0.576   -12.753 1.00 0.00 ? 305 GLU A OE1    1  
ATOM   1393  O OE2    . GLU A 1 92  ? 42.083 1.939   -11.378 1.00 0.00 ? 305 GLU A OE2    1  
ATOM   1394  H H      . GLU A 1 92  ? 37.053 3.598   -11.726 1.00 0.00 ? 305 GLU A H      1  
ATOM   1395  H HA     . GLU A 1 92  ? 37.904 1.512   -13.278 1.00 0.00 ? 305 GLU A HA     1  
ATOM   1396  H HB2    . GLU A 1 92  ? 38.280 2.249   -10.369 1.00 0.00 ? 305 GLU A HB2    1  
ATOM   1397  H HB3    . GLU A 1 92  ? 38.945 0.742   -10.966 1.00 0.00 ? 305 GLU A HB3    1  
ATOM   1398  H HG2    . GLU A 1 92  ? 39.540 2.923   -12.825 1.00 0.00 ? 305 GLU A HG2    1  
ATOM   1399  H HG3    . GLU A 1 92  ? 40.082 3.336   -11.210 1.00 0.00 ? 305 GLU A HG3    1  
ATOM   1400  H HE2    . GLU A 1 92  ? 42.077 1.529   -10.466 1.00 0.00 ? 305 GLU A HE2    1  
ATOM   1401  N N      . PRO A 1 93  ? 37.052 -0.763  -12.294 1.00 0.00 ? 306 PRO A N      1  
ATOM   1402  C CA     . PRO A 1 93  ? 36.286 -1.971  -12.040 1.00 0.00 ? 306 PRO A CA     1  
ATOM   1403  C C      . PRO A 1 93  ? 36.320 -2.338  -10.555 1.00 0.00 ? 306 PRO A C      1  
ATOM   1404  O O      . PRO A 1 93  ? 37.193 -1.884  -9.819  1.00 0.00 ? 306 PRO A O      1  
ATOM   1405  C CB     . PRO A 1 93  ? 36.916 -3.030  -12.929 1.00 0.00 ? 306 PRO A CB     1  
ATOM   1406  C CG     . PRO A 1 93  ? 38.294 -2.502  -13.294 1.00 0.00 ? 306 PRO A CG     1  
ATOM   1407  C CD     . PRO A 1 93  ? 38.338 -1.027  -12.933 1.00 0.00 ? 306 PRO A CD     1  
ATOM   1408  H HA     . PRO A 1 93  ? 35.323 -1.825  -12.264 1.00 0.00 ? 306 PRO A HA     1  
ATOM   1409  H HB2    . PRO A 1 93  ? 36.991 -3.984  -12.406 1.00 0.00 ? 306 PRO A HB2    1  
ATOM   1410  H HB3    . PRO A 1 93  ? 36.313 -3.201  -13.821 1.00 0.00 ? 306 PRO A HB3    1  
ATOM   1411  H HG2    . PRO A 1 93  ? 39.068 -3.050  -12.758 1.00 0.00 ? 306 PRO A HG2    1  
ATOM   1412  H HG3    . PRO A 1 93  ? 38.485 -2.640  -14.359 1.00 0.00 ? 306 PRO A HG3    1  
ATOM   1413  H HD2    . PRO A 1 93  ? 39.167 -0.809  -12.260 1.00 0.00 ? 306 PRO A HD2    1  
ATOM   1414  H HD3    . PRO A 1 93  ? 38.475 -0.405  -13.819 1.00 0.00 ? 306 PRO A HD3    1  
ATOM   1415  N N      . ARG A 1 94  ? 35.356 -3.158  -10.160 1.00 0.00 ? 307 ARG A N      1  
ATOM   1416  C CA     . ARG A 1 94  ? 35.264 -3.592  -8.776  1.00 0.00 ? 307 ARG A CA     1  
ATOM   1417  C C      . ARG A 1 94  ? 36.657 -3.898  -8.222  1.00 0.00 ? 307 ARG A C      1  
ATOM   1418  O O      . ARG A 1 94  ? 37.331 -4.810  -8.697  1.00 0.00 ? 307 ARG A O      1  
ATOM   1419  C CB     . ARG A 1 94  ? 34.387 -4.839  -8.647  1.00 0.00 ? 307 ARG A CB     1  
ATOM   1420  C CG     . ARG A 1 94  ? 32.984 -4.475  -8.155  1.00 0.00 ? 307 ARG A CG     1  
ATOM   1421  C CD     . ARG A 1 94  ? 32.285 -3.534  -9.139  1.00 0.00 ? 307 ARG A CD     1  
ATOM   1422  N NE     . ARG A 1 94  ? 32.009 -2.234  -8.488  1.00 0.00 ? 307 ARG A NE     1  
ATOM   1423  C CZ     . ARG A 1 94  ? 30.898 -1.964  -7.790  1.00 0.00 ? 307 ARG A CZ     1  
ATOM   1424  N NH1    . ARG A 1 94  ? 29.951 -2.901  -7.650  1.00 0.00 ? 307 ARG A NH1    1  
ATOM   1425  N NH2    . ARG A 1 94  ? 30.733 -0.756  -7.233  1.00 0.00 ? 307 ARG A NH2    1  
ATOM   1426  H H      . ARG A 1 94  ? 34.649 -3.523  -10.765 1.00 0.00 ? 307 ARG A H      1  
ATOM   1427  H HA     . ARG A 1 94  ? 34.808 -2.753  -8.251  1.00 0.00 ? 307 ARG A HA     1  
ATOM   1428  H HB2    . ARG A 1 94  ? 34.318 -5.341  -9.612  1.00 0.00 ? 307 ARG A HB2    1  
ATOM   1429  H HB3    . ARG A 1 94  ? 34.848 -5.543  -7.954  1.00 0.00 ? 307 ARG A HB3    1  
ATOM   1430  H HG2    . ARG A 1 94  ? 32.393 -5.380  -8.029  1.00 0.00 ? 307 ARG A HG2    1  
ATOM   1431  H HG3    . ARG A 1 94  ? 33.051 -3.998  -7.176  1.00 0.00 ? 307 ARG A HG3    1  
ATOM   1432  H HD2    . ARG A 1 94  ? 32.911 -3.384  -10.019 1.00 0.00 ? 307 ARG A HD2    1  
ATOM   1433  H HD3    . ARG A 1 94  ? 31.353 -3.983  -9.483  1.00 0.00 ? 307 ARG A HD3    1  
ATOM   1434  H HE     . ARG A 1 94  ? 32.697 -1.512  -8.573  1.00 0.00 ? 307 ARG A HE     1  
ATOM   1435  H HH11   . ARG A 1 94  ? 30.074 -3.802  -8.064  1.00 0.00 ? 307 ARG A HH11   1  
ATOM   1436  H HH12   . ARG A 1 94  ? 29.121 -2.699  -7.129  1.00 0.00 ? 307 ARG A HH12   1  
ATOM   1437  H HH21   . ARG A 1 94  ? 31.440 -0.056  -7.338  1.00 0.00 ? 307 ARG A HH21   1  
ATOM   1438  H HH22   . ARG A 1 94  ? 29.904 -0.554  -6.713  1.00 0.00 ? 307 ARG A HH22   1  
ATOM   1439  N N      . SER A 1 95  ? 37.046 -3.118  -7.224  1.00 0.00 ? 308 SER A N      1  
ATOM   1440  C CA     . SER A 1 95  ? 38.346 -3.294  -6.600  1.00 0.00 ? 308 SER A CA     1  
ATOM   1441  C C      . SER A 1 95  ? 38.451 -4.694  -5.993  1.00 0.00 ? 308 SER A C      1  
ATOM   1442  O O      . SER A 1 95  ? 39.548 -5.228  -5.841  1.00 0.00 ? 308 SER A O      1  
ATOM   1443  C CB     . SER A 1 95  ? 38.591 -2.230  -5.527  1.00 0.00 ? 308 SER A CB     1  
ATOM   1444  O OG     . SER A 1 95  ? 37.382 -1.830  -4.887  1.00 0.00 ? 308 SER A OG     1  
ATOM   1445  H H      . SER A 1 95  ? 36.491 -2.378  -6.843  1.00 0.00 ? 308 SER A H      1  
ATOM   1446  H HA     . SER A 1 95  ? 39.072 -3.170  -7.404  1.00 0.00 ? 308 SER A HA     1  
ATOM   1447  H HB2    . SER A 1 95  ? 39.283 -2.621  -4.782  1.00 0.00 ? 308 SER A HB2    1  
ATOM   1448  H HB3    . SER A 1 95  ? 39.067 -1.361  -5.980  1.00 0.00 ? 308 SER A HB3    1  
ATOM   1449  H HG     . SER A 1 95  ? 36.981 -1.052  -5.370  1.00 0.00 ? 308 SER A HG     1  
ATOM   1450  N N      . ALA A 1 96  ? 37.293 -5.249  -5.663  1.00 0.00 ? 309 ALA A N      1  
ATOM   1451  C CA     . ALA A 1 96  ? 37.241 -6.577  -5.076  1.00 0.00 ? 309 ALA A CA     1  
ATOM   1452  C C      . ALA A 1 96  ? 35.808 -7.109  -5.156  1.00 0.00 ? 309 ALA A C      1  
ATOM   1453  O O      . ALA A 1 96  ? 34.865 -6.338  -5.324  1.00 0.00 ? 309 ALA A O      1  
ATOM   1454  C CB     . ALA A 1 96  ? 37.763 -6.521  -3.639  1.00 0.00 ? 309 ALA A CB     1  
ATOM   1455  H H      . ALA A 1 96  ? 36.406 -4.807  -5.791  1.00 0.00 ? 309 ALA A H      1  
ATOM   1456  H HA     . ALA A 1 96  ? 37.893 -7.225  -5.662  1.00 0.00 ? 309 ALA A HA     1  
ATOM   1457  H HB1    . ALA A 1 96  ? 38.808 -6.829  -3.620  1.00 0.00 ? 309 ALA A HB1    1  
ATOM   1458  H HB2    . ALA A 1 96  ? 37.676 -5.504  -3.261  1.00 0.00 ? 309 ALA A HB2    1  
ATOM   1459  H HB3    . ALA A 1 96  ? 37.175 -7.192  -3.013  1.00 0.00 ? 309 ALA A HB3    1  
ATOM   1460  N N      . THR A 1 97  ? 35.690 -8.423  -5.032  1.00 0.00 ? 310 THR A N      1  
ATOM   1461  C CA     . THR A 1 97  ? 34.389 -9.067  -5.089  1.00 0.00 ? 310 THR A CA     1  
ATOM   1462  C C      . THR A 1 97  ? 33.672 -8.938  -3.743  1.00 0.00 ? 310 THR A C      1  
ATOM   1463  O O      . THR A 1 97  ? 34.276 -9.146  -2.692  1.00 0.00 ? 310 THR A O      1  
ATOM   1464  C CB     . THR A 1 97  ? 34.598 -10.516 -5.531  1.00 0.00 ? 310 THR A CB     1  
ATOM   1465  O OG1    . THR A 1 97  ? 34.776 -10.427 -6.941  1.00 0.00 ? 310 THR A OG1    1  
ATOM   1466  C CG2    . THR A 1 97  ? 33.335 -11.365 -5.368  1.00 0.00 ? 310 THR A CG2    1  
ATOM   1467  H H      . THR A 1 97  ? 36.463 -9.043  -4.897  1.00 0.00 ? 310 THR A H      1  
ATOM   1468  H HA     . THR A 1 97  ? 33.780 -8.545  -5.826  1.00 0.00 ? 310 THR A HA     1  
ATOM   1469  H HB     . THR A 1 97  ? 35.439 -10.966 -5.005  1.00 0.00 ? 310 THR A HB     1  
ATOM   1470  H HG1    . THR A 1 97  ? 35.165 -11.279 -7.291  1.00 0.00 ? 310 THR A HG1    1  
ATOM   1471  H HG21   . THR A 1 97  ? 32.616 -11.099 -6.143  1.00 0.00 ? 310 THR A HG21   1  
ATOM   1472  H HG22   . THR A 1 97  ? 33.593 -12.420 -5.458  1.00 0.00 ? 310 THR A HG22   1  
ATOM   1473  H HG23   . THR A 1 97  ? 32.897 -11.180 -4.387  1.00 0.00 ? 310 THR A HG23   1  
ATOM   1474  N N      . VAL A 1 98  ? 32.395 -8.596  -3.820  1.00 0.00 ? 311 VAL A N      1  
ATOM   1475  C CA     . VAL A 1 98  ? 31.589 -8.438  -2.621  1.00 0.00 ? 311 VAL A CA     1  
ATOM   1476  C C      . VAL A 1 98  ? 30.455 -9.463  -2.635  1.00 0.00 ? 311 VAL A C      1  
ATOM   1477  O O      . VAL A 1 98  ? 29.774 -9.628  -3.646  1.00 0.00 ? 311 VAL A O      1  
ATOM   1478  C CB     . VAL A 1 98  ? 31.090 -6.995  -2.513  1.00 0.00 ? 311 VAL A CB     1  
ATOM   1479  C CG1    . VAL A 1 98  ? 29.815 -6.918  -1.670  1.00 0.00 ? 311 VAL A CG1    1  
ATOM   1480  C CG2    . VAL A 1 98  ? 32.177 -6.080  -1.949  1.00 0.00 ? 311 VAL A CG2    1  
ATOM   1481  H H      . VAL A 1 98  ? 31.911 -8.429  -4.680  1.00 0.00 ? 311 VAL A H      1  
ATOM   1482  H HA     . VAL A 1 98  ? 32.232 -8.637  -1.764  1.00 0.00 ? 311 VAL A HA     1  
ATOM   1483  H HB     . VAL A 1 98  ? 30.848 -6.648  -3.517  1.00 0.00 ? 311 VAL A HB     1  
ATOM   1484  H HG11   . VAL A 1 98  ? 30.042 -7.199  -0.641  1.00 0.00 ? 311 VAL A HG11   1  
ATOM   1485  H HG12   . VAL A 1 98  ? 29.426 -5.900  -1.692  1.00 0.00 ? 311 VAL A HG12   1  
ATOM   1486  H HG13   . VAL A 1 98  ? 29.069 -7.602  -2.076  1.00 0.00 ? 311 VAL A HG13   1  
ATOM   1487  H HG21   . VAL A 1 98  ? 31.875 -5.719  -0.966  1.00 0.00 ? 311 VAL A HG21   1  
ATOM   1488  H HG22   . VAL A 1 98  ? 33.111 -6.635  -1.861  1.00 0.00 ? 311 VAL A HG22   1  
ATOM   1489  H HG23   . VAL A 1 98  ? 32.320 -5.230  -2.617  1.00 0.00 ? 311 VAL A HG23   1  
ATOM   1490  N N      . SER A 1 99  ? 30.286 -10.128 -1.501  1.00 0.00 ? 312 SER A N      1  
ATOM   1491  C CA     . SER A 1 99  ? 29.246 -11.134 -1.370  1.00 0.00 ? 312 SER A CA     1  
ATOM   1492  C C      . SER A 1 99  ? 28.588 -11.030 0.007   1.00 0.00 ? 312 SER A C      1  
ATOM   1493  O O      . SER A 1 99  ? 29.275 -11.002 1.026   1.00 0.00 ? 312 SER A O      1  
ATOM   1494  C CB     . SER A 1 99  ? 29.810 -12.540 -1.584  1.00 0.00 ? 312 SER A CB     1  
ATOM   1495  O OG     . SER A 1 99  ? 30.753 -12.897 -0.575  1.00 0.00 ? 312 SER A OG     1  
ATOM   1496  H H      . SER A 1 99  ? 30.845 -9.988  -0.683  1.00 0.00 ? 312 SER A H      1  
ATOM   1497  H HA     . SER A 1 99  ? 28.526 -10.909 -2.156  1.00 0.00 ? 312 SER A HA     1  
ATOM   1498  H HB2    . SER A 1 99  ? 28.993 -13.261 -1.587  1.00 0.00 ? 312 SER A HB2    1  
ATOM   1499  H HB3    . SER A 1 99  ? 30.287 -12.595 -2.561  1.00 0.00 ? 312 SER A HB3    1  
ATOM   1500  H HG     . SER A 1 99  ? 30.984 -12.095 -0.025  1.00 0.00 ? 312 SER A HG     1  
ATOM   1501  N N      . ALA A 1 100 ? 27.264 -10.975 -0.008  1.00 0.00 ? 313 ALA A N      1  
ATOM   1502  C CA     . ALA A 1 100 ? 26.505 -10.875 1.227   1.00 0.00 ? 313 ALA A CA     1  
ATOM   1503  C C      . ALA A 1 100 ? 26.595 -12.201 1.986   1.00 0.00 ? 313 ALA A C      1  
ATOM   1504  O O      . ALA A 1 100 ? 26.130 -13.231 1.500   1.00 0.00 ? 313 ALA A O      1  
ATOM   1505  C CB     . ALA A 1 100 ? 25.061 -10.482 0.908   1.00 0.00 ? 313 ALA A CB     1  
ATOM   1506  H H      . ALA A 1 100 ? 26.712 -10.999 -0.841  1.00 0.00 ? 313 ALA A H      1  
ATOM   1507  H HA     . ALA A 1 100 ? 26.957 -10.089 1.832   1.00 0.00 ? 313 ALA A HA     1  
ATOM   1508  H HB1    . ALA A 1 100 ? 24.430 -11.372 0.926   1.00 0.00 ? 313 ALA A HB1    1  
ATOM   1509  H HB2    . ALA A 1 100 ? 24.706 -9.770  1.653   1.00 0.00 ? 313 ALA A HB2    1  
ATOM   1510  H HB3    . ALA A 1 100 ? 25.018 -10.026 -0.080  1.00 0.00 ? 313 ALA A HB3    1  
ATOM   1511  N N      . ALA A 1 101 ? 27.197 -12.132 3.164   1.00 0.00 ? 314 ALA A N      1  
ATOM   1512  C CA     . ALA A 1 101 ? 27.354 -13.314 3.995   1.00 0.00 ? 314 ALA A CA     1  
ATOM   1513  C C      . ALA A 1 101 ? 25.974 -13.867 4.352   1.00 0.00 ? 314 ALA A C      1  
ATOM   1514  O O      . ALA A 1 101 ? 25.790 -15.081 4.436   1.00 0.00 ? 314 ALA A O      1  
ATOM   1515  C CB     . ALA A 1 101 ? 28.181 -12.962 5.233   1.00 0.00 ? 314 ALA A CB     1  
ATOM   1516  H H      . ALA A 1 101 ? 27.572 -11.290 3.552   1.00 0.00 ? 314 ALA A H      1  
ATOM   1517  H HA     . ALA A 1 101 ? 27.896 -14.059 3.412   1.00 0.00 ? 314 ALA A HA     1  
ATOM   1518  H HB1    . ALA A 1 101 ? 29.018 -12.328 4.943   1.00 0.00 ? 314 ALA A HB1    1  
ATOM   1519  H HB2    . ALA A 1 101 ? 27.554 -12.429 5.948   1.00 0.00 ? 314 ALA A HB2    1  
ATOM   1520  H HB3    . ALA A 1 101 ? 28.558 -13.877 5.690   1.00 0.00 ? 314 ALA A HB3    1  
ATOM   1521  N N      . THR A 1 102 ? 25.038 -12.951 4.554   1.00 0.00 ? 315 THR A N      1  
ATOM   1522  C CA     . THR A 1 102 ? 23.679 -13.333 4.900   1.00 0.00 ? 315 THR A CA     1  
ATOM   1523  C C      . THR A 1 102 ? 22.678 -12.348 4.295   1.00 0.00 ? 315 THR A C      1  
ATOM   1524  O O      . THR A 1 102 ? 23.069 -11.385 3.636   1.00 0.00 ? 315 THR A O      1  
ATOM   1525  C CB     . THR A 1 102 ? 23.590 -13.430 6.425   1.00 0.00 ? 315 THR A CB     1  
ATOM   1526  O OG1    . THR A 1 102 ? 22.292 -13.968 6.663   1.00 0.00 ? 315 THR A OG1    1  
ATOM   1527  C CG2    . THR A 1 102 ? 23.554 -12.055 7.097   1.00 0.00 ? 315 THR A CG2    1  
ATOM   1528  H H      . THR A 1 102 ? 25.195 -11.966 4.484   1.00 0.00 ? 315 THR A H      1  
ATOM   1529  H HA     . THR A 1 102 ? 23.474 -14.309 4.461   1.00 0.00 ? 315 THR A HA     1  
ATOM   1530  H HB     . THR A 1 102 ? 24.401 -14.038 6.824   1.00 0.00 ? 315 THR A HB     1  
ATOM   1531  H HG1    . THR A 1 102 ? 22.286 -14.480 7.521   1.00 0.00 ? 315 THR A HG1    1  
ATOM   1532  H HG21   . THR A 1 102 ? 24.564 -11.765 7.386   1.00 0.00 ? 315 THR A HG21   1  
ATOM   1533  H HG22   . THR A 1 102 ? 23.149 -11.321 6.402   1.00 0.00 ? 315 THR A HG22   1  
ATOM   1534  H HG23   . THR A 1 102 ? 22.922 -12.103 7.985   1.00 0.00 ? 315 THR A HG23   1  
ATOM   1535  N N      . THR A 1 103 ? 21.405 -12.622 4.539   1.00 0.00 ? 316 THR A N      1  
ATOM   1536  C CA     . THR A 1 103 ? 20.344 -11.773 4.026   1.00 0.00 ? 316 THR A CA     1  
ATOM   1537  C C      . THR A 1 103 ? 20.404 -10.391 4.680   1.00 0.00 ? 316 THR A C      1  
ATOM   1538  O O      . THR A 1 103 ? 20.023 -10.232 5.838   1.00 0.00 ? 316 THR A O      1  
ATOM   1539  C CB     . THR A 1 103 ? 19.012 -12.492 4.247   1.00 0.00 ? 316 THR A CB     1  
ATOM   1540  O OG1    . THR A 1 103 ? 19.310 -13.861 3.988   1.00 0.00 ? 316 THR A OG1    1  
ATOM   1541  C CG2    . THR A 1 103 ? 17.968 -12.132 3.188   1.00 0.00 ? 316 THR A CG2    1  
ATOM   1542  H H      . THR A 1 103 ? 21.095 -13.407 5.076   1.00 0.00 ? 316 THR A H      1  
ATOM   1543  H HA     . THR A 1 103 ? 20.506 -11.629 2.957   1.00 0.00 ? 316 THR A HA     1  
ATOM   1544  H HB     . THR A 1 103 ? 18.630 -12.304 5.251   1.00 0.00 ? 316 THR A HB     1  
ATOM   1545  H HG1    . THR A 1 103 ? 19.553 -13.983 3.026   1.00 0.00 ? 316 THR A HG1    1  
ATOM   1546  H HG21   . THR A 1 103 ? 18.273 -12.538 2.224   1.00 0.00 ? 316 THR A HG21   1  
ATOM   1547  H HG22   . THR A 1 103 ? 17.003 -12.553 3.472   1.00 0.00 ? 316 THR A HG22   1  
ATOM   1548  H HG23   . THR A 1 103 ? 17.884 -11.047 3.116   1.00 0.00 ? 316 THR A HG23   1  
ATOM   1549  N N      . VAL A 1 104 ? 20.885 -9.427  3.909   1.00 0.00 ? 317 VAL A N      1  
ATOM   1550  C CA     . VAL A 1 104 ? 21.000 -8.064  4.398   1.00 0.00 ? 317 VAL A CA     1  
ATOM   1551  C C      . VAL A 1 104 ? 20.288 -7.116  3.429   1.00 0.00 ? 317 VAL A C      1  
ATOM   1552  O O      . VAL A 1 104 ? 20.344 -7.307  2.216   1.00 0.00 ? 317 VAL A O      1  
ATOM   1553  C CB     . VAL A 1 104 ? 22.473 -7.706  4.610   1.00 0.00 ? 317 VAL A CB     1  
ATOM   1554  C CG1    . VAL A 1 104 ? 23.167 -8.744  5.494   1.00 0.00 ? 317 VAL A CG1    1  
ATOM   1555  C CG2    . VAL A 1 104 ? 23.198 -7.552  3.272   1.00 0.00 ? 317 VAL A CG2    1  
ATOM   1556  H H      . VAL A 1 104 ? 21.193 -9.565  2.967   1.00 0.00 ? 317 VAL A H      1  
ATOM   1557  H HA     . VAL A 1 104 ? 20.499 -8.019  5.365   1.00 0.00 ? 317 VAL A HA     1  
ATOM   1558  H HB     . VAL A 1 104 ? 22.513 -6.746  5.126   1.00 0.00 ? 317 VAL A HB     1  
ATOM   1559  H HG11   . VAL A 1 104 ? 22.454 -9.141  6.218   1.00 0.00 ? 317 VAL A HG11   1  
ATOM   1560  H HG12   . VAL A 1 104 ? 23.544 -9.557  4.873   1.00 0.00 ? 317 VAL A HG12   1  
ATOM   1561  H HG13   . VAL A 1 104 ? 23.997 -8.275  6.023   1.00 0.00 ? 317 VAL A HG13   1  
ATOM   1562  H HG21   . VAL A 1 104 ? 23.694 -8.489  3.018   1.00 0.00 ? 317 VAL A HG21   1  
ATOM   1563  H HG22   . VAL A 1 104 ? 22.476 -7.300  2.494   1.00 0.00 ? 317 VAL A HG22   1  
ATOM   1564  H HG23   . VAL A 1 104 ? 23.940 -6.758  3.350   1.00 0.00 ? 317 VAL A HG23   1  
ATOM   1565  N N      . SER A 1 105 ? 19.636 -6.116  4.003   1.00 0.00 ? 318 SER A N      1  
ATOM   1566  C CA     . SER A 1 105 ? 18.915 -5.138  3.205   1.00 0.00 ? 318 SER A CA     1  
ATOM   1567  C C      . SER A 1 105 ? 19.815 -3.938  2.908   1.00 0.00 ? 318 SER A C      1  
ATOM   1568  O O      . SER A 1 105 ? 20.406 -3.361  3.819   1.00 0.00 ? 318 SER A O      1  
ATOM   1569  C CB     . SER A 1 105 ? 17.638 -4.683  3.915   1.00 0.00 ? 318 SER A CB     1  
ATOM   1570  O OG     . SER A 1 105 ? 16.642 -4.248  2.994   1.00 0.00 ? 318 SER A OG     1  
ATOM   1571  H H      . SER A 1 105 ? 19.596 -5.968  4.991   1.00 0.00 ? 318 SER A H      1  
ATOM   1572  H HA     . SER A 1 105 ? 18.651 -5.657  2.283   1.00 0.00 ? 318 SER A HA     1  
ATOM   1573  H HB2    . SER A 1 105 ? 17.245 -5.503  4.515   1.00 0.00 ? 318 SER A HB2    1  
ATOM   1574  H HB3    . SER A 1 105 ? 17.877 -3.870  4.602   1.00 0.00 ? 318 SER A HB3    1  
ATOM   1575  H HG     . SER A 1 105 ? 16.044 -5.011  2.751   1.00 0.00 ? 318 SER A HG     1  
ATOM   1576  N N      . LEU A 1 106 ? 19.892 -3.598  1.631   1.00 0.00 ? 319 LEU A N      1  
ATOM   1577  C CA     . LEU A 1 106 ? 20.710 -2.476  1.202   1.00 0.00 ? 319 LEU A CA     1  
ATOM   1578  C C      . LEU A 1 106 ? 19.941 -1.656  0.164   1.00 0.00 ? 319 LEU A C      1  
ATOM   1579  O O      . LEU A 1 106 ? 18.931 -2.113  -0.369  1.00 0.00 ? 319 LEU A O      1  
ATOM   1580  C CB     . LEU A 1 106 ? 22.075 -2.965  0.711   1.00 0.00 ? 319 LEU A CB     1  
ATOM   1581  C CG     . LEU A 1 106 ? 22.081 -4.306  -0.026  1.00 0.00 ? 319 LEU A CG     1  
ATOM   1582  C CD1    . LEU A 1 106 ? 21.546 -4.152  -1.450  1.00 0.00 ? 319 LEU A CD1    1  
ATOM   1583  C CD2    . LEU A 1 106 ? 23.475 -4.937  -0.003  1.00 0.00 ? 319 LEU A CD2    1  
ATOM   1584  H H      . LEU A 1 106 ? 19.408 -4.073  0.895   1.00 0.00 ? 319 LEU A H      1  
ATOM   1585  H HA     . LEU A 1 106 ? 20.887 -1.849  2.075   1.00 0.00 ? 319 LEU A HA     1  
ATOM   1586  H HB2    . LEU A 1 106 ? 22.493 -2.207  0.049   1.00 0.00 ? 319 LEU A HB2    1  
ATOM   1587  H HB3    . LEU A 1 106 ? 22.741 -3.042  1.571   1.00 0.00 ? 319 LEU A HB3    1  
ATOM   1588  H HG     . LEU A 1 106 ? 21.411 -4.987  0.498   1.00 0.00 ? 319 LEU A HG     1  
ATOM   1589  H HD11   . LEU A 1 106 ? 22.378 -4.130  -2.152  1.00 0.00 ? 319 LEU A HD11   1  
ATOM   1590  H HD12   . LEU A 1 106 ? 20.894 -4.993  -1.686  1.00 0.00 ? 319 LEU A HD12   1  
ATOM   1591  H HD13   . LEU A 1 106 ? 20.981 -3.221  -1.528  1.00 0.00 ? 319 LEU A HD13   1  
ATOM   1592  H HD21   . LEU A 1 106 ? 23.411 -5.944  0.411   1.00 0.00 ? 319 LEU A HD21   1  
ATOM   1593  H HD22   . LEU A 1 106 ? 23.868 -4.985  -1.018  1.00 0.00 ? 319 LEU A HD22   1  
ATOM   1594  H HD23   . LEU A 1 106 ? 24.138 -4.332  0.616   1.00 0.00 ? 319 LEU A HD23   1  
ATOM   1595  N N      . LEU A 1 107 ? 20.448 -0.459  -0.090  1.00 0.00 ? 320 LEU A N      1  
ATOM   1596  C CA     . LEU A 1 107 ? 19.822 0.429   -1.055  1.00 0.00 ? 320 LEU A CA     1  
ATOM   1597  C C      . LEU A 1 107 ? 20.700 0.519   -2.305  1.00 0.00 ? 320 LEU A C      1  
ATOM   1598  O O      . LEU A 1 107 ? 21.913 0.331   -2.230  1.00 0.00 ? 320 LEU A O      1  
ATOM   1599  C CB     . LEU A 1 107 ? 19.519 1.787   -0.416  1.00 0.00 ? 320 LEU A CB     1  
ATOM   1600  C CG     . LEU A 1 107 ? 18.800 1.748   0.934   1.00 0.00 ? 320 LEU A CG     1  
ATOM   1601  C CD1    . LEU A 1 107 ? 19.607 2.482   2.006   1.00 0.00 ? 320 LEU A CD1    1  
ATOM   1602  C CD2    . LEU A 1 107 ? 17.376 2.293   0.812   1.00 0.00 ? 320 LEU A CD2    1  
ATOM   1603  H H      . LEU A 1 107 ? 21.269 -0.094  0.349   1.00 0.00 ? 320 LEU A H      1  
ATOM   1604  H HA     . LEU A 1 107 ? 18.866 -0.014  -1.336  1.00 0.00 ? 320 LEU A HA     1  
ATOM   1605  H HB2    . LEU A 1 107 ? 20.460 2.323   -0.289  1.00 0.00 ? 320 LEU A HB2    1  
ATOM   1606  H HB3    . LEU A 1 107 ? 18.913 2.366   -1.112  1.00 0.00 ? 320 LEU A HB3    1  
ATOM   1607  H HG     . LEU A 1 107 ? 18.720 0.706   1.248   1.00 0.00 ? 320 LEU A HG     1  
ATOM   1608  H HD11   . LEU A 1 107 ? 19.299 2.137   2.994   1.00 0.00 ? 320 LEU A HD11   1  
ATOM   1609  H HD12   . LEU A 1 107 ? 20.668 2.280   1.865   1.00 0.00 ? 320 LEU A HD12   1  
ATOM   1610  H HD13   . LEU A 1 107 ? 19.428 3.554   1.925   1.00 0.00 ? 320 LEU A HD13   1  
ATOM   1611  H HD21   . LEU A 1 107 ? 17.341 3.307   1.213   1.00 0.00 ? 320 LEU A HD21   1  
ATOM   1612  H HD22   . LEU A 1 107 ? 17.080 2.307   -0.236  1.00 0.00 ? 320 LEU A HD22   1  
ATOM   1613  H HD23   . LEU A 1 107 ? 16.694 1.657   1.375   1.00 0.00 ? 320 LEU A HD23   1  
ATOM   1614  N N      . SER A 1 108 ? 20.052 0.808   -3.424  1.00 0.00 ? 321 SER A N      1  
ATOM   1615  C CA     . SER A 1 108 ? 20.760 0.926   -4.688  1.00 0.00 ? 321 SER A CA     1  
ATOM   1616  C C      . SER A 1 108 ? 20.652 2.358   -5.216  1.00 0.00 ? 321 SER A C      1  
ATOM   1617  O O      . SER A 1 108 ? 19.571 2.944   -5.213  1.00 0.00 ? 321 SER A O      1  
ATOM   1618  C CB     . SER A 1 108 ? 20.213 -0.064  -5.719  1.00 0.00 ? 321 SER A CB     1  
ATOM   1619  O OG     . SER A 1 108 ? 19.120 0.481   -6.455  1.00 0.00 ? 321 SER A OG     1  
ATOM   1620  H H      . SER A 1 108 ? 19.065 0.960   -3.476  1.00 0.00 ? 321 SER A H      1  
ATOM   1621  H HA     . SER A 1 108 ? 21.797 0.679   -4.462  1.00 0.00 ? 321 SER A HA     1  
ATOM   1622  H HB2    . SER A 1 108 ? 21.009 -0.347  -6.408  1.00 0.00 ? 321 SER A HB2    1  
ATOM   1623  H HB3    . SER A 1 108 ? 19.891 -0.973  -5.213  1.00 0.00 ? 321 SER A HB3    1  
ATOM   1624  H HG     . SER A 1 108 ? 18.491 -0.248  -6.724  1.00 0.00 ? 321 SER A HG     1  
ATOM   1625  N N      . LEU A 1 109 ? 21.787 2.879   -5.658  1.00 0.00 ? 322 LEU A N      1  
ATOM   1626  C CA     . LEU A 1 109 ? 21.834 4.230   -6.189  1.00 0.00 ? 322 LEU A CA     1  
ATOM   1627  C C      . LEU A 1 109 ? 22.365 4.192   -7.624  1.00 0.00 ? 322 LEU A C      1  
ATOM   1628  O O      . LEU A 1 109 ? 23.281 3.429   -7.930  1.00 0.00 ? 322 LEU A O      1  
ATOM   1629  C CB     . LEU A 1 109 ? 22.637 5.143   -5.261  1.00 0.00 ? 322 LEU A CB     1  
ATOM   1630  C CG     . LEU A 1 109 ? 22.642 6.630   -5.621  1.00 0.00 ? 322 LEU A CG     1  
ATOM   1631  C CD1    . LEU A 1 109 ? 21.338 7.303   -5.189  1.00 0.00 ? 322 LEU A CD1    1  
ATOM   1632  C CD2    . LEU A 1 109 ? 23.870 7.331   -5.037  1.00 0.00 ? 322 LEU A CD2    1  
ATOM   1633  H H      . LEU A 1 109 ? 22.662 2.394   -5.658  1.00 0.00 ? 322 LEU A H      1  
ATOM   1634  H HA     . LEU A 1 109 ? 20.812 4.609   -6.209  1.00 0.00 ? 322 LEU A HA     1  
ATOM   1635  H HB2    . LEU A 1 109 ? 22.244 5.036   -4.250  1.00 0.00 ? 322 LEU A HB2    1  
ATOM   1636  H HB3    . LEU A 1 109 ? 23.669 4.791   -5.241  1.00 0.00 ? 322 LEU A HB3    1  
ATOM   1637  H HG     . LEU A 1 109 ? 22.706 6.718   -6.705  1.00 0.00 ? 322 LEU A HG     1  
ATOM   1638  H HD11   . LEU A 1 109 ? 20.520 6.585   -5.251  1.00 0.00 ? 322 LEU A HD11   1  
ATOM   1639  H HD12   . LEU A 1 109 ? 21.434 7.656   -4.162  1.00 0.00 ? 322 LEU A HD12   1  
ATOM   1640  H HD13   . LEU A 1 109 ? 21.130 8.148   -5.845  1.00 0.00 ? 322 LEU A HD13   1  
ATOM   1641  H HD21   . LEU A 1 109 ? 23.572 7.929   -4.176  1.00 0.00 ? 322 LEU A HD21   1  
ATOM   1642  H HD22   . LEU A 1 109 ? 24.601 6.586   -4.727  1.00 0.00 ? 322 LEU A HD22   1  
ATOM   1643  H HD23   . LEU A 1 109 ? 24.312 7.980   -5.794  1.00 0.00 ? 322 LEU A HD23   1  
ATOM   1644  N N      . HIS A 1 110 ? 21.768 5.023   -8.464  1.00 0.00 ? 323 HIS A N      1  
ATOM   1645  C CA     . HIS A 1 110 ? 22.168 5.095   -9.859  1.00 0.00 ? 323 HIS A CA     1  
ATOM   1646  C C      . HIS A 1 110 ? 23.488 5.859   -9.975  1.00 0.00 ? 323 HIS A C      1  
ATOM   1647  O O      . HIS A 1 110 ? 23.782 6.726   -9.153  1.00 0.00 ? 323 HIS A O      1  
ATOM   1648  C CB     . HIS A 1 110 ? 21.055 5.700   -10.715 1.00 0.00 ? 323 HIS A CB     1  
ATOM   1649  C CG     . HIS A 1 110 ? 20.820 4.978   -12.019 1.00 0.00 ? 323 HIS A CG     1  
ATOM   1650  N ND1    . HIS A 1 110 ? 21.560 5.233   -13.161 1.00 0.00 ? 323 HIS A ND1    1  
ATOM   1651  C CD2    . HIS A 1 110 ? 19.923 4.006   -12.351 1.00 0.00 ? 323 HIS A CD2    1  
ATOM   1652  C CE1    . HIS A 1 110 ? 21.118 4.446   -14.131 1.00 0.00 ? 323 HIS A CE1    1  
ATOM   1653  N NE2    . HIS A 1 110 ? 20.104 3.685   -13.626 1.00 0.00 ? 323 HIS A NE2    1  
ATOM   1654  H H      . HIS A 1 110 ? 21.023 5.641   -8.206  1.00 0.00 ? 323 HIS A H      1  
ATOM   1655  H HA     . HIS A 1 110 ? 22.323 4.068   -10.192 1.00 0.00 ? 323 HIS A HA     1  
ATOM   1656  H HB2    . HIS A 1 110 ? 20.128 5.701   -10.140 1.00 0.00 ? 323 HIS A HB2    1  
ATOM   1657  H HB3    . HIS A 1 110 ? 21.298 6.742   -10.926 1.00 0.00 ? 323 HIS A HB3    1  
ATOM   1658  H HD1    . HIS A 1 110 ? 22.301 5.900   -13.241 1.00 0.00 ? 323 HIS A HD1    1  
ATOM   1659  H HD2    . HIS A 1 110 ? 19.183 3.566   -11.682 1.00 0.00 ? 323 HIS A HD2    1  
ATOM   1660  H HE1    . HIS A 1 110 ? 21.499 4.411   -15.152 1.00 0.00 ? 323 HIS A HE1    1  
ATOM   1661  H HE2    . HIS A 1 110 ? 19.620 2.961   -14.119 1.00 0.00 ? 323 HIS A HE2    1  
ATOM   1662  N N      . SER A 1 111 ? 24.249 5.512   -11.003 1.00 0.00 ? 324 SER A N      1  
ATOM   1663  C CA     . SER A 1 111 ? 25.530 6.155   -11.238 1.00 0.00 ? 324 SER A CA     1  
ATOM   1664  C C      . SER A 1 111 ? 25.320 7.633   -11.571 1.00 0.00 ? 324 SER A C      1  
ATOM   1665  O O      . SER A 1 111 ? 26.118 8.482   -11.175 1.00 0.00 ? 324 SER A O      1  
ATOM   1666  C CB     . SER A 1 111 ? 26.298 5.460   -12.364 1.00 0.00 ? 324 SER A CB     1  
ATOM   1667  O OG     . SER A 1 111 ? 27.421 6.223   -12.794 1.00 0.00 ? 324 SER A OG     1  
ATOM   1668  H H      . SER A 1 111 ? 24.003 4.806   -11.667 1.00 0.00 ? 324 SER A H      1  
ATOM   1669  H HA     . SER A 1 111 ? 26.082 6.048   -10.303 1.00 0.00 ? 324 SER A HA     1  
ATOM   1670  H HB2    . SER A 1 111 ? 26.633 4.481   -12.024 1.00 0.00 ? 324 SER A HB2    1  
ATOM   1671  H HB3    . SER A 1 111 ? 25.628 5.292   -13.208 1.00 0.00 ? 324 SER A HB3    1  
ATOM   1672  H HG     . SER A 1 111 ? 27.165 6.802   -13.569 1.00 0.00 ? 324 SER A HG     1  
ATOM   1673  N N      . ALA A 1 112 ? 24.244 7.896   -12.297 1.00 0.00 ? 325 ALA A N      1  
ATOM   1674  C CA     . ALA A 1 112 ? 23.919 9.257   -12.689 1.00 0.00 ? 325 ALA A CA     1  
ATOM   1675  C C      . ALA A 1 112 ? 23.435 10.035  -11.463 1.00 0.00 ? 325 ALA A C      1  
ATOM   1676  O O      . ALA A 1 112 ? 23.663 11.239  -11.359 1.00 0.00 ? 325 ALA A O      1  
ATOM   1677  C CB     . ALA A 1 112 ? 22.880 9.231   -13.812 1.00 0.00 ? 325 ALA A CB     1  
ATOM   1678  H H      . ALA A 1 112 ? 23.601 7.199   -12.616 1.00 0.00 ? 325 ALA A H      1  
ATOM   1679  H HA     . ALA A 1 112 ? 24.830 9.720   -13.066 1.00 0.00 ? 325 ALA A HA     1  
ATOM   1680  H HB1    . ALA A 1 112 ? 23.358 9.490   -14.756 1.00 0.00 ? 325 ALA A HB1    1  
ATOM   1681  H HB2    . ALA A 1 112 ? 22.448 8.232   -13.884 1.00 0.00 ? 325 ALA A HB2    1  
ATOM   1682  H HB3    . ALA A 1 112 ? 22.092 9.952   -13.593 1.00 0.00 ? 325 ALA A HB3    1  
ATOM   1683  N N      . ASP A 1 113 ? 22.777 9.314   -10.567 1.00 0.00 ? 326 ASP A N      1  
ATOM   1684  C CA     . ASP A 1 113 ? 22.258 9.921   -9.353  1.00 0.00 ? 326 ASP A CA     1  
ATOM   1685  C C      . ASP A 1 113 ? 23.413 10.180  -8.385  1.00 0.00 ? 326 ASP A C      1  
ATOM   1686  O O      . ASP A 1 113 ? 23.363 11.117  -7.589  1.00 0.00 ? 326 ASP A O      1  
ATOM   1687  C CB     . ASP A 1 113 ? 21.257 8.996   -8.659  1.00 0.00 ? 326 ASP A CB     1  
ATOM   1688  C CG     . ASP A 1 113 ? 19.867 9.597   -8.438  1.00 0.00 ? 326 ASP A CG     1  
ATOM   1689  O OD1    . ASP A 1 113 ? 19.229 10.093  -9.377  1.00 0.00 ? 326 ASP A OD1    1  
ATOM   1690  O OD2    . ASP A 1 113 ? 19.437 9.541   -7.223  1.00 0.00 ? 326 ASP A OD2    1  
ATOM   1691  H H      . ASP A 1 113 ? 22.596 8.334   -10.661 1.00 0.00 ? 326 ASP A H      1  
ATOM   1692  H HA     . ASP A 1 113 ? 21.773 10.841  -9.679  1.00 0.00 ? 326 ASP A HA     1  
ATOM   1693  H HB2    . ASP A 1 113 ? 21.153 8.088   -9.253  1.00 0.00 ? 326 ASP A HB2    1  
ATOM   1694  H HB3    . ASP A 1 113 ? 21.668 8.701   -7.694  1.00 0.00 ? 326 ASP A HB3    1  
ATOM   1695  H HD2    . ASP A 1 113 ? 19.482 8.601   -6.886  1.00 0.00 ? 326 ASP A HD2    1  
ATOM   1696  N N      . PHE A 1 114 ? 24.428 9.332   -8.483  1.00 0.00 ? 327 PHE A N      1  
ATOM   1697  C CA     . PHE A 1 114 ? 25.593 9.457   -7.625  1.00 0.00 ? 327 PHE A CA     1  
ATOM   1698  C C      . PHE A 1 114 ? 26.413 10.697  -7.991  1.00 0.00 ? 327 PHE A C      1  
ATOM   1699  O O      . PHE A 1 114 ? 26.910 11.397  -7.110  1.00 0.00 ? 327 PHE A O      1  
ATOM   1700  C CB     . PHE A 1 114 ? 26.450 8.209   -7.850  1.00 0.00 ? 327 PHE A CB     1  
ATOM   1701  C CG     . PHE A 1 114 ? 27.642 8.092   -6.897  1.00 0.00 ? 327 PHE A CG     1  
ATOM   1702  C CD1    . PHE A 1 114 ? 28.829 8.672   -7.218  1.00 0.00 ? 327 PHE A CD1    1  
ATOM   1703  C CD2    . PHE A 1 114 ? 27.512 7.410   -5.728  1.00 0.00 ? 327 PHE A CD2    1  
ATOM   1704  C CE1    . PHE A 1 114 ? 29.935 8.563   -6.334  1.00 0.00 ? 327 PHE A CE1    1  
ATOM   1705  C CE2    . PHE A 1 114 ? 28.617 7.301   -4.843  1.00 0.00 ? 327 PHE A CE2    1  
ATOM   1706  C CZ     . PHE A 1 114 ? 29.805 7.881   -5.165  1.00 0.00 ? 327 PHE A CZ     1  
ATOM   1707  H H      . PHE A 1 114 ? 24.461 8.572   -9.133  1.00 0.00 ? 327 PHE A H      1  
ATOM   1708  H HA     . PHE A 1 114 ? 25.233 9.551   -6.601  1.00 0.00 ? 327 PHE A HA     1  
ATOM   1709  H HB2    . PHE A 1 114 ? 25.822 7.326   -7.741  1.00 0.00 ? 327 PHE A HB2    1  
ATOM   1710  H HB3    . PHE A 1 114 ? 26.818 8.215   -8.876  1.00 0.00 ? 327 PHE A HB3    1  
ATOM   1711  H HD1    . PHE A 1 114 ? 28.933 9.219   -8.156  1.00 0.00 ? 327 PHE A HD1    1  
ATOM   1712  H HD2    . PHE A 1 114 ? 26.561 6.945   -5.470  1.00 0.00 ? 327 PHE A HD2    1  
ATOM   1713  H HE1    . PHE A 1 114 ? 30.886 9.028   -6.591  1.00 0.00 ? 327 PHE A HE1    1  
ATOM   1714  H HE2    . PHE A 1 114 ? 28.515 6.754   -3.907  1.00 0.00 ? 327 PHE A HE2    1  
ATOM   1715  H HZ     . PHE A 1 114 ? 30.654 7.797   -4.486  1.00 0.00 ? 327 PHE A HZ     1  
ATOM   1716  N N      . GLN A 1 115 ? 26.526 10.930  -9.290  1.00 0.00 ? 328 GLN A N      1  
ATOM   1717  C CA     . GLN A 1 115 ? 27.277 12.072  -9.782  1.00 0.00 ? 328 GLN A CA     1  
ATOM   1718  C C      . GLN A 1 115 ? 26.485 13.363  -9.558  1.00 0.00 ? 328 GLN A C      1  
ATOM   1719  O O      . GLN A 1 115 ? 27.070 14.429  -9.376  1.00 0.00 ? 328 GLN A O      1  
ATOM   1720  C CB     . GLN A 1 115 ? 27.635 11.898  -11.260 1.00 0.00 ? 328 GLN A CB     1  
ATOM   1721  C CG     . GLN A 1 115 ? 29.151 11.932  -11.464 1.00 0.00 ? 328 GLN A CG     1  
ATOM   1722  C CD     . GLN A 1 115 ? 29.514 11.664  -12.925 1.00 0.00 ? 328 GLN A CD     1  
ATOM   1723  O OE1    . GLN A 1 115 ? 29.257 12.461  -13.812 1.00 0.00 ? 328 GLN A OE1    1  
ATOM   1724  N NE2    . GLN A 1 115 ? 30.124 10.499  -13.126 1.00 0.00 ? 328 GLN A NE2    1  
ATOM   1725  H H      . GLN A 1 115 ? 26.118 10.355  -9.999  1.00 0.00 ? 328 GLN A H      1  
ATOM   1726  H HA     . GLN A 1 115 ? 28.193 12.093  -9.192  1.00 0.00 ? 328 GLN A HA     1  
ATOM   1727  H HB2    . GLN A 1 115 ? 27.238 10.950  -11.625 1.00 0.00 ? 328 GLN A HB2    1  
ATOM   1728  H HB3    . GLN A 1 115 ? 27.168 12.688  -11.846 1.00 0.00 ? 328 GLN A HB3    1  
ATOM   1729  H HG2    . GLN A 1 115 ? 29.540 12.904  -11.161 1.00 0.00 ? 328 GLN A HG2    1  
ATOM   1730  H HG3    . GLN A 1 115 ? 29.625 11.187  -10.824 1.00 0.00 ? 328 GLN A HG3    1  
ATOM   1731  H HE21   . GLN A 1 115 ? 30.304 9.889   -12.354 1.00 0.00 ? 328 GLN A HE21   1  
ATOM   1732  H HE22   . GLN A 1 115 ? 30.400 10.231  -14.049 1.00 0.00 ? 328 GLN A HE22   1  
ATOM   1733  N N      . MET A 1 116 ? 25.169 13.222  -9.581  1.00 0.00 ? 329 MET A N      1  
ATOM   1734  C CA     . MET A 1 116 ? 24.291 14.364  -9.384  1.00 0.00 ? 329 MET A CA     1  
ATOM   1735  C C      . MET A 1 116 ? 24.213 14.746  -7.903  1.00 0.00 ? 329 MET A C      1  
ATOM   1736  O O      . MET A 1 116 ? 24.139 15.927  -7.567  1.00 0.00 ? 329 MET A O      1  
ATOM   1737  C CB     . MET A 1 116 ? 22.890 14.026  -9.898  1.00 0.00 ? 329 MET A CB     1  
ATOM   1738  C CG     . MET A 1 116 ? 21.906 15.156  -9.588  1.00 0.00 ? 329 MET A CG     1  
ATOM   1739  S SD     . MET A 1 116 ? 21.230 14.943  -7.950  1.00 0.00 ? 329 MET A SD     1  
ATOM   1740  C CE     . MET A 1 116 ? 20.055 13.637  -8.266  1.00 0.00 ? 329 MET A CE     1  
ATOM   1741  H H      . MET A 1 116 ? 24.701 12.351  -9.730  1.00 0.00 ? 329 MET A H      1  
ATOM   1742  H HA     . MET A 1 116 ? 24.738 15.179  -9.953  1.00 0.00 ? 329 MET A HA     1  
ATOM   1743  H HB2    . MET A 1 116 ? 22.926 13.855  -10.974 1.00 0.00 ? 329 MET A HB2    1  
ATOM   1744  H HB3    . MET A 1 116 ? 22.544 13.100  -9.439  1.00 0.00 ? 329 MET A HB3    1  
ATOM   1745  H HG2    . MET A 1 116 ? 22.410 16.120  -9.661  1.00 0.00 ? 329 MET A HG2    1  
ATOM   1746  H HG3    . MET A 1 116 ? 21.102 15.161  -10.324 1.00 0.00 ? 329 MET A HG3    1  
ATOM   1747  H HE1    . MET A 1 116 ? 20.584 12.750  -8.618  1.00 0.00 ? 329 MET A HE1    1  
ATOM   1748  H HE2    . MET A 1 116 ? 19.521 13.398  -7.347  1.00 0.00 ? 329 MET A HE2    1  
ATOM   1749  H HE3    . MET A 1 116 ? 19.346 13.962  -9.026  1.00 0.00 ? 329 MET A HE3    1  
ATOM   1750  N N      . LEU A 1 117 ? 24.233 13.724  -7.060  1.00 0.00 ? 330 LEU A N      1  
ATOM   1751  C CA     . LEU A 1 117 ? 24.165 13.937  -5.624  1.00 0.00 ? 330 LEU A CA     1  
ATOM   1752  C C      . LEU A 1 117 ? 25.521 14.438  -5.123  1.00 0.00 ? 330 LEU A C      1  
ATOM   1753  O O      . LEU A 1 117 ? 25.585 15.223  -4.178  1.00 0.00 ? 330 LEU A O      1  
ATOM   1754  C CB     . LEU A 1 117 ? 23.676 12.672  -4.917  1.00 0.00 ? 330 LEU A CB     1  
ATOM   1755  C CG     . LEU A 1 117 ? 24.752 11.643  -4.564  1.00 0.00 ? 330 LEU A CG     1  
ATOM   1756  C CD1    . LEU A 1 117 ? 25.439 12.000  -3.244  1.00 0.00 ? 330 LEU A CD1    1  
ATOM   1757  C CD2    . LEU A 1 117 ? 24.171 10.227  -4.544  1.00 0.00 ? 330 LEU A CD2    1  
ATOM   1758  H H      . LEU A 1 117 ? 24.293 12.767  -7.342  1.00 0.00 ? 330 LEU A H      1  
ATOM   1759  H HA     . LEU A 1 117 ? 23.421 14.714  -5.445  1.00 0.00 ? 330 LEU A HA     1  
ATOM   1760  H HB2    . LEU A 1 117 ? 23.167 12.966  -3.998  1.00 0.00 ? 330 LEU A HB2    1  
ATOM   1761  H HB3    . LEU A 1 117 ? 22.933 12.188  -5.551  1.00 0.00 ? 330 LEU A HB3    1  
ATOM   1762  H HG     . LEU A 1 117 ? 25.516 11.667  -5.341  1.00 0.00 ? 330 LEU A HG     1  
ATOM   1763  H HD11   . LEU A 1 117 ? 26.286 12.658  -3.442  1.00 0.00 ? 330 LEU A HD11   1  
ATOM   1764  H HD12   . LEU A 1 117 ? 24.729 12.506  -2.590  1.00 0.00 ? 330 LEU A HD12   1  
ATOM   1765  H HD13   . LEU A 1 117 ? 25.793 11.088  -2.761  1.00 0.00 ? 330 LEU A HD13   1  
ATOM   1766  H HD21   . LEU A 1 117 ? 24.984 9.501   -4.561  1.00 0.00 ? 330 LEU A HD21   1  
ATOM   1767  H HD22   . LEU A 1 117 ? 23.580 10.090  -3.639  1.00 0.00 ? 330 LEU A HD22   1  
ATOM   1768  H HD23   . LEU A 1 117 ? 23.537 10.083  -5.418  1.00 0.00 ? 330 LEU A HD23   1  
ATOM   1769  N N      . CYS A 1 118 ? 26.570 13.963  -5.778  1.00 0.00 ? 331 CYS A N      1  
ATOM   1770  C CA     . CYS A 1 118 ? 27.920 14.352  -5.410  1.00 0.00 ? 331 CYS A CA     1  
ATOM   1771  C C      . CYS A 1 118 ? 28.125 15.815  -5.810  1.00 0.00 ? 331 CYS A C      1  
ATOM   1772  O O      . CYS A 1 118 ? 28.886 16.538  -5.168  1.00 0.00 ? 331 CYS A O      1  
ATOM   1773  C CB     . CYS A 1 118 ? 28.967 13.435  -6.047  1.00 0.00 ? 331 CYS A CB     1  
ATOM   1774  S SG     . CYS A 1 118 ? 29.294 13.961  -7.768  1.00 0.00 ? 331 CYS A SG     1  
ATOM   1775  H H      . CYS A 1 118 ? 26.508 13.325  -6.546  1.00 0.00 ? 331 CYS A H      1  
ATOM   1776  H HA     . CYS A 1 118 ? 27.998 14.233  -4.329  1.00 0.00 ? 331 CYS A HA     1  
ATOM   1777  H HB2    . CYS A 1 118 ? 29.889 13.465  -5.468  1.00 0.00 ? 331 CYS A HB2    1  
ATOM   1778  H HB3    . CYS A 1 118 ? 28.615 12.403  -6.034  1.00 0.00 ? 331 CYS A HB3    1  
ATOM   1779  H HG     . CYS A 1 118 ? 30.150 12.982  -8.052  1.00 0.00 ? 331 CYS A HG     1  
ATOM   1780  N N      . SER A 1 119 ? 27.431 16.208  -6.868  1.00 0.00 ? 332 SER A N      1  
ATOM   1781  C CA     . SER A 1 119 ? 27.527 17.571  -7.361  1.00 0.00 ? 332 SER A CA     1  
ATOM   1782  C C      . SER A 1 119 ? 26.791 18.522  -6.417  1.00 0.00 ? 332 SER A C      1  
ATOM   1783  O O      . SER A 1 119 ? 27.148 19.695  -6.308  1.00 0.00 ? 332 SER A O      1  
ATOM   1784  C CB     . SER A 1 119 ? 26.959 17.686  -8.778  1.00 0.00 ? 332 SER A CB     1  
ATOM   1785  O OG     . SER A 1 119 ? 27.958 18.056  -9.725  1.00 0.00 ? 332 SER A OG     1  
ATOM   1786  H H      . SER A 1 119 ? 26.814 15.615  -7.385  1.00 0.00 ? 332 SER A H      1  
ATOM   1787  H HA     . SER A 1 119 ? 28.593 17.798  -7.378  1.00 0.00 ? 332 SER A HA     1  
ATOM   1788  H HB2    . SER A 1 119 ? 26.518 16.733  -9.070  1.00 0.00 ? 332 SER A HB2    1  
ATOM   1789  H HB3    . SER A 1 119 ? 26.159 18.425  -8.789  1.00 0.00 ? 332 SER A HB3    1  
ATOM   1790  H HG     . SER A 1 119 ? 27.603 18.760  -10.340 1.00 0.00 ? 332 SER A HG     1  
ATOM   1791  N N      . SER A 1 120 ? 25.777 17.983  -5.757  1.00 0.00 ? 333 SER A N      1  
ATOM   1792  C CA     . SER A 1 120 ? 24.987 18.769  -4.824  1.00 0.00 ? 333 SER A CA     1  
ATOM   1793  C C      . SER A 1 120 ? 25.817 19.093  -3.579  1.00 0.00 ? 333 SER A C      1  
ATOM   1794  O O      . SER A 1 120 ? 25.793 20.222  -3.090  1.00 0.00 ? 333 SER A O      1  
ATOM   1795  C CB     . SER A 1 120 ? 23.705 18.033  -4.430  1.00 0.00 ? 333 SER A CB     1  
ATOM   1796  O OG     . SER A 1 120 ? 22.697 18.927  -3.965  1.00 0.00 ? 333 SER A OG     1  
ATOM   1797  H H      . SER A 1 120 ? 25.493 17.029  -5.850  1.00 0.00 ? 333 SER A H      1  
ATOM   1798  H HA     . SER A 1 120 ? 24.730 19.682  -5.361  1.00 0.00 ? 333 SER A HA     1  
ATOM   1799  H HB2    . SER A 1 120 ? 23.328 17.476  -5.288  1.00 0.00 ? 333 SER A HB2    1  
ATOM   1800  H HB3    . SER A 1 120 ? 23.930 17.304  -3.651  1.00 0.00 ? 333 SER A HB3    1  
ATOM   1801  H HG     . SER A 1 120 ? 22.572 19.672  -4.620  1.00 0.00 ? 333 SER A HG     1  
ATOM   1802  N N      . SER A 1 121 ? 26.530 18.083  -3.104  1.00 0.00 ? 334 SER A N      1  
ATOM   1803  C CA     . SER A 1 121 ? 27.366 18.247  -1.926  1.00 0.00 ? 334 SER A CA     1  
ATOM   1804  C C      . SER A 1 121 ? 28.817 17.898  -2.261  1.00 0.00 ? 334 SER A C      1  
ATOM   1805  O O      . SER A 1 121 ? 29.115 16.766  -2.641  1.00 0.00 ? 334 SER A O      1  
ATOM   1806  C CB     . SER A 1 121 ? 26.863 17.380  -0.770  1.00 0.00 ? 334 SER A CB     1  
ATOM   1807  O OG     . SER A 1 121 ? 26.777 18.112  0.449   1.00 0.00 ? 334 SER A OG     1  
ATOM   1808  H H      . SER A 1 121 ? 26.544 17.169  -3.507  1.00 0.00 ? 334 SER A H      1  
ATOM   1809  H HA     . SER A 1 121 ? 27.279 19.299  -1.654  1.00 0.00 ? 334 SER A HA     1  
ATOM   1810  H HB2    . SER A 1 121 ? 25.883 16.975  -1.019  1.00 0.00 ? 334 SER A HB2    1  
ATOM   1811  H HB3    . SER A 1 121 ? 27.534 16.531  -0.636  1.00 0.00 ? 334 SER A HB3    1  
ATOM   1812  H HG     . SER A 1 121 ? 27.194 19.014  0.336   1.00 0.00 ? 334 SER A HG     1  
ATOM   1813  N N      . PRO A 1 122 ? 29.705 18.916  -2.105  1.00 0.00 ? 335 PRO A N      1  
ATOM   1814  C CA     . PRO A 1 122 ? 31.118 18.726  -2.387  1.00 0.00 ? 335 PRO A CA     1  
ATOM   1815  C C      . PRO A 1 122 ? 31.795 17.920  -1.277  1.00 0.00 ? 335 PRO A C      1  
ATOM   1816  O O      . PRO A 1 122 ? 32.872 17.360  -1.480  1.00 0.00 ? 335 PRO A O      1  
ATOM   1817  C CB     . PRO A 1 122 ? 31.681 20.130  -2.529  1.00 0.00 ? 335 PRO A CB     1  
ATOM   1818  C CG     . PRO A 1 122 ? 30.672 21.054  -1.866  1.00 0.00 ? 335 PRO A CG     1  
ATOM   1819  C CD     . PRO A 1 122 ? 29.388 20.269  -1.657  1.00 0.00 ? 335 PRO A CD     1  
ATOM   1820  H HA     . PRO A 1 122 ? 31.236 18.193  -3.224  1.00 0.00 ? 335 PRO A HA     1  
ATOM   1821  H HB2    . PRO A 1 122 ? 32.657 20.210  -2.049  1.00 0.00 ? 335 PRO A HB2    1  
ATOM   1822  H HB3    . PRO A 1 122 ? 31.820 20.392  -3.577  1.00 0.00 ? 335 PRO A HB3    1  
ATOM   1823  H HG2    . PRO A 1 122 ? 31.057 21.418  -0.913  1.00 0.00 ? 335 PRO A HG2    1  
ATOM   1824  H HG3    . PRO A 1 122 ? 30.488 21.929  -2.490  1.00 0.00 ? 335 PRO A HG3    1  
ATOM   1825  H HD2    . PRO A 1 122 ? 29.083 20.278  -0.611  1.00 0.00 ? 335 PRO A HD2    1  
ATOM   1826  H HD3    . PRO A 1 122 ? 28.566 20.693  -2.233  1.00 0.00 ? 335 PRO A HD3    1  
ATOM   1827  N N      . GLU A 1 123 ? 31.136 17.884  -0.128  1.00 0.00 ? 336 GLU A N      1  
ATOM   1828  C CA     . GLU A 1 123 ? 31.660 17.155  1.014   1.00 0.00 ? 336 GLU A CA     1  
ATOM   1829  C C      . GLU A 1 123 ? 31.433 15.653  0.834   1.00 0.00 ? 336 GLU A C      1  
ATOM   1830  O O      . GLU A 1 123 ? 32.253 14.842  1.261   1.00 0.00 ? 336 GLU A O      1  
ATOM   1831  C CB     . GLU A 1 123 ? 31.033 17.652  2.318   1.00 0.00 ? 336 GLU A CB     1  
ATOM   1832  C CG     . GLU A 1 123 ? 32.043 17.606  3.465   1.00 0.00 ? 336 GLU A CG     1  
ATOM   1833  C CD     . GLU A 1 123 ? 32.444 19.016  3.899   1.00 0.00 ? 336 GLU A CD     1  
ATOM   1834  O OE1    . GLU A 1 123 ? 33.423 19.572  3.377   1.00 0.00 ? 336 GLU A OE1    1  
ATOM   1835  O OE2    . GLU A 1 123 ? 31.700 19.538  4.814   1.00 0.00 ? 336 GLU A OE2    1  
ATOM   1836  H H      . GLU A 1 123 ? 30.260 18.341  0.029   1.00 0.00 ? 336 GLU A H      1  
ATOM   1837  H HA     . GLU A 1 123 ? 32.729 17.369  1.027   1.00 0.00 ? 336 GLU A HA     1  
ATOM   1838  H HB2    . GLU A 1 123 ? 30.673 18.672  2.186   1.00 0.00 ? 336 GLU A HB2    1  
ATOM   1839  H HB3    . GLU A 1 123 ? 30.166 17.039  2.566   1.00 0.00 ? 336 GLU A HB3    1  
ATOM   1840  H HG2    . GLU A 1 123 ? 31.613 17.069  4.311   1.00 0.00 ? 336 GLU A HG2    1  
ATOM   1841  H HG3    . GLU A 1 123 ? 32.928 17.052  3.153   1.00 0.00 ? 336 GLU A HG3    1  
ATOM   1842  H HE2    . GLU A 1 123 ? 31.097 20.228  4.412   1.00 0.00 ? 336 GLU A HE2    1  
ATOM   1843  N N      . ILE A 1 124 ? 30.316 15.327  0.201   1.00 0.00 ? 337 ILE A N      1  
ATOM   1844  C CA     . ILE A 1 124 ? 29.971 13.936  -0.041  1.00 0.00 ? 337 ILE A CA     1  
ATOM   1845  C C      . ILE A 1 124 ? 30.934 13.348  -1.074  1.00 0.00 ? 337 ILE A C      1  
ATOM   1846  O O      . ILE A 1 124 ? 31.240 12.157  -1.035  1.00 0.00 ? 337 ILE A O      1  
ATOM   1847  C CB     . ILE A 1 124 ? 28.497 13.810  -0.433  1.00 0.00 ? 337 ILE A CB     1  
ATOM   1848  C CG1    . ILE A 1 124 ? 27.592 14.430  0.633   1.00 0.00 ? 337 ILE A CG1    1  
ATOM   1849  C CG2    . ILE A 1 124 ? 28.129 12.353  -0.722  1.00 0.00 ? 337 ILE A CG2    1  
ATOM   1850  C CD1    . ILE A 1 124 ? 26.190 14.689  0.078   1.00 0.00 ? 337 ILE A CD1    1  
ATOM   1851  H H      . ILE A 1 124 ? 29.654 15.992  -0.144  1.00 0.00 ? 337 ILE A H      1  
ATOM   1852  H HA     . ILE A 1 124 ? 30.101 13.399  0.898   1.00 0.00 ? 337 ILE A HA     1  
ATOM   1853  H HB     . ILE A 1 124 ? 28.340 14.371  -1.355  1.00 0.00 ? 337 ILE A HB     1  
ATOM   1854  H HG12   . ILE A 1 124 ? 27.528 13.764  1.494   1.00 0.00 ? 337 ILE A HG12   1  
ATOM   1855  H HG13   . ILE A 1 124 ? 28.025 15.365  0.985   1.00 0.00 ? 337 ILE A HG13   1  
ATOM   1856  H HG21   . ILE A 1 124 ? 28.527 11.715  0.068   1.00 0.00 ? 337 ILE A HG21   1  
ATOM   1857  H HG22   . ILE A 1 124 ? 27.045 12.253  -0.759  1.00 0.00 ? 337 ILE A HG22   1  
ATOM   1858  H HG23   . ILE A 1 124 ? 28.555 12.054  -1.680  1.00 0.00 ? 337 ILE A HG23   1  
ATOM   1859  H HD11   . ILE A 1 124 ? 26.247 14.831  -1.002  1.00 0.00 ? 337 ILE A HD11   1  
ATOM   1860  H HD12   . ILE A 1 124 ? 25.548 13.836  0.297   1.00 0.00 ? 337 ILE A HD12   1  
ATOM   1861  H HD13   . ILE A 1 124 ? 25.776 15.585  0.540   1.00 0.00 ? 337 ILE A HD13   1  
ATOM   1862  N N      . ALA A 1 125 ? 31.386 14.210  -1.972  1.00 0.00 ? 338 ALA A N      1  
ATOM   1863  C CA     . ALA A 1 125 ? 32.310 13.791  -3.014  1.00 0.00 ? 338 ALA A CA     1  
ATOM   1864  C C      . ALA A 1 125 ? 33.688 13.544  -2.398  1.00 0.00 ? 338 ALA A C      1  
ATOM   1865  O O      . ALA A 1 125 ? 34.420 12.660  -2.841  1.00 0.00 ? 338 ALA A O      1  
ATOM   1866  C CB     . ALA A 1 125 ? 32.346 14.848  -4.120  1.00 0.00 ? 338 ALA A CB     1  
ATOM   1867  H H      . ALA A 1 125 ? 31.133 15.177  -1.997  1.00 0.00 ? 338 ALA A H      1  
ATOM   1868  H HA     . ALA A 1 125 ? 31.935 12.857  -3.433  1.00 0.00 ? 338 ALA A HA     1  
ATOM   1869  H HB1    . ALA A 1 125 ? 32.670 15.800  -3.701  1.00 0.00 ? 338 ALA A HB1    1  
ATOM   1870  H HB2    . ALA A 1 125 ? 33.043 14.536  -4.897  1.00 0.00 ? 338 ALA A HB2    1  
ATOM   1871  H HB3    . ALA A 1 125 ? 31.350 14.959  -4.548  1.00 0.00 ? 338 ALA A HB3    1  
ATOM   1872  N N      . GLU A 1 126 ? 34.000 14.340  -1.386  1.00 0.00 ? 339 GLU A N      1  
ATOM   1873  C CA     . GLU A 1 126 ? 35.278 14.218  -0.704  1.00 0.00 ? 339 GLU A CA     1  
ATOM   1874  C C      . GLU A 1 126 ? 35.273 12.998  0.218   1.00 0.00 ? 339 GLU A C      1  
ATOM   1875  O O      . GLU A 1 126 ? 36.301 12.346  0.397   1.00 0.00 ? 339 GLU A O      1  
ATOM   1876  C CB     . GLU A 1 126 ? 35.608 15.493  0.073   1.00 0.00 ? 339 GLU A CB     1  
ATOM   1877  C CG     . GLU A 1 126 ? 37.083 15.866  -0.086  1.00 0.00 ? 339 GLU A CG     1  
ATOM   1878  C CD     . GLU A 1 126 ? 37.356 17.268  0.464   1.00 0.00 ? 339 GLU A CD     1  
ATOM   1879  O OE1    . GLU A 1 126 ? 37.719 18.175  -0.301  1.00 0.00 ? 339 GLU A OE1    1  
ATOM   1880  O OE2    . GLU A 1 126 ? 37.178 17.399  1.735   1.00 0.00 ? 339 GLU A OE2    1  
ATOM   1881  H H      . GLU A 1 126 ? 33.398 15.055  -1.031  1.00 0.00 ? 339 GLU A H      1  
ATOM   1882  H HA     . GLU A 1 126 ? 36.015 14.081  -1.495  1.00 0.00 ? 339 GLU A HA     1  
ATOM   1883  H HB2    . GLU A 1 126 ? 34.982 16.312  -0.280  1.00 0.00 ? 339 GLU A HB2    1  
ATOM   1884  H HB3    . GLU A 1 126 ? 35.377 15.349  1.129   1.00 0.00 ? 339 GLU A HB3    1  
ATOM   1885  H HG2    . GLU A 1 126 ? 37.704 15.139  0.436   1.00 0.00 ? 339 GLU A HG2    1  
ATOM   1886  H HG3    . GLU A 1 126 ? 37.360 15.826  -1.139  1.00 0.00 ? 339 GLU A HG3    1  
ATOM   1887  H HE2    . GLU A 1 126 ? 37.839 18.051  2.108   1.00 0.00 ? 339 GLU A HE2    1  
ATOM   1888  N N      . ILE A 1 127 ? 34.105 12.726  0.781   1.00 0.00 ? 340 ILE A N      1  
ATOM   1889  C CA     . ILE A 1 127 ? 33.953 11.596  1.682   1.00 0.00 ? 340 ILE A CA     1  
ATOM   1890  C C      . ILE A 1 127 ? 34.047 10.295  0.882   1.00 0.00 ? 340 ILE A C      1  
ATOM   1891  O O      . ILE A 1 127 ? 34.526 9.283   1.391   1.00 0.00 ? 340 ILE A O      1  
ATOM   1892  C CB     . ILE A 1 127 ? 32.663 11.727  2.494   1.00 0.00 ? 340 ILE A CB     1  
ATOM   1893  C CG1    . ILE A 1 127 ? 32.931 11.523  3.987   1.00 0.00 ? 340 ILE A CG1    1  
ATOM   1894  C CG2    . ILE A 1 127 ? 31.586 10.775  1.970   1.00 0.00 ? 340 ILE A CG2    1  
ATOM   1895  C CD1    . ILE A 1 127 ? 31.915 12.290  4.836   1.00 0.00 ? 340 ILE A CD1    1  
ATOM   1896  H H      . ILE A 1 127 ? 33.274 13.261  0.632   1.00 0.00 ? 340 ILE A H      1  
ATOM   1897  H HA     . ILE A 1 127 ? 34.783 11.628  2.389   1.00 0.00 ? 340 ILE A HA     1  
ATOM   1898  H HB     . ILE A 1 127 ? 32.284 12.742  2.371   1.00 0.00 ? 340 ILE A HB     1  
ATOM   1899  H HG12   . ILE A 1 127 ? 32.883 10.462  4.226   1.00 0.00 ? 340 ILE A HG12   1  
ATOM   1900  H HG13   . ILE A 1 127 ? 33.939 11.859  4.228   1.00 0.00 ? 340 ILE A HG13   1  
ATOM   1901  H HG21   . ILE A 1 127 ? 31.869 9.747   2.194   1.00 0.00 ? 340 ILE A HG21   1  
ATOM   1902  H HG22   . ILE A 1 127 ? 30.635 11.004  2.450   1.00 0.00 ? 340 ILE A HG22   1  
ATOM   1903  H HG23   . ILE A 1 127 ? 31.488 10.897  0.891   1.00 0.00 ? 340 ILE A HG23   1  
ATOM   1904  H HD11   . ILE A 1 127 ? 30.906 12.004  4.542   1.00 0.00 ? 340 ILE A HD11   1  
ATOM   1905  H HD12   . ILE A 1 127 ? 32.068 12.052  5.888   1.00 0.00 ? 340 ILE A HD12   1  
ATOM   1906  H HD13   . ILE A 1 127 ? 32.048 13.361  4.682   1.00 0.00 ? 340 ILE A HD13   1  
ATOM   1907  N N      . PHE A 1 128 ? 33.582 10.365  -0.357  1.00 0.00 ? 341 PHE A N      1  
ATOM   1908  C CA     . PHE A 1 128 ? 33.608 9.206   -1.232  1.00 0.00 ? 341 PHE A CA     1  
ATOM   1909  C C      . PHE A 1 128 ? 35.034 8.894   -1.688  1.00 0.00 ? 341 PHE A C      1  
ATOM   1910  O O      . PHE A 1 128 ? 35.441 7.733   -1.715  1.00 0.00 ? 341 PHE A O      1  
ATOM   1911  C CB     . PHE A 1 128 ? 32.757 9.552   -2.457  1.00 0.00 ? 341 PHE A CB     1  
ATOM   1912  C CG     . PHE A 1 128 ? 31.299 9.102   -2.348  1.00 0.00 ? 341 PHE A CG     1  
ATOM   1913  C CD1    . PHE A 1 128 ? 31.005 7.840   -1.936  1.00 0.00 ? 341 PHE A CD1    1  
ATOM   1914  C CD2    . PHE A 1 128 ? 30.297 9.966   -2.665  1.00 0.00 ? 341 PHE A CD2    1  
ATOM   1915  C CE1    . PHE A 1 128 ? 29.651 7.424   -1.836  1.00 0.00 ? 341 PHE A CE1    1  
ATOM   1916  C CE2    . PHE A 1 128 ? 28.943 9.549   -2.564  1.00 0.00 ? 341 PHE A CE2    1  
ATOM   1917  C CZ     . PHE A 1 128 ? 28.649 8.287   -2.152  1.00 0.00 ? 341 PHE A CZ     1  
ATOM   1918  H H      . PHE A 1 128 ? 33.195 11.194  -0.763  1.00 0.00 ? 341 PHE A H      1  
ATOM   1919  H HA     . PHE A 1 128 ? 33.218 8.362   -0.662  1.00 0.00 ? 341 PHE A HA     1  
ATOM   1920  H HB2    . PHE A 1 128 ? 32.785 10.630  -2.613  1.00 0.00 ? 341 PHE A HB2    1  
ATOM   1921  H HB3    . PHE A 1 128 ? 33.204 9.091   -3.338  1.00 0.00 ? 341 PHE A HB3    1  
ATOM   1922  H HD1    . PHE A 1 128 ? 31.808 7.149   -1.683  1.00 0.00 ? 341 PHE A HD1    1  
ATOM   1923  H HD2    . PHE A 1 128 ? 30.532 10.978  -2.994  1.00 0.00 ? 341 PHE A HD2    1  
ATOM   1924  H HE1    . PHE A 1 128 ? 29.416 6.411   -1.506  1.00 0.00 ? 341 PHE A HE1    1  
ATOM   1925  H HE2    . PHE A 1 128 ? 28.139 10.240  -2.818  1.00 0.00 ? 341 PHE A HE2    1  
ATOM   1926  H HZ     . PHE A 1 128 ? 27.610 7.966   -2.075  1.00 0.00 ? 341 PHE A HZ     1  
ATOM   1927  N N      . ARG A 1 129 ? 35.755 9.951   -2.034  1.00 0.00 ? 342 ARG A N      1  
ATOM   1928  C CA     . ARG A 1 129 ? 37.128 9.804   -2.487  1.00 0.00 ? 342 ARG A CA     1  
ATOM   1929  C C      . ARG A 1 129 ? 38.016 9.315   -1.341  1.00 0.00 ? 342 ARG A C      1  
ATOM   1930  O O      . ARG A 1 129 ? 39.020 8.643   -1.573  1.00 0.00 ? 342 ARG A O      1  
ATOM   1931  C CB     . ARG A 1 129 ? 37.676 11.129  -3.020  1.00 0.00 ? 342 ARG A CB     1  
ATOM   1932  C CG     . ARG A 1 129 ? 38.335 11.939  -1.901  1.00 0.00 ? 342 ARG A CG     1  
ATOM   1933  C CD     . ARG A 1 129 ? 39.836 11.651  -1.827  1.00 0.00 ? 342 ARG A CD     1  
ATOM   1934  N NE     . ARG A 1 129 ? 40.463 11.895  -3.145  1.00 0.00 ? 342 ARG A NE     1  
ATOM   1935  C CZ     . ARG A 1 129 ? 41.733 11.585  -3.442  1.00 0.00 ? 342 ARG A CZ     1  
ATOM   1936  N NH1    . ARG A 1 129 ? 42.518 11.018  -2.516  1.00 0.00 ? 342 ARG A NH1    1  
ATOM   1937  N NH2    . ARG A 1 129 ? 42.217 11.843  -4.664  1.00 0.00 ? 342 ARG A NH2    1  
ATOM   1938  H H      . ARG A 1 129 ? 35.417 10.892  -2.009  1.00 0.00 ? 342 ARG A H      1  
ATOM   1939  H HA     . ARG A 1 129 ? 37.079 9.067   -3.288  1.00 0.00 ? 342 ARG A HA     1  
ATOM   1940  H HB2    . ARG A 1 129 ? 38.402 10.936  -3.809  1.00 0.00 ? 342 ARG A HB2    1  
ATOM   1941  H HB3    . ARG A 1 129 ? 36.867 11.709  -3.465  1.00 0.00 ? 342 ARG A HB3    1  
ATOM   1942  H HG2    . ARG A 1 129 ? 38.173 13.003  -2.073  1.00 0.00 ? 342 ARG A HG2    1  
ATOM   1943  H HG3    . ARG A 1 129 ? 37.867 11.695  -0.947  1.00 0.00 ? 342 ARG A HG3    1  
ATOM   1944  H HD2    . ARG A 1 129 ? 40.300 12.286  -1.071  1.00 0.00 ? 342 ARG A HD2    1  
ATOM   1945  H HD3    . ARG A 1 129 ? 40.002 10.619  -1.521  1.00 0.00 ? 342 ARG A HD3    1  
ATOM   1946  H HE     . ARG A 1 129 ? 39.905 12.317  -3.859  1.00 0.00 ? 342 ARG A HE     1  
ATOM   1947  H HH11   . ARG A 1 129 ? 42.156 10.825  -1.603  1.00 0.00 ? 342 ARG A HH11   1  
ATOM   1948  H HH12   . ARG A 1 129 ? 43.466 10.786  -2.737  1.00 0.00 ? 342 ARG A HH12   1  
ATOM   1949  H HH21   . ARG A 1 129 ? 41.632 12.266  -5.355  1.00 0.00 ? 342 ARG A HH21   1  
ATOM   1950  H HH22   . ARG A 1 129 ? 43.165 11.611  -4.886  1.00 0.00 ? 342 ARG A HH22   1  
ATOM   1951  N N      . LYS A 1 130 ? 37.614 9.673   -0.131  1.00 0.00 ? 343 LYS A N      1  
ATOM   1952  C CA     . LYS A 1 130 ? 38.361 9.279   1.052   1.00 0.00 ? 343 LYS A CA     1  
ATOM   1953  C C      . LYS A 1 130 ? 38.212 7.771   1.265   1.00 0.00 ? 343 LYS A C      1  
ATOM   1954  O O      . LYS A 1 130 ? 39.173 7.095   1.629   1.00 0.00 ? 343 LYS A O      1  
ATOM   1955  C CB     . LYS A 1 130 ? 37.934 10.116  2.258   1.00 0.00 ? 343 LYS A CB     1  
ATOM   1956  C CG     . LYS A 1 130 ? 38.995 11.165  2.601   1.00 0.00 ? 343 LYS A CG     1  
ATOM   1957  C CD     . LYS A 1 130 ? 39.231 12.111  1.422   1.00 0.00 ? 343 LYS A CD     1  
ATOM   1958  C CE     . LYS A 1 130 ? 40.506 12.933  1.626   1.00 0.00 ? 343 LYS A CE     1  
ATOM   1959  N NZ     . LYS A 1 130 ? 40.193 14.219  2.286   1.00 0.00 ? 343 LYS A NZ     1  
ATOM   1960  H H      . LYS A 1 130 ? 36.797 10.220  0.049   1.00 0.00 ? 343 LYS A H      1  
ATOM   1961  H HA     . LYS A 1 130 ? 39.413 9.499   0.862   1.00 0.00 ? 343 LYS A HA     1  
ATOM   1962  H HB2    . LYS A 1 130 ? 36.986 10.610  2.047   1.00 0.00 ? 343 LYS A HB2    1  
ATOM   1963  H HB3    . LYS A 1 130 ? 37.770 9.466   3.118   1.00 0.00 ? 343 LYS A HB3    1  
ATOM   1964  H HG2    . LYS A 1 130 ? 38.677 11.738  3.473   1.00 0.00 ? 343 LYS A HG2    1  
ATOM   1965  H HG3    . LYS A 1 130 ? 39.928 10.670  2.868   1.00 0.00 ? 343 LYS A HG3    1  
ATOM   1966  H HD2    . LYS A 1 130 ? 39.309 11.536  0.500   1.00 0.00 ? 343 LYS A HD2    1  
ATOM   1967  H HD3    . LYS A 1 130 ? 38.378 12.780  1.311   1.00 0.00 ? 343 LYS A HD3    1  
ATOM   1968  H HE2    . LYS A 1 130 ? 41.216 12.369  2.232   1.00 0.00 ? 343 LYS A HE2    1  
ATOM   1969  H HE3    . LYS A 1 130 ? 40.984 13.117  0.664   1.00 0.00 ? 343 LYS A HE3    1  
ATOM   1970  H HZ1    . LYS A 1 130 ? 39.202 14.328  2.352   1.00 0.00 ? 343 LYS A HZ1    1  
ATOM   1971  H HZ2    . LYS A 1 130 ? 40.592 14.228  3.204   1.00 0.00 ? 343 LYS A HZ2    1  
ATOM   1972  H HZ3    . LYS A 1 130 ? 40.577 14.972  1.749   1.00 0.00 ? 343 LYS A HZ3    1  
ATOM   1973  N N      . THR A 1 131 ? 37.000 7.290   1.030   1.00 0.00 ? 344 THR A N      1  
ATOM   1974  C CA     . THR A 1 131 ? 36.713 5.875   1.193   1.00 0.00 ? 344 THR A CA     1  
ATOM   1975  C C      . THR A 1 131 ? 37.240 5.083   -0.005  1.00 0.00 ? 344 THR A C      1  
ATOM   1976  O O      . THR A 1 131 ? 37.644 3.929   0.138   1.00 0.00 ? 344 THR A O      1  
ATOM   1977  C CB     . THR A 1 131 ? 35.206 5.720   1.409   1.00 0.00 ? 344 THR A CB     1  
ATOM   1978  O OG1    . THR A 1 131 ? 34.936 6.518   2.557   1.00 0.00 ? 344 THR A OG1    1  
ATOM   1979  C CG2    . THR A 1 131 ? 34.818 4.304   1.838   1.00 0.00 ? 344 THR A CG2    1  
ATOM   1980  H H      . THR A 1 131 ? 36.225 7.847   0.735   1.00 0.00 ? 344 THR A H      1  
ATOM   1981  H HA     . THR A 1 131 ? 37.245 5.515   2.073   1.00 0.00 ? 344 THR A HA     1  
ATOM   1982  H HB     . THR A 1 131 ? 34.653 6.022   0.519   1.00 0.00 ? 344 THR A HB     1  
ATOM   1983  H HG1    . THR A 1 131 ? 35.472 6.190   3.335   1.00 0.00 ? 344 THR A HG1    1  
ATOM   1984  H HG21   . THR A 1 131 ? 33.987 4.353   2.543   1.00 0.00 ? 344 THR A HG21   1  
ATOM   1985  H HG22   . THR A 1 131 ? 34.520 3.727   0.963   1.00 0.00 ? 344 THR A HG22   1  
ATOM   1986  H HG23   . THR A 1 131 ? 35.672 3.823   2.316   1.00 0.00 ? 344 THR A HG23   1  
ATOM   1987  N N      . ALA A 1 132 ? 37.219 5.733   -1.159  1.00 0.00 ? 345 ALA A N      1  
ATOM   1988  C CA     . ALA A 1 132 ? 37.689 5.104   -2.382  1.00 0.00 ? 345 ALA A CA     1  
ATOM   1989  C C      . ALA A 1 132 ? 39.204 4.904   -2.296  1.00 0.00 ? 345 ALA A C      1  
ATOM   1990  O O      . ALA A 1 132 ? 39.731 3.905   -2.785  1.00 0.00 ? 345 ALA A O      1  
ATOM   1991  C CB     . ALA A 1 132 ? 37.281 5.956   -3.585  1.00 0.00 ? 345 ALA A CB     1  
ATOM   1992  H H      . ALA A 1 132 ? 36.888 6.670   -1.267  1.00 0.00 ? 345 ALA A H      1  
ATOM   1993  H HA     . ALA A 1 132 ? 37.207 4.130   -2.461  1.00 0.00 ? 345 ALA A HA     1  
ATOM   1994  H HB1    . ALA A 1 132 ? 38.075 5.934   -4.331  1.00 0.00 ? 345 ALA A HB1    1  
ATOM   1995  H HB2    . ALA A 1 132 ? 36.364 5.558   -4.017  1.00 0.00 ? 345 ALA A HB2    1  
ATOM   1996  H HB3    . ALA A 1 132 ? 37.114 6.984   -3.262  1.00 0.00 ? 345 ALA A HB3    1  
ATOM   1997  N N      . LEU A 1 133 ? 39.863 5.868   -1.671  1.00 0.00 ? 346 LEU A N      1  
ATOM   1998  C CA     . LEU A 1 133 ? 41.305 5.810   -1.515  1.00 0.00 ? 346 LEU A CA     1  
ATOM   1999  C C      . LEU A 1 133 ? 41.660 4.742   -0.479  1.00 0.00 ? 346 LEU A C      1  
ATOM   2000  O O      . LEU A 1 133 ? 42.602 3.974   -0.672  1.00 0.00 ? 346 LEU A O      1  
ATOM   2001  C CB     . LEU A 1 133 ? 41.865 7.196   -1.184  1.00 0.00 ? 346 LEU A CB     1  
ATOM   2002  C CG     . LEU A 1 133 ? 41.999 7.528   0.303   1.00 0.00 ? 346 LEU A CG     1  
ATOM   2003  C CD1    . LEU A 1 133 ? 43.313 6.987   0.869   1.00 0.00 ? 346 LEU A CD1    1  
ATOM   2004  C CD2    . LEU A 1 133 ? 41.847 9.031   0.545   1.00 0.00 ? 346 LEU A CD2    1  
ATOM   2005  H H      . LEU A 1 133 ? 39.426 6.677   -1.275  1.00 0.00 ? 346 LEU A H      1  
ATOM   2006  H HA     . LEU A 1 133 ? 41.726 5.514   -2.476  1.00 0.00 ? 346 LEU A HA     1  
ATOM   2007  H HB2    . LEU A 1 133 ? 42.847 7.289   -1.648  1.00 0.00 ? 346 LEU A HB2    1  
ATOM   2008  H HB3    . LEU A 1 133 ? 41.222 7.945   -1.648  1.00 0.00 ? 346 LEU A HB3    1  
ATOM   2009  H HG     . LEU A 1 133 ? 41.190 7.032   0.838   1.00 0.00 ? 346 LEU A HG     1  
ATOM   2010  H HD11   . LEU A 1 133 ? 43.985 7.817   1.087   1.00 0.00 ? 346 LEU A HD11   1  
ATOM   2011  H HD12   . LEU A 1 133 ? 43.114 6.432   1.785   1.00 0.00 ? 346 LEU A HD12   1  
ATOM   2012  H HD13   . LEU A 1 133 ? 43.779 6.326   0.138   1.00 0.00 ? 346 LEU A HD13   1  
ATOM   2013  H HD21   . LEU A 1 133 ? 42.811 9.521   0.406   1.00 0.00 ? 346 LEU A HD21   1  
ATOM   2014  H HD22   . LEU A 1 133 ? 41.125 9.441   -0.161  1.00 0.00 ? 346 LEU A HD22   1  
ATOM   2015  H HD23   . LEU A 1 133 ? 41.497 9.202   1.563   1.00 0.00 ? 346 LEU A HD23   1  
ATOM   2016  N N      . GLU A 1 134 ? 40.887 4.727   0.597   1.00 0.00 ? 347 GLU A N      1  
ATOM   2017  C CA     . GLU A 1 134 ? 41.108 3.765   1.663   1.00 0.00 ? 347 GLU A CA     1  
ATOM   2018  C C      . GLU A 1 134 ? 40.814 2.347   1.169   1.00 0.00 ? 347 GLU A C      1  
ATOM   2019  O O      . GLU A 1 134 ? 41.570 1.418   1.450   1.00 0.00 ? 347 GLU A O      1  
ATOM   2020  C CB     . GLU A 1 134 ? 40.261 4.103   2.892   1.00 0.00 ? 347 GLU A CB     1  
ATOM   2021  C CG     . GLU A 1 134 ? 41.143 4.539   4.063   1.00 0.00 ? 347 GLU A CG     1  
ATOM   2022  C CD     . GLU A 1 134 ? 41.483 3.350   4.964   1.00 0.00 ? 347 GLU A CD     1  
ATOM   2023  O OE1    . GLU A 1 134 ? 42.520 2.698   4.766   1.00 0.00 ? 347 GLU A OE1    1  
ATOM   2024  O OE2    . GLU A 1 134 ? 40.627 3.111   5.899   1.00 0.00 ? 347 GLU A OE2    1  
ATOM   2025  H H      . GLU A 1 134 ? 40.123 5.355   0.746   1.00 0.00 ? 347 GLU A H      1  
ATOM   2026  H HA     . GLU A 1 134 ? 42.163 3.855   1.921   1.00 0.00 ? 347 GLU A HA     1  
ATOM   2027  H HB2    . GLU A 1 134 ? 39.559 4.901   2.645   1.00 0.00 ? 347 GLU A HB2    1  
ATOM   2028  H HB3    . GLU A 1 134 ? 39.669 3.235   3.181   1.00 0.00 ? 347 GLU A HB3    1  
ATOM   2029  H HG2    . GLU A 1 134 ? 42.062 4.987   3.685   1.00 0.00 ? 347 GLU A HG2    1  
ATOM   2030  H HG3    . GLU A 1 134 ? 40.631 5.305   4.644   1.00 0.00 ? 347 GLU A HG3    1  
ATOM   2031  H HE2    . GLU A 1 134 ? 40.886 2.285   6.398   1.00 0.00 ? 347 GLU A HE2    1  
ATOM   2032  N N      . ARG A 1 135 ? 39.713 2.225   0.441   1.00 0.00 ? 348 ARG A N      1  
ATOM   2033  C CA     . ARG A 1 135 ? 39.309 0.936   -0.095  1.00 0.00 ? 348 ARG A CA     1  
ATOM   2034  C C      . ARG A 1 135 ? 40.245 0.518   -1.232  1.00 0.00 ? 348 ARG A C      1  
ATOM   2035  O O      . ARG A 1 135 ? 40.641 -0.643  -1.319  1.00 0.00 ? 348 ARG A O      1  
ATOM   2036  C CB     . ARG A 1 135 ? 37.873 0.983   -0.618  1.00 0.00 ? 348 ARG A CB     1  
ATOM   2037  C CG     . ARG A 1 135 ? 36.881 0.549   0.465   1.00 0.00 ? 348 ARG A CG     1  
ATOM   2038  C CD     . ARG A 1 135 ? 36.557 1.710   1.408   1.00 0.00 ? 348 ARG A CD     1  
ATOM   2039  N NE     . ARG A 1 135 ? 35.618 1.261   2.460   1.00 0.00 ? 348 ARG A NE     1  
ATOM   2040  C CZ     . ARG A 1 135 ? 34.293 1.160   2.290   1.00 0.00 ? 348 ARG A CZ     1  
ATOM   2041  N NH1    . ARG A 1 135 ? 33.742 1.477   1.109   1.00 0.00 ? 348 ARG A NH1    1  
ATOM   2042  N NH2    . ARG A 1 135 ? 33.518 0.743   3.301   1.00 0.00 ? 348 ARG A NH2    1  
ATOM   2043  H H      . ARG A 1 135 ? 39.103 2.986   0.217   1.00 0.00 ? 348 ARG A H      1  
ATOM   2044  H HA     . ARG A 1 135 ? 39.383 0.248   0.747   1.00 0.00 ? 348 ARG A HA     1  
ATOM   2045  H HB2    . ARG A 1 135 ? 37.635 1.993   -0.950  1.00 0.00 ? 348 ARG A HB2    1  
ATOM   2046  H HB3    . ARG A 1 135 ? 37.776 0.331   -1.486  1.00 0.00 ? 348 ARG A HB3    1  
ATOM   2047  H HG2    . ARG A 1 135 ? 35.965 0.187   -0.001  1.00 0.00 ? 348 ARG A HG2    1  
ATOM   2048  H HG3    . ARG A 1 135 ? 37.299 -0.281  1.034   1.00 0.00 ? 348 ARG A HG3    1  
ATOM   2049  H HD2    . ARG A 1 135 ? 37.474 2.086   1.863   1.00 0.00 ? 348 ARG A HD2    1  
ATOM   2050  H HD3    . ARG A 1 135 ? 36.119 2.535   0.846   1.00 0.00 ? 348 ARG A HD3    1  
ATOM   2051  H HE     . ARG A 1 135 ? 35.996 1.016   3.352   1.00 0.00 ? 348 ARG A HE     1  
ATOM   2052  H HH11   . ARG A 1 135 ? 34.321 1.788   0.356   1.00 0.00 ? 348 ARG A HH11   1  
ATOM   2053  H HH12   . ARG A 1 135 ? 32.753 1.402   0.984   1.00 0.00 ? 348 ARG A HH12   1  
ATOM   2054  H HH21   . ARG A 1 135 ? 33.928 0.507   4.181   1.00 0.00 ? 348 ARG A HH21   1  
ATOM   2055  H HH22   . ARG A 1 135 ? 32.529 0.668   3.174   1.00 0.00 ? 348 ARG A HH22   1  
ATOM   2056  N N      . ARG A 1 136 ? 40.571 1.487   -2.075  1.00 0.00 ? 349 ARG A N      1  
ATOM   2057  C CA     . ARG A 1 136 ? 41.451 1.234   -3.202  1.00 0.00 ? 349 ARG A CA     1  
ATOM   2058  C C      . ARG A 1 136 ? 42.863 0.907   -2.710  1.00 0.00 ? 349 ARG A C      1  
ATOM   2059  O O      . ARG A 1 136 ? 43.518 0.014   -3.244  1.00 0.00 ? 349 ARG A O      1  
ATOM   2060  C CB     . ARG A 1 136 ? 41.512 2.444   -4.136  1.00 0.00 ? 349 ARG A CB     1  
ATOM   2061  C CG     . ARG A 1 136 ? 42.455 2.182   -5.311  1.00 0.00 ? 349 ARG A CG     1  
ATOM   2062  C CD     . ARG A 1 136 ? 43.135 3.475   -5.768  1.00 0.00 ? 349 ARG A CD     1  
ATOM   2063  N NE     . ARG A 1 136 ? 44.052 3.195   -6.895  1.00 0.00 ? 349 ARG A NE     1  
ATOM   2064  C CZ     . ARG A 1 136 ? 44.726 4.137   -7.568  1.00 0.00 ? 349 ARG A CZ     1  
ATOM   2065  N NH1    . ARG A 1 136 ? 44.591 5.428   -7.230  1.00 0.00 ? 349 ARG A NH1    1  
ATOM   2066  N NH2    . ARG A 1 136 ? 45.536 3.790   -8.577  1.00 0.00 ? 349 ARG A NH2    1  
ATOM   2067  H H      . ARG A 1 136 ? 40.243 2.429   -1.998  1.00 0.00 ? 349 ARG A H      1  
ATOM   2068  H HA     . ARG A 1 136 ? 41.008 0.381   -3.717  1.00 0.00 ? 349 ARG A HA     1  
ATOM   2069  H HB2    . ARG A 1 136 ? 40.514 2.670   -4.510  1.00 0.00 ? 349 ARG A HB2    1  
ATOM   2070  H HB3    . ARG A 1 136 ? 41.851 3.319   -3.582  1.00 0.00 ? 349 ARG A HB3    1  
ATOM   2071  H HG2    . ARG A 1 136 ? 43.212 1.453   -5.020  1.00 0.00 ? 349 ARG A HG2    1  
ATOM   2072  H HG3    . ARG A 1 136 ? 41.898 1.749   -6.141  1.00 0.00 ? 349 ARG A HG3    1  
ATOM   2073  H HD2    . ARG A 1 136 ? 42.384 4.203   -6.071  1.00 0.00 ? 349 ARG A HD2    1  
ATOM   2074  H HD3    . ARG A 1 136 ? 43.690 3.916   -4.939  1.00 0.00 ? 349 ARG A HD3    1  
ATOM   2075  H HE     . ARG A 1 136 ? 44.176 2.242   -7.172  1.00 0.00 ? 349 ARG A HE     1  
ATOM   2076  H HH11   . ARG A 1 136 ? 43.987 5.687   -6.477  1.00 0.00 ? 349 ARG A HH11   1  
ATOM   2077  H HH12   . ARG A 1 136 ? 45.095 6.131   -7.731  1.00 0.00 ? 349 ARG A HH12   1  
ATOM   2078  H HH21   . ARG A 1 136 ? 45.637 2.829   -8.829  1.00 0.00 ? 349 ARG A HH21   1  
ATOM   2079  H HH22   . ARG A 1 136 ? 46.040 4.494   -9.078  1.00 0.00 ? 349 ARG A HH22   1  
ATOM   2080  N N      . GLY A 1 137 ? 43.288 1.647   -1.696  1.00 0.00 ? 350 GLY A N      1  
ATOM   2081  C CA     . GLY A 1 137 ? 44.609 1.446   -1.127  1.00 0.00 ? 350 GLY A CA     1  
ATOM   2082  C C      . GLY A 1 137 ? 44.780 2.256   0.161   1.00 0.00 ? 350 GLY A C      1  
ATOM   2083  O O      . GLY A 1 137 ? 44.112 1.990   1.158   1.00 0.00 ? 350 GLY A O      1  
ATOM   2084  H H      . GLY A 1 137 ? 42.748 2.371   -1.268  1.00 0.00 ? 350 GLY A H      1  
ATOM   2085  H HA2    . GLY A 1 137 ? 44.762 0.388   -0.917  1.00 0.00 ? 350 GLY A HA2    1  
ATOM   2086  H HA3    . GLY A 1 137 ? 45.370 1.741   -1.850  1.00 0.00 ? 350 GLY A HA3    1  
ATOM   2087  N N      . ALA A 1 138 ? 45.678 3.228   0.096   1.00 0.00 ? 351 ALA A N      1  
ATOM   2088  C CA     . ALA A 1 138 ? 45.945 4.079   1.244   1.00 0.00 ? 351 ALA A CA     1  
ATOM   2089  C C      . ALA A 1 138 ? 46.867 3.341   2.215   1.00 0.00 ? 351 ALA A C      1  
ATOM   2090  O O      . ALA A 1 138 ? 47.104 3.810   3.328   1.00 0.00 ? 351 ALA A O      1  
ATOM   2091  C CB     . ALA A 1 138 ? 44.621 4.488   1.893   1.00 0.00 ? 351 ALA A CB     1  
ATOM   2092  H H      . ALA A 1 138 ? 46.217 3.437   -0.721  1.00 0.00 ? 351 ALA A H      1  
ATOM   2093  H HA     . ALA A 1 138 ? 46.451 4.973   0.882   1.00 0.00 ? 351 ALA A HA     1  
ATOM   2094  H HB1    . ALA A 1 138 ? 43.850 4.568   1.127   1.00 0.00 ? 351 ALA A HB1    1  
ATOM   2095  H HB2    . ALA A 1 138 ? 44.329 3.738   2.627   1.00 0.00 ? 351 ALA A HB2    1  
ATOM   2096  H HB3    . ALA A 1 138 ? 44.743 5.453   2.388   1.00 0.00 ? 351 ALA A HB3    1  
ATOM   2097  N N      . ALA A 1 139 ? 47.364 2.200   1.760   1.00 0.00 ? 352 ALA A N      1  
ATOM   2098  C CA     . ALA A 1 139 ? 48.256 1.394   2.575   1.00 0.00 ? 352 ALA A CA     1  
ATOM   2099  C C      . ALA A 1 139 ? 49.342 0.785   1.686   1.00 0.00 ? 352 ALA A C      1  
ATOM   2100  O O      . ALA A 1 139 ? 50.529 0.874   2.000   1.00 0.00 ? 352 ALA A O      1  
ATOM   2101  C CB     . ALA A 1 139 ? 47.446 0.328   3.318   1.00 0.00 ? 352 ALA A CB     1  
ATOM   2102  H H      . ALA A 1 139 ? 47.166 1.826   0.853   1.00 0.00 ? 352 ALA A H      1  
ATOM   2103  H HA     . ALA A 1 139 ? 48.724 2.052   3.307   1.00 0.00 ? 352 ALA A HA     1  
ATOM   2104  H HB1    . ALA A 1 139 ? 46.621 -0.005  2.688   1.00 0.00 ? 352 ALA A HB1    1  
ATOM   2105  H HB2    . ALA A 1 139 ? 48.090 -0.519  3.552   1.00 0.00 ? 352 ALA A HB2    1  
ATOM   2106  H HB3    . ALA A 1 139 ? 47.051 0.751   4.241   1.00 0.00 ? 352 ALA A HB3    1  
ATOM   2107  N N      . ALA A 1 140 ? 48.900 0.182   0.593   1.00 0.00 ? 353 ALA A N      1  
ATOM   2108  C CA     . ALA A 1 140 ? 49.819 -0.441  -0.344  1.00 0.00 ? 353 ALA A CA     1  
ATOM   2109  C C      . ALA A 1 140 ? 50.385 0.627   -1.282  1.00 0.00 ? 353 ALA A C      1  
ATOM   2110  O O      . ALA A 1 140 ? 51.591 0.873   -1.293  1.00 0.00 ? 353 ALA A O      1  
ATOM   2111  C CB     . ALA A 1 140 ? 49.098 -1.558  -1.100  1.00 0.00 ? 353 ALA A CB     1  
ATOM   2112  H H      . ALA A 1 140 ? 47.933 0.115   0.345   1.00 0.00 ? 353 ALA A H      1  
ATOM   2113  H HA     . ALA A 1 140 ? 50.635 -0.876  0.233   1.00 0.00 ? 353 ALA A HA     1  
ATOM   2114  H HB1    . ALA A 1 140 ? 49.212 -1.403  -2.173  1.00 0.00 ? 353 ALA A HB1    1  
ATOM   2115  H HB2    . ALA A 1 140 ? 49.531 -2.520  -0.824  1.00 0.00 ? 353 ALA A HB2    1  
ATOM   2116  H HB3    . ALA A 1 140 ? 48.040 -1.548  -0.841  1.00 0.00 ? 353 ALA A HB3    1  
ATOM   2117  N N      . SER A 1 141 ? 49.489 1.234   -2.046  1.00 0.00 ? 354 SER A N      1  
ATOM   2118  C CA     . SER A 1 141 ? 49.884 2.270   -2.985  1.00 0.00 ? 354 SER A CA     1  
ATOM   2119  C C      . SER A 1 141 ? 50.922 3.192   -2.341  1.00 0.00 ? 354 SER A C      1  
ATOM   2120  O O      . SER A 1 141 ? 52.002 3.398   -2.893  1.00 0.00 ? 354 SER A O      1  
ATOM   2121  C CB     . SER A 1 141 ? 48.673 3.080   -3.453  1.00 0.00 ? 354 SER A CB     1  
ATOM   2122  O OG     . SER A 1 141 ? 49.030 4.060   -4.424  1.00 0.00 ? 354 SER A OG     1  
ATOM   2123  H H      . SER A 1 141 ? 48.510 1.029   -2.030  1.00 0.00 ? 354 SER A H      1  
ATOM   2124  H HA     . SER A 1 141 ? 50.317 1.740   -3.833  1.00 0.00 ? 354 SER A HA     1  
ATOM   2125  H HB2    . SER A 1 141 ? 47.928 2.405   -3.876  1.00 0.00 ? 354 SER A HB2    1  
ATOM   2126  H HB3    . SER A 1 141 ? 48.211 3.570   -2.596  1.00 0.00 ? 354 SER A HB3    1  
ATOM   2127  H HG     . SER A 1 141 ? 48.366 4.058   -5.172  1.00 0.00 ? 354 SER A HG     1  
ATOM   2128  N N      . ALA A 1 142 ? 50.558 3.721   -1.183  1.00 0.00 ? 355 ALA A N      1  
ATOM   2129  C CA     . ALA A 1 142 ? 51.444 4.616   -0.457  1.00 0.00 ? 355 ALA A CA     1  
ATOM   2130  C C      . ALA A 1 142 ? 52.834 3.983   -0.362  1.00 0.00 ? 355 ALA A C      1  
ATOM   2131  O O      . ALA A 1 142 ? 53.736 4.339   -1.117  1.00 0.00 ? 355 ALA A O      1  
ATOM   2132  C CB     . ALA A 1 142 ? 50.848 4.924   0.917   1.00 0.00 ? 355 ALA A CB     1  
ATOM   2133  H H      . ALA A 1 142 ? 49.679 3.549   -0.740  1.00 0.00 ? 355 ALA A H      1  
ATOM   2134  H HA     . ALA A 1 142 ? 51.515 5.544   -1.025  1.00 0.00 ? 355 ALA A HA     1  
ATOM   2135  H HB1    . ALA A 1 142 ? 50.503 3.999   1.379   1.00 0.00 ? 355 ALA A HB1    1  
ATOM   2136  H HB2    . ALA A 1 142 ? 51.608 5.384   1.548   1.00 0.00 ? 355 ALA A HB2    1  
ATOM   2137  H HB3    . ALA A 1 142 ? 50.006 5.608   0.803   1.00 0.00 ? 355 ALA A HB3    1  
HETATM 2138  P P      . CMP B 2 .   ? 34.184 -0.680  -5.938  1.00 0.00 ? 370 CMP A P      1  
HETATM 2139  O O1P    . CMP B 2 .   ? 35.591 -0.696  -6.399  1.00 0.00 ? 370 CMP A O1P    1  
HETATM 2140  O O2P    . CMP B 2 .   ? 33.344 0.353   -6.844  1.00 0.00 ? 370 CMP A O2P    1  
HETATM 2141  O "O5'"  . CMP B 2 .   ? 33.560 -2.150  -6.098  1.00 0.00 ? 370 CMP A "O5'"  1  
HETATM 2142  C "C5'"  . CMP B 2 .   ? 34.251 -3.039  -5.208  1.00 0.00 ? 370 CMP A "C5'"  1  
HETATM 2143  C "C4'"  . CMP B 2 .   ? 34.074 -2.510  -3.797  1.00 0.00 ? 370 CMP A "C4'"  1  
HETATM 2144  O "O4'"  . CMP B 2 .   ? 34.639 -3.308  -2.759  1.00 0.00 ? 370 CMP A "O4'"  1  
HETATM 2145  C "C3'"  . CMP B 2 .   ? 34.858 -1.178  -3.677  1.00 0.00 ? 370 CMP A "C3'"  1  
HETATM 2146  O "O3'"  . CMP B 2 .   ? 34.137 -0.197  -4.398  1.00 0.00 ? 370 CMP A "O3'"  1  
HETATM 2147  C "C2'"  . CMP B 2 .   ? 34.888 -0.987  -2.150  1.00 0.00 ? 370 CMP A "C2'"  1  
HETATM 2148  O "O2'"  . CMP B 2 .   ? 33.793 -0.173  -1.722  1.00 0.00 ? 370 CMP A "O2'"  1  
HETATM 2149  C "C1'"  . CMP B 2 .   ? 34.756 -2.433  -1.613  1.00 0.00 ? 370 CMP A "C1'"  1  
HETATM 2150  N N9     . CMP B 2 .   ? 35.945 -2.785  -0.833  1.00 0.00 ? 370 CMP A N9     1  
HETATM 2151  C C8     . CMP B 2 .   ? 37.160 -3.142  -1.335  1.00 0.00 ? 370 CMP A C8     1  
HETATM 2152  N N7     . CMP B 2 .   ? 37.988 -3.390  -0.361  1.00 0.00 ? 370 CMP A N7     1  
HETATM 2153  C C5     . CMP B 2 .   ? 37.358 -3.202  0.824   1.00 0.00 ? 370 CMP A C5     1  
HETATM 2154  C C6     . CMP B 2 .   ? 37.734 -3.324  2.173   1.00 0.00 ? 370 CMP A C6     1  
HETATM 2155  N N6     . CMP B 2 .   ? 39.019 -3.703  2.518   1.00 0.00 ? 370 CMP A N6     1  
HETATM 2156  N N1     . CMP B 2 .   ? 36.827 -3.061  3.107   1.00 0.00 ? 370 CMP A N1     1  
HETATM 2157  C C2     . CMP B 2 .   ? 35.601 -2.697  2.787   1.00 0.00 ? 370 CMP A C2     1  
HETATM 2158  N N3     . CMP B 2 .   ? 35.202 -2.575  1.538   1.00 0.00 ? 370 CMP A N3     1  
HETATM 2159  C C4     . CMP B 2 .   ? 36.040 -2.818  0.534   1.00 0.00 ? 370 CMP A C4     1  
HETATM 2160  H "H5'1" . CMP B 2 .   ? 35.310 -3.066  -5.461  1.00 0.00 ? 370 CMP A "H5'1" 1  
HETATM 2161  H "H5'2" . CMP B 2 .   ? 33.826 -4.041  -5.284  1.00 0.00 ? 370 CMP A "H5'2" 1  
HETATM 2162  H "H4'"  . CMP B 2 .   ? 33.016 -2.338  -3.597  1.00 0.00 ? 370 CMP A "H4'"  1  
HETATM 2163  H "H3'"  . CMP B 2 .   ? 35.824 -0.779  -3.790  1.00 0.00 ? 370 CMP A "H3'"  1  
HETATM 2164  H "H2'"  . CMP B 2 .   ? 35.836 -0.551  -1.836  1.00 0.00 ? 370 CMP A "H2'"  1  
HETATM 2165  H "HO2'" . CMP B 2 .   ? 33.865 -0.090  -0.763  1.00 0.00 ? 370 CMP A "HO2'" 1  
HETATM 2166  H "H1'"  . CMP B 2 .   ? 33.865 -2.517  -0.990  1.00 0.00 ? 370 CMP A "H1'"  1  
HETATM 2167  H H8     . CMP B 2 .   ? 37.402 -3.210  -2.385  1.00 0.00 ? 370 CMP A H8     1  
HETATM 2168  H HN61   . CMP B 2 .   ? 39.266 -3.781  3.453   1.00 0.00 ? 370 CMP A HN61   1  
HETATM 2169  H HN62   . CMP B 2 .   ? 39.671 -3.897  1.826   1.00 0.00 ? 370 CMP A HN62   1  
HETATM 2170  H H2     . CMP B 2 .   ? 34.896 -2.493  3.579   1.00 0.00 ? 370 CMP A H2     1  
ATOM   2171  N N      . GLY A 1 1   ? 6.521  18.096  -3.990  1.00 0.00 ? 214 GLY A N      2  
ATOM   2172  C CA     . GLY A 1 1   ? 5.333  17.502  -3.402  1.00 0.00 ? 214 GLY A CA     2  
ATOM   2173  C C      . GLY A 1 1   ? 5.387  15.975  -3.481  1.00 0.00 ? 214 GLY A C      2  
ATOM   2174  O O      . GLY A 1 1   ? 6.086  15.418  -4.327  1.00 0.00 ? 214 GLY A O      2  
ATOM   2175  H H1     . GLY A 1 1   ? 6.353  18.681  -4.783  1.00 0.00 ? 214 GLY A H1     2  
ATOM   2176  H HA2    . GLY A 1 1   ? 5.244  17.813  -2.362  1.00 0.00 ? 214 GLY A HA2    2  
ATOM   2177  H HA3    . GLY A 1 1   ? 4.445  17.865  -3.921  1.00 0.00 ? 214 GLY A HA3    2  
ATOM   2178  N N      . SER A 1 2   ? 4.640  15.342  -2.588  1.00 0.00 ? 215 SER A N      2  
ATOM   2179  C CA     . SER A 1 2   ? 4.595  13.890  -2.546  1.00 0.00 ? 215 SER A CA     2  
ATOM   2180  C C      . SER A 1 2   ? 3.207  13.423  -2.103  1.00 0.00 ? 215 SER A C      2  
ATOM   2181  O O      . SER A 1 2   ? 2.644  13.956  -1.148  1.00 0.00 ? 215 SER A O      2  
ATOM   2182  C CB     . SER A 1 2   ? 5.667  13.332  -1.609  1.00 0.00 ? 215 SER A CB     2  
ATOM   2183  O OG     . SER A 1 2   ? 6.725  12.700  -2.325  1.00 0.00 ? 215 SER A OG     2  
ATOM   2184  H H      . SER A 1 2   ? 4.075  15.802  -1.905  1.00 0.00 ? 215 SER A H      2  
ATOM   2185  H HA     . SER A 1 2   ? 4.800  13.565  -3.567  1.00 0.00 ? 215 SER A HA     2  
ATOM   2186  H HB2    . SER A 1 2   ? 6.072  14.139  -1.001  1.00 0.00 ? 215 SER A HB2    2  
ATOM   2187  H HB3    . SER A 1 2   ? 5.213  12.615  -0.925  1.00 0.00 ? 215 SER A HB3    2  
ATOM   2188  H HG     . SER A 1 2   ? 6.835  11.757  -2.010  1.00 0.00 ? 215 SER A HG     2  
ATOM   2189  N N      . GLN A 1 3   ? 2.695  12.431  -2.818  1.00 0.00 ? 216 GLN A N      2  
ATOM   2190  C CA     . GLN A 1 3   ? 1.383  11.887  -2.509  1.00 0.00 ? 216 GLN A CA     2  
ATOM   2191  C C      . GLN A 1 3   ? 1.502  10.777  -1.461  1.00 0.00 ? 216 GLN A C      2  
ATOM   2192  O O      . GLN A 1 3   ? 2.607  10.363  -1.113  1.00 0.00 ? 216 GLN A O      2  
ATOM   2193  C CB     . GLN A 1 3   ? 0.691  11.374  -3.773  1.00 0.00 ? 216 GLN A CB     2  
ATOM   2194  C CG     . GLN A 1 3   ? -0.809 11.670  -3.735  1.00 0.00 ? 216 GLN A CG     2  
ATOM   2195  C CD     . GLN A 1 3   ? -1.257 12.395  -5.007  1.00 0.00 ? 216 GLN A CD     2  
ATOM   2196  O OE1    . GLN A 1 3   ? -1.104 13.596  -5.154  1.00 0.00 ? 216 GLN A OE1    2  
ATOM   2197  N NE2    . GLN A 1 3   ? -1.818 11.600  -5.913  1.00 0.00 ? 216 GLN A NE2    2  
ATOM   2198  H H      . GLN A 1 3   ? 3.159  12.002  -3.592  1.00 0.00 ? 216 GLN A H      2  
ATOM   2199  H HA     . GLN A 1 3   ? 0.811  12.720  -2.101  1.00 0.00 ? 216 GLN A HA     2  
ATOM   2200  H HB2    . GLN A 1 3   ? 1.136  11.843  -4.651  1.00 0.00 ? 216 GLN A HB2    2  
ATOM   2201  H HB3    . GLN A 1 3   ? 0.852  10.300  -3.870  1.00 0.00 ? 216 GLN A HB3    2  
ATOM   2202  H HG2    . GLN A 1 3   ? -1.365 10.738  -3.629  1.00 0.00 ? 216 GLN A HG2    2  
ATOM   2203  H HG3    . GLN A 1 3   ? -1.041 12.281  -2.863  1.00 0.00 ? 216 GLN A HG3    2  
ATOM   2204  H HE21   . GLN A 1 3   ? -1.913 10.622  -5.730  1.00 0.00 ? 216 GLN A HE21   2  
ATOM   2205  H HE22   . GLN A 1 3   ? -2.143 11.980  -6.779  1.00 0.00 ? 216 GLN A HE22   2  
ATOM   2206  N N      . GLU A 1 4   ? 0.349  10.328  -0.988  1.00 0.00 ? 217 GLU A N      2  
ATOM   2207  C CA     . GLU A 1 4   ? 0.310  9.275   0.013   1.00 0.00 ? 217 GLU A CA     2  
ATOM   2208  C C      . GLU A 1 4   ? -0.858 8.326   -0.260  1.00 0.00 ? 217 GLU A C      2  
ATOM   2209  O O      . GLU A 1 4   ? -1.772 8.210   0.555   1.00 0.00 ? 217 GLU A O      2  
ATOM   2210  C CB     . GLU A 1 4   ? 0.222  9.862   1.422   1.00 0.00 ? 217 GLU A CB     2  
ATOM   2211  C CG     . GLU A 1 4   ? 1.616  10.120  1.998   1.00 0.00 ? 217 GLU A CG     2  
ATOM   2212  C CD     . GLU A 1 4   ? 1.555  10.326  3.513   1.00 0.00 ? 217 GLU A CD     2  
ATOM   2213  O OE1    . GLU A 1 4   ? 1.526  9.346   4.271   1.00 0.00 ? 217 GLU A OE1    2  
ATOM   2214  O OE2    . GLU A 1 4   ? 1.539  11.558  3.895   1.00 0.00 ? 217 GLU A OE2    2  
ATOM   2215  H H      . GLU A 1 4   ? -0.545 10.671  -1.276  1.00 0.00 ? 217 GLU A H      2  
ATOM   2216  H HA     . GLU A 1 4   ? 1.254  8.740   -0.093  1.00 0.00 ? 217 GLU A HA     2  
ATOM   2217  H HB2    . GLU A 1 4   ? -0.344 10.795  1.398   1.00 0.00 ? 217 GLU A HB2    2  
ATOM   2218  H HB3    . GLU A 1 4   ? -0.322 9.177   2.073   1.00 0.00 ? 217 GLU A HB3    2  
ATOM   2219  H HG2    . GLU A 1 4   ? 2.270  9.279   1.768   1.00 0.00 ? 217 GLU A HG2    2  
ATOM   2220  H HG3    . GLU A 1 4   ? 2.051  11.000  1.525   1.00 0.00 ? 217 GLU A HG3    2  
ATOM   2221  H HE2    . GLU A 1 4   ? 2.017  11.652  4.768   1.00 0.00 ? 217 GLU A HE2    2  
ATOM   2222  N N      . VAL A 1 5   ? -0.793 7.673   -1.410  1.00 0.00 ? 218 VAL A N      2  
ATOM   2223  C CA     . VAL A 1 5   ? -1.834 6.738   -1.802  1.00 0.00 ? 218 VAL A CA     2  
ATOM   2224  C C      . VAL A 1 5   ? -1.540 5.368   -1.187  1.00 0.00 ? 218 VAL A C      2  
ATOM   2225  O O      . VAL A 1 5   ? -2.369 4.815   -0.467  1.00 0.00 ? 218 VAL A O      2  
ATOM   2226  C CB     . VAL A 1 5   ? -1.953 6.696   -3.326  1.00 0.00 ? 218 VAL A CB     2  
ATOM   2227  C CG1    . VAL A 1 5   ? -2.920 5.595   -3.770  1.00 0.00 ? 218 VAL A CG1    2  
ATOM   2228  C CG2    . VAL A 1 5   ? -2.381 8.056   -3.881  1.00 0.00 ? 218 VAL A CG2    2  
ATOM   2229  H H      . VAL A 1 5   ? -0.046 7.774   -2.069  1.00 0.00 ? 218 VAL A H      2  
ATOM   2230  H HA     . VAL A 1 5   ? -2.776 7.108   -1.399  1.00 0.00 ? 218 VAL A HA     2  
ATOM   2231  H HB     . VAL A 1 5   ? -0.970 6.462   -3.734  1.00 0.00 ? 218 VAL A HB     2  
ATOM   2232  H HG11   . VAL A 1 5   ? -3.843 6.048   -4.131  1.00 0.00 ? 218 VAL A HG11   2  
ATOM   2233  H HG12   . VAL A 1 5   ? -2.464 5.012   -4.570  1.00 0.00 ? 218 VAL A HG12   2  
ATOM   2234  H HG13   . VAL A 1 5   ? -3.141 4.943   -2.925  1.00 0.00 ? 218 VAL A HG13   2  
ATOM   2235  H HG21   . VAL A 1 5   ? -2.581 8.738   -3.054  1.00 0.00 ? 218 VAL A HG21   2  
ATOM   2236  H HG22   . VAL A 1 5   ? -1.582 8.463   -4.501  1.00 0.00 ? 218 VAL A HG22   2  
ATOM   2237  H HG23   . VAL A 1 5   ? -3.282 7.939   -4.481  1.00 0.00 ? 218 VAL A HG23   2  
ATOM   2238  N N      . ARG A 1 6   ? -0.356 4.859   -1.494  1.00 0.00 ? 219 ARG A N      2  
ATOM   2239  C CA     . ARG A 1 6   ? 0.058  3.564   -0.981  1.00 0.00 ? 219 ARG A CA     2  
ATOM   2240  C C      . ARG A 1 6   ? 1.582  3.437   -1.024  1.00 0.00 ? 219 ARG A C      2  
ATOM   2241  O O      . ARG A 1 6   ? 2.112  2.398   -1.414  1.00 0.00 ? 219 ARG A O      2  
ATOM   2242  C CB     . ARG A 1 6   ? -0.565 2.426   -1.792  1.00 0.00 ? 219 ARG A CB     2  
ATOM   2243  C CG     . ARG A 1 6   ? -1.130 1.342   -0.873  1.00 0.00 ? 219 ARG A CG     2  
ATOM   2244  C CD     . ARG A 1 6   ? -1.526 0.098   -1.670  1.00 0.00 ? 219 ARG A CD     2  
ATOM   2245  N NE     . ARG A 1 6   ? -1.853 -1.012  -0.747  1.00 0.00 ? 219 ARG A NE     2  
ATOM   2246  C CZ     . ARG A 1 6   ? -3.059 -1.198  -0.193  1.00 0.00 ? 219 ARG A CZ     2  
ATOM   2247  N NH1    . ARG A 1 6   ? -4.059 -0.348  -0.465  1.00 0.00 ? 219 ARG A NH1    2  
ATOM   2248  N NH2    . ARG A 1 6   ? -3.264 -2.233  0.633   1.00 0.00 ? 219 ARG A NH2    2  
ATOM   2249  H H      . ARG A 1 6   ? 0.314  5.314   -2.082  1.00 0.00 ? 219 ARG A H      2  
ATOM   2250  H HA     . ARG A 1 6   ? -0.308 3.540   0.044   1.00 0.00 ? 219 ARG A HA     2  
ATOM   2251  H HB2    . ARG A 1 6   ? -1.358 2.819   -2.428  1.00 0.00 ? 219 ARG A HB2    2  
ATOM   2252  H HB3    . ARG A 1 6   ? 0.186  1.991   -2.453  1.00 0.00 ? 219 ARG A HB3    2  
ATOM   2253  H HG2    . ARG A 1 6   ? -0.388 1.075   -0.120  1.00 0.00 ? 219 ARG A HG2    2  
ATOM   2254  H HG3    . ARG A 1 6   ? -1.999 1.729   -0.341  1.00 0.00 ? 219 ARG A HG3    2  
ATOM   2255  H HD2    . ARG A 1 6   ? -2.385 0.320   -2.304  1.00 0.00 ? 219 ARG A HD2    2  
ATOM   2256  H HD3    . ARG A 1 6   ? -0.710 -0.196  -2.330  1.00 0.00 ? 219 ARG A HD3    2  
ATOM   2257  H HE     . ARG A 1 6   ? -1.129 -1.664  -0.523  1.00 0.00 ? 219 ARG A HE     2  
ATOM   2258  H HH11   . ARG A 1 6   ? -3.906 0.424   -1.082  1.00 0.00 ? 219 ARG A HH11   2  
ATOM   2259  H HH12   . ARG A 1 6   ? -4.958 -0.487  -0.052  1.00 0.00 ? 219 ARG A HH12   2  
ATOM   2260  H HH21   . ARG A 1 6   ? -2.518 -2.866  0.837   1.00 0.00 ? 219 ARG A HH21   2  
ATOM   2261  H HH22   . ARG A 1 6   ? -4.164 -2.371  1.047   1.00 0.00 ? 219 ARG A HH22   2  
ATOM   2262  N N      . ARG A 1 7   ? 2.245  4.511   -0.619  1.00 0.00 ? 220 ARG A N      2  
ATOM   2263  C CA     . ARG A 1 7   ? 3.697  4.534   -0.608  1.00 0.00 ? 220 ARG A CA     2  
ATOM   2264  C C      . ARG A 1 7   ? 4.227  3.956   0.707   1.00 0.00 ? 220 ARG A C      2  
ATOM   2265  O O      . ARG A 1 7   ? 4.824  4.674   1.508   1.00 0.00 ? 220 ARG A O      2  
ATOM   2266  C CB     . ARG A 1 7   ? 4.228  5.959   -0.782  1.00 0.00 ? 220 ARG A CB     2  
ATOM   2267  C CG     . ARG A 1 7   ? 4.980  6.106   -2.107  1.00 0.00 ? 220 ARG A CG     2  
ATOM   2268  C CD     . ARG A 1 7   ? 4.004  6.241   -3.277  1.00 0.00 ? 220 ARG A CD     2  
ATOM   2269  N NE     . ARG A 1 7   ? 4.289  7.481   -4.033  1.00 0.00 ? 220 ARG A NE     2  
ATOM   2270  C CZ     . ARG A 1 7   ? 3.498  7.974   -4.995  1.00 0.00 ? 220 ARG A CZ     2  
ATOM   2271  N NH1    . ARG A 1 7   ? 2.367  7.334   -5.327  1.00 0.00 ? 220 ARG A NH1    2  
ATOM   2272  N NH2    . ARG A 1 7   ? 3.836  9.106   -5.628  1.00 0.00 ? 220 ARG A NH2    2  
ATOM   2273  H H      . ARG A 1 7   ? 1.806  5.352   -0.305  1.00 0.00 ? 220 ARG A H      2  
ATOM   2274  H HA     . ARG A 1 7   ? 3.993  3.915   -1.455  1.00 0.00 ? 220 ARG A HA     2  
ATOM   2275  H HB2    . ARG A 1 7   ? 3.399  6.665   -0.749  1.00 0.00 ? 220 ARG A HB2    2  
ATOM   2276  H HB3    . ARG A 1 7   ? 4.891  6.207   0.047   1.00 0.00 ? 220 ARG A HB3    2  
ATOM   2277  H HG2    . ARG A 1 7   ? 5.628  6.982   -2.065  1.00 0.00 ? 220 ARG A HG2    2  
ATOM   2278  H HG3    . ARG A 1 7   ? 5.622  5.241   -2.262  1.00 0.00 ? 220 ARG A HG3    2  
ATOM   2279  H HD2    . ARG A 1 7   ? 4.092  5.377   -3.936  1.00 0.00 ? 220 ARG A HD2    2  
ATOM   2280  H HD3    . ARG A 1 7   ? 2.978  6.259   -2.908  1.00 0.00 ? 220 ARG A HD3    2  
ATOM   2281  H HE     . ARG A 1 7   ? 5.125  7.984   -3.811  1.00 0.00 ? 220 ARG A HE     2  
ATOM   2282  H HH11   . ARG A 1 7   ? 2.115  6.489   -4.854  1.00 0.00 ? 220 ARG A HH11   2  
ATOM   2283  H HH12   . ARG A 1 7   ? 1.776  7.701   -6.045  1.00 0.00 ? 220 ARG A HH12   2  
ATOM   2284  H HH21   . ARG A 1 7   ? 4.679  9.583   -5.381  1.00 0.00 ? 220 ARG A HH21   2  
ATOM   2285  H HH22   . ARG A 1 7   ? 3.245  9.473   -6.346  1.00 0.00 ? 220 ARG A HH22   2  
ATOM   2286  N N      . GLY A 1 8   ? 3.988  2.667   0.887   1.00 0.00 ? 221 GLY A N      2  
ATOM   2287  C CA     . GLY A 1 8   ? 4.433  1.985   2.091   1.00 0.00 ? 221 GLY A CA     2  
ATOM   2288  C C      . GLY A 1 8   ? 5.936  1.705   2.039   1.00 0.00 ? 221 GLY A C      2  
ATOM   2289  O O      . GLY A 1 8   ? 6.628  1.817   3.049   1.00 0.00 ? 221 GLY A O      2  
ATOM   2290  H H      . GLY A 1 8   ? 3.502  2.090   0.230   1.00 0.00 ? 221 GLY A H      2  
ATOM   2291  H HA2    . GLY A 1 8   ? 4.204  2.595   2.965   1.00 0.00 ? 221 GLY A HA2    2  
ATOM   2292  H HA3    . GLY A 1 8   ? 3.888  1.047   2.206   1.00 0.00 ? 221 GLY A HA3    2  
ATOM   2293  N N      . ASP A 1 9   ? 6.398  1.344   0.850   1.00 0.00 ? 222 ASP A N      2  
ATOM   2294  C CA     . ASP A 1 9   ? 7.806  1.047   0.652   1.00 0.00 ? 222 ASP A CA     2  
ATOM   2295  C C      . ASP A 1 9   ? 8.610  2.348   0.711   1.00 0.00 ? 222 ASP A C      2  
ATOM   2296  O O      . ASP A 1 9   ? 9.725  2.369   1.230   1.00 0.00 ? 222 ASP A O      2  
ATOM   2297  C CB     . ASP A 1 9   ? 8.047  0.404   -0.715  1.00 0.00 ? 222 ASP A CB     2  
ATOM   2298  C CG     . ASP A 1 9   ? 8.749  -0.954  -0.676  1.00 0.00 ? 222 ASP A CG     2  
ATOM   2299  O OD1    . ASP A 1 9   ? 9.510  -1.253  0.256   1.00 0.00 ? 222 ASP A OD1    2  
ATOM   2300  O OD2    . ASP A 1 9   ? 8.483  -1.734  -1.669  1.00 0.00 ? 222 ASP A OD2    2  
ATOM   2301  H H      . ASP A 1 9   ? 5.828  1.256   0.032   1.00 0.00 ? 222 ASP A H      2  
ATOM   2302  H HA     . ASP A 1 9   ? 8.069  0.358   1.455   1.00 0.00 ? 222 ASP A HA     2  
ATOM   2303  H HB2    . ASP A 1 9   ? 7.087  0.287   -1.218  1.00 0.00 ? 222 ASP A HB2    2  
ATOM   2304  H HB3    . ASP A 1 9   ? 8.643  1.087   -1.321  1.00 0.00 ? 222 ASP A HB3    2  
ATOM   2305  H HD2    . ASP A 1 9   ? 7.531  -1.617  -1.950  1.00 0.00 ? 222 ASP A HD2    2  
ATOM   2306  N N      . PHE A 1 10  ? 8.014  3.400   0.172   1.00 0.00 ? 223 PHE A N      2  
ATOM   2307  C CA     . PHE A 1 10  ? 8.660  4.701   0.156   1.00 0.00 ? 223 PHE A CA     2  
ATOM   2308  C C      . PHE A 1 10  ? 8.803  5.260   1.574   1.00 0.00 ? 223 PHE A C      2  
ATOM   2309  O O      . PHE A 1 10  ? 9.747  5.993   1.864   1.00 0.00 ? 223 PHE A O      2  
ATOM   2310  C CB     . PHE A 1 10  ? 7.767  5.636   -0.660  1.00 0.00 ? 223 PHE A CB     2  
ATOM   2311  C CG     . PHE A 1 10  ? 8.162  7.111   -0.571  1.00 0.00 ? 223 PHE A CG     2  
ATOM   2312  C CD1    . PHE A 1 10  ? 7.671  7.889   0.430   1.00 0.00 ? 223 PHE A CD1    2  
ATOM   2313  C CD2    . PHE A 1 10  ? 9.006  7.645   -1.494  1.00 0.00 ? 223 PHE A CD2    2  
ATOM   2314  C CE1    . PHE A 1 10  ? 8.039  9.257   0.513   1.00 0.00 ? 223 PHE A CE1    2  
ATOM   2315  C CE2    . PHE A 1 10  ? 9.375  9.014   -1.413  1.00 0.00 ? 223 PHE A CE2    2  
ATOM   2316  C CZ     . PHE A 1 10  ? 8.883  9.791   -0.411  1.00 0.00 ? 223 PHE A CZ     2  
ATOM   2317  H H      . PHE A 1 10  ? 7.107  3.375   -0.249  1.00 0.00 ? 223 PHE A H      2  
ATOM   2318  H HA     . PHE A 1 10  ? 9.651  4.566   -0.279  1.00 0.00 ? 223 PHE A HA     2  
ATOM   2319  H HB2    . PHE A 1 10  ? 7.790  5.326   -1.704  1.00 0.00 ? 223 PHE A HB2    2  
ATOM   2320  H HB3    . PHE A 1 10  ? 6.736  5.526   -0.319  1.00 0.00 ? 223 PHE A HB3    2  
ATOM   2321  H HD1    . PHE A 1 10  ? 6.995  7.461   1.171   1.00 0.00 ? 223 PHE A HD1    2  
ATOM   2322  H HD2    . PHE A 1 10  ? 9.400  7.022   -2.298  1.00 0.00 ? 223 PHE A HD2    2  
ATOM   2323  H HE1    . PHE A 1 10  ? 7.646  9.881   1.315   1.00 0.00 ? 223 PHE A HE1    2  
ATOM   2324  H HE2    . PHE A 1 10  ? 10.050 9.442   -2.153  1.00 0.00 ? 223 PHE A HE2    2  
ATOM   2325  H HZ     . PHE A 1 10  ? 9.165  10.842  -0.348  1.00 0.00 ? 223 PHE A HZ     2  
ATOM   2326  N N      . VAL A 1 11  ? 7.852  4.891   2.419   1.00 0.00 ? 224 VAL A N      2  
ATOM   2327  C CA     . VAL A 1 11  ? 7.859  5.346   3.799   1.00 0.00 ? 224 VAL A CA     2  
ATOM   2328  C C      . VAL A 1 11  ? 9.011  4.672   4.547   1.00 0.00 ? 224 VAL A C      2  
ATOM   2329  O O      . VAL A 1 11  ? 9.740  5.327   5.291   1.00 0.00 ? 224 VAL A O      2  
ATOM   2330  C CB     . VAL A 1 11  ? 6.495  5.087   4.442   1.00 0.00 ? 224 VAL A CB     2  
ATOM   2331  C CG1    . VAL A 1 11  ? 6.541  5.350   5.949   1.00 0.00 ? 224 VAL A CG1    2  
ATOM   2332  C CG2    . VAL A 1 11  ? 5.405  5.924   3.772   1.00 0.00 ? 224 VAL A CG2    2  
ATOM   2333  H H      . VAL A 1 11  ? 7.087  4.294   2.175   1.00 0.00 ? 224 VAL A H      2  
ATOM   2334  H HA     . VAL A 1 11  ? 8.029  6.422   3.790   1.00 0.00 ? 224 VAL A HA     2  
ATOM   2335  H HB     . VAL A 1 11  ? 6.249  4.035   4.294   1.00 0.00 ? 224 VAL A HB     2  
ATOM   2336  H HG11   . VAL A 1 11  ? 5.587  5.071   6.396   1.00 0.00 ? 224 VAL A HG11   2  
ATOM   2337  H HG12   . VAL A 1 11  ? 7.340  4.759   6.398   1.00 0.00 ? 224 VAL A HG12   2  
ATOM   2338  H HG13   . VAL A 1 11  ? 6.730  6.408   6.127   1.00 0.00 ? 224 VAL A HG13   2  
ATOM   2339  H HG21   . VAL A 1 11  ? 5.132  6.754   4.423   1.00 0.00 ? 224 VAL A HG21   2  
ATOM   2340  H HG22   . VAL A 1 11  ? 5.777  6.313   2.825   1.00 0.00 ? 224 VAL A HG22   2  
ATOM   2341  H HG23   . VAL A 1 11  ? 4.528  5.301   3.591   1.00 0.00 ? 224 VAL A HG23   2  
ATOM   2342  N N      . ARG A 1 12  ? 9.140  3.372   4.323   1.00 0.00 ? 225 ARG A N      2  
ATOM   2343  C CA     . ARG A 1 12  ? 10.191 2.603   4.967   1.00 0.00 ? 225 ARG A CA     2  
ATOM   2344  C C      . ARG A 1 12  ? 11.563 3.047   4.457   1.00 0.00 ? 225 ARG A C      2  
ATOM   2345  O O      . ARG A 1 12  ? 12.536 3.057   5.208   1.00 0.00 ? 225 ARG A O      2  
ATOM   2346  C CB     . ARG A 1 12  ? 10.017 1.106   4.705   1.00 0.00 ? 225 ARG A CB     2  
ATOM   2347  C CG     . ARG A 1 12  ? 11.027 0.287   5.512   1.00 0.00 ? 225 ARG A CG     2  
ATOM   2348  C CD     . ARG A 1 12  ? 10.325 -0.538  6.593   1.00 0.00 ? 225 ARG A CD     2  
ATOM   2349  N NE     . ARG A 1 12  ? 11.145 -1.720  6.939   1.00 0.00 ? 225 ARG A NE     2  
ATOM   2350  C CZ     . ARG A 1 12  ? 11.370 -2.747  6.108   1.00 0.00 ? 225 ARG A CZ     2  
ATOM   2351  N NH1    . ARG A 1 12  ? 10.838 -2.743  4.878   1.00 0.00 ? 225 ARG A NH1    2  
ATOM   2352  N NH2    . ARG A 1 12  ? 12.126 -3.779  6.508   1.00 0.00 ? 225 ARG A NH2    2  
ATOM   2353  H H      . ARG A 1 12  ? 8.543  2.847   3.717   1.00 0.00 ? 225 ARG A H      2  
ATOM   2354  H HA     . ARG A 1 12  ? 10.081 2.816   6.031   1.00 0.00 ? 225 ARG A HA     2  
ATOM   2355  H HB2    . ARG A 1 12  ? 9.004  0.803   4.968   1.00 0.00 ? 225 ARG A HB2    2  
ATOM   2356  H HB3    . ARG A 1 12  ? 10.145 0.902   3.642   1.00 0.00 ? 225 ARG A HB3    2  
ATOM   2357  H HG2    . ARG A 1 12  ? 11.579 -0.375  4.845   1.00 0.00 ? 225 ARG A HG2    2  
ATOM   2358  H HG3    . ARG A 1 12  ? 11.755 0.954   5.974   1.00 0.00 ? 225 ARG A HG3    2  
ATOM   2359  H HD2    . ARG A 1 12  ? 10.161 0.074   7.480   1.00 0.00 ? 225 ARG A HD2    2  
ATOM   2360  H HD3    . ARG A 1 12  ? 9.344  -0.855  6.240   1.00 0.00 ? 225 ARG A HD3    2  
ATOM   2361  H HE     . ARG A 1 12  ? 11.555 -1.756  7.850   1.00 0.00 ? 225 ARG A HE     2  
ATOM   2362  H HH11   . ARG A 1 12  ? 10.274 -1.973  4.580   1.00 0.00 ? 225 ARG A HH11   2  
ATOM   2363  H HH12   . ARG A 1 12  ? 11.007 -3.509  4.258   1.00 0.00 ? 225 ARG A HH12   2  
ATOM   2364  H HH21   . ARG A 1 12  ? 12.522 -3.782  7.426   1.00 0.00 ? 225 ARG A HH21   2  
ATOM   2365  H HH22   . ARG A 1 12  ? 12.294 -4.546  5.888   1.00 0.00 ? 225 ARG A HH22   2  
ATOM   2366  N N      . ASN A 1 13  ? 11.597 3.405   3.181   1.00 0.00 ? 226 ASN A N      2  
ATOM   2367  C CA     . ASN A 1 13  ? 12.833 3.850   2.561   1.00 0.00 ? 226 ASN A CA     2  
ATOM   2368  C C      . ASN A 1 13  ? 13.235 5.205   3.148   1.00 0.00 ? 226 ASN A C      2  
ATOM   2369  O O      . ASN A 1 13  ? 14.420 5.523   3.230   1.00 0.00 ? 226 ASN A O      2  
ATOM   2370  C CB     . ASN A 1 13  ? 12.661 4.021   1.050   1.00 0.00 ? 226 ASN A CB     2  
ATOM   2371  C CG     . ASN A 1 13  ? 12.543 2.663   0.355   1.00 0.00 ? 226 ASN A CG     2  
ATOM   2372  O OD1    . ASN A 1 13  ? 12.007 1.708   0.890   1.00 0.00 ? 226 ASN A OD1    2  
ATOM   2373  N ND2    . ASN A 1 13  ? 13.072 2.632   -0.865  1.00 0.00 ? 226 ASN A ND2    2  
ATOM   2374  H H      . ASN A 1 13  ? 10.801 3.395   2.576   1.00 0.00 ? 226 ASN A H      2  
ATOM   2375  H HA     . ASN A 1 13  ? 13.561 3.068   2.780   1.00 0.00 ? 226 ASN A HA     2  
ATOM   2376  H HB2    . ASN A 1 13  ? 11.771 4.617   0.847   1.00 0.00 ? 226 ASN A HB2    2  
ATOM   2377  H HB3    . ASN A 1 13  ? 13.511 4.570   0.644   1.00 0.00 ? 226 ASN A HB3    2  
ATOM   2378  H HD21   . ASN A 1 13  ? 13.498 3.453   -1.246  1.00 0.00 ? 226 ASN A HD21   2  
ATOM   2379  H HD22   . ASN A 1 13  ? 13.044 1.789   -1.401  1.00 0.00 ? 226 ASN A HD22   2  
ATOM   2380  N N      . TRP A 1 14  ? 12.224 5.967   3.540   1.00 0.00 ? 227 TRP A N      2  
ATOM   2381  C CA     . TRP A 1 14  ? 12.457 7.280   4.116   1.00 0.00 ? 227 TRP A CA     2  
ATOM   2382  C C      . TRP A 1 14  ? 13.241 7.093   5.416   1.00 0.00 ? 227 TRP A C      2  
ATOM   2383  O O      . TRP A 1 14  ? 14.148 7.870   5.715   1.00 0.00 ? 227 TRP A O      2  
ATOM   2384  C CB     . TRP A 1 14  ? 11.140 8.033   4.315   1.00 0.00 ? 227 TRP A CB     2  
ATOM   2385  C CG     . TRP A 1 14  ? 11.013 9.300   3.466   1.00 0.00 ? 227 TRP A CG     2  
ATOM   2386  C CD1    . TRP A 1 14  ? 9.959  9.707   2.745   1.00 0.00 ? 227 TRP A CD1    2  
ATOM   2387  C CD2    . TRP A 1 14  ? 12.021 10.314  3.279   1.00 0.00 ? 227 TRP A CD2    2  
ATOM   2388  N NE1    . TRP A 1 14  ? 10.214 10.905  2.110   1.00 0.00 ? 227 TRP A NE1    2  
ATOM   2389  C CE2    . TRP A 1 14  ? 11.508 11.286  2.444   1.00 0.00 ? 227 TRP A CE2    2  
ATOM   2390  C CE3    . TRP A 1 14  ? 13.325 10.408  3.797   1.00 0.00 ? 227 TRP A CE3    2  
ATOM   2391  C CZ2    . TRP A 1 14  ? 12.229 12.421  2.054   1.00 0.00 ? 227 TRP A CZ2    2  
ATOM   2392  C CZ3    . TRP A 1 14  ? 14.033 11.547  3.398   1.00 0.00 ? 227 TRP A CZ3    2  
ATOM   2393  C CH2    . TRP A 1 14  ? 13.530 12.535  2.559   1.00 0.00 ? 227 TRP A CH2    2  
ATOM   2394  H H      . TRP A 1 14  ? 11.263 5.701   3.468   1.00 0.00 ? 227 TRP A H      2  
ATOM   2395  H HA     . TRP A 1 14  ? 13.047 7.857   3.403   1.00 0.00 ? 227 TRP A HA     2  
ATOM   2396  H HB2    . TRP A 1 14  ? 10.311 7.364   4.078   1.00 0.00 ? 227 TRP A HB2    2  
ATOM   2397  H HB3    . TRP A 1 14  ? 11.043 8.302   5.367   1.00 0.00 ? 227 TRP A HB3    2  
ATOM   2398  H HD1    . TRP A 1 14  ? 9.019  9.161   2.670   1.00 0.00 ? 227 TRP A HD1    2  
ATOM   2399  H HE1    . TRP A 1 14  ? 9.527  11.452  1.463   1.00 0.00 ? 227 TRP A HE1    2  
ATOM   2400  H HE3    . TRP A 1 14  ? 13.752 9.654   4.458   1.00 0.00 ? 227 TRP A HE3    2  
ATOM   2401  H HZ2    . TRP A 1 14  ? 11.801 13.174  1.393   1.00 0.00 ? 227 TRP A HZ2    2  
ATOM   2402  H HZ3    . TRP A 1 14  ? 15.050 11.670  3.772   1.00 0.00 ? 227 TRP A HZ3    2  
ATOM   2403  H HH2    . TRP A 1 14  ? 14.146 13.395  2.294   1.00 0.00 ? 227 TRP A HH2    2  
ATOM   2404  N N      . GLN A 1 15  ? 12.865 6.060   6.153   1.00 0.00 ? 228 GLN A N      2  
ATOM   2405  C CA     . GLN A 1 15  ? 13.522 5.762   7.414   1.00 0.00 ? 228 GLN A CA     2  
ATOM   2406  C C      . GLN A 1 15  ? 14.916 5.185   7.163   1.00 0.00 ? 228 GLN A C      2  
ATOM   2407  O O      . GLN A 1 15  ? 15.841 5.427   7.937   1.00 0.00 ? 228 GLN A O      2  
ATOM   2408  C CB     . GLN A 1 15  ? 12.677 4.807   8.261   1.00 0.00 ? 228 GLN A CB     2  
ATOM   2409  C CG     . GLN A 1 15  ? 13.500 4.215   9.407   1.00 0.00 ? 228 GLN A CG     2  
ATOM   2410  C CD     . GLN A 1 15  ? 12.743 4.313   10.733  1.00 0.00 ? 228 GLN A CD     2  
ATOM   2411  O OE1    . GLN A 1 15  ? 13.060 5.109   11.601  1.00 0.00 ? 228 GLN A OE1    2  
ATOM   2412  N NE2    . GLN A 1 15  ? 11.727 3.461   10.839  1.00 0.00 ? 228 GLN A NE2    2  
ATOM   2413  H H      . GLN A 1 15  ? 12.127 5.434   5.903   1.00 0.00 ? 228 GLN A H      2  
ATOM   2414  H HA     . GLN A 1 15  ? 13.605 6.718   7.931   1.00 0.00 ? 228 GLN A HA     2  
ATOM   2415  H HB2    . GLN A 1 15  ? 11.816 5.338   8.664   1.00 0.00 ? 228 GLN A HB2    2  
ATOM   2416  H HB3    . GLN A 1 15  ? 12.292 4.003   7.634   1.00 0.00 ? 228 GLN A HB3    2  
ATOM   2417  H HG2    . GLN A 1 15  ? 13.732 3.173   9.192   1.00 0.00 ? 228 GLN A HG2    2  
ATOM   2418  H HG3    . GLN A 1 15  ? 14.450 4.743   9.487   1.00 0.00 ? 228 GLN A HG3    2  
ATOM   2419  H HE21   . GLN A 1 15  ? 11.519 2.835   10.088  1.00 0.00 ? 228 GLN A HE21   2  
ATOM   2420  H HE22   . GLN A 1 15  ? 11.170 3.449   11.670  1.00 0.00 ? 228 GLN A HE22   2  
ATOM   2421  N N      . LEU A 1 16  ? 15.023 4.431   6.079   1.00 0.00 ? 229 LEU A N      2  
ATOM   2422  C CA     . LEU A 1 16  ? 16.288 3.817   5.715   1.00 0.00 ? 229 LEU A CA     2  
ATOM   2423  C C      . LEU A 1 16  ? 17.270 4.904   5.272   1.00 0.00 ? 229 LEU A C      2  
ATOM   2424  O O      . LEU A 1 16  ? 18.460 4.831   5.570   1.00 0.00 ? 229 LEU A O      2  
ATOM   2425  C CB     . LEU A 1 16  ? 16.073 2.720   4.670   1.00 0.00 ? 229 LEU A CB     2  
ATOM   2426  C CG     . LEU A 1 16  ? 15.892 1.301   5.214   1.00 0.00 ? 229 LEU A CG     2  
ATOM   2427  C CD1    . LEU A 1 16  ? 14.548 1.156   5.931   1.00 0.00 ? 229 LEU A CD1    2  
ATOM   2428  C CD2    . LEU A 1 16  ? 16.066 0.263   4.105   1.00 0.00 ? 229 LEU A CD2    2  
ATOM   2429  H H      . LEU A 1 16  ? 14.266 4.239   5.454   1.00 0.00 ? 229 LEU A H      2  
ATOM   2430  H HA     . LEU A 1 16  ? 16.687 3.336   6.609   1.00 0.00 ? 229 LEU A HA     2  
ATOM   2431  H HB2    . LEU A 1 16  ? 15.192 2.976   4.081   1.00 0.00 ? 229 LEU A HB2    2  
ATOM   2432  H HB3    . LEU A 1 16  ? 16.924 2.722   3.990   1.00 0.00 ? 229 LEU A HB3    2  
ATOM   2433  H HG     . LEU A 1 16  ? 16.672 1.117   5.953   1.00 0.00 ? 229 LEU A HG     2  
ATOM   2434  H HD11   . LEU A 1 16  ? 14.500 0.183   6.419   1.00 0.00 ? 229 LEU A HD11   2  
ATOM   2435  H HD12   . LEU A 1 16  ? 14.447 1.943   6.678   1.00 0.00 ? 229 LEU A HD12   2  
ATOM   2436  H HD13   . LEU A 1 16  ? 13.738 1.239   5.205   1.00 0.00 ? 229 LEU A HD13   2  
ATOM   2437  H HD21   . LEU A 1 16  ? 16.050 -0.737  4.538   1.00 0.00 ? 229 LEU A HD21   2  
ATOM   2438  H HD22   . LEU A 1 16  ? 15.253 0.360   3.385   1.00 0.00 ? 229 LEU A HD22   2  
ATOM   2439  H HD23   . LEU A 1 16  ? 17.018 0.426   3.600   1.00 0.00 ? 229 LEU A HD23   2  
ATOM   2440  N N      . VAL A 1 17  ? 16.732 5.888   4.564   1.00 0.00 ? 230 VAL A N      2  
ATOM   2441  C CA     . VAL A 1 17  ? 17.545 6.989   4.077   1.00 0.00 ? 230 VAL A CA     2  
ATOM   2442  C C      . VAL A 1 17  ? 17.955 7.876   5.254   1.00 0.00 ? 230 VAL A C      2  
ATOM   2443  O O      . VAL A 1 17  ? 18.987 8.542   5.205   1.00 0.00 ? 230 VAL A O      2  
ATOM   2444  C CB     . VAL A 1 17  ? 16.792 7.753   2.986   1.00 0.00 ? 230 VAL A CB     2  
ATOM   2445  C CG1    . VAL A 1 17  ? 17.557 9.010   2.568   1.00 0.00 ? 230 VAL A CG1    2  
ATOM   2446  C CG2    . VAL A 1 17  ? 16.513 6.854   1.781   1.00 0.00 ? 230 VAL A CG2    2  
ATOM   2447  H H      . VAL A 1 17  ? 15.762 5.940   4.325   1.00 0.00 ? 230 VAL A H      2  
ATOM   2448  H HA     . VAL A 1 17  ? 18.443 6.562   3.631   1.00 0.00 ? 230 VAL A HA     2  
ATOM   2449  H HB     . VAL A 1 17  ? 15.832 8.066   3.398   1.00 0.00 ? 230 VAL A HB     2  
ATOM   2450  H HG11   . VAL A 1 17  ? 17.595 9.067   1.481   1.00 0.00 ? 230 VAL A HG11   2  
ATOM   2451  H HG12   . VAL A 1 17  ? 17.050 9.892   2.961   1.00 0.00 ? 230 VAL A HG12   2  
ATOM   2452  H HG13   . VAL A 1 17  ? 18.571 8.967   2.966   1.00 0.00 ? 230 VAL A HG13   2  
ATOM   2453  H HG21   . VAL A 1 17  ? 15.622 7.208   1.261   1.00 0.00 ? 230 VAL A HG21   2  
ATOM   2454  H HG22   . VAL A 1 17  ? 17.364 6.883   1.101   1.00 0.00 ? 230 VAL A HG22   2  
ATOM   2455  H HG23   . VAL A 1 17  ? 16.353 5.831   2.119   1.00 0.00 ? 230 VAL A HG23   2  
ATOM   2456  N N      . ALA A 1 18  ? 17.123 7.856   6.286   1.00 0.00 ? 231 ALA A N      2  
ATOM   2457  C CA     . ALA A 1 18  ? 17.385 8.651   7.474   1.00 0.00 ? 231 ALA A CA     2  
ATOM   2458  C C      . ALA A 1 18  ? 18.519 8.006   8.273   1.00 0.00 ? 231 ALA A C      2  
ATOM   2459  O O      . ALA A 1 18  ? 19.185 8.675   9.064   1.00 0.00 ? 231 ALA A O      2  
ATOM   2460  C CB     . ALA A 1 18  ? 16.099 8.785   8.292   1.00 0.00 ? 231 ALA A CB     2  
ATOM   2461  H H      . ALA A 1 18  ? 16.285 7.312   6.317   1.00 0.00 ? 231 ALA A H      2  
ATOM   2462  H HA     . ALA A 1 18  ? 17.699 9.642   7.148   1.00 0.00 ? 231 ALA A HA     2  
ATOM   2463  H HB1    . ALA A 1 18  ? 16.179 8.182   9.197   1.00 0.00 ? 231 ALA A HB1    2  
ATOM   2464  H HB2    . ALA A 1 18  ? 15.950 9.830   8.564   1.00 0.00 ? 231 ALA A HB2    2  
ATOM   2465  H HB3    . ALA A 1 18  ? 15.253 8.440   7.698   1.00 0.00 ? 231 ALA A HB3    2  
ATOM   2466  N N      . ALA A 1 19  ? 18.707 6.716   8.038   1.00 0.00 ? 232 ALA A N      2  
ATOM   2467  C CA     . ALA A 1 19  ? 19.750 5.974   8.726   1.00 0.00 ? 232 ALA A CA     2  
ATOM   2468  C C      . ALA A 1 19  ? 21.104 6.304   8.096   1.00 0.00 ? 232 ALA A C      2  
ATOM   2469  O O      . ALA A 1 19  ? 22.150 6.002   8.670   1.00 0.00 ? 232 ALA A O      2  
ATOM   2470  C CB     . ALA A 1 19  ? 19.431 4.478   8.674   1.00 0.00 ? 232 ALA A CB     2  
ATOM   2471  H H      . ALA A 1 19  ? 18.161 6.180   7.394   1.00 0.00 ? 232 ALA A H      2  
ATOM   2472  H HA     . ALA A 1 19  ? 19.755 6.295   9.768   1.00 0.00 ? 232 ALA A HA     2  
ATOM   2473  H HB1    . ALA A 1 19  ? 19.144 4.203   7.659   1.00 0.00 ? 232 ALA A HB1    2  
ATOM   2474  H HB2    . ALA A 1 19  ? 20.313 3.909   8.969   1.00 0.00 ? 232 ALA A HB2    2  
ATOM   2475  H HB3    . ALA A 1 19  ? 18.611 4.257   9.357   1.00 0.00 ? 232 ALA A HB3    2  
ATOM   2476  N N      . VAL A 1 20  ? 21.042 6.919   6.924   1.00 0.00 ? 233 VAL A N      2  
ATOM   2477  C CA     . VAL A 1 20  ? 22.251 7.293   6.210   1.00 0.00 ? 233 VAL A CA     2  
ATOM   2478  C C      . VAL A 1 20  ? 22.366 8.818   6.175   1.00 0.00 ? 233 VAL A C      2  
ATOM   2479  O O      . VAL A 1 20  ? 21.554 9.491   5.542   1.00 0.00 ? 233 VAL A O      2  
ATOM   2480  C CB     . VAL A 1 20  ? 22.253 6.660   4.817   1.00 0.00 ? 233 VAL A CB     2  
ATOM   2481  C CG1    . VAL A 1 20  ? 23.592 6.890   4.113   1.00 0.00 ? 233 VAL A CG1    2  
ATOM   2482  C CG2    . VAL A 1 20  ? 21.921 5.169   4.891   1.00 0.00 ? 233 VAL A CG2    2  
ATOM   2483  H H      . VAL A 1 20  ? 20.188 7.161   6.465   1.00 0.00 ? 233 VAL A H      2  
ATOM   2484  H HA     . VAL A 1 20  ? 23.098 6.890   6.765   1.00 0.00 ? 233 VAL A HA     2  
ATOM   2485  H HB     . VAL A 1 20  ? 21.476 7.148   4.227   1.00 0.00 ? 233 VAL A HB     2  
ATOM   2486  H HG11   . VAL A 1 20  ? 23.460 7.613   3.307   1.00 0.00 ? 233 VAL A HG11   2  
ATOM   2487  H HG12   . VAL A 1 20  ? 24.318 7.274   4.829   1.00 0.00 ? 233 VAL A HG12   2  
ATOM   2488  H HG13   . VAL A 1 20  ? 23.951 5.947   3.700   1.00 0.00 ? 233 VAL A HG13   2  
ATOM   2489  H HG21   . VAL A 1 20  ? 20.968 4.983   4.395   1.00 0.00 ? 233 VAL A HG21   2  
ATOM   2490  H HG22   . VAL A 1 20  ? 22.706 4.597   4.397   1.00 0.00 ? 233 VAL A HG22   2  
ATOM   2491  H HG23   . VAL A 1 20  ? 21.853 4.863   5.935   1.00 0.00 ? 233 VAL A HG23   2  
ATOM   2492  N N      . PRO A 1 21  ? 23.408 9.333   6.881   1.00 0.00 ? 234 PRO A N      2  
ATOM   2493  C CA     . PRO A 1 21  ? 23.639 10.767  6.936   1.00 0.00 ? 234 PRO A CA     2  
ATOM   2494  C C      . PRO A 1 21  ? 24.233 11.277  5.622   1.00 0.00 ? 234 PRO A C      2  
ATOM   2495  O O      . PRO A 1 21  ? 24.088 12.451  5.285   1.00 0.00 ? 234 PRO A O      2  
ATOM   2496  C CB     . PRO A 1 21  ? 24.565 10.970  8.125   1.00 0.00 ? 234 PRO A CB     2  
ATOM   2497  C CG     . PRO A 1 21  ? 25.188 9.612   8.405   1.00 0.00 ? 234 PRO A CG     2  
ATOM   2498  C CD     . PRO A 1 21  ? 24.390 8.567   7.643   1.00 0.00 ? 234 PRO A CD     2  
ATOM   2499  H HA     . PRO A 1 21  ? 22.774 11.254  7.053   1.00 0.00 ? 234 PRO A HA     2  
ATOM   2500  H HB2    . PRO A 1 21  ? 25.332 11.712  7.900   1.00 0.00 ? 234 PRO A HB2    2  
ATOM   2501  H HB3    . PRO A 1 21  ? 24.014 11.334  8.991   1.00 0.00 ? 234 PRO A HB3    2  
ATOM   2502  H HG2    . PRO A 1 21  ? 26.232 9.599   8.092   1.00 0.00 ? 234 PRO A HG2    2  
ATOM   2503  H HG3    . PRO A 1 21  ? 25.173 9.399   9.474   1.00 0.00 ? 234 PRO A HG3    2  
ATOM   2504  H HD2    . PRO A 1 21  ? 25.032 7.981   6.985   1.00 0.00 ? 234 PRO A HD2    2  
ATOM   2505  H HD3    . PRO A 1 21  ? 23.905 7.865   8.322   1.00 0.00 ? 234 PRO A HD3    2  
ATOM   2506  N N      . LEU A 1 22  ? 24.888 10.369  4.913   1.00 0.00 ? 235 LEU A N      2  
ATOM   2507  C CA     . LEU A 1 22  ? 25.504 10.713  3.642   1.00 0.00 ? 235 LEU A CA     2  
ATOM   2508  C C      . LEU A 1 22  ? 24.444 11.299  2.709   1.00 0.00 ? 235 LEU A C      2  
ATOM   2509  O O      . LEU A 1 22  ? 24.720 12.237  1.963   1.00 0.00 ? 235 LEU A O      2  
ATOM   2510  C CB     . LEU A 1 22  ? 26.237 9.504   3.059   1.00 0.00 ? 235 LEU A CB     2  
ATOM   2511  C CG     . LEU A 1 22  ? 26.439 9.509   1.541   1.00 0.00 ? 235 LEU A CG     2  
ATOM   2512  C CD1    . LEU A 1 22  ? 27.926 9.488   1.186   1.00 0.00 ? 235 LEU A CD1    2  
ATOM   2513  C CD2    . LEU A 1 22  ? 25.674 8.360   0.883   1.00 0.00 ? 235 LEU A CD2    2  
ATOM   2514  H H      . LEU A 1 22  ? 25.001 9.415   5.194   1.00 0.00 ? 235 LEU A H      2  
ATOM   2515  H HA     . LEU A 1 22  ? 26.254 11.479  3.840   1.00 0.00 ? 235 LEU A HA     2  
ATOM   2516  H HB2    . LEU A 1 22  ? 27.216 9.431   3.534   1.00 0.00 ? 235 LEU A HB2    2  
ATOM   2517  H HB3    . LEU A 1 22  ? 25.685 8.604   3.328   1.00 0.00 ? 235 LEU A HB3    2  
ATOM   2518  H HG     . LEU A 1 22  ? 26.026 10.438  1.146   1.00 0.00 ? 235 LEU A HG     2  
ATOM   2519  H HD11   . LEU A 1 22  ? 28.041 9.549   0.104   1.00 0.00 ? 235 LEU A HD11   2  
ATOM   2520  H HD12   . LEU A 1 22  ? 28.424 10.337  1.654   1.00 0.00 ? 235 LEU A HD12   2  
ATOM   2521  H HD13   . LEU A 1 22  ? 28.372 8.561   1.546   1.00 0.00 ? 235 LEU A HD13   2  
ATOM   2522  H HD21   . LEU A 1 22  ? 25.813 8.402   -0.198  1.00 0.00 ? 235 LEU A HD21   2  
ATOM   2523  H HD22   . LEU A 1 22  ? 26.051 7.409   1.260   1.00 0.00 ? 235 LEU A HD22   2  
ATOM   2524  H HD23   . LEU A 1 22  ? 24.613 8.448   1.115   1.00 0.00 ? 235 LEU A HD23   2  
ATOM   2525  N N      . PHE A 1 23  ? 23.253 10.722  2.781   1.00 0.00 ? 236 PHE A N      2  
ATOM   2526  C CA     . PHE A 1 23  ? 22.151 11.177  1.952   1.00 0.00 ? 236 PHE A CA     2  
ATOM   2527  C C      . PHE A 1 23  ? 21.506 12.435  2.536   1.00 0.00 ? 236 PHE A C      2  
ATOM   2528  O O      . PHE A 1 23  ? 20.813 13.167  1.832   1.00 0.00 ? 236 PHE A O      2  
ATOM   2529  C CB     . PHE A 1 23  ? 21.115 10.051  1.930   1.00 0.00 ? 236 PHE A CB     2  
ATOM   2530  C CG     . PHE A 1 23  ? 21.362 8.999   0.847   1.00 0.00 ? 236 PHE A CG     2  
ATOM   2531  C CD1    . PHE A 1 23  ? 21.289 9.344   -0.467  1.00 0.00 ? 236 PHE A CD1    2  
ATOM   2532  C CD2    . PHE A 1 23  ? 21.655 7.718   1.198   1.00 0.00 ? 236 PHE A CD2    2  
ATOM   2533  C CE1    . PHE A 1 23  ? 21.520 8.367   -1.471  1.00 0.00 ? 236 PHE A CE1    2  
ATOM   2534  C CE2    . PHE A 1 23  ? 21.885 6.741   0.193   1.00 0.00 ? 236 PHE A CE2    2  
ATOM   2535  C CZ     . PHE A 1 23  ? 21.813 7.086   -1.120  1.00 0.00 ? 236 PHE A CZ     2  
ATOM   2536  H H      . PHE A 1 23  ? 23.038 9.960   3.391   1.00 0.00 ? 236 PHE A H      2  
ATOM   2537  H HA     . PHE A 1 23  ? 22.559 11.404  0.968   1.00 0.00 ? 236 PHE A HA     2  
ATOM   2538  H HB2    . PHE A 1 23  ? 21.105 9.561   2.903   1.00 0.00 ? 236 PHE A HB2    2  
ATOM   2539  H HB3    . PHE A 1 23  ? 20.125 10.484  1.781   1.00 0.00 ? 236 PHE A HB3    2  
ATOM   2540  H HD1    . PHE A 1 23  ? 21.054 10.370  -0.748  1.00 0.00 ? 236 PHE A HD1    2  
ATOM   2541  H HD2    . PHE A 1 23  ? 21.714 7.441   2.251   1.00 0.00 ? 236 PHE A HD2    2  
ATOM   2542  H HE1    . PHE A 1 23  ? 21.461 8.643   -2.524  1.00 0.00 ? 236 PHE A HE1    2  
ATOM   2543  H HE2    . PHE A 1 23  ? 22.120 5.714   0.475   1.00 0.00 ? 236 PHE A HE2    2  
ATOM   2544  H HZ     . PHE A 1 23  ? 21.989 6.336   -1.891  1.00 0.00 ? 236 PHE A HZ     2  
ATOM   2545  N N      . GLN A 1 24  ? 21.758 12.648  3.820   1.00 0.00 ? 237 GLN A N      2  
ATOM   2546  C CA     . GLN A 1 24  ? 21.211 13.805  4.508   1.00 0.00 ? 237 GLN A CA     2  
ATOM   2547  C C      . GLN A 1 24  ? 22.034 15.053  4.183   1.00 0.00 ? 237 GLN A C      2  
ATOM   2548  O O      . GLN A 1 24  ? 21.575 16.175  4.392   1.00 0.00 ? 237 GLN A O      2  
ATOM   2549  C CB     . GLN A 1 24  ? 21.149 13.566  6.018   1.00 0.00 ? 237 GLN A CB     2  
ATOM   2550  C CG     . GLN A 1 24  ? 20.234 12.387  6.349   1.00 0.00 ? 237 GLN A CG     2  
ATOM   2551  C CD     . GLN A 1 24  ? 18.822 12.618  5.806   1.00 0.00 ? 237 GLN A CD     2  
ATOM   2552  O OE1    . GLN A 1 24  ? 18.144 13.572  6.153   1.00 0.00 ? 237 GLN A OE1    2  
ATOM   2553  N NE2    . GLN A 1 24  ? 18.418 11.694  4.939   1.00 0.00 ? 237 GLN A NE2    2  
ATOM   2554  H H      . GLN A 1 24  ? 22.322 12.047  4.387   1.00 0.00 ? 237 GLN A H      2  
ATOM   2555  H HA     . GLN A 1 24  ? 20.198 13.919  4.123   1.00 0.00 ? 237 GLN A HA     2  
ATOM   2556  H HB2    . GLN A 1 24  ? 22.151 13.373  6.401   1.00 0.00 ? 237 GLN A HB2    2  
ATOM   2557  H HB3    . GLN A 1 24  ? 20.785 14.465  6.517   1.00 0.00 ? 237 GLN A HB3    2  
ATOM   2558  H HG2    . GLN A 1 24  ? 20.645 11.471  5.924   1.00 0.00 ? 237 GLN A HG2    2  
ATOM   2559  H HG3    . GLN A 1 24  ? 20.193 12.245  7.429   1.00 0.00 ? 237 GLN A HG3    2  
ATOM   2560  H HE21   . GLN A 1 24  ? 19.023 10.936  4.699   1.00 0.00 ? 237 GLN A HE21   2  
ATOM   2561  H HE22   . GLN A 1 24  ? 17.508 11.758  4.529   1.00 0.00 ? 237 GLN A HE22   2  
ATOM   2562  N N      . LYS A 1 25  ? 23.235 14.816  3.678   1.00 0.00 ? 238 LYS A N      2  
ATOM   2563  C CA     . LYS A 1 25  ? 24.126 15.907  3.323   1.00 0.00 ? 238 LYS A CA     2  
ATOM   2564  C C      . LYS A 1 25  ? 23.628 16.569  2.035   1.00 0.00 ? 238 LYS A C      2  
ATOM   2565  O O      . LYS A 1 25  ? 24.156 17.598  1.618   1.00 0.00 ? 238 LYS A O      2  
ATOM   2566  C CB     . LYS A 1 25  ? 25.572 15.413  3.240   1.00 0.00 ? 238 LYS A CB     2  
ATOM   2567  C CG     . LYS A 1 25  ? 26.135 15.129  4.635   1.00 0.00 ? 238 LYS A CG     2  
ATOM   2568  C CD     . LYS A 1 25  ? 27.641 14.864  4.575   1.00 0.00 ? 238 LYS A CD     2  
ATOM   2569  C CE     . LYS A 1 25  ? 28.134 14.213  5.868   1.00 0.00 ? 238 LYS A CE     2  
ATOM   2570  N NZ     . LYS A 1 25  ? 28.829 12.940  5.574   1.00 0.00 ? 238 LYS A NZ     2  
ATOM   2571  H H      . LYS A 1 25  ? 23.601 13.901  3.511   1.00 0.00 ? 238 LYS A H      2  
ATOM   2572  H HA     . LYS A 1 25  ? 24.082 16.641  4.128   1.00 0.00 ? 238 LYS A HA     2  
ATOM   2573  H HB2    . LYS A 1 25  ? 25.618 14.508  2.635   1.00 0.00 ? 238 LYS A HB2    2  
ATOM   2574  H HB3    . LYS A 1 25  ? 26.188 16.161  2.741   1.00 0.00 ? 238 LYS A HB3    2  
ATOM   2575  H HG2    . LYS A 1 25  ? 25.937 15.978  5.290   1.00 0.00 ? 238 LYS A HG2    2  
ATOM   2576  H HG3    . LYS A 1 25  ? 25.627 14.267  5.067   1.00 0.00 ? 238 LYS A HG3    2  
ATOM   2577  H HD2    . LYS A 1 25  ? 27.866 14.216  3.728   1.00 0.00 ? 238 LYS A HD2    2  
ATOM   2578  H HD3    . LYS A 1 25  ? 28.172 15.802  4.410   1.00 0.00 ? 238 LYS A HD3    2  
ATOM   2579  H HE2    . LYS A 1 25  ? 28.810 14.891  6.389   1.00 0.00 ? 238 LYS A HE2    2  
ATOM   2580  H HE3    . LYS A 1 25  ? 27.292 14.029  6.534   1.00 0.00 ? 238 LYS A HE3    2  
