data_2K6M
# 
_entry.id   2K6M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2K6M         
RCSB  RCSB100741   
WWPDB D_1000100741 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2K6N PDB 'Solution Structure of Human Supervillin Headpiece, Minimized Average'                                    
unspecified 1YU5 PDB 'Crystal Structure of the Headpiece Domain of Chicken Villin'                                             
unspecified 1QZP PDB 'NMR Structure of the Human Dematin Headpiece Domain'                                                     
unspecified 1ZV6 PDB 'NMR Structure of the human Dematin Headpiece S74E Mutant'                                                
unspecified 1QQV PDB 'Solution Structure of the Headpiece Domain of Chicken Villin'                                            
unspecified 1YU7 PDB 'Crystal Structure of the W64A Mutant of Villin Headpiece'                                                
unspecified 1UNC PDB 'Solution Structure of the Human Villin C-Terminal Headpiece Subdomain'                                   
unspecified 1UND PDB 'Solution Structure of the Human Advillin C-Terminal Subdomain'                                           
unspecified 1YU8 PDB 'Crystal Structure of the R37A Mutant of Villin Headpiece'                                                
unspecified 1VII PDB 'Thermostable Subdomain from Chicken Villin Headpiece, NMR, Minimized Average Structure'                  
unspecified 2PPZ PDB 'NMR Solution Structure of the Villin Headpiece Mutant G34L'                                              
unspecified 1UJS PDB 'Solution Structure of the Villin Headpiece Domain of Human Actin-Binding LIM protein homolog'            
unspecified 1YRF PDB 'Chicken Villin Subdomain HP-35, N68H, pH 6.7'                                                            
unspecified 1YRI PDB 'Chicken Villin Subdomain HP-35, N68H, pH 6.4'                                                            
unspecified 2JM0 PDB 'Solution Structure of Chicken Villin Headpiece Subdomain Containing a Fluorinated Sidechain in the Core' 
unspecified 1WY3 PDB 'Chicken Villin Subdomain HP-35, K65(NLE), N68H, pH 7.0'                                                  
unspecified 1WY4 PDB 'Chicken Villin Subdomain HP-35, K65(NLE), N68H, pH 5.1'                                                  
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K6M 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-11 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brown, J.W.'  1 
'Didem, V.'    2 
'McKnight, C.' 3 
# 
_citation.id                        primary 
_citation.title                     'How to arm a supervillin: designing F-actin binding activity into supervillin headpiece.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            393 
_citation.page_first                608 
_citation.page_last                 618 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19683541 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2009.08.018 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brown, J.W.'    1 
primary 'Vardar-Ulu, D.' 2 
primary 'McKnight, C.J.' 3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Supervillin 
_entity.formula_weight             7708.040 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 2149-2214, HP' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Archvillin, p205/p250' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 
_entity_poly.pdbx_seq_one_letter_code_can   MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 
_entity_poly.pdbx_strand_id                 S 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  ALA n 
1 4  LYS n 
1 5  LEU n 
1 6  CYS n 
1 7  LYS n 
1 8  THR n 
1 9  ILE n 
1 10 TYR n 
1 11 PRO n 
1 12 LEU n 
1 13 ALA n 
1 14 ASP n 
1 15 LEU n 
1 16 LEU n 
1 17 ALA n 
1 18 ARG n 
1 19 PRO n 
1 20 LEU n 
1 21 PRO n 
1 22 GLU n 
1 23 GLY n 
1 24 VAL n 
1 25 ASP n 
1 26 PRO n 
1 27 LEU n 
1 28 LYS n 
1 29 LEU n 
1 30 GLU n 
1 31 ILE n 
1 32 TYR n 
1 33 LEU n 
1 34 THR n 
1 35 ASP n 
1 36 GLU n 
1 37 ASP n 
1 38 PHE n 
1 39 GLU n 
1 40 PHE n 
1 41 ALA n 
1 42 LEU n 
1 43 ASP n 
1 44 MET n 
1 45 THR n 
1 46 ARG n 
1 47 ASP n 
1 48 GLU n 
1 49 TYR n 
1 50 ASN n 
1 51 ALA n 
1 52 LEU n 
1 53 PRO n 
1 54 ALA n 
1 55 TRP n 
1 56 LYS n 
1 57 GLN n 
1 58 VAL n 
1 59 ASN n 
1 60 LEU n 
1 61 LYS n 
1 62 LYS n 
1 63 ALA n 
1 64 LYS n 
1 65 GLY n 
1 66 LEU n 
1 67 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SVIL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'pSVHP(pET24A)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SVIL_HUMAN 
_struct_ref.pdbx_db_accession          O95425 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 
_struct_ref.pdbx_align_begin           2149 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2K6M 
_struct_ref_seq.pdbx_strand_id                S 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 67 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O95425 
_struct_ref_seq.db_align_beg                  2149 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  2214 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       11 
_struct_ref_seq.pdbx_auth_seq_align_end       76 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2K6M 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           S 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O95425 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            10 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1 '2D 1H-15N HSQC'                  1 
2  1 '2D 1H-13C HSQC'                  1 
3  1 '2D 1H-1H TOCSY'                  1 
4  1 '2D 1H-1H COSY'                   1 
5  1 '3D HNCA'                         1 
6  1 '3D HNCO'                         1 
7  1 '3D HN(C 3D HCCH-TOCSY'           1 
8  1 '3D HCCH-COSY'                    1 
9  1 '3D HNHA'                         1 
10 1 '3D HNHB'                         1 
11 1 '3D HN(CA)CO'                     1 
12 1 '2D 1H-1H NOESY'                  1 
13 1 '3D 1H-15N NOESY 3D 1H-13C NOESY' 1 
14 1 '3D HMQC-J'                       1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1.3-2.5 MM [U-13C SUPERVILLIN HEADPIECE, 4 MM DTT, 100 MM SODIUM CHLORIDE, 500 UM TMSP, 20 MM SODIUM PHOSPHATE, 95% H2O/5% D2O; 1.3-2.5 MM [U-15N] SUPERVILLIN HEADPIECE, 20 MM SODIUM PHOSPHATE, 500 UM TMSP, 4 MM DTT, 100 MM SODIUM CHLORIDE, 95% H2O/5% D2O; 1.3-2.5 MM [U- 10% 13C] SUPERVILLIN HEADPIECE, 4 MM DTT, 500 UM TMSP, 100 MM SODIUM CHLORIDE, 20 MM SODIUM PHOSPHATE, 95% H2O/5% D2O; 1.3-2.5 MM SUPERVILLIN HEADPIECE, 4 MM DTT, 500 UM TMSP, 100 MM SODIUM CHLORIDE, 20 MM SODIUM PHOSPHATE, 95% H2O/5% D2O; 1.3-2.5 MM [U-13C] SUPERVILLIN HEADPIECE, 4 MM DTT, 100 MM SODIUM CHLORIDE, 20 MM SODIUM PHOSPHATE, 500 UM TMSP, 95% H2O/5% D2O
;
_pdbx_nmr_sample_details.solvent_system   ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.type              ? 