ATOM   2581  H HZ1    . LYS A 1 25  ? 29.175 12.958  4.637   1.00 0.00 ? 238 LYS A HZ1    2  
ATOM   2582  H HZ2    . LYS A 1 25  ? 29.592 12.822  6.210   1.00 0.00 ? 238 LYS A HZ2    2  
ATOM   2583  H HZ3    . LYS A 1 25  ? 28.189 12.179  5.678   1.00 0.00 ? 238 LYS A HZ3    2  
ATOM   2584  N N      . LEU A 1 26  ? 22.618 15.949  1.443   1.00 0.00 ? 239 LEU A N      2  
ATOM   2585  C CA     . LEU A 1 26  ? 22.043 16.465  0.213   1.00 0.00 ? 239 LEU A CA     2  
ATOM   2586  C C      . LEU A 1 26  ? 20.818 17.319  0.546   1.00 0.00 ? 239 LEU A C      2  
ATOM   2587  O O      . LEU A 1 26  ? 20.139 17.076  1.541   1.00 0.00 ? 239 LEU A O      2  
ATOM   2588  C CB     . LEU A 1 26  ? 21.749 15.321  -0.761  1.00 0.00 ? 239 LEU A CB     2  
ATOM   2589  C CG     . LEU A 1 26  ? 22.943 14.449  -1.152  1.00 0.00 ? 239 LEU A CG     2  
ATOM   2590  C CD1    . LEU A 1 26  ? 22.486 13.046  -1.559  1.00 0.00 ? 239 LEU A CD1    2  
ATOM   2591  C CD2    . LEU A 1 26  ? 23.779 15.119  -2.244  1.00 0.00 ? 239 LEU A CD2    2  
ATOM   2592  H H      . LEU A 1 26  ? 22.194 15.112  1.790   1.00 0.00 ? 239 LEU A H      2  
ATOM   2593  H HA     . LEU A 1 26  ? 22.792 17.103  -0.257  1.00 0.00 ? 239 LEU A HA     2  
ATOM   2594  H HB2    . LEU A 1 26  ? 20.985 14.682  -0.319  1.00 0.00 ? 239 LEU A HB2    2  
ATOM   2595  H HB3    . LEU A 1 26  ? 21.322 15.747  -1.670  1.00 0.00 ? 239 LEU A HB3    2  
ATOM   2596  H HG     . LEU A 1 26  ? 23.585 14.337  -0.278  1.00 0.00 ? 239 LEU A HG     2  
ATOM   2597  H HD11   . LEU A 1 26  ? 21.929 12.594  -0.740  1.00 0.00 ? 239 LEU A HD11   2  
ATOM   2598  H HD12   . LEU A 1 26  ? 21.848 13.114  -2.440  1.00 0.00 ? 239 LEU A HD12   2  
ATOM   2599  H HD13   . LEU A 1 26  ? 23.357 12.433  -1.788  1.00 0.00 ? 239 LEU A HD13   2  
ATOM   2600  H HD21   . LEU A 1 26  ? 23.125 15.450  -3.050  1.00 0.00 ? 239 LEU A HD21   2  
ATOM   2601  H HD22   . LEU A 1 26  ? 24.301 15.979  -1.824  1.00 0.00 ? 239 LEU A HD22   2  
ATOM   2602  H HD23   . LEU A 1 26  ? 24.506 14.407  -2.633  1.00 0.00 ? 239 LEU A HD23   2  
ATOM   2603  N N      . GLY A 1 27  ? 20.575 18.304  -0.306  1.00 0.00 ? 240 GLY A N      2  
ATOM   2604  C CA     . GLY A 1 27  ? 19.444 19.197  -0.115  1.00 0.00 ? 240 GLY A CA     2  
ATOM   2605  C C      . GLY A 1 27  ? 18.164 18.408  0.165   1.00 0.00 ? 240 GLY A C      2  
ATOM   2606  O O      . GLY A 1 27  ? 18.178 17.178  0.175   1.00 0.00 ? 240 GLY A O      2  
ATOM   2607  H H      . GLY A 1 27  ? 21.132 18.496  -1.114  1.00 0.00 ? 240 GLY A H      2  
ATOM   2608  H HA2    . GLY A 1 27  ? 19.647 19.874  0.715   1.00 0.00 ? 240 GLY A HA2    2  
ATOM   2609  H HA3    . GLY A 1 27  ? 19.308 19.814  -1.004  1.00 0.00 ? 240 GLY A HA3    2  
ATOM   2610  N N      . PRO A 1 28  ? 17.059 19.167  0.394   1.00 0.00 ? 241 PRO A N      2  
ATOM   2611  C CA     . PRO A 1 28  ? 15.773 18.551  0.674   1.00 0.00 ? 241 PRO A CA     2  
ATOM   2612  C C      . PRO A 1 28  ? 15.153 17.972  -0.599  1.00 0.00 ? 241 PRO A C      2  
ATOM   2613  O O      . PRO A 1 28  ? 14.598 16.875  -0.579  1.00 0.00 ? 241 PRO A O      2  
ATOM   2614  C CB     . PRO A 1 28  ? 14.934 19.658  1.292   1.00 0.00 ? 241 PRO A CB     2  
ATOM   2615  C CG     . PRO A 1 28  ? 15.617 20.961  0.911   1.00 0.00 ? 241 PRO A CG     2  
ATOM   2616  C CD     . PRO A 1 28  ? 17.005 20.626  0.392   1.00 0.00 ? 241 PRO A CD     2  
ATOM   2617  H HA     . PRO A 1 28  ? 15.886 17.779  1.299   1.00 0.00 ? 241 PRO A HA     2  
ATOM   2618  H HB2    . PRO A 1 28  ? 13.911 19.629  0.917   1.00 0.00 ? 241 PRO A HB2    2  
ATOM   2619  H HB3    . PRO A 1 28  ? 14.879 19.548  2.376   1.00 0.00 ? 241 PRO A HB3    2  
ATOM   2620  H HG2    . PRO A 1 28  ? 15.040 21.486  0.149   1.00 0.00 ? 241 PRO A HG2    2  
ATOM   2621  H HG3    . PRO A 1 28  ? 15.681 21.625  1.774   1.00 0.00 ? 241 PRO A HG3    2  
ATOM   2622  H HD2    . PRO A 1 28  ? 17.161 21.026  -0.609  1.00 0.00 ? 241 PRO A HD2    2  
ATOM   2623  H HD3    . PRO A 1 28  ? 17.779 21.052  1.029   1.00 0.00 ? 241 PRO A HD3    2  
ATOM   2624  N N      . ALA A 1 29  ? 15.270 18.735  -1.676  1.00 0.00 ? 242 ALA A N      2  
ATOM   2625  C CA     . ALA A 1 29  ? 14.729 18.310  -2.955  1.00 0.00 ? 242 ALA A CA     2  
ATOM   2626  C C      . ALA A 1 29  ? 15.674 17.289  -3.591  1.00 0.00 ? 242 ALA A C      2  
ATOM   2627  O O      . ALA A 1 29  ? 15.253 16.474  -4.410  1.00 0.00 ? 242 ALA A O      2  
ATOM   2628  C CB     . ALA A 1 29  ? 14.508 19.534  -3.847  1.00 0.00 ? 242 ALA A CB     2  
ATOM   2629  H H      . ALA A 1 29  ? 15.725 19.625  -1.683  1.00 0.00 ? 242 ALA A H      2  
ATOM   2630  H HA     . ALA A 1 29  ? 13.767 17.834  -2.768  1.00 0.00 ? 242 ALA A HA     2  
ATOM   2631  H HB1    . ALA A 1 29  ? 13.645 19.363  -4.491  1.00 0.00 ? 242 ALA A HB1    2  
ATOM   2632  H HB2    . ALA A 1 29  ? 14.327 20.409  -3.224  1.00 0.00 ? 242 ALA A HB2    2  
ATOM   2633  H HB3    . ALA A 1 29  ? 15.392 19.701  -4.462  1.00 0.00 ? 242 ALA A HB3    2  
ATOM   2634  N N      . VAL A 1 30  ? 16.935 17.367  -3.190  1.00 0.00 ? 243 VAL A N      2  
ATOM   2635  C CA     . VAL A 1 30  ? 17.944 16.459  -3.710  1.00 0.00 ? 243 VAL A CA     2  
ATOM   2636  C C      . VAL A 1 30  ? 17.798 15.097  -3.028  1.00 0.00 ? 243 VAL A C      2  
ATOM   2637  O O      . VAL A 1 30  ? 17.825 14.062  -3.691  1.00 0.00 ? 243 VAL A O      2  
ATOM   2638  C CB     . VAL A 1 30  ? 19.336 17.069  -3.536  1.00 0.00 ? 243 VAL A CB     2  
ATOM   2639  C CG1    . VAL A 1 30  ? 20.405 16.188  -4.183  1.00 0.00 ? 243 VAL A CG1    2  
ATOM   2640  C CG2    . VAL A 1 30  ? 19.385 18.492  -4.097  1.00 0.00 ? 243 VAL A CG2    2  
ATOM   2641  H H      . VAL A 1 30  ? 17.269 18.033  -2.523  1.00 0.00 ? 243 VAL A H      2  
ATOM   2642  H HA     . VAL A 1 30  ? 17.759 16.340  -4.777  1.00 0.00 ? 243 VAL A HA     2  
ATOM   2643  H HB     . VAL A 1 30  ? 19.547 17.123  -2.467  1.00 0.00 ? 243 VAL A HB     2  
ATOM   2644  H HG11   . VAL A 1 30  ? 21.394 16.565  -3.922  1.00 0.00 ? 243 VAL A HG11   2  
ATOM   2645  H HG12   . VAL A 1 30  ? 20.301 15.164  -3.822  1.00 0.00 ? 243 VAL A HG12   2  
ATOM   2646  H HG13   . VAL A 1 30  ? 20.284 16.204  -5.266  1.00 0.00 ? 243 VAL A HG13   2  
ATOM   2647  H HG21   . VAL A 1 30  ? 19.961 18.498  -5.022  1.00 0.00 ? 243 VAL A HG21   2  
ATOM   2648  H HG22   . VAL A 1 30  ? 18.372 18.838  -4.298  1.00 0.00 ? 243 VAL A HG22   2  
ATOM   2649  H HG23   . VAL A 1 30  ? 19.857 19.153  -3.369  1.00 0.00 ? 243 VAL A HG23   2  
ATOM   2650  N N      . LEU A 1 31  ? 17.645 15.143  -1.713  1.00 0.00 ? 244 LEU A N      2  
ATOM   2651  C CA     . LEU A 1 31  ? 17.495 13.925  -0.934  1.00 0.00 ? 244 LEU A CA     2  
ATOM   2652  C C      . LEU A 1 31  ? 16.197 13.224  -1.338  1.00 0.00 ? 244 LEU A C      2  
ATOM   2653  O O      . LEU A 1 31  ? 16.128 11.995  -1.346  1.00 0.00 ? 244 LEU A O      2  
ATOM   2654  C CB     . LEU A 1 31  ? 17.590 14.231  0.562   1.00 0.00 ? 244 LEU A CB     2  
ATOM   2655  C CG     . LEU A 1 31  ? 16.717 13.371  1.478   1.00 0.00 ? 244 LEU A CG     2  
ATOM   2656  C CD1    . LEU A 1 31  ? 17.220 11.927  1.518   1.00 0.00 ? 244 LEU A CD1    2  
ATOM   2657  C CD2    . LEU A 1 31  ? 16.622 13.984  2.877   1.00 0.00 ? 244 LEU A CD2    2  
ATOM   2658  H H      . LEU A 1 31  ? 17.625 15.990  -1.181  1.00 0.00 ? 244 LEU A H      2  
ATOM   2659  H HA     . LEU A 1 31  ? 18.333 13.273  -1.184  1.00 0.00 ? 244 LEU A HA     2  
ATOM   2660  H HB2    . LEU A 1 31  ? 18.629 14.116  0.871   1.00 0.00 ? 244 LEU A HB2    2  
ATOM   2661  H HB3    . LEU A 1 31  ? 17.325 15.276  0.716   1.00 0.00 ? 244 LEU A HB3    2  
ATOM   2662  H HG     . LEU A 1 31  ? 15.708 13.349  1.067   1.00 0.00 ? 244 LEU A HG     2  
ATOM   2663  H HD11   . LEU A 1 31  ? 17.709 11.686  0.574   1.00 0.00 ? 244 LEU A HD11   2  
ATOM   2664  H HD12   . LEU A 1 31  ? 17.933 11.812  2.335   1.00 0.00 ? 244 LEU A HD12   2  
ATOM   2665  H HD13   . LEU A 1 31  ? 16.378 11.252  1.672   1.00 0.00 ? 244 LEU A HD13   2  
ATOM   2666  H HD21   . LEU A 1 31  ? 17.609 14.323  3.192   1.00 0.00 ? 244 LEU A HD21   2  
ATOM   2667  H HD22   . LEU A 1 31  ? 15.935 14.829  2.858   1.00 0.00 ? 244 LEU A HD22   2  
ATOM   2668  H HD23   . LEU A 1 31  ? 16.255 13.233  3.578   1.00 0.00 ? 244 LEU A HD23   2  
ATOM   2669  N N      . VAL A 1 32  ? 15.201 14.034  -1.663  1.00 0.00 ? 245 VAL A N      2  
ATOM   2670  C CA     . VAL A 1 32  ? 13.909 13.506  -2.066  1.00 0.00 ? 245 VAL A CA     2  
ATOM   2671  C C      . VAL A 1 32  ? 14.033 12.867  -3.451  1.00 0.00 ? 245 VAL A C      2  
ATOM   2672  O O      . VAL A 1 32  ? 13.391 11.856  -3.732  1.00 0.00 ? 245 VAL A O      2  
ATOM   2673  C CB     . VAL A 1 32  ? 12.851 14.611  -2.011  1.00 0.00 ? 245 VAL A CB     2  
ATOM   2674  C CG1    . VAL A 1 32  ? 11.552 14.162  -2.683  1.00 0.00 ? 245 VAL A CG1    2  
ATOM   2675  C CG2    . VAL A 1 32  ? 12.598 15.056  -0.570  1.00 0.00 ? 245 VAL A CG2    2  
ATOM   2676  H H      . VAL A 1 32  ? 15.265 15.032  -1.654  1.00 0.00 ? 245 VAL A H      2  
ATOM   2677  H HA     . VAL A 1 32  ? 13.629 12.736  -1.348  1.00 0.00 ? 245 VAL A HA     2  
ATOM   2678  H HB     . VAL A 1 32  ? 13.235 15.469  -2.564  1.00 0.00 ? 245 VAL A HB     2  
ATOM   2679  H HG11   . VAL A 1 32  ? 11.779 13.728  -3.657  1.00 0.00 ? 245 VAL A HG11   2  
ATOM   2680  H HG12   . VAL A 1 32  ? 11.060 13.417  -2.059  1.00 0.00 ? 245 VAL A HG12   2  
ATOM   2681  H HG13   . VAL A 1 32  ? 10.894 15.021  -2.811  1.00 0.00 ? 245 VAL A HG13   2  
ATOM   2682  H HG21   . VAL A 1 32  ? 11.719 14.544  -0.180  1.00 0.00 ? 245 VAL A HG21   2  
ATOM   2683  H HG22   . VAL A 1 32  ? 13.465 14.810  0.044   1.00 0.00 ? 245 VAL A HG22   2  
ATOM   2684  H HG23   . VAL A 1 32  ? 12.431 16.133  -0.546  1.00 0.00 ? 245 VAL A HG23   2  
ATOM   2685  N N      . GLU A 1 33  ? 14.864 13.482  -4.279  1.00 0.00 ? 246 GLU A N      2  
ATOM   2686  C CA     . GLU A 1 33  ? 15.082 12.986  -5.627  1.00 0.00 ? 246 GLU A CA     2  
ATOM   2687  C C      . GLU A 1 33  ? 16.033 11.787  -5.605  1.00 0.00 ? 246 GLU A C      2  
ATOM   2688  O O      . GLU A 1 33  ? 15.963 10.919  -6.473  1.00 0.00 ? 246 GLU A O      2  
ATOM   2689  C CB     . GLU A 1 33  ? 15.615 14.091  -6.539  1.00 0.00 ? 246 GLU A CB     2  
ATOM   2690  C CG     . GLU A 1 33  ? 14.486 15.015  -7.000  1.00 0.00 ? 246 GLU A CG     2  
ATOM   2691  C CD     . GLU A 1 33  ? 14.015 14.647  -8.408  1.00 0.00 ? 246 GLU A CD     2  
ATOM   2692  O OE1    . GLU A 1 33  ? 14.630 15.070  -9.398  1.00 0.00 ? 246 GLU A OE1    2  
ATOM   2693  O OE2    . GLU A 1 33  ? 12.969 13.892  -8.454  1.00 0.00 ? 246 GLU A OE2    2  
ATOM   2694  H H      . GLU A 1 33  ? 15.383 14.304  -4.043  1.00 0.00 ? 246 GLU A H      2  
ATOM   2695  H HA     . GLU A 1 33  ? 14.100 12.673  -5.982  1.00 0.00 ? 246 GLU A HA     2  
ATOM   2696  H HB2    . GLU A 1 33  ? 16.371 14.672  -6.010  1.00 0.00 ? 246 GLU A HB2    2  
ATOM   2697  H HB3    . GLU A 1 33  ? 16.103 13.648  -7.408  1.00 0.00 ? 246 GLU A HB3    2  
ATOM   2698  H HG2    . GLU A 1 33  ? 13.650 14.948  -6.304  1.00 0.00 ? 246 GLU A HG2    2  
ATOM   2699  H HG3    . GLU A 1 33  ? 14.829 16.050  -6.986  1.00 0.00 ? 246 GLU A HG3    2  
ATOM   2700  H HE2    . GLU A 1 33  ? 12.229 14.363  -8.931  1.00 0.00 ? 246 GLU A HE2    2  
ATOM   2701  N N      . ILE A 1 34  ? 16.899 11.779  -4.602  1.00 0.00 ? 247 ILE A N      2  
ATOM   2702  C CA     . ILE A 1 34  ? 17.863 10.700  -4.455  1.00 0.00 ? 247 ILE A CA     2  
ATOM   2703  C C      . ILE A 1 34  ? 17.163 9.473   -3.869  1.00 0.00 ? 247 ILE A C      2  
ATOM   2704  O O      . ILE A 1 34  ? 17.545 8.340   -4.155  1.00 0.00 ? 247 ILE A O      2  
ATOM   2705  C CB     . ILE A 1 34  ? 19.069 11.169  -3.641  1.00 0.00 ? 247 ILE A CB     2  
ATOM   2706  C CG1    . ILE A 1 34  ? 20.379 10.752  -4.312  1.00 0.00 ? 247 ILE A CG1    2  
ATOM   2707  C CG2    . ILE A 1 34  ? 18.982 10.672  -2.197  1.00 0.00 ? 247 ILE A CG2    2  
ATOM   2708  C CD1    . ILE A 1 34  ? 20.661 11.611  -5.546  1.00 0.00 ? 247 ILE A CD1    2  
ATOM   2709  H H      . ILE A 1 34  ? 16.949 12.489  -3.900  1.00 0.00 ? 247 ILE A H      2  
ATOM   2710  H HA     . ILE A 1 34  ? 18.224 10.449  -5.452  1.00 0.00 ? 247 ILE A HA     2  
ATOM   2711  H HB     . ILE A 1 34  ? 19.058 12.259  -3.608  1.00 0.00 ? 247 ILE A HB     2  
ATOM   2712  H HG12   . ILE A 1 34  ? 21.202 10.847  -3.603  1.00 0.00 ? 247 ILE A HG12   2  
ATOM   2713  H HG13   . ILE A 1 34  ? 20.327 9.702   -4.599  1.00 0.00 ? 247 ILE A HG13   2  
ATOM   2714  H HG21   . ILE A 1 34  ? 19.441 9.686   -2.122  1.00 0.00 ? 247 ILE A HG21   2  
ATOM   2715  H HG22   . ILE A 1 34  ? 19.507 11.366  -1.541  1.00 0.00 ? 247 ILE A HG22   2  
ATOM   2716  H HG23   . ILE A 1 34  ? 17.937 10.610  -1.896  1.00 0.00 ? 247 ILE A HG23   2  
ATOM   2717  H HD11   . ILE A 1 34  ? 21.440 11.141  -6.146  1.00 0.00 ? 247 ILE A HD11   2  
ATOM   2718  H HD12   . ILE A 1 34  ? 19.751 11.703  -6.140  1.00 0.00 ? 247 ILE A HD12   2  
ATOM   2719  H HD13   . ILE A 1 34  ? 20.992 12.602  -5.232  1.00 0.00 ? 247 ILE A HD13   2  
ATOM   2720  N N      . VAL A 1 35  ? 16.150 9.741   -3.057  1.00 0.00 ? 248 VAL A N      2  
ATOM   2721  C CA     . VAL A 1 35  ? 15.394 8.672   -2.427  1.00 0.00 ? 248 VAL A CA     2  
ATOM   2722  C C      . VAL A 1 35  ? 14.532 7.974   -3.480  1.00 0.00 ? 248 VAL A C      2  
ATOM   2723  O O      . VAL A 1 35  ? 14.375 6.754   -3.449  1.00 0.00 ? 248 VAL A O      2  
ATOM   2724  C CB     . VAL A 1 35  ? 14.576 9.228   -1.259  1.00 0.00 ? 248 VAL A CB     2  
ATOM   2725  C CG1    . VAL A 1 35  ? 13.635 8.163   -0.693  1.00 0.00 ? 248 VAL A CG1    2  
ATOM   2726  C CG2    . VAL A 1 35  ? 15.491 9.787   -0.167  1.00 0.00 ? 248 VAL A CG2    2  
ATOM   2727  H H      . VAL A 1 35  ? 15.845 10.666  -2.829  1.00 0.00 ? 248 VAL A H      2  
ATOM   2728  H HA     . VAL A 1 35  ? 16.110 7.954   -2.027  1.00 0.00 ? 248 VAL A HA     2  
ATOM   2729  H HB     . VAL A 1 35  ? 13.966 10.048  -1.637  1.00 0.00 ? 248 VAL A HB     2  
ATOM   2730  H HG11   . VAL A 1 35  ? 12.677 8.212   -1.211  1.00 0.00 ? 248 VAL A HG11   2  
ATOM   2731  H HG12   . VAL A 1 35  ? 14.075 7.176   -0.836  1.00 0.00 ? 248 VAL A HG12   2  
ATOM   2732  H HG13   . VAL A 1 35  ? 13.481 8.341   0.371   1.00 0.00 ? 248 VAL A HG13   2  
ATOM   2733  H HG21   . VAL A 1 35  ? 16.501 9.898   -0.561  1.00 0.00 ? 248 VAL A HG21   2  
ATOM   2734  H HG22   . VAL A 1 35  ? 15.118 10.760  0.155   1.00 0.00 ? 248 VAL A HG22   2  
ATOM   2735  H HG23   . VAL A 1 35  ? 15.504 9.104   0.682   1.00 0.00 ? 248 VAL A HG23   2  
ATOM   2736  N N      . ARG A 1 36  ? 13.996 8.776   -4.388  1.00 0.00 ? 249 ARG A N      2  
ATOM   2737  C CA     . ARG A 1 36  ? 13.155 8.250   -5.450  1.00 0.00 ? 249 ARG A CA     2  
ATOM   2738  C C      . ARG A 1 36  ? 14.014 7.600   -6.536  1.00 0.00 ? 249 ARG A C      2  
ATOM   2739  O O      . ARG A 1 36  ? 13.506 6.857   -7.373  1.00 0.00 ? 249 ARG A O      2  
ATOM   2740  C CB     . ARG A 1 36  ? 12.303 9.355   -6.076  1.00 0.00 ? 249 ARG A CB     2  
ATOM   2741  C CG     . ARG A 1 36  ? 10.850 9.261   -5.604  1.00 0.00 ? 249 ARG A CG     2  
ATOM   2742  C CD     . ARG A 1 36  ? 9.894  9.820   -6.659  1.00 0.00 ? 249 ARG A CD     2  
ATOM   2743  N NE     . ARG A 1 36  ? 8.806  8.852   -6.920  1.00 0.00 ? 249 ARG A NE     2  
ATOM   2744  C CZ     . ARG A 1 36  ? 7.950  8.942   -7.947  1.00 0.00 ? 249 ARG A CZ     2  
ATOM   2745  N NH1    . ARG A 1 36  ? 8.051  9.957   -8.816  1.00 0.00 ? 249 ARG A NH1    2  
ATOM   2746  N NH2    . ARG A 1 36  ? 6.994  8.017   -8.107  1.00 0.00 ? 249 ARG A NH2    2  
ATOM   2747  H H      . ARG A 1 36  ? 14.130 9.767   -4.406  1.00 0.00 ? 249 ARG A H      2  
ATOM   2748  H HA     . ARG A 1 36  ? 12.519 7.513   -4.960  1.00 0.00 ? 249 ARG A HA     2  
ATOM   2749  H HB2    . ARG A 1 36  ? 12.713 10.330  -5.811  1.00 0.00 ? 249 ARG A HB2    2  
ATOM   2750  H HB3    . ARG A 1 36  ? 12.341 9.278   -7.162  1.00 0.00 ? 249 ARG A HB3    2  
ATOM   2751  H HG2    . ARG A 1 36  ? 10.599 8.221   -5.394  1.00 0.00 ? 249 ARG A HG2    2  
ATOM   2752  H HG3    . ARG A 1 36  ? 10.731 9.812   -4.671  1.00 0.00 ? 249 ARG A HG3    2  
ATOM   2753  H HD2    . ARG A 1 36  ? 9.475  10.766  -6.317  1.00 0.00 ? 249 ARG A HD2    2  
ATOM   2754  H HD3    . ARG A 1 36  ? 10.437 10.027  -7.580  1.00 0.00 ? 249 ARG A HD3    2  
ATOM   2755  H HE     . ARG A 1 36  ? 8.702  8.081   -6.291  1.00 0.00 ? 249 ARG A HE     2  
ATOM   2756  H HH11   . ARG A 1 36  ? 8.765  10.647  -8.698  1.00 0.00 ? 249 ARG A HH11   2  
ATOM   2757  H HH12   . ARG A 1 36  ? 7.413  10.024  -9.583  1.00 0.00 ? 249 ARG A HH12   2  
ATOM   2758  H HH21   . ARG A 1 36  ? 6.919  7.260   -7.458  1.00 0.00 ? 249 ARG A HH21   2  
ATOM   2759  H HH22   . ARG A 1 36  ? 6.355  8.084   -8.873  1.00 0.00 ? 249 ARG A HH22   2  
ATOM   2760  N N      . ALA A 1 37  ? 15.303 7.906   -6.488  1.00 0.00 ? 250 ALA A N      2  
ATOM   2761  C CA     . ALA A 1 37  ? 16.238 7.361   -7.457  1.00 0.00 ? 250 ALA A CA     2  
ATOM   2762  C C      . ALA A 1 37  ? 16.822 6.054   -6.918  1.00 0.00 ? 250 ALA A C      2  
ATOM   2763  O O      . ALA A 1 37  ? 17.047 5.112   -7.675  1.00 0.00 ? 250 ALA A O      2  
ATOM   2764  C CB     . ALA A 1 37  ? 17.318 8.400   -7.765  1.00 0.00 ? 250 ALA A CB     2  
ATOM   2765  H H      . ALA A 1 37  ? 15.709 8.511   -5.803  1.00 0.00 ? 250 ALA A H      2  
ATOM   2766  H HA     . ALA A 1 37  ? 15.683 7.151   -8.371  1.00 0.00 ? 250 ALA A HA     2  
ATOM   2767  H HB1    . ALA A 1 37  ? 17.183 8.778   -8.778  1.00 0.00 ? 250 ALA A HB1    2  
ATOM   2768  H HB2    . ALA A 1 37  ? 17.241 9.225   -7.056  1.00 0.00 ? 250 ALA A HB2    2  
ATOM   2769  H HB3    . ALA A 1 37  ? 18.302 7.938   -7.678  1.00 0.00 ? 250 ALA A HB3    2  
ATOM   2770  N N      . LEU A 1 38  ? 17.052 6.040   -5.613  1.00 0.00 ? 251 LEU A N      2  
ATOM   2771  C CA     . LEU A 1 38  ? 17.606 4.864   -4.963  1.00 0.00 ? 251 LEU A CA     2  
ATOM   2772  C C      . LEU A 1 38  ? 16.495 3.835   -4.747  1.00 0.00 ? 251 LEU A C      2  
ATOM   2773  O O      . LEU A 1 38  ? 15.366 4.196   -4.419  1.00 0.00 ? 251 LEU A O      2  
ATOM   2774  C CB     . LEU A 1 38  ? 18.339 5.257   -3.679  1.00 0.00 ? 251 LEU A CB     2  
ATOM   2775  C CG     . LEU A 1 38  ? 17.460 5.755   -2.530  1.00 0.00 ? 251 LEU A CG     2  
ATOM   2776  C CD1    . LEU A 1 38  ? 16.936 4.586   -1.695  1.00 0.00 ? 251 LEU A CD1    2  
ATOM   2777  C CD2    . LEU A 1 38  ? 18.205 6.782   -1.676  1.00 0.00 ? 251 LEU A CD2    2  
ATOM   2778  H H      . LEU A 1 38  ? 16.867 6.810   -5.004  1.00 0.00 ? 251 LEU A H      2  
ATOM   2779  H HA     . LEU A 1 38  ? 18.346 4.436   -5.640  1.00 0.00 ? 251 LEU A HA     2  
ATOM   2780  H HB2    . LEU A 1 38  ? 18.905 4.393   -3.329  1.00 0.00 ? 251 LEU A HB2    2  
ATOM   2781  H HB3    . LEU A 1 38  ? 19.062 6.035   -3.921  1.00 0.00 ? 251 LEU A HB3    2  
ATOM   2782  H HG     . LEU A 1 38  ? 16.593 6.259   -2.958  1.00 0.00 ? 251 LEU A HG     2  
ATOM   2783  H HD11   . LEU A 1 38  ? 16.454 3.859   -2.349  1.00 0.00 ? 251 LEU A HD11   2  
ATOM   2784  H HD12   . LEU A 1 38  ? 17.766 4.111   -1.172  1.00 0.00 ? 251 LEU A HD12   2  
ATOM   2785  H HD13   . LEU A 1 38  ? 16.213 4.954   -0.967  1.00 0.00 ? 251 LEU A HD13   2  
ATOM   2786  H HD21   . LEU A 1 38  ? 18.490 7.632   -2.296  1.00 0.00 ? 251 LEU A HD21   2  
ATOM   2787  H HD22   . LEU A 1 38  ? 17.555 7.123   -0.869  1.00 0.00 ? 251 LEU A HD22   2  
ATOM   2788  H HD23   . LEU A 1 38  ? 19.099 6.324   -1.254  1.00 0.00 ? 251 LEU A HD23   2  
ATOM   2789  N N      . ARG A 1 39  ? 16.854 2.574   -4.940  1.00 0.00 ? 252 ARG A N      2  
ATOM   2790  C CA     . ARG A 1 39  ? 15.901 1.490   -4.770  1.00 0.00 ? 252 ARG A CA     2  
ATOM   2791  C C      . ARG A 1 39  ? 16.410 0.494   -3.726  1.00 0.00 ? 252 ARG A C      2  
ATOM   2792  O O      . ARG A 1 39  ? 17.521 -0.020  -3.845  1.00 0.00 ? 252 ARG A O      2  
ATOM   2793  C CB     . ARG A 1 39  ? 15.660 0.757   -6.090  1.00 0.00 ? 252 ARG A CB     2  
ATOM   2794  C CG     . ARG A 1 39  ? 14.398 -0.106  -6.017  1.00 0.00 ? 252 ARG A CG     2  
ATOM   2795  C CD     . ARG A 1 39  ? 13.139 0.750   -6.171  1.00 0.00 ? 252 ARG A CD     2  
ATOM   2796  N NE     . ARG A 1 39  ? 12.938 1.102   -7.594  1.00 0.00 ? 252 ARG A NE     2  
ATOM   2797  C CZ     . ARG A 1 39  ? 12.565 0.228   -8.539  1.00 0.00 ? 252 ARG A CZ     2  
ATOM   2798  N NH1    . ARG A 1 39  ? 12.350 -1.055  -8.217  1.00 0.00 ? 252 ARG A NH1    2  
ATOM   2799  N NH2    . ARG A 1 39  ? 12.406 0.636   -9.805  1.00 0.00 ? 252 ARG A NH2    2  
ATOM   2800  H H      . ARG A 1 39  ? 17.775 2.289   -5.207  1.00 0.00 ? 252 ARG A H      2  
ATOM   2801  H HA     . ARG A 1 39  ? 14.984 1.976   -4.435  1.00 0.00 ? 252 ARG A HA     2  
ATOM   2802  H HB2    . ARG A 1 39  ? 15.564 1.479   -6.901  1.00 0.00 ? 252 ARG A HB2    2  
ATOM   2803  H HB3    . ARG A 1 39  ? 16.521 0.129   -6.324  1.00 0.00 ? 252 ARG A HB3    2  
ATOM   2804  H HG2    . ARG A 1 39  ? 14.425 -0.864  -6.800  1.00 0.00 ? 252 ARG A HG2    2  
ATOM   2805  H HG3    . ARG A 1 39  ? 14.369 -0.633  -5.063  1.00 0.00 ? 252 ARG A HG3    2  
ATOM   2806  H HD2    . ARG A 1 39  ? 12.272 0.206   -5.796  1.00 0.00 ? 252 ARG A HD2    2  
ATOM   2807  H HD3    . ARG A 1 39  ? 13.231 1.657   -5.573  1.00 0.00 ? 252 ARG A HD3    2  
ATOM   2808  H HE     . ARG A 1 39  ? 13.090 2.052   -7.868  1.00 0.00 ? 252 ARG A HE     2  
ATOM   2809  H HH11   . ARG A 1 39  ? 12.469 -1.360  -7.272  1.00 0.00 ? 252 ARG A HH11   2  
ATOM   2810  H HH12   . ARG A 1 39  ? 12.072 -1.707  -8.922  1.00 0.00 ? 252 ARG A HH12   2  
ATOM   2811  H HH21   . ARG A 1 39  ? 12.567 1.594   -10.045 1.00 0.00 ? 252 ARG A HH21   2  
ATOM   2812  H HH22   . ARG A 1 39  ? 12.128 -0.015  -10.510 1.00 0.00 ? 252 ARG A HH22   2  
ATOM   2813  N N      . ALA A 1 40  ? 15.573 0.251   -2.729  1.00 0.00 ? 253 ALA A N      2  
ATOM   2814  C CA     . ALA A 1 40  ? 15.925 -0.674  -1.665  1.00 0.00 ? 253 ALA A CA     2  
ATOM   2815  C C      . ALA A 1 40  ? 15.636 -2.105  -2.124  1.00 0.00 ? 253 ALA A C      2  
ATOM   2816  O O      . ALA A 1 40  ? 14.507 -2.427  -2.491  1.00 0.00 ? 253 ALA A O      2  
ATOM   2817  C CB     . ALA A 1 40  ? 15.161 -0.304  -0.393  1.00 0.00 ? 253 ALA A CB     2  
ATOM   2818  H H      . ALA A 1 40  ? 14.671 0.673   -2.640  1.00 0.00 ? 253 ALA A H      2  
ATOM   2819  H HA     . ALA A 1 40  ? 16.994 -0.571  -1.476  1.00 0.00 ? 253 ALA A HA     2  
ATOM   2820  H HB1    . ALA A 1 40  ? 15.845 -0.310  0.457   1.00 0.00 ? 253 ALA A HB1    2  
ATOM   2821  H HB2    . ALA A 1 40  ? 14.729 0.690   -0.505  1.00 0.00 ? 253 ALA A HB2    2  
ATOM   2822  H HB3    . ALA A 1 40  ? 14.365 -1.029  -0.222  1.00 0.00 ? 253 ALA A HB3    2  
ATOM   2823  N N      . ARG A 1 41  ? 16.676 -2.925  -2.087  1.00 0.00 ? 254 ARG A N      2  
ATOM   2824  C CA     . ARG A 1 41  ? 16.548 -4.315  -2.494  1.00 0.00 ? 254 ARG A CA     2  
ATOM   2825  C C      . ARG A 1 41  ? 17.340 -5.220  -1.548  1.00 0.00 ? 254 ARG A C      2  
ATOM   2826  O O      . ARG A 1 41  ? 18.451 -4.881  -1.145  1.00 0.00 ? 254 ARG A O      2  
ATOM   2827  C CB     . ARG A 1 41  ? 17.051 -4.518  -3.925  1.00 0.00 ? 254 ARG A CB     2  
ATOM   2828  C CG     . ARG A 1 41  ? 16.448 -5.781  -4.543  1.00 0.00 ? 254 ARG A CG     2  
ATOM   2829  C CD     . ARG A 1 41  ? 17.544 -6.706  -5.077  1.00 0.00 ? 254 ARG A CD     2  
ATOM   2830  N NE     . ARG A 1 41  ? 17.084 -7.372  -6.317  1.00 0.00 ? 254 ARG A NE     2  
ATOM   2831  C CZ     . ARG A 1 41  ? 16.305 -8.462  -6.338  1.00 0.00 ? 254 ARG A CZ     2  
ATOM   2832  N NH1    . ARG A 1 41  ? 15.893 -9.015  -5.190  1.00 0.00 ? 254 ARG A NH1    2  
ATOM   2833  N NH2    . ARG A 1 41  ? 15.937 -8.998  -7.510  1.00 0.00 ? 254 ARG A NH2    2  
ATOM   2834  H H      . ARG A 1 41  ? 17.591 -2.655  -1.787  1.00 0.00 ? 254 ARG A H      2  
ATOM   2835  H HA     . ARG A 1 41  ? 15.480 -4.525  -2.436  1.00 0.00 ? 254 ARG A HA     2  
ATOM   2836  H HB2    . ARG A 1 41  ? 16.790 -3.651  -4.533  1.00 0.00 ? 254 ARG A HB2    2  
ATOM   2837  H HB3    . ARG A 1 41  ? 18.139 -4.592  -3.925  1.00 0.00 ? 254 ARG A HB3    2  
ATOM   2838  H HG2    . ARG A 1 41  ? 15.854 -6.308  -3.796  1.00 0.00 ? 254 ARG A HG2    2  
ATOM   2839  H HG3    . ARG A 1 41  ? 15.772 -5.506  -5.354  1.00 0.00 ? 254 ARG A HG3    2  
ATOM   2840  H HD2    . ARG A 1 41  ? 18.449 -6.134  -5.276  1.00 0.00 ? 254 ARG A HD2    2  
ATOM   2841  H HD3    . ARG A 1 41  ? 17.798 -7.453  -4.325  1.00 0.00 ? 254 ARG A HD3    2  
ATOM   2842  H HE     . ARG A 1 41  ? 17.374 -6.985  -7.192  1.00 0.00 ? 254 ARG A HE     2  
ATOM   2843  H HH11   . ARG A 1 41  ? 16.167 -8.615  -4.315  1.00 0.00 ? 254 ARG A HH11   2  
ATOM   2844  H HH12   . ARG A 1 41  ? 15.311 -9.828  -5.207  1.00 0.00 ? 254 ARG A HH12   2  
ATOM   2845  H HH21   . ARG A 1 41  ? 16.244 -8.586  -8.368  1.00 0.00 ? 254 ARG A HH21   2  
ATOM   2846  H HH22   . ARG A 1 41  ? 15.356 -9.811  -7.527  1.00 0.00 ? 254 ARG A HH22   2  
ATOM   2847  N N      . THR A 1 42  ? 16.737 -6.354  -1.224  1.00 0.00 ? 255 THR A N      2  
ATOM   2848  C CA     . THR A 1 42  ? 17.373 -7.310  -0.333  1.00 0.00 ? 255 THR A CA     2  
ATOM   2849  C C      . THR A 1 42  ? 18.032 -8.432  -1.138  1.00 0.00 ? 255 THR A C      2  
ATOM   2850  O O      . THR A 1 42  ? 17.474 -8.901  -2.130  1.00 0.00 ? 255 THR A O      2  
ATOM   2851  C CB     . THR A 1 42  ? 16.316 -7.812  0.653   1.00 0.00 ? 255 THR A CB     2  
ATOM   2852  O OG1    . THR A 1 42  ? 15.924 -6.642  1.367   1.00 0.00 ? 255 THR A OG1    2  
ATOM   2853  C CG2    . THR A 1 42  ? 16.907 -8.725  1.729   1.00 0.00 ? 255 THR A CG2    2  
ATOM   2854  H H      . THR A 1 42  ? 15.833 -6.623  -1.556  1.00 0.00 ? 255 THR A H      2  
ATOM   2855  H HA     . THR A 1 42  ? 18.166 -6.799  0.211   1.00 0.00 ? 255 THR A HA     2  
ATOM   2856  H HB     . THR A 1 42  ? 15.498 -8.307  0.130   1.00 0.00 ? 255 THR A HB     2  
ATOM   2857  H HG1    . THR A 1 42  ? 15.698 -5.910  0.725   1.00 0.00 ? 255 THR A HG1    2  
ATOM   2858  H HG21   . THR A 1 42  ? 16.438 -8.505  2.690   1.00 0.00 ? 255 THR A HG21   2  
ATOM   2859  H HG22   . THR A 1 42  ? 16.722 -9.766  1.465   1.00 0.00 ? 255 THR A HG22   2  
ATOM   2860  H HG23   . THR A 1 42  ? 17.981 -8.554  1.802   1.00 0.00 ? 255 THR A HG23   2  
ATOM   2861  N N      . VAL A 1 43  ? 19.212 -8.829  -0.684  1.00 0.00 ? 256 VAL A N      2  
ATOM   2862  C CA     . VAL A 1 43  ? 19.953 -9.886  -1.348  1.00 0.00 ? 256 VAL A CA     2  
ATOM   2863  C C      . VAL A 1 43  ? 20.183 -11.038 -0.368  1.00 0.00 ? 256 VAL A C      2  
ATOM   2864  O O      . VAL A 1 43  ? 20.651 -10.822 0.749   1.00 0.00 ? 256 VAL A O      2  
ATOM   2865  C CB     . VAL A 1 43  ? 21.254 -9.327  -1.930  1.00 0.00 ? 256 VAL A CB     2  
ATOM   2866  C CG1    . VAL A 1 43  ? 21.087 -8.978  -3.410  1.00 0.00 ? 256 VAL A CG1    2  
ATOM   2867  C CG2    . VAL A 1 43  ? 21.734 -8.113  -1.132  1.00 0.00 ? 256 VAL A CG2    2  
ATOM   2868  H H      . VAL A 1 43  ? 19.659 -8.442  0.123   1.00 0.00 ? 256 VAL A H      2  
ATOM   2869  H HA     . VAL A 1 43  ? 19.342 -10.247 -2.176  1.00 0.00 ? 256 VAL A HA     2  
ATOM   2870  H HB     . VAL A 1 43  ? 22.016 -10.102 -1.852  1.00 0.00 ? 256 VAL A HB     2  
ATOM   2871  H HG11   . VAL A 1 43  ? 21.342 -9.845  -4.019  1.00 0.00 ? 256 VAL A HG11   2  
ATOM   2872  H HG12   . VAL A 1 43  ? 20.054 -8.690  -3.602  1.00 0.00 ? 256 VAL A HG12   2  
ATOM   2873  H HG13   . VAL A 1 43  ? 21.748 -8.149  -3.664  1.00 0.00 ? 256 VAL A HG13   2  
ATOM   2874  H HG21   . VAL A 1 43  ? 21.151 -7.238  -1.415  1.00 0.00 ? 256 VAL A HG21   2  
ATOM   2875  H HG22   . VAL A 1 43  ? 21.605 -8.306  -0.066  1.00 0.00 ? 256 VAL A HG22   2  
ATOM   2876  H HG23   . VAL A 1 43  ? 22.788 -7.933  -1.342  1.00 0.00 ? 256 VAL A HG23   2  
ATOM   2877  N N      . PRO A 1 44  ? 19.836 -12.267 -0.833  1.00 0.00 ? 257 PRO A N      2  
ATOM   2878  C CA     . PRO A 1 44  ? 20.000 -13.453 -0.010  1.00 0.00 ? 257 PRO A CA     2  
ATOM   2879  C C      . PRO A 1 44  ? 21.471 -13.863 0.075   1.00 0.00 ? 257 PRO A C      2  
ATOM   2880  O O      . PRO A 1 44  ? 22.257 -13.555 -0.819  1.00 0.00 ? 257 PRO A O      2  
ATOM   2881  C CB     . PRO A 1 44  ? 19.126 -14.510 -0.663  1.00 0.00 ? 257 PRO A CB     2  
ATOM   2882  C CG     . PRO A 1 44  ? 18.872 -14.023 -2.081  1.00 0.00 ? 257 PRO A CG     2  
ATOM   2883  C CD     . PRO A 1 44  ? 19.280 -12.560 -2.150  1.00 0.00 ? 257 PRO A CD     2  
ATOM   2884  H HA     . PRO A 1 44  ? 19.714 -13.265 0.930   1.00 0.00 ? 257 PRO A HA     2  
ATOM   2885  H HB2    . PRO A 1 44  ? 19.623 -15.480 -0.667  1.00 0.00 ? 257 PRO A HB2    2  
ATOM   2886  H HB3    . PRO A 1 44  ? 18.189 -14.634 -0.120  1.00 0.00 ? 257 PRO A HB3    2  
ATOM   2887  H HG2    . PRO A 1 44  ? 19.444 -14.614 -2.796  1.00 0.00 ? 257 PRO A HG2    2  
ATOM   2888  H HG3    . PRO A 1 44  ? 17.820 -14.139 -2.342  1.00 0.00 ? 257 PRO A HG3    2  
ATOM   2889  H HD2    . PRO A 1 44  ? 20.016 -12.391 -2.937  1.00 0.00 ? 257 PRO A HD2    2  
ATOM   2890  H HD3    . PRO A 1 44  ? 18.425 -11.921 -2.372  1.00 0.00 ? 257 PRO A HD3    2  
ATOM   2891  N N      . ALA A 1 45  ? 21.799 -14.552 1.158   1.00 0.00 ? 258 ALA A N      2  
ATOM   2892  C CA     . ALA A 1 45  ? 23.163 -15.006 1.372   1.00 0.00 ? 258 ALA A CA     2  
ATOM   2893  C C      . ALA A 1 45  ? 23.629 -15.797 0.148   1.00 0.00 ? 258 ALA A C      2  
ATOM   2894  O O      . ALA A 1 45  ? 22.849 -16.532 -0.456  1.00 0.00 ? 258 ALA A O      2  
ATOM   2895  C CB     . ALA A 1 45  ? 23.230 -15.831 2.658   1.00 0.00 ? 258 ALA A CB     2  
ATOM   2896  H H      . ALA A 1 45  ? 21.154 -14.798 1.881   1.00 0.00 ? 258 ALA A H      2  
ATOM   2897  H HA     . ALA A 1 45  ? 23.793 -14.124 1.486   1.00 0.00 ? 258 ALA A HA     2  
ATOM   2898  H HB1    . ALA A 1 45  ? 23.141 -16.891 2.417   1.00 0.00 ? 258 ALA A HB1    2  
ATOM   2899  H HB2    . ALA A 1 45  ? 24.184 -15.651 3.155   1.00 0.00 ? 258 ALA A HB2    2  
ATOM   2900  H HB3    . ALA A 1 45  ? 22.415 -15.539 3.320   1.00 0.00 ? 258 ALA A HB3    2  
ATOM   2901  N N      . GLY A 1 46  ? 24.900 -15.619 -0.184  1.00 0.00 ? 259 GLY A N      2  
ATOM   2902  C CA     . GLY A 1 46  ? 25.480 -16.306 -1.325  1.00 0.00 ? 259 GLY A CA     2  
ATOM   2903  C C      . GLY A 1 46  ? 25.281 -15.500 -2.609  1.00 0.00 ? 259 GLY A C      2  
ATOM   2904  O O      . GLY A 1 46  ? 25.842 -15.836 -3.652  1.00 0.00 ? 259 GLY A O      2  
ATOM   2905  H H      . GLY A 1 46  ? 25.528 -15.019 0.312   1.00 0.00 ? 259 GLY A H      2  
ATOM   2906  H HA2    . GLY A 1 46  ? 26.544 -16.468 -1.154  1.00 0.00 ? 259 GLY A HA2    2  
ATOM   2907  H HA3    . GLY A 1 46  ? 25.021 -17.289 -1.434  1.00 0.00 ? 259 GLY A HA3    2  
ATOM   2908  N N      . ALA A 1 47  ? 24.480 -14.450 -2.494  1.00 0.00 ? 260 ALA A N      2  
ATOM   2909  C CA     . ALA A 1 47  ? 24.199 -13.594 -3.633  1.00 0.00 ? 260 ALA A CA     2  
ATOM   2910  C C      . ALA A 1 47  ? 25.320 -12.562 -3.778  1.00 0.00 ? 260 ALA A C      2  
ATOM   2911  O O      . ALA A 1 47  ? 25.543 -11.752 -2.879  1.00 0.00 ? 260 ALA A O      2  
ATOM   2912  C CB     . ALA A 1 47  ? 22.826 -12.941 -3.456  1.00 0.00 ? 260 ALA A CB     2  
ATOM   2913  H H      . ALA A 1 47  ? 24.027 -14.183 -1.643  1.00 0.00 ? 260 ALA A H      2  
ATOM   2914  H HA     . ALA A 1 47  ? 24.178 -14.221 -4.523  1.00 0.00 ? 260 ALA A HA     2  
ATOM   2915  H HB1    . ALA A 1 47  ? 22.893 -12.152 -2.708  1.00 0.00 ? 260 ALA A HB1    2  
ATOM   2916  H HB2    . ALA A 1 47  ? 22.501 -12.516 -4.406  1.00 0.00 ? 260 ALA A HB2    2  
ATOM   2917  H HB3    . ALA A 1 47  ? 22.107 -13.693 -3.130  1.00 0.00 ? 260 ALA A HB3    2  
ATOM   2918  N N      . VAL A 1 48  ? 25.996 -12.625 -4.916  1.00 0.00 ? 261 VAL A N      2  
ATOM   2919  C CA     . VAL A 1 48  ? 27.088 -11.707 -5.190  1.00 0.00 ? 261 VAL A CA     2  
ATOM   2920  C C      . VAL A 1 48  ? 26.518 -10.323 -5.508  1.00 0.00 ? 261 VAL A C      2  
ATOM   2921  O O      . VAL A 1 48  ? 25.577 -10.201 -6.292  1.00 0.00 ? 261 VAL A O      2  
ATOM   2922  C CB     . VAL A 1 48  ? 27.970 -12.262 -6.310  1.00 0.00 ? 261 VAL A CB     2  
ATOM   2923  C CG1    . VAL A 1 48  ? 29.082 -11.274 -6.673  1.00 0.00 ? 261 VAL A CG1    2  
ATOM   2924  C CG2    . VAL A 1 48  ? 28.551 -13.624 -5.926  1.00 0.00 ? 261 VAL A CG2    2  
ATOM   2925  H H      . VAL A 1 48  ? 25.808 -13.287 -5.642  1.00 0.00 ? 261 VAL A H      2  
ATOM   2926  H HA     . VAL A 1 48  ? 27.693 -11.637 -4.286  1.00 0.00 ? 261 VAL A HA     2  
ATOM   2927  H HB     . VAL A 1 48  ? 27.345 -12.401 -7.191  1.00 0.00 ? 261 VAL A HB     2  
ATOM   2928  H HG11   . VAL A 1 48  ? 28.857 -10.300 -6.240  1.00 0.00 ? 261 VAL A HG11   2  
ATOM   2929  H HG12   . VAL A 1 48  ? 30.031 -11.636 -6.279  1.00 0.00 ? 261 VAL A HG12   2  
ATOM   2930  H HG13   . VAL A 1 48  ? 29.148 -11.184 -7.757  1.00 0.00 ? 261 VAL A HG13   2  
ATOM   2931  H HG21   . VAL A 1 48  ? 28.868 -14.151 -6.826  1.00 0.00 ? 261 VAL A HG21   2  
ATOM   2932  H HG22   . VAL A 1 48  ? 29.407 -13.482 -5.267  1.00 0.00 ? 261 VAL A HG22   2  
ATOM   2933  H HG23   . VAL A 1 48  ? 27.790 -14.211 -5.410  1.00 0.00 ? 261 VAL A HG23   2  
ATOM   2934  N N      . ILE A 1 49  ? 27.110 -9.316  -4.885  1.00 0.00 ? 262 ILE A N      2  
ATOM   2935  C CA     . ILE A 1 49  ? 26.672 -7.945  -5.092  1.00 0.00 ? 262 ILE A CA     2  
ATOM   2936  C C      . ILE A 1 49  ? 27.617 -7.257  -6.078  1.00 0.00 ? 262 ILE A C      2  
ATOM   2937  O O      . ILE A 1 49  ? 27.175 -6.511  -6.951  1.00 0.00 ? 262 ILE A O      2  
ATOM   2938  C CB     . ILE A 1 49  ? 26.542 -7.216  -3.753  1.00 0.00 ? 262 ILE A CB     2  
ATOM   2939  C CG1    . ILE A 1 49  ? 25.820 -8.087  -2.722  1.00 0.00 ? 262 ILE A CG1    2  
ATOM   2940  C CG2    . ILE A 1 49  ? 25.861 -5.858  -3.933  1.00 0.00 ? 262 ILE A CG2    2  
ATOM   2941  C CD1    . ILE A 1 49  ? 26.026 -7.544  -1.307  1.00 0.00 ? 262 ILE A CD1    2  
ATOM   2942  H H      . ILE A 1 49  ? 27.874 -9.423  -4.249  1.00 0.00 ? 262 ILE A H      2  
ATOM   2943  H HA     . ILE A 1 49  ? 25.678 -7.984  -5.536  1.00 0.00 ? 262 ILE A HA     2  
ATOM   2944  H HB     . ILE A 1 49  ? 27.544 -7.026  -3.369  1.00 0.00 ? 262 ILE A HB     2  
ATOM   2945  H HG12   . ILE A 1 49  ? 24.756 -8.122  -2.952  1.00 0.00 ? 262 ILE A HG12   2  
ATOM   2946  H HG13   . ILE A 1 49  ? 26.192 -9.110  -2.781  1.00 0.00 ? 262 ILE A HG13   2  
ATOM   2947  H HG21   . ILE A 1 49  ? 26.390 -5.284  -4.693  1.00 0.00 ? 262 ILE A HG21   2  
ATOM   2948  H HG22   . ILE A 1 49  ? 24.828 -6.009  -4.245  1.00 0.00 ? 262 ILE A HG22   2  
ATOM   2949  H HG23   . ILE A 1 49  ? 25.880 -5.314  -2.988  1.00 0.00 ? 262 ILE A HG23   2  
ATOM   2950  H HD11   . ILE A 1 49  ? 27.002 -7.858  -0.936  1.00 0.00 ? 262 ILE A HD11   2  
ATOM   2951  H HD12   . ILE A 1 49  ? 25.976 -6.456  -1.324  1.00 0.00 ? 262 ILE A HD12   2  
ATOM   2952  H HD13   . ILE A 1 49  ? 25.247 -7.934  -0.651  1.00 0.00 ? 262 ILE A HD13   2  
ATOM   2953  N N      . CYS A 1 50  ? 28.903 -7.531  -5.906  1.00 0.00 ? 263 CYS A N      2  
ATOM   2954  C CA     . CYS A 1 50  ? 29.914 -6.946  -6.770  1.00 0.00 ? 263 CYS A CA     2  
ATOM   2955  C C      . CYS A 1 50  ? 30.937 -8.030  -7.113  1.00 0.00 ? 263 CYS A C      2  
ATOM   2956  O O      . CYS A 1 50  ? 31.198 -8.921  -6.306  1.00 0.00 ? 263 CYS A O      2  
ATOM   2957  C CB     . CYS A 1 50  ? 30.572 -5.725  -6.126  1.00 0.00 ? 263 CYS A CB     2  
ATOM   2958  S SG     . CYS A 1 50  ? 29.314 -4.727  -5.246  1.00 0.00 ? 263 CYS A SG     2  
ATOM   2959  H H      . CYS A 1 50  ? 29.255 -8.139  -5.194  1.00 0.00 ? 263 CYS A H      2  
ATOM   2960  H HA     . CYS A 1 50  ? 29.399 -6.602  -7.667  1.00 0.00 ? 263 CYS A HA     2  
ATOM   2961  H HB2    . CYS A 1 50  ? 31.347 -6.044  -5.429  1.00 0.00 ? 263 CYS A HB2    2  
ATOM   2962  H HB3    . CYS A 1 50  ? 31.059 -5.118  -6.888  1.00 0.00 ? 263 CYS A HB3    2  
ATOM   2963  H HG     . CYS A 1 50  ? 28.447 -4.678  -6.253  1.00 0.00 ? 263 CYS A HG     2  
ATOM   2964  N N      . ARG A 1 51  ? 31.490 -7.920  -8.312  1.00 0.00 ? 264 ARG A N      2  
ATOM   2965  C CA     . ARG A 1 51  ? 32.480 -8.879  -8.772  1.00 0.00 ? 264 ARG A CA     2  
ATOM   2966  C C      . ARG A 1 51  ? 33.713 -8.153  -9.313  1.00 0.00 ? 264 ARG A C      2  
ATOM   2967  O O      . ARG A 1 51  ? 33.593 -7.252  -10.141 1.00 0.00 ? 264 ARG A O      2  
ATOM   2968  C CB     . ARG A 1 51  ? 31.905 -9.780  -9.867  1.00 0.00 ? 264 ARG A CB     2  
ATOM   2969  C CG     . ARG A 1 51  ? 32.785 -11.013 -10.080 1.00 0.00 ? 264 ARG A CG     2  
ATOM   2970  C CD     . ARG A 1 51  ? 32.988 -11.292 -11.571 1.00 0.00 ? 264 ARG A CD     2  
ATOM   2971  N NE     . ARG A 1 51  ? 31.696 -11.640 -12.202 1.00 0.00 ? 264 ARG A NE     2  
ATOM   2972  C CZ     . ARG A 1 51  ? 31.562 -12.013 -13.482 1.00 0.00 ? 264 ARG A CZ     2  
ATOM   2973  N NH1    . ARG A 1 51  ? 32.640 -12.089 -14.274 1.00 0.00 ? 264 ARG A NH1    2  
ATOM   2974  N NH2    . ARG A 1 51  ? 30.349 -12.312 -13.969 1.00 0.00 ? 264 ARG A NH2    2  
ATOM   2975  H H      . ARG A 1 51  ? 31.274 -7.192  -8.963  1.00 0.00 ? 264 ARG A H      2  
ATOM   2976  H HA     . ARG A 1 51  ? 32.727 -9.469  -7.890  1.00 0.00 ? 264 ARG A HA     2  
ATOM   2977  H HB2    . ARG A 1 51  ? 30.896 -10.090 -9.596  1.00 0.00 ? 264 ARG A HB2    2  
ATOM   2978  H HB3    . ARG A 1 51  ? 31.827 -9.220  -10.799 1.00 0.00 ? 264 ARG A HB3    2  
ATOM   2979  H HG2    . ARG A 1 51  ? 33.752 -10.862 -9.600  1.00 0.00 ? 264 ARG A HG2    2  
ATOM   2980  H HG3    . ARG A 1 51  ? 32.325 -11.880 -9.605  1.00 0.00 ? 264 ARG A HG3    2  
ATOM   2981  H HD2    . ARG A 1 51  ? 33.415 -10.414 -12.058 1.00 0.00 ? 264 ARG A HD2    2  
ATOM   2982  H HD3    . ARG A 1 51  ? 33.700 -12.107 -11.704 1.00 0.00 ? 264 ARG A HD3    2  
ATOM   2983  H HE     . ARG A 1 51  ? 30.872 -11.595 -11.639 1.00 0.00 ? 264 ARG A HE     2  
ATOM   2984  H HH11   . ARG A 1 51  ? 33.544 -11.866 -13.911 1.00 0.00 ? 264 ARG A HH11   2  
ATOM   2985  H HH12   . ARG A 1 51  ? 32.539 -12.368 -15.230 1.00 0.00 ? 264 ARG A HH12   2  
ATOM   2986  H HH21   . ARG A 1 51  ? 29.546 -12.256 -13.377 1.00 0.00 ? 264 ARG A HH21   2  
ATOM   2987  H HH22   . ARG A 1 51  ? 30.249 -12.590 -14.924 1.00 0.00 ? 264 ARG A HH22   2  
ATOM   2988  N N      . ILE A 1 52  ? 34.870 -8.572  -8.820  1.00 0.00 ? 265 ILE A N      2  
ATOM   2989  C CA     . ILE A 1 52  ? 36.124 -7.973  -9.243  1.00 0.00 ? 265 ILE A CA     2  
ATOM   2990  C C      . ILE A 1 52  ? 36.219 -8.023  -10.770 1.00 0.00 ? 265 ILE A C      2  
ATOM   2991  O O      . ILE A 1 52  ? 35.813 -9.004  -11.389 1.00 0.00 ? 265 ILE A O      2  
ATOM   2992  C CB     . ILE A 1 52  ? 37.303 -8.640  -8.533  1.00 0.00 ? 265 ILE A CB     2  
ATOM   2993  C CG1    . ILE A 1 52  ? 38.604 -7.879  -8.797  1.00 0.00 ? 265 ILE A CG1    2  
ATOM   2994  C CG2    . ILE A 1 52  ? 37.414 -10.115 -8.921  1.00 0.00 ? 265 ILE A CG2    2  
ATOM   2995  C CD1    . ILE A 1 52  ? 39.705 -8.323  -7.831  1.00 0.00 ? 265 ILE A CD1    2  
ATOM   2996  H H      . ILE A 1 52  ? 34.959 -9.305  -8.147  1.00 0.00 ? 265 ILE A H      2  
ATOM   2997  H HA     . ILE A 1 52  ? 36.109 -6.929  -8.932  1.00 0.00 ? 265 ILE A HA     2  
ATOM   2998  H HB     . ILE A 1 52  ? 37.121 -8.602  -7.459  1.00 0.00 ? 265 ILE A HB     2  
ATOM   2999  H HG12   . ILE A 1 52  ? 38.927 -8.049  -9.824  1.00 0.00 ? 265 ILE A HG12   2  
ATOM   3000  H HG13   . ILE A 1 52  ? 38.431 -6.808  -8.689  1.00 0.00 ? 265 ILE A HG13   2  
ATOM   3001  H HG21   . ILE A 1 52  ? 38.443 -10.342 -9.198  1.00 0.00 ? 265 ILE A HG21   2  
ATOM   3002  H HG22   . ILE A 1 52  ? 37.121 -10.736 -8.074  1.00 0.00 ? 265 ILE A HG22   2  
ATOM   3003  H HG23   . ILE A 1 52  ? 36.756 -10.320 -9.765  1.00 0.00 ? 265 ILE A HG23   2  
ATOM   3004  H HD11   . ILE A 1 52  ? 39.707 -9.410  -7.757  1.00 0.00 ? 265 ILE A HD11   2  
ATOM   3005  H HD12   . ILE A 1 52  ? 40.672 -7.981  -8.201  1.00 0.00 ? 265 ILE A HD12   2  
ATOM   3006  H HD13   . ILE A 1 52  ? 39.520 -7.892  -6.846  1.00 0.00 ? 265 ILE A HD13   2  
ATOM   3007  N N      . GLY A 1 53  ? 36.756 -6.950  -11.333 1.00 0.00 ? 266 GLY A N      2  
ATOM   3008  C CA     . GLY A 1 53  ? 36.909 -6.859  -12.775 1.00 0.00 ? 266 GLY A CA     2  
ATOM   3009  C C      . GLY A 1 53  ? 35.716 -6.139  -13.408 1.00 0.00 ? 266 GLY A C      2  
ATOM   3010  O O      . GLY A 1 53  ? 35.893 -5.271  -14.262 1.00 0.00 ? 266 GLY A O      2  
ATOM   3011  H H      . GLY A 1 53  ? 37.083 -6.155  -10.822 1.00 0.00 ? 266 GLY A H      2  
ATOM   3012  H HA2    . GLY A 1 53  ? 37.829 -6.325  -13.013 1.00 0.00 ? 266 GLY A HA2    2  
ATOM   3013  H HA3    . GLY A 1 53  ? 37.002 -7.859  -13.199 1.00 0.00 ? 266 GLY A HA3    2  
ATOM   3014  N N      . GLU A 1 54  ? 34.530 -6.527  -12.966 1.00 0.00 ? 267 GLU A N      2  
ATOM   3015  C CA     . GLU A 1 54  ? 33.308 -5.929  -13.478 1.00 0.00 ? 267 GLU A CA     2  
ATOM   3016  C C      . GLU A 1 54  ? 33.252 -4.444  -13.118 1.00 0.00 ? 267 GLU A C      2  
ATOM   3017  O O      . GLU A 1 54  ? 33.633 -4.054  -12.015 1.00 0.00 ? 267 GLU A O      2  
ATOM   3018  C CB     . GLU A 1 54  ? 32.074 -6.668  -12.954 1.00 0.00 ? 267 GLU A CB     2  
ATOM   3019  C CG     . GLU A 1 54  ? 31.812 -7.940  -13.763 1.00 0.00 ? 267 GLU A CG     2  
ATOM   3020  C CD     . GLU A 1 54  ? 31.571 -7.611  -15.238 1.00 0.00 ? 267 GLU A CD     2  
ATOM   3021  O OE1    . GLU A 1 54  ? 32.359 -8.024  -16.102 1.00 0.00 ? 267 GLU A OE1    2  
ATOM   3022  O OE2    . GLU A 1 54  ? 30.520 -6.902  -15.473 1.00 0.00 ? 267 GLU A OE2    2  
ATOM   3023  H H      . GLU A 1 54  ? 34.395 -7.233  -12.270 1.00 0.00 ? 267 GLU A H      2  
ATOM   3024  H HA     . GLU A 1 54  ? 33.361 -6.046  -14.561 1.00 0.00 ? 267 GLU A HA     2  
ATOM   3025  H HB2    . GLU A 1 54  ? 32.219 -6.924  -11.904 1.00 0.00 ? 267 GLU A HB2    2  
ATOM   3026  H HB3    . GLU A 1 54  ? 31.205 -6.013  -13.007 1.00 0.00 ? 267 GLU A HB3    2  
ATOM   3027  H HG2    . GLU A 1 54  ? 32.664 -8.615  -13.672 1.00 0.00 ? 267 GLU A HG2    2  
ATOM   3028  H HG3    . GLU A 1 54  ? 30.946 -8.461  -13.357 1.00 0.00 ? 267 GLU A HG3    2  
ATOM   3029  H HE2    . GLU A 1 54  ? 29.727 -7.302  -15.014 1.00 0.00 ? 267 GLU A HE2    2  
ATOM   3030  N N      . PRO A 1 55  ? 32.761 -3.633  -14.094 1.00 0.00 ? 268 PRO A N      2  
ATOM   3031  C CA     . PRO A 1 55  ? 32.650 -2.200  -13.891 1.00 0.00 ? 268 PRO A CA     2  
ATOM   3032  C C      . PRO A 1 55  ? 31.472 -1.865  -12.973 1.00 0.00 ? 268 PRO A C      2  
ATOM   3033  O O      . PRO A 1 55  ? 30.382 -2.411  -13.133 1.00 0.00 ? 268 PRO A O      2  
ATOM   3034  C CB     . PRO A 1 55  ? 32.502 -1.615  -15.286 1.00 0.00 ? 268 PRO A CB     2  
ATOM   3035  C CG     . PRO A 1 55  ? 32.069 -2.768  -16.177 1.00 0.00 ? 268 PRO A CG     2  
ATOM   3036  C CD     . PRO A 1 55  ? 32.301 -4.061  -15.412 1.00 0.00 ? 268 PRO A CD     2  
ATOM   3037  H HA     . PRO A 1 55  ? 33.465 -1.850  -13.428 1.00 0.00 ? 268 PRO A HA     2  
ATOM   3038  H HB2    . PRO A 1 55  ? 31.762 -0.814  -15.297 1.00 0.00 ? 268 PRO A HB2    2  
ATOM   3039  H HB3    . PRO A 1 55  ? 33.441 -1.185  -15.632 1.00 0.00 ? 268 PRO A HB3    2  
ATOM   3040  H HG2    . PRO A 1 55  ? 31.018 -2.667  -16.447 1.00 0.00 ? 268 PRO A HG2    2  
ATOM   3041  H HG3    . PRO A 1 55  ? 32.638 -2.766  -17.106 1.00 0.00 ? 268 PRO A HG3    2  
ATOM   3042  H HD2    . PRO A 1 55  ? 31.386 -4.649  -15.341 1.00 0.00 ? 268 PRO A HD2    2  
ATOM   3043  H HD3    . PRO A 1 55  ? 33.044 -4.686  -15.908 1.00 0.00 ? 268 PRO A HD3    2  
ATOM   3044  N N      . GLY A 1 56  ? 31.732 -0.970  -12.033 1.00 0.00 ? 269 GLY A N      2  
ATOM   3045  C CA     . GLY A 1 56  ? 30.706 -0.556  -11.089 1.00 0.00 ? 269 GLY A CA     2  
ATOM   3046  C C      . GLY A 1 56  ? 29.946 0.666   -11.608 1.00 0.00 ? 269 GLY A C      2  
ATOM   3047  O O      . GLY A 1 56  ? 30.551 1.685   -11.936 1.00 0.00 ? 269 GLY A O      2  
ATOM   3048  H H      . GLY A 1 56  ? 32.621 -0.530  -11.909 1.00 0.00 ? 269 GLY A H      2  
ATOM   3049  H HA2    . GLY A 1 56  ? 30.011 -1.377  -10.920 1.00 0.00 ? 269 GLY A HA2    2  
ATOM   3050  H HA3    . GLY A 1 56  ? 31.164 -0.323  -10.128 1.00 0.00 ? 269 GLY A HA3    2  
ATOM   3051  N N      . ASP A 1 57  ? 28.631 0.524   -11.666 1.00 0.00 ? 270 ASP A N      2  
ATOM   3052  C CA     . ASP A 1 57  ? 27.780 1.603   -12.139 1.00 0.00 ? 270 ASP A CA     2  
ATOM   3053  C C      . ASP A 1 57  ? 26.604 1.779   -11.176 1.00 0.00 ? 270 ASP A C      2  
ATOM   3054  O O      . ASP A 1 57  ? 25.537 2.246   -11.573 1.00 0.00 ? 270 ASP A O      2  
ATOM   3055  C CB     . ASP A 1 57  ? 27.214 1.292   -13.525 1.00 0.00 ? 270 ASP A CB     2  
ATOM   3056  C CG     . ASP A 1 57  ? 27.609 2.283   -14.623 1.00 0.00 ? 270 ASP A CG     2  
ATOM   3057  O OD1    . ASP A 1 57  ? 28.785 2.377   -15.005 1.00 0.00 ? 270 ASP A OD1    2  
ATOM   3058  O OD2    . ASP A 1 57  ? 26.637 2.986   -15.097 1.00 0.00 ? 270 ASP A OD2    2  
ATOM   3059  H H      . ASP A 1 57  ? 28.146 -0.309  -11.398 1.00 0.00 ? 270 ASP A H      2  
ATOM   3060  H HA     . ASP A 1 57  ? 28.426 2.481   -12.174 1.00 0.00 ? 270 ASP A HA     2  
ATOM   3061  H HB2    . ASP A 1 57  ? 27.544 0.296   -13.821 1.00 0.00 ? 270 ASP A HB2    2  
ATOM   3062  H HB3    . ASP A 1 57  ? 26.127 1.261   -13.459 1.00 0.00 ? 270 ASP A HB3    2  
ATOM   3063  H HD2    . ASP A 1 57  ? 26.947 3.502   -15.896 1.00 0.00 ? 270 ASP A HD2    2  
ATOM   3064  N N      . ARG A 1 58  ? 26.838 1.397   -9.930  1.00 0.00 ? 271 ARG A N      2  
ATOM   3065  C CA     . ARG A 1 58  ? 25.811 1.506   -8.908  1.00 0.00 ? 271 ARG A CA     2  
ATOM   3066  C C      . ARG A 1 58  ? 26.439 1.436   -7.514  1.00 0.00 ? 271 ARG A C      2  
ATOM   3067  O O      . ARG A 1 58  ? 27.497 0.835   -7.336  1.00 0.00 ? 271 ARG A O      2  
ATOM   3068  C CB     . ARG A 1 58  ? 24.773 0.392   -9.048  1.00 0.00 ? 271 ARG A CB     2  
ATOM   3069  C CG     . ARG A 1 58  ? 25.430 -0.986  -8.945  1.00 0.00 ? 271 ARG A CG     2  
ATOM   3070  C CD     . ARG A 1 58  ? 25.719 -1.561  -10.334 1.00 0.00 ? 271 ARG A CD     2  
ATOM   3071  N NE     . ARG A 1 58  ? 24.753 -2.637  -10.648 1.00 0.00 ? 271 ARG A NE     2  
ATOM   3072  C CZ     . ARG A 1 58  ? 24.855 -3.452  -11.706 1.00 0.00 ? 271 ARG A CZ     2  
ATOM   3073  N NH1    . ARG A 1 58  ? 25.881 -3.319  -12.559 1.00 0.00 ? 271 ARG A NH1    2  
ATOM   3074  N NH2    . ARG A 1 58  ? 23.932 -4.402  -11.911 1.00 0.00 ? 271 ARG A NH2    2  
ATOM   3075  H H      . ARG A 1 58  ? 27.708 1.018   -9.615  1.00 0.00 ? 271 ARG A H      2  
ATOM   3076  H HA     . ARG A 1 58  ? 25.349 2.479   -9.080  1.00 0.00 ? 271 ARG A HA     2  
ATOM   3077  H HB2    . ARG A 1 58  ? 24.014 0.497   -8.272  1.00 0.00 ? 271 ARG A HB2    2  
ATOM   3078  H HB3    . ARG A 1 58  ? 24.262 0.485   -10.007 1.00 0.00 ? 271 ARG A HB3    2  
ATOM   3079  H HG2    . ARG A 1 58  ? 26.358 -0.909  -8.379  1.00 0.00 ? 271 ARG A HG2    2  
ATOM   3080  H HG3    . ARG A 1 58  ? 24.777 -1.664  -8.397  1.00 0.00 ? 271 ARG A HG3    2  
ATOM   3081  H HD2    . ARG A 1 58  ? 25.653 -0.772  -11.084 1.00 0.00 ? 271 ARG A HD2    2  
ATOM   3082  H HD3    . ARG A 1 58  ? 26.736 -1.951  -10.370 1.00 0.00 ? 271 ARG A HD3    2  
ATOM   3083  H HE     . ARG A 1 58  ? 23.976 -2.764  -10.031 1.00 0.00 ? 271 ARG A HE     2  
ATOM   3084  H HH11   . ARG A 1 58  ? 26.569 -2.611  -12.405 1.00 0.00 ? 271 ARG A HH11   2  
ATOM   3085  H HH12   . ARG A 1 58  ? 25.956 -3.928  -13.348 1.00 0.00 ? 271 ARG A HH12   2  
ATOM   3086  H HH21   . ARG A 1 58  ? 23.167 -4.502  -11.275 1.00 0.00 ? 271 ARG A HH21   2  
ATOM   3087  H HH22   . ARG A 1 58  ? 24.007 -5.010  -12.702 1.00 0.00 ? 271 ARG A HH22   2  
ATOM   3088  N N      . MET A 1 59  ? 25.761 2.058   -6.562  1.00 0.00 ? 272 MET A N      2  
ATOM   3089  C CA     . MET A 1 59  ? 26.239 2.073   -5.189  1.00 0.00 ? 272 MET A CA     2  
ATOM   3090  C C      . MET A 1 59  ? 25.444 1.096   -4.322  1.00 0.00 ? 272 MET A C      2  
ATOM   3091  O O      . MET A 1 59  ? 24.399 0.598   -4.738  1.00 0.00 ? 272 MET A O      2  
ATOM   3092  C CB     . MET A 1 59  ? 26.106 3.487   -4.619  1.00 0.00 ? 272 MET A CB     2  
ATOM   3093  C CG     . MET A 1 59  ? 27.483 4.107   -4.367  1.00 0.00 ? 272 MET A CG     2  
ATOM   3094  S SD     . MET A 1 59  ? 27.533 4.841   -2.740  1.00 0.00 ? 272 MET A SD     2  
ATOM   3095  C CE     . MET A 1 59  ? 28.256 3.496   -1.816  1.00 0.00 ? 272 MET A CE     2  
ATOM   3096  H H      . MET A 1 59  ? 24.900 2.545   -6.715  1.00 0.00 ? 272 MET A H      2  
ATOM   3097  H HA     . MET A 1 59  ? 27.282 1.761   -5.240  1.00 0.00 ? 272 MET A HA     2  
ATOM   3098  H HB2    . MET A 1 59  ? 25.544 4.112   -5.311  1.00 0.00 ? 272 MET A HB2    2  
ATOM   3099  H HB3    . MET A 1 59  ? 25.542 3.456   -3.687  1.00 0.00 ? 272 MET A HB3    2  
ATOM   3100  H HG2    . MET A 1 59  ? 28.257 3.344   -4.455  1.00 0.00 ? 272 MET A HG2    2  
ATOM   3101  H HG3    . MET A 1 59  ? 27.694 4.863   -5.123  1.00 0.00 ? 272 MET A HG3    2  
ATOM   3102  H HE1    . MET A 1 59  ? 28.513 2.683   -2.496  1.00 0.00 ? 272 MET A HE1    2  
ATOM   3103  H HE2    . MET A 1 59  ? 29.157 3.845   -1.310  1.00 0.00 ? 272 MET A HE2    2  
ATOM   3104  H HE3    . MET A 1 59  ? 27.540 3.138   -1.076  1.00 0.00 ? 272 MET A HE3    2  
ATOM   3105  N N      . PHE A 1 60  ? 25.970 0.850   -3.131  1.00 0.00 ? 273 PHE A N      2  
ATOM   3106  C CA     . PHE A 1 60  ? 25.323 -0.059  -2.199  1.00 0.00 ? 273 PHE A CA     2  
ATOM   3107  C C      . PHE A 1 60  ? 25.529 0.398   -0.754  1.00 0.00 ? 273 PHE A C      2  
ATOM   3108  O O      . PHE A 1 60  ? 26.576 0.948   -0.416  1.00 0.00 ? 273 PHE A O      2  
ATOM   3109  C CB     . PHE A 1 60  ? 25.976 -1.429  -2.386  1.00 0.00 ? 273 PHE A CB     2  
ATOM   3110  C CG     . PHE A 1 60  ? 25.531 -2.164  -3.653  1.00 0.00 ? 273 PHE A CG     2  
ATOM   3111  C CD1    . PHE A 1 60  ? 26.150 -1.913  -4.837  1.00 0.00 ? 273 PHE A CD1    2  
ATOM   3112  C CD2    . PHE A 1 60  ? 24.518 -3.068  -3.593  1.00 0.00 ? 273 PHE A CD2    2  
ATOM   3113  C CE1    . PHE A 1 60  ? 25.737 -2.593  -6.012  1.00 0.00 ? 273 PHE A CE1    2  
ATOM   3114  C CE2    . PHE A 1 60  ? 24.104 -3.750  -4.769  1.00 0.00 ? 273 PHE A CE2    2  
ATOM   3115  C CZ     . PHE A 1 60  ? 24.722 -3.498  -5.954  1.00 0.00 ? 273 PHE A CZ     2  
ATOM   3116  H H      . PHE A 1 60  ? 26.820 1.260   -2.799  1.00 0.00 ? 273 PHE A H      2  
ATOM   3117  H HA     . PHE A 1 60  ? 24.258 -0.056  -2.432  1.00 0.00 ? 273 PHE A HA     2  
ATOM   3118  H HB2    . PHE A 1 60  ? 27.059 -1.304  -2.413  1.00 0.00 ? 273 PHE A HB2    2  
ATOM   3119  H HB3    . PHE A 1 60  ? 25.748 -2.050  -1.520  1.00 0.00 ? 273 PHE A HB3    2  
ATOM   3120  H HD1    . PHE A 1 60  ? 26.962 -1.187  -4.886  1.00 0.00 ? 273 PHE A HD1    2  
ATOM   3121  H HD2    . PHE A 1 60  ? 24.021 -3.269  -2.644  1.00 0.00 ? 273 PHE A HD2    2  
ATOM   3122  H HE1    . PHE A 1 60  ? 26.232 -2.392  -6.962  1.00 0.00 ? 273 PHE A HE1    2  
ATOM   3123  H HE2    . PHE A 1 60  ? 23.292 -4.474  -4.722  1.00 0.00 ? 273 PHE A HE2    2  
ATOM   3124  H HZ     . PHE A 1 60  ? 24.406 -4.021  -6.856  1.00 0.00 ? 273 PHE A HZ     2  
ATOM   3125  N N      . PHE A 1 61  ? 24.512 0.154   0.060   1.00 0.00 ? 274 PHE A N      2  
ATOM   3126  C CA     . PHE A 1 61  ? 24.568 0.534   1.462   1.00 0.00 ? 274 PHE A CA     2  
ATOM   3127  C C      . PHE A 1 61  ? 23.835 -0.485  2.335   1.00 0.00 ? 274 PHE A C      2  
ATOM   3128  O O      . PHE A 1 61  ? 22.662 -0.774  2.108   1.00 0.00 ? 274 PHE A O      2  
ATOM   3129  C CB     . PHE A 1 61  ? 23.870 1.890   1.586   1.00 0.00 ? 274 PHE A CB     2  
ATOM   3130  C CG     . PHE A 1 61  ? 24.145 2.841   0.419   1.00 0.00 ? 274 PHE A CG     2  
ATOM   3131  C CD1    . PHE A 1 61  ? 23.378 2.779   -0.704  1.00 0.00 ? 274 PHE A CD1    2  
ATOM   3132  C CD2    . PHE A 1 61  ? 25.154 3.748   0.504   1.00 0.00 ? 274 PHE A CD2    2  
ATOM   3133  C CE1    . PHE A 1 61  ? 23.633 3.661   -1.787  1.00 0.00 ? 274 PHE A CE1    2  
ATOM   3134  C CE2    . PHE A 1 61  ? 25.409 4.630   -0.580  1.00 0.00 ? 274 PHE A CE2    2  
ATOM   3135  C CZ     . PHE A 1 61  ? 24.642 4.568   -1.702  1.00 0.00 ? 274 PHE A CZ     2  
ATOM   3136  H H      . PHE A 1 61  ? 23.663 -0.292  -0.223  1.00 0.00 ? 274 PHE A H      2  
ATOM   3137  H HA     . PHE A 1 61  ? 25.620 0.565   1.747   1.00 0.00 ? 274 PHE A HA     2  
ATOM   3138  H HB2    . PHE A 1 61  ? 22.795 1.728   1.664   1.00 0.00 ? 274 PHE A HB2    2  
ATOM   3139  H HB3    . PHE A 1 61  ? 24.189 2.368   2.512   1.00 0.00 ? 274 PHE A HB3    2  
ATOM   3140  H HD1    . PHE A 1 61  ? 22.569 2.052   -0.771  1.00 0.00 ? 274 PHE A HD1    2  
ATOM   3141  H HD2    . PHE A 1 61  ? 25.768 3.797   1.402   1.00 0.00 ? 274 PHE A HD2    2  
ATOM   3142  H HE1    . PHE A 1 61  ? 23.019 3.611   -2.685  1.00 0.00 ? 274 PHE A HE1    2  
ATOM   3143  H HE2    . PHE A 1 61  ? 26.218 5.357   -0.512  1.00 0.00 ? 274 PHE A HE2    2  
ATOM   3144  H HZ     . PHE A 1 61  ? 24.838 5.245   -2.534  1.00 0.00 ? 274 PHE A HZ     2  
ATOM   3145  N N      . VAL A 1 62  ? 24.558 -1.002  3.318   1.00 0.00 ? 275 VAL A N      2  
ATOM   3146  C CA     . VAL A 1 62  ? 23.992 -1.984  4.228   1.00 0.00 ? 275 VAL A CA     2  
ATOM   3147  C C      . VAL A 1 62  ? 23.062 -1.279  5.217   1.00 0.00 ? 275 VAL A C      2  
ATOM   3148  O O      . VAL A 1 62  ? 23.462 -0.319  5.873   1.00 0.00 ? 275 VAL A O      2  
ATOM   3149  C CB     . VAL A 1 62  ? 25.111 -2.769  4.914   1.00 0.00 ? 275 VAL A CB     2  
ATOM   3150  C CG1    . VAL A 1 62  ? 24.547 -3.706  5.984   1.00 0.00 ? 275 VAL A CG1    2  
ATOM   3151  C CG2    . VAL A 1 62  ? 25.944 -3.543  3.891   1.00 0.00 ? 275 VAL A CG2    2  
ATOM   3152  H H      . VAL A 1 62  ? 25.513 -0.762  3.496   1.00 0.00 ? 275 VAL A H      2  
ATOM   3153  H HA     . VAL A 1 62  ? 23.404 -2.684  3.632   1.00 0.00 ? 275 VAL A HA     2  
ATOM   3154  H HB     . VAL A 1 62  ? 25.768 -2.053  5.408   1.00 0.00 ? 275 VAL A HB     2  
ATOM   3155  H HG11   . VAL A 1 62  ? 24.228 -4.639  5.519   1.00 0.00 ? 275 VAL A HG11   2  
ATOM   3156  H HG12   . VAL A 1 62  ? 25.317 -3.914  6.727   1.00 0.00 ? 275 VAL A HG12   2  
ATOM   3157  H HG13   . VAL A 1 62  ? 23.693 -3.231  6.468   1.00 0.00 ? 275 VAL A HG13   2  
ATOM   3158  H HG21   . VAL A 1 62  ? 26.905 -3.046  3.754   1.00 0.00 ? 275 VAL A HG21   2  
ATOM   3159  H HG22   . VAL A 1 62  ? 26.109 -4.560  4.251   1.00 0.00 ? 275 VAL A HG22   2  
ATOM   3160  H HG23   . VAL A 1 62  ? 25.413 -3.578  2.940   1.00 0.00 ? 275 VAL A HG23   2  
ATOM   3161  N N      . VAL A 1 63  ? 21.839 -1.782  5.293   1.00 0.00 ? 276 VAL A N      2  
ATOM   3162  C CA     . VAL A 1 63  ? 20.849 -1.213  6.192   1.00 0.00 ? 276 VAL A CA     2  
ATOM   3163  C C      . VAL A 1 63  ? 20.660 -2.143  7.393   1.00 0.00 ? 276 VAL A C      2  
ATOM   3164  O O      . VAL A 1 63  ? 20.425 -1.683  8.508   1.00 0.00 ? 276 VAL A O      2  
ATOM   3165  C CB     . VAL A 1 63  ? 19.548 -0.942  5.434   1.00 0.00 ? 276 VAL A CB     2  
ATOM   3166  C CG1    . VAL A 1 63  ? 18.461 -0.426  6.379   1.00 0.00 ? 276 VAL A CG1    2  
ATOM   3167  C CG2    . VAL A 1 63  ? 19.779 0.032   4.278   1.00 0.00 ? 276 VAL A CG2    2  
ATOM   3168  H H      . VAL A 1 63  ? 21.522 -2.564  4.757   1.00 0.00 ? 276 VAL A H      2  
ATOM   3169  H HA     . VAL A 1 63  ? 21.238 -0.258  6.547   1.00 0.00 ? 276 VAL A HA     2  
ATOM   3170  H HB     . VAL A 1 63  ? 19.204 -1.887  5.012   1.00 0.00 ? 276 VAL A HB     2  
ATOM   3171  H HG11   . VAL A 1 63  ? 18.534 0.658   6.459   1.00 0.00 ? 276 VAL A HG11   2  
ATOM   3172  H HG12   . VAL A 1 63  ? 17.481 -0.695  5.986   1.00 0.00 ? 276 VAL A HG12   2  
ATOM   3173  H HG13   . VAL A 1 63  ? 18.593 -0.873  7.364   1.00 0.00 ? 276 VAL A HG13   2  
ATOM   3174  H HG21   . VAL A 1 63  ? 19.477 1.034   4.583   1.00 0.00 ? 276 VAL A HG21   2  
ATOM   3175  H HG22   . VAL A 1 63  ? 20.836 0.037   4.012   1.00 0.00 ? 276 VAL A HG22   2  
ATOM   3176  H HG23   . VAL A 1 63  ? 19.189 -0.279  3.417   1.00 0.00 ? 276 VAL A HG23   2  
ATOM   3177  N N      . GLU A 1 64  ? 20.772 -3.435  7.121   1.00 0.00 ? 277 GLU A N      2  
ATOM   3178  C CA     . GLU A 1 64  ? 20.615 -4.435  8.164   1.00 0.00 ? 277 GLU A CA     2  
ATOM   3179  C C      . GLU A 1 64  ? 21.347 -5.722  7.780   1.00 0.00 ? 277 GLU A C      2  
ATOM   3180  O O      . GLU A 1 64  ? 21.191 -6.220  6.666   1.00 0.00 ? 277 GLU A O      2  
ATOM   3181  C CB     . GLU A 1 64  ? 19.137 -4.708  8.447   1.00 0.00 ? 277 GLU A CB     2  
ATOM   3182  C CG     . GLU A 1 64  ? 18.952 -5.366  9.815   1.00 0.00 ? 277 GLU A CG     2  
ATOM   3183  C CD     . GLU A 1 64  ? 18.196 -6.690  9.688   1.00 0.00 ? 277 GLU A CD     2  
ATOM   3184  O OE1    . GLU A 1 64  ? 16.957 -6.706  9.749   1.00 0.00 ? 277 GLU A OE1    2  
ATOM   3185  O OE2    . GLU A 1 64  ? 18.941 -7.730  9.520   1.00 0.00 ? 277 GLU A OE2    2  
ATOM   3186  H H      . GLU A 1 64  ? 20.963 -3.802  6.211   1.00 0.00 ? 277 GLU A H      2  
ATOM   3187  H HA     . GLU A 1 64  ? 21.074 -4.000  9.052   1.00 0.00 ? 277 GLU A HA     2  
ATOM   3188  H HB2    . GLU A 1 64  ? 18.577 -3.773  8.410   1.00 0.00 ? 277 GLU A HB2    2  
ATOM   3189  H HB3    . GLU A 1 64  ? 18.728 -5.354  7.670   1.00 0.00 ? 277 GLU A HB3    2  
ATOM   3190  H HG2    . GLU A 1 64  ? 19.925 -5.541  10.273  1.00 0.00 ? 277 GLU A HG2    2  
ATOM   3191  H HG3    . GLU A 1 64  ? 18.406 -4.693  10.476  1.00 0.00 ? 277 GLU A HG3    2  
ATOM   3192  H HE2    . GLU A 1 64  ? 18.464 -8.406  8.959   1.00 0.00 ? 277 GLU A HE2    2  
ATOM   3193  N N      . GLY A 1 65  ? 22.130 -6.226  8.723   1.00 0.00 ? 278 GLY A N      2  
ATOM   3194  C CA     . GLY A 1 65  ? 22.886 -7.445  8.497   1.00 0.00 ? 278 GLY A CA     2  
ATOM   3195  C C      . GLY A 1 65  ? 24.368 -7.139  8.276   1.00 0.00 ? 278 GLY A C      2  
ATOM   3196  O O      . GLY A 1 65  ? 24.813 -6.014  8.498   1.00 0.00 ? 278 GLY A O      2  
ATOM   3197  H H      . GLY A 1 65  ? 22.251 -5.815  9.626   1.00 0.00 ? 278 GLY A H      2  
ATOM   3198  H HA2    . GLY A 1 65  ? 22.771 -8.112  9.352   1.00 0.00 ? 278 GLY A HA2    2  
ATOM   3199  H HA3    . GLY A 1 65  ? 22.486 -7.970  7.629   1.00 0.00 ? 278 GLY A HA3    2  
ATOM   3200  N N      . SER A 1 66  ? 25.092 -8.161  7.842   1.00 0.00 ? 279 SER A N      2  
ATOM   3201  C CA     . SER A 1 66  ? 26.515 -8.014  7.589   1.00 0.00 ? 279 SER A CA     2  
ATOM   3202  C C      . SER A 1 66  ? 26.872 -8.627  6.233   1.00 0.00 ? 279 SER A C      2  
ATOM   3203  O O      . SER A 1 66  ? 26.134 -9.462  5.712   1.00 0.00 ? 279 SER A O      2  
ATOM   3204  C CB     . SER A 1 66  ? 27.342 -8.667  8.699   1.00 0.00 ? 279 SER A CB     2  
ATOM   3205  O OG     . SER A 1 66  ? 27.321 -7.901  9.900   1.00 0.00 ? 279 SER A OG     2  
ATOM   3206  H H      . SER A 1 66  ? 24.722 -9.072  7.664   1.00 0.00 ? 279 SER A H      2  
ATOM   3207  H HA     . SER A 1 66  ? 26.700 -6.940  7.584   1.00 0.00 ? 279 SER A HA     2  
ATOM   3208  H HB2    . SER A 1 66  ? 26.955 -9.666  8.900   1.00 0.00 ? 279 SER A HB2    2  
ATOM   3209  H HB3    . SER A 1 66  ? 28.372 -8.786  8.362   1.00 0.00 ? 279 SER A HB3    2  
ATOM   3210  H HG     . SER A 1 66  ? 26.605 -8.240  10.510  1.00 0.00 ? 279 SER A HG     2  
ATOM   3211  N N      . VAL A 1 67  ? 28.002 -8.187  5.700   1.00 0.00 ? 280 VAL A N      2  
ATOM   3212  C CA     . VAL A 1 67  ? 28.465 -8.680  4.414   1.00 0.00 ? 280 VAL A CA     2  
ATOM   3213  C C      . VAL A 1 67  ? 29.915 -9.150  4.545   1.00 0.00 ? 280 VAL A C      2  
ATOM   3214  O O      . VAL A 1 67  ? 30.629 -8.727  5.452   1.00 0.00 ? 280 VAL A O      2  
ATOM   3215  C CB     . VAL A 1 67  ? 28.279 -7.605  3.341   1.00 0.00 ? 280 VAL A CB     2  
ATOM   3216  C CG1    . VAL A 1 67  ? 29.060 -7.953  2.074   1.00 0.00 ? 280 VAL A CG1    2  
ATOM   3217  C CG2    . VAL A 1 67  ? 26.797 -7.390  3.032   1.00 0.00 ? 280 VAL A CG2    2  
ATOM   3218  H H      . VAL A 1 67  ? 28.596 -7.507  6.130   1.00 0.00 ? 280 VAL A H      2  
ATOM   3219  H HA     . VAL A 1 67  ? 27.842 -9.535  4.146   1.00 0.00 ? 280 VAL A HA     2  
ATOM   3220  H HB     . VAL A 1 67  ? 28.678 -6.669  3.734   1.00 0.00 ? 280 VAL A HB     2  
ATOM   3221  H HG11   . VAL A 1 67  ? 28.750 -7.294  1.263   1.00 0.00 ? 280 VAL A HG11   2  
ATOM   3222  H HG12   . VAL A 1 67  ? 30.127 -7.826  2.257   1.00 0.00 ? 280 VAL A HG12   2  
ATOM   3223  H HG13   . VAL A 1 67  ? 28.861 -8.989  1.797   1.00 0.00 ? 280 VAL A HG13   2  
ATOM   3224  H HG21   . VAL A 1 67  ? 26.355 -6.747  3.793   1.00 0.00 ? 280 VAL A HG21   2  
ATOM   3225  H HG22   . VAL A 1 67  ? 26.695 -6.917  2.055   1.00 0.00 ? 280 VAL A HG22   2  
ATOM   3226  H HG23   . VAL A 1 67  ? 26.283 -8.351  3.026   1.00 0.00 ? 280 VAL A HG23   2  
ATOM   3227  N N      . SER A 1 68  ? 30.307 -10.019 3.625   1.00 0.00 ? 281 SER A N      2  
ATOM   3228  C CA     . SER A 1 68  ? 31.660 -10.551 3.625   1.00 0.00 ? 281 SER A CA     2  
ATOM   3229  C C      . SER A 1 68  ? 32.313 -10.321 2.261   1.00 0.00 ? 281 SER A C      2  
ATOM   3230  O O      . SER A 1 68  ? 31.711 -10.599 1.225   1.00 0.00 ? 281 SER A O      2  
ATOM   3231  C CB     . SER A 1 68  ? 31.666 -12.040 3.973   1.00 0.00 ? 281 SER A CB     2  
ATOM   3232  O OG     . SER A 1 68  ? 32.391 -12.306 5.170   1.00 0.00 ? 281 SER A OG     2  
ATOM   3233  H H      . SER A 1 68  ? 29.721 -10.358 2.889   1.00 0.00 ? 281 SER A H      2  
ATOM   3234  H HA     . SER A 1 68  ? 32.188 -9.994  4.400   1.00 0.00 ? 281 SER A HA     2  
ATOM   3235  H HB2    . SER A 1 68  ? 30.639 -12.390 4.085   1.00 0.00 ? 281 SER A HB2    2  
ATOM   3236  H HB3    . SER A 1 68  ? 32.106 -12.603 3.150   1.00 0.00 ? 281 SER A HB3    2  
ATOM   3237  H HG     . SER A 1 68  ? 31.850 -12.891 5.775   1.00 0.00 ? 281 SER A HG     2  
ATOM   3238  N N      . VAL A 1 69  ? 33.537 -9.815  2.305   1.00 0.00 ? 282 VAL A N      2  
ATOM   3239  C CA     . VAL A 1 69  ? 34.279 -9.545  1.085   1.00 0.00 ? 282 VAL A CA     2  
ATOM   3240  C C      . VAL A 1 69  ? 34.870 -10.852 0.552   1.00 0.00 ? 282 VAL A C      2  
ATOM   3241  O O      . VAL A 1 69  ? 35.280 -11.713 1.328   1.00 0.00 ? 282 VAL A O      2  
ATOM   3242  C CB     . VAL A 1 69  ? 35.338 -8.472  1.343   1.00 0.00 ? 282 VAL A CB     2  
ATOM   3243  C CG1    . VAL A 1 69  ? 36.102 -8.136  0.060   1.00 0.00 ? 282 VAL A CG1    2  
ATOM   3244  C CG2    . VAL A 1 69  ? 34.710 -7.218  1.953   1.00 0.00 ? 282 VAL A CG2    2  
ATOM   3245  H H      . VAL A 1 69  ? 34.020 -9.591  3.151   1.00 0.00 ? 282 VAL A H      2  
ATOM   3246  H HA     . VAL A 1 69  ? 33.574 -9.154  0.351   1.00 0.00 ? 282 VAL A HA     2  
ATOM   3247  H HB     . VAL A 1 69  ? 36.053 -8.873  2.062   1.00 0.00 ? 282 VAL A HB     2  
ATOM   3248  H HG11   . VAL A 1 69  ? 37.117 -7.829  0.312   1.00 0.00 ? 282 VAL A HG11   2  
ATOM   3249  H HG12   . VAL A 1 69  ? 36.137 -9.014  -0.583  1.00 0.00 ? 282 VAL A HG12   2  
ATOM   3250  H HG13   . VAL A 1 69  ? 35.596 -7.323  -0.461  1.00 0.00 ? 282 VAL A HG13   2  
ATOM   3251  H HG21   . VAL A 1 69  ? 34.119 -6.703  1.196   1.00 0.00 ? 282 VAL A HG21   2  
ATOM   3252  H HG22   . VAL A 1 69  ? 34.068 -7.501  2.786   1.00 0.00 ? 282 VAL A HG22   2  
ATOM   3253  H HG23   . VAL A 1 69  ? 35.498 -6.554  2.311   1.00 0.00 ? 282 VAL A HG23   2  
ATOM   3254  N N      . ALA A 1 70  ? 34.893 -10.959 -0.768  1.00 0.00 ? 283 ALA A N      2  
ATOM   3255  C CA     . ALA A 1 70  ? 35.426 -12.147 -1.414  1.00 0.00 ? 283 ALA A CA     2  
ATOM   3256  C C      . ALA A 1 70  ? 36.919 -11.948 -1.684  1.00 0.00 ? 283 ALA A C      2  
ATOM   3257  O O      . ALA A 1 70  ? 37.298 -11.369 -2.700  1.00 0.00 ? 283 ALA A O      2  
ATOM   3258  C CB     . ALA A 1 70  ? 34.635 -12.432 -2.692  1.00 0.00 ? 283 ALA A CB     2  
ATOM   3259  H H      . ALA A 1 70  ? 34.556 -10.254 -1.393  1.00 0.00 ? 283 ALA A H      2  
ATOM   3260  H HA     . ALA A 1 70  ? 35.297 -12.984 -0.728  1.00 0.00 ? 283 ALA A HA     2  
ATOM   3261  H HB1    . ALA A 1 70  ? 35.321 -12.735 -3.483  1.00 0.00 ? 283 ALA A HB1    2  
ATOM   3262  H HB2    . ALA A 1 70  ? 33.920 -13.232 -2.506  1.00 0.00 ? 283 ALA A HB2    2  
ATOM   3263  H HB3    . ALA A 1 70  ? 34.102 -11.532 -2.999  1.00 0.00 ? 283 ALA A HB3    2  
ATOM   3264  N N      . THR A 1 71  ? 37.726 -12.440 -0.755  1.00 0.00 ? 284 THR A N      2  
ATOM   3265  C CA     . THR A 1 71  ? 39.169 -12.324 -0.881  1.00 0.00 ? 284 THR A CA     2  
ATOM   3266  C C      . THR A 1 71  ? 39.867 -13.162 0.193   1.00 0.00 ? 284 THR A C      2  
ATOM   3267  O O      . THR A 1 71  ? 39.209 -13.756 1.046   1.00 0.00 ? 284 THR A O      2  
ATOM   3268  C CB     . THR A 1 71  ? 39.531 -10.839 -0.823  1.00 0.00 ? 284 THR A CB     2  
ATOM   3269  O OG1    . THR A 1 71  ? 40.327 -10.722 0.353   1.00 0.00 ? 284 THR A OG1    2  
ATOM   3270  C CG2    . THR A 1 71  ? 38.317 -9.952  -0.542  1.00 0.00 ? 284 THR A CG2    2  
ATOM   3271  H H      . THR A 1 71  ? 37.409 -12.911 0.069   1.00 0.00 ? 284 THR A H      2  
ATOM   3272  H HA     . THR A 1 71  ? 39.464 -12.734 -1.847  1.00 0.00 ? 284 THR A HA     2  
ATOM   3273  H HB     . THR A 1 71  ? 40.040 -10.527 -1.734  1.00 0.00 ? 284 THR A HB     2  
ATOM   3274  H HG1    . THR A 1 71  ? 40.818 -9.850  0.348   1.00 0.00 ? 284 THR A HG1    2  
ATOM   3275  H HG21   . THR A 1 71  ? 37.613 -10.488 0.094   1.00 0.00 ? 284 THR A HG21   2  
ATOM   3276  H HG22   . THR A 1 71  ? 38.641 -9.041  -0.037  1.00 0.00 ? 284 THR A HG22   2  
ATOM   3277  H HG23   . THR A 1 71  ? 37.832 -9.691  -1.483  1.00 0.00 ? 284 THR A HG23   2  
ATOM   3278  N N      . PRO A 1 72  ? 41.224 -13.184 0.114   1.00 0.00 ? 285 PRO A N      2  
ATOM   3279  C CA     . PRO A 1 72  ? 42.018 -13.939 1.068   1.00 0.00 ? 285 PRO A CA     2  
ATOM   3280  C C      . PRO A 1 72  ? 42.074 -13.225 2.420   1.00 0.00 ? 285 PRO A C      2  
ATOM   3281  O O      . PRO A 1 72  ? 42.255 -13.863 3.457   1.00 0.00 ? 285 PRO A O      2  
ATOM   3282  C CB     . PRO A 1 72  ? 43.383 -14.084 0.417   1.00 0.00 ? 285 PRO A CB     2  
ATOM   3283  C CG     . PRO A 1 72  ? 43.446 -13.016 -0.662  1.00 0.00 ? 285 PRO A CG     2  
ATOM   3284  C CD     . PRO A 1 72  ? 42.036 -12.493 -0.883  1.00 0.00 ? 285 PRO A CD     2  
ATOM   3285  H HA     . PRO A 1 72  ? 41.594 -14.827 1.246   1.00 0.00 ? 285 PRO A HA     2  
ATOM   3286  H HB2    . PRO A 1 72  ? 44.180 -13.950 1.147   1.00 0.00 ? 285 PRO A HB2    2  
ATOM   3287  H HB3    . PRO A 1 72  ? 43.508 -15.079 -0.011  1.00 0.00 ? 285 PRO A HB3    2  
ATOM   3288  H HG2    . PRO A 1 72  ? 44.110 -12.206 -0.359  1.00 0.00 ? 285 PRO A HG2    2  
ATOM   3289  H HG3    . PRO A 1 72  ? 43.849 -13.430 -1.587  1.00 0.00 ? 285 PRO A HG3    2  
ATOM   3290  H HD2    . PRO A 1 72  ? 41.989 -11.411 -0.752  1.00 0.00 ? 285 PRO A HD2    2  
ATOM   3291  H HD3    . PRO A 1 72  ? 41.688 -12.706 -1.894  1.00 0.00 ? 285 PRO A HD3    2  
ATOM   3292  N N      . ASN A 1 73  ? 41.914 -11.911 2.367   1.00 0.00 ? 286 ASN A N      2  
ATOM   3293  C CA     . ASN A 1 73  ? 41.944 -11.104 3.575   1.00 0.00 ? 286 ASN A CA     2  
ATOM   3294  C C      . ASN A 1 73  ? 40.788 -10.102 3.543   1.00 0.00 ? 286 ASN A C      2  
ATOM   3295  O O      . ASN A 1 73  ? 41.008 -8.892  3.569   1.00 0.00 ? 286 ASN A O      2  
ATOM   3296  C CB     . ASN A 1 73  ? 43.251 -10.314 3.677   1.00 0.00 ? 286 ASN A CB     2  
ATOM   3297  C CG     . ASN A 1 73  ? 44.316 -11.111 4.434   1.00 0.00 ? 286 ASN A CG     2  
ATOM   3298  O OD1    . ASN A 1 73  ? 45.201 -11.717 3.856   1.00 0.00 ? 286 ASN A OD1    2  
ATOM   3299  N ND2    . ASN A 1 73  ? 44.179 -11.074 5.757   1.00 0.00 ? 286 ASN A ND2    2  
ATOM   3300  H H      . ASN A 1 73  ? 41.767 -11.399 1.521   1.00 0.00 ? 286 ASN A H      2  
ATOM   3301  H HA     . ASN A 1 73  ? 41.858 -11.814 4.397   1.00 0.00 ? 286 ASN A HA     2  
ATOM   3302  H HB2    . ASN A 1 73  ? 43.614 -10.073 2.678   1.00 0.00 ? 286 ASN A HB2    2  
ATOM   3303  H HB3    . ASN A 1 73  ? 43.069 -9.367  4.186   1.00 0.00 ? 286 ASN A HB3    2  
ATOM   3304  H HD21   . ASN A 1 73  ? 43.429 -10.556 6.168   1.00 0.00 ? 286 ASN A HD21   2  
ATOM   3305  H HD22   . ASN A 1 73  ? 44.827 -11.564 6.340   1.00 0.00 ? 286 ASN A HD22   2  
ATOM   3306  N N      . PRO A 1 74  ? 39.548 -10.658 3.484   1.00 0.00 ? 287 PRO A N      2  
ATOM   3307  C CA     . PRO A 1 74  ? 38.357 -9.827  3.448   1.00 0.00 ? 287 PRO A CA     2  
ATOM   3308  C C      . PRO A 1 74  ? 38.062 -9.231  4.825   1.00 0.00 ? 287 PRO A C      2  
ATOM   3309  O O      . PRO A 1 74  ? 38.928 -9.219  5.699   1.00 0.00 ? 287 PRO A O      2  
ATOM   3310  C CB     . PRO A 1 74  ? 37.253 -10.745 2.949   1.00 0.00 ? 287 PRO A CB     2  
ATOM   3311  C CG     . PRO A 1 74  ? 37.758 -12.162 3.168   1.00 0.00 ? 287 PRO A CG     2  
ATOM   3312  C CD     . PRO A 1 74  ? 39.249 -12.086 3.451   1.00 0.00 ? 287 PRO A CD     2  
ATOM   3313  H HA     . PRO A 1 74  ? 38.495 -9.048  2.837   1.00 0.00 ? 287 PRO A HA     2  
ATOM   3314  H HB2    . PRO A 1 74  ? 36.325 -10.572 3.495   1.00 0.00 ? 287 PRO A HB2    2  
ATOM   3315  H HB3    . PRO A 1 74  ? 37.040 -10.564 1.896   1.00 0.00 ? 287 PRO A HB3    2  
ATOM   3316  H HG2    . PRO A 1 74  ? 37.233 -12.629 4.002   1.00 0.00 ? 287 PRO A HG2    2  
ATOM   3317  H HG3    . PRO A 1 74  ? 37.566 -12.775 2.286   1.00 0.00 ? 287 PRO A HG3    2  
ATOM   3318  H HD2    . PRO A 1 74  ? 39.497 -12.565 4.398   1.00 0.00 ? 287 PRO A HD2    2  
ATOM   3319  H HD3    . PRO A 1 74  ? 39.825 -12.594 2.677   1.00 0.00 ? 287 PRO A HD3    2  
ATOM   3320  N N      . VAL A 1 75  ? 36.837 -8.750  4.977   1.00 0.00 ? 288 VAL A N      2  
ATOM   3321  C CA     . VAL A 1 75  ? 36.416 -8.154  6.234   1.00 0.00 ? 288 VAL A CA     2  
ATOM   3322  C C      . VAL A 1 75  ? 34.901 -8.300  6.382   1.00 0.00 ? 288 VAL A C      2  
ATOM   3323  O O      . VAL A 1 75  ? 34.203 -8.585  5.410   1.00 0.00 ? 288 VAL A O      2  
ATOM   3324  C CB     . VAL A 1 75  ? 36.887 -6.700  6.306   1.00 0.00 ? 288 VAL A CB     2  
ATOM   3325  C CG1    . VAL A 1 75  ? 36.086 -5.916  7.348   1.00 0.00 ? 288 VAL A CG1    2  
ATOM   3326  C CG2    . VAL A 1 75  ? 38.387 -6.622  6.597   1.00 0.00 ? 288 VAL A CG2    2  
ATOM   3327  H H      . VAL A 1 75  ? 36.137 -8.764  4.262   1.00 0.00 ? 288 VAL A H      2  
ATOM   3328  H HA     . VAL A 1 75  ? 36.903 -8.706  7.038   1.00 0.00 ? 288 VAL A HA     2  
ATOM   3329  H HB     . VAL A 1 75  ? 36.709 -6.242  5.333   1.00 0.00 ? 288 VAL A HB     2  
ATOM   3330  H HG11   . VAL A 1 75  ? 36.234 -6.362  8.331   1.00 0.00 ? 288 VAL A HG11   2  
ATOM   3331  H HG12   . VAL A 1 75  ? 36.426 -4.881  7.363   1.00 0.00 ? 288 VAL A HG12   2  
ATOM   3332  H HG13   . VAL A 1 75  ? 35.027 -5.947  7.090   1.00 0.00 ? 288 VAL A HG13   2  
ATOM   3333  H HG21   . VAL A 1 75  ? 38.608 -5.693  7.120   1.00 0.00 ? 288 VAL A HG21   2  
ATOM   3334  H HG22   . VAL A 1 75  ? 38.681 -7.468  7.217   1.00 0.00 ? 288 VAL A HG22   2  
ATOM   3335  H HG23   . VAL A 1 75  ? 38.941 -6.650  5.657   1.00 0.00 ? 288 VAL A HG23   2  
ATOM   3336  N N      . GLU A 1 76  ? 34.436 -8.099  7.606   1.00 0.00 ? 289 GLU A N      2  
ATOM   3337  C CA     . GLU A 1 76  ? 33.015 -8.205  7.894   1.00 0.00 ? 289 GLU A CA     2  
ATOM   3338  C C      . GLU A 1 76  ? 32.373 -6.817  7.912   1.00 0.00 ? 289 GLU A C      2  
ATOM   3339  O O      . GLU A 1 76  ? 32.747 -5.966  8.716   1.00 0.00 ? 289 GLU A O      2  
ATOM   3340  C CB     . GLU A 1 76  ? 32.777 -8.937  9.217   1.00 0.00 ? 289 GLU A CB     2  
ATOM   3341  C CG     . GLU A 1 76  ? 31.389 -9.579  9.245   1.00 0.00 ? 289 GLU A CG     2  
ATOM   3342  C CD     . GLU A 1 76  ? 31.061 -10.114 10.641  1.00 0.00 ? 289 GLU A CD     2  
ATOM   3343  O OE1    . GLU A 1 76  ? 30.390 -9.426  11.426  1.00 0.00 ? 289 GLU A OE1    2  
ATOM   3344  O OE2    . GLU A 1 76  ? 31.528 -11.288 10.898  1.00 0.00 ? 289 GLU A OE2    2  
ATOM   3345  H H      . GLU A 1 76  ? 35.009 -7.868  8.392   1.00 0.00 ? 289 GLU A H      2  
ATOM   3346  H HA     . GLU A 1 76  ? 32.598 -8.796  7.079   1.00 0.00 ? 289 GLU A HA     2  
ATOM   3347  H HB2    . GLU A 1 76  ? 33.539 -9.704  9.355   1.00 0.00 ? 289 GLU A HB2    2  
ATOM   3348  H HB3    . GLU A 1 76  ? 32.875 -8.237  10.047  1.00 0.00 ? 289 GLU A HB3    2  
ATOM   3349  H HG2    . GLU A 1 76  ? 30.639 -8.847  8.947   1.00 0.00 ? 289 GLU A HG2    2  
ATOM   3350  H HG3    . GLU A 1 76  ? 31.346 -10.393 8.521   1.00 0.00 ? 289 GLU A HG3    2  
ATOM   3351  H HE2    . GLU A 1 76  ? 31.784 -11.350 11.863  1.00 0.00 ? 289 GLU A HE2    2  
ATOM   3352  N N      . LEU A 1 77  ? 31.416 -6.632  7.014   1.00 0.00 ? 290 LEU A N      2  
ATOM   3353  C CA     . LEU A 1 77  ? 30.716 -5.362  6.916   1.00 0.00 ? 290 LEU A CA     2  
ATOM   3354  C C      . LEU A 1 77  ? 29.409 -5.442  7.706   1.00 0.00 ? 290 LEU A C      2  
ATOM   3355  O O      . LEU A 1 77  ? 28.828 -6.516  7.844   1.00 0.00 ? 290 LEU A O      2  
ATOM   3356  C CB     . LEU A 1 77  ? 30.526 -4.966  5.451   1.00 0.00 ? 290 LEU A CB     2  
ATOM   3357  C CG     . LEU A 1 77  ? 31.767 -4.431  4.733   1.00 0.00 ? 290 LEU A CG     2  
ATOM   3358  C CD1    . LEU A 1 77  ? 31.582 -4.472  3.214   1.00 0.00 ? 290 LEU A CD1    2  
ATOM   3359  C CD2    . LEU A 1 77  ? 32.125 -3.029  5.229   1.00 0.00 ? 290 LEU A CD2    2  
ATOM   3360  H H      . LEU A 1 77  ? 31.117 -7.330  6.363   1.00 0.00 ? 290 LEU A H      2  
ATOM   3361  H HA     . LEU A 1 77  ? 31.352 -4.603  7.374   1.00 0.00 ? 290 LEU A HA     2  
ATOM   3362  H HB2    . LEU A 1 77  ? 30.162 -5.837  4.904   1.00 0.00 ? 290 LEU A HB2    2  
ATOM   3363  H HB3    . LEU A 1 77  ? 29.745 -4.208  5.398   1.00 0.00 ? 290 LEU A HB3    2  
ATOM   3364  H HG     . LEU A 1 77  ? 32.607 -5.082  4.972   1.00 0.00 ? 290 LEU A HG     2  
ATOM   3365  H HD11   . LEU A 1 77  ? 30.595 -4.869  2.979   1.00 0.00 ? 290 LEU A HD11   2  
ATOM   3366  H HD12   . LEU A 1 77  ? 31.675 -3.464  2.809   1.00 0.00 ? 290 LEU A HD12   2  
ATOM   3367  H HD13   . LEU A 1 77  ? 32.347 -5.111  2.773   1.00 0.00 ? 290 LEU A HD13   2  
ATOM   3368  H HD21   . LEU A 1 77  ? 33.178 -2.831  5.030   1.00 0.00 ? 290 LEU A HD21   2  
ATOM   3369  H HD22   . LEU A 1 77  ? 31.512 -2.292  4.710   1.00 0.00 ? 290 LEU A HD22   2  
ATOM   3370  H HD23   . LEU A 1 77  ? 31.940 -2.965  6.302   1.00 0.00 ? 290 LEU A HD23   2  
ATOM   3371  N N      . GLY A 1 78  ? 28.986 -4.289  8.205   1.00 0.00 ? 291 GLY A N      2  
ATOM   3372  C CA     . GLY A 1 78  ? 27.757 -4.216  8.978   1.00 0.00 ? 291 GLY A CA     2  
ATOM   3373  C C      . GLY A 1 78  ? 26.817 -3.149  8.413   1.00 0.00 ? 291 GLY A C      2  
ATOM   3374  O O      . GLY A 1 78  ? 27.083 -2.579  7.356   1.00 0.00 ? 291 GLY A O      2  
ATOM   3375  H H      . GLY A 1 78  ? 29.464 -3.420  8.088   1.00 0.00 ? 291 GLY A H      2  
ATOM   3376  H HA2    . GLY A 1 78  ? 27.260 -5.185  8.972   1.00 0.00 ? 291 GLY A HA2    2  
ATOM   3377  H HA3    . GLY A 1 78  ? 27.991 -3.985  10.018  1.00 0.00 ? 291 GLY A HA3    2  
ATOM   3378  N N      . PRO A 1 79  ? 25.708 -2.906  9.161   1.00 0.00 ? 292 PRO A N      2  
ATOM   3379  C CA     . PRO A 1 79  ? 24.726 -1.919  8.745   1.00 0.00 ? 292 PRO A CA     2  
ATOM   3380  C C      . PRO A 1 79  ? 25.242 -0.498  8.985   1.00 0.00 ? 292 PRO A C      2  
ATOM   3381  O O      . PRO A 1 79  ? 25.694 -0.175  10.083  1.00 0.00 ? 292 PRO A O      2  
ATOM   3382  C CB     . PRO A 1 79  ? 23.478 -2.241  9.551   1.00 0.00 ? 292 PRO A CB     2  
ATOM   3383  C CG     . PRO A 1 79  ? 23.945 -3.095  10.719  1.00 0.00 ? 292 PRO A CG     2  
ATOM   3384  C CD     . PRO A 1 79  ? 25.360 -3.562  10.418  1.00 0.00 ? 292 PRO A CD     2  
ATOM   3385  H HA     . PRO A 1 79  ? 24.560 -1.987  7.762   1.00 0.00 ? 292 PRO A HA     2  
ATOM   3386  H HB2    . PRO A 1 79  ? 22.995 -1.329  9.903   1.00 0.00 ? 292 PRO A HB2    2  
ATOM   3387  H HB3    . PRO A 1 79  ? 22.748 -2.776  8.943   1.00 0.00 ? 292 PRO A HB3    2  
ATOM   3388  H HG2    . PRO A 1 79  ? 23.920 -2.522  11.645  1.00 0.00 ? 292 PRO A HG2    2  
ATOM   3389  H HG3    . PRO A 1 79  ? 23.282 -3.950  10.854  1.00 0.00 ? 292 PRO A HG3    2  
ATOM   3390  H HD2    . PRO A 1 79  ? 26.047 -3.280  11.215  1.00 0.00 ? 292 PRO A HD2    2  
ATOM   3391  H HD3    . PRO A 1 79  ? 25.408 -4.647  10.325  1.00 0.00 ? 292 PRO A HD3    2  
ATOM   3392  N N      . GLY A 1 80  ? 25.157 0.312   7.941   1.00 0.00 ? 293 GLY A N      2  
ATOM   3393  C CA     . GLY A 1 80  ? 25.610 1.690   8.023   1.00 0.00 ? 293 GLY A CA     2  
ATOM   3394  C C      . GLY A 1 80  ? 26.925 1.882   7.266   1.00 0.00 ? 293 GLY A C      2  
ATOM   3395  O O      . GLY A 1 80  ? 27.611 2.886   7.450   1.00 0.00 ? 293 GLY A O      2  
ATOM   3396  H H      . GLY A 1 80  ? 24.789 0.041   7.051   1.00 0.00 ? 293 GLY A H      2  
ATOM   3397  H HA2    . GLY A 1 80  ? 24.848 2.353   7.612   1.00 0.00 ? 293 GLY A HA2    2  
ATOM   3398  H HA3    . GLY A 1 80  ? 25.745 1.971   9.068   1.00 0.00 ? 293 GLY A HA3    2  
ATOM   3399  N N      . ALA A 1 81  ? 27.236 0.904   6.428   1.00 0.00 ? 294 ALA A N      2  
ATOM   3400  C CA     . ALA A 1 81  ? 28.457 0.952   5.642   1.00 0.00 ? 294 ALA A CA     2  
ATOM   3401  C C      . ALA A 1 81  ? 28.099 1.028   4.156   1.00 0.00 ? 294 ALA A C      2  
ATOM   3402  O O      . ALA A 1 81  ? 27.051 0.535   3.740   1.00 0.00 ? 294 ALA A O      2  
ATOM   3403  C CB     . ALA A 1 81  ? 29.325 -0.264  5.970   1.00 0.00 ? 294 ALA A CB     2  
ATOM   3404  H H      . ALA A 1 81  ? 26.673 0.090   6.284   1.00 0.00 ? 294 ALA A H      2  
ATOM   3405  H HA     . ALA A 1 81  ? 28.997 1.857   5.922   1.00 0.00 ? 294 ALA A HA     2  
ATOM   3406  H HB1    . ALA A 1 81  ? 29.334 -0.423  7.048   1.00 0.00 ? 294 ALA A HB1    2  
ATOM   3407  H HB2    . ALA A 1 81  ? 28.917 -1.146  5.476   1.00 0.00 ? 294 ALA A HB2    2  
ATOM   3408  H HB3    . ALA A 1 81  ? 30.342 -0.089  5.621   1.00 0.00 ? 294 ALA A HB3    2  
ATOM   3409  N N      . PHE A 1 82  ? 28.989 1.649   3.396   1.00 0.00 ? 295 PHE A N      2  
ATOM   3410  C CA     . PHE A 1 82  ? 28.779 1.795   1.966   1.00 0.00 ? 295 PHE A CA     2  
ATOM   3411  C C      . PHE A 1 82  ? 29.941 1.189   1.176   1.00 0.00 ? 295 PHE A C      2  
ATOM   3412  O O      . PHE A 1 82  ? 31.091 1.252   1.610   1.00 0.00 ? 295 PHE A O      2  
ATOM   3413  C CB     . PHE A 1 82  ? 28.709 3.296   1.675   1.00 0.00 ? 295 PHE A CB     2  
ATOM   3414  C CG     . PHE A 1 82  ? 29.629 4.144   2.555   1.00 0.00 ? 295 PHE A CG     2  
ATOM   3415  C CD1    . PHE A 1 82  ? 29.232 4.506   3.804   1.00 0.00 ? 295 PHE A CD1    2  
ATOM   3416  C CD2    . PHE A 1 82  ? 30.845 4.535   2.088   1.00 0.00 ? 295 PHE A CD2    2  
ATOM   3417  C CE1    . PHE A 1 82  ? 30.086 5.293   4.621   1.00 0.00 ? 295 PHE A CE1    2  
ATOM   3418  C CE2    . PHE A 1 82  ? 31.700 5.322   2.905   1.00 0.00 ? 295 PHE A CE2    2  
ATOM   3419  C CZ     . PHE A 1 82  ? 31.302 5.685   4.154   1.00 0.00 ? 295 PHE A CZ     2  
ATOM   3420  H H      . PHE A 1 82  ? 29.838 2.046   3.741   1.00 0.00 ? 295 PHE A H      2  
ATOM   3421  H HA     . PHE A 1 82  ? 27.859 1.266   1.718   1.00 0.00 ? 295 PHE A HA     2  
ATOM   3422  H HB2    . PHE A 1 82  ? 28.965 3.466   0.629   1.00 0.00 ? 295 PHE A HB2    2  
ATOM   3423  H HB3    . PHE A 1 82  ? 27.681 3.634   1.810   1.00 0.00 ? 295 PHE A HB3    2  
ATOM   3424  H HD1    . PHE A 1 82  ? 28.258 4.192   4.178   1.00 0.00 ? 295 PHE A HD1    2  
ATOM   3425  H HD2    . PHE A 1 82  ? 31.164 4.245   1.088   1.00 0.00 ? 295 PHE A HD2    2  
ATOM   3426  H HE1    . PHE A 1 82  ? 29.768 5.583   5.623   1.00 0.00 ? 295 PHE A HE1    2  
ATOM   3427  H HE2    . PHE A 1 82  ? 32.674 5.636   2.530   1.00 0.00 ? 295 PHE A HE2    2  
ATOM   3428  H HZ     . PHE A 1 82  ? 31.958 6.289   4.781   1.00 0.00 ? 295 PHE A HZ     2  
ATOM   3429  N N      . PHE A 1 83  ? 29.601 0.616   0.031   1.00 0.00 ? 296 PHE A N      2  
ATOM   3430  C CA     . PHE A 1 83  ? 30.602 -0.002  -0.823  1.00 0.00 ? 296 PHE A CA     2  
ATOM   3431  C C      . PHE A 1 83  ? 30.182 0.060   -2.293  1.00 0.00 ? 296 PHE A C      2  
ATOM   3432  O O      . PHE A 1 83  ? 29.002 0.225   -2.598  1.00 0.00 ? 296 PHE A O      2  
ATOM   3433  C CB     . PHE A 1 83  ? 30.711 -1.467  -0.397  1.00 0.00 ? 296 PHE A CB     2  
ATOM   3434  C CG     . PHE A 1 83  ? 29.366 -2.188  -0.296  1.00 0.00 ? 296 PHE A CG     2  
ATOM   3435  C CD1    . PHE A 1 83  ? 28.604 -2.052  0.823   1.00 0.00 ? 296 PHE A CD1    2  
ATOM   3436  C CD2    . PHE A 1 83  ? 28.931 -2.964  -1.325  1.00 0.00 ? 296 PHE A CD2    2  
ATOM   3437  C CE1    . PHE A 1 83  ? 27.355 -2.720  0.917   1.00 0.00 ? 296 PHE A CE1    2  
ATOM   3438  C CE2    . PHE A 1 83  ? 27.683 -3.633  -1.230  1.00 0.00 ? 296 PHE A CE2    2  
ATOM   3439  C CZ     . PHE A 1 83  ? 26.921 -3.497  -0.112  1.00 0.00 ? 296 PHE A CZ     2  
ATOM   3440  H H      . PHE A 1 83  ? 28.665 0.569   -0.315  1.00 0.00 ? 296 PHE A H      2  
ATOM   3441  H HA     . PHE A 1 83  ? 31.530 0.556   -0.688  1.00 0.00 ? 296 PHE A HA     2  
ATOM   3442  H HB2    . PHE A 1 83  ? 31.343 -1.996  -1.111  1.00 0.00 ? 296 PHE A HB2    2  
ATOM   3443  H HB3    . PHE A 1 83  ? 31.213 -1.517  0.570   1.00 0.00 ? 296 PHE A HB3    2  
ATOM   3444  H HD1    . PHE A 1 83  ? 28.952 -1.429  1.647   1.00 0.00 ? 296 PHE A HD1    2  
ATOM   3445  H HD2    . PHE A 1 83  ? 29.542 -3.073  -2.220  1.00 0.00 ? 296 PHE A HD2    2  
ATOM   3446  H HE1    . PHE A 1 83  ? 26.745 -2.612  1.813   1.00 0.00 ? 296 PHE A HE1    2  
ATOM   3447  H HE2    . PHE A 1 83  ? 27.335 -4.255  -2.054  1.00 0.00 ? 296 PHE A HE2    2  
ATOM   3448  H HZ     . PHE A 1 83  ? 25.962 -4.010  -0.039  1.00 0.00 ? 296 PHE A HZ     2  
ATOM   3449  N N      . GLY A 1 84  ? 31.171 -0.077  -3.164  1.00 0.00 ? 297 GLY A N      2  
ATOM   3450  C CA     . GLY A 1 84  ? 30.919 -0.039  -4.594  1.00 0.00 ? 297 GLY A CA     2  
ATOM   3451  C C      . GLY A 1 84  ? 30.783 1.403   -5.089  1.00 0.00 ? 297 GLY A C      2  
ATOM   3452  O O      . GLY A 1 84  ? 30.010 1.678   -6.006  1.00 0.00 ? 297 GLY A O      2  
ATOM   3453  H H      . GLY A 1 84  ? 32.128 -0.211  -2.907  1.00 0.00 ? 297 GLY A H      2  
ATOM   3454  H HA2    . GLY A 1 84  ? 31.732 -0.533  -5.124  1.00 0.00 ? 297 GLY A HA2    2  
ATOM   3455  H HA3    . GLY A 1 84  ? 30.008 -0.592  -4.822  1.00 0.00 ? 297 GLY A HA3    2  
ATOM   3456  N N      . GLU A 1 85  ? 31.545 2.286   -4.460  1.00 0.00 ? 298 GLU A N      2  
ATOM   3457  C CA     . GLU A 1 85  ? 31.518 3.692   -4.825  1.00 0.00 ? 298 GLU A CA     2  
ATOM   3458  C C      . GLU A 1 85  ? 32.820 4.082   -5.526  1.00 0.00 ? 298 GLU A C      2  
ATOM   3459  O O      . GLU A 1 85  ? 32.869 5.081   -6.243  1.00 0.00 ? 298 GLU A O      2  
ATOM   3460  C CB     . GLU A 1 85  ? 31.271 4.572   -3.597  1.00 0.00 ? 298 GLU A CB     2  
ATOM   3461  C CG     . GLU A 1 85  ? 32.450 4.503   -2.627  1.00 0.00 ? 298 GLU A CG     2  
ATOM   3462  C CD     . GLU A 1 85  ? 32.322 3.299   -1.691  1.00 0.00 ? 298 GLU A CD     2  
ATOM   3463  O OE1    . GLU A 1 85  ? 31.276 3.123   -1.048  1.00 0.00 ? 298 GLU A OE1    2  
ATOM   3464  O OE2    . GLU A 1 85  ? 33.357 2.530   -1.645  1.00 0.00 ? 298 GLU A OE2    2  
ATOM   3465  H H      . GLU A 1 85  ? 32.170 2.053   -3.715  1.00 0.00 ? 298 GLU A H      2  
ATOM   3466  H HA     . GLU A 1 85  ? 30.680 3.797   -5.514  1.00 0.00 ? 298 GLU A HA     2  
ATOM   3467  H HB2    . GLU A 1 85  ? 31.113 5.603   -3.912  1.00 0.00 ? 298 GLU A HB2    2  
ATOM   3468  H HB3    . GLU A 1 85  ? 30.360 4.250   -3.093  1.00 0.00 ? 298 GLU A HB3    2  
ATOM   3469  H HG2    . GLU A 1 85  ? 33.383 4.435   -3.186  1.00 0.00 ? 298 GLU A HG2    2  
ATOM   3470  H HG3    . GLU A 1 85  ? 32.498 5.421   -2.040  1.00 0.00 ? 298 GLU A HG3    2  
ATOM   3471  H HE2    . GLU A 1 85  ? 33.094 1.591   -1.866  1.00 0.00 ? 298 GLU A HE2    2  
ATOM   3472  N N      . MET A 1 86  ? 33.845 3.274   -5.295  1.00 0.00 ? 299 MET A N      2  
ATOM   3473  C CA     . MET A 1 86  ? 35.144 3.523   -5.896  1.00 0.00 ? 299 MET A CA     2  
ATOM   3474  C C      . MET A 1 86  ? 35.037 3.609   -7.419  1.00 0.00 ? 299 MET A C      2  
ATOM   3475  O O      . MET A 1 86  ? 35.692 4.442   -8.045  1.00 0.00 ? 299 MET A O      2  
ATOM   3476  C CB     . MET A 1 86  ? 36.108 2.397   -5.515  1.00 0.00 ? 299 MET A CB     2  
ATOM   3477  C CG     . MET A 1 86  ? 37.514 2.942   -5.258  1.00 0.00 ? 299 MET A CG     2  
ATOM   3478  S SD     . MET A 1 86  ? 38.065 3.895   -6.663  1.00 0.00 ? 299 MET A SD     2  
ATOM   3479  C CE     . MET A 1 86  ? 39.639 3.114   -6.972  1.00 0.00 ? 299 MET A CE     2  
ATOM   3480  H H      . MET A 1 86  ? 33.798 2.464   -4.711  1.00 0.00 ? 299 MET A H      2  
ATOM   3481  H HA     . MET A 1 86  ? 35.475 4.481   -5.493  1.00 0.00 ? 299 MET A HA     2  
ATOM   3482  H HB2    . MET A 1 86  ? 35.743 1.888   -4.623  1.00 0.00 ? 299 MET A HB2    2  
ATOM   3483  H HB3    . MET A 1 86  ? 36.140 1.656   -6.313  1.00 0.00 ? 299 MET A HB3    2  
ATOM   3484  H HG2    . MET A 1 86  ? 37.515 3.563   -4.364  1.00 0.00 ? 299 MET A HG2    2  
ATOM   3485  H HG3    . MET A 1 86  ? 38.204 2.118   -5.076  1.00 0.00 ? 299 MET A HG3    2  
ATOM   3486  H HE1    . MET A 1 86  ? 39.769 2.968   -8.044  1.00 0.00 ? 299 MET A HE1    2  
ATOM   3487  H HE2    . MET A 1 86  ? 40.441 3.749   -6.593  1.00 0.00 ? 299 MET A HE2    2  
ATOM   3488  H HE3    . MET A 1 86  ? 39.671 2.149   -6.467  1.00 0.00 ? 299 MET A HE3    2  
ATOM   3489  N N      . ALA A 1 87  ? 34.205 2.740   -7.972  1.00 0.00 ? 300 ALA A N      2  
ATOM   3490  C CA     . ALA A 1 87  ? 34.002 2.707   -9.411  1.00 0.00 ? 300 ALA A CA     2  
ATOM   3491  C C      . ALA A 1 87  ? 33.176 3.923   -9.833  1.00 0.00 ? 300 ALA A C      2  
ATOM   3492  O O      . ALA A 1 87  ? 33.459 4.546   -10.855 1.00 0.00 ? 300 ALA A O      2  
ATOM   3493  C CB     . ALA A 1 87  ? 33.339 1.386   -9.803  1.00 0.00 ? 300 ALA A CB     2  
ATOM   3494  H H      . ALA A 1 87  ? 33.676 2.066   -7.456  1.00 0.00 ? 300 ALA A H      2  
ATOM   3495  H HA     . ALA A 1 87  ? 34.982 2.761   -9.885  1.00 0.00 ? 300 ALA A HA     2  
ATOM   3496  H HB1    . ALA A 1 87  ? 33.034 1.429   -10.848 1.00 0.00 ? 300 ALA A HB1    2  
ATOM   3497  H HB2    . ALA A 1 87  ? 34.046 0.568   -9.665  1.00 0.00 ? 300 ALA A HB2    2  
ATOM   3498  H HB3    . ALA A 1 87  ? 32.463 1.218   -9.176  1.00 0.00 ? 300 ALA A HB3    2  
ATOM   3499  N N      . LEU A 1 88  ? 32.171 4.224   -9.024  1.00 0.00 ? 301 LEU A N      2  
ATOM   3500  C CA     . LEU A 1 88  ? 31.302 5.356   -9.301  1.00 0.00 ? 301 LEU A CA     2  
ATOM   3501  C C      . LEU A 1 88  ? 32.042 6.655   -8.979  1.00 0.00 ? 301 LEU A C      2  
ATOM   3502  O O      . LEU A 1 88  ? 31.570 7.741   -9.309  1.00 0.00 ? 301 LEU A O      2  
ATOM   3503  C CB     . LEU A 1 88  ? 29.973 5.205   -8.557  1.00 0.00 ? 301 LEU A CB     2  
ATOM   3504  C CG     . LEU A 1 88  ? 28.997 4.175   -9.128  1.00 0.00 ? 301 LEU A CG     2  
ATOM   3505  C CD1    . LEU A 1 88  ? 27.818 3.952   -8.179  1.00 0.00 ? 301 LEU A CD1    2  
ATOM   3506  C CD2    . LEU A 1 88  ? 28.535 4.577   -10.530 1.00 0.00 ? 301 LEU A CD2    2  
ATOM   3507  H H      . LEU A 1 88  ? 31.948 3.714   -8.195  1.00 0.00 ? 301 LEU A H      2  
ATOM   3508  H HA     . LEU A 1 88  ? 31.076 5.341   -10.367 1.00 0.00 ? 301 LEU A HA     2  
ATOM   3509  H HB2    . LEU A 1 88  ? 30.188 4.937   -7.522  1.00 0.00 ? 301 LEU A HB2    2  
ATOM   3510  H HB3    . LEU A 1 88  ? 29.477 6.175   -8.538  1.00 0.00 ? 301 LEU A HB3    2  
ATOM   3511  H HG     . LEU A 1 88  ? 29.520 3.224   -9.222  1.00 0.00 ? 301 LEU A HG     2  
ATOM   3512  H HD11   . LEU A 1 88  ? 26.951 3.614   -8.749  1.00 0.00 ? 301 LEU A HD11   2  
ATOM   3513  H HD12   . LEU A 1 88  ? 28.084 3.195   -7.441  1.00 0.00 ? 301 LEU A HD12   2  
ATOM   3514  H HD13   . LEU A 1 88  ? 27.577 4.886   -7.672  1.00 0.00 ? 301 LEU A HD13   2  
ATOM   3515  H HD21   . LEU A 1 88  ? 28.320 5.646   -10.550 1.00 0.00 ? 301 LEU A HD21   2  
ATOM   3516  H HD22   . LEU A 1 88  ? 29.322 4.350   -11.250 1.00 0.00 ? 301 LEU A HD22   2  
ATOM   3517  H HD23   . LEU A 1 88  ? 27.634 4.021   -10.790 1.00 0.00 ? 301 LEU A HD23   2  
ATOM   3518  N N      . ILE A 1 89  ? 33.192 6.500   -8.339  1.00 0.00 ? 302 ILE A N      2  
ATOM   3519  C CA     . ILE A 1 89  ? 34.003 7.646   -7.969  1.00 0.00 ? 302 ILE A CA     2  
ATOM   3520  C C      . ILE A 1 89  ? 34.908 8.027   -9.143  1.00 0.00 ? 302 ILE A C      2  
ATOM   3521  O O      . ILE A 1 89  ? 35.102 9.208   -9.424  1.00 0.00 ? 302 ILE A O      2  
ATOM   3522  C CB     . ILE A 1 89  ? 34.764 7.369   -6.671  1.00 0.00 ? 302 ILE A CB     2  
ATOM   3523  C CG1    . ILE A 1 89  ? 33.997 7.901   -5.459  1.00 0.00 ? 302 ILE A CG1    2  
ATOM   3524  C CG2    . ILE A 1 89  ? 36.187 7.928   -6.740  1.00 0.00 ? 302 ILE A CG2    2  
ATOM   3525  C CD1    . ILE A 1 89  ? 33.857 6.823   -4.382  1.00 0.00 ? 302 ILE A CD1    2  
ATOM   3526  H H      . ILE A 1 89  ? 33.569 5.612   -8.074  1.00 0.00 ? 302 ILE A H      2  
ATOM   3527  H HA     . ILE A 1 89  ? 33.324 8.477   -7.772  1.00 0.00 ? 302 ILE A HA     2  
ATOM   3528  H HB     . ILE A 1 89  ? 34.849 6.288   -6.550  1.00 0.00 ? 302 ILE A HB     2  
ATOM   3529  H HG12   . ILE A 1 89  ? 34.515 8.767   -5.048  1.00 0.00 ? 302 ILE A HG12   2  
ATOM   3530  H HG13   . ILE A 1 89  ? 33.009 8.239   -5.771  1.00 0.00 ? 302 ILE A HG13   2  
ATOM   3531  H HG21   . ILE A 1 89  ? 36.617 7.952   -5.738  1.00 0.00 ? 302 ILE A HG21   2  
ATOM   3532  H HG22   . ILE A 1 89  ? 36.797 7.293   -7.381  1.00 0.00 ? 302 ILE A HG22   2  
ATOM   3533  H HG23   . ILE A 1 89  ? 36.161 8.939   -7.148  1.00 0.00 ? 302 ILE A HG23   2  
ATOM   3534  H HD11   . ILE A 1 89  ? 34.203 7.218   -3.426  1.00 0.00 ? 302 ILE A HD11   2  
ATOM   3535  H HD12   . ILE A 1 89  ? 32.812 6.528   -4.296  1.00 0.00 ? 302 ILE A HD12   2  
ATOM   3536  H HD13   . ILE A 1 89  ? 34.459 5.956   -4.656  1.00 0.00 ? 302 ILE A HD13   2  
ATOM   3537  N N      . SER A 1 90  ? 35.435 7.003   -9.798  1.00 0.00 ? 303 SER A N      2  
ATOM   3538  C CA     . SER A 1 90  ? 36.313 7.215   -10.935 1.00 0.00 ? 303 SER A CA     2  
ATOM   3539  C C      . SER A 1 90  ? 35.768 6.482   -12.162 1.00 0.00 ? 303 SER A C      2  
ATOM   3540  O O      . SER A 1 90  ? 35.540 7.094   -13.205 1.00 0.00 ? 303 SER A O      2  
ATOM   3541  C CB     . SER A 1 90  ? 37.737 6.745   -10.627 1.00 0.00 ? 303 SER A CB     2  
ATOM   3542  O OG     . SER A 1 90  ? 38.634 7.019   -11.700 1.00 0.00 ? 303 SER A OG     2  
ATOM   3543  H H      . SER A 1 90  ? 35.271 6.044   -9.563  1.00 0.00 ? 303 SER A H      2  
ATOM   3544  H HA     . SER A 1 90  ? 36.315 8.292   -11.102 1.00 0.00 ? 303 SER A HA     2  
ATOM   3545  H HB2    . SER A 1 90  ? 38.093 7.237   -9.722  1.00 0.00 ? 303 SER A HB2    2  
ATOM   3546  H HB3    . SER A 1 90  ? 37.729 5.674   -10.425 1.00 0.00 ? 303 SER A HB3    2  
ATOM   3547  H HG     . SER A 1 90  ? 39.469 7.442   -11.348 1.00 0.00 ? 303 SER A HG     2  
ATOM   3548  N N      . GLY A 1 91  ? 35.572 5.182   -11.998 1.00 0.00 ? 304 GLY A N      2  
ATOM   3549  C CA     . GLY A 1 91  ? 35.056 4.359   -13.079 1.00 0.00 ? 304 GLY A CA     2  
ATOM   3550  C C      . GLY A 1 91  ? 35.775 3.010   -13.131 1.00 0.00 ? 304 GLY A C      2  
ATOM   3551  O O      . GLY A 1 91  ? 35.374 2.118   -13.876 1.00 0.00 ? 304 GLY A O      2  
ATOM   3552  H H      . GLY A 1 91  ? 35.760 4.693   -11.146 1.00 0.00 ? 304 GLY A H      2  
ATOM   3553  H HA2    . GLY A 1 91  ? 33.988 4.201   -12.941 1.00 0.00 ? 304 GLY A HA2    2  
ATOM   3554  H HA3    . GLY A 1 91  ? 35.182 4.880   -14.028 1.00 0.00 ? 304 GLY A HA3    2  
ATOM   3555  N N      . GLU A 1 92  ? 36.827 2.903   -12.332 1.00 0.00 ? 305 GLU A N      2  
ATOM   3556  C CA     . GLU A 1 92  ? 37.605 1.677   -12.278 1.00 0.00 ? 305 GLU A CA     2  
ATOM   3557  C C      . GLU A 1 92  ? 36.700 0.489   -11.952 1.00 0.00 ? 305 GLU A C      2  
ATOM   3558  O O      . GLU A 1 92  ? 35.597 0.665   -11.436 1.00 0.00 ? 305 GLU A O      2  
ATOM   3559  C CB     . GLU A 1 92  ? 38.743 1.796   -11.263 1.00 0.00 ? 305 GLU A CB     2  
ATOM   3560  C CG     . GLU A 1 92  ? 39.971 2.462   -11.889 1.00 0.00 ? 305 GLU A CG     2  
ATOM   3561  C CD     . GLU A 1 92  ? 41.149 1.489   -11.954 1.00 0.00 ? 305 GLU A CD     2  
ATOM   3562  O OE1    . GLU A 1 92  ? 41.487 0.995   -13.040 1.00 0.00 ? 305 GLU A OE1    2  
ATOM   3563  O OE2    . GLU A 1 92  ? 41.723 1.251   -10.823 1.00 0.00 ? 305 GLU A OE2    2  
ATOM   3564  H H      . GLU A 1 92  ? 37.147 3.634   -11.729 1.00 0.00 ? 305 GLU A H      2  
ATOM   3565  H HA     . GLU A 1 92  ? 38.027 1.559   -13.275 1.00 0.00 ? 305 GLU A HA     2  
ATOM   3566  H HB2    . GLU A 1 92  ? 38.410 2.376   -10.402 1.00 0.00 ? 305 GLU A HB2    2  
ATOM   3567  H HB3    . GLU A 1 92  ? 39.012 0.805   -10.895 1.00 0.00 ? 305 GLU A HB3    2  
ATOM   3568  H HG2    . GLU A 1 92  ? 39.726 2.810   -12.893 1.00 0.00 ? 305 GLU A HG2    2  
ATOM   3569  H HG3    . GLU A 1 92  ? 40.250 3.339   -11.307 1.00 0.00 ? 305 GLU A HG3    2  
ATOM   3570  H HE2    . GLU A 1 92  ? 41.036 1.020   -10.133 1.00 0.00 ? 305 GLU A HE2    2  
ATOM   3571  N N      . PRO A 1 93  ? 37.213 -0.730  -12.274 1.00 0.00 ? 306 PRO A N      2  
ATOM   3572  C CA     . PRO A 1 93  ? 36.463 -1.948  -12.020 1.00 0.00 ? 306 PRO A CA     2  
ATOM   3573  C C      . PRO A 1 93  ? 36.474 -2.299  -10.530 1.00 0.00 ? 306 PRO A C      2  
ATOM   3574  O O      . PRO A 1 93  ? 37.271 -1.755  -9.767  1.00 0.00 ? 306 PRO A O      2  
ATOM   3575  C CB     . PRO A 1 93  ? 37.129 -3.007  -12.884 1.00 0.00 ? 306 PRO A CB     2  
ATOM   3576  C CG     . PRO A 1 93  ? 38.503 -2.458  -13.231 1.00 0.00 ? 306 PRO A CG     2  
ATOM   3577  C CD     . PRO A 1 93  ? 38.515 -0.978  -12.885 1.00 0.00 ? 306 PRO A CD     2  
ATOM   3578  H HA     . PRO A 1 93  ? 35.502 -1.821  -12.264 1.00 0.00 ? 306 PRO A HA     2  
ATOM   3579  H HB2    . PRO A 1 93  ? 37.210 -3.953  -12.350 1.00 0.00 ? 306 PRO A HB2    2  
ATOM   3580  H HB3    . PRO A 1 93  ? 36.546 -3.198  -13.786 1.00 0.00 ? 306 PRO A HB3    2  
ATOM   3581  H HG2    . PRO A 1 93  ? 39.276 -2.986  -12.673 1.00 0.00 ? 306 PRO A HG2    2  
ATOM   3582  H HG3    . PRO A 1 93  ? 38.717 -2.605  -14.290 1.00 0.00 ? 306 PRO A HG3    2  
ATOM   3583  H HD2    . PRO A 1 93  ? 39.327 -0.737  -12.199 1.00 0.00 ? 306 PRO A HD2    2  
ATOM   3584  H HD3    . PRO A 1 93  ? 38.658 -0.365  -13.776 1.00 0.00 ? 306 PRO A HD3    2  
ATOM   3585  N N      . ARG A 1 94  ? 35.581 -3.205  -10.162 1.00 0.00 ? 307 ARG A N      2  
ATOM   3586  C CA     . ARG A 1 94  ? 35.478 -3.635  -8.778  1.00 0.00 ? 307 ARG A CA     2  
ATOM   3587  C C      . ARG A 1 94  ? 36.868 -3.927  -8.208  1.00 0.00 ? 307 ARG A C      2  
ATOM   3588  O O      . ARG A 1 94  ? 37.572 -4.807  -8.700  1.00 0.00 ? 307 ARG A O      2  
ATOM   3589  C CB     . ARG A 1 94  ? 34.610 -4.888  -8.654  1.00 0.00 ? 307 ARG A CB     2  
ATOM   3590  C CG     . ARG A 1 94  ? 33.190 -4.531  -8.213  1.00 0.00 ? 307 ARG A CG     2  
ATOM   3591  C CD     . ARG A 1 94  ? 32.551 -3.531  -9.179  1.00 0.00 ? 307 ARG A CD     2  
ATOM   3592  N NE     . ARG A 1 94  ? 32.213 -2.280  -8.462  1.00 0.00 ? 307 ARG A NE     2  
ATOM   3593  C CZ     . ARG A 1 94  ? 31.048 -2.063  -7.839  1.00 0.00 ? 307 ARG A CZ     2  
ATOM   3594  N NH1    . ARG A 1 94  ? 30.100 -3.011  -7.839  1.00 0.00 ? 307 ARG A NH1    2  
ATOM   3595  N NH2    . ARG A 1 94  ? 30.828 -0.898  -7.215  1.00 0.00 ? 307 ARG A NH2    2  
ATOM   3596  H H      . ARG A 1 94  ? 34.937 -3.643  -10.790 1.00 0.00 ? 307 ARG A H      2  
ATOM   3597  H HA     . ARG A 1 94  ? 35.010 -2.798  -8.260  1.00 0.00 ? 307 ARG A HA     2  
ATOM   3598  H HB2    . ARG A 1 94  ? 34.577 -5.409  -9.611  1.00 0.00 ? 307 ARG A HB2    2  
ATOM   3599  H HB3    . ARG A 1 94  ? 35.057 -5.575  -7.934  1.00 0.00 ? 307 ARG A HB3    2  
ATOM   3600  H HG2    . ARG A 1 94  ? 32.581 -5.434  -8.164  1.00 0.00 ? 307 ARG A HG2    2  
ATOM   3601  H HG3    . ARG A 1 94  ? 33.212 -4.107  -7.208  1.00 0.00 ? 307 ARG A HG3    2  
ATOM   3602  H HD2    . ARG A 1 94  ? 33.237 -3.316  -9.998  1.00 0.00 ? 307 ARG A HD2    2  
ATOM   3603  H HD3    . ARG A 1 94  ? 31.652 -3.961  -9.619  1.00 0.00 ? 307 ARG A HD3    2  
ATOM   3604  H HE     . ARG A 1 94  ? 32.898 -1.551  -8.443  1.00 0.00 ? 307 ARG A HE     2  
ATOM   3605  H HH11   . ARG A 1 94  ? 30.264 -3.881  -8.305  1.00 0.00 ? 307 ARG A HH11   2  
ATOM   3606  H HH12   . ARG A 1 94  ? 29.230 -2.850  -7.373  1.00 0.00 ? 307 ARG A HH12   2  
ATOM   3607  H HH21   . ARG A 1 94  ? 31.535 -0.190  -7.214  1.00 0.00 ? 307 ARG A HH21   2  
ATOM   3608  H HH22   . ARG A 1 94  ? 29.958 -0.736  -6.749  1.00 0.00 ? 307 ARG A HH22   2  
ATOM   3609  N N      . SER A 1 95  ? 37.220 -3.171  -7.179  1.00 0.00 ? 308 SER A N      2  
ATOM   3610  C CA     . SER A 1 95  ? 38.513 -3.338  -6.536  1.00 0.00 ? 308 SER A CA     2  
ATOM   3611  C C      . SER A 1 95  ? 38.589 -4.709  -5.859  1.00 0.00 ? 308 SER A C      2  
ATOM   3612  O O      . SER A 1 95  ? 39.678 -5.219  -5.605  1.00 0.00 ? 308 SER A O      2  
ATOM   3613  C CB     . SER A 1 95  ? 38.768 -2.227  -5.515  1.00 0.00 ? 308 SER A CB     2  
ATOM   3614  O OG     . SER A 1 95  ? 37.583 -1.867  -4.811  1.00 0.00 ? 308 SER A OG     2  
ATOM   3615  H H      . SER A 1 95  ? 36.641 -2.458  -6.784  1.00 0.00 ? 308 SER A H      2  
ATOM   3616  H HA     . SER A 1 95  ? 39.246 -3.267  -7.340  1.00 0.00 ? 308 SER A HA     2  
ATOM   3617  H HB2    . SER A 1 95  ? 39.527 -2.556  -4.804  1.00 0.00 ? 308 SER A HB2    2  
ATOM   3618  H HB3    . SER A 1 95  ? 39.168 -1.351  -6.025  1.00 0.00 ? 308 SER A HB3    2  
ATOM   3619  H HG     . SER A 1 95  ? 37.073 -1.180  -5.328  1.00 0.00 ? 308 SER A HG     2  
ATOM   3620  N N      . ALA A 1 96  ? 37.417 -5.264  -5.588  1.00 0.00 ? 309 ALA A N      2  
ATOM   3621  C CA     . ALA A 1 96  ? 37.337 -6.565  -4.947  1.00 0.00 ? 309 ALA A CA     2  
ATOM   3622  C C      . ALA A 1 96  ? 35.912 -7.107  -5.078  1.00 0.00 ? 309 ALA A C      2  
ATOM   3623  O O      . ALA A 1 96  ? 34.976 -6.348  -5.326  1.00 0.00 ? 309 ALA A O      2  
ATOM   3624  C CB     . ALA A 1 96  ? 37.782 -6.444  -3.488  1.00 0.00 ? 309 ALA A CB     2  
ATOM   3625  H H      . ALA A 1 96  ? 36.536 -4.841  -5.799  1.00 0.00 ? 309 ALA A H      2  
ATOM   3626  H HA     . ALA A 1 96  ? 38.021 -7.235  -5.467  1.00 0.00 ? 309 ALA A HA     2  
ATOM   3627  H HB1    . ALA A 1 96  ? 37.347 -7.257  -2.906  1.00 0.00 ? 309 ALA A HB1    2  
ATOM   3628  H HB2    . ALA A 1 96  ? 38.868 -6.499  -3.433  1.00 0.00 ? 309 ALA A HB2    2  
ATOM   3629  H HB3    . ALA A 1 96  ? 37.447 -5.489  -3.084  1.00 0.00 ? 309 ALA A HB3    2  
ATOM   3630  N N      . THR A 1 97  ? 35.793 -8.416  -4.906  1.00 0.00 ? 310 THR A N      2  
ATOM   3631  C CA     . THR A 1 97  ? 34.498 -9.067  -5.003  1.00 0.00 ? 310 THR A CA     2  
ATOM   3632  C C      . THR A 1 97  ? 33.734 -8.936  -3.683  1.00 0.00 ? 310 THR A C      2  
ATOM   3633  O O      . THR A 1 97  ? 34.304 -9.129  -2.611  1.00 0.00 ? 310 THR A O      2  
ATOM   3634  C CB     . THR A 1 97  ? 34.729 -10.519 -5.428  1.00 0.00 ? 310 THR A CB     2  
ATOM   3635  O OG1    . THR A 1 97  ? 35.557 -10.414 -6.584  1.00 0.00 ? 310 THR A OG1    2  
ATOM   3636  C CG2    . THR A 1 97  ? 33.454 -11.189 -5.943  1.00 0.00 ? 310 THR A CG2    2  
ATOM   3637  H H      . THR A 1 97  ? 36.559 -9.025  -4.705  1.00 0.00 ? 310 THR A H      2  
ATOM   3638  H HA     . THR A 1 97  ? 33.910 -8.554  -5.765  1.00 0.00 ? 310 THR A HA     2  
ATOM   3639  H HB     . THR A 1 97  ? 35.172 -11.096 -4.617  1.00 0.00 ? 310 THR A HB     2  
ATOM   3640  H HG1    . THR A 1 97  ? 36.469 -10.097 -6.323  1.00 0.00 ? 310 THR A HG1    2  
ATOM   3641  H HG21   . THR A 1 97  ? 32.607 -10.519 -5.795  1.00 0.00 ? 310 THR A HG21   2  
ATOM   3642  H HG22   . THR A 1 97  ? 33.563 -11.410 -7.006  1.00 0.00 ? 310 THR A HG22   2  
ATOM   3643  H HG23   . THR A 1 97  ? 33.284 -12.115 -5.395  1.00 0.00 ? 310 THR A HG23   2  
ATOM   3644  N N      . VAL A 1 98  ? 32.457 -8.607  -3.807  1.00 0.00 ? 311 VAL A N      2  
ATOM   3645  C CA     . VAL A 1 98  ? 31.609 -8.447  -2.637  1.00 0.00 ? 311 VAL A CA     2  
ATOM   3646  C C      . VAL A 1 98  ? 30.504 -9.505  -2.664  1.00 0.00 ? 311 VAL A C      2  
ATOM   3647  O O      . VAL A 1 98  ? 29.856 -9.703  -3.692  1.00 0.00 ? 311 VAL A O      2  
ATOM   3648  C CB     . VAL A 1 98  ? 31.068 -7.017  -2.574  1.00 0.00 ? 311 VAL A CB     2  
ATOM   3649  C CG1    . VAL A 1 98  ? 29.747 -6.964  -1.804  1.00 0.00 ? 311 VAL A CG1    2  
ATOM   3650  C CG2    . VAL A 1 98  ? 32.098 -6.068  -1.961  1.00 0.00 ? 311 VAL A CG2    2  
ATOM   3651  H H      . VAL A 1 98  ? 32.001 -8.452  -4.683  1.00 0.00 ? 311 VAL A H      2  
ATOM   3652  H HA     . VAL A 1 98  ? 32.230 -8.612  -1.756  1.00 0.00 ? 311 VAL A HA     2  
ATOM   3653  H HB     . VAL A 1 98  ? 30.874 -6.688  -3.595  1.00 0.00 ? 311 VAL A HB     2  
ATOM   3654  H HG11   . VAL A 1 98  ? 29.924 -7.224  -0.760  1.00 0.00 ? 311 VAL A HG11   2  
ATOM   3655  H HG12   . VAL A 1 98  ? 29.332 -5.958  -1.863  1.00 0.00 ? 311 VAL A HG12   2  
ATOM   3656  H HG13   . VAL A 1 98  ? 29.044 -7.674  -2.240  1.00 0.00 ? 311 VAL A HG13   2  
ATOM   3657  H HG21   . VAL A 1 98  ? 31.757 -5.746  -0.977  1.00 0.00 ? 311 VAL A HG21   2  
ATOM   3658  H HG22   . VAL A 1 98  ? 33.055 -6.583  -1.864  1.00 0.00 ? 311 VAL A HG22   2  
ATOM   3659  H HG23   . VAL A 1 98  ? 32.219 -5.198  -2.606  1.00 0.00 ? 311 VAL A HG23   2  
ATOM   3660  N N      . SER A 1 99  ? 30.322 -10.155 -1.525  1.00 0.00 ? 312 SER A N      2  
ATOM   3661  C CA     . SER A 1 99  ? 29.305 -11.186 -1.406  1.00 0.00 ? 312 SER A CA     2  
ATOM   3662  C C      . SER A 1 99  ? 28.617 -11.088 -0.043  1.00 0.00 ? 312 SER A C      2  
ATOM   3663  O O      . SER A 1 99  ? 29.283 -11.042 0.990   1.00 0.00 ? 312 SER A O      2  
ATOM   3664  C CB     . SER A 1 99  ? 29.909 -12.580 -1.597  1.00 0.00 ? 312 SER A CB     2  
ATOM   3665  O OG     . SER A 1 99  ? 30.658 -12.997 -0.459  1.00 0.00 ? 312 SER A OG     2  
ATOM   3666  H H      . SER A 1 99  ? 30.853 -9.987  -0.695  1.00 0.00 ? 312 SER A H      2  
ATOM   3667  H HA     . SER A 1 99  ? 28.595 -10.986 -2.209  1.00 0.00 ? 312 SER A HA     2  
ATOM   3668  H HB2    . SER A 1 99  ? 29.112 -13.297 -1.790  1.00 0.00 ? 312 SER A HB2    2  
ATOM   3669  H HB3    . SER A 1 99  ? 30.555 -12.577 -2.475  1.00 0.00 ? 312 SER A HB3    2  
ATOM   3670  H HG     . SER A 1 99  ? 31.566 -13.306 -0.741  1.00 0.00 ? 312 SER A HG     2  
ATOM   3671  N N      . ALA A 1 100 ? 27.293 -11.061 -0.085  1.00 0.00 ? 313 ALA A N      2  
ATOM   3672  C CA     . ALA A 1 100 ? 26.507 -10.969 1.134   1.00 0.00 ? 313 ALA A CA     2  
ATOM   3673  C C      . ALA A 1 100 ? 26.628 -12.280 1.913   1.00 0.00 ? 313 ALA A C      2  
ATOM   3674  O O      . ALA A 1 100 ? 26.215 -13.334 1.431   1.00 0.00 ? 313 ALA A O      2  
ATOM   3675  C CB     . ALA A 1 100 ? 25.057 -10.631 0.782   1.00 0.00 ? 313 ALA A CB     2  
ATOM   3676  H H      . ALA A 1 100 ? 26.760 -11.099 -0.930  1.00 0.00 ? 313 ALA A H      2  
ATOM   3677  H HA     . ALA A 1 100 ? 26.921 -10.160 1.735   1.00 0.00 ? 313 ALA A HA     2  
ATOM   3678  H HB1    . ALA A 1 100 ? 24.488 -11.553 0.664   1.00 0.00 ? 313 ALA A HB1    2  
ATOM   3679  H HB2    . ALA A 1 100 ? 24.620 -10.034 1.583   1.00 0.00 ? 313 ALA A HB2    2  
ATOM   3680  H HB3    . ALA A 1 100 ? 25.031 -10.065 -0.149  1.00 0.00 ? 313 ALA A HB3    2  
ATOM   3681  N N      . ALA A 1 101 ? 27.196 -12.173 3.105   1.00 0.00 ? 314 ALA A N      2  
ATOM   3682  C CA     . ALA A 1 101 ? 27.376 -13.337 3.956   1.00 0.00 ? 314 ALA A CA     2  
ATOM   3683  C C      . ALA A 1 101 ? 26.006 -13.893 4.349   1.00 0.00 ? 314 ALA A C      2  
ATOM   3684  O O      . ALA A 1 101 ? 25.836 -15.105 4.471   1.00 0.00 ? 314 ALA A O      2  
ATOM   3685  C CB     . ALA A 1 101 ? 28.221 -12.955 5.173   1.00 0.00 ? 314 ALA A CB     2  
ATOM   3686  H H      . ALA A 1 101 ? 27.529 -11.312 3.491   1.00 0.00 ? 314 ALA A H      2  
ATOM   3687  H HA     . ALA A 1 101 ? 27.913 -14.090 3.378   1.00 0.00 ? 314 ALA A HA     2  
ATOM   3688  H HB1    . ALA A 1 101 ? 27.598 -12.972 6.067   1.00 0.00 ? 314 ALA A HB1    2  
ATOM   3689  H HB2    . ALA A 1 101 ? 29.039 -13.666 5.285   1.00 0.00 ? 314 ALA A HB2    2  
ATOM   3690  H HB3    . ALA A 1 101 ? 28.628 -11.953 5.032   1.00 0.00 ? 314 ALA A HB3    2  
ATOM   3691  N N      . THR A 1 102 ? 25.064 -12.980 4.534   1.00 0.00 ? 315 THR A N      2  
ATOM   3692  C CA     . THR A 1 102 ? 23.714 -13.365 4.911   1.00 0.00 ? 315 THR A CA     2  
ATOM   3693  C C      . THR A 1 102 ? 22.693 -12.416 4.280   1.00 0.00 ? 315 THR A C      2  
ATOM   3694  O O      . THR A 1 102 ? 23.067 -11.463 3.595   1.00 0.00 ? 315 THR A O      2  
ATOM   3695  C CB     . THR A 1 102 ? 23.642 -13.405 6.439   1.00 0.00 ? 315 THR A CB     2  
ATOM   3696  O OG1    . THR A 1 102 ? 22.356 -13.955 6.712   1.00 0.00 ? 315 THR A OG1    2  
ATOM   3697  C CG2    . THR A 1 102 ? 23.589 -12.008 7.059   1.00 0.00 ? 315 THR A CG2    2  
ATOM   3698  H H      . THR A 1 102 ? 25.210 -11.997 4.433   1.00 0.00 ? 315 THR A H      2  
ATOM   3699  H HA     . THR A 1 102 ? 23.515 -14.359 4.511   1.00 0.00 ? 315 THR A HA     2  
ATOM   3700  H HB     . THR A 1 102 ? 24.469 -13.983 6.851   1.00 0.00 ? 315 THR A HB     2  
ATOM   3701  H HG1    . THR A 1 102 ? 21.704 -13.222 6.902   1.00 0.00 ? 315 THR A HG1    2  
ATOM   3702  H HG21   . THR A 1 102 ? 23.134 -11.313 6.353   1.00 0.00 ? 315 THR A HG21   2  
ATOM   3703  H HG22   . THR A 1 102 ? 22.995 -12.038 7.972   1.00 0.00 ? 315 THR A HG22   2  
ATOM   3704  H HG23   . THR A 1 102 ? 24.600 -11.676 7.295   1.00 0.00 ? 315 THR A HG23   2  
ATOM   3705  N N      . THR A 1 103 ? 21.426 -12.707 4.533   1.00 0.00 ? 316 THR A N      2  
ATOM   3706  C CA     . THR A 1 103 ? 20.349 -11.891 3.997   1.00 0.00 ? 316 THR A CA     2  
ATOM   3707  C C      . THR A 1 103 ? 20.395 -10.486 4.599   1.00 0.00 ? 316 THR A C      2  
ATOM   3708  O O      . THR A 1 103 ? 20.023 -10.290 5.756   1.00 0.00 ? 316 THR A O      2  
ATOM   3709  C CB     . THR A 1 103 ? 19.030 -12.621 4.255   1.00 0.00 ? 316 THR A CB     2  
ATOM   3710  O OG1    . THR A 1 103 ? 19.293 -13.964 3.859   1.00 0.00 ? 316 THR A OG1    2  
ATOM   3711  C CG2    . THR A 1 103 ? 17.914 -12.166 3.313   1.00 0.00 ? 316 THR A CG2    2  
ATOM   3712  H H      . THR A 1 103 ? 21.131 -13.483 5.090   1.00 0.00 ? 316 THR A H      2  
ATOM   3713  H HA     . THR A 1 103 ? 20.501 -11.784 2.923   1.00 0.00 ? 316 THR A HA     2  
ATOM   3714  H HB     . THR A 1 103 ? 18.726 -12.518 5.297   1.00 0.00 ? 316 THR A HB     2  
ATOM   3715  H HG1    . THR A 1 103 ? 19.387 -14.547 4.667   1.00 0.00 ? 316 THR A HG1    2  
ATOM   3716  H HG21   . THR A 1 103 ? 16.955 -12.527 3.685   1.00 0.00 ? 316 THR A HG21   2  
ATOM   3717  H HG22   . THR A 1 103 ? 17.898 -11.077 3.268   1.00 0.00 ? 316 THR A HG22   2  
ATOM   3718  H HG23   . THR A 1 103 ? 18.093 -12.567 2.316   1.00 0.00 ? 316 THR A HG23   2  
ATOM   3719  N N      . VAL A 1 104 ? 20.855 -9.544  3.790   1.00 0.00 ? 317 VAL A N      2  
ATOM   3720  C CA     . VAL A 1 104 ? 20.954 -8.163  4.228   1.00 0.00 ? 317 VAL A CA     2  
ATOM   3721  C C      . VAL A 1 104 ? 20.199 -7.265  3.246   1.00 0.00 ? 317 VAL A C      2  
ATOM   3722  O O      . VAL A 1 104 ? 20.152 -7.548  2.051   1.00 0.00 ? 317 VAL A O      2  
ATOM   3723  C CB     . VAL A 1 104 ? 22.424 -7.769  4.389   1.00 0.00 ? 317 VAL A CB     2  
ATOM   3724  C CG1    . VAL A 1 104 ? 23.139 -8.706  5.364   1.00 0.00 ? 317 VAL A CG1    2  
ATOM   3725  C CG2    . VAL A 1 104 ? 23.135 -7.740  3.036   1.00 0.00 ? 317 VAL A CG2    2  
ATOM   3726  H H      . VAL A 1 104 ? 21.156 -9.712  2.851   1.00 0.00 ? 317 VAL A H      2  
ATOM   3727  H HA     . VAL A 1 104 ? 20.477 -8.092  5.206   1.00 0.00 ? 317 VAL A HA     2  
ATOM   3728  H HB     . VAL A 1 104 ? 22.457 -6.762  4.806   1.00 0.00 ? 317 VAL A HB     2  
ATOM   3729  H HG11   . VAL A 1 104 ? 22.400 -9.250  5.953   1.00 0.00 ? 317 VAL A HG11   2  
ATOM   3730  H HG12   . VAL A 1 104 ? 23.751 -9.413  4.806   1.00 0.00 ? 317 VAL A HG12   2  
ATOM   3731  H HG13   . VAL A 1 104 ? 23.774 -8.122  6.030   1.00 0.00 ? 317 VAL A HG13   2  
ATOM   3732  H HG21   . VAL A 1 104 ? 23.678 -6.801  2.930   1.00 0.00 ? 317 VAL A HG21   2  
ATOM   3733  H HG22   . VAL A 1 104 ? 23.836 -8.573  2.975   1.00 0.00 ? 317 VAL A HG22   2  
ATOM   3734  H HG23   . VAL A 1 104 ? 22.399 -7.826  2.235   1.00 0.00 ? 317 VAL A HG23   2  
ATOM   3735  N N      . SER A 1 105 ? 19.627 -6.199  3.788   1.00 0.00 ? 318 SER A N      2  
ATOM   3736  C CA     . SER A 1 105 ? 18.876 -5.258  2.975   1.00 0.00 ? 318 SER A CA     2  
ATOM   3737  C C      . SER A 1 105 ? 19.716 -4.007  2.712   1.00 0.00 ? 318 SER A C      2  
ATOM   3738  O O      . SER A 1 105 ? 20.115 -3.315  3.647   1.00 0.00 ? 318 SER A O      2  
ATOM   3739  C CB     . SER A 1 105 ? 17.555 -4.878  3.649   1.00 0.00 ? 318 SER A CB     2  
ATOM   3740  O OG     . SER A 1 105 ? 16.495 -4.742  2.706   1.00 0.00 ? 318 SER A OG     2  
ATOM   3741  H H      . SER A 1 105 ? 19.669 -5.976  4.762   1.00 0.00 ? 318 SER A H      2  
ATOM   3742  H HA     . SER A 1 105 ? 18.668 -5.783  2.043   1.00 0.00 ? 318 SER A HA     2  
ATOM   3743  H HB2    . SER A 1 105 ? 17.291 -5.640  4.383   1.00 0.00 ? 318 SER A HB2    2  
ATOM   3744  H HB3    . SER A 1 105 ? 17.682 -3.942  4.192   1.00 0.00 ? 318 SER A HB3    2  
ATOM   3745  H HG     . SER A 1 105 ? 16.224 -3.782  2.634   1.00 0.00 ? 318 SER A HG     2  
ATOM   3746  N N      . LEU A 1 106 ? 19.961 -3.755  1.434   1.00 0.00 ? 319 LEU A N      2  
ATOM   3747  C CA     . LEU A 1 106 ? 20.746 -2.600  1.037   1.00 0.00 ? 319 LEU A CA     2  
ATOM   3748  C C      . LEU A 1 106 ? 20.005 -1.839  -0.064  1.00 0.00 ? 319 LEU A C      2  
ATOM   3749  O O      . LEU A 1 106 ? 19.070 -2.365  -0.666  1.00 0.00 ? 319 LEU A O      2  
ATOM   3750  C CB     . LEU A 1 106 ? 22.163 -3.024  0.644   1.00 0.00 ? 319 LEU A CB     2  
ATOM   3751  C CG     . LEU A 1 106 ? 22.299 -4.419  0.030   1.00 0.00 ? 319 LEU A CG     2  
ATOM   3752  C CD1    . LEU A 1 106 ? 21.959 -5.504  1.053   1.00 0.00 ? 319 LEU A CD1    2  
ATOM   3753  C CD2    . LEU A 1 106 ? 21.453 -4.544  -1.240  1.00 0.00 ? 319 LEU A CD2    2  
ATOM   3754  H H      . LEU A 1 106 ? 19.633 -4.323  0.680   1.00 0.00 ? 319 LEU A H      2  
ATOM   3755  H HA     . LEU A 1 106 ? 20.835 -1.949  1.907   1.00 0.00 ? 319 LEU A HA     2  
ATOM   3756  H HB2    . LEU A 1 106 ? 22.556 -2.297  -0.066  1.00 0.00 ? 319 LEU A HB2    2  
ATOM   3757  H HB3    . LEU A 1 106 ? 22.795 -2.977  1.531   1.00 0.00 ? 319 LEU A HB3    2  
ATOM   3758  H HG     . LEU A 1 106 ? 23.339 -4.565  -0.261  1.00 0.00 ? 319 LEU A HG     2  
ATOM   3759  H HD11   . LEU A 1 106 ? 21.777 -5.044  2.024   1.00 0.00 ? 319 LEU A HD11   2  
ATOM   3760  H HD12   . LEU A 1 106 ? 21.066 -6.040  0.732   1.00 0.00 ? 319 LEU A HD12   2  
ATOM   3761  H HD13   . LEU A 1 106 ? 22.793 -6.203  1.132   1.00 0.00 ? 319 LEU A HD13   2  
ATOM   3762  H HD21   . LEU A 1 106 ? 20.652 -5.263  -1.074  1.00 0.00 ? 319 LEU A HD21   2  
ATOM   3763  H HD22   . LEU A 1 106 ? 21.025 -3.572  -1.488  1.00 0.00 ? 319 LEU A HD22   2  
ATOM   3764  H HD23   . LEU A 1 106 ? 22.082 -4.884  -2.063  1.00 0.00 ? 319 LEU A HD23   2  
ATOM   3765  N N      . LEU A 1 107 ? 20.450 -0.612  -0.295  1.00 0.00 ? 320 LEU A N      2  
ATOM   3766  C CA     . LEU A 1 107 ? 19.841 0.227   -1.312  1.00 0.00 ? 320 LEU A CA     2  
ATOM   3767  C C      . LEU A 1 107 ? 20.809 0.381   -2.487  1.00 0.00 ? 320 LEU A C      2  
ATOM   3768  O O      . LEU A 1 107 ? 22.023 0.295   -2.311  1.00 0.00 ? 320 LEU A O      2  
ATOM   3769  C CB     . LEU A 1 107 ? 19.389 1.558   -0.709  1.00 0.00 ? 320 LEU A CB     2  