# 
_pdbx_nmr_refine.entry_id           2K6M 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2K6M 
_pdbx_nmr_details.text       
;DISTANCE RESTRAINTS WERE DETERMINED FROM A NOESY BUILDUP SERIES. MIXING TIMES OF 50, 75, 100, 125 AND 150 US. EXTRA RESTRAINTS FROM 13C AND 15N-EDITTED NOESY BINED AS WEAK
;
# 
_pdbx_nmr_ensemble.entry_id                                      2K6M 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             22 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2K6M 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           CNS           1.1    BRUNGER 1 
'structure solution' CNS           1.1    ?       2 
'structure solution' NMRPIPE       ?      ?       3 
'structure solution' 'MOLMOL 2K.2' 2K.2   ?       4 
'structure solution' XWINNMR       3.1    ?       5 
'structure solution' TALOS         ?      ?       6 
'structure solution' PREDITOR      ?      ?       7 
'structure solution' NMRVIEW       7.0.16 ?       8 
# 
_exptl.entry_id          2K6M 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2K6M 
_struct.title                     'Solution Structure of Human Supervillin Headpiece' 
_struct.pdbx_descriptor           Supervillin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K6M 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;Supervillin, SVHP, HP, Headpiece, Villin, Archvillin, Actin capping, Actin-binding, Alternative splicing, Calcium, Cytoplasm, Cytoskeleton, Membrane, Phosphoprotein, Polymorphism, STRUCTURAL PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 11 ? LEU A 16 ? PRO S 20 LEU S 25 1 ? 6  
HELX_P HELX_P2 2 LEU A 29 ? LEU A 33 ? LEU S 38 LEU S 42 5 ? 5  
HELX_P HELX_P3 3 THR A 34 ? LEU A 42 ? THR S 43 LEU S 51 1 ? 9  
HELX_P HELX_P4 4 THR A 45 ? ASN A 50 ? THR S 54 ASN S 59 1 ? 6  
HELX_P HELX_P5 5 PRO A 53 ? GLY A 65 ? PRO S 62 GLY S 74 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2K6M 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? -18.258 -14.375 1.313   1.00 0.00 ? 10 MET S N    1  
ATOM 2     C CA   . MET A 1 1  ? -18.137 -13.394 2.424   1.00 0.00 ? 10 MET S CA   1  
ATOM 3     C C    . MET A 1 1  ? -17.466 -14.021 3.640   1.00 0.00 ? 10 MET S C    1  
ATOM 4     O O    . MET A 1 1  ? -16.466 -13.509 4.143   1.00 0.00 ? 10 MET S O    1  
ATOM 5     C CB   . MET A 1 1  ? -19.537 -12.900 2.791   1.00 0.00 ? 10 MET S CB   1  
ATOM 6     C CG   . MET A 1 1  ? -20.091 -11.866 1.825   1.00 0.00 ? 10 MET S CG   1  
ATOM 7     S SD   . MET A 1 1  ? -21.838 -11.518 2.109   1.00 0.00 ? 10 MET S SD   1  
ATOM 8     C CE   . MET A 1 1  ? -22.295 -10.781 0.541   1.00 0.00 ? 10 MET S CE   1  
ATOM 9     H H1   . MET A 1 1  ? -18.809 -13.928 0.553   1.00 0.00 ? 10 MET S H1   1  
ATOM 10    H H2   . MET A 1 1  ? -18.744 -15.216 1.685   1.00 0.00 ? 10 MET S H2   1  
ATOM 11    H H3   . MET A 1 1  ? -17.297 -14.608 0.990   1.00 0.00 ? 10 MET S H3   1  
ATOM 12    H HA   . MET A 1 1  ? -17.542 -12.560 2.083   1.00 0.00 ? 10 MET S HA   1  
ATOM 13    H HB2  . MET A 1 1  ? -20.212 -13.744 2.807   1.00 0.00 ? 10 MET S HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? -19.505 -12.460 3.777   1.00 0.00 ? 10 MET S HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? -19.534 -10.950 1.943   1.00 0.00 ? 10 MET S HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? -19.970 -12.233 0.818   1.00 0.00 ? 10 MET S HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? -22.323 -11.546 -0.221  1.00 0.00 ? 10 MET S HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? -21.566 -10.032 0.270   1.00 0.00 ? 10 MET S HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? -23.267 -10.322 0.629   1.00 0.00 ? 10 MET S HE3  1  