ATOM   3770  C CG     . LEU A 1 107 ? 18.595 1.469   0.595   1.00 0.00 ? 320 LEU A CG     2  
ATOM   3771  C CD1    . LEU A 1 107 ? 19.449 1.902   1.788   1.00 0.00 ? 320 LEU A CD1    2  
ATOM   3772  C CD2    . LEU A 1 107 ? 17.294 2.268   0.501   1.00 0.00 ? 320 LEU A CD2    2  
ATOM   3773  H H      . LEU A 1 107 ? 21.212 -0.192  0.199   1.00 0.00 ? 320 LEU A H      2  
ATOM   3774  H HA     . LEU A 1 107 ? 18.947 -0.287  -1.666  1.00 0.00 ? 320 LEU A HA     2  
ATOM   3775  H HB2    . LEU A 1 107 ? 20.272 2.173   -0.533  1.00 0.00 ? 320 LEU A HB2    2  
ATOM   3776  H HB3    . LEU A 1 107 ? 18.780 2.080   -1.447  1.00 0.00 ? 320 LEU A HB3    2  
ATOM   3777  H HG     . LEU A 1 107 ? 18.321 0.426   0.757   1.00 0.00 ? 320 LEU A HG     2  
ATOM   3778  H HD11   . LEU A 1 107 ? 20.236 1.166   1.958   1.00 0.00 ? 320 LEU A HD11   2  
ATOM   3779  H HD12   . LEU A 1 107 ? 19.899 2.873   1.580   1.00 0.00 ? 320 LEU A HD12   2  
ATOM   3780  H HD13   . LEU A 1 107 ? 18.822 1.975   2.676   1.00 0.00 ? 320 LEU A HD13   2  
ATOM   3781  H HD21   . LEU A 1 107 ? 16.981 2.331   -0.541  1.00 0.00 ? 320 LEU A HD21   2  
ATOM   3782  H HD22   . LEU A 1 107 ? 16.519 1.771   1.084   1.00 0.00 ? 320 LEU A HD22   2  
ATOM   3783  H HD23   . LEU A 1 107 ? 17.455 3.272   0.894   1.00 0.00 ? 320 LEU A HD23   2  
ATOM   3784  N N      . SER A 1 108 ? 20.236 0.606   -3.660  1.00 0.00 ? 321 SER A N      2  
ATOM   3785  C CA     . SER A 1 108 ? 21.033 0.773   -4.863  1.00 0.00 ? 321 SER A CA     2  
ATOM   3786  C C      . SER A 1 108 ? 20.947 2.221   -5.351  1.00 0.00 ? 321 SER A C      2  
ATOM   3787  O O      . SER A 1 108 ? 19.893 2.848   -5.260  1.00 0.00 ? 321 SER A O      2  
ATOM   3788  C CB     . SER A 1 108 ? 20.576 -0.186  -5.964  1.00 0.00 ? 321 SER A CB     2  
ATOM   3789  O OG     . SER A 1 108 ? 21.053 -1.511  -5.749  1.00 0.00 ? 321 SER A OG     2  
ATOM   3790  H H      . SER A 1 108 ? 19.247 0.676   -3.795  1.00 0.00 ? 321 SER A H      2  
ATOM   3791  H HA     . SER A 1 108 ? 22.054 0.529   -4.570  1.00 0.00 ? 321 SER A HA     2  
ATOM   3792  H HB2    . SER A 1 108 ? 19.487 -0.195  -6.007  1.00 0.00 ? 321 SER A HB2    2  
ATOM   3793  H HB3    . SER A 1 108 ? 20.931 0.175   -6.930  1.00 0.00 ? 321 SER A HB3    2  
ATOM   3794  H HG     . SER A 1 108 ? 20.862 -2.078  -6.550  1.00 0.00 ? 321 SER A HG     2  
ATOM   3795  N N      . LEU A 1 109 ? 22.070 2.709   -5.858  1.00 0.00 ? 322 LEU A N      2  
ATOM   3796  C CA     . LEU A 1 109 ? 22.134 4.071   -6.360  1.00 0.00 ? 322 LEU A CA     2  
ATOM   3797  C C      . LEU A 1 109 ? 22.633 4.053   -7.807  1.00 0.00 ? 322 LEU A C      2  
ATOM   3798  O O      . LEU A 1 109 ? 23.465 3.223   -8.170  1.00 0.00 ? 322 LEU A O      2  
ATOM   3799  C CB     . LEU A 1 109 ? 22.978 4.945   -5.430  1.00 0.00 ? 322 LEU A CB     2  
ATOM   3800  C CG     . LEU A 1 109 ? 22.365 6.291   -5.038  1.00 0.00 ? 322 LEU A CG     2  
ATOM   3801  C CD1    . LEU A 1 109 ? 23.383 7.162   -4.299  1.00 0.00 ? 322 LEU A CD1    2  
ATOM   3802  C CD2    . LEU A 1 109 ? 21.779 7.004   -6.258  1.00 0.00 ? 322 LEU A CD2    2  
ATOM   3803  H H      . LEU A 1 109 ? 22.922 2.191   -5.928  1.00 0.00 ? 322 LEU A H      2  
ATOM   3804  H HA     . LEU A 1 109 ? 21.121 4.472   -6.349  1.00 0.00 ? 322 LEU A HA     2  
ATOM   3805  H HB2    . LEU A 1 109 ? 23.182 4.381   -4.520  1.00 0.00 ? 322 LEU A HB2    2  
ATOM   3806  H HB3    . LEU A 1 109 ? 23.938 5.132   -5.911  1.00 0.00 ? 322 LEU A HB3    2  
ATOM   3807  H HG     . LEU A 1 109 ? 21.542 6.103   -4.347  1.00 0.00 ? 322 LEU A HG     2  
ATOM   3808  H HD11   . LEU A 1 109 ? 24.231 6.549   -3.991  1.00 0.00 ? 322 LEU A HD11   2  
ATOM   3809  H HD12   . LEU A 1 109 ? 23.731 7.956   -4.961  1.00 0.00 ? 322 LEU A HD12   2  
ATOM   3810  H HD13   . LEU A 1 109 ? 22.915 7.603   -3.419  1.00 0.00 ? 322 LEU A HD13   2  
ATOM   3811  H HD21   . LEU A 1 109 ? 21.678 8.068   -6.043  1.00 0.00 ? 322 LEU A HD21   2  
ATOM   3812  H HD22   . LEU A 1 109 ? 22.442 6.867   -7.111  1.00 0.00 ? 322 LEU A HD22   2  
ATOM   3813  H HD23   . LEU A 1 109 ? 20.799 6.585   -6.488  1.00 0.00 ? 322 LEU A HD23   2  
ATOM   3814  N N      . HIS A 1 110 ? 22.102 4.978   -8.593  1.00 0.00 ? 323 HIS A N      2  
ATOM   3815  C CA     . HIS A 1 110 ? 22.482 5.078   -9.992  1.00 0.00 ? 323 HIS A CA     2  
ATOM   3816  C C      . HIS A 1 110 ? 23.723 5.964   -10.124 1.00 0.00 ? 323 HIS A C      2  
ATOM   3817  O O      . HIS A 1 110 ? 23.959 6.836   -9.289  1.00 0.00 ? 323 HIS A O      2  
ATOM   3818  C CB     . HIS A 1 110 ? 21.309 5.573   -10.840 1.00 0.00 ? 323 HIS A CB     2  
ATOM   3819  C CG     . HIS A 1 110 ? 21.205 4.907   -12.191 1.00 0.00 ? 323 HIS A CG     2  
ATOM   3820  N ND1    . HIS A 1 110 ? 21.583 5.533   -13.366 1.00 0.00 ? 323 HIS A ND1    2  
ATOM   3821  C CD2    . HIS A 1 110 ? 20.763 3.665   -12.542 1.00 0.00 ? 323 HIS A CD2    2  
ATOM   3822  C CE1    . HIS A 1 110 ? 21.374 4.697   -14.372 1.00 0.00 ? 323 HIS A CE1    2  
ATOM   3823  N NE2    . HIS A 1 110 ? 20.864 3.540   -13.859 1.00 0.00 ? 323 HIS A NE2    2  
ATOM   3824  H H      . HIS A 1 110 ? 21.426 5.649   -8.289  1.00 0.00 ? 323 HIS A H      2  
ATOM   3825  H HA     . HIS A 1 110 ? 22.730 4.070   -10.322 1.00 0.00 ? 323 HIS A HA     2  
ATOM   3826  H HB2    . HIS A 1 110 ? 20.382 5.404   -10.291 1.00 0.00 ? 323 HIS A HB2    2  
ATOM   3827  H HB3    . HIS A 1 110 ? 21.404 6.649   -10.982 1.00 0.00 ? 323 HIS A HB3    2  
ATOM   3828  H HD1    . HIS A 1 110 ? 21.952 6.459   -13.443 1.00 0.00 ? 323 HIS A HD1    2  
ATOM   3829  H HD2    . HIS A 1 110 ? 20.389 2.905   -11.856 1.00 0.00 ? 323 HIS A HD2    2  
ATOM   3830  H HE1    . HIS A 1 110 ? 21.573 4.898   -15.425 1.00 0.00 ? 323 HIS A HE1    2  
ATOM   3831  H HE2    . HIS A 1 110 ? 20.663 2.711   -14.382 1.00 0.00 ? 323 HIS A HE2    2  
ATOM   3832  N N      . SER A 1 111 ? 24.483 5.711   -11.179 1.00 0.00 ? 324 SER A N      2  
ATOM   3833  C CA     . SER A 1 111 ? 25.693 6.474   -11.431 1.00 0.00 ? 324 SER A CA     2  
ATOM   3834  C C      . SER A 1 111 ? 25.340 7.935   -11.717 1.00 0.00 ? 324 SER A C      2  
ATOM   3835  O O      . SER A 1 111 ? 26.079 8.842   -11.336 1.00 0.00 ? 324 SER A O      2  
ATOM   3836  C CB     . SER A 1 111 ? 26.486 5.882   -12.598 1.00 0.00 ? 324 SER A CB     2  
ATOM   3837  O OG     . SER A 1 111 ? 25.751 5.922   -13.818 1.00 0.00 ? 324 SER A OG     2  
ATOM   3838  H H      . SER A 1 111 ? 24.283 5.000   -11.854 1.00 0.00 ? 324 SER A H      2  
ATOM   3839  H HA     . SER A 1 111 ? 26.281 6.395   -10.516 1.00 0.00 ? 324 SER A HA     2  
ATOM   3840  H HB2    . SER A 1 111 ? 27.419 6.430   -12.718 1.00 0.00 ? 324 SER A HB2    2  
ATOM   3841  H HB3    . SER A 1 111 ? 26.750 4.849   -12.369 1.00 0.00 ? 324 SER A HB3    2  
ATOM   3842  H HG     . SER A 1 111 ? 25.170 6.736   -13.840 1.00 0.00 ? 324 SER A HG     2  
ATOM   3843  N N      . ALA A 1 112 ? 24.212 8.118   -12.386 1.00 0.00 ? 325 ALA A N      2  
ATOM   3844  C CA     . ALA A 1 112 ? 23.752 9.453   -12.727 1.00 0.00 ? 325 ALA A CA     2  
ATOM   3845  C C      . ALA A 1 112 ? 23.261 10.158  -11.461 1.00 0.00 ? 325 ALA A C      2  
ATOM   3846  O O      . ALA A 1 112 ? 23.432 11.367  -11.314 1.00 0.00 ? 325 ALA A O      2  
ATOM   3847  C CB     . ALA A 1 112 ? 22.666 9.359   -13.801 1.00 0.00 ? 325 ALA A CB     2  
ATOM   3848  H H      . ALA A 1 112 ? 23.617 7.375   -12.692 1.00 0.00 ? 325 ALA A H      2  
ATOM   3849  H HA     . ALA A 1 112 ? 24.601 10.003  -13.134 1.00 0.00 ? 325 ALA A HA     2  
ATOM   3850  H HB1    . ALA A 1 112 ? 21.977 8.552   -13.553 1.00 0.00 ? 325 ALA A HB1    2  
ATOM   3851  H HB2    . ALA A 1 112 ? 22.120 10.302  -13.848 1.00 0.00 ? 325 ALA A HB2    2  
ATOM   3852  H HB3    . ALA A 1 112 ? 23.128 9.159   -14.768 1.00 0.00 ? 325 ALA A HB3    2  
ATOM   3853  N N      . ASP A 1 113 ? 22.659 9.372   -10.581 1.00 0.00 ? 326 ASP A N      2  
ATOM   3854  C CA     . ASP A 1 113 ? 22.142 9.906   -9.332  1.00 0.00 ? 326 ASP A CA     2  
ATOM   3855  C C      . ASP A 1 113 ? 23.306 10.173  -8.376  1.00 0.00 ? 326 ASP A C      2  
ATOM   3856  O O      . ASP A 1 113 ? 23.244 11.087  -7.555  1.00 0.00 ? 326 ASP A O      2  
ATOM   3857  C CB     . ASP A 1 113 ? 21.195 8.911   -8.658  1.00 0.00 ? 326 ASP A CB     2  
ATOM   3858  C CG     . ASP A 1 113 ? 19.836 8.747   -9.342  1.00 0.00 ? 326 ASP A CG     2  
ATOM   3859  O OD1    . ASP A 1 113 ? 19.058 9.706   -9.453  1.00 0.00 ? 326 ASP A OD1    2  
ATOM   3860  O OD2    . ASP A 1 113 ? 19.585 7.559   -9.778  1.00 0.00 ? 326 ASP A OD2    2  
ATOM   3861  H H      . ASP A 1 113 ? 22.524 8.390   -10.708 1.00 0.00 ? 326 ASP A H      2  
ATOM   3862  H HA     . ASP A 1 113 ? 21.612 10.818  -9.607  1.00 0.00 ? 326 ASP A HA     2  
ATOM   3863  H HB2    . ASP A 1 113 ? 21.684 7.938   -8.616  1.00 0.00 ? 326 ASP A HB2    2  
ATOM   3864  H HB3    . ASP A 1 113 ? 21.030 9.230   -7.628  1.00 0.00 ? 326 ASP A HB3    2  
ATOM   3865  H HD2    . ASP A 1 113 ? 19.810 6.883   -9.076  1.00 0.00 ? 326 ASP A HD2    2  
ATOM   3866  N N      . PHE A 1 114 ? 24.342 9.357   -8.512  1.00 0.00 ? 327 PHE A N      2  
ATOM   3867  C CA     . PHE A 1 114 ? 25.518 9.493   -7.670  1.00 0.00 ? 327 PHE A CA     2  
ATOM   3868  C C      . PHE A 1 114 ? 26.337 10.723  -8.068  1.00 0.00 ? 327 PHE A C      2  
ATOM   3869  O O      . PHE A 1 114 ? 26.888 11.411  -7.210  1.00 0.00 ? 327 PHE A O      2  
ATOM   3870  C CB     . PHE A 1 114 ? 26.367 8.238   -7.882  1.00 0.00 ? 327 PHE A CB     2  
ATOM   3871  C CG     . PHE A 1 114 ? 27.585 8.148   -6.961  1.00 0.00 ? 327 PHE A CG     2  
ATOM   3872  C CD1    . PHE A 1 114 ? 28.765 8.708   -7.336  1.00 0.00 ? 327 PHE A CD1    2  
ATOM   3873  C CD2    . PHE A 1 114 ? 27.487 7.508   -5.765  1.00 0.00 ? 327 PHE A CD2    2  
ATOM   3874  C CE1    . PHE A 1 114 ? 29.896 8.625   -6.481  1.00 0.00 ? 327 PHE A CE1    2  
ATOM   3875  C CE2    . PHE A 1 114 ? 28.617 7.424   -4.909  1.00 0.00 ? 327 PHE A CE2    2  
ATOM   3876  C CZ     . PHE A 1 114 ? 29.797 7.985   -5.285  1.00 0.00 ? 327 PHE A CZ     2  
ATOM   3877  H H      . PHE A 1 114 ? 24.385 8.615   -9.182  1.00 0.00 ? 327 PHE A H      2  
ATOM   3878  H HA     . PHE A 1 114 ? 25.169 9.607   -6.644  1.00 0.00 ? 327 PHE A HA     2  
ATOM   3879  H HB2    . PHE A 1 114 ? 25.741 7.359   -7.728  1.00 0.00 ? 327 PHE A HB2    2  
ATOM   3880  H HB3    . PHE A 1 114 ? 26.705 8.212   -8.918  1.00 0.00 ? 327 PHE A HB3    2  
ATOM   3881  H HD1    . PHE A 1 114 ? 28.844 9.222   -8.294  1.00 0.00 ? 327 PHE A HD1    2  
ATOM   3882  H HD2    . PHE A 1 114 ? 26.541 7.058   -5.463  1.00 0.00 ? 327 PHE A HD2    2  
ATOM   3883  H HE1    . PHE A 1 114 ? 30.842 9.075   -6.783  1.00 0.00 ? 327 PHE A HE1    2  
ATOM   3884  H HE2    . PHE A 1 114 ? 28.538 6.910   -3.951  1.00 0.00 ? 327 PHE A HE2    2  
ATOM   3885  H HZ     . PHE A 1 114 ? 30.665 7.921   -4.629  1.00 0.00 ? 327 PHE A HZ     2  
ATOM   3886  N N      . GLN A 1 115 ? 26.392 10.961  -9.370  1.00 0.00 ? 328 GLN A N      2  
ATOM   3887  C CA     . GLN A 1 115 ? 27.136 12.096  -9.892  1.00 0.00 ? 328 GLN A CA     2  
ATOM   3888  C C      . GLN A 1 115 ? 26.372 13.395  -9.632  1.00 0.00 ? 328 GLN A C      2  
ATOM   3889  O O      . GLN A 1 115 ? 26.977 14.454  -9.471  1.00 0.00 ? 328 GLN A O      2  
ATOM   3890  C CB     . GLN A 1 115 ? 27.427 11.920  -11.384 1.00 0.00 ? 328 GLN A CB     2  
ATOM   3891  C CG     . GLN A 1 115 ? 28.887 11.526  -11.614 1.00 0.00 ? 328 GLN A CG     2  
ATOM   3892  C CD     . GLN A 1 115 ? 29.228 11.529  -13.106 1.00 0.00 ? 328 GLN A CD     2  
ATOM   3893  O OE1    . GLN A 1 115 ? 28.380 11.336  -13.962 1.00 0.00 ? 328 GLN A OE1    2  
ATOM   3894  N NE2    . GLN A 1 115 ? 30.511 11.758  -13.367 1.00 0.00 ? 328 GLN A NE2    2  
ATOM   3895  H H      . GLN A 1 115 ? 25.942 10.397  -10.061 1.00 0.00 ? 328 GLN A H      2  
ATOM   3896  H HA     . GLN A 1 115 ? 28.076 12.103  -9.342  1.00 0.00 ? 328 GLN A HA     2  
ATOM   3897  H HB2    . GLN A 1 115 ? 26.771 11.155  -11.799 1.00 0.00 ? 328 GLN A HB2    2  
ATOM   3898  H HB3    . GLN A 1 115 ? 27.210 12.849  -11.912 1.00 0.00 ? 328 GLN A HB3    2  
ATOM   3899  H HG2    . GLN A 1 115 ? 29.543 12.220  -11.087 1.00 0.00 ? 328 GLN A HG2    2  
ATOM   3900  H HG3    . GLN A 1 115 ? 29.070 10.536  -11.197 1.00 0.00 ? 328 GLN A HG3    2  
ATOM   3901  H HE21   . GLN A 1 115 ? 31.155 11.908  -12.617 1.00 0.00 ? 328 GLN A HE21   2  
ATOM   3902  H HE22   . GLN A 1 115 ? 30.832 11.779  -14.315 1.00 0.00 ? 328 GLN A HE22   2  
ATOM   3903  N N      . MET A 1 116 ? 25.053 13.273  -9.598  1.00 0.00 ? 329 MET A N      2  
ATOM   3904  C CA     . MET A 1 116 ? 24.201 14.425  -9.360  1.00 0.00 ? 329 MET A CA     2  
ATOM   3905  C C      . MET A 1 116 ? 24.194 14.805  -7.878  1.00 0.00 ? 329 MET A C      2  
ATOM   3906  O O      . MET A 1 116 ? 24.150 15.987  -7.537  1.00 0.00 ? 329 MET A O      2  
ATOM   3907  C CB     . MET A 1 116 ? 22.773 14.107  -9.812  1.00 0.00 ? 329 MET A CB     2  
ATOM   3908  C CG     . MET A 1 116 ? 21.832 15.276  -9.519  1.00 0.00 ? 329 MET A CG     2  
ATOM   3909  S SD     . MET A 1 116 ? 20.151 14.689  -9.388  1.00 0.00 ? 329 MET A SD     2  
ATOM   3910  C CE     . MET A 1 116 ? 20.067 14.380  -7.632  1.00 0.00 ? 329 MET A CE     2  
ATOM   3911  H H      . MET A 1 116 ? 24.567 12.408  -9.730  1.00 0.00 ? 329 MET A H      2  
ATOM   3912  H HA     . MET A 1 116 ? 24.632 15.235  -9.949  1.00 0.00 ? 329 MET A HA     2  
ATOM   3913  H HB2    . MET A 1 116 ? 22.766 13.887  -10.880 1.00 0.00 ? 329 MET A HB2    2  
ATOM   3914  H HB3    . MET A 1 116 ? 22.417 13.212  -9.300  1.00 0.00 ? 329 MET A HB3    2  
ATOM   3915  H HG2    . MET A 1 116 ? 22.127 15.768  -8.593  1.00 0.00 ? 329 MET A HG2    2  
ATOM   3916  H HG3    . MET A 1 116 ? 21.905 16.020  -10.312 1.00 0.00 ? 329 MET A HG3    2  
ATOM   3917  H HE1    . MET A 1 116 ? 20.386 15.270  -7.090  1.00 0.00 ? 329 MET A HE1    2  
ATOM   3918  H HE2    . MET A 1 116 ? 19.042 14.134  -7.355  1.00 0.00 ? 329 MET A HE2    2  
ATOM   3919  H HE3    . MET A 1 116 ? 20.723 13.547  -7.377  1.00 0.00 ? 329 MET A HE3    2  
ATOM   3920  N N      . LEU A 1 117 ? 24.239 13.783  -7.038  1.00 0.00 ? 330 LEU A N      2  
ATOM   3921  C CA     . LEU A 1 117 ? 24.239 13.996  -5.600  1.00 0.00 ? 330 LEU A CA     2  
ATOM   3922  C C      . LEU A 1 117 ? 25.619 14.491  -5.162  1.00 0.00 ? 330 LEU A C      2  
ATOM   3923  O O      . LEU A 1 117 ? 25.729 15.283  -4.228  1.00 0.00 ? 330 LEU A O      2  
ATOM   3924  C CB     . LEU A 1 117 ? 23.781 12.730  -4.871  1.00 0.00 ? 330 LEU A CB     2  
ATOM   3925  C CG     . LEU A 1 117 ? 24.847 11.654  -4.661  1.00 0.00 ? 330 LEU A CG     2  
ATOM   3926  C CD1    . LEU A 1 117 ? 25.723 11.979  -3.449  1.00 0.00 ? 330 LEU A CD1    2  
ATOM   3927  C CD2    . LEU A 1 117 ? 24.212 10.266  -4.554  1.00 0.00 ? 330 LEU A CD2    2  
ATOM   3928  H H      . LEU A 1 117 ? 24.274 12.825  -7.323  1.00 0.00 ? 330 LEU A H      2  
ATOM   3929  H HA     . LEU A 1 117 ? 23.508 14.774  -5.385  1.00 0.00 ? 330 LEU A HA     2  
ATOM   3930  H HB2    . LEU A 1 117 ? 23.387 13.019  -3.897  1.00 0.00 ? 330 LEU A HB2    2  
ATOM   3931  H HB3    . LEU A 1 117 ? 22.955 12.291  -5.431  1.00 0.00 ? 330 LEU A HB3    2  
ATOM   3932  H HG     . LEU A 1 117 ? 25.499 11.642  -5.535  1.00 0.00 ? 330 LEU A HG     2  
ATOM   3933  H HD11   . LEU A 1 117 ? 25.134 12.522  -2.710  1.00 0.00 ? 330 LEU A HD11   2  
ATOM   3934  H HD12   . LEU A 1 117 ? 26.092 11.052  -3.010  1.00 0.00 ? 330 LEU A HD12   2  
ATOM   3935  H HD13   . LEU A 1 117 ? 26.566 12.593  -3.764  1.00 0.00 ? 330 LEU A HD13   2  
ATOM   3936  H HD21   . LEU A 1 117 ? 23.687 10.179  -3.602  1.00 0.00 ? 330 LEU A HD21   2  
ATOM   3937  H HD22   . LEU A 1 117 ? 23.505 10.126  -5.371  1.00 0.00 ? 330 LEU A HD22   2  
ATOM   3938  H HD23   . LEU A 1 117 ? 24.990 9.504   -4.610  1.00 0.00 ? 330 LEU A HD23   2  
ATOM   3939  N N      . CYS A 1 118 ? 26.635 14.005  -5.859  1.00 0.00 ? 331 CYS A N      2  
ATOM   3940  C CA     . CYS A 1 118 ? 28.003 14.389  -5.553  1.00 0.00 ? 331 CYS A CA     2  
ATOM   3941  C C      . CYS A 1 118 ? 28.204 15.840  -5.994  1.00 0.00 ? 331 CYS A C      2  
ATOM   3942  O O      . CYS A 1 118 ? 28.985 16.574  -5.389  1.00 0.00 ? 331 CYS A O      2  
ATOM   3943  C CB     . CYS A 1 118 ? 29.015 13.447  -6.209  1.00 0.00 ? 331 CYS A CB     2  
ATOM   3944  S SG     . CYS A 1 118 ? 29.269 13.923  -7.959  1.00 0.00 ? 331 CYS A SG     2  
ATOM   3945  H H      . CYS A 1 118 ? 26.536 13.361  -6.617  1.00 0.00 ? 331 CYS A H      2  
ATOM   3946  H HA     . CYS A 1 118 ? 28.122 14.292  -4.474  1.00 0.00 ? 331 CYS A HA     2  
ATOM   3947  H HB2    . CYS A 1 118 ? 29.962 13.487  -5.672  1.00 0.00 ? 331 CYS A HB2    2  
ATOM   3948  H HB3    . CYS A 1 118 ? 28.657 12.420  -6.152  1.00 0.00 ? 331 CYS A HB3    2  
ATOM   3949  H HG     . CYS A 1 118 ? 29.997 15.007  -7.702  1.00 0.00 ? 331 CYS A HG     2  
ATOM   3950  N N      . SER A 1 119 ? 27.487 16.211  -7.045  1.00 0.00 ? 332 SER A N      2  
ATOM   3951  C CA     . SER A 1 119 ? 27.577 17.561  -7.573  1.00 0.00 ? 332 SER A CA     2  
ATOM   3952  C C      . SER A 1 119 ? 26.845 18.535  -6.648  1.00 0.00 ? 332 SER A C      2  
ATOM   3953  O O      . SER A 1 119 ? 27.241 19.693  -6.521  1.00 0.00 ? 332 SER A O      2  
ATOM   3954  C CB     . SER A 1 119 ? 27.000 17.638  -8.989  1.00 0.00 ? 332 SER A CB     2  
ATOM   3955  O OG     . SER A 1 119 ? 25.623 18.007  -8.984  1.00 0.00 ? 332 SER A OG     2  
ATOM   3956  H H      . SER A 1 119 ? 26.854 15.608  -7.530  1.00 0.00 ? 332 SER A H      2  
ATOM   3957  H HA     . SER A 1 119 ? 28.642 17.789  -7.603  1.00 0.00 ? 332 SER A HA     2  
ATOM   3958  H HB2    . SER A 1 119 ? 27.567 18.364  -9.572  1.00 0.00 ? 332 SER A HB2    2  
ATOM   3959  H HB3    . SER A 1 119 ? 27.116 16.672  -9.480  1.00 0.00 ? 332 SER A HB3    2  
ATOM   3960  H HG     . SER A 1 119 ? 25.472 18.770  -9.611  1.00 0.00 ? 332 SER A HG     2  
ATOM   3961  N N      . SER A 1 120 ? 25.790 18.030  -6.025  1.00 0.00 ? 333 SER A N      2  
ATOM   3962  C CA     . SER A 1 120 ? 24.999 18.842  -5.115  1.00 0.00 ? 333 SER A CA     2  
ATOM   3963  C C      . SER A 1 120 ? 25.804 19.142  -3.848  1.00 0.00 ? 333 SER A C      2  
ATOM   3964  O O      . SER A 1 120 ? 25.855 20.285  -3.398  1.00 0.00 ? 333 SER A O      2  
ATOM   3965  C CB     . SER A 1 120 ? 23.685 18.144  -4.756  1.00 0.00 ? 333 SER A CB     2  
ATOM   3966  O OG     . SER A 1 120 ? 22.954 18.863  -3.767  1.00 0.00 ? 333 SER A OG     2  
ATOM   3967  H H      . SER A 1 120 ? 25.475 17.088  -6.133  1.00 0.00 ? 333 SER A H      2  
ATOM   3968  H HA     . SER A 1 120 ? 24.785 19.762  -5.659  1.00 0.00 ? 333 SER A HA     2  
ATOM   3969  H HB2    . SER A 1 120 ? 23.074 18.040  -5.653  1.00 0.00 ? 333 SER A HB2    2  
ATOM   3970  H HB3    . SER A 1 120 ? 23.895 17.139  -4.394  1.00 0.00 ? 333 SER A HB3    2  
ATOM   3971  H HG     . SER A 1 120 ? 22.054 18.444  -3.635  1.00 0.00 ? 333 SER A HG     2  
ATOM   3972  N N      . SER A 1 121 ? 26.412 18.095  -3.310  1.00 0.00 ? 334 SER A N      2  
ATOM   3973  C CA     . SER A 1 121 ? 27.211 18.233  -2.104  1.00 0.00 ? 334 SER A CA     2  
ATOM   3974  C C      . SER A 1 121 ? 28.674 17.903  -2.406  1.00 0.00 ? 334 SER A C      2  
ATOM   3975  O O      . SER A 1 121 ? 28.992 16.785  -2.808  1.00 0.00 ? 334 SER A O      2  
ATOM   3976  C CB     . SER A 1 121 ? 26.684 17.330  -0.988  1.00 0.00 ? 334 SER A CB     2  
ATOM   3977  O OG     . SER A 1 121 ? 25.595 17.927  -0.287  1.00 0.00 ? 334 SER A OG     2  
ATOM   3978  H H      . SER A 1 121 ? 26.366 17.169  -3.683  1.00 0.00 ? 334 SER A H      2  
ATOM   3979  H HA     . SER A 1 121 ? 27.108 19.276  -1.807  1.00 0.00 ? 334 SER A HA     2  
ATOM   3980  H HB2    . SER A 1 121 ? 26.362 16.378  -1.412  1.00 0.00 ? 334 SER A HB2    2  
ATOM   3981  H HB3    . SER A 1 121 ? 27.488 17.110  -0.287  1.00 0.00 ? 334 SER A HB3    2  
ATOM   3982  H HG     . SER A 1 121 ? 24.868 17.256  -0.149  1.00 0.00 ? 334 SER A HG     2  
ATOM   3983  N N      . PRO A 1 122 ? 29.548 18.923  -2.196  1.00 0.00 ? 335 PRO A N      2  
ATOM   3984  C CA     . PRO A 1 122 ? 30.971 18.753  -2.441  1.00 0.00 ? 335 PRO A CA     2  
ATOM   3985  C C      . PRO A 1 122 ? 31.622 17.921  -1.335  1.00 0.00 ? 335 PRO A C      2  
ATOM   3986  O O      . PRO A 1 122 ? 32.711 17.380  -1.520  1.00 0.00 ? 335 PRO A O      2  
ATOM   3987  C CB     . PRO A 1 122 ? 31.526 20.165  -2.528  1.00 0.00 ? 335 PRO A CB     2  
ATOM   3988  C CG     . PRO A 1 122 ? 30.491 21.062  -1.871  1.00 0.00 ? 335 PRO A CG     2  
ATOM   3989  C CD     . PRO A 1 122 ? 29.207 20.261  -1.721  1.00 0.00 ? 335 PRO A CD     2  
ATOM   3990  H HA     . PRO A 1 122 ? 31.118 18.244  -3.289  1.00 0.00 ? 335 PRO A HA     2  
ATOM   3991  H HB2    . PRO A 1 122 ? 32.487 20.239  -2.019  1.00 0.00 ? 335 PRO A HB2    2  
ATOM   3992  H HB3    . PRO A 1 122 ? 31.692 20.456  -3.566  1.00 0.00 ? 335 PRO A HB3    2  
ATOM   3993  H HG2    . PRO A 1 122 ? 30.844 21.403  -0.897  1.00 0.00 ? 335 PRO A HG2    2  
ATOM   3994  H HG3    . PRO A 1 122 ? 30.317 21.952  -2.475  1.00 0.00 ? 335 PRO A HG3    2  
ATOM   3995  H HD2    . PRO A 1 122 ? 28.872 20.240  -0.685  1.00 0.00 ? 335 PRO A HD2    2  
ATOM   3996  H HD3    . PRO A 1 122 ? 28.399 20.695  -2.309  1.00 0.00 ? 335 PRO A HD3    2  
ATOM   3997  N N      . GLU A 1 123 ? 30.928 17.846  -0.208  1.00 0.00 ? 336 GLU A N      2  
ATOM   3998  C CA     . GLU A 1 123 ? 31.425 17.089  0.928   1.00 0.00 ? 336 GLU A CA     2  
ATOM   3999  C C      . GLU A 1 123 ? 31.254 15.589  0.682   1.00 0.00 ? 336 GLU A C      2  
ATOM   4000  O O      . GLU A 1 123 ? 32.105 14.791  1.073   1.00 0.00 ? 336 GLU A O      2  
ATOM   4001  C CB     . GLU A 1 123 ? 30.726 17.517  2.219   1.00 0.00 ? 336 GLU A CB     2  
ATOM   4002  C CG     . GLU A 1 123 ? 31.293 16.765  3.424   1.00 0.00 ? 336 GLU A CG     2  
ATOM   4003  C CD     . GLU A 1 123 ? 32.354 17.601  4.144   1.00 0.00 ? 336 GLU A CD     2  
ATOM   4004  O OE1    . GLU A 1 123 ? 32.105 18.098  5.252   1.00 0.00 ? 336 GLU A OE1    2  
ATOM   4005  O OE2    . GLU A 1 123 ? 33.471 17.725  3.511   1.00 0.00 ? 336 GLU A OE2    2  
ATOM   4006  H H      . GLU A 1 123 ? 30.043 18.289  -0.067  1.00 0.00 ? 336 GLU A H      2  
ATOM   4007  H HA     . GLU A 1 123 ? 32.485 17.334  0.997   1.00 0.00 ? 336 GLU A HA     2  
ATOM   4008  H HB2    . GLU A 1 123 ? 30.849 18.590  2.366   1.00 0.00 ? 336 GLU A HB2    2  
ATOM   4009  H HB3    . GLU A 1 123 ? 29.655 17.327  2.138   1.00 0.00 ? 336 GLU A HB3    2  
ATOM   4010  H HG2    . GLU A 1 123 ? 30.487 16.519  4.117   1.00 0.00 ? 336 GLU A HG2    2  
ATOM   4011  H HG3    . GLU A 1 123 ? 31.729 15.821  3.097   1.00 0.00 ? 336 GLU A HG3    2  
ATOM   4012  H HE2    . GLU A 1 123 ? 33.687 16.876  3.028   1.00 0.00 ? 336 GLU A HE2    2  
ATOM   4013  N N      . ILE A 1 124 ? 30.148 15.250  0.036   1.00 0.00 ? 337 ILE A N      2  
ATOM   4014  C CA     . ILE A 1 124 ? 29.855 13.858  -0.266  1.00 0.00 ? 337 ILE A CA     2  
ATOM   4015  C C      . ILE A 1 124 ? 30.864 13.341  -1.292  1.00 0.00 ? 337 ILE A C      2  
ATOM   4016  O O      . ILE A 1 124 ? 31.261 12.177  -1.245  1.00 0.00 ? 337 ILE A O      2  
ATOM   4017  C CB     . ILE A 1 124 ? 28.397 13.702  -0.704  1.00 0.00 ? 337 ILE A CB     2  
ATOM   4018  C CG1    . ILE A 1 124 ? 27.447 13.862  0.485   1.00 0.00 ? 337 ILE A CG1    2  
ATOM   4019  C CG2    . ILE A 1 124 ? 28.184 12.374  -1.433  1.00 0.00 ? 337 ILE A CG2    2  
ATOM   4020  C CD1    . ILE A 1 124 ? 26.019 14.144  0.012   1.00 0.00 ? 337 ILE A CD1    2  
ATOM   4021  H H      . ILE A 1 124 ? 29.461 15.905  -0.278  1.00 0.00 ? 337 ILE A H      2  
ATOM   4022  H HA     . ILE A 1 124 ? 29.977 13.291  0.657   1.00 0.00 ? 337 ILE A HA     2  
ATOM   4023  H HB     . ILE A 1 124 ? 28.165 14.498  -1.411  1.00 0.00 ? 337 ILE A HB     2  
ATOM   4024  H HG12   . ILE A 1 124 ? 27.461 12.957  1.091   1.00 0.00 ? 337 ILE A HG12   2  
ATOM   4025  H HG13   . ILE A 1 124 ? 27.791 14.677  1.122   1.00 0.00 ? 337 ILE A HG13   2  
ATOM   4026  H HG21   . ILE A 1 124 ? 28.512 12.471  -2.468  1.00 0.00 ? 337 ILE A HG21   2  
ATOM   4027  H HG22   . ILE A 1 124 ? 28.761 11.592  -0.939  1.00 0.00 ? 337 ILE A HG22   2  
ATOM   4028  H HG23   . ILE A 1 124 ? 27.126 12.113  -1.410  1.00 0.00 ? 337 ILE A HG23   2  
ATOM   4029  H HD11   . ILE A 1 124 ? 26.036 14.446  -1.035  1.00 0.00 ? 337 ILE A HD11   2  
ATOM   4030  H HD12   . ILE A 1 124 ? 25.417 13.243  0.121   1.00 0.00 ? 337 ILE A HD12   2  
ATOM   4031  H HD13   . ILE A 1 124 ? 25.589 14.944  0.614   1.00 0.00 ? 337 ILE A HD13   2  
ATOM   4032  N N      . ALA A 1 125 ? 31.250 14.229  -2.196  1.00 0.00 ? 338 ALA A N      2  
ATOM   4033  C CA     . ALA A 1 125 ? 32.206 13.876  -3.232  1.00 0.00 ? 338 ALA A CA     2  
ATOM   4034  C C      . ALA A 1 125 ? 33.583 13.667  -2.599  1.00 0.00 ? 338 ALA A C      2  
ATOM   4035  O O      . ALA A 1 125 ? 34.359 12.827  -3.055  1.00 0.00 ? 338 ALA A O      2  
ATOM   4036  C CB     . ALA A 1 125 ? 32.218 14.962  -4.308  1.00 0.00 ? 338 ALA A CB     2  
ATOM   4037  H H      . ALA A 1 125 ? 30.923 15.173  -2.228  1.00 0.00 ? 338 ALA A H      2  
ATOM   4038  H HA     . ALA A 1 125 ? 31.876 12.939  -3.682  1.00 0.00 ? 338 ALA A HA     2  
ATOM   4039  H HB1    . ALA A 1 125 ? 31.197 15.286  -4.510  1.00 0.00 ? 338 ALA A HB1    2  
ATOM   4040  H HB2    . ALA A 1 125 ? 32.805 15.812  -3.960  1.00 0.00 ? 338 ALA A HB2    2  
ATOM   4041  H HB3    . ALA A 1 125 ? 32.660 14.565  -5.222  1.00 0.00 ? 338 ALA A HB3    2  
ATOM   4042  N N      . GLU A 1 126 ? 33.846 14.443  -1.559  1.00 0.00 ? 339 GLU A N      2  
ATOM   4043  C CA     . GLU A 1 126 ? 35.116 14.354  -0.859  1.00 0.00 ? 339 GLU A CA     2  
ATOM   4044  C C      . GLU A 1 126 ? 35.149 13.104  0.024   1.00 0.00 ? 339 GLU A C      2  
ATOM   4045  O O      . GLU A 1 126 ? 36.176 12.434  0.119   1.00 0.00 ? 339 GLU A O      2  
ATOM   4046  C CB     . GLU A 1 126 ? 35.378 15.616  -0.034  1.00 0.00 ? 339 GLU A CB     2  
ATOM   4047  C CG     . GLU A 1 126 ? 36.870 15.950  0.000   1.00 0.00 ? 339 GLU A CG     2  
ATOM   4048  C CD     . GLU A 1 126 ? 37.149 17.287  -0.688  1.00 0.00 ? 339 GLU A CD     2  
ATOM   4049  O OE1    . GLU A 1 126 ? 37.730 18.192  -0.071  1.00 0.00 ? 339 GLU A OE1    2  
ATOM   4050  O OE2    . GLU A 1 126 ? 36.739 17.367  -1.909  1.00 0.00 ? 339 GLU A OE2    2  
ATOM   4051  H H      . GLU A 1 126 ? 33.209 15.124  -1.195  1.00 0.00 ? 339 GLU A H      2  
ATOM   4052  H HA     . GLU A 1 126 ? 35.872 14.275  -1.640  1.00 0.00 ? 339 GLU A HA     2  
ATOM   4053  H HB2    . GLU A 1 126 ? 34.823 16.453  -0.457  1.00 0.00 ? 339 GLU A HB2    2  
ATOM   4054  H HB3    . GLU A 1 126 ? 35.010 15.472  0.983   1.00 0.00 ? 339 GLU A HB3    2  
ATOM   4055  H HG2    . GLU A 1 126 ? 37.214 15.989  1.033   1.00 0.00 ? 339 GLU A HG2    2  
ATOM   4056  H HG3    . GLU A 1 126 ? 37.434 15.158  -0.493  1.00 0.00 ? 339 GLU A HG3    2  
ATOM   4057  H HE2    . GLU A 1 126 ? 36.780 16.468  -2.344  1.00 0.00 ? 339 GLU A HE2    2  
ATOM   4058  N N      . ILE A 1 127 ? 34.012 12.830  0.647   1.00 0.00 ? 340 ILE A N      2  
ATOM   4059  C CA     . ILE A 1 127 ? 33.898 11.673  1.519   1.00 0.00 ? 340 ILE A CA     2  
ATOM   4060  C C      . ILE A 1 127 ? 34.059 10.397  0.689   1.00 0.00 ? 340 ILE A C      2  
ATOM   4061  O O      . ILE A 1 127 ? 34.583 9.397   1.178   1.00 0.00 ? 340 ILE A O      2  
ATOM   4062  C CB     . ILE A 1 127 ? 32.593 11.728  2.315   1.00 0.00 ? 340 ILE A CB     2  
ATOM   4063  C CG1    . ILE A 1 127 ? 32.858 11.580  3.814   1.00 0.00 ? 340 ILE A CG1    2  
ATOM   4064  C CG2    . ILE A 1 127 ? 31.595 10.687  1.803   1.00 0.00 ? 340 ILE A CG2    2  
ATOM   4065  C CD1    . ILE A 1 127 ? 31.745 12.234  4.635   1.00 0.00 ? 340 ILE A CD1    2  
ATOM   4066  H H      . ILE A 1 127 ? 33.182 13.380  0.564   1.00 0.00 ? 340 ILE A H      2  
ATOM   4067  H HA     . ILE A 1 127 ? 34.717 11.723  2.237   1.00 0.00 ? 340 ILE A HA     2  
ATOM   4068  H HB     . ILE A 1 127 ? 32.142 12.709  2.163   1.00 0.00 ? 340 ILE A HB     2  
ATOM   4069  H HG12   . ILE A 1 127 ? 32.931 10.523  4.071   1.00 0.00 ? 340 ILE A HG12   2  
ATOM   4070  H HG13   . ILE A 1 127 ? 33.816 12.035  4.064   1.00 0.00 ? 340 ILE A HG13   2  
ATOM   4071  H HG21   . ILE A 1 127 ? 31.966 9.687   2.026   1.00 0.00 ? 340 ILE A HG21   2  
ATOM   4072  H HG22   . ILE A 1 127 ? 30.633 10.836  2.294   1.00 0.00 ? 340 ILE A HG22   2  
ATOM   4073  H HG23   . ILE A 1 127 ? 31.474 10.799  0.726   1.00 0.00 ? 340 ILE A HG23   2  
ATOM   4074  H HD11   . ILE A 1 127 ? 32.117 12.461  5.634   1.00 0.00 ? 340 ILE A HD11   2  
ATOM   4075  H HD12   . ILE A 1 127 ? 31.428 13.156  4.147   1.00 0.00 ? 340 ILE A HD12   2  
ATOM   4076  H HD13   . ILE A 1 127 ? 30.899 11.552  4.709   1.00 0.00 ? 340 ILE A HD13   2  
ATOM   4077  N N      . PHE A 1 128 ? 33.600 10.473  -0.551  1.00 0.00 ? 341 PHE A N      2  
ATOM   4078  C CA     . PHE A 1 128 ? 33.687 9.338   -1.452  1.00 0.00 ? 341 PHE A CA     2  
ATOM   4079  C C      . PHE A 1 128 ? 35.127 9.114   -1.917  1.00 0.00 ? 341 PHE A C      2  
ATOM   4080  O O      . PHE A 1 128 ? 35.608 7.983   -1.940  1.00 0.00 ? 341 PHE A O      2  
ATOM   4081  C CB     . PHE A 1 128 ? 32.817 9.663   -2.668  1.00 0.00 ? 341 PHE A CB     2  
ATOM   4082  C CG     . PHE A 1 128 ? 31.352 9.247   -2.515  1.00 0.00 ? 341 PHE A CG     2  
ATOM   4083  C CD1    . PHE A 1 128 ? 31.043 7.994   -2.085  1.00 0.00 ? 341 PHE A CD1    2  
ATOM   4084  C CD2    . PHE A 1 128 ? 30.360 10.130  -2.808  1.00 0.00 ? 341 PHE A CD2    2  
ATOM   4085  C CE1    . PHE A 1 128 ? 29.685 7.608   -1.943  1.00 0.00 ? 341 PHE A CE1    2  
ATOM   4086  C CE2    . PHE A 1 128 ? 29.001 9.743   -2.666  1.00 0.00 ? 341 PHE A CE2    2  
ATOM   4087  C CZ     . PHE A 1 128 ? 28.692 8.490   -2.236  1.00 0.00 ? 341 PHE A CZ     2  
ATOM   4088  H H      . PHE A 1 128 ? 33.177 11.291  -0.941  1.00 0.00 ? 341 PHE A H      2  
ATOM   4089  H HA     . PHE A 1 128 ? 33.345 8.461   -0.902  1.00 0.00 ? 341 PHE A HA     2  
ATOM   4090  H HB2    . PHE A 1 128 ? 32.861 10.736  -2.856  1.00 0.00 ? 341 PHE A HB2    2  
ATOM   4091  H HB3    . PHE A 1 128 ? 33.235 9.169   -3.545  1.00 0.00 ? 341 PHE A HB3    2  
ATOM   4092  H HD1    . PHE A 1 128 ? 31.838 7.287   -1.849  1.00 0.00 ? 341 PHE A HD1    2  
ATOM   4093  H HD2    . PHE A 1 128 ? 30.608 11.133  -3.152  1.00 0.00 ? 341 PHE A HD2    2  
ATOM   4094  H HE1    . PHE A 1 128 ? 29.437 6.603   -1.598  1.00 0.00 ? 341 PHE A HE1    2  
ATOM   4095  H HE2    . PHE A 1 128 ? 28.206 10.450  -2.901  1.00 0.00 ? 341 PHE A HE2    2  
ATOM   4096  H HZ     . PHE A 1 128 ? 27.649 8.193   -2.126  1.00 0.00 ? 341 PHE A HZ     2  
ATOM   4097  N N      . ARG A 1 129 ? 35.777 10.213  -2.275  1.00 0.00 ? 342 ARG A N      2  
ATOM   4098  C CA     . ARG A 1 129 ? 37.153 10.152  -2.738  1.00 0.00 ? 342 ARG A CA     2  
ATOM   4099  C C      . ARG A 1 129 ? 38.070 9.664   -1.614  1.00 0.00 ? 342 ARG A C      2  
ATOM   4100  O O      . ARG A 1 129 ? 39.077 9.007   -1.870  1.00 0.00 ? 342 ARG A O      2  
ATOM   4101  C CB     . ARG A 1 129 ? 37.633 11.522  -3.221  1.00 0.00 ? 342 ARG A CB     2  
ATOM   4102  C CG     . ARG A 1 129 ? 39.158 11.556  -3.343  1.00 0.00 ? 342 ARG A CG     2  
ATOM   4103  C CD     . ARG A 1 129 ? 39.806 11.939  -2.012  1.00 0.00 ? 342 ARG A CD     2  
ATOM   4104  N NE     . ARG A 1 129 ? 41.060 12.686  -2.255  1.00 0.00 ? 342 ARG A NE     2  
ATOM   4105  C CZ     . ARG A 1 129 ? 41.118 14.008  -2.465  1.00 0.00 ? 342 ARG A CZ     2  
ATOM   4106  N NH1    . ARG A 1 129 ? 39.993 14.737  -2.462  1.00 0.00 ? 342 ARG A NH1    2  
ATOM   4107  N NH2    . ARG A 1 129 ? 42.300 14.603  -2.678  1.00 0.00 ? 342 ARG A NH2    2  
ATOM   4108  H H      . ARG A 1 129 ? 35.379 11.129  -2.253  1.00 0.00 ? 342 ARG A H      2  
ATOM   4109  H HA     . ARG A 1 129 ? 37.137 9.443   -3.565  1.00 0.00 ? 342 ARG A HA     2  
ATOM   4110  H HB2    . ARG A 1 129 ? 37.181 11.749  -4.186  1.00 0.00 ? 342 ARG A HB2    2  
ATOM   4111  H HB3    . ARG A 1 129 ? 37.303 12.292  -2.525  1.00 0.00 ? 342 ARG A HB3    2  
ATOM   4112  H HG2    . ARG A 1 129 ? 39.523 10.580  -3.662  1.00 0.00 ? 342 ARG A HG2    2  
ATOM   4113  H HG3    . ARG A 1 129 ? 39.449 12.272  -4.112  1.00 0.00 ? 342 ARG A HG3    2  
ATOM   4114  H HD2    . ARG A 1 129 ? 39.119 12.547  -1.424  1.00 0.00 ? 342 ARG A HD2    2  
ATOM   4115  H HD3    . ARG A 1 129 ? 40.015 11.042  -1.428  1.00 0.00 ? 342 ARG A HD3    2  
ATOM   4116  H HE     . ARG A 1 129 ? 41.918 12.173  -2.264  1.00 0.00 ? 342 ARG A HE     2  
ATOM   4117  H HH11   . ARG A 1 129 ? 39.110 14.294  -2.303  1.00 0.00 ? 342 ARG A HH11   2  
ATOM   4118  H HH12   . ARG A 1 129 ? 40.036 15.724  -2.618  1.00 0.00 ? 342 ARG A HH12   2  
ATOM   4119  H HH21   . ARG A 1 129 ? 43.139 14.059  -2.680  1.00 0.00 ? 342 ARG A HH21   2  
ATOM   4120  H HH22   . ARG A 1 129 ? 42.343 15.589  -2.834  1.00 0.00 ? 342 ARG A HH22   2  
ATOM   4121  N N      . LYS A 1 130 ? 37.687 10.006  -0.392  1.00 0.00 ? 343 LYS A N      2  
ATOM   4122  C CA     . LYS A 1 130 ? 38.462 9.612   0.773   1.00 0.00 ? 343 LYS A CA     2  
ATOM   4123  C C      . LYS A 1 130 ? 38.270 8.115   1.024   1.00 0.00 ? 343 LYS A C      2  
ATOM   4124  O O      . LYS A 1 130 ? 39.212 7.421   1.405   1.00 0.00 ? 343 LYS A O      2  
ATOM   4125  C CB     . LYS A 1 130 ? 38.105 10.488  1.975   1.00 0.00 ? 343 LYS A CB     2  
ATOM   4126  C CG     . LYS A 1 130 ? 39.197 11.528  2.238   1.00 0.00 ? 343 LYS A CG     2  
ATOM   4127  C CD     . LYS A 1 130 ? 39.268 12.548  1.100   1.00 0.00 ? 343 LYS A CD     2  
ATOM   4128  C CE     . LYS A 1 130 ? 39.340 13.975  1.646   1.00 0.00 ? 343 LYS A CE     2  
ATOM   4129  N NZ     . LYS A 1 130 ? 40.734 14.472  1.613   1.00 0.00 ? 343 LYS A NZ     2  
ATOM   4130  H H      . LYS A 1 130 ? 36.866 10.541  -0.192  1.00 0.00 ? 343 LYS A H      2  
ATOM   4131  H HA     . LYS A 1 130 ? 39.512 9.792   0.543   1.00 0.00 ? 343 LYS A HA     2  
ATOM   4132  H HB2    . LYS A 1 130 ? 37.155 10.991  1.795   1.00 0.00 ? 343 LYS A HB2    2  
ATOM   4133  H HB3    . LYS A 1 130 ? 37.973 9.863   2.858   1.00 0.00 ? 343 LYS A HB3    2  
ATOM   4134  H HG2    . LYS A 1 130 ? 38.996 12.041  3.179   1.00 0.00 ? 343 LYS A HG2    2  
ATOM   4135  H HG3    . LYS A 1 130 ? 40.160 11.031  2.346   1.00 0.00 ? 343 LYS A HG3    2  
ATOM   4136  H HD2    . LYS A 1 130 ? 40.142 12.347  0.480   1.00 0.00 ? 343 LYS A HD2    2  
ATOM   4137  H HD3    . LYS A 1 130 ? 38.392 12.445  0.459   1.00 0.00 ? 343 LYS A HD3    2  
ATOM   4138  H HE2    . LYS A 1 130 ? 38.700 14.631  1.056   1.00 0.00 ? 343 LYS A HE2    2  
ATOM   4139  H HE3    . LYS A 1 130 ? 38.964 14.000  2.669   1.00 0.00 ? 343 LYS A HE3    2  
ATOM   4140  H HZ1    . LYS A 1 130 ? 41.084 14.546  2.547   1.00 0.00 ? 343 LYS A HZ1    2  
ATOM   4141  H HZ2    . LYS A 1 130 ? 41.303 13.836  1.093   1.00 0.00 ? 343 LYS A HZ2    2  
ATOM   4142  H HZ3    . LYS A 1 130 ? 40.757 15.372  1.177   1.00 0.00 ? 343 LYS A HZ3    2  
ATOM   4143  N N      . THR A 1 131 ? 37.046 7.661   0.801   1.00 0.00 ? 344 THR A N      2  
ATOM   4144  C CA     . THR A 1 131 ? 36.719 6.260   0.999   1.00 0.00 ? 344 THR A CA     2  
ATOM   4145  C C      . THR A 1 131 ? 37.229 5.423   -0.176  1.00 0.00 ? 344 THR A C      2  
ATOM   4146  O O      . THR A 1 131 ? 37.618 4.270   0.001   1.00 0.00 ? 344 THR A O      2  
ATOM   4147  C CB     . THR A 1 131 ? 35.209 6.152   1.212   1.00 0.00 ? 344 THR A CB     2  
ATOM   4148  O OG1    . THR A 1 131 ? 35.036 6.394   2.606   1.00 0.00 ? 344 THR A OG1    2  
ATOM   4149  C CG2    . THR A 1 131 ? 34.689 4.726   1.015   1.00 0.00 ? 344 THR A CG2    2  
ATOM   4150  H H      . THR A 1 131 ? 36.286 8.232   0.492   1.00 0.00 ? 344 THR A H      2  
ATOM   4151  H HA     . THR A 1 131 ? 37.238 5.908   1.890   1.00 0.00 ? 344 THR A HA     2  
ATOM   4152  H HB     . THR A 1 131 ? 34.673 6.853   0.572   1.00 0.00 ? 344 THR A HB     2  
ATOM   4153  H HG1    . THR A 1 131 ? 35.349 7.316   2.834   1.00 0.00 ? 344 THR A HG1    2  
ATOM   4154  H HG21   . THR A 1 131 ? 33.600 4.734   1.005   1.00 0.00 ? 344 THR A HG21   2  
ATOM   4155  H HG22   . THR A 1 131 ? 35.059 4.332   0.069   1.00 0.00 ? 344 THR A HG22   2  
ATOM   4156  H HG23   . THR A 1 131 ? 35.040 4.096   1.833   1.00 0.00 ? 344 THR A HG23   2  
ATOM   4157  N N      . ALA A 1 132 ? 37.208 6.036   -1.351  1.00 0.00 ? 345 ALA A N      2  
ATOM   4158  C CA     . ALA A 1 132 ? 37.664 5.362   -2.554  1.00 0.00 ? 345 ALA A CA     2  
ATOM   4159  C C      . ALA A 1 132 ? 39.180 5.170   -2.485  1.00 0.00 ? 345 ALA A C      2  
ATOM   4160  O O      . ALA A 1 132 ? 39.707 4.174   -2.978  1.00 0.00 ? 345 ALA A O      2  
ATOM   4161  C CB     . ALA A 1 132 ? 37.233 6.165   -3.784  1.00 0.00 ? 345 ALA A CB     2  
ATOM   4162  H H      . ALA A 1 132 ? 36.889 6.974   -1.487  1.00 0.00 ? 345 ALA A H      2  
ATOM   4163  H HA     . ALA A 1 132 ? 37.183 4.384   -2.588  1.00 0.00 ? 345 ALA A HA     2  
ATOM   4164  H HB1    . ALA A 1 132 ? 37.119 5.494   -4.634  1.00 0.00 ? 345 ALA A HB1    2  
ATOM   4165  H HB2    . ALA A 1 132 ? 36.283 6.659   -3.580  1.00 0.00 ? 345 ALA A HB2    2  
ATOM   4166  H HB3    . ALA A 1 132 ? 37.991 6.915   -4.011  1.00 0.00 ? 345 ALA A HB3    2  
ATOM   4167  N N      . LEU A 1 133 ? 39.839 6.140   -1.867  1.00 0.00 ? 346 LEU A N      2  
ATOM   4168  C CA     . LEU A 1 133 ? 41.284 6.090   -1.726  1.00 0.00 ? 346 LEU A CA     2  
ATOM   4169  C C      . LEU A 1 133 ? 41.656 5.019   -0.700  1.00 0.00 ? 346 LEU A C      2  
ATOM   4170  O O      . LEU A 1 133 ? 42.597 4.254   -0.908  1.00 0.00 ? 346 LEU A O      2  
ATOM   4171  C CB     . LEU A 1 133 ? 41.837 7.478   -1.395  1.00 0.00 ? 346 LEU A CB     2  
ATOM   4172  C CG     . LEU A 1 133 ? 42.043 7.780   0.090   1.00 0.00 ? 346 LEU A CG     2  
ATOM   4173  C CD1    . LEU A 1 133 ? 43.401 7.266   0.571   1.00 0.00 ? 346 LEU A CD1    2  
ATOM   4174  C CD2    . LEU A 1 133 ? 41.862 9.273   0.375   1.00 0.00 ? 346 LEU A CD2    2  
ATOM   4175  H H      . LEU A 1 133 ? 39.402 6.946   -1.468  1.00 0.00 ? 346 LEU A H      2  
ATOM   4176  H HA     . LEU A 1 133 ? 41.697 5.800   -2.693  1.00 0.00 ? 346 LEU A HA     2  
ATOM   4177  H HB2    . LEU A 1 133 ? 42.793 7.596   -1.906  1.00 0.00 ? 346 LEU A HB2    2  
ATOM   4178  H HB3    . LEU A 1 133 ? 41.160 8.225   -1.808  1.00 0.00 ? 346 LEU A HB3    2  
ATOM   4179  H HG     . LEU A 1 133 ? 41.279 7.249   0.657   1.00 0.00 ? 346 LEU A HG     2  
ATOM   4180  H HD11   . LEU A 1 133 ? 43.722 6.438   -0.062  1.00 0.00 ? 346 LEU A HD11   2  
ATOM   4181  H HD12   . LEU A 1 133 ? 44.135 8.069   0.517   1.00 0.00 ? 346 LEU A HD12   2  
ATOM   4182  H HD13   . LEU A 1 133 ? 43.315 6.922   1.603   1.00 0.00 ? 346 LEU A HD13   2  
ATOM   4183  H HD21   . LEU A 1 133 ? 42.838 9.757   0.410   1.00 0.00 ? 346 LEU A HD21   2  
ATOM   4184  H HD22   . LEU A 1 133 ? 41.261 9.723   -0.414  1.00 0.00 ? 346 LEU A HD22   2  
ATOM   4185  H HD23   . LEU A 1 133 ? 41.359 9.401   1.334   1.00 0.00 ? 346 LEU A HD23   2  
ATOM   4186  N N      . GLU A 1 134 ? 40.897 4.996   0.386   1.00 0.00 ? 347 GLU A N      2  
ATOM   4187  C CA     . GLU A 1 134 ? 41.135 4.030   1.445   1.00 0.00 ? 347 GLU A CA     2  
ATOM   4188  C C      . GLU A 1 134 ? 40.810 2.617   0.958   1.00 0.00 ? 347 GLU A C      2  
ATOM   4189  O O      . GLU A 1 134 ? 41.542 1.673   1.250   1.00 0.00 ? 347 GLU A O      2  
ATOM   4190  C CB     . GLU A 1 134 ? 40.326 4.379   2.697   1.00 0.00 ? 347 GLU A CB     2  
ATOM   4191  C CG     . GLU A 1 134 ? 41.200 5.083   3.737   1.00 0.00 ? 347 GLU A CG     2  
ATOM   4192  C CD     . GLU A 1 134 ? 41.555 4.137   4.886   1.00 0.00 ? 347 GLU A CD     2  
ATOM   4193  O OE1    . GLU A 1 134 ? 40.711 3.335   5.312   1.00 0.00 ? 347 GLU A OE1    2  
ATOM   4194  O OE2    . GLU A 1 134 ? 42.758 4.256   5.337   1.00 0.00 ? 347 GLU A OE2    2  
ATOM   4195  H H      . GLU A 1 134 ? 40.133 5.621   0.548   1.00 0.00 ? 347 GLU A H      2  
ATOM   4196  H HA     . GLU A 1 134 ? 42.198 4.108   1.675   1.00 0.00 ? 347 GLU A HA     2  
ATOM   4197  H HB2    . GLU A 1 134 ? 39.488 5.021   2.426   1.00 0.00 ? 347 GLU A HB2    2  
ATOM   4198  H HB3    . GLU A 1 134 ? 39.905 3.470   3.127   1.00 0.00 ? 347 GLU A HB3    2  
ATOM   4199  H HG2    . GLU A 1 134 ? 42.113 5.446   3.263   1.00 0.00 ? 347 GLU A HG2    2  
ATOM   4200  H HG3    . GLU A 1 134 ? 40.676 5.956   4.127   1.00 0.00 ? 347 GLU A HG3    2  
ATOM   4201  H HE2    . GLU A 1 134 ? 42.736 4.452   6.318   1.00 0.00 ? 347 GLU A HE2    2  
ATOM   4202  N N      . ARG A 1 135 ? 39.711 2.517   0.225   1.00 0.00 ? 348 ARG A N      2  
ATOM   4203  C CA     . ARG A 1 135 ? 39.280 1.234   -0.304  1.00 0.00 ? 348 ARG A CA     2  
ATOM   4204  C C      . ARG A 1 135 ? 40.218 0.780   -1.424  1.00 0.00 ? 348 ARG A C      2  
ATOM   4205  O O      . ARG A 1 135 ? 40.596 -0.389  -1.487  1.00 0.00 ? 348 ARG A O      2  
ATOM   4206  C CB     . ARG A 1 135 ? 37.851 1.314   -0.848  1.00 0.00 ? 348 ARG A CB     2  
ATOM   4207  C CG     . ARG A 1 135 ? 36.840 0.842   0.199   1.00 0.00 ? 348 ARG A CG     2  
ATOM   4208  C CD     . ARG A 1 135 ? 36.582 1.929   1.243   1.00 0.00 ? 348 ARG A CD     2  
ATOM   4209  N NE     . ARG A 1 135 ? 35.709 1.404   2.317   1.00 0.00 ? 348 ARG A NE     2  
ATOM   4210  C CZ     . ARG A 1 135 ? 34.399 1.161   2.169   1.00 0.00 ? 348 ARG A CZ     2  
ATOM   4211  N NH1    . ARG A 1 135 ? 33.803 1.395   0.993   1.00 0.00 ? 348 ARG A NH1    2  
ATOM   4212  N NH2    . ARG A 1 135 ? 33.686 0.684   3.199   1.00 0.00 ? 348 ARG A NH2    2  
ATOM   4213  H H      . ARG A 1 135 ? 39.121 3.290   -0.006  1.00 0.00 ? 348 ARG A H      2  
ATOM   4214  H HA     . ARG A 1 135 ? 39.324 0.553   0.544   1.00 0.00 ? 348 ARG A HA     2  
ATOM   4215  H HB2    . ARG A 1 135 ? 37.626 2.341   -1.138  1.00 0.00 ? 348 ARG A HB2    2  
ATOM   4216  H HB3    . ARG A 1 135 ? 37.764 0.703   -1.745  1.00 0.00 ? 348 ARG A HB3    2  
ATOM   4217  H HG2    . ARG A 1 135 ? 35.904 0.572   -0.291  1.00 0.00 ? 348 ARG A HG2    2  
ATOM   4218  H HG3    . ARG A 1 135 ? 37.213 -0.057  0.690   1.00 0.00 ? 348 ARG A HG3    2  
ATOM   4219  H HD2    . ARG A 1 135 ? 37.526 2.271   1.665   1.00 0.00 ? 348 ARG A HD2    2  
ATOM   4220  H HD3    . ARG A 1 135 ? 36.112 2.793   0.771   1.00 0.00 ? 348 ARG A HD3    2  
ATOM   4221  H HE     . ARG A 1 135 ? 36.123 1.218   3.208   1.00 0.00 ? 348 ARG A HE     2  
ATOM   4222  H HH11   . ARG A 1 135 ? 34.335 1.751   0.224   1.00 0.00 ? 348 ARG A HH11   2  
ATOM   4223  H HH12   . ARG A 1 135 ? 32.826 1.215   0.882   1.00 0.00 ? 348 ARG A HH12   2  
ATOM   4224  H HH21   . ARG A 1 135 ? 34.131 0.510   4.077   1.00 0.00 ? 348 ARG A HH21   2  
ATOM   4225  H HH22   . ARG A 1 135 ? 32.709 0.503   3.088   1.00 0.00 ? 348 ARG A HH22   2  
ATOM   4226  N N      . ARG A 1 136 ? 40.568 1.728   -2.281  1.00 0.00 ? 349 ARG A N      2  
ATOM   4227  C CA     . ARG A 1 136 ? 41.456 1.441   -3.395  1.00 0.00 ? 349 ARG A CA     2  
ATOM   4228  C C      . ARG A 1 136 ? 42.861 1.115   -2.883  1.00 0.00 ? 349 ARG A C      2  
ATOM   4229  O O      . ARG A 1 136 ? 43.496 0.176   -3.359  1.00 0.00 ? 349 ARG A O      2  
ATOM   4230  C CB     . ARG A 1 136 ? 41.533 2.626   -4.358  1.00 0.00 ? 349 ARG A CB     2  
ATOM   4231  C CG     . ARG A 1 136 ? 42.498 2.335   -5.509  1.00 0.00 ? 349 ARG A CG     2  
ATOM   4232  C CD     . ARG A 1 136 ? 43.403 3.538   -5.783  1.00 0.00 ? 349 ARG A CD     2  
ATOM   4233  N NE     . ARG A 1 136 ? 44.032 3.405   -7.116  1.00 0.00 ? 349 ARG A NE     2  
ATOM   4234  C CZ     . ARG A 1 136 ? 44.978 4.230   -7.586  1.00 0.00 ? 349 ARG A CZ     2  
ATOM   4235  N NH1    . ARG A 1 136 ? 45.410 5.251   -6.835  1.00 0.00 ? 349 ARG A NH1    2  
ATOM   4236  N NH2    . ARG A 1 136 ? 45.492 4.033   -8.809  1.00 0.00 ? 349 ARG A NH2    2  
ATOM   4237  H H      . ARG A 1 136 ? 40.256 2.677   -2.223  1.00 0.00 ? 349 ARG A H      2  
ATOM   4238  H HA     . ARG A 1 136 ? 41.010 0.578   -3.891  1.00 0.00 ? 349 ARG A HA     2  
ATOM   4239  H HB2    . ARG A 1 136 ? 40.542 2.842   -4.756  1.00 0.00 ? 349 ARG A HB2    2  
ATOM   4240  H HB3    . ARG A 1 136 ? 41.861 3.516   -3.820  1.00 0.00 ? 349 ARG A HB3    2  
ATOM   4241  H HG2    . ARG A 1 136 ? 43.106 1.464   -5.267  1.00 0.00 ? 349 ARG A HG2    2  
ATOM   4242  H HG3    . ARG A 1 136 ? 41.933 2.089   -6.409  1.00 0.00 ? 349 ARG A HG3    2  
ATOM   4243  H HD2    . ARG A 1 136 ? 42.823 4.459   -5.735  1.00 0.00 ? 349 ARG A HD2    2  
ATOM   4244  H HD3    . ARG A 1 136 ? 44.173 3.606   -5.014  1.00 0.00 ? 349 ARG A HD3    2  
ATOM   4245  H HE     . ARG A 1 136 ? 43.732 2.654   -7.703  1.00 0.00 ? 349 ARG A HE     2  
ATOM   4246  H HH11   . ARG A 1 136 ? 45.027 5.398   -5.923  1.00 0.00 ? 349 ARG A HH11   2  
ATOM   4247  H HH12   . ARG A 1 136 ? 46.116 5.867   -7.185  1.00 0.00 ? 349 ARG A HH12   2  
ATOM   4248  H HH21   . ARG A 1 136 ? 45.169 3.271   -9.370  1.00 0.00 ? 349 ARG A HH21   2  
ATOM   4249  H HH22   . ARG A 1 136 ? 46.197 4.649   -9.159  1.00 0.00 ? 349 ARG A HH22   2  
ATOM   4250  N N      . GLY A 1 137 ? 43.305 1.911   -1.921  1.00 0.00 ? 350 GLY A N      2  
ATOM   4251  C CA     . GLY A 1 137 ? 44.623 1.720   -1.341  1.00 0.00 ? 350 GLY A CA     2  
ATOM   4252  C C      . GLY A 1 137 ? 44.704 2.344   0.054   1.00 0.00 ? 350 GLY A C      2  
ATOM   4253  O O      . GLY A 1 137 ? 43.918 2.006   0.937   1.00 0.00 ? 350 GLY A O      2  
ATOM   4254  H H      . GLY A 1 137 ? 42.782 2.673   -1.540  1.00 0.00 ? 350 GLY A H      2  
ATOM   4255  H HA2    . GLY A 1 137 ? 44.846 0.654   -1.279  1.00 0.00 ? 350 GLY A HA2    2  
ATOM   4256  H HA3    . GLY A 1 137 ? 45.378 2.166   -1.988  1.00 0.00 ? 350 GLY A HA3    2  
ATOM   4257  N N      . ALA A 1 138 ? 45.662 3.247   0.208   1.00 0.00 ? 351 ALA A N      2  
ATOM   4258  C CA     . ALA A 1 138 ? 45.856 3.923   1.480   1.00 0.00 ? 351 ALA A CA     2  
ATOM   4259  C C      . ALA A 1 138 ? 46.149 2.884   2.564   1.00 0.00 ? 351 ALA A C      2  
ATOM   4260  O O      . ALA A 1 138 ? 46.004 3.165   3.753   1.00 0.00 ? 351 ALA A O      2  
ATOM   4261  C CB     . ALA A 1 138 ? 44.623 4.769   1.801   1.00 0.00 ? 351 ALA A CB     2  
ATOM   4262  H H      . ALA A 1 138 ? 46.298 3.516   -0.515  1.00 0.00 ? 351 ALA A H      2  
ATOM   4263  H HA     . ALA A 1 138 ? 46.718 4.582   1.377   1.00 0.00 ? 351 ALA A HA     2  
ATOM   4264  H HB1    . ALA A 1 138 ? 44.928 5.799   1.989   1.00 0.00 ? 351 ALA A HB1    2  
ATOM   4265  H HB2    . ALA A 1 138 ? 43.933 4.743   0.957   1.00 0.00 ? 351 ALA A HB2    2  
ATOM   4266  H HB3    . ALA A 1 138 ? 44.128 4.369   2.686   1.00 0.00 ? 351 ALA A HB3    2  
ATOM   4267  N N      . ALA A 1 139 ? 46.557 1.706   2.116   1.00 0.00 ? 352 ALA A N      2  
ATOM   4268  C CA     . ALA A 1 139 ? 46.871 0.624   3.034   1.00 0.00 ? 352 ALA A CA     2  
ATOM   4269  C C      . ALA A 1 139 ? 48.391 0.467   3.128   1.00 0.00 ? 352 ALA A C      2  
ATOM   4270  O O      . ALA A 1 139 ? 49.132 1.113   2.389   1.00 0.00 ? 352 ALA A O      2  
ATOM   4271  C CB     . ALA A 1 139 ? 46.181 -0.659  2.567   1.00 0.00 ? 352 ALA A CB     2  
ATOM   4272  H H      . ALA A 1 139 ? 46.672 1.486   1.148   1.00 0.00 ? 352 ALA A H      2  
ATOM   4273  H HA     . ALA A 1 139 ? 46.481 0.897   4.014   1.00 0.00 ? 352 ALA A HA     2  
ATOM   4274  H HB1    . ALA A 1 139 ? 46.854 -1.218  1.917   1.00 0.00 ? 352 ALA A HB1    2  
ATOM   4275  H HB2    . ALA A 1 139 ? 45.923 -1.269  3.434   1.00 0.00 ? 352 ALA A HB2    2  
ATOM   4276  H HB3    . ALA A 1 139 ? 45.274 -0.405  2.020   1.00 0.00 ? 352 ALA A HB3    2  
ATOM   4277  N N      . ALA A 1 140 ? 48.809 -0.393  4.045   1.00 0.00 ? 353 ALA A N      2  
ATOM   4278  C CA     . ALA A 1 140 ? 50.226 -0.643  4.246   1.00 0.00 ? 353 ALA A CA     2  
ATOM   4279  C C      . ALA A 1 140 ? 50.904 -0.826  2.886   1.00 0.00 ? 353 ALA A C      2  
ATOM   4280  O O      . ALA A 1 140 ? 50.634 -1.795  2.179   1.00 0.00 ? 353 ALA A O      2  
ATOM   4281  C CB     . ALA A 1 140 ? 50.407 -1.859  5.156   1.00 0.00 ? 353 ALA A CB     2  
ATOM   4282  H H      . ALA A 1 140 ? 48.199 -0.915  4.642   1.00 0.00 ? 353 ALA A H      2  
ATOM   4283  H HA     . ALA A 1 140 ? 50.650 0.232   4.739   1.00 0.00 ? 353 ALA A HA     2  
ATOM   4284  H HB1    . ALA A 1 140 ? 49.885 -1.689  6.098   1.00 0.00 ? 353 ALA A HB1    2  
ATOM   4285  H HB2    . ALA A 1 140 ? 49.995 -2.743  4.668   1.00 0.00 ? 353 ALA A HB2    2  
ATOM   4286  H HB3    . ALA A 1 140 ? 51.467 -2.012  5.352   1.00 0.00 ? 353 ALA A HB3    2  
ATOM   4287  N N      . SER A 1 141 ? 51.773 0.120   2.563   1.00 0.00 ? 354 SER A N      2  
ATOM   4288  C CA     . SER A 1 141 ? 52.493 0.075   1.301   1.00 0.00 ? 354 SER A CA     2  
ATOM   4289  C C      . SER A 1 141 ? 52.997 -1.344  1.037   1.00 0.00 ? 354 SER A C      2  
ATOM   4290  O O      . SER A 1 141 ? 53.288 -2.088  1.972   1.00 0.00 ? 354 SER A O      2  
ATOM   4291  C CB     . SER A 1 141 ? 53.661 1.063   1.298   1.00 0.00 ? 354 SER A CB     2  
ATOM   4292  O OG     . SER A 1 141 ? 53.252 2.377   1.666   1.00 0.00 ? 354 SER A OG     2  
ATOM   4293  H H      . SER A 1 141 ? 51.988 0.905   3.144   1.00 0.00 ? 354 SER A H      2  
ATOM   4294  H HA     . SER A 1 141 ? 51.767 0.370   0.544   1.00 0.00 ? 354 SER A HA     2  
ATOM   4295  H HB2    . SER A 1 141 ? 54.431 0.717   1.989   1.00 0.00 ? 354 SER A HB2    2  
ATOM   4296  H HB3    . SER A 1 141 ? 54.113 1.088   0.306   1.00 0.00 ? 354 SER A HB3    2  
ATOM   4297  H HG     . SER A 1 141 ? 52.253 2.436   1.667   1.00 0.00 ? 354 SER A HG     2  
ATOM   4298  N N      . ALA A 1 142 ? 53.085 -1.678  -0.243  1.00 0.00 ? 355 ALA A N      2  
ATOM   4299  C CA     . ALA A 1 142 ? 53.548 -2.996  -0.642  1.00 0.00 ? 355 ALA A CA     2  
ATOM   4300  C C      . ALA A 1 142 ? 52.620 -4.059  -0.052  1.00 0.00 ? 355 ALA A C      2  
ATOM   4301  O O      . ALA A 1 142 ? 51.401 -3.968  -0.187  1.00 0.00 ? 355 ALA A O      2  
ATOM   4302  C CB     . ALA A 1 142 ? 55.002 -3.182  -0.201  1.00 0.00 ? 355 ALA A CB     2  
ATOM   4303  H H      . ALA A 1 142 ? 52.846 -1.067  -0.998  1.00 0.00 ? 355 ALA A H      2  
ATOM   4304  H HA     . ALA A 1 142 ? 53.502 -3.049  -1.730  1.00 0.00 ? 355 ALA A HA     2  
ATOM   4305  H HB1    . ALA A 1 142 ? 55.101 -4.124  0.337   1.00 0.00 ? 355 ALA A HB1    2  
ATOM   4306  H HB2    . ALA A 1 142 ? 55.648 -3.194  -1.079  1.00 0.00 ? 355 ALA A HB2    2  
ATOM   4307  H HB3    . ALA A 1 142 ? 55.291 -2.358  0.451   1.00 0.00 ? 355 ALA A HB3    2  
HETATM 4308  P P      . CMP B 2 .   ? 34.291 -0.792  -5.968  1.00 0.00 ? 370 CMP A P      2  
HETATM 4309  O O1P    . CMP B 2 .   ? 35.707 -0.798  -6.396  1.00 0.00 ? 370 CMP A O1P    2  
HETATM 4310  O O2P    . CMP B 2 .   ? 33.467 0.244   -6.886  1.00 0.00 ? 370 CMP A O2P    2  
HETATM 4311  O "O5'"  . CMP B 2 .   ? 33.677 -2.263  -6.152  1.00 0.00 ? 370 CMP A "O5'"  2  
HETATM 4312  C "C5'"  . CMP B 2 .   ? 34.351 -3.154  -5.251  1.00 0.00 ? 370 CMP A "C5'"  2  
HETATM 4313  C "C4'"  . CMP B 2 .   ? 34.139 -2.635  -3.841  1.00 0.00 ? 370 CMP A "C4'"  2  
HETATM 4314  O "O4'"  . CMP B 2 .   ? 34.684 -3.438  -2.796  1.00 0.00 ? 370 CMP A "O4'"  2  
HETATM 4315  C "C3'"  . CMP B 2 .   ? 34.914 -1.300  -3.694  1.00 0.00 ? 370 CMP A "C3'"  2  
HETATM 4316  O "O3'"  . CMP B 2 .   ? 34.206 -0.319  -4.426  1.00 0.00 ? 370 CMP A "O3'"  2  
HETATM 4317  C "C2'"  . CMP B 2 .   ? 34.907 -1.121  -2.166  1.00 0.00 ? 370 CMP A "C2'"  2  
HETATM 4318  O "O2'"  . CMP B 2 .   ? 33.800 -0.315  -1.759  1.00 0.00 ? 370 CMP A "O2'"  2  
HETATM 4319  C "C1'"  . CMP B 2 .   ? 34.770 -2.569  -1.643  1.00 0.00 ? 370 CMP A "C1'"  2  
HETATM 4320  N N9     . CMP B 2 .   ? 35.942 -2.922  -0.837  1.00 0.00 ? 370 CMP A N9     2  
HETATM 4321  C C8     . CMP B 2 .   ? 37.167 -3.283  -1.313  1.00 0.00 ? 370 CMP A C8     2  
HETATM 4322  N N7     . CMP B 2 .   ? 37.974 -3.529  -0.321  1.00 0.00 ? 370 CMP A N7     2  
HETATM 4323  C C5     . CMP B 2 .   ? 37.320 -3.336  0.850   1.00 0.00 ? 370 CMP A C5     2  
HETATM 4324  C C6     . CMP B 2 .   ? 37.668 -3.455  2.207   1.00 0.00 ? 370 CMP A C6     2  
HETATM 4325  N N6     . CMP B 2 .   ? 38.945 -3.835  2.579   1.00 0.00 ? 370 CMP A N6     2  
HETATM 4326  N N1     . CMP B 2 .   ? 36.744 -3.187  3.122   1.00 0.00 ? 370 CMP A N1     2  
HETATM 4327  C C2     . CMP B 2 .   ? 35.524 -2.822  2.776   1.00 0.00 ? 370 CMP A C2     2  
HETATM 4328  N N3     . CMP B 2 .   ? 35.152 -2.704  1.519   1.00 0.00 ? 370 CMP A N3     2  
HETATM 4329  C C4     . CMP B 2 .   ? 36.009 -2.951  0.533   1.00 0.00 ? 370 CMP A C4     2  
HETATM 4330  H "H5'1" . CMP B 2 .   ? 35.418 -3.174  -5.480  1.00 0.00 ? 370 CMP A "H5'1" 2  
HETATM 4331  H "H5'2" . CMP B 2 .   ? 33.934 -4.158  -5.343  1.00 0.00 ? 370 CMP A "H5'2" 2  
HETATM 4332  H "H4'"  . CMP B 2 .   ? 33.076 -2.470  -3.665  1.00 0.00 ? 370 CMP A "H4'"  2  
HETATM 4333  H "H3'"  . CMP B 2 .   ? 35.885 -0.924  -3.802  1.00 0.00 ? 370 CMP A "H3'"  2  
HETATM 4334  H "H2'"  . CMP B 2 .   ? 35.846 -0.681  -1.828  1.00 0.00 ? 370 CMP A "H2'"  2  
HETATM 4335  H "HO2'" . CMP B 2 .   ? 33.849 -0.236  -0.797  1.00 0.00 ? 370 CMP A "HO2'" 2  
HETATM 4336  H "H1'"  . CMP B 2 .   ? 33.865 -2.662  -1.040  1.00 0.00 ? 370 CMP A "H1'"  2  
HETATM 4337  H H8     . CMP B 2 .   ? 37.430 -3.355  -2.358  1.00 0.00 ? 370 CMP A H8     2  
HETATM 4338  H HN61   . CMP B 2 .   ? 39.173 -3.910  3.519   1.00 0.00 ? 370 CMP A HN61   2  
HETATM 4339  H HN62   . CMP B 2 .   ? 39.610 -4.033  1.901   1.00 0.00 ? 370 CMP A HN62   2  
HETATM 4340  H H2     . CMP B 2 .   ? 34.803 -2.614  3.552   1.00 0.00 ? 370 CMP A H2     2  
ATOM   4341  N N      . GLY A 1 1   ? 7.343  -9.218  -3.927  1.00 0.00 ? 214 GLY A N      3  
ATOM   4342  C CA     . GLY A 1 1   ? 7.962  -8.210  -3.084  1.00 0.00 ? 214 GLY A CA     3  
ATOM   4343  C C      . GLY A 1 1   ? 6.997  -7.054  -2.813  1.00 0.00 ? 214 GLY A C      3  
ATOM   4344  O O      . GLY A 1 1   ? 5.924  -7.255  -2.247  1.00 0.00 ? 214 GLY A O      3  
ATOM   4345  H H1     . GLY A 1 1   ? 7.249  -8.965  -4.889  1.00 0.00 ? 214 GLY A H1     3  
ATOM   4346  H HA2    . GLY A 1 1   ? 8.270  -8.659  -2.139  1.00 0.00 ? 214 GLY A HA2    3  
ATOM   4347  H HA3    . GLY A 1 1   ? 8.863  -7.831  -3.566  1.00 0.00 ? 214 GLY A HA3    3  
ATOM   4348  N N      . SER A 1 2   ? 7.412  -5.867  -3.233  1.00 0.00 ? 215 SER A N      3  
ATOM   4349  C CA     . SER A 1 2   ? 6.598  -4.679  -3.044  1.00 0.00 ? 215 SER A CA     3  
ATOM   4350  C C      . SER A 1 2   ? 7.139  -3.532  -3.899  1.00 0.00 ? 215 SER A C      3  
ATOM   4351  O O      . SER A 1 2   ? 8.351  -3.371  -4.032  1.00 0.00 ? 215 SER A O      3  
ATOM   4352  C CB     . SER A 1 2   ? 6.557  -4.269  -1.570  1.00 0.00 ? 215 SER A CB     3  
ATOM   4353  O OG     . SER A 1 2   ? 5.247  -3.884  -1.160  1.00 0.00 ? 215 SER A OG     3  
ATOM   4354  H H      . SER A 1 2   ? 8.286  -5.712  -3.693  1.00 0.00 ? 215 SER A H      3  
ATOM   4355  H HA     . SER A 1 2   ? 5.596  -4.960  -3.371  1.00 0.00 ? 215 SER A HA     3  
ATOM   4356  H HB2    . SER A 1 2   ? 6.899  -5.099  -0.953  1.00 0.00 ? 215 SER A HB2    3  
ATOM   4357  H HB3    . SER A 1 2   ? 7.246  -3.442  -1.405  1.00 0.00 ? 215 SER A HB3    3  
ATOM   4358  H HG     . SER A 1 2   ? 4.564  -4.304  -1.757  1.00 0.00 ? 215 SER A HG     3  
ATOM   4359  N N      . GLN A 1 3   ? 6.215  -2.764  -4.456  1.00 0.00 ? 216 GLN A N      3  
ATOM   4360  C CA     . GLN A 1 3   ? 6.584  -1.636  -5.295  1.00 0.00 ? 216 GLN A CA     3  
ATOM   4361  C C      . GLN A 1 3   ? 5.683  -0.436  -4.997  1.00 0.00 ? 216 GLN A C      3  
ATOM   4362  O O      . GLN A 1 3   ? 6.092  0.496   -4.306  1.00 0.00 ? 216 GLN A O      3  
ATOM   4363  C CB     . GLN A 1 3   ? 6.525  -2.013  -6.777  1.00 0.00 ? 216 GLN A CB     3  
ATOM   4364  C CG     . GLN A 1 3   ? 7.923  -2.016  -7.397  1.00 0.00 ? 216 GLN A CG     3  
ATOM   4365  C CD     . GLN A 1 3   ? 8.186  -3.323  -8.148  1.00 0.00 ? 216 GLN A CD     3  
ATOM   4366  O OE1    . GLN A 1 3   ? 8.405  -4.372  -7.564  1.00 0.00 ? 216 GLN A OE1    3  
ATOM   4367  N NE2    . GLN A 1 3   ? 8.154  -3.202  -9.473  1.00 0.00 ? 216 GLN A NE2    3  
ATOM   4368  H H      . GLN A 1 3   ? 5.231  -2.902  -4.342  1.00 0.00 ? 216 GLN A H      3  
ATOM   4369  H HA     . GLN A 1 3   ? 7.613  -1.402  -5.027  1.00 0.00 ? 216 GLN A HA     3  
ATOM   4370  H HB2    . GLN A 1 3   ? 6.071  -2.998  -6.888  1.00 0.00 ? 216 GLN A HB2    3  
ATOM   4371  H HB3    . GLN A 1 3   ? 5.888  -1.306  -7.309  1.00 0.00 ? 216 GLN A HB3    3  
ATOM   4372  H HG2    . GLN A 1 3   ? 8.024  -1.173  -8.081  1.00 0.00 ? 216 GLN A HG2    3  
ATOM   4373  H HG3    . GLN A 1 3   ? 8.672  -1.884  -6.617  1.00 0.00 ? 216 GLN A HG3    3  
ATOM   4374  H HE21   . GLN A 1 3   ? 7.969  -2.312  -9.889  1.00 0.00 ? 216 GLN A HE21   3  
ATOM   4375  H HE22   . GLN A 1 3   ? 8.314  -4.002  -10.051 1.00 0.00 ? 216 GLN A HE22   3  
ATOM   4376  N N      . GLU A 1 4   ? 4.474  -0.498  -5.535  1.00 0.00 ? 217 GLU A N      3  
ATOM   4377  C CA     . GLU A 1 4   ? 3.511  0.573   -5.335  1.00 0.00 ? 217 GLU A CA     3  
ATOM   4378  C C      . GLU A 1 4   ? 2.168  0.001   -4.877  1.00 0.00 ? 217 GLU A C      3  
ATOM   4379  O O      . GLU A 1 4   ? 1.165  0.126   -5.577  1.00 0.00 ? 217 GLU A O      3  
ATOM   4380  C CB     . GLU A 1 4   ? 3.347  1.406   -6.608  1.00 0.00 ? 217 GLU A CB     3  
ATOM   4381  C CG     . GLU A 1 4   ? 4.623  2.190   -6.919  1.00 0.00 ? 217 GLU A CG     3  
ATOM   4382  C CD     . GLU A 1 4   ? 4.923  2.176   -8.420  1.00 0.00 ? 217 GLU A CD     3  
ATOM   4383  O OE1    . GLU A 1 4   ? 4.653  3.167   -9.115  1.00 0.00 ? 217 GLU A OE1    3  
ATOM   4384  O OE2    . GLU A 1 4   ? 5.457  1.087   -8.858  1.00 0.00 ? 217 GLU A OE2    3  
ATOM   4385  H H      . GLU A 1 4   ? 4.149  -1.259  -6.095  1.00 0.00 ? 217 GLU A H      3  
ATOM   4386  H HA     . GLU A 1 4   ? 3.933  1.200   -4.550  1.00 0.00 ? 217 GLU A HA     3  
ATOM   4387  H HB2    . GLU A 1 4   ? 3.104  0.752   -7.446  1.00 0.00 ? 217 GLU A HB2    3  
ATOM   4388  H HB3    . GLU A 1 4   ? 2.511  2.096   -6.490  1.00 0.00 ? 217 GLU A HB3    3  
ATOM   4389  H HG2    . GLU A 1 4   ? 4.515  3.219   -6.576  1.00 0.00 ? 217 GLU A HG2    3  
ATOM   4390  H HG3    . GLU A 1 4   ? 5.461  1.758   -6.373  1.00 0.00 ? 217 GLU A HG3    3  
ATOM   4391  H HE2    . GLU A 1 4   ? 5.909  1.257   -9.735  1.00 0.00 ? 217 GLU A HE2    3  
ATOM   4392  N N      . VAL A 1 5   ? 2.193  -0.613  -3.704  1.00 0.00 ? 218 VAL A N      3  
ATOM   4393  C CA     . VAL A 1 5   ? 0.989  -1.205  -3.144  1.00 0.00 ? 218 VAL A CA     3  
ATOM   4394  C C      . VAL A 1 5   ? 0.269  -0.166  -2.280  1.00 0.00 ? 218 VAL A C      3  
ATOM   4395  O O      . VAL A 1 5   ? -0.922 0.079   -2.462  1.00 0.00 ? 218 VAL A O      3  
ATOM   4396  C CB     . VAL A 1 5   ? 1.342  -2.480  -2.375  1.00 0.00 ? 218 VAL A CB     3  
ATOM   4397  C CG1    . VAL A 1 5   ? 0.212  -2.875  -1.422  1.00 0.00 ? 218 VAL A CG1    3  
ATOM   4398  C CG2    . VAL A 1 5   ? 1.676  -3.624  -3.335  1.00 0.00 ? 218 VAL A CG2    3  
ATOM   4399  H H      . VAL A 1 5   ? 3.013  -0.710  -3.139  1.00 0.00 ? 218 VAL A H      3  
ATOM   4400  H HA     . VAL A 1 5   ? 0.340  -1.480  -3.975  1.00 0.00 ? 218 VAL A HA     3  
ATOM   4401  H HB     . VAL A 1 5   ? 2.229  -2.276  -1.776  1.00 0.00 ? 218 VAL A HB     3  
ATOM   4402  H HG11   . VAL A 1 5   ? -0.733 -2.890  -1.965  1.00 0.00 ? 218 VAL A HG11   3  
ATOM   4403  H HG12   . VAL A 1 5   ? 0.412  -3.867  -1.013  1.00 0.00 ? 218 VAL A HG12   3  
ATOM   4404  H HG13   . VAL A 1 5   ? 0.152  -2.152  -0.608  1.00 0.00 ? 218 VAL A HG13   3  
ATOM   4405  H HG21   . VAL A 1 5   ? 0.882  -3.721  -4.074  1.00 0.00 ? 218 VAL A HG21   3  
ATOM   4406  H HG22   . VAL A 1 5   ? 2.618  -3.410  -3.840  1.00 0.00 ? 218 VAL A HG22   3  
ATOM   4407  H HG23   . VAL A 1 5   ? 1.767  -4.554  -2.774  1.00 0.00 ? 218 VAL A HG23   3  
ATOM   4408  N N      . ARG A 1 6   ? 1.024  0.415   -1.359  1.00 0.00 ? 219 ARG A N      3  
ATOM   4409  C CA     . ARG A 1 6   ? 0.473  1.422   -0.467  1.00 0.00 ? 219 ARG A CA     3  
ATOM   4410  C C      . ARG A 1 6   ? 1.600  2.229   0.183   1.00 0.00 ? 219 ARG A C      3  
ATOM   4411  O O      . ARG A 1 6   ? 1.635  2.380   1.402   1.00 0.00 ? 219 ARG A O      3  
ATOM   4412  C CB     . ARG A 1 6   ? -0.381 0.780   0.627   1.00 0.00 ? 219 ARG A CB     3  
ATOM   4413  C CG     . ARG A 1 6   ? -1.843 0.667   0.186   1.00 0.00 ? 219 ARG A CG     3  
ATOM   4414  C CD     . ARG A 1 6   ? -2.767 0.485   1.391   1.00 0.00 ? 219 ARG A CD     3  
ATOM   4415  N NE     . ARG A 1 6   ? -3.891 -0.411  1.036   1.00 0.00 ? 219 ARG A NE     3  
ATOM   4416  C CZ     . ARG A 1 6   ? -5.010 -0.003  0.423   1.00 0.00 ? 219 ARG A CZ     3  
ATOM   4417  N NH1    . ARG A 1 6   ? -5.163 1.286   0.093   1.00 0.00 ? 219 ARG A NH1    3  
ATOM   4418  N NH2    . ARG A 1 6   ? -5.978 -0.886  0.140   1.00 0.00 ? 219 ARG A NH2    3  
ATOM   4419  H H      . ARG A 1 6   ? 1.992  0.210   -1.218  1.00 0.00 ? 219 ARG A H      3  
ATOM   4420  H HA     . ARG A 1 6   ? -0.144 2.054   -1.107  1.00 0.00 ? 219 ARG A HA     3  
ATOM   4421  H HB2    . ARG A 1 6   ? 0.007  -0.210  0.863   1.00 0.00 ? 219 ARG A HB2    3  
ATOM   4422  H HB3    . ARG A 1 6   ? -0.319 1.374   1.539   1.00 0.00 ? 219 ARG A HB3    3  
ATOM   4423  H HG2    . ARG A 1 6   ? -2.130 1.562   -0.366  1.00 0.00 ? 219 ARG A HG2    3  
ATOM   4424  H HG3    . ARG A 1 6   ? -1.956 -0.177  -0.495  1.00 0.00 ? 219 ARG A HG3    3  
ATOM   4425  H HD2    . ARG A 1 6   ? -2.208 0.067   2.228   1.00 0.00 ? 219 ARG A HD2    3  
ATOM   4426  H HD3    . ARG A 1 6   ? -3.150 1.453   1.716   1.00 0.00 ? 219 ARG A HD3    3  
ATOM   4427  H HE     . ARG A 1 6   ? -3.810 -1.380  1.269   1.00 0.00 ? 219 ARG A HE     3  
ATOM   4428  H HH11   . ARG A 1 6   ? -4.441 1.945   0.304   1.00 0.00 ? 219 ARG A HH11   3  
ATOM   4429  H HH12   . ARG A 1 6   ? -5.999 1.590   -0.364  1.00 0.00 ? 219 ARG A HH12   3  
ATOM   4430  H HH21   . ARG A 1 6   ? -5.865 -1.848  0.387   1.00 0.00 ? 219 ARG A HH21   3  
ATOM   4431  H HH22   . ARG A 1 6   ? -6.814 -0.582  -0.317  1.00 0.00 ? 219 ARG A HH22   3  
ATOM   4432  N N      . ARG A 1 7   ? 2.492  2.725   -0.662  1.00 0.00 ? 220 ARG A N      3  
ATOM   4433  C CA     . ARG A 1 7   ? 3.616  3.513   -0.185  1.00 0.00 ? 220 ARG A CA     3  
ATOM   4434  C C      . ARG A 1 7   ? 4.279  2.822   1.008   1.00 0.00 ? 220 ARG A C      3  
ATOM   4435  O O      . ARG A 1 7   ? 4.361  3.394   2.094   1.00 0.00 ? 220 ARG A O      3  
ATOM   4436  C CB     . ARG A 1 7   ? 3.169  4.916   0.231   1.00 0.00 ? 220 ARG A CB     3  
ATOM   4437  C CG     . ARG A 1 7   ? 3.224  5.882   -0.955  1.00 0.00 ? 220 ARG A CG     3  
ATOM   4438  C CD     . ARG A 1 7   ? 4.415  6.835   -0.830  1.00 0.00 ? 220 ARG A CD     3  
ATOM   4439  N NE     . ARG A 1 7   ? 4.308  7.912   -1.839  1.00 0.00 ? 220 ARG A NE     3  
ATOM   4440  C CZ     . ARG A 1 7   ? 3.527  8.993   -1.705  1.00 0.00 ? 220 ARG A CZ     3  
ATOM   4441  N NH1    . ARG A 1 7   ? 2.780  9.146   -0.604  1.00 0.00 ? 220 ARG A NH1    3  
ATOM   4442  N NH2    . ARG A 1 7   ? 3.494  9.920   -2.673  1.00 0.00 ? 220 ARG A NH2    3  
ATOM   4443  H H      . ARG A 1 7   ? 2.455  2.598   -1.652  1.00 0.00 ? 220 ARG A H      3  
ATOM   4444  H HA     . ARG A 1 7   ? 4.297  3.569   -1.034  1.00 0.00 ? 220 ARG A HA     3  
ATOM   4445  H HB2    . ARG A 1 7   ? 2.153  4.876   0.625   1.00 0.00 ? 220 ARG A HB2    3  
ATOM   4446  H HB3    . ARG A 1 7   ? 3.808  5.283   1.033   1.00 0.00 ? 220 ARG A HB3    3  
ATOM   4447  H HG2    . ARG A 1 7   ? 3.301  5.319   -1.884  1.00 0.00 ? 220 ARG A HG2    3  
ATOM   4448  H HG3    . ARG A 1 7   ? 2.298  6.455   -1.004  1.00 0.00 ? 220 ARG A HG3    3  
ATOM   4449  H HD2    . ARG A 1 7   ? 4.443  7.264   0.171   1.00 0.00 ? 220 ARG A HD2    3  
ATOM   4450  H HD3    . ARG A 1 7   ? 5.346  6.286   -0.969  1.00 0.00 ? 220 ARG A HD3    3  
ATOM   4451  H HE     . ARG A 1 7   ? 4.853  7.828   -2.673  1.00 0.00 ? 220 ARG A HE     3  
ATOM   4452  H HH11   . ARG A 1 7   ? 2.804  8.455   0.118   1.00 0.00 ? 220 ARG A HH11   3  
ATOM   4453  H HH12   . ARG A 1 7   ? 2.196  9.953   -0.503  1.00 0.00 ? 220 ARG A HH12   3  
ATOM   4454  H HH21   . ARG A 1 7   ? 4.052  9.805   -3.494  1.00 0.00 ? 220 ARG A HH21   3  
ATOM   4455  H HH22   . ARG A 1 7   ? 2.911  10.726  -2.573  1.00 0.00 ? 220 ARG A HH22   3  
ATOM   4456  N N      . GLY A 1 8   ? 4.736  1.602   0.766   1.00 0.00 ? 221 GLY A N      3  
ATOM   4457  C CA     . GLY A 1 8   ? 5.390  0.827   1.807   1.00 0.00 ? 221 GLY A CA     3  
ATOM   4458  C C      . GLY A 1 8   ? 6.903  0.775   1.584   1.00 0.00 ? 221 GLY A C      3  
ATOM   4459  O O      . GLY A 1 8   ? 7.677  0.811   2.538   1.00 0.00 ? 221 GLY A O      3  
ATOM   4460  H H      . GLY A 1 8   ? 4.666  1.144   -0.119  1.00 0.00 ? 221 GLY A H      3  
ATOM   4461  H HA2    . GLY A 1 8   ? 5.178  1.269   2.781   1.00 0.00 ? 221 GLY A HA2    3  
ATOM   4462  H HA3    . GLY A 1 8   ? 4.985  -0.184  1.821   1.00 0.00 ? 221 GLY A HA3    3  
ATOM   4463  N N      . ASP A 1 9   ? 7.278  0.691   0.315   1.00 0.00 ? 222 ASP A N      3  
ATOM   4464  C CA     . ASP A 1 9   ? 8.685  0.633   -0.046  1.00 0.00 ? 222 ASP A CA     3  
ATOM   4465  C C      . ASP A 1 9   ? 9.301  2.026   0.098   1.00 0.00 ? 222 ASP A C      3  
ATOM   4466  O O      . ASP A 1 9   ? 10.460 2.159   0.489   1.00 0.00 ? 222 ASP A O      3  
ATOM   4467  C CB     . ASP A 1 9   ? 8.862  0.185   -1.498  1.00 0.00 ? 222 ASP A CB     3  
ATOM   4468  C CG     . ASP A 1 9   ? 10.124 -0.637  -1.772  1.00 0.00 ? 222 ASP A CG     3  
ATOM   4469  O OD1    . ASP A 1 9   ? 10.557 -1.440  -0.932  1.00 0.00 ? 222 ASP A OD1    3  
ATOM   4470  O OD2    . ASP A 1 9   ? 10.676 -0.422  -2.917  1.00 0.00 ? 222 ASP A OD2    3  
ATOM   4471  H H      . ASP A 1 9   ? 6.643  0.662   -0.456  1.00 0.00 ? 222 ASP A H      3  
ATOM   4472  H HA     . ASP A 1 9   ? 9.127  -0.091  0.638   1.00 0.00 ? 222 ASP A HA     3  
ATOM   4473  H HB2    . ASP A 1 9   ? 7.993  -0.405  -1.789  1.00 0.00 ? 222 ASP A HB2    3  
ATOM   4474  H HB3    . ASP A 1 9   ? 8.876  1.069   -2.136  1.00 0.00 ? 222 ASP A HB3    3  
ATOM   4475  H HD2    . ASP A 1 9   ? 11.520 -0.952  -2.995  1.00 0.00 ? 222 ASP A HD2    3  
ATOM   4476  N N      . PHE A 1 10  ? 8.499  3.029   -0.227  1.00 0.00 ? 223 PHE A N      3  
ATOM   4477  C CA     . PHE A 1 10  ? 8.952  4.408   -0.139  1.00 0.00 ? 223 PHE A CA     3  
ATOM   4478  C C      . PHE A 1 10  ? 9.138  4.832   1.319   1.00 0.00 ? 223 PHE A C      3  
ATOM   4479  O O      . PHE A 1 10  ? 10.014 5.638   1.628   1.00 0.00 ? 223 PHE A O      3  
ATOM   4480  C CB     . PHE A 1 10  ? 7.865  5.276   -0.776  1.00 0.00 ? 223 PHE A CB     3  
ATOM   4481  C CG     . PHE A 1 10  ? 8.044  6.775   -0.529  1.00 0.00 ? 223 PHE A CG     3  
ATOM   4482  C CD1    . PHE A 1 10  ? 8.776  7.525   -1.396  1.00 0.00 ? 223 PHE A CD1    3  
ATOM   4483  C CD2    . PHE A 1 10  ? 7.469  7.360   0.557   1.00 0.00 ? 223 PHE A CD2    3  
ATOM   4484  C CE1    . PHE A 1 10  ? 8.942  8.917   -1.167  1.00 0.00 ? 223 PHE A CE1    3  
ATOM   4485  C CE2    . PHE A 1 10  ? 7.635  8.750   0.786   1.00 0.00 ? 223 PHE A CE2    3  
ATOM   4486  C CZ     . PHE A 1 10  ? 8.368  9.500   -0.081  1.00 0.00 ? 223 PHE A CZ     3  
ATOM   4487  H H      . PHE A 1 10  ? 7.558  2.913   -0.544  1.00 0.00 ? 223 PHE A H      3  
ATOM   4488  H HA     . PHE A 1 10  ? 9.909  4.467   -0.658  1.00 0.00 ? 223 PHE A HA     3  
ATOM   4489  H HB2    . PHE A 1 10  ? 7.853  5.094   -1.851  1.00 0.00 ? 223 PHE A HB2    3  
ATOM   4490  H HB3    . PHE A 1 10  ? 6.894  4.968   -0.388  1.00 0.00 ? 223 PHE A HB3    3  
ATOM   4491  H HD1    . PHE A 1 10  ? 9.236  7.058   -2.266  1.00 0.00 ? 223 PHE A HD1    3  
ATOM   4492  H HD2    . PHE A 1 10  ? 6.882  6.758   1.252   1.00 0.00 ? 223 PHE A HD2    3  
ATOM   4493  H HE1    . PHE A 1 10  ? 9.529  9.517   -1.862  1.00 0.00 ? 223 PHE A HE1    3  
ATOM   4494  H HE2    . PHE A 1 10  ? 7.174  9.218   1.656   1.00 0.00 ? 223 PHE A HE2    3  
ATOM   4495  H HZ     . PHE A 1 10  ? 8.494  10.568  0.095   1.00 0.00 ? 223 PHE A HZ     3  
ATOM   4496  N N      . VAL A 1 11  ? 8.299  4.270   2.177   1.00 0.00 ? 224 VAL A N      3  
ATOM   4497  C CA     . VAL A 1 11  ? 8.360  4.579   3.595   1.00 0.00 ? 224 VAL A CA     3  
ATOM   4498  C C      . VAL A 1 11  ? 9.611  3.939   4.200   1.00 0.00 ? 224 VAL A C      3  
ATOM   4499  O O      . VAL A 1 11  ? 10.283 4.545   5.032   1.00 0.00 ? 224 VAL A O      3  
ATOM   4500  C CB     . VAL A 1 11  ? 7.068  4.134   4.285   1.00 0.00 ? 224 VAL A CB     3  
ATOM   4501  C CG1    . VAL A 1 11  ? 7.205  4.207   5.806   1.00 0.00 ? 224 VAL A CG1    3  
ATOM   4502  C CG2    . VAL A 1 11  ? 5.876  4.961   3.800   1.00 0.00 ? 224 VAL A CG2    3  
ATOM   4503  H H      . VAL A 1 11  ? 7.589  3.615   1.917   1.00 0.00 ? 224 VAL A H      3  
ATOM   4504  H HA     . VAL A 1 11  ? 8.438  5.662   3.692   1.00 0.00 ? 224 VAL A HA     3  
ATOM   4505  H HB     . VAL A 1 11  ? 6.886  3.094   4.014   1.00 0.00 ? 224 VAL A HB     3  
ATOM   4506  H HG11   . VAL A 1 11  ? 7.271  5.251   6.115   1.00 0.00 ? 224 VAL A HG11   3  
ATOM   4507  H HG12   . VAL A 1 11  ? 6.335  3.745   6.272   1.00 0.00 ? 224 VAL A HG12   3  
ATOM   4508  H HG13   . VAL A 1 11  ? 8.107  3.680   6.116   1.00 0.00 ? 224 VAL A HG13   3  
ATOM   4509  H HG21   . VAL A 1 11  ? 5.937  5.966   4.218   1.00 0.00 ? 224 VAL A HG21   3  
ATOM   4510  H HG22   . VAL A 1 11  ? 5.890  5.018   2.712   1.00 0.00 ? 224 VAL A HG22   3  
ATOM   4511  H HG23   . VAL A 1 11  ? 4.949  4.488   4.126   1.00 0.00 ? 224 VAL A HG23   3  
ATOM   4512  N N      . ARG A 1 12  ? 9.886  2.721   3.756   1.00 0.00 ? 225 ARG A N      3  
ATOM   4513  C CA     . ARG A 1 12  ? 11.045 1.991   4.242   1.00 0.00 ? 225 ARG A CA     3  
ATOM   4514  C C      . ARG A 1 12  ? 12.334 2.641   3.734   1.00 0.00 ? 225 ARG A C      3  
ATOM   4515  O O      . ARG A 1 12  ? 13.344 2.654   4.435   1.00 0.00 ? 225 ARG A O      3  
ATOM   4516  C CB     . ARG A 1 12  ? 11.005 0.530   3.790   1.00 0.00 ? 225 ARG A CB     3  
ATOM   4517  C CG     . ARG A 1 12  ? 11.687 -0.379  4.815   1.00 0.00 ? 225 ARG A CG     3  
ATOM   4518  C CD     . ARG A 1 12  ? 11.564 -1.850  4.410   1.00 0.00 ? 225 ARG A CD     3  
ATOM   4519  N NE     . ARG A 1 12  ? 10.244 -2.378  4.817   1.00 0.00 ? 225 ARG A NE     3  
ATOM   4520  C CZ     . ARG A 1 12  ? 9.716  -3.520  4.356   1.00 0.00 ? 225 ARG A CZ     3  
ATOM   4521  N NH1    . ARG A 1 12  ? 10.393 -4.259  3.467   1.00 0.00 ? 225 ARG A NH1    3  
ATOM   4522  N NH2    . ARG A 1 12  ? 8.511  -3.922  4.782   1.00 0.00 ? 225 ARG A NH2    3  
ATOM   4523  H H      . ARG A 1 12  ? 9.334  2.234   3.078   1.00 0.00 ? 225 ARG A H      3  
ATOM   4524  H HA     . ARG A 1 12  ? 10.976 2.052   5.329   1.00 0.00 ? 225 ARG A HA     3  
ATOM   4525  H HB2    . ARG A 1 12  ? 9.971  0.216   3.651   1.00 0.00 ? 225 ARG A HB2    3  
ATOM   4526  H HB3    . ARG A 1 12  ? 11.501 0.432   2.824   1.00 0.00 ? 225 ARG A HB3    3  
ATOM   4527  H HG2    . ARG A 1 12  ? 12.740 -0.110  4.903   1.00 0.00 ? 225 ARG A HG2    3  
ATOM   4528  H HG3    . ARG A 1 12  ? 11.236 -0.231  5.796   1.00 0.00 ? 225 ARG A HG3    3  
ATOM   4529  H HD2    . ARG A 1 12  ? 11.687 -1.950  3.331   1.00 0.00 ? 225 ARG A HD2    3  
ATOM   4530  H HD3    . ARG A 1 12  ? 12.359 -2.432  4.878   1.00 0.00 ? 225 ARG A HD3    3  
ATOM   4531  H HE     . ARG A 1 12  ? 9.712  -1.851  5.480   1.00 0.00 ? 225 ARG A HE     3  
ATOM   4532  H HH11   . ARG A 1 12  ? 11.292 -3.959  3.149   1.00 0.00 ? 225 ARG A HH11   3  
ATOM   4533  H HH12   . ARG A 1 12  ? 9.999  -5.112  3.121   1.00 0.00 ? 225 ARG A HH12   3  
ATOM   4534  H HH21   . ARG A 1 12  ? 8.006  -3.371  5.445   1.00 0.00 ? 225 ARG A HH21   3  
ATOM   4535  H HH22   . ARG A 1 12  ? 8.117  -4.775  4.436   1.00 0.00 ? 225 ARG A HH22   3  
ATOM   4536  N N      . ASN A 1 13  ? 12.256 3.164   2.520   1.00 0.00 ? 226 ASN A N      3  
ATOM   4537  C CA     . ASN A 1 13  ? 13.403 3.814   1.909   1.00 0.00 ? 226 ASN A CA     3  
ATOM   4538  C C      . ASN A 1 13  ? 13.667 5.144   2.618   1.00 0.00 ? 226 ASN A C      3  
ATOM   4539  O O      . ASN A 1 13  ? 14.810 5.590   2.704   1.00 0.00 ? 226 ASN A O      3  
ATOM   4540  C CB     . ASN A 1 13  ? 13.146 4.108   0.430   1.00 0.00 ? 226 ASN A CB     3  
ATOM   4541  C CG     . ASN A 1 13  ? 13.687 2.984   -0.455  1.00 0.00 ? 226 ASN A CG     3  
ATOM   4542  O OD1    . ASN A 1 13  ? 14.846 2.606   -0.383  1.00 0.00 ? 226 ASN A OD1    3  
ATOM   4543  N ND2    . ASN A 1 13  ? 12.788 2.474   -1.290  1.00 0.00 ? 226 ASN A ND2    3  
ATOM   4544  H H      . ASN A 1 13  ? 11.429 3.149   1.957   1.00 0.00 ? 226 ASN A H      3  
ATOM   4545  H HA     . ASN A 1 13  ? 14.227 3.110   2.026   1.00 0.00 ? 226 ASN A HA     3  
ATOM   4546  H HB2    . ASN A 1 13  ? 12.076 4.228   0.260   1.00 0.00 ? 226 ASN A HB2    3  
ATOM   4547  H HB3    . ASN A 1 13  ? 13.619 5.052   0.156   1.00 0.00 ? 226 ASN A HB3    3  
ATOM   4548  H HD21   . ASN A 1 13  ? 11.854 2.830   -1.299  1.00 0.00 ? 226 ASN A HD21   3  
ATOM   4549  H HD22   . ASN A 1 13  ? 13.046 1.732   -1.911  1.00 0.00 ? 226 ASN A HD22   3  
ATOM   4550  N N      . TRP A 1 14  ? 12.589 5.741   3.107   1.00 0.00 ? 227 TRP A N      3  
ATOM   4551  C CA     . TRP A 1 14  ? 12.690 7.012   3.805   1.00 0.00 ? 227 TRP A CA     3  
ATOM   4552  C C      . TRP A 1 14  ? 13.515 6.789   5.074   1.00 0.00 ? 227 TRP A C      3  
ATOM   4553  O O      . TRP A 1 14  ? 14.444 7.546   5.355   1.00 0.00 ? 227 TRP A O      3  
ATOM   4554  C CB     . TRP A 1 14  ? 11.303 7.593   4.088   1.00 0.00 ? 227 TRP A CB     3  
ATOM   4555  C CG     . TRP A 1 14  ? 11.033 8.928   3.390   1.00 0.00 ? 227 TRP A CG     3  
ATOM   4556  C CD1    . TRP A 1 14  ? 9.896  9.345   2.818   1.00 0.00 ? 227 TRP A CD1    3  
ATOM   4557  C CD2    . TRP A 1 14  ? 11.972 10.010  3.212   1.00 0.00 ? 227 TRP A CD2    3  
ATOM   4558  N NE1    . TRP A 1 14  ? 10.032 10.611  2.287   1.00 0.00 ? 227 TRP A NE1    3  
ATOM   4559  C CE2    . TRP A 1 14  ? 11.334 11.029  2.535   1.00 0.00 ? 227 TRP A CE2    3  
ATOM   4560  C CE3    . TRP A 1 14  ? 13.316 10.124  3.612   1.00 0.00 ? 227 TRP A CE3    3  
ATOM   4561  C CZ2    . TRP A 1 14  ? 11.961 12.234  2.197   1.00 0.00 ? 227 TRP A CZ2    3  
ATOM   4562  C CZ3    . TRP A 1 14  ? 13.928 11.335  3.266   1.00 0.00 ? 227 TRP A CZ3    3  
ATOM   4563  C CH2    . TRP A 1 14  ? 13.299 12.370  2.583   1.00 0.00 ? 227 TRP A CH2    3  
ATOM   4564  H H      . TRP A 1 14  ? 11.663 5.372   3.033   1.00 0.00 ? 227 TRP A H      3  
ATOM   4565  H HA     . TRP A 1 14  ? 13.201 7.714   3.146   1.00 0.00 ? 227 TRP A HA     3  
ATOM   4566  H HB2    . TRP A 1 14  ? 10.547 6.872   3.776   1.00 0.00 ? 227 TRP A HB2    3  
ATOM   4567  H HB3    . TRP A 1 14  ? 11.190 7.728   5.164   1.00 0.00 ? 227 TRP A HB3    3  
ATOM   4568  H HD1    . TRP A 1 14  ? 8.979  8.757   2.778   1.00 0.00 ? 227 TRP A HD1    3  
ATOM   4569  H HE1    . TRP A 1 14  ? 9.259  11.179  1.769   1.00 0.00 ? 227 TRP A HE1    3  
ATOM   4570  H HE3    . TRP A 1 14  ? 13.841 9.335   4.147   1.00 0.00 ? 227 TRP A HE3    3  
ATOM   4571  H HZ2    . TRP A 1 14  ? 11.434 13.024  1.660   1.00 0.00 ? 227 TRP A HZ2    3  
ATOM   4572  H HZ3    . TRP A 1 14  ? 14.970 11.476  3.551   1.00 0.00 ? 227 TRP A HZ3    3  
ATOM   4573  H HH2    . TRP A 1 14  ? 13.846 13.284  2.351   1.00 0.00 ? 227 TRP A HH2    3  
ATOM   4574  N N      . GLN A 1 15  ? 13.147 5.749   5.806   1.00 0.00 ? 228 GLN A N      3  
ATOM   4575  C CA     . GLN A 1 15  ? 13.842 5.417   7.039   1.00 0.00 ? 228 GLN A CA     3  
ATOM   4576  C C      . GLN A 1 15  ? 15.253 4.910   6.733   1.00 0.00 ? 228 GLN A C      3  
ATOM   4577  O O      . GLN A 1 15  ? 16.176 5.121   7.519   1.00 0.00 ? 228 GLN A O      3  
ATOM   4578  C CB     . GLN A 1 15  ? 13.054 4.390   7.854   1.00 0.00 ? 228 GLN A CB     3  
ATOM   4579  C CG     . GLN A 1 15  ? 12.861 3.095   7.063   1.00 0.00 ? 228 GLN A CG     3  
ATOM   4580  C CD     . GLN A 1 15  ? 12.242 2.004   7.939   1.00 0.00 ? 228 GLN A CD     3  
ATOM   4581  O OE1    . GLN A 1 15  ? 11.083 1.648   7.806   1.00 0.00 ? 228 GLN A OE1    3  
ATOM   4582  N NE2    . GLN A 1 15  ? 13.079 1.494   8.838   1.00 0.00 ? 228 GLN A NE2    3  
ATOM   4583  H H      . GLN A 1 15  ? 12.391 5.138   5.571   1.00 0.00 ? 228 GLN A H      3  
ATOM   4584  H HA     . GLN A 1 15  ? 13.898 6.351   7.600   1.00 0.00 ? 228 GLN A HA     3  
ATOM   4585  H HB2    . GLN A 1 15  ? 13.581 4.176   8.784   1.00 0.00 ? 228 GLN A HB2    3  
ATOM   4586  H HB3    . GLN A 1 15  ? 12.083 4.803   8.125   1.00 0.00 ? 228 GLN A HB3    3  
ATOM   4587  H HG2    . GLN A 1 15  ? 12.219 3.283   6.202   1.00 0.00 ? 228 GLN A HG2    3  
ATOM   4588  H HG3    . GLN A 1 15  ? 13.821 2.754   6.675   1.00 0.00 ? 228 GLN A HG3    3  
ATOM   4589  H HE21   . GLN A 1 15  ? 14.019 1.830   8.894   1.00 0.00 ? 228 GLN A HE21   3  
ATOM   4590  H HE22   . GLN A 1 15  ? 12.768 0.773   9.458   1.00 0.00 ? 228 GLN A HE22   3  
ATOM   4591  N N      . LEU A 1 16  ? 15.376 4.252   5.590   1.00 0.00 ? 229 LEU A N      3  
ATOM   4592  C CA     . LEU A 1 16  ? 16.658 3.713   5.171   1.00 0.00 ? 229 LEU A CA     3  
ATOM   4593  C C      . LEU A 1 16  ? 17.592 4.865   4.795   1.00 0.00 ? 229 LEU A C      3  
ATOM   4594  O O      . LEU A 1 16  ? 18.784 4.827   5.100   1.00 0.00 ? 229 LEU A O      3  
ATOM   4595  C CB     . LEU A 1 16  ? 16.468 2.686   4.053   1.00 0.00 ? 229 LEU A CB     3  
ATOM   4596  C CG     . LEU A 1 16  ? 16.497 1.217   4.480   1.00 0.00 ? 229 LEU A CG     3  
ATOM   4597  C CD1    . LEU A 1 16  ? 15.560 0.972   5.664   1.00 0.00 ? 229 LEU A CD1    3  
ATOM   4598  C CD2    . LEU A 1 16  ? 16.180 0.297   3.299   1.00 0.00 ? 229 LEU A CD2    3  
ATOM   4599  H H      . LEU A 1 16  ? 14.620 4.086   4.957   1.00 0.00 ? 229 LEU A H      3  
ATOM   4600  H HA     . LEU A 1 16  ? 17.086 3.185   6.024   1.00 0.00 ? 229 LEU A HA     3  
ATOM   4601  H HB2    . LEU A 1 16  ? 15.514 2.883   3.564   1.00 0.00 ? 229 LEU A HB2    3  
ATOM   4602  H HB3    . LEU A 1 16  ? 17.247 2.842   3.307   1.00 0.00 ? 229 LEU A HB3    3  
ATOM   4603  H HG     . LEU A 1 16  ? 17.507 0.977   4.812   1.00 0.00 ? 229 LEU A HG     3  
ATOM   4604  H HD11   . LEU A 1 16  ? 15.753 -0.017  6.081   1.00 0.00 ? 229 LEU A HD11   3  
ATOM   4605  H HD12   . LEU A 1 16  ? 15.736 1.728   6.428   1.00 0.00 ? 229 LEU A HD12   3  
ATOM   4606  H HD13   . LEU A 1 16  ? 14.525 1.029   5.327   1.00 0.00 ? 229 LEU A HD13   3  
ATOM   4607  H HD21   . LEU A 1 16  ? 15.397 0.745   2.689   1.00 0.00 ? 229 LEU A HD21   3  
ATOM   4608  H HD22   . LEU A 1 16  ? 17.078 0.159   2.695   1.00 0.00 ? 229 LEU A HD22   3  
ATOM   4609  H HD23   . LEU A 1 16  ? 15.842 -0.670  3.672   1.00 0.00 ? 229 LEU A HD23   3  
ATOM   4610  N N      . VAL A 1 17  ? 17.016 5.862   4.140   1.00 0.00 ? 230 VAL A N      3  
ATOM   4611  C CA     . VAL A 1 17  ? 17.782 7.023   3.720   1.00 0.00 ? 230 VAL A CA     3  
ATOM   4612  C C      . VAL A 1 17  ? 18.136 7.866   4.946   1.00 0.00 ? 230 VAL A C      3  
ATOM   4613  O O      . VAL A 1 17  ? 19.141 8.577   4.947   1.00 0.00 ? 230 VAL A O      3  
ATOM   4614  C CB     . VAL A 1 17  ? 17.006 7.806   2.659   1.00 0.00 ? 230 VAL A CB     3  
ATOM   4615  C CG1    . VAL A 1 17  ? 17.465 9.265   2.611   1.00 0.00 ? 230 VAL A CG1    3  
ATOM   4616  C CG2    . VAL A 1 17  ? 17.134 7.146   1.286   1.00 0.00 ? 230 VAL A CG2    3  
ATOM   4617  H H      . VAL A 1 17  ? 16.047 5.885   3.896   1.00 0.00 ? 230 VAL A H      3  
ATOM   4618  H HA     . VAL A 1 17  ? 18.704 6.661   3.264   1.00 0.00 ? 230 VAL A HA     3  
ATOM   4619  H HB     . VAL A 1 17  ? 15.953 7.795   2.938   1.00 0.00 ? 230 VAL A HB     3  
ATOM   4620  H HG11   . VAL A 1 17  ? 17.393 9.634   1.587   1.00 0.00 ? 230 VAL A HG11   3  
ATOM   4621  H HG12   . VAL A 1 17  ? 16.828 9.867   3.259   1.00 0.00 ? 230 VAL A HG12   3  
ATOM   4622  H HG13   . VAL A 1 17  ? 18.498 9.333   2.951   1.00 0.00 ? 230 VAL A HG13   3  
ATOM   4623  H HG21   . VAL A 1 17  ? 17.082 7.909   0.509   1.00 0.00 ? 230 VAL A HG21   3  
ATOM   4624  H HG22   . VAL A 1 17  ? 18.091 6.626   1.220   1.00 0.00 ? 230 VAL A HG22   3  
ATOM   4625  H HG23   . VAL A 1 17  ? 16.323 6.431   1.149   1.00 0.00 ? 230 VAL A HG23   3  
ATOM   4626  N N      . ALA A 1 18  ? 17.293 7.759   5.962   1.00 0.00 ? 231 ALA A N      3  
ATOM   4627  C CA     . ALA A 1 18  ? 17.504 8.503   7.192   1.00 0.00 ? 231 ALA A CA     3  
ATOM   4628  C C      . ALA A 1 18  ? 18.650 7.863   7.979   1.00 0.00 ? 231 ALA A C      3  
ATOM   4629  O O      . ALA A 1 18  ? 19.284 8.520   8.803   1.00 0.00 ? 231 ALA A O      3  
ATOM   4630  C CB     . ALA A 1 18  ? 16.201 8.548   7.992   1.00 0.00 ? 231 ALA A CB     3  
ATOM   4631  H H      . ALA A 1 18  ? 16.478 7.179   5.954   1.00 0.00 ? 231 ALA A H      3  
ATOM   4632  H HA     . ALA A 1 18  ? 17.785 9.520   6.920   1.00 0.00 ? 231 ALA A HA     3  
ATOM   4633  H HB1    . ALA A 1 18  ? 16.430 8.590   9.057   1.00 0.00 ? 231 ALA A HB1    3  
ATOM   4634  H HB2    . ALA A 1 18  ? 15.630 9.432   7.707   1.00 0.00 ? 231 ALA A HB2    3  
ATOM   4635  H HB3    . ALA A 1 18  ? 15.614 7.654   7.781   1.00 0.00 ? 231 ALA A HB3    3  
ATOM   4636  N N      . ALA A 1 19  ? 18.880 6.589   7.697   1.00 0.00 ? 232 ALA A N      3  
ATOM   4637  C CA     . ALA A 1 19  ? 19.937 5.853   8.368   1.00 0.00 ? 232 ALA A CA     3  
ATOM   4638  C C      . ALA A 1 19  ? 21.289 6.257   7.776   1.00 0.00 ? 232 ALA A C      3  
ATOM   4639  O O      . ALA A 1 19  ? 22.332 6.030   8.387   1.00 0.00 ? 232 ALA A O      3  
ATOM   4640  C CB     . ALA A 1 19  ? 19.671 4.351   8.246   1.00 0.00 ? 232 ALA A CB     3  
ATOM   4641  H H      . ALA A 1 19  ? 18.358 6.062   7.025   1.00 0.00 ? 232 ALA A H      3  
ATOM   4642  H HA     . ALA A 1 19  ? 19.916 6.129   9.423   1.00 0.00 ? 232 ALA A HA     3  
ATOM   4643  H HB1    . ALA A 1 19  ? 18.715 4.112   8.712   1.00 0.00 ? 232 ALA A HB1    3  
ATOM   4644  H HB2    . ALA A 1 19  ? 19.642 4.073   7.193   1.00 0.00 ? 232 ALA A HB2    3  
ATOM   4645  H HB3    . ALA A 1 19  ? 20.468 3.799   8.746   1.00 0.00 ? 232 ALA A HB3    3  
ATOM   4646  N N      . VAL A 1 20  ? 21.226 6.847   6.591   1.00 0.00 ? 233 VAL A N      3  
ATOM   4647  C CA     . VAL A 1 20  ? 22.432 7.285   5.909   1.00 0.00 ? 233 VAL A CA     3  
ATOM   4648  C C      . VAL A 1 20  ? 22.479 8.814   5.893   1.00 0.00 ? 233 VAL A C      3  
ATOM   4649  O O      . VAL A 1 20  ? 21.644 9.458   5.261   1.00 0.00 ? 233 VAL A O      3  
ATOM   4650  C CB     . VAL A 1 20  ? 22.493 6.671   4.508   1.00 0.00 ? 233 VAL A CB     3  
ATOM   4651  C CG1    . VAL A 1 20  ? 23.873 6.876   3.879   1.00 0.00 ? 233 VAL A CG1    3  
ATOM   4652  C CG2    . VAL A 1 20  ? 22.122 5.187   4.544   1.00 0.00 ? 233 VAL A CG2    3  
ATOM   4653  H H      . VAL A 1 20  ? 20.375 7.028   6.101   1.00 0.00 ? 233 VAL A H      3  
ATOM   4654  H HA     . VAL A 1 20  ? 23.285 6.913   6.478   1.00 0.00 ? 233 VAL A HA     3  
ATOM   4655  H HB     . VAL A 1 20  ? 21.762 7.185   3.886   1.00 0.00 ? 233 VAL A HB     3  
ATOM   4656  H HG11   . VAL A 1 20  ? 24.536 7.346   4.606   1.00 0.00 ? 233 VAL A HG11   3  
ATOM   4657  H HG12   . VAL A 1 20  ? 24.283 5.912   3.582   1.00 0.00 ? 233 VAL A HG12   3  
ATOM   4658  H HG13   . VAL A 1 20  ? 23.781 7.518   3.003   1.00 0.00 ? 233 VAL A HG13   3  
ATOM   4659  H HG21   . VAL A 1 20  ? 21.114 5.074   4.944   1.00 0.00 ? 233 VAL A HG21   3  
ATOM   4660  H HG22   . VAL A 1 20  ? 22.159 4.780   3.534   1.00 0.00 ? 233 VAL A HG22   3  
ATOM   4661  H HG23   . VAL A 1 20  ? 22.826 4.651   5.178   1.00 0.00 ? 233 VAL A HG23   3  
ATOM   4662  N N      . PRO A 1 21  ? 23.491 9.366   6.617   1.00 0.00 ? 234 PRO A N      3  
ATOM   4663  C CA     . PRO A 1 21  ? 23.657 10.807  6.692   1.00 0.00 ? 234 PRO A CA     3  
ATOM   4664  C C      . PRO A 1 21  ? 24.239 11.361  5.391   1.00 0.00 ? 234 PRO A C      3  
ATOM   4665  O O      . PRO A 1 21  ? 24.050 12.533  5.071   1.00 0.00 ? 234 PRO A O      3  
ATOM   4666  C CB     . PRO A 1 21  ? 24.561 11.037  7.892   1.00 0.00 ? 234 PRO A CB     3  
ATOM   4667  C CG     . PRO A 1 21  ? 25.241 9.704   8.162   1.00 0.00 ? 234 PRO A CG     3  
ATOM   4668  C CD     . PRO A 1 21  ? 24.498 8.634   7.378   1.00 0.00 ? 234 PRO A CD     3  
ATOM   4669  H HA     . PRO A 1 21  ? 22.769 11.253  6.806   1.00 0.00 ? 234 PRO A HA     3  
ATOM   4670  H HB2    . PRO A 1 21  ? 25.295 11.815  7.685   1.00 0.00 ? 234 PRO A HB2    3  
ATOM   4671  H HB3    . PRO A 1 21  ? 23.985 11.364  8.758   1.00 0.00 ? 234 PRO A HB3    3  
ATOM   4672  H HG2    . PRO A 1 21  ? 26.287 9.741   7.860   1.00 0.00 ? 234 PRO A HG2    3  
ATOM   4673  H HG3    . PRO A 1 21  ? 25.225 9.476   9.229   1.00 0.00 ? 234 PRO A HG3    3  
ATOM   4674  H HD2    . PRO A 1 21  ? 25.172 8.086   6.720   1.00 0.00 ? 234 PRO A HD2    3  
ATOM   4675  H HD3    . PRO A 1 21  ? 24.039 7.904   8.043   1.00 0.00 ? 234 PRO A HD3    3  
ATOM   4676  N N      . LEU A 1 22  ? 24.936 10.490  4.674   1.00 0.00 ? 235 LEU A N      3  
ATOM   4677  C CA     . LEU A 1 22  ? 25.547 10.878  3.414   1.00 0.00 ? 235 LEU A CA     3  
ATOM   4678  C C      . LEU A 1 22  ? 24.470 11.427  2.477   1.00 0.00 ? 235 LEU A C      3  
ATOM   4679  O O      . LEU A 1 22  ? 24.709 12.385  1.744   1.00 0.00 ? 235 LEU A O      3  
ATOM   4680  C CB     . LEU A 1 22  ? 26.340 9.711   2.822   1.00 0.00 ? 235 LEU A CB     3  
ATOM   4681  C CG     . LEU A 1 22  ? 26.588 9.766   1.314   1.00 0.00 ? 235 LEU A CG     3  
ATOM   4682  C CD1    . LEU A 1 22  ? 28.085 9.698   1.001   1.00 0.00 ? 235 LEU A CD1    3  
ATOM   4683  C CD2    . LEU A 1 22  ? 25.802 8.671   0.589   1.00 0.00 ? 235 LEU A CD2    3  
ATOM   4684  H H      . LEU A 1 22  ? 25.086 9.539   4.941   1.00 0.00 ? 235 LEU A H      3  
ATOM   4685  H HA     . LEU A 1 22  ? 26.259 11.675  3.628   1.00 0.00 ? 235 LEU A HA     3  
ATOM   4686  H HB2    . LEU A 1 22  ? 27.305 9.660   3.327   1.00 0.00 ? 235 LEU A HB2    3  
ATOM   4687  H HB3    . LEU A 1 22  ? 25.811 8.786   3.051   1.00 0.00 ? 235 LEU A HB3    3  
ATOM   4688  H HG     . LEU A 1 22  ? 26.224 10.723  0.942   1.00 0.00 ? 235 LEU A HG     3  
ATOM   4689  H HD11   . LEU A 1 22  ? 28.229 9.669   -0.079  1.00 0.00 ? 235 LEU A HD11   3  
ATOM   4690  H HD12   . LEU A 1 22  ? 28.581 10.578  1.410   1.00 0.00 ? 235 LEU A HD12   3  
ATOM   4691  H HD13   . LEU A 1 22  ? 28.509 8.800   1.450   1.00 0.00 ? 235 LEU A HD13   3  
ATOM   4692  H HD21   . LEU A 1 22  ? 24.735 8.813   0.765   1.00 0.00 ? 235 LEU A HD21   3  
ATOM   4693  H HD22   . LEU A 1 22  ? 26.004 8.726   -0.480  1.00 0.00 ? 235 LEU A HD22   3  
ATOM   4694  H HD23   . LEU A 1 22  ? 26.106 7.695   0.966   1.00 0.00 ? 235 LEU A HD23   3  
ATOM   4695  N N      . PHE A 1 23  ? 23.306 10.797  2.532   1.00 0.00 ? 236 PHE A N      3  
ATOM   4696  C CA     . PHE A 1 23  ? 22.191 11.210  1.696   1.00 0.00 ? 236 PHE A CA     3  
ATOM   4697  C C      . PHE A 1 23  ? 21.487 12.432  2.289   1.00 0.00 ? 236 PHE A C      3  
ATOM   4698  O O      . PHE A 1 23  ? 20.789 13.156  1.579   1.00 0.00 ? 236 PHE A O      3  
ATOM   4699  C CB     . PHE A 1 23  ? 21.206 10.040  1.653   1.00 0.00 ? 236 PHE A CB     3  
ATOM   4700  C CG     . PHE A 1 23  ? 21.547 8.979   0.604   1.00 0.00 ? 236 PHE A CG     3  
ATOM   4701  C CD1    . PHE A 1 23  ? 21.914 9.356   -0.650  1.00 0.00 ? 236 PHE A CD1    3  
ATOM   4702  C CD2    . PHE A 1 23  ? 21.480 7.659   0.925   1.00 0.00 ? 236 PHE A CD2    3  
ATOM   4703  C CE1    . PHE A 1 23  ? 22.230 8.373   -1.624  1.00 0.00 ? 236 PHE A CE1    3  
ATOM   4704  C CE2    . PHE A 1 23  ? 21.795 6.675   -0.049  1.00 0.00 ? 236 PHE A CE2    3  
ATOM   4705  C CZ     . PHE A 1 23  ? 22.164 7.053   -1.303  1.00 0.00 ? 236 PHE A CZ     3  
ATOM   4706  H H      . PHE A 1 23  ? 23.119 10.017  3.130   1.00 0.00 ? 236 PHE A H      3  
ATOM   4707  H HA     . PHE A 1 23  ? 22.597 11.466  0.718   1.00 0.00 ? 236 PHE A HA     3  
ATOM   4708  H HB2    . PHE A 1 23  ? 21.176 9.567   2.635   1.00 0.00 ? 236 PHE A HB2    3  
ATOM   4709  H HB3    . PHE A 1 23  ? 20.207 10.426  1.454   1.00 0.00 ? 236 PHE A HB3    3  
ATOM   4710  H HD1    . PHE A 1 23  ? 21.968 10.415  -0.907  1.00 0.00 ? 236 PHE A HD1    3  
ATOM   4711  H HD2    . PHE A 1 23  ? 21.185 7.357   1.930   1.00 0.00 ? 236 PHE A HD2    3  
ATOM   4712  H HE1    . PHE A 1 23  ? 22.525 8.675   -2.628  1.00 0.00 ? 236 PHE A HE1    3  
ATOM   4713  H HE2    . PHE A 1 23  ? 21.742 5.617   0.208   1.00 0.00 ? 236 PHE A HE2    3  
ATOM   4714  H HZ     . PHE A 1 23  ? 22.406 6.297   -2.051  1.00 0.00 ? 236 PHE A HZ     3  
ATOM   4715  N N      . GLN A 1 24  ? 21.692 12.624  3.584   1.00 0.00 ? 237 GLN A N      3  
ATOM   4716  C CA     . GLN A 1 24  ? 21.085 13.746  4.279   1.00 0.00 ? 237 GLN A CA     3  
ATOM   4717  C C      . GLN A 1 24  ? 21.863 15.032  3.994   1.00 0.00 ? 237 GLN A C      3  
ATOM   4718  O O      . GLN A 1 24  ? 21.358 16.131  4.219   1.00 0.00 ? 237 GLN A O      3  
ATOM   4719  C CB     . GLN A 1 24  ? 21.002 13.478  5.783   1.00 0.00 ? 237 GLN A CB     3  
ATOM   4720  C CG     . GLN A 1 24  ? 20.131 12.254  6.074   1.00 0.00 ? 237 GLN A CG     3  
ATOM   4721  C CD     . GLN A 1 24  ? 18.659 12.546  5.782   1.00 0.00 ? 237 GLN A CD     3  
ATOM   4722  O OE1    . GLN A 1 24  ? 17.936 13.103  6.591   1.00 0.00 ? 237 GLN A OE1    3  
ATOM   4723  N NE2    . GLN A 1 24  ? 18.254 12.138  4.582   1.00 0.00 ? 237 GLN A NE2    3  
ATOM   4724  H H      . GLN A 1 24  ? 22.260 12.031  4.153   1.00 0.00 ? 237 GLN A H      3  
ATOM   4725  H HA     . GLN A 1 24  ? 20.076 13.826  3.874   1.00 0.00 ? 237 GLN A HA     3  
ATOM   4726  H HB2    . GLN A 1 24  ? 22.002 13.321  6.184   1.00 0.00 ? 237 GLN A HB2    3  
ATOM   4727  H HB3    . GLN A 1 24  ? 20.589 14.351  6.289   1.00 0.00 ? 237 GLN A HB3    3  
ATOM   4728  H HG2    . GLN A 1 24  ? 20.467 11.412  5.469   1.00 0.00 ? 237 GLN A HG2    3  
ATOM   4729  H HG3    . GLN A 1 24  ? 20.247 11.961  7.118   1.00 0.00 ? 237 GLN A HG3    3  
ATOM   4730  H HE21   . GLN A 1 24  ? 18.899 11.687  3.964   1.00 0.00 ? 237 GLN A HE21   3  
ATOM   4731  H HE22   . GLN A 1 24  ? 17.307 12.284  4.297   1.00 0.00 ? 237 GLN A HE22   3  
ATOM   4732  N N      . LYS A 1 25  ? 23.080 14.852  3.501   1.00 0.00 ? 238 LYS A N      3  
ATOM   4733  C CA     . LYS A 1 25  ? 23.934 15.984  3.183   1.00 0.00 ? 238 LYS A CA     3  
ATOM   4734  C C      . LYS A 1 25  ? 23.407 16.675  1.924   1.00 0.00 ? 238 LYS A C      3  
ATOM   4735  O O      . LYS A 1 25  ? 23.919 17.720  1.524   1.00 0.00 ? 238 LYS A O      3  
ATOM   4736  C CB     . LYS A 1 25  ? 25.395 15.541  3.075   1.00 0.00 ? 238 LYS A CB     3  
ATOM   4737  C CG     . LYS A 1 25  ? 26.028 15.403  4.461   1.00 0.00 ? 238 LYS A CG     3  
ATOM   4738  C CD     . LYS A 1 25  ? 27.507 15.025  4.352   1.00 0.00 ? 238 LYS A CD     3  
ATOM   4739  C CE     . LYS A 1 25  ? 27.912 14.069  5.476   1.00 0.00 ? 238 LYS A CE     3  
ATOM   4740  N NZ     . LYS A 1 25  ? 29.073 14.606  6.220   1.00 0.00 ? 238 LYS A NZ     3  
ATOM   4741  H H      . LYS A 1 25  ? 23.484 13.955  3.321   1.00 0.00 ? 238 LYS A H      3  
ATOM   4742  H HA     . LYS A 1 25  ? 23.869 16.685  4.014   1.00 0.00 ? 238 LYS A HA     3  
ATOM   4743  H HB2    . LYS A 1 25  ? 25.452 14.588  2.550   1.00 0.00 ? 238 LYS A HB2    3  
ATOM   4744  H HB3    . LYS A 1 25  ? 25.955 16.265  2.485   1.00 0.00 ? 238 LYS A HB3    3  
ATOM   4745  H HG2    . LYS A 1 25  ? 25.928 16.343  5.005   1.00 0.00 ? 238 LYS A HG2    3  
ATOM   4746  H HG3    . LYS A 1 25  ? 25.496 14.645  5.035   1.00 0.00 ? 238 LYS A HG3    3  
ATOM   4747  H HD2    . LYS A 1 25  ? 27.696 14.558  3.386   1.00 0.00 ? 238 LYS A HD2    3  
ATOM   4748  H HD3    . LYS A 1 25  ? 28.120 15.925  4.397   1.00 0.00 ? 238 LYS A HD3    3  
ATOM   4749  H HE2    . LYS A 1 25  ? 27.073 13.922  6.156   1.00 0.00 ? 238 LYS A HE2    3  
ATOM   4750  H HE3    . LYS A 1 25  ? 28.160 13.093  5.059   1.00 0.00 ? 238 LYS A HE3    3  
ATOM   4751  H HZ1    . LYS A 1 25  ? 29.019 15.604  6.248   1.00 0.00 ? 238 LYS A HZ1    3  
ATOM   4752  H HZ2    . LYS A 1 25  ? 29.068 14.245  7.153   1.00 0.00 ? 238 LYS A HZ2    3  
ATOM   4753  H HZ3    . LYS A 1 25  ? 29.918 14.331  5.762   1.00 0.00 ? 238 LYS A HZ3    3  
ATOM   4754  N N      . LEU A 1 26  ? 22.390 16.064  1.333   1.00 0.00 ? 239 LEU A N      3  
ATOM   4755  C CA     . LEU A 1 26  ? 21.790 16.608  0.126   1.00 0.00 ? 239 LEU A CA     3  
ATOM   4756  C C      . LEU A 1 26  ? 20.552 17.426  0.503   1.00 0.00 ? 239 LEU A C      3  
ATOM   4757  O O      . LEU A 1 26  ? 19.910 17.156  1.517   1.00 0.00 ? 239 LEU A O      3  
ATOM   4758  C CB     . LEU A 1 26  ? 21.505 15.492  -0.880  1.00 0.00 ? 239 LEU A CB     3  
ATOM   4759  C CG     . LEU A 1 26  ? 22.702 14.625  -1.278  1.00 0.00 ? 239 LEU A CG     3  
ATOM   4760  C CD1    . LEU A 1 26  ? 22.315 13.146  -1.330  1.00 0.00 ? 239 LEU A CD1    3  
ATOM   4761  C CD2    . LEU A 1 26  ? 23.312 15.105  -2.597  1.00 0.00 ? 239 LEU A CD2    3  
ATOM   4762  H H      . LEU A 1 26  ? 21.980 15.215  1.664   1.00 0.00 ? 239 LEU A H      3  
ATOM   4763  H HA     . LEU A 1 26  ? 22.519 17.275  -0.330  1.00 0.00 ? 239 LEU A HA     3  
ATOM   4764  H HB2    . LEU A 1 26  ? 20.734 14.842  -0.465  1.00 0.00 ? 239 LEU A HB2    3  
ATOM   4765  H HB3    . LEU A 1 26  ? 21.091 15.940  -1.783  1.00 0.00 ? 239 LEU A HB3    3  
ATOM   4766  H HG     . LEU A 1 26  ? 23.469 14.730  -0.511  1.00 0.00 ? 239 LEU A HG     3  
ATOM   4767  H HD11   . LEU A 1 26  ? 21.894 12.915  -2.308  1.00 0.00 ? 239 LEU A HD11   3  
ATOM   4768  H HD12   . LEU A 1 26  ? 23.200 12.533  -1.161  1.00 0.00 ? 239 LEU A HD12   3  
ATOM   4769  H HD13   . LEU A 1 26  ? 21.576 12.937  -0.557  1.00 0.00 ? 239 LEU A HD13   3  
ATOM   4770  H HD21   . LEU A 1 26  ? 23.555 16.165  -2.519  1.00 0.00 ? 239 LEU A HD21   3  
ATOM   4771  H HD22   . LEU A 1 26  ? 24.219 14.538  -2.804  1.00 0.00 ? 239 LEU A HD22   3  
ATOM   4772  H HD23   . LEU A 1 26  ? 22.596 14.955  -3.404  1.00 0.00 ? 239 LEU A HD23   3  
ATOM   4773  N N      . GLY A 1 27  ? 20.256 18.410  -0.333  1.00 0.00 ? 240 GLY A N      3  
ATOM   4774  C CA     . GLY A 1 27  ? 19.108 19.270  -0.101  1.00 0.00 ? 240 GLY A CA     3  
ATOM   4775  C C      . GLY A 1 27  ? 17.845 18.442  0.148   1.00 0.00 ? 240 GLY A C      3  
ATOM   4776  O O      . GLY A 1 27  ? 17.894 17.214  0.145   1.00 0.00 ? 240 GLY A O      3  
ATOM   4777  H H      . GLY A 1 27  ? 20.784 18.623  -1.155  1.00 0.00 ? 240 GLY A H      3  
ATOM   4778  H HA2    . GLY A 1 27  ? 19.300 19.914  0.757   1.00 0.00 ? 240 GLY A HA2    3  
ATOM   4779  H HA3    . GLY A 1 27  ? 18.957 19.921  -0.962  1.00 0.00 ? 240 GLY A HA3    3  
ATOM   4780  N N      . PRO A 1 28  ? 16.716 19.169  0.362   1.00 0.00 ? 241 PRO A N      3  
ATOM   4781  C CA     . PRO A 1 28  ? 15.442 18.515  0.612   1.00 0.00 ? 241 PRO A CA     3  
ATOM   4782  C C      . PRO A 1 28  ? 14.863 17.931  -0.678  1.00 0.00 ? 241 PRO A C      3  
ATOM   4783  O O      . PRO A 1 28  ? 14.324 16.825  -0.676  1.00 0.00 ? 241 PRO A O      3  
ATOM   4784  C CB     . PRO A 1 28  ? 14.561 19.592  1.224   1.00 0.00 ? 241 PRO A CB     3  
ATOM   4785  C CG     . PRO A 1 28  ? 15.214 20.917  0.868   1.00 0.00 ? 241 PRO A CG     3  
ATOM   4786  C CD     . PRO A 1 28  ? 16.621 20.625  0.372   1.00 0.00 ? 241 PRO A CD     3  
ATOM   4787  H HA     . PRO A 1 28  ? 15.565 17.740  1.232   1.00 0.00 ? 241 PRO A HA     3  
ATOM   4788  H HB2    . PRO A 1 28  ? 13.546 19.537  0.829   1.00 0.00 ? 241 PRO A HB2    3  
ATOM   4789  H HB3    . PRO A 1 28  ? 14.488 19.469  2.305   1.00 0.00 ? 241 PRO A HB3    3  
ATOM   4790  H HG2    . PRO A 1 28  ? 14.637 21.432  0.099   1.00 0.00 ? 241 PRO A HG2    3  
ATOM   4791  H HG3    . PRO A 1 28  ? 15.244 21.573  1.738   1.00 0.00 ? 241 PRO A HG3    3  
ATOM   4792  H HD2    . PRO A 1 28  ? 16.784 21.040  -0.623  1.00 0.00 ? 241 PRO A HD2    3  
ATOM   4793  H HD3    . PRO A 1 28  ? 17.371 21.066  1.029   1.00 0.00 ? 241 PRO A HD3    3  
ATOM   4794  N N      . ALA A 1 29  ? 14.996 18.699  -1.749  1.00 0.00 ? 242 ALA A N      3  
ATOM   4795  C CA     . ALA A 1 29  ? 14.492 18.271  -3.044  1.00 0.00 ? 242 ALA A CA     3  
ATOM   4796  C C      . ALA A 1 29  ? 15.453 17.245  -3.646  1.00 0.00 ? 242 ALA A C      3  
ATOM   4797  O O      . ALA A 1 29  ? 15.051 16.417  -4.462  1.00 0.00 ? 242 ALA A O      3  
ATOM   4798  C CB     . ALA A 1 29  ? 14.303 19.492  -3.947  1.00 0.00 ? 242 ALA A CB     3  
ATOM   4799  H H      . ALA A 1 29  ? 15.435 19.597  -1.743  1.00 0.00 ? 242 ALA A H      3  
ATOM   4800  H HA     . ALA A 1 29  ? 13.522 17.800  -2.884  1.00 0.00 ? 242 ALA A HA     3  
ATOM   4801  H HB1    . ALA A 1 29  ? 13.933 20.329  -3.354  1.00 0.00 ? 242 ALA A HB1    3  
ATOM   4802  H HB2    . ALA A 1 29  ? 15.258 19.761  -4.399  1.00 0.00 ? 242 ALA A HB2    3  
ATOM   4803  H HB3    . ALA A 1 29  ? 13.584 19.256  -4.731  1.00 0.00 ? 242 ALA A HB3    3  
ATOM   4804  N N      . VAL A 1 30  ? 16.705 17.331  -3.219  1.00 0.00 ? 243 VAL A N      3  
ATOM   4805  C CA     . VAL A 1 30  ? 17.726 16.420  -3.706  1.00 0.00 ? 243 VAL A CA     3  
ATOM   4806  C C      . VAL A 1 30  ? 17.573 15.068  -3.005  1.00 0.00 ? 243 VAL A C      3  
ATOM   4807  O O      . VAL A 1 30  ? 17.635 14.021  -3.647  1.00 0.00 ? 243 VAL A O      3  
ATOM   4808  C CB     . VAL A 1 30  ? 19.113 17.038  -3.517  1.00 0.00 ? 243 VAL A CB     3  
ATOM   4809  C CG1    . VAL A 1 30  ? 20.186 16.198  -4.211  1.00 0.00 ? 243 VAL A CG1    3  
ATOM   4810  C CG2    . VAL A 1 30  ? 19.140 18.484  -4.015  1.00 0.00 ? 243 VAL A CG2    3  
ATOM   4811  H H      . VAL A 1 30  ? 17.023 18.007  -2.555  1.00 0.00 ? 243 VAL A H      3  
ATOM   4812  H HA     . VAL A 1 30  ? 17.561 16.281  -4.775  1.00 0.00 ? 243 VAL A HA     3  
ATOM   4813  H HB     . VAL A 1 30  ? 19.332 17.047  -2.450  1.00 0.00 ? 243 VAL A HB     3  
ATOM   4814  H HG11   . VAL A 1 30  ? 20.072 15.153  -3.923  1.00 0.00 ? 243 VAL A HG11   3  
ATOM   4815  H HG12   . VAL A 1 30  ? 20.080 16.291  -5.291  1.00 0.00 ? 243 VAL A HG12   3  
ATOM   4816  H HG13   . VAL A 1 30  ? 21.174 16.551  -3.911  1.00 0.00 ? 243 VAL A HG13   3  
ATOM   4817  H HG21   . VAL A 1 30  ? 20.082 18.673  -4.529  1.00 0.00 ? 243 VAL A HG21   3  
ATOM   4818  H HG22   . VAL A 1 30  ? 18.311 18.647  -4.704  1.00 0.00 ? 243 VAL A HG22   3  
ATOM   4819  H HG23   . VAL A 1 30  ? 19.047 19.162  -3.167  1.00 0.00 ? 243 VAL A HG23   3  
ATOM   4820  N N      . LEU A 1 31  ? 17.377 15.135  -1.696  1.00 0.00 ? 244 LEU A N      3  
ATOM   4821  C CA     . LEU A 1 31  ? 17.216 13.930  -0.900  1.00 0.00 ? 244 LEU A CA     3  
ATOM   4822  C C      . LEU A 1 31  ? 15.939 13.205  -1.335  1.00 0.00 ? 244 LEU A C      3  
ATOM   4823  O O      . LEU A 1 31  ? 15.873 11.978  -1.291  1.00 0.00 ? 244 LEU A O      3  
ATOM   4824  C CB     . LEU A 1 31  ? 17.257 14.264  0.592   1.00 0.00 ? 244 LEU A CB     3  
ATOM   4825  C CG     . LEU A 1 31  ? 16.361 13.412  1.494   1.00 0.00 ? 244 LEU A CG     3  
ATOM   4826  C CD1    . LEU A 1 31  ? 16.888 11.979  1.595   1.00 0.00 ? 244 LEU A CD1    3  
ATOM   4827  C CD2    . LEU A 1 31  ? 16.195 14.060  2.870   1.00 0.00 ? 244 LEU A CD2    3  
ATOM   4828  H H      . LEU A 1 31  ? 17.328 15.991  -1.181  1.00 0.00 ? 244 LEU A H      3  
ATOM   4829  H HA     . LEU A 1 31  ? 18.067 13.283  -1.110  1.00 0.00 ? 244 LEU A HA     3  
ATOM   4830  H HB2    . LEU A 1 31  ? 18.286 14.165  0.938   1.00 0.00 ? 244 LEU A HB2    3  
ATOM   4831  H HB3    . LEU A 1 31  ? 16.976 15.309  0.718   1.00 0.00 ? 244 LEU A HB3    3  
ATOM   4832  H HG     . LEU A 1 31  ? 15.370 13.359  1.042   1.00 0.00 ? 244 LEU A HG     3  
ATOM   4833  H HD11   . LEU A 1 31  ? 16.079 11.315  1.897   1.00 0.00 ? 244 LEU A HD11   3  
ATOM   4834  H HD12   . LEU A 1 31  ? 17.274 11.665  0.625   1.00 0.00 ? 244 LEU A HD12   3  
ATOM   4835  H HD13   . LEU A 1 31  ? 17.689 11.937  2.333   1.00 0.00 ? 244 LEU A HD13   3  
ATOM   4836  H HD21   . LEU A 1 31  ? 17.176 14.212  3.321   1.00 0.00 ? 244 LEU A HD21   3  
ATOM   4837  H HD22   . LEU A 1 31  ? 15.693 15.021  2.762   1.00 0.00 ? 244 LEU A HD22   3  
ATOM   4838  H HD23   . LEU A 1 31  ? 15.599 13.407  3.509   1.00 0.00 ? 244 LEU A HD23   3  
ATOM   4839  N N      . VAL A 1 32  ? 14.957 13.997  -1.742  1.00 0.00 ? 245 VAL A N      3  
ATOM   4840  C CA     . VAL A 1 32  ? 13.687 13.446  -2.182  1.00 0.00 ? 245 VAL A CA     3  
ATOM   4841  C C      . VAL A 1 32  ? 13.867 12.799  -3.558  1.00 0.00 ? 245 VAL A C      3  
ATOM   4842  O O      . VAL A 1 32  ? 13.251 11.775  -3.851  1.00 0.00 ? 245 VAL A O      3  
ATOM   4843  C CB     . VAL A 1 32  ? 12.612 14.534  -2.169  1.00 0.00 ? 245 VAL A CB     3  
ATOM   4844  C CG1    . VAL A 1 32  ? 11.456 14.175  -3.105  1.00 0.00 ? 245 VAL A CG1    3  
ATOM   4845  C CG2    . VAL A 1 32  ? 12.108 14.789  -0.748  1.00 0.00 ? 245 VAL A CG2    3  
ATOM   4846  H H      . VAL A 1 32  ? 15.020 14.993  -1.773  1.00 0.00 ? 245 VAL A H      3  
ATOM   4847  H HA     . VAL A 1 32  ? 13.397 12.676  -1.468  1.00 0.00 ? 245 VAL A HA     3  
ATOM   4848  H HB     . VAL A 1 32  ? 13.064 15.456  -2.535  1.00 0.00 ? 245 VAL A HB     3  
ATOM   4849  H HG11   . VAL A 1 32  ? 11.080 13.182  -2.853  1.00 0.00 ? 245 VAL A HG11   3  
ATOM   4850  H HG12   . VAL A 1 32  ? 10.656 14.906  -2.991  1.00 0.00 ? 245 VAL A HG12   3  
ATOM   4851  H HG13   . VAL A 1 32  ? 11.809 14.178  -4.136  1.00 0.00 ? 245 VAL A HG13   3  
ATOM   4852  H HG21   . VAL A 1 32  ? 12.949 14.771  -0.055  1.00 0.00 ? 245 VAL A HG21   3  
ATOM   4853  H HG22   . VAL A 1 32  ? 11.622 15.764  -0.704  1.00 0.00 ? 245 VAL A HG22   3  
ATOM   4854  H HG23   . VAL A 1 32  ? 11.393 14.015  -0.471  1.00 0.00 ? 245 VAL A HG23   3  
ATOM   4855  N N      . GLU A 1 33  ? 14.712 13.423  -4.364  1.00 0.00 ? 246 GLU A N      3  
ATOM   4856  C CA     . GLU A 1 33  ? 14.980 12.922  -5.701  1.00 0.00 ? 246 GLU A CA     3  
ATOM   4857  C C      . GLU A 1 33  ? 15.942 11.734  -5.639  1.00 0.00 ? 246 GLU A C      3  
ATOM   4858  O O      . GLU A 1 33  ? 15.904 10.853  -6.498  1.00 0.00 ? 246 GLU A O      3  
ATOM   4859  C CB     . GLU A 1 33  ? 15.532 14.028  -6.602  1.00 0.00 ? 246 GLU A CB     3  
ATOM   4860  C CG     . GLU A 1 33  ? 14.399 14.788  -7.294  1.00 0.00 ? 246 GLU A CG     3  
ATOM   4861  C CD     . GLU A 1 33  ? 14.454 14.591  -8.810  1.00 0.00 ? 246 GLU A CD     3  
ATOM   4862  O OE1    . GLU A 1 33  ? 13.987 13.561  -9.319  1.00 0.00 ? 246 GLU A OE1    3  
ATOM   4863  O OE2    . GLU A 1 33  ? 15.005 15.556  -9.466  1.00 0.00 ? 246 GLU A OE2    3  
ATOM   4864  H H      . GLU A 1 33  ? 15.209 14.256  -4.118  1.00 0.00 ? 246 GLU A H      3  
ATOM   4865  H HA     . GLU A 1 33  ? 14.014 12.596  -6.087  1.00 0.00 ? 246 GLU A HA     3  
ATOM   4866  H HB2    . GLU A 1 33  ? 16.130 14.721  -6.009  1.00 0.00 ? 246 GLU A HB2    3  
ATOM   4867  H HB3    . GLU A 1 33  ? 16.195 13.595  -7.351  1.00 0.00 ? 246 GLU A HB3    3  
ATOM   4868  H HG2    . GLU A 1 33  ? 13.439 14.442  -6.913  1.00 0.00 ? 246 GLU A HG2    3  
ATOM   4869  H HG3    . GLU A 1 33  ? 14.471 15.850  -7.059  1.00 0.00 ? 246 GLU A HG3    3  
ATOM   4870  H HE2    . GLU A 1 33  ? 15.763 15.939  -8.939  1.00 0.00 ? 246 GLU A HE2    3  
ATOM   4871  N N      . ILE A 1 34  ? 16.782 11.747  -4.616  1.00 0.00 ? 247 ILE A N      3  
ATOM   4872  C CA     . ILE A 1 34  ? 17.753 10.681  -4.430  1.00 0.00 ? 247 ILE A CA     3  
ATOM   4873  C C      . ILE A 1 34  ? 17.047 9.445   -3.871  1.00 0.00 ? 247 ILE A C      3  
ATOM   4874  O O      . ILE A 1 34  ? 17.439 8.316   -4.162  1.00 0.00 ? 247 ILE A O      3  
ATOM   4875  C CB     . ILE A 1 34  ? 18.922 11.165  -3.568  1.00 0.00 ? 247 ILE A CB     3  
ATOM   4876  C CG1    . ILE A 1 34  ? 20.262 10.756  -4.183  1.00 0.00 ? 247 ILE A CG1    3  
ATOM   4877  C CG2    . ILE A 1 34  ? 18.779 10.674  -2.127  1.00 0.00 ? 247 ILE A CG2    3  
ATOM   4878  C CD1    . ILE A 1 34  ? 20.557 11.568  -5.445  1.00 0.00 ? 247 ILE A CD1    3  
ATOM   4879  H H      . ILE A 1 34  ? 16.808 12.467  -3.922  1.00 0.00 ? 247 ILE A H      3  
ATOM   4880  H HA     . ILE A 1 34  ? 18.158 10.433  -5.412  1.00 0.00 ? 247 ILE A HA     3  
ATOM   4881  H HB     . ILE A 1 34  ? 18.898 12.254  -3.542  1.00 0.00 ? 247 ILE A HB     3  
ATOM   4882  H HG12   . ILE A 1 34  ? 21.060 10.905  -3.456  1.00 0.00 ? 247 ILE A HG12   3  
ATOM   4883  H HG13   . ILE A 1 34  ? 20.247 9.694   -4.425  1.00 0.00 ? 247 ILE A HG13   3  
ATOM   4884  H HG21   . ILE A 1 34  ? 19.103 9.634   -2.063  1.00 0.00 ? 247 ILE A HG21   3  
ATOM   4885  H HG22   . ILE A 1 34  ? 19.396 11.287  -1.471  1.00 0.00 ? 247 ILE A HG22   3  
ATOM   4886  H HG23   . ILE A 1 34  ? 17.736 10.749  -1.818  1.00 0.00 ? 247 ILE A HG23   3  
ATOM   4887  H HD11   . ILE A 1 34  ? 21.015 12.518  -5.168  1.00 0.00 ? 247 ILE A HD11   3  
ATOM   4888  H HD12   . ILE A 1 34  ? 21.239 11.010  -6.086  1.00 0.00 ? 247 ILE A HD12   3  
ATOM   4889  H HD13   . ILE A 1 34  ? 19.626 11.758  -5.981  1.00 0.00 ? 247 ILE A HD13   3  
ATOM   4890  N N      . VAL A 1 35  ? 16.016 9.700   -3.078  1.00 0.00 ? 248 VAL A N      3  
ATOM   4891  C CA     . VAL A 1 35  ? 15.251 8.622   -2.476  1.00 0.00 ? 248 VAL A CA     3  
ATOM   4892  C C      . VAL A 1 35  ? 14.398 7.945   -3.550  1.00 0.00 ? 248 VAL A C      3  
ATOM   4893  O O      . VAL A 1 35  ? 14.269 6.721   -3.567  1.00 0.00 ? 248 VAL A O      3  
ATOM   4894  C CB     . VAL A 1 35  ? 14.423 9.158   -1.306  1.00 0.00 ? 248 VAL A CB     3  
ATOM   4895  C CG1    . VAL A 1 35  ? 13.442 8.099   -0.798  1.00 0.00 ? 248 VAL A CG1    3  
ATOM   4896  C CG2    . VAL A 1 35  ? 15.328 9.654   -0.176  1.00 0.00 ? 248 VAL A CG2    3  
ATOM   4897  H H      . VAL A 1 35  ? 15.703 10.620  -2.847  1.00 0.00 ? 248 VAL A H      3  
ATOM   4898  H HA     . VAL A 1 35  ? 15.961 7.895   -2.081  1.00 0.00 ? 248 VAL A HA     3  
ATOM   4899  H HB     . VAL A 1 35  ? 13.842 10.006  -1.667  1.00 0.00 ? 248 VAL A HB     3  
ATOM   4900  H HG11   . VAL A 1 35  ? 12.439 8.332   -1.157  1.00 0.00 ? 248 VAL A HG11   3  
ATOM   4901  H HG12   . VAL A 1 35  ? 13.742 7.119   -1.168  1.00 0.00 ? 248 VAL A HG12   3  
ATOM   4902  H HG13   . VAL A 1 35  ? 13.446 8.093   0.292   1.00 0.00 ? 248 VAL A HG13   3  
ATOM   4903  H HG21   . VAL A 1 35  ? 15.360 8.908   0.618   1.00 0.00 ? 248 VAL A HG21   3  
ATOM   4904  H HG22   . VAL A 1 35  ? 16.334 9.818   -0.562  1.00 0.00 ? 248 VAL A HG22   3  
ATOM   4905  H HG23   . VAL A 1 35  ? 14.934 10.590  0.221   1.00 0.00 ? 248 VAL A HG23   3  
ATOM   4906  N N      . ARG A 1 36  ? 13.838 8.769   -4.423  1.00 0.00 ? 249 ARG A N      3  
ATOM   4907  C CA     . ARG A 1 36  ? 13.002 8.265   -5.499  1.00 0.00 ? 249 ARG A CA     3  
ATOM   4908  C C      . ARG A 1 36  ? 13.868 7.681   -6.616  1.00 0.00 ? 249 ARG A C      3  
ATOM   4909  O O      . ARG A 1 36  ? 13.364 6.992   -7.502  1.00 0.00 ? 249 ARG A O      3  
ATOM   4910  C CB     . ARG A 1 36  ? 12.119 9.373   -6.076  1.00 0.00 ? 249 ARG A CB     3  
ATOM   4911  C CG     . ARG A 1 36  ? 10.636 9.034   -5.913  1.00 0.00 ? 249 ARG A CG     3  
ATOM   4912  C CD     . ARG A 1 36  ? 9.871  9.278   -7.216  1.00 0.00 ? 249 ARG A CD     3  
ATOM   4913  N NE     . ARG A 1 36  ? 8.592  9.964   -6.931  1.00 0.00 ? 249 ARG A NE     3  
ATOM   4914  C CZ     . ARG A 1 36  ? 7.560  10.016  -7.784  1.00 0.00 ? 249 ARG A CZ     3  
ATOM   4915  N NH1    . ARG A 1 36  ? 7.651  9.421   -8.982  1.00 0.00 ? 249 ARG A NH1    3  
ATOM   4916  N NH2    . ARG A 1 36  ? 6.438  10.662  -7.441  1.00 0.00 ? 249 ARG A NH2    3  
ATOM   4917  H H      . ARG A 1 36  ? 13.948 9.763   -4.404  1.00 0.00 ? 249 ARG A H      3  
ATOM   4918  H HA     . ARG A 1 36  ? 12.386 7.494   -5.036  1.00 0.00 ? 249 ARG A HA     3  
ATOM   4919  H HB2    . ARG A 1 36  ? 12.336 10.316  -5.572  1.00 0.00 ? 249 ARG A HB2    3  
ATOM   4920  H HB3    . ARG A 1 36  ? 12.350 9.516   -7.132  1.00 0.00 ? 249 ARG A HB3    3  
ATOM   4921  H HG2    . ARG A 1 36  ? 10.529 7.991   -5.615  1.00 0.00 ? 249 ARG A HG2    3  
ATOM   4922  H HG3    . ARG A 1 36  ? 10.205 9.639   -5.116  1.00 0.00 ? 249 ARG A HG3    3  
ATOM   4923  H HD2    . ARG A 1 36  ? 10.475 9.883   -7.893  1.00 0.00 ? 249 ARG A HD2    3  
ATOM   4924  H HD3    . ARG A 1 36  ? 9.681  8.330   -7.718  1.00 0.00 ? 249 ARG A HD3    3  
ATOM   4925  H HE     . ARG A 1 36  ? 8.491  10.420  -6.045  1.00 0.00 ? 249 ARG A HE     3  
ATOM   4926  H HH11   . ARG A 1 36  ? 8.488  8.939   -9.238  1.00 0.00 ? 249 ARG A HH11   3  
ATOM   4927  H HH12   . ARG A 1 36  ? 6.881  9.460   -9.618  1.00 0.00 ? 249 ARG A HH12   3  
ATOM   4928  H HH21   . ARG A 1 36  ? 6.369  11.106  -6.547  1.00 0.00 ? 249 ARG A HH21   3  
ATOM   4929  H HH22   . ARG A 1 36  ? 5.668  10.701  -8.077  1.00 0.00 ? 249 ARG A HH22   3  
ATOM   4930  N N      . ALA A 1 37  ? 15.158 7.976   -6.538  1.00 0.00 ? 250 ALA A N      3  
ATOM   4931  C CA     . ALA A 1 37  ? 16.099 7.488   -7.530  1.00 0.00 ? 250 ALA A CA     3  
ATOM   4932  C C      . ALA A 1 37  ? 16.694 6.161   -7.055  1.00 0.00 ? 250 ALA A C      3  
ATOM   4933  O O      . ALA A 1 37  ? 16.943 5.264   -7.859  1.00 0.00 ? 250 ALA A O      3  
ATOM   4934  C CB     . ALA A 1 37  ? 17.171 8.550   -7.783  1.00 0.00 ? 250 ALA A CB     3  
ATOM   4935  H H      . ALA A 1 37  ? 15.560 8.537   -5.814  1.00 0.00 ? 250 ALA A H      3  
ATOM   4936  H HA     . ALA A 1 37  ? 15.548 7.319   -8.455  1.00 0.00 ? 250 ALA A HA     3  
ATOM   4937  H HB1    . ALA A 1 37  ? 16.826 9.237   -8.557  1.00 0.00 ? 250 ALA A HB1    3  
ATOM   4938  H HB2    . ALA A 1 37  ? 17.359 9.103   -6.864  1.00 0.00 ? 250 ALA A HB2    3  
ATOM   4939  H HB3    . ALA A 1 37  ? 18.091 8.067   -8.111  1.00 0.00 ? 250 ALA A HB3    3  
ATOM   4940  N N      . LEU A 1 38  ? 16.904 6.078   -5.749  1.00 0.00 ? 251 LEU A N      3  
ATOM   4941  C CA     . LEU A 1 38  ? 17.464 4.876   -5.156  1.00 0.00 ? 251 LEU A CA     3  
ATOM   4942  C C      . LEU A 1 38  ? 16.332 3.908   -4.807  1.00 0.00 ? 251 LEU A C      3  
ATOM   4943  O O      . LEU A 1 38  ? 15.211 4.333   -4.532  1.00 0.00 ? 251 LEU A O      3  
ATOM   4944  C CB     . LEU A 1 38  ? 18.359 5.232   -3.966  1.00 0.00 ? 251 LEU A CB     3  
ATOM   4945  C CG     . LEU A 1 38  ? 17.650 5.842   -2.755  1.00 0.00 ? 251 LEU A CG     3  
ATOM   4946  C CD1    . LEU A 1 38  ? 17.103 4.753   -1.832  1.00 0.00 ? 251 LEU A CD1    3  
ATOM   4947  C CD2    . LEU A 1 38  ? 18.572 6.813   -2.013  1.00 0.00 ? 251 LEU A CD2    3  
ATOM   4948  H H      . LEU A 1 38  ? 16.698 6.812   -5.101  1.00 0.00 ? 251 LEU A H      3  
ATOM   4949  H HA     . LEU A 1 38  ? 18.100 4.408   -5.908  1.00 0.00 ? 251 LEU A HA     3  
ATOM   4950  H HB2    . LEU A 1 38  ? 18.875 4.329   -3.642  1.00 0.00 ? 251 LEU A HB2    3  
ATOM   4951  H HB3    . LEU A 1 38  ? 19.121 5.932   -4.307  1.00 0.00 ? 251 LEU A HB3    3  
ATOM   4952  H HG     . LEU A 1 38  ? 16.797 6.419   -3.113  1.00 0.00 ? 251 LEU A HG     3  
ATOM   4953  H HD11   . LEU A 1 38  ? 17.274 3.776   -2.283  1.00 0.00 ? 251 LEU A HD11   3  
ATOM   4954  H HD12   . LEU A 1 38  ? 17.612 4.802   -0.869  1.00 0.00 ? 251 LEU A HD12   3  
ATOM   4955  H HD13   . LEU A 1 38  ? 16.034 4.903   -1.685  1.00 0.00 ? 251 LEU A HD13   3  
ATOM   4956  H HD21   . LEU A 1 38  ? 19.573 6.762   -2.440  1.00 0.00 ? 251 LEU A HD21   3  
ATOM   4957  H HD22   . LEU A 1 38  ? 18.186 7.828   -2.112  1.00 0.00 ? 251 LEU A HD22   3  
ATOM   4958  H HD23   . LEU A 1 38  ? 18.613 6.541   -0.959  1.00 0.00 ? 251 LEU A HD23   3  