ATOM 20    N N    . LEU A 1 2  ? -18.022 -15.134 4.109   1.00 0.00 ? 11 LEU S N    1  
ATOM 21    C CA   . LEU A 1 2  ? -17.477 -15.832 5.268   1.00 0.00 ? 11 LEU S CA   1  
ATOM 22    C C    . LEU A 1 2  ? -16.413 -16.838 4.846   1.00 0.00 ? 11 LEU S C    1  
ATOM 23    O O    . LEU A 1 2  ? -15.465 -17.102 5.586   1.00 0.00 ? 11 LEU S O    1  
ATOM 24    C CB   . LEU A 1 2  ? -18.595 -16.543 6.032   1.00 0.00 ? 11 LEU S CB   1  
ATOM 25    C CG   . LEU A 1 2  ? -19.522 -15.624 6.829   1.00 0.00 ? 11 LEU S CG   1  
ATOM 26    C CD1  . LEU A 1 2  ? -20.659 -16.420 7.450   1.00 0.00 ? 11 LEU S CD1  1  
ATOM 27    C CD2  . LEU A 1 2  ? -18.741 -14.881 7.902   1.00 0.00 ? 11 LEU S CD2  1  
ATOM 28    H H    . LEU A 1 2  ? -18.818 -15.494 3.665   1.00 0.00 ? 11 LEU S H    1  
ATOM 29    H HA   . LEU A 1 2  ? -17.024 -15.095 5.915   1.00 0.00 ? 11 LEU S HA   1  
ATOM 30    H HB2  . LEU A 1 2  ? -19.193 -17.095 5.321   1.00 0.00 ? 11 LEU S HB2  1  
ATOM 31    H HB3  . LEU A 1 2  ? -18.144 -17.244 6.718   1.00 0.00 ? 11 LEU S HB3  1  
ATOM 32    H HG   . LEU A 1 2  ? -19.954 -14.891 6.161   1.00 0.00 ? 11 LEU S HG   1  
ATOM 33    H HD11 . LEU A 1 2  ? -20.414 -16.658 8.474   1.00 0.00 ? 11 LEU S HD11 1  
ATOM 34    H HD12 . LEU A 1 2  ? -20.805 -17.333 6.892   1.00 0.00 ? 11 LEU S HD12 1  
ATOM 35    H HD13 . LEU A 1 2  ? -21.566 -15.833 7.423   1.00 0.00 ? 11 LEU S HD13 1  
ATOM 36    H HD21 . LEU A 1 2  ? -17.874 -15.461 8.182   1.00 0.00 ? 11 LEU S HD21 1  
ATOM 37    H HD22 . LEU A 1 2  ? -19.369 -14.732 8.767   1.00 0.00 ? 11 LEU S HD22 1  
ATOM 38    H HD23 . LEU A 1 2  ? -18.424 -13.922 7.518   1.00 0.00 ? 11 LEU S HD23 1  
ATOM 39    N N    . ALA A 1 3  ? -16.576 -17.401 3.653   1.00 0.00 ? 12 ALA S N    1  
ATOM 40    C CA   . ALA A 1 3  ? -15.629 -18.379 3.133   1.00 0.00 ? 12 ALA S CA   1  
ATOM 41    C C    . ALA A 1 3  ? -14.460 -17.695 2.433   1.00 0.00 ? 12 ALA S C    1  
ATOM 42    O O    . ALA A 1 3  ? -13.306 -18.087 2.605   1.00 0.00 ? 12 ALA S O    1  
ATOM 43    C CB   . ALA A 1 3  ? -16.330 -19.336 2.181   1.00 0.00 ? 12 ALA S CB   1  
ATOM 44    H H    . ALA A 1 3  ? -17.353 -17.150 3.108   1.00 0.00 ? 12 ALA S H    1  
ATOM 45    H HA   . ALA A 1 3  ? -15.251 -18.952 3.967   1.00 0.00 ? 12 ALA S HA   1  
ATOM 46    H HB1  . ALA A 1 3  ? -15.592 -19.877 1.606   1.00 0.00 ? 12 ALA S HB1  1  
ATOM 47    H HB2  . ALA A 1 3  ? -16.967 -18.777 1.512   1.00 0.00 ? 12 ALA S HB2  1  
ATOM 48    H HB3  . ALA A 1 3  ? -16.928 -20.034 2.747   1.00 0.00 ? 12 ALA S HB3  1  
ATOM 49    N N    . LYS A 1 4  ? -14.766 -16.671 1.643   1.00 0.00 ? 13 LYS S N    1  
ATOM 50    C CA   . LYS A 1 4  ? -13.740 -15.932 0.917   1.00 0.00 ? 13 LYS S CA   1  
ATOM 51    C C    . LYS A 1 4  ? -13.701 -14.473 1.363   1.00 0.00 ? 13 LYS S C    1  
ATOM 52    O O    . LYS A 1 4  ? -14.740 -13.863 1.615   1.00 0.00 ? 13 LYS S O    1  
ATOM 53    C CB   . LYS A 1 4  ? -13.994 -16.009 -0.590  1.00 0.00 ? 13 LYS S CB   1  
ATOM 54    C CG   . LYS A 1 4  ? -14.271 -17.419 -1.089  1.00 0.00 ? 13 LYS S CG   1  
ATOM 55    C CD   . LYS A 1 4  ? -13.667 -17.652 -2.466  1.00 0.00 ? 13 LYS S CD   1  
ATOM 56    C CE   . LYS A 1 4  ? -14.633 -18.386 -3.381  1.00 0.00 ? 13 LYS S CE   1  
ATOM 57    N NZ   . LYS A 1 4  ? -14.447 -19.863 -3.319  1.00 0.00 ? 13 LYS S NZ   1  
ATOM 58    H H    . LYS A 1 4  ? -15.705 -16.406 1.547   1.00 0.00 ? 13 LYS S H    1  