ATOM   4959  N N      . ARG A 1 39  ? 16.664 2.626   -4.830  1.00 0.00 ? 252 ARG A N      3  
ATOM   4960  C CA     . ARG A 1 39  ? 15.688 1.595   -4.520  1.00 0.00 ? 252 ARG A CA     3  
ATOM   4961  C C      . ARG A 1 39  ? 16.263 0.611   -3.498  1.00 0.00 ? 252 ARG A C      3  
ATOM   4962  O O      . ARG A 1 39  ? 17.418 0.201   -3.607  1.00 0.00 ? 252 ARG A O      3  
ATOM   4963  C CB     . ARG A 1 39  ? 15.277 0.829   -5.779  1.00 0.00 ? 252 ARG A CB     3  
ATOM   4964  C CG     . ARG A 1 39  ? 13.757 0.835   -5.952  1.00 0.00 ? 252 ARG A CG     3  
ATOM   4965  C CD     . ARG A 1 39  ? 13.124 -0.382  -5.275  1.00 0.00 ? 252 ARG A CD     3  
ATOM   4966  N NE     . ARG A 1 39  ? 12.623 -1.328  -6.298  1.00 0.00 ? 252 ARG A NE     3  
ATOM   4967  C CZ     . ARG A 1 39  ? 12.141 -2.546  -6.023  1.00 0.00 ? 252 ARG A CZ     3  
ATOM   4968  N NH1    . ARG A 1 39  ? 12.091 -2.977  -4.755  1.00 0.00 ? 252 ARG A NH1    3  
ATOM   4969  N NH2    . ARG A 1 39  ? 11.709 -3.337  -7.016  1.00 0.00 ? 252 ARG A NH2    3  
ATOM   4970  H H      . ARG A 1 39  ? 17.578 2.289   -5.056  1.00 0.00 ? 252 ARG A H      3  
ATOM   4971  H HA     . ARG A 1 39  ? 14.835 2.133   -4.109  1.00 0.00 ? 252 ARG A HA     3  
ATOM   4972  H HB2    . ARG A 1 39  ? 15.747 1.279   -6.653  1.00 0.00 ? 252 ARG A HB2    3  
ATOM   4973  H HB3    . ARG A 1 39  ? 15.636 -0.199  -5.718  1.00 0.00 ? 252 ARG A HB3    3  
ATOM   4974  H HG2    . ARG A 1 39  ? 13.343 1.749   -5.526  1.00 0.00 ? 252 ARG A HG2    3  
ATOM   4975  H HG3    . ARG A 1 39  ? 13.507 0.836   -7.013  1.00 0.00 ? 252 ARG A HG3    3  
ATOM   4976  H HD2    . ARG A 1 39  ? 13.857 -0.877  -4.639  1.00 0.00 ? 252 ARG A HD2    3  
ATOM   4977  H HD3    . ARG A 1 39  ? 12.304 -0.065  -4.630  1.00 0.00 ? 252 ARG A HD3    3  
ATOM   4978  H HE     . ARG A 1 39  ? 12.646 -1.038  -7.255  1.00 0.00 ? 252 ARG A HE     3  
ATOM   4979  H HH11   . ARG A 1 39  ? 12.414 -2.388  -4.014  1.00 0.00 ? 252 ARG A HH11   3  
ATOM   4980  H HH12   . ARG A 1 39  ? 11.731 -3.887  -4.549  1.00 0.00 ? 252 ARG A HH12   3  
ATOM   4981  H HH21   . ARG A 1 39  ? 11.746 -3.016  -7.961  1.00 0.00 ? 252 ARG A HH21   3  
ATOM   4982  H HH22   . ARG A 1 39  ? 11.349 -4.246  -6.810  1.00 0.00 ? 252 ARG A HH22   3  
ATOM   4983  N N      . ALA A 1 40  ? 15.431 0.261   -2.529  1.00 0.00 ? 253 ALA A N      3  
ATOM   4984  C CA     . ALA A 1 40  ? 15.841 -0.667  -1.489  1.00 0.00 ? 253 ALA A CA     3  
ATOM   4985  C C      . ALA A 1 40  ? 15.691 -2.100  -2.001  1.00 0.00 ? 253 ALA A C      3  
ATOM   4986  O O      . ALA A 1 40  ? 14.609 -2.499  -2.431  1.00 0.00 ? 253 ALA A O      3  
ATOM   4987  C CB     . ALA A 1 40  ? 15.020 -0.410  -0.223  1.00 0.00 ? 253 ALA A CB     3  
ATOM   4988  H H      . ALA A 1 40  ? 14.493 0.599   -2.448  1.00 0.00 ? 253 ALA A H      3  
ATOM   4989  H HA     . ALA A 1 40  ? 16.892 -0.477  -1.270  1.00 0.00 ? 253 ALA A HA     3  
ATOM   4990  H HB1    . ALA A 1 40  ? 14.421 -1.292  0.006   1.00 0.00 ? 253 ALA A HB1    3  
ATOM   4991  H HB2    . ALA A 1 40  ? 15.692 -0.202  0.609   1.00 0.00 ? 253 ALA A HB2    3  
ATOM   4992  H HB3    . ALA A 1 40  ? 14.363 0.444   -0.383  1.00 0.00 ? 253 ALA A HB3    3  
ATOM   4993  N N      . ARG A 1 41  ? 16.790 -2.836  -1.940  1.00 0.00 ? 254 ARG A N      3  
ATOM   4994  C CA     . ARG A 1 41  ? 16.794 -4.217  -2.391  1.00 0.00 ? 254 ARG A CA     3  
ATOM   4995  C C      . ARG A 1 41  ? 17.605 -5.088  -1.431  1.00 0.00 ? 254 ARG A C      3  
ATOM   4996  O O      . ARG A 1 41  ? 18.693 -4.702  -1.005  1.00 0.00 ? 254 ARG A O      3  
ATOM   4997  C CB     . ARG A 1 41  ? 17.385 -4.334  -3.799  1.00 0.00 ? 254 ARG A CB     3  
ATOM   4998  C CG     . ARG A 1 41  ? 17.067 -5.698  -4.415  1.00 0.00 ? 254 ARG A CG     3  
ATOM   4999  C CD     . ARG A 1 41  ? 18.320 -6.571  -4.490  1.00 0.00 ? 254 ARG A CD     3  
ATOM   5000  N NE     . ARG A 1 41  ? 18.586 -6.955  -5.894  1.00 0.00 ? 254 ARG A NE     3  
ATOM   5001  C CZ     . ARG A 1 41  ? 19.015 -6.104  -6.837  1.00 0.00 ? 254 ARG A CZ     3  
ATOM   5002  N NH1    . ARG A 1 41  ? 19.227 -4.817  -6.531  1.00 0.00 ? 254 ARG A NH1    3  
ATOM   5003  N NH2    . ARG A 1 41  ? 19.229 -6.541  -8.086  1.00 0.00 ? 254 ARG A NH2    3  
ATOM   5004  H H      . ARG A 1 41  ? 17.665 -2.504  -1.587  1.00 0.00 ? 254 ARG A H      3  
ATOM   5005  H HA     . ARG A 1 41  ? 15.744 -4.511  -2.397  1.00 0.00 ? 254 ARG A HA     3  
ATOM   5006  H HB2    . ARG A 1 41  ? 16.984 -3.542  -4.431  1.00 0.00 ? 254 ARG A HB2    3  
ATOM   5007  H HB3    . ARG A 1 41  ? 18.464 -4.192  -3.756  1.00 0.00 ? 254 ARG A HB3    3  
ATOM   5008  H HG2    . ARG A 1 41  ? 16.304 -6.201  -3.820  1.00 0.00 ? 254 ARG A HG2    3  
ATOM   5009  H HG3    . ARG A 1 41  ? 16.653 -5.561  -5.414  1.00 0.00 ? 254 ARG A HG3    3  
ATOM   5010  H HD2    . ARG A 1 41  ? 19.175 -6.030  -4.084  1.00 0.00 ? 254 ARG A HD2    3  
ATOM   5011  H HD3    . ARG A 1 41  ? 18.188 -7.464  -3.879  1.00 0.00 ? 254 ARG A HD3    3  
ATOM   5012  H HE     . ARG A 1 41  ? 18.437 -7.908  -6.156  1.00 0.00 ? 254 ARG A HE     3  
ATOM   5013  H HH11   . ARG A 1 41  ? 19.067 -4.491  -5.600  1.00 0.00 ? 254 ARG A HH11   3  
ATOM   5014  H HH12   . ARG A 1 41  ? 19.547 -4.182  -7.235  1.00 0.00 ? 254 ARG A HH12   3  
ATOM   5015  H HH21   . ARG A 1 41  ? 19.070 -7.501  -8.314  1.00 0.00 ? 254 ARG A HH21   3  
ATOM   5016  H HH22   . ARG A 1 41  ? 19.548 -5.905  -8.789  1.00 0.00 ? 254 ARG A HH22   3  
ATOM   5017  N N      . THR A 1 42  ? 17.046 -6.248  -1.118  1.00 0.00 ? 255 THR A N      3  
ATOM   5018  C CA     . THR A 1 42  ? 17.704 -7.177  -0.216  1.00 0.00 ? 255 THR A CA     3  
ATOM   5019  C C      . THR A 1 42  ? 18.432 -8.265  -1.008  1.00 0.00 ? 255 THR A C      3  
ATOM   5020  O O      . THR A 1 42  ? 17.904 -8.778  -1.994  1.00 0.00 ? 255 THR A O      3  
ATOM   5021  C CB     . THR A 1 42  ? 16.650 -7.729  0.746   1.00 0.00 ? 255 THR A CB     3  
ATOM   5022  O OG1    . THR A 1 42  ? 15.946 -6.572  1.191   1.00 0.00 ? 255 THR A OG1    3  
ATOM   5023  C CG2    . THR A 1 42  ? 17.266 -8.304  2.023   1.00 0.00 ? 255 THR A CG2    3  
ATOM   5024  H H      . THR A 1 42  ? 16.161 -6.555  -1.469  1.00 0.00 ? 255 THR A H      3  
ATOM   5025  H HA     . THR A 1 42  ? 18.461 -6.631  0.347   1.00 0.00 ? 255 THR A HA     3  
ATOM   5026  H HB     . THR A 1 42  ? 16.020 -8.467  0.252   1.00 0.00 ? 255 THR A HB     3  
ATOM   5027  H HG1    . THR A 1 42  ? 14.983 -6.794  1.342   1.00 0.00 ? 255 THR A HG1    3  
ATOM   5028  H HG21   . THR A 1 42  ? 16.989 -9.354  2.120   1.00 0.00 ? 255 THR A HG21   3  
ATOM   5029  H HG22   . THR A 1 42  ? 18.352 -8.217  1.974   1.00 0.00 ? 255 THR A HG22   3  
ATOM   5030  H HG23   . THR A 1 42  ? 16.897 -7.750  2.886   1.00 0.00 ? 255 THR A HG23   3  
ATOM   5031  N N      . VAL A 1 43  ? 19.633 -8.585  -0.548  1.00 0.00 ? 256 VAL A N      3  
ATOM   5032  C CA     . VAL A 1 43  ? 20.439 -9.601  -1.201  1.00 0.00 ? 256 VAL A CA     3  
ATOM   5033  C C      . VAL A 1 43  ? 20.546 -10.826 -0.288  1.00 0.00 ? 256 VAL A C      3  
ATOM   5034  O O      . VAL A 1 43  ? 20.944 -10.708 0.869   1.00 0.00 ? 256 VAL A O      3  
ATOM   5035  C CB     . VAL A 1 43  ? 21.801 -9.022  -1.586  1.00 0.00 ? 256 VAL A CB     3  
ATOM   5036  C CG1    . VAL A 1 43  ? 21.794 -8.517  -3.030  1.00 0.00 ? 256 VAL A CG1    3  
ATOM   5037  C CG2    . VAL A 1 43  ? 22.218 -7.913  -0.619  1.00 0.00 ? 256 VAL A CG2    3  
ATOM   5038  H H      . VAL A 1 43  ? 20.054 -8.162  0.255   1.00 0.00 ? 256 VAL A H      3  
ATOM   5039  H HA     . VAL A 1 43  ? 19.923 -9.891  -2.117  1.00 0.00 ? 256 VAL A HA     3  
ATOM   5040  H HB     . VAL A 1 43  ? 22.538 -9.822  -1.515  1.00 0.00 ? 256 VAL A HB     3  
ATOM   5041  H HG11   . VAL A 1 43  ? 22.524 -7.714  -3.138  1.00 0.00 ? 256 VAL A HG11   3  
ATOM   5042  H HG12   . VAL A 1 43  ? 22.051 -9.335  -3.702  1.00 0.00 ? 256 VAL A HG12   3  
ATOM   5043  H HG13   . VAL A 1 43  ? 20.801 -8.142  -3.279  1.00 0.00 ? 256 VAL A HG13   3  
ATOM   5044  H HG21   . VAL A 1 43  ? 22.052 -8.243  0.407   1.00 0.00 ? 256 VAL A HG21   3  
ATOM   5045  H HG22   . VAL A 1 43  ? 23.275 -7.686  -0.760  1.00 0.00 ? 256 VAL A HG22   3  
ATOM   5046  H HG23   . VAL A 1 43  ? 21.626 -7.019  -0.814  1.00 0.00 ? 256 VAL A HG23   3  
ATOM   5047  N N      . PRO A 1 44  ? 20.173 -12.002 -0.859  1.00 0.00 ? 257 PRO A N      3  
ATOM   5048  C CA     . PRO A 1 44  ? 20.223 -13.246 -0.110  1.00 0.00 ? 257 PRO A CA     3  
ATOM   5049  C C      . PRO A 1 44  ? 21.664 -13.737 0.042   1.00 0.00 ? 257 PRO A C      3  
ATOM   5050  O O      . PRO A 1 44  ? 22.514 -13.450 -0.799  1.00 0.00 ? 257 PRO A O      3  
ATOM   5051  C CB     . PRO A 1 44  ? 19.346 -14.212 -0.892  1.00 0.00 ? 257 PRO A CB     3  
ATOM   5052  C CG     . PRO A 1 44  ? 19.214 -13.619 -2.286  1.00 0.00 ? 257 PRO A CG     3  
ATOM   5053  C CD     . PRO A 1 44  ? 19.695 -12.179 -2.228  1.00 0.00 ? 257 PRO A CD     3  
ATOM   5054  H HA     . PRO A 1 44  ? 19.882 -13.106 0.819   1.00 0.00 ? 257 PRO A HA     3  
ATOM   5055  H HB2    . PRO A 1 44  ? 19.796 -15.204 -0.930  1.00 0.00 ? 257 PRO A HB2    3  
ATOM   5056  H HB3    . PRO A 1 44  ? 18.370 -14.322 -0.421  1.00 0.00 ? 257 PRO A HB3    3  
ATOM   5057  H HG2    . PRO A 1 44  ? 19.807 -14.191 -3.001  1.00 0.00 ? 257 PRO A HG2    3  
ATOM   5058  H HG3    . PRO A 1 44  ? 18.179 -13.663 -2.622  1.00 0.00 ? 257 PRO A HG3    3  
ATOM   5059  H HD2    . PRO A 1 44  ? 20.491 -11.997 -2.951  1.00 0.00 ? 257 PRO A HD2    3  
ATOM   5060  H HD3    . PRO A 1 44  ? 18.890 -11.483 -2.460  1.00 0.00 ? 257 PRO A HD3    3  
ATOM   5061  N N      . ALA A 1 45  ? 21.896 -14.468 1.123   1.00 0.00 ? 258 ALA A N      3  
ATOM   5062  C CA     . ALA A 1 45  ? 23.219 -15.001 1.397   1.00 0.00 ? 258 ALA A CA     3  
ATOM   5063  C C      . ALA A 1 45  ? 23.741 -15.722 0.152   1.00 0.00 ? 258 ALA A C      3  
ATOM   5064  O O      . ALA A 1 45  ? 23.041 -16.548 -0.430  1.00 0.00 ? 258 ALA A O      3  
ATOM   5065  C CB     . ALA A 1 45  ? 23.157 -15.918 2.619   1.00 0.00 ? 258 ALA A CB     3  
ATOM   5066  H H      . ALA A 1 45  ? 21.199 -14.697 1.802   1.00 0.00 ? 258 ALA A H      3  
ATOM   5067  H HA     . ALA A 1 45  ? 23.875 -14.159 1.621   1.00 0.00 ? 258 ALA A HA     3  
ATOM   5068  H HB1    . ALA A 1 45  ? 22.346 -15.597 3.274   1.00 0.00 ? 258 ALA A HB1    3  
ATOM   5069  H HB2    . ALA A 1 45  ? 22.979 -16.943 2.296   1.00 0.00 ? 258 ALA A HB2    3  
ATOM   5070  H HB3    . ALA A 1 45  ? 24.102 -15.866 3.160   1.00 0.00 ? 258 ALA A HB3    3  
ATOM   5071  N N      . GLY A 1 46  ? 24.967 -15.383 -0.219  1.00 0.00 ? 259 GLY A N      3  
ATOM   5072  C CA     . GLY A 1 46  ? 25.591 -15.987 -1.383  1.00 0.00 ? 259 GLY A CA     3  
ATOM   5073  C C      . GLY A 1 46  ? 25.324 -15.158 -2.641  1.00 0.00 ? 259 GLY A C      3  
ATOM   5074  O O      . GLY A 1 46  ? 25.868 -15.447 -3.706  1.00 0.00 ? 259 GLY A O      3  
ATOM   5075  H H      . GLY A 1 46  ? 25.530 -14.710 0.260   1.00 0.00 ? 259 GLY A H      3  
ATOM   5076  H HA2    . GLY A 1 46  ? 26.665 -16.074 -1.221  1.00 0.00 ? 259 GLY A HA2    3  
ATOM   5077  H HA3    . GLY A 1 46  ? 25.207 -16.998 -1.522  1.00 0.00 ? 259 GLY A HA3    3  
ATOM   5078  N N      . ALA A 1 47  ? 24.488 -14.144 -2.476  1.00 0.00 ? 260 ALA A N      3  
ATOM   5079  C CA     . ALA A 1 47  ? 24.144 -13.270 -3.584  1.00 0.00 ? 260 ALA A CA     3  
ATOM   5080  C C      . ALA A 1 47  ? 25.311 -12.322 -3.863  1.00 0.00 ? 260 ALA A C      3  
ATOM   5081  O O      . ALA A 1 47  ? 25.720 -11.560 -2.987  1.00 0.00 ? 260 ALA A O      3  
ATOM   5082  C CB     . ALA A 1 47  ? 22.849 -12.521 -3.261  1.00 0.00 ? 260 ALA A CB     3  
ATOM   5083  H H      . ALA A 1 47  ? 24.051 -13.915 -1.606  1.00 0.00 ? 260 ALA A H      3  
ATOM   5084  H HA     . ALA A 1 47  ? 23.978 -13.896 -4.461  1.00 0.00 ? 260 ALA A HA     3  
ATOM   5085  H HB1    . ALA A 1 47  ? 22.075 -13.237 -2.983  1.00 0.00 ? 260 ALA A HB1    3  
ATOM   5086  H HB2    . ALA A 1 47  ? 23.024 -11.835 -2.433  1.00 0.00 ? 260 ALA A HB2    3  
ATOM   5087  H HB3    . ALA A 1 47  ? 22.526 -11.959 -4.138  1.00 0.00 ? 260 ALA A HB3    3  
ATOM   5088  N N      . VAL A 1 48  ? 25.816 -12.399 -5.086  1.00 0.00 ? 261 VAL A N      3  
ATOM   5089  C CA     . VAL A 1 48  ? 26.928 -11.557 -5.491  1.00 0.00 ? 261 VAL A CA     3  
ATOM   5090  C C      . VAL A 1 48  ? 26.427 -10.129 -5.715  1.00 0.00 ? 261 VAL A C      3  
ATOM   5091  O O      . VAL A 1 48  ? 25.596 -9.890  -6.589  1.00 0.00 ? 261 VAL A O      3  
ATOM   5092  C CB     . VAL A 1 48  ? 27.613 -12.150 -6.724  1.00 0.00 ? 261 VAL A CB     3  
ATOM   5093  C CG1    . VAL A 1 48  ? 28.692 -11.208 -7.259  1.00 0.00 ? 261 VAL A CG1    3  
ATOM   5094  C CG2    . VAL A 1 48  ? 28.195 -13.531 -6.416  1.00 0.00 ? 261 VAL A CG2    3  
ATOM   5095  H H      . VAL A 1 48  ? 25.478 -13.021 -5.791  1.00 0.00 ? 261 VAL A H      3  
ATOM   5096  H HA     . VAL A 1 48  ? 27.651 -11.551 -4.674  1.00 0.00 ? 261 VAL A HA     3  
ATOM   5097  H HB     . VAL A 1 48  ? 26.858 -12.271 -7.500  1.00 0.00 ? 261 VAL A HB     3  
ATOM   5098  H HG11   . VAL A 1 48  ? 29.221 -10.750 -6.424  1.00 0.00 ? 261 VAL A HG11   3  
ATOM   5099  H HG12   . VAL A 1 48  ? 29.397 -11.771 -7.871  1.00 0.00 ? 261 VAL A HG12   3  
ATOM   5100  H HG13   . VAL A 1 48  ? 28.227 -10.430 -7.865  1.00 0.00 ? 261 VAL A HG13   3  
ATOM   5101  H HG21   . VAL A 1 48  ? 28.495 -14.014 -7.346  1.00 0.00 ? 261 VAL A HG21   3  
ATOM   5102  H HG22   . VAL A 1 48  ? 29.064 -13.422 -5.766  1.00 0.00 ? 261 VAL A HG22   3  
ATOM   5103  H HG23   . VAL A 1 48  ? 27.441 -14.141 -5.916  1.00 0.00 ? 261 VAL A HG23   3  
ATOM   5104  N N      . ILE A 1 49  ? 26.953 -9.217  -4.910  1.00 0.00 ? 262 ILE A N      3  
ATOM   5105  C CA     . ILE A 1 49  ? 26.569 -7.819  -5.010  1.00 0.00 ? 262 ILE A CA     3  
ATOM   5106  C C      . ILE A 1 49  ? 27.532 -7.096  -5.953  1.00 0.00 ? 262 ILE A C      3  
ATOM   5107  O O      . ILE A 1 49  ? 27.107 -6.306  -6.793  1.00 0.00 ? 262 ILE A O      3  
ATOM   5108  C CB     . ILE A 1 49  ? 26.479 -7.188  -3.619  1.00 0.00 ? 262 ILE A CB     3  
ATOM   5109  C CG1    . ILE A 1 49  ? 25.711 -8.094  -2.654  1.00 0.00 ? 262 ILE A CG1    3  
ATOM   5110  C CG2    . ILE A 1 49  ? 25.873 -5.785  -3.692  1.00 0.00 ? 262 ILE A CG2    3  
ATOM   5111  C CD1    . ILE A 1 49  ? 25.878 -7.621  -1.209  1.00 0.00 ? 262 ILE A CD1    3  
ATOM   5112  H H      . ILE A 1 49  ? 27.628 -9.420  -4.201  1.00 0.00 ? 262 ILE A H      3  
ATOM   5113  H HA     . ILE A 1 49  ? 25.569 -7.786  -5.445  1.00 0.00 ? 262 ILE A HA     3  
ATOM   5114  H HB     . ILE A 1 49  ? 27.490 -7.082  -3.226  1.00 0.00 ? 262 ILE A HB     3  
ATOM   5115  H HG12   . ILE A 1 49  ? 24.654 -8.101  -2.919  1.00 0.00 ? 262 ILE A HG12   3  
ATOM   5116  H HG13   . ILE A 1 49  ? 26.070 -9.118  -2.748  1.00 0.00 ? 262 ILE A HG13   3  
ATOM   5117  H HG21   . ILE A 1 49  ? 26.449 -5.176  -4.390  1.00 0.00 ? 262 ILE A HG21   3  
ATOM   5118  H HG22   . ILE A 1 49  ? 24.841 -5.852  -4.036  1.00 0.00 ? 262 ILE A HG22   3  
ATOM   5119  H HG23   . ILE A 1 49  ? 25.898 -5.327  -2.704  1.00 0.00 ? 262 ILE A HG23   3  
ATOM   5120  H HD11   . ILE A 1 49  ? 26.906 -7.785  -0.888  1.00 0.00 ? 262 ILE A HD11   3  
ATOM   5121  H HD12   . ILE A 1 49  ? 25.642 -6.559  -1.145  1.00 0.00 ? 262 ILE A HD12   3  
ATOM   5122  H HD13   . ILE A 1 49  ? 25.201 -8.182  -0.563  1.00 0.00 ? 262 ILE A HD13   3  
ATOM   5123  N N      . CYS A 1 50  ? 28.813 -7.392  -5.780  1.00 0.00 ? 263 CYS A N      3  
ATOM   5124  C CA     . CYS A 1 50  ? 29.839 -6.780  -6.606  1.00 0.00 ? 263 CYS A CA     3  
ATOM   5125  C C      . CYS A 1 50  ? 30.781 -7.882  -7.096  1.00 0.00 ? 263 CYS A C      3  
ATOM   5126  O O      . CYS A 1 50  ? 31.124 -8.791  -6.343  1.00 0.00 ? 263 CYS A O      3  
ATOM   5127  C CB     . CYS A 1 50  ? 30.590 -5.681  -5.851  1.00 0.00 ? 263 CYS A CB     3  
ATOM   5128  S SG     . CYS A 1 50  ? 29.455 -4.822  -4.703  1.00 0.00 ? 263 CYS A SG     3  
ATOM   5129  H H      . CYS A 1 50  ? 29.150 -8.037  -5.094  1.00 0.00 ? 263 CYS A H      3  
ATOM   5130  H HA     . CYS A 1 50  ? 29.328 -6.306  -7.443  1.00 0.00 ? 263 CYS A HA     3  
ATOM   5131  H HB2    . CYS A 1 50  ? 31.423 -6.114  -5.296  1.00 0.00 ? 263 CYS A HB2    3  
ATOM   5132  H HB3    . CYS A 1 50  ? 31.015 -4.969  -6.557  1.00 0.00 ? 263 CYS A HB3    3  
ATOM   5133  H HG     . CYS A 1 50  ? 28.393 -4.859  -5.503  1.00 0.00 ? 263 CYS A HG     3  
ATOM   5134  N N      . ARG A 1 51  ? 31.172 -7.763  -8.357  1.00 0.00 ? 264 ARG A N      3  
ATOM   5135  C CA     . ARG A 1 51  ? 32.067 -8.737  -8.957  1.00 0.00 ? 264 ARG A CA     3  
ATOM   5136  C C      . ARG A 1 51  ? 33.358 -8.058  -9.420  1.00 0.00 ? 264 ARG A C      3  
ATOM   5137  O O      . ARG A 1 51  ? 33.322 -7.143  -10.241 1.00 0.00 ? 264 ARG A O      3  
ATOM   5138  C CB     . ARG A 1 51  ? 31.406 -9.429  -10.152 1.00 0.00 ? 264 ARG A CB     3  
ATOM   5139  C CG     . ARG A 1 51  ? 32.284 -10.567 -10.680 1.00 0.00 ? 264 ARG A CG     3  
ATOM   5140  C CD     . ARG A 1 51  ? 31.434 -11.779 -11.068 1.00 0.00 ? 264 ARG A CD     3  
ATOM   5141  N NE     . ARG A 1 51  ? 30.678 -11.491 -12.307 1.00 0.00 ? 264 ARG A NE     3  
ATOM   5142  C CZ     . ARG A 1 51  ? 29.390 -11.121 -12.332 1.00 0.00 ? 264 ARG A CZ     3  
ATOM   5143  N NH1    . ARG A 1 51  ? 28.707 -10.992 -11.187 1.00 0.00 ? 264 ARG A NH1    3  
ATOM   5144  N NH2    . ARG A 1 51  ? 28.785 -10.880 -13.503 1.00 0.00 ? 264 ARG A NH2    3  
ATOM   5145  H H      . ARG A 1 51  ? 30.888 -7.020  -8.963  1.00 0.00 ? 264 ARG A H      3  
ATOM   5146  H HA     . ARG A 1 51  ? 32.265 -9.459  -8.165  1.00 0.00 ? 264 ARG A HA     3  
ATOM   5147  H HB2    . ARG A 1 51  ? 30.434 -9.822  -9.857  1.00 0.00 ? 264 ARG A HB2    3  
ATOM   5148  H HB3    . ARG A 1 51  ? 31.230 -8.703  -10.945 1.00 0.00 ? 264 ARG A HB3    3  
ATOM   5149  H HG2    . ARG A 1 51  ? 32.850 -10.222 -11.545 1.00 0.00 ? 264 ARG A HG2    3  
ATOM   5150  H HG3    . ARG A 1 51  ? 33.008 -10.855 -9.919  1.00 0.00 ? 264 ARG A HG3    3  
ATOM   5151  H HD2    . ARG A 1 51  ? 32.074 -12.648 -11.217 1.00 0.00 ? 264 ARG A HD2    3  
ATOM   5152  H HD3    . ARG A 1 51  ? 30.745 -12.024 -10.261 1.00 0.00 ? 264 ARG A HD3    3  
ATOM   5153  H HE     . ARG A 1 51  ? 31.158 -11.577 -13.181 1.00 0.00 ? 264 ARG A HE     3  
ATOM   5154  H HH11   . ARG A 1 51  ? 29.159 -11.172 -10.312 1.00 0.00 ? 264 ARG A HH11   3  
ATOM   5155  H HH12   . ARG A 1 51  ? 27.746 -10.717 -11.205 1.00 0.00 ? 264 ARG A HH12   3  
ATOM   5156  H HH21   . ARG A 1 51  ? 29.294 -10.975 -14.359 1.00 0.00 ? 264 ARG A HH21   3  
ATOM   5157  H HH22   . ARG A 1 51  ? 27.823 -10.604 -13.522 1.00 0.00 ? 264 ARG A HH22   3  
ATOM   5158  N N      . ILE A 1 52  ? 34.467 -8.533  -8.873  1.00 0.00 ? 265 ILE A N      3  
ATOM   5159  C CA     . ILE A 1 52  ? 35.766 -7.984  -9.220  1.00 0.00 ? 265 ILE A CA     3  
ATOM   5160  C C      . ILE A 1 52  ? 35.952 -8.040  -10.738 1.00 0.00 ? 265 ILE A C      3  
ATOM   5161  O O      . ILE A 1 52  ? 35.508 -8.986  -11.386 1.00 0.00 ? 265 ILE A O      3  
ATOM   5162  C CB     . ILE A 1 52  ? 36.875 -8.693  -8.439  1.00 0.00 ? 265 ILE A CB     3  
ATOM   5163  C CG1    . ILE A 1 52  ? 38.244 -8.088  -8.755  1.00 0.00 ? 265 ILE A CG1    3  
ATOM   5164  C CG2    . ILE A 1 52  ? 36.842 -10.202 -8.690  1.00 0.00 ? 265 ILE A CG2    3  
ATOM   5165  C CD1    . ILE A 1 52  ? 39.210 -8.276  -7.585  1.00 0.00 ? 265 ILE A CD1    3  
ATOM   5166  H H      . ILE A 1 52  ? 34.488 -9.279  -8.207  1.00 0.00 ? 265 ILE A H      3  
ATOM   5167  H HA     . ILE A 1 52  ? 35.773 -6.938  -8.909  1.00 0.00 ? 265 ILE A HA     3  
ATOM   5168  H HB     . ILE A 1 52  ? 36.694 -8.540  -7.374  1.00 0.00 ? 265 ILE A HB     3  
ATOM   5169  H HG12   . ILE A 1 52  ? 38.653 -8.557  -9.650  1.00 0.00 ? 265 ILE A HG12   3  
ATOM   5170  H HG13   . ILE A 1 52  ? 38.134 -7.026  -8.974  1.00 0.00 ? 265 ILE A HG13   3  
ATOM   5171  H HG21   . ILE A 1 52  ? 37.572 -10.458 -9.458  1.00 0.00 ? 265 ILE A HG21   3  
ATOM   5172  H HG22   . ILE A 1 52  ? 37.086 -10.730 -7.767  1.00 0.00 ? 265 ILE A HG22   3  
ATOM   5173  H HG23   . ILE A 1 52  ? 35.846 -10.494 -9.022  1.00 0.00 ? 265 ILE A HG23   3  
ATOM   5174  H HD11   . ILE A 1 52  ? 39.391 -7.315  -7.104  1.00 0.00 ? 265 ILE A HD11   3  
ATOM   5175  H HD12   . ILE A 1 52  ? 38.777 -8.968  -6.862  1.00 0.00 ? 265 ILE A HD12   3  
ATOM   5176  H HD13   . ILE A 1 52  ? 40.153 -8.681  -7.954  1.00 0.00 ? 265 ILE A HD13   3  
ATOM   5177  N N      . GLY A 1 53  ? 36.608 -7.013  -11.260 1.00 0.00 ? 266 GLY A N      3  
ATOM   5178  C CA     . GLY A 1 53  ? 36.857 -6.935  -12.689 1.00 0.00 ? 266 GLY A CA     3  
ATOM   5179  C C      . GLY A 1 53  ? 35.738 -6.170  -13.399 1.00 0.00 ? 266 GLY A C      3  
ATOM   5180  O O      . GLY A 1 53  ? 36.003 -5.333  -14.261 1.00 0.00 ? 266 GLY A O      3  
ATOM   5181  H H      . GLY A 1 53  ? 36.966 -6.248  -10.725 1.00 0.00 ? 266 GLY A H      3  
ATOM   5182  H HA2    . GLY A 1 53  ? 37.812 -6.441  -12.868 1.00 0.00 ? 266 GLY A HA2    3  
ATOM   5183  H HA3    . GLY A 1 53  ? 36.936 -7.940  -13.104 1.00 0.00 ? 266 GLY A HA3    3  
ATOM   5184  N N      . GLU A 1 54  ? 34.512 -6.485  -13.011 1.00 0.00 ? 267 GLU A N      3  
ATOM   5185  C CA     . GLU A 1 54  ? 33.352 -5.839  -13.601 1.00 0.00 ? 267 GLU A CA     3  
ATOM   5186  C C      . GLU A 1 54  ? 33.286 -4.372  -13.171 1.00 0.00 ? 267 GLU A C      3  
ATOM   5187  O O      . GLU A 1 54  ? 33.582 -4.044  -12.023 1.00 0.00 ? 267 GLU A O      3  
ATOM   5188  C CB     . GLU A 1 54  ? 32.064 -6.577  -13.228 1.00 0.00 ? 267 GLU A CB     3  
ATOM   5189  C CG     . GLU A 1 54  ? 31.868 -7.815  -14.107 1.00 0.00 ? 267 GLU A CG     3  
ATOM   5190  C CD     . GLU A 1 54  ? 31.697 -7.422  -15.576 1.00 0.00 ? 267 GLU A CD     3  
ATOM   5191  O OE1    . GLU A 1 54  ? 32.695 -7.263  -16.294 1.00 0.00 ? 267 GLU A OE1    3  
ATOM   5192  O OE2    . GLU A 1 54  ? 30.475 -7.285  -15.965 1.00 0.00 ? 267 GLU A OE2    3  
ATOM   5193  H H      . GLU A 1 54  ? 34.305 -7.167  -12.310 1.00 0.00 ? 267 GLU A H      3  
ATOM   5194  H HA     . GLU A 1 54  ? 33.500 -5.902  -14.678 1.00 0.00 ? 267 GLU A HA     3  
ATOM   5195  H HB2    . GLU A 1 54  ? 32.100 -6.873  -12.180 1.00 0.00 ? 267 GLU A HB2    3  
ATOM   5196  H HB3    . GLU A 1 54  ? 31.211 -5.908  -13.341 1.00 0.00 ? 267 GLU A HB3    3  
ATOM   5197  H HG2    . GLU A 1 54  ? 32.724 -8.479  -14.001 1.00 0.00 ? 267 GLU A HG2    3  
ATOM   5198  H HG3    . GLU A 1 54  ? 30.992 -8.368  -13.770 1.00 0.00 ? 267 GLU A HG3    3  
ATOM   5199  H HE2    . GLU A 1 54  ? 29.924 -8.052  -15.639 1.00 0.00 ? 267 GLU A HE2    3  
ATOM   5200  N N      . PRO A 1 55  ? 32.886 -3.506  -14.140 1.00 0.00 ? 268 PRO A N      3  
ATOM   5201  C CA     . PRO A 1 55  ? 32.778 -2.081  -13.874 1.00 0.00 ? 268 PRO A CA     3  
ATOM   5202  C C      . PRO A 1 55  ? 31.535 -1.773  -13.037 1.00 0.00 ? 268 PRO A C      3  
ATOM   5203  O O      . PRO A 1 55  ? 30.477 -2.365  -13.248 1.00 0.00 ? 268 PRO A O      3  
ATOM   5204  C CB     . PRO A 1 55  ? 32.749 -1.426  -15.245 1.00 0.00 ? 268 PRO A CB     3  
ATOM   5205  C CG     . PRO A 1 55  ? 32.374 -2.526  -16.225 1.00 0.00 ? 268 PRO A CG     3  
ATOM   5206  C CD     . PRO A 1 55  ? 32.527 -3.859  -15.511 1.00 0.00 ? 268 PRO A CD     3  
ATOM   5207  H HA     . PRO A 1 55  ? 33.558 -1.770  -13.330 1.00 0.00 ? 268 PRO A HA     3  
ATOM   5208  H HB2    . PRO A 1 55  ? 32.023 -0.613  -15.273 1.00 0.00 ? 268 PRO A HB2    3  
ATOM   5209  H HB3    . PRO A 1 55  ? 33.720 -0.996  -15.493 1.00 0.00 ? 268 PRO A HB3    3  
ATOM   5210  H HG2    . PRO A 1 55  ? 31.349 -2.394  -16.572 1.00 0.00 ? 268 PRO A HG2    3  
ATOM   5211  H HG3    . PRO A 1 55  ? 33.016 -2.487  -17.105 1.00 0.00 ? 268 PRO A HG3    3  
ATOM   5212  H HD2    . PRO A 1 55  ? 31.602 -4.433  -15.543 1.00 0.00 ? 268 PRO A HD2    3  
ATOM   5213  H HD3    . PRO A 1 55  ? 33.299 -4.472  -15.977 1.00 0.00 ? 268 PRO A HD3    3  
ATOM   5214  N N      . GLY A 1 56  ? 31.703 -0.847  -12.105 1.00 0.00 ? 269 GLY A N      3  
ATOM   5215  C CA     . GLY A 1 56  ? 30.608 -0.452  -11.236 1.00 0.00 ? 269 GLY A CA     3  
ATOM   5216  C C      . GLY A 1 56  ? 29.828 0.721   -11.833 1.00 0.00 ? 269 GLY A C      3  
ATOM   5217  O O      . GLY A 1 56  ? 30.423 1.676   -12.331 1.00 0.00 ? 269 GLY A O      3  
ATOM   5218  H H      . GLY A 1 56  ? 32.566 -0.371  -11.940 1.00 0.00 ? 269 GLY A H      3  
ATOM   5219  H HA2    . GLY A 1 56  ? 29.937 -1.299  -11.082 1.00 0.00 ? 269 GLY A HA2    3  
ATOM   5220  H HA3    . GLY A 1 56  ? 30.998 -0.174  -10.256 1.00 0.00 ? 269 GLY A HA3    3  
ATOM   5221  N N      . ASP A 1 57  ? 28.510 0.611   -11.763 1.00 0.00 ? 270 ASP A N      3  
ATOM   5222  C CA     . ASP A 1 57  ? 27.643 1.651   -12.290 1.00 0.00 ? 270 ASP A CA     3  
ATOM   5223  C C      . ASP A 1 57  ? 26.527 1.938   -11.285 1.00 0.00 ? 270 ASP A C      3  
ATOM   5224  O O      . ASP A 1 57  ? 25.459 2.421   -11.657 1.00 0.00 ? 270 ASP A O      3  
ATOM   5225  C CB     . ASP A 1 57  ? 26.994 1.213   -13.605 1.00 0.00 ? 270 ASP A CB     3  
ATOM   5226  C CG     . ASP A 1 57  ? 27.754 1.620   -14.869 1.00 0.00 ? 270 ASP A CG     3  
ATOM   5227  O OD1    . ASP A 1 57  ? 27.762 2.797   -15.258 1.00 0.00 ? 270 ASP A OD1    3  
ATOM   5228  O OD2    . ASP A 1 57  ? 28.365 0.657   -15.471 1.00 0.00 ? 270 ASP A OD2    3  
ATOM   5229  H H      . ASP A 1 57  ? 28.034 -0.168  -11.356 1.00 0.00 ? 270 ASP A H      3  
ATOM   5230  H HA     . ASP A 1 57  ? 28.293 2.512   -12.450 1.00 0.00 ? 270 ASP A HA     3  
ATOM   5231  H HB2    . ASP A 1 57  ? 26.887 0.128   -13.596 1.00 0.00 ? 270 ASP A HB2    3  
ATOM   5232  H HB3    . ASP A 1 57  ? 25.988 1.632   -13.653 1.00 0.00 ? 270 ASP A HB3    3  
ATOM   5233  H HD2    . ASP A 1 57  ? 29.244 0.480   -15.029 1.00 0.00 ? 270 ASP A HD2    3  
ATOM   5234  N N      . ARG A 1 58  ? 26.813 1.629   -10.028 1.00 0.00 ? 271 ARG A N      3  
ATOM   5235  C CA     . ARG A 1 58  ? 25.846 1.848   -8.965  1.00 0.00 ? 271 ARG A CA     3  
ATOM   5236  C C      . ARG A 1 58  ? 26.519 1.707   -7.598  1.00 0.00 ? 271 ARG A C      3  
ATOM   5237  O O      . ARG A 1 58  ? 27.593 1.116   -7.489  1.00 0.00 ? 271 ARG A O      3  
ATOM   5238  C CB     . ARG A 1 58  ? 24.688 0.854   -9.061  1.00 0.00 ? 271 ARG A CB     3  
ATOM   5239  C CG     . ARG A 1 58  ? 25.183 -0.584  -8.886  1.00 0.00 ? 271 ARG A CG     3  
ATOM   5240  C CD     . ARG A 1 58  ? 24.293 -1.567  -9.649  1.00 0.00 ? 271 ARG A CD     3  
ATOM   5241  N NE     . ARG A 1 58  ? 24.500 -1.411  -11.106 1.00 0.00 ? 271 ARG A NE     3  
ATOM   5242  C CZ     . ARG A 1 58  ? 25.525 -1.947  -11.781 1.00 0.00 ? 271 ARG A CZ     3  
ATOM   5243  N NH1    . ARG A 1 58  ? 26.444 -2.679  -11.134 1.00 0.00 ? 271 ARG A NH1    3  
ATOM   5244  N NH2    . ARG A 1 58  ? 25.633 -1.754  -13.102 1.00 0.00 ? 271 ARG A NH2    3  
ATOM   5245  H H      . ARG A 1 58  ? 27.684 1.237   -9.732  1.00 0.00 ? 271 ARG A H      3  
ATOM   5246  H HA     . ARG A 1 58  ? 25.485 2.864   -9.122  1.00 0.00 ? 271 ARG A HA     3  
ATOM   5247  H HB2    . ARG A 1 58  ? 23.944 1.081   -8.297  1.00 0.00 ? 271 ARG A HB2    3  
ATOM   5248  H HB3    . ARG A 1 58  ? 24.194 0.956   -10.028 1.00 0.00 ? 271 ARG A HB3    3  
ATOM   5249  H HG2    . ARG A 1 58  ? 26.210 -0.665  -9.243  1.00 0.00 ? 271 ARG A HG2    3  
ATOM   5250  H HG3    . ARG A 1 58  ? 25.192 -0.843  -7.826  1.00 0.00 ? 271 ARG A HG3    3  
ATOM   5251  H HD2    . ARG A 1 58  ? 24.525 -2.589  -9.347  1.00 0.00 ? 271 ARG A HD2    3  
ATOM   5252  H HD3    . ARG A 1 58  ? 23.247 -1.391  -9.400  1.00 0.00 ? 271 ARG A HD3    3  
ATOM   5253  H HE     . ARG A 1 58  ? 23.832 -0.871  -11.619 1.00 0.00 ? 271 ARG A HE     3  
ATOM   5254  H HH11   . ARG A 1 58  ? 26.365 -2.824  -10.148 1.00 0.00 ? 271 ARG A HH11   3  
ATOM   5255  H HH12   . ARG A 1 58  ? 27.209 -3.079  -11.638 1.00 0.00 ? 271 ARG A HH12   3  
ATOM   5256  H HH21   . ARG A 1 58  ? 24.947 -1.209  -13.585 1.00 0.00 ? 271 ARG A HH21   3  
ATOM   5257  H HH22   . ARG A 1 58  ? 26.398 -2.154  -13.607 1.00 0.00 ? 271 ARG A HH22   3  
ATOM   5258  N N      . MET A 1 59  ? 25.860 2.257   -6.590  1.00 0.00 ? 272 MET A N      3  
ATOM   5259  C CA     . MET A 1 59  ? 26.381 2.200   -5.235  1.00 0.00 ? 272 MET A CA     3  
ATOM   5260  C C      . MET A 1 59  ? 25.583 1.212   -4.381  1.00 0.00 ? 272 MET A C      3  
ATOM   5261  O O      . MET A 1 59  ? 24.503 0.775   -4.778  1.00 0.00 ? 272 MET A O      3  
ATOM   5262  C CB     . MET A 1 59  ? 26.313 3.592   -4.602  1.00 0.00 ? 272 MET A CB     3  
ATOM   5263  C CG     . MET A 1 59  ? 27.710 4.201   -4.466  1.00 0.00 ? 272 MET A CG     3  
ATOM   5264  S SD     . MET A 1 59  ? 28.761 3.113   -3.519  1.00 0.00 ? 272 MET A SD     3  
ATOM   5265  C CE     . MET A 1 59  ? 28.205 3.505   -1.869  1.00 0.00 ? 272 MET A CE     3  
ATOM   5266  H H      . MET A 1 59  ? 24.987 2.736   -6.687  1.00 0.00 ? 272 MET A H      3  
ATOM   5267  H HA     . MET A 1 59  ? 27.412 1.858   -5.332  1.00 0.00 ? 272 MET A HA     3  
ATOM   5268  H HB2    . MET A 1 59  ? 25.686 4.242   -5.212  1.00 0.00 ? 272 MET A HB2    3  
ATOM   5269  H HB3    . MET A 1 59  ? 25.844 3.526   -3.620  1.00 0.00 ? 272 MET A HB3    3  
ATOM   5270  H HG2    . MET A 1 59  ? 28.140 4.368   -5.454  1.00 0.00 ? 272 MET A HG2    3  
ATOM   5271  H HG3    . MET A 1 59  ? 27.645 5.174   -3.979  1.00 0.00 ? 272 MET A HG3    3  
ATOM   5272  H HE1    . MET A 1 59  ? 28.353 2.640   -1.221  1.00 0.00 ? 272 MET A HE1    3  
ATOM   5273  H HE2    . MET A 1 59  ? 28.778 4.350   -1.484  1.00 0.00 ? 272 MET A HE2    3  
ATOM   5274  H HE3    . MET A 1 59  ? 27.148 3.765   -1.893  1.00 0.00 ? 272 MET A HE3    3  
ATOM   5275  N N      . PHE A 1 60  ? 26.146 0.888   -3.227  1.00 0.00 ? 273 PHE A N      3  
ATOM   5276  C CA     . PHE A 1 60  ? 25.500 -0.041  -2.315  1.00 0.00 ? 273 PHE A CA     3  
ATOM   5277  C C      . PHE A 1 60  ? 25.696 0.392   -0.861  1.00 0.00 ? 273 PHE A C      3  
ATOM   5278  O O      . PHE A 1 60  ? 26.788 0.809   -0.475  1.00 0.00 ? 273 PHE A O      3  
ATOM   5279  C CB     . PHE A 1 60  ? 26.163 -1.405  -2.522  1.00 0.00 ? 273 PHE A CB     3  
ATOM   5280  C CG     . PHE A 1 60  ? 25.817 -2.068  -3.857  1.00 0.00 ? 273 PHE A CG     3  
ATOM   5281  C CD1    . PHE A 1 60  ? 26.471 -1.695  -4.990  1.00 0.00 ? 273 PHE A CD1    3  
ATOM   5282  C CD2    . PHE A 1 60  ? 24.858 -3.030  -3.910  1.00 0.00 ? 273 PHE A CD2    3  
ATOM   5283  C CE1    . PHE A 1 60  ? 26.150 -2.311  -6.229  1.00 0.00 ? 273 PHE A CE1    3  
ATOM   5284  C CE2    . PHE A 1 60  ? 24.537 -3.647  -5.149  1.00 0.00 ? 273 PHE A CE2    3  
ATOM   5285  C CZ     . PHE A 1 60  ? 25.191 -3.273  -6.283  1.00 0.00 ? 273 PHE A CZ     3  
ATOM   5286  H H      . PHE A 1 60  ? 27.024 1.247   -2.913  1.00 0.00 ? 273 PHE A H      3  
ATOM   5287  H HA     . PHE A 1 60  ? 24.436 -0.040  -2.552  1.00 0.00 ? 273 PHE A HA     3  
ATOM   5288  H HB2    . PHE A 1 60  ? 27.244 -1.286  -2.456  1.00 0.00 ? 273 PHE A HB2    3  
ATOM   5289  H HB3    . PHE A 1 60  ? 25.864 -2.069  -1.711  1.00 0.00 ? 273 PHE A HB3    3  
ATOM   5290  H HD1    . PHE A 1 60  ? 27.240 -0.925  -4.948  1.00 0.00 ? 273 PHE A HD1    3  
ATOM   5291  H HD2    . PHE A 1 60  ? 24.334 -3.329  -3.002  1.00 0.00 ? 273 PHE A HD2    3  
ATOM   5292  H HE1    . PHE A 1 60  ? 26.674 -2.013  -7.137  1.00 0.00 ? 273 PHE A HE1    3  
ATOM   5293  H HE2    . PHE A 1 60  ? 23.768 -4.417  -5.191  1.00 0.00 ? 273 PHE A HE2    3  
ATOM   5294  H HZ     . PHE A 1 60  ? 24.945 -3.747  -7.234  1.00 0.00 ? 273 PHE A HZ     3  
ATOM   5295  N N      . PHE A 1 61  ? 24.622 0.279   -0.093  1.00 0.00 ? 274 PHE A N      3  
ATOM   5296  C CA     . PHE A 1 61  ? 24.663 0.654   1.310   1.00 0.00 ? 274 PHE A CA     3  
ATOM   5297  C C      . PHE A 1 61  ? 23.942 -0.381  2.176   1.00 0.00 ? 274 PHE A C      3  
ATOM   5298  O O      . PHE A 1 61  ? 22.775 -0.690  1.937   1.00 0.00 ? 274 PHE A O      3  
ATOM   5299  C CB     . PHE A 1 61  ? 23.940 1.997   1.435   1.00 0.00 ? 274 PHE A CB     3  
ATOM   5300  C CG     . PHE A 1 61  ? 24.367 3.033   0.392   1.00 0.00 ? 274 PHE A CG     3  
ATOM   5301  C CD1    . PHE A 1 61  ? 23.894 2.952   -0.880  1.00 0.00 ? 274 PHE A CD1    3  
ATOM   5302  C CD2    . PHE A 1 61  ? 25.221 4.034   0.738   1.00 0.00 ? 274 PHE A CD2    3  
ATOM   5303  C CE1    . PHE A 1 61  ? 24.291 3.913   -1.847  1.00 0.00 ? 274 PHE A CE1    3  
ATOM   5304  C CE2    . PHE A 1 61  ? 25.617 4.995   -0.229  1.00 0.00 ? 274 PHE A CE2    3  
ATOM   5305  C CZ     . PHE A 1 61  ? 25.144 4.915   -1.501  1.00 0.00 ? 274 PHE A CZ     3  
ATOM   5306  H H      . PHE A 1 61  ? 23.739 -0.061  -0.414  1.00 0.00 ? 274 PHE A H      3  
ATOM   5307  H HA     . PHE A 1 61  ? 25.712 0.702   1.602   1.00 0.00 ? 274 PHE A HA     3  
ATOM   5308  H HB2    . PHE A 1 61  ? 22.867 1.831   1.348   1.00 0.00 ? 274 PHE A HB2    3  
ATOM   5309  H HB3    . PHE A 1 61  ? 24.121 2.404   2.430   1.00 0.00 ? 274 PHE A HB3    3  
ATOM   5310  H HD1    . PHE A 1 61  ? 23.212 2.150   -1.157  1.00 0.00 ? 274 PHE A HD1    3  
ATOM   5311  H HD2    . PHE A 1 61  ? 25.600 4.099   1.759   1.00 0.00 ? 274 PHE A HD2    3  
ATOM   5312  H HE1    . PHE A 1 61  ? 23.913 3.848   -2.867  1.00 0.00 ? 274 PHE A HE1    3  
ATOM   5313  H HE2    . PHE A 1 61  ? 26.301 5.797   0.049   1.00 0.00 ? 274 PHE A HE2    3  
ATOM   5314  H HZ     . PHE A 1 61  ? 25.449 5.651   -2.243  1.00 0.00 ? 274 PHE A HZ     3  
ATOM   5315  N N      . VAL A 1 62  ? 24.666 -0.888  3.162   1.00 0.00 ? 275 VAL A N      3  
ATOM   5316  C CA     . VAL A 1 62  ? 24.110 -1.882  4.065   1.00 0.00 ? 275 VAL A CA     3  
ATOM   5317  C C      . VAL A 1 62  ? 23.154 -1.198  5.044   1.00 0.00 ? 275 VAL A C      3  
ATOM   5318  O O      . VAL A 1 62  ? 23.495 -0.176  5.639   1.00 0.00 ? 275 VAL A O      3  
ATOM   5319  C CB     . VAL A 1 62  ? 25.238 -2.643  4.764   1.00 0.00 ? 275 VAL A CB     3  
ATOM   5320  C CG1    . VAL A 1 62  ? 24.683 -3.586  5.834   1.00 0.00 ? 275 VAL A CG1    3  
ATOM   5321  C CG2    . VAL A 1 62  ? 26.094 -3.406  3.751   1.00 0.00 ? 275 VAL A CG2    3  
ATOM   5322  H H      . VAL A 1 62  ? 25.614 -0.630  3.350   1.00 0.00 ? 275 VAL A H      3  
ATOM   5323  H HA     . VAL A 1 62  ? 23.545 -2.593  3.462   1.00 0.00 ? 275 VAL A HA     3  
ATOM   5324  H HB     . VAL A 1 62  ? 25.877 -1.913  5.260   1.00 0.00 ? 275 VAL A HB     3  
ATOM   5325  H HG11   . VAL A 1 62  ? 25.471 -3.833  6.544   1.00 0.00 ? 275 VAL A HG11   3  
ATOM   5326  H HG12   . VAL A 1 62  ? 23.862 -3.097  6.358   1.00 0.00 ? 275 VAL A HG12   3  
ATOM   5327  H HG13   . VAL A 1 62  ? 24.319 -4.498  5.361   1.00 0.00 ? 275 VAL A HG13   3  
ATOM   5328  H HG21   . VAL A 1 62  ? 26.299 -4.408  4.130   1.00 0.00 ? 275 VAL A HG21   3  
ATOM   5329  H HG22   . VAL A 1 62  ? 25.559 -3.478  2.804   1.00 0.00 ? 275 VAL A HG22   3  
ATOM   5330  H HG23   . VAL A 1 62  ? 27.034 -2.877  3.599   1.00 0.00 ? 275 VAL A HG23   3  
ATOM   5331  N N      . VAL A 1 63  ? 21.975 -1.787  5.179   1.00 0.00 ? 276 VAL A N      3  
ATOM   5332  C CA     . VAL A 1 63  ? 20.967 -1.247  6.076   1.00 0.00 ? 276 VAL A CA     3  
ATOM   5333  C C      . VAL A 1 63  ? 20.904 -2.105  7.341   1.00 0.00 ? 276 VAL A C      3  
ATOM   5334  O O      . VAL A 1 63  ? 20.942 -1.581  8.454   1.00 0.00 ? 276 VAL A O      3  
ATOM   5335  C CB     . VAL A 1 63  ? 19.622 -1.149  5.354   1.00 0.00 ? 276 VAL A CB     3  
ATOM   5336  C CG1    . VAL A 1 63  ? 18.527 -0.651  6.299   1.00 0.00 ? 276 VAL A CG1    3  
ATOM   5337  C CG2    . VAL A 1 63  ? 19.729 -0.254  4.117   1.00 0.00 ? 276 VAL A CG2    3  
ATOM   5338  H H      . VAL A 1 63  ? 21.705 -2.618  4.692   1.00 0.00 ? 276 VAL A H      3  
ATOM   5339  H HA     . VAL A 1 63  ? 21.277 -0.239  6.351   1.00 0.00 ? 276 VAL A HA     3  
ATOM   5340  H HB     . VAL A 1 63  ? 19.348 -2.150  5.019   1.00 0.00 ? 276 VAL A HB     3  
ATOM   5341  H HG11   . VAL A 1 63  ? 18.639 0.423   6.450   1.00 0.00 ? 276 VAL A HG11   3  
ATOM   5342  H HG12   . VAL A 1 63  ? 17.550 -0.857  5.862   1.00 0.00 ? 276 VAL A HG12   3  
ATOM   5343  H HG13   . VAL A 1 63  ? 18.612 -1.165  7.255   1.00 0.00 ? 276 VAL A HG13   3  
ATOM   5344  H HG21   . VAL A 1 63  ? 20.586 -0.562  3.518   1.00 0.00 ? 276 VAL A HG21   3  
ATOM   5345  H HG22   . VAL A 1 63  ? 18.820 -0.346  3.522   1.00 0.00 ? 276 VAL A HG22   3  
ATOM   5346  H HG23   . VAL A 1 63  ? 19.856 0.782   4.429   1.00 0.00 ? 276 VAL A HG23   3  
ATOM   5347  N N      . GLU A 1 64  ? 20.809 -3.410  7.130   1.00 0.00 ? 277 GLU A N      3  
ATOM   5348  C CA     . GLU A 1 64  ? 20.739 -4.346  8.239   1.00 0.00 ? 277 GLU A CA     3  
ATOM   5349  C C      . GLU A 1 64  ? 21.412 -5.667  7.863   1.00 0.00 ? 277 GLU A C      3  
ATOM   5350  O O      . GLU A 1 64  ? 21.133 -6.230  6.806   1.00 0.00 ? 277 GLU A O      3  
ATOM   5351  C CB     . GLU A 1 64  ? 19.291 -4.573  8.676   1.00 0.00 ? 277 GLU A CB     3  
ATOM   5352  C CG     . GLU A 1 64  ? 19.213 -4.896  10.169  1.00 0.00 ? 277 GLU A CG     3  
ATOM   5353  C CD     . GLU A 1 64  ? 17.946 -4.305  10.792  1.00 0.00 ? 277 GLU A CD     3  
ATOM   5354  O OE1    . GLU A 1 64  ? 16.832 -4.743  10.466  1.00 0.00 ? 277 GLU A OE1    3  
ATOM   5355  O OE2    . GLU A 1 64  ? 18.148 -3.358  11.644  1.00 0.00 ? 277 GLU A OE2    3  
ATOM   5356  H H      . GLU A 1 64  ? 20.778 -3.828  6.222   1.00 0.00 ? 277 GLU A H      3  
ATOM   5357  H HA     . GLU A 1 64  ? 21.287 -3.871  9.053   1.00 0.00 ? 277 GLU A HA     3  
ATOM   5358  H HB2    . GLU A 1 64  ? 18.699 -3.683  8.461   1.00 0.00 ? 277 GLU A HB2    3  
ATOM   5359  H HB3    . GLU A 1 64  ? 18.858 -5.391  8.100   1.00 0.00 ? 277 GLU A HB3    3  
ATOM   5360  H HG2    . GLU A 1 64  ? 19.222 -5.976  10.312  1.00 0.00 ? 277 GLU A HG2    3  
ATOM   5361  H HG3    . GLU A 1 64  ? 20.091 -4.500  10.678  1.00 0.00 ? 277 GLU A HG3    3  
ATOM   5362  H HE2    . GLU A 1 64  ? 17.731 -3.594  12.522  1.00 0.00 ? 277 GLU A HE2    3  
ATOM   5363  N N      . GLY A 1 65  ? 22.286 -6.123  8.748   1.00 0.00 ? 278 GLY A N      3  
ATOM   5364  C CA     . GLY A 1 65  ? 23.001 -7.367  8.521   1.00 0.00 ? 278 GLY A CA     3  
ATOM   5365  C C      . GLY A 1 65  ? 24.495 -7.110  8.308   1.00 0.00 ? 278 GLY A C      3  
ATOM   5366  O O      . GLY A 1 65  ? 24.977 -6.002  8.537   1.00 0.00 ? 278 GLY A O      3  
ATOM   5367  H H      . GLY A 1 65  ? 22.508 -5.658  9.605   1.00 0.00 ? 278 GLY A H      3  
ATOM   5368  H HA2    . GLY A 1 65  ? 22.861 -8.032  9.373   1.00 0.00 ? 278 GLY A HA2    3  
ATOM   5369  H HA3    . GLY A 1 65  ? 22.588 -7.875  7.650   1.00 0.00 ? 278 GLY A HA3    3  
ATOM   5370  N N      . SER A 1 66  ? 25.185 -8.153  7.873   1.00 0.00 ? 279 SER A N      3  
ATOM   5371  C CA     . SER A 1 66  ? 26.614 -8.055  7.626   1.00 0.00 ? 279 SER A CA     3  
ATOM   5372  C C      . SER A 1 66  ? 26.950 -8.646  6.255   1.00 0.00 ? 279 SER A C      3  
ATOM   5373  O O      . SER A 1 66  ? 26.179 -9.433  5.708   1.00 0.00 ? 279 SER A O      3  
ATOM   5374  C CB     . SER A 1 66  ? 27.412 -8.765  8.720   1.00 0.00 ? 279 SER A CB     3  
ATOM   5375  O OG     . SER A 1 66  ? 27.440 -8.017  9.933   1.00 0.00 ? 279 SER A OG     3  
ATOM   5376  H H      . SER A 1 66  ? 24.786 -9.052  7.688   1.00 0.00 ? 279 SER A H      3  
ATOM   5377  H HA     . SER A 1 66  ? 26.837 -6.988  7.648   1.00 0.00 ? 279 SER A HA     3  
ATOM   5378  H HB2    . SER A 1 66  ? 26.975 -9.746  8.909   1.00 0.00 ? 279 SER A HB2    3  
ATOM   5379  H HB3    . SER A 1 66  ? 28.432 -8.933  8.375   1.00 0.00 ? 279 SER A HB3    3  
ATOM   5380  H HG     . SER A 1 66  ? 26.762 -8.379  10.573  1.00 0.00 ? 279 SER A HG     3  
ATOM   5381  N N      . VAL A 1 67  ? 28.103 -8.244  5.740   1.00 0.00 ? 280 VAL A N      3  
ATOM   5382  C CA     . VAL A 1 67  ? 28.551 -8.724  4.443   1.00 0.00 ? 280 VAL A CA     3  
ATOM   5383  C C      . VAL A 1 67  ? 29.999 -9.206  4.555   1.00 0.00 ? 280 VAL A C      3  
ATOM   5384  O O      . VAL A 1 67  ? 30.723 -8.800  5.462   1.00 0.00 ? 280 VAL A O      3  
ATOM   5385  C CB     . VAL A 1 67  ? 28.365 -7.632  3.388   1.00 0.00 ? 280 VAL A CB     3  
ATOM   5386  C CG1    . VAL A 1 67  ? 29.272 -7.876  2.181   1.00 0.00 ? 280 VAL A CG1    3  
ATOM   5387  C CG2    . VAL A 1 67  ? 26.899 -7.528  2.960   1.00 0.00 ? 280 VAL A CG2    3  
ATOM   5388  H H      . VAL A 1 67  ? 28.725 -7.604  6.191   1.00 0.00 ? 280 VAL A H      3  
ATOM   5389  H HA     . VAL A 1 67  ? 27.920 -9.570  4.169   1.00 0.00 ? 280 VAL A HA     3  
ATOM   5390  H HB     . VAL A 1 67  ? 28.651 -6.681  3.836   1.00 0.00 ? 280 VAL A HB     3  
ATOM   5391  H HG11   . VAL A 1 67  ? 29.093 -8.876  1.788   1.00 0.00 ? 280 VAL A HG11   3  
ATOM   5392  H HG12   . VAL A 1 67  ? 29.057 -7.137  1.409   1.00 0.00 ? 280 VAL A HG12   3  
ATOM   5393  H HG13   . VAL A 1 67  ? 30.315 -7.787  2.487   1.00 0.00 ? 280 VAL A HG13   3  
ATOM   5394  H HG21   . VAL A 1 67  ? 26.844 -7.125  1.949   1.00 0.00 ? 280 VAL A HG21   3  
ATOM   5395  H HG22   . VAL A 1 67  ? 26.443 -8.518  2.981   1.00 0.00 ? 280 VAL A HG22   3  
ATOM   5396  H HG23   . VAL A 1 67  ? 26.367 -6.869  3.644   1.00 0.00 ? 280 VAL A HG23   3  
ATOM   5397  N N      . SER A 1 68  ? 30.377 -10.065 3.620   1.00 0.00 ? 281 SER A N      3  
ATOM   5398  C CA     . SER A 1 68  ? 31.725 -10.608 3.603   1.00 0.00 ? 281 SER A CA     3  
ATOM   5399  C C      . SER A 1 68  ? 32.358 -10.392 2.226   1.00 0.00 ? 281 SER A C      3  
ATOM   5400  O O      . SER A 1 68  ? 31.738 -10.679 1.203   1.00 0.00 ? 281 SER A O      3  
ATOM   5401  C CB     . SER A 1 68  ? 31.726 -12.095 3.960   1.00 0.00 ? 281 SER A CB     3  
ATOM   5402  O OG     . SER A 1 68  ? 32.105 -12.318 5.315   1.00 0.00 ? 281 SER A OG     3  
ATOM   5403  H H      . SER A 1 68  ? 29.781 -10.391 2.887   1.00 0.00 ? 281 SER A H      3  
ATOM   5404  H HA     . SER A 1 68  ? 32.270 -10.051 4.366   1.00 0.00 ? 281 SER A HA     3  
ATOM   5405  H HB2    . SER A 1 68  ? 30.732 -12.510 3.788   1.00 0.00 ? 281 SER A HB2    3  
ATOM   5406  H HB3    . SER A 1 68  ? 32.410 -12.626 3.299   1.00 0.00 ? 281 SER A HB3    3  
ATOM   5407  H HG     . SER A 1 68  ? 32.991 -11.893 5.497   1.00 0.00 ? 281 SER A HG     3  
ATOM   5408  N N      . VAL A 1 69  ? 33.583 -9.888  2.245   1.00 0.00 ? 282 VAL A N      3  
ATOM   5409  C CA     . VAL A 1 69  ? 34.305 -9.631  1.012   1.00 0.00 ? 282 VAL A CA     3  
ATOM   5410  C C      . VAL A 1 69  ? 34.890 -10.943 0.486   1.00 0.00 ? 282 VAL A C      3  
ATOM   5411  O O      . VAL A 1 69  ? 35.312 -11.796 1.265   1.00 0.00 ? 282 VAL A O      3  
ATOM   5412  C CB     . VAL A 1 69  ? 35.368 -8.553  1.242   1.00 0.00 ? 282 VAL A CB     3  
ATOM   5413  C CG1    . VAL A 1 69  ? 36.111 -8.231  -0.055  1.00 0.00 ? 282 VAL A CG1    3  
ATOM   5414  C CG2    . VAL A 1 69  ? 34.746 -7.292  1.847   1.00 0.00 ? 282 VAL A CG2    3  
ATOM   5415  H H      . VAL A 1 69  ? 34.079 -9.659  3.082   1.00 0.00 ? 282 VAL A H      3  
ATOM   5416  H HA     . VAL A 1 69  ? 33.589 -9.249  0.284   1.00 0.00 ? 282 VAL A HA     3  
ATOM   5417  H HB     . VAL A 1 69  ? 36.093 -8.945  1.956   1.00 0.00 ? 282 VAL A HB     3  
ATOM   5418  H HG11   . VAL A 1 69  ? 37.131 -7.926  0.178   1.00 0.00 ? 282 VAL A HG11   3  
ATOM   5419  H HG12   . VAL A 1 69  ? 36.132 -9.115  -0.692  1.00 0.00 ? 282 VAL A HG12   3  
ATOM   5420  H HG13   . VAL A 1 69  ? 35.600 -7.420  -0.575  1.00 0.00 ? 282 VAL A HG13   3  
ATOM   5421  H HG21   . VAL A 1 69  ? 33.766 -7.122  1.403   1.00 0.00 ? 282 VAL A HG21   3  
ATOM   5422  H HG22   . VAL A 1 69  ? 34.640 -7.422  2.924   1.00 0.00 ? 282 VAL A HG22   3  
ATOM   5423  H HG23   . VAL A 1 69  ? 35.392 -6.437  1.646   1.00 0.00 ? 282 VAL A HG23   3  
ATOM   5424  N N      . ALA A 1 70  ? 34.896 -11.064 -0.834  1.00 0.00 ? 283 ALA A N      3  
ATOM   5425  C CA     . ALA A 1 70  ? 35.423 -12.258 -1.475  1.00 0.00 ? 283 ALA A CA     3  
ATOM   5426  C C      . ALA A 1 70  ? 36.912 -12.063 -1.762  1.00 0.00 ? 283 ALA A C      3  
ATOM   5427  O O      . ALA A 1 70  ? 37.281 -11.495 -2.788  1.00 0.00 ? 283 ALA A O      3  
ATOM   5428  C CB     . ALA A 1 70  ? 34.618 -12.554 -2.742  1.00 0.00 ? 283 ALA A CB     3  
ATOM   5429  H H      . ALA A 1 70  ? 34.552 -10.365 -1.461  1.00 0.00 ? 283 ALA A H      3  
ATOM   5430  H HA     . ALA A 1 70  ? 35.300 -13.088 -0.779  1.00 0.00 ? 283 ALA A HA     3  
ATOM   5431  H HB1    . ALA A 1 70  ? 34.319 -11.617 -3.210  1.00 0.00 ? 283 ALA A HB1    3  
ATOM   5432  H HB2    . ALA A 1 70  ? 35.233 -13.128 -3.435  1.00 0.00 ? 283 ALA A HB2    3  
ATOM   5433  H HB3    . ALA A 1 70  ? 33.729 -13.130 -2.481  1.00 0.00 ? 283 ALA A HB3    3  
ATOM   5434  N N      . THR A 1 71  ? 37.728 -12.545 -0.836  1.00 0.00 ? 284 THR A N      3  
ATOM   5435  C CA     . THR A 1 71  ? 39.170 -12.431 -0.978  1.00 0.00 ? 284 THR A CA     3  
ATOM   5436  C C      . THR A 1 71  ? 39.878 -13.251 0.103   1.00 0.00 ? 284 THR A C      3  
ATOM   5437  O O      . THR A 1 71  ? 39.230 -13.830 0.973   1.00 0.00 ? 284 THR A O      3  
ATOM   5438  C CB     . THR A 1 71  ? 39.533 -10.945 -0.947  1.00 0.00 ? 284 THR A CB     3  
ATOM   5439  O OG1    . THR A 1 71  ? 40.345 -10.810 0.216   1.00 0.00 ? 284 THR A OG1    3  
ATOM   5440  C CG2    . THR A 1 71  ? 38.323 -10.053 -0.662  1.00 0.00 ? 284 THR A CG2    3  
ATOM   5441  H H      . THR A 1 71  ? 37.421 -13.006 -0.004  1.00 0.00 ? 284 THR A H      3  
ATOM   5442  H HA     . THR A 1 71  ? 39.456 -12.856 -1.940  1.00 0.00 ? 284 THR A HA     3  
ATOM   5443  H HB     . THR A 1 71  ? 40.027 -10.646 -1.871  1.00 0.00 ? 284 THR A HB     3  
ATOM   5444  H HG1    . THR A 1 71  ? 40.828 -9.934  0.195   1.00 0.00 ? 284 THR A HG1    3  
ATOM   5445  H HG21   . THR A 1 71  ? 37.823 -9.807  -1.599  1.00 0.00 ? 284 THR A HG21   3  
ATOM   5446  H HG22   . THR A 1 71  ? 37.628 -10.582 -0.009  1.00 0.00 ? 284 THR A HG22   3  
ATOM   5447  H HG23   . THR A 1 71  ? 38.653 -9.137  -0.174  1.00 0.00 ? 284 THR A HG23   3  
ATOM   5448  N N      . PRO A 1 72  ? 41.235 -13.276 0.009   1.00 0.00 ? 285 PRO A N      3  
ATOM   5449  C CA     . PRO A 1 72  ? 42.038 -14.015 0.968   1.00 0.00 ? 285 PRO A CA     3  
ATOM   5450  C C      . PRO A 1 72  ? 42.109 -13.280 2.307   1.00 0.00 ? 285 PRO A C      3  
ATOM   5451  O O      . PRO A 1 72  ? 42.303 -13.901 3.351   1.00 0.00 ? 285 PRO A O      3  
ATOM   5452  C CB     . PRO A 1 72  ? 43.397 -14.173 0.304   1.00 0.00 ? 285 PRO A CB     3  
ATOM   5453  C CG     . PRO A 1 72  ? 43.448 -13.123 -0.793  1.00 0.00 ? 285 PRO A CG     3  
ATOM   5454  C CD     . PRO A 1 72  ? 42.037 -12.602 -1.008  1.00 0.00 ? 285 PRO A CD     3  
ATOM   5455  H HA     . PRO A 1 72  ? 41.616 -14.901 1.164   1.00 0.00 ? 285 PRO A HA     3  
ATOM   5456  H HB2    . PRO A 1 72  ? 44.202 -14.027 1.024   1.00 0.00 ? 285 PRO A HB2    3  
ATOM   5457  H HB3    . PRO A 1 72  ? 43.515 -15.175 -0.108  1.00 0.00 ? 285 PRO A HB3    3  
ATOM   5458  H HG2    . PRO A 1 72  ? 44.117 -12.309 -0.511  1.00 0.00 ? 285 PRO A HG2    3  
ATOM   5459  H HG3    . PRO A 1 72  ? 43.842 -13.553 -1.715  1.00 0.00 ? 285 PRO A HG3    3  
ATOM   5460  H HD2    . PRO A 1 72  ? 41.993 -11.519 -0.893  1.00 0.00 ? 285 PRO A HD2    3  
ATOM   5461  H HD3    . PRO A 1 72  ? 41.679 -12.832 -2.011  1.00 0.00 ? 285 PRO A HD3    3  
ATOM   5462  N N      . ASN A 1 73  ? 41.948 -11.966 2.234   1.00 0.00 ? 286 ASN A N      3  
ATOM   5463  C CA     . ASN A 1 73  ? 41.993 -11.139 3.427   1.00 0.00 ? 286 ASN A CA     3  
ATOM   5464  C C      . ASN A 1 73  ? 40.836 -10.138 3.392   1.00 0.00 ? 286 ASN A C      3  
ATOM   5465  O O      . ASN A 1 73  ? 41.056 -8.928  3.394   1.00 0.00 ? 286 ASN A O      3  
ATOM   5466  C CB     . ASN A 1 73  ? 43.299 -10.348 3.502   1.00 0.00 ? 286 ASN A CB     3  
ATOM   5467  C CG     . ASN A 1 73  ? 44.378 -11.138 4.246   1.00 0.00 ? 286 ASN A CG     3  
ATOM   5468  O OD1    . ASN A 1 73  ? 44.888 -12.140 3.773   1.00 0.00 ? 286 ASN A OD1    3  
ATOM   5469  N ND2    . ASN A 1 73  ? 44.694 -10.633 5.436   1.00 0.00 ? 286 ASN A ND2    3  
ATOM   5470  H H      . ASN A 1 73  ? 41.791 -11.469 1.380   1.00 0.00 ? 286 ASN A H      3  
ATOM   5471  H HA     . ASN A 1 73  ? 41.915 -11.836 4.262   1.00 0.00 ? 286 ASN A HA     3  
ATOM   5472  H HB2    . ASN A 1 73  ? 43.645 -10.114 2.495   1.00 0.00 ? 286 ASN A HB2    3  
ATOM   5473  H HB3    . ASN A 1 73  ? 43.126 -9.398  4.007   1.00 0.00 ? 286 ASN A HB3    3  
ATOM   5474  H HD21   . ASN A 1 73  ? 44.236 -9.808  5.766   1.00 0.00 ? 286 ASN A HD21   3  
ATOM   5475  H HD22   . ASN A 1 73  ? 45.388 -11.080 6.000   1.00 0.00 ? 286 ASN A HD22   3  
ATOM   5476  N N      . PRO A 1 74  ? 39.595 -10.695 3.360   1.00 0.00 ? 287 PRO A N      3  
ATOM   5477  C CA     . PRO A 1 74  ? 38.404 -9.865  3.324   1.00 0.00 ? 287 PRO A CA     3  
ATOM   5478  C C      . PRO A 1 74  ? 38.126 -9.243  4.694   1.00 0.00 ? 287 PRO A C      3  
ATOM   5479  O O      . PRO A 1 74  ? 39.003 -9.217  5.556   1.00 0.00 ? 287 PRO A O      3  
ATOM   5480  C CB     . PRO A 1 74  ? 37.292 -10.791 2.856   1.00 0.00 ? 287 PRO A CB     3  
ATOM   5481  C CG     . PRO A 1 74  ? 37.800 -12.204 3.093   1.00 0.00 ? 287 PRO A CG     3  
ATOM   5482  C CD     . PRO A 1 74  ? 39.296 -12.124 3.356   1.00 0.00 ? 287 PRO A CD     3  
ATOM   5483  H HA     . PRO A 1 74  ? 38.534 -9.097  2.697   1.00 0.00 ? 287 PRO A HA     3  
ATOM   5484  H HB2    . PRO A 1 74  ? 36.372 -10.609 3.411   1.00 0.00 ? 287 PRO A HB2    3  
ATOM   5485  H HB3    . PRO A 1 74  ? 37.067 -10.629 1.802   1.00 0.00 ? 287 PRO A HB3    3  
ATOM   5486  H HG2    . PRO A 1 74  ? 37.288 -12.657 3.942   1.00 0.00 ? 287 PRO A HG2    3  
ATOM   5487  H HG3    . PRO A 1 74  ? 37.598 -12.833 2.227   1.00 0.00 ? 287 PRO A HG3    3  
ATOM   5488  H HD2    . PRO A 1 74  ? 39.556 -12.586 4.309   1.00 0.00 ? 287 PRO A HD2    3  
ATOM   5489  H HD3    . PRO A 1 74  ? 39.862 -12.645 2.585   1.00 0.00 ? 287 PRO A HD3    3  
ATOM   5490  N N      . VAL A 1 75  ? 36.903 -8.759  4.853   1.00 0.00 ? 288 VAL A N      3  
ATOM   5491  C CA     . VAL A 1 75  ? 36.500 -8.140  6.103   1.00 0.00 ? 288 VAL A CA     3  
ATOM   5492  C C      . VAL A 1 75  ? 34.986 -8.280  6.272   1.00 0.00 ? 288 VAL A C      3  
ATOM   5493  O O      . VAL A 1 75  ? 34.277 -8.588  5.314   1.00 0.00 ? 288 VAL A O      3  
ATOM   5494  C CB     . VAL A 1 75  ? 36.973 -6.686  6.144   1.00 0.00 ? 288 VAL A CB     3  
ATOM   5495  C CG1    . VAL A 1 75  ? 36.212 -5.891  7.207   1.00 0.00 ? 288 VAL A CG1    3  
ATOM   5496  C CG2    . VAL A 1 75  ? 38.483 -6.606  6.376   1.00 0.00 ? 288 VAL A CG2    3  
ATOM   5497  H H      . VAL A 1 75  ? 36.195 -8.784  4.146   1.00 0.00 ? 288 VAL A H      3  
ATOM   5498  H HA     . VAL A 1 75  ? 36.995 -8.678  6.911   1.00 0.00 ? 288 VAL A HA     3  
ATOM   5499  H HB     . VAL A 1 75  ? 36.760 -6.236  5.174   1.00 0.00 ? 288 VAL A HB     3  
ATOM   5500  H HG11   . VAL A 1 75  ? 35.146 -5.908  6.980   1.00 0.00 ? 288 VAL A HG11   3  
ATOM   5501  H HG12   . VAL A 1 75  ? 36.382 -6.338  8.186   1.00 0.00 ? 288 VAL A HG12   3  
ATOM   5502  H HG13   . VAL A 1 75  ? 36.566 -4.859  7.213   1.00 0.00 ? 288 VAL A HG13   3  
ATOM   5503  H HG21   . VAL A 1 75  ? 39.000 -6.623  5.418   1.00 0.00 ? 288 VAL A HG21   3  
ATOM   5504  H HG22   . VAL A 1 75  ? 38.722 -5.682  6.902   1.00 0.00 ? 288 VAL A HG22   3  
ATOM   5505  H HG23   . VAL A 1 75  ? 38.803 -7.458  6.977   1.00 0.00 ? 288 VAL A HG23   3  
ATOM   5506  N N      . GLU A 1 76  ? 34.534 -8.048  7.496   1.00 0.00 ? 289 GLU A N      3  
ATOM   5507  C CA     . GLU A 1 76  ? 33.117 -8.146  7.802   1.00 0.00 ? 289 GLU A CA     3  
ATOM   5508  C C      . GLU A 1 76  ? 32.474 -6.758  7.780   1.00 0.00 ? 289 GLU A C      3  
ATOM   5509  O O      . GLU A 1 76  ? 32.861 -5.878  8.546   1.00 0.00 ? 289 GLU A O      3  
ATOM   5510  C CB     . GLU A 1 76  ? 32.894 -8.832  9.151   1.00 0.00 ? 289 GLU A CB     3  
ATOM   5511  C CG     . GLU A 1 76  ? 31.487 -9.429  9.236   1.00 0.00 ? 289 GLU A CG     3  
ATOM   5512  C CD     . GLU A 1 76  ? 31.156 -9.850  10.670  1.00 0.00 ? 289 GLU A CD     3  
ATOM   5513  O OE1    . GLU A 1 76  ? 31.425 -10.996 11.056  1.00 0.00 ? 289 GLU A OE1    3  
ATOM   5514  O OE2    . GLU A 1 76  ? 30.600 -8.936  11.391  1.00 0.00 ? 289 GLU A OE2    3  
ATOM   5515  H H      . GLU A 1 76  ? 35.117 -7.800  8.269   1.00 0.00 ? 289 GLU A H      3  
ATOM   5516  H HA     . GLU A 1 76  ? 32.692 -8.764  7.012   1.00 0.00 ? 289 GLU A HA     3  
ATOM   5517  H HB2    . GLU A 1 76  ? 33.635 -9.619  9.290   1.00 0.00 ? 289 GLU A HB2    3  
ATOM   5518  H HB3    . GLU A 1 76  ? 33.037 -8.113  9.957   1.00 0.00 ? 289 GLU A HB3    3  
ATOM   5519  H HG2    . GLU A 1 76  ? 30.757 -8.698  8.890   1.00 0.00 ? 289 GLU A HG2    3  
ATOM   5520  H HG3    . GLU A 1 76  ? 31.414 -10.292 8.574   1.00 0.00 ? 289 GLU A HG3    3  
ATOM   5521  H HE2    . GLU A 1 76  ? 30.993 -8.941  12.311  1.00 0.00 ? 289 GLU A HE2    3  
ATOM   5522  N N      . LEU A 1 77  ? 31.500 -6.607  6.893   1.00 0.00 ? 290 LEU A N      3  
ATOM   5523  C CA     . LEU A 1 77  ? 30.799 -5.341  6.760   1.00 0.00 ? 290 LEU A CA     3  
ATOM   5524  C C      . LEU A 1 77  ? 29.512 -5.388  7.587   1.00 0.00 ? 290 LEU A C      3  
ATOM   5525  O O      . LEU A 1 77  ? 28.949 -6.459  7.806   1.00 0.00 ? 290 LEU A O      3  
ATOM   5526  C CB     . LEU A 1 77  ? 30.571 -5.008  5.285   1.00 0.00 ? 290 LEU A CB     3  
ATOM   5527  C CG     . LEU A 1 77  ? 31.769 -4.422  4.537   1.00 0.00 ? 290 LEU A CG     3  
ATOM   5528  C CD1    . LEU A 1 77  ? 31.477 -4.304  3.040   1.00 0.00 ? 290 LEU A CD1    3  
ATOM   5529  C CD2    . LEU A 1 77  ? 32.197 -3.084  5.145   1.00 0.00 ? 290 LEU A CD2    3  
ATOM   5530  H H      . LEU A 1 77  ? 31.191 -7.329  6.274   1.00 0.00 ? 290 LEU A H      3  
ATOM   5531  H HA     . LEU A 1 77  ? 31.445 -4.566  7.170   1.00 0.00 ? 290 LEU A HA     3  
ATOM   5532  H HB2    . LEU A 1 77  ? 30.255 -5.916  4.772   1.00 0.00 ? 290 LEU A HB2    3  
ATOM   5533  H HB3    . LEU A 1 77  ? 29.744 -4.299  5.217   1.00 0.00 ? 290 LEU A HB3    3  
ATOM   5534  H HG     . LEU A 1 77  ? 32.610 -5.108  4.647   1.00 0.00 ? 290 LEU A HG     3  
ATOM   5535  H HD11   . LEU A 1 77  ? 32.287 -4.764  2.474   1.00 0.00 ? 290 LEU A HD11   3  
ATOM   5536  H HD12   . LEU A 1 77  ? 30.540 -4.811  2.812   1.00 0.00 ? 290 LEU A HD12   3  
ATOM   5537  H HD13   . LEU A 1 77  ? 31.396 -3.251  2.767   1.00 0.00 ? 290 LEU A HD13   3  
ATOM   5538  H HD21   . LEU A 1 77  ? 31.356 -2.645  5.683   1.00 0.00 ? 290 LEU A HD21   3  
ATOM   5539  H HD22   . LEU A 1 77  ? 33.024 -3.246  5.835   1.00 0.00 ? 290 LEU A HD22   3  
ATOM   5540  H HD23   . LEU A 1 77  ? 32.512 -2.408  4.351   1.00 0.00 ? 290 LEU A HD23   3  
ATOM   5541  N N      . GLY A 1 78  ? 29.084 -4.212  8.023   1.00 0.00 ? 291 GLY A N      3  
ATOM   5542  C CA     . GLY A 1 78  ? 27.874 -4.105  8.820   1.00 0.00 ? 291 GLY A CA     3  
ATOM   5543  C C      . GLY A 1 78  ? 26.941 -3.029  8.260   1.00 0.00 ? 291 GLY A C      3  
ATOM   5544  O O      . GLY A 1 78  ? 27.177 -2.504  7.173   1.00 0.00 ? 291 GLY A O      3  
ATOM   5545  H H      . GLY A 1 78  ? 29.548 -3.345  7.840   1.00 0.00 ? 291 GLY A H      3  
ATOM   5546  H HA2    . GLY A 1 78  ? 27.358 -5.065  8.837   1.00 0.00 ? 291 GLY A HA2    3  
ATOM   5547  H HA3    . GLY A 1 78  ? 28.133 -3.866  9.851   1.00 0.00 ? 291 GLY A HA3    3  
ATOM   5548  N N      . PRO A 1 79  ? 25.875 -2.727  9.048   1.00 0.00 ? 292 PRO A N      3  
ATOM   5549  C CA     . PRO A 1 79  ? 24.906 -1.723  8.641   1.00 0.00 ? 292 PRO A CA     3  
ATOM   5550  C C      . PRO A 1 79  ? 25.474 -0.312  8.809   1.00 0.00 ? 292 PRO A C      3  
ATOM   5551  O O      . PRO A 1 79  ? 26.177 -0.034  9.780   1.00 0.00 ? 292 PRO A O      3  
ATOM   5552  C CB     . PRO A 1 79  ? 23.686 -1.978  9.511   1.00 0.00 ? 292 PRO A CB     3  
ATOM   5553  C CG     . PRO A 1 79  ? 24.179 -2.809  10.686  1.00 0.00 ? 292 PRO A CG     3  
ATOM   5554  C CD     . PRO A 1 79  ? 25.564 -3.329  10.340  1.00 0.00 ? 292 PRO A CD     3  
ATOM   5555  H HA     . PRO A 1 79  ? 24.694 -1.818  7.669   1.00 0.00 ? 292 PRO A HA     3  
ATOM   5556  H HB2    . PRO A 1 79  ? 23.246 -1.042  9.852   1.00 0.00 ? 292 PRO A HB2    3  
ATOM   5557  H HB3    . PRO A 1 79  ? 22.914 -2.510  8.955   1.00 0.00 ? 292 PRO A HB3    3  
ATOM   5558  H HG2    . PRO A 1 79  ? 24.213 -2.203  11.592  1.00 0.00 ? 292 PRO A HG2    3  
ATOM   5559  H HG3    . PRO A 1 79  ? 23.497 -3.636  10.882  1.00 0.00 ? 292 PRO A HG3    3  
ATOM   5560  H HD2    . PRO A 1 79  ? 26.295 -3.042  11.097  1.00 0.00 ? 292 PRO A HD2    3  
ATOM   5561  H HD3    . PRO A 1 79  ? 25.576 -4.417  10.283  1.00 0.00 ? 292 PRO A HD3    3  
ATOM   5562  N N      . GLY A 1 80  ? 25.149 0.540   7.849   1.00 0.00 ? 293 GLY A N      3  
ATOM   5563  C CA     . GLY A 1 80  ? 25.618 1.915   7.877   1.00 0.00 ? 293 GLY A CA     3  
ATOM   5564  C C      . GLY A 1 80  ? 26.959 2.052   7.153   1.00 0.00 ? 293 GLY A C      3  
ATOM   5565  O O      . GLY A 1 80  ? 27.691 3.015   7.373   1.00 0.00 ? 293 GLY A O      3  
ATOM   5566  H H      . GLY A 1 80  ? 24.577 0.306   7.063   1.00 0.00 ? 293 GLY A H      3  
ATOM   5567  H HA2    . GLY A 1 80  ? 24.880 2.566   7.409   1.00 0.00 ? 293 GLY A HA2    3  
ATOM   5568  H HA3    . GLY A 1 80  ? 25.723 2.246   8.910   1.00 0.00 ? 293 GLY A HA3    3  
ATOM   5569  N N      . ALA A 1 81  ? 27.240 1.074   6.305   1.00 0.00 ? 294 ALA A N      3  
ATOM   5570  C CA     . ALA A 1 81  ? 28.479 1.073   5.547   1.00 0.00 ? 294 ALA A CA     3  
ATOM   5571  C C      . ALA A 1 81  ? 28.158 1.073   4.052   1.00 0.00 ? 294 ALA A C      3  
ATOM   5572  O O      . ALA A 1 81  ? 27.234 0.391   3.611   1.00 0.00 ? 294 ALA A O      3  
ATOM   5573  C CB     . ALA A 1 81  ? 29.330 -0.129  5.961   1.00 0.00 ? 294 ALA A CB     3  
ATOM   5574  H H      . ALA A 1 81  ? 26.638 0.293   6.132   1.00 0.00 ? 294 ALA A H      3  
ATOM   5575  H HA     . ALA A 1 81  ? 29.020 1.986   5.795   1.00 0.00 ? 294 ALA A HA     3  
ATOM   5576  H HB1    . ALA A 1 81  ? 29.592 -0.044  7.016   1.00 0.00 ? 294 ALA A HB1    3  
ATOM   5577  H HB2    . ALA A 1 81  ? 28.764 -1.047  5.800   1.00 0.00 ? 294 ALA A HB2    3  
ATOM   5578  H HB3    . ALA A 1 81  ? 30.240 -0.155  5.362   1.00 0.00 ? 294 ALA A HB3    3  
ATOM   5579  N N      . PHE A 1 82  ? 28.939 1.845   3.311   1.00 0.00 ? 295 PHE A N      3  
ATOM   5580  C CA     . PHE A 1 82  ? 28.750 1.943   1.873   1.00 0.00 ? 295 PHE A CA     3  
ATOM   5581  C C      . PHE A 1 82  ? 29.961 1.388   1.122   1.00 0.00 ? 295 PHE A C      3  
ATOM   5582  O O      . PHE A 1 82  ? 31.094 1.508   1.587   1.00 0.00 ? 295 PHE A O      3  
ATOM   5583  C CB     . PHE A 1 82  ? 28.597 3.429   1.543   1.00 0.00 ? 295 PHE A CB     3  
ATOM   5584  C CG     . PHE A 1 82  ? 29.438 4.353   2.425   1.00 0.00 ? 295 PHE A CG     3  
ATOM   5585  C CD1    . PHE A 1 82  ? 28.971 4.741   3.642   1.00 0.00 ? 295 PHE A CD1    3  
ATOM   5586  C CD2    . PHE A 1 82  ? 30.651 4.788   1.992   1.00 0.00 ? 295 PHE A CD2    3  
ATOM   5587  C CE1    . PHE A 1 82  ? 29.752 5.599   4.462   1.00 0.00 ? 295 PHE A CE1    3  
ATOM   5588  C CE2    . PHE A 1 82  ? 31.432 5.645   2.811   1.00 0.00 ? 295 PHE A CE2    3  
ATOM   5589  C CZ     . PHE A 1 82  ? 30.966 6.033   4.029   1.00 0.00 ? 295 PHE A CZ     3  
ATOM   5590  H H      . PHE A 1 82  ? 29.690 2.397   3.677   1.00 0.00 ? 295 PHE A H      3  
ATOM   5591  H HA     . PHE A 1 82  ? 27.868 1.354   1.623   1.00 0.00 ? 295 PHE A HA     3  
ATOM   5592  H HB2    . PHE A 1 82  ? 28.872 3.589   0.501   1.00 0.00 ? 295 PHE A HB2    3  
ATOM   5593  H HB3    . PHE A 1 82  ? 27.547 3.706   1.641   1.00 0.00 ? 295 PHE A HB3    3  
ATOM   5594  H HD1    . PHE A 1 82  ? 27.998 4.393   3.990   1.00 0.00 ? 295 PHE A HD1    3  
ATOM   5595  H HD2    . PHE A 1 82  ? 31.025 4.476   1.017   1.00 0.00 ? 295 PHE A HD2    3  
ATOM   5596  H HE1    . PHE A 1 82  ? 29.378 5.909   5.438   1.00 0.00 ? 295 PHE A HE1    3  
ATOM   5597  H HE2    . PHE A 1 82  ? 32.405 5.992   2.464   1.00 0.00 ? 295 PHE A HE2    3  
ATOM   5598  H HZ     . PHE A 1 82  ? 31.565 6.691   4.658   1.00 0.00 ? 295 PHE A HZ     3  
ATOM   5599  N N      . PHE A 1 83  ? 29.681 0.793   -0.028  1.00 0.00 ? 296 PHE A N      3  
ATOM   5600  C CA     . PHE A 1 83  ? 30.734 0.218   -0.850  1.00 0.00 ? 296 PHE A CA     3  
ATOM   5601  C C      . PHE A 1 83  ? 30.365 0.276   -2.333  1.00 0.00 ? 296 PHE A C      3  
ATOM   5602  O O      . PHE A 1 83  ? 29.189 0.361   -2.681  1.00 0.00 ? 296 PHE A O      3  
ATOM   5603  C CB     . PHE A 1 83  ? 30.881 -1.245  -0.429  1.00 0.00 ? 296 PHE A CB     3  
ATOM   5604  C CG     . PHE A 1 83  ? 29.559 -2.014  -0.380  1.00 0.00 ? 296 PHE A CG     3  
ATOM   5605  C CD1    . PHE A 1 83  ? 28.757 -1.919  0.715   1.00 0.00 ? 296 PHE A CD1    3  
ATOM   5606  C CD2    . PHE A 1 83  ? 29.185 -2.793  -1.430  1.00 0.00 ? 296 PHE A CD2    3  
ATOM   5607  C CE1    . PHE A 1 83  ? 27.531 -2.631  0.761   1.00 0.00 ? 296 PHE A CE1    3  
ATOM   5608  C CE2    . PHE A 1 83  ? 27.958 -3.507  -1.383  1.00 0.00 ? 296 PHE A CE2    3  
ATOM   5609  C CZ     . PHE A 1 83  ? 27.157 -3.411  -0.289  1.00 0.00 ? 296 PHE A CZ     3  
ATOM   5610  H H      . PHE A 1 83  ? 28.757 0.699   -0.400  1.00 0.00 ? 296 PHE A H      3  
ATOM   5611  H HA     . PHE A 1 83  ? 31.635 0.807   -0.678  1.00 0.00 ? 296 PHE A HA     3  
ATOM   5612  H HB2    . PHE A 1 83  ? 31.555 -1.746  -1.125  1.00 0.00 ? 296 PHE A HB2    3  
ATOM   5613  H HB3    . PHE A 1 83  ? 31.350 -1.285  0.554   1.00 0.00 ? 296 PHE A HB3    3  
ATOM   5614  H HD1    . PHE A 1 83  ? 29.056 -1.294  1.557   1.00 0.00 ? 296 PHE A HD1    3  
ATOM   5615  H HD2    . PHE A 1 83  ? 29.828 -2.870  -2.307  1.00 0.00 ? 296 PHE A HD2    3  
ATOM   5616  H HE1    . PHE A 1 83  ? 26.888 -2.555  1.638   1.00 0.00 ? 296 PHE A HE1    3  
ATOM   5617  H HE2    . PHE A 1 83  ? 27.659 -4.131  -2.225  1.00 0.00 ? 296 PHE A HE2    3  
ATOM   5618  H HZ     . PHE A 1 83  ? 26.215 -3.959  -0.253  1.00 0.00 ? 296 PHE A HZ     3  
ATOM   5619  N N      . GLY A 1 84  ? 31.394 0.229   -3.168  1.00 0.00 ? 297 GLY A N      3  
ATOM   5620  C CA     . GLY A 1 84  ? 31.192 0.275   -4.607  1.00 0.00 ? 297 GLY A CA     3  
ATOM   5621  C C      . GLY A 1 84  ? 31.078 1.719   -5.097  1.00 0.00 ? 297 GLY A C      3  
ATOM   5622  O O      . GLY A 1 84  ? 30.347 2.000   -6.046  1.00 0.00 ? 297 GLY A O      3  
ATOM   5623  H H      . GLY A 1 84  ? 32.347 0.160   -2.876  1.00 0.00 ? 297 GLY A H      3  
ATOM   5624  H HA2    . GLY A 1 84  ? 32.023 -0.220  -5.109  1.00 0.00 ? 297 GLY A HA2    3  
ATOM   5625  H HA3    . GLY A 1 84  ? 30.287 -0.275  -4.868  1.00 0.00 ? 297 GLY A HA3    3  
ATOM   5626  N N      . GLU A 1 85  ? 31.812 2.598   -4.430  1.00 0.00 ? 298 GLU A N      3  
ATOM   5627  C CA     . GLU A 1 85  ? 31.802 4.006   -4.787  1.00 0.00 ? 298 GLU A CA     3  
ATOM   5628  C C      . GLU A 1 85  ? 33.046 4.354   -5.609  1.00 0.00 ? 298 GLU A C      3  
ATOM   5629  O O      . GLU A 1 85  ? 33.063 5.356   -6.321  1.00 0.00 ? 298 GLU A O      3  
ATOM   5630  C CB     . GLU A 1 85  ? 31.704 4.887   -3.541  1.00 0.00 ? 298 GLU A CB     3  
ATOM   5631  C CG     . GLU A 1 85  ? 32.915 4.682   -2.627  1.00 0.00 ? 298 GLU A CG     3  
ATOM   5632  C CD     . GLU A 1 85  ? 32.668 3.539   -1.640  1.00 0.00 ? 298 GLU A CD     3  
ATOM   5633  O OE1    . GLU A 1 85  ? 31.592 3.470   -1.028  1.00 0.00 ? 298 GLU A OE1    3  
ATOM   5634  O OE2    . GLU A 1 85  ? 33.644 2.704   -1.519  1.00 0.00 ? 298 GLU A OE2    3  
ATOM   5635  H H      . GLU A 1 85  ? 32.403 2.361   -3.660  1.00 0.00 ? 298 GLU A H      3  
ATOM   5636  H HA     . GLU A 1 85  ? 30.908 4.145   -5.394  1.00 0.00 ? 298 GLU A HA     3  
ATOM   5637  H HB2    . GLU A 1 85  ? 31.640 5.935   -3.836  1.00 0.00 ? 298 GLU A HB2    3  
ATOM   5638  H HB3    . GLU A 1 85  ? 30.790 4.653   -2.996  1.00 0.00 ? 298 GLU A HB3    3  
ATOM   5639  H HG2    . GLU A 1 85  ? 33.796 4.463   -3.230  1.00 0.00 ? 298 GLU A HG2    3  
ATOM   5640  H HG3    . GLU A 1 85  ? 33.123 5.601   -2.081  1.00 0.00 ? 298 GLU A HG3    3  
ATOM   5641  H HE2    . GLU A 1 85  ? 33.299 1.767   -1.570  1.00 0.00 ? 298 GLU A HE2    3  
ATOM   5642  N N      . MET A 1 86  ? 34.055 3.506   -5.481  1.00 0.00 ? 299 MET A N      3  
ATOM   5643  C CA     . MET A 1 86  ? 35.300 3.710   -6.203  1.00 0.00 ? 299 MET A CA     3  
ATOM   5644  C C      . MET A 1 86  ? 35.058 3.751   -7.714  1.00 0.00 ? 299 MET A C      3  
ATOM   5645  O O      . MET A 1 86  ? 35.686 4.534   -8.425  1.00 0.00 ? 299 MET A O      3  
ATOM   5646  C CB     . MET A 1 86  ? 36.275 2.579   -5.872  1.00 0.00 ? 299 MET A CB     3  
ATOM   5647  C CG     . MET A 1 86  ? 37.184 2.963   -4.703  1.00 0.00 ? 299 MET A CG     3  
ATOM   5648  S SD     . MET A 1 86  ? 38.356 1.654   -4.386  1.00 0.00 ? 299 MET A SD     3  
ATOM   5649  C CE     . MET A 1 86  ? 39.245 1.653   -5.933  1.00 0.00 ? 299 MET A CE     3  
ATOM   5650  H H      . MET A 1 86  ? 34.033 2.693   -4.900  1.00 0.00 ? 299 MET A H      3  
ATOM   5651  H HA     . MET A 1 86  ? 35.680 4.674   -5.863  1.00 0.00 ? 299 MET A HA     3  
ATOM   5652  H HB2    . MET A 1 86  ? 35.718 1.675   -5.623  1.00 0.00 ? 299 MET A HB2    3  
ATOM   5653  H HB3    . MET A 1 86  ? 36.881 2.348   -6.749  1.00 0.00 ? 299 MET A HB3    3  
ATOM   5654  H HG2    . MET A 1 86  ? 37.713 3.888   -4.931  1.00 0.00 ? 299 MET A HG2    3  
ATOM   5655  H HG3    . MET A 1 86  ? 36.585 3.149   -3.811  1.00 0.00 ? 299 MET A HG3    3  
ATOM   5656  H HE1    . MET A 1 86  ? 40.096 0.975   -5.863  1.00 0.00 ? 299 MET A HE1    3  
ATOM   5657  H HE2    . MET A 1 86  ? 38.582 1.321   -6.733  1.00 0.00 ? 299 MET A HE2    3  
ATOM   5658  H HE3    . MET A 1 86  ? 39.600 2.660   -6.149  1.00 0.00 ? 299 MET A HE3    3  
ATOM   5659  N N      . ALA A 1 87  ? 34.147 2.897   -8.158  1.00 0.00 ? 300 ALA A N      3  
ATOM   5660  C CA     . ALA A 1 87  ? 33.814 2.826   -9.570  1.00 0.00 ? 300 ALA A CA     3  
ATOM   5661  C C      . ALA A 1 87  ? 32.967 4.041   -9.953  1.00 0.00 ? 300 ALA A C      3  
ATOM   5662  O O      . ALA A 1 87  ? 33.104 4.578   -11.050 1.00 0.00 ? 300 ALA A O      3  
ATOM   5663  C CB     . ALA A 1 87  ? 33.102 1.503   -9.860  1.00 0.00 ? 300 ALA A CB     3  
ATOM   5664  H H      . ALA A 1 87  ? 33.640 2.265   -7.571  1.00 0.00 ? 300 ALA A H      3  
ATOM   5665  H HA     . ALA A 1 87  ? 34.748 2.853   -10.132 1.00 0.00 ? 300 ALA A HA     3  
ATOM   5666  H HB1    . ALA A 1 87  ? 33.276 1.217   -10.898 1.00 0.00 ? 300 ALA A HB1    3  
ATOM   5667  H HB2    . ALA A 1 87  ? 33.490 0.729   -9.200  1.00 0.00 ? 300 ALA A HB2    3  
ATOM   5668  H HB3    . ALA A 1 87  ? 32.031 1.622   -9.691  1.00 0.00 ? 300 ALA A HB3    3  
ATOM   5669  N N      . LEU A 1 88  ? 32.108 4.440   -9.025  1.00 0.00 ? 301 LEU A N      3  
ATOM   5670  C CA     . LEU A 1 88  ? 31.238 5.581   -9.251  1.00 0.00 ? 301 LEU A CA     3  
ATOM   5671  C C      . LEU A 1 88  ? 32.033 6.871   -9.046  1.00 0.00 ? 301 LEU A C      3  
ATOM   5672  O O      . LEU A 1 88  ? 31.576 7.952   -9.415  1.00 0.00 ? 301 LEU A O      3  
ATOM   5673  C CB     . LEU A 1 88  ? 29.988 5.484   -8.375  1.00 0.00 ? 301 LEU A CB     3  
ATOM   5674  C CG     . LEU A 1 88  ? 28.842 4.638   -8.933  1.00 0.00 ? 301 LEU A CG     3  
ATOM   5675  C CD1    . LEU A 1 88  ? 27.762 4.409   -7.874  1.00 0.00 ? 301 LEU A CD1    3  
ATOM   5676  C CD2    . LEU A 1 88  ? 28.269 5.264   -10.208 1.00 0.00 ? 301 LEU A CD2    3  
ATOM   5677  H H      . LEU A 1 88  ? 32.002 3.997   -8.134  1.00 0.00 ? 301 LEU A H      3  
ATOM   5678  H HA     . LEU A 1 88  ? 30.908 5.540   -10.289 1.00 0.00 ? 301 LEU A HA     3  
ATOM   5679  H HB2    . LEU A 1 88  ? 30.277 5.073   -7.408  1.00 0.00 ? 301 LEU A HB2    3  
ATOM   5680  H HB3    . LEU A 1 88  ? 29.615 6.492   -8.195  1.00 0.00 ? 301 LEU A HB3    3  
ATOM   5681  H HG     . LEU A 1 88  ? 29.239 3.661   -9.205  1.00 0.00 ? 301 LEU A HG     3  
ATOM   5682  H HD11   . LEU A 1 88  ? 26.806 4.223   -8.363  1.00 0.00 ? 301 LEU A HD11   3  
ATOM   5683  H HD12   . LEU A 1 88  ? 28.031 3.548   -7.262  1.00 0.00 ? 301 LEU A HD12   3  
ATOM   5684  H HD13   . LEU A 1 88  ? 27.682 5.292   -7.240  1.00 0.00 ? 301 LEU A HD13   3  
ATOM   5685  H HD21   . LEU A 1 88  ? 27.362 4.733   -10.496 1.00 0.00 ? 301 LEU A HD21   3  
ATOM   5686  H HD22   . LEU A 1 88  ? 28.035 6.312   -10.024 1.00 0.00 ? 301 LEU A HD22   3  
ATOM   5687  H HD23   . LEU A 1 88  ? 29.004 5.192   -11.009 1.00 0.00 ? 301 LEU A HD23   3  
ATOM   5688  N N      . ILE A 1 89  ? 33.212 6.716   -8.461  1.00 0.00 ? 302 ILE A N      3  
ATOM   5689  C CA     . ILE A 1 89  ? 34.076 7.855   -8.202  1.00 0.00 ? 302 ILE A CA     3  
ATOM   5690  C C      . ILE A 1 89  ? 34.789 8.252   -9.496  1.00 0.00 ? 302 ILE A C      3  
ATOM   5691  O O      . ILE A 1 89  ? 34.810 9.426   -9.863  1.00 0.00 ? 302 ILE A O      3  
ATOM   5692  C CB     . ILE A 1 89  ? 35.026 7.556   -7.042  1.00 0.00 ? 302 ILE A CB     3  
ATOM   5693  C CG1    . ILE A 1 89  ? 34.363 7.858   -5.697  1.00 0.00 ? 302 ILE A CG1    3  
ATOM   5694  C CG2    . ILE A 1 89  ? 36.350 8.305   -7.210  1.00 0.00 ? 302 ILE A CG2    3  
ATOM   5695  C CD1    . ILE A 1 89  ? 35.102 7.161   -4.552  1.00 0.00 ? 302 ILE A CD1    3  
ATOM   5696  H H      . ILE A 1 89  ? 33.577 5.833   -8.164  1.00 0.00 ? 302 ILE A H      3  
ATOM   5697  H HA     . ILE A 1 89  ? 33.439 8.684   -7.891  1.00 0.00 ? 302 ILE A HA     3  
ATOM   5698  H HB     . ILE A 1 89  ? 35.256 6.489   -7.056  1.00 0.00 ? 302 ILE A HB     3  
ATOM   5699  H HG12   . ILE A 1 89  ? 34.353 8.934   -5.526  1.00 0.00 ? 302 ILE A HG12   3  
ATOM   5700  H HG13   . ILE A 1 89  ? 33.325 7.528   -5.717  1.00 0.00 ? 302 ILE A HG13   3  
ATOM   5701  H HG21   . ILE A 1 89  ? 36.889 7.902   -8.068  1.00 0.00 ? 302 ILE A HG21   3  
ATOM   5702  H HG22   . ILE A 1 89  ? 36.150 9.363   -7.371  1.00 0.00 ? 302 ILE A HG22   3  
ATOM   5703  H HG23   . ILE A 1 89  ? 36.954 8.182   -6.310  1.00 0.00 ? 302 ILE A HG23   3  
ATOM   5704  H HD11   . ILE A 1 89  ? 35.989 6.662   -4.943  1.00 0.00 ? 302 ILE A HD11   3  
ATOM   5705  H HD12   . ILE A 1 89  ? 35.399 7.900   -3.809  1.00 0.00 ? 302 ILE A HD12   3  
ATOM   5706  H HD13   . ILE A 1 89  ? 34.444 6.425   -4.090  1.00 0.00 ? 302 ILE A HD13   3  
ATOM   5707  N N      . SER A 1 90  ? 35.358 7.250   -10.152 1.00 0.00 ? 303 SER A N      3  
ATOM   5708  C CA     . SER A 1 90  ? 36.072 7.480   -11.396 1.00 0.00 ? 303 SER A CA     3  
ATOM   5709  C C      . SER A 1 90  ? 35.517 6.567   -12.492 1.00 0.00 ? 303 SER A C      3  
ATOM   5710  O O      . SER A 1 90  ? 35.029 7.045   -13.514 1.00 0.00 ? 303 SER A O      3  
ATOM   5711  C CB     . SER A 1 90  ? 37.573 7.249   -11.221 1.00 0.00 ? 303 SER A CB     3  
ATOM   5712  O OG     . SER A 1 90  ? 38.338 8.381   -11.624 1.00 0.00 ? 303 SER A OG     3  
ATOM   5713  H H      . SER A 1 90  ? 35.336 6.299   -9.845  1.00 0.00 ? 303 SER A H      3  
ATOM   5714  H HA     . SER A 1 90  ? 35.892 8.527   -11.643 1.00 0.00 ? 303 SER A HA     3  
ATOM   5715  H HB2    . SER A 1 90  ? 37.785 7.021   -10.176 1.00 0.00 ? 303 SER A HB2    3  
ATOM   5716  H HB3    . SER A 1 90  ? 37.877 6.380   -11.805 1.00 0.00 ? 303 SER A HB3    3  
ATOM   5717  H HG     . SER A 1 90  ? 38.815 8.770   -10.836 1.00 0.00 ? 303 SER A HG     3  
ATOM   5718  N N      . GLY A 1 91  ? 35.613 5.270   -12.241 1.00 0.00 ? 304 GLY A N      3  
ATOM   5719  C CA     . GLY A 1 91  ? 35.129 4.285   -13.193 1.00 0.00 ? 304 GLY A CA     3  
ATOM   5720  C C      . GLY A 1 91  ? 36.057 3.070   -13.247 1.00 0.00 ? 304 GLY A C      3  
ATOM   5721  O O      . GLY A 1 91  ? 36.324 2.536   -14.322 1.00 0.00 ? 304 GLY A O      3  
ATOM   5722  H H      . GLY A 1 91  ? 36.012 4.889   -11.407 1.00 0.00 ? 304 GLY A H      3  
ATOM   5723  H HA2    . GLY A 1 91  ? 34.124 3.969   -12.915 1.00 0.00 ? 304 GLY A HA2    3  
ATOM   5724  H HA3    . GLY A 1 91  ? 35.057 4.736   -14.184 1.00 0.00 ? 304 GLY A HA3    3  
ATOM   5725  N N      . GLU A 1 92  ? 36.522 2.670   -12.073 1.00 0.00 ? 305 GLU A N      3  
ATOM   5726  C CA     . GLU A 1 92  ? 37.414 1.527   -11.972 1.00 0.00 ? 305 GLU A CA     3  
ATOM   5727  C C      . GLU A 1 92  ? 36.614 0.250   -11.707 1.00 0.00 ? 305 GLU A C      3  
ATOM   5728  O O      . GLU A 1 92  ? 35.474 0.312   -11.248 1.00 0.00 ? 305 GLU A O      3  
ATOM   5729  C CB     . GLU A 1 92  ? 38.469 1.749   -10.886 1.00 0.00 ? 305 GLU A CB     3  
ATOM   5730  C CG     . GLU A 1 92  ? 39.591 2.659   -11.390 1.00 0.00 ? 305 GLU A CG     3  
ATOM   5731  C CD     . GLU A 1 92  ? 40.963 2.102   -11.004 1.00 0.00 ? 305 GLU A CD     3  
ATOM   5732  O OE1    . GLU A 1 92  ? 41.434 1.134   -11.620 1.00 0.00 ? 305 GLU A OE1    3  
ATOM   5733  O OE2    . GLU A 1 92  ? 41.545 2.712   -10.028 1.00 0.00 ? 305 GLU A OE2    3  
ATOM   5734  H H      . GLU A 1 92  ? 36.300 3.110   -11.203 1.00 0.00 ? 305 GLU A H      3  
ATOM   5735  H HA     . GLU A 1 92  ? 37.909 1.459   -12.942 1.00 0.00 ? 305 GLU A HA     3  
ATOM   5736  H HB2    . GLU A 1 92  ? 38.002 2.193   -10.007 1.00 0.00 ? 305 GLU A HB2    3  
ATOM   5737  H HB3    . GLU A 1 92  ? 38.885 0.790   -10.576 1.00 0.00 ? 305 GLU A HB3    3  
ATOM   5738  H HG2    . GLU A 1 92  ? 39.525 2.758   -12.473 1.00 0.00 ? 305 GLU A HG2    3  
ATOM   5739  H HG3    . GLU A 1 92  ? 39.470 3.658   -10.970 1.00 0.00 ? 305 GLU A HG3    3  
ATOM   5740  H HE2    . GLU A 1 92  ? 41.372 2.228   -9.170  1.00 0.00 ? 305 GLU A HE2    3  
ATOM   5741  N N      . PRO A 1 93  ? 37.259 -0.907  -12.013 1.00 0.00 ? 306 PRO A N      3  
ATOM   5742  C CA     . PRO A 1 93  ? 36.620 -2.196  -11.813 1.00 0.00 ? 306 PRO A CA     3  
ATOM   5743  C C      . PRO A 1 93  ? 36.588 -2.567  -10.328 1.00 0.00 ? 306 PRO A C      3  
ATOM   5744  O O      . PRO A 1 93  ? 37.491 -2.207  -9.575  1.00 0.00 ? 306 PRO A O      3  
ATOM   5745  C CB     . PRO A 1 93  ? 37.430 -3.172  -12.652 1.00 0.00 ? 306 PRO A CB     3  
ATOM   5746  C CG     . PRO A 1 93  ? 38.760 -2.487  -12.919 1.00 0.00 ? 306 PRO A CG     3  
ATOM   5747  C CD     . PRO A 1 93  ? 38.609 -1.018  -12.557 1.00 0.00 ? 306 PRO A CD     3  
ATOM   5748  H HA     . PRO A 1 93  ? 35.664 -2.159  -12.105 1.00 0.00 ? 306 PRO A HA     3  
ATOM   5749  H HB2    . PRO A 1 93  ? 37.575 -4.114  -12.123 1.00 0.00 ? 306 PRO A HB2    3  
ATOM   5750  H HB3    . PRO A 1 93  ? 36.916 -3.404  -13.585 1.00 0.00 ? 306 PRO A HB3    3  
ATOM   5751  H HG2    . PRO A 1 93  ? 39.552 -2.946  -12.326 1.00 0.00 ? 306 PRO A HG2    3  
ATOM   5752  H HG3    . PRO A 1 93  ? 39.042 -2.596  -13.965 1.00 0.00 ? 306 PRO A HG3    3  
ATOM   5753  H HD2    . PRO A 1 93  ? 39.357 -0.711  -11.827 1.00 0.00 ? 306 PRO A HD2    3  
ATOM   5754  H HD3    . PRO A 1 93  ? 38.738 -0.380  -13.432 1.00 0.00 ? 306 PRO A HD3    3  
ATOM   5755  N N      . ARG A 1 94  ? 35.537 -3.282  -9.953  1.00 0.00 ? 307 ARG A N      3  
ATOM   5756  C CA     . ARG A 1 94  ? 35.376 -3.706  -8.572  1.00 0.00 ? 307 ARG A CA     3  
ATOM   5757  C C      . ARG A 1 94  ? 36.733 -4.071  -7.967  1.00 0.00 ? 307 ARG A C      3  
ATOM   5758  O O      . ARG A 1 94  ? 37.284 -5.130  -8.263  1.00 0.00 ? 307 ARG A O      3  
ATOM   5759  C CB     . ARG A 1 94  ? 34.440 -4.912  -8.472  1.00 0.00 ? 307 ARG A CB     3  
ATOM   5760  C CG     . ARG A 1 94  ? 33.040 -4.484  -8.026  1.00 0.00 ? 307 ARG A CG     3  
ATOM   5761  C CD     . ARG A 1 94  ? 32.387 -3.576  -9.070  1.00 0.00 ? 307 ARG A CD     3  
ATOM   5762  N NE     . ARG A 1 94  ? 32.197 -2.218  -8.512  1.00 0.00 ? 307 ARG A NE     3  
ATOM   5763  C CZ     . ARG A 1 94  ? 31.124 -1.839  -7.803  1.00 0.00 ? 307 ARG A CZ     3  
ATOM   5764  N NH1    . ARG A 1 94  ? 30.137 -2.713  -7.564  1.00 0.00 ? 307 ARG A NH1    3  
ATOM   5765  N NH2    . ARG A 1 94  ? 31.038 -0.587  -7.337  1.00 0.00 ? 307 ARG A NH2    3  
ATOM   5766  H H      . ARG A 1 94  ? 34.807 -3.571  -10.571 1.00 0.00 ? 307 ARG A H      3  
ATOM   5767  H HA     . ARG A 1 94  ? 34.940 -2.845  -8.066  1.00 0.00 ? 307 ARG A HA     3  
ATOM   5768  H HB2    . ARG A 1 94  ? 34.380 -5.412  -9.439  1.00 0.00 ? 307 ARG A HB2    3  
ATOM   5769  H HB3    . ARG A 1 94  ? 34.846 -5.635  -7.765  1.00 0.00 ? 307 ARG A HB3    3  
ATOM   5770  H HG2    . ARG A 1 94  ? 32.420 -5.366  -7.867  1.00 0.00 ? 307 ARG A HG2    3  
ATOM   5771  H HG3    . ARG A 1 94  ? 33.103 -3.961  -7.072  1.00 0.00 ? 307 ARG A HG3    3  
ATOM   5772  H HD2    . ARG A 1 94  ? 33.009 -3.526  -9.963  1.00 0.00 ? 307 ARG A HD2    3  
ATOM   5773  H HD3    . ARG A 1 94  ? 31.425 -3.990  -9.374  1.00 0.00 ? 307 ARG A HD3    3  
ATOM   5774  H HE     . ARG A 1 94  ? 32.916 -1.540  -8.672  1.00 0.00 ? 307 ARG A HE     3  
ATOM   5775  H HH11   . ARG A 1 94  ? 30.202 -3.648  -7.913  1.00 0.00 ? 307 ARG A HH11   3  
ATOM   5776  H HH12   . ARG A 1 94  ? 29.336 -2.431  -7.036  1.00 0.00 ? 307 ARG A HH12   3  
ATOM   5777  H HH21   . ARG A 1 94  ? 31.774 0.066   -7.515  1.00 0.00 ? 307 ARG A HH21   3  
ATOM   5778  H HH22   . ARG A 1 94  ? 30.237 -0.304  -6.808  1.00 0.00 ? 307 ARG A HH22   3  
ATOM   5779  N N      . SER A 1 95  ? 37.232 -3.174  -7.130  1.00 0.00 ? 308 SER A N      3  
ATOM   5780  C CA     . SER A 1 95  ? 38.513 -3.388  -6.480  1.00 0.00 ? 308 SER A CA     3  
ATOM   5781  C C      . SER A 1 95  ? 38.566 -4.792  -5.875  1.00 0.00 ? 308 SER A C      3  
ATOM   5782  O O      . SER A 1 95  ? 39.644 -5.360  -5.707  1.00 0.00 ? 308 SER A O      3  
ATOM   5783  C CB     . SER A 1 95  ? 38.766 -2.335  -5.398  1.00 0.00 ? 308 SER A CB     3  
ATOM   5784  O OG     . SER A 1 95  ? 37.551 -1.850  -4.832  1.00 0.00 ? 308 SER A OG     3  
ATOM   5785  H H      . SER A 1 95  ? 36.777 -2.315  -6.895  1.00 0.00 ? 308 SER A H      3  
ATOM   5786  H HA     . SER A 1 95  ? 39.259 -3.282  -7.269  1.00 0.00 ? 308 SER A HA     3  
ATOM   5787  H HB2    . SER A 1 95  ? 39.387 -2.765  -4.612  1.00 0.00 ? 308 SER A HB2    3  
ATOM   5788  H HB3    . SER A 1 95  ? 39.324 -1.502  -5.826  1.00 0.00 ? 308 SER A HB3    3  
ATOM   5789  H HG     . SER A 1 95  ? 37.225 -1.059  -5.349  1.00 0.00 ? 308 SER A HG     3  
ATOM   5790  N N      . ALA A 1 96  ? 37.388 -5.312  -5.566  1.00 0.00 ? 309 ALA A N      3  
ATOM   5791  C CA     . ALA A 1 96  ? 37.285 -6.640  -4.983  1.00 0.00 ? 309 ALA A CA     3  
ATOM   5792  C C      . ALA A 1 96  ? 35.838 -7.126  -5.084  1.00 0.00 ? 309 ALA A C      3  
ATOM   5793  O O      . ALA A 1 96  ? 34.920 -6.324  -5.252  1.00 0.00 ? 309 ALA A O      3  
ATOM   5794  C CB     . ALA A 1 96  ? 37.789 -6.604  -3.539  1.00 0.00 ? 309 ALA A CB     3  
ATOM   5795  H H      . ALA A 1 96  ? 36.515 -4.844  -5.705  1.00 0.00 ? 309 ALA A H      3  
ATOM   5796  H HA     . ALA A 1 96  ? 37.925 -7.307  -5.562  1.00 0.00 ? 309 ALA A HA     3  
ATOM   5797  H HB1    . ALA A 1 96  ? 37.212 -7.305  -2.935  1.00 0.00 ? 309 ALA A HB1    3  
ATOM   5798  H HB2    . ALA A 1 96  ? 38.842 -6.885  -3.515  1.00 0.00 ? 309 ALA A HB2    3  
ATOM   5799  H HB3    . ALA A 1 96  ? 37.672 -5.597  -3.138  1.00 0.00 ? 309 ALA A HB3    3  
ATOM   5800  N N      . THR A 1 97  ? 35.679 -8.437  -4.976  1.00 0.00 ? 310 THR A N      3  
ATOM   5801  C CA     . THR A 1 97  ? 34.359 -9.039  -5.053  1.00 0.00 ? 310 THR A CA     3  
ATOM   5802  C C      . THR A 1 97  ? 33.646 -8.937  -3.703  1.00 0.00 ? 310 THR A C      3  
ATOM   5803  O O      . THR A 1 97  ? 34.244 -9.200  -2.661  1.00 0.00 ? 310 THR A O      3  
ATOM   5804  C CB     . THR A 1 97  ? 34.524 -10.478 -5.546  1.00 0.00 ? 310 THR A CB     3  
ATOM   5805  O OG1    . THR A 1 97  ? 34.992 -10.335 -6.884  1.00 0.00 ? 310 THR A OG1    3  
ATOM   5806  C CG2    . THR A 1 97  ? 33.184 -11.203 -5.694  1.00 0.00 ? 310 THR A CG2    3  
ATOM   5807  H H      . THR A 1 97  ? 36.431 -9.082  -4.840  1.00 0.00 ? 310 THR A H      3  
ATOM   5808  H HA     . THR A 1 97  ? 33.765 -8.474  -5.772  1.00 0.00 ? 310 THR A HA     3  
ATOM   5809  H HB     . THR A 1 97  ? 35.199 -11.037 -4.898  1.00 0.00 ? 310 THR A HB     3  
ATOM   5810  H HG1    . THR A 1 97  ? 35.095 -11.236 -7.308  1.00 0.00 ? 310 THR A HG1    3  
ATOM   5811  H HG21   . THR A 1 97  ? 32.728 -11.328 -4.712  1.00 0.00 ? 310 THR A HG21   3  
ATOM   5812  H HG22   . THR A 1 97  ? 32.523 -10.616 -6.331  1.00 0.00 ? 310 THR A HG22   3  
ATOM   5813  H HG23   . THR A 1 97  ? 33.349 -12.182 -6.145  1.00 0.00 ? 310 THR A HG23   3  
ATOM   5814  N N      . VAL A 1 98  ? 32.379 -8.554  -3.766  1.00 0.00 ? 311 VAL A N      3  
ATOM   5815  C CA     . VAL A 1 98  ? 31.579 -8.414  -2.561  1.00 0.00 ? 311 VAL A CA     3  
ATOM   5816  C C      . VAL A 1 98  ? 30.416 -9.407  -2.608  1.00 0.00 ? 311 VAL A C      3  
ATOM   5817  O O      . VAL A 1 98  ? 29.714 -9.498  -3.613  1.00 0.00 ? 311 VAL A O      3  
ATOM   5818  C CB     . VAL A 1 98  ? 31.121 -6.963  -2.403  1.00 0.00 ? 311 VAL A CB     3  
ATOM   5819  C CG1    . VAL A 1 98  ? 29.918 -6.868  -1.462  1.00 0.00 ? 311 VAL A CG1    3  
ATOM   5820  C CG2    . VAL A 1 98  ? 32.268 -6.074  -1.919  1.00 0.00 ? 311 VAL A CG2    3  
ATOM   5821  H H      . VAL A 1 98  ? 31.901 -8.342  -4.618  1.00 0.00 ? 311 VAL A H      3  
ATOM   5822  H HA     . VAL A 1 98  ? 32.217 -8.660  -1.712  1.00 0.00 ? 311 VAL A HA     3  
ATOM   5823  H HB     . VAL A 1 98  ? 30.809 -6.602  -3.383  1.00 0.00 ? 311 VAL A HB     3  
ATOM   5824  H HG11   . VAL A 1 98  ? 30.098 -6.089  -0.721  1.00 0.00 ? 311 VAL A HG11   3  
ATOM   5825  H HG12   . VAL A 1 98  ? 29.026 -6.622  -2.038  1.00 0.00 ? 311 VAL A HG12   3  
ATOM   5826  H HG13   . VAL A 1 98  ? 29.774 -7.823  -0.958  1.00 0.00 ? 311 VAL A HG13   3  
ATOM   5827  H HG21   . VAL A 1 98  ? 32.102 -5.803  -0.876  1.00 0.00 ? 311 VAL A HG21   3  
ATOM   5828  H HG22   . VAL A 1 98  ? 33.209 -6.617  -2.007  1.00 0.00 ? 311 VAL A HG22   3  
ATOM   5829  H HG23   . VAL A 1 98  ? 32.310 -5.171  -2.528  1.00 0.00 ? 311 VAL A HG23   3  
ATOM   5830  N N      . SER A 1 99  ? 30.250 -10.126 -1.508  1.00 0.00 ? 312 SER A N      3  
ATOM   5831  C CA     . SER A 1 99  ? 29.184 -11.109 -1.411  1.00 0.00 ? 312 SER A CA     3  
ATOM   5832  C C      . SER A 1 99  ? 28.537 -11.044 -0.026  1.00 0.00 ? 312 SER A C      3  
ATOM   5833  O O      . SER A 1 99  ? 29.229 -11.088 0.990   1.00 0.00 ? 312 SER A O      3  
ATOM   5834  C CB     . SER A 1 99  ? 29.709 -12.520 -1.685  1.00 0.00 ? 312 SER A CB     3  
ATOM   5835  O OG     . SER A 1 99  ? 30.271 -13.116 -0.520  1.00 0.00 ? 312 SER A OG     3  
ATOM   5836  H H      . SER A 1 99  ? 30.825 -10.045 -0.694  1.00 0.00 ? 312 SER A H      3  
ATOM   5837  H HA     . SER A 1 99  ? 28.465 -10.833 -2.182  1.00 0.00 ? 312 SER A HA     3  
ATOM   5838  H HB2    . SER A 1 99  ? 28.896 -13.144 -2.056  1.00 0.00 ? 312 SER A HB2    3  
ATOM   5839  H HB3    . SER A 1 99  ? 30.463 -12.479 -2.472  1.00 0.00 ? 312 SER A HB3    3  
ATOM   5840  H HG     . SER A 1 99  ? 30.626 -14.026 -0.738  1.00 0.00 ? 312 SER A HG     3  
ATOM   5841  N N      . ALA A 1 100 ? 27.216 -10.941 -0.030  1.00 0.00 ? 313 ALA A N      3  
ATOM   5842  C CA     . ALA A 1 100 ? 26.467 -10.869 1.214   1.00 0.00 ? 313 ALA A CA     3  
ATOM   5843  C C      . ALA A 1 100 ? 26.565 -12.212 1.941   1.00 0.00 ? 313 ALA A C      3  
ATOM   5844  O O      . ALA A 1 100 ? 26.105 -13.233 1.430   1.00 0.00 ? 313 ALA A O      3  
ATOM   5845  C CB     . ALA A 1 100 ? 25.020 -10.471 0.917   1.00 0.00 ? 313 ALA A CB     3  
ATOM   5846  H H      . ALA A 1 100 ? 26.660 -10.907 -0.859  1.00 0.00 ? 313 ALA A H      3  
ATOM   5847  H HA     . ALA A 1 100 ? 26.925 -10.098 1.832   1.00 0.00 ? 313 ALA A HA     3  
ATOM   5848  H HB1    . ALA A 1 100 ? 24.707 -9.695  1.615   1.00 0.00 ? 313 ALA A HB1    3  
ATOM   5849  H HB2    . ALA A 1 100 ? 24.950 -10.092 -0.103  1.00 0.00 ? 313 ALA A HB2    3  
ATOM   5850  H HB3    . ALA A 1 100 ? 24.374 -11.341 1.027   1.00 0.00 ? 313 ALA A HB3    3  
ATOM   5851  N N      . ALA A 1 101 ? 27.165 -12.168 3.121   1.00 0.00 ? 314 ALA A N      3  
ATOM   5852  C CA     . ALA A 1 101 ? 27.328 -13.370 3.923   1.00 0.00 ? 314 ALA A CA     3  
ATOM   5853  C C      . ALA A 1 101 ? 25.949 -13.918 4.298   1.00 0.00 ? 314 ALA A C      3  
ATOM   5854  O O      . ALA A 1 101 ? 25.763 -15.130 4.390   1.00 0.00 ? 314 ALA A O      3  
ATOM   5855  C CB     . ALA A 1 101 ? 28.182 -13.051 5.151   1.00 0.00 ? 314 ALA A CB     3  
ATOM   5856  H H      . ALA A 1 101 ? 27.535 -11.335 3.529   1.00 0.00 ? 314 ALA A H      3  
ATOM   5857  H HA     . ALA A 1 101 ? 27.849 -14.107 3.314   1.00 0.00 ? 314 ALA A HA     3  
ATOM   5858  H HB1    . ALA A 1 101 ? 27.577 -12.526 5.889   1.00 0.00 ? 314 ALA A HB1    3  
ATOM   5859  H HB2    . ALA A 1 101 ? 28.558 -13.978 5.582   1.00 0.00 ? 314 ALA A HB2    3  
ATOM   5860  H HB3    . ALA A 1 101 ? 29.022 -12.421 4.856   1.00 0.00 ? 314 ALA A HB3    3  
ATOM   5861  N N      . THR A 1 102 ? 25.019 -12.998 4.505   1.00 0.00 ? 315 THR A N      3  
ATOM   5862  C CA     . THR A 1 102 ? 23.663 -13.374 4.869   1.00 0.00 ? 315 THR A CA     3  
ATOM   5863  C C      . THR A 1 102 ? 22.657 -12.383 4.277   1.00 0.00 ? 315 THR A C      3  
ATOM   5864  O O      . THR A 1 102 ? 23.047 -11.400 3.649   1.00 0.00 ? 315 THR A O      3  
ATOM   5865  C CB     . THR A 1 102 ? 23.592 -13.474 6.393   1.00 0.00 ? 315 THR A CB     3  
ATOM   5866  O OG1    . THR A 1 102 ? 22.287 -13.984 6.648   1.00 0.00 ? 315 THR A OG1    3  
ATOM   5867  C CG2    . THR A 1 102 ? 23.596 -12.102 7.071   1.00 0.00 ? 315 THR A CG2    3  
ATOM   5868  H H      . THR A 1 102 ? 25.177 -12.013 4.428   1.00 0.00 ? 315 THR A H      3  
ATOM   5869  H HA     . THR A 1 102 ? 23.447 -14.348 4.430   1.00 0.00 ? 315 THR A HA     3  
ATOM   5870  H HB     . THR A 1 102 ? 24.396 -14.101 6.780   1.00 0.00 ? 315 THR A HB     3  
ATOM   5871  H HG1    . THR A 1 102 ? 21.651 -13.230 6.815   1.00 0.00 ? 315 THR A HG1    3  
ATOM   5872  H HG21   . THR A 1 102 ? 23.198 -11.356 6.382   1.00 0.00 ? 315 THR A HG21   3  
ATOM   5873  H HG22   . THR A 1 102 ? 22.973 -12.137 7.966   1.00 0.00 ? 315 THR A HG22   3  
ATOM   5874  H HG23   . THR A 1 102 ? 24.615 -11.835 7.347   1.00 0.00 ? 315 THR A HG23   3  
ATOM   5875  N N      . THR A 1 103 ? 21.385 -12.677 4.500   1.00 0.00 ? 316 THR A N      3  
ATOM   5876  C CA     . THR A 1 103 ? 20.321 -11.825 3.997   1.00 0.00 ? 316 THR A CA     3  
ATOM   5877  C C      . THR A 1 103 ? 20.378 -10.450 4.667   1.00 0.00 ? 316 THR A C      3  
ATOM   5878  O O      . THR A 1 103 ? 19.993 -10.305 5.825   1.00 0.00 ? 316 THR A O      3  
ATOM   5879  C CB     . THR A 1 103 ? 18.991 -12.551 4.211   1.00 0.00 ? 316 THR A CB     3  
ATOM   5880  O OG1    . THR A 1 103 ? 19.268 -13.899 3.837   1.00 0.00 ? 316 THR A OG1    3  
ATOM   5881  C CG2    . THR A 1 103 ? 17.913 -12.103 3.223   1.00 0.00 ? 316 THR A CG2    3  
ATOM   5882  H H      . THR A 1 103 ? 21.077 -13.480 5.012   1.00 0.00 ? 316 THR A H      3  
ATOM   5883  H HA     . THR A 1 103 ? 20.482 -11.668 2.930   1.00 0.00 ? 316 THR A HA     3  
ATOM   5884  H HB     . THR A 1 103 ? 18.648 -12.438 5.240   1.00 0.00 ? 316 THR A HB     3  
ATOM   5885  H HG1    . THR A 1 103 ? 19.379 -13.962 2.846   1.00 0.00 ? 316 THR A HG1    3  
ATOM   5886  H HG21   . THR A 1 103 ? 16.966 -12.576 3.481   1.00 0.00 ? 316 THR A HG21   3  
ATOM   5887  H HG22   . THR A 1 103 ? 17.804 -11.020 3.271   1.00 0.00 ? 316 THR A HG22   3  
ATOM   5888  H HG23   . THR A 1 103 ? 18.202 -12.395 2.213   1.00 0.00 ? 316 THR A HG23   3  
ATOM   5889  N N      . VAL A 1 104 ? 20.861 -9.478  3.907   1.00 0.00 ? 317 VAL A N      3  
ATOM   5890  C CA     . VAL A 1 104 ? 20.973 -8.120  4.413   1.00 0.00 ? 317 VAL A CA     3  
ATOM   5891  C C      . VAL A 1 104 ? 20.286 -7.160  3.440   1.00 0.00 ? 317 VAL A C      3  
ATOM   5892  O O      . VAL A 1 104 ? 20.349 -7.351  2.227   1.00 0.00 ? 317 VAL A O      3  
ATOM   5893  C CB     . VAL A 1 104 ? 22.443 -7.773  4.659   1.00 0.00 ? 317 VAL A CB     3  
ATOM   5894  C CG1    . VAL A 1 104 ? 23.123 -8.843  5.516   1.00 0.00 ? 317 VAL A CG1    3  
ATOM   5895  C CG2    . VAL A 1 104 ? 23.187 -7.573  3.337   1.00 0.00 ? 317 VAL A CG2    3  
ATOM   5896  H H      . VAL A 1 104 ? 21.172 -9.604  2.966   1.00 0.00 ? 317 VAL A H      3  
ATOM   5897  H HA     . VAL A 1 104 ? 20.453 -8.081  5.370   1.00 0.00 ? 317 VAL A HA     3  
ATOM   5898  H HB     . VAL A 1 104 ? 22.477 -6.832  5.209   1.00 0.00 ? 317 VAL A HB     3  
ATOM   5899  H HG11   . VAL A 1 104 ? 22.410 -9.235  6.241   1.00 0.00 ? 317 VAL A HG11   3  
ATOM   5900  H HG12   . VAL A 1 104 ? 23.473 -9.652  4.875   1.00 0.00 ? 317 VAL A HG12   3  
ATOM   5901  H HG13   . VAL A 1 104 ? 23.971 -8.403  6.041   1.00 0.00 ? 317 VAL A HG13   3  
ATOM   5902  H HG21   . VAL A 1 104 ? 22.474 -7.584  2.513   1.00 0.00 ? 317 VAL A HG21   3  
ATOM   5903  H HG22   . VAL A 1 104 ? 23.708 -6.616  3.355   1.00 0.00 ? 317 VAL A HG22   3  
ATOM   5904  H HG23   . VAL A 1 104 ? 23.911 -8.377  3.203   1.00 0.00 ? 317 VAL A HG23   3  
ATOM   5905  N N      . SER A 1 105 ? 19.649 -6.148  4.009   1.00 0.00 ? 318 SER A N      3  
ATOM   5906  C CA     . SER A 1 105 ? 18.951 -5.157  3.206   1.00 0.00 ? 318 SER A CA     3  
ATOM   5907  C C      . SER A 1 105 ? 19.885 -3.984  2.895   1.00 0.00 ? 318 SER A C      3  
ATOM   5908  O O      . SER A 1 105 ? 20.544 -3.457  3.790   1.00 0.00 ? 318 SER A O      3  
ATOM   5909  C CB     . SER A 1 105 ? 17.691 -4.659  3.918   1.00 0.00 ? 318 SER A CB     3  
ATOM   5910  O OG     . SER A 1 105 ? 16.603 -5.567  3.775   1.00 0.00 ? 318 SER A OG     3  
ATOM   5911  H H      . SER A 1 105 ? 19.603 -5.998  4.996   1.00 0.00 ? 318 SER A H      3  
ATOM   5912  H HA     . SER A 1 105 ? 18.669 -5.675  2.289   1.00 0.00 ? 318 SER A HA     3  
ATOM   5913  H HB2    . SER A 1 105 ? 17.907 -4.514  4.977   1.00 0.00 ? 318 SER A HB2    3  
ATOM   5914  H HB3    . SER A 1 105 ? 17.409 -3.686  3.516   1.00 0.00 ? 318 SER A HB3    3  
ATOM   5915  H HG     . SER A 1 105 ? 15.852 -5.125  3.283   1.00 0.00 ? 318 SER A HG     3  
ATOM   5916  N N      . LEU A 1 106 ? 19.909 -3.610  1.625   1.00 0.00 ? 319 LEU A N      3  
ATOM   5917  C CA     . LEU A 1 106 ? 20.751 -2.510  1.185   1.00 0.00 ? 319 LEU A CA     3  
ATOM   5918  C C      . LEU A 1 106 ? 19.982 -1.661  0.169   1.00 0.00 ? 319 LEU A C      3  
ATOM   5919  O O      . LEU A 1 106 ? 18.954 -2.090  -0.353  1.00 0.00 ? 319 LEU A O      3  
ATOM   5920  C CB     . LEU A 1 106 ? 22.089 -3.035  0.660   1.00 0.00 ? 319 LEU A CB     3  
ATOM   5921  C CG     . LEU A 1 106 ? 22.045 -4.385  -0.058  1.00 0.00 ? 319 LEU A CG     3  
ATOM   5922  C CD1    . LEU A 1 106 ? 21.470 -4.236  -1.468  1.00 0.00 ? 319 LEU A CD1    3  
ATOM   5923  C CD2    . LEU A 1 106 ? 23.424 -5.046  -0.068  1.00 0.00 ? 319 LEU A CD2    3  
ATOM   5924  H H      . LEU A 1 106 ? 19.370 -4.045  0.903   1.00 0.00 ? 319 LEU A H      3  
ATOM   5925  H HA     . LEU A 1 106 ? 20.965 -1.894  2.058   1.00 0.00 ? 319 LEU A HA     3  
ATOM   5926  H HB2    . LEU A 1 106 ? 22.504 -2.294  -0.023  1.00 0.00 ? 319 LEU A HB2    3  
ATOM   5927  H HB3    . LEU A 1 106 ? 22.778 -3.116  1.501   1.00 0.00 ? 319 LEU A HB3    3  
ATOM   5928  H HG     . LEU A 1 106 ? 21.375 -5.045  0.494   1.00 0.00 ? 319 LEU A HG     3  
ATOM   5929  H HD11   . LEU A 1 106 ? 20.760 -5.042  -1.659  1.00 0.00 ? 319 LEU A HD11   3  
ATOM   5930  H HD12   . LEU A 1 106 ? 20.961 -3.276  -1.555  1.00 0.00 ? 319 LEU A HD12   3  
ATOM   5931  H HD13   . LEU A 1 106 ? 22.279 -4.285  -2.198  1.00 0.00 ? 319 LEU A HD13   3  
ATOM   5932  H HD21   . LEU A 1 106 ? 23.773 -5.145  -1.097  1.00 0.00 ? 319 LEU A HD21   3  
ATOM   5933  H HD22   . LEU A 1 106 ? 24.126 -4.431  0.495   1.00 0.00 ? 319 LEU A HD22   3  
ATOM   5934  H HD23   . LEU A 1 106 ? 23.358 -6.033  0.389   1.00 0.00 ? 319 LEU A HD23   3  
ATOM   5935  N N      . LEU A 1 107 ? 20.511 -0.472  -0.080  1.00 0.00 ? 320 LEU A N      3  
ATOM   5936  C CA     . LEU A 1 107 ? 19.888 0.440   -1.024  1.00 0.00 ? 320 LEU A CA     3  
ATOM   5937  C C      . LEU A 1 107 ? 20.735 0.507   -2.296  1.00 0.00 ? 320 LEU A C      3  
ATOM   5938  O O      . LEU A 1 107 ? 21.944 0.278   -2.255  1.00 0.00 ? 320 LEU A O      3  
ATOM   5939  C CB     . LEU A 1 107 ? 19.648 1.803   -0.373  1.00 0.00 ? 320 LEU A CB     3  
ATOM   5940  C CG     . LEU A 1 107 ? 18.886 1.787   0.954   1.00 0.00 ? 320 LEU A CG     3  
ATOM   5941  C CD1    . LEU A 1 107 ? 19.625 2.599   2.021   1.00 0.00 ? 320 LEU A CD1    3  
ATOM   5942  C CD2    . LEU A 1 107 ? 17.446 2.267   0.765   1.00 0.00 ? 320 LEU A CD2    3  
ATOM   5943  H H      . LEU A 1 107 ? 21.347 -0.132  0.349   1.00 0.00 ? 320 LEU A H      3  
ATOM   5944  H HA     . LEU A 1 107 ? 18.912 0.029   -1.281  1.00 0.00 ? 320 LEU A HA     3  
ATOM   5945  H HB2    . LEU A 1 107 ? 20.614 2.281   -0.208  1.00 0.00 ? 320 LEU A HB2    3  
ATOM   5946  H HB3    . LEU A 1 107 ? 19.099 2.429   -1.076  1.00 0.00 ? 320 LEU A HB3    3  
ATOM   5947  H HG     . LEU A 1 107 ? 18.839 0.758   1.309   1.00 0.00 ? 320 LEU A HG     3  
ATOM   5948  H HD11   . LEU A 1 107 ? 19.305 3.640   1.971   1.00 0.00 ? 320 LEU A HD11   3  
ATOM   5949  H HD12   . LEU A 1 107 ? 19.397 2.196   3.008   1.00 0.00 ? 320 LEU A HD12   3  
ATOM   5950  H HD13   . LEU A 1 107 ? 20.699 2.540   1.843   1.00 0.00 ? 320 LEU A HD13   3  
ATOM   5951  H HD21   . LEU A 1 107 ? 16.759 1.519   1.161   1.00 0.00 ? 320 LEU A HD21   3  
ATOM   5952  H HD22   . LEU A 1 107 ? 17.303 3.209   1.295   1.00 0.00 ? 320 LEU A HD22   3  
ATOM   5953  H HD23   . LEU A 1 107 ? 17.249 2.414   -0.297  1.00 0.00 ? 320 LEU A HD23   3  
ATOM   5954  N N      . SER A 1 108 ? 20.069 0.822   -3.397  1.00 0.00 ? 321 SER A N      3  
ATOM   5955  C CA     . SER A 1 108 ? 20.745 0.923   -4.679  1.00 0.00 ? 321 SER A CA     3  
ATOM   5956  C C      . SER A 1 108 ? 20.643 2.353   -5.214  1.00 0.00 ? 321 SER A C      3  
ATOM   5957  O O      . SER A 1 108 ? 19.570 2.953   -5.189  1.00 0.00 ? 321 SER A O      3  
ATOM   5958  C CB     . SER A 1 108 ? 20.159 -0.065  -5.690  1.00 0.00 ? 321 SER A CB     3  
ATOM   5959  O OG     . SER A 1 108 ? 21.073 -1.112  -6.003  1.00 0.00 ? 321 SER A OG     3  
ATOM   5960  H H      . SER A 1 108 ? 19.086 1.007   -3.422  1.00 0.00 ? 321 SER A H      3  
ATOM   5961  H HA     . SER A 1 108 ? 21.784 0.663   -4.478  1.00 0.00 ? 321 SER A HA     3  
ATOM   5962  H HB2    . SER A 1 108 ? 19.241 -0.494  -5.288  1.00 0.00 ? 321 SER A HB2    3  
ATOM   5963  H HB3    . SER A 1 108 ? 19.890 0.467   -6.602  1.00 0.00 ? 321 SER A HB3    3  
ATOM   5964  H HG     . SER A 1 108 ? 22.010 -0.811  -5.831  1.00 0.00 ? 321 SER A HG     3  
ATOM   5965  N N      . LEU A 1 109 ? 21.774 2.856   -5.686  1.00 0.00 ? 322 LEU A N      3  
ATOM   5966  C CA     . LEU A 1 109 ? 21.825 4.204   -6.225  1.00 0.00 ? 322 LEU A CA     3  
ATOM   5967  C C      . LEU A 1 109 ? 22.380 4.157   -7.651  1.00 0.00 ? 322 LEU A C      3  
ATOM   5968  O O      . LEU A 1 109 ? 23.321 3.414   -7.930  1.00 0.00 ? 322 LEU A O      3  
ATOM   5969  C CB     . LEU A 1 109 ? 22.610 5.126   -5.290  1.00 0.00 ? 322 LEU A CB     3  
ATOM   5970  C CG     . LEU A 1 109 ? 22.825 6.558   -5.786  1.00 0.00 ? 322 LEU A CG     3  
ATOM   5971  C CD1    . LEU A 1 109 ? 21.574 7.409   -5.565  1.00 0.00 ? 322 LEU A CD1    3  
ATOM   5972  C CD2    . LEU A 1 109 ? 24.064 7.181   -5.139  1.00 0.00 ? 322 LEU A CD2    3  
ATOM   5973  H H      . LEU A 1 109 ? 22.642 2.361   -5.702  1.00 0.00 ? 322 LEU A H      3  
ATOM   5974  H HA     . LEU A 1 109 ? 20.802 4.579   -6.266  1.00 0.00 ? 322 LEU A HA     3  
ATOM   5975  H HB2    . LEU A 1 109 ? 22.089 5.169   -4.333  1.00 0.00 ? 322 LEU A HB2    3  
ATOM   5976  H HB3    . LEU A 1 109 ? 23.585 4.677   -5.103  1.00 0.00 ? 322 LEU A HB3    3  
ATOM   5977  H HG     . LEU A 1 109 ? 23.006 6.524   -6.860  1.00 0.00 ? 322 LEU A HG     3  
ATOM   5978  H HD11   . LEU A 1 109 ? 20.740 6.981   -6.122  1.00 0.00 ? 322 LEU A HD11   3  
ATOM   5979  H HD12   . LEU A 1 109 ? 21.329 7.427   -4.502  1.00 0.00 ? 322 LEU A HD12   3  
ATOM   5980  H HD13   . LEU A 1 109 ? 21.759 8.426   -5.912  1.00 0.00 ? 322 LEU A HD13   3  
ATOM   5981  H HD21   . LEU A 1 109 ? 24.013 7.053   -4.057  1.00 0.00 ? 322 LEU A HD21   3  
ATOM   5982  H HD22   . LEU A 1 109 ? 24.959 6.690   -5.521  1.00 0.00 ? 322 LEU A HD22   3  
ATOM   5983  H HD23   . LEU A 1 109 ? 24.103 8.245   -5.378  1.00 0.00 ? 322 LEU A HD23   3  
ATOM   5984  N N      . HIS A 1 110 ? 21.775 4.960   -8.514  1.00 0.00 ? 323 HIS A N      3  
ATOM   5985  C CA     . HIS A 1 110 ? 22.198 5.019   -9.903  1.00 0.00 ? 323 HIS A CA     3  
ATOM   5986  C C      . HIS A 1 110 ? 23.450 5.889   -10.022 1.00 0.00 ? 323 HIS A C      3  
ATOM   5987  O O      . HIS A 1 110 ? 23.680 6.768   -9.193  1.00 0.00 ? 323 HIS A O      3  
ATOM   5988  C CB     . HIS A 1 110 ? 21.054 5.500   -10.799 1.00 0.00 ? 323 HIS A CB     3  
ATOM   5989  C CG     . HIS A 1 110 ? 21.407 5.565   -12.264 1.00 0.00 ? 323 HIS A CG     3  
ATOM   5990  N ND1    . HIS A 1 110 ? 21.967 4.501   -12.949 1.00 0.00 ? 323 HIS A ND1    3  
ATOM   5991  C CD2    . HIS A 1 110 ? 21.274 6.578   -13.170 1.00 0.00 ? 323 HIS A CD2    3  
ATOM   5992  C CE1    . HIS A 1 110 ? 22.159 4.867   -14.208 1.00 0.00 ? 323 HIS A CE1    3  
ATOM   5993  N NE2    . HIS A 1 110 ? 21.729 6.155   -14.342 1.00 0.00 ? 323 HIS A NE2    3  
ATOM   5994  H H      . HIS A 1 110 ? 21.011 5.560   -8.279  1.00 0.00 ? 323 HIS A H      3  
ATOM   5995  H HA     . HIS A 1 110 ? 22.444 3.998   -10.199 1.00 0.00 ? 323 HIS A HA     3  
ATOM   5996  H HB2    . HIS A 1 110 ? 20.200 4.834   -10.670 1.00 0.00 ? 323 HIS A HB2    3  
ATOM   5997  H HB3    . HIS A 1 110 ? 20.738 6.489   -10.466 1.00 0.00 ? 323 HIS A HB3    3  
ATOM   5998  H HD1    . HIS A 1 110 ? 22.189 3.607   -12.559 1.00 0.00 ? 323 HIS A HD1    3  
ATOM   5999  H HD2    . HIS A 1 110 ? 20.864 7.567   -12.964 1.00 0.00 ? 323 HIS A HD2    3  
ATOM   6000  H HE1    . HIS A 1 110 ? 22.586 4.248   -14.998 1.00 0.00 ? 323 HIS A HE1    3  
ATOM   6001  H HE2    . HIS A 1 110 ? 21.702 6.672   -15.198 1.00 0.00 ? 323 HIS A HE2    3  
ATOM   6002  N N      . SER A 1 111 ? 24.226 5.613   -11.059 1.00 0.00 ? 324 SER A N      3  
ATOM   6003  C CA     . SER A 1 111 ? 25.450 6.360   -11.297 1.00 0.00 ? 324 SER A CA     3  
ATOM   6004  C C      . SER A 1 111 ? 25.120 7.823   -11.598 1.00 0.00 ? 324 SER A C      3  
ATOM   6005  O O      . SER A 1 111 ? 25.859 8.723   -11.205 1.00 0.00 ? 324 SER A O      3  
ATOM   6006  C CB     . SER A 1 111 ? 26.253 5.749   -12.448 1.00 0.00 ? 324 SER A CB     3  
ATOM   6007  O OG     . SER A 1 111 ? 25.626 5.966   -13.710 1.00 0.00 ? 324 SER A OG     3  
ATOM   6008  H H      . SER A 1 111 ? 24.031 4.896   -11.729 1.00 0.00 ? 324 SER A H      3  
ATOM   6009  H HA     . SER A 1 111 ? 26.022 6.278   -10.373 1.00 0.00 ? 324 SER A HA     3  
ATOM   6010  H HB2    . SER A 1 111 ? 27.253 6.181   -12.462 1.00 0.00 ? 324 SER A HB2    3  
ATOM   6011  H HB3    . SER A 1 111 ? 26.370 4.679   -12.281 1.00 0.00 ? 324 SER A HB3    3  
ATOM   6012  H HG     . SER A 1 111 ? 26.209 6.537   -14.288 1.00 0.00 ? 324 SER A HG     3  
ATOM   6013  N N      . ALA A 1 112 ? 24.008 8.015   -12.293 1.00 0.00 ? 325 ALA A N      3  
ATOM   6014  C CA     . ALA A 1 112 ? 23.571 9.354   -12.651 1.00 0.00 ? 325 ALA A CA     3  
ATOM   6015  C C      . ALA A 1 112 ? 23.069 10.073  -11.397 1.00 0.00 ? 325 ALA A C      3  
ATOM   6016  O O      . ALA A 1 112 ? 23.209 11.289  -11.277 1.00 0.00 ? 325 ALA A O      3  
ATOM   6017  C CB     . ALA A 1 112 ? 22.502 9.268   -13.741 1.00 0.00 ? 325 ALA A CB     3  
ATOM   6018  H H      . ALA A 1 112 ? 23.412 7.277   -12.609 1.00 0.00 ? 325 ALA A H      3  
ATOM   6019  H HA     . ALA A 1 112 ? 24.434 9.890   -13.047 1.00 0.00 ? 325 ALA A HA     3  
ATOM   6020  H HB1    . ALA A 1 112 ? 22.548 8.289   -14.219 1.00 0.00 ? 325 ALA A HB1    3  
ATOM   6021  H HB2    . ALA A 1 112 ? 21.516 9.408   -13.296 1.00 0.00 ? 325 ALA A HB2    3  
ATOM   6022  H HB3    . ALA A 1 112 ? 22.678 10.044  -14.485 1.00 0.00 ? 325 ALA A HB3    3  
ATOM   6023  N N      . ASP A 1 113 ? 22.494 9.291   -10.495 1.00 0.00 ? 326 ASP A N      3  
ATOM   6024  C CA     . ASP A 1 113 ? 21.970 9.839   -9.255  1.00 0.00 ? 326 ASP A CA     3  
ATOM   6025  C C      . ASP A 1 113 ? 23.134 10.172  -8.318  1.00 0.00 ? 326 ASP A C      3  
ATOM   6026  O O      . ASP A 1 113 ? 23.051 11.112  -7.530  1.00 0.00 ? 326 ASP A O      3  
ATOM   6027  C CB     . ASP A 1 113 ? 21.066 8.830   -8.546  1.00 0.00 ? 326 ASP A CB     3  
ATOM   6028  C CG     . ASP A 1 113 ? 19.998 9.444   -7.639  1.00 0.00 ? 326 ASP A CG     3  
ATOM   6029  O OD1    . ASP A 1 113 ? 19.712 8.927   -6.549  1.00 0.00 ? 326 ASP A OD1    3  
ATOM   6030  O OD2    . ASP A 1 113 ? 19.443 10.515  -8.098  1.00 0.00 ? 326 ASP A OD2    3  
ATOM   6031  H H      . ASP A 1 113 ? 22.384 8.303   -10.601 1.00 0.00 ? 326 ASP A H      3  
ATOM   6032  H HA     . ASP A 1 113 ? 21.406 10.725  -9.549  1.00 0.00 ? 326 ASP A HA     3  
ATOM   6033  H HB2    . ASP A 1 113 ? 20.571 8.216   -9.299  1.00 0.00 ? 326 ASP A HB2    3  
ATOM   6034  H HB3    . ASP A 1 113 ? 21.689 8.163   -7.950  1.00 0.00 ? 326 ASP A HB3    3  
ATOM   6035  H HD2    . ASP A 1 113 ? 18.754 10.275  -8.783  1.00 0.00 ? 326 ASP A HD2    3  
ATOM   6036  N N      . PHE A 1 114 ? 24.191 9.382   -8.435  1.00 0.00 ? 327 PHE A N      3  
ATOM   6037  C CA     . PHE A 1 114 ? 25.369 9.580   -7.609  1.00 0.00 ? 327 PHE A CA     3  
ATOM   6038  C C      . PHE A 1 114 ? 26.146 10.822  -8.051  1.00 0.00 ? 327 PHE A C      3  
ATOM   6039  O O      . PHE A 1 114 ? 26.695 11.544  -7.220  1.00 0.00 ? 327 PHE A O      3  
ATOM   6040  C CB     . PHE A 1 114 ? 26.256 8.347   -7.791  1.00 0.00 ? 327 PHE A CB     3  
ATOM   6041  C CG     . PHE A 1 114 ? 27.576 8.410   -7.019  1.00 0.00 ? 327 PHE A CG     3  
ATOM   6042  C CD1    . PHE A 1 114 ? 28.601 9.169   -7.488  1.00 0.00 ? 327 PHE A CD1    3  
ATOM   6043  C CD2    . PHE A 1 114 ? 27.723 7.708   -5.864  1.00 0.00 ? 327 PHE A CD2    3  
ATOM   6044  C CE1    . PHE A 1 114 ? 29.827 9.228   -6.772  1.00 0.00 ? 327 PHE A CE1    3  
ATOM   6045  C CE2    . PHE A 1 114 ? 28.947 7.766   -5.147  1.00 0.00 ? 327 PHE A CE2    3  
ATOM   6046  C CZ     . PHE A 1 114 ? 29.973 8.525   -5.617  1.00 0.00 ? 327 PHE A CZ     3  
ATOM   6047  H H      . PHE A 1 114 ? 24.251 8.619   -9.080  1.00 0.00 ? 327 PHE A H      3  
ATOM   6048  H HA     . PHE A 1 114 ? 25.025 9.715   -6.583  1.00 0.00 ? 327 PHE A HA     3  
ATOM   6049  H HB2    . PHE A 1 114 ? 25.702 7.464   -7.471  1.00 0.00 ? 327 PHE A HB2    3  
ATOM   6050  H HB3    . PHE A 1 114 ? 26.473 8.220   -8.851  1.00 0.00 ? 327 PHE A HB3    3  
ATOM   6051  H HD1    . PHE A 1 114 ? 28.484 9.732   -8.414  1.00 0.00 ? 327 PHE A HD1    3  
ATOM   6052  H HD2    . PHE A 1 114 ? 26.899 7.100   -5.487  1.00 0.00 ? 327 PHE A HD2    3  
ATOM   6053  H HE1    . PHE A 1 114 ? 30.650 9.836   -7.148  1.00 0.00 ? 327 PHE A HE1    3  
ATOM   6054  H HE2    . PHE A 1 114 ? 29.065 7.204   -4.221  1.00 0.00 ? 327 PHE A HE2    3  
ATOM   6055  H HZ     . PHE A 1 114 ? 30.913 8.571   -5.067  1.00 0.00 ? 327 PHE A HZ     3  
ATOM   6056  N N      . GLN A 1 115 ? 26.168 11.033  -9.359  1.00 0.00 ? 328 GLN A N      3  
ATOM   6057  C CA     . GLN A 1 115 ? 26.869 12.174  -9.922  1.00 0.00 ? 328 GLN A CA     3  
ATOM   6058  C C      . GLN A 1 115 ? 26.086 13.462  -9.656  1.00 0.00 ? 328 GLN A C      3  
ATOM   6059  O O      . GLN A 1 115 ? 26.674 14.534  -9.523  1.00 0.00 ? 328 GLN A O      3  
ATOM   6060  C CB     . GLN A 1 115 ? 27.116 11.982  -11.419 1.00 0.00 ? 328 GLN A CB     3  
ATOM   6061  C CG     . GLN A 1 115 ? 28.611 11.850  -11.716 1.00 0.00 ? 328 GLN A CG     3  
ATOM   6062  C CD     . GLN A 1 115 ? 28.911 12.176  -13.180 1.00 0.00 ? 328 GLN A CD     3  
ATOM   6063  O OE1    . GLN A 1 115 ? 28.049 12.126  -14.044 1.00 0.00 ? 328 GLN A OE1    3  
ATOM   6064  N NE2    . GLN A 1 115 ? 30.177 12.512  -13.412 1.00 0.00 ? 328 GLN A NE2    3  
ATOM   6065  H H      . GLN A 1 115 ? 25.719 10.440  -10.028 1.00 0.00 ? 328 GLN A H      3  
ATOM   6066  H HA     . GLN A 1 115 ? 27.827 12.210  -9.403  1.00 0.00 ? 328 GLN A HA     3  
ATOM   6067  H HB2    . GLN A 1 115 ? 26.592 11.092  -11.767 1.00 0.00 ? 328 GLN A HB2    3  
ATOM   6068  H HB3    . GLN A 1 115 ? 26.706 12.828  -11.970 1.00 0.00 ? 328 GLN A HB3    3  
ATOM   6069  H HG2    . GLN A 1 115 ? 29.175 12.521  -11.067 1.00 0.00 ? 328 GLN A HG2    3  
ATOM   6070  H HG3    . GLN A 1 115 ? 28.942 10.836  -11.491 1.00 0.00 ? 328 GLN A HG3    3  
ATOM   6071  H HE21   . GLN A 1 115 ? 30.834 12.534  -12.659 1.00 0.00 ? 328 GLN A HE21   3  
ATOM   6072  H HE22   . GLN A 1 115 ? 30.471 12.743  -14.339 1.00 0.00 ? 328 GLN A HE22   3  
ATOM   6073  N N      . MET A 1 116 ? 24.771 13.313  -9.584  1.00 0.00 ? 329 MET A N      3  
ATOM   6074  C CA     . MET A 1 116 ? 23.902 14.450  -9.337  1.00 0.00 ? 329 MET A CA     3  
ATOM   6075  C C      . MET A 1 116 ? 23.934 14.853  -7.861  1.00 0.00 ? 329 MET A C      3  
ATOM   6076  O O      . MET A 1 116 ? 23.857 16.037  -7.535  1.00 0.00 ? 329 MET A O      3  
ATOM   6077  C CB     . MET A 1 116 ? 22.470 14.095  -9.739  1.00 0.00 ? 329 MET A CB     3  
ATOM   6078  C CG     . MET A 1 116 ? 21.520 15.266  -9.476  1.00 0.00 ? 329 MET A CG     3  
ATOM   6079  S SD     . MET A 1 116 ? 19.853 14.664  -9.263  1.00 0.00 ? 329 MET A SD     3  
ATOM   6080  C CE     . MET A 1 116 ? 19.973 14.000  -7.610  1.00 0.00 ? 329 MET A CE     3  
ATOM   6081  H H      . MET A 1 116 ? 24.301 12.437  -9.693  1.00 0.00 ? 329 MET A H      3  
ATOM   6082  H HA     . MET A 1 116 ? 24.298 15.260  -9.951  1.00 0.00 ? 329 MET A HA     3  
ATOM   6083  H HB2    . MET A 1 116 ? 22.439 13.828  -10.794 1.00 0.00 ? 329 MET A HB2    3  
ATOM   6084  H HB3    . MET A 1 116 ? 22.137 13.220  -9.179  1.00 0.00 ? 329 MET A HB3    3  
ATOM   6085  H HG2    . MET A 1 116 ? 21.836 15.809  -8.585  1.00 0.00 ? 329 MET A HG2    3  
ATOM   6086  H HG3    . MET A 1 116 ? 21.558 15.970  -10.307 1.00 0.00 ? 329 MET A HG3    3  
ATOM   6087  H HE1    . MET A 1 116 ? 19.065 13.444  -7.375  1.00 0.00 ? 329 MET A HE1    3  
ATOM   6088  H HE2    . MET A 1 116 ? 20.833 13.334  -7.548  1.00 0.00 ? 329 MET A HE2    3  
ATOM   6089  H HE3    . MET A 1 116 ? 20.093 14.816  -6.898  1.00 0.00 ? 329 MET A HE3    3  
ATOM   6090  N N      . LEU A 1 117 ? 24.046 13.846  -7.007  1.00 0.00 ? 330 LEU A N      3  
ATOM   6091  C CA     . LEU A 1 117 ? 24.088 14.081  -5.574  1.00 0.00 ? 330 LEU A CA     3  
ATOM   6092  C C      . LEU A 1 117 ? 25.468 14.618  -5.190  1.00 0.00 ? 330 LEU A C      3  
ATOM   6093  O O      . LEU A 1 117 ? 25.587 15.444  -4.287  1.00 0.00 ? 330 LEU A O      3  
ATOM   6094  C CB     . LEU A 1 117 ? 23.687 12.815  -4.812  1.00 0.00 ? 330 LEU A CB     3  
ATOM   6095  C CG     . LEU A 1 117 ? 24.830 11.871  -4.432  1.00 0.00 ? 330 LEU A CG     3  
ATOM   6096  C CD1    . LEU A 1 117 ? 25.509 12.326  -3.139  1.00 0.00 ? 330 LEU A CD1    3  
ATOM   6097  C CD2    . LEU A 1 117 ? 24.338 10.425  -4.343  1.00 0.00 ? 330 LEU A CD2    3  
ATOM   6098  H H      . LEU A 1 117 ? 24.107 12.886  -7.281  1.00 0.00 ? 330 LEU A H      3  
ATOM   6099  H HA     . LEU A 1 117 ? 23.344 14.843  -5.346  1.00 0.00 ? 330 LEU A HA     3  
ATOM   6100  H HB2    . LEU A 1 117 ? 23.169 13.112  -3.901  1.00 0.00 ? 330 LEU A HB2    3  
ATOM   6101  H HB3    . LEU A 1 117 ? 22.972 12.261  -5.420  1.00 0.00 ? 330 LEU A HB3    3  
ATOM   6102  H HG     . LEU A 1 117 ? 25.581 11.908  -5.221  1.00 0.00 ? 330 LEU A HG     3  
ATOM   6103  H HD11   . LEU A 1 117 ? 24.750 12.607  -2.409  1.00 0.00 ? 330 LEU A HD11   3  
ATOM   6104  H HD12   . LEU A 1 117 ? 26.113 11.511  -2.740  1.00 0.00 ? 330 LEU A HD12   3  
ATOM   6105  H HD13   . LEU A 1 117 ? 26.148 13.184  -3.347  1.00 0.00 ? 330 LEU A HD13   3  
ATOM   6106  H HD21   . LEU A 1 117 ? 23.521 10.274  -5.048  1.00 0.00 ? 330 LEU A HD21   3  
ATOM   6107  H HD22   . LEU A 1 117 ? 25.158 9.748   -4.586  1.00 0.00 ? 330 LEU A HD22   3  
ATOM   6108  H HD23   . LEU A 1 117 ? 23.987 10.222  -3.332  1.00 0.00 ? 330 LEU A HD23   3  
ATOM   6109  N N      . CYS A 1 118 ? 26.476 14.126  -5.896  1.00 0.00 ? 331 CYS A N      3  
ATOM   6110  C CA     . CYS A 1 118 ? 27.844 14.547  -5.640  1.00 0.00 ? 331 CYS A CA     3  
ATOM   6111  C C      . CYS A 1 118 ? 28.000 15.991  -6.123  1.00 0.00 ? 331 CYS A C      3  
ATOM   6112  O O      . CYS A 1 118 ? 28.793 16.751  -5.570  1.00 0.00 ? 331 CYS A O      3  
ATOM   6113  C CB     . CYS A 1 118 ? 28.857 13.611  -6.302  1.00 0.00 ? 331 CYS A CB     3  
ATOM   6114  S SG     . CYS A 1 118 ? 28.913 12.017  -5.406  1.00 0.00 ? 331 CYS A SG     3  
ATOM   6115  H H      . CYS A 1 118 ? 26.371 13.455  -6.628  1.00 0.00 ? 331 CYS A H      3  
ATOM   6116  H HA     . CYS A 1 118 ? 27.996 14.481  -4.563  1.00 0.00 ? 331 CYS A HA     3  
ATOM   6117  H HB2    . CYS A 1 118 ? 28.583 13.443  -7.343  1.00 0.00 ? 331 CYS A HB2    3  
ATOM   6118  H HB3    . CYS A 1 118 ? 29.844 14.073  -6.303  1.00 0.00 ? 331 CYS A HB3    3  
ATOM   6119  H HG     . CYS A 1 118 ? 30.236 11.884  -5.442  1.00 0.00 ? 331 CYS A HG     3  
ATOM   6120  N N      . SER A 1 119 ? 27.232 16.324  -7.149  1.00 0.00 ? 332 SER A N      3  
ATOM   6121  C CA     . SER A 1 119 ? 27.275 17.663  -7.712  1.00 0.00 ? 332 SER A CA     3  
ATOM   6122  C C      . SER A 1 119 ? 26.595 18.652  -6.764  1.00 0.00 ? 332 SER A C      3  
ATOM   6123  O O      . SER A 1 119 ? 26.944 19.832  -6.736  1.00 0.00 ? 332 SER A O      3  
ATOM   6124  C CB     . SER A 1 119 ? 26.607 17.704  -9.088  1.00 0.00 ? 332 SER A CB     3  
ATOM   6125  O OG     . SER A 1 119 ? 25.202 17.920  -8.994  1.00 0.00 ? 332 SER A OG     3  
ATOM   6126  H H      . SER A 1 119 ? 26.589 15.700  -7.593  1.00 0.00 ? 332 SER A H      3  
ATOM   6127  H HA     . SER A 1 119 ? 28.334 17.898  -7.816  1.00 0.00 ? 332 SER A HA     3  
ATOM   6128  H HB2    . SER A 1 119 ? 27.057 18.496  -9.687  1.00 0.00 ? 332 SER A HB2    3  
ATOM   6129  H HB3    . SER A 1 119 ? 26.795 16.766  -9.611  1.00 0.00 ? 332 SER A HB3    3  
ATOM   6130  H HG     . SER A 1 119 ? 24.721 17.336  -9.647  1.00 0.00 ? 332 SER A HG     3  
ATOM   6131  N N      . SER A 1 120 ? 25.636 18.136  -6.009  1.00 0.00 ? 333 SER A N      3  
ATOM   6132  C CA     . SER A 1 120 ? 24.905 18.959  -5.061  1.00 0.00 ? 333 SER A CA     3  
ATOM   6133  C C      . SER A 1 120 ? 25.807 19.328  -3.881  1.00 0.00 ? 333 SER A C      3  
ATOM   6134  O O      . SER A 1 120 ? 25.717 20.432  -3.348  1.00 0.00 ? 333 SER A O      3  
ATOM   6135  C CB     . SER A 1 120 ? 23.648 18.241  -4.564  1.00 0.00 ? 333 SER A CB     3  
ATOM   6136  O OG     . SER A 1 120 ? 22.496 18.590  -5.327  1.00 0.00 ? 333 SER A OG     3  
ATOM   6137  H H      . SER A 1 120 ? 25.358 17.175  -6.037  1.00 0.00 ? 333 SER A H      3  
ATOM   6138  H HA     . SER A 1 120 ? 24.617 19.852  -5.617  1.00 0.00 ? 333 SER A HA     3  
ATOM   6139  H HB2    . SER A 1 120 ? 23.803 17.164  -4.613  1.00 0.00 ? 333 SER A HB2    3  
ATOM   6140  H HB3    . SER A 1 120 ? 23.478 18.492  -3.517  1.00 0.00 ? 333 SER A HB3    3  
ATOM   6141  H HG     . SER A 1 120 ? 21.825 17.851  -5.291  1.00 0.00 ? 333 SER A HG     3  
ATOM   6142  N N      . SER A 1 121 ? 26.657 18.382  -3.511  1.00 0.00 ? 334 SER A N      3  
ATOM   6143  C CA     . SER A 1 121 ? 27.576 18.593  -2.404  1.00 0.00 ? 334 SER A CA     3  
ATOM   6144  C C      . SER A 1 121 ? 28.946 18.001  -2.741  1.00 0.00 ? 334 SER A C      3  
ATOM   6145  O O      . SER A 1 121 ? 29.073 16.794  -2.940  1.00 0.00 ? 334 SER A O      3  
ATOM   6146  C CB     . SER A 1 121 ? 27.034 17.976  -1.114  1.00 0.00 ? 334 SER A CB     3  
ATOM   6147  O OG     . SER A 1 121 ? 26.816 18.956  -0.103  1.00 0.00 ? 334 SER A OG     3  
ATOM   6148  H H      . SER A 1 121 ? 26.724 17.486  -3.950  1.00 0.00 ? 334 SER A H      3  
ATOM   6149  H HA     . SER A 1 121 ? 27.643 19.674  -2.288  1.00 0.00 ? 334 SER A HA     3  
ATOM   6150  H HB2    . SER A 1 121 ? 26.098 17.458  -1.324  1.00 0.00 ? 334 SER A HB2    3  
ATOM   6151  H HB3    . SER A 1 121 ? 27.737 17.228  -0.746  1.00 0.00 ? 334 SER A HB3    3  
ATOM   6152  H HG     . SER A 1 121 ? 27.451 18.814  0.655   1.00 0.00 ? 334 SER A HG     3  
ATOM   6153  N N      . PRO A 1 122 ? 29.962 18.903  -2.797  1.00 0.00 ? 335 PRO A N      3  
ATOM   6154  C CA     . PRO A 1 122 ? 31.319 18.482  -3.107  1.00 0.00 ? 335 PRO A CA     3  
ATOM   6155  C C      . PRO A 1 122 ? 31.962 17.778  -1.910  1.00 0.00 ? 335 PRO A C      3  
ATOM   6156  O O      . PRO A 1 122 ? 33.051 17.221  -2.025  1.00 0.00 ? 335 PRO A O      3  
ATOM   6157  C CB     . PRO A 1 122 ? 32.044 19.757  -3.506  1.00 0.00 ? 335 PRO A CB     3  
ATOM   6158  C CG     . PRO A 1 122 ? 31.206 20.902  -2.962  1.00 0.00 ? 335 PRO A CG     3  
ATOM   6159  C CD     . PRO A 1 122 ? 29.850 20.340  -2.567  1.00 0.00 ? 335 PRO A CD     3  
ATOM   6160  H HA     . PRO A 1 122 ? 31.313 17.811  -3.848  1.00 0.00 ? 335 PRO A HA     3  
ATOM   6161  H HB2    . PRO A 1 122 ? 33.052 19.779  -3.092  1.00 0.00 ? 335 PRO A HB2    3  
ATOM   6162  H HB3    . PRO A 1 122 ? 32.144 19.827  -4.589  1.00 0.00 ? 335 PRO A HB3    3  
ATOM   6163  H HG2    . PRO A 1 122 ? 31.694 21.358  -2.100  1.00 0.00 ? 335 PRO A HG2    3  
ATOM   6164  H HG3    . PRO A 1 122 ? 31.091 21.682  -3.714  1.00 0.00 ? 335 PRO A HG3    3  
ATOM   6165  H HD2    . PRO A 1 122 ? 29.618 20.558  -1.525  1.00 0.00 ? 335 PRO A HD2    3  
ATOM   6166  H HD3    . PRO A 1 122 ? 29.051 20.775  -3.168  1.00 0.00 ? 335 PRO A HD3    3  
ATOM   6167  N N      . GLU A 1 123 ? 31.259 17.828  -0.788  1.00 0.00 ? 336 GLU A N      3  
ATOM   6168  C CA     . GLU A 1 123 ? 31.747 17.203  0.429   1.00 0.00 ? 336 GLU A CA     3  
ATOM   6169  C C      . GLU A 1 123 ? 31.503 15.693  0.385   1.00 0.00 ? 336 GLU A C      3  
ATOM   6170  O O      . GLU A 1 123 ? 32.323 14.913  0.868   1.00 0.00 ? 336 GLU A O      3  
ATOM   6171  C CB     . GLU A 1 123 ? 31.097 17.827  1.666   1.00 0.00 ? 336 GLU A CB     3  
ATOM   6172  C CG     . GLU A 1 123 ? 32.024 17.733  2.879   1.00 0.00 ? 336 GLU A CG     3  
ATOM   6173  C CD     . GLU A 1 123 ? 32.492 19.122  3.321   1.00 0.00 ? 336 GLU A CD     3  
ATOM   6174  O OE1    . GLU A 1 123 ? 32.974 19.907  2.491   1.00 0.00 ? 336 GLU A OE1    3  
ATOM   6175  O OE2    . GLU A 1 123 ? 32.336 19.376  4.576   1.00 0.00 ? 336 GLU A OE2    3  
ATOM   6176  H H      . GLU A 1 123 ? 30.372 18.284  -0.702  1.00 0.00 ? 336 GLU A H      3  
ATOM   6177  H HA     . GLU A 1 123 ? 32.818 17.403  0.449   1.00 0.00 ? 336 GLU A HA     3  
ATOM   6178  H HB2    . GLU A 1 123 ? 30.857 18.871  1.467   1.00 0.00 ? 336 GLU A HB2    3  
ATOM   6179  H HB3    . GLU A 1 123 ? 30.157 17.319  1.882   1.00 0.00 ? 336 GLU A HB3    3  
ATOM   6180  H HG2    . GLU A 1 123 ? 31.505 17.242  3.702   1.00 0.00 ? 336 GLU A HG2    3  
ATOM   6181  H HG3    . GLU A 1 123 ? 32.889 17.116  2.633   1.00 0.00 ? 336 GLU A HG3    3  
ATOM   6182  H HE2    . GLU A 1 123 ? 31.410 19.712  4.745   1.00 0.00 ? 336 GLU A HE2    3  
ATOM   6183  N N      . ILE A 1 124 ? 30.372 15.325  -0.200  1.00 0.00 ? 337 ILE A N      3  
ATOM   6184  C CA     . ILE A 1 124 ? 30.009 13.922  -0.313  1.00 0.00 ? 337 ILE A CA     3  
ATOM   6185  C C      . ILE A 1 124 ? 30.972 13.228  -1.280  1.00 0.00 ? 337 ILE A C      3  
ATOM   6186  O O      . ILE A 1 124 ? 31.328 12.069  -1.080  1.00 0.00 ? 337 ILE A O      3  
ATOM   6187  C CB     . ILE A 1 124 ? 28.537 13.780  -0.704  1.00 0.00 ? 337 ILE A CB     3  
ATOM   6188  C CG1    . ILE A 1 124 ? 27.624 14.358  0.379   1.00 0.00 ? 337 ILE A CG1    3  
ATOM   6189  C CG2    . ILE A 1 124 ? 28.194 12.323  -1.024  1.00 0.00 ? 337 ILE A CG2    3  
ATOM   6190  C CD1    . ILE A 1 124 ? 26.237 14.672  -0.183  1.00 0.00 ? 337 ILE A CD1    3  
ATOM   6191  H H      . ILE A 1 124 ? 29.711 15.965  -0.591  1.00 0.00 ? 337 ILE A H      3  
ATOM   6192  H HA     . ILE A 1 124 ? 30.127 13.474  0.673   1.00 0.00 ? 337 ILE A HA     3  
ATOM   6193  H HB     . ILE A 1 124 ? 28.367 14.358  -1.612  1.00 0.00 ? 337 ILE A HB     3  
ATOM   6194  H HG12   . ILE A 1 124 ? 27.536 13.650  1.202   1.00 0.00 ? 337 ILE A HG12   3  
ATOM   6195  H HG13   . ILE A 1 124 ? 28.069 15.267  0.787   1.00 0.00 ? 337 ILE A HG13   3  
ATOM   6196  H HG21   . ILE A 1 124 ? 28.647 11.670  -0.278  1.00 0.00 ? 337 ILE A HG21   3  
ATOM   6197  H HG22   . ILE A 1 124 ? 27.112 12.194  -1.010  1.00 0.00 ? 337 ILE A HG22   3  
ATOM   6198  H HG23   . ILE A 1 124 ? 28.578 12.068  -2.012  1.00 0.00 ? 337 ILE A HG23   3  
ATOM   6199  H HD11   . ILE A 1 124 ? 26.329 15.378  -1.009  1.00 0.00 ? 337 ILE A HD11   3  
ATOM   6200  H HD12   . ILE A 1 124 ? 25.775 13.752  -0.543  1.00 0.00 ? 337 ILE A HD12   3  
ATOM   6201  H HD13   . ILE A 1 124 ? 25.617 15.107  0.600   1.00 0.00 ? 337 ILE A HD13   3  
ATOM   6202  N N      . ALA A 1 125 ? 31.365 13.968  -2.306  1.00 0.00 ? 338 ALA A N      3  
ATOM   6203  C CA     . ALA A 1 125 ? 32.279 13.438  -3.303  1.00 0.00 ? 338 ALA A CA     3  
ATOM   6204  C C      . ALA A 1 125 ? 33.664 13.264  -2.678  1.00 0.00 ? 338 ALA A C      3  
ATOM   6205  O O      . ALA A 1 125 ? 34.404 12.351  -3.042  1.00 0.00 ? 338 ALA A O      3  
ATOM   6206  C CB     . ALA A 1 125 ? 32.301 14.366  -4.520  1.00 0.00 ? 338 ALA A CB     3  
ATOM   6207  H H      . ALA A 1 125 ? 31.070 14.911  -2.461  1.00 0.00 ? 338 ALA A H      3  
ATOM   6208  H HA     . ALA A 1 125 ? 31.904 12.463  -3.613  1.00 0.00 ? 338 ALA A HA     3  
ATOM   6209  H HB1    . ALA A 1 125 ? 32.913 13.921  -5.306  1.00 0.00 ? 338 ALA A HB1    3  
ATOM   6210  H HB2    . ALA A 1 125 ? 31.285 14.507  -4.888  1.00 0.00 ? 338 ALA A HB2    3  
ATOM   6211  H HB3    . ALA A 1 125 ? 32.721 15.331  -4.234  1.00 0.00 ? 338 ALA A HB3    3  
ATOM   6212  N N      . GLU A 1 126 ? 33.975 14.155  -1.748  1.00 0.00 ? 339 GLU A N      3  
ATOM   6213  C CA     . GLU A 1 126 ? 35.258 14.111  -1.068  1.00 0.00 ? 339 GLU A CA     3  
ATOM   6214  C C      . GLU A 1 126 ? 35.276 12.981  -0.037  1.00 0.00 ? 339 GLU A C      3  
ATOM   6215  O O      . GLU A 1 126 ? 36.318 12.379  0.213   1.00 0.00 ? 339 GLU A O      3  
ATOM   6216  C CB     . GLU A 1 126 ? 35.579 15.456  -0.413  1.00 0.00 ? 339 GLU A CB     3  
ATOM   6217  C CG     . GLU A 1 126 ? 36.270 16.397  -1.402  1.00 0.00 ? 339 GLU A CG     3  
ATOM   6218  C CD     . GLU A 1 126 ? 36.834 17.627  -0.686  1.00 0.00 ? 339 GLU A CD     3  
ATOM   6219  O OE1    . GLU A 1 126 ? 38.061 17.782  -0.596  1.00 0.00 ? 339 GLU A OE1    3  
ATOM   6220  O OE2    . GLU A 1 126 ? 35.948 18.437  -0.214  1.00 0.00 ? 339 GLU A OE2    3  
ATOM   6221  H H      . GLU A 1 126 ? 33.368 14.894  -1.458  1.00 0.00 ? 339 GLU A H      3  
ATOM   6222  H HA     . GLU A 1 126 ? 35.992 13.910  -1.849  1.00 0.00 ? 339 GLU A HA     3  
ATOM   6223  H HB2    . GLU A 1 126 ? 34.659 15.915  -0.050  1.00 0.00 ? 339 GLU A HB2    3  
ATOM   6224  H HB3    . GLU A 1 126 ? 36.220 15.299  0.454   1.00 0.00 ? 339 GLU A HB3    3  
ATOM   6225  H HG2    . GLU A 1 126 ? 37.074 15.868  -1.912  1.00 0.00 ? 339 GLU A HG2    3  
ATOM   6226  H HG3    . GLU A 1 126 ? 35.560 16.712  -2.167  1.00 0.00 ? 339 GLU A HG3    3  
ATOM   6227  H HE2    . GLU A 1 126 ? 35.150 17.924  0.105   1.00 0.00 ? 339 GLU A HE2    3  
ATOM   6228  N N      . ILE A 1 127 ? 34.107 12.727  0.535   1.00 0.00 ? 340 ILE A N      3  
ATOM   6229  C CA     . ILE A 1 127 ? 33.975 11.680  1.533   1.00 0.00 ? 340 ILE A CA     3  
ATOM   6230  C C      . ILE A 1 127 ? 34.104 10.315  0.854   1.00 0.00 ? 340 ILE A C      3  
ATOM   6231  O O      . ILE A 1 127 ? 34.603 9.365   1.454   1.00 0.00 ? 340 ILE A O      3  
ATOM   6232  C CB     . ILE A 1 127 ? 32.675 11.854  2.322   1.00 0.00 ? 340 ILE A CB     3  
ATOM   6233  C CG1    . ILE A 1 127 ? 32.952 11.934  3.824   1.00 0.00 ? 340 ILE A CG1    3  
ATOM   6234  C CG2    . ILE A 1 127 ? 31.675 10.747  1.982   1.00 0.00 ? 340 ILE A CG2    3  
ATOM   6235  C CD1    . ILE A 1 127 ? 31.928 12.830  4.523   1.00 0.00 ? 340 ILE A CD1    3  
ATOM   6236  H H      . ILE A 1 127 ? 33.263 13.221  0.326   1.00 0.00 ? 340 ILE A H      3  
ATOM   6237  H HA     . ILE A 1 127 ? 34.797 11.794  2.238   1.00 0.00 ? 340 ILE A HA     3  
ATOM   6238  H HB     . ILE A 1 127 ? 32.220 12.799  2.027   1.00 0.00 ? 340 ILE A HB     3  
ATOM   6239  H HG12   . ILE A 1 127 ? 32.921 10.934  4.257   1.00 0.00 ? 340 ILE A HG12   3  
ATOM   6240  H HG13   . ILE A 1 127 ? 33.956 12.323  3.992   1.00 0.00 ? 340 ILE A HG13   3  
ATOM   6241  H HG21   . ILE A 1 127 ? 32.117 9.776   2.206   1.00 0.00 ? 340 ILE A HG21   3  
ATOM   6242  H HG22   . ILE A 1 127 ? 30.770 10.879  2.575   1.00 0.00 ? 340 ILE A HG22   3  
ATOM   6243  H HG23   . ILE A 1 127 ? 31.425 10.796  0.921   1.00 0.00 ? 340 ILE A HG23   3  
ATOM   6244  H HD11   . ILE A 1 127 ? 32.400 13.330  5.369   1.00 0.00 ? 340 ILE A HD11   3  
ATOM   6245  H HD12   . ILE A 1 127 ? 31.559 13.577  3.820   1.00 0.00 ? 340 ILE A HD12   3  
ATOM   6246  H HD13   . ILE A 1 127 ? 31.096 12.223  4.879   1.00 0.00 ? 340 ILE A HD13   3  
ATOM   6247  N N      . PHE A 1 128 ? 33.646 10.261  -0.387  1.00 0.00 ? 341 PHE A N      3  
ATOM   6248  C CA     . PHE A 1 128 ? 33.704 9.028   -1.154  1.00 0.00 ? 341 PHE A CA     3  
ATOM   6249  C C      . PHE A 1 128 ? 35.141 8.711   -1.574  1.00 0.00 ? 341 PHE A C      3  
ATOM   6250  O O      . PHE A 1 128 ? 35.584 7.568   -1.467  1.00 0.00 ? 341 PHE A O      3  
ATOM   6251  C CB     . PHE A 1 128 ? 32.854 9.240   -2.408  1.00 0.00 ? 341 PHE A CB     3  
ATOM   6252  C CG     . PHE A 1 128 ? 31.408 8.761   -2.268  1.00 0.00 ? 341 PHE A CG     3  
ATOM   6253  C CD1    . PHE A 1 128 ? 31.138 7.588   -1.633  1.00 0.00 ? 341 PHE A CD1    3  
ATOM   6254  C CD2    . PHE A 1 128 ? 30.392 9.508   -2.779  1.00 0.00 ? 341 PHE A CD2    3  
ATOM   6255  C CE1    . PHE A 1 128 ? 29.796 7.144   -1.504  1.00 0.00 ? 341 PHE A CE1    3  
ATOM   6256  C CE2    . PHE A 1 128 ? 29.050 9.063   -2.648  1.00 0.00 ? 341 PHE A CE2    3  
ATOM   6257  C CZ     . PHE A 1 128 ? 28.780 7.891   -2.014  1.00 0.00 ? 341 PHE A CZ     3  
ATOM   6258  H H      . PHE A 1 128 ? 33.241 11.039  -0.869  1.00 0.00 ? 341 PHE A H      3  
ATOM   6259  H HA     . PHE A 1 128 ? 33.330 8.230   -0.512  1.00 0.00 ? 341 PHE A HA     3  
ATOM   6260  H HB2    . PHE A 1 128 ? 32.852 10.301  -2.658  1.00 0.00 ? 341 PHE A HB2    3  
ATOM   6261  H HB3    . PHE A 1 128 ? 33.320 8.717   -3.244  1.00 0.00 ? 341 PHE A HB3    3  
ATOM   6262  H HD1    . PHE A 1 128 ? 31.953 6.991   -1.225  1.00 0.00 ? 341 PHE A HD1    3  
ATOM   6263  H HD2    . PHE A 1 128 ? 30.608 10.447  -3.288  1.00 0.00 ? 341 PHE A HD2    3  
ATOM   6264  H HE1    . PHE A 1 128 ? 29.579 6.205   -0.995  1.00 0.00 ? 341 PHE A HE1    3  
ATOM   6265  H HE2    . PHE A 1 128 ? 28.235 9.661   -3.057  1.00 0.00 ? 341 PHE A HE2    3  
ATOM   6266  H HZ     . PHE A 1 128 ? 27.749 7.549   -1.914  1.00 0.00 ? 341 PHE A HZ     3  
ATOM   6267  N N      . ARG A 1 129 ? 35.828 9.742   -2.042  1.00 0.00 ? 342 ARG A N      3  
ATOM   6268  C CA     . ARG A 1 129 ? 37.205 9.588   -2.478  1.00 0.00 ? 342 ARG A CA     3  
ATOM   6269  C C      . ARG A 1 129 ? 38.101 9.223   -1.292  1.00 0.00 ? 342 ARG A C      3  
ATOM   6270  O O      . ARG A 1 129 ? 39.118 8.553   -1.459  1.00 0.00 ? 342 ARG A O      3  
ATOM   6271  C CB     . ARG A 1 129 ? 37.726 10.873  -3.124  1.00 0.00 ? 342 ARG A CB     3  
ATOM   6272  C CG     . ARG A 1 129 ? 38.344 11.802  -2.077  1.00 0.00 ? 342 ARG A CG     3  
ATOM   6273  C CD     . ARG A 1 129 ? 39.848 11.551  -1.941  1.00 0.00 ? 342 ARG A CD     3  
ATOM   6274  N NE     . ARG A 1 129 ? 40.482 12.668  -1.208  1.00 0.00 ? 342 ARG A NE     3  
ATOM   6275  C CZ     . ARG A 1 129 ? 41.792 12.948  -1.253  1.00 0.00 ? 342 ARG A CZ     3  
ATOM   6276  N NH1    . ARG A 1 129 ? 42.613 12.196  -1.998  1.00 0.00 ? 342 ARG A NH1    3  
ATOM   6277  N NH2    . ARG A 1 129 ? 42.281 13.982  -0.554  1.00 0.00 ? 342 ARG A NH2    3  
ATOM   6278  H H      . ARG A 1 129 ? 35.460 10.668  -2.125  1.00 0.00 ? 342 ARG A H      3  
ATOM   6279  H HA     . ARG A 1 129 ? 37.178 8.780   -3.210  1.00 0.00 ? 342 ARG A HA     3  
ATOM   6280  H HB2    . ARG A 1 129 ? 38.470 10.627  -3.883  1.00 0.00 ? 342 ARG A HB2    3  
ATOM   6281  H HB3    . ARG A 1 129 ? 36.909 11.385  -3.633  1.00 0.00 ? 342 ARG A HB3    3  
ATOM   6282  H HG2    . ARG A 1 129 ? 38.169 12.841  -2.360  1.00 0.00 ? 342 ARG A HG2    3  
ATOM   6283  H HG3    . ARG A 1 129 ? 37.857 11.647  -1.115  1.00 0.00 ? 342 ARG A HG3    3  
ATOM   6284  H HD2    . ARG A 1 129 ? 40.021 10.613  -1.414  1.00 0.00 ? 342 ARG A HD2    3  
ATOM   6285  H HD3    . ARG A 1 129 ? 40.299 11.450  -2.929  1.00 0.00 ? 342 ARG A HD3    3  
ATOM   6286  H HE     . ARG A 1 129 ? 39.898 13.250  -0.642  1.00 0.00 ? 342 ARG A HE     3  
ATOM   6287  H HH11   . ARG A 1 129 ? 42.248 11.424  -2.520  1.00 0.00 ? 342 ARG A HH11   3  
ATOM   6288  H HH12   . ARG A 1 129 ? 43.590 12.405  -2.032  1.00 0.00 ? 342 ARG A HH12   3  
ATOM   6289  H HH21   . ARG A 1 129 ? 41.669 14.545  0.001   1.00 0.00 ? 342 ARG A HH21   3  
ATOM   6290  H HH22   . ARG A 1 129 ? 43.258 14.191  -0.589  1.00 0.00 ? 342 ARG A HH22   3  
ATOM   6291  N N      . LYS A 1 130 ? 37.689 9.682   -0.118  1.00 0.00 ? 343 LYS A N      3  
ATOM   6292  C CA     . LYS A 1 130 ? 38.440 9.413   1.096   1.00 0.00 ? 343 LYS A CA     3  
ATOM   6293  C C      . LYS A 1 130 ? 38.357 7.920   1.422   1.00 0.00 ? 343 LYS A C      3  
ATOM   6294  O O      . LYS A 1 130 ? 39.352 7.308   1.805   1.00 0.00 ? 343 LYS A O      3  
ATOM   6295  C CB     . LYS A 1 130 ? 37.963 10.318  2.234   1.00 0.00 ? 343 LYS A CB     3  
ATOM   6296  C CG     . LYS A 1 130 ? 38.735 11.639  2.244   1.00 0.00 ? 343 LYS A CG     3  
ATOM   6297  C CD     . LYS A 1 130 ? 40.133 11.451  2.838   1.00 0.00 ? 343 LYS A CD     3  
ATOM   6298  C CE     . LYS A 1 130 ? 40.105 11.597  4.361   1.00 0.00 ? 343 LYS A CE     3  
ATOM   6299  N NZ     . LYS A 1 130 ? 41.479 11.731  4.894   1.00 0.00 ? 343 LYS A NZ     3  
ATOM   6300  H H      . LYS A 1 130 ? 36.860 10.226  0.010   1.00 0.00 ? 343 LYS A H      3  
ATOM   6301  H HA     . LYS A 1 130 ? 39.482 9.665   0.898   1.00 0.00 ? 343 LYS A HA     3  
ATOM   6302  H HB2    . LYS A 1 130 ? 36.897 10.517  2.122   1.00 0.00 ? 343 LYS A HB2    3  
ATOM   6303  H HB3    . LYS A 1 130 ? 38.094 9.808   3.188   1.00 0.00 ? 343 LYS A HB3    3  
ATOM   6304  H HG2    . LYS A 1 130 ? 38.817 12.024  1.228   1.00 0.00 ? 343 LYS A HG2    3  
ATOM   6305  H HG3    . LYS A 1 130 ? 38.186 12.381  2.823   1.00 0.00 ? 343 LYS A HG3    3  
ATOM   6306  H HD2    . LYS A 1 130 ? 40.518 10.467  2.570   1.00 0.00 ? 343 LYS A HD2    3  
ATOM   6307  H HD3    . LYS A 1 130 ? 40.815 12.187  2.412   1.00 0.00 ? 343 LYS A HD3    3  
ATOM   6308  H HE2    . LYS A 1 130 ? 39.514 12.470  4.638   1.00 0.00 ? 343 LYS A HE2    3  
ATOM   6309  H HE3    . LYS A 1 130 ? 39.618 10.729  4.806   1.00 0.00 ? 343 LYS A HE3    3  
ATOM   6310  H HZ1    . LYS A 1 130 ? 41.441 11.883  5.882   1.00 0.00 ? 343 LYS A HZ1    3  
ATOM   6311  H HZ2    . LYS A 1 130 ? 41.993 10.893  4.705   1.00 0.00 ? 343 LYS A HZ2    3  
ATOM   6312  H HZ3    . LYS A 1 130 ? 41.933 12.506  4.455   1.00 0.00 ? 343 LYS A HZ3    3  
ATOM   6313  N N      . THR A 1 131 ? 37.160 7.377   1.258   1.00 0.00 ? 344 THR A N      3  
ATOM   6314  C CA     . THR A 1 131 ? 36.933 5.968   1.530   1.00 0.00 ? 344 THR A CA     3  
ATOM   6315  C C      . THR A 1 131 ? 37.463 5.110   0.378   1.00 0.00 ? 344 THR A C      3  
ATOM   6316  O O      . THR A 1 131 ? 37.932 3.993   0.596   1.00 0.00 ? 344 THR A O      3  
ATOM   6317  C CB     . THR A 1 131 ? 35.439 5.771   1.795   1.00 0.00 ? 344 THR A CB     3  
ATOM   6318  O OG1    . THR A 1 131 ? 35.189 6.546   2.964   1.00 0.00 ? 344 THR A OG1    3  
ATOM   6319  C CG2    . THR A 1 131 ? 35.103 4.340   2.217   1.00 0.00 ? 344 THR A CG2    3  
ATOM   6320  H H      . THR A 1 131 ? 36.354 7.882   0.946   1.00 0.00 ? 344 THR A H      3  
ATOM   6321  H HA     . THR A 1 131 ? 37.500 5.694   2.420   1.00 0.00 ? 344 THR A HA     3  
ATOM   6322  H HB     . THR A 1 131 ? 34.847 6.071   0.930   1.00 0.00 ? 344 THR A HB     3  
ATOM   6323  H HG1    . THR A 1 131 ? 34.543 7.280   2.756   1.00 0.00 ? 344 THR A HG1    3  
ATOM   6324  H HG21   . THR A 1 131 ? 34.714 3.790   1.361   1.00 0.00 ? 344 THR A HG21   3  
ATOM   6325  H HG22   . THR A 1 131 ? 36.003 3.849   2.586   1.00 0.00 ? 344 THR A HG22   3  
ATOM   6326  H HG23   . THR A 1 131 ? 34.352 4.360   3.006   1.00 0.00 ? 344 THR A HG23   3  
ATOM   6327  N N      . ALA A 1 132 ? 37.374 5.666   -0.821  1.00 0.00 ? 345 ALA A N      3  
ATOM   6328  C CA     . ALA A 1 132 ? 37.839 4.966   -2.006  1.00 0.00 ? 345 ALA A CA     3  
ATOM   6329  C C      . ALA A 1 132 ? 39.354 4.771   -1.916  1.00 0.00 ? 345 ALA A C      3  
ATOM   6330  O O      . ALA A 1 132 ? 39.887 3.782   -2.416  1.00 0.00 ? 345 ALA A O      3  
ATOM   6331  C CB     . ALA A 1 132 ? 37.426 5.748   -3.255  1.00 0.00 ? 345 ALA A CB     3  
ATOM   6332  H H      . ALA A 1 132 ? 36.992 6.575   -0.989  1.00 0.00 ? 345 ALA A H      3  
ATOM   6333  H HA     . ALA A 1 132 ? 37.356 3.989   -2.027  1.00 0.00 ? 345 ALA A HA     3  
ATOM   6334  H HB1    . ALA A 1 132 ? 38.297 5.906   -3.890  1.00 0.00 ? 345 ALA A HB1    3  
ATOM   6335  H HB2    . ALA A 1 132 ? 36.673 5.182   -3.805  1.00 0.00 ? 345 ALA A HB2    3  
ATOM   6336  H HB3    . ALA A 1 132 ? 37.011 6.711   -2.960  1.00 0.00 ? 345 ALA A HB3    3  
ATOM   6337  N N      . LEU A 1 133 ? 40.005 5.730   -1.275  1.00 0.00 ? 346 LEU A N      3  
ATOM   6338  C CA     . LEU A 1 133 ? 41.448 5.676   -1.113  1.00 0.00 ? 346 LEU A CA     3  
ATOM   6339  C C      . LEU A 1 133 ? 41.804 4.574   -0.112  1.00 0.00 ? 346 LEU A C      3  
ATOM   6340  O O      . LEU A 1 133 ? 42.803 3.878   -0.280  1.00 0.00 ? 346 LEU A O      3  
ATOM   6341  C CB     . LEU A 1 133 ? 41.997 7.053   -0.733  1.00 0.00 ? 346 LEU A CB     3  
ATOM   6342  C CG     . LEU A 1 133 ? 42.242 7.288   0.760   1.00 0.00 ? 346 LEU A CG     3  
ATOM   6343  C CD1    . LEU A 1 133 ? 43.692 6.972   1.133   1.00 0.00 ? 346 LEU A CD1    3  
ATOM   6344  C CD2    . LEU A 1 133 ? 41.844 8.709   1.162   1.00 0.00 ? 346 LEU A CD2    3  
ATOM   6345  H H      . LEU A 1 133 ? 39.564 6.532   -0.872  1.00 0.00 ? 346 LEU A H      3  
ATOM   6346  H HA     . LEU A 1 133 ? 41.876 5.415   -2.081  1.00 0.00 ? 346 LEU A HA     3  
ATOM   6347  H HB2    . LEU A 1 133 ? 42.935 7.207   -1.264  1.00 0.00 ? 346 LEU A HB2    3  
ATOM   6348  H HB3    . LEU A 1 133 ? 41.299 7.811   -1.090  1.00 0.00 ? 346 LEU A HB3    3  
ATOM   6349  H HG     . LEU A 1 133 ? 41.608 6.604   1.322   1.00 0.00 ? 346 LEU A HG     3  
ATOM   6350  H HD11   . LEU A 1 133 ? 44.011 6.067   0.616   1.00 0.00 ? 346 LEU A HD11   3  
ATOM   6351  H HD12   . LEU A 1 133 ? 44.332 7.803   0.839   1.00 0.00 ? 346 LEU A HD12   3  
ATOM   6352  H HD13   . LEU A 1 133 ? 43.764 6.820   2.209   1.00 0.00 ? 346 LEU A HD13   3  
ATOM   6353  H HD21   . LEU A 1 133 ? 41.078 8.666   1.938   1.00 0.00 ? 346 LEU A HD21   3  
ATOM   6354  H HD22   . LEU A 1 133 ? 42.717 9.237   1.545   1.00 0.00 ? 346 LEU A HD22   3  
ATOM   6355  H HD23   . LEU A 1 133 ? 41.452 9.238   0.294   1.00 0.00 ? 346 LEU A HD23   3  
ATOM   6356  N N      . GLU A 1 134 ? 40.965 4.452   0.907   1.00 0.00 ? 347 GLU A N      3  
ATOM   6357  C CA     . GLU A 1 134 ? 41.179 3.448   1.935   1.00 0.00 ? 347 GLU A CA     3  
ATOM   6358  C C      . GLU A 1 134 ? 40.829 2.058   1.399   1.00 0.00 ? 347 GLU A C      3  
ATOM   6359  O O      . GLU A 1 134 ? 41.507 1.079   1.711   1.00 0.00 ? 347 GLU A O      3  
ATOM   6360  C CB     . GLU A 1 134 ? 40.370 3.771   3.193   1.00 0.00 ? 347 GLU A CB     3  
ATOM   6361  C CG     . GLU A 1 134 ? 40.876 5.052   3.857   1.00 0.00 ? 347 GLU A CG     3  
ATOM   6362  C CD     . GLU A 1 134 ? 40.115 5.335   5.153   1.00 0.00 ? 347 GLU A CD     3  
ATOM   6363  O OE1    . GLU A 1 134 ? 39.664 4.397   5.826   1.00 0.00 ? 347 GLU A OE1    3  
ATOM   6364  O OE2    . GLU A 1 134 ? 40.000 6.585   5.456   1.00 0.00 ? 347 GLU A OE2    3  
ATOM   6365  H H      . GLU A 1 134 ? 40.155 5.023   1.035   1.00 0.00 ? 347 GLU A H      3  
ATOM   6366  H HA     . GLU A 1 134 ? 42.242 3.496   2.171   1.00 0.00 ? 347 GLU A HA     3  
ATOM   6367  H HB2    . GLU A 1 134 ? 39.317 3.883   2.934   1.00 0.00 ? 347 GLU A HB2    3  
ATOM   6368  H HB3    . GLU A 1 134 ? 40.438 2.941   3.896   1.00 0.00 ? 347 GLU A HB3    3  
ATOM   6369  H HG2    . GLU A 1 134 ? 41.942 4.959   4.070   1.00 0.00 ? 347 GLU A HG2    3  
ATOM   6370  H HG3    . GLU A 1 134 ? 40.761 5.892   3.172   1.00 0.00 ? 347 GLU A HG3    3  
ATOM   6371  H HE2    . GLU A 1 134 ? 40.837 7.074   5.212   1.00 0.00 ? 347 GLU A HE2    3  
ATOM   6372  N N      . ARG A 1 135 ? 39.771 2.014   0.603   1.00 0.00 ? 348 ARG A N      3  
ATOM   6373  C CA     . ARG A 1 135 ? 39.323 0.761   0.020   1.00 0.00 ? 348 ARG A CA     3  
ATOM   6374  C C      . ARG A 1 135 ? 40.308 0.292   -1.051  1.00 0.00 ? 348 ARG A C      3  
ATOM   6375  O O      . ARG A 1 135 ? 40.649 -0.890  -1.112  1.00 0.00 ? 348 ARG A O      3  
ATOM   6376  C CB     . ARG A 1 135 ? 37.934 0.908   -0.603  1.00 0.00 ? 348 ARG A CB     3  
ATOM   6377  C CG     . ARG A 1 135 ? 36.838 0.591   0.417   1.00 0.00 ? 348 ARG A CG     3  
ATOM   6378  C CD     . ARG A 1 135 ? 36.661 1.745   1.408   1.00 0.00 ? 348 ARG A CD     3  
ATOM   6379  N NE     . ARG A 1 135 ? 35.750 1.338   2.500   1.00 0.00 ? 348 ARG A NE     3  
ATOM   6380  C CZ     . ARG A 1 135 ? 34.433 1.150   2.349   1.00 0.00 ? 348 ARG A CZ     3  
ATOM   6381  N NH1    . ARG A 1 135 ? 33.863 1.331   1.151   1.00 0.00 ? 348 ARG A NH1    3  
ATOM   6382  N NH2    . ARG A 1 135 ? 33.684 0.780   3.398   1.00 0.00 ? 348 ARG A NH2    3  
ATOM   6383  H H      . ARG A 1 135 ? 39.225 2.815   0.353   1.00 0.00 ? 348 ARG A H      3  
ATOM   6384  H HA     . ARG A 1 135 ? 39.290 0.063   0.857   1.00 0.00 ? 348 ARG A HA     3  
ATOM   6385  H HB2    . ARG A 1 135 ? 37.805 1.925   -0.977  1.00 0.00 ? 348 ARG A HB2    3  
ATOM   6386  H HB3    . ARG A 1 135 ? 37.843 0.240   -1.460  1.00 0.00 ? 348 ARG A HB3    3  
ATOM   6387  H HG2    . ARG A 1 135 ? 35.898 0.405   -0.100  1.00 0.00 ? 348 ARG A HG2    3  
ATOM   6388  H HG3    . ARG A 1 135 ? 37.092 -0.320  0.957   1.00 0.00 ? 348 ARG A HG3    3  
ATOM   6389  H HD2    . ARG A 1 135 ? 37.629 2.034   1.818   1.00 0.00 ? 348 ARG A HD2    3  
ATOM   6390  H HD3    . ARG A 1 135 ? 36.259 2.618   0.894   1.00 0.00 ? 348 ARG A HD3    3  
ATOM   6391  H HE     . ARG A 1 135 ? 36.144 1.194   3.409   1.00 0.00 ? 348 ARG A HE     3  
ATOM   6392  H HH11   . ARG A 1 135 ? 34.421 1.607   0.368   1.00 0.00 ? 348 ARG A HH11   3  
ATOM   6393  H HH12   . ARG A 1 135 ? 32.879 1.191   1.038   1.00 0.00 ? 348 ARG A HH12   3  
ATOM   6394  H HH21   . ARG A 1 135 ? 34.109 0.645   4.293   1.00 0.00 ? 348 ARG A HH21   3  
ATOM   6395  H HH22   . ARG A 1 135 ? 32.701 0.640   3.286   1.00 0.00 ? 348 ARG A HH22   3  
ATOM   6396  N N      . ARG A 1 136 ? 40.739 1.239   -1.870  1.00 0.00 ? 349 ARG A N      3  
ATOM   6397  C CA     . ARG A 1 136 ? 41.678 0.937   -2.937  1.00 0.00 ? 349 ARG A CA     3  
ATOM   6398  C C      . ARG A 1 136 ? 43.051 0.598   -2.354  1.00 0.00 ? 349 ARG A C      3  
ATOM   6399  O O      . ARG A 1 136 ? 43.684 -0.372  -2.770  1.00 0.00 ? 349 ARG A O      3  
ATOM   6400  C CB     . ARG A 1 136 ? 41.817 2.118   -3.899  1.00 0.00 ? 349 ARG A CB     3  
ATOM   6401  C CG     . ARG A 1 136 ? 42.778 1.783   -5.042  1.00 0.00 ? 349 ARG A CG     3  
ATOM   6402  C CD     . ARG A 1 136 ? 43.541 3.028   -5.500  1.00 0.00 ? 349 ARG A CD     3  
ATOM   6403  N NE     . ARG A 1 136 ? 44.140 2.793   -6.832  1.00 0.00 ? 349 ARG A NE     3  
ATOM   6404  C CZ     . ARG A 1 136 ? 45.162 3.503   -7.332  1.00 0.00 ? 349 ARG A CZ     3  
ATOM   6405  N NH1    . ARG A 1 136 ? 45.704 4.495   -6.613  1.00 0.00 ? 349 ARG A NH1    3  
ATOM   6406  N NH2    . ARG A 1 136 ? 45.642 3.219   -8.551  1.00 0.00 ? 349 ARG A NH2    3  
ATOM   6407  H H      . ARG A 1 136 ? 40.457 2.197   -1.814  1.00 0.00 ? 349 ARG A H      3  
ATOM   6408  H HA     . ARG A 1 136 ? 41.248 0.079   -3.452  1.00 0.00 ? 349 ARG A HA     3  
ATOM   6409  H HB2    . ARG A 1 136 ? 40.841 2.378   -4.305  1.00 0.00 ? 349 ARG A HB2    3  
ATOM   6410  H HB3    . ARG A 1 136 ? 42.181 2.991   -3.358  1.00 0.00 ? 349 ARG A HB3    3  
ATOM   6411  H HG2    . ARG A 1 136 ? 43.484 1.020   -4.717  1.00 0.00 ? 349 ARG A HG2    3  
ATOM   6412  H HG3    . ARG A 1 136 ? 42.220 1.366   -5.880  1.00 0.00 ? 349 ARG A HG3    3  
ATOM   6413  H HD2    . ARG A 1 136 ? 42.866 3.883   -5.541  1.00 0.00 ? 349 ARG A HD2    3  
ATOM   6414  H HD3    . ARG A 1 136 ? 44.321 3.273   -4.779  1.00 0.00 ? 349 ARG A HD3    3  
ATOM   6415  H HE     . ARG A 1 136 ? 43.760 2.060   -7.395  1.00 0.00 ? 349 ARG A HE     3  
ATOM   6416  H HH11   . ARG A 1 136 ? 45.346 4.707   -5.704  1.00 0.00 ? 349 ARG A HH11   3  
ATOM   6417  H HH12   . ARG A 1 136 ? 46.466 5.024   -6.986  1.00 0.00 ? 349 ARG A HH12   3  
ATOM   6418  H HH21   . ARG A 1 136 ? 45.238 2.478   -9.087  1.00 0.00 ? 349 ARG A HH21   3  
ATOM   6419  H HH22   . ARG A 1 136 ? 46.404 3.748   -8.924  1.00 0.00 ? 349 ARG A HH22   3  
ATOM   6420  N N      . GLY A 1 137 ? 43.473 1.416   -1.401  1.00 0.00 ? 350 GLY A N      3  
ATOM   6421  C CA     . GLY A 1 137 ? 44.759 1.214   -0.755  1.00 0.00 ? 350 GLY A CA     3  
ATOM   6422  C C      . GLY A 1 137 ? 44.755 1.780   0.665   1.00 0.00 ? 350 GLY A C      3  
ATOM   6423  O O      . GLY A 1 137 ? 43.931 1.390   1.490   1.00 0.00 ? 350 GLY A O      3  
ATOM   6424  H H      . GLY A 1 137 ? 42.952 2.202   -1.068  1.00 0.00 ? 350 GLY A H      3  
ATOM   6425  H HA2    . GLY A 1 137 ? 44.993 0.150   -0.726  1.00 0.00 ? 350 GLY A HA2    3  
ATOM   6426  H HA3    . GLY A 1 137 ? 45.542 1.696   -1.341  1.00 0.00 ? 350 GLY A HA3    3  
ATOM   6427  N N      . ALA A 1 138 ? 45.686 2.692   0.907   1.00 0.00 ? 351 ALA A N      3  
ATOM   6428  C CA     . ALA A 1 138 ? 45.800 3.316   2.215   1.00 0.00 ? 351 ALA A CA     3  
ATOM   6429  C C      . ALA A 1 138 ? 46.007 2.233   3.276   1.00 0.00 ? 351 ALA A C      3  
ATOM   6430  O O      . ALA A 1 138 ? 45.788 2.471   4.462   1.00 0.00 ? 351 ALA A O      3  
ATOM   6431  C CB     . ALA A 1 138 ? 44.558 4.167   2.485   1.00 0.00 ? 351 ALA A CB     3  
ATOM   6432  H H      . ALA A 1 138 ? 46.353 3.004   0.231   1.00 0.00 ? 351 ALA A H      3  
ATOM   6433  H HA     . ALA A 1 138 ? 46.674 3.966   2.197   1.00 0.00 ? 351 ALA A HA     3  
ATOM   6434  H HB1    . ALA A 1 138 ? 44.861 5.142   2.863   1.00 0.00 ? 351 ALA A HB1    3  
ATOM   6435  H HB2    . ALA A 1 138 ? 43.996 4.294   1.559   1.00 0.00 ? 351 ALA A HB2    3  
ATOM   6436  H HB3    . ALA A 1 138 ? 43.930 3.669   3.225   1.00 0.00 ? 351 ALA A HB3    3  
ATOM   6437  N N      . ALA A 1 139 ? 46.426 1.065   2.810   1.00 0.00 ? 352 ALA A N      3  
ATOM   6438  C CA     . ALA A 1 139 ? 46.665 -0.055  3.704   1.00 0.00 ? 352 ALA A CA     3  
ATOM   6439  C C      . ALA A 1 139 ? 47.467 0.427   4.916   1.00 0.00 ? 352 ALA A C      3  
ATOM   6440  O O      . ALA A 1 139 ? 48.221 1.394   4.821   1.00 0.00 ? 352 ALA A O      3  
ATOM   6441  C CB     . ALA A 1 139 ? 47.378 -1.174  2.941   1.00 0.00 ? 352 ALA A CB     3  
ATOM   6442  H H      . ALA A 1 139 ? 46.603 0.880   1.844   1.00 0.00 ? 352 ALA A H      3  
ATOM   6443  H HA     . ALA A 1 139 ? 45.697 -0.422  4.043   1.00 0.00 ? 352 ALA A HA     3  
ATOM   6444  H HB1    . ALA A 1 139 ? 46.671 -1.663  2.271   1.00 0.00 ? 352 ALA A HB1    3  
ATOM   6445  H HB2    . ALA A 1 139 ? 48.199 -0.752  2.361   1.00 0.00 ? 352 ALA A HB2    3  
ATOM   6446  H HB3    . ALA A 1 139 ? 47.771 -1.902  3.650   1.00 0.00 ? 352 ALA A HB3    3  
ATOM   6447  N N      . ALA A 1 140 ? 47.277 -0.270  6.026   1.00 0.00 ? 353 ALA A N      3  
ATOM   6448  C CA     . ALA A 1 140 ? 47.972 0.074   7.255   1.00 0.00 ? 353 ALA A CA     3  
ATOM   6449  C C      . ALA A 1 140 ? 47.324 1.315   7.872   1.00 0.00 ? 353 ALA A C      3  
ATOM   6450  O O      . ALA A 1 140 ? 46.627 1.219   8.880   1.00 0.00 ? 353 ALA A O      3  
ATOM   6451  C CB     . ALA A 1 140 ? 49.459 0.278   6.959   1.00 0.00 ? 353 ALA A CB     3  
ATOM   6452  H H      . ALA A 1 140 ? 46.662 -1.056  6.094   1.00 0.00 ? 353 ALA A H      3  
ATOM   6453  H HA     . ALA A 1 140 ? 47.863 -0.764  7.943   1.00 0.00 ? 353 ALA A HA     3  
ATOM   6454  H HB1    . ALA A 1 140 ? 49.745 1.297   7.221   1.00 0.00 ? 353 ALA A HB1    3  
ATOM   6455  H HB2    . ALA A 1 140 ? 50.047 -0.427  7.547   1.00 0.00 ? 353 ALA A HB2    3  
ATOM   6456  H HB3    . ALA A 1 140 ? 49.646 0.112   5.898   1.00 0.00 ? 353 ALA A HB3    3  
ATOM   6457  N N      . SER A 1 141 ? 47.577 2.451   7.240   1.00 0.00 ? 354 SER A N      3  
ATOM   6458  C CA     . SER A 1 141 ? 47.027 3.710   7.714   1.00 0.00 ? 354 SER A CA     3  
ATOM   6459  C C      . SER A 1 141 ? 45.749 4.046   6.944   1.00 0.00 ? 354 SER A C      3  
ATOM   6460  O O      . SER A 1 141 ? 45.809 4.477   5.794   1.00 0.00 ? 354 SER A O      3  
ATOM   6461  C CB     . SER A 1 141 ? 48.045 4.844   7.575   1.00 0.00 ? 354 SER A CB     3  
ATOM   6462  O OG     . SER A 1 141 ? 48.476 5.334   8.841   1.00 0.00 ? 354 SER A OG     3  
ATOM   6463  H H      . SER A 1 141 ? 48.145 2.521   6.420   1.00 0.00 ? 354 SER A H      3  
ATOM   6464  H HA     . SER A 1 141 ? 46.807 3.549   8.770   1.00 0.00 ? 354 SER A HA     3  
ATOM   6465  H HB2    . SER A 1 141 ? 48.908 4.488   7.010   1.00 0.00 ? 354 SER A HB2    3  
ATOM   6466  H HB3    . SER A 1 141 ? 47.603 5.659   7.001   1.00 0.00 ? 354 SER A HB3    3  
ATOM   6467  H HG     . SER A 1 141 ? 49.461 5.195   8.944   1.00 0.00 ? 354 SER A HG     3  
ATOM   6468  N N      . ALA A 1 142 ? 44.623 3.836   7.610   1.00 0.00 ? 355 ALA A N      3  
ATOM   6469  C CA     . ALA A 1 142 ? 43.332 4.111   7.001   1.00 0.00 ? 355 ALA A CA     3  
ATOM   6470  C C      . ALA A 1 142 ? 42.644 5.246   7.765   1.00 0.00 ? 355 ALA A C      3  
ATOM   6471  O O      . ALA A 1 142 ? 41.822 4.997   8.645   1.00 0.00 ? 355 ALA A O      3  
ATOM   6472  C CB     . ALA A 1 142 ? 42.494 2.832   6.980   1.00 0.00 ? 355 ALA A CB     3  
ATOM   6473  H H      . ALA A 1 142 ? 44.583 3.485   8.545   1.00 0.00 ? 355 ALA A H      3  
ATOM   6474  H HA     . ALA A 1 142 ? 43.509 4.431   5.975   1.00 0.00 ? 355 ALA A HA     3  
ATOM   6475  H HB1    . ALA A 1 142 ? 42.864 2.142   7.739   1.00 0.00 ? 355 ALA A HB1    3  
ATOM   6476  H HB2    . ALA A 1 142 ? 41.452 3.076   7.190   1.00 0.00 ? 355 ALA A HB2    3  
ATOM   6477  H HB3    . ALA A 1 142 ? 42.568 2.364   5.998   1.00 0.00 ? 355 ALA A HB3    3  
HETATM 6478  P P      . CMP B 2 .   ? 34.463 -0.604  -6.000  1.00 0.00 ? 370 CMP A P      3  
HETATM 6479  O O1P    . CMP B 2 .   ? 35.878 -0.626  -6.432  1.00 0.00 ? 370 CMP A O1P    3  
HETATM 6480  O O2P    . CMP B 2 .   ? 33.645 0.434   -6.921  1.00 0.00 ? 370 CMP A O2P    3  
HETATM 6481  O "O5'"  . CMP B 2 .   ? 33.834 -2.072  -6.173  1.00 0.00 ? 370 CMP A "O5'"  3  
HETATM 6482  C "C5'"  . CMP B 2 .   ? 34.503 -2.964  -5.270  1.00 0.00 ? 370 CMP A "C5'"  3  
HETATM 6483  C "C4'"  . CMP B 2 .   ? 34.300 -2.434  -3.862  1.00 0.00 ? 370 CMP A "C4'"  3  
HETATM 6484  O "O4'"  . CMP B 2 .   ? 34.841 -3.236  -2.813  1.00 0.00 ? 370 CMP A "O4'"  3  
HETATM 6485  C "C3'"  . CMP B 2 .   ? 35.088 -1.105  -3.725  1.00 0.00 ? 370 CMP A "C3'"  3  
HETATM 6486  O "O3'"  . CMP B 2 .   ? 34.387 -0.122  -4.461  1.00 0.00 ? 370 CMP A "O3'"  3  
HETATM 6487  C "C2'"  . CMP B 2 .   ? 35.087 -0.916  -2.199  1.00 0.00 ? 370 CMP A "C2'"  3  
HETATM 6488  O "O2'"  . CMP B 2 .   ? 33.988 -0.097  -1.793  1.00 0.00 ? 370 CMP A "O2'"  3  
HETATM 6489  C "C1'"  . CMP B 2 .   ? 34.938 -2.361  -1.665  1.00 0.00 ? 370 CMP A "C1'"  3  
HETATM 6490  N N9     . CMP B 2 .   ? 36.109 -2.719  -0.862  1.00 0.00 ? 370 CMP A N9     3  
HETATM 6491  C C8     . CMP B 2 .   ? 37.337 -3.068  -1.338  1.00 0.00 ? 370 CMP A C8     3  
HETATM 6492  N N7     . CMP B 2 .   ? 38.143 -3.323  -0.347  1.00 0.00 ? 370 CMP A N7     3  
HETATM 6493  C C5     . CMP B 2 .   ? 37.484 -3.150  0.824   1.00 0.00 ? 370 CMP A C5     3  
HETATM 6494  C C6     . CMP B 2 .   ? 37.828 -3.287  2.180   1.00 0.00 ? 370 CMP A C6     3  
HETATM 6495  N N6     . CMP B 2 .   ? 39.107 -3.667  2.551   1.00 0.00 ? 370 CMP A N6     3  
HETATM 6496  N N1     . CMP B 2 .   ? 36.900 -3.036  3.096   1.00 0.00 ? 370 CMP A N1     3  
HETATM 6497  C C2     . CMP B 2 .   ? 35.680 -2.672  2.751   1.00 0.00 ? 370 CMP A C2     3  
HETATM 6498  N N3     . CMP B 2 .   ? 35.310 -2.537  1.494   1.00 0.00 ? 370 CMP A N3     3  
HETATM 6499  C C4     . CMP B 2 .   ? 36.171 -2.767  0.508   1.00 0.00 ? 370 CMP A C4     3  
HETATM 6500  H "H5'1" . CMP B 2 .   ? 35.568 -2.994  -5.501  1.00 0.00 ? 370 CMP A "H5'1" 3  
HETATM 6501  H "H5'2" . CMP B 2 .   ? 34.076 -3.963  -5.355  1.00 0.00 ? 370 CMP A "H5'2" 3  
HETATM 6502  H "H4'"  . CMP B 2 .   ? 33.240 -2.257  -3.684  1.00 0.00 ? 370 CMP A "H4'"  3  
HETATM 6503  H "H3'"  . CMP B 2 .   ? 36.053 -0.680  -3.798  1.00 0.00 ? 370 CMP A "H3'"  3  
HETATM 6504  H "H2'"  . CMP B 2 .   ? 36.031 -0.484  -1.865  1.00 0.00 ? 370 CMP A "H2'"  3  
HETATM 6505  H "HO2'" . CMP B 2 .   ? 34.040 -0.015  -0.832  1.00 0.00 ? 370 CMP A "HO2'" 3  
HETATM 6506  H "H1'"  . CMP B 2 .   ? 34.035 -2.442  -1.061  1.00 0.00 ? 370 CMP A "H1'"  3  
HETATM 6507  H H8     . CMP B 2 .   ? 37.604 -3.124  -2.383  1.00 0.00 ? 370 CMP A H8     3  
HETATM 6508  H HN61   . CMP B 2 .   ? 39.332 -3.753  3.491   1.00 0.00 ? 370 CMP A HN61   3  
HETATM 6509  H HN62   . CMP B 2 .   ? 39.774 -3.851  1.873   1.00 0.00 ? 370 CMP A HN62   3  
HETATM 6510  H H2     . CMP B 2 .   ? 34.956 -2.477  3.527   1.00 0.00 ? 370 CMP A H2     3  
ATOM   6511  N N      . GLY A 1 1   ? 1.630  -4.373  -10.100 1.00 0.00 ? 214 GLY A N      4  
ATOM   6512  C CA     . GLY A 1 1   ? 3.014  -4.410  -10.538 1.00 0.00 ? 214 GLY A CA     4  
ATOM   6513  C C      . GLY A 1 1   ? 3.970  -4.375  -9.344  1.00 0.00 ? 214 GLY A C      4  
ATOM   6514  O O      . GLY A 1 1   ? 4.291  -5.415  -8.771  1.00 0.00 ? 214 GLY A O      4  
ATOM   6515  H H1     . GLY A 1 1   ? 0.975  -4.792  -10.729 1.00 0.00 ? 214 GLY A H1     4  
ATOM   6516  H HA2    . GLY A 1 1   ? 3.190  -5.314  -11.122 1.00 0.00 ? 214 GLY A HA2    4  
ATOM   6517  H HA3    . GLY A 1 1   ? 3.215  -3.563  -11.194 1.00 0.00 ? 214 GLY A HA3    4  
ATOM   6518  N N      . SER A 1 2   ? 4.396  -3.168  -9.004  1.00 0.00 ? 215 SER A N      4  
ATOM   6519  C CA     . SER A 1 2   ? 5.308  -2.984  -7.887  1.00 0.00 ? 215 SER A CA     4  
ATOM   6520  C C      . SER A 1 2   ? 5.425  -1.496  -7.547  1.00 0.00 ? 215 SER A C      4  
ATOM   6521  O O      . SER A 1 2   ? 4.975  -0.645  -8.310  1.00 0.00 ? 215 SER A O      4  
ATOM   6522  C CB     . SER A 1 2   ? 6.687  -3.567  -8.201  1.00 0.00 ? 215 SER A CB     4  
ATOM   6523  O OG     . SER A 1 2   ? 6.763  -4.955  -7.888  1.00 0.00 ? 215 SER A OG     4  
ATOM   6524  H H      . SER A 1 2   ? 4.129  -2.327  -9.474  1.00 0.00 ? 215 SER A H      4  
ATOM   6525  H HA     . SER A 1 2   ? 4.863  -3.532  -7.056  1.00 0.00 ? 215 SER A HA     4  
ATOM   6526  H HB2    . SER A 1 2   ? 6.911  -3.420  -9.257  1.00 0.00 ? 215 SER A HB2    4  
ATOM   6527  H HB3    . SER A 1 2   ? 7.446  -3.026  -7.637  1.00 0.00 ? 215 SER A HB3    4  
ATOM   6528  H HG     . SER A 1 2   ? 7.719  -5.247  -7.859  1.00 0.00 ? 215 SER A HG     4  
ATOM   6529  N N      . GLN A 1 3   ? 6.033  -1.230  -6.400  1.00 0.00 ? 216 GLN A N      4  
ATOM   6530  C CA     . GLN A 1 3   ? 6.215  0.139   -5.950  1.00 0.00 ? 216 GLN A CA     4  
ATOM   6531  C C      . GLN A 1 3   ? 4.900  0.697   -5.404  1.00 0.00 ? 216 GLN A C      4  
ATOM   6532  O O      . GLN A 1 3   ? 4.832  1.121   -4.251  1.00 0.00 ? 216 GLN A O      4  
ATOM   6533  C CB     . GLN A 1 3   ? 6.759  1.019   -7.077  1.00 0.00 ? 216 GLN A CB     4  
ATOM   6534  C CG     . GLN A 1 3   ? 7.803  2.004   -6.548  1.00 0.00 ? 216 GLN A CG     4  
ATOM   6535  C CD     . GLN A 1 3   ? 9.175  1.336   -6.422  1.00 0.00 ? 216 GLN A CD     4  
ATOM   6536  O OE1    . GLN A 1 3   ? 9.689  0.739   -7.353  1.00 0.00 ? 216 GLN A OE1    4  
ATOM   6537  N NE2    . GLN A 1 3   ? 9.733  1.469   -5.223  1.00 0.00 ? 216 GLN A NE2    4  
ATOM   6538  H H      . GLN A 1 3   ? 6.398  -1.930  -5.785  1.00 0.00 ? 216 GLN A H      4  
ATOM   6539  H HA     . GLN A 1 3   ? 6.955  0.085   -5.150  1.00 0.00 ? 216 GLN A HA     4  
ATOM   6540  H HB2    . GLN A 1 3   ? 7.205  0.393   -7.850  1.00 0.00 ? 216 GLN A HB2    4  
ATOM   6541  H HB3    . GLN A 1 3   ? 5.940  1.567   -7.543  1.00 0.00 ? 216 GLN A HB3    4  
ATOM   6542  H HG2    . GLN A 1 3   ? 7.872  2.861   -7.218  1.00 0.00 ? 216 GLN A HG2    4  
ATOM   6543  H HG3    . GLN A 1 3   ? 7.490  2.384   -5.576  1.00 0.00 ? 216 GLN A HG3    4  
ATOM   6544  H HE21   . GLN A 1 3   ? 9.257  1.972   -4.502  1.00 0.00 ? 216 GLN A HE21   4  
ATOM   6545  H HE22   . GLN A 1 3   ? 10.631 1.066   -5.043  1.00 0.00 ? 216 GLN A HE22   4  
ATOM   6546  N N      . GLU A 1 4   ? 3.888  0.681   -6.259  1.00 0.00 ? 217 GLU A N      4  
ATOM   6547  C CA     . GLU A 1 4   ? 2.578  1.181   -5.877  1.00 0.00 ? 217 GLU A CA     4  
ATOM   6548  C C      . GLU A 1 4   ? 1.887  0.193   -4.933  1.00 0.00 ? 217 GLU A C      4  
ATOM   6549  O O      . GLU A 1 4   ? 0.939  -0.486  -5.325  1.00 0.00 ? 217 GLU A O      4  
ATOM   6550  C CB     . GLU A 1 4   ? 1.714  1.456   -7.109  1.00 0.00 ? 217 GLU A CB     4  
ATOM   6551  C CG     . GLU A 1 4   ? 2.054  2.816   -7.723  1.00 0.00 ? 217 GLU A CG     4  
ATOM   6552  C CD     . GLU A 1 4   ? 3.318  2.730   -8.582  1.00 0.00 ? 217 GLU A CD     4  
ATOM   6553  O OE1    . GLU A 1 4   ? 4.310  3.415   -8.294  1.00 0.00 ? 217 GLU A OE1    4  
ATOM   6554  O OE2    . GLU A 1 4   ? 3.244  1.915   -9.579  1.00 0.00 ? 217 GLU A OE2    4  
ATOM   6555  H H      . GLU A 1 4   ? 3.951  0.335   -7.194  1.00 0.00 ? 217 GLU A H      4  
ATOM   6556  H HA     . GLU A 1 4   ? 2.766  2.120   -5.356  1.00 0.00 ? 217 GLU A HA     4  
ATOM   6557  H HB2    . GLU A 1 4   ? 1.869  0.671   -7.849  1.00 0.00 ? 217 GLU A HB2    4  
ATOM   6558  H HB3    . GLU A 1 4   ? 0.661  1.431   -6.833  1.00 0.00 ? 217 GLU A HB3    4  
ATOM   6559  H HG2    . GLU A 1 4   ? 1.218  3.162   -8.332  1.00 0.00 ? 217 GLU A HG2    4  
ATOM   6560  H HG3    . GLU A 1 4   ? 2.197  3.551   -6.931  1.00 0.00 ? 217 GLU A HG3    4  
ATOM   6561  H HE2    . GLU A 1 4   ? 2.319  1.923   -9.959  1.00 0.00 ? 217 GLU A HE2    4  
ATOM   6562  N N      . VAL A 1 5   ? 2.389  0.145   -3.708  1.00 0.00 ? 218 VAL A N      4  
ATOM   6563  C CA     . VAL A 1 5   ? 1.833  -0.748  -2.705  1.00 0.00 ? 218 VAL A CA     4  
ATOM   6564  C C      . VAL A 1 5   ? 1.216  0.081   -1.577  1.00 0.00 ? 218 VAL A C      4  
ATOM   6565  O O      . VAL A 1 5   ? 1.132  -0.380  -0.439  1.00 0.00 ? 218 VAL A O      4  
ATOM   6566  C CB     . VAL A 1 5   ? 2.908  -1.720  -2.216  1.00 0.00 ? 218 VAL A CB     4  
ATOM   6567  C CG1    . VAL A 1 5   ? 2.315  -2.754  -1.255  1.00 0.00 ? 218 VAL A CG1    4  
ATOM   6568  C CG2    . VAL A 1 5   ? 3.607  -2.402  -3.393  1.00 0.00 ? 218 VAL A CG2    4  
ATOM   6569  H H      . VAL A 1 5   ? 3.160  0.700   -3.397  1.00 0.00 ? 218 VAL A H      4  
ATOM   6570  H HA     . VAL A 1 5   ? 1.044  -1.329  -3.184  1.00 0.00 ? 218 VAL A HA     4  
ATOM   6571  H HB     . VAL A 1 5   ? 3.655  -1.145  -1.670  1.00 0.00 ? 218 VAL A HB     4  
ATOM   6572  H HG11   . VAL A 1 5   ? 2.994  -3.603  -1.172  1.00 0.00 ? 218 VAL A HG11   4  
ATOM   6573  H HG12   . VAL A 1 5   ? 2.178  -2.300  -0.274  1.00 0.00 ? 218 VAL A HG12   4  
ATOM   6574  H HG13   . VAL A 1 5   ? 1.352  -3.094  -1.637  1.00 0.00 ? 218 VAL A HG13   4  
ATOM   6575  H HG21   . VAL A 1 5   ? 4.030  -3.352  -3.064  1.00 0.00 ? 218 VAL A HG21   4  
ATOM   6576  H HG22   . VAL A 1 5   ? 2.884  -2.583  -4.190  1.00 0.00 ? 218 VAL A HG22   4  
ATOM   6577  H HG23   . VAL A 1 5   ? 4.404  -1.759  -3.764  1.00 0.00 ? 218 VAL A HG23   4  
ATOM   6578  N N      . ARG A 1 6   ? 0.803  1.289   -1.930  1.00 0.00 ? 219 ARG A N      4  
ATOM   6579  C CA     . ARG A 1 6   ? 0.197  2.186   -0.960  1.00 0.00 ? 219 ARG A CA     4  
ATOM   6580  C C      . ARG A 1 6   ? 1.278  2.977   -0.221  1.00 0.00 ? 219 ARG A C      4  
ATOM   6581  O O      . ARG A 1 6   ? 1.153  3.238   0.974   1.00 0.00 ? 219 ARG A O      4  
ATOM   6582  C CB     . ARG A 1 6   ? -0.644 1.412   0.056   1.00 0.00 ? 219 ARG A CB     4  
ATOM   6583  C CG     . ARG A 1 6   ? -1.774 2.282   0.610   1.00 0.00 ? 219 ARG A CG     4  
ATOM   6584  C CD     . ARG A 1 6   ? -2.614 1.508   1.628   1.00 0.00 ? 219 ARG A CD     4  
ATOM   6585  N NE     . ARG A 1 6   ? -3.841 2.268   1.955   1.00 0.00 ? 219 ARG A NE     4  
ATOM   6586  C CZ     . ARG A 1 6   ? -4.940 1.725   2.495   1.00 0.00 ? 219 ARG A CZ     4  
ATOM   6587  N NH1    . ARG A 1 6   ? -4.972 0.414   2.773   1.00 0.00 ? 219 ARG A NH1    4  
ATOM   6588  N NH2    . ARG A 1 6   ? -6.007 2.492   2.757   1.00 0.00 ? 219 ARG A NH2    4  
ATOM   6589  H H      . ARG A 1 6   ? 0.875  1.655   -2.858  1.00 0.00 ? 219 ARG A H      4  
ATOM   6590  H HA     . ARG A 1 6   ? -0.438 2.847   -1.551  1.00 0.00 ? 219 ARG A HA     4  
ATOM   6591  H HB2    . ARG A 1 6   ? -1.062 0.522   -0.415  1.00 0.00 ? 219 ARG A HB2    4  
ATOM   6592  H HB3    . ARG A 1 6   ? -0.009 1.070   0.874   1.00 0.00 ? 219 ARG A HB3    4  
ATOM   6593  H HG2    . ARG A 1 6   ? -1.355 3.172   1.079   1.00 0.00 ? 219 ARG A HG2    4  
ATOM   6594  H HG3    . ARG A 1 6   ? -2.410 2.622   -0.208  1.00 0.00 ? 219 ARG A HG3    4  
ATOM   6595  H HD2    . ARG A 1 6   ? -2.878 0.530   1.226   1.00 0.00 ? 219 ARG A HD2    4  
ATOM   6596  H HD3    . ARG A 1 6   ? -2.032 1.335   2.534   1.00 0.00 ? 219 ARG A HD3    4  
ATOM   6597  H HE     . ARG A 1 6   ? -3.850 3.250   1.760   1.00 0.00 ? 219 ARG A HE     4  
ATOM   6598  H HH11   . ARG A 1 6   ? -4.175 -0.159  2.577   1.00 0.00 ? 219 ARG A HH11   4  
ATOM   6599  H HH12   . ARG A 1 6   ? -5.792 0.009   3.176   1.00 0.00 ? 219 ARG A HH12   4  
ATOM   6600  H HH21   . ARG A 1 6   ? -5.983 3.469   2.550   1.00 0.00 ? 219 ARG A HH21   4  
ATOM   6601  H HH22   . ARG A 1 6   ? -6.827 2.086   3.160   1.00 0.00 ? 219 ARG A HH22   4  
ATOM   6602  N N      . ARG A 1 7   ? 2.316  3.334   -0.963  1.00 0.00 ? 220 ARG A N      4  
ATOM   6603  C CA     . ARG A 1 7   ? 3.419  4.090   -0.393  1.00 0.00 ? 220 ARG A CA     4  
ATOM   6604  C C      . ARG A 1 7   ? 3.904  3.428   0.898   1.00 0.00 ? 220 ARG A C      4  
ATOM   6605  O O      . ARG A 1 7   ? 3.856  4.035   1.967   1.00 0.00 ? 220 ARG A O      4  
ATOM   6606  C CB     . ARG A 1 7   ? 3.002  5.531   -0.093  1.00 0.00 ? 220 ARG A CB     4  
ATOM   6607  C CG     . ARG A 1 7   ? 3.101  6.403   -1.346  1.00 0.00 ? 220 ARG A CG     4  
ATOM   6608  C CD     . ARG A 1 7   ? 4.415  7.188   -1.365  1.00 0.00 ? 220 ARG A CD     4  
ATOM   6609  N NE     . ARG A 1 7   ? 4.392  8.238   -0.323  1.00 0.00 ? 220 ARG A NE     4  
ATOM   6610  C CZ     . ARG A 1 7   ? 3.796  9.430   -0.470  1.00 0.00 ? 220 ARG A CZ     4  
ATOM   6611  N NH1    . ARG A 1 7   ? 3.172  9.729   -1.617  1.00 0.00 ? 220 ARG A NH1    4  
ATOM   6612  N NH2    . ARG A 1 7   ? 3.826  10.321  0.530   1.00 0.00 ? 220 ARG A NH2    4  
ATOM   6613  H H      . ARG A 1 7   ? 2.410  3.118   -1.934  1.00 0.00 ? 220 ARG A H      4  
ATOM   6614  H HA     . ARG A 1 7   ? 4.194  4.072   -1.159  1.00 0.00 ? 220 ARG A HA     4  
ATOM   6615  H HB2    . ARG A 1 7   ? 1.980  5.547   0.284   1.00 0.00 ? 220 ARG A HB2    4  
ATOM   6616  H HB3    . ARG A 1 7   ? 3.638  5.942   0.692   1.00 0.00 ? 220 ARG A HB3    4  
ATOM   6617  H HG2    . ARG A 1 7   ? 3.035  5.776   -2.236  1.00 0.00 ? 220 ARG A HG2    4  
ATOM   6618  H HG3    . ARG A 1 7   ? 2.260  7.095   -1.381  1.00 0.00 ? 220 ARG A HG3    4  
ATOM   6619  H HD2    . ARG A 1 7   ? 5.254  6.513   -1.195  1.00 0.00 ? 220 ARG A HD2    4  
ATOM   6620  H HD3    . ARG A 1 7   ? 4.564  7.640   -2.346  1.00 0.00 ? 220 ARG A HD3    4  
ATOM   6621  H HE     . ARG A 1 7   ? 4.849  8.047   0.546   1.00 0.00 ? 220 ARG A HE     4  
ATOM   6622  H HH11   . ARG A 1 7   ? 3.150  9.064   -2.362  1.00 0.00 ? 220 ARG A HH11   4  
ATOM   6623  H HH12   . ARG A 1 7   ? 2.728  10.619  -1.727  1.00 0.00 ? 220 ARG A HH12   4  
ATOM   6624  H HH21   . ARG A 1 7   ? 4.292  10.098  1.386   1.00 0.00 ? 220 ARG A HH21   4  
ATOM   6625  H HH22   . ARG A 1 7   ? 3.382  11.211  0.420   1.00 0.00 ? 220 ARG A HH22   4  
ATOM   6626  N N      . GLY A 1 8   ? 4.360  2.192   0.756   1.00 0.00 ? 221 GLY A N      4  
ATOM   6627  C CA     . GLY A 1 8   ? 4.853  1.441   1.898   1.00 0.00 ? 221 GLY A CA     4  
ATOM   6628  C C      . GLY A 1 8   ? 6.372  1.264   1.823   1.00 0.00 ? 221 GLY A C      4  
ATOM   6629  O O      . GLY A 1 8   ? 7.054  1.286   2.846   1.00 0.00 ? 221 GLY A O      4  
ATOM   6630  H H      . GLY A 1 8   ? 4.395  1.706   -0.117  1.00 0.00 ? 221 GLY A H      4  
ATOM   6631  H HA2    . GLY A 1 8   ? 4.590  1.959   2.820   1.00 0.00 ? 221 GLY A HA2    4  
ATOM   6632  H HA3    . GLY A 1 8   ? 4.372  0.464   1.931   1.00 0.00 ? 221 GLY A HA3    4  
ATOM   6633  N N      . ASP A 1 9   ? 6.855  1.091   0.602   1.00 0.00 ? 222 ASP A N      4  
ATOM   6634  C CA     . ASP A 1 9   ? 8.280  0.910   0.379   1.00 0.00 ? 222 ASP A CA     4  
ATOM   6635  C C      . ASP A 1 9   ? 8.983  2.266   0.477   1.00 0.00 ? 222 ASP A C      4  
ATOM   6636  O O      . ASP A 1 9   ? 10.126 2.346   0.925   1.00 0.00 ? 222 ASP A O      4  
ATOM   6637  C CB     . ASP A 1 9   ? 8.552  0.336   -1.012  1.00 0.00 ? 222 ASP A CB     4  
ATOM   6638  C CG     . ASP A 1 9   ? 7.885  -1.011  -1.298  1.00 0.00 ? 222 ASP A CG     4  
ATOM   6639  O OD1    . ASP A 1 9   ? 8.520  -2.071  -1.204  1.00 0.00 ? 222 ASP A OD1    4  
ATOM   6640  O OD2    . ASP A 1 9   ? 6.641  -0.942  -1.635  1.00 0.00 ? 222 ASP A OD2    4  
ATOM   6641  H H      . ASP A 1 9   ? 6.293  1.075   -0.226  1.00 0.00 ? 222 ASP A H      4  
ATOM   6642  H HA     . ASP A 1 9   ? 8.604  0.215   1.154   1.00 0.00 ? 222 ASP A HA     4  
ATOM   6643  H HB2    . ASP A 1 9   ? 8.216  1.057   -1.758  1.00 0.00 ? 222 ASP A HB2    4  
ATOM   6644  H HB3    . ASP A 1 9   ? 9.629  0.225   -1.139  1.00 0.00 ? 222 ASP A HB3    4  
ATOM   6645  H HD2    . ASP A 1 9   ? 6.083  -1.469  -0.994  1.00 0.00 ? 222 ASP A HD2    4  
ATOM   6646  N N      . PHE A 1 10  ? 8.271  3.298   0.051   1.00 0.00 ? 223 PHE A N      4  
ATOM   6647  C CA     . PHE A 1 10  ? 8.812  4.646   0.085   1.00 0.00 ? 223 PHE A CA     4  
ATOM   6648  C C      . PHE A 1 10  ? 8.944  5.148   1.524   1.00 0.00 ? 223 PHE A C      4  
ATOM   6649  O O      . PHE A 1 10  ? 9.838  5.935   1.832   1.00 0.00 ? 223 PHE A O      4  
ATOM   6650  C CB     . PHE A 1 10  ? 7.827  5.543   -0.667  1.00 0.00 ? 223 PHE A CB     4  
ATOM   6651  C CG     . PHE A 1 10  ? 8.061  7.040   -0.455  1.00 0.00 ? 223 PHE A CG     4  
ATOM   6652  C CD1    . PHE A 1 10  ? 7.501  7.672   0.611   1.00 0.00 ? 223 PHE A CD1    4  
ATOM   6653  C CD2    . PHE A 1 10  ? 8.830  7.740   -1.332  1.00 0.00 ? 223 PHE A CD2    4  
ATOM   6654  C CE1    . PHE A 1 10  ? 7.719  9.061   0.809   1.00 0.00 ? 223 PHE A CE1    4  
ATOM   6655  C CE2    . PHE A 1 10  ? 9.047  9.129   -1.135  1.00 0.00 ? 223 PHE A CE2    4  
ATOM   6656  C CZ     . PHE A 1 10  ? 8.487  9.761   -0.068  1.00 0.00 ? 223 PHE A CZ     4  
ATOM   6657  H H      . PHE A 1 10  ? 7.342  3.225   -0.312  1.00 0.00 ? 223 PHE A H      4  
ATOM   6658  H HA     . PHE A 1 10  ? 9.799  4.610   -0.378  1.00 0.00 ? 223 PHE A HA     4  
ATOM   6659  H HB2    . PHE A 1 10  ? 7.891  5.324   -1.733  1.00 0.00 ? 223 PHE A HB2    4  
ATOM   6660  H HB3    . PHE A 1 10  ? 6.814  5.297   -0.352  1.00 0.00 ? 223 PHE A HB3    4  
ATOM   6661  H HD1    . PHE A 1 10  ? 6.885  7.111   1.316   1.00 0.00 ? 223 PHE A HD1    4  
ATOM   6662  H HD2    . PHE A 1 10  ? 9.278  7.234   -2.187  1.00 0.00 ? 223 PHE A HD2    4  
ATOM   6663  H HE1    . PHE A 1 10  ? 7.270  9.567   1.664   1.00 0.00 ? 223 PHE A HE1    4  
ATOM   6664  H HE2    . PHE A 1 10  ? 9.662  9.689   -1.838  1.00 0.00 ? 223 PHE A HE2    4  
ATOM   6665  H HZ     . PHE A 1 10  ? 8.654  10.827  0.083   1.00 0.00 ? 223 PHE A HZ     4  
ATOM   6666  N N      . VAL A 1 11  ? 8.040  4.673   2.368   1.00 0.00 ? 224 VAL A N      4  
ATOM   6667  C CA     . VAL A 1 11  ? 8.044  5.064   3.768   1.00 0.00 ? 224 VAL A CA     4  
ATOM   6668  C C      . VAL A 1 11  ? 9.238  4.415   4.470   1.00 0.00 ? 224 VAL A C      4  
ATOM   6669  O O      . VAL A 1 11  ? 9.935  5.066   5.247   1.00 0.00 ? 224 VAL A O      4  
ATOM   6670  C CB     . VAL A 1 11  ? 6.704  4.706   4.414   1.00 0.00 ? 224 VAL A CB     4  
ATOM   6671  C CG1    . VAL A 1 11  ? 6.806  4.739   5.940   1.00 0.00 ? 224 VAL A CG1    4  
ATOM   6672  C CG2    . VAL A 1 11  ? 5.591  5.633   3.919   1.00 0.00 ? 224 VAL A CG2    4  
ATOM   6673  H H      . VAL A 1 11  ? 7.315  4.034   2.109   1.00 0.00 ? 224 VAL A H      4  
ATOM   6674  H HA     . VAL A 1 11  ? 8.160  6.147   3.806   1.00 0.00 ? 224 VAL A HA     4  
ATOM   6675  H HB     . VAL A 1 11  ? 6.448  3.689   4.117   1.00 0.00 ? 224 VAL A HB     4  
ATOM   6676  H HG11   . VAL A 1 11  ? 7.527  3.993   6.272   1.00 0.00 ? 224 VAL A HG11   4  
ATOM   6677  H HG12   . VAL A 1 11  ? 7.132  5.728   6.262   1.00 0.00 ? 224 VAL A HG12   4  
ATOM   6678  H HG13   . VAL A 1 11  ? 5.830  4.519   6.375   1.00 0.00 ? 224 VAL A HG13   4  
ATOM   6679  H HG21   . VAL A 1 11  ? 5.824  5.973   2.909   1.00 0.00 ? 224 VAL A HG21   4  
ATOM   6680  H HG22   . VAL A 1 11  ? 4.644  5.094   3.912   1.00 0.00 ? 224 VAL A HG22   4  
ATOM   6681  H HG23   . VAL A 1 11  ? 5.514  6.495   4.583   1.00 0.00 ? 224 VAL A HG23   4  
ATOM   6682  N N      . ARG A 1 12  ? 9.438  3.139   4.172   1.00 0.00 ? 225 ARG A N      4  
ATOM   6683  C CA     . ARG A 1 12  ? 10.537 2.395   4.765   1.00 0.00 ? 225 ARG A CA     4  
ATOM   6684  C C      . ARG A 1 12  ? 11.876 2.928   4.253   1.00 0.00 ? 225 ARG A C      4  
ATOM   6685  O O      . ARG A 1 12  ? 12.862 2.949   4.988   1.00 0.00 ? 225 ARG A O      4  
ATOM   6686  C CB     . ARG A 1 12  ? 10.431 0.905   4.440   1.00 0.00 ? 225 ARG A CB     4  
ATOM   6687  C CG     . ARG A 1 12  ? 10.367 0.067   5.720   1.00 0.00 ? 225 ARG A CG     4  
ATOM   6688  C CD     . ARG A 1 12  ? 11.685 -0.674  5.956   1.00 0.00 ? 225 ARG A CD     4  
ATOM   6689  N NE     . ARG A 1 12  ? 11.602 -2.044  5.402   1.00 0.00 ? 225 ARG A NE     4  
ATOM   6690  C CZ     . ARG A 1 12  ? 10.818 -3.009  5.903   1.00 0.00 ? 225 ARG A CZ     4  
ATOM   6691  N NH1    . ARG A 1 12  ? 10.048 -2.761  6.970   1.00 0.00 ? 225 ARG A NH1    4  
ATOM   6692  N NH2    . ARG A 1 12  ? 10.807 -4.223  5.337   1.00 0.00 ? 225 ARG A NH2    4  
ATOM   6693  H H      . ARG A 1 12  ? 8.866  2.617   3.539   1.00 0.00 ? 225 ARG A H      4  
ATOM   6694  H HA     . ARG A 1 12  ? 10.434 2.557   5.838   1.00 0.00 ? 225 ARG A HA     4  
ATOM   6695  H HB2    . ARG A 1 12  ? 9.541  0.722   3.839   1.00 0.00 ? 225 ARG A HB2    4  
ATOM   6696  H HB3    . ARG A 1 12  ? 11.288 0.597   3.842   1.00 0.00 ? 225 ARG A HB3    4  
ATOM   6697  H HG2    . ARG A 1 12  ? 10.151 0.713   6.570   1.00 0.00 ? 225 ARG A HG2    4  
ATOM   6698  H HG3    . ARG A 1 12  ? 9.550  -0.650  5.649   1.00 0.00 ? 225 ARG A HG3    4  
ATOM   6699  H HD2    . ARG A 1 12  ? 12.506 -0.132  5.485   1.00 0.00 ? 225 ARG A HD2    4  
ATOM   6700  H HD3    . ARG A 1 12  ? 11.902 -0.716  7.024   1.00 0.00 ? 225 ARG A HD3    4  
ATOM   6701  H HE     . ARG A 1 12  ? 12.164 -2.262  4.606   1.00 0.00 ? 225 ARG A HE     4  
ATOM   6702  H HH11   . ARG A 1 12  ? 10.057 -1.854  7.394   1.00 0.00 ? 225 ARG A HH11   4  
ATOM   6703  H HH12   . ARG A 1 12  ? 9.463  -3.481  7.344   1.00 0.00 ? 225 ARG A HH12   4  
ATOM   6704  H HH21   . ARG A 1 12  ? 11.383 -4.409  4.540   1.00 0.00 ? 225 ARG A HH21   4  
ATOM   6705  H HH22   . ARG A 1 12  ? 10.223 -4.944  5.710   1.00 0.00 ? 225 ARG A HH22   4  
ATOM   6706  N N      . ASN A 1 13  ? 11.869 3.346   2.996   1.00 0.00 ? 226 ASN A N      4  
ATOM   6707  C CA     . ASN A 1 13  ? 13.070 3.878   2.377   1.00 0.00 ? 226 ASN A CA     4  
ATOM   6708  C C      . ASN A 1 13  ? 13.400 5.238   2.997   1.00 0.00 ? 226 ASN A C      4  
ATOM   6709  O O      . ASN A 1 13  ? 14.566 5.623   3.074   1.00 0.00 ? 226 ASN A O      4  
ATOM   6710  C CB     . ASN A 1 13  ? 12.874 4.078   0.873   1.00 0.00 ? 226 ASN A CB     4  
ATOM   6711  C CG     . ASN A 1 13  ? 12.752 2.735   0.152   1.00 0.00 ? 226 ASN A CG     4  
ATOM   6712  O OD1    . ASN A 1 13  ? 12.683 1.679   0.759   1.00 0.00 ? 226 ASN A OD1    4  
ATOM   6713  N ND2    . ASN A 1 13  ? 12.728 2.833   -1.175  1.00 0.00 ? 226 ASN A ND2    4  
ATOM   6714  H H      . ASN A 1 13  ? 11.063 3.327   2.405   1.00 0.00 ? 226 ASN A H      4  
ATOM   6715  H HA     . ASN A 1 13  ? 13.844 3.134   2.569   1.00 0.00 ? 226 ASN A HA     4  
ATOM   6716  H HB2    . ASN A 1 13  ? 11.977 4.673   0.697   1.00 0.00 ? 226 ASN A HB2    4  
ATOM   6717  H HB3    . ASN A 1 13  ? 13.714 4.641   0.465   1.00 0.00 ? 226 ASN A HB3    4  
ATOM   6718  H HD21   . ASN A 1 13  ? 12.788 3.731   -1.610  1.00 0.00 ? 226 ASN A HD21   4  
ATOM   6719  H HD22   . ASN A 1 13  ? 12.650 2.010   -1.735  1.00 0.00 ? 226 ASN A HD22   4  
ATOM   6720  N N      . TRP A 1 14  ? 12.352 5.927   3.422   1.00 0.00 ? 227 TRP A N      4  
ATOM   6721  C CA     . TRP A 1 14  ? 12.516 7.236   4.033   1.00 0.00 ? 227 TRP A CA     4  
ATOM   6722  C C      . TRP A 1 14  ? 13.324 7.060   5.320   1.00 0.00 ? 227 TRP A C      4  
ATOM   6723  O O      . TRP A 1 14  ? 14.273 7.802   5.566   1.00 0.00 ? 227 TRP A O      4  
ATOM   6724  C CB     . TRP A 1 14  ? 11.159 7.906   4.265   1.00 0.00 ? 227 TRP A CB     4  
ATOM   6725  C CG     . TRP A 1 14  ? 10.974 9.217   3.500   1.00 0.00 ? 227 TRP A CG     4  
ATOM   6726  C CD1    . TRP A 1 14  ? 9.863  9.676   2.905   1.00 0.00 ? 227 TRP A CD1    4  
ATOM   6727  C CD2    . TRP A 1 14  ? 11.978 10.228  3.271   1.00 0.00 ? 227 TRP A CD2    4  
ATOM   6728  N NE1    . TRP A 1 14  ? 10.078 10.903  2.312   1.00 0.00 ? 227 TRP A NE1    4  
ATOM   6729  C CE2    . TRP A 1 14  ? 11.405 11.250  2.541   1.00 0.00 ? 227 TRP A CE2    4  
ATOM   6730  C CE3    . TRP A 1 14  ? 13.326 10.278  3.666   1.00 0.00 ? 227 TRP A CE3    4  
ATOM   6731  C CZ2    . TRP A 1 14  ? 12.105 12.395  2.144   1.00 0.00 ? 227 TRP A CZ2    4  
ATOM   6732  C CZ3    . TRP A 1 14  ? 14.012 11.429  3.261   1.00 0.00 ? 227 TRP A CZ3    4  
ATOM   6733  C CH2    . TRP A 1 14  ? 13.450 12.466  2.527   1.00 0.00 ? 227 TRP A CH2    4  
ATOM   6734  H H      . TRP A 1 14  ? 11.407 5.607   3.356   1.00 0.00 ? 227 TRP A H      4  
ATOM   6735  H HA     . TRP A 1 14  ? 13.063 7.865   3.331   1.00 0.00 ? 227 TRP A HA     4  
ATOM   6736  H HB2    . TRP A 1 14  ? 10.369 7.213   3.975   1.00 0.00 ? 227 TRP A HB2    4  
ATOM   6737  H HB3    . TRP A 1 14  ? 11.039 8.098   5.331   1.00 0.00 ? 227 TRP A HB3    4  
ATOM   6738  H HD1    . TRP A 1 14  ? 8.911  9.146   2.893   1.00 0.00 ? 227 TRP A HD1    4  
ATOM   6739  H HE1    . TRP A 1 14  ? 9.343  11.493  1.765   1.00 0.00 ? 227 TRP A HE1    4  
ATOM   6740  H HE3    . TRP A 1 14  ? 13.802 9.485   4.242   1.00 0.00 ? 227 TRP A HE3    4  
ATOM   6741  H HZ2    . TRP A 1 14  ? 11.629 13.188  1.567   1.00 0.00 ? 227 TRP A HZ2    4  
ATOM   6742  H HZ3    . TRP A 1 14  ? 15.062 11.518  3.542   1.00 0.00 ? 227 TRP A HZ3    4  
ATOM   6743  H HH2    . TRP A 1 14  ? 14.053 13.331  2.250   1.00 0.00 ? 227 TRP A HH2    4  
ATOM   6744  N N      . GLN A 1 15  ? 12.918 6.073   6.105   1.00 0.00 ? 228 GLN A N      4  
ATOM   6745  C CA     . GLN A 1 15  ? 13.593 5.791   7.361   1.00 0.00 ? 228 GLN A CA     4  
ATOM   6746  C C      . GLN A 1 15  ? 14.970 5.178   7.096   1.00 0.00 ? 228 GLN A C      4  
ATOM   6747  O O      . GLN A 1 15  ? 15.899 5.372   7.879   1.00 0.00 ? 228 GLN A O      4  
ATOM   6748  C CB     . GLN A 1 15  ? 12.746 4.873   8.245   1.00 0.00 ? 228 GLN A CB     4  
ATOM   6749  C CG     . GLN A 1 15  ? 12.589 3.490   7.608   1.00 0.00 ? 228 GLN A CG     4  
ATOM   6750  C CD     . GLN A 1 15  ? 12.200 2.446   8.656   1.00 0.00 ? 228 GLN A CD     4  
ATOM   6751  O OE1    . GLN A 1 15  ? 12.979 2.075   9.519   1.00 0.00 ? 228 GLN A OE1    4  
ATOM   6752  N NE2    . GLN A 1 15  ? 10.956 1.993   8.533   1.00 0.00 ? 228 GLN A NE2    4  
ATOM   6753  H H      . GLN A 1 15  ? 12.145 5.474   5.897   1.00 0.00 ? 228 GLN A H      4  
ATOM   6754  H HA     . GLN A 1 15  ? 13.705 6.757   7.853   1.00 0.00 ? 228 GLN A HA     4  
ATOM   6755  H HB2    . GLN A 1 15  ? 13.210 4.776   9.225   1.00 0.00 ? 228 GLN A HB2    4  
ATOM   6756  H HB3    . GLN A 1 15  ? 11.763 5.318   8.400   1.00 0.00 ? 228 GLN A HB3    4  
ATOM   6757  H HG2    . GLN A 1 15  ? 11.828 3.529   6.829   1.00 0.00 ? 228 GLN A HG2    4  
ATOM   6758  H HG3    . GLN A 1 15  ? 13.523 3.199   7.128   1.00 0.00 ? 228 GLN A HG3    4  
ATOM   6759  H HE21   . GLN A 1 15  ? 10.368 2.339   7.802   1.00 0.00 ? 228 GLN A HE21   4  
ATOM   6760  H HE22   . GLN A 1 15  ? 10.608 1.307   9.173   1.00 0.00 ? 228 GLN A HE22   4  
ATOM   6761  N N      . LEU A 1 16  ? 15.058 4.452   5.992   1.00 0.00 ? 229 LEU A N      4  
ATOM   6762  C CA     . LEU A 1 16  ? 16.306 3.812   5.615   1.00 0.00 ? 229 LEU A CA     4  
ATOM   6763  C C      . LEU A 1 16  ? 17.307 4.877   5.166   1.00 0.00 ? 229 LEU A C      4  
ATOM   6764  O O      . LEU A 1 16  ? 18.499 4.774   5.451   1.00 0.00 ? 229 LEU A O      4  
ATOM   6765  C CB     . LEU A 1 16  ? 16.055 2.724   4.568   1.00 0.00 ? 229 LEU A CB     4  
ATOM   6766  C CG     . LEU A 1 16  ? 16.459 1.303   4.967   1.00 0.00 ? 229 LEU A CG     4  
ATOM   6767  C CD1    . LEU A 1 16  ? 15.770 0.881   6.265   1.00 0.00 ? 229 LEU A CD1    4  
ATOM   6768  C CD2    . LEU A 1 16  ? 16.191 0.317   3.828   1.00 0.00 ? 229 LEU A CD2    4  
ATOM   6769  H H      . LEU A 1 16  ? 14.297 4.301   5.361   1.00 0.00 ? 229 LEU A H      4  
ATOM   6770  H HA     . LEU A 1 16  ? 16.702 3.319   6.503   1.00 0.00 ? 229 LEU A HA     4  
ATOM   6771  H HB2    . LEU A 1 16  ? 14.993 2.722   4.322   1.00 0.00 ? 229 LEU A HB2    4  
ATOM   6772  H HB3    . LEU A 1 16  ? 16.593 2.992   3.658   1.00 0.00 ? 229 LEU A HB3    4  
ATOM   6773  H HG     . LEU A 1 16  ? 17.533 1.294   5.154   1.00 0.00 ? 229 LEU A HG     4  
ATOM   6774  H HD11   . LEU A 1 16  ? 15.648 -0.202  6.277   1.00 0.00 ? 229 LEU A HD11   4  
ATOM   6775  H HD12   . LEU A 1 16  ? 16.379 1.187   7.116   1.00 0.00 ? 229 LEU A HD12   4  
ATOM   6776  H HD13   . LEU A 1 16  ? 14.792 1.357   6.329   1.00 0.00 ? 229 LEU A HD13   4  
ATOM   6777  H HD21   . LEU A 1 16  ? 17.135 -0.097  3.476   1.00 0.00 ? 229 LEU A HD21   4  
ATOM   6778  H HD22   . LEU A 1 16  ? 15.553 -0.489  4.189   1.00 0.00 ? 229 LEU A HD22   4  
ATOM   6779  H HD23   . LEU A 1 16  ? 15.693 0.835   3.008   1.00 0.00 ? 229 LEU A HD23   4  
ATOM   6780  N N      . VAL A 1 17  ? 16.786 5.877   4.470   1.00 0.00 ? 230 VAL A N      4  
ATOM   6781  C CA     . VAL A 1 17  ? 17.619 6.962   3.979   1.00 0.00 ? 230 VAL A CA     4  
ATOM   6782  C C      . VAL A 1 17  ? 18.052 7.839   5.155   1.00 0.00 ? 230 VAL A C      4  
ATOM   6783  O O      . VAL A 1 17  ? 19.099 8.484   5.101   1.00 0.00 ? 230 VAL A O      4  
ATOM   6784  C CB     . VAL A 1 17  ? 16.875 7.743   2.893   1.00 0.00 ? 230 VAL A CB     4  
ATOM   6785  C CG1    . VAL A 1 17  ? 17.432 9.161   2.760   1.00 0.00 ? 230 VAL A CG1    4  
ATOM   6786  C CG2    . VAL A 1 17  ? 16.929 7.005   1.554   1.00 0.00 ? 230 VAL A CG2    4  
ATOM   6787  H H      . VAL A 1 17  ? 15.814 5.955   4.243   1.00 0.00 ? 230 VAL A H      4  
ATOM   6788  H HA     . VAL A 1 17  ? 18.506 6.517   3.528   1.00 0.00 ? 230 VAL A HA     4  
ATOM   6789  H HB     . VAL A 1 17  ? 15.830 7.819   3.193   1.00 0.00 ? 230 VAL A HB     4  
ATOM   6790  H HG11   . VAL A 1 17  ? 18.507 9.149   2.941   1.00 0.00 ? 230 VAL A HG11   4  
ATOM   6791  H HG12   . VAL A 1 17  ? 17.237 9.535   1.755   1.00 0.00 ? 230 VAL A HG12   4  
ATOM   6792  H HG13   . VAL A 1 17  ? 16.949 9.812   3.490   1.00 0.00 ? 230 VAL A HG13   4  
ATOM   6793  H HG21   . VAL A 1 17  ? 17.832 7.291   1.017   1.00 0.00 ? 230 VAL A HG21   4  
ATOM   6794  H HG22   . VAL A 1 17  ? 16.937 5.929   1.732   1.00 0.00 ? 230 VAL A HG22   4  
ATOM   6795  H HG23   . VAL A 1 17  ? 16.054 7.267   0.959   1.00 0.00 ? 230 VAL A HG23   4  
ATOM   6796  N N      . ALA A 1 18  ? 17.226 7.836   6.191   1.00 0.00 ? 231 ALA A N      4  
ATOM   6797  C CA     . ALA A 1 18  ? 17.511 8.624   7.378   1.00 0.00 ? 231 ALA A CA     4  
ATOM   6798  C C      . ALA A 1 18  ? 18.651 7.968   8.158   1.00 0.00 ? 231 ALA A C      4  
ATOM   6799  O O      . ALA A 1 18  ? 19.337 8.629   8.937   1.00 0.00 ? 231 ALA A O      4  
ATOM   6800  C CB     . ALA A 1 18  ? 16.237 8.765   8.214   1.00 0.00 ? 231 ALA A CB     4  
ATOM   6801  H H      . ALA A 1 18  ? 16.377 7.309   6.227   1.00 0.00 ? 231 ALA A H      4  
ATOM   6802  H HA     . ALA A 1 18  ? 17.828 9.614   7.052   1.00 0.00 ? 231 ALA A HA     4  
ATOM   6803  H HB1    . ALA A 1 18  ? 16.013 7.815   8.698   1.00 0.00 ? 231 ALA A HB1    4  
ATOM   6804  H HB2    . ALA A 1 18  ? 16.386 9.533   8.974   1.00 0.00 ? 231 ALA A HB2    4  
ATOM   6805  H HB3    . ALA A 1 18  ? 15.408 9.049   7.568   1.00 0.00 ? 231 ALA A HB3    4  
ATOM   6806  N N      . ALA A 1 19  ? 18.820 6.675   7.923   1.00 0.00 ? 232 ALA A N      4  
ATOM   6807  C CA     . ALA A 1 19  ? 19.866 5.921   8.594   1.00 0.00 ? 232 ALA A CA     4  
ATOM   6808  C C      . ALA A 1 19  ? 21.215 6.244   7.949   1.00 0.00 ? 232 ALA A C      4  
ATOM   6809  O O      . ALA A 1 19  ? 22.266 5.968   8.526   1.00 0.00 ? 232 ALA A O      4  
ATOM   6810  C CB     . ALA A 1 19  ? 19.536 4.429   8.540   1.00 0.00 ? 232 ALA A CB     4  
ATOM   6811  H H      . ALA A 1 19  ? 18.258 6.144   7.289   1.00 0.00 ? 232 ALA A H      4  
ATOM   6812  H HA     . ALA A 1 19  ? 19.886 6.239   9.637   1.00 0.00 ? 232 ALA A HA     4  
ATOM   6813  H HB1    . ALA A 1 19  ? 18.476 4.298   8.319   1.00 0.00 ? 232 ALA A HB1    4  
ATOM   6814  H HB2    . ALA A 1 19  ? 20.129 3.954   7.758   1.00 0.00 ? 232 ALA A HB2    4  
ATOM   6815  H HB3    . ALA A 1 19  ? 19.766 3.970   9.501   1.00 0.00 ? 232 ALA A HB3    4  
ATOM   6816  N N      . VAL A 1 20  ? 21.142 6.825   6.760   1.00 0.00 ? 233 VAL A N      4  
ATOM   6817  C CA     . VAL A 1 20  ? 22.346 7.188   6.031   1.00 0.00 ? 233 VAL A CA     4  
ATOM   6818  C C      . VAL A 1 20  ? 22.513 8.709   6.056   1.00 0.00 ? 233 VAL A C      4  
ATOM   6819  O O      . VAL A 1 20  ? 21.704 9.436   5.482   1.00 0.00 ? 233 VAL A O      4  
ATOM   6820  C CB     . VAL A 1 20  ? 22.289 6.617   4.612   1.00 0.00 ? 233 VAL A CB     4  
ATOM   6821  C CG1    . VAL A 1 20  ? 23.585 6.907   3.852   1.00 0.00 ? 233 VAL A CG1    4  
ATOM   6822  C CG2    . VAL A 1 20  ? 21.993 5.117   4.637   1.00 0.00 ? 233 VAL A CG2    4  
ATOM   6823  H H      . VAL A 1 20  ? 20.284 7.046   6.297   1.00 0.00 ? 233 VAL A H      4  
ATOM   6824  H HA     . VAL A 1 20  ? 23.192 6.733   6.544   1.00 0.00 ? 233 VAL A HA     4  
ATOM   6825  H HB     . VAL A 1 20  ? 21.473 7.111   4.083   1.00 0.00 ? 233 VAL A HB     4  
ATOM   6826  H HG11   . VAL A 1 20  ? 24.293 7.401   4.518   1.00 0.00 ? 233 VAL A HG11   4  
ATOM   6827  H HG12   . VAL A 1 20  ? 24.015 5.972   3.494   1.00 0.00 ? 233 VAL A HG12   4  
ATOM   6828  H HG13   . VAL A 1 20  ? 23.371 7.558   3.004   1.00 0.00 ? 233 VAL A HG13   4  
ATOM   6829  H HG21   . VAL A 1 20  ? 21.460 4.836   3.728   1.00 0.00 ? 233 VAL A HG21   4  
ATOM   6830  H HG22   . VAL A 1 20  ? 22.930 4.562   4.694   1.00 0.00 ? 233 VAL A HG22   4  
ATOM   6831  H HG23   . VAL A 1 20  ? 21.378 4.881   5.506   1.00 0.00 ? 233 VAL A HG23   4  
ATOM   6832  N N      . PRO A 1 21  ? 23.596 9.156   6.746   1.00 0.00 ? 234 PRO A N      4  
ATOM   6833  C CA     . PRO A 1 21  ? 23.880 10.577  6.854   1.00 0.00 ? 234 PRO A CA     4  
ATOM   6834  C C      . PRO A 1 21  ? 24.446 11.125  5.542   1.00 0.00 ? 234 PRO A C      4  
ATOM   6835  O O      . PRO A 1 21  ? 24.336 12.318  5.265   1.00 0.00 ? 234 PRO A O      4  
ATOM   6836  C CB     . PRO A 1 21  ? 24.852 10.696  8.015   1.00 0.00 ? 234 PRO A CB     4  
ATOM   6837  C CG     . PRO A 1 21  ? 25.436 9.306   8.216   1.00 0.00 ? 234 PRO A CG     4  
ATOM   6838  C CD     . PRO A 1 21  ? 24.576 8.324   7.438   1.00 0.00 ? 234 PRO A CD     4  
ATOM   6839  H HA     . PRO A 1 21  ? 23.036 11.088  7.022   1.00 0.00 ? 234 PRO A HA     4  
ATOM   6840  H HB2    . PRO A 1 21  ? 25.636 11.421  7.796   1.00 0.00 ? 234 PRO A HB2    4  
ATOM   6841  H HB3    . PRO A 1 21  ? 24.344 11.040  8.917   1.00 0.00 ? 234 PRO A HB3    4  
ATOM   6842  H HG2    . PRO A 1 21  ? 26.468 9.273   7.866   1.00 0.00 ? 234 PRO A HG2    4  
ATOM   6843  H HG3    . PRO A 1 21  ? 25.450 9.047   9.274   1.00 0.00 ? 234 PRO A HG3    4  
ATOM   6844  H HD2    . PRO A 1 21  ? 25.174 7.747   6.733   1.00 0.00 ? 234 PRO A HD2    4  
ATOM   6845  H HD3    . PRO A 1 21  ? 24.090 7.611   8.103   1.00 0.00 ? 234 PRO A HD3    4  
ATOM   6846  N N      . LEU A 1 22  ? 25.037 10.226  4.769   1.00 0.00 ? 235 LEU A N      4  
ATOM   6847  C CA     . LEU A 1 22  ? 25.620 10.604  3.493   1.00 0.00 ? 235 LEU A CA     4  
ATOM   6848  C C      . LEU A 1 22  ? 24.548 11.266  2.624   1.00 0.00 ? 235 LEU A C      4  
ATOM   6849  O O      . LEU A 1 22  ? 24.823 12.245  1.933   1.00 0.00 ? 235 LEU A O      4  
ATOM   6850  C CB     . LEU A 1 22  ? 26.290 9.398   2.832   1.00 0.00 ? 235 LEU A CB     4  
ATOM   6851  C CG     . LEU A 1 22  ? 26.535 9.509   1.325   1.00 0.00 ? 235 LEU A CG     4  
ATOM   6852  C CD1    . LEU A 1 22  ? 28.026 9.679   1.024   1.00 0.00 ? 235 LEU A CD1    4  
ATOM   6853  C CD2    . LEU A 1 22  ? 25.933 8.316   0.582   1.00 0.00 ? 235 LEU A CD2    4  
ATOM   6854  H H      . LEU A 1 22  ? 25.122 9.257   5.002   1.00 0.00 ? 235 LEU A H      4  
ATOM   6855  H HA     . LEU A 1 22  ? 26.402 11.336  3.695   1.00 0.00 ? 235 LEU A HA     4  
ATOM   6856  H HB2    . LEU A 1 22  ? 27.247 9.224   3.324   1.00 0.00 ? 235 LEU A HB2    4  
ATOM   6857  H HB3    . LEU A 1 22  ? 25.673 8.518   3.015   1.00 0.00 ? 235 LEU A HB3    4  
ATOM   6858  H HG     . LEU A 1 22  ? 26.030 10.404  0.962   1.00 0.00 ? 235 LEU A HG     4  
ATOM   6859  H HD11   . LEU A 1 22  ? 28.549 8.747   1.238   1.00 0.00 ? 235 LEU A HD11   4  
ATOM   6860  H HD12   . LEU A 1 22  ? 28.157 9.935   -0.028  1.00 0.00 ? 235 LEU A HD12   4  
ATOM   6861  H HD13   . LEU A 1 22  ? 28.433 10.476  1.646   1.00 0.00 ? 235 LEU A HD13   4  
ATOM   6862  H HD21   . LEU A 1 22  ? 24.960 8.075   1.010   1.00 0.00 ? 235 LEU A HD21   4  
ATOM   6863  H HD22   . LEU A 1 22  ? 25.815 8.566   -0.472  1.00 0.00 ? 235 LEU A HD22   4  
ATOM   6864  H HD23   . LEU A 1 22  ? 26.595 7.455   0.678   1.00 0.00 ? 235 LEU A HD23   4  
ATOM   6865  N N      . PHE A 1 23  ? 23.350 10.703  2.687   1.00 0.00 ? 236 PHE A N      4  
ATOM   6866  C CA     . PHE A 1 23  ? 22.237 11.226  1.915   1.00 0.00 ? 236 PHE A CA     4  
ATOM   6867  C C      . PHE A 1 23  ? 21.646 12.472  2.579   1.00 0.00 ? 236 PHE A C      4  
ATOM   6868  O O      . PHE A 1 23  ? 20.867 13.197  1.963   1.00 0.00 ? 236 PHE A O      4  
ATOM   6869  C CB     . PHE A 1 23  ? 21.170 10.131  1.871   1.00 0.00 ? 236 PHE A CB     4  
ATOM   6870  C CG     . PHE A 1 23  ? 21.446 9.032   0.843   1.00 0.00 ? 236 PHE A CG     4  
ATOM   6871  C CD1    . PHE A 1 23  ? 21.904 9.360   -0.395  1.00 0.00 ? 236 PHE A CD1    4  
ATOM   6872  C CD2    . PHE A 1 23  ? 21.234 7.729   1.167   1.00 0.00 ? 236 PHE A CD2    4  
ATOM   6873  C CE1    . PHE A 1 23  ? 22.161 8.340   -1.349  1.00 0.00 ? 236 PHE A CE1    4  
ATOM   6874  C CE2    . PHE A 1 23  ? 21.492 6.709   0.213   1.00 0.00 ? 236 PHE A CE2    4  
ATOM   6875  C CZ     . PHE A 1 23  ? 21.949 7.036   -1.025  1.00 0.00 ? 236 PHE A CZ     4  
ATOM   6876  H H      . PHE A 1 23  ? 23.136 9.907   3.252   1.00 0.00 ? 236 PHE A H      4  
ATOM   6877  H HA     . PHE A 1 23  ? 22.622 11.490  0.930   1.00 0.00 ? 236 PHE A HA     4  
ATOM   6878  H HB2    . PHE A 1 23  ? 21.088 9.678   2.859   1.00 0.00 ? 236 PHE A HB2    4  
ATOM   6879  H HB3    . PHE A 1 23  ? 20.204 10.587  1.649   1.00 0.00 ? 236 PHE A HB3    4  
ATOM   6880  H HD1    . PHE A 1 23  ? 22.073 10.405  -0.654  1.00 0.00 ? 236 PHE A HD1    4  
ATOM   6881  H HD2    . PHE A 1 23  ? 20.867 7.467   2.160   1.00 0.00 ? 236 PHE A HD2    4  
ATOM   6882  H HE1    . PHE A 1 23  ? 22.528 8.602   -2.342  1.00 0.00 ? 236 PHE A HE1    4  
ATOM   6883  H HE2    . PHE A 1 23  ? 21.322 5.664   0.473   1.00 0.00 ? 236 PHE A HE2    4  
ATOM   6884  H HZ     . PHE A 1 23  ? 22.147 6.254   -1.758  1.00 0.00 ? 236 PHE A HZ     4  
ATOM   6885  N N      . GLN A 1 24  ? 22.041 12.682  3.826   1.00 0.00 ? 237 GLN A N      4  
ATOM   6886  C CA     . GLN A 1 24  ? 21.559 13.828  4.580   1.00 0.00 ? 237 GLN A CA     4  
ATOM   6887  C C      . GLN A 1 24  ? 22.318 15.091  4.166   1.00 0.00 ? 237 GLN A C      4  
ATOM   6888  O O      . GLN A 1 24  ? 21.849 16.204  4.400   1.00 0.00 ? 237 GLN A O      4  
ATOM   6889  C CB     . GLN A 1 24  ? 21.681 13.583  6.085   1.00 0.00 ? 237 GLN A CB     4  
ATOM   6890  C CG     . GLN A 1 24  ? 20.762 12.445  6.532   1.00 0.00 ? 237 GLN A CG     4  
ATOM   6891  C CD     . GLN A 1 24  ? 19.299 12.765  6.213   1.00 0.00 ? 237 GLN A CD     4  
ATOM   6892  O OE1    . GLN A 1 24  ? 18.627 13.494  6.924   1.00 0.00 ? 237 GLN A OE1    4  
ATOM   6893  N NE2    . GLN A 1 24  ? 18.846 12.181  5.108   1.00 0.00 ? 237 GLN A NE2    4  
ATOM   6894  H H      . GLN A 1 24  ? 22.675 12.087  4.320   1.00 0.00 ? 237 GLN A H      4  
ATOM   6895  H HA     . GLN A 1 24  ? 20.506 13.926  4.318   1.00 0.00 ? 237 GLN A HA     4  
ATOM   6896  H HB2    . GLN A 1 24  ? 22.714 13.340  6.335   1.00 0.00 ? 237 GLN A HB2    4  
ATOM   6897  H HB3    . GLN A 1 24  ? 21.428 14.494  6.627   1.00 0.00 ? 237 GLN A HB3    4  
ATOM   6898  H HG2    . GLN A 1 24  ? 21.052 11.521  6.034   1.00 0.00 ? 237 GLN A HG2    4  
ATOM   6899  H HG3    . GLN A 1 24  ? 20.876 12.279  7.603   1.00 0.00 ? 237 GLN A HG3    4  
ATOM   6900  H HE21   . GLN A 1 24  ? 19.450 11.593  4.569   1.00 0.00 ? 237 GLN A HE21   4  
ATOM   6901  H HE22   . GLN A 1 24  ? 17.901 12.329  4.815   1.00 0.00 ? 237 GLN A HE22   4  
ATOM   6902  N N      . LYS A 1 25  ? 23.476 14.876  3.560   1.00 0.00 ? 238 LYS A N      4  
ATOM   6903  C CA     . LYS A 1 25  ? 24.302 15.983  3.112   1.00 0.00 ? 238 LYS A CA     4  
ATOM   6904  C C      . LYS A 1 25  ? 23.729 16.550  1.811   1.00 0.00 ? 238 LYS A C      4  
ATOM   6905  O O      . LYS A 1 25  ? 24.267 17.506  1.255   1.00 0.00 ? 238 LYS A O      4  
ATOM   6906  C CB     . LYS A 1 25  ? 25.766 15.549  3.000   1.00 0.00 ? 238 LYS A CB     4  
ATOM   6907  C CG     . LYS A 1 25  ? 26.424 15.480  4.380   1.00 0.00 ? 238 LYS A CG     4  
ATOM   6908  C CD     . LYS A 1 25  ? 27.240 14.195  4.534   1.00 0.00 ? 238 LYS A CD     4  
ATOM   6909  C CE     . LYS A 1 25  ? 28.065 14.220  5.821   1.00 0.00 ? 238 LYS A CE     4  
ATOM   6910  N NZ     . LYS A 1 25  ? 28.111 12.875  6.435   1.00 0.00 ? 238 LYS A NZ     4  
ATOM   6911  H H      . LYS A 1 25  ? 23.850 13.967  3.375   1.00 0.00 ? 238 LYS A H      4  
ATOM   6912  H HA     . LYS A 1 25  ? 24.254 16.758  3.877   1.00 0.00 ? 238 LYS A HA     4  
ATOM   6913  H HB2    . LYS A 1 25  ? 25.824 14.575  2.516   1.00 0.00 ? 238 LYS A HB2    4  
ATOM   6914  H HB3    . LYS A 1 25  ? 26.310 16.251  2.369   1.00 0.00 ? 238 LYS A HB3    4  
ATOM   6915  H HG2    . LYS A 1 25  ? 27.071 16.345  4.522   1.00 0.00 ? 238 LYS A HG2    4  
ATOM   6916  H HG3    . LYS A 1 25  ? 25.658 15.523  5.155   1.00 0.00 ? 238 LYS A HG3    4  
ATOM   6917  H HD2    . LYS A 1 25  ? 26.572 13.334  4.543   1.00 0.00 ? 238 LYS A HD2    4  
ATOM   6918  H HD3    . LYS A 1 25  ? 27.902 14.075  3.676   1.00 0.00 ? 238 LYS A HD3    4  
ATOM   6919  H HE2    . LYS A 1 25  ? 29.077 14.563  5.605   1.00 0.00 ? 238 LYS A HE2    4  
ATOM   6920  H HE3    . LYS A 1 25  ? 27.632 14.932  6.524   1.00 0.00 ? 238 LYS A HE3    4  
ATOM   6921  H HZ1    . LYS A 1 25  ? 27.783 12.926  7.378   1.00 0.00 ? 238 LYS A HZ1    4  
ATOM   6922  H HZ2    . LYS A 1 25  ? 27.530 12.250  5.914   1.00 0.00 ? 238 LYS A HZ2    4  
ATOM   6923  H HZ3    . LYS A 1 25  ? 29.052 12.537  6.428   1.00 0.00 ? 238 LYS A HZ3    4  
ATOM   6924  N N      . LEU A 1 26  ? 22.643 15.935  1.365   1.00 0.00 ? 239 LEU A N      4  
ATOM   6925  C CA     . LEU A 1 26  ? 21.990 16.366  0.140   1.00 0.00 ? 239 LEU A CA     4  
ATOM   6926  C C      . LEU A 1 26  ? 20.781 17.236  0.491   1.00 0.00 ? 239 LEU A C      4  
ATOM   6927  O O      . LEU A 1 26  ? 20.091 16.978  1.475   1.00 0.00 ? 239 LEU A O      4  
ATOM   6928  C CB     . LEU A 1 26  ? 21.647 15.160  -0.737  1.00 0.00 ? 239 LEU A CB     4  
ATOM   6929  C CG     . LEU A 1 26  ? 22.829 14.305  -1.194  1.00 0.00 ? 239 LEU A CG     4  
ATOM   6930  C CD1    . LEU A 1 26  ? 22.348 12.989  -1.810  1.00 0.00 ? 239 LEU A CD1    4  
ATOM   6931  C CD2    . LEU A 1 26  ? 23.734 15.087  -2.148  1.00 0.00 ? 239 LEU A CD2    4  
ATOM   6932  H H      . LEU A 1 26  ? 22.212 15.158  1.823   1.00 0.00 ? 239 LEU A H      4  
ATOM   6933  H HA     . LEU A 1 26  ? 22.704 16.974  -0.414  1.00 0.00 ? 239 LEU A HA     4  
ATOM   6934  H HB2    . LEU A 1 26  ? 20.954 14.522  -0.187  1.00 0.00 ? 239 LEU A HB2    4  
ATOM   6935  H HB3    . LEU A 1 26  ? 21.118 15.517  -1.620  1.00 0.00 ? 239 LEU A HB3    4  
ATOM   6936  H HG     . LEU A 1 26  ? 23.426 14.051  -0.319  1.00 0.00 ? 239 LEU A HG     4  
ATOM   6937  H HD11   . LEU A 1 26  ? 21.932 13.182  -2.799  1.00 0.00 ? 239 LEU A HD11   4  
ATOM   6938  H HD12   . LEU A 1 26  ? 23.189 12.301  -1.898  1.00 0.00 ? 239 LEU A HD12   4  
ATOM   6939  H HD13   . LEU A 1 26  ? 21.583 12.549  -1.173  1.00 0.00 ? 239 LEU A HD13   4  
ATOM   6940  H HD21   . LEU A 1 26  ? 24.119 14.417  -2.916  1.00 0.00 ? 239 LEU A HD21   4  
ATOM   6941  H HD22   . LEU A 1 26  ? 23.163 15.888  -2.618  1.00 0.00 ? 239 LEU A HD22   4  
ATOM   6942  H HD23   . LEU A 1 26  ? 24.567 15.515  -1.590  1.00 0.00 ? 239 LEU A HD23   4  
ATOM   6943  N N      . GLY A 1 27  ? 20.562 18.249  -0.335  1.00 0.00 ? 240 GLY A N      4  
ATOM   6944  C CA     . GLY A 1 27  ? 19.448 19.158  -0.124  1.00 0.00 ? 240 GLY A CA     4  
ATOM   6945  C C      . GLY A 1 27  ? 18.142 18.388  0.078   1.00 0.00 ? 240 GLY A C      4  
ATOM   6946  O O      . GLY A 1 27  ? 18.140 17.158  0.107   1.00 0.00 ? 240 GLY A O      4  
ATOM   6947  H H      . GLY A 1 27  ? 21.128 18.451  -1.135  1.00 0.00 ? 240 GLY A H      4  
ATOM   6948  H HA2    . GLY A 1 27  ? 19.645 19.784  0.746   1.00 0.00 ? 240 GLY A HA2    4  
ATOM   6949  H HA3    . GLY A 1 27  ? 19.352 19.826  -0.981  1.00 0.00 ? 240 GLY A HA3    4  
ATOM   6950  N N      . PRO A 1 28  ? 17.034 19.163  0.216   1.00 0.00 ? 241 PRO A N      4  
ATOM   6951  C CA     . PRO A 1 28  ? 15.724 18.567  0.414   1.00 0.00 ? 241 PRO A CA     4  
ATOM   6952  C C      . PRO A 1 28  ? 15.187 17.973  -0.890  1.00 0.00 ? 241 PRO A C      4  
ATOM   6953  O O      . PRO A 1 28  ? 14.615 16.884  -0.892  1.00 0.00 ? 241 PRO A O      4  
ATOM   6954  C CB     . PRO A 1 28  ? 14.857 19.693  0.955   1.00 0.00 ? 241 PRO A CB     4  
ATOM   6955  C CG     . PRO A 1 28  ? 15.580 20.982  0.602   1.00 0.00 ? 241 PRO A CG     4  
ATOM   6956  C CD     . PRO A 1 28  ? 16.998 20.622  0.187   1.00 0.00 ? 241 PRO A CD     4  
ATOM   6957  H HA     . PRO A 1 28  ? 15.783 17.804  1.058   1.00 0.00 ? 241 PRO A HA     4  
ATOM   6958  H HB2    . PRO A 1 28  ? 13.862 19.668  0.509   1.00 0.00 ? 241 PRO A HB2    4  
ATOM   6959  H HB3    . PRO A 1 28  ? 14.724 19.601  2.033   1.00 0.00 ? 241 PRO A HB3    4  
ATOM   6960  H HG2    . PRO A 1 28  ? 15.065 21.500  -0.207  1.00 0.00 ? 241 PRO A HG2    4  
ATOM   6961  H HG3    . PRO A 1 28  ? 15.592 21.659  1.456   1.00 0.00 ? 241 PRO A HG3    4  
ATOM   6962  H HD2    . PRO A 1 28  ? 17.228 21.004  -0.807  1.00 0.00 ? 241 PRO A HD2    4  
ATOM   6963  H HD3    . PRO A 1 28  ? 17.731 21.050  0.870   1.00 0.00 ? 241 PRO A HD3    4  
ATOM   6964  N N      . ALA A 1 29  ? 15.392 18.714  -1.968  1.00 0.00 ? 242 ALA A N      4  
ATOM   6965  C CA     . ALA A 1 29  ? 14.937 18.275  -3.276  1.00 0.00 ? 242 ALA A CA     4  
ATOM   6966  C C      . ALA A 1 29  ? 15.907 17.226  -3.823  1.00 0.00 ? 242 ALA A C      4  
ATOM   6967  O O      . ALA A 1 29  ? 15.529 16.399  -4.653  1.00 0.00 ? 242 ALA A O      4  
ATOM   6968  C CB     . ALA A 1 29  ? 14.803 19.485  -4.203  1.00 0.00 ? 242 ALA A CB     4  
ATOM   6969  H H      . ALA A 1 29  ? 15.858 19.599  -1.958  1.00 0.00 ? 242 ALA A H      4  
ATOM   6970  H HA     . ALA A 1 29  ? 13.955 17.820  -3.150  1.00 0.00 ? 242 ALA A HA     4  
ATOM   6971  H HB1    . ALA A 1 29  ? 13.835 19.455  -4.703  1.00 0.00 ? 242 ALA A HB1    4  
ATOM   6972  H HB2    . ALA A 1 29  ? 14.883 20.402  -3.619  1.00 0.00 ? 242 ALA A HB2    4  
ATOM   6973  H HB3    . ALA A 1 29  ? 15.597 19.460  -4.950  1.00 0.00 ? 242 ALA A HB3    4  
ATOM   6974  N N      . VAL A 1 30  ? 17.137 17.292  -3.335  1.00 0.00 ? 243 VAL A N      4  
ATOM   6975  C CA     . VAL A 1 30  ? 18.163 16.359  -3.765  1.00 0.00 ? 243 VAL A CA     4  
ATOM   6976  C C      . VAL A 1 30  ? 17.951 15.015  -3.062  1.00 0.00 ? 243 VAL A C      4  
ATOM   6977  O O      . VAL A 1 30  ? 17.991 13.964  -3.699  1.00 0.00 ? 243 VAL A O      4  
ATOM   6978  C CB     . VAL A 1 30  ? 19.550 16.953  -3.514  1.00 0.00 ? 243 VAL A CB     4  
ATOM   6979  C CG1    . VAL A 1 30  ? 20.623 16.193  -4.297  1.00 0.00 ? 243 VAL A CG1    4  
ATOM   6980  C CG2    . VAL A 1 30  ? 19.577 18.444  -3.851  1.00 0.00 ? 243 VAL A CG2    4  
ATOM   6981  H H      . VAL A 1 30  ? 17.435 17.967  -2.661  1.00 0.00 ? 243 VAL A H      4  
ATOM   6982  H HA     . VAL A 1 30  ? 18.048 16.214  -4.839  1.00 0.00 ? 243 VAL A HA     4  
ATOM   6983  H HB     . VAL A 1 30  ? 19.773 16.845  -2.451  1.00 0.00 ? 243 VAL A HB     4  
ATOM   6984  H HG11   . VAL A 1 30  ? 20.594 16.500  -5.343  1.00 0.00 ? 243 VAL A HG11   4  
ATOM   6985  H HG12   . VAL A 1 30  ? 21.604 16.417  -3.880  1.00 0.00 ? 243 VAL A HG12   4  
ATOM   6986  H HG13   . VAL A 1 30  ? 20.434 15.122  -4.228  1.00 0.00 ? 243 VAL A HG13   4  
ATOM   6987  H HG21   . VAL A 1 30  ? 20.428 18.655  -4.498  1.00 0.00 ? 243 VAL A HG21   4  
ATOM   6988  H HG22   . VAL A 1 30  ? 18.654 18.717  -4.363  1.00 0.00 ? 243 VAL A HG22   4  
ATOM   6989  H HG23   . VAL A 1 30  ? 19.667 19.023  -2.932  1.00 0.00 ? 243 VAL A HG23   4  
ATOM   6990  N N      . LEU A 1 31  ? 17.731 15.095  -1.759  1.00 0.00 ? 244 LEU A N      4  
ATOM   6991  C CA     . LEU A 1 31  ? 17.512 13.899  -0.962  1.00 0.00 ? 244 LEU A CA     4  
ATOM   6992  C C      . LEU A 1 31  ? 16.224 13.214  -1.422  1.00 0.00 ? 244 LEU A C      4  
ATOM   6993  O O      . LEU A 1 31  ? 16.145 11.986  -1.448  1.00 0.00 ? 244 LEU A O      4  
ATOM   6994  C CB     . LEU A 1 31  ? 17.530 14.239  0.530   1.00 0.00 ? 244 LEU A CB     4  
ATOM   6995  C CG     . LEU A 1 31  ? 16.640 13.374  1.425   1.00 0.00 ? 244 LEU A CG     4  
ATOM   6996  C CD1    . LEU A 1 31  ? 17.077 11.908  1.379   1.00 0.00 ? 244 LEU A CD1    4  
ATOM   6997  C CD2    . LEU A 1 31  ? 16.607 13.918  2.854   1.00 0.00 ? 244 LEU A CD2    4  
ATOM   6998  H H      . LEU A 1 31  ? 17.700 15.954  -1.248  1.00 0.00 ? 244 LEU A H      4  
ATOM   6999  H HA     . LEU A 1 31  ? 18.348 13.226  -1.149  1.00 0.00 ? 244 LEU A HA     4  
ATOM   7000  H HB2    . LEU A 1 31  ? 18.557 14.161  0.887   1.00 0.00 ? 244 LEU A HB2    4  
ATOM   7001  H HB3    . LEU A 1 31  ? 17.228 15.279  0.649   1.00 0.00 ? 244 LEU A HB3    4  
ATOM   7002  H HG     . LEU A 1 31  ? 15.622 13.418  1.039   1.00 0.00 ? 244 LEU A HG     4  
ATOM   7003  H HD11   . LEU A 1 31  ? 16.228 11.269  1.624   1.00 0.00 ? 244 LEU A HD11   4  
ATOM   7004  H HD12   . LEU A 1 31  ? 17.437 11.667  0.379   1.00 0.00 ? 244 LEU A HD12   4  
ATOM   7005  H HD13   . LEU A 1 31  ? 17.876 11.744  2.103   1.00 0.00 ? 244 LEU A HD13   4  
ATOM   7006  H HD21   . LEU A 1 31  ? 17.613 13.905  3.272   1.00 0.00 ? 244 LEU A HD21   4  
ATOM   7007  H HD22   . LEU A 1 31  ? 16.229 14.941  2.845   1.00 0.00 ? 244 LEU A HD22   4  
ATOM   7008  H HD23   . LEU A 1 31  ? 15.952 13.295  3.465   1.00 0.00 ? 244 LEU A HD23   4  
ATOM   7009  N N      . VAL A 1 32  ? 15.247 14.036  -1.773  1.00 0.00 ? 245 VAL A N      4  
ATOM   7010  C CA     . VAL A 1 32  ? 13.966 13.525  -2.229  1.00 0.00 ? 245 VAL A CA     4  
ATOM   7011  C C      . VAL A 1 32  ? 14.136 12.904  -3.618  1.00 0.00 ? 245 VAL A C      4  
ATOM   7012  O O      . VAL A 1 32  ? 13.476 11.918  -3.945  1.00 0.00 ? 245 VAL A O      4  
ATOM   7013  C CB     . VAL A 1 32  ? 12.916 14.637  -2.197  1.00 0.00 ? 245 VAL A CB     4  
ATOM   7014  C CG1    . VAL A 1 32  ? 11.619 14.188  -2.874  1.00 0.00 ? 245 VAL A CG1    4  
ATOM   7015  C CG2    . VAL A 1 32  ? 12.654 15.101  -0.763  1.00 0.00 ? 245 VAL A CG2    4  
ATOM   7016  H H      . VAL A 1 32  ? 15.319 15.033  -1.748  1.00 0.00 ? 245 VAL A H      4  
ATOM   7017  H HA     . VAL A 1 32  ? 13.654 12.746  -1.532  1.00 0.00 ? 245 VAL A HA     4  
ATOM   7018  H HB     . VAL A 1 32  ? 13.308 15.486  -2.756  1.00 0.00 ? 245 VAL A HB     4  
ATOM   7019  H HG11   . VAL A 1 32  ? 11.849 13.760  -3.849  1.00 0.00 ? 245 VAL A HG11   4  
ATOM   7020  H HG12   . VAL A 1 32  ? 11.128 13.438  -2.254  1.00 0.00 ? 245 VAL A HG12   4  
ATOM   7021  H HG13   . VAL A 1 32  ? 10.959 15.045  -2.999  1.00 0.00 ? 245 VAL A HG13   4  
ATOM   7022  H HG21   . VAL A 1 32  ? 13.550 14.948  -0.162  1.00 0.00 ? 245 VAL A HG21   4  
ATOM   7023  H HG22   . VAL A 1 32  ? 12.394 16.160  -0.764  1.00 0.00 ? 245 VAL A HG22   4  
ATOM   7024  H HG23   . VAL A 1 32  ? 11.829 14.527  -0.340  1.00 0.00 ? 245 VAL A HG23   4  
ATOM   7025  N N      . GLU A 1 33  ? 15.022 13.507  -4.396  1.00 0.00 ? 246 GLU A N      4  
ATOM   7026  C CA     . GLU A 1 33  ? 15.286 13.025  -5.741  1.00 0.00 ? 246 GLU A CA     4  
ATOM   7027  C C      . GLU A 1 33  ? 16.195 11.795  -5.695  1.00 0.00 ? 246 GLU A C      4  
ATOM   7028  O O      . GLU A 1 33  ? 16.134 10.940  -6.578  1.00 0.00 ? 246 GLU A O      4  
ATOM   7029  C CB     . GLU A 1 33  ? 15.900 14.128  -6.607  1.00 0.00 ? 246 GLU A CB     4  
ATOM   7030  C CG     . GLU A 1 33  ? 14.812 15.000  -7.234  1.00 0.00 ? 246 GLU A CG     4  
ATOM   7031  C CD     . GLU A 1 33  ? 14.860 14.925  -8.762  1.00 0.00 ? 246 GLU A CD     4  
ATOM   7032  O OE1    . GLU A 1 33  ? 14.175 14.085  -9.363  1.00 0.00 ? 246 GLU A OE1    4  
ATOM   7033  O OE2    . GLU A 1 33  ? 15.643 15.781  -9.326  1.00 0.00 ? 246 GLU A OE2    4  
ATOM   7034  H H      . GLU A 1 33  ? 15.554 14.308  -4.122  1.00 0.00 ? 246 GLU A H      4  
ATOM   7035  H HA     . GLU A 1 33  ? 14.314 12.752  -6.148  1.00 0.00 ? 246 GLU A HA     4  
ATOM   7036  H HB2    . GLU A 1 33  ? 16.563 14.745  -6.001  1.00 0.00 ? 246 GLU A HB2    4  
ATOM   7037  H HB3    . GLU A 1 33  ? 16.510 13.682  -7.392  1.00 0.00 ? 246 GLU A HB3    4  
ATOM   7038  H HG2    . GLU A 1 33  ? 13.832 14.678  -6.881  1.00 0.00 ? 246 GLU A HG2    4  
ATOM   7039  H HG3    . GLU A 1 33  ? 14.941 16.035  -6.913  1.00 0.00 ? 246 GLU A HG3    4  
ATOM   7040  H HE2    . GLU A 1 33  ? 16.428 15.969  -8.733  1.00 0.00 ? 246 GLU A HE2    4  
ATOM   7041  N N      . ILE A 1 34  ? 17.018 11.744  -4.657  1.00 0.00 ? 247 ILE A N      4  
ATOM   7042  C CA     . ILE A 1 34  ? 17.937 10.632  -4.486  1.00 0.00 ? 247 ILE A CA     4  
ATOM   7043  C C      . ILE A 1 34  ? 17.179 9.431   -3.918  1.00 0.00 ? 247 ILE A C      4  
ATOM   7044  O O      . ILE A 1 34  ? 17.537 8.285   -4.182  1.00 0.00 ? 247 ILE A O      4  
ATOM   7045  C CB     . ILE A 1 34  ? 19.139 11.058  -3.638  1.00 0.00 ? 247 ILE A CB     4  
ATOM   7046  C CG1    . ILE A 1 34  ? 20.450 10.583  -4.268  1.00 0.00 ? 247 ILE A CG1    4  
ATOM   7047  C CG2    . ILE A 1 34  ? 18.989 10.575  -2.194  1.00 0.00 ? 247 ILE A CG2    4  
ATOM   7048  C CD1    . ILE A 1 34  ? 20.811 11.434  -5.488  1.00 0.00 ? 247 ILE A CD1    4  
ATOM   7049  H H      . ILE A 1 34  ? 17.062 12.444  -3.945  1.00 0.00 ? 247 ILE A H      4  
ATOM   7050  H HA     . ILE A 1 34  ? 18.318 10.367  -5.472  1.00 0.00 ? 247 ILE A HA     4  
ATOM   7051  H HB     . ILE A 1 34  ? 19.169 12.147  -3.612  1.00 0.00 ? 247 ILE A HB     4  
ATOM   7052  H HG12   . ILE A 1 34  ? 21.251 10.637  -3.533  1.00 0.00 ? 247 ILE A HG12   4  
ATOM   7053  H HG13   . ILE A 1 34  ? 20.358 9.538   -4.564  1.00 0.00 ? 247 ILE A HG13   4  
ATOM   7054  H HG21   . ILE A 1 34  ? 19.254 9.520   -2.134  1.00 0.00 ? 247 ILE A HG21   4  
ATOM   7055  H HG22   . ILE A 1 34  ? 19.650 11.153  -1.548  1.00 0.00 ? 247 ILE A HG22   4  
ATOM   7056  H HG23   . ILE A 1 34  ? 17.957 10.709  -1.871  1.00 0.00 ? 247 ILE A HG23   4  
ATOM   7057  H HD11   . ILE A 1 34  ? 21.432 10.850  -6.166  1.00 0.00 ? 247 ILE A HD11   4  
ATOM   7058  H HD12   . ILE A 1 34  ? 19.900 11.738  -6.001  1.00 0.00 ? 247 ILE A HD12   4  
ATOM   7059  H HD13   . ILE A 1 34  ? 21.360 12.319  -5.164  1.00 0.00 ? 247 ILE A HD13   4  
ATOM   7060  N N      . VAL A 1 35  ? 16.144 9.735   -3.149  1.00 0.00 ? 248 VAL A N      4  
ATOM   7061  C CA     . VAL A 1 35  ? 15.332 8.695   -2.541  1.00 0.00 ? 248 VAL A CA     4  
ATOM   7062  C C      . VAL A 1 35  ? 14.464 8.038   -3.617  1.00 0.00 ? 248 VAL A C      4  
ATOM   7063  O O      . VAL A 1 35  ? 14.308 6.819   -3.634  1.00 0.00 ? 248 VAL A O      4  
ATOM   7064  C CB     . VAL A 1 35  ? 14.514 9.277   -1.387  1.00 0.00 ? 248 VAL A CB     4  
ATOM   7065  C CG1    . VAL A 1 35  ? 13.514 8.250   -0.850  1.00 0.00 ? 248 VAL A CG1    4  
ATOM   7066  C CG2    . VAL A 1 35  ? 15.427 9.789   -0.271  1.00 0.00 ? 248 VAL A CG2    4  
ATOM   7067  H H      . VAL A 1 35  ? 15.859 10.671  -2.938  1.00 0.00 ? 248 VAL A H      4  
ATOM   7068  H HA     . VAL A 1 35  ? 16.009 7.946   -2.131  1.00 0.00 ? 248 VAL A HA     4  
ATOM   7069  H HB     . VAL A 1 35  ? 13.947 10.125  -1.771  1.00 0.00 ? 248 VAL A HB     4  
ATOM   7070  H HG11   . VAL A 1 35  ? 12.680 8.767   -0.377  1.00 0.00 ? 248 VAL A HG11   4  
ATOM   7071  H HG12   . VAL A 1 35  ? 13.144 7.639   -1.674  1.00 0.00 ? 248 VAL A HG12   4  
ATOM   7072  H HG13   . VAL A 1 35  ? 14.009 7.611   -0.118  1.00 0.00 ? 248 VAL A HG13   4  
ATOM   7073  H HG21   . VAL A 1 35  ? 16.451 9.851   -0.639  1.00 0.00 ? 248 VAL A HG21   4  
ATOM   7074  H HG22   . VAL A 1 35  ? 15.094 10.778  0.047   1.00 0.00 ? 248 VAL A HG22   4  
ATOM   7075  H HG23   . VAL A 1 35  ? 15.386 9.103   0.575   1.00 0.00 ? 248 VAL A HG23   4  
ATOM   7076  N N      . ARG A 1 36  ? 13.923 8.876   -4.489  1.00 0.00 ? 249 ARG A N      4  
ATOM   7077  C CA     . ARG A 1 36  ? 13.076 8.393   -5.566  1.00 0.00 ? 249 ARG A CA     4  
ATOM   7078  C C      . ARG A 1 36  ? 13.930 7.793   -6.684  1.00 0.00 ? 249 ARG A C      4  
ATOM   7079  O O      . ARG A 1 36  ? 13.403 7.180   -7.612  1.00 0.00 ? 249 ARG A O      4  
ATOM   7080  C CB     . ARG A 1 36  ? 12.217 9.521   -6.140  1.00 0.00 ? 249 ARG A CB     4  
ATOM   7081  C CG     . ARG A 1 36  ? 10.909 9.666   -5.357  1.00 0.00 ? 249 ARG A CG     4  
ATOM   7082  C CD     . ARG A 1 36  ? 9.938  10.601  -6.081  1.00 0.00 ? 249 ARG A CD     4  
ATOM   7083  N NE     . ARG A 1 36  ? 8.584  10.005  -6.103  1.00 0.00 ? 249 ARG A NE     4  
ATOM   7084  C CZ     . ARG A 1 36  ? 7.471  10.680  -6.419  1.00 0.00 ? 249 ARG A CZ     4  
ATOM   7085  N NH1    . ARG A 1 36  ? 7.545  11.978  -6.744  1.00 0.00 ? 249 ARG A NH1    4  
ATOM   7086  N NH2    . ARG A 1 36  ? 6.284  10.058  -6.413  1.00 0.00 ? 249 ARG A NH2    4  
ATOM   7087  H H      . ARG A 1 36  ? 14.055 9.868   -4.469  1.00 0.00 ? 249 ARG A H      4  
ATOM   7088  H HA     . ARG A 1 36  ? 12.445 7.634   -5.104  1.00 0.00 ? 249 ARG A HA     4  
ATOM   7089  H HB2    . ARG A 1 36  ? 12.770 10.459  -6.105  1.00 0.00 ? 249 ARG A HB2    4  
ATOM   7090  H HB3    . ARG A 1 36  ? 11.996 9.318   -7.188  1.00 0.00 ? 249 ARG A HB3    4  
ATOM   7091  H HG2    . ARG A 1 36  ? 10.449 8.687   -5.227  1.00 0.00 ? 249 ARG A HG2    4  
ATOM   7092  H HG3    . ARG A 1 36  ? 11.119 10.055  -4.361  1.00 0.00 ? 249 ARG A HG3    4  
ATOM   7093  H HD2    . ARG A 1 36  ? 9.911  11.569  -5.581  1.00 0.00 ? 249 ARG A HD2    4  
ATOM   7094  H HD3    . ARG A 1 36  ? 10.283 10.778  -7.100  1.00 0.00 ? 249 ARG A HD3    4  
ATOM   7095  H HE     . ARG A 1 36  ? 8.492  9.038   -5.865  1.00 0.00 ? 249 ARG A HE     4  
ATOM   7096  H HH11   . ARG A 1 36  ? 8.430  12.443  -6.750  1.00 0.00 ? 249 ARG A HH11   4  
ATOM   7097  H HH12   . ARG A 1 36  ? 6.714  12.483  -6.981  1.00 0.00 ? 249 ARG A HH12   4  
ATOM   7098  H HH21   . ARG A 1 36  ? 6.229  9.089   -6.171  1.00 0.00 ? 249 ARG A HH21   4  
ATOM   7099  H HH22   . ARG A 1 36  ? 5.453  10.562  -6.649  1.00 0.00 ? 249 ARG A HH22   4  
ATOM   7100  N N      . ALA A 1 37  ? 15.235 7.990   -6.560  1.00 0.00 ? 250 ALA A N      4  
ATOM   7101  C CA     . ALA A 1 37  ? 16.167 7.475   -7.550  1.00 0.00 ? 250 ALA A CA     4  
ATOM   7102  C C      . ALA A 1 37  ? 16.753 6.152   -7.052  1.00 0.00 ? 250 ALA A C      4  
ATOM   7103  O O      . ALA A 1 37  ? 16.999 5.243   -7.843  1.00 0.00 ? 250 ALA A O      4  
ATOM   7104  C CB     . ALA A 1 37  ? 17.246 8.523   -7.827  1.00 0.00 ? 250 ALA A CB     4  
ATOM   7105  H H      . ALA A 1 37  ? 15.655 8.489   -5.803  1.00 0.00 ? 250 ALA A H      4  
ATOM   7106  H HA     . ALA A 1 37  ? 15.609 7.294   -8.469  1.00 0.00 ? 250 ALA A HA     4  
ATOM   7107  H HB1    . ALA A 1 37  ? 18.190 8.024   -8.044  1.00 0.00 ? 250 ALA A HB1    4  
ATOM   7108  H HB2    . ALA A 1 37  ? 16.951 9.131   -8.684  1.00 0.00 ? 250 ALA A HB2    4  
ATOM   7109  H HB3    . ALA A 1 37  ? 17.366 9.163   -6.953  1.00 0.00 ? 250 ALA A HB3    4  
ATOM   7110  N N      . LEU A 1 38  ? 16.959 6.087   -5.744  1.00 0.00 ? 251 LEU A N      4  
ATOM   7111  C CA     . LEU A 1 38  ? 17.510 4.891   -5.133  1.00 0.00 ? 251 LEU A CA     4  
ATOM   7112  C C      . LEU A 1 38  ? 16.397 3.859   -4.943  1.00 0.00 ? 251 LEU A C      4  
ATOM   7113  O O      . LEU A 1 38  ? 15.233 4.221   -4.774  1.00 0.00 ? 251 LEU A O      4  
ATOM   7114  C CB     . LEU A 1 38  ? 18.249 5.242   -3.839  1.00 0.00 ? 251 LEU A CB     4  
ATOM   7115  C CG     . LEU A 1 38  ? 17.370 5.630   -2.650  1.00 0.00 ? 251 LEU A CG     4  
ATOM   7116  C CD1    . LEU A 1 38  ? 16.750 4.392   -1.999  1.00 0.00 ? 251 LEU A CD1    4  
ATOM   7117  C CD2    . LEU A 1 38  ? 18.152 6.476   -1.642  1.00 0.00 ? 251 LEU A CD2    4  
ATOM   7118  H H      . LEU A 1 38  ? 16.755 6.832   -5.109  1.00 0.00 ? 251 LEU A H      4  
ATOM   7119  H HA     . LEU A 1 38  ? 18.247 4.481   -5.824  1.00 0.00 ? 251 LEU A HA     4  
ATOM   7120  H HB2    . LEU A 1 38  ? 18.862 4.388   -3.551  1.00 0.00 ? 251 LEU A HB2    4  
ATOM   7121  H HB3    . LEU A 1 38  ? 18.931 6.067   -4.047  1.00 0.00 ? 251 LEU A HB3    4  
ATOM   7122  H HG     . LEU A 1 38  ? 16.549 6.246   -3.017  1.00 0.00 ? 251 LEU A HG     4  
ATOM   7123  H HD11   . LEU A 1 38  ? 15.689 4.347   -2.241  1.00 0.00 ? 251 LEU A HD11   4  
ATOM   7124  H HD12   . LEU A 1 38  ? 17.247 3.498   -2.374  1.00 0.00 ? 251 LEU A HD12   4  
ATOM   7125  H HD13   . LEU A 1 38  ? 16.874 4.450   -0.917  1.00 0.00 ? 251 LEU A HD13   4  
ATOM   7126  H HD21   . LEU A 1 38  ? 18.648 7.296   -2.164  1.00 0.00 ? 251 LEU A HD21   4  
ATOM   7127  H HD22   . LEU A 1 38  ? 17.467 6.882   -0.899  1.00 0.00 ? 251 LEU A HD22   4  
ATOM   7128  H HD23   . LEU A 1 38  ? 18.899 5.855   -1.149  1.00 0.00 ? 251 LEU A HD23   4  
ATOM   7129  N N      . ARG A 1 39  ? 16.792 2.595   -4.981  1.00 0.00 ? 252 ARG A N      4  
ATOM   7130  C CA     . ARG A 1 39  ? 15.842 1.508   -4.816  1.00 0.00 ? 252 ARG A CA     4  
ATOM   7131  C C      . ARG A 1 39  ? 16.355 0.508   -3.777  1.00 0.00 ? 252 ARG A C      4  
ATOM   7132  O O      . ARG A 1 39  ? 17.458 -0.019  -3.911  1.00 0.00 ? 252 ARG A O      4  
ATOM   7133  C CB     . ARG A 1 39  ? 15.601 0.781   -6.139  1.00 0.00 ? 252 ARG A CB     4  
ATOM   7134  C CG     . ARG A 1 39  ? 14.104 0.631   -6.418  1.00 0.00 ? 252 ARG A CG     4  
ATOM   7135  C CD     . ARG A 1 39  ? 13.520 -0.556  -5.649  1.00 0.00 ? 252 ARG A CD     4  
ATOM   7136  N NE     . ARG A 1 39  ? 12.182 -0.895  -6.182  1.00 0.00 ? 252 ARG A NE     4  
ATOM   7137  C CZ     . ARG A 1 39  ? 11.965 -1.395  -7.406  1.00 0.00 ? 252 ARG A CZ     4  
ATOM   7138  N NH1    . ARG A 1 39  ? 12.997 -1.617  -8.231  1.00 0.00 ? 252 ARG A NH1    4  
ATOM   7139  N NH2    . ARG A 1 39  ? 10.717 -1.673  -7.805  1.00 0.00 ? 252 ARG A NH2    4  
ATOM   7140  H H      . ARG A 1 39  ? 17.741 2.309   -5.120  1.00 0.00 ? 252 ARG A H      4  
ATOM   7141  H HA     . ARG A 1 39  ? 14.925 1.990   -4.476  1.00 0.00 ? 252 ARG A HA     4  
ATOM   7142  H HB2    . ARG A 1 39  ? 16.072 1.334   -6.953  1.00 0.00 ? 252 ARG A HB2    4  
ATOM   7143  H HB3    . ARG A 1 39  ? 16.069 -0.203  -6.108  1.00 0.00 ? 252 ARG A HB3    4  
ATOM   7144  H HG2    . ARG A 1 39  ? 13.584 1.545   -6.133  1.00 0.00 ? 252 ARG A HG2    4  
ATOM   7145  H HG3    . ARG A 1 39  ? 13.941 0.492   -7.487  1.00 0.00 ? 252 ARG A HG3    4  
ATOM   7146  H HD2    . ARG A 1 39  ? 14.182 -1.416  -5.733  1.00 0.00 ? 252 ARG A HD2    4  
ATOM   7147  H HD3    . ARG A 1 39  ? 13.447 -0.312  -4.589  1.00 0.00 ? 252 ARG A HD3    4  
ATOM   7148  H HE     . ARG A 1 39  ? 11.389 -0.741  -5.591  1.00 0.00 ? 252 ARG A HE     4  
ATOM   7149  H HH11   . ARG A 1 39  ? 13.928 -1.409  -7.933  1.00 0.00 ? 252 ARG A HH11   4  
ATOM   7150  H HH12   . ARG A 1 39  ? 12.835 -1.989  -9.146  1.00 0.00 ? 252 ARG A HH12   4  
ATOM   7151  H HH21   . ARG A 1 39  ? 9.946  -1.507  -7.189  1.00 0.00 ? 252 ARG A HH21   4  
ATOM   7152  H HH22   . ARG A 1 39  ? 10.554 -2.045  -8.719  1.00 0.00 ? 252 ARG A HH22   4  
ATOM   7153  N N      . ALA A 1 40  ? 15.529 0.276   -2.768  1.00 0.00 ? 253 ALA A N      4  
ATOM   7154  C CA     . ALA A 1 40  ? 15.887 -0.652  -1.708  1.00 0.00 ? 253 ALA A CA     4  
ATOM   7155  C C      . ALA A 1 40  ? 15.592 -2.081  -2.168  1.00 0.00 ? 253 ALA A C      4  
ATOM   7156  O O      . ALA A 1 40  ? 14.459 -2.402  -2.522  1.00 0.00 ? 253 ALA A O      4  
ATOM   7157  C CB     . ALA A 1 40  ? 15.130 -0.282  -0.430  1.00 0.00 ? 253 ALA A CB     4  
ATOM   7158  H H      . ALA A 1 40  ? 14.634 0.709   -2.667  1.00 0.00 ? 253 ALA A H      4  
ATOM   7159  H HA     . ALA A 1 40  ? 16.956 -0.551  -1.524  1.00 0.00 ? 253 ALA A HA     4  
ATOM   7160  H HB1    . ALA A 1 40  ? 15.546 0.636   -0.014  1.00 0.00 ? 253 ALA A HB1    4  
ATOM   7161  H HB2    . ALA A 1 40  ? 14.076 -0.132  -0.662  1.00 0.00 ? 253 ALA A HB2    4  
ATOM   7162  H HB3    . ALA A 1 40  ? 15.230 -1.088  0.297   1.00 0.00 ? 253 ALA A HB3    4  
ATOM   7163  N N      . ARG A 1 41  ? 16.632 -2.902  -2.146  1.00 0.00 ? 254 ARG A N      4  
ATOM   7164  C CA     . ARG A 1 41  ? 16.499 -4.289  -2.555  1.00 0.00 ? 254 ARG A CA     4  
ATOM   7165  C C      . ARG A 1 41  ? 17.296 -5.199  -1.618  1.00 0.00 ? 254 ARG A C      4  
ATOM   7166  O O      . ARG A 1 41  ? 18.399 -4.848  -1.197  1.00 0.00 ? 254 ARG A O      4  
ATOM   7167  C CB     . ARG A 1 41  ? 16.992 -4.489  -3.990  1.00 0.00 ? 254 ARG A CB     4  
ATOM   7168  C CG     . ARG A 1 41  ? 16.204 -5.598  -4.690  1.00 0.00 ? 254 ARG A CG     4  
ATOM   7169  C CD     . ARG A 1 41  ? 17.138 -6.699  -5.197  1.00 0.00 ? 254 ARG A CD     4  
ATOM   7170  N NE     . ARG A 1 41  ? 17.252 -6.629  -6.671  1.00 0.00 ? 254 ARG A NE     4  
ATOM   7171  C CZ     . ARG A 1 41  ? 17.929 -7.515  -7.414  1.00 0.00 ? 254 ARG A CZ     4  
ATOM   7172  N NH1    . ARG A 1 41  ? 18.558 -8.543  -6.827  1.00 0.00 ? 254 ARG A NH1    4  
ATOM   7173  N NH2    . ARG A 1 41  ? 17.978 -7.372  -8.745  1.00 0.00 ? 254 ARG A NH2    4  
ATOM   7174  H H      . ARG A 1 41  ? 17.550 -2.632  -1.856  1.00 0.00 ? 254 ARG A H      4  
ATOM   7175  H HA     . ARG A 1 41  ? 15.432 -4.498  -2.490  1.00 0.00 ? 254 ARG A HA     4  
ATOM   7176  H HB2    . ARG A 1 41  ? 16.889 -3.558  -4.547  1.00 0.00 ? 254 ARG A HB2    4  
ATOM   7177  H HB3    . ARG A 1 41  ? 18.053 -4.741  -3.982  1.00 0.00 ? 254 ARG A HB3    4  
ATOM   7178  H HG2    . ARG A 1 41  ? 15.475 -6.022  -4.001  1.00 0.00 ? 254 ARG A HG2    4  
ATOM   7179  H HG3    . ARG A 1 41  ? 15.645 -5.179  -5.528  1.00 0.00 ? 254 ARG A HG3    4  
ATOM   7180  H HD2    . ARG A 1 41  ? 18.123 -6.590  -4.741  1.00 0.00 ? 254 ARG A HD2    4  
ATOM   7181  H HD3    . ARG A 1 41  ? 16.756 -7.676  -4.898  1.00 0.00 ? 254 ARG A HD3    4  
ATOM   7182  H HE     . ARG A 1 41  ? 16.795 -5.874  -7.141  1.00 0.00 ? 254 ARG A HE     4  
ATOM   7183  H HH11   . ARG A 1 41  ? 18.521 -8.648  -5.833  1.00 0.00 ? 254 ARG A HH11   4  
ATOM   7184  H HH12   . ARG A 1 41  ? 19.063 -9.203  -7.382  1.00 0.00 ? 254 ARG A HH12   4  
ATOM   7185  H HH21   . ARG A 1 41  ? 17.510 -6.605  -9.185  1.00 0.00 ? 254 ARG A HH21   4  
ATOM   7186  H HH22   . ARG A 1 41  ? 18.485 -8.032  -9.301  1.00 0.00 ? 254 ARG A HH22   4  
ATOM   7187  N N      . THR A 1 42  ? 16.709 -6.348  -1.319  1.00 0.00 ? 255 THR A N      4  
ATOM   7188  C CA     . THR A 1 42  ? 17.351 -7.310  -0.439  1.00 0.00 ? 255 THR A CA     4  
ATOM   7189  C C      . THR A 1 42  ? 17.991 -8.435  -1.255  1.00 0.00 ? 255 THR A C      4  
ATOM   7190  O O      . THR A 1 42  ? 17.416 -8.896  -2.240  1.00 0.00 ? 255 THR A O      4  
ATOM   7191  C CB     . THR A 1 42  ? 16.307 -7.804  0.563   1.00 0.00 ? 255 THR A CB     4  
ATOM   7192  O OG1    . THR A 1 42  ? 15.870 -6.618  1.222   1.00 0.00 ? 255 THR A OG1    4  
ATOM   7193  C CG2    . THR A 1 42  ? 16.921 -8.647  1.683   1.00 0.00 ? 255 THR A CG2    4  
ATOM   7194  H H      . THR A 1 42  ? 15.813 -6.624  -1.665  1.00 0.00 ? 255 THR A H      4  
ATOM   7195  H HA     . THR A 1 42  ? 18.156 -6.804  0.094   1.00 0.00 ? 255 THR A HA     4  
ATOM   7196  H HB     . THR A 1 42  ? 15.510 -8.349  0.058   1.00 0.00 ? 255 THR A HB     4  
ATOM   7197  H HG1    . THR A 1 42  ? 15.204 -6.136  0.653   1.00 0.00 ? 255 THR A HG1    4  
ATOM   7198  H HG21   . THR A 1 42  ? 16.494 -8.349  2.639   1.00 0.00 ? 255 THR A HG21   4  
ATOM   7199  H HG22   . THR A 1 42  ? 16.709 -9.700  1.502   1.00 0.00 ? 255 THR A HG22   4  
ATOM   7200  H HG23   . THR A 1 42  ? 18.001 -8.491  1.703   1.00 0.00 ? 255 THR A HG23   4  
ATOM   7201  N N      . VAL A 1 43  ? 19.171 -8.844  -0.815  1.00 0.00 ? 256 VAL A N      4  
ATOM   7202  C CA     . VAL A 1 43  ? 19.895 -9.906  -1.491  1.00 0.00 ? 256 VAL A CA     4  
ATOM   7203  C C      . VAL A 1 43  ? 20.129 -11.061 -0.516  1.00 0.00 ? 256 VAL A C      4  
ATOM   7204  O O      . VAL A 1 43  ? 20.589 -10.848 0.605   1.00 0.00 ? 256 VAL A O      4  
ATOM   7205  C CB     . VAL A 1 43  ? 21.193 -9.357  -2.089  1.00 0.00 ? 256 VAL A CB     4  
ATOM   7206  C CG1    . VAL A 1 43  ? 21.007 -8.994  -3.564  1.00 0.00 ? 256 VAL A CG1    4  
ATOM   7207  C CG2    . VAL A 1 43  ? 21.700 -8.156  -1.288  1.00 0.00 ? 256 VAL A CG2    4  
ATOM   7208  H H      . VAL A 1 43  ? 19.632 -8.463  -0.012  1.00 0.00 ? 256 VAL A H      4  
ATOM   7209  H HA     . VAL A 1 43  ? 19.270 -10.260 -2.311  1.00 0.00 ? 256 VAL A HA     4  
ATOM   7210  H HB     . VAL A 1 43  ? 21.947 -10.142 -2.030  1.00 0.00 ? 256 VAL A HB     4  
ATOM   7211  H HG11   . VAL A 1 43  ? 19.943 -8.910  -3.786  1.00 0.00 ? 256 VAL A HG11   4  
ATOM   7212  H HG12   . VAL A 1 43  ? 21.497 -8.043  -3.768  1.00 0.00 ? 256 VAL A HG12   4  
ATOM   7213  H HG13   . VAL A 1 43  ? 21.447 -9.772  -4.188  1.00 0.00 ? 256 VAL A HG13   4  
ATOM   7214  H HG21   . VAL A 1 43  ? 21.682 -8.395  -0.224  1.00 0.00 ? 256 VAL A HG21   4  
ATOM   7215  H HG22   . VAL A 1 43  ? 22.721 -7.922  -1.591  1.00 0.00 ? 256 VAL A HG22   4  
ATOM   7216  H HG23   . VAL A 1 43  ? 21.058 -7.296  -1.478  1.00 0.00 ? 256 VAL A HG23   4  
ATOM   7217  N N      . PRO A 1 44  ? 19.791 -12.291 -0.989  1.00 0.00 ? 257 PRO A N      4  
ATOM   7218  C CA     . PRO A 1 44  ? 19.959 -13.479 -0.171  1.00 0.00 ? 257 PRO A CA     4  
ATOM   7219  C C      . PRO A 1 44  ? 21.432 -13.881 -0.082  1.00 0.00 ? 257 PRO A C      4  
ATOM   7220  O O      . PRO A 1 44  ? 22.219 -13.567 -0.973  1.00 0.00 ? 257 PRO A O      4  
ATOM   7221  C CB     . PRO A 1 44  ? 19.093 -14.539 -0.834  1.00 0.00 ? 257 PRO A CB     4  
ATOM   7222  C CG     . PRO A 1 44  ? 18.843 -14.046 -2.250  1.00 0.00 ? 257 PRO A CG     4  
ATOM   7223  C CD     . PRO A 1 44  ? 19.242 -12.581 -2.311  1.00 0.00 ? 257 PRO A CD     4  
ATOM   7224  H HA     . PRO A 1 44  ? 19.667 -13.298 0.768   1.00 0.00 ? 257 PRO A HA     4  
ATOM   7225  H HB2    . PRO A 1 44  ? 19.597 -15.506 -0.841  1.00 0.00 ? 257 PRO A HB2    4  
ATOM   7226  H HB3    . PRO A 1 44  ? 18.156 -14.672 -0.295  1.00 0.00 ? 257 PRO A HB3    4  
ATOM   7227  H HG2    . PRO A 1 44  ? 19.422 -14.629 -2.966  1.00 0.00 ? 257 PRO A HG2    4  
ATOM   7228  H HG3    . PRO A 1 44  ? 17.793 -14.167 -2.516  1.00 0.00 ? 257 PRO A HG3    4  
ATOM   7229  H HD2    . PRO A 1 44  ? 19.980 -12.403 -3.093  1.00 0.00 ? 257 PRO A HD2    4  
ATOM   7230  H HD3    . PRO A 1 44  ? 18.384 -11.945 -2.531  1.00 0.00 ? 257 PRO A HD3    4  
ATOM   7231  N N      . ALA A 1 45  ? 21.761 -14.567 1.002   1.00 0.00 ? 258 ALA A N      4  
ATOM   7232  C CA     . ALA A 1 45  ? 23.127 -15.014 1.220   1.00 0.00 ? 258 ALA A CA     4  
ATOM   7233  C C      . ALA A 1 45  ? 23.599 -15.808 -0.000  1.00 0.00 ? 258 ALA A C      4  
ATOM   7234  O O      . ALA A 1 45  ? 22.819 -16.539 -0.609  1.00 0.00 ? 258 ALA A O      4  
ATOM   7235  C CB     . ALA A 1 45  ? 23.197 -15.833 2.511   1.00 0.00 ? 258 ALA A CB     4  
ATOM   7236  H H      . ALA A 1 45  ? 21.115 -14.818 1.723   1.00 0.00 ? 258 ALA A H      4  
ATOM   7237  H HA     . ALA A 1 45  ? 23.752 -14.129 1.330   1.00 0.00 ? 258 ALA A HA     4  
ATOM   7238  H HB1    . ALA A 1 45  ? 24.150 -15.648 3.006   1.00 0.00 ? 258 ALA A HB1    4  
ATOM   7239  H HB2    . ALA A 1 45  ? 22.381 -15.540 3.171   1.00 0.00 ? 258 ALA A HB2    4  
ATOM   7240  H HB3    . ALA A 1 45  ? 23.110 -16.893 2.274   1.00 0.00 ? 258 ALA A HB3    4  
ATOM   7241  N N      . GLY A 1 46  ? 24.873 -15.636 -0.321  1.00 0.00 ? 259 GLY A N      4  
ATOM   7242  C CA     . GLY A 1 46  ? 25.458 -16.328 -1.458  1.00 0.00 ? 259 GLY A CA     4  
ATOM   7243  C C      . GLY A 1 46  ? 25.264 -15.526 -2.746  1.00 0.00 ? 259 GLY A C      4  
ATOM   7244  O O      . GLY A 1 46  ? 25.859 -15.845 -3.775  1.00 0.00 ? 259 GLY A O      4  
ATOM   7245  H H      . GLY A 1 46  ? 25.500 -15.039 0.179   1.00 0.00 ? 259 GLY A H      4  
ATOM   7246  H HA2    . GLY A 1 46  ? 26.521 -16.489 -1.282  1.00 0.00 ? 259 GLY A HA2    4  
ATOM   7247  H HA3    . GLY A 1 46  ? 25.000 -17.311 -1.564  1.00 0.00 ? 259 GLY A HA3    4  
ATOM   7248  N N      . ALA A 1 47  ? 24.430 -14.502 -2.648  1.00 0.00 ? 260 ALA A N      4  
ATOM   7249  C CA     . ALA A 1 47  ? 24.151 -13.652 -3.793  1.00 0.00 ? 260 ALA A CA     4  
ATOM   7250  C C      . ALA A 1 47  ? 25.284 -12.638 -3.958  1.00 0.00 ? 260 ALA A C      4  
ATOM   7251  O O      . ALA A 1 47  ? 25.546 -11.842 -3.057  1.00 0.00 ? 260 ALA A O      4  
ATOM   7252  C CB     . ALA A 1 47  ? 22.788 -12.979 -3.610  1.00 0.00 ? 260 ALA A CB     4  
ATOM   7253  H H      . ALA A 1 47  ? 23.950 -14.249 -1.808  1.00 0.00 ? 260 ALA A H      4  
ATOM   7254  H HA     . ALA A 1 47  ? 24.112 -14.289 -4.677  1.00 0.00 ? 260 ALA A HA     4  
ATOM   7255  H HB1    . ALA A 1 47  ? 22.817 -12.334 -2.732  1.00 0.00 ? 260 ALA A HB1    4  
ATOM   7256  H HB2    . ALA A 1 47  ? 22.556 -12.383 -4.492  1.00 0.00 ? 260 ALA A HB2    4  
ATOM   7257  H HB3    . ALA A 1 47  ? 22.022 -13.742 -3.475  1.00 0.00 ? 260 ALA A HB3    4  
ATOM   7258  N N      . VAL A 1 48  ? 25.924 -12.698 -5.117  1.00 0.00 ? 261 VAL A N      4  
ATOM   7259  C CA     . VAL A 1 48  ? 27.024 -11.795 -5.411  1.00 0.00 ? 261 VAL A CA     4  
ATOM   7260  C C      . VAL A 1 48  ? 26.471 -10.391 -5.662  1.00 0.00 ? 261 VAL A C      4  
ATOM   7261  O O      . VAL A 1 48  ? 25.543 -10.216 -6.452  1.00 0.00 ? 261 VAL A O      4  
ATOM   7262  C CB     . VAL A 1 48  ? 27.843 -12.333 -6.587  1.00 0.00 ? 261 VAL A CB     4  
ATOM   7263  C CG1    . VAL A 1 48  ? 28.845 -11.289 -7.080  1.00 0.00 ? 261 VAL A CG1    4  
ATOM   7264  C CG2    . VAL A 1 48  ? 28.550 -13.636 -6.210  1.00 0.00 ? 261 VAL A CG2    4  
ATOM   7265  H H      . VAL A 1 48  ? 25.705 -13.347 -5.844  1.00 0.00 ? 261 VAL A H      4  
ATOM   7266  H HA     . VAL A 1 48  ? 27.671 -11.766 -4.534  1.00 0.00 ? 261 VAL A HA     4  
ATOM   7267  H HB     . VAL A 1 48  ? 27.154 -12.549 -7.403  1.00 0.00 ? 261 VAL A HB     4  
ATOM   7268  H HG11   . VAL A 1 48  ? 28.876 -10.455 -6.379  1.00 0.00 ? 261 VAL A HG11   4  
ATOM   7269  H HG12   . VAL A 1 48  ? 29.836 -11.740 -7.151  1.00 0.00 ? 261 VAL A HG12   4  
ATOM   7270  H HG13   . VAL A 1 48  ? 28.540 -10.927 -8.062  1.00 0.00 ? 261 VAL A HG13   4  
ATOM   7271  H HG21   . VAL A 1 48  ? 29.459 -13.410 -5.653  1.00 0.00 ? 261 VAL A HG21   4  
ATOM   7272  H HG22   . VAL A 1 48  ? 27.887 -14.244 -5.594  1.00 0.00 ? 261 VAL A HG22   4  
ATOM   7273  H HG23   . VAL A 1 48  ? 28.806 -14.185 -7.116  1.00 0.00 ? 261 VAL A HG23   4  
ATOM   7274  N N      . ILE A 1 49  ? 27.064 -9.425  -4.975  1.00 0.00 ? 262 ILE A N      4  
ATOM   7275  C CA     . ILE A 1 49  ? 26.642 -8.041  -5.113  1.00 0.00 ? 262 ILE A CA     4  
ATOM   7276  C C      . ILE A 1 49  ? 27.631 -7.298  -6.013  1.00 0.00 ? 262 ILE A C      4  
ATOM   7277  O O      . ILE A 1 49  ? 27.229 -6.505  -6.862  1.00 0.00 ? 262 ILE A O      4  
ATOM   7278  C CB     . ILE A 1 49  ? 26.459 -7.396  -3.738  1.00 0.00 ? 262 ILE A CB     4  
ATOM   7279  C CG1    . ILE A 1 49  ? 25.737 -8.346  -2.779  1.00 0.00 ? 262 ILE A CG1    4  
ATOM   7280  C CG2    . ILE A 1 49  ? 25.744 -6.049  -3.855  1.00 0.00 ? 262 ILE A CG2    4  
ATOM   7281  C CD1    . ILE A 1 49  ? 25.861 -7.864  -1.333  1.00 0.00 ? 262 ILE A CD1    4  
ATOM   7282  H H      . ILE A 1 49  ? 27.817 -9.575  -4.335  1.00 0.00 ? 262 ILE A H      4  
ATOM   7283  H HA     . ILE A 1 49  ? 25.666 -8.044  -5.601  1.00 0.00 ? 262 ILE A HA     4  
ATOM   7284  H HB     . ILE A 1 49  ? 27.445 -7.202  -3.317  1.00 0.00 ? 262 ILE A HB     4  
ATOM   7285  H HG12   . ILE A 1 49  ? 24.684 -8.416  -3.054  1.00 0.00 ? 262 ILE A HG12   4  
ATOM   7286  H HG13   . ILE A 1 49  ? 26.157 -9.348  -2.870  1.00 0.00 ? 262 ILE A HG13   4  
ATOM   7287  H HG21   . ILE A 1 49  ? 25.691 -5.580  -2.872  1.00 0.00 ? 262 ILE A HG21   4  
ATOM   7288  H HG22   . ILE A 1 49  ? 26.296 -5.402  -4.537  1.00 0.00 ? 262 ILE A HG22   4  
ATOM   7289  H HG23   . ILE A 1 49  ? 24.736 -6.204  -4.238  1.00 0.00 ? 262 ILE A HG23   4  
ATOM   7290  H HD11   . ILE A 1 49  ? 26.693 -8.377  -0.849  1.00 0.00 ? 262 ILE A HD11   4  
ATOM   7291  H HD12   . ILE A 1 49  ? 26.041 -6.789  -1.322  1.00 0.00 ? 262 ILE A HD12   4  
ATOM   7292  H HD13   . ILE A 1 49  ? 24.937 -8.083  -0.796  1.00 0.00 ? 262 ILE A HD13   4  
ATOM   7293  N N      . CYS A 1 50  ? 28.907 -7.582  -5.798  1.00 0.00 ? 263 CYS A N      4  
ATOM   7294  C CA     . CYS A 1 50  ? 29.957 -6.951  -6.579  1.00 0.00 ? 263 CYS A CA     4  
ATOM   7295  C C      . CYS A 1 50  ? 30.930 -8.038  -7.043  1.00 0.00 ? 263 CYS A C      4  
ATOM   7296  O O      . CYS A 1 50  ? 31.205 -8.984  -6.307  1.00 0.00 ? 263 CYS A O      4  
ATOM   7297  C CB     . CYS A 1 50  ? 30.668 -5.850  -5.787  1.00 0.00 ? 263 CYS A CB     4  
ATOM   7298  S SG     . CYS A 1 50  ? 29.457 -4.935  -4.764  1.00 0.00 ? 263 CYS A SG     4  
ATOM   7299  H H      . CYS A 1 50  ? 29.226 -8.229  -5.104  1.00 0.00 ? 263 CYS A H      4  
ATOM   7300  H HA     . CYS A 1 50  ? 29.471 -6.477  -7.430  1.00 0.00 ? 263 CYS A HA     4  
ATOM   7301  H HB2    . CYS A 1 50  ? 31.437 -6.287  -5.150  1.00 0.00 ? 263 CYS A HB2    4  
ATOM   7302  H HB3    . CYS A 1 50  ? 31.170 -5.167  -6.470  1.00 0.00 ? 263 CYS A HB3    4  
ATOM   7303  H HG     . CYS A 1 50  ? 30.324 -4.049  -4.282  1.00 0.00 ? 263 CYS A HG     4  
ATOM   7304  N N      . ARG A 1 51  ? 31.421 -7.865  -8.261  1.00 0.00 ? 264 ARG A N      4  
ATOM   7305  C CA     . ARG A 1 51  ? 32.356 -8.819  -8.832  1.00 0.00 ? 264 ARG A CA     4  
ATOM   7306  C C      . ARG A 1 51  ? 33.600 -8.096  -9.354  1.00 0.00 ? 264 ARG A C      4  
ATOM   7307  O O      . ARG A 1 51  ? 33.498 -7.213  -10.204 1.00 0.00 ? 264 ARG A O      4  
ATOM   7308  C CB     . ARG A 1 51  ? 31.713 -9.603  -9.977  1.00 0.00 ? 264 ARG A CB     4  
ATOM   7309  C CG     . ARG A 1 51  ? 32.498 -10.882 -10.276 1.00 0.00 ? 264 ARG A CG     4  
ATOM   7310  C CD     . ARG A 1 51  ? 31.555 -12.071 -10.467 1.00 0.00 ? 264 ARG A CD     4  
ATOM   7311  N NE     . ARG A 1 51  ? 30.997 -12.061 -11.837 1.00 0.00 ? 264 ARG A NE     4  
ATOM   7312  C CZ     . ARG A 1 51  ? 30.458 -13.131 -12.438 1.00 0.00 ? 264 ARG A CZ     4  
ATOM   7313  N NH1    . ARG A 1 51  ? 30.402 -14.303 -11.792 1.00 0.00 ? 264 ARG A NH1    4  
ATOM   7314  N NH2    . ARG A 1 51  ? 29.976 -13.028 -13.684 1.00 0.00 ? 264 ARG A NH2    4  
ATOM   7315  H H      . ARG A 1 51  ? 31.191 -7.093  -8.852  1.00 0.00 ? 264 ARG A H      4  
ATOM   7316  H HA     . ARG A 1 51  ? 32.608 -9.489  -8.010  1.00 0.00 ? 264 ARG A HA     4  
ATOM   7317  H HB2    . ARG A 1 51  ? 30.684 -9.855  -9.718  1.00 0.00 ? 264 ARG A HB2    4  
ATOM   7318  H HB3    . ARG A 1 51  ? 31.671 -8.980  -10.871 1.00 0.00 ? 264 ARG A HB3    4  
ATOM   7319  H HG2    . ARG A 1 51  ? 33.100 -10.742 -11.174 1.00 0.00 ? 264 ARG A HG2    4  
ATOM   7320  H HG3    . ARG A 1 51  ? 33.188 -11.088 -9.459  1.00 0.00 ? 264 ARG A HG3    4  
ATOM   7321  H HD2    . ARG A 1 51  ? 32.093 -13.003 -10.292 1.00 0.00 ? 264 ARG A HD2    4  
ATOM   7322  H HD3    . ARG A 1 51  ? 30.748 -12.027 -9.737  1.00 0.00 ? 264 ARG A HD3    4  
ATOM   7323  H HE     . ARG A 1 51  ? 31.024 -11.202 -12.348 1.00 0.00 ? 264 ARG A HE     4  
ATOM   7324  H HH11   . ARG A 1 51  ? 30.762 -14.380 -10.862 1.00 0.00 ? 264 ARG A HH11   4  
ATOM   7325  H HH12   . ARG A 1 51  ? 30.000 -15.103 -12.241 1.00 0.00 ? 264 ARG A HH12   4  
ATOM   7326  H HH21   . ARG A 1 51  ? 30.019 -12.153 -14.166 1.00 0.00 ? 264 ARG A HH21   4  
ATOM   7327  H HH22   . ARG A 1 51  ? 29.575 -13.827 -14.132 1.00 0.00 ? 264 ARG A HH22   4  
ATOM   7328  N N      . ILE A 1 52  ? 34.745 -8.497  -8.822  1.00 0.00 ? 265 ILE A N      4  
ATOM   7329  C CA     . ILE A 1 52  ? 36.007 -7.899  -9.224  1.00 0.00 ? 265 ILE A CA     4  
ATOM   7330  C C      . ILE A 1 52  ? 36.146 -7.984  -10.745 1.00 0.00 ? 265 ILE A C      4  
ATOM   7331  O O      . ILE A 1 52  ? 35.814 -9.004  -11.346 1.00 0.00 ? 265 ILE A O      4  
ATOM   7332  C CB     . ILE A 1 52  ? 37.169 -8.538  -8.463  1.00 0.00 ? 265 ILE A CB     4  
ATOM   7333  C CG1    . ILE A 1 52  ? 38.488 -7.829  -8.779  1.00 0.00 ? 265 ILE A CG1    4  
ATOM   7334  C CG2    . ILE A 1 52  ? 37.246 -10.041 -8.740  1.00 0.00 ? 265 ILE A CG2    4  
ATOM   7335  C CD1    . ILE A 1 52  ? 39.456 -7.920  -7.598  1.00 0.00 ? 265 ILE A CD1    4  
ATOM   7336  H H      . ILE A 1 52  ? 34.819 -9.216  -8.131  1.00 0.00 ? 265 ILE A H      4  