ATOM 59    H HA   . LYS A 1 4  ? -12.786 -16.388 1.136   1.00 0.00 ? 13 LYS S HA   1  
ATOM 60    H HB2  . LYS A 1 4  ? -14.846 -15.392 -0.831  1.00 0.00 ? 13 LYS S HB2  1  
ATOM 61    H HB3  . LYS A 1 4  ? -13.126 -15.630 -1.109  1.00 0.00 ? 13 LYS S HB3  1  
ATOM 62    H HG2  . LYS A 1 4  ? -13.842 -18.127 -0.394  1.00 0.00 ? 13 LYS S HG2  1  
ATOM 63    H HG3  . LYS A 1 4  ? -15.339 -17.567 -1.145  1.00 0.00 ? 13 LYS S HG3  1  
ATOM 64    H HD2  . LYS A 1 4  ? -13.423 -16.699 -2.908  1.00 0.00 ? 13 LYS S HD2  1  
ATOM 65    H HD3  . LYS A 1 4  ? -12.769 -18.243 -2.359  1.00 0.00 ? 13 LYS S HD3  1  
ATOM 66    H HE2  . LYS A 1 4  ? -15.644 -18.148 -3.084  1.00 0.00 ? 13 LYS S HE2  1  
ATOM 67    H HE3  . LYS A 1 4  ? -14.470 -18.054 -4.396  1.00 0.00 ? 13 LYS S HE3  1  
ATOM 68    H HZ1  . LYS A 1 4  ? -15.083 -20.332 -3.995  1.00 0.00 ? 13 LYS S HZ1  1  
ATOM 69    H HZ2  . LYS A 1 4  ? -14.658 -20.209 -2.361  1.00 0.00 ? 13 LYS S HZ2  1  
ATOM 70    H HZ3  . LYS A 1 4  ? -13.465 -20.109 -3.556  1.00 0.00 ? 13 LYS S HZ3  1  
ATOM 71    N N    . LEU A 1 5  ? -12.496 -13.921 1.458   1.00 0.00 ? 14 LEU S N    1  
ATOM 72    C CA   . LEU A 1 5  ? -12.324 -12.533 1.873   1.00 0.00 ? 14 LEU S CA   1  
ATOM 73    C C    . LEU A 1 5  ? -12.377 -11.596 0.671   1.00 0.00 ? 14 LEU S C    1  
ATOM 74    O O    . LEU A 1 5  ? -12.159 -12.016 -0.466  1.00 0.00 ? 14 LEU S O    1  
ATOM 75    C CB   . LEU A 1 5  ? -10.994 -12.360 2.609   1.00 0.00 ? 14 LEU S CB   1  
ATOM 76    C CG   . LEU A 1 5  ? -10.864 -13.160 3.907   1.00 0.00 ? 14 LEU S CG   1  
ATOM 77    C CD1  . LEU A 1 5  ? -9.429  -13.624 4.107   1.00 0.00 ? 14 LEU S CD1  1  
ATOM 78    C CD2  . LEU A 1 5  ? -11.328 -12.328 5.091   1.00 0.00 ? 14 LEU S CD2  1  
ATOM 79    H H    . LEU A 1 5  ? -11.705 -14.458 1.243   1.00 0.00 ? 14 LEU S H    1  
ATOM 80    H HA   . LEU A 1 5  ? -13.131 -12.284 2.545   1.00 0.00 ? 14 LEU S HA   1  
ATOM 81    H HB2  . LEU A 1 5  ? -10.197 -12.660 1.944   1.00 0.00 ? 14 LEU S HB2  1  
ATOM 82    H HB3  . LEU A 1 5  ? -10.869 -11.314 2.844   1.00 0.00 ? 14 LEU S HB3  1  
ATOM 83    H HG   . LEU A 1 5  ? -11.492 -14.037 3.846   1.00 0.00 ? 14 LEU S HG   1  
ATOM 84    H HD11 . LEU A 1 5  ? -9.200  -13.638 5.163   1.00 0.00 ? 14 LEU S HD11 1  
ATOM 85    H HD12 . LEU A 1 5  ? -8.758  -12.945 3.602   1.00 0.00 ? 14 LEU S HD12 1  
ATOM 86    H HD13 . LEU A 1 5  ? -9.311  -14.616 3.699   1.00 0.00 ? 14 LEU S HD13 1  
ATOM 87    H HD21 . LEU A 1 5  ? -10.907 -12.728 6.002   1.00 0.00 ? 14 LEU S HD21 1  
ATOM 88    H HD22 . LEU A 1 5  ? -12.406 -12.355 5.152   1.00 0.00 ? 14 LEU S HD22 1  
ATOM 89    H HD23 . LEU A 1 5  ? -11.002 -11.305 4.964   1.00 0.00 ? 14 LEU S HD23 1  
ATOM 90    N N    . CYS A 1 6  ? -12.671 -10.326 0.929   1.00 0.00 ? 15 CYS S N    1  
ATOM 91    C CA   . CYS A 1 6  ? -12.755 -9.332  -0.135  1.00 0.00 ? 15 CYS S CA   1  
ATOM 92    C C    . CYS A 1 6  ? -12.104 -8.019  0.291   1.00 0.00 ? 15 CYS S C    1  
ATOM 93    O O    . CYS A 1 6  ? -12.580 -7.348  1.206   1.00 0.00 ? 15 CYS S O    1  
ATOM 94    C CB   . CYS A 1 6  ? -14.215 -9.088  -0.520  1.00 0.00 ? 15 CYS S CB   1  
ATOM 95    S SG   . CYS A 1 6  ? -14.473 -8.787  -2.284  1.00 0.00 ? 15 CYS S SG   1  
ATOM 96    H H    . CYS A 1 6  ? -12.837 -10.051 1.854   1.00 0.00 ? 15 CYS S H    1  
ATOM 97    H HA   . CYS A 1 6  ? -12.227 -9.719  -0.993  1.00 0.00 ? 15 CYS S HA   1  
ATOM 98    H HB2  . CYS A 1 6  ? -14.801 -9.953  -0.246  1.00 0.00 ? 15 CYS S HB2  1  