ATOM   7337  H HA     . ILE A 1 52  ? 35.975 -6.847  -8.938  1.00 0.00 ? 265 ILE A HA     4  
ATOM   7338  H HB     . ILE A 1 52  ? 36.987 -8.418  -7.395  1.00 0.00 ? 265 ILE A HB     4  
ATOM   7339  H HG12   . ILE A 1 52  ? 38.943 -8.276  -9.662  1.00 0.00 ? 265 ILE A HG12   4  
ATOM   7340  H HG13   . ILE A 1 52  ? 38.294 -6.783  -9.014  1.00 0.00 ? 265 ILE A HG13   4  
ATOM   7341  H HG21   . ILE A 1 52  ? 37.849 -10.215 -9.632  1.00 0.00 ? 265 ILE A HG21   4  
ATOM   7342  H HG22   . ILE A 1 52  ? 37.703 -10.546 -7.889  1.00 0.00 ? 265 ILE A HG22   4  
ATOM   7343  H HG23   . ILE A 1 52  ? 36.241 -10.433 -8.899  1.00 0.00 ? 265 ILE A HG23   4  
ATOM   7344  H HD11   . ILE A 1 52  ? 40.298 -8.559  -7.866  1.00 0.00 ? 265 ILE A HD11   4  
ATOM   7345  H HD12   . ILE A 1 52  ? 39.821 -6.924  -7.349  1.00 0.00 ? 265 ILE A HD12   4  
ATOM   7346  H HD13   . ILE A 1 52  ? 38.939 -8.344  -6.736  1.00 0.00 ? 265 ILE A HD13   4  
ATOM   7347  N N      . GLY A 1 53  ? 36.638 -6.899  -11.324 1.00 0.00 ? 266 GLY A N      4  
ATOM   7348  C CA     . GLY A 1 53  ? 36.825 -6.838  -12.763 1.00 0.00 ? 266 GLY A CA     4  
ATOM   7349  C C      . GLY A 1 53  ? 35.660 -6.111  -13.438 1.00 0.00 ? 266 GLY A C      4  
ATOM   7350  O O      . GLY A 1 53  ? 35.870 -5.267  -14.308 1.00 0.00 ? 266 GLY A O      4  
ATOM   7351  H H      . GLY A 1 53  ? 36.906 -6.073  -10.828 1.00 0.00 ? 266 GLY A H      4  
ATOM   7352  H HA2    . GLY A 1 53  ? 37.759 -6.325  -12.991 1.00 0.00 ? 266 GLY A HA2    4  
ATOM   7353  H HA3    . GLY A 1 53  ? 36.910 -7.848  -13.165 1.00 0.00 ? 266 GLY A HA3    4  
ATOM   7354  N N      . GLU A 1 54  ? 34.456 -6.465  -13.010 1.00 0.00 ? 267 GLU A N      4  
ATOM   7355  C CA     . GLU A 1 54  ? 33.258 -5.857  -13.562 1.00 0.00 ? 267 GLU A CA     4  
ATOM   7356  C C      . GLU A 1 54  ? 33.194 -4.375  -13.187 1.00 0.00 ? 267 GLU A C      4  
ATOM   7357  O O      . GLU A 1 54  ? 33.555 -3.996  -12.074 1.00 0.00 ? 267 GLU A O      4  
ATOM   7358  C CB     . GLU A 1 54  ? 32.003 -6.596  -13.094 1.00 0.00 ? 267 GLU A CB     4  
ATOM   7359  C CG     . GLU A 1 54  ? 31.766 -7.858  -13.926 1.00 0.00 ? 267 GLU A CG     4  
ATOM   7360  C CD     . GLU A 1 54  ? 31.424 -7.503  -15.375 1.00 0.00 ? 267 GLU A CD     4  
ATOM   7361  O OE1    . GLU A 1 54  ? 30.311 -7.032  -15.651 1.00 0.00 ? 267 GLU A OE1    4  
ATOM   7362  O OE2    . GLU A 1 54  ? 32.363 -7.733  -16.229 1.00 0.00 ? 267 GLU A OE2    4  
ATOM   7363  H H      . GLU A 1 54  ? 34.294 -7.153  -12.303 1.00 0.00 ? 267 GLU A H      4  
ATOM   7364  H HA     . GLU A 1 54  ? 33.351 -5.961  -14.644 1.00 0.00 ? 267 GLU A HA     4  
ATOM   7365  H HB2    . GLU A 1 54  ? 32.105 -6.863  -12.042 1.00 0.00 ? 267 GLU A HB2    4  
ATOM   7366  H HB3    . GLU A 1 54  ? 31.138 -5.937  -13.172 1.00 0.00 ? 267 GLU A HB3    4  
ATOM   7367  H HG2    . GLU A 1 54  ? 32.658 -8.484  -13.903 1.00 0.00 ? 267 GLU A HG2    4  
ATOM   7368  H HG3    . GLU A 1 54  ? 30.956 -8.440  -13.488 1.00 0.00 ? 267 GLU A HG3    4  
ATOM   7369  H HE2    . GLU A 1 54  ? 32.010 -8.283  -16.986 1.00 0.00 ? 267 GLU A HE2    4  
ATOM   7370  N N      . PRO A 1 55  ? 32.719 -3.555  -14.163 1.00 0.00 ? 268 PRO A N      4  
ATOM   7371  C CA     . PRO A 1 55  ? 32.603 -2.123  -13.946 1.00 0.00 ? 268 PRO A CA     4  
ATOM   7372  C C      . PRO A 1 55  ? 31.409 -1.800  -13.044 1.00 0.00 ? 268 PRO A C      4  
ATOM   7373  O O      . PRO A 1 55  ? 30.330 -2.368  -13.210 1.00 0.00 ? 268 PRO A O      4  
ATOM   7374  C CB     . PRO A 1 55  ? 32.476 -1.523  -15.336 1.00 0.00 ? 268 PRO A CB     4  
ATOM   7375  C CG     . PRO A 1 55  ? 32.060 -2.667  -16.247 1.00 0.00 ? 268 PRO A CG     4  
ATOM   7376  C CD     . PRO A 1 55  ? 32.281 -3.968  -15.493 1.00 0.00 ? 268 PRO A CD     4  
ATOM   7377  H HA     . PRO A 1 55  ? 33.409 -1.777  -13.465 1.00 0.00 ? 268 PRO A HA     4  
ATOM   7378  H HB2    . PRO A 1 55  ? 31.736 -0.723  -15.351 1.00 0.00 ? 268 PRO A HB2    4  
ATOM   7379  H HB3    . PRO A 1 55  ? 33.422 -1.089  -15.663 1.00 0.00 ? 268 PRO A HB3    4  
ATOM   7380  H HG2    . PRO A 1 55  ? 31.013 -2.565  -16.534 1.00 0.00 ? 268 PRO A HG2    4  
ATOM   7381  H HG3    . PRO A 1 55  ? 32.645 -2.655  -17.167 1.00 0.00 ? 268 PRO A HG3    4  
ATOM   7382  H HD2    . PRO A 1 55  ? 31.366 -4.558  -15.443 1.00 0.00 ? 268 PRO A HD2    4  
ATOM   7383  H HD3    . PRO A 1 55  ? 33.033 -4.587  -15.982 1.00 0.00 ? 268 PRO A HD3    4  
ATOM   7384  N N      . GLY A 1 56  ? 31.642 -0.889  -12.111 1.00 0.00 ? 269 GLY A N      4  
ATOM   7385  C CA     . GLY A 1 56  ? 30.599 -0.484  -11.184 1.00 0.00 ? 269 GLY A CA     4  
ATOM   7386  C C      . GLY A 1 56  ? 29.787 0.684   -11.749 1.00 0.00 ? 269 GLY A C      4  
ATOM   7387  O O      . GLY A 1 56  ? 30.350 1.711   -12.126 1.00 0.00 ? 269 GLY A O      4  
ATOM   7388  H H      . GLY A 1 56  ? 32.522 -0.431  -11.984 1.00 0.00 ? 269 GLY A H      4  
ATOM   7389  H HA2    . GLY A 1 56  ? 29.938 -1.326  -10.983 1.00 0.00 ? 269 GLY A HA2    4  
ATOM   7390  H HA3    . GLY A 1 56  ? 31.045 -0.194  -10.233 1.00 0.00 ? 269 GLY A HA3    4  
ATOM   7391  N N      . ASP A 1 57  ? 28.478 0.488   -11.788 1.00 0.00 ? 270 ASP A N      4  
ATOM   7392  C CA     . ASP A 1 57  ? 27.582 1.513   -12.300 1.00 0.00 ? 270 ASP A CA     4  
ATOM   7393  C C      . ASP A 1 57  ? 26.430 1.714   -11.314 1.00 0.00 ? 270 ASP A C      4  
ATOM   7394  O O      . ASP A 1 57  ? 25.334 2.110   -11.709 1.00 0.00 ? 270 ASP A O      4  
ATOM   7395  C CB     . ASP A 1 57  ? 26.987 1.100   -13.647 1.00 0.00 ? 270 ASP A CB     4  
ATOM   7396  C CG     . ASP A 1 57  ? 26.570 2.260   -14.552 1.00 0.00 ? 270 ASP A CG     4  
ATOM   7397  O OD1    . ASP A 1 57  ? 25.518 2.885   -14.348 1.00 0.00 ? 270 ASP A OD1    4  
ATOM   7398  O OD2    . ASP A 1 57  ? 27.388 2.521   -15.516 1.00 0.00 ? 270 ASP A OD2    4  
ATOM   7399  H H      . ASP A 1 57  ? 28.028 -0.350  -11.479 1.00 0.00 ? 270 ASP A H      4  
ATOM   7400  H HA     . ASP A 1 57  ? 28.201 2.404   -12.408 1.00 0.00 ? 270 ASP A HA     4  
ATOM   7401  H HB2    . ASP A 1 57  ? 27.716 0.488   -14.178 1.00 0.00 ? 270 ASP A HB2    4  
ATOM   7402  H HB3    . ASP A 1 57  ? 26.116 0.471   -13.464 1.00 0.00 ? 270 ASP A HB3    4  
ATOM   7403  H HD2    . ASP A 1 57  ? 28.332 2.426   -15.199 1.00 0.00 ? 270 ASP A HD2    4  
ATOM   7404  N N      . ARG A 1 58  ? 26.717 1.435   -10.052 1.00 0.00 ? 271 ARG A N      4  
ATOM   7405  C CA     . ARG A 1 58  ? 25.718 1.581   -9.007  1.00 0.00 ? 271 ARG A CA     4  
ATOM   7406  C C      . ARG A 1 58  ? 26.372 1.480   -7.628  1.00 0.00 ? 271 ARG A C      4  
ATOM   7407  O O      . ARG A 1 58  ? 27.410 0.837   -7.476  1.00 0.00 ? 271 ARG A O      4  
ATOM   7408  C CB     . ARG A 1 58  ? 24.632 0.510   -9.129  1.00 0.00 ? 271 ARG A CB     4  
ATOM   7409  C CG     . ARG A 1 58  ? 25.249 -0.889  -9.200  1.00 0.00 ? 271 ARG A CG     4  
ATOM   7410  C CD     . ARG A 1 58  ? 24.837 -1.606  -10.488 1.00 0.00 ? 271 ARG A CD     4  
ATOM   7411  N NE     . ARG A 1 58  ? 24.441 -3.000  -10.187 1.00 0.00 ? 271 ARG A NE     4  
ATOM   7412  C CZ     . ARG A 1 58  ? 23.221 -3.360  -9.767  1.00 0.00 ? 271 ARG A CZ     4  
ATOM   7413  N NH1    . ARG A 1 58  ? 22.270 -2.432  -9.594  1.00 0.00 ? 271 ARG A NH1    4  
ATOM   7414  N NH2    . ARG A 1 58  ? 22.952 -4.650  -9.518  1.00 0.00 ? 271 ARG A NH2    4  
ATOM   7415  H H      . ARG A 1 58  ? 27.611 1.114   -9.739  1.00 0.00 ? 271 ARG A H      4  
ATOM   7416  H HA     . ARG A 1 58  ? 25.290 2.571   -9.167  1.00 0.00 ? 271 ARG A HA     4  
ATOM   7417  H HB2    . ARG A 1 58  ? 23.958 0.570   -8.275  1.00 0.00 ? 271 ARG A HB2    4  
ATOM   7418  H HB3    . ARG A 1 58  ? 24.034 0.692   -10.022 1.00 0.00 ? 271 ARG A HB3    4  
ATOM   7419  H HG2    . ARG A 1 58  ? 26.335 -0.815  -9.153  1.00 0.00 ? 271 ARG A HG2    4  
ATOM   7420  H HG3    . ARG A 1 58  ? 24.932 -1.474  -8.337  1.00 0.00 ? 271 ARG A HG3    4  
ATOM   7421  H HD2    . ARG A 1 58  ? 24.008 -1.077  -10.958 1.00 0.00 ? 271 ARG A HD2    4  
ATOM   7422  H HD3    . ARG A 1 58  ? 25.664 -1.599  -11.198 1.00 0.00 ? 271 ARG A HD3    4  
ATOM   7423  H HE     . ARG A 1 58  ? 25.128 -3.717  -10.305 1.00 0.00 ? 271 ARG A HE     4  
ATOM   7424  H HH11   . ARG A 1 58  ? 22.471 -1.470  -9.779  1.00 0.00 ? 271 ARG A HH11   4  
ATOM   7425  H HH12   . ARG A 1 58  ? 21.360 -2.701  -9.280  1.00 0.00 ? 271 ARG A HH12   4  
ATOM   7426  H HH21   . ARG A 1 58  ? 23.661 -5.342  -9.646  1.00 0.00 ? 271 ARG A HH21   4  
ATOM   7427  H HH22   . ARG A 1 58  ? 22.041 -4.919  -9.204  1.00 0.00 ? 271 ARG A HH22   4  
ATOM   7428  N N      . MET A 1 59  ? 25.739 2.123   -6.659  1.00 0.00 ? 272 MET A N      4  
ATOM   7429  C CA     . MET A 1 59  ? 26.246 2.114   -5.298  1.00 0.00 ? 272 MET A CA     4  
ATOM   7430  C C      . MET A 1 59  ? 25.480 1.110   -4.434  1.00 0.00 ? 272 MET A C      4  
ATOM   7431  O O      . MET A 1 59  ? 24.430 0.614   -4.836  1.00 0.00 ? 272 MET A O      4  
ATOM   7432  C CB     . MET A 1 59  ? 26.115 3.514   -4.693  1.00 0.00 ? 272 MET A CB     4  
ATOM   7433  C CG     . MET A 1 59  ? 27.489 4.158   -4.501  1.00 0.00 ? 272 MET A CG     4  
ATOM   7434  S SD     . MET A 1 59  ? 27.618 4.842   -2.856  1.00 0.00 ? 272 MET A SD     4  
ATOM   7435  C CE     . MET A 1 59  ? 28.347 3.456   -2.001  1.00 0.00 ? 272 MET A CE     4  
ATOM   7436  H H      . MET A 1 59  ? 24.895 2.644   -6.792  1.00 0.00 ? 272 MET A H      4  
ATOM   7437  H HA     . MET A 1 59  ? 27.291 1.812   -5.377  1.00 0.00 ? 272 MET A HA     4  
ATOM   7438  H HB2    . MET A 1 59  ? 25.504 4.138   -5.345  1.00 0.00 ? 272 MET A HB2    4  
ATOM   7439  H HB3    . MET A 1 59  ? 25.601 3.452   -3.734  1.00 0.00 ? 272 MET A HB3    4  
ATOM   7440  H HG2    . MET A 1 59  ? 28.273 3.418   -4.658  1.00 0.00 ? 272 MET A HG2    4  
ATOM   7441  H HG3    . MET A 1 59  ? 27.639 4.943   -5.242  1.00 0.00 ? 272 MET A HG3    4  
ATOM   7442  H HE1    . MET A 1 59  ? 27.579 2.938   -1.427  1.00 0.00 ? 272 MET A HE1    4  
ATOM   7443  H HE2    . MET A 1 59  ? 28.782 2.769   -2.726  1.00 0.00 ? 272 MET A HE2    4  
ATOM   7444  H HE3    . MET A 1 59  ? 29.125 3.814   -1.327  1.00 0.00 ? 272 MET A HE3    4  
ATOM   7445  N N      . PHE A 1 60  ? 26.036 0.842   -3.261  1.00 0.00 ? 273 PHE A N      4  
ATOM   7446  C CA     . PHE A 1 60  ? 25.418 -0.093  -2.336  1.00 0.00 ? 273 PHE A CA     4  
ATOM   7447  C C      . PHE A 1 60  ? 25.599 0.367   -0.888  1.00 0.00 ? 273 PHE A C      4  
ATOM   7448  O O      . PHE A 1 60  ? 26.669 0.845   -0.514  1.00 0.00 ? 273 PHE A O      4  
ATOM   7449  C CB     . PHE A 1 60  ? 26.122 -1.438  -2.524  1.00 0.00 ? 273 PHE A CB     4  
ATOM   7450  C CG     . PHE A 1 60  ? 25.840 -2.105  -3.872  1.00 0.00 ? 273 PHE A CG     4  
ATOM   7451  C CD1    . PHE A 1 60  ? 26.442 -1.639  -4.999  1.00 0.00 ? 273 PHE A CD1    4  
ATOM   7452  C CD2    . PHE A 1 60  ? 24.989 -3.163  -3.942  1.00 0.00 ? 273 PHE A CD2    4  
ATOM   7453  C CE1    . PHE A 1 60  ? 26.182 -2.259  -6.250  1.00 0.00 ? 273 PHE A CE1    4  
ATOM   7454  C CE2    . PHE A 1 60  ? 24.729 -3.782  -5.194  1.00 0.00 ? 273 PHE A CE2    4  
ATOM   7455  C CZ     . PHE A 1 60  ? 25.331 -3.317  -6.321  1.00 0.00 ? 273 PHE A CZ     4  
ATOM   7456  H H      . PHE A 1 60  ? 26.891 1.251   -2.940  1.00 0.00 ? 273 PHE A H      4  
ATOM   7457  H HA     . PHE A 1 60  ? 24.355 -0.128  -2.574  1.00 0.00 ? 273 PHE A HA     4  
ATOM   7458  H HB2    . PHE A 1 60  ? 27.196 -1.292  -2.419  1.00 0.00 ? 273 PHE A HB2    4  
ATOM   7459  H HB3    . PHE A 1 60  ? 25.813 -2.113  -1.725  1.00 0.00 ? 273 PHE A HB3    4  
ATOM   7460  H HD1    . PHE A 1 60  ? 27.125 -0.792  -4.942  1.00 0.00 ? 273 PHE A HD1    4  
ATOM   7461  H HD2    . PHE A 1 60  ? 24.507 -3.537  -3.039  1.00 0.00 ? 273 PHE A HD2    4  
ATOM   7462  H HE1    . PHE A 1 60  ? 26.664 -1.886  -7.153  1.00 0.00 ? 273 PHE A HE1    4  
ATOM   7463  H HE2    . PHE A 1 60  ? 24.046 -4.631  -5.251  1.00 0.00 ? 273 PHE A HE2    4  
ATOM   7464  H HZ     . PHE A 1 60  ? 25.131 -3.792  -7.281  1.00 0.00 ? 273 PHE A HZ     4  
ATOM   7465  N N      . PHE A 1 61  ? 24.538 0.205   -0.113  1.00 0.00 ? 274 PHE A N      4  
ATOM   7466  C CA     . PHE A 1 61  ? 24.566 0.598   1.286   1.00 0.00 ? 274 PHE A CA     4  
ATOM   7467  C C      . PHE A 1 61  ? 23.864 -0.442  2.162   1.00 0.00 ? 274 PHE A C      4  
ATOM   7468  O O      . PHE A 1 61  ? 22.704 -0.777  1.926   1.00 0.00 ? 274 PHE A O      4  
ATOM   7469  C CB     . PHE A 1 61  ? 23.815 1.927   1.394   1.00 0.00 ? 274 PHE A CB     4  
ATOM   7470  C CG     . PHE A 1 61  ? 24.169 2.931   0.295   1.00 0.00 ? 274 PHE A CG     4  
ATOM   7471  C CD1    . PHE A 1 61  ? 25.291 3.692   0.405   1.00 0.00 ? 274 PHE A CD1    4  
ATOM   7472  C CD2    . PHE A 1 61  ? 23.361 3.063   -0.792  1.00 0.00 ? 274 PHE A CD2    4  
ATOM   7473  C CE1    . PHE A 1 61  ? 25.618 4.625   -0.615  1.00 0.00 ? 274 PHE A CE1    4  
ATOM   7474  C CE2    . PHE A 1 61  ? 23.689 3.995   -1.811  1.00 0.00 ? 274 PHE A CE2    4  
ATOM   7475  C CZ     . PHE A 1 61  ? 24.811 4.757   -1.702  1.00 0.00 ? 274 PHE A CZ     4  
ATOM   7476  H H      . PHE A 1 61  ? 23.671 -0.184  -0.424  1.00 0.00 ? 274 PHE A H      4  
ATOM   7477  H HA     . PHE A 1 61  ? 25.612 0.671   1.581   1.00 0.00 ? 274 PHE A HA     4  
ATOM   7478  H HB2    . PHE A 1 61  ? 22.744 1.731   1.361   1.00 0.00 ? 274 PHE A HB2    4  
ATOM   7479  H HB3    . PHE A 1 61  ? 24.028 2.376   2.364   1.00 0.00 ? 274 PHE A HB3    4  
ATOM   7480  H HD1    . PHE A 1 61  ? 25.938 3.587   1.275   1.00 0.00 ? 274 PHE A HD1    4  
ATOM   7481  H HD2    . PHE A 1 61  ? 22.462 2.453   -0.879  1.00 0.00 ? 274 PHE A HD2    4  
ATOM   7482  H HE1    . PHE A 1 61  ? 26.517 5.235   -0.527  1.00 0.00 ? 274 PHE A HE1    4  
ATOM   7483  H HE2    . PHE A 1 61  ? 23.042 4.101   -2.681  1.00 0.00 ? 274 PHE A HE2    4  
ATOM   7484  H HZ     . PHE A 1 61  ? 25.062 5.472   -2.484  1.00 0.00 ? 274 PHE A HZ     4  
ATOM   7485  N N      . VAL A 1 62  ? 24.597 -0.925  3.155   1.00 0.00 ? 275 VAL A N      4  
ATOM   7486  C CA     . VAL A 1 62  ? 24.060 -1.920  4.067   1.00 0.00 ? 275 VAL A CA     4  
ATOM   7487  C C      . VAL A 1 62  ? 23.140 -1.234  5.079   1.00 0.00 ? 275 VAL A C      4  
ATOM   7488  O O      . VAL A 1 62  ? 23.540 -0.274  5.736   1.00 0.00 ? 275 VAL A O      4  
ATOM   7489  C CB     . VAL A 1 62  ? 25.201 -2.696  4.728   1.00 0.00 ? 275 VAL A CB     4  
ATOM   7490  C CG1    . VAL A 1 62  ? 24.664 -3.688  5.760   1.00 0.00 ? 275 VAL A CG1    4  
ATOM   7491  C CG2    . VAL A 1 62  ? 26.060 -3.405  3.679   1.00 0.00 ? 275 VAL A CG2    4  
ATOM   7492  H H      . VAL A 1 62  ? 25.539 -0.647  3.340   1.00 0.00 ? 275 VAL A H      4  
ATOM   7493  H HA     . VAL A 1 62  ? 23.471 -2.622  3.478   1.00 0.00 ? 275 VAL A HA     4  
ATOM   7494  H HB     . VAL A 1 62  ? 25.836 -1.978  5.250   1.00 0.00 ? 275 VAL A HB     4  
ATOM   7495  H HG11   . VAL A 1 62  ? 25.338 -3.721  6.618   1.00 0.00 ? 275 VAL A HG11   4  
ATOM   7496  H HG12   . VAL A 1 62  ? 23.674 -3.371  6.088   1.00 0.00 ? 275 VAL A HG12   4  
ATOM   7497  H HG13   . VAL A 1 62  ? 24.599 -4.679  5.312   1.00 0.00 ? 275 VAL A HG13   4  
ATOM   7498  H HG21   . VAL A 1 62  ? 25.487 -3.524  2.760   1.00 0.00 ? 275 VAL A HG21   4  
ATOM   7499  H HG22   . VAL A 1 62  ? 26.951 -2.812  3.477   1.00 0.00 ? 275 VAL A HG22   4  
ATOM   7500  H HG23   . VAL A 1 62  ? 26.354 -4.386  4.054   1.00 0.00 ? 275 VAL A HG23   4  
ATOM   7501  N N      . VAL A 1 63  ? 21.925 -1.753  5.172   1.00 0.00 ? 276 VAL A N      4  
ATOM   7502  C CA     . VAL A 1 63  ? 20.944 -1.202  6.093   1.00 0.00 ? 276 VAL A CA     4  
ATOM   7503  C C      . VAL A 1 63  ? 20.791 -2.142  7.290   1.00 0.00 ? 276 VAL A C      4  
ATOM   7504  O O      . VAL A 1 63  ? 20.787 -1.696  8.437   1.00 0.00 ? 276 VAL A O      4  
ATOM   7505  C CB     . VAL A 1 63  ? 19.624 -0.946  5.361   1.00 0.00 ? 276 VAL A CB     4  
ATOM   7506  C CG1    . VAL A 1 63  ? 18.525 -0.533  6.342   1.00 0.00 ? 276 VAL A CG1    4  
ATOM   7507  C CG2    . VAL A 1 63  ? 19.801 0.102   4.262   1.00 0.00 ? 276 VAL A CG2    4  
ATOM   7508  H H      . VAL A 1 63  ? 21.607 -2.534  4.634   1.00 0.00 ? 276 VAL A H      4  
ATOM   7509  H HA     . VAL A 1 63  ? 21.326 -0.243  6.445   1.00 0.00 ? 276 VAL A HA     4  
ATOM   7510  H HB     . VAL A 1 63  ? 19.318 -1.879  4.888   1.00 0.00 ? 276 VAL A HB     4  
ATOM   7511  H HG11   . VAL A 1 63  ? 18.659 0.513   6.618   1.00 0.00 ? 276 VAL A HG11   4  
ATOM   7512  H HG12   . VAL A 1 63  ? 17.551 -0.663  5.870   1.00 0.00 ? 276 VAL A HG12   4  
ATOM   7513  H HG13   . VAL A 1 63  ? 18.582 -1.155  7.235   1.00 0.00 ? 276 VAL A HG13   4  
ATOM   7514  H HG21   . VAL A 1 63  ? 19.570 1.090   4.661   1.00 0.00 ? 276 VAL A HG21   4  
ATOM   7515  H HG22   . VAL A 1 63  ? 20.832 0.087   3.908   1.00 0.00 ? 276 VAL A HG22   4  
ATOM   7516  H HG23   . VAL A 1 63  ? 19.129 -0.121  3.434   1.00 0.00 ? 276 VAL A HG23   4  
ATOM   7517  N N      . GLU A 1 64  ? 20.669 -3.425  6.983   1.00 0.00 ? 277 GLU A N      4  
ATOM   7518  C CA     . GLU A 1 64  ? 20.517 -4.431  8.021   1.00 0.00 ? 277 GLU A CA     4  
ATOM   7519  C C      . GLU A 1 64  ? 21.274 -5.705  7.639   1.00 0.00 ? 277 GLU A C      4  
ATOM   7520  O O      . GLU A 1 64  ? 21.158 -6.187  6.514   1.00 0.00 ? 277 GLU A O      4  
ATOM   7521  C CB     . GLU A 1 64  ? 19.039 -4.730  8.282   1.00 0.00 ? 277 GLU A CB     4  
ATOM   7522  C CG     . GLU A 1 64  ? 18.540 -3.980  9.519   1.00 0.00 ? 277 GLU A CG     4  
ATOM   7523  C CD     . GLU A 1 64  ? 17.054 -4.255  9.764   1.00 0.00 ? 277 GLU A CD     4  
ATOM   7524  O OE1    . GLU A 1 64  ? 16.211 -3.386  9.501   1.00 0.00 ? 277 GLU A OE1    4  
ATOM   7525  O OE2    . GLU A 1 64  ? 16.789 -5.422  10.246  1.00 0.00 ? 277 GLU A OE2    4  
ATOM   7526  H H      . GLU A 1 64  ? 20.674 -3.779  6.048   1.00 0.00 ? 277 GLU A H      4  
ATOM   7527  H HA     . GLU A 1 64  ? 20.957 -3.993  8.916   1.00 0.00 ? 277 GLU A HA     4  
ATOM   7528  H HB2    . GLU A 1 64  ? 18.447 -4.441  7.414   1.00 0.00 ? 277 GLU A HB2    4  
ATOM   7529  H HB3    . GLU A 1 64  ? 18.900 -5.802  8.421   1.00 0.00 ? 277 GLU A HB3    4  
ATOM   7530  H HG2    . GLU A 1 64  ? 19.118 -4.283  10.391  1.00 0.00 ? 277 GLU A HG2    4  
ATOM   7531  H HG3    . GLU A 1 64  ? 18.697 -2.909  9.389   1.00 0.00 ? 277 GLU A HG3    4  
ATOM   7532  H HE2    . GLU A 1 64  ? 15.909 -5.745  9.896   1.00 0.00 ? 277 GLU A HE2    4  
ATOM   7533  N N      . GLY A 1 65  ? 22.033 -6.213  8.599   1.00 0.00 ? 278 GLY A N      4  
ATOM   7534  C CA     . GLY A 1 65  ? 22.809 -7.423  8.378   1.00 0.00 ? 278 GLY A CA     4  
ATOM   7535  C C      . GLY A 1 65  ? 24.289 -7.094  8.170   1.00 0.00 ? 278 GLY A C      4  
ATOM   7536  O O      . GLY A 1 65  ? 24.728 -5.984  8.467   1.00 0.00 ? 278 GLY A O      4  
ATOM   7537  H H      . GLY A 1 65  ? 22.122 -5.815  9.511   1.00 0.00 ? 278 GLY A H      4  
ATOM   7538  H HA2    . GLY A 1 65  ? 22.697 -8.092  9.231   1.00 0.00 ? 278 GLY A HA2    4  
ATOM   7539  H HA3    . GLY A 1 65  ? 22.424 -7.951  7.505   1.00 0.00 ? 278 GLY A HA3    4  
ATOM   7540  N N      . SER A 1 66  ? 25.015 -8.078  7.663   1.00 0.00 ? 279 SER A N      4  
ATOM   7541  C CA     . SER A 1 66  ? 26.436 -7.907  7.412   1.00 0.00 ? 279 SER A CA     4  
ATOM   7542  C C      . SER A 1 66  ? 26.823 -8.596  6.102   1.00 0.00 ? 279 SER A C      4  
ATOM   7543  O O      . SER A 1 66  ? 26.106 -9.472  5.621   1.00 0.00 ? 279 SER A O      4  
ATOM   7544  C CB     . SER A 1 66  ? 27.270 -8.462  8.568   1.00 0.00 ? 279 SER A CB     4  
ATOM   7545  O OG     . SER A 1 66  ? 27.356 -7.542  9.653   1.00 0.00 ? 279 SER A OG     4  
ATOM   7546  H H      . SER A 1 66  ? 24.649 -8.978  7.424   1.00 0.00 ? 279 SER A H      4  
ATOM   7547  H HA     . SER A 1 66  ? 26.589 -6.831  7.338   1.00 0.00 ? 279 SER A HA     4  
ATOM   7548  H HB2    . SER A 1 66  ? 26.828 -9.395  8.919   1.00 0.00 ? 279 SER A HB2    4  
ATOM   7549  H HB3    . SER A 1 66  ? 28.272 -8.698  8.212   1.00 0.00 ? 279 SER A HB3    4  
ATOM   7550  H HG     . SER A 1 66  ? 28.231 -7.059  9.624   1.00 0.00 ? 279 SER A HG     4  
ATOM   7551  N N      . VAL A 1 67  ? 27.955 -8.172  5.559   1.00 0.00 ? 280 VAL A N      4  
ATOM   7552  C CA     . VAL A 1 67  ? 28.445 -8.737  4.314   1.00 0.00 ? 280 VAL A CA     4  
ATOM   7553  C C      . VAL A 1 67  ? 29.922 -9.105  4.472   1.00 0.00 ? 280 VAL A C      4  
ATOM   7554  O O      . VAL A 1 67  ? 30.622 -8.534  5.307   1.00 0.00 ? 280 VAL A O      4  
ATOM   7555  C CB     . VAL A 1 67  ? 28.193 -7.763  3.161   1.00 0.00 ? 280 VAL A CB     4  
ATOM   7556  C CG1    . VAL A 1 67  ? 26.749 -7.257  3.179   1.00 0.00 ? 280 VAL A CG1    4  
ATOM   7557  C CG2    . VAL A 1 67  ? 29.183 -6.596  3.203   1.00 0.00 ? 280 VAL A CG2    4  
ATOM   7558  H H      . VAL A 1 67  ? 28.532 -7.459  5.956   1.00 0.00 ? 280 VAL A H      4  
ATOM   7559  H HA     . VAL A 1 67  ? 27.877 -9.646  4.118   1.00 0.00 ? 280 VAL A HA     4  
ATOM   7560  H HB     . VAL A 1 67  ? 28.349 -8.301  2.227   1.00 0.00 ? 280 VAL A HB     4  
ATOM   7561  H HG11   . VAL A 1 67  ? 26.066 -8.107  3.169   1.00 0.00 ? 280 VAL A HG11   4  
ATOM   7562  H HG12   . VAL A 1 67  ? 26.582 -6.665  4.079   1.00 0.00 ? 280 VAL A HG12   4  
ATOM   7563  H HG13   . VAL A 1 67  ? 26.571 -6.637  2.299   1.00 0.00 ? 280 VAL A HG13   4  
ATOM   7564  H HG21   . VAL A 1 67  ? 28.789 -5.807  3.843   1.00 0.00 ? 280 VAL A HG21   4  
ATOM   7565  H HG22   . VAL A 1 67  ? 30.137 -6.944  3.599   1.00 0.00 ? 280 VAL A HG22   4  
ATOM   7566  H HG23   . VAL A 1 67  ? 29.328 -6.207  2.195   1.00 0.00 ? 280 VAL A HG23   4  
ATOM   7567  N N      . SER A 1 68  ? 30.353 -10.057 3.657   1.00 0.00 ? 281 SER A N      4  
ATOM   7568  C CA     . SER A 1 68  ? 31.733 -10.508 3.697   1.00 0.00 ? 281 SER A CA     4  
ATOM   7569  C C      . SER A 1 68  ? 32.391 -10.297 2.332   1.00 0.00 ? 281 SER A C      4  
ATOM   7570  O O      . SER A 1 68  ? 31.815 -10.639 1.300   1.00 0.00 ? 281 SER A O      4  
ATOM   7571  C CB     . SER A 1 68  ? 31.821 -11.980 4.106   1.00 0.00 ? 281 SER A CB     4  
ATOM   7572  O OG     . SER A 1 68  ? 32.378 -12.140 5.408   1.00 0.00 ? 281 SER A OG     4  
ATOM   7573  H H      . SER A 1 68  ? 29.777 -10.517 2.981   1.00 0.00 ? 281 SER A H      4  
ATOM   7574  H HA     . SER A 1 68  ? 32.217 -9.892  4.454   1.00 0.00 ? 281 SER A HA     4  
ATOM   7575  H HB2    . SER A 1 68  ? 30.825 -12.423 4.081   1.00 0.00 ? 281 SER A HB2    4  
ATOM   7576  H HB3    . SER A 1 68  ? 32.429 -12.523 3.383   1.00 0.00 ? 281 SER A HB3    4  
ATOM   7577  H HG     . SER A 1 68  ? 31.951 -12.917 5.870   1.00 0.00 ? 281 SER A HG     4  
ATOM   7578  N N      . VAL A 1 69  ? 33.591 -9.735  2.369   1.00 0.00 ? 282 VAL A N      4  
ATOM   7579  C CA     . VAL A 1 69  ? 34.334 -9.474  1.149   1.00 0.00 ? 282 VAL A CA     4  
ATOM   7580  C C      . VAL A 1 69  ? 34.898 -10.791 0.609   1.00 0.00 ? 282 VAL A C      4  
ATOM   7581  O O      . VAL A 1 69  ? 35.269 -11.674 1.381   1.00 0.00 ? 282 VAL A O      4  
ATOM   7582  C CB     . VAL A 1 69  ? 35.415 -8.423  1.408   1.00 0.00 ? 282 VAL A CB     4  
ATOM   7583  C CG1    . VAL A 1 69  ? 36.194 -8.111  0.129   1.00 0.00 ? 282 VAL A CG1    4  
ATOM   7584  C CG2    . VAL A 1 69  ? 34.810 -7.151  2.006   1.00 0.00 ? 282 VAL A CG2    4  
ATOM   7585  H H      . VAL A 1 69  ? 34.053 -9.460  3.213   1.00 0.00 ? 282 VAL A H      4  
ATOM   7586  H HA     . VAL A 1 69  ? 33.635 -9.067  0.419   1.00 0.00 ? 282 VAL A HA     4  
ATOM   7587  H HB     . VAL A 1 69  ? 36.115 -8.835  2.135   1.00 0.00 ? 282 VAL A HB     4  
ATOM   7588  H HG11   . VAL A 1 69  ? 36.224 -8.998  -0.504  1.00 0.00 ? 282 VAL A HG11   4  
ATOM   7589  H HG12   . VAL A 1 69  ? 35.703 -7.298  -0.406  1.00 0.00 ? 282 VAL A HG12   4  
ATOM   7590  H HG13   . VAL A 1 69  ? 37.211 -7.815  0.387   1.00 0.00 ? 282 VAL A HG13   4  
ATOM   7591  H HG21   . VAL A 1 69  ? 34.208 -6.645  1.251   1.00 0.00 ? 282 VAL A HG21   4  
ATOM   7592  H HG22   . VAL A 1 69  ? 34.181 -7.413  2.857   1.00 0.00 ? 282 VAL A HG22   4  
ATOM   7593  H HG23   . VAL A 1 69  ? 35.610 -6.489  2.337   1.00 0.00 ? 282 VAL A HG23   4  
ATOM   7594  N N      . ALA A 1 70  ? 34.944 -10.880 -0.713  1.00 0.00 ? 283 ALA A N      4  
ATOM   7595  C CA     . ALA A 1 70  ? 35.456 -12.073 -1.364  1.00 0.00 ? 283 ALA A CA     4  
ATOM   7596  C C      . ALA A 1 70  ? 36.961 -11.917 -1.595  1.00 0.00 ? 283 ALA A C      4  
ATOM   7597  O O      . ALA A 1 70  ? 37.382 -11.344 -2.599  1.00 0.00 ? 283 ALA A O      4  
ATOM   7598  C CB     . ALA A 1 70  ? 34.688 -12.314 -2.665  1.00 0.00 ? 283 ALA A CB     4  
ATOM   7599  H H      . ALA A 1 70  ? 34.640 -10.157 -1.333  1.00 0.00 ? 283 ALA A H      4  
ATOM   7600  H HA     . ALA A 1 70  ? 35.285 -12.917 -0.694  1.00 0.00 ? 283 ALA A HA     4  
ATOM   7601  H HB1    . ALA A 1 70  ? 34.065 -11.447 -2.886  1.00 0.00 ? 283 ALA A HB1    4  
ATOM   7602  H HB2    . ALA A 1 70  ? 35.394 -12.471 -3.480  1.00 0.00 ? 283 ALA A HB2    4  
ATOM   7603  H HB3    . ALA A 1 70  ? 34.057 -13.196 -2.557  1.00 0.00 ? 283 ALA A HB3    4  
ATOM   7604  N N      . THR A 1 71  ? 37.729 -12.437 -0.649  1.00 0.00 ? 284 THR A N      4  
ATOM   7605  C CA     . THR A 1 71  ? 39.178 -12.362 -0.738  1.00 0.00 ? 284 THR A CA     4  
ATOM   7606  C C      . THR A 1 71  ? 39.823 -13.233 0.342   1.00 0.00 ? 284 THR A C      4  
ATOM   7607  O O      . THR A 1 71  ? 39.127 -13.821 1.168   1.00 0.00 ? 284 THR A O      4  
ATOM   7608  C CB     . THR A 1 71  ? 39.582 -10.889 -0.651  1.00 0.00 ? 284 THR A CB     4  
ATOM   7609  O OG1    . THR A 1 71  ? 40.335 -10.805 0.555   1.00 0.00 ? 284 THR A OG1    4  
ATOM   7610  C CG2    . THR A 1 71  ? 38.385 -9.967  -0.407  1.00 0.00 ? 284 THR A CG2    4  
ATOM   7611  H H      . THR A 1 71  ? 37.378 -12.902 0.164   1.00 0.00 ? 284 THR A H      4  
ATOM   7612  H HA     . THR A 1 71  ? 39.485 -12.769 -1.701  1.00 0.00 ? 284 THR A HA     4  
ATOM   7613  H HB     . THR A 1 71  ? 40.133 -10.584 -1.540  1.00 0.00 ? 284 THR A HB     4  
ATOM   7614  H HG1    . THR A 1 71  ? 40.827 -9.936  0.591   1.00 0.00 ? 284 THR A HG1    4  
ATOM   7615  H HG21   . THR A 1 71  ? 38.718 -9.068  0.111   1.00 0.00 ? 284 THR A HG21   4  
ATOM   7616  H HG22   . THR A 1 71  ? 37.938 -9.692  -1.362  1.00 0.00 ? 284 THR A HG22   4  
ATOM   7617  H HG23   . THR A 1 71  ? 37.645 -10.486 0.203   1.00 0.00 ? 284 THR A HG23   4  
ATOM   7618  N N      . PRO A 1 72  ? 41.182 -13.290 0.299   1.00 0.00 ? 285 PRO A N      4  
ATOM   7619  C CA     . PRO A 1 72  ? 41.929 -14.079 1.263   1.00 0.00 ? 285 PRO A CA     4  
ATOM   7620  C C      . PRO A 1 72  ? 41.966 -13.387 2.627   1.00 0.00 ? 285 PRO A C      4  
ATOM   7621  O O      . PRO A 1 72  ? 42.105 -14.044 3.658   1.00 0.00 ? 285 PRO A O      4  
ATOM   7622  C CB     . PRO A 1 72  ? 43.307 -14.252 0.647   1.00 0.00 ? 285 PRO A CB     4  
ATOM   7623  C CG     . PRO A 1 72  ? 43.428 -13.170 -0.415  1.00 0.00 ? 285 PRO A CG     4  
ATOM   7624  C CD     . PRO A 1 72  ? 42.038 -12.607 -0.666  1.00 0.00 ? 285 PRO A CD     4  
ATOM   7625  H HA     . PRO A 1 72  ? 41.478 -14.958 1.416   1.00 0.00 ? 285 PRO A HA     4  
ATOM   7626  H HB2    . PRO A 1 72  ? 44.088 -14.148 1.400   1.00 0.00 ? 285 PRO A HB2    4  
ATOM   7627  H HB3    . PRO A 1 72  ? 43.417 -15.243 0.208   1.00 0.00 ? 285 PRO A HB3    4  
ATOM   7628  H HG2    . PRO A 1 72  ? 44.104 -12.383 -0.082  1.00 0.00 ? 285 PRO A HG2    4  
ATOM   7629  H HG3    . PRO A 1 72  ? 43.845 -13.581 -1.333  1.00 0.00 ? 285 PRO A HG3    4  
ATOM   7630  H HD2    . PRO A 1 72  ? 42.017 -11.526 -0.519  1.00 0.00 ? 285 PRO A HD2    4  
ATOM   7631  H HD3    . PRO A 1 72  ? 41.713 -12.796 -1.689  1.00 0.00 ? 285 PRO A HD3    4  
ATOM   7632  N N      . ASN A 1 73  ? 41.840 -12.068 2.589   1.00 0.00 ? 286 ASN A N      4  
ATOM   7633  C CA     . ASN A 1 73  ? 41.857 -11.279 3.810   1.00 0.00 ? 286 ASN A CA     4  
ATOM   7634  C C      . ASN A 1 73  ? 40.732 -10.244 3.759   1.00 0.00 ? 286 ASN A C      4  
ATOM   7635  O O      . ASN A 1 73  ? 40.985 -9.042  3.813   1.00 0.00 ? 286 ASN A O      4  
ATOM   7636  C CB     . ASN A 1 73  ? 43.182 -10.529 3.961   1.00 0.00 ? 286 ASN A CB     4  
ATOM   7637  C CG     . ASN A 1 73  ? 44.203 -11.370 4.729   1.00 0.00 ? 286 ASN A CG     4  
ATOM   7638  O OD1    . ASN A 1 73  ? 45.055 -12.033 4.159   1.00 0.00 ? 286 ASN A OD1    4  
ATOM   7639  N ND2    . ASN A 1 73  ? 44.073 -11.306 6.051   1.00 0.00 ? 286 ASN A ND2    4  
ATOM   7640  H H      . ASN A 1 73  ? 41.726 -11.541 1.747   1.00 0.00 ? 286 ASN A H      4  
ATOM   7641  H HA     . ASN A 1 73  ? 41.727 -11.998 4.618   1.00 0.00 ? 286 ASN A HA     4  
ATOM   7642  H HB2    . ASN A 1 73  ? 43.578 -10.280 2.977   1.00 0.00 ? 286 ASN A HB2    4  
ATOM   7643  H HB3    . ASN A 1 73  ? 43.014 -9.588  4.484   1.00 0.00 ? 286 ASN A HB3    4  
ATOM   7644  H HD21   . ASN A 1 73  ? 43.352 -10.743 6.455   1.00 0.00 ? 286 ASN A HD21   4  
ATOM   7645  H HD22   . ASN A 1 73  ? 44.695 -11.822 6.641   1.00 0.00 ? 286 ASN A HD22   4  
ATOM   7646  N N      . PRO A 1 74  ? 39.479 -10.763 3.653   1.00 0.00 ? 287 PRO A N      4  
ATOM   7647  C CA     . PRO A 1 74  ? 38.313 -9.898  3.595   1.00 0.00 ? 287 PRO A CA     4  
ATOM   7648  C C      . PRO A 1 74  ? 37.993 -9.316  4.972   1.00 0.00 ? 287 PRO A C      4  
ATOM   7649  O O      . PRO A 1 74  ? 38.836 -9.330  5.867   1.00 0.00 ? 287 PRO A O      4  
ATOM   7650  C CB     . PRO A 1 74  ? 37.200 -10.775 3.046   1.00 0.00 ? 287 PRO A CB     4  
ATOM   7651  C CG     . PRO A 1 74  ? 37.656 -12.209 3.256   1.00 0.00 ? 287 PRO A CG     4  
ATOM   7652  C CD     . PRO A 1 74  ? 39.140 -12.182 3.586   1.00 0.00 ? 287 PRO A CD     4  
ATOM   7653  H HA     . PRO A 1 74  ? 38.493 -9.112  3.001   1.00 0.00 ? 287 PRO A HA     4  
ATOM   7654  H HB2    . PRO A 1 74  ? 36.260 -10.585 3.567   1.00 0.00 ? 287 PRO A HB2    4  
ATOM   7655  H HB3    . PRO A 1 74  ? 37.025 -10.570 1.990   1.00 0.00 ? 287 PRO A HB3    4  
ATOM   7656  H HG2    . PRO A 1 74  ? 37.094 -12.675 4.064   1.00 0.00 ? 287 PRO A HG2    4  
ATOM   7657  H HG3    . PRO A 1 74  ? 37.476 -12.802 2.360   1.00 0.00 ? 287 PRO A HG3    4  
ATOM   7658  H HD2    . PRO A 1 74  ? 39.345 -12.682 4.532   1.00 0.00 ? 287 PRO A HD2    4  
ATOM   7659  H HD3    . PRO A 1 74  ? 39.725 -12.693 2.822   1.00 0.00 ? 287 PRO A HD3    4  
ATOM   7660  N N      . VAL A 1 75  ? 36.771 -8.817  5.100   1.00 0.00 ? 288 VAL A N      4  
ATOM   7661  C CA     . VAL A 1 75  ? 36.330 -8.232  6.354   1.00 0.00 ? 288 VAL A CA     4  
ATOM   7662  C C      . VAL A 1 75  ? 34.809 -8.364  6.465   1.00 0.00 ? 288 VAL A C      4  
ATOM   7663  O O      . VAL A 1 75  ? 34.130 -8.617  5.472   1.00 0.00 ? 288 VAL A O      4  
ATOM   7664  C CB     . VAL A 1 75  ? 36.813 -6.784  6.454   1.00 0.00 ? 288 VAL A CB     4  
ATOM   7665  C CG1    . VAL A 1 75  ? 35.990 -6.001  7.479   1.00 0.00 ? 288 VAL A CG1    4  
ATOM   7666  C CG2    . VAL A 1 75  ? 38.305 -6.726  6.789   1.00 0.00 ? 288 VAL A CG2    4  
ATOM   7667  H H      . VAL A 1 75  ? 36.091 -8.810  4.367   1.00 0.00 ? 288 VAL A H      4  
ATOM   7668  H HA     . VAL A 1 75  ? 36.791 -8.799  7.163   1.00 0.00 ? 288 VAL A HA     4  
ATOM   7669  H HB     . VAL A 1 75  ? 36.669 -6.315  5.481   1.00 0.00 ? 288 VAL A HB     4  
ATOM   7670  H HG11   . VAL A 1 75  ? 34.940 -6.016  7.190   1.00 0.00 ? 288 VAL A HG11   4  
ATOM   7671  H HG12   . VAL A 1 75  ? 36.102 -6.459  8.463   1.00 0.00 ? 288 VAL A HG12   4  
ATOM   7672  H HG13   . VAL A 1 75  ? 36.342 -4.970  7.517   1.00 0.00 ? 288 VAL A HG13   4  
ATOM   7673  H HG21   . VAL A 1 75  ? 38.558 -7.546  7.460   1.00 0.00 ? 288 VAL A HG21   4  
ATOM   7674  H HG22   . VAL A 1 75  ? 38.886 -6.814  5.872   1.00 0.00 ? 288 VAL A HG22   4  
ATOM   7675  H HG23   . VAL A 1 75  ? 38.532 -5.776  7.273   1.00 0.00 ? 288 VAL A HG23   4  
ATOM   7676  N N      . GLU A 1 76  ? 34.319 -8.186  7.684   1.00 0.00 ? 289 GLU A N      4  
ATOM   7677  C CA     . GLU A 1 76  ? 32.892 -8.282  7.938   1.00 0.00 ? 289 GLU A CA     4  
ATOM   7678  C C      . GLU A 1 76  ? 32.278 -6.885  8.051   1.00 0.00 ? 289 GLU A C      4  
ATOM   7679  O O      . GLU A 1 76  ? 32.628 -6.119  8.948   1.00 0.00 ? 289 GLU A O      4  
ATOM   7680  C CB     . GLU A 1 76  ? 32.613 -9.107  9.197   1.00 0.00 ? 289 GLU A CB     4  
ATOM   7681  C CG     . GLU A 1 76  ? 31.205 -9.703  9.161   1.00 0.00 ? 289 GLU A CG     4  
ATOM   7682  C CD     . GLU A 1 76  ? 30.869 -10.396 10.483  1.00 0.00 ? 289 GLU A CD     4  
ATOM   7683  O OE1    . GLU A 1 76  ? 31.153 -11.592 10.646  1.00 0.00 ? 289 GLU A OE1    4  
ATOM   7684  O OE2    . GLU A 1 76  ? 30.293 -9.646  11.360  1.00 0.00 ? 289 GLU A OE2    4  
ATOM   7685  H H      . GLU A 1 76  ? 34.878 -7.981  8.486   1.00 0.00 ? 289 GLU A H      4  
ATOM   7686  H HA     . GLU A 1 76  ? 32.478 -8.800  7.073   1.00 0.00 ? 289 GLU A HA     4  
ATOM   7687  H HB2    . GLU A 1 76  ? 33.349 -9.906  9.282   1.00 0.00 ? 289 GLU A HB2    4  
ATOM   7688  H HB3    . GLU A 1 76  ? 32.723 -8.477  10.080  1.00 0.00 ? 289 GLU A HB3    4  
ATOM   7689  H HG2    . GLU A 1 76  ? 30.478 -8.916  8.963   1.00 0.00 ? 289 GLU A HG2    4  
ATOM   7690  H HG3    . GLU A 1 76  ? 31.130 -10.420 8.342   1.00 0.00 ? 289 GLU A HG3    4  
ATOM   7691  H HE2    . GLU A 1 76  ? 30.629 -8.708  11.282  1.00 0.00 ? 289 GLU A HE2    4  
ATOM   7692  N N      . LEU A 1 77  ? 31.373 -6.596  7.127   1.00 0.00 ? 290 LEU A N      4  
ATOM   7693  C CA     . LEU A 1 77  ? 30.707 -5.304  7.112   1.00 0.00 ? 290 LEU A CA     4  
ATOM   7694  C C      . LEU A 1 77  ? 29.352 -5.426  7.813   1.00 0.00 ? 290 LEU A C      4  
ATOM   7695  O O      . LEU A 1 77  ? 28.747 -6.496  7.820   1.00 0.00 ? 290 LEU A O      4  
ATOM   7696  C CB     . LEU A 1 77  ? 30.613 -4.767  5.682   1.00 0.00 ? 290 LEU A CB     4  
ATOM   7697  C CG     . LEU A 1 77  ? 31.881 -4.117  5.125   1.00 0.00 ? 290 LEU A CG     4  
ATOM   7698  C CD1    . LEU A 1 77  ? 31.765 -3.892  3.617   1.00 0.00 ? 290 LEU A CD1    4  
ATOM   7699  C CD2    . LEU A 1 77  ? 32.209 -2.824  5.875   1.00 0.00 ? 290 LEU A CD2    4  
ATOM   7700  H H      . LEU A 1 77  ? 31.094 -7.225  6.401   1.00 0.00 ? 290 LEU A H      4  
ATOM   7701  H HA     . LEU A 1 77  ? 31.327 -4.610  7.676   1.00 0.00 ? 290 LEU A HA     4  
ATOM   7702  H HB2    . LEU A 1 77  ? 30.332 -5.590  5.024   1.00 0.00 ? 290 LEU A HB2    4  
ATOM   7703  H HB3    . LEU A 1 77  ? 29.806 -4.036  5.641   1.00 0.00 ? 290 LEU A HB3    4  
ATOM   7704  H HG     . LEU A 1 77  ? 32.715 -4.803  5.285   1.00 0.00 ? 290 LEU A HG     4  
ATOM   7705  H HD11   . LEU A 1 77  ? 30.907 -4.443  3.231   1.00 0.00 ? 290 LEU A HD11   4  
ATOM   7706  H HD12   . LEU A 1 77  ? 31.633 -2.828  3.417   1.00 0.00 ? 290 LEU A HD12   4  
ATOM   7707  H HD13   . LEU A 1 77  ? 32.673 -4.243  3.126   1.00 0.00 ? 290 LEU A HD13   4  
ATOM   7708  H HD21   . LEU A 1 77  ? 31.718 -2.834  6.848   1.00 0.00 ? 290 LEU A HD21   4  
ATOM   7709  H HD22   . LEU A 1 77  ? 33.288 -2.747  6.013   1.00 0.00 ? 290 LEU A HD22   4  
ATOM   7710  H HD23   . LEU A 1 77  ? 31.855 -1.970  5.297   1.00 0.00 ? 290 LEU A HD23   4  
ATOM   7711  N N      . GLY A 1 78  ? 28.916 -4.313  8.385   1.00 0.00 ? 291 GLY A N      4  
ATOM   7712  C CA     . GLY A 1 78  ? 27.645 -4.281  9.087   1.00 0.00 ? 291 GLY A CA     4  
ATOM   7713  C C      . GLY A 1 78  ? 26.724 -3.207  8.505   1.00 0.00 ? 291 GLY A C      4  
ATOM   7714  O O      . GLY A 1 78  ? 27.019 -2.631  7.459   1.00 0.00 ? 291 GLY A O      4  
ATOM   7715  H H      . GLY A 1 78  ? 29.415 -3.447  8.374   1.00 0.00 ? 291 GLY A H      4  
ATOM   7716  H HA2    . GLY A 1 78  ? 27.162 -5.256  9.017   1.00 0.00 ? 291 GLY A HA2    4  
ATOM   7717  H HA3    . GLY A 1 78  ? 27.815 -4.085  10.146  1.00 0.00 ? 291 GLY A HA3    4  
ATOM   7718  N N      . PRO A 1 79  ? 25.597 -2.964  9.226   1.00 0.00 ? 292 PRO A N      4  
ATOM   7719  C CA     . PRO A 1 79  ? 24.631 -1.969  8.792   1.00 0.00 ? 292 PRO A CA     4  
ATOM   7720  C C      . PRO A 1 79  ? 25.146 -0.553  9.056   1.00 0.00 ? 292 PRO A C      4  
ATOM   7721  O O      . PRO A 1 79  ? 25.591 -0.245  10.161  1.00 0.00 ? 292 PRO A O      4  
ATOM   7722  C CB     . PRO A 1 79  ? 23.361 -2.292  9.563   1.00 0.00 ? 292 PRO A CB     4  
ATOM   7723  C CG     . PRO A 1 79  ? 23.793 -3.156  10.736  1.00 0.00 ? 292 PRO A CG     4  
ATOM   7724  C CD     . PRO A 1 79  ? 25.214 -3.627  10.470  1.00 0.00 ? 292 PRO A CD     4  
ATOM   7725  H HA     . PRO A 1 79  ? 24.490 -2.030  7.804   1.00 0.00 ? 292 PRO A HA     4  
ATOM   7726  H HB2    . PRO A 1 79  ? 22.872 -1.381  9.909   1.00 0.00 ? 292 PRO A HB2    4  
ATOM   7727  H HB3    . PRO A 1 79  ? 22.645 -2.818  8.933   1.00 0.00 ? 292 PRO A HB3    4  
ATOM   7728  H HG2    . PRO A 1 79  ? 23.747 -2.589  11.666  1.00 0.00 ? 292 PRO A HG2    4  
ATOM   7729  H HG3    . PRO A 1 79  ? 23.124 -4.008  10.849  1.00 0.00 ? 292 PRO A HG3    4  
ATOM   7730  H HD2    . PRO A 1 79  ? 25.882 -3.353  11.286  1.00 0.00 ? 292 PRO A HD2    4  
ATOM   7731  H HD3    . PRO A 1 79  ? 25.259 -4.711  10.370  1.00 0.00 ? 292 PRO A HD3    4  
ATOM   7732  N N      . GLY A 1 80  ? 25.070 0.271   8.021   1.00 0.00 ? 293 GLY A N      4  
ATOM   7733  C CA     . GLY A 1 80  ? 25.523 1.648   8.126   1.00 0.00 ? 293 GLY A CA     4  
ATOM   7734  C C      . GLY A 1 80  ? 26.837 1.852   7.369   1.00 0.00 ? 293 GLY A C      4  
ATOM   7735  O O      . GLY A 1 80  ? 27.522 2.854   7.565   1.00 0.00 ? 293 GLY A O      4  
ATOM   7736  H H      . GLY A 1 80  ? 24.707 0.014   7.126   1.00 0.00 ? 293 GLY A H      4  
ATOM   7737  H HA2    . GLY A 1 80  ? 24.762 2.317   7.727   1.00 0.00 ? 293 GLY A HA2    4  
ATOM   7738  H HA3    . GLY A 1 80  ? 25.660 1.910   9.175   1.00 0.00 ? 293 GLY A HA3    4  
ATOM   7739  N N      . ALA A 1 81  ? 27.149 0.885   6.518   1.00 0.00 ? 294 ALA A N      4  
ATOM   7740  C CA     . ALA A 1 81  ? 28.369 0.946   5.730   1.00 0.00 ? 294 ALA A CA     4  
ATOM   7741  C C      . ALA A 1 81  ? 28.008 1.050   4.247   1.00 0.00 ? 294 ALA A C      4  
ATOM   7742  O O      . ALA A 1 81  ? 26.901 0.690   3.847   1.00 0.00 ? 294 ALA A O      4  
ATOM   7743  C CB     . ALA A 1 81  ? 29.235 -0.278  6.036   1.00 0.00 ? 294 ALA A CB     4  
ATOM   7744  H H      . ALA A 1 81  ? 26.586 0.073   6.364   1.00 0.00 ? 294 ALA A H      4  
ATOM   7745  H HA     . ALA A 1 81  ? 28.911 1.843   6.028   1.00 0.00 ? 294 ALA A HA     4  
ATOM   7746  H HB1    . ALA A 1 81  ? 29.044 -1.052  5.292   1.00 0.00 ? 294 ALA A HB1    4  
ATOM   7747  H HB2    . ALA A 1 81  ? 30.286 0.005   6.004   1.00 0.00 ? 294 ALA A HB2    4  
ATOM   7748  H HB3    . ALA A 1 81  ? 28.990 -0.658  7.027   1.00 0.00 ? 294 ALA A HB3    4  
ATOM   7749  N N      . PHE A 1 82  ? 28.962 1.544   3.472   1.00 0.00 ? 295 PHE A N      4  
ATOM   7750  C CA     . PHE A 1 82  ? 28.758 1.700   2.042   1.00 0.00 ? 295 PHE A CA     4  
ATOM   7751  C C      . PHE A 1 82  ? 29.945 1.139   1.255   1.00 0.00 ? 295 PHE A C      4  
ATOM   7752  O O      . PHE A 1 82  ? 31.086 1.218   1.706   1.00 0.00 ? 295 PHE A O      4  
ATOM   7753  C CB     . PHE A 1 82  ? 28.644 3.201   1.767   1.00 0.00 ? 295 PHE A CB     4  
ATOM   7754  C CG     . PHE A 1 82  ? 29.788 4.030   2.355   1.00 0.00 ? 295 PHE A CG     4  
ATOM   7755  C CD1    . PHE A 1 82  ? 29.926 4.142   3.703   1.00 0.00 ? 295 PHE A CD1    4  
ATOM   7756  C CD2    . PHE A 1 82  ? 30.667 4.656   1.527   1.00 0.00 ? 295 PHE A CD2    4  
ATOM   7757  C CE1    . PHE A 1 82  ? 30.988 4.911   4.247   1.00 0.00 ? 295 PHE A CE1    4  
ATOM   7758  C CE2    . PHE A 1 82  ? 31.730 5.425   2.071   1.00 0.00 ? 295 PHE A CE2    4  
ATOM   7759  C CZ     . PHE A 1 82  ? 31.868 5.536   3.420   1.00 0.00 ? 295 PHE A CZ     4  
ATOM   7760  H H      . PHE A 1 82  ? 29.859 1.834   3.805   1.00 0.00 ? 295 PHE A H      4  
ATOM   7761  H HA     . PHE A 1 82  ? 27.857 1.146   1.780   1.00 0.00 ? 295 PHE A HA     4  
ATOM   7762  H HB2    . PHE A 1 82  ? 28.608 3.361   0.691   1.00 0.00 ? 295 PHE A HB2    4  
ATOM   7763  H HB3    . PHE A 1 82  ? 27.700 3.563   2.176   1.00 0.00 ? 295 PHE A HB3    4  
ATOM   7764  H HD1    . PHE A 1 82  ? 29.220 3.640   4.366   1.00 0.00 ? 295 PHE A HD1    4  
ATOM   7765  H HD2    . PHE A 1 82  ? 30.558 4.567   0.447   1.00 0.00 ? 295 PHE A HD2    4  
ATOM   7766  H HE1    . PHE A 1 82  ? 31.098 4.999   5.328   1.00 0.00 ? 295 PHE A HE1    4  
ATOM   7767  H HE2    . PHE A 1 82  ? 32.435 5.927   1.408   1.00 0.00 ? 295 PHE A HE2    4  
ATOM   7768  H HZ     . PHE A 1 82  ? 32.683 6.127   3.838   1.00 0.00 ? 295 PHE A HZ     4  
ATOM   7769  N N      . PHE A 1 83  ? 29.634 0.585   0.093   1.00 0.00 ? 296 PHE A N      4  
ATOM   7770  C CA     . PHE A 1 83  ? 30.660 0.011   -0.762  1.00 0.00 ? 296 PHE A CA     4  
ATOM   7771  C C      . PHE A 1 83  ? 30.264 0.109   -2.236  1.00 0.00 ? 296 PHE A C      4  
ATOM   7772  O O      . PHE A 1 83  ? 29.088 0.273   -2.557  1.00 0.00 ? 296 PHE A O      4  
ATOM   7773  C CB     . PHE A 1 83  ? 30.788 -1.464  -0.377  1.00 0.00 ? 296 PHE A CB     4  
ATOM   7774  C CG     . PHE A 1 83  ? 29.454 -2.210  -0.316  1.00 0.00 ? 296 PHE A CG     4  
ATOM   7775  C CD1    . PHE A 1 83  ? 28.569 -1.942  0.682   1.00 0.00 ? 296 PHE A CD1    4  
ATOM   7776  C CD2    . PHE A 1 83  ? 29.151 -3.140  -1.261  1.00 0.00 ? 296 PHE A CD2    4  
ATOM   7777  C CE1    . PHE A 1 83  ? 27.331 -2.634  0.739   1.00 0.00 ? 296 PHE A CE1    4  
ATOM   7778  C CE2    . PHE A 1 83  ? 27.911 -3.833  -1.205  1.00 0.00 ? 296 PHE A CE2    4  
ATOM   7779  C CZ     . PHE A 1 83  ? 27.028 -3.564  -0.206  1.00 0.00 ? 296 PHE A CZ     4  
ATOM   7780  H H      . PHE A 1 83  ? 28.702 0.525   -0.267  1.00 0.00 ? 296 PHE A H      4  
ATOM   7781  H HA     . PHE A 1 83  ? 31.575 0.579   -0.594  1.00 0.00 ? 296 PHE A HA     4  
ATOM   7782  H HB2    . PHE A 1 83  ? 31.438 -1.962  -1.097  1.00 0.00 ? 296 PHE A HB2    4  
ATOM   7783  H HB3    . PHE A 1 83  ? 31.277 -1.535  0.595   1.00 0.00 ? 296 PHE A HB3    4  
ATOM   7784  H HD1    . PHE A 1 83  ? 28.813 -1.196  1.439   1.00 0.00 ? 296 PHE A HD1    4  
ATOM   7785  H HD2    . PHE A 1 83  ? 29.859 -3.355  -2.061  1.00 0.00 ? 296 PHE A HD2    4  
ATOM   7786  H HE1    . PHE A 1 83  ? 26.623 -2.419  1.539   1.00 0.00 ? 296 PHE A HE1    4  
ATOM   7787  H HE2    . PHE A 1 83  ? 27.669 -4.577  -1.961  1.00 0.00 ? 296 PHE A HE2    4  
ATOM   7788  H HZ     . PHE A 1 83  ? 26.077 -4.095  -0.163  1.00 0.00 ? 296 PHE A HZ     4  
ATOM   7789  N N      . GLY A 1 84  ? 31.268 0.004   -3.094  1.00 0.00 ? 297 GLY A N      4  
ATOM   7790  C CA     . GLY A 1 84  ? 31.040 0.079   -4.527  1.00 0.00 ? 297 GLY A CA     4  
ATOM   7791  C C      . GLY A 1 84  ? 30.899 1.532   -4.985  1.00 0.00 ? 297 GLY A C      4  
ATOM   7792  O O      . GLY A 1 84  ? 30.143 1.825   -5.909  1.00 0.00 ? 297 GLY A O      4  
ATOM   7793  H H      . GLY A 1 84  ? 32.222 -0.129  -2.824  1.00 0.00 ? 297 GLY A H      4  
ATOM   7794  H HA2    . GLY A 1 84  ? 31.867 -0.395  -5.055  1.00 0.00 ? 297 GLY A HA2    4  
ATOM   7795  H HA3    . GLY A 1 84  ? 30.137 -0.476  -4.784  1.00 0.00 ? 297 GLY A HA3    4  
ATOM   7796  N N      . GLU A 1 85  ? 31.641 2.403   -4.316  1.00 0.00 ? 298 GLU A N      4  
ATOM   7797  C CA     . GLU A 1 85  ? 31.610 3.819   -4.643  1.00 0.00 ? 298 GLU A CA     4  
ATOM   7798  C C      . GLU A 1 85  ? 32.886 4.221   -5.386  1.00 0.00 ? 298 GLU A C      4  
ATOM   7799  O O      . GLU A 1 85  ? 32.913 5.240   -6.073  1.00 0.00 ? 298 GLU A O      4  
ATOM   7800  C CB     . GLU A 1 85  ? 31.417 4.668   -3.385  1.00 0.00 ? 298 GLU A CB     4  
ATOM   7801  C CG     . GLU A 1 85  ? 32.576 4.470   -2.407  1.00 0.00 ? 298 GLU A CG     4  
ATOM   7802  C CD     . GLU A 1 85  ? 32.331 3.258   -1.505  1.00 0.00 ? 298 GLU A CD     4  
ATOM   7803  O OE1    . GLU A 1 85  ? 31.207 3.063   -1.020  1.00 0.00 ? 298 GLU A OE1    4  
ATOM   7804  O OE2    . GLU A 1 85  ? 33.361 2.504   -1.314  1.00 0.00 ? 298 GLU A OE2    4  
ATOM   7805  H H      . GLU A 1 85  ? 32.254 2.157   -3.567  1.00 0.00 ? 298 GLU A H      4  
ATOM   7806  H HA     . GLU A 1 85  ? 30.747 3.946   -5.297  1.00 0.00 ? 298 GLU A HA     4  
ATOM   7807  H HB2    . GLU A 1 85  ? 31.343 5.720   -3.660  1.00 0.00 ? 298 GLU A HB2    4  
ATOM   7808  H HB3    . GLU A 1 85  ? 30.478 4.399   -2.901  1.00 0.00 ? 298 GLU A HB3    4  
ATOM   7809  H HG2    . GLU A 1 85  ? 33.504 4.333   -2.961  1.00 0.00 ? 298 GLU A HG2    4  
ATOM   7810  H HG3    . GLU A 1 85  ? 32.697 5.364   -1.796  1.00 0.00 ? 298 GLU A HG3    4  
ATOM   7811  H HE2    . GLU A 1 85  ? 33.138 1.557   -1.544  1.00 0.00 ? 298 GLU A HE2    4  
ATOM   7812  N N      . MET A 1 86  ? 33.912 3.399   -5.221  1.00 0.00 ? 299 MET A N      4  
ATOM   7813  C CA     . MET A 1 86  ? 35.188 3.657   -5.867  1.00 0.00 ? 299 MET A CA     4  
ATOM   7814  C C      . MET A 1 86  ? 35.039 3.668   -7.389  1.00 0.00 ? 299 MET A C      4  
ATOM   7815  O O      . MET A 1 86  ? 35.710 4.437   -8.076  1.00 0.00 ? 299 MET A O      4  
ATOM   7816  C CB     . MET A 1 86  ? 36.193 2.578   -5.460  1.00 0.00 ? 299 MET A CB     4  
ATOM   7817  C CG     . MET A 1 86  ? 37.584 3.178   -5.241  1.00 0.00 ? 299 MET A CG     4  
ATOM   7818  S SD     . MET A 1 86  ? 38.170 3.925   -6.752  1.00 0.00 ? 299 MET A SD     4  
ATOM   7819  C CE     . MET A 1 86  ? 39.740 3.093   -6.920  1.00 0.00 ? 299 MET A CE     4  
ATOM   7820  H H      . MET A 1 86  ? 33.882 2.573   -4.659  1.00 0.00 ? 299 MET A H      4  
ATOM   7821  H HA     . MET A 1 86  ? 35.499 4.641   -5.517  1.00 0.00 ? 299 MET A HA     4  
ATOM   7822  H HB2    . MET A 1 86  ? 35.857 2.088   -4.546  1.00 0.00 ? 299 MET A HB2    4  
ATOM   7823  H HB3    . MET A 1 86  ? 36.242 1.811   -6.232  1.00 0.00 ? 299 MET A HB3    4  
ATOM   7824  H HG2    . MET A 1 86  ? 37.546 3.924   -4.447  1.00 0.00 ? 299 MET A HG2    4  
ATOM   7825  H HG3    . MET A 1 86  ? 38.277 2.403   -4.917  1.00 0.00 ? 299 MET A HG3    4  
ATOM   7826  H HE1    . MET A 1 86  ? 40.542 3.765   -6.614  1.00 0.00 ? 299 MET A HE1    4  
ATOM   7827  H HE2    . MET A 1 86  ? 39.750 2.204   -6.290  1.00 0.00 ? 299 MET A HE2    4  
ATOM   7828  H HE3    . MET A 1 86  ? 39.887 2.803   -7.961  1.00 0.00 ? 299 MET A HE3    4  
ATOM   7829  N N      . ALA A 1 87  ? 34.156 2.806   -7.873  1.00 0.00 ? 300 ALA A N      4  
ATOM   7830  C CA     . ALA A 1 87  ? 33.911 2.707   -9.301  1.00 0.00 ? 300 ALA A CA     4  
ATOM   7831  C C      . ALA A 1 87  ? 33.075 3.906   -9.755  1.00 0.00 ? 300 ALA A C      4  
ATOM   7832  O O      . ALA A 1 87  ? 33.356 4.506   -10.791 1.00 0.00 ? 300 ALA A O      4  
ATOM   7833  C CB     . ALA A 1 87  ? 33.233 1.372   -9.611  1.00 0.00 ? 300 ALA A CB     4  
ATOM   7834  H H      . ALA A 1 87  ? 33.615 2.184   -7.306  1.00 0.00 ? 300 ALA A H      4  
ATOM   7835  H HA     . ALA A 1 87  ? 34.877 2.735   -9.806  1.00 0.00 ? 300 ALA A HA     4  
ATOM   7836  H HB1    . ALA A 1 87  ? 33.800 0.561   -9.155  1.00 0.00 ? 300 ALA A HB1    4  
ATOM   7837  H HB2    . ALA A 1 87  ? 32.219 1.377   -9.210  1.00 0.00 ? 300 ALA A HB2    4  
ATOM   7838  H HB3    . ALA A 1 87  ? 33.195 1.225   -10.691 1.00 0.00 ? 300 ALA A HB3    4  
ATOM   7839  N N      . LEU A 1 88  ? 32.065 4.218   -8.957  1.00 0.00 ? 301 LEU A N      4  
ATOM   7840  C CA     . LEU A 1 88  ? 31.186 5.333   -9.264  1.00 0.00 ? 301 LEU A CA     4  
ATOM   7841  C C      . LEU A 1 88  ? 31.916 6.646   -8.975  1.00 0.00 ? 301 LEU A C      4  
ATOM   7842  O O      . LEU A 1 88  ? 31.432 7.720   -9.328  1.00 0.00 ? 301 LEU A O      4  
ATOM   7843  C CB     . LEU A 1 88  ? 29.858 5.191   -8.517  1.00 0.00 ? 301 LEU A CB     4  
ATOM   7844  C CG     . LEU A 1 88  ? 28.889 4.141   -9.066  1.00 0.00 ? 301 LEU A CG     4  
ATOM   7845  C CD1    . LEU A 1 88  ? 27.528 4.235   -8.371  1.00 0.00 ? 301 LEU A CD1    4  
ATOM   7846  C CD2    . LEU A 1 88  ? 28.765 4.252   -10.586 1.00 0.00 ? 301 LEU A CD2    4  
ATOM   7847  H H      . LEU A 1 88  ? 31.843 3.724   -8.116  1.00 0.00 ? 301 LEU A H      4  
ATOM   7848  H HA     . LEU A 1 88  ? 30.962 5.289   -10.330 1.00 0.00 ? 301 LEU A HA     4  
ATOM   7849  H HB2    . LEU A 1 88  ? 30.074 4.948   -7.476  1.00 0.00 ? 301 LEU A HB2    4  
ATOM   7850  H HB3    . LEU A 1 88  ? 29.356 6.158   -8.522  1.00 0.00 ? 301 LEU A HB3    4  
ATOM   7851  H HG     . LEU A 1 88  ? 29.295 3.154   -8.847  1.00 0.00 ? 301 LEU A HG     4  
ATOM   7852  H HD11   . LEU A 1 88  ? 26.745 3.924   -9.064  1.00 0.00 ? 301 LEU A HD11   4  
ATOM   7853  H HD12   . LEU A 1 88  ? 27.522 3.583   -7.498  1.00 0.00 ? 301 LEU A HD12   4  
ATOM   7854  H HD13   . LEU A 1 88  ? 27.351 5.264   -8.058  1.00 0.00 ? 301 LEU A HD13   4  
ATOM   7855  H HD21   . LEU A 1 88  ? 27.834 3.785   -10.910 1.00 0.00 ? 301 LEU A HD21   4  
ATOM   7856  H HD22   . LEU A 1 88  ? 28.765 5.302   -10.876 1.00 0.00 ? 301 LEU A HD22   4  
ATOM   7857  H HD23   . LEU A 1 88  ? 29.608 3.745   -11.058 1.00 0.00 ? 301 LEU A HD23   4  
ATOM   7858  N N      . ILE A 1 89  ? 33.069 6.517   -8.335  1.00 0.00 ? 302 ILE A N      4  
ATOM   7859  C CA     . ILE A 1 89  ? 33.871 7.679   -7.995  1.00 0.00 ? 302 ILE A CA     4  
ATOM   7860  C C      . ILE A 1 89  ? 34.766 8.042   -9.181  1.00 0.00 ? 302 ILE A C      4  
ATOM   7861  O O      . ILE A 1 89  ? 34.942 9.219   -9.495  1.00 0.00 ? 302 ILE A O      4  
ATOM   7862  C CB     . ILE A 1 89  ? 34.641 7.438   -6.695  1.00 0.00 ? 302 ILE A CB     4  
ATOM   7863  C CG1    . ILE A 1 89  ? 33.797 7.824   -5.478  1.00 0.00 ? 302 ILE A CG1    4  
ATOM   7864  C CG2    . ILE A 1 89  ? 35.987 8.164   -6.713  1.00 0.00 ? 302 ILE A CG2    4  
ATOM   7865  C CD1    . ILE A 1 89  ? 34.188 6.993   -4.254  1.00 0.00 ? 302 ILE A CD1    4  
ATOM   7866  H H      . ILE A 1 89  ? 33.455 5.640   -8.051  1.00 0.00 ? 302 ILE A H      4  
ATOM   7867  H HA     . ILE A 1 89  ? 33.185 8.507   -7.814  1.00 0.00 ? 302 ILE A HA     4  
ATOM   7868  H HB     . ILE A 1 89  ? 34.851 6.371   -6.615  1.00 0.00 ? 302 ILE A HB     4  
ATOM   7869  H HG12   . ILE A 1 89  ? 33.931 8.884   -5.260  1.00 0.00 ? 302 ILE A HG12   4  
ATOM   7870  H HG13   . ILE A 1 89  ? 32.740 7.675   -5.701  1.00 0.00 ? 302 ILE A HG13   4  
ATOM   7871  H HG21   . ILE A 1 89  ? 35.898 9.081   -7.294  1.00 0.00 ? 302 ILE A HG21   4  
ATOM   7872  H HG22   . ILE A 1 89  ? 36.281 8.408   -5.692  1.00 0.00 ? 302 ILE A HG22   4  
ATOM   7873  H HG23   . ILE A 1 89  ? 36.741 7.519   -7.164  1.00 0.00 ? 302 ILE A HG23   4  
ATOM   7874  H HD11   . ILE A 1 89  ? 35.121 7.373   -3.839  1.00 0.00 ? 302 ILE A HD11   4  
ATOM   7875  H HD12   . ILE A 1 89  ? 33.401 7.062   -3.502  1.00 0.00 ? 302 ILE A HD12   4  
ATOM   7876  H HD13   . ILE A 1 89  ? 34.318 5.951   -4.549  1.00 0.00 ? 302 ILE A HD13   4  
ATOM   7877  N N      . SER A 1 90  ? 35.308 7.009   -9.810  1.00 0.00 ? 303 SER A N      4  
ATOM   7878  C CA     . SER A 1 90  ? 36.180 7.203   -10.955 1.00 0.00 ? 303 SER A CA     4  
ATOM   7879  C C      . SER A 1 90  ? 35.637 6.437   -12.163 1.00 0.00 ? 303 SER A C      4  
ATOM   7880  O O      . SER A 1 90  ? 35.422 7.019   -13.226 1.00 0.00 ? 303 SER A O      4  
ATOM   7881  C CB     . SER A 1 90  ? 37.609 6.756   -10.642 1.00 0.00 ? 303 SER A CB     4  
ATOM   7882  O OG     . SER A 1 90  ? 38.572 7.730   -11.034 1.00 0.00 ? 303 SER A OG     4  
ATOM   7883  H H      . SER A 1 90  ? 35.159 6.055   -9.548  1.00 0.00 ? 303 SER A H      4  
ATOM   7884  H HA     . SER A 1 90  ? 36.170 8.276   -11.146 1.00 0.00 ? 303 SER A HA     4  
ATOM   7885  H HB2    . SER A 1 90  ? 37.703 6.564   -9.572  1.00 0.00 ? 303 SER A HB2    4  
ATOM   7886  H HB3    . SER A 1 90  ? 37.815 5.816   -11.154 1.00 0.00 ? 303 SER A HB3    4  
ATOM   7887  H HG     . SER A 1 90  ? 38.199 8.649   -10.908 1.00 0.00 ? 303 SER A HG     4  
ATOM   7888  N N      . GLY A 1 91  ? 35.431 5.145   -11.959 1.00 0.00 ? 304 GLY A N      4  
ATOM   7889  C CA     . GLY A 1 91  ? 34.917 4.294   -13.018 1.00 0.00 ? 304 GLY A CA     4  
ATOM   7890  C C      . GLY A 1 91  ? 35.656 2.954   -13.054 1.00 0.00 ? 304 GLY A C      4  
ATOM   7891  O O      . GLY A 1 91  ? 35.285 2.055   -13.807 1.00 0.00 ? 304 GLY A O      4  
ATOM   7892  H H      . GLY A 1 91  ? 35.608 4.680   -11.091 1.00 0.00 ? 304 GLY A H      4  
ATOM   7893  H HA2    . GLY A 1 91  ? 33.851 4.120   -12.866 1.00 0.00 ? 304 GLY A HA2    4  
ATOM   7894  H HA3    . GLY A 1 91  ? 35.023 4.797   -13.979 1.00 0.00 ? 304 GLY A HA3    4  
ATOM   7895  N N      . GLU A 1 92  ? 36.691 2.864   -12.230 1.00 0.00 ? 305 GLU A N      4  
ATOM   7896  C CA     . GLU A 1 92  ? 37.486 1.651   -12.157 1.00 0.00 ? 305 GLU A CA     4  
ATOM   7897  C C      . GLU A 1 92  ? 36.594 0.450   -11.841 1.00 0.00 ? 305 GLU A C      4  
ATOM   7898  O O      . GLU A 1 92  ? 35.492 0.610   -11.319 1.00 0.00 ? 305 GLU A O      4  
ATOM   7899  C CB     . GLU A 1 92  ? 38.605 1.791   -11.123 1.00 0.00 ? 305 GLU A CB     4  
ATOM   7900  C CG     . GLU A 1 92  ? 39.873 2.363   -11.760 1.00 0.00 ? 305 GLU A CG     4  
ATOM   7901  C CD     . GLU A 1 92  ? 41.121 1.657   -11.228 1.00 0.00 ? 305 GLU A CD     4  
ATOM   7902  O OE1    . GLU A 1 92  ? 41.269 0.440   -11.412 1.00 0.00 ? 305 GLU A OE1    4  
ATOM   7903  O OE2    . GLU A 1 92  ? 41.956 2.419   -10.606 1.00 0.00 ? 305 GLU A OE2    4  
ATOM   7904  H H      . GLU A 1 92  ? 36.986 3.601   -11.621 1.00 0.00 ? 305 GLU A H      4  
ATOM   7905  H HA     . GLU A 1 92  ? 37.928 1.534   -13.147 1.00 0.00 ? 305 GLU A HA     4  
ATOM   7906  H HB2    . GLU A 1 92  ? 38.276 2.438   -10.311 1.00 0.00 ? 305 GLU A HB2    4  
ATOM   7907  H HB3    . GLU A 1 92  ? 38.823 0.817   -10.684 1.00 0.00 ? 305 GLU A HB3    4  
ATOM   7908  H HG2    . GLU A 1 92  ? 39.821 2.254   -12.843 1.00 0.00 ? 305 GLU A HG2    4  
ATOM   7909  H HG3    . GLU A 1 92  ? 39.938 3.432   -11.550 1.00 0.00 ? 305 GLU A HG3    4  
ATOM   7910  H HE2    . GLU A 1 92  ? 41.965 3.328   -11.023 1.00 0.00 ? 305 GLU A HE2    4  
ATOM   7911  N N      . PRO A 1 93  ? 37.116 -0.760  -12.181 1.00 0.00 ? 306 PRO A N      4  
ATOM   7912  C CA     . PRO A 1 93  ? 36.379 -1.988  -11.939 1.00 0.00 ? 306 PRO A CA     4  
ATOM   7913  C C      . PRO A 1 93  ? 36.400 -2.357  -10.455 1.00 0.00 ? 306 PRO A C      4  
ATOM   7914  O O      . PRO A 1 93  ? 37.271 -1.907  -9.711  1.00 0.00 ? 306 PRO A O      4  
ATOM   7915  C CB     . PRO A 1 93  ? 37.050 -3.029  -12.820 1.00 0.00 ? 306 PRO A CB     4  
ATOM   7916  C CG     . PRO A 1 93  ? 38.418 -2.464  -13.165 1.00 0.00 ? 306 PRO A CG     4  
ATOM   7917  C CD     . PRO A 1 93  ? 38.417 -0.988  -12.802 1.00 0.00 ? 306 PRO A CD     4  
ATOM   7918  H HA     . PRO A 1 93  ? 35.415 -1.867  -12.177 1.00 0.00 ? 306 PRO A HA     4  
ATOM   7919  H HB2    . PRO A 1 93  ? 37.142 -3.982  -12.297 1.00 0.00 ? 306 PRO A HB2    4  
ATOM   7920  H HB3    . PRO A 1 93  ? 36.465 -3.215  -13.720 1.00 0.00 ? 306 PRO A HB3    4  
ATOM   7921  H HG2    . PRO A 1 93  ? 39.199 -2.992  -12.618 1.00 0.00 ? 306 PRO A HG2    4  
ATOM   7922  H HG3    . PRO A 1 93  ? 38.628 -2.595  -14.227 1.00 0.00 ? 306 PRO A HG3    4  
ATOM   7923  H HD2    . PRO A 1 93  ? 39.230 -0.749  -12.116 1.00 0.00 ? 306 PRO A HD2    4  
ATOM   7924  H HD3    . PRO A 1 93  ? 38.550 -0.363  -13.684 1.00 0.00 ? 306 PRO A HD3    4  
ATOM   7925  N N      . ARG A 1 94  ? 35.431 -3.173  -10.066 1.00 0.00 ? 307 ARG A N      4  
ATOM   7926  C CA     . ARG A 1 94  ? 35.327 -3.608  -8.684  1.00 0.00 ? 307 ARG A CA     4  
ATOM   7927  C C      . ARG A 1 94  ? 36.717 -3.902  -8.115  1.00 0.00 ? 307 ARG A C      4  
ATOM   7928  O O      . ARG A 1 94  ? 37.355 -4.880  -8.503  1.00 0.00 ? 307 ARG A O      4  
ATOM   7929  C CB     . ARG A 1 94  ? 34.458 -4.861  -8.564  1.00 0.00 ? 307 ARG A CB     4  
ATOM   7930  C CG     . ARG A 1 94  ? 33.049 -4.507  -8.084  1.00 0.00 ? 307 ARG A CG     4  
ATOM   7931  C CD     . ARG A 1 94  ? 32.338 -3.601  -9.092  1.00 0.00 ? 307 ARG A CD     4  
ATOM   7932  N NE     . ARG A 1 94  ? 32.072 -2.279  -8.482  1.00 0.00 ? 307 ARG A NE     4  
ATOM   7933  C CZ     . ARG A 1 94  ? 30.977 -1.989  -7.766  1.00 0.00 ? 307 ARG A CZ     4  
ATOM   7934  N NH1    . ARG A 1 94  ? 30.040 -2.925  -7.565  1.00 0.00 ? 307 ARG A NH1    4  
ATOM   7935  N NH2    . ARG A 1 94  ? 30.819 -0.762  -7.251  1.00 0.00 ? 307 ARG A NH2    4  
ATOM   7936  H H      . ARG A 1 94  ? 34.727 -3.535  -10.677 1.00 0.00 ? 307 ARG A H      4  
ATOM   7937  H HA     . ARG A 1 94  ? 34.859 -2.772  -8.164  1.00 0.00 ? 307 ARG A HA     4  
ATOM   7938  H HB2    . ARG A 1 94  ? 34.402 -5.362  -9.531  1.00 0.00 ? 307 ARG A HB2    4  
ATOM   7939  H HB3    . ARG A 1 94  ? 34.918 -5.562  -7.867  1.00 0.00 ? 307 ARG A HB3    4  
ATOM   7940  H HG2    . ARG A 1 94  ? 32.471 -5.420  -7.939  1.00 0.00 ? 307 ARG A HG2    4  
ATOM   7941  H HG3    . ARG A 1 94  ? 33.105 -4.009  -7.117  1.00 0.00 ? 307 ARG A HG3    4  
ATOM   7942  H HD2    . ARG A 1 94  ? 32.953 -3.482  -9.984  1.00 0.00 ? 307 ARG A HD2    4  
ATOM   7943  H HD3    . ARG A 1 94  ? 31.402 -4.060  -9.409  1.00 0.00 ? 307 ARG A HD3    4  
ATOM   7944  H HE     . ARG A 1 94  ? 32.751 -1.557  -8.614  1.00 0.00 ? 307 ARG A HE     4  
ATOM   7945  H HH11   . ARG A 1 94  ? 30.158 -3.841  -7.948  1.00 0.00 ? 307 ARG A HH11   4  
ATOM   7946  H HH12   . ARG A 1 94  ? 29.223 -2.709  -7.029  1.00 0.00 ? 307 ARG A HH12   4  
ATOM   7947  H HH21   . ARG A 1 94  ? 31.518 -0.063  -7.402  1.00 0.00 ? 307 ARG A HH21   4  
ATOM   7948  H HH22   . ARG A 1 94  ? 30.002 -0.545  -6.716  1.00 0.00 ? 307 ARG A HH22   4  
ATOM   7949  N N      . SER A 1 95  ? 37.143 -3.040  -7.203  1.00 0.00 ? 308 SER A N      4  
ATOM   7950  C CA     . SER A 1 95  ? 38.445 -3.196  -6.577  1.00 0.00 ? 308 SER A CA     4  
ATOM   7951  C C      . SER A 1 95  ? 38.515 -4.535  -5.840  1.00 0.00 ? 308 SER A C      4  
ATOM   7952  O O      . SER A 1 95  ? 39.601 -5.030  -5.546  1.00 0.00 ? 308 SER A O      4  
ATOM   7953  C CB     . SER A 1 95  ? 38.733 -2.044  -5.612  1.00 0.00 ? 308 SER A CB     4  
ATOM   7954  O OG     . SER A 1 95  ? 37.570 -1.648  -4.890  1.00 0.00 ? 308 SER A OG     4  
ATOM   7955  H H      . SER A 1 95  ? 36.617 -2.248  -6.893  1.00 0.00 ? 308 SER A H      4  
ATOM   7956  H HA     . SER A 1 95  ? 39.164 -3.172  -7.396  1.00 0.00 ? 308 SER A HA     4  
ATOM   7957  H HB2    . SER A 1 95  ? 39.510 -2.345  -4.910  1.00 0.00 ? 308 SER A HB2    4  
ATOM   7958  H HB3    . SER A 1 95  ? 39.121 -1.192  -6.170  1.00 0.00 ? 308 SER A HB3    4  
ATOM   7959  H HG     . SER A 1 95  ? 37.089 -0.924  -5.385  1.00 0.00 ? 308 SER A HG     4  
ATOM   7960  N N      . ALA A 1 96  ? 37.340 -5.084  -5.565  1.00 0.00 ? 309 ALA A N      4  
ATOM   7961  C CA     . ALA A 1 96  ? 37.255 -6.356  -4.869  1.00 0.00 ? 309 ALA A CA     4  
ATOM   7962  C C      . ALA A 1 96  ? 35.837 -6.915  -5.011  1.00 0.00 ? 309 ALA A C      4  
ATOM   7963  O O      . ALA A 1 96  ? 34.902 -6.176  -5.312  1.00 0.00 ? 309 ALA A O      4  
ATOM   7964  C CB     . ALA A 1 96  ? 37.663 -6.168  -3.407  1.00 0.00 ? 309 ALA A CB     4  
ATOM   7965  H H      . ALA A 1 96  ? 36.461 -4.676  -5.808  1.00 0.00 ? 309 ALA A H      4  
ATOM   7966  H HA     . ALA A 1 96  ? 37.956 -7.043  -5.344  1.00 0.00 ? 309 ALA A HA     4  
ATOM   7967  H HB1    . ALA A 1 96  ? 37.269 -5.220  -3.040  1.00 0.00 ? 309 ALA A HB1    4  
ATOM   7968  H HB2    . ALA A 1 96  ? 37.261 -6.985  -2.808  1.00 0.00 ? 309 ALA A HB2    4  
ATOM   7969  H HB3    . ALA A 1 96  ? 38.751 -6.162  -3.332  1.00 0.00 ? 309 ALA A HB3    4  
ATOM   7970  N N      . THR A 1 97  ? 35.724 -8.216  -4.786  1.00 0.00 ? 310 THR A N      4  
ATOM   7971  C CA     . THR A 1 97  ? 34.436 -8.883  -4.885  1.00 0.00 ? 310 THR A CA     4  
ATOM   7972  C C      . THR A 1 97  ? 33.694 -8.810  -3.550  1.00 0.00 ? 310 THR A C      4  
ATOM   7973  O O      . THR A 1 97  ? 34.284 -9.039  -2.494  1.00 0.00 ? 310 THR A O      4  
ATOM   7974  C CB     . THR A 1 97  ? 34.681 -10.315 -5.367  1.00 0.00 ? 310 THR A CB     4  
ATOM   7975  O OG1    . THR A 1 97  ? 35.242 -10.152 -6.667  1.00 0.00 ? 310 THR A OG1    4  
ATOM   7976  C CG2    . THR A 1 97  ? 33.379 -11.079 -5.615  1.00 0.00 ? 310 THR A CG2    4  
ATOM   7977  H H      . THR A 1 97  ? 36.490 -8.811  -4.541  1.00 0.00 ? 310 THR A H      4  
ATOM   7978  H HA     . THR A 1 97  ? 33.829 -8.352  -5.618  1.00 0.00 ? 310 THR A HA     4  
ATOM   7979  H HB     . THR A 1 97  ? 35.323 -10.855 -4.672  1.00 0.00 ? 310 THR A HB     4  
ATOM   7980  H HG1    . THR A 1 97  ? 36.238 -10.089 -6.604  1.00 0.00 ? 310 THR A HG1    4  
ATOM   7981  H HG21   . THR A 1 97  ? 32.777 -10.542 -6.347  1.00 0.00 ? 310 THR A HG21   4  
ATOM   7982  H HG22   . THR A 1 97  ? 33.610 -12.075 -5.996  1.00 0.00 ? 310 THR A HG22   4  
ATOM   7983  H HG23   . THR A 1 97  ? 32.825 -11.167 -4.682  1.00 0.00 ? 310 THR A HG23   4  
ATOM   7984  N N      . VAL A 1 98  ? 32.411 -8.491  -3.638  1.00 0.00 ? 311 VAL A N      4  
ATOM   7985  C CA     . VAL A 1 98  ? 31.582 -8.385  -2.450  1.00 0.00 ? 311 VAL A CA     4  
ATOM   7986  C C      . VAL A 1 98  ? 30.464 -9.427  -2.519  1.00 0.00 ? 311 VAL A C      4  
ATOM   7987  O O      . VAL A 1 98  ? 29.773 -9.534  -3.532  1.00 0.00 ? 311 VAL A O      4  
ATOM   7988  C CB     . VAL A 1 98  ? 31.059 -6.955  -2.302  1.00 0.00 ? 311 VAL A CB     4  
ATOM   7989  C CG1    . VAL A 1 98  ? 29.794 -6.919  -1.442  1.00 0.00 ? 311 VAL A CG1    4  
ATOM   7990  C CG2    . VAL A 1 98  ? 32.137 -6.033  -1.728  1.00 0.00 ? 311 VAL A CG2    4  
ATOM   7991  H H      . VAL A 1 98  ? 31.940 -8.306  -4.500  1.00 0.00 ? 311 VAL A H      4  
ATOM   7992  H HA     . VAL A 1 98  ? 32.213 -8.605  -1.588  1.00 0.00 ? 311 VAL A HA     4  
ATOM   7993  H HB     . VAL A 1 98  ? 30.800 -6.588  -3.295  1.00 0.00 ? 311 VAL A HB     4  
ATOM   7994  H HG11   . VAL A 1 98  ? 29.859 -6.094  -0.733  1.00 0.00 ? 311 VAL A HG11   4  
ATOM   7995  H HG12   . VAL A 1 98  ? 28.923 -6.779  -2.084  1.00 0.00 ? 311 VAL A HG12   4  
ATOM   7996  H HG13   . VAL A 1 98  ? 29.698 -7.859  -0.899  1.00 0.00 ? 311 VAL A HG13   4  
ATOM   7997  H HG21   . VAL A 1 98  ? 33.089 -6.564  -1.694  1.00 0.00 ? 311 VAL A HG21   4  
ATOM   7998  H HG22   . VAL A 1 98  ? 32.237 -5.151  -2.362  1.00 0.00 ? 311 VAL A HG22   4  
ATOM   7999  H HG23   . VAL A 1 98  ? 31.856 -5.727  -0.721  1.00 0.00 ? 311 VAL A HG23   4  
ATOM   8000  N N      . SER A 1 99  ? 30.319 -10.167 -1.430  1.00 0.00 ? 312 SER A N      4  
ATOM   8001  C CA     . SER A 1 99  ? 29.296 -11.196 -1.354  1.00 0.00 ? 312 SER A CA     4  
ATOM   8002  C C      . SER A 1 99  ? 28.573 -11.116 -0.009  1.00 0.00 ? 312 SER A C      4  
ATOM   8003  O O      . SER A 1 99  ? 29.211 -11.082 1.042   1.00 0.00 ? 312 SER A O      4  
ATOM   8004  C CB     . SER A 1 99  ? 29.899 -12.588 -1.551  1.00 0.00 ? 312 SER A CB     4  
ATOM   8005  O OG     . SER A 1 99  ? 30.433 -13.114 -0.339  1.00 0.00 ? 312 SER A OG     4  
ATOM   8006  H H      . SER A 1 99  ? 30.885 -10.072 -0.611  1.00 0.00 ? 312 SER A H      4  
ATOM   8007  H HA     . SER A 1 99  ? 28.609 -10.979 -2.172  1.00 0.00 ? 312 SER A HA     4  
ATOM   8008  H HB2    . SER A 1 99  ? 29.134 -13.263 -1.934  1.00 0.00 ? 312 SER A HB2    4  
ATOM   8009  H HB3    . SER A 1 99  ? 30.687 -12.538 -2.303  1.00 0.00 ? 312 SER A HB3    4  
ATOM   8010  H HG     . SER A 1 99  ? 31.227 -13.689 -0.536  1.00 0.00 ? 312 SER A HG     4  
ATOM   8011  N N      . ALA A 1 100 ? 27.250 -11.088 -0.085  1.00 0.00 ? 313 ALA A N      4  
ATOM   8012  C CA     . ALA A 1 100 ? 26.433 -11.014 1.114   1.00 0.00 ? 313 ALA A CA     4  
ATOM   8013  C C      . ALA A 1 100 ? 26.540 -12.332 1.882   1.00 0.00 ? 313 ALA A C      4  
ATOM   8014  O O      . ALA A 1 100 ? 26.138 -13.381 1.380   1.00 0.00 ? 313 ALA A O      4  
ATOM   8015  C CB     . ALA A 1 100 ? 24.990 -10.678 0.729   1.00 0.00 ? 313 ALA A CB     4  
ATOM   8016  H H      . ALA A 1 100 ? 26.739 -11.115 -0.944  1.00 0.00 ? 313 ALA A H      4  
ATOM   8017  H HA     . ALA A 1 100 ? 26.826 -10.209 1.735   1.00 0.00 ? 313 ALA A HA     4  
ATOM   8018  H HB1    . ALA A 1 100 ? 24.474 -10.252 1.589   1.00 0.00 ? 313 ALA A HB1    4  
ATOM   8019  H HB2    . ALA A 1 100 ? 24.990 -9.957  -0.088  1.00 0.00 ? 313 ALA A HB2    4  
ATOM   8020  H HB3    . ALA A 1 100 ? 24.479 -11.587 0.412   1.00 0.00 ? 313 ALA A HB3    4  
ATOM   8021  N N      . ALA A 1 101 ? 27.082 -12.236 3.087   1.00 0.00 ? 314 ALA A N      4  
ATOM   8022  C CA     . ALA A 1 101 ? 27.247 -13.409 3.929   1.00 0.00 ? 314 ALA A CA     4  
ATOM   8023  C C      . ALA A 1 101 ? 25.869 -13.951 4.317   1.00 0.00 ? 314 ALA A C      4  
ATOM   8024  O O      . ALA A 1 101 ? 25.691 -15.160 4.456   1.00 0.00 ? 314 ALA A O      4  
ATOM   8025  C CB     . ALA A 1 101 ? 28.095 -13.047 5.149   1.00 0.00 ? 314 ALA A CB     4  
ATOM   8026  H H      . ALA A 1 101 ? 27.406 -11.380 3.487   1.00 0.00 ? 314 ALA A H      4  
ATOM   8027  H HA     . ALA A 1 101 ? 27.774 -14.164 3.346   1.00 0.00 ? 314 ALA A HA     4  
ATOM   8028  H HB1    . ALA A 1 101 ? 28.412 -13.958 5.656   1.00 0.00 ? 314 ALA A HB1    4  
ATOM   8029  H HB2    . ALA A 1 101 ? 28.974 -12.487 4.828   1.00 0.00 ? 314 ALA A HB2    4  
ATOM   8030  H HB3    . ALA A 1 101 ? 27.505 -12.437 5.834   1.00 0.00 ? 314 ALA A HB3    4  
ATOM   8031  N N      . THR A 1 102 ? 24.931 -13.030 4.478   1.00 0.00 ? 315 THR A N      4  
ATOM   8032  C CA     . THR A 1 102 ? 23.576 -13.400 4.847   1.00 0.00 ? 315 THR A CA     4  
ATOM   8033  C C      . THR A 1 102 ? 22.567 -12.455 4.191   1.00 0.00 ? 315 THR A C      4  
ATOM   8034  O O      . THR A 1 102 ? 22.952 -11.531 3.475   1.00 0.00 ? 315 THR A O      4  
ATOM   8035  C CB     . THR A 1 102 ? 23.488 -13.417 6.374   1.00 0.00 ? 315 THR A CB     4  
ATOM   8036  O OG1    . THR A 1 102 ? 22.191 -13.943 6.642   1.00 0.00 ? 315 THR A OG1    4  
ATOM   8037  C CG2    . THR A 1 102 ? 23.450 -12.009 6.973   1.00 0.00 ? 315 THR A CG2    4  
ATOM   8038  H H      . THR A 1 102 ? 25.085 -12.049 4.363   1.00 0.00 ? 315 THR A H      4  
ATOM   8039  H HA     . THR A 1 102 ? 23.375 -14.399 4.461   1.00 0.00 ? 315 THR A HA     4  
ATOM   8040  H HB     . THR A 1 102 ? 24.301 -14.001 6.805   1.00 0.00 ? 315 THR A HB     4  
ATOM   8041  H HG1    . THR A 1 102 ? 22.050 -14.019 7.630   1.00 0.00 ? 315 THR A HG1    4  
ATOM   8042  H HG21   . THR A 1 102 ? 22.936 -12.037 7.935   1.00 0.00 ? 315 THR A HG21   4  
ATOM   8043  H HG22   . THR A 1 102 ? 24.468 -11.648 7.116   1.00 0.00 ? 315 THR A HG22   4  
ATOM   8044  H HG23   . THR A 1 102 ? 22.918 -11.340 6.297   1.00 0.00 ? 315 THR A HG23   4  
ATOM   8045  N N      . THR A 1 103 ? 21.296 -12.717 4.459   1.00 0.00 ? 316 THR A N      4  
ATOM   8046  C CA     . THR A 1 103 ? 20.230 -11.901 3.904   1.00 0.00 ? 316 THR A CA     4  
ATOM   8047  C C      . THR A 1 103 ? 20.287 -10.485 4.481   1.00 0.00 ? 316 THR A C      4  
ATOM   8048  O O      . THR A 1 103 ? 19.914 -10.265 5.632   1.00 0.00 ? 316 THR A O      4  
ATOM   8049  C CB     . THR A 1 103 ? 18.903 -12.613 4.169   1.00 0.00 ? 316 THR A CB     4  
ATOM   8050  O OG1    . THR A 1 103 ? 19.019 -13.843 3.459   1.00 0.00 ? 316 THR A OG1    4  
ATOM   8051  C CG2    . THR A 1 103 ? 17.718 -11.910 3.503   1.00 0.00 ? 316 THR A CG2    4  
ATOM   8052  H H      . THR A 1 103 ? 20.992 -13.470 5.042   1.00 0.00 ? 316 THR A H      4  
ATOM   8053  H HA     . THR A 1 103 ? 20.388 -11.814 2.829   1.00 0.00 ? 316 THR A HA     4  
ATOM   8054  H HB     . THR A 1 103 ? 18.732 -12.733 5.239   1.00 0.00 ? 316 THR A HB     4  
ATOM   8055  H HG1    . THR A 1 103 ? 19.802 -14.362 3.803   1.00 0.00 ? 316 THR A HG1    4  
ATOM   8056  H HG21   . THR A 1 103 ? 16.788 -12.253 3.959   1.00 0.00 ? 316 THR A HG21   4  
ATOM   8057  H HG22   . THR A 1 103 ? 17.812 -10.833 3.638   1.00 0.00 ? 316 THR A HG22   4  
ATOM   8058  H HG23   . THR A 1 103 ? 17.709 -12.144 2.439   1.00 0.00 ? 316 THR A HG23   4  
ATOM   8059  N N      . VAL A 1 104 ? 20.757 -9.562  3.655   1.00 0.00 ? 317 VAL A N      4  
ATOM   8060  C CA     . VAL A 1 104 ? 20.866 -8.174  4.069   1.00 0.00 ? 317 VAL A CA     4  
ATOM   8061  C C      . VAL A 1 104 ? 20.135 -7.285  3.061   1.00 0.00 ? 317 VAL A C      4  
ATOM   8062  O O      . VAL A 1 104 ? 20.092 -7.596  1.872   1.00 0.00 ? 317 VAL A O      4  
ATOM   8063  C CB     . VAL A 1 104 ? 22.338 -7.794  4.241   1.00 0.00 ? 317 VAL A CB     4  
ATOM   8064  C CG1    . VAL A 1 104 ? 23.034 -8.733  5.230   1.00 0.00 ? 317 VAL A CG1    4  
ATOM   8065  C CG2    . VAL A 1 104 ? 23.063 -7.782  2.895   1.00 0.00 ? 317 VAL A CG2    4  
ATOM   8066  H H      . VAL A 1 104 ? 21.057 -9.750  2.720   1.00 0.00 ? 317 VAL A H      4  
ATOM   8067  H HA     . VAL A 1 104 ? 20.378 -8.079  5.039   1.00 0.00 ? 317 VAL A HA     4  
ATOM   8068  H HB     . VAL A 1 104 ? 22.379 -6.786  4.653   1.00 0.00 ? 317 VAL A HB     4  
ATOM   8069  H HG11   . VAL A 1 104 ? 23.521 -9.540  4.683   1.00 0.00 ? 317 VAL A HG11   4  
ATOM   8070  H HG12   . VAL A 1 104 ? 23.780 -8.176  5.796   1.00 0.00 ? 317 VAL A HG12   4  
ATOM   8071  H HG13   . VAL A 1 104 ? 22.296 -9.151  5.915   1.00 0.00 ? 317 VAL A HG13   4  
ATOM   8072  H HG21   . VAL A 1 104 ? 23.682 -6.887  2.823   1.00 0.00 ? 317 VAL A HG21   4  
ATOM   8073  H HG22   . VAL A 1 104 ? 23.695 -8.667  2.813   1.00 0.00 ? 317 VAL A HG22   4  
ATOM   8074  H HG23   . VAL A 1 104 ? 22.331 -7.782  2.088   1.00 0.00 ? 317 VAL A HG23   4  
ATOM   8075  N N      . SER A 1 105 ? 19.578 -6.198  3.573   1.00 0.00 ? 318 SER A N      4  
ATOM   8076  C CA     . SER A 1 105 ? 18.850 -5.263  2.732   1.00 0.00 ? 318 SER A CA     4  
ATOM   8077  C C      . SER A 1 105 ? 19.692 -4.007  2.496   1.00 0.00 ? 318 SER A C      4  
ATOM   8078  O O      . SER A 1 105 ? 20.049 -3.307  3.443   1.00 0.00 ? 318 SER A O      4  
ATOM   8079  C CB     . SER A 1 105 ? 17.505 -4.890  3.358   1.00 0.00 ? 318 SER A CB     4  
ATOM   8080  O OG     . SER A 1 105 ? 16.512 -4.627  2.372   1.00 0.00 ? 318 SER A OG     4  
ATOM   8081  H H      . SER A 1 105 ? 19.618 -5.953  4.542   1.00 0.00 ? 318 SER A H      4  
ATOM   8082  H HA     . SER A 1 105 ? 18.679 -5.790  1.794   1.00 0.00 ? 318 SER A HA     4  
ATOM   8083  H HB2    . SER A 1 105 ? 17.169 -5.701  4.005   1.00 0.00 ? 318 SER A HB2    4  
ATOM   8084  H HB3    . SER A 1 105 ? 17.631 -4.011  3.991   1.00 0.00 ? 318 SER A HB3    4  
ATOM   8085  H HG     . SER A 1 105 ? 16.200 -3.679  2.445   1.00 0.00 ? 318 SER A HG     4  
ATOM   8086  N N      . LEU A 1 106 ? 19.985 -3.759  1.228   1.00 0.00 ? 319 LEU A N      4  
ATOM   8087  C CA     . LEU A 1 106 ? 20.779 -2.599  0.856   1.00 0.00 ? 319 LEU A CA     4  
ATOM   8088  C C      . LEU A 1 106 ? 20.023 -1.787  -0.197  1.00 0.00 ? 319 LEU A C      4  
ATOM   8089  O O      . LEU A 1 106 ? 19.062 -2.274  -0.791  1.00 0.00 ? 319 LEU A O      4  
ATOM   8090  C CB     . LEU A 1 106 ? 22.179 -3.029  0.413   1.00 0.00 ? 319 LEU A CB     4  
ATOM   8091  C CG     . LEU A 1 106 ? 22.305 -4.455  -0.126  1.00 0.00 ? 319 LEU A CG     4  
ATOM   8092  C CD1    . LEU A 1 106 ? 22.061 -5.483  0.979   1.00 0.00 ? 319 LEU A CD1    4  
ATOM   8093  C CD2    . LEU A 1 106 ? 21.379 -4.671  -1.326  1.00 0.00 ? 319 LEU A CD2    4  
ATOM   8094  H H      . LEU A 1 106 ? 19.692 -4.333  0.464   1.00 0.00 ? 319 LEU A H      4  
ATOM   8095  H HA     . LEU A 1 106 ? 20.896 -1.984  1.748   1.00 0.00 ? 319 LEU A HA     4  
ATOM   8096  H HB2    . LEU A 1 106 ? 22.522 -2.338  -0.357  1.00 0.00 ? 319 LEU A HB2    4  
ATOM   8097  H HB3    . LEU A 1 106 ? 22.855 -2.921  1.262   1.00 0.00 ? 319 LEU A HB3    4  
ATOM   8098  H HG     . LEU A 1 106 ? 23.326 -4.597  -0.479  1.00 0.00 ? 319 LEU A HG     4  
ATOM   8099  H HD11   . LEU A 1 106 ? 21.117 -5.997  0.796   1.00 0.00 ? 319 LEU A HD11   4  
ATOM   8100  H HD12   . LEU A 1 106 ? 22.874 -6.208  0.988   1.00 0.00 ? 319 LEU A HD12   4  
ATOM   8101  H HD13   . LEU A 1 106 ? 22.016 -4.976  1.944   1.00 0.00 ? 319 LEU A HD13   4  
ATOM   8102  H HD21   . LEU A 1 106 ? 20.566 -5.339  -1.041  1.00 0.00 ? 319 LEU A HD21   4  
ATOM   8103  H HD22   . LEU A 1 106 ? 20.967 -3.713  -1.644  1.00 0.00 ? 319 LEU A HD22   4  
ATOM   8104  H HD23   . LEU A 1 106 ? 21.944 -5.114  -2.145  1.00 0.00 ? 319 LEU A HD23   4  
ATOM   8105  N N      . LEU A 1 107 ? 20.485 -0.562  -0.396  1.00 0.00 ? 320 LEU A N      4  
ATOM   8106  C CA     . LEU A 1 107 ? 19.864 0.324   -1.368  1.00 0.00 ? 320 LEU A CA     4  
ATOM   8107  C C      . LEU A 1 107 ? 20.764 0.432   -2.600  1.00 0.00 ? 320 LEU A C      4  
ATOM   8108  O O      . LEU A 1 107 ? 21.985 0.328   -2.493  1.00 0.00 ? 320 LEU A O      4  
ATOM   8109  C CB     . LEU A 1 107 ? 19.532 1.673   -0.728  1.00 0.00 ? 320 LEU A CB     4  
ATOM   8110  C CG     . LEU A 1 107 ? 18.969 1.621   0.693   1.00 0.00 ? 320 LEU A CG     4  
ATOM   8111  C CD1    . LEU A 1 107 ? 20.079 1.800   1.731   1.00 0.00 ? 320 LEU A CD1    4  
ATOM   8112  C CD2    . LEU A 1 107 ? 17.844 2.642   0.875   1.00 0.00 ? 320 LEU A CD2    4  
ATOM   8113  H H      . LEU A 1 107 ? 21.267 -0.173  0.090   1.00 0.00 ? 320 LEU A H      4  
ATOM   8114  H HA     . LEU A 1 107 ? 18.921 -0.131  -1.668  1.00 0.00 ? 320 LEU A HA     4  
ATOM   8115  H HB2    . LEU A 1 107 ? 20.439 2.280   -0.716  1.00 0.00 ? 320 LEU A HB2    4  
ATOM   8116  H HB3    . LEU A 1 107 ? 18.813 2.187   -1.364  1.00 0.00 ? 320 LEU A HB3    4  
ATOM   8117  H HG     . LEU A 1 107 ? 18.536 0.633   0.854   1.00 0.00 ? 320 LEU A HG     4  
ATOM   8118  H HD11   . LEU A 1 107 ? 20.502 0.828   1.983   1.00 0.00 ? 320 LEU A HD11   4  
ATOM   8119  H HD12   . LEU A 1 107 ? 20.860 2.441   1.320   1.00 0.00 ? 320 LEU A HD12   4  
ATOM   8120  H HD13   . LEU A 1 107 ? 19.667 2.261   2.629   1.00 0.00 ? 320 LEU A HD13   4  
ATOM   8121  H HD21   . LEU A 1 107 ? 17.680 2.816   1.938   1.00 0.00 ? 320 LEU A HD21   4  
ATOM   8122  H HD22   . LEU A 1 107 ? 18.122 3.578   0.392   1.00 0.00 ? 320 LEU A HD22   4  
ATOM   8123  H HD23   . LEU A 1 107 ? 16.929 2.258   0.425   1.00 0.00 ? 320 LEU A HD23   4  
ATOM   8124  N N      . SER A 1 108 ? 20.127 0.641   -3.743  1.00 0.00 ? 321 SER A N      4  
ATOM   8125  C CA     . SER A 1 108 ? 20.855 0.764   -4.995  1.00 0.00 ? 321 SER A CA     4  
ATOM   8126  C C      . SER A 1 108 ? 20.709 2.185   -5.546  1.00 0.00 ? 321 SER A C      4  
ATOM   8127  O O      . SER A 1 108 ? 19.596 2.696   -5.665  1.00 0.00 ? 321 SER A O      4  
ATOM   8128  C CB     . SER A 1 108 ? 20.362 -0.257  -6.021  1.00 0.00 ? 321 SER A CB     4  
ATOM   8129  O OG     . SER A 1 108 ? 20.819 -1.574  -5.725  1.00 0.00 ? 321 SER A OG     4  
ATOM   8130  H H      . SER A 1 108 ? 19.133 0.724   -3.822  1.00 0.00 ? 321 SER A H      4  
ATOM   8131  H HA     . SER A 1 108 ? 21.895 0.555   -4.745  1.00 0.00 ? 321 SER A HA     4  
ATOM   8132  H HB2    . SER A 1 108 ? 19.272 -0.249  -6.047  1.00 0.00 ? 321 SER A HB2    4  
ATOM   8133  H HB3    . SER A 1 108 ? 20.707 0.032   -7.014  1.00 0.00 ? 321 SER A HB3    4  
ATOM   8134  H HG     . SER A 1 108 ? 20.645 -1.789  -4.765  1.00 0.00 ? 321 SER A HG     4  
ATOM   8135  N N      . LEU A 1 109 ? 21.847 2.779   -5.870  1.00 0.00 ? 322 LEU A N      4  
ATOM   8136  C CA     . LEU A 1 109 ? 21.860 4.129   -6.405  1.00 0.00 ? 322 LEU A CA     4  
ATOM   8137  C C      . LEU A 1 109 ? 22.482 4.112   -7.804  1.00 0.00 ? 322 LEU A C      4  
ATOM   8138  O O      . LEU A 1 109 ? 23.507 3.467   -8.023  1.00 0.00 ? 322 LEU A O      4  
ATOM   8139  C CB     . LEU A 1 109 ? 22.556 5.085   -5.434  1.00 0.00 ? 322 LEU A CB     4  
ATOM   8140  C CG     . LEU A 1 109 ? 22.707 6.532   -5.909  1.00 0.00 ? 322 LEU A CG     4  
ATOM   8141  C CD1    . LEU A 1 109 ? 21.616 7.423   -5.310  1.00 0.00 ? 322 LEU A CD1    4  
ATOM   8142  C CD2    . LEU A 1 109 ? 24.110 7.064   -5.609  1.00 0.00 ? 322 LEU A CD2    4  
ATOM   8143  H H      . LEU A 1 109 ? 22.748 2.355   -5.770  1.00 0.00 ? 322 LEU A H      4  
ATOM   8144  H HA     . LEU A 1 109 ? 20.824 4.456   -6.493  1.00 0.00 ? 322 LEU A HA     4  
ATOM   8145  H HB2    . LEU A 1 109 ? 21.999 5.087   -4.497  1.00 0.00 ? 322 LEU A HB2    4  
ATOM   8146  H HB3    . LEU A 1 109 ? 23.548 4.690   -5.215  1.00 0.00 ? 322 LEU A HB3    4  
ATOM   8147  H HG     . LEU A 1 109 ? 22.580 6.551   -6.991  1.00 0.00 ? 322 LEU A HG     4  
ATOM   8148  H HD11   . LEU A 1 109 ? 20.654 7.165   -5.753  1.00 0.00 ? 322 LEU A HD11   4  
ATOM   8149  H HD12   . LEU A 1 109 ? 21.573 7.269   -4.232  1.00 0.00 ? 322 LEU A HD12   4  
ATOM   8150  H HD13   . LEU A 1 109 ? 21.844 8.467   -5.520  1.00 0.00 ? 322 LEU A HD13   4  
ATOM   8151  H HD21   . LEU A 1 109 ? 24.468 7.643   -6.461  1.00 0.00 ? 322 LEU A HD21   4  
ATOM   8152  H HD22   . LEU A 1 109 ? 24.075 7.700   -4.725  1.00 0.00 ? 322 LEU A HD22   4  
ATOM   8153  H HD23   . LEU A 1 109 ? 24.785 6.227   -5.430  1.00 0.00 ? 322 LEU A HD23   4  
ATOM   8154  N N      . HIS A 1 110 ? 21.838 4.828   -8.712  1.00 0.00 ? 323 HIS A N      4  
ATOM   8155  C CA     . HIS A 1 110 ? 22.316 4.904   -10.082 1.00 0.00 ? 323 HIS A CA     4  
ATOM   8156  C C      . HIS A 1 110 ? 23.601 5.733   -10.133 1.00 0.00 ? 323 HIS A C      4  
ATOM   8157  O O      . HIS A 1 110 ? 23.820 6.597   -9.285  1.00 0.00 ? 323 HIS A O      4  
ATOM   8158  C CB     . HIS A 1 110 ? 21.224 5.446   -11.009 1.00 0.00 ? 323 HIS A CB     4  
ATOM   8159  C CG     . HIS A 1 110 ? 21.301 4.917   -12.422 1.00 0.00 ? 323 HIS A CG     4  
ATOM   8160  N ND1    . HIS A 1 110 ? 21.643 5.712   -13.502 1.00 0.00 ? 323 HIS A ND1    4  
ATOM   8161  C CD2    . HIS A 1 110 ? 21.078 3.667   -12.919 1.00 0.00 ? 323 HIS A CD2    4  
ATOM   8162  C CE1    . HIS A 1 110 ? 21.623 4.964   -14.594 1.00 0.00 ? 323 HIS A CE1    4  
ATOM   8163  N NE2    . HIS A 1 110 ? 21.271 3.697   -14.232 1.00 0.00 ? 323 HIS A NE2    4  
ATOM   8164  H H      . HIS A 1 110 ? 21.005 5.351   -8.525  1.00 0.00 ? 323 HIS A H      4  
ATOM   8165  H HA     . HIS A 1 110 ? 22.539 3.884   -10.392 1.00 0.00 ? 323 HIS A HA     4  
ATOM   8166  H HB2    . HIS A 1 110 ? 20.249 5.194   -10.591 1.00 0.00 ? 323 HIS A HB2    4  
ATOM   8167  H HB3    . HIS A 1 110 ? 21.289 6.532   -11.034 1.00 0.00 ? 323 HIS A HB3    4  
ATOM   8168  H HD1    . HIS A 1 110 ? 21.868 6.685   -13.463 1.00 0.00 ? 323 HIS A HD1    4  
ATOM   8169  H HD2    . HIS A 1 110 ? 20.788 2.792   -12.338 1.00 0.00 ? 323 HIS A HD2    4  
ATOM   8170  H HE1    . HIS A 1 110 ? 21.847 5.302   -15.606 1.00 0.00 ? 323 HIS A HE1    4  
ATOM   8171  H HE2    . HIS A 1 110 ? 21.230 2.907   -14.844 1.00 0.00 ? 323 HIS A HE2    4  
ATOM   8172  N N      . SER A 1 111 ? 24.415 5.441   -11.137 1.00 0.00 ? 324 SER A N      4  
ATOM   8173  C CA     . SER A 1 111 ? 25.673 6.149   -11.309 1.00 0.00 ? 324 SER A CA     4  
ATOM   8174  C C      . SER A 1 111 ? 25.405 7.623   -11.619 1.00 0.00 ? 324 SER A C      4  
ATOM   8175  O O      . SER A 1 111 ? 26.184 8.493   -11.232 1.00 0.00 ? 324 SER A O      4  
ATOM   8176  C CB     . SER A 1 111 ? 26.512 5.517   -12.420 1.00 0.00 ? 324 SER A CB     4  
ATOM   8177  O OG     . SER A 1 111 ? 26.001 5.821   -13.714 1.00 0.00 ? 324 SER A OG     4  
ATOM   8178  H H      . SER A 1 111 ? 24.228 4.738   -11.822 1.00 0.00 ? 324 SER A H      4  
ATOM   8179  H HA     . SER A 1 111 ? 26.194 6.047   -10.357 1.00 0.00 ? 324 SER A HA     4  
ATOM   8180  H HB2    . SER A 1 111 ? 27.541 5.871   -12.344 1.00 0.00 ? 324 SER A HB2    4  
ATOM   8181  H HB3    . SER A 1 111 ? 26.537 4.436   -12.285 1.00 0.00 ? 324 SER A HB3    4  
ATOM   8182  H HG     . SER A 1 111 ? 26.116 6.796   -13.907 1.00 0.00 ? 324 SER A HG     4  
ATOM   8183  N N      . ALA A 1 112 ? 24.303 7.858   -12.315 1.00 0.00 ? 325 ALA A N      4  
ATOM   8184  C CA     . ALA A 1 112 ? 23.923 9.212   -12.682 1.00 0.00 ? 325 ALA A CA     4  
ATOM   8185  C C      . ALA A 1 112 ? 23.443 9.958   -11.434 1.00 0.00 ? 325 ALA A C      4  
ATOM   8186  O O      . ALA A 1 112 ? 23.653 11.164  -11.310 1.00 0.00 ? 325 ALA A O      4  
ATOM   8187  C CB     . ALA A 1 112 ? 22.857 9.164   -13.778 1.00 0.00 ? 325 ALA A CB     4  
ATOM   8188  H H      . ALA A 1 112 ? 23.674 7.145   -12.626 1.00 0.00 ? 325 ALA A H      4  
ATOM   8189  H HA     . ALA A 1 112 ? 24.809 9.710   -13.075 1.00 0.00 ? 325 ALA A HA     4  
ATOM   8190  H HB1    . ALA A 1 112 ? 22.966 8.243   -14.351 1.00 0.00 ? 325 ALA A HB1    4  
ATOM   8191  H HB2    . ALA A 1 112 ? 21.867 9.195   -13.324 1.00 0.00 ? 325 ALA A HB2    4  
ATOM   8192  H HB3    . ALA A 1 112 ? 22.979 10.021  -14.441 1.00 0.00 ? 325 ALA A HB3    4  
ATOM   8193  N N      . ASP A 1 113 ? 22.810 9.209   -10.543 1.00 0.00 ? 326 ASP A N      4  
ATOM   8194  C CA     . ASP A 1 113 ? 22.299 9.785   -9.311  1.00 0.00 ? 326 ASP A CA     4  
ATOM   8195  C C      . ASP A 1 113 ? 23.464 10.043  -8.353  1.00 0.00 ? 326 ASP A C      4  
ATOM   8196  O O      . ASP A 1 113 ? 23.404 10.956  -7.529  1.00 0.00 ? 326 ASP A O      4  
ATOM   8197  C CB     . ASP A 1 113 ? 21.322 8.832   -8.621  1.00 0.00 ? 326 ASP A CB     4  
ATOM   8198  C CG     . ASP A 1 113 ? 20.068 8.494   -9.430  1.00 0.00 ? 326 ASP A CG     4  
ATOM   8199  O OD1    . ASP A 1 113 ? 19.670 7.325   -9.534  1.00 0.00 ? 326 ASP A OD1    4  
ATOM   8200  O OD2    . ASP A 1 113 ? 19.482 9.507   -9.974  1.00 0.00 ? 326 ASP A OD2    4  
ATOM   8201  H H      . ASP A 1 113 ? 22.644 8.230   -10.653 1.00 0.00 ? 326 ASP A H      4  
ATOM   8202  H HA     . ASP A 1 113 ? 21.795 10.704  -9.611  1.00 0.00 ? 326 ASP A HA     4  
ATOM   8203  H HB2    . ASP A 1 113 ? 21.845 7.904   -8.388  1.00 0.00 ? 326 ASP A HB2    4  
ATOM   8204  H HB3    . ASP A 1 113 ? 21.016 9.271   -7.672  1.00 0.00 ? 326 ASP A HB3    4  
ATOM   8205  H HD2    . ASP A 1 113 ? 18.490 9.388   -9.938  1.00 0.00 ? 326 ASP A HD2    4  
ATOM   8206  N N      . PHE A 1 114 ? 24.495 9.223   -8.491  1.00 0.00 ? 327 PHE A N      4  
ATOM   8207  C CA     . PHE A 1 114 ? 25.672 9.351   -7.649  1.00 0.00 ? 327 PHE A CA     4  
ATOM   8208  C C      . PHE A 1 114 ? 26.472 10.603  -8.011  1.00 0.00 ? 327 PHE A C      4  
ATOM   8209  O O      . PHE A 1 114 ? 26.988 11.292  -7.132  1.00 0.00 ? 327 PHE A O      4  
ATOM   8210  C CB     . PHE A 1 114 ? 26.538 8.116   -7.899  1.00 0.00 ? 327 PHE A CB     4  
ATOM   8211  C CG     . PHE A 1 114 ? 27.768 8.024   -6.994  1.00 0.00 ? 327 PHE A CG     4  
ATOM   8212  C CD1    . PHE A 1 114 ? 27.666 7.455   -5.763  1.00 0.00 ? 327 PHE A CD1    4  
ATOM   8213  C CD2    . PHE A 1 114 ? 28.963 8.512   -7.419  1.00 0.00 ? 327 PHE A CD2    4  
ATOM   8214  C CE1    . PHE A 1 114 ? 28.808 7.370   -4.922  1.00 0.00 ? 327 PHE A CE1    4  
ATOM   8215  C CE2    . PHE A 1 114 ? 30.105 8.428   -6.579  1.00 0.00 ? 327 PHE A CE2    4  
ATOM   8216  C CZ     . PHE A 1 114 ? 30.003 7.859   -5.349  1.00 0.00 ? 327 PHE A CZ     4  
ATOM   8217  H H      . PHE A 1 114 ? 24.535 8.485   -9.163  1.00 0.00 ? 327 PHE A H      4  
ATOM   8218  H HA     . PHE A 1 114 ? 25.324 9.431   -6.619  1.00 0.00 ? 327 PHE A HA     4  
ATOM   8219  H HB2    . PHE A 1 114 ? 25.929 7.223   -7.757  1.00 0.00 ? 327 PHE A HB2    4  
ATOM   8220  H HB3    . PHE A 1 114 ? 26.864 8.118   -8.939  1.00 0.00 ? 327 PHE A HB3    4  
ATOM   8221  H HD1    . PHE A 1 114 ? 26.708 7.065   -5.421  1.00 0.00 ? 327 PHE A HD1    4  
ATOM   8222  H HD2    . PHE A 1 114 ? 29.046 8.969   -8.406  1.00 0.00 ? 327 PHE A HD2    4  
ATOM   8223  H HE1    . PHE A 1 114 ? 28.726 6.915   -3.936  1.00 0.00 ? 327 PHE A HE1    4  
ATOM   8224  H HE2    . PHE A 1 114 ? 31.063 8.819   -6.922  1.00 0.00 ? 327 PHE A HE2    4  
ATOM   8225  H HZ     . PHE A 1 114 ? 30.880 7.793   -4.704  1.00 0.00 ? 327 PHE A HZ     4  
ATOM   8226  N N      . GLN A 1 115 ? 26.552 10.861  -9.308  1.00 0.00 ? 328 GLN A N      4  
ATOM   8227  C CA     . GLN A 1 115 ? 27.281 12.018  -9.798  1.00 0.00 ? 328 GLN A CA     4  
ATOM   8228  C C      . GLN A 1 115 ? 26.489 13.298  -9.528  1.00 0.00 ? 328 GLN A C      4  
ATOM   8229  O O      . GLN A 1 115 ? 27.072 14.364  -9.332  1.00 0.00 ? 328 GLN A O      4  
ATOM   8230  C CB     . GLN A 1 115 ? 27.600 11.875  -11.288 1.00 0.00 ? 328 GLN A CB     4  
ATOM   8231  C CG     . GLN A 1 115 ? 28.749 10.890  -11.511 1.00 0.00 ? 328 GLN A CG     4  
ATOM   8232  C CD     . GLN A 1 115 ? 29.325 11.029  -12.922 1.00 0.00 ? 328 GLN A CD     4  
ATOM   8233  O OE1    . GLN A 1 115 ? 28.988 10.291  -13.834 1.00 0.00 ? 328 GLN A OE1    4  
ATOM   8234  N NE2    . GLN A 1 115 ? 30.210 12.014  -13.051 1.00 0.00 ? 328 GLN A NE2    4  
ATOM   8235  H H      . GLN A 1 115 ? 26.129 10.297  -10.017 1.00 0.00 ? 328 GLN A H      4  
ATOM   8236  H HA     . GLN A 1 115 ? 28.213 12.034  -9.234  1.00 0.00 ? 328 GLN A HA     4  
ATOM   8237  H HB2    . GLN A 1 115 ? 26.714 11.532  -11.822 1.00 0.00 ? 328 GLN A HB2    4  
ATOM   8238  H HB3    . GLN A 1 115 ? 27.865 12.848  -11.702 1.00 0.00 ? 328 GLN A HB3    4  
ATOM   8239  H HG2    . GLN A 1 115 ? 29.533 11.068  -10.775 1.00 0.00 ? 328 GLN A HG2    4  
ATOM   8240  H HG3    . GLN A 1 115 ? 28.395 9.871   -11.358 1.00 0.00 ? 328 GLN A HG3    4  
ATOM   8241  H HE21   . GLN A 1 115 ? 30.442 12.583  -12.262 1.00 0.00 ? 328 GLN A HE21   4  
ATOM   8242  H HE22   . GLN A 1 115 ? 30.642 12.184  -13.936 1.00 0.00 ? 328 GLN A HE22   4  
ATOM   8243  N N      . MET A 1 116 ? 25.172 13.153  -9.526  1.00 0.00 ? 329 MET A N      4  
ATOM   8244  C CA     . MET A 1 116 ? 24.294 14.285  -9.283  1.00 0.00 ? 329 MET A CA     4  
ATOM   8245  C C      . MET A 1 116 ? 24.283 14.660  -7.799  1.00 0.00 ? 329 MET A C      4  
ATOM   8246  O O      . MET A 1 116 ? 24.138 15.831  -7.454  1.00 0.00 ? 329 MET A O      4  
ATOM   8247  C CB     . MET A 1 116 ? 22.874 13.935  -9.732  1.00 0.00 ? 329 MET A CB     4  
ATOM   8248  C CG     . MET A 1 116 ? 21.873 14.990  -9.257  1.00 0.00 ? 329 MET A CG     4  
ATOM   8249  S SD     . MET A 1 116 ? 21.293 14.588  -7.619  1.00 0.00 ? 329 MET A SD     4  
ATOM   8250  C CE     . MET A 1 116 ? 19.781 13.731  -8.026  1.00 0.00 ? 329 MET A CE     4  
ATOM   8251  H H      . MET A 1 116 ? 24.706 12.282  -9.687  1.00 0.00 ? 329 MET A H      4  
ATOM   8252  H HA     . MET A 1 116 ? 24.706 15.106  -9.870  1.00 0.00 ? 329 MET A HA     4  
ATOM   8253  H HB2    . MET A 1 116 ? 22.841 13.860  -10.819 1.00 0.00 ? 329 MET A HB2    4  
ATOM   8254  H HB3    . MET A 1 116 ? 22.594 12.959  -9.337  1.00 0.00 ? 329 MET A HB3    4  
ATOM   8255  H HG2    . MET A 1 116 ? 22.344 15.974  -9.255  1.00 0.00 ? 329 MET A HG2    4  
ATOM   8256  H HG3    . MET A 1 116 ? 21.031 15.041  -9.948  1.00 0.00 ? 329 MET A HG3    4  
ATOM   8257  H HE1    . MET A 1 116 ? 19.355 13.295  -7.123  1.00 0.00 ? 329 MET A HE1    4  
ATOM   8258  H HE2    . MET A 1 116 ? 19.070 14.435  -8.459  1.00 0.00 ? 329 MET A HE2    4  
ATOM   8259  H HE3    . MET A 1 116 ? 19.995 12.941  -8.746  1.00 0.00 ? 329 MET A HE3    4  
ATOM   8260  N N      . LEU A 1 117 ? 24.436 13.644  -6.963  1.00 0.00 ? 330 LEU A N      4  
ATOM   8261  C CA     . LEU A 1 117 ? 24.445 13.853  -5.525  1.00 0.00 ? 330 LEU A CA     4  
ATOM   8262  C C      . LEU A 1 117 ? 25.784 14.468  -5.112  1.00 0.00 ? 330 LEU A C      4  
ATOM   8263  O O      . LEU A 1 117 ? 25.845 15.255  -4.168  1.00 0.00 ? 330 LEU A O      4  
ATOM   8264  C CB     . LEU A 1 117 ? 24.113 12.551  -4.793  1.00 0.00 ? 330 LEU A CB     4  
ATOM   8265  C CG     . LEU A 1 117 ? 25.310 11.706  -4.352  1.00 0.00 ? 330 LEU A CG     4  
ATOM   8266  C CD1    . LEU A 1 117 ? 25.839 12.170  -2.993  1.00 0.00 ? 330 LEU A CD1    4  
ATOM   8267  C CD2    . LEU A 1 117 ? 24.960 10.217  -4.353  1.00 0.00 ? 330 LEU A CD2    4  
ATOM   8268  H H      . LEU A 1 117 ? 24.552 12.694  -7.253  1.00 0.00 ? 330 LEU A H      4  
ATOM   8269  H HA     . LEU A 1 117 ? 23.652 14.564  -5.294  1.00 0.00 ? 330 LEU A HA     4  
ATOM   8270  H HB2    . LEU A 1 117 ? 23.521 12.795  -3.911  1.00 0.00 ? 330 LEU A HB2    4  
ATOM   8271  H HB3    . LEU A 1 117 ? 23.483 11.943  -5.441  1.00 0.00 ? 330 LEU A HB3    4  
ATOM   8272  H HG     . LEU A 1 117 ? 26.114 11.848  -5.075  1.00 0.00 ? 330 LEU A HG     4  
ATOM   8273  H HD11   . LEU A 1 117 ? 26.694 12.829  -3.141  1.00 0.00 ? 330 LEU A HD11   4  
ATOM   8274  H HD12   . LEU A 1 117 ? 25.054 12.707  -2.463  1.00 0.00 ? 330 LEU A HD12   4  
ATOM   8275  H HD13   . LEU A 1 117 ? 26.145 11.303  -2.408  1.00 0.00 ? 330 LEU A HD13   4  
ATOM   8276  H HD21   . LEU A 1 117 ? 25.834 9.638   -4.653  1.00 0.00 ? 330 LEU A HD21   4  
ATOM   8277  H HD22   . LEU A 1 117 ? 24.651 9.916   -3.352  1.00 0.00 ? 330 LEU A HD22   4  
ATOM   8278  H HD23   . LEU A 1 117 ? 24.146 10.036  -5.055  1.00 0.00 ? 330 LEU A HD23   4  
ATOM   8279  N N      . CYS A 1 118 ? 26.823 14.086  -5.839  1.00 0.00 ? 331 CYS A N      4  
ATOM   8280  C CA     . CYS A 1 118 ? 28.158 14.589  -5.559  1.00 0.00 ? 331 CYS A CA     4  
ATOM   8281  C C      . CYS A 1 118 ? 28.212 16.060  -5.977  1.00 0.00 ? 331 CYS A C      4  
ATOM   8282  O O      . CYS A 1 118 ? 28.932 16.854  -5.372  1.00 0.00 ? 331 CYS A O      4  
ATOM   8283  C CB     . CYS A 1 118 ? 29.234 13.756  -6.258  1.00 0.00 ? 331 CYS A CB     4  
ATOM   8284  S SG     . CYS A 1 118 ? 29.628 14.486  -7.889  1.00 0.00 ? 331 CYS A SG     4  
ATOM   8285  H H      . CYS A 1 118 ? 26.765 13.446  -6.605  1.00 0.00 ? 331 CYS A H      4  
ATOM   8286  H HA     . CYS A 1 118 ? 28.312 14.485  -4.485  1.00 0.00 ? 331 CYS A HA     4  
ATOM   8287  H HB2    . CYS A 1 118 ? 30.132 13.718  -5.641  1.00 0.00 ? 331 CYS A HB2    4  
ATOM   8288  H HB3    . CYS A 1 118 ? 28.889 12.731  -6.383  1.00 0.00 ? 331 CYS A HB3    4  
ATOM   8289  H HG     . CYS A 1 118 ? 29.526 13.351  -8.577  1.00 0.00 ? 331 CYS A HG     4  
ATOM   8290  N N      . SER A 1 119 ? 27.444 16.379  -7.008  1.00 0.00 ? 332 SER A N      4  
ATOM   8291  C CA     . SER A 1 119 ? 27.396 17.741  -7.513  1.00 0.00 ? 332 SER A CA     4  
ATOM   8292  C C      . SER A 1 119 ? 26.613 18.631  -6.545  1.00 0.00 ? 332 SER A C      4  
ATOM   8293  O O      . SER A 1 119 ? 26.885 19.826  -6.438  1.00 0.00 ? 332 SER A O      4  
ATOM   8294  C CB     . SER A 1 119 ? 26.766 17.789  -8.907  1.00 0.00 ? 332 SER A CB     4  
ATOM   8295  O OG     . SER A 1 119 ? 25.349 17.924  -8.847  1.00 0.00 ? 332 SER A OG     4  
ATOM   8296  H H      . SER A 1 119 ? 26.862 15.727  -7.494  1.00 0.00 ? 332 SER A H      4  
ATOM   8297  H HA     . SER A 1 119 ? 28.435 18.062  -7.573  1.00 0.00 ? 332 SER A HA     4  
ATOM   8298  H HB2    . SER A 1 119 ? 27.187 18.625  -9.466  1.00 0.00 ? 332 SER A HB2    4  
ATOM   8299  H HB3    . SER A 1 119 ? 27.021 16.881  -9.452  1.00 0.00 ? 332 SER A HB3    4  
ATOM   8300  H HG     . SER A 1 119 ? 25.039 18.581  -9.535  1.00 0.00 ? 332 SER A HG     4  
ATOM   8301  N N      . SER A 1 120 ? 25.658 18.014  -5.866  1.00 0.00 ? 333 SER A N      4  
ATOM   8302  C CA     . SER A 1 120 ? 24.834 18.736  -4.910  1.00 0.00 ? 333 SER A CA     4  
ATOM   8303  C C      . SER A 1 120 ? 25.649 19.060  -3.657  1.00 0.00 ? 333 SER A C      4  
ATOM   8304  O O      . SER A 1 120 ? 25.585 20.175  -3.142  1.00 0.00 ? 333 SER A O      4  
ATOM   8305  C CB     . SER A 1 120 ? 23.587 17.931  -4.540  1.00 0.00 ? 333 SER A CB     4  
ATOM   8306  O OG     . SER A 1 120 ? 22.748 18.636  -3.629  1.00 0.00 ? 333 SER A OG     4  
ATOM   8307  H H      . SER A 1 120 ? 25.444 17.041  -5.959  1.00 0.00 ? 333 SER A H      4  
ATOM   8308  H HA     . SER A 1 120 ? 24.536 19.652  -5.421  1.00 0.00 ? 333 SER A HA     4  
ATOM   8309  H HB2    . SER A 1 120 ? 23.024 17.697  -5.444  1.00 0.00 ? 333 SER A HB2    4  
ATOM   8310  H HB3    . SER A 1 120 ? 23.887 16.981  -4.097  1.00 0.00 ? 333 SER A HB3    4  
ATOM   8311  H HG     . SER A 1 120 ? 22.436 19.490  -4.043  1.00 0.00 ? 333 SER A HG     4  
ATOM   8312  N N      . SER A 1 121 ? 26.395 18.064  -3.202  1.00 0.00 ? 334 SER A N      4  
ATOM   8313  C CA     . SER A 1 121 ? 27.221 18.229  -2.017  1.00 0.00 ? 334 SER A CA     4  
ATOM   8314  C C      . SER A 1 121 ? 28.682 17.916  -2.350  1.00 0.00 ? 334 SER A C      4  
ATOM   8315  O O      . SER A 1 121 ? 29.012 16.785  -2.706  1.00 0.00 ? 334 SER A O      4  
ATOM   8316  C CB     . SER A 1 121 ? 26.733 17.334  -0.876  1.00 0.00 ? 334 SER A CB     4  
ATOM   8317  O OG     . SER A 1 121 ? 26.978 17.917  0.401   1.00 0.00 ? 334 SER A OG     4  
ATOM   8318  H H      . SER A 1 121 ? 26.441 17.160  -3.626  1.00 0.00 ? 334 SER A H      4  
ATOM   8319  H HA     . SER A 1 121 ? 27.110 19.275  -1.731  1.00 0.00 ? 334 SER A HA     4  
ATOM   8320  H HB2    . SER A 1 121 ? 25.665 17.150  -0.992  1.00 0.00 ? 334 SER A HB2    4  
ATOM   8321  H HB3    . SER A 1 121 ? 27.232 16.367  -0.935  1.00 0.00 ? 334 SER A HB3    4  
ATOM   8322  H HG     . SER A 1 121 ? 26.123 17.985  0.915   1.00 0.00 ? 334 SER A HG     4  
ATOM   8323  N N      . PRO A 1 122 ? 29.538 18.964  -2.219  1.00 0.00 ? 335 PRO A N      4  
ATOM   8324  C CA     . PRO A 1 122 ? 30.956 18.811  -2.502  1.00 0.00 ? 335 PRO A CA     4  
ATOM   8325  C C      . PRO A 1 122 ? 31.660 18.049  -1.377  1.00 0.00 ? 335 PRO A C      4  
ATOM   8326  O O      . PRO A 1 122 ? 32.759 17.530  -1.569  1.00 0.00 ? 335 PRO A O      4  
ATOM   8327  C CB     . PRO A 1 122 ? 31.476 20.229  -2.676  1.00 0.00 ? 335 PRO A CB     4  
ATOM   8328  C CG     . PRO A 1 122 ? 30.442 21.136  -2.030  1.00 0.00 ? 335 PRO A CG     4  
ATOM   8329  C CD     . PRO A 1 122 ? 29.182 20.316  -1.799  1.00 0.00 ? 335 PRO A CD     4  
ATOM   8330  H HA     . PRO A 1 122 ? 31.087 18.264  -3.328  1.00 0.00 ? 335 PRO A HA     4  
ATOM   8331  H HB2    . PRO A 1 122 ? 32.451 20.348  -2.202  1.00 0.00 ? 335 PRO A HB2    4  
ATOM   8332  H HB3    . PRO A 1 122 ? 31.603 20.471  -3.731  1.00 0.00 ? 335 PRO A HB3    4  
ATOM   8333  H HG2    . PRO A 1 122 ? 30.818 21.531  -1.086  1.00 0.00 ? 335 PRO A HG2    4  
ATOM   8334  H HG3    . PRO A 1 122 ? 30.229 21.990  -2.672  1.00 0.00 ? 335 PRO A HG3    4  
ATOM   8335  H HD2    . PRO A 1 122 ? 28.881 20.339  -0.753  1.00 0.00 ? 335 PRO A HD2    4  
ATOM   8336  H HD3    . PRO A 1 122 ? 28.346 20.704  -2.381  1.00 0.00 ? 335 PRO A HD3    4  
ATOM   8337  N N      . GLU A 1 123 ? 30.999 18.008  -0.230  1.00 0.00 ? 336 GLU A N      4  
ATOM   8338  C CA     . GLU A 1 123 ? 31.549 17.319  0.925   1.00 0.00 ? 336 GLU A CA     4  
ATOM   8339  C C      . GLU A 1 123 ? 31.392 15.804  0.764   1.00 0.00 ? 336 GLU A C      4  
ATOM   8340  O O      . GLU A 1 123 ? 32.235 15.037  1.226   1.00 0.00 ? 336 GLU A O      4  
ATOM   8341  C CB     . GLU A 1 123 ? 30.889 17.803  2.218   1.00 0.00 ? 336 GLU A CB     4  
ATOM   8342  C CG     . GLU A 1 123 ? 31.879 17.768  3.385   1.00 0.00 ? 336 GLU A CG     4  
ATOM   8343  C CD     . GLU A 1 123 ? 32.362 19.176  3.736   1.00 0.00 ? 336 GLU A CD     4  
ATOM   8344  O OE1    . GLU A 1 123 ? 31.723 19.868  4.542   1.00 0.00 ? 336 GLU A OE1    4  
ATOM   8345  O OE2    . GLU A 1 123 ? 33.446 19.545  3.140   1.00 0.00 ? 336 GLU A OE2    4  
ATOM   8346  H H      . GLU A 1 123 ? 30.107 18.433  -0.083  1.00 0.00 ? 336 GLU A H      4  
ATOM   8347  H HA     . GLU A 1 123 ? 32.607 17.581  0.944   1.00 0.00 ? 336 GLU A HA     4  
ATOM   8348  H HB2    . GLU A 1 123 ? 30.518 18.819  2.082   1.00 0.00 ? 336 GLU A HB2    4  
ATOM   8349  H HB3    . GLU A 1 123 ? 30.028 17.177  2.448   1.00 0.00 ? 336 GLU A HB3    4  
ATOM   8350  H HG2    . GLU A 1 123 ? 31.404 17.315  4.255   1.00 0.00 ? 336 GLU A HG2    4  
ATOM   8351  H HG3    . GLU A 1 123 ? 32.732 17.141  3.125   1.00 0.00 ? 336 GLU A HG3    4  
ATOM   8352  H HE2    . GLU A 1 123 ? 34.174 19.687  3.810   1.00 0.00 ? 336 GLU A HE2    4  
ATOM   8353  N N      . ILE A 1 124 ? 30.307 15.421  0.107   1.00 0.00 ? 337 ILE A N      4  
ATOM   8354  C CA     . ILE A 1 124 ? 30.029 14.013  -0.121  1.00 0.00 ? 337 ILE A CA     4  
ATOM   8355  C C      . ILE A 1 124 ? 31.050 13.451  -1.112  1.00 0.00 ? 337 ILE A C      4  
ATOM   8356  O O      . ILE A 1 124 ? 31.426 12.281  -1.026  1.00 0.00 ? 337 ILE A O      4  
ATOM   8357  C CB     . ILE A 1 124 ? 28.576 13.818  -0.558  1.00 0.00 ? 337 ILE A CB     4  
ATOM   8358  C CG1    . ILE A 1 124 ? 27.614 14.123  0.592   1.00 0.00 ? 337 ILE A CG1    4  
ATOM   8359  C CG2    . ILE A 1 124 ? 28.359 12.415  -1.130  1.00 0.00 ? 337 ILE A CG2    4  
ATOM   8360  C CD1    . ILE A 1 124 ? 26.207 14.416  0.065   1.00 0.00 ? 337 ILE A CD1    4  
ATOM   8361  H H      . ILE A 1 124 ? 29.628 16.052  -0.266  1.00 0.00 ? 337 ILE A H      4  
ATOM   8362  H HA     . ILE A 1 124 ? 30.153 13.498  0.832   1.00 0.00 ? 337 ILE A HA     4  
ATOM   8363  H HB     . ILE A 1 124 ? 28.361 14.527  -1.356  1.00 0.00 ? 337 ILE A HB     4  
ATOM   8364  H HG12   . ILE A 1 124 ? 27.579 13.276  1.277   1.00 0.00 ? 337 ILE A HG12   4  
ATOM   8365  H HG13   . ILE A 1 124 ? 27.979 14.979  1.159   1.00 0.00 ? 337 ILE A HG13   4  
ATOM   8366  H HG21   . ILE A 1 124 ? 28.457 12.446  -2.215  1.00 0.00 ? 337 ILE A HG21   4  
ATOM   8367  H HG22   . ILE A 1 124 ? 29.105 11.736  -0.717  1.00 0.00 ? 337 ILE A HG22   4  
ATOM   8368  H HG23   . ILE A 1 124 ? 27.362 12.065  -0.865  1.00 0.00 ? 337 ILE A HG23   4  
ATOM   8369  H HD11   . ILE A 1 124 ? 25.801 15.288  0.578   1.00 0.00 ? 337 ILE A HD11   4  
ATOM   8370  H HD12   . ILE A 1 124 ? 26.254 14.614  -1.006  1.00 0.00 ? 337 ILE A HD12   4  
ATOM   8371  H HD13   . ILE A 1 124 ? 25.564 13.555  0.247   1.00 0.00 ? 337 ILE A HD13   4  
ATOM   8372  N N      . ALA A 1 125 ? 31.471 14.308  -2.031  1.00 0.00 ? 338 ALA A N      4  
ATOM   8373  C CA     . ALA A 1 125 ? 32.440 13.910  -3.037  1.00 0.00 ? 338 ALA A CA     4  
ATOM   8374  C C      . ALA A 1 125 ? 33.806 13.717  -2.375  1.00 0.00 ? 338 ALA A C      4  
ATOM   8375  O O      . ALA A 1 125 ? 34.588 12.866  -2.794  1.00 0.00 ? 338 ALA A O      4  
ATOM   8376  C CB     . ALA A 1 125 ? 32.476 14.956  -4.153  1.00 0.00 ? 338 ALA A CB     4  
ATOM   8377  H H      . ALA A 1 125 ? 31.161 15.256  -2.094  1.00 0.00 ? 338 ALA A H      4  
ATOM   8378  H HA     . ALA A 1 125 ? 32.112 12.959  -3.458  1.00 0.00 ? 338 ALA A HA     4  
ATOM   8379  H HB1    . ALA A 1 125 ? 31.528 15.494  -4.177  1.00 0.00 ? 338 ALA A HB1    4  
ATOM   8380  H HB2    . ALA A 1 125 ? 33.287 15.659  -3.967  1.00 0.00 ? 338 ALA A HB2    4  
ATOM   8381  H HB3    . ALA A 1 125 ? 32.637 14.461  -5.111  1.00 0.00 ? 338 ALA A HB3    4  
ATOM   8382  N N      . GLU A 1 126 ? 34.051 14.522  -1.352  1.00 0.00 ? 339 GLU A N      4  
ATOM   8383  C CA     . GLU A 1 126 ? 35.309 14.451  -0.628  1.00 0.00 ? 339 GLU A CA     4  
ATOM   8384  C C      . GLU A 1 126 ? 35.329 13.221  0.282   1.00 0.00 ? 339 GLU A C      4  
ATOM   8385  O O      . GLU A 1 126 ? 36.384 12.633  0.514   1.00 0.00 ? 339 GLU A O      4  
ATOM   8386  C CB     . GLU A 1 126 ? 35.554 15.731  0.173   1.00 0.00 ? 339 GLU A CB     4  
ATOM   8387  C CG     . GLU A 1 126 ? 36.589 16.621  -0.515  1.00 0.00 ? 339 GLU A CG     4  
ATOM   8388  C CD     . GLU A 1 126 ? 35.968 17.376  -1.692  1.00 0.00 ? 339 GLU A CD     4  
ATOM   8389  O OE1    . GLU A 1 126 ? 35.133 16.815  -2.417  1.00 0.00 ? 339 GLU A OE1    4  
ATOM   8390  O OE2    . GLU A 1 126 ? 36.380 18.589  -1.839  1.00 0.00 ? 339 GLU A OE2    4  
ATOM   8391  H H      . GLU A 1 126 ? 33.410 15.213  -1.018  1.00 0.00 ? 339 GLU A H      4  
ATOM   8392  H HA     . GLU A 1 126 ? 36.079 14.357  -1.394  1.00 0.00 ? 339 GLU A HA     4  
ATOM   8393  H HB2    . GLU A 1 126 ? 34.617 16.278  0.287   1.00 0.00 ? 339 GLU A HB2    4  
ATOM   8394  H HB3    . GLU A 1 126 ? 35.898 15.476  1.176   1.00 0.00 ? 339 GLU A HB3    4  
ATOM   8395  H HG2    . GLU A 1 126 ? 36.999 17.331  0.202   1.00 0.00 ? 339 GLU A HG2    4  
ATOM   8396  H HG3    . GLU A 1 126 ? 37.421 16.010  -0.869  1.00 0.00 ? 339 GLU A HG3    4  
ATOM   8397  H HE2    . GLU A 1 126 ? 36.116 19.139  -1.047  1.00 0.00 ? 339 GLU A HE2    4  
ATOM   8398  N N      . ILE A 1 127 ? 34.149 12.869  0.774   1.00 0.00 ? 340 ILE A N      4  
ATOM   8399  C CA     . ILE A 1 127 ? 34.018 11.720  1.653   1.00 0.00 ? 340 ILE A CA     4  
ATOM   8400  C C      . ILE A 1 127 ? 34.145 10.437  0.830   1.00 0.00 ? 340 ILE A C      4  
ATOM   8401  O O      . ILE A 1 127 ? 34.636 9.424   1.326   1.00 0.00 ? 340 ILE A O      4  
ATOM   8402  C CB     . ILE A 1 127 ? 32.721 11.809  2.459   1.00 0.00 ? 340 ILE A CB     4  
ATOM   8403  C CG1    . ILE A 1 127 ? 33.002 11.717  3.961   1.00 0.00 ? 340 ILE A CG1    4  
ATOM   8404  C CG2    . ILE A 1 127 ? 31.716 10.752  1.998   1.00 0.00 ? 340 ILE A CG2    4  
ATOM   8405  C CD1    . ILE A 1 127 ? 31.984 12.533  4.759   1.00 0.00 ? 340 ILE A CD1    4  
ATOM   8406  H H      . ILE A 1 127 ? 33.296 13.353  0.580   1.00 0.00 ? 340 ILE A H      4  
ATOM   8407  H HA     . ILE A 1 127 ? 34.843 11.758  2.364   1.00 0.00 ? 340 ILE A HA     4  
ATOM   8408  H HB     . ILE A 1 127 ? 32.270 12.784  2.275   1.00 0.00 ? 340 ILE A HB     4  
ATOM   8409  H HG12   . ILE A 1 127 ? 32.966 10.675  4.277   1.00 0.00 ? 340 ILE A HG12   4  
ATOM   8410  H HG13   . ILE A 1 127 ? 34.008 12.080  4.169   1.00 0.00 ? 340 ILE A HG13   4  
ATOM   8411  H HG21   . ILE A 1 127 ? 30.746 10.949  2.455   1.00 0.00 ? 340 ILE A HG21   4  
ATOM   8412  H HG22   . ILE A 1 127 ? 31.620 10.790  0.913   1.00 0.00 ? 340 ILE A HG22   4  
ATOM   8413  H HG23   . ILE A 1 127 ? 32.064 9.764   2.298   1.00 0.00 ? 340 ILE A HG23   4  
ATOM   8414  H HD11   . ILE A 1 127 ? 30.993 12.406  4.323   1.00 0.00 ? 340 ILE A HD11   4  
ATOM   8415  H HD12   . ILE A 1 127 ? 31.973 12.188  5.793   1.00 0.00 ? 340 ILE A HD12   4  
ATOM   8416  H HD13   . ILE A 1 127 ? 32.260 13.587  4.731   1.00 0.00 ? 340 ILE A HD13   4  
ATOM   8417  N N      . PHE A 1 128 ? 33.693 10.521  -0.413  1.00 0.00 ? 341 PHE A N      4  
ATOM   8418  C CA     . PHE A 1 128 ? 33.750 9.379   -1.309  1.00 0.00 ? 341 PHE A CA     4  
ATOM   8419  C C      . PHE A 1 128 ? 35.178 9.140   -1.802  1.00 0.00 ? 341 PHE A C      4  
ATOM   8420  O O      . PHE A 1 128 ? 35.652 8.003   -1.818  1.00 0.00 ? 341 PHE A O      4  
ATOM   8421  C CB     . PHE A 1 128 ? 32.857 9.706   -2.508  1.00 0.00 ? 341 PHE A CB     4  
ATOM   8422  C CG     . PHE A 1 128 ? 31.413 9.223   -2.358  1.00 0.00 ? 341 PHE A CG     4  
ATOM   8423  C CD1    . PHE A 1 128 ? 31.158 7.916   -2.084  1.00 0.00 ? 341 PHE A CD1    4  
ATOM   8424  C CD2    . PHE A 1 128 ? 30.385 10.101  -2.497  1.00 0.00 ? 341 PHE A CD2    4  
ATOM   8425  C CE1    . PHE A 1 128 ? 29.818 7.467   -1.945  1.00 0.00 ? 341 PHE A CE1    4  
ATOM   8426  C CE2    . PHE A 1 128 ? 29.043 9.654   -2.359  1.00 0.00 ? 341 PHE A CE2    4  
ATOM   8427  C CZ     . PHE A 1 128 ? 28.789 8.346   -2.085  1.00 0.00 ? 341 PHE A CZ     4  
ATOM   8428  H H      . PHE A 1 128 ? 33.296 11.350  -0.808  1.00 0.00 ? 341 PHE A H      4  
ATOM   8429  H HA     . PHE A 1 128 ? 33.412 8.509   -0.745  1.00 0.00 ? 341 PHE A HA     4  
ATOM   8430  H HB2    . PHE A 1 128 ? 32.854 10.785  -2.662  1.00 0.00 ? 341 PHE A HB2    4  
ATOM   8431  H HB3    . PHE A 1 128 ? 33.288 9.257   -3.402  1.00 0.00 ? 341 PHE A HB3    4  
ATOM   8432  H HD1    . PHE A 1 128 ? 31.982 7.212   -1.971  1.00 0.00 ? 341 PHE A HD1    4  
ATOM   8433  H HD2    . PHE A 1 128 ? 30.588 11.149  -2.717  1.00 0.00 ? 341 PHE A HD2    4  
ATOM   8434  H HE1    . PHE A 1 128 ? 29.613 6.419   -1.725  1.00 0.00 ? 341 PHE A HE1    4  
ATOM   8435  H HE2    . PHE A 1 128 ? 28.219 10.357  -2.471  1.00 0.00 ? 341 PHE A HE2    4  
ATOM   8436  H HZ     . PHE A 1 128 ? 27.760 8.001   -1.978  1.00 0.00 ? 341 PHE A HZ     4  
ATOM   8437  N N      . ARG A 1 129 ? 35.825 10.227  -2.194  1.00 0.00 ? 342 ARG A N      4  
ATOM   8438  C CA     . ARG A 1 129 ? 37.190 10.149  -2.686  1.00 0.00 ? 342 ARG A CA     4  
ATOM   8439  C C      . ARG A 1 129 ? 38.130 9.680   -1.575  1.00 0.00 ? 342 ARG A C      4  
ATOM   8440  O O      . ARG A 1 129 ? 39.142 9.034   -1.843  1.00 0.00 ? 342 ARG A O      4  
ATOM   8441  C CB     . ARG A 1 129 ? 37.666 11.507  -3.207  1.00 0.00 ? 342 ARG A CB     4  
ATOM   8442  C CG     . ARG A 1 129 ? 38.201 12.375  -2.066  1.00 0.00 ? 342 ARG A CG     4  
ATOM   8443  C CD     . ARG A 1 129 ? 39.701 12.149  -1.863  1.00 0.00 ? 342 ARG A CD     4  
ATOM   8444  N NE     . ARG A 1 129 ? 40.473 13.117  -2.675  1.00 0.00 ? 342 ARG A NE     4  
ATOM   8445  C CZ     . ARG A 1 129 ? 41.810 13.125  -2.764  1.00 0.00 ? 342 ARG A CZ     4  
ATOM   8446  N NH1    . ARG A 1 129 ? 42.531 12.217  -2.091  1.00 0.00 ? 342 ARG A NH1    4  
ATOM   8447  N NH2    . ARG A 1 129 ? 42.425 14.040  -3.524  1.00 0.00 ? 342 ARG A NH2    4  
ATOM   8448  H H      . ARG A 1 129 ? 35.433 11.147  -2.177  1.00 0.00 ? 342 ARG A H      4  
ATOM   8449  H HA     . ARG A 1 129 ? 37.152 9.425   -3.500  1.00 0.00 ? 342 ARG A HA     4  
ATOM   8450  H HB2    . ARG A 1 129 ? 38.446 11.361  -3.955  1.00 0.00 ? 342 ARG A HB2    4  
ATOM   8451  H HB3    . ARG A 1 129 ? 36.842 12.020  -3.703  1.00 0.00 ? 342 ARG A HB3    4  
ATOM   8452  H HG2    . ARG A 1 129 ? 38.014 13.427  -2.286  1.00 0.00 ? 342 ARG A HG2    4  
ATOM   8453  H HG3    . ARG A 1 129 ? 37.666 12.142  -1.145  1.00 0.00 ? 342 ARG A HG3    4  
ATOM   8454  H HD2    . ARG A 1 129 ? 39.954 12.262  -0.809  1.00 0.00 ? 342 ARG A HD2    4  
ATOM   8455  H HD3    . ARG A 1 129 ? 39.965 11.131  -2.147  1.00 0.00 ? 342 ARG A HD3    4  
ATOM   8456  H HE     . ARG A 1 129 ? 39.965 13.809  -3.189  1.00 0.00 ? 342 ARG A HE     4  
ATOM   8457  H HH11   . ARG A 1 129 ? 42.071 11.534  -1.524  1.00 0.00 ? 342 ARG A HH11   4  
ATOM   8458  H HH12   . ARG A 1 129 ? 43.529 12.222  -2.158  1.00 0.00 ? 342 ARG A HH12   4  
ATOM   8459  H HH21   . ARG A 1 129 ? 41.888 14.717  -4.025  1.00 0.00 ? 342 ARG A HH21   4  
ATOM   8460  H HH22   . ARG A 1 129 ? 43.423 14.046  -3.590  1.00 0.00 ? 342 ARG A HH22   4  
ATOM   8461  N N      . LYS A 1 130 ? 37.763 10.023  -0.348  1.00 0.00 ? 343 LYS A N      4  
ATOM   8462  C CA     . LYS A 1 130 ? 38.560 9.644   0.806   1.00 0.00 ? 343 LYS A CA     4  
ATOM   8463  C C      . LYS A 1 130 ? 38.395 8.146   1.066   1.00 0.00 ? 343 LYS A C      4  
ATOM   8464  O O      . LYS A 1 130 ? 39.351 7.467   1.435   1.00 0.00 ? 343 LYS A O      4  
ATOM   8465  C CB     . LYS A 1 130 ? 38.209 10.520  2.010   1.00 0.00 ? 343 LYS A CB     4  
ATOM   8466  C CG     . LYS A 1 130 ? 39.285 11.584  2.246   1.00 0.00 ? 343 LYS A CG     4  
ATOM   8467  C CD     . LYS A 1 130 ? 38.866 12.550  3.356   1.00 0.00 ? 343 LYS A CD     4  
ATOM   8468  C CE     . LYS A 1 130 ? 39.553 12.199  4.677   1.00 0.00 ? 343 LYS A CE     4  
ATOM   8469  N NZ     . LYS A 1 130 ? 40.922 12.763  4.715   1.00 0.00 ? 343 LYS A NZ     4  
ATOM   8470  H H      . LYS A 1 130 ? 36.939 10.548  -0.138  1.00 0.00 ? 343 LYS A H      4  
ATOM   8471  H HA     . LYS A 1 130 ? 39.605 9.838   0.559   1.00 0.00 ? 343 LYS A HA     4  
ATOM   8472  H HB2    . LYS A 1 130 ? 37.246 11.003  1.845   1.00 0.00 ? 343 LYS A HB2    4  
ATOM   8473  H HB3    . LYS A 1 130 ? 38.107 9.898   2.898   1.00 0.00 ? 343 LYS A HB3    4  
ATOM   8474  H HG2    . LYS A 1 130 ? 40.225 11.102  2.515   1.00 0.00 ? 343 LYS A HG2    4  
ATOM   8475  H HG3    . LYS A 1 130 ? 39.462 12.137  1.324   1.00 0.00 ? 343 LYS A HG3    4  
ATOM   8476  H HD2    . LYS A 1 130 ? 39.119 13.570  3.069   1.00 0.00 ? 343 LYS A HD2    4  
ATOM   8477  H HD3    . LYS A 1 130 ? 37.783 12.514  3.484   1.00 0.00 ? 343 LYS A HD3    4  
ATOM   8478  H HE2    . LYS A 1 130 ? 38.971 12.588  5.511   1.00 0.00 ? 343 LYS A HE2    4  
ATOM   8479  H HE3    . LYS A 1 130 ? 39.596 11.117  4.795   1.00 0.00 ? 343 LYS A HE3    4  
ATOM   8480  H HZ1    . LYS A 1 130 ? 41.193 12.914  5.665   1.00 0.00 ? 343 LYS A HZ1    4  
ATOM   8481  H HZ2    . LYS A 1 130 ? 41.557 12.122  4.283   1.00 0.00 ? 343 LYS A HZ2    4  
ATOM   8482  H HZ3    . LYS A 1 130 ? 40.938 13.631  4.220   1.00 0.00 ? 343 LYS A HZ3    4  
ATOM   8483  N N      . THR A 1 131 ? 37.173 7.674   0.863   1.00 0.00 ? 344 THR A N      4  
ATOM   8484  C CA     . THR A 1 131 ? 36.869 6.269   1.070   1.00 0.00 ? 344 THR A CA     4  
ATOM   8485  C C      . THR A 1 131 ? 37.348 5.438   -0.121  1.00 0.00 ? 344 THR A C      4  
ATOM   8486  O O      . THR A 1 131 ? 37.746 4.285   0.041   1.00 0.00 ? 344 THR A O      4  
ATOM   8487  C CB     . THR A 1 131 ? 35.367 6.144   1.334   1.00 0.00 ? 344 THR A CB     4  
ATOM   8488  O OG1    . THR A 1 131 ? 35.149 6.949   2.490   1.00 0.00 ? 344 THR A OG1    4  
ATOM   8489  C CG2    . THR A 1 131 ? 34.966 4.736   1.780   1.00 0.00 ? 344 THR A CG2    4  
ATOM   8490  H H      . THR A 1 131 ? 36.400 8.234   0.562   1.00 0.00 ? 344 THR A H      4  
ATOM   8491  H HA     . THR A 1 131 ? 37.422 5.923   1.945   1.00 0.00 ? 344 THR A HA     4  
ATOM   8492  H HB     . THR A 1 131 ? 34.791 6.455   0.463   1.00 0.00 ? 344 THR A HB     4  
ATOM   8493  H HG1    . THR A 1 131 ? 35.291 7.913   2.266   1.00 0.00 ? 344 THR A HG1    4  
ATOM   8494  H HG21   . THR A 1 131 ? 34.214 4.804   2.566   1.00 0.00 ? 344 THR A HG21   4  
ATOM   8495  H HG22   . THR A 1 131 ? 34.555 4.190   0.931   1.00 0.00 ? 344 THR A HG22   4  
ATOM   8496  H HG23   . THR A 1 131 ? 35.843 4.212   2.160   1.00 0.00 ? 344 THR A HG23   4  
ATOM   8497  N N      . ALA A 1 132 ? 37.294 6.055   -1.292  1.00 0.00 ? 345 ALA A N      4  
ATOM   8498  C CA     . ALA A 1 132 ? 37.717 5.387   -2.511  1.00 0.00 ? 345 ALA A CA     4  
ATOM   8499  C C      . ALA A 1 132 ? 39.237 5.210   -2.489  1.00 0.00 ? 345 ALA A C      4  
ATOM   8500  O O      . ALA A 1 132 ? 39.755 4.194   -2.949  1.00 0.00 ? 345 ALA A O      4  
ATOM   8501  C CB     . ALA A 1 132 ? 37.241 6.186   -3.724  1.00 0.00 ? 345 ALA A CB     4  
ATOM   8502  H H      . ALA A 1 132 ? 36.970 6.993   -1.416  1.00 0.00 ? 345 ALA A H      4  
ATOM   8503  H HA     . ALA A 1 132 ? 37.247 4.404   -2.531  1.00 0.00 ? 345 ALA A HA     4  
ATOM   8504  H HB1    . ALA A 1 132 ? 37.990 6.130   -4.514  1.00 0.00 ? 345 ALA A HB1    4  
ATOM   8505  H HB2    . ALA A 1 132 ? 36.299 5.772   -4.086  1.00 0.00 ? 345 ALA A HB2    4  
ATOM   8506  H HB3    . ALA A 1 132 ? 37.093 7.228   -3.438  1.00 0.00 ? 345 ALA A HB3    4  
ATOM   8507  N N      . LEU A 1 133 ? 39.910 6.216   -1.949  1.00 0.00 ? 346 LEU A N      4  
ATOM   8508  C CA     . LEU A 1 133 ? 41.360 6.185   -1.862  1.00 0.00 ? 346 LEU A CA     4  
ATOM   8509  C C      . LEU A 1 133 ? 41.781 5.158   -0.808  1.00 0.00 ? 346 LEU A C      4  
ATOM   8510  O O      . LEU A 1 133 ? 42.777 4.457   -0.983  1.00 0.00 ? 346 LEU A O      4  
ATOM   8511  C CB     . LEU A 1 133 ? 41.911 7.588   -1.606  1.00 0.00 ? 346 LEU A CB     4  
ATOM   8512  C CG     . LEU A 1 133 ? 42.086 7.985   -0.139  1.00 0.00 ? 346 LEU A CG     4  
ATOM   8513  C CD1    . LEU A 1 133 ? 43.425 7.485   0.409   1.00 0.00 ? 346 LEU A CD1    4  
ATOM   8514  C CD2    . LEU A 1 133 ? 41.918 9.494   0.046   1.00 0.00 ? 346 LEU A CD2    4  
ATOM   8515  H H      . LEU A 1 133 ? 39.482 7.040   -1.577  1.00 0.00 ? 346 LEU A H      4  
ATOM   8516  H HA     . LEU A 1 133 ? 41.739 5.861   -2.831  1.00 0.00 ? 346 LEU A HA     4  
ATOM   8517  H HB2    . LEU A 1 133 ? 42.878 7.674   -2.102  1.00 0.00 ? 346 LEU A HB2    4  
ATOM   8518  H HB3    . LEU A 1 133 ? 41.246 8.311   -2.080  1.00 0.00 ? 346 LEU A HB3    4  
ATOM   8519  H HG     . LEU A 1 133 ? 41.301 7.499   0.441   1.00 0.00 ? 346 LEU A HG     4  
ATOM   8520  H HD11   . LEU A 1 133 ? 44.037 8.338   0.703   1.00 0.00 ? 346 LEU A HD11   4  
ATOM   8521  H HD12   . LEU A 1 133 ? 43.249 6.848   1.274   1.00 0.00 ? 346 LEU A HD12   4  
ATOM   8522  H HD13   . LEU A 1 133 ? 43.943 6.915   -0.363  1.00 0.00 ? 346 LEU A HD13   4  
ATOM   8523  H HD21   . LEU A 1 133 ? 41.179 9.866   -0.663  1.00 0.00 ? 346 LEU A HD21   4  
ATOM   8524  H HD22   . LEU A 1 133 ? 41.583 9.700   1.062   1.00 0.00 ? 346 LEU A HD22   4  