ATOM 99    H HB3  . CYS A 1 6  ? -14.583 -8.226  0.019   1.00 0.00 ? 15 CYS S HB3  1  
ATOM 100   H HG   . CYS A 1 6  ? -13.747 -9.194  -2.763  1.00 0.00 ? 15 CYS S HG   1  
ATOM 101   N N    . LYS A 1 7  ? -11.015 -7.660  -0.380  1.00 0.00 ? 16 LYS S N    1  
ATOM 102   C CA   . LYS A 1 7  ? -10.300 -6.426  -0.075  1.00 0.00 ? 16 LYS S CA   1  
ATOM 103   C C    . LYS A 1 7  ? -10.444 -5.420  -1.212  1.00 0.00 ? 16 LYS S C    1  
ATOM 104   O O    . LYS A 1 7  ? -10.695 -5.794  -2.358  1.00 0.00 ? 16 LYS S O    1  
ATOM 105   C CB   . LYS A 1 7  ? -8.820  -6.718  0.177   1.00 0.00 ? 16 LYS S CB   1  
ATOM 106   C CG   . LYS A 1 7  ? -8.537  -7.274  1.564   1.00 0.00 ? 16 LYS S CG   1  
ATOM 107   C CD   . LYS A 1 7  ? -7.383  -6.544  2.235   1.00 0.00 ? 16 LYS S CD   1  
ATOM 108   C CE   . LYS A 1 7  ? -7.641  -6.338  3.719   1.00 0.00 ? 16 LYS S CE   1  
ATOM 109   N NZ   . LYS A 1 7  ? -8.631  -5.253  3.964   1.00 0.00 ? 16 LYS S NZ   1  
ATOM 110   H H    . LYS A 1 7  ? -10.686 -8.236  -1.102  1.00 0.00 ? 16 LYS S H    1  
ATOM 111   H HA   . LYS A 1 7  ? -10.733 -6.005  0.820   1.00 0.00 ? 16 LYS S HA   1  
ATOM 112   H HB2  . LYS A 1 7  ? -8.477  -7.436  -0.552  1.00 0.00 ? 16 LYS S HB2  1  
ATOM 113   H HB3  . LYS A 1 7  ? -8.260  -5.802  0.059   1.00 0.00 ? 16 LYS S HB3  1  
ATOM 114   H HG2  . LYS A 1 7  ? -9.421  -7.163  2.173   1.00 0.00 ? 16 LYS S HG2  1  
ATOM 115   H HG3  . LYS A 1 7  ? -8.286  -8.321  1.477   1.00 0.00 ? 16 LYS S HG3  1  
ATOM 116   H HD2  . LYS A 1 7  ? -6.482  -7.128  2.115   1.00 0.00 ? 16 LYS S HD2  1  
ATOM 117   H HD3  . LYS A 1 7  ? -7.257  -5.582  1.764   1.00 0.00 ? 16 LYS S HD3  1  
ATOM 118   H HE2  . LYS A 1 7  ? -8.020  -7.259  4.137   1.00 0.00 ? 16 LYS S HE2  1  
ATOM 119   H HE3  . LYS A 1 7  ? -6.710  -6.080  4.202   1.00 0.00 ? 16 LYS S HE3  1  
ATOM 120   H HZ1  . LYS A 1 7  ? -8.639  -4.588  3.165   1.00 0.00 ? 16 LYS S HZ1  1  
ATOM 121   H HZ2  . LYS A 1 7  ? -8.383  -4.733  4.831   1.00 0.00 ? 16 LYS S HZ2  1  
ATOM 122   H HZ3  . LYS A 1 7  ? -9.584  -5.655  4.075   1.00 0.00 ? 16 LYS S HZ3  1  
ATOM 123   N N    . THR A 1 8  ? -10.284 -4.142  -0.889  1.00 0.00 ? 17 THR S N    1  
ATOM 124   C CA   . THR A 1 8  ? -10.398 -3.081  -1.883  1.00 0.00 ? 17 THR S CA   1  
ATOM 125   C C    . THR A 1 8  ? -9.246  -2.089  -1.756  1.00 0.00 ? 17 THR S C    1  
ATOM 126   O O    . THR A 1 8  ? -8.945  -1.610  -0.663  1.00 0.00 ? 17 THR S O    1  
ATOM 127   C CB   . THR A 1 8  ? -11.733 -2.354  -1.733  1.00 0.00 ? 17 THR S CB   1  
ATOM 128   O OG1  . THR A 1 8  ? -11.848 -1.312  -2.685  1.00 0.00 ? 17 THR S OG1  1  
ATOM 129   C CG2  . THR A 1 8  ? -11.932 -1.744  -0.360  1.00 0.00 ? 17 THR S CG2  1  
ATOM 130   H H    . THR A 1 8  ? -10.087 -3.904  0.042   1.00 0.00 ? 17 THR S H    1  
ATOM 131   H HA   . THR A 1 8  ? -10.356 -3.539  -2.860  1.00 0.00 ? 17 THR S HA   1  
ATOM 132   H HB   . THR A 1 8  ? -12.537 -3.057  -1.901  1.00 0.00 ? 17 THR S HB   1  
ATOM 133   H HG1  . THR A 1 8  ? -11.220 -0.617  -2.478  1.00 0.00 ? 17 THR S HG1  1  
ATOM 134   H HG21 . THR A 1 8  ? -12.842 -1.162  -0.353  1.00 0.00 ? 17 THR S HG21 1  
ATOM 135   H HG22 . THR A 1 8  ? -11.094 -1.105  -0.126  1.00 0.00 ? 17 THR S HG22 1  
ATOM 136   H HG23 . THR A 1 8  ? -12.003 -2.532  0.376   1.00 0.00 ? 17 THR S HG23 1  
ATOM 137   N N    . ILE A 1 9  ? -8.603  -1.789  -2.880  1.00 0.00 ? 18 ILE S N    1  
ATOM 138   C CA   . ILE A 1 9  ? -7.484  -0.860  -2.896  1.00 0.00 ? 18 ILE S CA   1  
ATOM 139   C C    . ILE A 1 9  ? -7.961  0.571   -3.119  1.00 0.00 ? 18 ILE S C    1  