ATOM   8525  H HD23   . LEU A 1 133 ? 42.872 9.990   -0.129  1.00 0.00 ? 346 LEU A HD23   4  
ATOM   8526  N N      . GLU A 1 134 ? 41.002 5.100   0.261   1.00 0.00 ? 347 GLU A N      4  
ATOM   8527  C CA     . GLU A 1 134 ? 41.281 4.171   1.342   1.00 0.00 ? 347 GLU A CA     4  
ATOM   8528  C C      . GLU A 1 134 ? 40.922 2.744   0.922   1.00 0.00 ? 347 GLU A C      4  
ATOM   8529  O O      . GLU A 1 134 ? 41.618 1.795   1.276   1.00 0.00 ? 347 GLU A O      4  
ATOM   8530  C CB     . GLU A 1 134 ? 40.536 4.571   2.616   1.00 0.00 ? 347 GLU A CB     4  
ATOM   8531  C CG     . GLU A 1 134 ? 40.288 3.356   3.512   1.00 0.00 ? 347 GLU A CG     4  
ATOM   8532  C CD     . GLU A 1 134 ? 40.353 3.742   4.991   1.00 0.00 ? 347 GLU A CD     4  
ATOM   8533  O OE1    . GLU A 1 134 ? 41.380 3.515   5.648   1.00 0.00 ? 347 GLU A OE1    4  
ATOM   8534  O OE2    . GLU A 1 134 ? 39.286 4.301   5.456   1.00 0.00 ? 347 GLU A OE2    4  
ATOM   8535  H H      . GLU A 1 134 ? 40.193 5.674   0.395   1.00 0.00 ? 347 GLU A H      4  
ATOM   8536  H HA     . GLU A 1 134 ? 42.354 4.245   1.518   1.00 0.00 ? 347 GLU A HA     4  
ATOM   8537  H HB2    . GLU A 1 134 ? 41.113 5.318   3.162   1.00 0.00 ? 347 GLU A HB2    4  
ATOM   8538  H HB3    . GLU A 1 134 ? 39.583 5.035   2.355   1.00 0.00 ? 347 GLU A HB3    4  
ATOM   8539  H HG2    . GLU A 1 134 ? 39.312 2.926   3.287   1.00 0.00 ? 347 GLU A HG2    4  
ATOM   8540  H HG3    . GLU A 1 134 ? 41.032 2.588   3.301   1.00 0.00 ? 347 GLU A HG3    4  
ATOM   8541  H HE2    . GLU A 1 134 ? 38.508 3.680   5.364   1.00 0.00 ? 347 GLU A HE2    4  
ATOM   8542  N N      . ARG A 1 135 ? 39.835 2.639   0.172   1.00 0.00 ? 348 ARG A N      4  
ATOM   8543  C CA     . ARG A 1 135 ? 39.374 1.344   -0.301  1.00 0.00 ? 348 ARG A CA     4  
ATOM   8544  C C      . ARG A 1 135 ? 40.311 0.812   -1.386  1.00 0.00 ? 348 ARG A C      4  
ATOM   8545  O O      . ARG A 1 135 ? 40.670 -0.365  -1.379  1.00 0.00 ? 348 ARG A O      4  
ATOM   8546  C CB     . ARG A 1 135 ? 37.953 1.436   -0.861  1.00 0.00 ? 348 ARG A CB     4  
ATOM   8547  C CG     . ARG A 1 135 ? 36.922 1.008   0.184   1.00 0.00 ? 348 ARG A CG     4  
ATOM   8548  C CD     . ARG A 1 135 ? 36.622 2.148   1.158   1.00 0.00 ? 348 ARG A CD     4  
ATOM   8549  N NE     . ARG A 1 135 ? 35.798 1.651   2.282   1.00 0.00 ? 348 ARG A NE     4  
ATOM   8550  C CZ     . ARG A 1 135 ? 34.471 1.474   2.219   1.00 0.00 ? 348 ARG A CZ     4  
ATOM   8551  N NH1    . ARG A 1 135 ? 33.810 1.753   1.088   1.00 0.00 ? 348 ARG A NH1    4  
ATOM   8552  N NH2    . ARG A 1 135 ? 33.805 1.018   3.290   1.00 0.00 ? 348 ARG A NH2    4  
ATOM   8553  H H      . ARG A 1 135 ? 39.273 3.416   -0.113  1.00 0.00 ? 348 ARG A H      4  
ATOM   8554  H HA     . ARG A 1 135 ? 39.391 0.703   0.581   1.00 0.00 ? 348 ARG A HA     4  
ATOM   8555  H HB2    . ARG A 1 135 ? 37.750 2.457   -1.181  1.00 0.00 ? 348 ARG A HB2    4  
ATOM   8556  H HB3    . ARG A 1 135 ? 37.866 0.803   -1.745  1.00 0.00 ? 348 ARG A HB3    4  
ATOM   8557  H HG2    . ARG A 1 135 ? 36.002 0.697   -0.312  1.00 0.00 ? 348 ARG A HG2    4  
ATOM   8558  H HG3    . ARG A 1 135 ? 37.294 0.143   0.734   1.00 0.00 ? 348 ARG A HG3    4  
ATOM   8559  H HD2    . ARG A 1 135 ? 37.553 2.568   1.537   1.00 0.00 ? 348 ARG A HD2    4  
ATOM   8560  H HD3    . ARG A 1 135 ? 36.098 2.952   0.640   1.00 0.00 ? 348 ARG A HD3    4  
ATOM   8561  H HE     . ARG A 1 135 ? 36.260 1.434   3.142   1.00 0.00 ? 348 ARG A HE     4  
ATOM   8562  H HH11   . ARG A 1 135 ? 34.307 2.092   0.290   1.00 0.00 ? 348 ARG A HH11   4  
ATOM   8563  H HH12   . ARG A 1 135 ? 32.819 1.620   1.042   1.00 0.00 ? 348 ARG A HH12   4  
ATOM   8564  H HH21   . ARG A 1 135 ? 34.298 0.810   4.134   1.00 0.00 ? 348 ARG A HH21   4  
ATOM   8565  H HH22   . ARG A 1 135 ? 32.815 0.885   3.243   1.00 0.00 ? 348 ARG A HH22   4  
ATOM   8566  N N      . ARG A 1 136 ? 40.680 1.704   -2.294  1.00 0.00 ? 349 ARG A N      4  
ATOM   8567  C CA     . ARG A 1 136 ? 41.567 1.338   -3.385  1.00 0.00 ? 349 ARG A CA     4  
ATOM   8568  C C      . ARG A 1 136 ? 42.981 1.084   -2.856  1.00 0.00 ? 349 ARG A C      4  
ATOM   8569  O O      . ARG A 1 136 ? 43.640 0.129   -3.268  1.00 0.00 ? 349 ARG A O      4  
ATOM   8570  C CB     . ARG A 1 136 ? 41.618 2.439   -4.446  1.00 0.00 ? 349 ARG A CB     4  
ATOM   8571  C CG     . ARG A 1 136 ? 42.557 3.569   -4.020  1.00 0.00 ? 349 ARG A CG     4  
ATOM   8572  C CD     . ARG A 1 136 ? 42.534 4.713   -5.036  1.00 0.00 ? 349 ARG A CD     4  
ATOM   8573  N NE     . ARG A 1 136 ? 43.508 5.756   -4.645  1.00 0.00 ? 349 ARG A NE     4  
ATOM   8574  C CZ     . ARG A 1 136 ? 43.681 6.908   -5.307  1.00 0.00 ? 349 ARG A CZ     4  
ATOM   8575  N NH1    . ARG A 1 136 ? 42.946 7.172   -6.396  1.00 0.00 ? 349 ARG A NH1    4  
ATOM   8576  N NH2    . ARG A 1 136 ? 44.589 7.797   -4.880  1.00 0.00 ? 349 ARG A NH2    4  
ATOM   8577  H H      . ARG A 1 136 ? 40.383 2.658   -2.293  1.00 0.00 ? 349 ARG A H      4  
ATOM   8578  H HA     . ARG A 1 136 ? 41.136 0.429   -3.803  1.00 0.00 ? 349 ARG A HA     4  
ATOM   8579  H HB2    . ARG A 1 136 ? 41.956 2.019   -5.395  1.00 0.00 ? 349 ARG A HB2    4  
ATOM   8580  H HB3    . ARG A 1 136 ? 40.617 2.835   -4.611  1.00 0.00 ? 349 ARG A HB3    4  
ATOM   8581  H HG2    . ARG A 1 136 ? 42.261 3.942   -3.040  1.00 0.00 ? 349 ARG A HG2    4  
ATOM   8582  H HG3    . ARG A 1 136 ? 43.573 3.186   -3.922  1.00 0.00 ? 349 ARG A HG3    4  
ATOM   8583  H HD2    . ARG A 1 136 ? 42.773 4.333   -6.029  1.00 0.00 ? 349 ARG A HD2    4  
ATOM   8584  H HD3    . ARG A 1 136 ? 41.533 5.141   -5.091  1.00 0.00 ? 349 ARG A HD3    4  
ATOM   8585  H HE     . ARG A 1 136 ? 44.074 5.591   -3.837  1.00 0.00 ? 349 ARG A HE     4  
ATOM   8586  H HH11   . ARG A 1 136 ? 42.268 6.509   -6.715  1.00 0.00 ? 349 ARG A HH11   4  
ATOM   8587  H HH12   . ARG A 1 136 ? 43.075 8.032   -6.890  1.00 0.00 ? 349 ARG A HH12   4  
ATOM   8588  H HH21   . ARG A 1 136 ? 45.138 7.600   -4.067  1.00 0.00 ? 349 ARG A HH21   4  
ATOM   8589  H HH22   . ARG A 1 136 ? 44.718 8.657   -5.375  1.00 0.00 ? 349 ARG A HH22   4  
ATOM   8590  N N      . GLY A 1 137 ? 43.405 1.954   -1.951  1.00 0.00 ? 350 GLY A N      4  
ATOM   8591  C CA     . GLY A 1 137 ? 44.729 1.836   -1.362  1.00 0.00 ? 350 GLY A CA     4  
ATOM   8592  C C      . GLY A 1 137 ? 44.851 2.709   -0.112  1.00 0.00 ? 350 GLY A C      4  
ATOM   8593  O O      . GLY A 1 137 ? 44.081 2.558   0.834   1.00 0.00 ? 350 GLY A O      4  
ATOM   8594  H H      . GLY A 1 137 ? 42.864 2.727   -1.622  1.00 0.00 ? 350 GLY A H      4  
ATOM   8595  H HA2    . GLY A 1 137 ? 44.924 0.795   -1.103  1.00 0.00 ? 350 GLY A HA2    4  
ATOM   8596  H HA3    . GLY A 1 137 ? 45.483 2.129   -2.092  1.00 0.00 ? 350 GLY A HA3    4  
ATOM   8597  N N      . ALA A 1 138 ? 45.828 3.605   -0.149  1.00 0.00 ? 351 ALA A N      4  
ATOM   8598  C CA     . ALA A 1 138 ? 46.062 4.503   0.968   1.00 0.00 ? 351 ALA A CA     4  
ATOM   8599  C C      . ALA A 1 138 ? 46.922 3.793   2.017   1.00 0.00 ? 351 ALA A C      4  
ATOM   8600  O O      . ALA A 1 138 ? 48.085 4.141   2.209   1.00 0.00 ? 351 ALA A O      4  
ATOM   8601  C CB     . ALA A 1 138 ? 44.721 4.972   1.536   1.00 0.00 ? 351 ALA A CB     4  
ATOM   8602  H H      . ALA A 1 138 ? 46.450 3.721   -0.923  1.00 0.00 ? 351 ALA A H      4  
ATOM   8603  H HA     . ALA A 1 138 ? 46.606 5.368   0.591   1.00 0.00 ? 351 ALA A HA     4  
ATOM   8604  H HB1    . ALA A 1 138 ? 44.850 5.940   2.020   1.00 0.00 ? 351 ALA A HB1    4  
ATOM   8605  H HB2    . ALA A 1 138 ? 43.997 5.065   0.727   1.00 0.00 ? 351 ALA A HB2    4  
ATOM   8606  H HB3    . ALA A 1 138 ? 44.360 4.247   2.265   1.00 0.00 ? 351 ALA A HB3    4  
ATOM   8607  N N      . ALA A 1 139 ? 46.315 2.810   2.666   1.00 0.00 ? 352 ALA A N      4  
ATOM   8608  C CA     . ALA A 1 139 ? 47.010 2.048   3.689   1.00 0.00 ? 352 ALA A CA     4  
ATOM   8609  C C      . ALA A 1 139 ? 47.548 0.753   3.076   1.00 0.00 ? 352 ALA A C      4  
ATOM   8610  O O      . ALA A 1 139 ? 46.834 0.062   2.351   1.00 0.00 ? 352 ALA A O      4  
ATOM   8611  C CB     . ALA A 1 139 ? 46.066 1.790   4.864   1.00 0.00 ? 352 ALA A CB     4  
ATOM   8612  H H      . ALA A 1 139 ? 45.369 2.533   2.503   1.00 0.00 ? 352 ALA A H      4  
ATOM   8613  H HA     . ALA A 1 139 ? 47.850 2.649   4.038   1.00 0.00 ? 352 ALA A HA     4  
ATOM   8614  H HB1    . ALA A 1 139 ? 45.456 0.911   4.653   1.00 0.00 ? 352 ALA A HB1    4  
ATOM   8615  H HB2    . ALA A 1 139 ? 46.649 1.619   5.769   1.00 0.00 ? 352 ALA A HB2    4  
ATOM   8616  H HB3    . ALA A 1 139 ? 45.419 2.655   5.007   1.00 0.00 ? 352 ALA A HB3    4  
ATOM   8617  N N      . ALA A 1 140 ? 48.801 0.461   3.393   1.00 0.00 ? 353 ALA A N      4  
ATOM   8618  C CA     . ALA A 1 140 ? 49.442 -0.739  2.883   1.00 0.00 ? 353 ALA A CA     4  
ATOM   8619  C C      . ALA A 1 140 ? 49.551 -0.647  1.360   1.00 0.00 ? 353 ALA A C      4  
ATOM   8620  O O      . ALA A 1 140 ? 49.503 0.445   0.796   1.00 0.00 ? 353 ALA A O      4  
ATOM   8621  C CB     . ALA A 1 140 ? 48.657 -1.970  3.338   1.00 0.00 ? 353 ALA A CB     4  
ATOM   8622  H H      . ALA A 1 140 ? 49.375 1.028   3.984   1.00 0.00 ? 353 ALA A H      4  
ATOM   8623  H HA     . ALA A 1 140 ? 50.445 -0.785  3.309   1.00 0.00 ? 353 ALA A HA     4  
ATOM   8624  H HB1    . ALA A 1 140 ? 48.241 -2.479  2.468   1.00 0.00 ? 353 ALA A HB1    4  
ATOM   8625  H HB2    . ALA A 1 140 ? 49.321 -2.649  3.873   1.00 0.00 ? 353 ALA A HB2    4  
ATOM   8626  H HB3    . ALA A 1 140 ? 47.846 -1.660  3.999   1.00 0.00 ? 353 ALA A HB3    4  
ATOM   8627  N N      . SER A 1 141 ? 49.692 -1.807  0.737   1.00 0.00 ? 354 SER A N      4  
ATOM   8628  C CA     . SER A 1 141 ? 49.808 -1.871  -0.710  1.00 0.00 ? 354 SER A CA     4  
ATOM   8629  C C      . SER A 1 141 ? 51.014 -1.054  -1.176  1.00 0.00 ? 354 SER A C      4  
ATOM   8630  O O      . SER A 1 141 ? 52.102 -1.597  -1.360  1.00 0.00 ? 354 SER A O      4  
ATOM   8631  C CB     . SER A 1 141 ? 48.532 -1.367  -1.387  1.00 0.00 ? 354 SER A CB     4  
ATOM   8632  O OG     . SER A 1 141 ? 47.727 -2.437  -1.873  1.00 0.00 ? 354 SER A OG     4  
ATOM   8633  H H      . SER A 1 141 ? 49.730 -2.691  1.203   1.00 0.00 ? 354 SER A H      4  
ATOM   8634  H HA     . SER A 1 141 ? 49.949 -2.927  -0.942  1.00 0.00 ? 354 SER A HA     4  
ATOM   8635  H HB2    . SER A 1 141 ? 47.955 -0.774  -0.677  1.00 0.00 ? 354 SER A HB2    4  
ATOM   8636  H HB3    . SER A 1 141 ? 48.797 -0.707  -2.213  1.00 0.00 ? 354 SER A HB3    4  
ATOM   8637  H HG     . SER A 1 141 ? 46.774 -2.142  -1.951  1.00 0.00 ? 354 SER A HG     4  
ATOM   8638  N N      . ALA A 1 142 ? 50.780 0.239   -1.351  1.00 0.00 ? 355 ALA A N      4  
ATOM   8639  C CA     . ALA A 1 142 ? 51.835 1.137   -1.792  1.00 0.00 ? 355 ALA A CA     4  
ATOM   8640  C C      . ALA A 1 142 ? 53.121 0.821   -1.024  1.00 0.00 ? 355 ALA A C      4  
ATOM   8641  O O      . ALA A 1 142 ? 53.396 1.429   0.010   1.00 0.00 ? 355 ALA A O      4  
ATOM   8642  C CB     . ALA A 1 142 ? 51.383 2.586   -1.602  1.00 0.00 ? 355 ALA A CB     4  
ATOM   8643  H H      . ALA A 1 142 ? 49.893 0.672   -1.198  1.00 0.00 ? 355 ALA A H      4  
ATOM   8644  H HA     . ALA A 1 142 ? 52.002 0.957   -2.853  1.00 0.00 ? 355 ALA A HA     4  
ATOM   8645  H HB1    . ALA A 1 142 ? 51.898 3.017   -0.743  1.00 0.00 ? 355 ALA A HB1    4  
ATOM   8646  H HB2    . ALA A 1 142 ? 51.624 3.161   -2.496  1.00 0.00 ? 355 ALA A HB2    4  
ATOM   8647  H HB3    . ALA A 1 142 ? 50.307 2.612   -1.432  1.00 0.00 ? 355 ALA A HB3    4  
HETATM 8648  P P      . CMP B 2 .   ? 34.279 -0.669  -5.952  1.00 0.00 ? 370 CMP A P      4  
HETATM 8649  O O1P    . CMP B 2 .   ? 35.682 -0.631  -6.421  1.00 0.00 ? 370 CMP A O1P    4  
HETATM 8650  O O2P    . CMP B 2 .   ? 33.398 0.350   -6.835  1.00 0.00 ? 370 CMP A O2P    4  
HETATM 8651  O "O5'"  . CMP B 2 .   ? 33.703 -2.157  -6.130  1.00 0.00 ? 370 CMP A "O5'"  4  
HETATM 8652  C "C5'"  . CMP B 2 .   ? 34.428 -3.036  -5.259  1.00 0.00 ? 370 CMP A "C5'"  4  
HETATM 8653  C "C4'"  . CMP B 2 .   ? 34.243 -2.535  -3.839  1.00 0.00 ? 370 CMP A "C4'"  4  
HETATM 8654  O "O4'"  . CMP B 2 .   ? 34.844 -3.331  -2.817  1.00 0.00 ? 370 CMP A "O4'"  4  
HETATM 8655  C "C3'"  . CMP B 2 .   ? 34.984 -1.179  -3.702  1.00 0.00 ? 370 CMP A "C3'"  4  
HETATM 8656  O "O3'"  . CMP B 2 .   ? 34.227 -0.213  -4.403  1.00 0.00 ? 370 CMP A "O3'"  4  
HETATM 8657  C "C2'"  . CMP B 2 .   ? 35.018 -1.013  -2.173  1.00 0.00 ? 370 CMP A "C2'"  4  
HETATM 8658  O "O2'"  . CMP B 2 .   ? 33.901 -0.242  -1.726  1.00 0.00 ? 370 CMP A "O2'"  4  
HETATM 8659  C "C1'"  . CMP B 2 .   ? 34.939 -2.469  -1.659  1.00 0.00 ? 370 CMP A "C1'"  4  
HETATM 8660  N N9     . CMP B 2 .   ? 36.143 -2.794  -0.893  1.00 0.00 ? 370 CMP A N9     4  
HETATM 8661  C C8     . CMP B 2 .   ? 37.366 -3.100  -1.407  1.00 0.00 ? 370 CMP A C8     4  
HETATM 8662  N N7     . CMP B 2 .   ? 38.209 -3.336  -0.442  1.00 0.00 ? 370 CMP A N7     4  
HETATM 8663  C C5     . CMP B 2 .   ? 37.580 -3.191  0.749   1.00 0.00 ? 370 CMP A C5     4  
HETATM 8664  C C6     . CMP B 2 .   ? 37.968 -3.325  2.093   1.00 0.00 ? 370 CMP A C6     4  
HETATM 8665  N N6     . CMP B 2 .   ? 39.269 -3.666  2.425   1.00 0.00 ? 370 CMP A N6     4  
HETATM 8666  N N1     . CMP B 2 .   ? 37.060 -3.109  3.038   1.00 0.00 ? 370 CMP A N1     4  
HETATM 8667  C C2     . CMP B 2 .   ? 35.819 -2.783  2.732   1.00 0.00 ? 370 CMP A C2     4  
HETATM 8668  N N3     . CMP B 2 .   ? 35.409 -2.653  1.487   1.00 0.00 ? 370 CMP A N3     4  
HETATM 8669  C C4     . CMP B 2 .   ? 36.247 -2.849  0.475   1.00 0.00 ? 370 CMP A C4     4  
HETATM 8670  H "H5'1" . CMP B 2 .   ? 35.488 -3.023  -5.520  1.00 0.00 ? 370 CMP A "H5'1" 4  
HETATM 8671  H "H5'2" . CMP B 2 .   ? 34.037 -4.049  -5.348  1.00 0.00 ? 370 CMP A "H5'2" 4  
HETATM 8672  H "H4'"  . CMP B 2 .   ? 33.183 -2.402  -3.629  1.00 0.00 ? 370 CMP A "H4'"  4  
HETATM 8673  H "H3'"  . CMP B 2 .   ? 35.935 -0.741  -3.812  1.00 0.00 ? 370 CMP A "H3'"  4  
HETATM 8674  H "H2'"  . CMP B 2 .   ? 35.953 -0.549  -1.858  1.00 0.00 ? 370 CMP A "H2'"  4  
HETATM 8675  H "HO2'" . CMP B 2 .   ? 33.977 -0.172  -0.765  1.00 0.00 ? 370 CMP A "HO2'" 4  
HETATM 8676  H "H1'"  . CMP B 2 .   ? 34.055 -2.594  -1.032  1.00 0.00 ? 370 CMP A "H1'"  4  
HETATM 8677  H H8     . CMP B 2 .   ? 37.604 -3.142  -2.459  1.00 0.00 ? 370 CMP A H8     4  
HETATM 8678  H HN61   . CMP B 2 .   ? 39.524 -3.751  3.357   1.00 0.00 ? 370 CMP A HN61   4  
HETATM 8679  H HN62   . CMP B 2 .   ? 39.922 -3.824  1.726   1.00 0.00 ? 370 CMP A HN62   4  
HETATM 8680  H H2     . CMP B 2 .   ? 35.113 -2.616  3.531   1.00 0.00 ? 370 CMP A H2     4  
ATOM   8681  N N      . GLY A 1 1   ? 8.454  -3.605  -12.377 1.00 0.00 ? 214 GLY A N      5  
ATOM   8682  C CA     . GLY A 1 1   ? 7.422  -3.586  -11.355 1.00 0.00 ? 214 GLY A CA     5  
ATOM   8683  C C      . GLY A 1 1   ? 7.406  -2.247  -10.616 1.00 0.00 ? 214 GLY A C      5  
ATOM   8684  O O      . GLY A 1 1   ? 8.416  -1.545  -10.573 1.00 0.00 ? 214 GLY A O      5  
ATOM   8685  H H1     . GLY A 1 1   ? 9.095  -4.370  -12.317 1.00 0.00 ? 214 GLY A H1     5  
ATOM   8686  H HA2    . GLY A 1 1   ? 6.449  -3.765  -11.812 1.00 0.00 ? 214 GLY A HA2    5  
ATOM   8687  H HA3    . GLY A 1 1   ? 7.595  -4.395  -10.645 1.00 0.00 ? 214 GLY A HA3    5  
ATOM   8688  N N      . SER A 1 2   ? 6.248  -1.931  -10.054 1.00 0.00 ? 215 SER A N      5  
ATOM   8689  C CA     . SER A 1 2   ? 6.087  -0.687  -9.320  1.00 0.00 ? 215 SER A CA     5  
ATOM   8690  C C      . SER A 1 2   ? 5.260  -0.929  -8.057  1.00 0.00 ? 215 SER A C      5  
ATOM   8691  O O      . SER A 1 2   ? 4.216  -1.577  -8.108  1.00 0.00 ? 215 SER A O      5  
ATOM   8692  C CB     . SER A 1 2   ? 5.427  0.384   -10.189 1.00 0.00 ? 215 SER A CB     5  
ATOM   8693  O OG     . SER A 1 2   ? 4.103  0.022   -10.570 1.00 0.00 ? 215 SER A OG     5  
ATOM   8694  H H      . SER A 1 2   ? 5.432  -2.507  -10.094 1.00 0.00 ? 215 SER A H      5  
ATOM   8695  H HA     . SER A 1 2   ? 7.099  -0.372  -9.061  1.00 0.00 ? 215 SER A HA     5  
ATOM   8696  H HB2    . SER A 1 2   ? 5.403  1.328   -9.645  1.00 0.00 ? 215 SER A HB2    5  
ATOM   8697  H HB3    . SER A 1 2   ? 6.030  0.547   -11.084 1.00 0.00 ? 215 SER A HB3    5  
ATOM   8698  H HG     . SER A 1 2   ? 3.574  0.842   -10.789 1.00 0.00 ? 215 SER A HG     5  
ATOM   8699  N N      . GLN A 1 3   ? 5.758  -0.395  -6.950  1.00 0.00 ? 216 GLN A N      5  
ATOM   8700  C CA     . GLN A 1 3   ? 5.076  -0.545  -5.675  1.00 0.00 ? 216 GLN A CA     5  
ATOM   8701  C C      . GLN A 1 3   ? 4.444  0.782   -5.251  1.00 0.00 ? 216 GLN A C      5  
ATOM   8702  O O      . GLN A 1 3   ? 5.151  1.759   -5.003  1.00 0.00 ? 216 GLN A O      5  
ATOM   8703  C CB     . GLN A 1 3   ? 6.033  -1.065  -4.600  1.00 0.00 ? 216 GLN A CB     5  
ATOM   8704  C CG     . GLN A 1 3   ? 5.524  -2.376  -3.999  1.00 0.00 ? 216 GLN A CG     5  
ATOM   8705  C CD     . GLN A 1 3   ? 5.587  -2.340  -2.472  1.00 0.00 ? 216 GLN A CD     5  
ATOM   8706  O OE1    . GLN A 1 3   ? 5.329  -1.330  -1.837  1.00 0.00 ? 216 GLN A OE1    5  
ATOM   8707  N NE2    . GLN A 1 3   ? 5.945  -3.495  -1.918  1.00 0.00 ? 216 GLN A NE2    5  
ATOM   8708  H H      . GLN A 1 3   ? 6.607  0.131   -6.916  1.00 0.00 ? 216 GLN A H      5  
ATOM   8709  H HA     . GLN A 1 3   ? 4.297  -1.287  -5.848  1.00 0.00 ? 216 GLN A HA     5  
ATOM   8710  H HB2    . GLN A 1 3   ? 7.022  -1.219  -5.032  1.00 0.00 ? 216 GLN A HB2    5  
ATOM   8711  H HB3    . GLN A 1 3   ? 6.142  -0.318  -3.814  1.00 0.00 ? 216 GLN A HB3    5  
ATOM   8712  H HG2    . GLN A 1 3   ? 4.496  -2.552  -4.320  1.00 0.00 ? 216 GLN A HG2    5  
ATOM   8713  H HG3    . GLN A 1 3   ? 6.121  -3.208  -4.373  1.00 0.00 ? 216 GLN A HG3    5  
ATOM   8714  H HE21   . GLN A 1 3   ? 6.143  -4.286  -2.496  1.00 0.00 ? 216 GLN A HE21   5  
ATOM   8715  H HE22   . GLN A 1 3   ? 6.015  -3.572  -0.923  1.00 0.00 ? 216 GLN A HE22   5  
ATOM   8716  N N      . GLU A 1 4   ? 3.122  0.777   -5.183  1.00 0.00 ? 217 GLU A N      5  
ATOM   8717  C CA     . GLU A 1 4   ? 2.387  1.968   -4.794  1.00 0.00 ? 217 GLU A CA     5  
ATOM   8718  C C      . GLU A 1 4   ? 1.005  1.589   -4.257  1.00 0.00 ? 217 GLU A C      5  
ATOM   8719  O O      . GLU A 1 4   ? -0.010 1.861   -4.897  1.00 0.00 ? 217 GLU A O      5  
ATOM   8720  C CB     . GLU A 1 4   ? 2.270  2.946   -5.964  1.00 0.00 ? 217 GLU A CB     5  
ATOM   8721  C CG     . GLU A 1 4   ? 1.571  2.294   -7.158  1.00 0.00 ? 217 GLU A CG     5  
ATOM   8722  C CD     . GLU A 1 4   ? 0.607  3.273   -7.832  1.00 0.00 ? 217 GLU A CD     5  
ATOM   8723  O OE1    . GLU A 1 4   ? 1.035  4.091   -8.660  1.00 0.00 ? 217 GLU A OE1    5  
ATOM   8724  O OE2    . GLU A 1 4   ? -0.625 3.162   -7.468  1.00 0.00 ? 217 GLU A OE2    5  
ATOM   8725  H H      . GLU A 1 4   ? 2.554  -0.022  -5.387  1.00 0.00 ? 217 GLU A H      5  
ATOM   8726  H HA     . GLU A 1 4   ? 2.978  2.427   -4.002  1.00 0.00 ? 217 GLU A HA     5  
ATOM   8727  H HB2    . GLU A 1 4   ? 1.714  3.830   -5.650  1.00 0.00 ? 217 GLU A HB2    5  
ATOM   8728  H HB3    . GLU A 1 4   ? 3.264  3.285   -6.260  1.00 0.00 ? 217 GLU A HB3    5  
ATOM   8729  H HG2    . GLU A 1 4   ? 2.315  1.955   -7.879  1.00 0.00 ? 217 GLU A HG2    5  
ATOM   8730  H HG3    . GLU A 1 4   ? 1.024  1.410   -6.825  1.00 0.00 ? 217 GLU A HG3    5  
ATOM   8731  H HE2    . GLU A 1 4   ? -0.960 4.038   -7.122  1.00 0.00 ? 217 GLU A HE2    5  
ATOM   8732  N N      . VAL A 1 5   ? 1.010  0.965   -3.088  1.00 0.00 ? 218 VAL A N      5  
ATOM   8733  C CA     . VAL A 1 5   ? -0.230 0.544   -2.459  1.00 0.00 ? 218 VAL A CA     5  
ATOM   8734  C C      . VAL A 1 5   ? -0.779 1.691   -1.608  1.00 0.00 ? 218 VAL A C      5  
ATOM   8735  O O      . VAL A 1 5   ? -1.899 2.152   -1.828  1.00 0.00 ? 218 VAL A O      5  
ATOM   8736  C CB     . VAL A 1 5   ? -0.001 -0.739  -1.657  1.00 0.00 ? 218 VAL A CB     5  
ATOM   8737  C CG1    . VAL A 1 5   ? -1.268 -1.147  -0.903  1.00 0.00 ? 218 VAL A CG1    5  
ATOM   8738  C CG2    . VAL A 1 5   ? 0.487  -1.872  -2.562  1.00 0.00 ? 218 VAL A CG2    5  
ATOM   8739  H H      . VAL A 1 5   ? 1.841  0.746   -2.575  1.00 0.00 ? 218 VAL A H      5  
ATOM   8740  H HA     . VAL A 1 5   ? -0.943 0.323   -3.252  1.00 0.00 ? 218 VAL A HA     5  
ATOM   8741  H HB     . VAL A 1 5   ? 0.777  -0.540  -0.921  1.00 0.00 ? 218 VAL A HB     5  
ATOM   8742  H HG11   . VAL A 1 5   ? -1.005 -1.458  0.108   1.00 0.00 ? 218 VAL A HG11   5  
ATOM   8743  H HG12   . VAL A 1 5   ? -1.952 -0.300  -0.855  1.00 0.00 ? 218 VAL A HG12   5  
ATOM   8744  H HG13   . VAL A 1 5   ? -1.750 -1.975  -1.424  1.00 0.00 ? 218 VAL A HG13   5  
ATOM   8745  H HG21   . VAL A 1 5   ? -0.154 -2.744  -2.431  1.00 0.00 ? 218 VAL A HG21   5  
ATOM   8746  H HG22   . VAL A 1 5   ? 0.449  -1.546  -3.603  1.00 0.00 ? 218 VAL A HG22   5  
ATOM   8747  H HG23   . VAL A 1 5   ? 1.512  -2.131  -2.299  1.00 0.00 ? 218 VAL A HG23   5  
ATOM   8748  N N      . ARG A 1 6   ? 0.034  2.119   -0.654  1.00 0.00 ? 219 ARG A N      5  
ATOM   8749  C CA     . ARG A 1 6   ? -0.356 3.204   0.232   1.00 0.00 ? 219 ARG A CA     5  
ATOM   8750  C C      . ARG A 1 6   ? 0.883  3.874   0.827   1.00 0.00 ? 219 ARG A C      5  
ATOM   8751  O O      . ARG A 1 6   ? 0.928  4.149   2.026   1.00 0.00 ? 219 ARG A O      5  
ATOM   8752  C CB     . ARG A 1 6   ? -1.248 2.695   1.366   1.00 0.00 ? 219 ARG A CB     5  
ATOM   8753  C CG     . ARG A 1 6   ? -0.576 1.544   2.117   1.00 0.00 ? 219 ARG A CG     5  
ATOM   8754  C CD     . ARG A 1 6   ? -1.471 1.031   3.247   1.00 0.00 ? 219 ARG A CD     5  
ATOM   8755  N NE     . ARG A 1 6   ? -0.669 0.241   4.209   1.00 0.00 ? 219 ARG A NE     5  
ATOM   8756  C CZ     . ARG A 1 6   ? -0.199 -0.990  3.963   1.00 0.00 ? 219 ARG A CZ     5  
ATOM   8757  N NH1    . ARG A 1 6   ? -0.446 -1.579  2.785   1.00 0.00 ? 219 ARG A NH1    5  
ATOM   8758  N NH2    . ARG A 1 6   ? 0.520  -1.629  4.895   1.00 0.00 ? 219 ARG A NH2    5  
ATOM   8759  H H      . ARG A 1 6   ? 0.943  1.739   -0.481  1.00 0.00 ? 219 ARG A H      5  
ATOM   8760  H HA     . ARG A 1 6   ? -0.910 3.895   -0.403  1.00 0.00 ? 219 ARG A HA     5  
ATOM   8761  H HB2    . ARG A 1 6   ? -1.462 3.509   2.057   1.00 0.00 ? 219 ARG A HB2    5  
ATOM   8762  H HB3    . ARG A 1 6   ? -2.203 2.361   0.961   1.00 0.00 ? 219 ARG A HB3    5  
ATOM   8763  H HG2    . ARG A 1 6   ? -0.356 0.732   1.424   1.00 0.00 ? 219 ARG A HG2    5  
ATOM   8764  H HG3    . ARG A 1 6   ? 0.377  1.880   2.527   1.00 0.00 ? 219 ARG A HG3    5  
ATOM   8765  H HD2    . ARG A 1 6   ? -1.944 1.869   3.757   1.00 0.00 ? 219 ARG A HD2    5  
ATOM   8766  H HD3    . ARG A 1 6   ? -2.271 0.413   2.836   1.00 0.00 ? 219 ARG A HD3    5  
ATOM   8767  H HE     . ARG A 1 6   ? -0.467 0.652   5.097   1.00 0.00 ? 219 ARG A HE     5  
ATOM   8768  H HH11   . ARG A 1 6   ? -0.982 -1.101  2.090   1.00 0.00 ? 219 ARG A HH11   5  
ATOM   8769  H HH12   . ARG A 1 6   ? -0.094 -2.497  2.602   1.00 0.00 ? 219 ARG A HH12   5  
ATOM   8770  H HH21   . ARG A 1 6   ? 0.705  -1.190  5.775   1.00 0.00 ? 219 ARG A HH21   5  
ATOM   8771  H HH22   . ARG A 1 6   ? 0.871  -2.548  4.712   1.00 0.00 ? 219 ARG A HH22   5  
ATOM   8772  N N      . ARG A 1 7   ? 1.858  4.118   -0.036  1.00 0.00 ? 220 ARG A N      5  
ATOM   8773  C CA     . ARG A 1 7   ? 3.094  4.752   0.390   1.00 0.00 ? 220 ARG A CA     5  
ATOM   8774  C C      . ARG A 1 7   ? 3.612  4.096   1.672   1.00 0.00 ? 220 ARG A C      5  
ATOM   8775  O O      . ARG A 1 7   ? 3.763  4.761   2.696   1.00 0.00 ? 220 ARG A O      5  
ATOM   8776  C CB     . ARG A 1 7   ? 2.890  6.248   0.637   1.00 0.00 ? 220 ARG A CB     5  
ATOM   8777  C CG     . ARG A 1 7   ? 3.840  7.080   -0.228  1.00 0.00 ? 220 ARG A CG     5  
ATOM   8778  C CD     . ARG A 1 7   ? 3.184  7.451   -1.560  1.00 0.00 ? 220 ARG A CD     5  
ATOM   8779  N NE     . ARG A 1 7   ? 4.164  7.314   -2.661  1.00 0.00 ? 220 ARG A NE     5  
ATOM   8780  C CZ     . ARG A 1 7   ? 4.004  7.850   -3.879  1.00 0.00 ? 220 ARG A CZ     5  
ATOM   8781  N NH1    . ARG A 1 7   ? 2.904  8.562   -4.159  1.00 0.00 ? 220 ARG A NH1    5  
ATOM   8782  N NH2    . ARG A 1 7   ? 4.945  7.674   -4.817  1.00 0.00 ? 220 ARG A NH2    5  
ATOM   8783  H H      . ARG A 1 7   ? 1.813  3.891   -1.009  1.00 0.00 ? 220 ARG A H      5  
ATOM   8784  H HA     . ARG A 1 7   ? 3.787  4.596   -0.437  1.00 0.00 ? 220 ARG A HA     5  
ATOM   8785  H HB2    . ARG A 1 7   ? 1.859  6.519   0.415   1.00 0.00 ? 220 ARG A HB2    5  
ATOM   8786  H HB3    . ARG A 1 7   ? 3.060  6.473   1.690   1.00 0.00 ? 220 ARG A HB3    5  
ATOM   8787  H HG2    . ARG A 1 7   ? 4.124  7.987   0.307   1.00 0.00 ? 220 ARG A HG2    5  
ATOM   8788  H HG3    . ARG A 1 7   ? 4.755  6.519   -0.413  1.00 0.00 ? 220 ARG A HG3    5  
ATOM   8789  H HD2    . ARG A 1 7   ? 2.325  6.807   -1.744  1.00 0.00 ? 220 ARG A HD2    5  
ATOM   8790  H HD3    . ARG A 1 7   ? 2.812  8.475   -1.519  1.00 0.00 ? 220 ARG A HD3    5  
ATOM   8791  H HE     . ARG A 1 7   ? 4.996  6.789   -2.485  1.00 0.00 ? 220 ARG A HE     5  
ATOM   8792  H HH11   . ARG A 1 7   ? 2.202  8.693   -3.460  1.00 0.00 ? 220 ARG A HH11   5  
ATOM   8793  H HH12   . ARG A 1 7   ? 2.786  8.962   -5.068  1.00 0.00 ? 220 ARG A HH12   5  
ATOM   8794  H HH21   . ARG A 1 7   ? 5.766  7.142   -4.608  1.00 0.00 ? 220 ARG A HH21   5  
ATOM   8795  H HH22   . ARG A 1 7   ? 4.827  8.073   -5.726  1.00 0.00 ? 220 ARG A HH22   5  
ATOM   8796  N N      . GLY A 1 8   ? 3.868  2.800   1.575   1.00 0.00 ? 221 GLY A N      5  
ATOM   8797  C CA     . GLY A 1 8   ? 4.366  2.048   2.714   1.00 0.00 ? 221 GLY A CA     5  
ATOM   8798  C C      . GLY A 1 8   ? 5.854  1.730   2.554   1.00 0.00 ? 221 GLY A C      5  
ATOM   8799  O O      . GLY A 1 8   ? 6.599  1.720   3.534   1.00 0.00 ? 221 GLY A O      5  
ATOM   8800  H H      . GLY A 1 8   ? 3.743  2.267   0.738   1.00 0.00 ? 221 GLY A H      5  
ATOM   8801  H HA2    . GLY A 1 8   ? 4.209  2.620   3.628   1.00 0.00 ? 221 GLY A HA2    5  
ATOM   8802  H HA3    . GLY A 1 8   ? 3.802  1.120   2.816   1.00 0.00 ? 221 GLY A HA3    5  
ATOM   8803  N N      . ASP A 1 9   ? 6.243  1.481   1.313   1.00 0.00 ? 222 ASP A N      5  
ATOM   8804  C CA     . ASP A 1 9   ? 7.630  1.165   1.013   1.00 0.00 ? 222 ASP A CA     5  
ATOM   8805  C C      . ASP A 1 9   ? 8.465  2.445   1.072   1.00 0.00 ? 222 ASP A C      5  
ATOM   8806  O O      . ASP A 1 9   ? 9.608  2.424   1.527   1.00 0.00 ? 222 ASP A O      5  
ATOM   8807  C CB     . ASP A 1 9   ? 7.768  0.575   -0.392  1.00 0.00 ? 222 ASP A CB     5  
ATOM   8808  C CG     . ASP A 1 9   ? 7.045  1.351   -1.494  1.00 0.00 ? 222 ASP A CG     5  
ATOM   8809  O OD1    . ASP A 1 9   ? 7.679  1.991   -2.346  1.00 0.00 ? 222 ASP A OD1    5  
ATOM   8810  O OD2    . ASP A 1 9   ? 5.757  1.281   -1.455  1.00 0.00 ? 222 ASP A OD2    5  
ATOM   8811  H H      . ASP A 1 9   ? 5.632  1.492   0.522   1.00 0.00 ? 222 ASP A H      5  
ATOM   8812  H HA     . ASP A 1 9   ? 7.928  0.437   1.768   1.00 0.00 ? 222 ASP A HA     5  
ATOM   8813  H HB2    . ASP A 1 9   ? 8.827  0.518   -0.644  1.00 0.00 ? 222 ASP A HB2    5  
ATOM   8814  H HB3    . ASP A 1 9   ? 7.389  -0.447  -0.380  1.00 0.00 ? 222 ASP A HB3    5  
ATOM   8815  H HD2    . ASP A 1 9   ? 5.473  0.364   -1.177  1.00 0.00 ? 222 ASP A HD2    5  
ATOM   8816  N N      . PHE A 1 10  ? 7.862  3.529   0.606   1.00 0.00 ? 223 PHE A N      5  
ATOM   8817  C CA     . PHE A 1 10  ? 8.536  4.816   0.601   1.00 0.00 ? 223 PHE A CA     5  
ATOM   8818  C C      . PHE A 1 10  ? 8.762  5.322   2.027   1.00 0.00 ? 223 PHE A C      5  
ATOM   8819  O O      . PHE A 1 10  ? 9.736  6.025   2.292   1.00 0.00 ? 223 PHE A O      5  
ATOM   8820  C CB     . PHE A 1 10  ? 7.622  5.796   -0.137  1.00 0.00 ? 223 PHE A CB     5  
ATOM   8821  C CG     . PHE A 1 10  ? 8.064  7.258   -0.032  1.00 0.00 ? 223 PHE A CG     5  
ATOM   8822  C CD1    . PHE A 1 10  ? 8.922  7.775   -0.952  1.00 0.00 ? 223 PHE A CD1    5  
ATOM   8823  C CD2    . PHE A 1 10  ? 7.598  8.038   0.979   1.00 0.00 ? 223 PHE A CD2    5  
ATOM   8824  C CE1    . PHE A 1 10  ? 9.331  9.133   -0.856  1.00 0.00 ? 223 PHE A CE1    5  
ATOM   8825  C CE2    . PHE A 1 10  ? 8.008  9.394   1.076   1.00 0.00 ? 223 PHE A CE2    5  
ATOM   8826  C CZ     . PHE A 1 10  ? 8.866  9.912   0.156   1.00 0.00 ? 223 PHE A CZ     5  
ATOM   8827  H H      . PHE A 1 10  ? 6.932  3.537   0.238   1.00 0.00 ? 223 PHE A H      5  
ATOM   8828  H HA     . PHE A 1 10  ? 9.500  4.674   0.111   1.00 0.00 ? 223 PHE A HA     5  
ATOM   8829  H HB2    . PHE A 1 10  ? 7.578  5.515   -1.189  1.00 0.00 ? 223 PHE A HB2    5  
ATOM   8830  H HB3    . PHE A 1 10  ? 6.611  5.704   0.260   1.00 0.00 ? 223 PHE A HB3    5  
ATOM   8831  H HD1    . PHE A 1 10  ? 9.294  7.150   -1.763  1.00 0.00 ? 223 PHE A HD1    5  
ATOM   8832  H HD2    . PHE A 1 10  ? 6.911  7.622   1.715   1.00 0.00 ? 223 PHE A HD2    5  
ATOM   8833  H HE1    . PHE A 1 10  ? 10.019 9.548   -1.592  1.00 0.00 ? 223 PHE A HE1    5  
ATOM   8834  H HE2    . PHE A 1 10  ? 7.635  10.019  1.886   1.00 0.00 ? 223 PHE A HE2    5  
ATOM   8835  H HZ     . PHE A 1 10  ? 9.180  10.954  0.230   1.00 0.00 ? 223 PHE A HZ     5  
ATOM   8836  N N      . VAL A 1 11  ? 7.846  4.946   2.907   1.00 0.00 ? 224 VAL A N      5  
ATOM   8837  C CA     . VAL A 1 11  ? 7.933  5.353   4.299   1.00 0.00 ? 224 VAL A CA     5  
ATOM   8838  C C      . VAL A 1 11  ? 9.112  4.638   4.962   1.00 0.00 ? 224 VAL A C      5  
ATOM   8839  O O      . VAL A 1 11  ? 9.880  5.253   5.699   1.00 0.00 ? 224 VAL A O      5  
ATOM   8840  C CB     . VAL A 1 11  ? 6.602  5.092   5.004   1.00 0.00 ? 224 VAL A CB     5  
ATOM   8841  C CG1    . VAL A 1 11  ? 6.711  5.379   6.504   1.00 0.00 ? 224 VAL A CG1    5  
ATOM   8842  C CG2    . VAL A 1 11  ? 5.475  5.910   4.371   1.00 0.00 ? 224 VAL A CG2    5  
ATOM   8843  H H      . VAL A 1 11  ? 7.057  4.375   2.682   1.00 0.00 ? 224 VAL A H      5  
ATOM   8844  H HA     . VAL A 1 11  ? 8.120  6.427   4.316   1.00 0.00 ? 224 VAL A HA     5  
ATOM   8845  H HB     . VAL A 1 11  ? 6.358  4.037   4.882   1.00 0.00 ? 224 VAL A HB     5  
ATOM   8846  H HG11   . VAL A 1 11  ? 6.904  6.441   6.657   1.00 0.00 ? 224 VAL A HG11   5  
ATOM   8847  H HG12   . VAL A 1 11  ? 5.776  5.106   6.995   1.00 0.00 ? 224 VAL A HG12   5  
ATOM   8848  H HG13   . VAL A 1 11  ? 7.527  4.795   6.927   1.00 0.00 ? 224 VAL A HG13   5  
ATOM   8849  H HG21   . VAL A 1 11  ? 4.513  5.478   4.645   1.00 0.00 ? 224 VAL A HG21   5  
ATOM   8850  H HG22   . VAL A 1 11  ? 5.527  6.939   4.728   1.00 0.00 ? 224 VAL A HG22   5  
ATOM   8851  H HG23   . VAL A 1 11  ? 5.583  5.896   3.285   1.00 0.00 ? 224 VAL A HG23   5  
ATOM   8852  N N      . ARG A 1 12  ? 9.217  3.349   4.676   1.00 0.00 ? 225 ARG A N      5  
ATOM   8853  C CA     . ARG A 1 12  ? 10.289 2.544   5.235   1.00 0.00 ? 225 ARG A CA     5  
ATOM   8854  C C      . ARG A 1 12  ? 11.640 2.997   4.678   1.00 0.00 ? 225 ARG A C      5  
ATOM   8855  O O      . ARG A 1 12  ? 12.650 2.956   5.380   1.00 0.00 ? 225 ARG A O      5  
ATOM   8856  C CB     . ARG A 1 12  ? 10.087 1.060   4.917   1.00 0.00 ? 225 ARG A CB     5  
ATOM   8857  C CG     . ARG A 1 12  ? 11.119 0.198   5.647   1.00 0.00 ? 225 ARG A CG     5  
ATOM   8858  C CD     . ARG A 1 12  ? 11.825 -0.751  4.676   1.00 0.00 ? 225 ARG A CD     5  
ATOM   8859  N NE     . ARG A 1 12  ? 11.445 -2.151  4.971   1.00 0.00 ? 225 ARG A NE     5  
ATOM   8860  C CZ     . ARG A 1 12  ? 10.257 -2.688  4.664   1.00 0.00 ? 225 ARG A CZ     5  
ATOM   8861  N NH1    . ARG A 1 12  ? 9.324  -1.946  4.052   1.00 0.00 ? 225 ARG A NH1    5  
ATOM   8862  N NH2    . ARG A 1 12  ? 10.001 -3.968  4.971   1.00 0.00 ? 225 ARG A NH2    5  
ATOM   8863  H H      . ARG A 1 12  ? 8.588  2.856   4.075   1.00 0.00 ? 225 ARG A H      5  
ATOM   8864  H HA     . ARG A 1 12  ? 10.231 2.711   6.311   1.00 0.00 ? 225 ARG A HA     5  
ATOM   8865  H HB2    . ARG A 1 12  ? 9.082  0.756   5.210   1.00 0.00 ? 225 ARG A HB2    5  
ATOM   8866  H HB3    . ARG A 1 12  ? 10.169 0.900   3.844   1.00 0.00 ? 225 ARG A HB3    5  
ATOM   8867  H HG2    . ARG A 1 12  ? 11.854 0.838   6.134   1.00 0.00 ? 225 ARG A HG2    5  
ATOM   8868  H HG3    . ARG A 1 12  ? 10.628 -0.378  6.432   1.00 0.00 ? 225 ARG A HG3    5  
ATOM   8869  H HD2    . ARG A 1 12  ? 11.555 -0.502  3.650   1.00 0.00 ? 225 ARG A HD2    5  
ATOM   8870  H HD3    . ARG A 1 12  ? 12.905 -0.633  4.760   1.00 0.00 ? 225 ARG A HD3    5  
ATOM   8871  H HE     . ARG A 1 12  ? 12.119 -2.732  5.428   1.00 0.00 ? 225 ARG A HE     5  
ATOM   8872  H HH11   . ARG A 1 12  ? 9.516  -0.991  3.824   1.00 0.00 ? 225 ARG A HH11   5  
ATOM   8873  H HH12   . ARG A 1 12  ? 8.438  -2.346  3.823   1.00 0.00 ? 225 ARG A HH12   5  
ATOM   8874  H HH21   . ARG A 1 12  ? 10.696 -4.521  5.428   1.00 0.00 ? 225 ARG A HH21   5  
ATOM   8875  H HH22   . ARG A 1 12  ? 9.113  -4.368  4.742   1.00 0.00 ? 225 ARG A HH22   5  
ATOM   8876  N N      . ASN A 1 13  ? 11.616 3.418   3.423   1.00 0.00 ? 226 ASN A N      5  
ATOM   8877  C CA     . ASN A 1 13  ? 12.826 3.879   2.764   1.00 0.00 ? 226 ASN A CA     5  
ATOM   8878  C C      . ASN A 1 13  ? 13.274 5.200   3.395   1.00 0.00 ? 226 ASN A C      5  
ATOM   8879  O O      . ASN A 1 13  ? 14.465 5.504   3.428   1.00 0.00 ? 226 ASN A O      5  
ATOM   8880  C CB     . ASN A 1 13  ? 12.582 4.127   1.274   1.00 0.00 ? 226 ASN A CB     5  
ATOM   8881  C CG     . ASN A 1 13  ? 12.435 2.806   0.516   1.00 0.00 ? 226 ASN A CG     5  
ATOM   8882  O OD1    . ASN A 1 13  ? 11.884 1.836   1.009   1.00 0.00 ? 226 ASN A OD1    5  
ATOM   8883  N ND2    . ASN A 1 13  ? 12.957 2.823   -0.707  1.00 0.00 ? 226 ASN A ND2    5  
ATOM   8884  H H      . ASN A 1 13  ? 10.790 3.448   2.859   1.00 0.00 ? 226 ASN A H      5  
ATOM   8885  H HA     . ASN A 1 13  ? 13.552 3.080   2.909   1.00 0.00 ? 226 ASN A HA     5  
ATOM   8886  H HB2    . ASN A 1 13  ? 11.682 4.727   1.143   1.00 0.00 ? 226 ASN A HB2    5  
ATOM   8887  H HB3    . ASN A 1 13  ? 13.411 4.700   0.857   1.00 0.00 ? 226 ASN A HB3    5  
ATOM   8888  H HD21   . ASN A 1 13  ? 13.395 3.653   -1.052  1.00 0.00 ? 226 ASN A HD21   5  
ATOM   8889  H HD22   . ASN A 1 13  ? 12.910 2.007   -1.282  1.00 0.00 ? 226 ASN A HD22   5  
ATOM   8890  N N      . TRP A 1 14  ? 12.295 5.949   3.881   1.00 0.00 ? 227 TRP A N      5  
ATOM   8891  C CA     . TRP A 1 14  ? 12.573 7.228   4.510   1.00 0.00 ? 227 TRP A CA     5  
ATOM   8892  C C      . TRP A 1 14  ? 13.447 6.971   5.739   1.00 0.00 ? 227 TRP A C      5  
ATOM   8893  O O      . TRP A 1 14  ? 14.373 7.732   6.017   1.00 0.00 ? 227 TRP A O      5  
ATOM   8894  C CB     . TRP A 1 14  ? 11.277 7.970   4.842   1.00 0.00 ? 227 TRP A CB     5  
ATOM   8895  C CG     . TRP A 1 14  ? 11.038 9.219   3.991   1.00 0.00 ? 227 TRP A CG     5  
ATOM   8896  C CD1    . TRP A 1 14  ? 9.905  9.602   3.388   1.00 0.00 ? 227 TRP A CD1    5  
ATOM   8897  C CD2    . TRP A 1 14  ? 12.008 10.239  3.671   1.00 0.00 ? 227 TRP A CD2    5  
ATOM   8898  N NE1    . TRP A 1 14  ? 10.072 10.791  2.705   1.00 0.00 ? 227 TRP A NE1    5  
ATOM   8899  C CE2    . TRP A 1 14  ? 11.392 11.189  2.883   1.00 0.00 ? 227 TRP A CE2    5  
ATOM   8900  C CE3    . TRP A 1 14  ? 13.361 10.354  4.035   1.00 0.00 ? 227 TRP A CE3    5  
ATOM   8901  C CZ2    . TRP A 1 14  ? 12.051 12.323  2.393   1.00 0.00 ? 227 TRP A CZ2    5  
ATOM   8902  C CZ3    . TRP A 1 14  ? 14.006 11.493  3.537   1.00 0.00 ? 227 TRP A CZ3    5  
ATOM   8903  C CH2    . TRP A 1 14  ? 13.399 12.459  2.743   1.00 0.00 ? 227 TRP A CH2    5  
ATOM   8904  H H      . TRP A 1 14  ? 11.328 5.694   3.851   1.00 0.00 ? 227 TRP A H      5  
ATOM   8905  H HA     . TRP A 1 14  ? 13.115 7.843   3.790   1.00 0.00 ? 227 TRP A HA     5  
ATOM   8906  H HB2    . TRP A 1 14  ? 10.436 7.288   4.711   1.00 0.00 ? 227 TRP A HB2    5  
ATOM   8907  H HB3    . TRP A 1 14  ? 11.293 8.257   5.894   1.00 0.00 ? 227 TRP A HB3    5  
ATOM   8908  H HD1    . TRP A 1 14  ? 8.969  9.046   3.431   1.00 0.00 ? 227 TRP A HD1    5  
ATOM   8909  H HE1    . TRP A 1 14  ? 9.310  11.318  2.133   1.00 0.00 ? 227 TRP A HE1    5  
ATOM   8910  H HE3    . TRP A 1 14  ? 13.871 9.617   4.656   1.00 0.00 ? 227 TRP A HE3    5  
ATOM   8911  H HZ2    . TRP A 1 14  ? 11.542 13.060  1.772   1.00 0.00 ? 227 TRP A HZ2    5  
ATOM   8912  H HZ3    . TRP A 1 14  ? 15.057 11.631  3.789   1.00 0.00 ? 227 TRP A HZ3    5  
ATOM   8913  H HH2    . TRP A 1 14  ? 13.972 13.319  2.394   1.00 0.00 ? 227 TRP A HH2    5  
ATOM   8914  N N      . GLN A 1 15  ? 13.120 5.898   6.443   1.00 0.00 ? 228 GLN A N      5  
ATOM   8915  C CA     . GLN A 1 15  ? 13.863 5.531   7.637   1.00 0.00 ? 228 GLN A CA     5  
ATOM   8916  C C      . GLN A 1 15  ? 15.228 4.953   7.256   1.00 0.00 ? 228 GLN A C      5  
ATOM   8917  O O      . GLN A 1 15  ? 16.205 5.130   7.982   1.00 0.00 ? 228 GLN A O      5  
ATOM   8918  C CB     . GLN A 1 15  ? 13.070 4.544   8.495   1.00 0.00 ? 228 GLN A CB     5  
ATOM   8919  C CG     . GLN A 1 15  ? 11.565 4.714   8.277   1.00 0.00 ? 228 GLN A CG     5  
ATOM   8920  C CD     . GLN A 1 15  ? 10.800 4.572   9.594   1.00 0.00 ? 228 GLN A CD     5  
ATOM   8921  O OE1    . GLN A 1 15  ? 11.167 5.127   10.617  1.00 0.00 ? 228 GLN A OE1    5  
ATOM   8922  N NE2    . GLN A 1 15  ? 9.719  3.801   9.513   1.00 0.00 ? 228 GLN A NE2    5  
ATOM   8923  H H      . GLN A 1 15  ? 12.365 5.285   6.211   1.00 0.00 ? 228 GLN A H      5  
ATOM   8924  H HA     . GLN A 1 15  ? 13.996 6.459   8.192   1.00 0.00 ? 228 GLN A HA     5  
ATOM   8925  H HB2    . GLN A 1 15  ? 13.364 3.524   8.249   1.00 0.00 ? 228 GLN A HB2    5  
ATOM   8926  H HB3    . GLN A 1 15  ? 13.307 4.698   9.548   1.00 0.00 ? 228 GLN A HB3    5  
ATOM   8927  H HG2    . GLN A 1 15  ? 11.365 5.691   7.839   1.00 0.00 ? 228 GLN A HG2    5  
ATOM   8928  H HG3    . GLN A 1 15  ? 11.210 3.967   7.565   1.00 0.00 ? 228 GLN A HG3    5  
ATOM   8929  H HE21   . GLN A 1 15  ? 9.473  3.374   8.643   1.00 0.00 ? 228 GLN A HE21   5  
ATOM   8930  H HE22   . GLN A 1 15  ? 9.153  3.647   10.322  1.00 0.00 ? 228 GLN A HE22   5  
ATOM   8931  N N      . LEU A 1 16  ? 15.250 4.273   6.119   1.00 0.00 ? 229 LEU A N      5  
ATOM   8932  C CA     . LEU A 1 16  ? 16.478 3.668   5.633   1.00 0.00 ? 229 LEU A CA     5  
ATOM   8933  C C      . LEU A 1 16  ? 17.451 4.771   5.208   1.00 0.00 ? 229 LEU A C      5  
ATOM   8934  O O      . LEU A 1 16  ? 18.649 4.681   5.471   1.00 0.00 ? 229 LEU A O      5  
ATOM   8935  C CB     . LEU A 1 16  ? 16.175 2.656   4.527   1.00 0.00 ? 229 LEU A CB     5  
ATOM   8936  C CG     . LEU A 1 16  ? 15.936 1.215   4.984   1.00 0.00 ? 229 LEU A CG     5  
ATOM   8937  C CD1    . LEU A 1 16  ? 14.716 1.128   5.904   1.00 0.00 ? 229 LEU A CD1    5  
ATOM   8938  C CD2    . LEU A 1 16  ? 15.819 0.271   3.785   1.00 0.00 ? 229 LEU A CD2    5  
ATOM   8939  H H      . LEU A 1 16  ? 14.450 4.134   5.534   1.00 0.00 ? 229 LEU A H      5  
ATOM   8940  H HA     . LEU A 1 16  ? 16.922 3.117   6.462   1.00 0.00 ? 229 LEU A HA     5  
ATOM   8941  H HB2    . LEU A 1 16  ? 15.294 2.994   3.983   1.00 0.00 ? 229 LEU A HB2    5  
ATOM   8942  H HB3    . LEU A 1 16  ? 17.006 2.658   3.821   1.00 0.00 ? 229 LEU A HB3    5  
ATOM   8943  H HG     . LEU A 1 16  ? 16.800 0.893   5.565   1.00 0.00 ? 229 LEU A HG     5  
ATOM   8944  H HD11   . LEU A 1 16  ? 13.808 1.107   5.301   1.00 0.00 ? 229 LEU A HD11   5  
ATOM   8945  H HD12   . LEU A 1 16  ? 14.777 0.218   6.502   1.00 0.00 ? 229 LEU A HD12   5  
ATOM   8946  H HD13   . LEU A 1 16  ? 14.696 1.995   6.564   1.00 0.00 ? 229 LEU A HD13   5  
ATOM   8947  H HD21   . LEU A 1 16  ? 16.503 0.594   3.001   1.00 0.00 ? 229 LEU A HD21   5  
ATOM   8948  H HD22   . LEU A 1 16  ? 16.072 -0.742  4.095   1.00 0.00 ? 229 LEU A HD22   5  
ATOM   8949  H HD23   . LEU A 1 16  ? 14.797 0.292   3.406   1.00 0.00 ? 229 LEU A HD23   5  
ATOM   8950  N N      . VAL A 1 17  ? 16.899 5.784   4.558   1.00 0.00 ? 230 VAL A N      5  
ATOM   8951  C CA     . VAL A 1 17  ? 17.703 6.902   4.093   1.00 0.00 ? 230 VAL A CA     5  
ATOM   8952  C C      . VAL A 1 17  ? 18.138 7.745   5.294   1.00 0.00 ? 230 VAL A C      5  
ATOM   8953  O O      . VAL A 1 17  ? 19.175 8.405   5.250   1.00 0.00 ? 230 VAL A O      5  
ATOM   8954  C CB     . VAL A 1 17  ? 16.927 7.706   3.048   1.00 0.00 ? 230 VAL A CB     5  
ATOM   8955  C CG1    . VAL A 1 17  ? 17.648 9.014   2.717   1.00 0.00 ? 230 VAL A CG1    5  
ATOM   8956  C CG2    . VAL A 1 17  ? 16.688 6.877   1.784   1.00 0.00 ? 230 VAL A CG2    5  
ATOM   8957  H H      . VAL A 1 17  ? 15.923 5.849   4.347   1.00 0.00 ? 230 VAL A H      5  
ATOM   8958  H HA     . VAL A 1 17  ? 18.590 6.492   3.613   1.00 0.00 ? 230 VAL A HA     5  
ATOM   8959  H HB     . VAL A 1 17  ? 15.955 7.957   3.472   1.00 0.00 ? 230 VAL A HB     5  
ATOM   8960  H HG11   . VAL A 1 17  ? 16.956 9.696   2.221   1.00 0.00 ? 230 VAL A HG11   5  
ATOM   8961  H HG12   . VAL A 1 17  ? 18.011 9.472   3.637   1.00 0.00 ? 230 VAL A HG12   5  
ATOM   8962  H HG13   . VAL A 1 17  ? 18.490 8.808   2.056   1.00 0.00 ? 230 VAL A HG13   5  
ATOM   8963  H HG21   . VAL A 1 17  ? 16.678 7.534   0.916   1.00 0.00 ? 230 VAL A HG21   5  
ATOM   8964  H HG22   . VAL A 1 17  ? 17.488 6.144   1.675   1.00 0.00 ? 230 VAL A HG22   5  
ATOM   8965  H HG23   . VAL A 1 17  ? 15.731 6.361   1.863   1.00 0.00 ? 230 VAL A HG23   5  
ATOM   8966  N N      . ALA A 1 18  ? 17.323 7.695   6.338   1.00 0.00 ? 231 ALA A N      5  
ATOM   8967  C CA     . ALA A 1 18  ? 17.611 8.446   7.548   1.00 0.00 ? 231 ALA A CA     5  
ATOM   8968  C C      . ALA A 1 18  ? 18.784 7.793   8.281   1.00 0.00 ? 231 ALA A C      5  
ATOM   8969  O O      . ALA A 1 18  ? 19.467 8.444   9.071   1.00 0.00 ? 231 ALA A O      5  
ATOM   8970  C CB     . ALA A 1 18  ? 16.352 8.521   8.414   1.00 0.00 ? 231 ALA A CB     5  
ATOM   8971  H H      . ALA A 1 18  ? 16.482 7.155   6.365   1.00 0.00 ? 231 ALA A H      5  
ATOM   8972  H HA     . ALA A 1 18  ? 17.894 9.456   7.253   1.00 0.00 ? 231 ALA A HA     5  
ATOM   8973  H HB1    . ALA A 1 18  ? 16.317 9.485   8.922   1.00 0.00 ? 231 ALA A HB1    5  
ATOM   8974  H HB2    . ALA A 1 18  ? 15.469 8.412   7.782   1.00 0.00 ? 231 ALA A HB2    5  
ATOM   8975  H HB3    . ALA A 1 18  ? 16.371 7.721   9.153   1.00 0.00 ? 231 ALA A HB3    5  
ATOM   8976  N N      . ALA A 1 19  ? 18.983 6.515   7.994   1.00 0.00 ? 232 ALA A N      5  
ATOM   8977  C CA     . ALA A 1 19  ? 20.062 5.767   8.616   1.00 0.00 ? 232 ALA A CA     5  
ATOM   8978  C C      . ALA A 1 19  ? 21.387 6.139   7.948   1.00 0.00 ? 232 ALA A C      5  
ATOM   8979  O O      . ALA A 1 19  ? 22.458 5.835   8.470   1.00 0.00 ? 232 ALA A O      5  
ATOM   8980  C CB     . ALA A 1 19  ? 19.764 4.269   8.525   1.00 0.00 ? 232 ALA A CB     5  
ATOM   8981  H H      . ALA A 1 19  ? 18.424 5.993   7.349   1.00 0.00 ? 232 ALA A H      5  
ATOM   8982  H HA     . ALA A 1 19  ? 20.102 6.055   9.667   1.00 0.00 ? 232 ALA A HA     5  
ATOM   8983  H HB1    . ALA A 1 19  ? 19.958 3.801   9.490   1.00 0.00 ? 232 ALA A HB1    5  
ATOM   8984  H HB2    . ALA A 1 19  ? 18.719 4.123   8.254   1.00 0.00 ? 232 ALA A HB2    5  
ATOM   8985  H HB3    . ALA A 1 19  ? 20.403 3.816   7.767   1.00 0.00 ? 232 ALA A HB3    5  
ATOM   8986  N N      . VAL A 1 20  ? 21.271 6.792   6.800   1.00 0.00 ? 233 VAL A N      5  
ATOM   8987  C CA     . VAL A 1 20  ? 22.447 7.209   6.054   1.00 0.00 ? 233 VAL A CA     5  
ATOM   8988  C C      . VAL A 1 20  ? 22.537 8.737   6.066   1.00 0.00 ? 233 VAL A C      5  
ATOM   8989  O O      . VAL A 1 20  ? 21.693 9.417   5.484   1.00 0.00 ? 233 VAL A O      5  
ATOM   8990  C CB     . VAL A 1 20  ? 22.404 6.623   4.642   1.00 0.00 ? 233 VAL A CB     5  
ATOM   8991  C CG1    . VAL A 1 20  ? 23.730 6.853   3.913   1.00 0.00 ? 233 VAL A CG1    5  
ATOM   8992  C CG2    . VAL A 1 20  ? 22.048 5.135   4.676   1.00 0.00 ? 233 VAL A CG2    5  
ATOM   8993  H H      . VAL A 1 20  ? 20.396 7.035   6.381   1.00 0.00 ? 233 VAL A H      5  
ATOM   8994  H HA     . VAL A 1 20  ? 23.320 6.802   6.563   1.00 0.00 ? 233 VAL A HA     5  
ATOM   8995  H HB     . VAL A 1 20  ? 21.623 7.142   4.087   1.00 0.00 ? 233 VAL A HB     5  
ATOM   8996  H HG11   . VAL A 1 20  ? 23.603 7.640   3.169   1.00 0.00 ? 233 VAL A HG11   5  
ATOM   8997  H HG12   . VAL A 1 20  ? 24.492 7.153   4.632   1.00 0.00 ? 233 VAL A HG12   5  
ATOM   8998  H HG13   . VAL A 1 20  ? 24.039 5.932   3.421   1.00 0.00 ? 233 VAL A HG13   5  
ATOM   8999  H HG21   . VAL A 1 20  ? 22.863 4.557   4.240   1.00 0.00 ? 233 VAL A HG21   5  
ATOM   9000  H HG22   . VAL A 1 20  ? 21.892 4.822   5.708   1.00 0.00 ? 233 VAL A HG22   5  
ATOM   9001  H HG23   . VAL A 1 20  ? 21.136 4.967   4.103   1.00 0.00 ? 233 VAL A HG23   5  
ATOM   9002  N N      . PRO A 1 21  ? 23.595 9.244   6.752   1.00 0.00 ? 234 PRO A N      5  
ATOM   9003  C CA     . PRO A 1 21  ? 23.807 10.678  6.847   1.00 0.00 ? 234 PRO A CA     5  
ATOM   9004  C C      . PRO A 1 21  ? 24.348 11.242  5.531   1.00 0.00 ? 234 PRO A C      5  
ATOM   9005  O O      . PRO A 1 21  ? 24.191 12.428  5.249   1.00 0.00 ? 234 PRO A O      5  
ATOM   9006  C CB     . PRO A 1 21  ? 24.770 10.858  8.010   1.00 0.00 ? 234 PRO A CB     5  
ATOM   9007  C CG     . PRO A 1 21  ? 25.422 9.502   8.224   1.00 0.00 ? 234 PRO A CG     5  
ATOM   9008  C CD     . PRO A 1 21  ? 24.614 8.470   7.455   1.00 0.00 ? 234 PRO A CD     5  
ATOM   9009  H HA     . PRO A 1 21  ? 22.939 11.148  7.009   1.00 0.00 ? 234 PRO A HA     5  
ATOM   9010  H HB2    . PRO A 1 21  ? 25.517 11.619  7.784   1.00 0.00 ? 234 PRO A HB2    5  
ATOM   9011  H HB3    . PRO A 1 21  ? 24.243 11.184  8.907   1.00 0.00 ? 234 PRO A HB3    5  
ATOM   9012  H HG2    . PRO A 1 21  ? 26.455 9.516   7.875   1.00 0.00 ? 234 PRO A HG2    5  
ATOM   9013  H HG3    . PRO A 1 21  ? 25.446 9.254   9.285   1.00 0.00 ? 234 PRO A HG3    5  
ATOM   9014  H HD2    . PRO A 1 21  ? 25.241 7.916   6.756   1.00 0.00 ? 234 PRO A HD2    5  
ATOM   9015  H HD3    . PRO A 1 21  ? 24.163 7.739   8.127   1.00 0.00 ? 234 PRO A HD3    5  
ATOM   9016  N N      . LEU A 1 22  ? 24.971 10.362  4.760   1.00 0.00 ? 235 LEU A N      5  
ATOM   9017  C CA     . LEU A 1 22  ? 25.535 10.757  3.481   1.00 0.00 ? 235 LEU A CA     5  
ATOM   9018  C C      . LEU A 1 22  ? 24.442 11.396  2.622   1.00 0.00 ? 235 LEU A C      5  
ATOM   9019  O O      . LEU A 1 22  ? 24.682 12.397  1.949   1.00 0.00 ? 235 LEU A O      5  
ATOM   9020  C CB     . LEU A 1 22  ? 26.228 9.567   2.812   1.00 0.00 ? 235 LEU A CB     5  
ATOM   9021  C CG     . LEU A 1 22  ? 26.526 9.719   1.319   1.00 0.00 ? 235 LEU A CG     5  
ATOM   9022  C CD1    . LEU A 1 22  ? 28.018 9.963   1.080   1.00 0.00 ? 235 LEU A CD1    5  
ATOM   9023  C CD2    . LEU A 1 22  ? 26.011 8.513   0.531   1.00 0.00 ? 235 LEU A CD2    5  
ATOM   9024  H H      . LEU A 1 22  ? 25.094 9.399   4.998   1.00 0.00 ? 235 LEU A H      5  
ATOM   9025  H HA     . LEU A 1 22  ? 26.302 11.506  3.679   1.00 0.00 ? 235 LEU A HA     5  
ATOM   9026  H HB2    . LEU A 1 22  ? 27.166 9.378   3.332   1.00 0.00 ? 235 LEU A HB2    5  
ATOM   9027  H HB3    . LEU A 1 22  ? 25.603 8.685   2.949   1.00 0.00 ? 235 LEU A HB3    5  
ATOM   9028  H HG     . LEU A 1 22  ? 25.993 10.596  0.951   1.00 0.00 ? 235 LEU A HG     5  
ATOM   9029  H HD11   . LEU A 1 22  ? 28.404 10.632  1.850   1.00 0.00 ? 235 LEU A HD11   5  
ATOM   9030  H HD12   . LEU A 1 22  ? 28.553 9.015   1.121   1.00 0.00 ? 235 LEU A HD12   5  
ATOM   9031  H HD13   . LEU A 1 22  ? 28.159 10.419  0.100   1.00 0.00 ? 235 LEU A HD13   5  
ATOM   9032  H HD21   . LEU A 1 22  ? 26.604 7.634   0.782   1.00 0.00 ? 235 LEU A HD21   5  
ATOM   9033  H HD22   . LEU A 1 22  ? 24.967 8.332   0.787   1.00 0.00 ? 235 LEU A HD22   5  
ATOM   9034  H HD23   . LEU A 1 22  ? 26.093 8.714   -0.538  1.00 0.00 ? 235 LEU A HD23   5  
ATOM   9035  N N      . PHE A 1 23  ? 23.264 10.790  2.673   1.00 0.00 ? 236 PHE A N      5  
ATOM   9036  C CA     . PHE A 1 23  ? 22.134 11.287  1.907   1.00 0.00 ? 236 PHE A CA     5  
ATOM   9037  C C      . PHE A 1 23  ? 21.528 12.528  2.568   1.00 0.00 ? 236 PHE A C      5  
ATOM   9038  O O      . PHE A 1 23  ? 20.749 13.248  1.946   1.00 0.00 ? 236 PHE A O      5  
ATOM   9039  C CB     . PHE A 1 23  ? 21.085 10.173  1.884   1.00 0.00 ? 236 PHE A CB     5  
ATOM   9040  C CG     . PHE A 1 23  ? 21.423 9.021   0.936   1.00 0.00 ? 236 PHE A CG     5  
ATOM   9041  C CD1    . PHE A 1 23  ? 21.942 9.282   -0.294  1.00 0.00 ? 236 PHE A CD1    5  
ATOM   9042  C CD2    . PHE A 1 23  ? 21.204 7.736   1.324   1.00 0.00 ? 236 PHE A CD2    5  
ATOM   9043  C CE1    . PHE A 1 23  ? 22.255 8.212   -1.173  1.00 0.00 ? 236 PHE A CE1    5  
ATOM   9044  C CE2    . PHE A 1 23  ? 21.518 6.665   0.444   1.00 0.00 ? 236 PHE A CE2    5  
ATOM   9045  C CZ     . PHE A 1 23  ? 22.036 6.926   -0.786  1.00 0.00 ? 236 PHE A CZ     5  
ATOM   9046  H H      . PHE A 1 23  ? 23.078 9.976   3.223   1.00 0.00 ? 236 PHE A H      5  
ATOM   9047  H HA     . PHE A 1 23  ? 22.504 11.549  0.916   1.00 0.00 ? 236 PHE A HA     5  
ATOM   9048  H HB2    . PHE A 1 23  ? 20.967 9.778   2.893   1.00 0.00 ? 236 PHE A HB2    5  
ATOM   9049  H HB3    . PHE A 1 23  ? 20.125 10.599  1.594   1.00 0.00 ? 236 PHE A HB3    5  
ATOM   9050  H HD1    . PHE A 1 23  ? 22.116 10.311  -0.604  1.00 0.00 ? 236 PHE A HD1    5  
ATOM   9051  H HD2    . PHE A 1 23  ? 20.789 7.526   2.310   1.00 0.00 ? 236 PHE A HD2    5  
ATOM   9052  H HE1    . PHE A 1 23  ? 22.671 8.420   -2.159  1.00 0.00 ? 236 PHE A HE1    5  
ATOM   9053  H HE2    . PHE A 1 23  ? 21.343 5.636   0.755   1.00 0.00 ? 236 PHE A HE2    5  
ATOM   9054  H HZ     . PHE A 1 23  ? 22.277 6.105   -1.461  1.00 0.00 ? 236 PHE A HZ     5  
ATOM   9055  N N      . GLN A 1 24  ? 21.910 12.739  3.819   1.00 0.00 ? 237 GLN A N      5  
ATOM   9056  C CA     . GLN A 1 24  ? 21.413 13.879  4.570   1.00 0.00 ? 237 GLN A CA     5  
ATOM   9057  C C      . GLN A 1 24  ? 22.175 15.146  4.175   1.00 0.00 ? 237 GLN A C      5  
ATOM   9058  O O      . GLN A 1 24  ? 21.686 16.257  4.376   1.00 0.00 ? 237 GLN A O      5  
ATOM   9059  C CB     . GLN A 1 24  ? 21.511 13.628  6.076   1.00 0.00 ? 237 GLN A CB     5  
ATOM   9060  C CG     . GLN A 1 24  ? 20.561 12.508  6.508   1.00 0.00 ? 237 GLN A CG     5  
ATOM   9061  C CD     . GLN A 1 24  ? 19.110 12.862  6.174   1.00 0.00 ? 237 GLN A CD     5  
ATOM   9062  O OE1    . GLN A 1 24  ? 18.534 13.799  6.704   1.00 0.00 ? 237 GLN A OE1    5  
ATOM   9063  N NE2    . GLN A 1 24  ? 18.552 12.062  5.270   1.00 0.00 ? 237 GLN A NE2    5  
ATOM   9064  H H      . GLN A 1 24  ? 22.543 12.147  4.318   1.00 0.00 ? 237 GLN A H      5  
ATOM   9065  H HA     . GLN A 1 24  ? 20.364 13.976  4.291   1.00 0.00 ? 237 GLN A HA     5  
ATOM   9066  H HB2    . GLN A 1 24  ? 22.535 13.362  6.339   1.00 0.00 ? 237 GLN A HB2    5  
ATOM   9067  H HB3    . GLN A 1 24  ? 21.270 14.543  6.617   1.00 0.00 ? 237 GLN A HB3    5  
ATOM   9068  H HG2    . GLN A 1 24  ? 20.836 11.580  6.008   1.00 0.00 ? 237 GLN A HG2    5  
ATOM   9069  H HG3    . GLN A 1 24  ? 20.660 12.336  7.580   1.00 0.00 ? 237 GLN A HG3    5  
ATOM   9070  H HE21   . GLN A 1 24  ? 19.080 11.310  4.874   1.00 0.00 ? 237 GLN A HE21   5  
ATOM   9071  H HE22   . GLN A 1 24  ? 17.606 12.212  4.985   1.00 0.00 ? 237 GLN A HE22   5  
ATOM   9072  N N      . LYS A 1 25  ? 23.360 14.937  3.621   1.00 0.00 ? 238 LYS A N      5  
ATOM   9073  C CA     . LYS A 1 25  ? 24.194 16.048  3.196   1.00 0.00 ? 238 LYS A CA     5  
ATOM   9074  C C      . LYS A 1 25  ? 23.632 16.637  1.900   1.00 0.00 ? 238 LYS A C      5  
ATOM   9075  O O      . LYS A 1 25  ? 24.155 17.623  1.384   1.00 0.00 ? 238 LYS A O      5  
ATOM   9076  C CB     . LYS A 1 25  ? 25.656 15.611  3.090   1.00 0.00 ? 238 LYS A CB     5  
ATOM   9077  C CG     . LYS A 1 25  ? 26.272 15.412  4.477   1.00 0.00 ? 238 LYS A CG     5  
ATOM   9078  C CD     . LYS A 1 25  ? 27.080 14.115  4.537   1.00 0.00 ? 238 LYS A CD     5  
ATOM   9079  C CE     . LYS A 1 25  ? 28.132 14.175  5.646   1.00 0.00 ? 238 LYS A CE     5  
ATOM   9080  N NZ     . LYS A 1 25  ? 28.483 12.812  6.102   1.00 0.00 ? 238 LYS A NZ     5  
ATOM   9081  H H      . LYS A 1 25  ? 23.751 14.031  3.462   1.00 0.00 ? 238 LYS A H      5  
ATOM   9082  H HA     . LYS A 1 25  ? 24.142 16.811  3.973   1.00 0.00 ? 238 LYS A HA     5  
ATOM   9083  H HB2    . LYS A 1 25  ? 25.722 14.684  2.522   1.00 0.00 ? 238 LYS A HB2    5  
ATOM   9084  H HB3    . LYS A 1 25  ? 26.225 16.361  2.541   1.00 0.00 ? 238 LYS A HB3    5  
ATOM   9085  H HG2    . LYS A 1 25  ? 26.915 16.258  4.717   1.00 0.00 ? 238 LYS A HG2    5  
ATOM   9086  H HG3    . LYS A 1 25  ? 25.482 15.388  5.228   1.00 0.00 ? 238 LYS A HG3    5  
ATOM   9087  H HD2    . LYS A 1 25  ? 26.411 13.272  4.710   1.00 0.00 ? 238 LYS A HD2    5  
ATOM   9088  H HD3    . LYS A 1 25  ? 27.568 13.942  3.578   1.00 0.00 ? 238 LYS A HD3    5  
ATOM   9089  H HE2    . LYS A 1 25  ? 29.025 14.684  5.282   1.00 0.00 ? 238 LYS A HE2    5  
ATOM   9090  H HE3    . LYS A 1 25  ? 27.752 14.759  6.484   1.00 0.00 ? 238 LYS A HE3    5  
ATOM   9091  H HZ1    . LYS A 1 25  ? 27.651 12.323  6.364   1.00 0.00 ? 238 LYS A HZ1    5  
ATOM   9092  H HZ2    . LYS A 1 25  ? 28.940 12.320  5.360   1.00 0.00 ? 238 LYS A HZ2    5  
ATOM   9093  H HZ3    . LYS A 1 25  ? 29.097 12.871  6.889   1.00 0.00 ? 238 LYS A HZ3    5  
ATOM   9094  N N      . LEU A 1 26  ? 22.575 16.005  1.412   1.00 0.00 ? 239 LEU A N      5  
ATOM   9095  C CA     . LEU A 1 26  ? 21.936 16.452  0.186   1.00 0.00 ? 239 LEU A CA     5  
ATOM   9096  C C      . LEU A 1 26  ? 20.752 17.356  0.533   1.00 0.00 ? 239 LEU A C      5  
ATOM   9097  O O      . LEU A 1 26  ? 20.086 17.151  1.547   1.00 0.00 ? 239 LEU A O      5  
ATOM   9098  C CB     . LEU A 1 26  ? 21.560 15.256  -0.690  1.00 0.00 ? 239 LEU A CB     5  
ATOM   9099  C CG     . LEU A 1 26  ? 22.728 14.479  -1.301  1.00 0.00 ? 239 LEU A CG     5  
ATOM   9100  C CD1    . LEU A 1 26  ? 22.274 13.102  -1.789  1.00 0.00 ? 239 LEU A CD1    5  
ATOM   9101  C CD2    . LEU A 1 26  ? 23.403 15.287  -2.412  1.00 0.00 ? 239 LEU A CD2    5  
ATOM   9102  H H      . LEU A 1 26  ? 22.156 15.203  1.838   1.00 0.00 ? 239 LEU A H      5  
ATOM   9103  H HA     . LEU A 1 26  ? 22.668 17.040  -0.368  1.00 0.00 ? 239 LEU A HA     5  
ATOM   9104  H HB2    . LEU A 1 26  ? 20.964 14.566  -0.093  1.00 0.00 ? 239 LEU A HB2    5  
ATOM   9105  H HB3    . LEU A 1 26  ? 20.922 15.610  -1.501  1.00 0.00 ? 239 LEU A HB3    5  
ATOM   9106  H HG     . LEU A 1 26  ? 23.473 14.315  -0.524  1.00 0.00 ? 239 LEU A HG     5  
ATOM   9107  H HD11   . LEU A 1 26  ? 23.003 12.349  -1.485  1.00 0.00 ? 239 LEU A HD11   5  
ATOM   9108  H HD12   . LEU A 1 26  ? 21.304 12.863  -1.355  1.00 0.00 ? 239 LEU A HD12   5  
ATOM   9109  H HD13   . LEU A 1 26  ? 22.194 13.109  -2.876  1.00 0.00 ? 239 LEU A HD13   5  
ATOM   9110  H HD21   . LEU A 1 26  ? 23.121 14.877  -3.381  1.00 0.00 ? 239 LEU A HD21   5  
ATOM   9111  H HD22   . LEU A 1 26  ? 23.084 16.327  -2.349  1.00 0.00 ? 239 LEU A HD22   5  
ATOM   9112  H HD23   . LEU A 1 26  ? 24.486 15.230  -2.294  1.00 0.00 ? 239 LEU A HD23   5  
ATOM   9113  N N      . GLY A 1 27  ? 20.526 18.338  -0.327  1.00 0.00 ? 240 GLY A N      5  
ATOM   9114  C CA     . GLY A 1 27  ? 19.433 19.274  -0.124  1.00 0.00 ? 240 GLY A CA     5  
ATOM   9115  C C      . GLY A 1 27  ? 18.123 18.535  0.152   1.00 0.00 ? 240 GLY A C      5  
ATOM   9116  O O      . GLY A 1 27  ? 18.101 17.308  0.227   1.00 0.00 ? 240 GLY A O      5  
ATOM   9117  H H      . GLY A 1 27  ? 21.072 18.499  -1.149  1.00 0.00 ? 240 GLY A H      5  
ATOM   9118  H HA2    . GLY A 1 27  ? 19.666 19.934  0.712   1.00 0.00 ? 240 GLY A HA2    5  
ATOM   9119  H HA3    . GLY A 1 27  ? 19.320 19.904  -1.006  1.00 0.00 ? 240 GLY A HA3    5  
ATOM   9120  N N      . PRO A 1 28  ? 17.032 19.335  0.302   1.00 0.00 ? 241 PRO A N      5  
ATOM   9121  C CA     . PRO A 1 28  ? 15.721 18.769  0.568   1.00 0.00 ? 241 PRO A CA     5  
ATOM   9122  C C      . PRO A 1 28  ? 15.128 18.138  -0.693  1.00 0.00 ? 241 PRO A C      5  
ATOM   9123  O O      . PRO A 1 28  ? 14.548 17.055  -0.636  1.00 0.00 ? 241 PRO A O      5  
ATOM   9124  C CB     . PRO A 1 28  ? 14.892 19.930  1.097   1.00 0.00 ? 241 PRO A CB     5  
ATOM   9125  C CG     . PRO A 1 28  ? 15.624 21.192  0.670   1.00 0.00 ? 241 PRO A CG     5  
ATOM   9126  C CD     . PRO A 1 28  ? 17.019 20.792  0.219   1.00 0.00 ? 241 PRO A CD     5  
ATOM   9127  H HA     . PRO A 1 28  ? 15.790 18.029  1.237   1.00 0.00 ? 241 PRO A HA     5  
ATOM   9128  H HB2    . PRO A 1 28  ? 13.882 19.907  0.687   1.00 0.00 ? 241 PRO A HB2    5  
ATOM   9129  H HB3    . PRO A 1 28  ? 14.797 19.880  2.181   1.00 0.00 ? 241 PRO A HB3    5  
ATOM   9130  H HG2    . PRO A 1 28  ? 15.089 21.688  -0.139  1.00 0.00 ? 241 PRO A HG2    5  
ATOM   9131  H HG3    . PRO A 1 28  ? 15.678 21.900  1.497   1.00 0.00 ? 241 PRO A HG3    5  
ATOM   9132  H HD2    . PRO A 1 28  ? 17.220 21.133  -0.797  1.00 0.00 ? 241 PRO A HD2    5  
ATOM   9133  H HD3    . PRO A 1 28  ? 17.784 21.231  0.860   1.00 0.00 ? 241 PRO A HD3    5  
ATOM   9134  N N      . ALA A 1 29  ? 15.296 18.841  -1.804  1.00 0.00 ? 242 ALA A N      5  
ATOM   9135  C CA     . ALA A 1 29  ? 14.786 18.363  -3.077  1.00 0.00 ? 242 ALA A CA     5  
ATOM   9136  C C      . ALA A 1 29  ? 15.734 17.299  -3.635  1.00 0.00 ? 242 ALA A C      5  
ATOM   9137  O O      . ALA A 1 29  ? 15.323 16.447  -4.421  1.00 0.00 ? 242 ALA A O      5  
ATOM   9138  C CB     . ALA A 1 29  ? 14.608 19.544  -4.033  1.00 0.00 ? 242 ALA A CB     5  
ATOM   9139  H H      . ALA A 1 29  ? 15.770 19.721  -1.841  1.00 0.00 ? 242 ALA A H      5  
ATOM   9140  H HA     . ALA A 1 29  ? 13.811 17.909  -2.894  1.00 0.00 ? 242 ALA A HA     5  
ATOM   9141  H HB1    . ALA A 1 29  ? 15.033 19.293  -5.004  1.00 0.00 ? 242 ALA A HB1    5  
ATOM   9142  H HB2    . ALA A 1 29  ? 13.546 19.764  -4.145  1.00 0.00 ? 242 ALA A HB2    5  
ATOM   9143  H HB3    . ALA A 1 29  ? 15.118 20.419  -3.628  1.00 0.00 ? 242 ALA A HB3    5  
ATOM   9144  N N      . VAL A 1 30  ? 16.985 17.385  -3.206  1.00 0.00 ? 243 VAL A N      5  
ATOM   9145  C CA     . VAL A 1 30  ? 17.995 16.441  -3.653  1.00 0.00 ? 243 VAL A CA     5  
ATOM   9146  C C      . VAL A 1 30  ? 17.818 15.119  -2.904  1.00 0.00 ? 243 VAL A C      5  
ATOM   9147  O O      . VAL A 1 30  ? 17.874 14.048  -3.507  1.00 0.00 ? 243 VAL A O      5  
ATOM   9148  C CB     . VAL A 1 30  ? 19.390 17.045  -3.479  1.00 0.00 ? 243 VAL A CB     5  
ATOM   9149  C CG1    . VAL A 1 30  ? 20.466 16.107  -4.028  1.00 0.00 ? 243 VAL A CG1    5  
ATOM   9150  C CG2    . VAL A 1 30  ? 19.476 18.424  -4.135  1.00 0.00 ? 243 VAL A CG2    5  
ATOM   9151  H H      . VAL A 1 30  ? 17.311 18.082  -2.567  1.00 0.00 ? 243 VAL A H      5  
ATOM   9152  H HA     . VAL A 1 30  ? 17.834 16.266  -4.717  1.00 0.00 ? 243 VAL A HA     5  
ATOM   9153  H HB     . VAL A 1 30  ? 19.569 17.171  -2.410  1.00 0.00 ? 243 VAL A HB     5  
ATOM   9154  H HG11   . VAL A 1 30  ? 21.451 16.479  -3.745  1.00 0.00 ? 243 VAL A HG11   5  
ATOM   9155  H HG12   . VAL A 1 30  ? 20.324 15.108  -3.616  1.00 0.00 ? 243 VAL A HG12   5  
ATOM   9156  H HG13   . VAL A 1 30  ? 20.392 16.066  -5.114  1.00 0.00 ? 243 VAL A HG13   5  
ATOM   9157  H HG21   . VAL A 1 30  ? 20.242 18.410  -4.910  1.00 0.00 ? 243 VAL A HG21   5  
ATOM   9158  H HG22   . VAL A 1 30  ? 18.514 18.675  -4.581  1.00 0.00 ? 243 VAL A HG22   5  
ATOM   9159  H HG23   . VAL A 1 30  ? 19.733 19.170  -3.383  1.00 0.00 ? 243 VAL A HG23   5  
ATOM   9160  N N      . LEU A 1 31  ? 17.608 15.236  -1.601  1.00 0.00 ? 244 LEU A N      5  
ATOM   9161  C CA     . LEU A 1 31  ? 17.422 14.064  -0.764  1.00 0.00 ? 244 LEU A CA     5  
ATOM   9162  C C      . LEU A 1 31  ? 16.151 13.330  -1.195  1.00 0.00 ? 244 LEU A C      5  
ATOM   9163  O O      . LEU A 1 31  ? 16.100 12.101  -1.169  1.00 0.00 ? 244 LEU A O      5  
ATOM   9164  C CB     . LEU A 1 31  ? 17.435 14.455  0.715   1.00 0.00 ? 244 LEU A CB     5  
ATOM   9165  C CG     . LEU A 1 31  ? 16.564 13.603  1.641   1.00 0.00 ? 244 LEU A CG     5  
ATOM   9166  C CD1    . LEU A 1 31  ? 17.064 12.158  1.688   1.00 0.00 ? 244 LEU A CD1    5  
ATOM   9167  C CD2    . LEU A 1 31  ? 16.476 14.225  3.036   1.00 0.00 ? 244 LEU A CD2    5  
ATOM   9168  H H      . LEU A 1 31  ? 17.563 16.112  -1.119  1.00 0.00 ? 244 LEU A H      5  
ATOM   9169  H HA     . LEU A 1 31  ? 18.275 13.405  -0.930  1.00 0.00 ? 244 LEU A HA     5  
ATOM   9170  H HB2    . LEU A 1 31  ? 18.463 14.410  1.074   1.00 0.00 ? 244 LEU A HB2    5  
ATOM   9171  H HB3    . LEU A 1 31  ? 17.113 15.492  0.799   1.00 0.00 ? 244 LEU A HB3    5  
ATOM   9172  H HG     . LEU A 1 31  ? 15.553 13.581  1.235   1.00 0.00 ? 244 LEU A HG     5  
ATOM   9173  H HD11   . LEU A 1 31  ? 17.551 11.911  0.744   1.00 0.00 ? 244 LEU A HD11   5  
ATOM   9174  H HD12   . LEU A 1 31  ? 17.776 12.046  2.506   1.00 0.00 ? 244 LEU A HD12   5  
ATOM   9175  H HD13   . LEU A 1 31  ? 16.220 11.486  1.848   1.00 0.00 ? 244 LEU A HD13   5  
ATOM   9176  H HD21   . LEU A 1 31  ? 16.236 13.450  3.765   1.00 0.00 ? 244 LEU A HD21   5  
ATOM   9177  H HD22   . LEU A 1 31  ? 17.433 14.680  3.293   1.00 0.00 ? 244 LEU A HD22   5  
ATOM   9178  H HD23   . LEU A 1 31  ? 15.697 14.986  3.047   1.00 0.00 ? 244 LEU A HD23   5  
ATOM   9179  N N      . VAL A 1 32  ? 15.156 14.115  -1.584  1.00 0.00 ? 245 VAL A N      5  
ATOM   9180  C CA     . VAL A 1 32  ? 13.889 13.555  -2.020  1.00 0.00 ? 245 VAL A CA     5  
ATOM   9181  C C      . VAL A 1 32  ? 14.067 12.914  -3.398  1.00 0.00 ? 245 VAL A C      5  
ATOM   9182  O O      . VAL A 1 32  ? 13.427 11.910  -3.707  1.00 0.00 ? 245 VAL A O      5  
ATOM   9183  C CB     . VAL A 1 32  ? 12.804 14.635  -1.999  1.00 0.00 ? 245 VAL A CB     5  
ATOM   9184  C CG1    . VAL A 1 32  ? 11.620 14.240  -2.884  1.00 0.00 ? 245 VAL A CG1    5  
ATOM   9185  C CG2    . VAL A 1 32  ? 12.348 14.924  -0.568  1.00 0.00 ? 245 VAL A CG2    5  
ATOM   9186  H H      . VAL A 1 32  ? 15.207 15.113  -1.603  1.00 0.00 ? 245 VAL A H      5  
ATOM   9187  H HA     . VAL A 1 32  ? 13.608 12.781  -1.307  1.00 0.00 ? 245 VAL A HA     5  
ATOM   9188  H HB     . VAL A 1 32  ? 13.235 15.550  -2.405  1.00 0.00 ? 245 VAL A HB     5  
ATOM   9189  H HG11   . VAL A 1 32  ? 10.767 14.879  -2.655  1.00 0.00 ? 245 VAL A HG11   5  
ATOM   9190  H HG12   . VAL A 1 32  ? 11.894 14.362  -3.932  1.00 0.00 ? 245 VAL A HG12   5  
ATOM   9191  H HG13   . VAL A 1 32  ? 11.356 13.200  -2.696  1.00 0.00 ? 245 VAL A HG13   5  
ATOM   9192  H HG21   . VAL A 1 32  ? 13.182 14.778  0.117   1.00 0.00 ? 245 VAL A HG21   5  
ATOM   9193  H HG22   . VAL A 1 32  ? 11.997 15.954  -0.500  1.00 0.00 ? 245 VAL A HG22   5  
ATOM   9194  H HG23   . VAL A 1 32  ? 11.536 14.246  -0.302  1.00 0.00 ? 245 VAL A HG23   5  
ATOM   9195  N N      . GLU A 1 33  ? 14.939 13.521  -4.189  1.00 0.00 ? 246 GLU A N      5  
ATOM   9196  C CA     . GLU A 1 33  ? 15.210 13.022  -5.527  1.00 0.00 ? 246 GLU A CA     5  
ATOM   9197  C C      . GLU A 1 33  ? 16.146 11.814  -5.463  1.00 0.00 ? 246 GLU A C      5  
ATOM   9198  O O      . GLU A 1 33  ? 16.105 10.946  -6.334  1.00 0.00 ? 246 GLU A O      5  
ATOM   9199  C CB     . GLU A 1 33  ? 15.793 14.123  -6.416  1.00 0.00 ? 246 GLU A CB     5  
ATOM   9200  C CG     . GLU A 1 33  ? 14.699 15.081  -6.891  1.00 0.00 ? 246 GLU A CG     5  
ATOM   9201  C CD     . GLU A 1 33  ? 14.314 14.796  -8.344  1.00 0.00 ? 246 GLU A CD     5  
ATOM   9202  O OE1    . GLU A 1 33  ? 15.151 14.322  -9.125  1.00 0.00 ? 246 GLU A OE1    5  
ATOM   9203  O OE2    . GLU A 1 33  ? 13.094 15.082  -8.651  1.00 0.00 ? 246 GLU A OE2    5  
ATOM   9204  H H      . GLU A 1 33  ? 15.455 14.338  -3.930  1.00 0.00 ? 246 GLU A H      5  
ATOM   9205  H HA     . GLU A 1 33  ? 14.240 12.718  -5.924  1.00 0.00 ? 246 GLU A HA     5  
ATOM   9206  H HB2    . GLU A 1 33  ? 16.551 14.677  -5.864  1.00 0.00 ? 246 GLU A HB2    5  
ATOM   9207  H HB3    . GLU A 1 33  ? 16.289 13.675  -7.277  1.00 0.00 ? 246 GLU A HB3    5  
ATOM   9208  H HG2    . GLU A 1 33  ? 13.821 14.982  -6.252  1.00 0.00 ? 246 GLU A HG2    5  
ATOM   9209  H HG3    . GLU A 1 33  ? 15.047 16.110  -6.799  1.00 0.00 ? 246 GLU A HG3    5  
ATOM   9210  H HE2    . GLU A 1 33  ? 13.019 15.251  -9.634  1.00 0.00 ? 246 GLU A HE2    5  
ATOM   9211  N N      . ILE A 1 34  ? 16.970 11.798  -4.426  1.00 0.00 ? 247 ILE A N      5  
ATOM   9212  C CA     . ILE A 1 34  ? 17.916 10.712  -4.238  1.00 0.00 ? 247 ILE A CA     5  
ATOM   9213  C C      . ILE A 1 34  ? 17.184 9.498   -3.662  1.00 0.00 ? 247 ILE A C      5  
ATOM   9214  O O      . ILE A 1 34  ? 17.555 8.357   -3.935  1.00 0.00 ? 247 ILE A O      5  
ATOM   9215  C CB     . ILE A 1 34  ? 19.101 11.174  -3.388  1.00 0.00 ? 247 ILE A CB     5  
ATOM   9216  C CG1    . ILE A 1 34  ? 20.429 10.757  -4.026  1.00 0.00 ? 247 ILE A CG1    5  
ATOM   9217  C CG2    . ILE A 1 34  ? 18.974 10.672  -1.948  1.00 0.00 ? 247 ILE A CG2    5  
ATOM   9218  C CD1    . ILE A 1 34  ? 20.726 11.594  -5.272  1.00 0.00 ? 247 ILE A CD1    5  
ATOM   9219  H H      . ILE A 1 34  ? 16.998 12.509  -3.723  1.00 0.00 ? 247 ILE A H      5  
ATOM   9220  H HA     . ILE A 1 34  ? 18.308 10.445  -5.220  1.00 0.00 ? 247 ILE A HA     5  
ATOM   9221  H HB     . ILE A 1 34  ? 19.090 12.264  -3.352  1.00 0.00 ? 247 ILE A HB     5  
ATOM   9222  H HG12   . ILE A 1 34  ? 21.235 10.874  -3.303  1.00 0.00 ? 247 ILE A HG12   5  
ATOM   9223  H HG13   . ILE A 1 34  ? 20.391 9.701   -4.294  1.00 0.00 ? 247 ILE A HG13   5  
ATOM   9224  H HG21   . ILE A 1 34  ? 19.705 11.182  -1.320  1.00 0.00 ? 247 ILE A HG21   5  
ATOM   9225  H HG22   . ILE A 1 34  ? 17.970 10.879  -1.579  1.00 0.00 ? 247 ILE A HG22   5  
ATOM   9226  H HG23   . ILE A 1 34  ? 19.157 9.598   -1.921  1.00 0.00 ? 247 ILE A HG23   5  
ATOM   9227  H HD11   . ILE A 1 34  ? 21.680 11.285  -5.698  1.00 0.00 ? 247 ILE A HD11   5  
ATOM   9228  H HD12   . ILE A 1 34  ? 19.935 11.447  -6.005  1.00 0.00 ? 247 ILE A HD12   5  
ATOM   9229  H HD13   . ILE A 1 34  ? 20.775 12.648  -4.997  1.00 0.00 ? 247 ILE A HD13   5  
ATOM   9230  N N      . VAL A 1 35  ? 16.157 9.785   -2.876  1.00 0.00 ? 248 VAL A N      5  
ATOM   9231  C CA     . VAL A 1 35  ? 15.369 8.731   -2.259  1.00 0.00 ? 248 VAL A CA     5  
ATOM   9232  C C      . VAL A 1 35  ? 14.484 8.073   -3.320  1.00 0.00 ? 248 VAL A C      5  
ATOM   9233  O O      . VAL A 1 35  ? 14.329 6.853   -3.335  1.00 0.00 ? 248 VAL A O      5  
ATOM   9234  C CB     . VAL A 1 35  ? 14.571 9.294   -1.081  1.00 0.00 ? 248 VAL A CB     5  
ATOM   9235  C CG1    . VAL A 1 35  ? 13.643 8.232   -0.489  1.00 0.00 ? 248 VAL A CG1    5  
ATOM   9236  C CG2    . VAL A 1 35  ? 15.504 9.866   -0.012  1.00 0.00 ? 248 VAL A CG2    5  
ATOM   9237  H H      . VAL A 1 35  ? 15.861 10.715  -2.658  1.00 0.00 ? 248 VAL A H      5  
ATOM   9238  H HA     . VAL A 1 35  ? 16.063 7.985   -1.870  1.00 0.00 ? 248 VAL A HA     5  
ATOM   9239  H HB     . VAL A 1 35  ? 13.952 10.109  -1.456  1.00 0.00 ? 248 VAL A HB     5  
ATOM   9240  H HG11   . VAL A 1 35  ? 14.232 7.371   -0.171  1.00 0.00 ? 248 VAL A HG11   5  
ATOM   9241  H HG12   . VAL A 1 35  ? 13.115 8.648   0.369   1.00 0.00 ? 248 VAL A HG12   5  
ATOM   9242  H HG13   . VAL A 1 35  ? 12.921 7.919   -1.244  1.00 0.00 ? 248 VAL A HG13   5  
ATOM   9243  H HG21   . VAL A 1 35  ? 15.548 9.181   0.836   1.00 0.00 ? 248 VAL A HG21   5  
ATOM   9244  H HG22   . VAL A 1 35  ? 16.502 9.992   -0.429  1.00 0.00 ? 248 VAL A HG22   5  
ATOM   9245  H HG23   . VAL A 1 35  ? 15.124 10.832  0.323   1.00 0.00 ? 248 VAL A HG23   5  
ATOM   9246  N N      . ARG A 1 36  ? 13.928 8.912   -4.182  1.00 0.00 ? 249 ARG A N      5  
ATOM   9247  C CA     . ARG A 1 36  ? 13.063 8.427   -5.245  1.00 0.00 ? 249 ARG A CA     5  
ATOM   9248  C C      . ARG A 1 36  ? 13.897 7.826   -6.376  1.00 0.00 ? 249 ARG A C      5  
ATOM   9249  O O      . ARG A 1 36  ? 13.357 7.199   -7.286  1.00 0.00 ? 249 ARG A O      5  
ATOM   9250  C CB     . ARG A 1 36  ? 12.193 9.555   -5.804  1.00 0.00 ? 249 ARG A CB     5  
ATOM   9251  C CG     . ARG A 1 36  ? 11.044 9.887   -4.850  1.00 0.00 ? 249 ARG A CG     5  
ATOM   9252  C CD     . ARG A 1 36  ? 10.158 10.995  -5.424  1.00 0.00 ? 249 ARG A CD     5  
ATOM   9253  N NE     . ARG A 1 36  ? 8.773  10.842  -4.928  1.00 0.00 ? 249 ARG A NE     5  
ATOM   9254  C CZ     . ARG A 1 36  ? 7.859  11.822  -4.939  1.00 0.00 ? 249 ARG A CZ     5  
ATOM   9255  N NH1    . ARG A 1 36  ? 8.179  13.031  -5.419  1.00 0.00 ? 249 ARG A NH1    5  
ATOM   9256  N NH2    . ARG A 1 36  ? 6.625  11.594  -4.469  1.00 0.00 ? 249 ARG A NH2    5  
ATOM   9257  H H      . ARG A 1 36  ? 14.059 9.903   -4.163  1.00 0.00 ? 249 ARG A H      5  
ATOM   9258  H HA     . ARG A 1 36  ? 12.438 7.669   -4.772  1.00 0.00 ? 249 ARG A HA     5  
ATOM   9259  H HB2    . ARG A 1 36  ? 12.805 10.443  -5.966  1.00 0.00 ? 249 ARG A HB2    5  
ATOM   9260  H HB3    . ARG A 1 36  ? 11.792 9.263   -6.774  1.00 0.00 ? 249 ARG A HB3    5  
ATOM   9261  H HG2    . ARG A 1 36  ? 10.445 8.994   -4.672  1.00 0.00 ? 249 ARG A HG2    5  
ATOM   9262  H HG3    . ARG A 1 36  ? 11.446 10.200  -3.886  1.00 0.00 ? 249 ARG A HG3    5  
ATOM   9263  H HD2    . ARG A 1 36  ? 10.551 11.971  -5.137  1.00 0.00 ? 249 ARG A HD2    5  
ATOM   9264  H HD3    . ARG A 1 36  ? 10.171 10.955  -6.513  1.00 0.00 ? 249 ARG A HD3    5  
ATOM   9265  H HE     . ARG A 1 36  ? 8.501  9.952   -4.563  1.00 0.00 ? 249 ARG A HE     5  
ATOM   9266  H HH11   . ARG A 1 36  ? 9.099  13.202  -5.770  1.00 0.00 ? 249 ARG A HH11   5  
ATOM   9267  H HH12   . ARG A 1 36  ? 7.497  13.763  -5.427  1.00 0.00 ? 249 ARG A HH12   5  
ATOM   9268  H HH21   . ARG A 1 36  ? 6.386  10.690  -4.110  1.00 0.00 ? 249 ARG A HH21   5  
ATOM   9269  H HH22   . ARG A 1 36  ? 5.943  12.325  -4.476  1.00 0.00 ? 249 ARG A HH22   5  
ATOM   9270  N N      . ALA A 1 37  ? 15.202 8.039   -6.284  1.00 0.00 ? 250 ALA A N      5  
ATOM   9271  C CA     . ALA A 1 37  ? 16.117 7.526   -7.289  1.00 0.00 ? 250 ALA A CA     5  
ATOM   9272  C C      . ALA A 1 37  ? 16.686 6.186   -6.819  1.00 0.00 ? 250 ALA A C      5  
ATOM   9273  O O      . ALA A 1 37  ? 16.878 5.273   -7.620  1.00 0.00 ? 250 ALA A O      5  
ATOM   9274  C CB     . ALA A 1 37  ? 17.212 8.561   -7.560  1.00 0.00 ? 250 ALA A CB     5  
ATOM   9275  H H      . ALA A 1 37  ? 15.634 8.550   -5.541  1.00 0.00 ? 250 ALA A H      5  
ATOM   9276  H HA     . ALA A 1 37  ? 15.549 7.368   -8.206  1.00 0.00 ? 250 ALA A HA     5  
ATOM   9277  H HB1    . ALA A 1 37  ? 16.843 9.302   -8.270  1.00 0.00 ? 250 ALA A HB1    5  
ATOM   9278  H HB2    . ALA A 1 37  ? 17.483 9.056   -6.627  1.00 0.00 ? 250 ALA A HB2    5  
ATOM   9279  H HB3    . ALA A 1 37  ? 18.087 8.064   -7.976  1.00 0.00 ? 250 ALA A HB3    5  
ATOM   9280  N N      . LEU A 1 38  ? 16.940 6.110   -5.520  1.00 0.00 ? 251 LEU A N      5  
ATOM   9281  C CA     . LEU A 1 38  ? 17.483 4.897   -4.933  1.00 0.00 ? 251 LEU A CA     5  
ATOM   9282  C C      . LEU A 1 38  ? 16.356 3.878   -4.746  1.00 0.00 ? 251 LEU A C      5  
ATOM   9283  O O      . LEU A 1 38  ? 15.195 4.252   -4.594  1.00 0.00 ? 251 LEU A O      5  
ATOM   9284  C CB     . LEU A 1 38  ? 18.241 5.219   -3.644  1.00 0.00 ? 251 LEU A CB     5  
ATOM   9285  C CG     . LEU A 1 38  ? 17.398 5.755   -2.485  1.00 0.00 ? 251 LEU A CG     5  
ATOM   9286  C CD1    . LEU A 1 38  ? 16.723 4.612   -1.724  1.00 0.00 ? 251 LEU A CD1    5  
ATOM   9287  C CD2    . LEU A 1 38  ? 18.235 6.642   -1.561  1.00 0.00 ? 251 LEU A CD2    5  
ATOM   9288  H H      . LEU A 1 38  ? 16.780 6.857   -4.875  1.00 0.00 ? 251 LEU A H      5  
ATOM   9289  H HA     . LEU A 1 38  ? 18.206 4.488   -5.639  1.00 0.00 ? 251 LEU A HA     5  
ATOM   9290  H HB2    . LEU A 1 38  ? 18.750 4.315   -3.310  1.00 0.00 ? 251 LEU A HB2    5  
ATOM   9291  H HB3    . LEU A 1 38  ? 19.015 5.952   -3.874  1.00 0.00 ? 251 LEU A HB3    5  
ATOM   9292  H HG     . LEU A 1 38  ? 16.605 6.379   -2.899  1.00 0.00 ? 251 LEU A HG     5  
ATOM   9293  H HD11   . LEU A 1 38  ? 16.962 3.663   -2.206  1.00 0.00 ? 251 LEU A HD11   5  
ATOM   9294  H HD12   . LEU A 1 38  ? 17.083 4.598   -0.695  1.00 0.00 ? 251 LEU A HD12   5  
ATOM   9295  H HD13   . LEU A 1 38  ? 15.643 4.759   -1.730  1.00 0.00 ? 251 LEU A HD13   5  
ATOM   9296  H HD21   . LEU A 1 38  ? 19.174 6.140   -1.328  1.00 0.00 ? 251 LEU A HD21   5  
ATOM   9297  H HD22   . LEU A 1 38  ? 18.444 7.590   -2.059  1.00 0.00 ? 251 LEU A HD22   5  
ATOM   9298  H HD23   . LEU A 1 38  ? 17.684 6.829   -0.640  1.00 0.00 ? 251 LEU A HD23   5  
ATOM   9299  N N      . ARG A 1 39  ? 16.741 2.610   -4.762  1.00 0.00 ? 252 ARG A N      5  
ATOM   9300  C CA     . ARG A 1 39  ? 15.778 1.535   -4.597  1.00 0.00 ? 252 ARG A CA     5  
ATOM   9301  C C      . ARG A 1 39  ? 16.293 0.513   -3.581  1.00 0.00 ? 252 ARG A C      5  
ATOM   9302  O O      . ARG A 1 39  ? 17.393 -0.016  -3.730  1.00 0.00 ? 252 ARG A O      5  
ATOM   9303  C CB     . ARG A 1 39  ? 15.507 0.828   -5.926  1.00 0.00 ? 252 ARG A CB     5  
ATOM   9304  C CG     . ARG A 1 39  ? 14.019 0.879   -6.280  1.00 0.00 ? 252 ARG A CG     5  
ATOM   9305  C CD     . ARG A 1 39  ? 13.387 -0.511  -6.195  1.00 0.00 ? 252 ARG A CD     5  
ATOM   9306  N NE     . ARG A 1 39  ? 12.827 -0.894  -7.510  1.00 0.00 ? 252 ARG A NE     5  
ATOM   9307  C CZ     . ARG A 1 39  ? 12.049 -1.967  -7.711  1.00 0.00 ? 252 ARG A CZ     5  
ATOM   9308  N NH1    . ARG A 1 39  ? 11.734 -2.769  -6.685  1.00 0.00 ? 252 ARG A NH1    5  
ATOM   9309  N NH2    . ARG A 1 39  ? 11.586 -2.238  -8.939  1.00 0.00 ? 252 ARG A NH2    5  
ATOM   9310  H H      . ARG A 1 39  ? 17.688 2.315   -4.886  1.00 0.00 ? 252 ARG A H      5  
ATOM   9311  H HA     . ARG A 1 39  ? 14.873 2.023   -4.237  1.00 0.00 ? 252 ARG A HA     5  
ATOM   9312  H HB2    . ARG A 1 39  ? 16.089 1.300   -6.718  1.00 0.00 ? 252 ARG A HB2    5  
ATOM   9313  H HB3    . ARG A 1 39  ? 15.834 -0.209  -5.864  1.00 0.00 ? 252 ARG A HB3    5  
ATOM   9314  H HG2    . ARG A 1 39  ? 13.503 1.559   -5.602  1.00 0.00 ? 252 ARG A HG2    5  
ATOM   9315  H HG3    . ARG A 1 39  ? 13.895 1.278   -7.287  1.00 0.00 ? 252 ARG A HG3    5  
ATOM   9316  H HD2    . ARG A 1 39  ? 14.135 -1.241  -5.882  1.00 0.00 ? 252 ARG A HD2    5  
ATOM   9317  H HD3    . ARG A 1 39  ? 12.601 -0.517  -5.440  1.00 0.00 ? 252 ARG A HD3    5  
ATOM   9318  H HE     . ARG A 1 39  ? 13.043 -0.318  -8.298  1.00 0.00 ? 252 ARG A HE     5  
ATOM   9319  H HH11   . ARG A 1 39  ? 12.079 -2.567  -5.769  1.00 0.00 ? 252 ARG A HH11   5  
ATOM   9320  H HH12   . ARG A 1 39  ? 11.152 -3.569  -6.835  1.00 0.00 ? 252 ARG A HH12   5  
ATOM   9321  H HH21   . ARG A 1 39  ? 11.821 -1.640  -9.706  1.00 0.00 ? 252 ARG A HH21   5  
ATOM   9322  H HH22   . ARG A 1 39  ? 11.005 -3.038  -9.090  1.00 0.00 ? 252 ARG A HH22   5  
ATOM   9323  N N      . ALA A 1 40  ? 15.474 0.268   -2.568  1.00 0.00 ? 253 ALA A N      5  
ATOM   9324  C CA     . ALA A 1 40  ? 15.833 -0.680  -1.528  1.00 0.00 ? 253 ALA A CA     5  
ATOM   9325  C C      . ALA A 1 40  ? 15.536 -2.101  -2.013  1.00 0.00 ? 253 ALA A C      5  
ATOM   9326  O O      . ALA A 1 40  ? 14.402 -2.413  -2.373  1.00 0.00 ? 253 ALA A O      5  
ATOM   9327  C CB     . ALA A 1 40  ? 15.080 -0.335  -0.241  1.00 0.00 ? 253 ALA A CB     5  
ATOM   9328  H H      . ALA A 1 40  ? 14.581 0.703   -2.454  1.00 0.00 ? 253 ALA A H      5  
ATOM   9329  H HA     . ALA A 1 40  ? 16.904 -0.583  -1.345  1.00 0.00 ? 253 ALA A HA     5  
ATOM   9330  H HB1    . ALA A 1 40  ? 15.534 -0.865  0.598   1.00 0.00 ? 253 ALA A HB1    5  
ATOM   9331  H HB2    . ALA A 1 40  ? 15.135 0.739   -0.065  1.00 0.00 ? 253 ALA A HB2    5  
ATOM   9332  H HB3    . ALA A 1 40  ? 14.037 -0.635  -0.339  1.00 0.00 ? 253 ALA A HB3    5  
ATOM   9333  N N      . ARG A 1 41  ? 16.575 -2.923  -2.009  1.00 0.00 ? 254 ARG A N      5  
ATOM   9334  C CA     . ARG A 1 41  ? 16.441 -4.302  -2.445  1.00 0.00 ? 254 ARG A CA     5  
ATOM   9335  C C      . ARG A 1 41  ? 17.244 -5.228  -1.529  1.00 0.00 ? 254 ARG A C      5  
ATOM   9336  O O      . ARG A 1 41  ? 18.365 -4.905  -1.143  1.00 0.00 ? 254 ARG A O      5  
ATOM   9337  C CB     . ARG A 1 41  ? 16.925 -4.474  -3.885  1.00 0.00 ? 254 ARG A CB     5  
ATOM   9338  C CG     . ARG A 1 41  ? 16.812 -5.933  -4.331  1.00 0.00 ? 254 ARG A CG     5  
ATOM   9339  C CD     . ARG A 1 41  ? 18.181 -6.499  -4.713  1.00 0.00 ? 254 ARG A CD     5  
ATOM   9340  N NE     . ARG A 1 41  ? 18.155 -6.990  -6.109  1.00 0.00 ? 254 ARG A NE     5  
ATOM   9341  C CZ     . ARG A 1 41  ? 19.242 -7.374  -6.791  1.00 0.00 ? 254 ARG A CZ     5  
ATOM   9342  N NH1    . ARG A 1 41  ? 20.448 -7.327  -6.210  1.00 0.00 ? 254 ARG A NH1    5  
ATOM   9343  N NH2    . ARG A 1 41  ? 19.123 -7.807  -8.053  1.00 0.00 ? 254 ARG A NH2    5  
ATOM   9344  H H      . ARG A 1 41  ? 17.495 -2.660  -1.715  1.00 0.00 ? 254 ARG A H      5  
ATOM   9345  H HA     . ARG A 1 41  ? 15.374 -4.513  -2.377  1.00 0.00 ? 254 ARG A HA     5  
ATOM   9346  H HB2    . ARG A 1 41  ? 16.337 -3.840  -4.550  1.00 0.00 ? 254 ARG A HB2    5  
ATOM   9347  H HB3    . ARG A 1 41  ? 17.961 -4.145  -3.967  1.00 0.00 ? 254 ARG A HB3    5  
ATOM   9348  H HG2    . ARG A 1 41  ? 16.379 -6.530  -3.529  1.00 0.00 ? 254 ARG A HG2    5  
ATOM   9349  H HG3    . ARG A 1 41  ? 16.134 -6.005  -5.182  1.00 0.00 ? 254 ARG A HG3    5  
ATOM   9350  H HD2    . ARG A 1 41  ? 18.945 -5.728  -4.605  1.00 0.00 ? 254 ARG A HD2    5  
ATOM   9351  H HD3    . ARG A 1 41  ? 18.450 -7.311  -4.038  1.00 0.00 ? 254 ARG A HD3    5  
ATOM   9352  H HE     . ARG A 1 41  ? 17.269 -7.038  -6.572  1.00 0.00 ? 254 ARG A HE     5  
ATOM   9353  H HH11   . ARG A 1 41  ? 20.537 -7.005  -5.267  1.00 0.00 ? 254 ARG A HH11   5  
ATOM   9354  H HH12   . ARG A 1 41  ? 21.260 -7.615  -6.719  1.00 0.00 ? 254 ARG A HH12   5  
ATOM   9355  H HH21   . ARG A 1 41  ? 18.223 -7.843  -8.487  1.00 0.00 ? 254 ARG A HH21   5  
ATOM   9356  H HH22   . ARG A 1 41  ? 19.935 -8.094  -8.562  1.00 0.00 ? 254 ARG A HH22   5  
ATOM   9357  N N      . THR A 1 42  ? 16.638 -6.363  -1.210  1.00 0.00 ? 255 THR A N      5  
ATOM   9358  C CA     . THR A 1 42  ? 17.282 -7.339  -0.348  1.00 0.00 ? 255 THR A CA     5  
ATOM   9359  C C      . THR A 1 42  ? 17.923 -8.447  -1.184  1.00 0.00 ? 255 THR A C      5  
ATOM   9360  O O      . THR A 1 42  ? 17.350 -8.891  -2.177  1.00 0.00 ? 255 THR A O      5  
ATOM   9361  C CB     . THR A 1 42  ? 16.240 -7.852  0.647   1.00 0.00 ? 255 THR A CB     5  
ATOM   9362  O OG1    . THR A 1 42  ? 15.982 -6.732  1.490   1.00 0.00 ? 255 THR A OG1    5  
ATOM   9363  C CG2    . THR A 1 42  ? 16.808 -8.910  1.597   1.00 0.00 ? 255 THR A CG2    5  
ATOM   9364  H H      . THR A 1 42  ? 15.725 -6.618  -1.529  1.00 0.00 ? 255 THR A H      5  
ATOM   9365  H HA     . THR A 1 42  ? 18.087 -6.841  0.193   1.00 0.00 ? 255 THR A HA     5  
ATOM   9366  H HB     . THR A 1 42  ? 15.358 -8.228  0.128   1.00 0.00 ? 255 THR A HB     5  
ATOM   9367  H HG1    . THR A 1 42  ? 15.033 -6.435  1.382   1.00 0.00 ? 255 THR A HG1    5  
ATOM   9368  H HG21   . THR A 1 42  ? 16.483 -9.898  1.275   1.00 0.00 ? 255 THR A HG21   5  
ATOM   9369  H HG22   . THR A 1 42  ? 17.896 -8.861  1.584   1.00 0.00 ? 255 THR A HG22   5  
ATOM   9370  H HG23   . THR A 1 42  ? 16.447 -8.719  2.609   1.00 0.00 ? 255 THR A HG23   5  
ATOM   9371  N N      . VAL A 1 43  ? 19.104 -8.865  -0.750  1.00 0.00 ? 256 VAL A N      5  
ATOM   9372  C CA     . VAL A 1 43  ? 19.828 -9.914  -1.446  1.00 0.00 ? 256 VAL A CA     5  
ATOM   9373  C C      . VAL A 1 43  ? 20.104 -11.066 -0.478  1.00 0.00 ? 256 VAL A C      5  
ATOM   9374  O O      . VAL A 1 43  ? 20.615 -10.851 0.619   1.00 0.00 ? 256 VAL A O      5  
ATOM   9375  C CB     . VAL A 1 43  ? 21.102 -9.343  -2.073  1.00 0.00 ? 256 VAL A CB     5  
ATOM   9376  C CG1    . VAL A 1 43  ? 20.877 -8.987  -3.544  1.00 0.00 ? 256 VAL A CG1    5  
ATOM   9377  C CG2    . VAL A 1 43  ? 21.605 -8.131  -1.287  1.00 0.00 ? 256 VAL A CG2    5  
ATOM   9378  H H      . VAL A 1 43  ? 19.563 -8.498  0.059   1.00 0.00 ? 256 VAL A H      5  
ATOM   9379  H HA     . VAL A 1 43  ? 19.190 -10.277 -2.251  1.00 0.00 ? 256 VAL A HA     5  
ATOM   9380  H HB     . VAL A 1 43  ? 21.872 -10.113 -2.029  1.00 0.00 ? 256 VAL A HB     5  
ATOM   9381  H HG11   . VAL A 1 43  ? 21.291 -7.999  -3.746  1.00 0.00 ? 256 VAL A HG11   5  
ATOM   9382  H HG12   . VAL A 1 43  ? 21.372 -9.725  -4.176  1.00 0.00 ? 256 VAL A HG12   5  
ATOM   9383  H HG13   . VAL A 1 43  ? 19.808 -8.984  -3.758  1.00 0.00 ? 256 VAL A HG13   5  
ATOM   9384  H HG21   . VAL A 1 43  ? 21.598 -8.362  -0.221  1.00 0.00 ? 256 VAL A HG21   5  
ATOM   9385  H HG22   . VAL A 1 43  ? 22.621 -7.890  -1.600  1.00 0.00 ? 256 VAL A HG22   5  
ATOM   9386  H HG23   . VAL A 1 43  ? 20.954 -7.278  -1.478  1.00 0.00 ? 256 VAL A HG23   5  
ATOM   9387  N N      . PRO A 1 44  ? 19.743 -12.297 -0.932  1.00 0.00 ? 257 PRO A N      5  
ATOM   9388  C CA     . PRO A 1 44  ? 19.945 -13.484 -0.118  1.00 0.00 ? 257 PRO A CA     5  
ATOM   9389  C C      . PRO A 1 44  ? 21.421 -13.887 -0.095  1.00 0.00 ? 257 PRO A C      5  
ATOM   9390  O O      . PRO A 1 44  ? 22.169 -13.571 -1.018  1.00 0.00 ? 257 PRO A O      5  
ATOM   9391  C CB     . PRO A 1 44  ? 19.050 -14.543 -0.739  1.00 0.00 ? 257 PRO A CB     5  
ATOM   9392  C CG     . PRO A 1 44  ? 18.736 -14.055 -2.143  1.00 0.00 ? 257 PRO A CG     5  
ATOM   9393  C CD     . PRO A 1 44  ? 19.136 -12.590 -2.226  1.00 0.00 ? 257 PRO A CD     5  
ATOM   9394  H HA     . PRO A 1 44  ? 19.698 -13.299 0.832   1.00 0.00 ? 257 PRO A HA     5  
ATOM   9395  H HB2    . PRO A 1 44  ? 19.550 -15.511 -0.765  1.00 0.00 ? 257 PRO A HB2    5  
ATOM   9396  H HB3    . PRO A 1 44  ? 18.137 -14.673 -0.157  1.00 0.00 ? 257 PRO A HB3    5  
ATOM   9397  H HG2    . PRO A 1 44  ? 19.282 -14.641 -2.882  1.00 0.00 ? 257 PRO A HG2    5  
ATOM   9398  H HG3    . PRO A 1 44  ? 17.675 -14.174 -2.361  1.00 0.00 ? 257 PRO A HG3    5  
ATOM   9399  H HD2    . PRO A 1 44  ? 19.837 -12.416 -3.042  1.00 0.00 ? 257 PRO A HD2    5  
ATOM   9400  H HD3    . PRO A 1 44  ? 18.270 -11.954 -2.410  1.00 0.00 ? 257 PRO A HD3    5  
ATOM   9401  N N      . ALA A 1 45  ? 21.796 -14.578 0.972   1.00 0.00 ? 258 ALA A N      5  
ATOM   9402  C CA     . ALA A 1 45  ? 23.169 -15.028 1.128   1.00 0.00 ? 258 ALA A CA     5  
ATOM   9403  C C      . ALA A 1 45  ? 23.567 -15.866 -0.088  1.00 0.00 ? 258 ALA A C      5  
ATOM   9404  O O      . ALA A 1 45  ? 22.777 -16.670 -0.578  1.00 0.00 ? 258 ALA A O      5  
ATOM   9405  C CB     . ALA A 1 45  ? 23.306 -15.802 2.441   1.00 0.00 ? 258 ALA A CB     5  
ATOM   9406  H H      . ALA A 1 45  ? 21.181 -14.831 1.719   1.00 0.00 ? 258 ALA A H      5  
ATOM   9407  H HA     . ALA A 1 45  ? 23.804 -14.143 1.174   1.00 0.00 ? 258 ALA A HA     5  
ATOM   9408  H HB1    . ALA A 1 45  ? 22.475 -15.550 3.100   1.00 0.00 ? 258 ALA A HB1    5  
ATOM   9409  H HB2    . ALA A 1 45  ? 23.295 -16.872 2.234   1.00 0.00 ? 258 ALA A HB2    5  
ATOM   9410  H HB3    . ALA A 1 45  ? 24.246 -15.535 2.923   1.00 0.00 ? 258 ALA A HB3    5  
ATOM   9411  N N      . GLY A 1 46  ? 24.794 -15.650 -0.539  1.00 0.00 ? 259 GLY A N      5  
ATOM   9412  C CA     . GLY A 1 46  ? 25.308 -16.376 -1.689  1.00 0.00 ? 259 GLY A CA     5  
ATOM   9413  C C      . GLY A 1 46  ? 25.126 -15.567 -2.974  1.00 0.00 ? 259 GLY A C      5  
ATOM   9414  O O      . GLY A 1 46  ? 25.619 -15.956 -4.032  1.00 0.00 ? 259 GLY A O      5  
ATOM   9415  H H      . GLY A 1 46  ? 25.431 -14.994 -0.135  1.00 0.00 ? 259 GLY A H      5  
ATOM   9416  H HA2    . GLY A 1 46  ? 26.364 -16.598 -1.540  1.00 0.00 ? 259 GLY A HA2    5  
ATOM   9417  H HA3    . GLY A 1 46  ? 24.791 -17.331 -1.781  1.00 0.00 ? 259 GLY A HA3    5  
ATOM   9418  N N      . ALA A 1 47  ? 24.417 -14.455 -2.841  1.00 0.00 ? 260 ALA A N      5  
ATOM   9419  C CA     . ALA A 1 47  ? 24.164 -13.587 -3.978  1.00 0.00 ? 260 ALA A CA     5  
ATOM   9420  C C      . ALA A 1 47  ? 25.334 -12.614 -4.142  1.00 0.00 ? 260 ALA A C      5  
ATOM   9421  O O      . ALA A 1 47  ? 25.618 -11.823 -3.245  1.00 0.00 ? 260 ALA A O      5  
ATOM   9422  C CB     . ALA A 1 47  ? 22.829 -12.866 -3.785  1.00 0.00 ? 260 ALA A CB     5  
ATOM   9423  H H      . ALA A 1 47  ? 24.020 -14.145 -1.977  1.00 0.00 ? 260 ALA A H      5  
ATOM   9424  H HA     . ALA A 1 47  ? 24.098 -14.216 -4.867  1.00 0.00 ? 260 ALA A HA     5  
ATOM   9425  H HB1    . ALA A 1 47  ? 22.154 -13.501 -3.210  1.00 0.00 ? 260 ALA A HB1    5  
ATOM   9426  H HB2    . ALA A 1 47  ? 22.996 -11.933 -3.247  1.00 0.00 ? 260 ALA A HB2    5  
ATOM   9427  H HB3    . ALA A 1 47  ? 22.388 -12.652 -4.757  1.00 0.00 ? 260 ALA A HB3    5  
ATOM   9428  N N      . VAL A 1 48  ? 25.982 -12.707 -5.295  1.00 0.00 ? 261 VAL A N      5  
ATOM   9429  C CA     . VAL A 1 48  ? 27.115 -11.845 -5.588  1.00 0.00 ? 261 VAL A CA     5  
ATOM   9430  C C      . VAL A 1 48  ? 26.611 -10.426 -5.865  1.00 0.00 ? 261 VAL A C      5  
ATOM   9431  O O      . VAL A 1 48  ? 25.785 -10.219 -6.752  1.00 0.00 ? 261 VAL A O      5  
ATOM   9432  C CB     . VAL A 1 48  ? 27.929 -12.426 -6.744  1.00 0.00 ? 261 VAL A CB     5  
ATOM   9433  C CG1    . VAL A 1 48  ? 29.018 -11.450 -7.194  1.00 0.00 ? 261 VAL A CG1    5  
ATOM   9434  C CG2    . VAL A 1 48  ? 28.531 -13.781 -6.364  1.00 0.00 ? 261 VAL A CG2    5  
ATOM   9435  H H      . VAL A 1 48  ? 25.745 -13.354 -6.019  1.00 0.00 ? 261 VAL A H      5  
ATOM   9436  H HA     . VAL A 1 48  ? 27.750 -11.825 -4.703  1.00 0.00 ? 261 VAL A HA     5  
ATOM   9437  H HB     . VAL A 1 48  ? 27.253 -12.584 -7.584  1.00 0.00 ? 261 VAL A HB     5  
ATOM   9438  H HG11   . VAL A 1 48  ? 29.617 -11.154 -6.333  1.00 0.00 ? 261 VAL A HG11   5  
ATOM   9439  H HG12   . VAL A 1 48  ? 29.657 -11.933 -7.932  1.00 0.00 ? 261 VAL A HG12   5  
ATOM   9440  H HG13   . VAL A 1 48  ? 28.555 -10.568 -7.635  1.00 0.00 ? 261 VAL A HG13   5  
ATOM   9441  H HG21   . VAL A 1 48  ? 28.860 -14.298 -7.266  1.00 0.00 ? 261 VAL A HG21   5  
ATOM   9442  H HG22   . VAL A 1 48  ? 29.382 -13.627 -5.702  1.00 0.00 ? 261 VAL A HG22   5  
ATOM   9443  H HG23   . VAL A 1 48  ? 27.778 -14.383 -5.856  1.00 0.00 ? 261 VAL A HG23   5  
ATOM   9444  N N      . ILE A 1 49  ? 27.131 -9.487  -5.088  1.00 0.00 ? 262 ILE A N      5  
ATOM   9445  C CA     . ILE A 1 49  ? 26.745 -8.094  -5.239  1.00 0.00 ? 262 ILE A CA     5  
ATOM   9446  C C      . ILE A 1 49  ? 27.722 -7.399  -6.189  1.00 0.00 ? 262 ILE A C      5  
ATOM   9447  O O      . ILE A 1 49  ? 27.305 -6.675  -7.093  1.00 0.00 ? 262 ILE A O      5  
ATOM   9448  C CB     . ILE A 1 49  ? 26.632 -7.418  -3.871  1.00 0.00 ? 262 ILE A CB     5  
ATOM   9449  C CG1    . ILE A 1 49  ? 25.821 -8.279  -2.900  1.00 0.00 ? 262 ILE A CG1    5  
ATOM   9450  C CG2    . ILE A 1 49  ? 26.059 -6.006  -4.003  1.00 0.00 ? 262 ILE A CG2    5  
ATOM   9451  C CD1    . ILE A 1 49  ? 25.907 -7.728  -1.475  1.00 0.00 ? 262 ILE A CD1    5  
ATOM   9452  H H      . ILE A 1 49  ? 27.802 -9.664  -4.369  1.00 0.00 ? 262 ILE A H      5  
ATOM   9453  H HA     . ILE A 1 49  ? 25.753 -8.076  -5.690  1.00 0.00 ? 262 ILE A HA     5  
ATOM   9454  H HB     . ILE A 1 49  ? 27.635 -7.321  -3.454  1.00 0.00 ? 262 ILE A HB     5  
ATOM   9455  H HG12   . ILE A 1 49  ? 24.779 -8.309  -3.219  1.00 0.00 ? 262 ILE A HG12   5  
ATOM   9456  H HG13   . ILE A 1 49  ? 26.190 -9.303  -2.921  1.00 0.00 ? 262 ILE A HG13   5  
ATOM   9457  H HG21   . ILE A 1 49  ? 26.226 -5.458  -3.075  1.00 0.00 ? 262 ILE A HG21   5  
ATOM   9458  H HG22   . ILE A 1 49  ? 26.553 -5.488  -4.824  1.00 0.00 ? 262 ILE A HG22   5  
ATOM   9459  H HG23   . ILE A 1 49  ? 24.989 -6.065  -4.202  1.00 0.00 ? 262 ILE A HG23   5  
ATOM   9460  H HD11   . ILE A 1 49  ? 26.859 -8.019  -1.031  1.00 0.00 ? 262 ILE A HD11   5  
ATOM   9461  H HD12   . ILE A 1 49  ? 25.836 -6.640  -1.501  1.00 0.00 ? 262 ILE A HD12   5  
ATOM   9462  H HD13   . ILE A 1 49  ? 25.089 -8.132  -0.879  1.00 0.00 ? 262 ILE A HD13   5  
ATOM   9463  N N      . CYS A 1 50  ? 29.002 -7.642  -5.953  1.00 0.00 ? 263 CYS A N      5  
ATOM   9464  C CA     . CYS A 1 50  ? 30.042 -7.049  -6.776  1.00 0.00 ? 263 CYS A CA     5  
ATOM   9465  C C      . CYS A 1 50  ? 31.088 -8.123  -7.079  1.00 0.00 ? 263 CYS A C      5  
ATOM   9466  O O      . CYS A 1 50  ? 31.359 -8.984  -6.243  1.00 0.00 ? 263 CYS A O      5  
ATOM   9467  C CB     . CYS A 1 50  ? 30.662 -5.821  -6.107  1.00 0.00 ? 263 CYS A CB     5  
ATOM   9468  S SG     . CYS A 1 50  ? 29.379 -4.895  -5.186  1.00 0.00 ? 263 CYS A SG     5  
ATOM   9469  H H      . CYS A 1 50  ? 29.333 -8.232  -5.216  1.00 0.00 ? 263 CYS A H      5  
ATOM   9470  H HA     . CYS A 1 50  ? 29.560 -6.709  -7.693  1.00 0.00 ? 263 CYS A HA     5  
ATOM   9471  H HB2    . CYS A 1 50  ? 31.457 -6.129  -5.427  1.00 0.00 ? 263 CYS A HB2    5  
ATOM   9472  H HB3    . CYS A 1 50  ? 31.118 -5.177  -6.858  1.00 0.00 ? 263 CYS A HB3    5  
ATOM   9473  H HG     . CYS A 1 50  ? 29.986 -4.954  -4.004  1.00 0.00 ? 263 CYS A HG     5  
ATOM   9474  N N      . ARG A 1 51  ? 31.648 -8.038  -8.277  1.00 0.00 ? 264 ARG A N      5  
ATOM   9475  C CA     . ARG A 1 51  ? 32.659 -8.992  -8.700  1.00 0.00 ? 264 ARG A CA     5  
ATOM   9476  C C      . ARG A 1 51  ? 33.883 -8.259  -9.251  1.00 0.00 ? 264 ARG A C      5  
ATOM   9477  O O      . ARG A 1 51  ? 33.757 -7.397  -10.120 1.00 0.00 ? 264 ARG A O      5  
ATOM   9478  C CB     . ARG A 1 51  ? 32.111 -9.935  -9.772  1.00 0.00 ? 264 ARG A CB     5  
ATOM   9479  C CG     . ARG A 1 51  ? 33.126 -11.029 -10.112 1.00 0.00 ? 264 ARG A CG     5  
ATOM   9480  C CD     . ARG A 1 51  ? 32.925 -11.539 -11.539 1.00 0.00 ? 264 ARG A CD     5  
ATOM   9481  N NE     . ARG A 1 51  ? 34.206 -12.047 -12.081 1.00 0.00 ? 264 ARG A NE     5  
ATOM   9482  C CZ     . ARG A 1 51  ? 34.346 -12.583 -13.301 1.00 0.00 ? 264 ARG A CZ     5  
ATOM   9483  N NH1    . ARG A 1 51  ? 33.285 -12.685 -14.114 1.00 0.00 ? 264 ARG A NH1    5  
ATOM   9484  N NH2    . ARG A 1 51  ? 35.547 -13.017 -13.709 1.00 0.00 ? 264 ARG A NH2    5  
ATOM   9485  H H      . ARG A 1 51  ? 31.423 -7.334  -8.950  1.00 0.00 ? 264 ARG A H      5  
ATOM   9486  H HA     . ARG A 1 51  ? 32.910 -9.551  -7.798  1.00 0.00 ? 264 ARG A HA     5  
ATOM   9487  H HB2    . ARG A 1 51  ? 31.185 -10.390 -9.423  1.00 0.00 ? 264 ARG A HB2    5  
ATOM   9488  H HB3    . ARG A 1 51  ? 31.869 -9.368  -10.671 1.00 0.00 ? 264 ARG A HB3    5  
ATOM   9489  H HG2    . ARG A 1 51  ? 34.138 -10.638 -10.000 1.00 0.00 ? 264 ARG A HG2    5  
ATOM   9490  H HG3    . ARG A 1 51  ? 33.025 -11.855 -9.409  1.00 0.00 ? 264 ARG A HG3    5  
ATOM   9491  H HD2    . ARG A 1 51  ? 32.177 -12.332 -11.550 1.00 0.00 ? 264 ARG A HD2    5  
ATOM   9492  H HD3    . ARG A 1 51  ? 32.547 -10.736 -12.172 1.00 0.00 ? 264 ARG A HD3    5  
ATOM   9493  H HE     . ARG A 1 51  ? 35.017 -11.985 -11.499 1.00 0.00 ? 264 ARG A HE     5  
ATOM   9494  H HH11   . ARG A 1 51  ? 32.390 -12.361 -13.810 1.00 0.00 ? 264 ARG A HH11   5  
ATOM   9495  H HH12   . ARG A 1 51  ? 33.390 -13.084 -15.024 1.00 0.00 ? 264 ARG A HH12   5  
ATOM   9496  H HH21   . ARG A 1 51  ? 36.338 -12.941 -13.102 1.00 0.00 ? 264 ARG A HH21   5  
ATOM   9497  H HH22   . ARG A 1 51  ? 35.651 -13.417 -14.618 1.00 0.00 ? 264 ARG A HH22   5  
ATOM   9498  N N      . ILE A 1 52  ? 35.042 -8.629  -8.725  1.00 0.00 ? 265 ILE A N      5  
ATOM   9499  C CA     . ILE A 1 52  ? 36.288 -8.018  -9.155  1.00 0.00 ? 265 ILE A CA     5  
ATOM   9500  C C      . ILE A 1 52  ? 36.402 -8.118  -10.677 1.00 0.00 ? 265 ILE A C      5  
ATOM   9501  O O      . ILE A 1 52  ? 36.130 -9.169  -11.255 1.00 0.00 ? 265 ILE A O      5  
ATOM   9502  C CB     . ILE A 1 52  ? 37.472 -8.633  -8.407  1.00 0.00 ? 265 ILE A CB     5  
ATOM   9503  C CG1    . ILE A 1 52  ? 38.792 -8.006  -8.858  1.00 0.00 ? 265 ILE A CG1    5  
ATOM   9504  C CG2    . ILE A 1 52  ? 37.482 -10.156 -8.553  1.00 0.00 ? 265 ILE A CG2    5  
ATOM   9505  C CD1    . ILE A 1 52  ? 39.832 -8.047  -7.737  1.00 0.00 ? 265 ILE A CD1    5  
ATOM   9506  H H      . ILE A 1 52  ? 35.137 -9.332  -8.020  1.00 0.00 ? 265 ILE A H      5  
ATOM   9507  H HA     . ILE A 1 52  ? 36.247 -6.964  -8.880  1.00 0.00 ? 265 ILE A HA     5  
ATOM   9508  H HB     . ILE A 1 52  ? 37.358 -8.413  -7.345  1.00 0.00 ? 265 ILE A HB     5  
ATOM   9509  H HG12   . ILE A 1 52  ? 39.173 -8.538  -9.731  1.00 0.00 ? 265 ILE A HG12   5  
ATOM   9510  H HG13   . ILE A 1 52  ? 38.623 -6.974  -9.164  1.00 0.00 ? 265 ILE A HG13   5  
ATOM   9511  H HG21   . ILE A 1 52  ? 38.183 -10.441 -9.337  1.00 0.00 ? 265 ILE A HG21   5  
ATOM   9512  H HG22   . ILE A 1 52  ? 37.786 -10.610 -7.611  1.00 0.00 ? 265 ILE A HG22   5  
ATOM   9513  H HG23   . ILE A 1 52  ? 36.482 -10.502 -8.817  1.00 0.00 ? 265 ILE A HG23   5  
ATOM   9514  H HD11   . ILE A 1 52  ? 39.443 -8.630  -6.903  1.00 0.00 ? 265 ILE A HD11   5  
ATOM   9515  H HD12   . ILE A 1 52  ? 40.748 -8.507  -8.107  1.00 0.00 ? 265 ILE A HD12   5  
ATOM   9516  H HD13   . ILE A 1 52  ? 40.046 -7.031  -7.402  1.00 0.00 ? 265 ILE A HD13   5  
ATOM   9517  N N      . GLY A 1 53  ? 36.807 -7.011  -11.282 1.00 0.00 ? 266 GLY A N      5  
ATOM   9518  C CA     . GLY A 1 53  ? 36.960 -6.961  -12.726 1.00 0.00 ? 266 GLY A CA     5  
ATOM   9519  C C      . GLY A 1 53  ? 35.805 -6.197  -13.375 1.00 0.00 ? 266 GLY A C      5  
ATOM   9520  O O      . GLY A 1 53  ? 36.027 -5.277  -14.160 1.00 0.00 ? 266 GLY A O      5  
ATOM   9521  H H      . GLY A 1 53  ? 37.027 -6.161  -10.805 1.00 0.00 ? 266 GLY A H      5  
ATOM   9522  H HA2    . GLY A 1 53  ? 37.906 -6.480  -12.979 1.00 0.00 ? 266 GLY A HA2    5  
ATOM   9523  H HA3    . GLY A 1 53  ? 37.001 -7.974  -13.126 1.00 0.00 ? 266 GLY A HA3    5  
ATOM   9524  N N      . GLU A 1 54  ? 34.595 -6.607  -13.022 1.00 0.00 ? 267 GLU A N      5  
ATOM   9525  C CA     . GLU A 1 54  ? 33.404 -5.972  -13.560 1.00 0.00 ? 267 GLU A CA     5  
ATOM   9526  C C      . GLU A 1 54  ? 33.316 -4.520  -13.086 1.00 0.00 ? 267 GLU A C      5  
ATOM   9527  O O      . GLU A 1 54  ? 33.577 -4.227  -11.921 1.00 0.00 ? 267 GLU A O      5  
ATOM   9528  C CB     . GLU A 1 54  ? 32.145 -6.751  -13.174 1.00 0.00 ? 267 GLU A CB     5  
ATOM   9529  C CG     . GLU A 1 54  ? 32.063 -8.073  -13.940 1.00 0.00 ? 267 GLU A CG     5  
ATOM   9530  C CD     . GLU A 1 54  ? 31.599 -7.843  -15.381 1.00 0.00 ? 267 GLU A CD     5  
ATOM   9531  O OE1    . GLU A 1 54  ? 32.434 -7.648  -16.276 1.00 0.00 ? 267 GLU A OE1    5  
ATOM   9532  O OE2    . GLU A 1 54  ? 30.321 -7.874  -15.554 1.00 0.00 ? 267 GLU A OE2    5  
ATOM   9533  H H      . GLU A 1 54  ? 34.422 -7.355  -12.382 1.00 0.00 ? 267 GLU A H      5  
ATOM   9534  H HA     . GLU A 1 54  ? 33.524 -6.001  -14.643 1.00 0.00 ? 267 GLU A HA     5  
ATOM   9535  H HB2    . GLU A 1 54  ? 32.149 -6.948  -12.102 1.00 0.00 ? 267 GLU A HB2    5  
ATOM   9536  H HB3    . GLU A 1 54  ? 31.261 -6.149  -13.384 1.00 0.00 ? 267 GLU A HB3    5  
ATOM   9537  H HG2    . GLU A 1 54  ? 33.038 -8.559  -13.941 1.00 0.00 ? 267 GLU A HG2    5  
ATOM   9538  H HG3    . GLU A 1 54  ? 31.371 -8.748  -13.435 1.00 0.00 ? 267 GLU A HG3    5  
ATOM   9539  H HE2    . GLU A 1 54  ? 30.093 -7.551  -16.472 1.00 0.00 ? 267 GLU A HE2    5  
ATOM   9540  N N      . PRO A 1 55  ? 32.937 -3.626  -14.039 1.00 0.00 ? 268 PRO A N      5  
ATOM   9541  C CA     . PRO A 1 55  ? 32.812 -2.212  -13.731 1.00 0.00 ? 268 PRO A CA     5  
ATOM   9542  C C      . PRO A 1 55  ? 31.543 -1.938  -12.920 1.00 0.00 ? 268 PRO A C      5  
ATOM   9543  O O      . PRO A 1 55  ? 30.522 -2.593  -13.119 1.00 0.00 ? 268 PRO A O      5  
ATOM   9544  C CB     . PRO A 1 55  ? 32.817 -1.513  -15.080 1.00 0.00 ? 268 PRO A CB     5  
ATOM   9545  C CG     . PRO A 1 55  ? 32.477 -2.583  -16.106 1.00 0.00 ? 268 PRO A CG     5  
ATOM   9546  C CD     . PRO A 1 55  ? 32.620 -3.938  -15.430 1.00 0.00 ? 268 PRO A CD     5  
ATOM   9547  H HA     . PRO A 1 55  ? 33.573 -1.913  -13.155 1.00 0.00 ? 268 PRO A HA     5  
ATOM   9548  H HB2    . PRO A 1 55  ? 32.086 -0.704  -15.105 1.00 0.00 ? 268 PRO A HB2    5  
ATOM   9549  H HB3    . PRO A 1 55  ? 33.791 -1.069  -15.287 1.00 0.00 ? 268 PRO A HB3    5  
ATOM   9550  H HG2    . PRO A 1 55  ? 31.462 -2.448  -16.477 1.00 0.00 ? 268 PRO A HG2    5  
ATOM   9551  H HG3    . PRO A 1 55  ? 33.144 -2.514  -16.965 1.00 0.00 ? 268 PRO A HG3    5  
ATOM   9552  H HD2    . PRO A 1 55  ? 31.700 -4.517  -15.505 1.00 0.00 ? 268 PRO A HD2    5  
ATOM   9553  H HD3    . PRO A 1 55  ? 33.409 -4.530  -15.892 1.00 0.00 ? 268 PRO A HD3    5  
ATOM   9554  N N      . GLY A 1 56  ? 31.650 -0.968  -12.024 1.00 0.00 ? 269 GLY A N      5  
ATOM   9555  C CA     . GLY A 1 56  ? 30.524 -0.599  -11.182 1.00 0.00 ? 269 GLY A CA     5  
ATOM   9556  C C      . GLY A 1 56  ? 29.785 0.613   -11.755 1.00 0.00 ? 269 GLY A C      5  
ATOM   9557  O O      . GLY A 1 56  ? 30.405 1.511   -12.322 1.00 0.00 ? 269 GLY A O      5  
ATOM   9558  H H      . GLY A 1 56  ? 32.484 -0.439  -11.869 1.00 0.00 ? 269 GLY A H      5  
ATOM   9559  H HA2    . GLY A 1 56  ? 29.838 -1.441  -11.097 1.00 0.00 ? 269 GLY A HA2    5  
ATOM   9560  H HA3    . GLY A 1 56  ? 30.877 -0.372  -10.176 1.00 0.00 ? 269 GLY A HA3    5  
ATOM   9561  N N      . ASP A 1 57  ? 28.471 0.596   -11.588 1.00 0.00 ? 270 ASP A N      5  
ATOM   9562  C CA     . ASP A 1 57  ? 27.641 1.683   -12.081 1.00 0.00 ? 270 ASP A CA     5  
ATOM   9563  C C      . ASP A 1 57  ? 26.505 1.942   -11.090 1.00 0.00 ? 270 ASP A C      5  
ATOM   9564  O O      . ASP A 1 57  ? 25.487 2.532   -11.447 1.00 0.00 ? 270 ASP A O      5  
ATOM   9565  C CB     . ASP A 1 57  ? 27.017 1.329   -13.433 1.00 0.00 ? 270 ASP A CB     5  
ATOM   9566  C CG     . ASP A 1 57  ? 27.772 1.861   -14.652 1.00 0.00 ? 270 ASP A CG     5  
ATOM   9567  O OD1    . ASP A 1 57  ? 28.911 2.341   -14.540 1.00 0.00 ? 270 ASP A OD1    5  
ATOM   9568  O OD2    . ASP A 1 57  ? 27.137 1.769   -15.771 1.00 0.00 ? 270 ASP A OD2    5  
ATOM   9569  H H      . ASP A 1 57  ? 27.974 -0.139  -11.126 1.00 0.00 ? 270 ASP A H      5  
ATOM   9570  H HA     . ASP A 1 57  ? 28.313 2.535   -12.177 1.00 0.00 ? 270 ASP A HA     5  
ATOM   9571  H HB2    . ASP A 1 57  ? 26.948 0.244   -13.511 1.00 0.00 ? 270 ASP A HB2    5  
ATOM   9572  H HB3    . ASP A 1 57  ? 25.999 1.716   -13.458 1.00 0.00 ? 270 ASP A HB3    5  
ATOM   9573  H HD2    . ASP A 1 57  ? 26.201 2.103   -15.661 1.00 0.00 ? 270 ASP A HD2    5  
ATOM   9574  N N      . ARG A 1 58  ? 26.717 1.487   -9.863  1.00 0.00 ? 271 ARG A N      5  
ATOM   9575  C CA     . ARG A 1 58  ? 25.723 1.662   -8.818  1.00 0.00 ? 271 ARG A CA     5  
ATOM   9576  C C      . ARG A 1 58  ? 26.370 1.505   -7.439  1.00 0.00 ? 271 ARG A C      5  
ATOM   9577  O O      . ARG A 1 58  ? 27.377 0.814   -7.297  1.00 0.00 ? 271 ARG A O      5  
ATOM   9578  C CB     . ARG A 1 58  ? 24.589 0.645   -8.960  1.00 0.00 ? 271 ARG A CB     5  
ATOM   9579  C CG     . ARG A 1 58  ? 25.102 -0.781  -8.739  1.00 0.00 ? 271 ARG A CG     5  
ATOM   9580  C CD     . ARG A 1 58  ? 24.671 -1.701  -9.885  1.00 0.00 ? 271 ARG A CD     5  
ATOM   9581  N NE     . ARG A 1 58  ? 25.862 -2.268  -10.554 1.00 0.00 ? 271 ARG A NE     5  
ATOM   9582  C CZ     . ARG A 1 58  ? 25.852 -2.796  -11.785 1.00 0.00 ? 271 ARG A CZ     5  
ATOM   9583  N NH1    . ARG A 1 58  ? 24.712 -2.833  -12.489 1.00 0.00 ? 271 ARG A NH1    5  
ATOM   9584  N NH2    . ARG A 1 58  ? 26.980 -3.289  -12.312 1.00 0.00 ? 271 ARG A NH2    5  
ATOM   9585  H H      . ARG A 1 58  ? 27.548 1.009   -9.580  1.00 0.00 ? 271 ARG A H      5  
ATOM   9586  H HA     . ARG A 1 58  ? 25.344 2.673   -8.960  1.00 0.00 ? 271 ARG A HA     5  
ATOM   9587  H HB2    . ARG A 1 58  ? 23.804 0.868   -8.238  1.00 0.00 ? 271 ARG A HB2    5  
ATOM   9588  H HB3    . ARG A 1 58  ? 24.145 0.726   -9.951  1.00 0.00 ? 271 ARG A HB3    5  
ATOM   9589  H HG2    . ARG A 1 58  ? 26.189 -0.773  -8.665  1.00 0.00 ? 271 ARG A HG2    5  
ATOM   9590  H HG3    . ARG A 1 58  ? 24.719 -1.167  -7.794  1.00 0.00 ? 271 ARG A HG3    5  
ATOM   9591  H HD2    . ARG A 1 58  ? 24.042 -2.504  -9.499  1.00 0.00 ? 271 ARG A HD2    5  
ATOM   9592  H HD3    . ARG A 1 58  ? 24.070 -1.144  -10.603 1.00 0.00 ? 271 ARG A HD3    5  
ATOM   9593  H HE     . ARG A 1 58  ? 26.729 -2.258  -10.056 1.00 0.00 ? 271 ARG A HE     5  
ATOM   9594  H HH11   . ARG A 1 58  ? 23.869 -2.465  -12.095 1.00 0.00 ? 271 ARG A HH11   5  
ATOM   9595  H HH12   . ARG A 1 58  ? 24.704 -3.227  -13.408 1.00 0.00 ? 271 ARG A HH12   5  
ATOM   9596  H HH21   . ARG A 1 58  ? 27.832 -3.261  -11.787 1.00 0.00 ? 271 ARG A HH21   5  
ATOM   9597  H HH22   . ARG A 1 58  ? 26.973 -3.683  -13.232 1.00 0.00 ? 271 ARG A HH22   5  
ATOM   9598  N N      . MET A 1 59  ? 25.765 2.160   -6.459  1.00 0.00 ? 272 MET A N      5  
ATOM   9599  C CA     . MET A 1 59  ? 26.268 2.102   -5.098  1.00 0.00 ? 272 MET A CA     5  
ATOM   9600  C C      . MET A 1 59  ? 25.465 1.108   -4.257  1.00 0.00 ? 272 MET A C      5  
ATOM   9601  O O      . MET A 1 59  ? 24.408 0.643   -4.682  1.00 0.00 ? 272 MET A O      5  
ATOM   9602  C CB     . MET A 1 59  ? 26.185 3.491   -4.463  1.00 0.00 ? 272 MET A CB     5  
ATOM   9603  C CG     . MET A 1 59  ? 27.580 4.086   -4.259  1.00 0.00 ? 272 MET A CG     5  
ATOM   9604  S SD     . MET A 1 59  ? 27.738 4.715   -2.595  1.00 0.00 ? 272 MET A SD     5  
ATOM   9605  C CE     . MET A 1 59  ? 28.407 3.274   -1.781  1.00 0.00 ? 272 MET A CE     5  
ATOM   9606  H H      . MET A 1 59  ? 24.945 2.720   -6.583  1.00 0.00 ? 272 MET A H      5  
ATOM   9607  H HA     . MET A 1 59  ? 27.302 1.765   -5.182  1.00 0.00 ? 272 MET A HA     5  
ATOM   9608  H HB2    . MET A 1 59  ? 25.595 4.151   -5.100  1.00 0.00 ? 272 MET A HB2    5  
ATOM   9609  H HB3    . MET A 1 59  ? 25.669 3.428   -3.505  1.00 0.00 ? 272 MET A HB3    5  
ATOM   9610  H HG2    . MET A 1 59  ? 28.339 3.324   -4.441  1.00 0.00 ? 272 MET A HG2    5  
ATOM   9611  H HG3    . MET A 1 59  ? 27.753 4.886   -4.977  1.00 0.00 ? 272 MET A HG3    5  
ATOM   9612  H HE1    . MET A 1 59  ? 27.651 2.847   -1.121  1.00 0.00 ? 272 MET A HE1    5  
ATOM   9613  H HE2    . MET A 1 59  ? 28.696 2.536   -2.528  1.00 0.00 ? 272 MET A HE2    5  
ATOM   9614  H HE3    . MET A 1 59  ? 29.280 3.561   -1.195  1.00 0.00 ? 272 MET A HE3    5  
ATOM   9615  N N      . PHE A 1 60  ? 25.997 0.811   -3.081  1.00 0.00 ? 273 PHE A N      5  
ATOM   9616  C CA     . PHE A 1 60  ? 25.342 -0.120  -2.177  1.00 0.00 ? 273 PHE A CA     5  
ATOM   9617  C C      . PHE A 1 60  ? 25.532 0.306   -0.720  1.00 0.00 ? 273 PHE A C      5  
ATOM   9618  O O      . PHE A 1 60  ? 26.613 0.751   -0.334  1.00 0.00 ? 273 PHE A O      5  
ATOM   9619  C CB     . PHE A 1 60  ? 26.000 -1.485  -2.387  1.00 0.00 ? 273 PHE A CB     5  
ATOM   9620  C CG     . PHE A 1 60  ? 25.521 -2.221  -3.640  1.00 0.00 ? 273 PHE A CG     5  
ATOM   9621  C CD1    . PHE A 1 60  ? 26.102 -1.967  -4.842  1.00 0.00 ? 273 PHE A CD1    5  
ATOM   9622  C CD2    . PHE A 1 60  ? 24.512 -3.128  -3.551  1.00 0.00 ? 273 PHE A CD2    5  
ATOM   9623  C CE1    . PHE A 1 60  ? 25.658 -2.649  -6.005  1.00 0.00 ? 273 PHE A CE1    5  
ATOM   9624  C CE2    . PHE A 1 60  ? 24.067 -3.811  -4.714  1.00 0.00 ? 273 PHE A CE2    5  
ATOM   9625  C CZ     . PHE A 1 60  ? 24.650 -3.558  -5.916  1.00 0.00 ? 273 PHE A CZ     5  
ATOM   9626  H H      . PHE A 1 60  ? 26.857 1.193   -2.744  1.00 0.00 ? 273 PHE A H      5  
ATOM   9627  H HA     . PHE A 1 60  ? 24.279 -0.114  -2.420  1.00 0.00 ? 273 PHE A HA     5  
ATOM   9628  H HB2    . PHE A 1 60  ? 27.080 -1.351  -2.448  1.00 0.00 ? 273 PHE A HB2    5  
ATOM   9629  H HB3    . PHE A 1 60  ? 25.805 -2.109  -1.515  1.00 0.00 ? 273 PHE A HB3    5  
ATOM   9630  H HD1    . PHE A 1 60  ? 26.912 -1.239  -4.913  1.00 0.00 ? 273 PHE A HD1    5  
ATOM   9631  H HD2    . PHE A 1 60  ? 24.046 -3.332  -2.586  1.00 0.00 ? 273 PHE A HD2    5  
ATOM   9632  H HE1    . PHE A 1 60  ? 26.125 -2.446  -6.968  1.00 0.00 ? 273 PHE A HE1    5  
ATOM   9633  H HE2    . PHE A 1 60  ? 23.259 -4.539  -4.642  1.00 0.00 ? 273 PHE A HE2    5  
ATOM   9634  H HZ     . PHE A 1 60  ? 24.308 -4.082  -6.809  1.00 0.00 ? 273 PHE A HZ     5  
ATOM   9635  N N      . PHE A 1 61  ? 24.465 0.155   0.052   1.00 0.00 ? 274 PHE A N      5  
ATOM   9636  C CA     . PHE A 1 61  ? 24.501 0.518   1.458   1.00 0.00 ? 274 PHE A CA     5  
ATOM   9637  C C      . PHE A 1 61  ? 23.778 -0.525  2.312   1.00 0.00 ? 274 PHE A C      5  
ATOM   9638  O O      . PHE A 1 61  ? 22.616 -0.840  2.062   1.00 0.00 ? 274 PHE A O      5  
ATOM   9639  C CB     . PHE A 1 61  ? 23.777 1.860   1.592   1.00 0.00 ? 274 PHE A CB     5  
ATOM   9640  C CG     . PHE A 1 61  ? 24.207 2.904   0.559   1.00 0.00 ? 274 PHE A CG     5  
ATOM   9641  C CD1    . PHE A 1 61  ? 23.699 2.863   -0.702  1.00 0.00 ? 274 PHE A CD1    5  
ATOM   9642  C CD2    . PHE A 1 61  ? 25.097 3.873   0.901   1.00 0.00 ? 274 PHE A CD2    5  
ATOM   9643  C CE1    . PHE A 1 61  ? 24.096 3.832   -1.660  1.00 0.00 ? 274 PHE A CE1    5  
ATOM   9644  C CE2    . PHE A 1 61  ? 25.495 4.842   -0.057  1.00 0.00 ? 274 PHE A CE2    5  
ATOM   9645  C CZ     . PHE A 1 61  ? 24.986 4.801   -1.317  1.00 0.00 ? 274 PHE A CZ     5  
ATOM   9646  H H      . PHE A 1 61  ? 23.590 -0.207  -0.270  1.00 0.00 ? 274 PHE A H      5  
ATOM   9647  H HA     . PHE A 1 61  ? 25.549 0.565   1.754   1.00 0.00 ? 274 PHE A HA     5  
ATOM   9648  H HB2    . PHE A 1 61  ? 22.704 1.693   1.501   1.00 0.00 ? 274 PHE A HB2    5  
ATOM   9649  H HB3    . PHE A 1 61  ? 23.955 2.258   2.591   1.00 0.00 ? 274 PHE A HB3    5  
ATOM   9650  H HD1    . PHE A 1 61  ? 22.985 2.086   -0.976  1.00 0.00 ? 274 PHE A HD1    5  
ATOM   9651  H HD2    . PHE A 1 61  ? 25.505 3.907   1.912   1.00 0.00 ? 274 PHE A HD2    5  
ATOM   9652  H HE1    . PHE A 1 61  ? 23.688 3.799   -2.670  1.00 0.00 ? 274 PHE A HE1    5  
ATOM   9653  H HE2    . PHE A 1 61  ? 26.209 5.620   0.217   1.00 0.00 ? 274 PHE A HE2    5  
ATOM   9654  H HZ     . PHE A 1 61  ? 25.292 5.545   -2.053  1.00 0.00 ? 274 PHE A HZ     5  
ATOM   9655  N N      . VAL A 1 62  ? 24.496 -1.033  3.303   1.00 0.00 ? 275 VAL A N      5  
ATOM   9656  C CA     . VAL A 1 62  ? 23.937 -2.034  4.196   1.00 0.00 ? 275 VAL A CA     5  
ATOM   9657  C C      . VAL A 1 62  ? 23.028 -1.349  5.219   1.00 0.00 ? 275 VAL A C      5  
ATOM   9658  O O      . VAL A 1 62  ? 23.438 -0.392  5.876   1.00 0.00 ? 275 VAL A O      5  
ATOM   9659  C CB     . VAL A 1 62  ? 25.062 -2.844  4.843   1.00 0.00 ? 275 VAL A CB     5  
ATOM   9660  C CG1    . VAL A 1 62  ? 24.515 -3.772  5.929   1.00 0.00 ? 275 VAL A CG1    5  
ATOM   9661  C CG2    . VAL A 1 62  ? 25.846 -3.632  3.791   1.00 0.00 ? 275 VAL A CG2    5  
ATOM   9662  H H      . VAL A 1 62  ? 25.441 -0.770  3.500   1.00 0.00 ? 275 VAL A H      5  
ATOM   9663  H HA     . VAL A 1 62  ? 23.336 -2.714  3.592   1.00 0.00 ? 275 VAL A HA     5  
ATOM   9664  H HB     . VAL A 1 62  ? 25.750 -2.143  5.317   1.00 0.00 ? 275 VAL A HB     5  
ATOM   9665  H HG11   . VAL A 1 62  ? 25.296 -3.973  6.662   1.00 0.00 ? 275 VAL A HG11   5  
ATOM   9666  H HG12   . VAL A 1 62  ? 23.668 -3.295  6.421   1.00 0.00 ? 275 VAL A HG12   5  
ATOM   9667  H HG13   . VAL A 1 62  ? 24.192 -4.710  5.476   1.00 0.00 ? 275 VAL A HG13   5  
ATOM   9668  H HG21   . VAL A 1 62  ? 25.367 -3.515  2.819   1.00 0.00 ? 275 VAL A HG21   5  
ATOM   9669  H HG22   . VAL A 1 62  ? 26.867 -3.254  3.741   1.00 0.00 ? 275 VAL A HG22   5  
ATOM   9670  H HG23   . VAL A 1 62  ? 25.861 -4.687  4.066   1.00 0.00 ? 275 VAL A HG23   5  
ATOM   9671  N N      . VAL A 1 63  ? 21.812 -1.865  5.322   1.00 0.00 ? 276 VAL A N      5  
ATOM   9672  C CA     . VAL A 1 63  ? 20.843 -1.315  6.254   1.00 0.00 ? 276 VAL A CA     5  
ATOM   9673  C C      . VAL A 1 63  ? 20.695 -2.261  7.447   1.00 0.00 ? 276 VAL A C      5  
ATOM   9674  O O      . VAL A 1 63  ? 20.600 -1.815  8.589   1.00 0.00 ? 276 VAL A O      5  
ATOM   9675  C CB     . VAL A 1 63  ? 19.518 -1.050  5.535   1.00 0.00 ? 276 VAL A CB     5  
ATOM   9676  C CG1    . VAL A 1 63  ? 18.442 -0.590  6.520   1.00 0.00 ? 276 VAL A CG1    5  
ATOM   9677  C CG2    . VAL A 1 63  ? 19.702 -0.031  4.408   1.00 0.00 ? 276 VAL A CG2    5  
ATOM   9678  H H      . VAL A 1 63  ? 21.489 -2.642  4.784   1.00 0.00 ? 276 VAL A H      5  
ATOM   9679  H HA     . VAL A 1 63  ? 21.232 -0.360  6.608   1.00 0.00 ? 276 VAL A HA     5  
ATOM   9680  H HB     . VAL A 1 63  ? 19.186 -1.986  5.088   1.00 0.00 ? 276 VAL A HB     5  
ATOM   9681  H HG11   . VAL A 1 63  ? 17.463 -0.911  6.165   1.00 0.00 ? 276 VAL A HG11   5  
ATOM   9682  H HG12   . VAL A 1 63  ? 18.636 -1.027  7.499   1.00 0.00 ? 276 VAL A HG12   5  
ATOM   9683  H HG13   . VAL A 1 63  ? 18.462 0.497   6.597   1.00 0.00 ? 276 VAL A HG13   5  
ATOM   9684  H HG21   . VAL A 1 63  ? 19.367 -0.467  3.467   1.00 0.00 ? 276 VAL A HG21   5  
ATOM   9685  H HG22   . VAL A 1 63  ? 19.113 0.860   4.625   1.00 0.00 ? 276 VAL A HG22   5  
ATOM   9686  H HG23   . VAL A 1 63  ? 20.755 0.239   4.328   1.00 0.00 ? 276 VAL A HG23   5  
ATOM   9687  N N      . GLU A 1 64  ? 20.683 -3.551  7.142   1.00 0.00 ? 277 GLU A N      5  
ATOM   9688  C CA     . GLU A 1 64  ? 20.549 -4.563  8.175   1.00 0.00 ? 277 GLU A CA     5  
ATOM   9689  C C      . GLU A 1 64  ? 21.294 -5.837  7.769   1.00 0.00 ? 277 GLU A C      5  
ATOM   9690  O O      . GLU A 1 64  ? 21.154 -6.309  6.642   1.00 0.00 ? 277 GLU A O      5  
ATOM   9691  C CB     . GLU A 1 64  ? 19.076 -4.859  8.466   1.00 0.00 ? 277 GLU A CB     5  
ATOM   9692  C CG     . GLU A 1 64  ? 18.689 -4.385  9.868   1.00 0.00 ? 277 GLU A CG     5  
ATOM   9693  C CD     . GLU A 1 64  ? 17.813 -3.132  9.801   1.00 0.00 ? 277 GLU A CD     5  
ATOM   9694  O OE1    . GLU A 1 64  ? 16.853 -3.088  9.016   1.00 0.00 ? 277 GLU A OE1    5  
ATOM   9695  O OE2    . GLU A 1 64  ? 18.156 -2.183  10.603  1.00 0.00 ? 277 GLU A OE2    5  
ATOM   9696  H H      . GLU A 1 64  ? 20.761 -3.905  6.209   1.00 0.00 ? 277 GLU A H      5  
ATOM   9697  H HA     . GLU A 1 64  ? 21.010 -4.132  9.064   1.00 0.00 ? 277 GLU A HA     5  
ATOM   9698  H HB2    . GLU A 1 64  ? 18.449 -4.362  7.725   1.00 0.00 ? 277 GLU A HB2    5  
ATOM   9699  H HB3    . GLU A 1 64  ? 18.892 -5.929  8.376   1.00 0.00 ? 277 GLU A HB3    5  
ATOM   9700  H HG2    . GLU A 1 64  ? 18.155 -5.179  10.390  1.00 0.00 ? 277 GLU A HG2    5  
ATOM   9701  H HG3    . GLU A 1 64  ? 19.589 -4.173  10.446  1.00 0.00 ? 277 GLU A HG3    5  
ATOM   9702  H HE2    . GLU A 1 64  ? 18.823 -1.584  10.160  1.00 0.00 ? 277 GLU A HE2    5  
ATOM   9703  N N      . GLY A 1 65  ? 22.069 -6.356  8.710   1.00 0.00 ? 278 GLY A N      5  
ATOM   9704  C CA     . GLY A 1 65  ? 22.835 -7.566  8.466   1.00 0.00 ? 278 GLY A CA     5  
ATOM   9705  C C      . GLY A 1 65  ? 24.316 -7.244  8.256   1.00 0.00 ? 278 GLY A C      5  
ATOM   9706  O O      . GLY A 1 65  ? 24.751 -6.119  8.503   1.00 0.00 ? 278 GLY A O      5  
ATOM   9707  H H      . GLY A 1 65  ? 22.176 -5.965  9.625   1.00 0.00 ? 278 GLY A H      5  
ATOM   9708  H HA2    . GLY A 1 65  ? 22.723 -8.248  9.308   1.00 0.00 ? 278 GLY A HA2    5  
ATOM   9709  H HA3    . GLY A 1 65  ? 22.442 -8.077  7.587   1.00 0.00 ? 278 GLY A HA3    5  
ATOM   9710  N N      . SER A 1 66  ? 25.050 -8.249  7.804   1.00 0.00 ? 279 SER A N      5  
ATOM   9711  C CA     . SER A 1 66  ? 26.473 -8.087  7.559   1.00 0.00 ? 279 SER A CA     5  
ATOM   9712  C C      . SER A 1 66  ? 26.841 -8.683  6.199   1.00 0.00 ? 279 SER A C      5  
ATOM   9713  O O      . SER A 1 66  ? 26.103 -9.505  5.657   1.00 0.00 ? 279 SER A O      5  