ATOM 140   O O    . ILE A 1 9  ? -8.926  0.812   -3.844  1.00 0.00 ? 18 ILE S O    1  
ATOM 141   C CB   . ILE A 1 9  ? -6.476  -1.251  -4.001  1.00 0.00 ? 18 ILE S CB   1  
ATOM 142   C CG1  . ILE A 1 9  ? -5.586  -2.407  -3.526  1.00 0.00 ? 18 ILE S CG1  1  
ATOM 143   C CG2  . ILE A 1 9  ? -5.627  -0.052  -4.417  1.00 0.00 ? 18 ILE S CG2  1  
ATOM 144   C CD1  . ILE A 1 9  ? -6.307  -3.440  -2.684  1.00 0.00 ? 18 ILE S CD1  1  
ATOM 145   H H    . ILE A 1 9  ? -8.882  -2.208  -3.720  1.00 0.00 ? 18 ILE S H    1  
ATOM 146   H HA   . ILE A 1 9  ? -6.984  -0.920  -1.942  1.00 0.00 ? 18 ILE S HA   1  
ATOM 147   H HB   . ILE A 1 9  ? -7.035  -1.575  -4.865  1.00 0.00 ? 18 ILE S HB   1  
ATOM 148   H HG12 . ILE A 1 9  ? -5.184  -2.914  -4.387  1.00 0.00 ? 18 ILE S HG12 1  
ATOM 149   H HG13 . ILE A 1 9  ? -4.772  -2.008  -2.938  1.00 0.00 ? 18 ILE S HG13 1  
ATOM 150   H HG21 . ILE A 1 9  ? -5.137  0.361   -3.550  1.00 0.00 ? 18 ILE S HG21 1  
ATOM 151   H HG22 . ILE A 1 9  ? -6.260  0.700   -4.865  1.00 0.00 ? 18 ILE S HG22 1  
ATOM 152   H HG23 . ILE A 1 9  ? -4.886  -0.366  -5.136  1.00 0.00 ? 18 ILE S HG23 1  
ATOM 153   H HD11 . ILE A 1 9  ? -7.246  -3.694  -3.151  1.00 0.00 ? 18 ILE S HD11 1  
ATOM 154   H HD12 . ILE A 1 9  ? -6.491  -3.038  -1.699  1.00 0.00 ? 18 ILE S HD12 1  
ATOM 155   H HD13 . ILE A 1 9  ? -5.695  -4.327  -2.601  1.00 0.00 ? 18 ILE S HD13 1  
ATOM 156   N N    . TYR A 1 10 ? -7.270  1.517   -2.492  1.00 0.00 ? 19 TYR S N    1  
ATOM 157   C CA   . TYR A 1 10 ? -7.610  2.926   -2.622  1.00 0.00 ? 19 TYR S CA   1  
ATOM 158   C C    . TYR A 1 10 ? -6.742  3.579   -3.698  1.00 0.00 ? 19 TYR S C    1  
ATOM 159   O O    . TYR A 1 10 ? -5.576  3.221   -3.866  1.00 0.00 ? 19 TYR S O    1  
ATOM 160   C CB   . TYR A 1 10 ? -7.452  3.636   -1.268  1.00 0.00 ? 19 TYR S CB   1  
ATOM 161   C CG   . TYR A 1 10 ? -8.549  3.292   -0.271  1.00 0.00 ? 19 TYR S CG   1  
ATOM 162   C CD1  . TYR A 1 10 ? -9.395  2.209   -0.489  1.00 0.00 ? 19 TYR S CD1  1  
ATOM 163   C CD2  . TYR A 1 10 ? -8.751  4.051   0.882   1.00 0.00 ? 19 TYR S CD2  1  
ATOM 164   C CE1  . TYR A 1 10 ? -10.401 1.891   0.401   1.00 0.00 ? 19 TYR S CE1  1  
ATOM 165   C CE2  . TYR A 1 10 ? -9.758  3.737   1.774   1.00 0.00 ? 19 TYR S CE2  1  
ATOM 166   C CZ   . TYR A 1 10 ? -10.580 2.658   1.529   1.00 0.00 ? 19 TYR S CZ   1  
ATOM 167   O OH   . TYR A 1 10 ? -11.586 2.346   2.414   1.00 0.00 ? 19 TYR S OH   1  
ATOM 168   H H    . TYR A 1 10 ? -6.508  1.261   -1.934  1.00 0.00 ? 19 TYR S H    1  
ATOM 169   H HA   . TYR A 1 10 ? -8.643  2.985   -2.930  1.00 0.00 ? 19 TYR S HA   1  
ATOM 170   H HB2  . TYR A 1 10 ? -6.504  3.353   -0.830  1.00 0.00 ? 19 TYR S HB2  1  
ATOM 171   H HB3  . TYR A 1 10 ? -7.467  4.706   -1.425  1.00 0.00 ? 19 TYR S HB3  1  
ATOM 172   H HD1  . TYR A 1 10 ? -9.254  1.605   -1.370  1.00 0.00 ? 19 TYR S HD1  1  
ATOM 173   H HD2  . TYR A 1 10 ? -8.109  4.899   1.083   1.00 0.00 ? 19 TYR S HD2  1  
ATOM 174   H HE1  . TYR A 1 10 ? -11.043 1.046   0.209   1.00 0.00 ? 19 TYR S HE1  1  
ATOM 175   H HE2  . TYR A 1 10 ? -9.896  4.340   2.659   1.00 0.00 ? 19 TYR S HE2  1  
ATOM 176   H HH   . TYR A 1 10 ? -12.411 2.734   2.112   1.00 0.00 ? 19 TYR S HH   1  
ATOM 177   N N    . PRO A 1 11 ? -7.309  4.528   -4.465  1.00 0.00 ? 20 PRO S N    1  
ATOM 178   C CA   . PRO A 1 11 ? -6.600  5.217   -5.548  1.00 0.00 ? 20 PRO S CA   1  
ATOM 179   C C    . PRO A 1 11 ? -5.200  5.681   -5.150  1.00 0.00 ? 20 PRO S C    1  
ATOM 180   O O    . PRO A 1 11 ? -5.045  6.543   -4.285  1.00 0.00 ? 20 PRO S O    1  
ATOM 181   C CB   . PRO A 1 11 ? -7.496  6.425   -5.870  1.00 0.00 ? 20 PRO S CB   1  
ATOM 182   C CG   . PRO A 1 11 ? -8.597  6.409   -4.857  1.00 0.00 ? 20 PRO S CG   1  
ATOM 183   C CD   . PRO A 1 11 ? -8.692  4.998   -4.353  1.00 0.00 ? 20 PRO S CD   1  
ATOM 184   H HA   . PRO A 1 11 ? -6.523  4.587   -6.422  1.00 0.00 ? 20 PRO S HA   1  
ATOM 185   H HB2  . PRO A 1 11 ? -6.913  7.334   -5.798  1.00 0.00 ? 20 PRO S HB2  1  
ATOM 186   H HB3  . PRO A 1 11 ? -7.885  6.324   -6.872  1.00 0.00 ? 20 PRO S HB3  1  
ATOM 187   H HG2  . PRO A 1 11 ? -8.357  7.077   -4.043  1.00 0.00 ? 20 PRO S HG2  1  
ATOM 188   H HG3  . PRO A 1 11 ? -9.527  6.703   -5.321  1.00 0.00 ? 20 PRO S HG3  1  
ATOM 189   H HD2  . PRO A 1 11 ? -9.027  4.982   -3.326  1.00 0.00 ? 20 PRO S HD2  1  
ATOM 190   H HD3  . PRO A 1 11 ? -9.349  4.412   -4.980  1.00 0.00 ? 20 PRO S HD3  1  
ATOM 191   N N    . LEU A 1 12 ? -4.184  5.101   -5.793  1.00 0.00 ? 21 LEU S N    1  
ATOM 192   C CA   . LEU A 1 12 ? -2.791  5.445   -5.518  1.00 0.00 ? 21 LEU S CA   1  
ATOM 193   C C    . LEU A 1 12 ? -2.598  6.951   -5.348  1.00 0.00 ? 21 LEU S C    1  
ATOM 194   O O    . LEU A 1 12 ? -1.799  7.391   -4.527  1.00 0.00 ? 21 LEU S O    1  
ATOM 195   C CB   . LEU A 1 12 ? -1.887  4.935   -6.640  1.00 0.00 ? 21 LEU S CB   1  
ATOM 196   C CG   . LEU A 1 12 ? -2.011  5.685   -7.969  1.00 0.00 ? 21 LEU S CG   1  
ATOM 197   C CD1  . LEU A 1 12 ? -1.029  6.843   -8.024  1.00 0.00 ? 21 LEU S CD1  1  
ATOM 198   C CD2  . LEU A 1 12 ? -1.786  4.737   -9.137  1.00 0.00 ? 21 LEU S CD2  1  
ATOM 199   H H    . LEU A 1 12 ? -4.375  4.415   -6.467  1.00 0.00 ? 21 LEU S H    1  
ATOM 200   H HA   . LEU A 1 12 ? -2.512  4.957   -4.601  1.00 0.00 ? 21 LEU S HA   1  
ATOM 201   H HB2  . LEU A 1 12 ? -0.862  5.009   -6.303  1.00 0.00 ? 21 LEU S HB2  1  
ATOM 202   H HB3  . LEU A 1 12 ? -2.119  3.895   -6.816  1.00 0.00 ? 21 LEU S HB3  1  
ATOM 203   H HG   . LEU A 1 12 ? -3.010  6.090   -8.054  1.00 0.00 ? 21 LEU S HG   1  
ATOM 204   H HD11 . LEU A 1 12 ? -0.751  7.128   -7.020  1.00 0.00 ? 21 LEU S HD11 1  
ATOM 205   H HD12 . LEU A 1 12 ? -1.490  7.684   -8.521  1.00 0.00 ? 21 LEU S HD12 1  
ATOM 206   H HD13 . LEU A 1 12 ? -0.146  6.543   -8.570  1.00 0.00 ? 21 LEU S HD13 1  
ATOM 207   H HD21 . LEU A 1 12 ? -2.103  5.212   -10.053 1.00 0.00 ? 21 LEU S HD21 1  
ATOM 208   H HD22 . LEU A 1 12 ? -2.359  3.834   -8.985  1.00 0.00 ? 21 LEU S HD22 1  
ATOM 209   H HD23 . LEU A 1 12 ? -0.737  4.490   -9.203  1.00 0.00 ? 21 LEU S HD23 1  
ATOM 210   N N    . ALA A 1 13 ? -3.334  7.739   -6.121  1.00 0.00 ? 22 ALA S N    1  
ATOM 211   C CA   . ALA A 1 13 ? -3.228  9.191   -6.030  1.00 0.00 ? 22 ALA S CA   1  
ATOM 212   C C    . ALA A 1 13 ? -3.497  9.658   -4.607  1.00 0.00 ? 22 ALA S C    1  
ATOM 213   O O    . ALA A 1 13 ? -2.700  10.393  -4.021  1.00 0.00 ? 22 ALA S O    1  
ATOM 214   C CB   . ALA A 1 13 ? -4.191  9.856   -7.002  1.00 0.00 ? 22 ALA S CB   1  
ATOM 215   H H    . ALA A 1 13 ? -3.960  7.341   -6.760  1.00 0.00 ? 22 ALA S H    1  
ATOM 216   H HA   . ALA A 1 13 ? -2.221  9.470   -6.305  1.00 0.00 ? 22 ALA S HA   1  
ATOM 217   H HB1  . ALA A 1 13 ? -5.125  9.314   -7.011  1.00 0.00 ? 22 ALA S HB1  1  
ATOM 218   H HB2  . ALA A 1 13 ? -3.763  9.850   -7.994  1.00 0.00 ? 22 ALA S HB2  1  
ATOM 219   H HB3  . ALA A 1 13 ? -4.370  10.874  -6.692  1.00 0.00 ? 22 ALA S HB3  1  
ATOM 220   N N    . ASP A 1 14 ? -4.622  9.218   -4.054  1.00 0.00 ? 23 ASP S N    1  