ATOM   9714  C CB     . SER A 1 66  ? 27.300 -8.741  8.667   1.00 0.00 ? 279 SER A CB     5  
ATOM   9715  O OG     . SER A 1 66  ? 27.313 -7.958  9.857   1.00 0.00 ? 279 SER A OG     5  
ATOM   9716  H H      . SER A 1 66  ? 24.688 -9.161  7.605   1.00 0.00 ? 279 SER A H      5  
ATOM   9717  H HA     . SER A 1 66  ? 26.646 -7.011  7.564   1.00 0.00 ? 279 SER A HA     5  
ATOM   9718  H HB2    . SER A 1 66  ? 26.894 -9.729  8.887   1.00 0.00 ? 279 SER A HB2    5  
ATOM   9719  H HB3    . SER A 1 66  ? 28.322 -8.887  8.318   1.00 0.00 ? 279 SER A HB3    5  
ATOM   9720  H HG     . SER A 1 66  ? 26.428 -8.023  10.319  1.00 0.00 ? 279 SER A HG     5  
ATOM   9721  N N      . VAL A 1 67  ? 27.982 -8.247  5.686   1.00 0.00 ? 280 VAL A N      5  
ATOM   9722  C CA     . VAL A 1 67  ? 28.457 -8.728  4.400   1.00 0.00 ? 280 VAL A CA     5  
ATOM   9723  C C      . VAL A 1 67  ? 29.909 -9.189  4.539   1.00 0.00 ? 280 VAL A C      5  
ATOM   9724  O O      . VAL A 1 67  ? 30.613 -8.770  5.456   1.00 0.00 ? 280 VAL A O      5  
ATOM   9725  C CB     . VAL A 1 67  ? 28.274 -7.643  3.336   1.00 0.00 ? 280 VAL A CB     5  
ATOM   9726  C CG1    . VAL A 1 67  ? 29.147 -7.922  2.112   1.00 0.00 ? 280 VAL A CG1    5  
ATOM   9727  C CG2    . VAL A 1 67  ? 26.801 -7.508  2.941   1.00 0.00 ? 280 VAL A CG2    5  
ATOM   9728  H H      . VAL A 1 67  ? 28.577 -7.579  6.134   1.00 0.00 ? 280 VAL A H      5  
ATOM   9729  H HA     . VAL A 1 67  ? 27.841 -9.582  4.121   1.00 0.00 ? 280 VAL A HA     5  
ATOM   9730  H HB     . VAL A 1 67  ? 28.594 -6.694  3.766   1.00 0.00 ? 280 VAL A HB     5  
ATOM   9731  H HG11   . VAL A 1 67  ? 28.945 -7.176  1.343   1.00 0.00 ? 280 VAL A HG11   5  
ATOM   9732  H HG12   . VAL A 1 67  ? 30.198 -7.875  2.397   1.00 0.00 ? 280 VAL A HG12   5  
ATOM   9733  H HG13   . VAL A 1 67  ? 28.921 -8.915  1.723   1.00 0.00 ? 280 VAL A HG13   5  
ATOM   9734  H HG21   . VAL A 1 67  ? 26.291 -6.865  3.657   1.00 0.00 ? 280 VAL A HG21   5  
ATOM   9735  H HG22   . VAL A 1 67  ? 26.732 -7.068  1.945   1.00 0.00 ? 280 VAL A HG22   5  
ATOM   9736  H HG23   . VAL A 1 67  ? 26.334 -8.493  2.936   1.00 0.00 ? 280 VAL A HG23   5  
ATOM   9737  N N      . SER A 1 68  ? 30.314 -10.047 3.613   1.00 0.00 ? 281 SER A N      5  
ATOM   9738  C CA     . SER A 1 68  ? 31.670 -10.570 3.619   1.00 0.00 ? 281 SER A CA     5  
ATOM   9739  C C      . SER A 1 68  ? 32.329 -10.333 2.260   1.00 0.00 ? 281 SER A C      5  
ATOM   9740  O O      . SER A 1 68  ? 31.735 -10.619 1.220   1.00 0.00 ? 281 SER A O      5  
ATOM   9741  C CB     . SER A 1 68  ? 31.683 -12.061 3.963   1.00 0.00 ? 281 SER A CB     5  
ATOM   9742  O OG     . SER A 1 68  ? 31.901 -12.287 5.353   1.00 0.00 ? 281 SER A OG     5  
ATOM   9743  H H      . SER A 1 68  ? 29.736 -10.382 2.870   1.00 0.00 ? 281 SER A H      5  
ATOM   9744  H HA     . SER A 1 68  ? 32.190 -10.015 4.399   1.00 0.00 ? 281 SER A HA     5  
ATOM   9745  H HB2    . SER A 1 68  ? 30.733 -12.510 3.668   1.00 0.00 ? 281 SER A HB2    5  
ATOM   9746  H HB3    . SER A 1 68  ? 32.463 -12.560 3.388   1.00 0.00 ? 281 SER A HB3    5  
ATOM   9747  H HG     . SER A 1 68  ? 32.568 -13.020 5.479   1.00 0.00 ? 281 SER A HG     5  
ATOM   9748  N N      . VAL A 1 69  ? 33.547 -9.815  2.311   1.00 0.00 ? 282 VAL A N      5  
ATOM   9749  C CA     . VAL A 1 69  ? 34.293 -9.536  1.095   1.00 0.00 ? 282 VAL A CA     5  
ATOM   9750  C C      . VAL A 1 69  ? 34.901 -10.836 0.566   1.00 0.00 ? 282 VAL A C      5  
ATOM   9751  O O      . VAL A 1 69  ? 35.313 -11.695 1.345   1.00 0.00 ? 282 VAL A O      5  
ATOM   9752  C CB     . VAL A 1 69  ? 35.339 -8.451  1.360   1.00 0.00 ? 282 VAL A CB     5  
ATOM   9753  C CG1    . VAL A 1 69  ? 36.114 -8.113  0.085   1.00 0.00 ? 282 VAL A CG1    5  
ATOM   9754  C CG2    . VAL A 1 69  ? 34.692 -7.200  1.956   1.00 0.00 ? 282 VAL A CG2    5  
ATOM   9755  H H      . VAL A 1 69  ? 34.022 -9.586  3.160   1.00 0.00 ? 282 VAL A H      5  
ATOM   9756  H HA     . VAL A 1 69  ? 33.589 -9.153  0.357   1.00 0.00 ? 282 VAL A HA     5  
ATOM   9757  H HB     . VAL A 1 69  ? 36.049 -8.841  2.090   1.00 0.00 ? 282 VAL A HB     5  
ATOM   9758  H HG11   . VAL A 1 69  ? 36.163 -8.995  -0.554  1.00 0.00 ? 282 VAL A HG11   5  
ATOM   9759  H HG12   . VAL A 1 69  ? 35.607 -7.308  -0.446  1.00 0.00 ? 282 VAL A HG12   5  
ATOM   9760  H HG13   . VAL A 1 69  ? 37.124 -7.797  0.346   1.00 0.00 ? 282 VAL A HG13   5  
ATOM   9761  H HG21   . VAL A 1 69  ? 33.685 -7.439  2.300   1.00 0.00 ? 282 VAL A HG21   5  
ATOM   9762  H HG22   . VAL A 1 69  ? 35.289 -6.847  2.798   1.00 0.00 ? 282 VAL A HG22   5  
ATOM   9763  H HG23   . VAL A 1 69  ? 34.640 -6.420  1.196   1.00 0.00 ? 282 VAL A HG23   5  
ATOM   9764  N N      . ALA A 1 70  ? 34.939 -10.941 -0.754  1.00 0.00 ? 283 ALA A N      5  
ATOM   9765  C CA     . ALA A 1 70  ? 35.490 -12.122 -1.396  1.00 0.00 ? 283 ALA A CA     5  
ATOM   9766  C C      . ALA A 1 70  ? 36.984 -11.908 -1.651  1.00 0.00 ? 283 ALA A C      5  
ATOM   9767  O O      . ALA A 1 70  ? 37.368 -11.321 -2.662  1.00 0.00 ? 283 ALA A O      5  
ATOM   9768  C CB     . ALA A 1 70  ? 34.715 -12.413 -2.683  1.00 0.00 ? 283 ALA A CB     5  
ATOM   9769  H H      . ALA A 1 70  ? 34.603 -10.237 -1.380  1.00 0.00 ? 283 ALA A H      5  
ATOM   9770  H HA     . ALA A 1 70  ? 35.362 -12.961 -0.713  1.00 0.00 ? 283 ALA A HA     5  
ATOM   9771  H HB1    . ALA A 1 70  ? 34.244 -11.496 -3.038  1.00 0.00 ? 283 ALA A HB1    5  
ATOM   9772  H HB2    . ALA A 1 70  ? 35.401 -12.786 -3.444  1.00 0.00 ? 283 ALA A HB2    5  
ATOM   9773  H HB3    . ALA A 1 70  ? 33.949 -13.161 -2.484  1.00 0.00 ? 283 ALA A HB3    5  
ATOM   9774  N N      . THR A 1 71  ? 37.786 -12.396 -0.717  1.00 0.00 ? 284 THR A N      5  
ATOM   9775  C CA     . THR A 1 71  ? 39.230 -12.267 -0.827  1.00 0.00 ? 284 THR A CA     5  
ATOM   9776  C C      . THR A 1 71  ? 39.924 -13.096 0.255   1.00 0.00 ? 284 THR A C      5  
ATOM   9777  O O      . THR A 1 71  ? 39.264 -13.693 1.104   1.00 0.00 ? 284 THR A O      5  
ATOM   9778  C CB     . THR A 1 71  ? 39.576 -10.778 -0.767  1.00 0.00 ? 284 THR A CB     5  
ATOM   9779  O OG1    . THR A 1 71  ? 40.364 -10.652 0.413   1.00 0.00 ? 284 THR A OG1    5  
ATOM   9780  C CG2    . THR A 1 71  ? 38.352 -9.902  -0.493  1.00 0.00 ? 284 THR A CG2    5  
ATOM   9781  H H      . THR A 1 71  ? 37.467 -12.873 0.102   1.00 0.00 ? 284 THR A H      5  
ATOM   9782  H HA     . THR A 1 71  ? 39.538 -12.674 -1.790  1.00 0.00 ? 284 THR A HA     5  
ATOM   9783  H HB     . THR A 1 71  ? 40.087 -10.460 -1.676  1.00 0.00 ? 284 THR A HB     5  
ATOM   9784  H HG1    . THR A 1 71  ? 40.841 -9.773  0.414   1.00 0.00 ? 284 THR A HG1    5  
ATOM   9785  H HG21   . THR A 1 71  ? 37.646 -10.450 0.131   1.00 0.00 ? 284 THR A HG21   5  
ATOM   9786  H HG22   . THR A 1 71  ? 38.663 -8.994  0.022   1.00 0.00 ? 284 THR A HG22   5  
ATOM   9787  H HG23   . THR A 1 71  ? 37.875 -9.640  -1.437  1.00 0.00 ? 284 THR A HG23   5  
ATOM   9788  N N      . PRO A 1 72  ? 41.282 -13.108 0.187   1.00 0.00 ? 285 PRO A N      5  
ATOM   9789  C CA     . PRO A 1 72  ? 42.073 -13.855 1.150   1.00 0.00 ? 285 PRO A CA     5  
ATOM   9790  C C      . PRO A 1 72  ? 42.113 -13.137 2.500   1.00 0.00 ? 285 PRO A C      5  
ATOM   9791  O O      . PRO A 1 72  ? 42.293 -13.770 3.539   1.00 0.00 ? 285 PRO A O      5  
ATOM   9792  C CB     . PRO A 1 72  ? 43.445 -13.992 0.510   1.00 0.00 ? 285 PRO A CB     5  
ATOM   9793  C CG     . PRO A 1 72  ? 43.510 -12.926 -0.571  1.00 0.00 ? 285 PRO A CG     5  
ATOM   9794  C CD     . PRO A 1 72  ? 42.098 -12.414 -0.805  1.00 0.00 ? 285 PRO A CD     5  
ATOM   9795  H HA     . PRO A 1 72  ? 41.656 -14.746 1.327   1.00 0.00 ? 285 PRO A HA     5  
ATOM   9796  H HB2    . PRO A 1 72  ? 44.236 -13.849 1.247   1.00 0.00 ? 285 PRO A HB2    5  
ATOM   9797  H HB3    . PRO A 1 72  ? 43.581 -14.987 0.086   1.00 0.00 ? 285 PRO A HB3    5  
ATOM   9798  H HG2    . PRO A 1 72  ? 44.166 -12.111 -0.265  1.00 0.00 ? 285 PRO A HG2    5  
ATOM   9799  H HG3    . PRO A 1 72  ? 43.923 -13.340 -1.491  1.00 0.00 ? 285 PRO A HG3    5  
ATOM   9800  H HD2    . PRO A 1 72  ? 42.042 -11.333 -0.677  1.00 0.00 ? 285 PRO A HD2    5  
ATOM   9801  H HD3    . PRO A 1 72  ? 41.759 -12.633 -1.818  1.00 0.00 ? 285 PRO A HD3    5  
ATOM   9802  N N      . ASN A 1 73  ? 41.941 -11.824 2.442   1.00 0.00 ? 286 ASN A N      5  
ATOM   9803  C CA     . ASN A 1 73  ? 41.956 -11.014 3.648   1.00 0.00 ? 286 ASN A CA     5  
ATOM   9804  C C      . ASN A 1 73  ? 40.791 -10.022 3.604   1.00 0.00 ? 286 ASN A C      5  
ATOM   9805  O O      . ASN A 1 73  ? 41.000 -8.811  3.630   1.00 0.00 ? 286 ASN A O      5  
ATOM   9806  C CB     . ASN A 1 73  ? 43.255 -10.212 3.758   1.00 0.00 ? 286 ASN A CB     5  
ATOM   9807  C CG     . ASN A 1 73  ? 44.316 -10.993 4.536   1.00 0.00 ? 286 ASN A CG     5  
ATOM   9808  O OD1    . ASN A 1 73  ? 45.137 -11.701 3.975   1.00 0.00 ? 286 ASN A OD1    5  
ATOM   9809  N ND2    . ASN A 1 73  ? 44.255 -10.825 5.853   1.00 0.00 ? 286 ASN A ND2    5  
ATOM   9810  H H      . ASN A 1 73  ? 41.796 -11.317 1.593   1.00 0.00 ? 286 ASN A H      5  
ATOM   9811  H HA     . ASN A 1 73  ? 41.869 -11.723 4.471   1.00 0.00 ? 286 ASN A HA     5  
ATOM   9812  H HB2    . ASN A 1 73  ? 43.627 -9.978  2.761   1.00 0.00 ? 286 ASN A HB2    5  
ATOM   9813  H HB3    . ASN A 1 73  ? 43.059 -9.262  4.256   1.00 0.00 ? 286 ASN A HB3    5  
ATOM   9814  H HD21   . ASN A 1 73  ? 43.556 -10.229 6.248   1.00 0.00 ? 286 ASN A HD21   5  
ATOM   9815  H HD22   . ASN A 1 73  ? 44.908 -11.294 6.448   1.00 0.00 ? 286 ASN A HD22   5  
ATOM   9816  N N      . PRO A 1 74  ? 39.556 -10.589 3.538   1.00 0.00 ? 287 PRO A N      5  
ATOM   9817  C CA     . PRO A 1 74  ? 38.358 -9.769  3.491   1.00 0.00 ? 287 PRO A CA     5  
ATOM   9818  C C      . PRO A 1 74  ? 38.048 -9.172  4.865   1.00 0.00 ? 287 PRO A C      5  
ATOM   9819  O O      . PRO A 1 74  ? 38.907 -9.151  5.744   1.00 0.00 ? 287 PRO A O      5  
ATOM   9820  C CB     . PRO A 1 74  ? 37.265 -10.697 2.987   1.00 0.00 ? 287 PRO A CB     5  
ATOM   9821  C CG     . PRO A 1 74  ? 37.781 -12.109 3.213   1.00 0.00 ? 287 PRO A CG     5  
ATOM   9822  C CD     . PRO A 1 74  ? 39.269 -12.021 3.507   1.00 0.00 ? 287 PRO A CD     5  
ATOM   9823  H HA     . PRO A 1 74  ? 38.494 -8.989  2.879   1.00 0.00 ? 287 PRO A HA     5  
ATOM   9824  H HB2    . PRO A 1 74  ? 36.332 -10.532 3.525   1.00 0.00 ? 287 PRO A HB2    5  
ATOM   9825  H HB3    . PRO A 1 74  ? 37.059 -10.521 1.931   1.00 0.00 ? 287 PRO A HB3    5  
ATOM   9826  H HG2    . PRO A 1 74  ? 37.255 -12.580 4.044   1.00 0.00 ? 287 PRO A HG2    5  
ATOM   9827  H HG3    . PRO A 1 74  ? 37.602 -12.726 2.332   1.00 0.00 ? 287 PRO A HG3    5  
ATOM   9828  H HD2    . PRO A 1 74  ? 39.515 -12.494 4.457   1.00 0.00 ? 287 PRO A HD2    5  
ATOM   9829  H HD3    . PRO A 1 74  ? 39.856 -12.525 2.738   1.00 0.00 ? 287 PRO A HD3    5  
ATOM   9830  N N      . VAL A 1 75  ? 36.817 -8.700  5.006   1.00 0.00 ? 288 VAL A N      5  
ATOM   9831  C CA     . VAL A 1 75  ? 36.383 -8.104  6.258   1.00 0.00 ? 288 VAL A CA     5  
ATOM   9832  C C      . VAL A 1 75  ? 34.870 -8.279  6.404   1.00 0.00 ? 288 VAL A C      5  
ATOM   9833  O O      . VAL A 1 75  ? 34.180 -8.583  5.431   1.00 0.00 ? 288 VAL A O      5  
ATOM   9834  C CB     . VAL A 1 75  ? 36.825 -6.640  6.321   1.00 0.00 ? 288 VAL A CB     5  
ATOM   9835  C CG1    . VAL A 1 75  ? 36.005 -5.865  7.353   1.00 0.00 ? 288 VAL A CG1    5  
ATOM   9836  C CG2    . VAL A 1 75  ? 38.322 -6.532  6.616   1.00 0.00 ? 288 VAL A CG2    5  
ATOM   9837  H H      . VAL A 1 75  ? 36.124 -8.721  4.285   1.00 0.00 ? 288 VAL A H      5  
ATOM   9838  H HA     . VAL A 1 75  ? 36.878 -8.641  7.067   1.00 0.00 ? 288 VAL A HA     5  
ATOM   9839  H HB     . VAL A 1 75  ? 36.643 -6.193  5.344   1.00 0.00 ? 288 VAL A HB     5  
ATOM   9840  H HG11   . VAL A 1 75  ? 36.159 -6.299  8.341   1.00 0.00 ? 288 VAL A HG11   5  
ATOM   9841  H HG12   . VAL A 1 75  ? 36.323 -4.822  7.361   1.00 0.00 ? 288 VAL A HG12   5  
ATOM   9842  H HG13   . VAL A 1 75  ? 34.947 -5.920  7.094   1.00 0.00 ? 288 VAL A HG13   5  
ATOM   9843  H HG21   . VAL A 1 75  ? 38.881 -6.595  5.683   1.00 0.00 ? 288 VAL A HG21   5  
ATOM   9844  H HG22   . VAL A 1 75  ? 38.529 -5.577  7.100   1.00 0.00 ? 288 VAL A HG22   5  
ATOM   9845  H HG23   . VAL A 1 75  ? 38.623 -7.345  7.276   1.00 0.00 ? 288 VAL A HG23   5  
ATOM   9846  N N      . GLU A 1 76  ? 34.398 -8.079  7.625   1.00 0.00 ? 289 GLU A N      5  
ATOM   9847  C CA     . GLU A 1 76  ? 32.979 -8.210  7.911   1.00 0.00 ? 289 GLU A CA     5  
ATOM   9848  C C      . GLU A 1 76  ? 32.309 -6.835  7.918   1.00 0.00 ? 289 GLU A C      5  
ATOM   9849  O O      . GLU A 1 76  ? 32.673 -5.969  8.713   1.00 0.00 ? 289 GLU A O      5  
ATOM   9850  C CB     . GLU A 1 76  ? 32.752 -8.938  9.236   1.00 0.00 ? 289 GLU A CB     5  
ATOM   9851  C CG     . GLU A 1 76  ? 31.361 -9.572  9.283   1.00 0.00 ? 289 GLU A CG     5  
ATOM   9852  C CD     . GLU A 1 76  ? 31.022 -10.049 10.697  1.00 0.00 ? 289 GLU A CD     5  
ATOM   9853  O OE1    . GLU A 1 76  ? 31.540 -11.083 11.142  1.00 0.00 ? 289 GLU A OE1    5  
ATOM   9854  O OE2    . GLU A 1 76  ? 30.188 -9.303  11.338  1.00 0.00 ? 289 GLU A OE2    5  
ATOM   9855  H H      . GLU A 1 76  ? 34.966 -7.831  8.411   1.00 0.00 ? 289 GLU A H      5  
ATOM   9856  H HA     . GLU A 1 76  ? 32.576 -8.814  7.098   1.00 0.00 ? 289 GLU A HA     5  
ATOM   9857  H HB2    . GLU A 1 76  ? 33.511 -9.710  9.367   1.00 0.00 ? 289 GLU A HB2    5  
ATOM   9858  H HB3    . GLU A 1 76  ? 32.864 -8.238  10.064  1.00 0.00 ? 289 GLU A HB3    5  
ATOM   9859  H HG2    . GLU A 1 76  ? 30.616 -8.848  8.951   1.00 0.00 ? 289 GLU A HG2    5  
ATOM   9860  H HG3    . GLU A 1 76  ? 31.317 -10.413 8.590   1.00 0.00 ? 289 GLU A HG3    5  
ATOM   9861  H HE2    . GLU A 1 76  ? 29.260 -9.659  11.233  1.00 0.00 ? 289 GLU A HE2    5  
ATOM   9862  N N      . LEU A 1 77  ? 31.345 -6.676  7.024   1.00 0.00 ? 290 LEU A N      5  
ATOM   9863  C CA     . LEU A 1 77  ? 30.622 -5.421  6.918   1.00 0.00 ? 290 LEU A CA     5  
ATOM   9864  C C      . LEU A 1 77  ? 29.327 -5.513  7.728   1.00 0.00 ? 290 LEU A C      5  
ATOM   9865  O O      . LEU A 1 77  ? 28.776 -6.599  7.902   1.00 0.00 ? 290 LEU A O      5  
ATOM   9866  C CB     . LEU A 1 77  ? 30.404 -5.049  5.450   1.00 0.00 ? 290 LEU A CB     5  
ATOM   9867  C CG     . LEU A 1 77  ? 31.603 -4.431  4.730   1.00 0.00 ? 290 LEU A CG     5  
ATOM   9868  C CD1    . LEU A 1 77  ? 31.333 -4.297  3.230   1.00 0.00 ? 290 LEU A CD1    5  
ATOM   9869  C CD2    . LEU A 1 77  ? 31.992 -3.093  5.363   1.00 0.00 ? 290 LEU A CD2    5  
ATOM   9870  H H      . LEU A 1 77  ? 31.057 -7.386  6.382   1.00 0.00 ? 290 LEU A H      5  
ATOM   9871  H HA     . LEU A 1 77  ? 31.248 -4.644  7.357   1.00 0.00 ? 290 LEU A HA     5  
ATOM   9872  H HB2    . LEU A 1 77  ? 30.105 -5.949  4.910   1.00 0.00 ? 290 LEU A HB2    5  
ATOM   9873  H HB3    . LEU A 1 77  ? 29.569 -4.351  5.393   1.00 0.00 ? 290 LEU A HB3    5  
ATOM   9874  H HG     . LEU A 1 77  ? 32.454 -5.100  4.844   1.00 0.00 ? 290 LEU A HG     5  
ATOM   9875  H HD11   . LEU A 1 77  ? 32.043 -4.909  2.676   1.00 0.00 ? 290 LEU A HD11   5  
ATOM   9876  H HD12   . LEU A 1 77  ? 30.318 -4.631  3.012   1.00 0.00 ? 290 LEU A HD12   5  
ATOM   9877  H HD13   . LEU A 1 77  ? 31.442 -3.253  2.932   1.00 0.00 ? 290 LEU A HD13   5  
ATOM   9878  H HD21   . LEU A 1 77  ? 32.803 -3.250  6.075   1.00 0.00 ? 290 LEU A HD21   5  
ATOM   9879  H HD22   . LEU A 1 77  ? 32.320 -2.404  4.586   1.00 0.00 ? 290 LEU A HD22   5  
ATOM   9880  H HD23   . LEU A 1 77  ? 31.130 -2.673  5.882   1.00 0.00 ? 290 LEU A HD23   5  
ATOM   9881  N N      . GLY A 1 78  ? 28.879 -4.359  8.201   1.00 0.00 ? 291 GLY A N      5  
ATOM   9882  C CA     . GLY A 1 78  ? 27.658 -4.296  8.988   1.00 0.00 ? 291 GLY A CA     5  
ATOM   9883  C C      . GLY A 1 78  ? 26.707 -3.230  8.440   1.00 0.00 ? 291 GLY A C      5  
ATOM   9884  O O      . GLY A 1 78  ? 26.961 -2.647  7.387   1.00 0.00 ? 291 GLY A O      5  
ATOM   9885  H H      . GLY A 1 78  ? 29.332 -3.481  8.055   1.00 0.00 ? 291 GLY A H      5  
ATOM   9886  H HA2    . GLY A 1 78  ? 27.166 -5.268  8.979   1.00 0.00 ? 291 GLY A HA2    5  
ATOM   9887  H HA3    . GLY A 1 78  ? 27.902 -4.072  10.026  1.00 0.00 ? 291 GLY A HA3    5  
ATOM   9888  N N      . PRO A 1 79  ? 25.601 -3.004  9.198   1.00 0.00 ? 292 PRO A N      5  
ATOM   9889  C CA     . PRO A 1 79  ? 24.610 -2.019  8.800   1.00 0.00 ? 292 PRO A CA     5  
ATOM   9890  C C      . PRO A 1 79  ? 25.118 -0.597  9.051   1.00 0.00 ? 292 PRO A C      5  
ATOM   9891  O O      . PRO A 1 79  ? 25.536 -0.271  10.161  1.00 0.00 ? 292 PRO A O      5  
ATOM   9892  C CB     . PRO A 1 79  ? 23.369 -2.359  9.610   1.00 0.00 ? 292 PRO A CB     5  
ATOM   9893  C CG     . PRO A 1 79  ? 23.850 -3.222  10.764  1.00 0.00 ? 292 PRO A CG     5  
ATOM   9894  C CD     . PRO A 1 79  ? 25.266 -3.675  10.450  1.00 0.00 ? 292 PRO A CD     5  
ATOM   9895  H HA     . PRO A 1 79  ? 24.438 -2.077  7.816   1.00 0.00 ? 292 PRO A HA     5  
ATOM   9896  H HB2    . PRO A 1 79  ? 22.881 -1.455  9.974   1.00 0.00 ? 292 PRO A HB2    5  
ATOM   9897  H HB3    . PRO A 1 79  ? 22.640 -2.891  9.001   1.00 0.00 ? 292 PRO A HB3    5  
ATOM   9898  H HG2    . PRO A 1 79  ? 23.828 -2.658  11.697  1.00 0.00 ? 292 PRO A HG2    5  
ATOM   9899  H HG3    . PRO A 1 79  ? 23.194 -4.083  10.896  1.00 0.00 ? 292 PRO A HG3    5  
ATOM   9900  H HD2    . PRO A 1 79  ? 25.957 -3.397  11.246  1.00 0.00 ? 292 PRO A HD2    5  
ATOM   9901  H HD3    . PRO A 1 79  ? 25.322 -4.759  10.345  1.00 0.00 ? 292 PRO A HD3    5  
ATOM   9902  N N      . GLY A 1 80  ? 25.064 0.211   8.003   1.00 0.00 ? 293 GLY A N      5  
ATOM   9903  C CA     . GLY A 1 80  ? 25.512 1.590   8.096   1.00 0.00 ? 293 GLY A CA     5  
ATOM   9904  C C      . GLY A 1 80  ? 26.823 1.793   7.332   1.00 0.00 ? 293 GLY A C      5  
ATOM   9905  O O      . GLY A 1 80  ? 27.507 2.797   7.522   1.00 0.00 ? 293 GLY A O      5  
ATOM   9906  H H      . GLY A 1 80  ? 24.721 -0.062  7.103   1.00 0.00 ? 293 GLY A H      5  
ATOM   9907  H HA2    . GLY A 1 80  ? 24.746 2.253   7.694   1.00 0.00 ? 293 GLY A HA2    5  
ATOM   9908  H HA3    . GLY A 1 80  ? 25.652 1.860   9.143   1.00 0.00 ? 293 GLY A HA3    5  
ATOM   9909  N N      . ALA A 1 81  ? 27.132 0.823   6.484   1.00 0.00 ? 294 ALA A N      5  
ATOM   9910  C CA     . ALA A 1 81  ? 28.347 0.883   5.690   1.00 0.00 ? 294 ALA A CA     5  
ATOM   9911  C C      . ALA A 1 81  ? 27.980 0.954   4.206   1.00 0.00 ? 294 ALA A C      5  
ATOM   9912  O O      . ALA A 1 81  ? 26.945 0.432   3.793   1.00 0.00 ? 294 ALA A O      5  
ATOM   9913  C CB     . ALA A 1 81  ? 29.229 -0.324  6.015   1.00 0.00 ? 294 ALA A CB     5  
ATOM   9914  H H      . ALA A 1 81  ? 26.570 0.010   6.334   1.00 0.00 ? 294 ALA A H      5  
ATOM   9915  H HA     . ALA A 1 81  ? 28.880 1.792   5.967   1.00 0.00 ? 294 ALA A HA     5  
ATOM   9916  H HB1    . ALA A 1 81  ? 29.609 -0.757  5.090   1.00 0.00 ? 294 ALA A HB1    5  
ATOM   9917  H HB2    . ALA A 1 81  ? 30.065 -0.006  6.637   1.00 0.00 ? 294 ALA A HB2    5  
ATOM   9918  H HB3    . ALA A 1 81  ? 28.641 -1.070  6.550   1.00 0.00 ? 294 ALA A HB3    5  
ATOM   9919  N N      . PHE A 1 82  ? 28.848 1.603   3.445   1.00 0.00 ? 295 PHE A N      5  
ATOM   9920  C CA     . PHE A 1 82  ? 28.627 1.749   2.016   1.00 0.00 ? 295 PHE A CA     5  
ATOM   9921  C C      . PHE A 1 82  ? 29.829 1.236   1.220   1.00 0.00 ? 295 PHE A C      5  
ATOM   9922  O O      . PHE A 1 82  ? 30.970 1.367   1.660   1.00 0.00 ? 295 PHE A O      5  
ATOM   9923  C CB     . PHE A 1 82  ? 28.449 3.244   1.741   1.00 0.00 ? 295 PHE A CB     5  
ATOM   9924  C CG     . PHE A 1 82  ? 29.486 4.132   2.432   1.00 0.00 ? 295 PHE A CG     5  
ATOM   9925  C CD1    . PHE A 1 82  ? 29.445 4.300   3.782   1.00 0.00 ? 295 PHE A CD1    5  
ATOM   9926  C CD2    . PHE A 1 82  ? 30.448 4.752   1.699   1.00 0.00 ? 295 PHE A CD2    5  
ATOM   9927  C CE1    . PHE A 1 82  ? 30.407 5.124   4.423   1.00 0.00 ? 295 PHE A CE1    5  
ATOM   9928  C CE2    . PHE A 1 82  ? 31.411 5.575   2.341   1.00 0.00 ? 295 PHE A CE2    5  
ATOM   9929  C CZ     . PHE A 1 82  ? 31.370 5.744   3.689   1.00 0.00 ? 295 PHE A CZ     5  
ATOM   9930  H H      . PHE A 1 82  ? 29.687 2.025   3.788   1.00 0.00 ? 295 PHE A H      5  
ATOM   9931  H HA     . PHE A 1 82  ? 27.747 1.158   1.763   1.00 0.00 ? 295 PHE A HA     5  
ATOM   9932  H HB2    . PHE A 1 82  ? 28.500 3.413   0.666   1.00 0.00 ? 295 PHE A HB2    5  
ATOM   9933  H HB3    . PHE A 1 82  ? 27.454 3.546   2.064   1.00 0.00 ? 295 PHE A HB3    5  
ATOM   9934  H HD1    . PHE A 1 82  ? 28.674 3.803   4.370   1.00 0.00 ? 295 PHE A HD1    5  
ATOM   9935  H HD2    . PHE A 1 82  ? 30.481 4.617   0.617   1.00 0.00 ? 295 PHE A HD2    5  
ATOM   9936  H HE1    . PHE A 1 82  ? 30.374 5.259   5.505   1.00 0.00 ? 295 PHE A HE1    5  
ATOM   9937  H HE2    . PHE A 1 82  ? 32.182 6.073   1.752   1.00 0.00 ? 295 PHE A HE2    5  
ATOM   9938  H HZ     . PHE A 1 82  ? 32.108 6.376   4.182   1.00 0.00 ? 295 PHE A HZ     5  
ATOM   9939  N N      . PHE A 1 83  ? 29.532 0.663   0.064   1.00 0.00 ? 296 PHE A N      5  
ATOM   9940  C CA     . PHE A 1 83  ? 30.574 0.130   -0.797  1.00 0.00 ? 296 PHE A CA     5  
ATOM   9941  C C      . PHE A 1 83  ? 30.161 0.204   -2.268  1.00 0.00 ? 296 PHE A C      5  
ATOM   9942  O O      . PHE A 1 83  ? 28.979 0.339   -2.579  1.00 0.00 ? 296 PHE A O      5  
ATOM   9943  C CB     . PHE A 1 83  ? 30.769 -1.336  -0.407  1.00 0.00 ? 296 PHE A CB     5  
ATOM   9944  C CG     . PHE A 1 83  ? 29.471 -2.146  -0.359  1.00 0.00 ? 296 PHE A CG     5  
ATOM   9945  C CD1    . PHE A 1 83  ? 29.029 -2.789  -1.472  1.00 0.00 ? 296 PHE A CD1    5  
ATOM   9946  C CD2    . PHE A 1 83  ? 28.759 -2.220  0.798   1.00 0.00 ? 296 PHE A CD2    5  
ATOM   9947  C CE1    . PHE A 1 83  ? 27.823 -3.540  -1.427  1.00 0.00 ? 296 PHE A CE1    5  
ATOM   9948  C CE2    . PHE A 1 83  ? 27.555 -2.971  0.843   1.00 0.00 ? 296 PHE A CE2    5  
ATOM   9949  C CZ     . PHE A 1 83  ? 27.112 -3.615  -0.271  1.00 0.00 ? 296 PHE A CZ     5  
ATOM   9950  H H      . PHE A 1 83  ? 28.601 0.561   -0.287  1.00 0.00 ? 296 PHE A H      5  
ATOM   9951  H HA     . PHE A 1 83  ? 31.465 0.738   -0.640  1.00 0.00 ? 296 PHE A HA     5  
ATOM   9952  H HB2    . PHE A 1 83  ? 31.450 -1.804  -1.119  1.00 0.00 ? 296 PHE A HB2    5  
ATOM   9953  H HB3    . PHE A 1 83  ? 31.249 -1.382  0.570   1.00 0.00 ? 296 PHE A HB3    5  
ATOM   9954  H HD1    . PHE A 1 83  ? 29.599 -2.729  -2.399  1.00 0.00 ? 296 PHE A HD1    5  
ATOM   9955  H HD2    . PHE A 1 83  ? 29.114 -1.705  1.690   1.00 0.00 ? 296 PHE A HD2    5  
ATOM   9956  H HE1    . PHE A 1 83  ? 27.470 -4.056  -2.320  1.00 0.00 ? 296 PHE A HE1    5  
ATOM   9957  H HE2    . PHE A 1 83  ? 26.985 -3.032  1.770   1.00 0.00 ? 296 PHE A HE2    5  
ATOM   9958  H HZ     . PHE A 1 83  ? 26.188 -4.191  -0.236  1.00 0.00 ? 296 PHE A HZ     5  
ATOM   9959  N N      . GLY A 1 84  ? 31.159 0.111   -3.135  1.00 0.00 ? 297 GLY A N      5  
ATOM   9960  C CA     . GLY A 1 84  ? 30.914 0.165   -4.567  1.00 0.00 ? 297 GLY A CA     5  
ATOM   9961  C C      . GLY A 1 84  ? 30.783 1.612   -5.045  1.00 0.00 ? 297 GLY A C      5  
ATOM   9962  O O      . GLY A 1 84  ? 30.027 1.897   -5.972  1.00 0.00 ? 297 GLY A O      5  
ATOM   9963  H H      . GLY A 1 84  ? 32.118 0.001   -2.875  1.00 0.00 ? 297 GLY A H      5  
ATOM   9964  H HA2    . GLY A 1 84  ? 31.731 -0.325  -5.097  1.00 0.00 ? 297 GLY A HA2    5  
ATOM   9965  H HA3    . GLY A 1 84  ? 30.004 -0.385  -4.805  1.00 0.00 ? 297 GLY A HA3    5  
ATOM   9966  N N      . GLU A 1 85  ? 31.533 2.489   -4.393  1.00 0.00 ? 298 GLU A N      5  
ATOM   9967  C CA     . GLU A 1 85  ? 31.509 3.899   -4.740  1.00 0.00 ? 298 GLU A CA     5  
ATOM   9968  C C      . GLU A 1 85  ? 32.779 4.278   -5.504  1.00 0.00 ? 298 GLU A C      5  
ATOM   9969  O O      . GLU A 1 85  ? 32.807 5.287   -6.207  1.00 0.00 ? 298 GLU A O      5  
ATOM   9970  C CB     . GLU A 1 85  ? 31.340 4.769   -3.492  1.00 0.00 ? 298 GLU A CB     5  
ATOM   9971  C CG     . GLU A 1 85  ? 32.555 4.647   -2.571  1.00 0.00 ? 298 GLU A CG     5  
ATOM   9972  C CD     . GLU A 1 85  ? 32.422 3.437   -1.644  1.00 0.00 ? 298 GLU A CD     5  
ATOM   9973  O OE1    . GLU A 1 85  ? 31.444 3.341   -0.888  1.00 0.00 ? 298 GLU A OE1    5  
ATOM   9974  O OE2    . GLU A 1 85  ? 33.380 2.578   -1.728  1.00 0.00 ? 298 GLU A OE2    5  
ATOM   9975  H H      . GLU A 1 85  ? 32.145 2.248   -3.639  1.00 0.00 ? 298 GLU A H      5  
ATOM   9976  H HA     . GLU A 1 85  ? 30.639 4.025   -5.384  1.00 0.00 ? 298 GLU A HA     5  
ATOM   9977  H HB2    . GLU A 1 85  ? 31.204 5.810   -3.786  1.00 0.00 ? 298 GLU A HB2    5  
ATOM   9978  H HB3    . GLU A 1 85  ? 30.440 4.469   -2.956  1.00 0.00 ? 298 GLU A HB3    5  
ATOM   9979  H HG2    . GLU A 1 85  ? 33.462 4.554   -3.168  1.00 0.00 ? 298 GLU A HG2    5  
ATOM   9980  H HG3    . GLU A 1 85  ? 32.657 5.555   -1.977  1.00 0.00 ? 298 GLU A HG3    5  
ATOM   9981  H HE2    . GLU A 1 85  ? 33.029 1.657   -1.559  1.00 0.00 ? 298 GLU A HE2    5  
ATOM   9982  N N      . MET A 1 86  ? 33.800 3.449   -5.341  1.00 0.00 ? 299 MET A N      5  
ATOM   9983  C CA     . MET A 1 86  ? 35.070 3.685   -6.006  1.00 0.00 ? 299 MET A CA     5  
ATOM   9984  C C      . MET A 1 86  ? 34.881 3.808   -7.519  1.00 0.00 ? 299 MET A C      5  
ATOM   9985  O O      . MET A 1 86  ? 35.502 4.656   -8.159  1.00 0.00 ? 299 MET A O      5  
ATOM   9986  C CB     . MET A 1 86  ? 36.027 2.530   -5.704  1.00 0.00 ? 299 MET A CB     5  
ATOM   9987  C CG     . MET A 1 86  ? 37.483 2.998   -5.750  1.00 0.00 ? 299 MET A CG     5  
ATOM   9988  S SD     . MET A 1 86  ? 38.480 1.804   -6.624  1.00 0.00 ? 299 MET A SD     5  
ATOM   9989  C CE     . MET A 1 86  ? 39.837 2.846   -7.134  1.00 0.00 ? 299 MET A CE     5  
ATOM   9990  H H      . MET A 1 86  ? 33.770 2.631   -4.766  1.00 0.00 ? 299 MET A H      5  
ATOM   9991  H HA     . MET A 1 86  ? 35.443 4.625   -5.601  1.00 0.00 ? 299 MET A HA     5  
ATOM   9992  H HB2    . MET A 1 86  ? 35.806 2.118   -4.719  1.00 0.00 ? 299 MET A HB2    5  
ATOM   9993  H HB3    . MET A 1 86  ? 35.876 1.728   -6.427  1.00 0.00 ? 299 MET A HB3    5  
ATOM   9994  H HG2    . MET A 1 86  ? 37.546 3.968   -6.245  1.00 0.00 ? 299 MET A HG2    5  
ATOM   9995  H HG3    . MET A 1 86  ? 37.864 3.131   -4.738  1.00 0.00 ? 299 MET A HG3    5  
ATOM   9996  H HE1    . MET A 1 86  ? 39.894 2.863   -8.222  1.00 0.00 ? 299 MET A HE1    5  
ATOM   9997  H HE2    . MET A 1 86  ? 39.677 3.858   -6.763  1.00 0.00 ? 299 MET A HE2    5  
ATOM   9998  H HE3    . MET A 1 86  ? 40.769 2.453   -6.728  1.00 0.00 ? 299 MET A HE3    5  
ATOM   9999  N N      . ALA A 1 87  ? 34.021 2.950   -8.048  1.00 0.00 ? 300 ALA A N      5  
ATOM   10000 C CA     . ALA A 1 87  ? 33.743 2.952   -9.474  1.00 0.00 ? 300 ALA A CA     5  
ATOM   10001 C C      . ALA A 1 87  ? 32.904 4.182   -9.824  1.00 0.00 ? 300 ALA A C      5  
ATOM   10002 O O      . ALA A 1 87  ? 33.180 4.868   -10.807 1.00 0.00 ? 300 ALA A O      5  
ATOM   10003 C CB     . ALA A 1 87  ? 33.049 1.644   -9.861  1.00 0.00 ? 300 ALA A CB     5  
ATOM   10004 H H      . ALA A 1 87  ? 33.521 2.263   -7.521  1.00 0.00 ? 300 ALA A H      5  
ATOM   10005 H HA     . ALA A 1 87  ? 34.697 3.012   -9.999  1.00 0.00 ? 300 ALA A HA     5  
ATOM   10006 H HB1    . ALA A 1 87  ? 33.799 0.909   -10.156 1.00 0.00 ? 300 ALA A HB1    5  
ATOM   10007 H HB2    . ALA A 1 87  ? 32.485 1.265   -9.008  1.00 0.00 ? 300 ALA A HB2    5  
ATOM   10008 H HB3    . ALA A 1 87  ? 32.371 1.826   -10.694 1.00 0.00 ? 300 ALA A HB3    5  
ATOM   10009 N N      . LEU A 1 88  ? 31.895 4.425   -8.999  1.00 0.00 ? 301 LEU A N      5  
ATOM   10010 C CA     . LEU A 1 88  ? 31.014 5.561   -9.208  1.00 0.00 ? 301 LEU A CA     5  
ATOM   10011 C C      . LEU A 1 88  ? 31.799 6.857   -8.995  1.00 0.00 ? 301 LEU A C      5  
ATOM   10012 O O      . LEU A 1 88  ? 31.364 7.927   -9.415  1.00 0.00 ? 301 LEU A O      5  
ATOM   10013 C CB     . LEU A 1 88  ? 29.770 5.443   -8.327  1.00 0.00 ? 301 LEU A CB     5  
ATOM   10014 C CG     . LEU A 1 88  ? 28.672 4.507   -8.835  1.00 0.00 ? 301 LEU A CG     5  
ATOM   10015 C CD1    . LEU A 1 88  ? 27.392 4.665   -8.015  1.00 0.00 ? 301 LEU A CD1    5  
ATOM   10016 C CD2    . LEU A 1 88  ? 28.425 4.714   -10.331 1.00 0.00 ? 301 LEU A CD2    5  
ATOM   10017 H H      . LEU A 1 88  ? 31.678 3.862   -8.202  1.00 0.00 ? 301 LEU A H      5  
ATOM   10018 H HA     . LEU A 1 88  ? 30.678 5.528   -10.245 1.00 0.00 ? 301 LEU A HA     5  
ATOM   10019 H HB2    . LEU A 1 88  ? 30.080 5.105   -7.338  1.00 0.00 ? 301 LEU A HB2    5  
ATOM   10020 H HB3    . LEU A 1 88  ? 29.342 6.438   -8.203  1.00 0.00 ? 301 LEU A HB3    5  
ATOM   10021 H HG     . LEU A 1 88  ? 29.014 3.479   -8.705  1.00 0.00 ? 301 LEU A HG     5  
ATOM   10022 H HD11   . LEU A 1 88  ? 27.505 5.499   -7.322  1.00 0.00 ? 301 LEU A HD11   5  
ATOM   10023 H HD12   . LEU A 1 88  ? 26.553 4.859   -8.684  1.00 0.00 ? 301 LEU A HD12   5  
ATOM   10024 H HD13   . LEU A 1 88  ? 27.204 3.749   -7.453  1.00 0.00 ? 301 LEU A HD13   5  
ATOM   10025 H HD21   . LEU A 1 88  ? 29.127 4.107   -10.903 1.00 0.00 ? 301 LEU A HD21   5  
ATOM   10026 H HD22   . LEU A 1 88  ? 27.405 4.416   -10.575 1.00 0.00 ? 301 LEU A HD22   5  
ATOM   10027 H HD23   . LEU A 1 88  ? 28.566 5.765   -10.580 1.00 0.00 ? 301 LEU A HD23   5  
ATOM   10028 N N      . ILE A 1 89  ? 32.944 6.716   -8.341  1.00 0.00 ? 302 ILE A N      5  
ATOM   10029 C CA     . ILE A 1 89  ? 33.793 7.862   -8.066  1.00 0.00 ? 302 ILE A CA     5  
ATOM   10030 C C      . ILE A 1 89  ? 34.715 8.106   -9.262  1.00 0.00 ? 302 ILE A C      5  
ATOM   10031 O O      . ILE A 1 89  ? 34.885 9.244   -9.699  1.00 0.00 ? 302 ILE A O      5  
ATOM   10032 C CB     . ILE A 1 89  ? 34.540 7.672   -6.744  1.00 0.00 ? 302 ILE A CB     5  
ATOM   10033 C CG1    . ILE A 1 89  ? 33.598 7.857   -5.551  1.00 0.00 ? 302 ILE A CG1    5  
ATOM   10034 C CG2    . ILE A 1 89  ? 35.756 8.595   -6.663  1.00 0.00 ? 302 ILE A CG2    5  
ATOM   10035 C CD1    . ILE A 1 89  ? 34.140 7.146   -4.310  1.00 0.00 ? 302 ILE A CD1    5  
ATOM   10036 H H      . ILE A 1 89  ? 33.291 5.842   -8.002  1.00 0.00 ? 302 ILE A H      5  
ATOM   10037 H HA     . ILE A 1 89  ? 33.144 8.730   -7.948  1.00 0.00 ? 302 ILE A HA     5  
ATOM   10038 H HB     . ILE A 1 89  ? 34.909 6.647   -6.705  1.00 0.00 ? 302 ILE A HB     5  
ATOM   10039 H HG12   . ILE A 1 89  ? 33.475 8.920   -5.342  1.00 0.00 ? 302 ILE A HG12   5  
ATOM   10040 H HG13   . ILE A 1 89  ? 32.611 7.465   -5.799  1.00 0.00 ? 302 ILE A HG13   5  
ATOM   10041 H HG21   . ILE A 1 89  ? 36.667 8.009   -6.786  1.00 0.00 ? 302 ILE A HG21   5  
ATOM   10042 H HG22   . ILE A 1 89  ? 35.696 9.346   -7.451  1.00 0.00 ? 302 ILE A HG22   5  
ATOM   10043 H HG23   . ILE A 1 89  ? 35.772 9.090   -5.691  1.00 0.00 ? 302 ILE A HG23   5  
ATOM   10044 H HD11   . ILE A 1 89  ? 35.139 7.519   -4.086  1.00 0.00 ? 302 ILE A HD11   5  
ATOM   10045 H HD12   . ILE A 1 89  ? 33.480 7.341   -3.463  1.00 0.00 ? 302 ILE A HD12   5  
ATOM   10046 H HD13   . ILE A 1 89  ? 34.184 6.074   -4.495  1.00 0.00 ? 302 ILE A HD13   5  
ATOM   10047 N N      . SER A 1 90  ? 35.288 7.019   -9.759  1.00 0.00 ? 303 SER A N      5  
ATOM   10048 C CA     . SER A 1 90  ? 36.189 7.102   -10.896 1.00 0.00 ? 303 SER A CA     5  
ATOM   10049 C C      . SER A 1 90  ? 35.649 6.259   -12.053 1.00 0.00 ? 303 SER A C      5  
ATOM   10050 O O      . SER A 1 90  ? 35.434 6.771   -13.151 1.00 0.00 ? 303 SER A O      5  
ATOM   10051 C CB     . SER A 1 90  ? 37.597 6.640   -10.518 1.00 0.00 ? 303 SER A CB     5  
ATOM   10052 O OG     . SER A 1 90  ? 38.351 7.679   -9.897  1.00 0.00 ? 303 SER A OG     5  
ATOM   10053 H H      . SER A 1 90  ? 35.145 6.098   -9.398  1.00 0.00 ? 303 SER A H      5  
ATOM   10054 H HA     . SER A 1 90  ? 36.214 8.157   -11.169 1.00 0.00 ? 303 SER A HA     5  
ATOM   10055 H HB2    . SER A 1 90  ? 37.530 5.788   -9.841  1.00 0.00 ? 303 SER A HB2    5  
ATOM   10056 H HB3    . SER A 1 90  ? 38.120 6.298   -11.411 1.00 0.00 ? 303 SER A HB3    5  
ATOM   10057 H HG     . SER A 1 90  ? 38.448 7.494   -8.919  1.00 0.00 ? 303 SER A HG     5  
ATOM   10058 N N      . GLY A 1 91  ? 35.443 4.982   -11.769 1.00 0.00 ? 304 GLY A N      5  
ATOM   10059 C CA     . GLY A 1 91  ? 34.932 4.064   -12.772 1.00 0.00 ? 304 GLY A CA     5  
ATOM   10060 C C      . GLY A 1 91  ? 35.755 2.775   -12.806 1.00 0.00 ? 304 GLY A C      5  
ATOM   10061 O O      . GLY A 1 91  ? 35.477 1.878   -13.600 1.00 0.00 ? 304 GLY A O      5  
ATOM   10062 H H      . GLY A 1 91  ? 35.620 4.573   -10.874 1.00 0.00 ? 304 GLY A H      5  
ATOM   10063 H HA2    . GLY A 1 91  ? 33.890 3.829   -12.557 1.00 0.00 ? 304 GLY A HA2    5  
ATOM   10064 H HA3    . GLY A 1 91  ? 34.956 4.541   -13.752 1.00 0.00 ? 304 GLY A HA3    5  
ATOM   10065 N N      . GLU A 1 92  ? 36.751 2.723   -11.935 1.00 0.00 ? 305 GLU A N      5  
ATOM   10066 C CA     . GLU A 1 92  ? 37.618 1.559   -11.856 1.00 0.00 ? 305 GLU A CA     5  
ATOM   10067 C C      . GLU A 1 92  ? 36.786 0.295   -11.629 1.00 0.00 ? 305 GLU A C      5  
ATOM   10068 O O      . GLU A 1 92  ? 35.647 0.370   -11.171 1.00 0.00 ? 305 GLU A O      5  
ATOM   10069 C CB     . GLU A 1 92  ? 38.668 1.731   -10.757 1.00 0.00 ? 305 GLU A CB     5  
ATOM   10070 C CG     . GLU A 1 92  ? 39.768 2.699   -11.196 1.00 0.00 ? 305 GLU A CG     5  
ATOM   10071 C CD     . GLU A 1 92  ? 40.684 2.052   -12.237 1.00 0.00 ? 305 GLU A CD     5  
ATOM   10072 O OE1    . GLU A 1 92  ? 40.823 2.577   -13.352 1.00 0.00 ? 305 GLU A OE1    5  
ATOM   10073 O OE2    . GLU A 1 92  ? 41.263 0.965   -11.853 1.00 0.00 ? 305 GLU A OE2    5  
ATOM   10074 H H      . GLU A 1 92  ? 36.972 3.458   -11.293 1.00 0.00 ? 305 GLU A H      5  
ATOM   10075 H HA     . GLU A 1 92  ? 38.118 1.503   -12.823 1.00 0.00 ? 305 GLU A HA     5  
ATOM   10076 H HB2    . GLU A 1 92  ? 38.192 2.103   -9.850  1.00 0.00 ? 305 GLU A HB2    5  
ATOM   10077 H HB3    . GLU A 1 92  ? 39.105 0.763   -10.514 1.00 0.00 ? 305 GLU A HB3    5  
ATOM   10078 H HG2    . GLU A 1 92  ? 39.319 3.601   -11.612 1.00 0.00 ? 305 GLU A HG2    5  
ATOM   10079 H HG3    . GLU A 1 92  ? 40.356 3.004   -10.331 1.00 0.00 ? 305 GLU A HG3    5  
ATOM   10080 H HE2    . GLU A 1 92  ? 42.115 1.181   -11.378 1.00 0.00 ? 305 GLU A HE2    5  
ATOM   10081 N N      . PRO A 1 93  ? 37.405 -0.868  -11.967 1.00 0.00 ? 306 PRO A N      5  
ATOM   10082 C CA     . PRO A 1 93  ? 36.735 -2.147  -11.804 1.00 0.00 ? 306 PRO A CA     5  
ATOM   10083 C C      . PRO A 1 93  ? 36.690 -2.559  -10.331 1.00 0.00 ? 306 PRO A C      5  
ATOM   10084 O O      . PRO A 1 93  ? 37.566 -2.186  -9.551  1.00 0.00 ? 306 PRO A O      5  
ATOM   10085 C CB     . PRO A 1 93  ? 37.524 -3.117  -12.668 1.00 0.00 ? 306 PRO A CB     5  
ATOM   10086 C CG     . PRO A 1 93  ? 38.870 -2.457  -12.913 1.00 0.00 ? 306 PRO A CG     5  
ATOM   10087 C CD     . PRO A 1 93  ? 38.753 -0.996  -12.511 1.00 0.00 ? 306 PRO A CD     5  
ATOM   10088 H HA     . PRO A 1 93  ? 35.781 -2.079  -12.097 1.00 0.00 ? 306 PRO A HA     5  
ATOM   10089 H HB2    . PRO A 1 93  ? 37.644 -4.078  -12.167 1.00 0.00 ? 306 PRO A HB2    5  
ATOM   10090 H HB3    . PRO A 1 93  ? 37.007 -3.312  -13.608 1.00 0.00 ? 306 PRO A HB3    5  
ATOM   10091 H HG2    . PRO A 1 93  ? 39.650 -2.951  -12.333 1.00 0.00 ? 306 PRO A HG2    5  
ATOM   10092 H HG3    . PRO A 1 93  ? 39.152 -2.543  -13.963 1.00 0.00 ? 306 PRO A HG3    5  
ATOM   10093 H HD2    . PRO A 1 93  ? 39.507 -0.727  -11.771 1.00 0.00 ? 306 PRO A HD2    5  
ATOM   10094 H HD3    . PRO A 1 93  ? 38.899 -0.337  -13.368 1.00 0.00 ? 306 PRO A HD3    5  
ATOM   10095 N N      . ARG A 1 94  ? 35.662 -3.323  -9.994  1.00 0.00 ? 307 ARG A N      5  
ATOM   10096 C CA     . ARG A 1 94  ? 35.492 -3.790  -8.629  1.00 0.00 ? 307 ARG A CA     5  
ATOM   10097 C C      . ARG A 1 94  ? 36.854 -4.072  -7.991  1.00 0.00 ? 307 ARG A C      5  
ATOM   10098 O O      . ARG A 1 94  ? 37.482 -5.088  -8.283  1.00 0.00 ? 307 ARG A O      5  
ATOM   10099 C CB     . ARG A 1 94  ? 34.642 -5.061  -8.583  1.00 0.00 ? 307 ARG A CB     5  
ATOM   10100 C CG     . ARG A 1 94  ? 33.208 -4.747  -8.150  1.00 0.00 ? 307 ARG A CG     5  
ATOM   10101 C CD     . ARG A 1 94  ? 32.479 -3.934  -9.221  1.00 0.00 ? 307 ARG A CD     5  
ATOM   10102 N NE     . ARG A 1 94  ? 31.657 -2.880  -8.583  1.00 0.00 ? 307 ARG A NE     5  
ATOM   10103 C CZ     . ARG A 1 94  ? 32.065 -1.617  -8.400  1.00 0.00 ? 307 ARG A CZ     5  
ATOM   10104 N NH1    . ARG A 1 94  ? 33.286 -1.242  -8.805  1.00 0.00 ? 307 ARG A NH1    5  
ATOM   10105 N NH2    . ARG A 1 94  ? 31.252 -0.729  -7.812  1.00 0.00 ? 307 ARG A NH2    5  
ATOM   10106 H H      . ARG A 1 94  ? 34.955 -3.623  -10.634 1.00 0.00 ? 307 ARG A H      5  
ATOM   10107 H HA     . ARG A 1 94  ? 34.981 -2.975  -8.117  1.00 0.00 ? 307 ARG A HA     5  
ATOM   10108 H HB2    . ARG A 1 94  ? 34.634 -5.533  -9.565  1.00 0.00 ? 307 ARG A HB2    5  
ATOM   10109 H HB3    . ARG A 1 94  ? 35.086 -5.776  -7.889  1.00 0.00 ? 307 ARG A HB3    5  
ATOM   10110 H HG2    . ARG A 1 94  ? 32.669 -5.675  -7.963  1.00 0.00 ? 307 ARG A HG2    5  
ATOM   10111 H HG3    . ARG A 1 94  ? 33.222 -4.191  -7.212  1.00 0.00 ? 307 ARG A HG3    5  
ATOM   10112 H HD2    . ARG A 1 94  ? 33.201 -3.482  -9.901  1.00 0.00 ? 307 ARG A HD2    5  
ATOM   10113 H HD3    . ARG A 1 94  ? 31.845 -4.589  -9.818  1.00 0.00 ? 307 ARG A HD3    5  
ATOM   10114 H HE     . ARG A 1 94  ? 30.740 -3.126  -8.270  1.00 0.00 ? 307 ARG A HE     5  
ATOM   10115 H HH11   . ARG A 1 94  ? 33.894 -1.905  -9.242  1.00 0.00 ? 307 ARG A HH11   5  
ATOM   10116 H HH12   . ARG A 1 94  ? 33.591 -0.300  -8.667  1.00 0.00 ? 307 ARG A HH12   5  
ATOM   10117 H HH21   . ARG A 1 94  ? 30.340 -1.008  -7.511  1.00 0.00 ? 307 ARG A HH21   5  
ATOM   10118 H HH22   . ARG A 1 94  ? 31.556 0.214   -7.675  1.00 0.00 ? 307 ARG A HH22   5  
ATOM   10119 N N      . SER A 1 95  ? 37.270 -3.154  -7.130  1.00 0.00 ? 308 SER A N      5  
ATOM   10120 C CA     . SER A 1 95  ? 38.546 -3.292  -6.447  1.00 0.00 ? 308 SER A CA     5  
ATOM   10121 C C      . SER A 1 95  ? 38.624 -4.653  -5.753  1.00 0.00 ? 308 SER A C      5  
ATOM   10122 O O      . SER A 1 95  ? 39.714 -5.149  -5.472  1.00 0.00 ? 308 SER A O      5  
ATOM   10123 C CB     . SER A 1 95  ? 38.752 -2.166  -5.434  1.00 0.00 ? 308 SER A CB     5  
ATOM   10124 O OG     . SER A 1 95  ? 37.531 -1.775  -4.813  1.00 0.00 ? 308 SER A OG     5  
ATOM   10125 H H      . SER A 1 95  ? 36.753 -2.331  -6.897  1.00 0.00 ? 308 SER A H      5  
ATOM   10126 H HA     . SER A 1 95  ? 39.301 -3.218  -7.231  1.00 0.00 ? 308 SER A HA     5  
ATOM   10127 H HB2    . SER A 1 95  ? 39.460 -2.490  -4.670  1.00 0.00 ? 308 SER A HB2    5  
ATOM   10128 H HB3    . SER A 1 95  ? 39.196 -1.304  -5.934  1.00 0.00 ? 308 SER A HB3    5  
ATOM   10129 H HG     . SER A 1 95  ? 37.040 -1.129  -5.397  1.00 0.00 ? 308 SER A HG     5  
ATOM   10130 N N      . ALA A 1 96  ? 37.454 -5.218  -5.495  1.00 0.00 ? 309 ALA A N      5  
ATOM   10131 C CA     . ALA A 1 96  ? 37.375 -6.511  -4.838  1.00 0.00 ? 309 ALA A CA     5  
ATOM   10132 C C      . ALA A 1 96  ? 35.959 -7.071  -4.989  1.00 0.00 ? 309 ALA A C      5  
ATOM   10133 O O      . ALA A 1 96  ? 35.021 -6.327  -5.271  1.00 0.00 ? 309 ALA A O      5  
ATOM   10134 C CB     . ALA A 1 96  ? 37.791 -6.366  -3.372  1.00 0.00 ? 309 ALA A CB     5  
ATOM   10135 H H      . ALA A 1 96  ? 36.571 -4.807  -5.727  1.00 0.00 ? 309 ALA A H      5  
ATOM   10136 H HA     . ALA A 1 96  ? 38.077 -7.180  -5.337  1.00 0.00 ? 309 ALA A HA     5  
ATOM   10137 H HB1    . ALA A 1 96  ? 38.869 -6.496  -3.286  1.00 0.00 ? 309 ALA A HB1    5  
ATOM   10138 H HB2    . ALA A 1 96  ? 37.514 -5.374  -3.014  1.00 0.00 ? 309 ALA A HB2    5  
ATOM   10139 H HB3    . ALA A 1 96  ? 37.284 -7.123  -2.775  1.00 0.00 ? 309 ALA A HB3    5  
ATOM   10140 N N      . THR A 1 97  ? 35.850 -8.377  -4.797  1.00 0.00 ? 310 THR A N      5  
ATOM   10141 C CA     . THR A 1 97  ? 34.565 -9.046  -4.909  1.00 0.00 ? 310 THR A CA     5  
ATOM   10142 C C      . THR A 1 97  ? 33.777 -8.908  -3.605  1.00 0.00 ? 310 THR A C      5  
ATOM   10143 O O      . THR A 1 97  ? 34.331 -9.079  -2.520  1.00 0.00 ? 310 THR A O      5  
ATOM   10144 C CB     . THR A 1 97  ? 34.821 -10.498 -5.315  1.00 0.00 ? 310 THR A CB     5  
ATOM   10145 O OG1    . THR A 1 97  ? 35.447 -10.397 -6.590  1.00 0.00 ? 310 THR A OG1    5  
ATOM   10146 C CG2    . THR A 1 97  ? 33.526 -11.265 -5.594  1.00 0.00 ? 310 THR A CG2    5  
ATOM   10147 H H      . THR A 1 97  ? 36.618 -8.976  -4.569  1.00 0.00 ? 310 THR A H      5  
ATOM   10148 H HA     . THR A 1 97  ? 33.985 -8.548  -5.686  1.00 0.00 ? 310 THR A HA     5  
ATOM   10149 H HB     . THR A 1 97  ? 35.423 -11.011 -4.565  1.00 0.00 ? 310 THR A HB     5  
ATOM   10150 H HG1    . THR A 1 97  ? 36.290 -9.866  -6.517  1.00 0.00 ? 310 THR A HG1    5  
ATOM   10151 H HG21   . THR A 1 97  ? 33.746 -12.135 -6.214  1.00 0.00 ? 310 THR A HG21   5  
ATOM   10152 H HG22   . THR A 1 97  ? 33.087 -11.592 -4.652  1.00 0.00 ? 310 THR A HG22   5  
ATOM   10153 H HG23   . THR A 1 97  ? 32.825 -10.615 -6.116  1.00 0.00 ? 310 THR A HG23   5  
ATOM   10154 N N      . VAL A 1 98  ? 32.497 -8.602  -3.753  1.00 0.00 ? 311 VAL A N      5  
ATOM   10155 C CA     . VAL A 1 98  ? 31.627 -8.440  -2.601  1.00 0.00 ? 311 VAL A CA     5  
ATOM   10156 C C      . VAL A 1 98  ? 30.519 -9.494  -2.651  1.00 0.00 ? 311 VAL A C      5  
ATOM   10157 O O      . VAL A 1 98  ? 29.871 -9.670  -3.681  1.00 0.00 ? 311 VAL A O      5  
ATOM   10158 C CB     . VAL A 1 98  ? 31.088 -7.009  -2.549  1.00 0.00 ? 311 VAL A CB     5  
ATOM   10159 C CG1    . VAL A 1 98  ? 29.789 -6.941  -1.743  1.00 0.00 ? 311 VAL A CG1    5  
ATOM   10160 C CG2    . VAL A 1 98  ? 32.136 -6.048  -1.982  1.00 0.00 ? 311 VAL A CG2    5  
ATOM   10161 H H      . VAL A 1 98  ? 32.054 -8.465  -4.640  1.00 0.00 ? 311 VAL A H      5  
ATOM   10162 H HA     . VAL A 1 98  ? 32.230 -8.606  -1.709  1.00 0.00 ? 311 VAL A HA     5  
ATOM   10163 H HB     . VAL A 1 98  ? 30.866 -6.697  -3.569  1.00 0.00 ? 311 VAL A HB     5  
ATOM   10164 H HG11   . VAL A 1 98  ? 30.000 -7.156  -0.695  1.00 0.00 ? 311 VAL A HG11   5  
ATOM   10165 H HG12   . VAL A 1 98  ? 29.359 -5.943  -1.830  1.00 0.00 ? 311 VAL A HG12   5  
ATOM   10166 H HG13   . VAL A 1 98  ? 29.083 -7.675  -2.130  1.00 0.00 ? 311 VAL A HG13   5  
ATOM   10167 H HG21   . VAL A 1 98  ? 33.091 -6.565  -1.891  1.00 0.00 ? 311 VAL A HG21   5  
ATOM   10168 H HG22   . VAL A 1 98  ? 32.247 -5.195  -2.651  1.00 0.00 ? 311 VAL A HG22   5  
ATOM   10169 H HG23   . VAL A 1 98  ? 31.817 -5.701  -1.000  1.00 0.00 ? 311 VAL A HG23   5  
ATOM   10170 N N      . SER A 1 99  ? 30.337 -10.168 -1.525  1.00 0.00 ? 312 SER A N      5  
ATOM   10171 C CA     . SER A 1 99  ? 29.319 -11.200 -1.427  1.00 0.00 ? 312 SER A CA     5  
ATOM   10172 C C      . SER A 1 99  ? 28.615 -11.114 -0.072  1.00 0.00 ? 312 SER A C      5  
ATOM   10173 O O      . SER A 1 99  ? 29.269 -11.076 0.970   1.00 0.00 ? 312 SER A O      5  
ATOM   10174 C CB     . SER A 1 99  ? 29.924 -12.591 -1.624  1.00 0.00 ? 312 SER A CB     5  
ATOM   10175 O OG     . SER A 1 99  ? 30.487 -13.104 -0.419  1.00 0.00 ? 312 SER A OG     5  
ATOM   10176 H H      . SER A 1 99  ? 30.869 -10.019 -0.691  1.00 0.00 ? 312 SER A H      5  
ATOM   10177 H HA     . SER A 1 99  ? 28.618 -10.992 -2.236  1.00 0.00 ? 312 SER A HA     5  
ATOM   10178 H HB2    . SER A 1 99  ? 29.155 -13.274 -1.984  1.00 0.00 ? 312 SER A HB2    5  
ATOM   10179 H HB3    . SER A 1 99  ? 30.695 -12.546 -2.394  1.00 0.00 ? 312 SER A HB3    5  
ATOM   10180 H HG     . SER A 1 99  ? 30.663 -12.356 0.221   1.00 0.00 ? 312 SER A HG     5  
ATOM   10181 N N      . ALA A 1 100 ? 27.292 -11.087 -0.128  1.00 0.00 ? 313 ALA A N      5  
ATOM   10182 C CA     . ALA A 1 100 ? 26.493 -11.007 1.082   1.00 0.00 ? 313 ALA A CA     5  
ATOM   10183 C C      . ALA A 1 100 ? 26.616 -12.320 1.859   1.00 0.00 ? 313 ALA A C      5  
ATOM   10184 O O      . ALA A 1 100 ? 26.215 -13.374 1.370   1.00 0.00 ? 313 ALA A O      5  
ATOM   10185 C CB     . ALA A 1 100 ? 25.043 -10.682 0.717   1.00 0.00 ? 313 ALA A CB     5  
ATOM   10186 H H      . ALA A 1 100 ? 26.768 -11.119 -0.979  1.00 0.00 ? 313 ALA A H      5  
ATOM   10187 H HA     . ALA A 1 100 ? 26.892 -10.195 1.691   1.00 0.00 ? 313 ALA A HA     5  
ATOM   10188 H HB1    . ALA A 1 100 ? 25.027 -9.992  -0.128  1.00 0.00 ? 313 ALA A HB1    5  
ATOM   10189 H HB2    . ALA A 1 100 ? 24.522 -11.600 0.446   1.00 0.00 ? 313 ALA A HB2    5  
ATOM   10190 H HB3    . ALA A 1 100 ? 24.547 -10.220 1.571   1.00 0.00 ? 313 ALA A HB3    5  
ATOM   10191 N N      . ALA A 1 101 ? 27.174 -12.211 3.055   1.00 0.00 ? 314 ALA A N      5  
ATOM   10192 C CA     . ALA A 1 101 ? 27.357 -13.377 3.904   1.00 0.00 ? 314 ALA A CA     5  
ATOM   10193 C C      . ALA A 1 101 ? 25.989 -13.948 4.280   1.00 0.00 ? 314 ALA A C      5  
ATOM   10194 O O      . ALA A 1 101 ? 25.826 -15.162 4.384   1.00 0.00 ? 314 ALA A O      5  
ATOM   10195 C CB     . ALA A 1 101 ? 28.185 -12.989 5.132   1.00 0.00 ? 314 ALA A CB     5  
ATOM   10196 H H      . ALA A 1 101 ? 27.499 -11.350 3.446   1.00 0.00 ? 314 ALA A H      5  
ATOM   10197 H HA     . ALA A 1 101 ? 27.908 -14.122 3.331   1.00 0.00 ? 314 ALA A HA     5  
ATOM   10198 H HB1    . ALA A 1 101 ? 28.763 -12.093 4.913   1.00 0.00 ? 314 ALA A HB1    5  
ATOM   10199 H HB2    . ALA A 1 101 ? 27.518 -12.796 5.973   1.00 0.00 ? 314 ALA A HB2    5  
ATOM   10200 H HB3    . ALA A 1 101 ? 28.861 -13.805 5.385   1.00 0.00 ? 314 ALA A HB3    5  
ATOM   10201 N N      . THR A 1 102 ? 25.039 -13.044 4.474   1.00 0.00 ? 315 THR A N      5  
ATOM   10202 C CA     . THR A 1 102 ? 23.689 -13.443 4.836   1.00 0.00 ? 315 THR A CA     5  
ATOM   10203 C C      . THR A 1 102 ? 22.667 -12.490 4.213   1.00 0.00 ? 315 THR A C      5  
ATOM   10204 O O      . THR A 1 102 ? 23.036 -11.543 3.522   1.00 0.00 ? 315 THR A O      5  
ATOM   10205 C CB     . THR A 1 102 ? 23.609 -13.508 6.362   1.00 0.00 ? 315 THR A CB     5  
ATOM   10206 O OG1    . THR A 1 102 ? 22.332 -14.086 6.618   1.00 0.00 ? 315 THR A OG1    5  
ATOM   10207 C CG2    . THR A 1 102 ? 23.525 -12.122 7.004   1.00 0.00 ? 315 THR A CG2    5  
ATOM   10208 H H      . THR A 1 102 ? 25.178 -12.058 4.387   1.00 0.00 ? 315 THR A H      5  
ATOM   10209 H HA     . THR A 1 102 ? 23.499 -14.433 4.419   1.00 0.00 ? 315 THR A HA     5  
ATOM   10210 H HB     . THR A 1 102 ? 24.443 -14.078 6.771   1.00 0.00 ? 315 THR A HB     5  
ATOM   10211 H HG1    . THR A 1 102 ? 22.340 -15.056 6.372   1.00 0.00 ? 315 THR A HG1    5  
ATOM   10212 H HG21   . THR A 1 102 ? 22.805 -12.143 7.821   1.00 0.00 ? 315 THR A HG21   5  
ATOM   10213 H HG22   . THR A 1 102 ? 24.505 -11.841 7.391   1.00 0.00 ? 315 THR A HG22   5  
ATOM   10214 H HG23   . THR A 1 102 ? 23.208 -11.394 6.257   1.00 0.00 ? 315 THR A HG23   5  
ATOM   10215 N N      . THR A 1 103 ? 21.400 -12.775 4.481   1.00 0.00 ? 316 THR A N      5  
ATOM   10216 C CA     . THR A 1 103 ? 20.321 -11.955 3.956   1.00 0.00 ? 316 THR A CA     5  
ATOM   10217 C C      . THR A 1 103 ? 20.375 -10.552 4.562   1.00 0.00 ? 316 THR A C      5  
ATOM   10218 O O      . THR A 1 103 ? 20.010 -10.357 5.721   1.00 0.00 ? 316 THR A O      5  
ATOM   10219 C CB     . THR A 1 103 ? 19.002 -12.683 4.223   1.00 0.00 ? 316 THR A CB     5  
ATOM   10220 O OG1    . THR A 1 103 ? 19.309 -14.055 3.995   1.00 0.00 ? 316 THR A OG1    5  
ATOM   10221 C CG2    . THR A 1 103 ? 17.934 -12.361 3.177   1.00 0.00 ? 316 THR A CG2    5  
ATOM   10222 H H      . THR A 1 103 ? 21.109 -13.548 5.044   1.00 0.00 ? 316 THR A H      5  
ATOM   10223 H HA     . THR A 1 103 ? 20.465 -11.846 2.882   1.00 0.00 ? 316 THR A HA     5  
ATOM   10224 H HB     . THR A 1 103 ? 18.638 -12.471 5.229   1.00 0.00 ? 316 THR A HB     5  
ATOM   10225 H HG1    . THR A 1 103 ? 18.493 -14.616 4.131   1.00 0.00 ? 316 THR A HG1    5  
ATOM   10226 H HG21   . THR A 1 103 ? 18.216 -12.804 2.222   1.00 0.00 ? 316 THR A HG21   5  
ATOM   10227 H HG22   . THR A 1 103 ? 16.976 -12.770 3.498   1.00 0.00 ? 316 THR A HG22   5  
ATOM   10228 H HG23   . THR A 1 103 ? 17.849 -11.280 3.065   1.00 0.00 ? 316 THR A HG23   5  
ATOM   10229 N N      . VAL A 1 104 ? 20.834 -9.609  3.751   1.00 0.00 ? 317 VAL A N      5  
ATOM   10230 C CA     . VAL A 1 104 ? 20.940 -8.229  4.193   1.00 0.00 ? 317 VAL A CA     5  
ATOM   10231 C C      . VAL A 1 104 ? 20.177 -7.327  3.222   1.00 0.00 ? 317 VAL A C      5  
ATOM   10232 O O      . VAL A 1 104 ? 20.140 -7.593  2.021   1.00 0.00 ? 317 VAL A O      5  
ATOM   10233 C CB     . VAL A 1 104 ? 22.412 -7.839  4.341   1.00 0.00 ? 317 VAL A CB     5  
ATOM   10234 C CG1    . VAL A 1 104 ? 23.131 -8.769  5.320   1.00 0.00 ? 317 VAL A CG1    5  
ATOM   10235 C CG2    . VAL A 1 104 ? 23.115 -7.825  2.982   1.00 0.00 ? 317 VAL A CG2    5  
ATOM   10236 H H      . VAL A 1 104 ? 21.129 -9.776  2.811   1.00 0.00 ? 317 VAL A H      5  
ATOM   10237 H HA     . VAL A 1 104 ? 20.473 -8.161  5.175   1.00 0.00 ? 317 VAL A HA     5  
ATOM   10238 H HB     . VAL A 1 104 ? 22.452 -6.829  4.748   1.00 0.00 ? 317 VAL A HB     5  
ATOM   10239 H HG11   . VAL A 1 104 ? 23.744 -8.177  6.000   1.00 0.00 ? 317 VAL A HG11   5  
ATOM   10240 H HG12   . VAL A 1 104 ? 22.394 -9.333  5.893   1.00 0.00 ? 317 VAL A HG12   5  
ATOM   10241 H HG13   . VAL A 1 104 ? 23.765 -9.460  4.766   1.00 0.00 ? 317 VAL A HG13   5  
ATOM   10242 H HG21   . VAL A 1 104 ? 23.675 -6.897  2.871   1.00 0.00 ? 317 VAL A HG21   5  
ATOM   10243 H HG22   . VAL A 1 104 ? 23.799 -8.673  2.918   1.00 0.00 ? 317 VAL A HG22   5  
ATOM   10244 H HG23   . VAL A 1 104 ? 22.372 -7.899  2.188   1.00 0.00 ? 317 VAL A HG23   5  
ATOM   10245 N N      . SER A 1 105 ? 19.587 -6.279  3.777   1.00 0.00 ? 318 SER A N      5  
ATOM   10246 C CA     . SER A 1 105 ? 18.827 -5.336  2.973   1.00 0.00 ? 318 SER A CA     5  
ATOM   10247 C C      . SER A 1 105 ? 19.654 -4.072  2.727   1.00 0.00 ? 318 SER A C      5  
ATOM   10248 O O      . SER A 1 105 ? 20.030 -3.377  3.669   1.00 0.00 ? 318 SER A O      5  
ATOM   10249 C CB     . SER A 1 105 ? 17.502 -4.979  3.650   1.00 0.00 ? 318 SER A CB     5  
ATOM   10250 O OG     . SER A 1 105 ? 16.473 -4.712  2.702   1.00 0.00 ? 318 SER A OG     5  
ATOM   10251 H H      . SER A 1 105 ? 19.622 -6.070  4.753   1.00 0.00 ? 318 SER A H      5  
ATOM   10252 H HA     . SER A 1 105 ? 18.627 -5.852  2.035   1.00 0.00 ? 318 SER A HA     5  
ATOM   10253 H HB2    . SER A 1 105 ? 17.194 -5.798  4.299   1.00 0.00 ? 318 SER A HB2    5  
ATOM   10254 H HB3    . SER A 1 105 ? 17.644 -4.105  4.286   1.00 0.00 ? 318 SER A HB3    5  
ATOM   10255 H HG     . SER A 1 105 ? 16.633 -3.828  2.263   1.00 0.00 ? 318 SER A HG     5  
ATOM   10256 N N      . LEU A 1 106 ? 19.916 -3.814  1.454   1.00 0.00 ? 319 LEU A N      5  
ATOM   10257 C CA     . LEU A 1 106 ? 20.692 -2.647  1.070   1.00 0.00 ? 319 LEU A CA     5  
ATOM   10258 C C      . LEU A 1 106 ? 19.944 -1.878  -0.020  1.00 0.00 ? 319 LEU A C      5  
ATOM   10259 O O      . LEU A 1 106 ? 19.010 -2.403  -0.625  1.00 0.00 ? 319 LEU A O      5  
ATOM   10260 C CB     . LEU A 1 106 ? 22.112 -3.055  0.672   1.00 0.00 ? 319 LEU A CB     5  
ATOM   10261 C CG     . LEU A 1 106 ? 22.257 -4.436  0.031   1.00 0.00 ? 319 LEU A CG     5  
ATOM   10262 C CD1    . LEU A 1 106 ? 21.928 -5.544  1.034   1.00 0.00 ? 319 LEU A CD1    5  
ATOM   10263 C CD2    . LEU A 1 106 ? 21.412 -4.544  -1.240  1.00 0.00 ? 319 LEU A CD2    5  
ATOM   10264 H H      . LEU A 1 106 ? 19.608 -4.385  0.693   1.00 0.00 ? 319 LEU A H      5  
ATOM   10265 H HA     . LEU A 1 106 ? 20.775 -2.008  1.950   1.00 0.00 ? 319 LEU A HA     5  
ATOM   10266 H HB2    . LEU A 1 106 ? 22.500 -2.311  -0.024  1.00 0.00 ? 319 LEU A HB2    5  
ATOM   10267 H HB3    . LEU A 1 106 ? 22.741 -3.020  1.561   1.00 0.00 ? 319 LEU A HB3    5  
ATOM   10268 H HG     . LEU A 1 106 ? 23.299 -4.569  -0.263  1.00 0.00 ? 319 LEU A HG     5  
ATOM   10269 H HD11   . LEU A 1 106 ? 20.914 -5.904  0.857   1.00 0.00 ? 319 LEU A HD11   5  
ATOM   10270 H HD12   . LEU A 1 106 ? 22.632 -6.367  0.912   1.00 0.00 ? 319 LEU A HD12   5  
ATOM   10271 H HD13   . LEU A 1 106 ? 22.002 -5.150  2.048   1.00 0.00 ? 319 LEU A HD13   5  
ATOM   10272 H HD21   . LEU A 1 106 ? 21.063 -3.553  -1.529  1.00 0.00 ? 319 LEU A HD21   5  
ATOM   10273 H HD22   . LEU A 1 106 ? 22.016 -4.966  -2.044  1.00 0.00 ? 319 LEU A HD22   5  
ATOM   10274 H HD23   . LEU A 1 106 ? 20.554 -5.190  -1.051  1.00 0.00 ? 319 LEU A HD23   5  
ATOM   10275 N N      . LEU A 1 107 ? 20.382 -0.647  -0.237  1.00 0.00 ? 320 LEU A N      5  
ATOM   10276 C CA     . LEU A 1 107 ? 19.765 0.200   -1.244  1.00 0.00 ? 320 LEU A CA     5  
ATOM   10277 C C      . LEU A 1 107 ? 20.707 0.328   -2.443  1.00 0.00 ? 320 LEU A C      5  
ATOM   10278 O O      . LEU A 1 107 ? 21.926 0.256   -2.290  1.00 0.00 ? 320 LEU A O      5  
ATOM   10279 C CB     . LEU A 1 107 ? 19.356 1.544   -0.638  1.00 0.00 ? 320 LEU A CB     5  
ATOM   10280 C CG     . LEU A 1 107 ? 18.475 1.475   0.611   1.00 0.00 ? 320 LEU A CG     5  
ATOM   10281 C CD1    . LEU A 1 107 ? 19.273 1.834   1.866   1.00 0.00 ? 320 LEU A CD1    5  
ATOM   10282 C CD2    . LEU A 1 107 ? 17.231 2.351   0.453   1.00 0.00 ? 320 LEU A CD2    5  
ATOM   10283 H H      . LEU A 1 107 ? 21.141 -0.228  0.260   1.00 0.00 ? 320 LEU A H      5  
ATOM   10284 H HA     . LEU A 1 107 ? 18.852 -0.296  -1.575  1.00 0.00 ? 320 LEU A HA     5  
ATOM   10285 H HB2    . LEU A 1 107 ? 20.261 2.099   -0.389  1.00 0.00 ? 320 LEU A HB2    5  
ATOM   10286 H HB3    . LEU A 1 107 ? 18.829 2.118   -1.399  1.00 0.00 ? 320 LEU A HB3    5  
ATOM   10287 H HG     . LEU A 1 107 ? 18.132 0.447   0.731   1.00 0.00 ? 320 LEU A HG     5  
ATOM   10288 H HD11   . LEU A 1 107 ? 18.716 1.528   2.752   1.00 0.00 ? 320 LEU A HD11   5  
ATOM   10289 H HD12   . LEU A 1 107 ? 20.234 1.319   1.846   1.00 0.00 ? 320 LEU A HD12   5  
ATOM   10290 H HD13   . LEU A 1 107 ? 19.440 2.911   1.895   1.00 0.00 ? 320 LEU A HD13   5  
ATOM   10291 H HD21   . LEU A 1 107 ? 17.443 3.353   0.825   1.00 0.00 ? 320 LEU A HD21   5  
ATOM   10292 H HD22   . LEU A 1 107 ? 16.955 2.405   -0.600  1.00 0.00 ? 320 LEU A HD22   5  
ATOM   10293 H HD23   . LEU A 1 107 ? 16.407 1.918   1.023   1.00 0.00 ? 320 LEU A HD23   5  
ATOM   10294 N N      . SER A 1 108 ? 20.108 0.516   -3.610  1.00 0.00 ? 321 SER A N      5  
ATOM   10295 C CA     . SER A 1 108 ? 20.878 0.655   -4.834  1.00 0.00 ? 321 SER A CA     5  
ATOM   10296 C C      . SER A 1 108 ? 20.733 2.074   -5.386  1.00 0.00 ? 321 SER A C      5  
ATOM   10297 O O      . SER A 1 108 ? 19.622 2.592   -5.491  1.00 0.00 ? 321 SER A O      5  
ATOM   10298 C CB     . SER A 1 108 ? 20.438 -0.371  -5.881  1.00 0.00 ? 321 SER A CB     5  
ATOM   10299 O OG     . SER A 1 108 ? 21.290 -1.512  -5.902  1.00 0.00 ? 321 SER A OG     5  
ATOM   10300 H H      . SER A 1 108 ? 19.116 0.573   -3.726  1.00 0.00 ? 321 SER A H      5  
ATOM   10301 H HA     . SER A 1 108 ? 21.912 0.460   -4.548  1.00 0.00 ? 321 SER A HA     5  
ATOM   10302 H HB2    . SER A 1 108 ? 19.415 -0.685  -5.672  1.00 0.00 ? 321 SER A HB2    5  
ATOM   10303 H HB3    . SER A 1 108 ? 20.433 0.097   -6.866  1.00 0.00 ? 321 SER A HB3    5  
ATOM   10304 H HG     . SER A 1 108 ? 21.620 -1.675  -6.832  1.00 0.00 ? 321 SER A HG     5  
ATOM   10305 N N      . LEU A 1 109 ? 21.871 2.662   -5.724  1.00 0.00 ? 322 LEU A N      5  
ATOM   10306 C CA     . LEU A 1 109 ? 21.883 4.012   -6.262  1.00 0.00 ? 322 LEU A CA     5  
ATOM   10307 C C      . LEU A 1 109 ? 22.441 3.983   -7.687  1.00 0.00 ? 322 LEU A C      5  
ATOM   10308 O O      . LEU A 1 109 ? 23.342 3.202   -7.989  1.00 0.00 ? 322 LEU A O      5  
ATOM   10309 C CB     . LEU A 1 109 ? 22.641 4.955   -5.326  1.00 0.00 ? 322 LEU A CB     5  
ATOM   10310 C CG     . LEU A 1 109 ? 22.494 6.450   -5.618  1.00 0.00 ? 322 LEU A CG     5  
ATOM   10311 C CD1    . LEU A 1 109 ? 21.234 7.016   -4.960  1.00 0.00 ? 322 LEU A CD1    5  
ATOM   10312 C CD2    . LEU A 1 109 ? 23.752 7.216   -5.201  1.00 0.00 ? 322 LEU A CD2    5  
ATOM   10313 H H      . LEU A 1 109 ? 22.770 2.234   -5.636  1.00 0.00 ? 322 LEU A H      5  
ATOM   10314 H HA     . LEU A 1 109 ? 20.851 4.358   -6.302  1.00 0.00 ? 322 LEU A HA     5  
ATOM   10315 H HB2    . LEU A 1 109 ? 22.304 4.770   -4.306  1.00 0.00 ? 322 LEU A HB2    5  
ATOM   10316 H HB3    . LEU A 1 109 ? 23.700 4.699   -5.364  1.00 0.00 ? 322 LEU A HB3    5  
ATOM   10317 H HG     . LEU A 1 109 ? 22.381 6.579   -6.694  1.00 0.00 ? 322 LEU A HG     5  
ATOM   10318 H HD11   . LEU A 1 109 ? 20.961 6.397   -4.106  1.00 0.00 ? 322 LEU A HD11   5  
ATOM   10319 H HD12   . LEU A 1 109 ? 21.426 8.036   -4.624  1.00 0.00 ? 322 LEU A HD12   5  
ATOM   10320 H HD13   . LEU A 1 109 ? 20.418 7.020   -5.683  1.00 0.00 ? 322 LEU A HD13   5  
ATOM   10321 H HD21   . LEU A 1 109 ? 24.483 6.519   -4.789  1.00 0.00 ? 322 LEU A HD21   5  
ATOM   10322 H HD22   . LEU A 1 109 ? 24.178 7.716   -6.071  1.00 0.00 ? 322 LEU A HD22   5  
ATOM   10323 H HD23   . LEU A 1 109 ? 23.492 7.957   -4.447  1.00 0.00 ? 322 LEU A HD23   5  
ATOM   10324 N N      . HIS A 1 110 ? 21.880 4.842   -8.526  1.00 0.00 ? 323 HIS A N      5  
ATOM   10325 C CA     . HIS A 1 110 ? 22.310 4.924   -9.911  1.00 0.00 ? 323 HIS A CA     5  
ATOM   10326 C C      . HIS A 1 110 ? 23.560 5.801   -10.010 1.00 0.00 ? 323 HIS A C      5  
ATOM   10327 O O      . HIS A 1 110 ? 23.774 6.680   -9.177  1.00 0.00 ? 323 HIS A O      5  
ATOM   10328 C CB     . HIS A 1 110 ? 21.169 5.416   -10.805 1.00 0.00 ? 323 HIS A CB     5  
ATOM   10329 C CG     . HIS A 1 110 ? 21.139 4.773   -12.171 1.00 0.00 ? 323 HIS A CG     5  
ATOM   10330 N ND1    . HIS A 1 110 ? 21.396 5.476   -13.336 1.00 0.00 ? 323 HIS A ND1    5  
ATOM   10331 C CD2    . HIS A 1 110 ? 20.882 3.488   -12.547 1.00 0.00 ? 323 HIS A CD2    5  
ATOM   10332 C CE1    . HIS A 1 110 ? 21.293 4.641   -14.359 1.00 0.00 ? 323 HIS A CE1    5  
ATOM   10333 N NE2    . HIS A 1 110 ? 20.975 3.409   -13.868 1.00 0.00 ? 323 HIS A NE2    5  
ATOM   10334 H H      . HIS A 1 110 ? 21.148 5.474   -8.272  1.00 0.00 ? 323 HIS A H      5  
ATOM   10335 H HA     . HIS A 1 110 ? 22.561 3.910   -10.222 1.00 0.00 ? 323 HIS A HA     5  
ATOM   10336 H HB2    . HIS A 1 110 ? 20.220 5.224   -10.304 1.00 0.00 ? 323 HIS A HB2    5  
ATOM   10337 H HB3    . HIS A 1 110 ? 21.255 6.496   -10.925 1.00 0.00 ? 323 HIS A HB3    5  
ATOM   10338 H HD1    . HIS A 1 110 ? 21.620 6.449   -13.395 1.00 0.00 ? 323 HIS A HD1    5  
ATOM   10339 H HD2    . HIS A 1 110 ? 20.641 2.665   -11.874 1.00 0.00 ? 323 HIS A HD2    5  
ATOM   10340 H HE1    . HIS A 1 110 ? 21.439 4.893   -15.409 1.00 0.00 ? 323 HIS A HE1    5  
ATOM   10341 H HE2    . HIS A 1 110 ? 20.889 2.572   -14.408 1.00 0.00 ? 323 HIS A HE2    5  
ATOM   10342 N N      . SER A 1 111 ? 24.353 5.530   -11.036 1.00 0.00 ? 324 SER A N      5  
ATOM   10343 C CA     . SER A 1 111 ? 25.577 6.282   -11.255 1.00 0.00 ? 324 SER A CA     5  
ATOM   10344 C C      . SER A 1 111 ? 25.244 7.738   -11.586 1.00 0.00 ? 324 SER A C      5  
ATOM   10345 O O      . SER A 1 111 ? 26.011 8.643   -11.261 1.00 0.00 ? 324 SER A O      5  
ATOM   10346 C CB     . SER A 1 111 ? 26.414 5.661   -12.375 1.00 0.00 ? 324 SER A CB     5  
ATOM   10347 O OG     . SER A 1 111 ? 25.933 6.029   -13.666 1.00 0.00 ? 324 SER A OG     5  
ATOM   10348 H H      . SER A 1 111 ? 24.172 4.813   -11.710 1.00 0.00 ? 324 SER A H      5  
ATOM   10349 H HA     . SER A 1 111 ? 26.126 6.219   -10.316 1.00 0.00 ? 324 SER A HA     5  
ATOM   10350 H HB2    . SER A 1 111 ? 27.451 5.976   -12.271 1.00 0.00 ? 324 SER A HB2    5  
ATOM   10351 H HB3    . SER A 1 111 ? 26.399 4.575   -12.280 1.00 0.00 ? 324 SER A HB3    5  
ATOM   10352 H HG     . SER A 1 111 ? 26.118 5.297   -14.322 1.00 0.00 ? 324 SER A HG     5  
ATOM   10353 N N      . ALA A 1 112 ? 24.099 7.919   -12.226 1.00 0.00 ? 325 ALA A N      5  
ATOM   10354 C CA     . ALA A 1 112 ? 23.655 9.250   -12.605 1.00 0.00 ? 325 ALA A CA     5  
ATOM   10355 C C      . ALA A 1 112 ? 23.216 10.012  -11.353 1.00 0.00 ? 325 ALA A C      5  
ATOM   10356 O O      . ALA A 1 112 ? 23.378 11.228  -11.273 1.00 0.00 ? 325 ALA A O      5  
ATOM   10357 C CB     . ALA A 1 112 ? 22.536 9.139   -13.643 1.00 0.00 ? 325 ALA A CB     5  
ATOM   10358 H H      . ALA A 1 112 ? 23.480 7.178   -12.486 1.00 0.00 ? 325 ALA A H      5  
ATOM   10359 H HA     . ALA A 1 112 ? 24.502 9.766   -13.056 1.00 0.00 ? 325 ALA A HA     5  
ATOM   10360 H HB1    . ALA A 1 112 ? 21.578 9.354   -13.169 1.00 0.00 ? 325 ALA A HB1    5  
ATOM   10361 H HB2    . ALA A 1 112 ? 22.713 9.855   -14.446 1.00 0.00 ? 325 ALA A HB2    5  
ATOM   10362 H HB3    . ALA A 1 112 ? 22.519 8.129   -14.053 1.00 0.00 ? 325 ALA A HB3    5  
ATOM   10363 N N      . ASP A 1 113 ? 22.668 9.264   -10.406 1.00 0.00 ? 326 ASP A N      5  
ATOM   10364 C CA     . ASP A 1 113 ? 22.203 9.853   -9.162  1.00 0.00 ? 326 ASP A CA     5  
ATOM   10365 C C      . ASP A 1 113 ? 23.409 10.187  -8.280  1.00 0.00 ? 326 ASP A C      5  
ATOM   10366 O O      . ASP A 1 113 ? 23.385 11.166  -7.535  1.00 0.00 ? 326 ASP A O      5  
ATOM   10367 C CB     . ASP A 1 113 ? 21.310 8.879   -8.391  1.00 0.00 ? 326 ASP A CB     5  
ATOM   10368 C CG     . ASP A 1 113 ? 19.999 9.477   -7.874  1.00 0.00 ? 326 ASP A CG     5  
ATOM   10369 O OD1    . ASP A 1 113 ? 19.318 10.234  -8.582  1.00 0.00 ? 326 ASP A OD1    5  
ATOM   10370 O OD2    . ASP A 1 113 ? 19.679 9.131   -6.672  1.00 0.00 ? 326 ASP A OD2    5  
ATOM   10371 H H      . ASP A 1 113 ? 22.539 8.275   -10.479 1.00 0.00 ? 326 ASP A H      5  
ATOM   10372 H HA     . ASP A 1 113 ? 21.644 10.741  -9.456  1.00 0.00 ? 326 ASP A HA     5  
ATOM   10373 H HB2    . ASP A 1 113 ? 21.076 8.034   -9.038  1.00 0.00 ? 326 ASP A HB2    5  
ATOM   10374 H HB3    . ASP A 1 113 ? 21.872 8.487   -7.544  1.00 0.00 ? 326 ASP A HB3    5  
ATOM   10375 H HD2    . ASP A 1 113 ? 20.504 8.972   -6.132  1.00 0.00 ? 326 ASP A HD2    5  
ATOM   10376 N N      . PHE A 1 114 ? 24.434 9.356   -8.395  1.00 0.00 ? 327 PHE A N      5  
ATOM   10377 C CA     . PHE A 1 114 ? 25.646 9.550   -7.617  1.00 0.00 ? 327 PHE A CA     5  
ATOM   10378 C C      . PHE A 1 114 ? 26.401 10.797  -8.083  1.00 0.00 ? 327 PHE A C      5  
ATOM   10379 O O      . PHE A 1 114 ? 26.982 11.515  -7.270  1.00 0.00 ? 327 PHE A O      5  
ATOM   10380 C CB     . PHE A 1 114 ? 26.527 8.320   -7.845  1.00 0.00 ? 327 PHE A CB     5  
ATOM   10381 C CG     . PHE A 1 114 ? 27.699 8.204   -6.870  1.00 0.00 ? 327 PHE A CG     5  
ATOM   10382 C CD1    . PHE A 1 114 ? 28.888 8.796   -7.163  1.00 0.00 ? 327 PHE A CD1    5  
ATOM   10383 C CD2    . PHE A 1 114 ? 27.553 7.510   -5.709  1.00 0.00 ? 327 PHE A CD2    5  
ATOM   10384 C CE1    . PHE A 1 114 ? 29.977 8.688   -6.256  1.00 0.00 ? 327 PHE A CE1    5  
ATOM   10385 C CE2    . PHE A 1 114 ? 28.640 7.403   -4.804  1.00 0.00 ? 327 PHE A CE2    5  
ATOM   10386 C CZ     . PHE A 1 114 ? 29.829 7.995   -5.097  1.00 0.00 ? 327 PHE A CZ     5  
ATOM   10387 H H      . PHE A 1 114 ? 24.445 8.562   -9.004  1.00 0.00 ? 327 PHE A H      5  
ATOM   10388 H HA     . PHE A 1 114 ? 25.346 9.677   -6.577  1.00 0.00 ? 327 PHE A HA     5  
ATOM   10389 H HB2    . PHE A 1 114 ? 25.910 7.425   -7.764  1.00 0.00 ? 327 PHE A HB2    5  
ATOM   10390 H HB3    . PHE A 1 114 ? 26.916 8.348   -8.863  1.00 0.00 ? 327 PHE A HB3    5  
ATOM   10391 H HD1    . PHE A 1 114 ? 29.006 9.352   -8.092  1.00 0.00 ? 327 PHE A HD1    5  
ATOM   10392 H HD2    . PHE A 1 114 ? 26.599 7.036   -5.474  1.00 0.00 ? 327 PHE A HD2    5  
ATOM   10393 H HE1    . PHE A 1 114 ? 30.929 9.163   -6.491  1.00 0.00 ? 327 PHE A HE1    5  
ATOM   10394 H HE2    . PHE A 1 114 ? 28.523 6.847   -3.873  1.00 0.00 ? 327 PHE A HE2    5  
ATOM   10395 H HZ     . PHE A 1 114 ? 30.666 7.912   -4.401  1.00 0.00 ? 327 PHE A HZ     5  
ATOM   10396 N N      . GLN A 1 115 ? 26.369 11.016  -9.389  1.00 0.00 ? 328 GLN A N      5  
ATOM   10397 C CA     . GLN A 1 115 ? 27.043 12.164  -9.973  1.00 0.00 ? 328 GLN A CA     5  
ATOM   10398 C C      . GLN A 1 115 ? 26.257 13.444  -9.685  1.00 0.00 ? 328 GLN A C      5  
ATOM   10399 O O      . GLN A 1 115 ? 26.838 14.523  -9.584  1.00 0.00 ? 328 GLN A O      5  
ATOM   10400 C CB     . GLN A 1 115 ? 27.248 11.972  -11.476 1.00 0.00 ? 328 GLN A CB     5  
ATOM   10401 C CG     . GLN A 1 115 ? 28.540 11.203  -11.760 1.00 0.00 ? 328 GLN A CG     5  
ATOM   10402 C CD     . GLN A 1 115 ? 28.793 11.092  -13.266 1.00 0.00 ? 328 GLN A CD     5  
ATOM   10403 O OE1    . GLN A 1 115 ? 28.431 10.123  -13.912 1.00 0.00 ? 328 GLN A OE1    5  
ATOM   10404 N NE2    . GLN A 1 115 ? 29.432 12.136  -13.785 1.00 0.00 ? 328 GLN A NE2    5  
ATOM   10405 H H      . GLN A 1 115 ? 25.895 10.427  -10.043 1.00 0.00 ? 328 GLN A H      5  
ATOM   10406 H HA     . GLN A 1 115 ? 28.016 12.208  -9.483  1.00 0.00 ? 328 GLN A HA     5  
ATOM   10407 H HB2    . GLN A 1 115 ? 26.400 11.433  -11.898 1.00 0.00 ? 328 GLN A HB2    5  
ATOM   10408 H HB3    . GLN A 1 115 ? 27.284 12.944  -11.969 1.00 0.00 ? 328 GLN A HB3    5  
ATOM   10409 H HG2    . GLN A 1 115 ? 29.380 11.707  -11.284 1.00 0.00 ? 328 GLN A HG2    5  
ATOM   10410 H HG3    . GLN A 1 115 ? 28.477 10.205  -11.324 1.00 0.00 ? 328 GLN A HG3    5  
ATOM   10411 H HE21   . GLN A 1 115 ? 29.701 12.900  -13.199 1.00 0.00 ? 328 GLN A HE21   5  
ATOM   10412 H HE22   . GLN A 1 115 ? 29.643 12.157  -14.762 1.00 0.00 ? 328 GLN A HE22   5  
ATOM   10413 N N      . MET A 1 116 ? 24.948 13.281  -9.560  1.00 0.00 ? 329 MET A N      5  
ATOM   10414 C CA     . MET A 1 116 ? 24.077 14.410  -9.286  1.00 0.00 ? 329 MET A CA     5  
ATOM   10415 C C      . MET A 1 116 ? 24.182 14.842  -7.821  1.00 0.00 ? 329 MET A C      5  
ATOM   10416 O O      . MET A 1 116 ? 24.162 16.034  -7.518  1.00 0.00 ? 329 MET A O      5  
ATOM   10417 C CB     . MET A 1 116 ? 22.630 14.029  -9.603  1.00 0.00 ? 329 MET A CB     5  
ATOM   10418 C CG     . MET A 1 116 ? 21.668 15.153  -9.213  1.00 0.00 ? 329 MET A CG     5  
ATOM   10419 S SD     . MET A 1 116 ? 19.986 14.552  -9.237  1.00 0.00 ? 329 MET A SD     5  
ATOM   10420 C CE     . MET A 1 116 ? 19.845 13.962  -7.557  1.00 0.00 ? 329 MET A CE     5  
ATOM   10421 H H      . MET A 1 116 ? 24.483 12.400  -9.643  1.00 0.00 ? 329 MET A H      5  
ATOM   10422 H HA     . MET A 1 116 ? 24.427 15.214  -9.934  1.00 0.00 ? 329 MET A HA     5  
ATOM   10423 H HB2    . MET A 1 116 ? 22.531 13.814  -10.667 1.00 0.00 ? 329 MET A HB2    5  
ATOM   10424 H HB3    . MET A 1 116 ? 22.365 13.117  -9.068  1.00 0.00 ? 329 MET A HB3    5  
ATOM   10425 H HG2    . MET A 1 116 ? 21.915 15.526  -8.220  1.00 0.00 ? 329 MET A HG2    5  
ATOM   10426 H HG3    . MET A 1 116 ? 21.773 15.989  -9.904  1.00 0.00 ? 329 MET A HG3    5  
ATOM   10427 H HE1    . MET A 1 116 ? 20.483 13.089  -7.424  1.00 0.00 ? 329 MET A HE1    5  
ATOM   10428 H HE2    . MET A 1 116 ? 20.156 14.748  -6.869  1.00 0.00 ? 329 MET A HE2    5  
ATOM   10429 H HE3    . MET A 1 116 ? 18.809 13.690  -7.355  1.00 0.00 ? 329 MET A HE3    5  
ATOM   10430 N N      . LEU A 1 117 ? 24.292 13.848  -6.952  1.00 0.00 ? 330 LEU A N      5  
ATOM   10431 C CA     . LEU A 1 117 ? 24.401 14.109  -5.527  1.00 0.00 ? 330 LEU A CA     5  
ATOM   10432 C C      . LEU A 1 117 ? 25.812 14.606  -5.210  1.00 0.00 ? 330 LEU A C      5  
ATOM   10433 O O      . LEU A 1 117 ? 26.001 15.412  -4.300  1.00 0.00 ? 330 LEU A O      5  
ATOM   10434 C CB     . LEU A 1 117 ? 23.989 12.874  -4.723  1.00 0.00 ? 330 LEU A CB     5  
ATOM   10435 C CG     . LEU A 1 117 ? 24.822 11.612  -4.957  1.00 0.00 ? 330 LEU A CG     5  
ATOM   10436 C CD1    . LEU A 1 117 ? 26.091 11.628  -4.103  1.00 0.00 ? 330 LEU A CD1    5  
ATOM   10437 C CD2    . LEU A 1 117 ? 23.987 10.352  -4.720  1.00 0.00 ? 330 LEU A CD2    5  
ATOM   10438 H H      . LEU A 1 117 ? 24.308 12.881  -7.207  1.00 0.00 ? 330 LEU A H      5  
ATOM   10439 H HA     . LEU A 1 117 ? 23.693 14.902  -5.285  1.00 0.00 ? 330 LEU A HA     5  
ATOM   10440 H HB2    . LEU A 1 117 ? 24.033 13.124  -3.663  1.00 0.00 ? 330 LEU A HB2    5  
ATOM   10441 H HB3    . LEU A 1 117 ? 22.948 12.646  -4.954  1.00 0.00 ? 330 LEU A HB3    5  
ATOM   10442 H HG     . LEU A 1 117 ? 25.136 11.599  -6.001  1.00 0.00 ? 330 LEU A HG     5  
ATOM   10443 H HD11   . LEU A 1 117 ? 26.666 12.528  -4.323  1.00 0.00 ? 330 LEU A HD11   5  
ATOM   10444 H HD12   . LEU A 1 117 ? 25.819 11.620  -3.048  1.00 0.00 ? 330 LEU A HD12   5  
ATOM   10445 H HD13   . LEU A 1 117 ? 26.693 10.749  -4.330  1.00 0.00 ? 330 LEU A HD13   5  
ATOM   10446 H HD21   . LEU A 1 117 ? 23.157 10.586  -4.053  1.00 0.00 ? 330 LEU A HD21   5  
ATOM   10447 H HD22   . LEU A 1 117 ? 23.598 9.990   -5.672  1.00 0.00 ? 330 LEU A HD22   5  
ATOM   10448 H HD23   . LEU A 1 117 ? 24.612 9.583   -4.267  1.00 0.00 ? 330 LEU A HD23   5  
ATOM   10449 N N      . CYS A 1 118 ? 26.768 14.104  -5.978  1.00 0.00 ? 331 CYS A N      5  
ATOM   10450 C CA     . CYS A 1 118 ? 28.158 14.488  -5.791  1.00 0.00 ? 331 CYS A CA     5  
ATOM   10451 C C      . CYS A 1 118 ? 28.308 15.958  -6.187  1.00 0.00 ? 331 CYS A C      5  
ATOM   10452 O O      . CYS A 1 118 ? 29.035 16.708  -5.538  1.00 0.00 ? 331 CYS A O      5  
ATOM   10453 C CB     . CYS A 1 118 ? 29.105 13.584  -6.581  1.00 0.00 ? 331 CYS A CB     5  
ATOM   10454 S SG     . CYS A 1 118 ? 29.918 12.393  -5.454  1.00 0.00 ? 331 CYS A SG     5  
ATOM   10455 H H      . CYS A 1 118 ? 26.606 13.450  -6.717  1.00 0.00 ? 331 CYS A H      5  
ATOM   10456 H HA     . CYS A 1 118 ? 28.381 14.348  -4.733  1.00 0.00 ? 331 CYS A HA     5  
ATOM   10457 H HB2    . CYS A 1 118 ? 28.552 13.048  -7.352  1.00 0.00 ? 331 CYS A HB2    5  
ATOM   10458 H HB3    . CYS A 1 118 ? 29.856 14.187  -7.090  1.00 0.00 ? 331 CYS A HB3    5  
ATOM   10459 H HG     . CYS A 1 118 ? 28.862 11.599  -5.304  1.00 0.00 ? 331 CYS A HG     5  
ATOM   10460 N N      . SER A 1 119 ? 27.610 16.325  -7.252  1.00 0.00 ? 332 SER A N      5  
ATOM   10461 C CA     . SER A 1 119 ? 27.657 17.692  -7.742  1.00 0.00 ? 332 SER A CA     5  
ATOM   10462 C C      . SER A 1 119 ? 26.866 18.611  -6.809  1.00 0.00 ? 332 SER A C      5  
ATOM   10463 O O      . SER A 1 119 ? 27.172 19.796  -6.693  1.00 0.00 ? 332 SER A O      5  
ATOM   10464 C CB     . SER A 1 119 ? 27.108 17.785  -9.168  1.00 0.00 ? 332 SER A CB     5  
ATOM   10465 O OG     . SER A 1 119 ? 27.637 18.906  -9.871  1.00 0.00 ? 332 SER A OG     5  
ATOM   10466 H H      . SER A 1 119 ? 27.021 15.709  -7.774  1.00 0.00 ? 332 SER A H      5  
ATOM   10467 H HA     . SER A 1 119 ? 28.712 17.963  -7.741  1.00 0.00 ? 332 SER A HA     5  
ATOM   10468 H HB2    . SER A 1 119 ? 27.350 16.870  -9.709  1.00 0.00 ? 332 SER A HB2    5  
ATOM   10469 H HB3    . SER A 1 119 ? 26.022 17.857  -9.134  1.00 0.00 ? 332 SER A HB3    5  
ATOM   10470 H HG     . SER A 1 119 ? 26.967 19.648  -9.884  1.00 0.00 ? 332 SER A HG     5  
ATOM   10471 N N      . SER A 1 120 ? 25.864 18.028  -6.168  1.00 0.00 ? 333 SER A N      5  
ATOM   10472 C CA     . SER A 1 120 ? 25.026 18.780  -5.248  1.00 0.00 ? 333 SER A CA     5  
ATOM   10473 C C      . SER A 1 120 ? 25.822 19.142  -3.992  1.00 0.00 ? 333 SER A C      5  
ATOM   10474 O O      . SER A 1 120 ? 25.733 20.265  -3.498  1.00 0.00 ? 333 SER A O      5  
ATOM   10475 C CB     . SER A 1 120 ? 23.773 17.988  -4.871  1.00 0.00 ? 333 SER A CB     5  
ATOM   10476 O OG     . SER A 1 120 ? 22.614 18.816  -4.815  1.00 0.00 ? 333 SER A OG     5  
ATOM   10477 H H      . SER A 1 120 ? 25.620 17.064  -6.267  1.00 0.00 ? 333 SER A H      5  
ATOM   10478 H HA     . SER A 1 120 ? 24.738 19.680  -5.790  1.00 0.00 ? 333 SER A HA     5  
ATOM   10479 H HB2    . SER A 1 120 ? 23.614 17.192  -5.600  1.00 0.00 ? 333 SER A HB2    5  
ATOM   10480 H HB3    . SER A 1 120 ? 23.923 17.508  -3.904  1.00 0.00 ? 333 SER A HB3    5  
ATOM   10481 H HG     . SER A 1 120 ? 22.144 18.688  -3.942  1.00 0.00 ? 333 SER A HG     5  
ATOM   10482 N N      . SER A 1 121 ? 26.582 18.169  -3.511  1.00 0.00 ? 334 SER A N      5  
ATOM   10483 C CA     . SER A 1 121 ? 27.393 18.371  -2.323  1.00 0.00 ? 334 SER A CA     5  
ATOM   10484 C C      . SER A 1 121 ? 28.854 18.029  -2.622  1.00 0.00 ? 334 SER A C      5  
ATOM   10485 O O      . SER A 1 121 ? 29.169 16.897  -2.987  1.00 0.00 ? 334 SER A O      5  
ATOM   10486 C CB     . SER A 1 121 ? 26.879 17.527  -1.155  1.00 0.00 ? 334 SER A CB     5  
ATOM   10487 O OG     . SER A 1 121 ? 27.355 18.005  0.100   1.00 0.00 ? 334 SER A OG     5  
ATOM   10488 H H      . SER A 1 121 ? 26.649 17.258  -3.919  1.00 0.00 ? 334 SER A H      5  
ATOM   10489 H HA     . SER A 1 121 ? 27.290 19.429  -2.079  1.00 0.00 ? 334 SER A HA     5  
ATOM   10490 H HB2    . SER A 1 121 ? 25.789 17.534  -1.155  1.00 0.00 ? 334 SER A HB2    5  
ATOM   10491 H HB3    . SER A 1 121 ? 27.191 16.491  -1.291  1.00 0.00 ? 334 SER A HB3    5  
ATOM   10492 H HG     . SER A 1 121 ? 28.339 17.844  0.177   1.00 0.00 ? 334 SER A HG     5  
ATOM   10493 N N      . PRO A 1 122 ? 29.731 19.054  -2.451  1.00 0.00 ? 335 PRO A N      5  
ATOM   10494 C CA     . PRO A 1 122 ? 31.152 18.874  -2.699  1.00 0.00 ? 335 PRO A CA     5  
ATOM   10495 C C      . PRO A 1 122 ? 31.808 18.079  -1.569  1.00 0.00 ? 335 PRO A C      5  
ATOM   10496 O O      . PRO A 1 122 ? 32.858 17.467  -1.764  1.00 0.00 ? 335 PRO A O      5  
ATOM   10497 C CB     . PRO A 1 122 ? 31.709 20.281  -2.837  1.00 0.00 ? 335 PRO A CB     5  
ATOM   10498 C CG     . PRO A 1 122 ? 30.678 21.202  -2.204  1.00 0.00 ? 335 PRO A CG     5  
ATOM   10499 C CD     . PRO A 1 122 ? 29.395 20.409  -2.020  1.00 0.00 ? 335 PRO A CD     5  
ATOM   10500 H HA     . PRO A 1 122 ? 31.293 18.336  -3.530  1.00 0.00 ? 335 PRO A HA     5  
ATOM   10501 H HB2    . PRO A 1 122 ? 32.673 20.371  -2.336  1.00 0.00 ? 335 PRO A HB2    5  
ATOM   10502 H HB3    . PRO A 1 122 ? 31.870 20.537  -3.885  1.00 0.00 ? 335 PRO A HB3    5  
ATOM   10503 H HG2    . PRO A 1 122 ? 31.037 21.574  -1.244  1.00 0.00 ? 335 PRO A HG2    5  
ATOM   10504 H HG3    . PRO A 1 122 ? 30.502 22.071  -2.838  1.00 0.00 ? 335 PRO A HG3    5  
ATOM   10505 H HD2    . PRO A 1 122 ? 29.066 20.422  -0.980  1.00 0.00 ? 335 PRO A HD2    5  
ATOM   10506 H HD3    . PRO A 1 122 ? 28.583 20.824  -2.617  1.00 0.00 ? 335 PRO A HD3    5  
ATOM   10507 N N      . GLU A 1 123 ? 31.164 18.113  -0.412  1.00 0.00 ? 336 GLU A N      5  
ATOM   10508 C CA     . GLU A 1 123 ? 31.672 17.403  0.750   1.00 0.00 ? 336 GLU A CA     5  
ATOM   10509 C C      . GLU A 1 123 ? 31.419 15.901  0.605   1.00 0.00 ? 336 GLU A C      5  
ATOM   10510 O O      . GLU A 1 123 ? 32.247 15.087  1.011   1.00 0.00 ? 336 GLU A O      5  
ATOM   10511 C CB     . GLU A 1 123 ? 31.050 17.944  2.038   1.00 0.00 ? 336 GLU A CB     5  
ATOM   10512 C CG     . GLU A 1 123 ? 32.116 18.160  3.114   1.00 0.00 ? 336 GLU A CG     5  
ATOM   10513 C CD     . GLU A 1 123 ? 32.435 19.648  3.278   1.00 0.00 ? 336 GLU A CD     5  
ATOM   10514 O OE1    . GLU A 1 123 ? 31.574 20.421  3.723   1.00 0.00 ? 336 GLU A OE1    5  
ATOM   10515 O OE2    . GLU A 1 123 ? 33.627 19.992  2.926   1.00 0.00 ? 336 GLU A OE2    5  
ATOM   10516 H H      . GLU A 1 123 ? 30.311 18.614  -0.262  1.00 0.00 ? 336 GLU A H      5  
ATOM   10517 H HA     . GLU A 1 123 ? 32.744 17.599  0.762   1.00 0.00 ? 336 GLU A HA     5  
ATOM   10518 H HB2    . GLU A 1 123 ? 30.539 18.884  1.833   1.00 0.00 ? 336 GLU A HB2    5  
ATOM   10519 H HB3    . GLU A 1 123 ? 30.297 17.245  2.403   1.00 0.00 ? 336 GLU A HB3    5  
ATOM   10520 H HG2    . GLU A 1 123 ? 31.769 17.751  4.063   1.00 0.00 ? 336 GLU A HG2    5  
ATOM   10521 H HG3    . GLU A 1 123 ? 33.023 17.618  2.845   1.00 0.00 ? 336 GLU A HG3    5  
ATOM   10522 H HE2    . GLU A 1 123 ? 34.072 20.490  3.669   1.00 0.00 ? 336 GLU A HE2    5  
ATOM   10523 N N      . ILE A 1 124 ? 30.271 15.579  0.028   1.00 0.00 ? 337 ILE A N      5  
ATOM   10524 C CA     . ILE A 1 124 ? 29.898 14.190  -0.174  1.00 0.00 ? 337 ILE A CA     5  
ATOM   10525 C C      . ILE A 1 124 ? 30.822 13.566  -1.221  1.00 0.00 ? 337 ILE A C      5  
ATOM   10526 O O      . ILE A 1 124 ? 31.129 12.376  -1.154  1.00 0.00 ? 337 ILE A O      5  
ATOM   10527 C CB     . ILE A 1 124 ? 28.412 14.078  -0.521  1.00 0.00 ? 337 ILE A CB     5  
ATOM   10528 C CG1    . ILE A 1 124 ? 27.541 14.578  0.633   1.00 0.00 ? 337 ILE A CG1    5  
ATOM   10529 C CG2    . ILE A 1 124 ? 28.052 12.650  -0.934  1.00 0.00 ? 337 ILE A CG2    5  
ATOM   10530 C CD1    . ILE A 1 124 ? 26.119 14.879  0.156   1.00 0.00 ? 337 ILE A CD1    5  
ATOM   10531 H H      . ILE A 1 124 ? 29.602 16.248  -0.299  1.00 0.00 ? 337 ILE A H      5  
ATOM   10532 H HA     . ILE A 1 124 ? 30.048 13.670  0.772   1.00 0.00 ? 337 ILE A HA     5  
ATOM   10533 H HB     . ILE A 1 124 ? 28.213 14.721  -1.378  1.00 0.00 ? 337 ILE A HB     5  
ATOM   10534 H HG12   . ILE A 1 124 ? 27.513 13.829  1.424   1.00 0.00 ? 337 ILE A HG12   5  
ATOM   10535 H HG13   . ILE A 1 124 ? 27.982 15.478  1.063   1.00 0.00 ? 337 ILE A HG13   5  
ATOM   10536 H HG21   . ILE A 1 124 ? 28.947 12.029  -0.917  1.00 0.00 ? 337 ILE A HG21   5  
ATOM   10537 H HG22   . ILE A 1 124 ? 27.317 12.245  -0.238  1.00 0.00 ? 337 ILE A HG22   5  
ATOM   10538 H HG23   . ILE A 1 124 ? 27.634 12.657  -1.941  1.00 0.00 ? 337 ILE A HG23   5  
ATOM   10539 H HD11   . ILE A 1 124 ? 26.085 14.840  -0.933  1.00 0.00 ? 337 ILE A HD11   5  
ATOM   10540 H HD12   . ILE A 1 124 ? 25.433 14.138  0.567   1.00 0.00 ? 337 ILE A HD12   5  
ATOM   10541 H HD13   . ILE A 1 124 ? 25.824 15.873  0.493   1.00 0.00 ? 337 ILE A HD13   5  
ATOM   10542 N N      . ALA A 1 125 ? 31.241 14.396  -2.166  1.00 0.00 ? 338 ALA A N      5  
ATOM   10543 C CA     . ALA A 1 125 ? 32.123 13.939  -3.225  1.00 0.00 ? 338 ALA A CA     5  
ATOM   10544 C C      . ALA A 1 125 ? 33.514 13.672  -2.646  1.00 0.00 ? 338 ALA A C      5  
ATOM   10545 O O      . ALA A 1 125 ? 34.221 12.777  -3.105  1.00 0.00 ? 338 ALA A O      5  
ATOM   10546 C CB     . ALA A 1 125 ? 32.151 14.977  -4.349  1.00 0.00 ? 338 ALA A CB     5  
ATOM   10547 H H      . ALA A 1 125 ? 30.986 15.361  -2.213  1.00 0.00 ? 338 ALA A H      5  
ATOM   10548 H HA     . ALA A 1 125 ? 31.718 13.008  -3.618  1.00 0.00 ? 338 ALA A HA     5  
ATOM   10549 H HB1    . ALA A 1 125 ? 32.967 15.679  -4.177  1.00 0.00 ? 338 ALA A HB1    5  
ATOM   10550 H HB2    . ALA A 1 125 ? 32.299 14.475  -5.305  1.00 0.00 ? 338 ALA A HB2    5  
ATOM   10551 H HB3    . ALA A 1 125 ? 31.204 15.518  -4.367  1.00 0.00 ? 338 ALA A HB3    5  
ATOM   10552 N N      . GLU A 1 126 ? 33.865 14.466  -1.643  1.00 0.00 ? 339 GLU A N      5  
ATOM   10553 C CA     . GLU A 1 126 ? 35.157 14.325  -0.995  1.00 0.00 ? 339 GLU A CA     5  
ATOM   10554 C C      . GLU A 1 126 ? 35.162 13.102  -0.076  1.00 0.00 ? 339 GLU A C      5  
ATOM   10555 O O      . GLU A 1 126 ? 36.157 12.384  0.003   1.00 0.00 ? 339 GLU A O      5  
ATOM   10556 C CB     . GLU A 1 126 ? 35.523 15.594  -0.222  1.00 0.00 ? 339 GLU A CB     5  
ATOM   10557 C CG     . GLU A 1 126 ? 36.349 16.546  -1.090  1.00 0.00 ? 339 GLU A CG     5  
ATOM   10558 C CD     . GLU A 1 126 ? 36.376 17.953  -0.487  1.00 0.00 ? 339 GLU A CD     5  
ATOM   10559 O OE1    . GLU A 1 126 ? 35.323 18.481  -0.099  1.00 0.00 ? 339 GLU A OE1    5  
ATOM   10560 O OE2    . GLU A 1 126 ? 37.543 18.498  -0.427  1.00 0.00 ? 339 GLU A OE2    5  
ATOM   10561 H H      . GLU A 1 126 ? 33.284 15.192  -1.275  1.00 0.00 ? 339 GLU A H      5  
ATOM   10562 H HA     . GLU A 1 126 ? 35.874 14.182  -1.805  1.00 0.00 ? 339 GLU A HA     5  
ATOM   10563 H HB2    . GLU A 1 126 ? 34.615 16.095  0.112   1.00 0.00 ? 339 GLU A HB2    5  
ATOM   10564 H HB3    . GLU A 1 126 ? 36.088 15.329  0.673   1.00 0.00 ? 339 GLU A HB3    5  
ATOM   10565 H HG2    . GLU A 1 126 ? 37.367 16.168  -1.185  1.00 0.00 ? 339 GLU A HG2    5  
ATOM   10566 H HG3    . GLU A 1 126 ? 35.928 16.585  -2.094  1.00 0.00 ? 339 GLU A HG3    5  
ATOM   10567 H HE2    . GLU A 1 126 ? 38.073 18.261  -1.241  1.00 0.00 ? 339 GLU A HE2    5  
ATOM   10568 N N      . ILE A 1 127 ? 34.037 12.903  0.594   1.00 0.00 ? 340 ILE A N      5  
ATOM   10569 C CA     . ILE A 1 127 ? 33.898 11.779  1.506   1.00 0.00 ? 340 ILE A CA     5  
ATOM   10570 C C      . ILE A 1 127 ? 33.959 10.473  0.710   1.00 0.00 ? 340 ILE A C      5  
ATOM   10571 O O      . ILE A 1 127 ? 34.451 9.462   1.207   1.00 0.00 ? 340 ILE A O      5  
ATOM   10572 C CB     . ILE A 1 127 ? 32.631 11.927  2.349   1.00 0.00 ? 340 ILE A CB     5  
ATOM   10573 C CG1    . ILE A 1 127 ? 32.946 11.790  3.840   1.00 0.00 ? 340 ILE A CG1    5  
ATOM   10574 C CG2    . ILE A 1 127 ? 31.553 10.939  1.898   1.00 0.00 ? 340 ILE A CG2    5  
ATOM   10575 C CD1    . ILE A 1 127 ? 31.914 12.536  4.689   1.00 0.00 ? 340 ILE A CD1    5  
ATOM   10576 H H      . ILE A 1 127 ? 33.232 13.492  0.525   1.00 0.00 ? 340 ILE A H      5  
ATOM   10577 H HA     . ILE A 1 127 ? 34.746 11.807  2.190   1.00 0.00 ? 340 ILE A HA     5  
ATOM   10578 H HB     . ILE A 1 127 ? 32.232 12.929  2.194   1.00 0.00 ? 340 ILE A HB     5  
ATOM   10579 H HG12   . ILE A 1 127 ? 32.956 10.736  4.117   1.00 0.00 ? 340 ILE A HG12   5  
ATOM   10580 H HG13   . ILE A 1 127 ? 33.942 12.183  4.043   1.00 0.00 ? 340 ILE A HG13   5  
ATOM   10581 H HG21   . ILE A 1 127 ? 30.620 11.156  2.418   1.00 0.00 ? 340 ILE A HG21   5  
ATOM   10582 H HG22   . ILE A 1 127 ? 31.400 11.033  0.822   1.00 0.00 ? 340 ILE A HG22   5  
ATOM   10583 H HG23   . ILE A 1 127 ? 31.871 9.922   2.132   1.00 0.00 ? 340 ILE A HG23   5  
ATOM   10584 H HD11   . ILE A 1 127 ? 30.930 12.094  4.536   1.00 0.00 ? 340 ILE A HD11   5  
ATOM   10585 H HD12   . ILE A 1 127 ? 32.187 12.461  5.742   1.00 0.00 ? 340 ILE A HD12   5  
ATOM   10586 H HD13   . ILE A 1 127 ? 31.891 13.586  4.393   1.00 0.00 ? 340 ILE A HD13   5  
ATOM   10587 N N      . PHE A 1 128 ? 33.452 10.539  -0.513  1.00 0.00 ? 341 PHE A N      5  
ATOM   10588 C CA     . PHE A 1 128 ? 33.442 9.374   -1.382  1.00 0.00 ? 341 PHE A CA     5  
ATOM   10589 C C      . PHE A 1 128 ? 34.848 9.065   -1.901  1.00 0.00 ? 341 PHE A C      5  
ATOM   10590 O O      . PHE A 1 128 ? 35.259 7.906   -1.940  1.00 0.00 ? 341 PHE A O      5  
ATOM   10591 C CB     . PHE A 1 128 ? 32.536 9.709   -2.567  1.00 0.00 ? 341 PHE A CB     5  
ATOM   10592 C CG     . PHE A 1 128 ? 31.093 9.228   -2.403  1.00 0.00 ? 341 PHE A CG     5  
ATOM   10593 C CD1    . PHE A 1 128 ? 30.843 7.958   -1.985  1.00 0.00 ? 341 PHE A CD1    5  
ATOM   10594 C CD2    . PHE A 1 128 ? 30.060 10.070  -2.677  1.00 0.00 ? 341 PHE A CD2    5  
ATOM   10595 C CE1    . PHE A 1 128 ? 29.503 7.512   -1.832  1.00 0.00 ? 341 PHE A CE1    5  
ATOM   10596 C CE2    . PHE A 1 128 ? 28.721 9.623   -2.524  1.00 0.00 ? 341 PHE A CE2    5  
ATOM   10597 C CZ     . PHE A 1 128 ? 28.471 8.353   -2.105  1.00 0.00 ? 341 PHE A CZ     5  
ATOM   10598 H H      . PHE A 1 128 ? 33.055 11.366  -0.910  1.00 0.00 ? 341 PHE A H      5  
ATOM   10599 H HA     . PHE A 1 128 ? 33.083 8.532   -0.790  1.00 0.00 ? 341 PHE A HA     5  
ATOM   10600 H HB2    . PHE A 1 128 ? 32.534 10.788  -2.717  1.00 0.00 ? 341 PHE A HB2    5  
ATOM   10601 H HB3    . PHE A 1 128 ? 32.956 9.263   -3.470  1.00 0.00 ? 341 PHE A HB3    5  
ATOM   10602 H HD1    . PHE A 1 128 ? 31.670 7.284   -1.766  1.00 0.00 ? 341 PHE A HD1    5  
ATOM   10603 H HD2    . PHE A 1 128 ? 30.261 11.087  -3.012  1.00 0.00 ? 341 PHE A HD2    5  
ATOM   10604 H HE1    . PHE A 1 128 ? 29.302 6.494   -1.496  1.00 0.00 ? 341 PHE A HE1    5  
ATOM   10605 H HE2    . PHE A 1 128 ? 27.894 10.298  -2.743  1.00 0.00 ? 341 PHE A HE2    5  
ATOM   10606 H HZ     . PHE A 1 128 ? 27.443 8.011   -1.988  1.00 0.00 ? 341 PHE A HZ     5  
ATOM   10607 N N      . ARG A 1 129 ? 35.548 10.122  -2.285  1.00 0.00 ? 342 ARG A N      5  
ATOM   10608 C CA     . ARG A 1 129 ? 36.900 9.979   -2.800  1.00 0.00 ? 342 ARG A CA     5  
ATOM   10609 C C      . ARG A 1 129 ? 37.838 9.486   -1.697  1.00 0.00 ? 342 ARG A C      5  
ATOM   10610 O O      . ARG A 1 129 ? 38.797 8.766   -1.969  1.00 0.00 ? 342 ARG A O      5  
ATOM   10611 C CB     . ARG A 1 129 ? 37.424 11.307  -3.350  1.00 0.00 ? 342 ARG A CB     5  
ATOM   10612 C CG     . ARG A 1 129 ? 38.918 11.219  -3.665  1.00 0.00 ? 342 ARG A CG     5  
ATOM   10613 C CD     . ARG A 1 129 ? 39.759 11.506  -2.420  1.00 0.00 ? 342 ARG A CD     5  
ATOM   10614 N NE     . ARG A 1 129 ? 40.424 12.822  -2.551  1.00 0.00 ? 342 ARG A NE     5  
ATOM   10615 C CZ     . ARG A 1 129 ? 41.513 13.041  -3.300  1.00 0.00 ? 342 ARG A CZ     5  
ATOM   10616 N NH1    . ARG A 1 129 ? 42.067 12.034  -3.989  1.00 0.00 ? 342 ARG A NH1    5  
ATOM   10617 N NH2    . ARG A 1 129 ? 42.049 14.268  -3.359  1.00 0.00 ? 342 ARG A NH2    5  
ATOM   10618 H H      . ARG A 1 129 ? 35.207 11.063  -2.250  1.00 0.00 ? 342 ARG A H      5  
ATOM   10619 H HA     . ARG A 1 129 ? 36.816 9.245   -3.601  1.00 0.00 ? 342 ARG A HA     5  
ATOM   10620 H HB2    . ARG A 1 129 ? 36.872 11.574  -4.252  1.00 0.00 ? 342 ARG A HB2    5  
ATOM   10621 H HB3    . ARG A 1 129 ? 37.248 12.101  -2.623  1.00 0.00 ? 342 ARG A HB3    5  
ATOM   10622 H HG2    . ARG A 1 129 ? 39.154 10.226  -4.048  1.00 0.00 ? 342 ARG A HG2    5  
ATOM   10623 H HG3    . ARG A 1 129 ? 39.169 11.931  -4.451  1.00 0.00 ? 342 ARG A HG3    5  
ATOM   10624 H HD2    . ARG A 1 129 ? 39.125 11.495  -1.533  1.00 0.00 ? 342 ARG A HD2    5  
ATOM   10625 H HD3    . ARG A 1 129 ? 40.506 10.723  -2.287  1.00 0.00 ? 342 ARG A HD3    5  
ATOM   10626 H HE     . ARG A 1 129 ? 40.037 13.595  -2.049  1.00 0.00 ? 342 ARG A HE     5  
ATOM   10627 H HH11   . ARG A 1 129 ? 41.667 11.120  -3.945  1.00 0.00 ? 342 ARG A HH11   5  
ATOM   10628 H HH12   . ARG A 1 129 ? 42.879 12.199  -4.549  1.00 0.00 ? 342 ARG A HH12   5  
ATOM   10629 H HH21   . ARG A 1 129 ? 41.636 15.020  -2.844  1.00 0.00 ? 342 ARG A HH21   5  
ATOM   10630 H HH22   . ARG A 1 129 ? 42.862 14.432  -3.918  1.00 0.00 ? 342 ARG A HH22   5  
ATOM   10631 N N      . LYS A 1 130 ? 37.529 9.894   -0.475  1.00 0.00 ? 343 LYS A N      5  
ATOM   10632 C CA     . LYS A 1 130 ? 38.332 9.502   0.671   1.00 0.00 ? 343 LYS A CA     5  
ATOM   10633 C C      . LYS A 1 130 ? 38.166 8.002   0.916   1.00 0.00 ? 343 LYS A C      5  
ATOM   10634 O O      . LYS A 1 130 ? 39.121 7.320   1.286   1.00 0.00 ? 343 LYS A O      5  
ATOM   10635 C CB     . LYS A 1 130 ? 37.989 10.366  1.887   1.00 0.00 ? 343 LYS A CB     5  
ATOM   10636 C CG     . LYS A 1 130 ? 39.064 11.428  2.126   1.00 0.00 ? 343 LYS A CG     5  
ATOM   10637 C CD     . LYS A 1 130 ? 39.259 12.300  0.884   1.00 0.00 ? 343 LYS A CD     5  
ATOM   10638 C CE     . LYS A 1 130 ? 39.434 13.770  1.268   1.00 0.00 ? 343 LYS A CE     5  
ATOM   10639 N NZ     . LYS A 1 130 ? 40.861 14.077  1.511   1.00 0.00 ? 343 LYS A NZ     5  
ATOM   10640 H H      . LYS A 1 130 ? 36.747 10.480  -0.262  1.00 0.00 ? 343 LYS A H      5  
ATOM   10641 H HA     . LYS A 1 130 ? 39.374 9.699   0.420   1.00 0.00 ? 343 LYS A HA     5  
ATOM   10642 H HB2    . LYS A 1 130 ? 37.023 10.848  1.735   1.00 0.00 ? 343 LYS A HB2    5  
ATOM   10643 H HB3    . LYS A 1 130 ? 37.892 9.735   2.770   1.00 0.00 ? 343 LYS A HB3    5  
ATOM   10644 H HG2    . LYS A 1 130 ? 38.780 12.053  2.972   1.00 0.00 ? 343 LYS A HG2    5  
ATOM   10645 H HG3    . LYS A 1 130 ? 40.005 10.945  2.388   1.00 0.00 ? 343 LYS A HG3    5  
ATOM   10646 H HD2    . LYS A 1 130 ? 40.135 11.959  0.330   1.00 0.00 ? 343 LYS A HD2    5  
ATOM   10647 H HD3    . LYS A 1 130 ? 38.402 12.192  0.221   1.00 0.00 ? 343 LYS A HD3    5  
ATOM   10648 H HE2    . LYS A 1 130 ? 39.049 14.408  0.472   1.00 0.00 ? 343 LYS A HE2    5  
ATOM   10649 H HE3    . LYS A 1 130 ? 38.851 13.990  2.162   1.00 0.00 ? 343 LYS A HE3    5  
ATOM   10650 H HZ1    . LYS A 1 130 ? 41.007 15.064  1.437   1.00 0.00 ? 343 LYS A HZ1    5  
ATOM   10651 H HZ2    . LYS A 1 130 ? 41.117 13.771  2.428   1.00 0.00 ? 343 LYS A HZ2    5  
ATOM   10652 H HZ3    . LYS A 1 130 ? 41.424 13.605  0.833   1.00 0.00 ? 343 LYS A HZ3    5  
ATOM   10653 N N      . THR A 1 131 ? 36.947 7.531   0.700   1.00 0.00 ? 344 THR A N      5  
ATOM   10654 C CA     . THR A 1 131 ? 36.643 6.123   0.893   1.00 0.00 ? 344 THR A CA     5  
ATOM   10655 C C      . THR A 1 131 ? 37.161 5.299   -0.288  1.00 0.00 ? 344 THR A C      5  
ATOM   10656 O O      . THR A 1 131 ? 37.561 4.148   -0.118  1.00 0.00 ? 344 THR A O      5  
ATOM   10657 C CB     . THR A 1 131 ? 35.134 5.990   1.111   1.00 0.00 ? 344 THR A CB     5  
ATOM   10658 O OG1    . THR A 1 131 ? 34.956 6.298   2.491   1.00 0.00 ? 344 THR A OG1    5  
ATOM   10659 C CG2    . THR A 1 131 ? 34.650 4.544   0.987   1.00 0.00 ? 344 THR A CG2    5  
ATOM   10660 H H      . THR A 1 131 ? 36.175 8.092   0.399   1.00 0.00 ? 344 THR A H      5  
ATOM   10661 H HA     . THR A 1 131 ? 37.171 5.776   1.781   1.00 0.00 ? 344 THR A HA     5  
ATOM   10662 H HB     . THR A 1 131 ? 34.584 6.644   0.436   1.00 0.00 ? 344 THR A HB     5  
ATOM   10663 H HG1    . THR A 1 131 ? 34.032 6.048   2.780   1.00 0.00 ? 344 THR A HG1    5  
ATOM   10664 H HG21   . THR A 1 131 ? 35.124 3.934   1.757   1.00 0.00 ? 344 THR A HG21   5  
ATOM   10665 H HG22   . THR A 1 131 ? 33.568 4.511   1.113   1.00 0.00 ? 344 THR A HG22   5  
ATOM   10666 H HG23   . THR A 1 131 ? 34.914 4.155   0.003   1.00 0.00 ? 344 THR A HG23   5  
ATOM   10667 N N      . ALA A 1 132 ? 37.136 5.920   -1.458  1.00 0.00 ? 345 ALA A N      5  
ATOM   10668 C CA     . ALA A 1 132 ? 37.598 5.259   -2.667  1.00 0.00 ? 345 ALA A CA     5  
ATOM   10669 C C      . ALA A 1 132 ? 39.117 5.088   -2.601  1.00 0.00 ? 345 ALA A C      5  
ATOM   10670 O O      . ALA A 1 132 ? 39.649 4.065   -3.028  1.00 0.00 ? 345 ALA A O      5  
ATOM   10671 C CB     . ALA A 1 132 ? 37.154 6.063   -3.890  1.00 0.00 ? 345 ALA A CB     5  
ATOM   10672 H H      . ALA A 1 132 ? 36.809 6.856   -1.587  1.00 0.00 ? 345 ALA A H      5  
ATOM   10673 H HA     . ALA A 1 132 ? 37.131 4.274   -2.705  1.00 0.00 ? 345 ALA A HA     5  
ATOM   10674 H HB1    . ALA A 1 132 ? 37.818 5.848   -4.726  1.00 0.00 ? 345 ALA A HB1    5  
ATOM   10675 H HB2    . ALA A 1 132 ? 36.134 5.786   -4.156  1.00 0.00 ? 345 ALA A HB2    5  
ATOM   10676 H HB3    . ALA A 1 132 ? 37.193 7.127   -3.659  1.00 0.00 ? 345 ALA A HB3    5  
ATOM   10677 N N      . LEU A 1 133 ? 39.772 6.106   -2.062  1.00 0.00 ? 346 LEU A N      5  
ATOM   10678 C CA     . LEU A 1 133 ? 41.219 6.081   -1.935  1.00 0.00 ? 346 LEU A CA     5  
ATOM   10679 C C      . LEU A 1 133 ? 41.614 5.076   -0.850  1.00 0.00 ? 346 LEU A C      5  
ATOM   10680 O O      . LEU A 1 133 ? 42.570 4.321   -1.018  1.00 0.00 ? 346 LEU A O      5  
ATOM   10681 C CB     . LEU A 1 133 ? 41.760 7.492   -1.693  1.00 0.00 ? 346 LEU A CB     5  
ATOM   10682 C CG     . LEU A 1 133 ? 42.049 7.858   -0.236  1.00 0.00 ? 346 LEU A CG     5  
ATOM   10683 C CD1    . LEU A 1 133 ? 43.444 7.388   0.183   1.00 0.00 ? 346 LEU A CD1    5  
ATOM   10684 C CD2    . LEU A 1 133 ? 41.855 9.358   0.002   1.00 0.00 ? 346 LEU A CD2    5  
ATOM   10685 H H      . LEU A 1 133 ? 39.331 6.935   -1.716  1.00 0.00 ? 346 LEU A H      5  
ATOM   10686 H HA     . LEU A 1 133 ? 41.625 5.739   -2.887  1.00 0.00 ? 346 LEU A HA     5  
ATOM   10687 H HB2    . LEU A 1 133 ? 42.680 7.610   -2.265  1.00 0.00 ? 346 LEU A HB2    5  
ATOM   10688 H HB3    . LEU A 1 133 ? 41.041 8.207   -2.091  1.00 0.00 ? 346 LEU A HB3    5  
ATOM   10689 H HG     . LEU A 1 133 ? 41.330 7.337   0.397   1.00 0.00 ? 346 LEU A HG     5  
ATOM   10690 H HD11   . LEU A 1 133 ? 44.065 8.253   0.413   1.00 0.00 ? 346 LEU A HD11   5  
ATOM   10691 H HD12   . LEU A 1 133 ? 43.364 6.752   1.064   1.00 0.00 ? 346 LEU A HD12   5  
ATOM   10692 H HD13   . LEU A 1 133 ? 43.895 6.823   -0.633  1.00 0.00 ? 346 LEU A HD13   5  
ATOM   10693 H HD21   . LEU A 1 133 ? 41.054 9.725   -0.638  1.00 0.00 ? 346 LEU A HD21   5  
ATOM   10694 H HD22   . LEU A 1 133 ? 41.595 9.529   1.047   1.00 0.00 ? 346 LEU A HD22   5  
ATOM   10695 H HD23   . LEU A 1 133 ? 42.780 9.884   -0.234  1.00 0.00 ? 346 LEU A HD23   5  
ATOM   10696 N N      . GLU A 1 134 ? 40.858 5.100   0.237   1.00 0.00 ? 347 GLU A N      5  
ATOM   10697 C CA     . GLU A 1 134 ? 41.118 4.201   1.349   1.00 0.00 ? 347 GLU A CA     5  
ATOM   10698 C C      . GLU A 1 134 ? 40.873 2.751   0.927   1.00 0.00 ? 347 GLU A C      5  
ATOM   10699 O O      . GLU A 1 134 ? 41.667 1.867   1.243   1.00 0.00 ? 347 GLU A O      5  
ATOM   10700 C CB     . GLU A 1 134 ? 40.264 4.570   2.564   1.00 0.00 ? 347 GLU A CB     5  
ATOM   10701 C CG     . GLU A 1 134 ? 40.942 5.656   3.401   1.00 0.00 ? 347 GLU A CG     5  
ATOM   10702 C CD     . GLU A 1 134 ? 41.549 5.067   4.676   1.00 0.00 ? 347 GLU A CD     5  
ATOM   10703 O OE1    . GLU A 1 134 ? 42.503 4.278   4.602   1.00 0.00 ? 347 GLU A OE1    5  
ATOM   10704 O OE2    . GLU A 1 134 ? 40.994 5.456   5.775   1.00 0.00 ? 347 GLU A OE2    5  
ATOM   10705 H H      . GLU A 1 134 ? 40.083 5.718   0.365   1.00 0.00 ? 347 GLU A H      5  
ATOM   10706 H HA     . GLU A 1 134 ? 42.171 4.342   1.596   1.00 0.00 ? 347 GLU A HA     5  
ATOM   10707 H HB2    . GLU A 1 134 ? 39.286 4.919   2.232   1.00 0.00 ? 347 GLU A HB2    5  
ATOM   10708 H HB3    . GLU A 1 134 ? 40.096 3.685   3.177   1.00 0.00 ? 347 GLU A HB3    5  
ATOM   10709 H HG2    . GLU A 1 134 ? 41.722 6.140   2.813   1.00 0.00 ? 347 GLU A HG2    5  
ATOM   10710 H HG3    . GLU A 1 134 ? 40.216 6.426   3.662   1.00 0.00 ? 347 GLU A HG3    5  
ATOM   10711 H HE2    . GLU A 1 134 ? 41.323 4.901   6.538   1.00 0.00 ? 347 GLU A HE2    5  
ATOM   10712 N N      . ARG A 1 135 ? 39.771 2.552   0.219   1.00 0.00 ? 348 ARG A N      5  
ATOM   10713 C CA     . ARG A 1 135 ? 39.412 1.225   -0.249  1.00 0.00 ? 348 ARG A CA     5  
ATOM   10714 C C      . ARG A 1 135 ? 40.348 0.789   -1.378  1.00 0.00 ? 348 ARG A C      5  
ATOM   10715 O O      . ARG A 1 135 ? 40.726 -0.378  -1.460  1.00 0.00 ? 348 ARG A O      5  
ATOM   10716 C CB     . ARG A 1 135 ? 37.967 1.191   -0.753  1.00 0.00 ? 348 ARG A CB     5  
ATOM   10717 C CG     . ARG A 1 135 ? 37.016 0.709   0.344   1.00 0.00 ? 348 ARG A CG     5  
ATOM   10718 C CD     . ARG A 1 135 ? 36.525 1.880   1.198   1.00 0.00 ? 348 ARG A CD     5  
ATOM   10719 N NE     . ARG A 1 135 ? 35.624 1.388   2.263   1.00 0.00 ? 348 ARG A NE     5  
ATOM   10720 C CZ     . ARG A 1 135 ? 34.308 1.192   2.102   1.00 0.00 ? 348 ARG A CZ     5  
ATOM   10721 N NH1    . ARG A 1 135 ? 33.732 1.446   0.920   1.00 0.00 ? 348 ARG A NH1    5  
ATOM   10722 N NH2    . ARG A 1 135 ? 33.568 0.741   3.125   1.00 0.00 ? 348 ARG A NH2    5  
ATOM   10723 H H      . ARG A 1 135 ? 39.131 3.278   -0.034  1.00 0.00 ? 348 ARG A H      5  
ATOM   10724 H HA     . ARG A 1 135 ? 39.523 0.581   0.623   1.00 0.00 ? 348 ARG A HA     5  
ATOM   10725 H HB2    . ARG A 1 135 ? 37.671 2.185   -1.086  1.00 0.00 ? 348 ARG A HB2    5  
ATOM   10726 H HB3    . ARG A 1 135 ? 37.896 0.531   -1.618  1.00 0.00 ? 348 ARG A HB3    5  
ATOM   10727 H HG2    . ARG A 1 135 ? 36.162 0.201   -0.108  1.00 0.00 ? 348 ARG A HG2    5  
ATOM   10728 H HG3    . ARG A 1 135 ? 37.523 -0.020  0.976   1.00 0.00 ? 348 ARG A HG3    5  
ATOM   10729 H HD2    . ARG A 1 135 ? 37.375 2.399   1.640   1.00 0.00 ? 348 ARG A HD2    5  
ATOM   10730 H HD3    . ARG A 1 135 ? 36.001 2.602   0.572   1.00 0.00 ? 348 ARG A HD3    5  
ATOM   10731 H HE     . ARG A 1 135 ? 36.022 1.188   3.158   1.00 0.00 ? 348 ARG A HE     5  
ATOM   10732 H HH11   . ARG A 1 135 ? 34.284 1.782   0.157   1.00 0.00 ? 348 ARG A HH11   5  
ATOM   10733 H HH12   . ARG A 1 135 ? 32.750 1.300   0.800   1.00 0.00 ? 348 ARG A HH12   5  
ATOM   10734 H HH21   . ARG A 1 135 ? 33.998 0.552   4.008   1.00 0.00 ? 348 ARG A HH21   5  
ATOM   10735 H HH22   . ARG A 1 135 ? 32.586 0.596   3.006   1.00 0.00 ? 348 ARG A HH22   5  
ATOM   10736 N N      . ARG A 1 136 ? 40.696 1.751   -2.220  1.00 0.00 ? 349 ARG A N      5  
ATOM   10737 C CA     . ARG A 1 136 ? 41.581 1.481   -3.340  1.00 0.00 ? 349 ARG A CA     5  
ATOM   10738 C C      . ARG A 1 136 ? 42.994 1.172   -2.838  1.00 0.00 ? 349 ARG A C      5  
ATOM   10739 O O      . ARG A 1 136 ? 43.626 0.222   -3.299  1.00 0.00 ? 349 ARG A O      5  
ATOM   10740 C CB     . ARG A 1 136 ? 41.638 2.673   -4.297  1.00 0.00 ? 349 ARG A CB     5  
ATOM   10741 C CG     . ARG A 1 136 ? 42.714 2.468   -5.366  1.00 0.00 ? 349 ARG A CG     5  
ATOM   10742 C CD     . ARG A 1 136 ? 42.886 3.726   -6.220  1.00 0.00 ? 349 ARG A CD     5  
ATOM   10743 N NE     . ARG A 1 136 ? 43.512 3.378   -7.515  1.00 0.00 ? 349 ARG A NE     5  
ATOM   10744 C CZ     . ARG A 1 136 ? 44.787 2.990   -7.652  1.00 0.00 ? 349 ARG A CZ     5  
ATOM   10745 N NH1    . ARG A 1 136 ? 45.579 2.898   -6.575  1.00 0.00 ? 349 ARG A NH1    5  
ATOM   10746 N NH2    . ARG A 1 136 ? 45.270 2.692   -8.867  1.00 0.00 ? 349 ARG A NH2    5  
ATOM   10747 H H      . ARG A 1 136 ? 40.385 2.698   -2.146  1.00 0.00 ? 349 ARG A H      5  
ATOM   10748 H HA     . ARG A 1 136 ? 41.144 0.616   -3.839  1.00 0.00 ? 349 ARG A HA     5  
ATOM   10749 H HB2    . ARG A 1 136 ? 40.667 2.807   -4.774  1.00 0.00 ? 349 ARG A HB2    5  
ATOM   10750 H HB3    . ARG A 1 136 ? 41.847 3.584   -3.738  1.00 0.00 ? 349 ARG A HB3    5  
ATOM   10751 H HG2    . ARG A 1 136 ? 43.661 2.215   -4.890  1.00 0.00 ? 349 ARG A HG2    5  
ATOM   10752 H HG3    . ARG A 1 136 ? 42.442 1.626   -6.003  1.00 0.00 ? 349 ARG A HG3    5  
ATOM   10753 H HD2    . ARG A 1 136 ? 41.917 4.195   -6.390  1.00 0.00 ? 349 ARG A HD2    5  
ATOM   10754 H HD3    . ARG A 1 136 ? 43.503 4.452   -5.692  1.00 0.00 ? 349 ARG A HD3    5  
ATOM   10755 H HE     . ARG A 1 136 ? 42.948 3.435   -8.338  1.00 0.00 ? 349 ARG A HE     5  
ATOM   10756 H HH11   . ARG A 1 136 ? 45.218 3.119   -5.669  1.00 0.00 ? 349 ARG A HH11   5  
ATOM   10757 H HH12   . ARG A 1 136 ? 46.531 2.608   -6.678  1.00 0.00 ? 349 ARG A HH12   5  
ATOM   10758 H HH21   . ARG A 1 136 ? 44.679 2.761   -9.670  1.00 0.00 ? 349 ARG A HH21   5  
ATOM   10759 H HH22   . ARG A 1 136 ? 46.221 2.404   -8.969  1.00 0.00 ? 349 ARG A HH22   5  
ATOM   10760 N N      . GLY A 1 137 ? 43.447 1.990   -1.901  1.00 0.00 ? 350 GLY A N      5  
ATOM   10761 C CA     . GLY A 1 137 ? 44.773 1.816   -1.331  1.00 0.00 ? 350 GLY A CA     5  
ATOM   10762 C C      . GLY A 1 137 ? 44.804 2.262   0.131   1.00 0.00 ? 350 GLY A C      5  
ATOM   10763 O O      . GLY A 1 137 ? 44.077 1.722   0.965   1.00 0.00 ? 350 GLY A O      5  
ATOM   10764 H H      . GLY A 1 137 ? 42.926 2.761   -1.531  1.00 0.00 ? 350 GLY A H      5  
ATOM   10765 H HA2    . GLY A 1 137 ? 45.068 0.769   -1.402  1.00 0.00 ? 350 GLY A HA2    5  
ATOM   10766 H HA3    . GLY A 1 137 ? 45.498 2.391   -1.907  1.00 0.00 ? 350 GLY A HA3    5  
ATOM   10767 N N      . ALA A 1 138 ? 45.652 3.244   0.399   1.00 0.00 ? 351 ALA A N      5  
ATOM   10768 C CA     . ALA A 1 138 ? 45.788 3.769   1.748   1.00 0.00 ? 351 ALA A CA     5  
ATOM   10769 C C      . ALA A 1 138 ? 46.028 2.612   2.719   1.00 0.00 ? 351 ALA A C      5  
ATOM   10770 O O      . ALA A 1 138 ? 45.581 2.655   3.864   1.00 0.00 ? 351 ALA A O      5  
ATOM   10771 C CB     . ALA A 1 138 ? 44.543 4.582   2.107   1.00 0.00 ? 351 ALA A CB     5  
ATOM   10772 H H      . ALA A 1 138 ? 46.239 3.678   -0.283  1.00 0.00 ? 351 ALA A H      5  
ATOM   10773 H HA     . ALA A 1 138 ? 46.654 4.431   1.761   1.00 0.00 ? 351 ALA A HA     5  
ATOM   10774 H HB1    . ALA A 1 138 ? 43.877 3.976   2.721   1.00 0.00 ? 351 ALA A HB1    5  
ATOM   10775 H HB2    . ALA A 1 138 ? 44.837 5.473   2.661   1.00 0.00 ? 351 ALA A HB2    5  
ATOM   10776 H HB3    . ALA A 1 138 ? 44.025 4.878   1.193   1.00 0.00 ? 351 ALA A HB3    5  
ATOM   10777 N N      . ALA A 1 139 ? 46.734 1.605   2.226   1.00 0.00 ? 352 ALA A N      5  
ATOM   10778 C CA     . ALA A 1 139 ? 47.039 0.438   3.037   1.00 0.00 ? 352 ALA A CA     5  
ATOM   10779 C C      . ALA A 1 139 ? 45.744 -0.315  3.348   1.00 0.00 ? 352 ALA A C      5  
ATOM   10780 O O      . ALA A 1 139 ? 44.694 0.299   3.530   1.00 0.00 ? 352 ALA A O      5  
ATOM   10781 C CB     . ALA A 1 139 ? 47.778 0.875   4.303   1.00 0.00 ? 352 ALA A CB     5  
ATOM   10782 H H      . ALA A 1 139 ? 47.094 1.578   1.295   1.00 0.00 ? 352 ALA A H      5  
ATOM   10783 H HA     . ALA A 1 139 ? 47.694 -0.209  2.453   1.00 0.00 ? 352 ALA A HA     5  
ATOM   10784 H HB1    . ALA A 1 139 ? 48.852 0.767   4.152   1.00 0.00 ? 352 ALA A HB1    5  
ATOM   10785 H HB2    . ALA A 1 139 ? 47.544 1.917   4.519   1.00 0.00 ? 352 ALA A HB2    5  
ATOM   10786 H HB3    . ALA A 1 139 ? 47.465 0.251   5.140   1.00 0.00 ? 352 ALA A HB3    5  
ATOM   10787 N N      . ALA A 1 140 ? 45.861 -1.633  3.399   1.00 0.00 ? 353 ALA A N      5  
ATOM   10788 C CA     . ALA A 1 140 ? 44.712 -2.476  3.684   1.00 0.00 ? 353 ALA A CA     5  
ATOM   10789 C C      . ALA A 1 140 ? 43.963 -1.916  4.896   1.00 0.00 ? 353 ALA A C      5  
ATOM   10790 O O      . ALA A 1 140 ? 44.556 -1.252  5.744   1.00 0.00 ? 353 ALA A O      5  
ATOM   10791 C CB     . ALA A 1 140 ? 45.178 -3.917  3.903   1.00 0.00 ? 353 ALA A CB     5  
ATOM   10792 H H      . ALA A 1 140 ? 46.719 -2.125  3.249   1.00 0.00 ? 353 ALA A H      5  
ATOM   10793 H HA     . ALA A 1 140 ? 44.055 -2.447  2.816   1.00 0.00 ? 353 ALA A HA     5  
ATOM   10794 H HB1    . ALA A 1 140 ? 45.275 -4.417  2.939   1.00 0.00 ? 353 ALA A HB1    5  
ATOM   10795 H HB2    . ALA A 1 140 ? 46.142 -3.914  4.410   1.00 0.00 ? 353 ALA A HB2    5  
ATOM   10796 H HB3    . ALA A 1 140 ? 44.447 -4.447  4.515   1.00 0.00 ? 353 ALA A HB3    5  
ATOM   10797 N N      . SER A 1 141 ? 42.671 -2.204  4.938   1.00 0.00 ? 354 SER A N      5  
ATOM   10798 C CA     . SER A 1 141 ? 41.834 -1.738  6.030   1.00 0.00 ? 354 SER A CA     5  
ATOM   10799 C C      . SER A 1 141 ? 41.745 -0.211  6.005   1.00 0.00 ? 354 SER A C      5  
ATOM   10800 O O      . SER A 1 141 ? 42.564 0.452   5.372   1.00 0.00 ? 354 SER A O      5  
ATOM   10801 C CB     . SER A 1 141 ? 42.374 -2.216  7.380   1.00 0.00 ? 354 SER A CB     5  
ATOM   10802 O OG     . SER A 1 141 ? 42.587 -3.625  7.400   1.00 0.00 ? 354 SER A OG     5  
ATOM   10803 H H      . SER A 1 141 ? 42.196 -2.746  4.243   1.00 0.00 ? 354 SER A H      5  
ATOM   10804 H HA     . SER A 1 141 ? 40.855 -2.182  5.853   1.00 0.00 ? 354 SER A HA     5  
ATOM   10805 H HB2    . SER A 1 141 ? 43.311 -1.704  7.597   1.00 0.00 ? 354 SER A HB2    5  
ATOM   10806 H HB3    . SER A 1 141 ? 41.672 -1.944  8.168   1.00 0.00 ? 354 SER A HB3    5  
ATOM   10807 H HG     . SER A 1 141 ? 41.793 -4.085  7.797   1.00 0.00 ? 354 SER A HG     5  
ATOM   10808 N N      . ALA A 1 142 ? 40.742 0.303   6.702   1.00 0.00 ? 355 ALA A N      5  
ATOM   10809 C CA     . ALA A 1 142 ? 40.534 1.739   6.767   1.00 0.00 ? 355 ALA A CA     5  
ATOM   10810 C C      . ALA A 1 142 ? 39.996 2.110   8.151   1.00 0.00 ? 355 ALA A C      5  
ATOM   10811 O O      . ALA A 1 142 ? 40.630 1.824   9.165   1.00 0.00 ? 355 ALA A O      5  
ATOM   10812 C CB     . ALA A 1 142 ? 39.594 2.171   5.641   1.00 0.00 ? 355 ALA A CB     5  
ATOM   10813 H H      . ALA A 1 142 ? 40.079 -0.243  7.214   1.00 0.00 ? 355 ALA A H      5  
ATOM   10814 H HA     . ALA A 1 142 ? 41.501 2.222   6.622   1.00 0.00 ? 355 ALA A HA     5  
ATOM   10815 H HB1    . ALA A 1 142 ? 38.954 1.335   5.361   1.00 0.00 ? 355 ALA A HB1    5  
ATOM   10816 H HB2    . ALA A 1 142 ? 38.977 3.003   5.981   1.00 0.00 ? 355 ALA A HB2    5  
ATOM   10817 H HB3    . ALA A 1 142 ? 40.180 2.485   4.777   1.00 0.00 ? 355 ALA A HB3    5  
HETATM 10818 P P      . CMP B 2 .   ? 34.287 -0.649  -6.049  1.00 0.00 ? 370 CMP A P      5  
HETATM 10819 O O1P    . CMP B 2 .   ? 35.698 -0.678  -6.490  1.00 0.00 ? 370 CMP A O1P    5  
HETATM 10820 O O2P    . CMP B 2 .   ? 33.467 0.392   -6.964  1.00 0.00 ? 370 CMP A O2P    5  
HETATM 10821 O "O5'"  . CMP B 2 .   ? 33.651 -2.114  -6.217  1.00 0.00 ? 370 CMP A "O5'"  5  
HETATM 10822 C "C5'"  . CMP B 2 .   ? 34.321 -3.009  -5.319  1.00 0.00 ? 370 CMP A "C5'"  5  
HETATM 10823 C "C4'"  . CMP B 2 .   ? 34.129 -2.479  -3.909  1.00 0.00 ? 370 CMP A "C4'"  5  
HETATM 10824 O "O4'"  . CMP B 2 .   ? 34.675 -3.283  -2.865  1.00 0.00 ? 370 CMP A "O4'"  5  
HETATM 10825 C "C3'"  . CMP B 2 .   ? 34.925 -1.154  -3.777  1.00 0.00 ? 370 CMP A "C3'"  5  
HETATM 10826 O "O3'"  . CMP B 2 .   ? 34.223 -0.166  -4.509  1.00 0.00 ? 370 CMP A "O3'"  5  
HETATM 10827 C "C2'"  . CMP B 2 .   ? 34.936 -0.965  -2.251  1.00 0.00 ? 370 CMP A "C2'"  5  
HETATM 10828 O "O2'"  . CMP B 2 .   ? 33.843 -0.141  -1.837  1.00 0.00 ? 370 CMP A "O2'"  5  
HETATM 10829 C "C1'"  . CMP B 2 .   ? 34.784 -2.409  -1.717  1.00 0.00 ? 370 CMP A "C1'"  5  
HETATM 10830 N N9     . CMP B 2 .   ? 35.958 -2.773  -0.922  1.00 0.00 ? 370 CMP A N9     5  
HETATM 10831 C C8     . CMP B 2 .   ? 37.182 -3.123  -1.406  1.00 0.00 ? 370 CMP A C8     5  
HETATM 10832 N N7     . CMP B 2 .   ? 37.992 -3.385  -0.421  1.00 0.00 ? 370 CMP A N7     5  
HETATM 10833 C C5     . CMP B 2 .   ? 37.342 -3.213  0.755   1.00 0.00 ? 370 CMP A C5     5  
HETATM 10834 C C6     . CMP B 2 .   ? 37.693 -3.355  2.107   1.00 0.00 ? 370 CMP A C6     5  
HETATM 10835 N N6     . CMP B 2 .   ? 38.973 -3.740  2.471   1.00 0.00 ? 370 CMP A N6     5  
HETATM 10836 N N1     . CMP B 2 .   ? 36.771 -3.104  3.030   1.00 0.00 ? 370 CMP A N1     5  
HETATM 10837 C C2     . CMP B 2 .   ? 35.550 -2.736  2.694   1.00 0.00 ? 370 CMP A C2     5  
HETATM 10838 N N3     . CMP B 2 .   ? 35.174 -2.597  1.439   1.00 0.00 ? 370 CMP A N3     5  
HETATM 10839 C C4     . CMP B 2 .   ? 36.029 -2.825  0.448   1.00 0.00 ? 370 CMP A C4     5  
HETATM 10840 H "H5'1" . CMP B 2 .   ? 35.384 -3.045  -5.558  1.00 0.00 ? 370 CMP A "H5'1" 5  
HETATM 10841 H "H5'2" . CMP B 2 .   ? 33.889 -4.007  -5.401  1.00 0.00 ? 370 CMP A "H5'2" 5  
HETATM 10842 H "H4'"  . CMP B 2 .   ? 33.071 -2.298  -3.724  1.00 0.00 ? 370 CMP A "H4'"  5  
HETATM 10843 H "H3'"  . CMP B 2 .   ? 35.889 -0.725  -3.851  1.00 0.00 ? 370 CMP A "H3'"  5  
HETATM 10844 H "H2'"  . CMP B 2 .   ? 35.883 -0.538  -1.924  1.00 0.00 ? 370 CMP A "H2'"  5  
HETATM 10845 H "HO2'" . CMP B 2 .   ? 33.902 -0.059  -0.878  1.00 0.00 ? 370 CMP A "HO2'" 5  
HETATM 10846 H "H1'"  . CMP B 2 .   ? 33.884 -2.486  -1.107  1.00 0.00 ? 370 CMP A "H1'"  5  
HETATM 10847 H H8     . CMP B 2 .   ? 37.443 -3.177  -2.453  1.00 0.00 ? 370 CMP A H8     5  
HETATM 10848 H HN61   . CMP B 2 .   ? 39.204 -3.829  3.408   1.00 0.00 ? 370 CMP A HN61   5  
HETATM 10849 H HN62   . CMP B 2 .   ? 39.636 -3.924  1.787   1.00 0.00 ? 370 CMP A HN62   5  
HETATM 10850 H H2     . CMP B 2 .   ? 34.831 -2.542  3.476   1.00 0.00 ? 370 CMP A H2     5  
ATOM   10851 N N      . GLY A 1 1   ? 3.053  15.604  -3.744  1.00 0.00 ? 214 GLY A N      6  
ATOM   10852 C CA     . GLY A 1 1   ? 2.793  15.077  -2.417  1.00 0.00 ? 214 GLY A CA     6  
ATOM   10853 C C      . GLY A 1 1   ? 1.780  13.930  -2.470  1.00 0.00 ? 214 GLY A C      6  
ATOM   10854 O O      . GLY A 1 1   ? 1.123  13.726  -3.490  1.00 0.00 ? 214 GLY A O      6  
ATOM   10855 H H1     . GLY A 1 1   ? 3.506  14.970  -4.370  1.00 0.00 ? 214 GLY A H1     6  
ATOM   10856 H HA2    . GLY A 1 1   ? 3.724  14.724  -1.972  1.00 0.00 ? 214 GLY A HA2    6  
ATOM   10857 H HA3    . GLY A 1 1   ? 2.415  15.871  -1.773  1.00 0.00 ? 214 GLY A HA3    6  
ATOM   10858 N N      . SER A 1 2   ? 1.686  13.213  -1.360  1.00 0.00 ? 215 SER A N      6  
ATOM   10859 C CA     . SER A 1 2   ? 0.764  12.094  -1.268  1.00 0.00 ? 215 SER A CA     6  
ATOM   10860 C C      . SER A 1 2   ? 0.467  11.780  0.199   1.00 0.00 ? 215 SER A C      6  
ATOM   10861 O O      . SER A 1 2   ? 1.287  12.055  1.075   1.00 0.00 ? 215 SER A O      6  
ATOM   10862 C CB     . SER A 1 2   ? 1.329  10.858  -1.971  1.00 0.00 ? 215 SER A CB     6  
ATOM   10863 O OG     . SER A 1 2   ? 0.315  9.899   -2.260  1.00 0.00 ? 215 SER A OG     6  
ATOM   10864 H H      . SER A 1 2   ? 2.224  13.387  -0.535  1.00 0.00 ? 215 SER A H      6  
ATOM   10865 H HA     . SER A 1 2   ? -0.139 12.421  -1.780  1.00 0.00 ? 215 SER A HA     6  
ATOM   10866 H HB2    . SER A 1 2   ? 1.817  11.159  -2.898  1.00 0.00 ? 215 SER A HB2    6  
ATOM   10867 H HB3    . SER A 1 2   ? 2.093  10.399  -1.343  1.00 0.00 ? 215 SER A HB3    6  
ATOM   10868 H HG     . SER A 1 2   ? 0.731  9.043   -2.568  1.00 0.00 ? 215 SER A HG     6  
ATOM   10869 N N      . GLN A 1 3   ? -0.707 11.209  0.423   1.00 0.00 ? 216 GLN A N      6  
ATOM   10870 C CA     . GLN A 1 3   ? -1.123 10.855  1.770   1.00 0.00 ? 216 GLN A CA     6  
ATOM   10871 C C      . GLN A 1 3   ? -1.133 9.335   1.939   1.00 0.00 ? 216 GLN A C      6  
ATOM   10872 O O      . GLN A 1 3   ? -2.196 8.725   2.046   1.00 0.00 ? 216 GLN A O      6  
ATOM   10873 C CB     . GLN A 1 3   ? -2.494 11.452  2.095   1.00 0.00 ? 216 GLN A CB     6  
ATOM   10874 C CG     . GLN A 1 3   ? -2.405 12.411  3.284   1.00 0.00 ? 216 GLN A CG     6  
ATOM   10875 C CD     . GLN A 1 3   ? -3.269 13.653  3.051   1.00 0.00 ? 216 GLN A CD     6  
ATOM   10876 O OE1    . GLN A 1 3   ? -4.342 13.596  2.474   1.00 0.00 ? 216 GLN A OE1    6  
ATOM   10877 N NE2    . GLN A 1 3   ? -2.742 14.776  3.532   1.00 0.00 ? 216 GLN A NE2    6  
ATOM   10878 H H      . GLN A 1 3   ? -1.368 10.989  -0.295  1.00 0.00 ? 216 GLN A H      6  
ATOM   10879 H HA     . GLN A 1 3   ? -0.375 11.296  2.429   1.00 0.00 ? 216 GLN A HA     6  
ATOM   10880 H HB2    . GLN A 1 3   ? -2.879 11.982  1.224   1.00 0.00 ? 216 GLN A HB2    6  
ATOM   10881 H HB3    . GLN A 1 3   ? -3.199 10.652  2.320   1.00 0.00 ? 216 GLN A HB3    6  
ATOM   10882 H HG2    . GLN A 1 3   ? -2.732 11.902  4.191   1.00 0.00 ? 216 GLN A HG2    6  
ATOM   10883 H HG3    . GLN A 1 3   ? -1.369 12.709  3.440   1.00 0.00 ? 216 GLN A HG3    6  
ATOM   10884 H HE21   . GLN A 1 3   ? -1.856 14.754  3.996   1.00 0.00 ? 216 GLN A HE21   6  
ATOM   10885 H HE22   . GLN A 1 3   ? -3.232 15.642  3.429   1.00 0.00 ? 216 GLN A HE22   6  
ATOM   10886 N N      . GLU A 1 4   ? 0.063  8.766   1.960   1.00 0.00 ? 217 GLU A N      6  
ATOM   10887 C CA     . GLU A 1 4   ? 0.206  7.328   2.116   1.00 0.00 ? 217 GLU A CA     6  
ATOM   10888 C C      . GLU A 1 4   ? -0.890 6.599   1.336   1.00 0.00 ? 217 GLU A C      6  
ATOM   10889 O O      . GLU A 1 4   ? -1.778 5.989   1.929   1.00 0.00 ? 217 GLU A O      6  
ATOM   10890 C CB     . GLU A 1 4   ? 0.184  6.932   3.593   1.00 0.00 ? 217 GLU A CB     6  
ATOM   10891 C CG     . GLU A 1 4   ? 1.090  5.727   3.851   1.00 0.00 ? 217 GLU A CG     6  
ATOM   10892 C CD     . GLU A 1 4   ? 1.658  5.761   5.272   1.00 0.00 ? 217 GLU A CD     6  
ATOM   10893 O OE1    . GLU A 1 4   ? 0.959  6.174   6.208   1.00 0.00 ? 217 GLU A OE1    6  
ATOM   10894 O OE2    . GLU A 1 4   ? 2.872  5.339   5.384   1.00 0.00 ? 217 GLU A OE2    6  
ATOM   10895 H H      . GLU A 1 4   ? 0.924  9.269   1.873   1.00 0.00 ? 217 GLU A H      6  
ATOM   10896 H HA     . GLU A 1 4   ? 1.182  7.087   1.696   1.00 0.00 ? 217 GLU A HA     6  
ATOM   10897 H HB2    . GLU A 1 4   ? 0.509  7.773   4.204   1.00 0.00 ? 217 GLU A HB2    6  
ATOM   10898 H HB3    . GLU A 1 4   ? -0.837 6.695   3.895   1.00 0.00 ? 217 GLU A HB3    6  
ATOM   10899 H HG2    . GLU A 1 4   ? 0.526  4.805   3.703   1.00 0.00 ? 217 GLU A HG2    6  
ATOM   10900 H HG3    . GLU A 1 4   ? 1.906  5.719   3.129   1.00 0.00 ? 217 GLU A HG3    6  
ATOM   10901 H HE2    . GLU A 1 4   ? 3.482  6.103   5.595   1.00 0.00 ? 217 GLU A HE2    6  
ATOM   10902 N N      . VAL A 1 5   ? -0.791 6.686   0.018   1.00 0.00 ? 218 VAL A N      6  
ATOM   10903 C