ATOM 221   C CA   . ASP A 1 14 ? -5.009  9.577   -2.692  1.00 0.00 ? 23 ASP S CA   1  
ATOM 222   C C    . ASP A 1 14 ? -3.878  9.304   -1.708  1.00 0.00 ? 23 ASP S C    1  
ATOM 223   O O    . ASP A 1 14 ? -3.581  10.124  -0.839  1.00 0.00 ? 23 ASP S O    1  
ATOM 224   C CB   . ASP A 1 14 ? -6.252  8.787   -2.279  1.00 0.00 ? 23 ASP S CB   1  
ATOM 225   C CG   . ASP A 1 14 ? -7.521  9.325   -2.915  1.00 0.00 ? 23 ASP S CG   1  
ATOM 226   O OD1  . ASP A 1 14 ? -7.626  9.281   -4.159  1.00 0.00 ? 23 ASP S OD1  1  
ATOM 227   O OD2  . ASP A 1 14 ? -8.407  9.790   -2.169  1.00 0.00 ? 23 ASP S OD2  1  
ATOM 228   H H    . ASP A 1 14 ? -5.208  8.631   -4.574  1.00 0.00 ? 23 ASP S H    1  
ATOM 229   H HA   . ASP A 1 14 ? -5.240  10.629  -2.676  1.00 0.00 ? 23 ASP S HA   1  
ATOM 230   H HB2  . ASP A 1 14 ? -6.132  7.757   -2.582  1.00 0.00 ? 23 ASP S HB2  1  
ATOM 231   H HB3  . ASP A 1 14 ? -6.359  8.832   -1.206  1.00 0.00 ? 23 ASP S HB3  1  
ATOM 232   N N    . LEU A 1 15 ? -3.255  8.143   -1.850  1.00 0.00 ? 24 LEU S N    1  
ATOM 233   C CA   . LEU A 1 15 ? -2.159  7.743   -0.972  1.00 0.00 ? 24 LEU S CA   1  
ATOM 234   C C    . LEU A 1 15 ? -0.827  8.317   -1.443  1.00 0.00 ? 24 LEU S C    1  
ATOM 235   O O    . LEU A 1 15 ? 0.166   8.273   -0.716  1.00 0.00 ? 24 LEU S O    1  
ATOM 236   C CB   . LEU A 1 15 ? -2.066  6.216   -0.902  1.00 0.00 ? 24 LEU S CB   1  
ATOM 237   C CG   . LEU A 1 15 ? -2.456  5.479   -2.186  1.00 0.00 ? 24 LEU S CG   1  
ATOM 238   C CD1  . LEU A 1 15 ? -1.578  4.258   -2.413  1.00 0.00 ? 24 LEU S CD1  1  
ATOM 239   C CD2  . LEU A 1 15 ? -3.923  5.086   -2.136  1.00 0.00 ? 24 LEU S CD2  1  
ATOM 240   H H    . LEU A 1 15 ? -3.544  7.535   -2.563  1.00 0.00 ? 24 LEU S H    1  
ATOM 241   H HA   . LEU A 1 15 ? -2.371  8.126   0.014   1.00 0.00 ? 24 LEU S HA   1  
ATOM 242   H HB2  . LEU A 1 15 ? -1.051  5.949   -0.650  1.00 0.00 ? 24 LEU S HB2  1  
ATOM 243   H HB3  . LEU A 1 15 ? -2.717  5.879   -0.111  1.00 0.00 ? 24 LEU S HB3  1  
ATOM 244   H HG   . LEU A 1 15 ? -2.320  6.140   -3.023  1.00 0.00 ? 24 LEU S HG   1  
ATOM 245   H HD11 . LEU A 1 15 ? -1.327  4.180   -3.460  1.00 0.00 ? 24 LEU S HD11 1  
ATOM 246   H HD12 . LEU A 1 15 ? -2.112  3.370   -2.107  1.00 0.00 ? 24 LEU S HD12 1  
ATOM 247   H HD13 . LEU A 1 15 ? -0.672  4.353   -1.833  1.00 0.00 ? 24 LEU S HD13 1  
ATOM 248   H HD21 . LEU A 1 15 ? -4.065  4.313   -1.395  1.00 0.00 ? 24 LEU S HD21 1  
ATOM 249   H HD22 . LEU A 1 15 ? -4.228  4.718   -3.103  1.00 0.00 ? 24 LEU S HD22 1  
ATOM 250   H HD23 . LEU A 1 15 ? -4.517  5.950   -1.875  1.00 0.00 ? 24 LEU S HD23 1  
ATOM 251   N N    . LEU A 1 16 ? -0.801  8.833   -2.665  1.00 0.00 ? 25 LEU S N    1  
ATOM 252   C CA   . LEU A 1 16 ? 0.419   9.387   -3.225  1.00 0.00 ? 25 LEU S CA   1  
ATOM 253   C C    . LEU A 1 16 ? 0.405   10.916  -3.238  1.00 0.00 ? 25 LEU S C    1  
ATOM 254   O O    . LEU A 1 16 ? 0.971   11.539  -4.138  1.00 0.00 ? 25 LEU S O    1  
ATOM 255   C CB   . LEU A 1 16 ? 0.633   8.834   -4.632  1.00 0.00 ? 25 LEU S CB   1  
ATOM 256   C CG   . LEU A 1 16 ? 2.084   8.841   -5.110  1.00 0.00 ? 25 LEU S CG   1  
ATOM 257   C CD1  . LEU A 1 16 ? 2.967   8.103   -4.117  1.00 0.00 ? 25 LEU S CD1  1  
ATOM 258   C CD2  . LEU A 1 16 ? 2.191   8.216   -6.494  1.00 0.00 ? 25 LEU S CD2  1  
ATOM 259   H H    . LEU A 1 16 ? -1.611  8.828   -3.208  1.00 0.00 ? 25 LEU S H    1  
ATOM 260   H HA   . LEU A 1 16 ? 1.236   9.063   -2.600  1.00 0.00 ? 25 LEU S HA   1  
ATOM 261   H HB2  . LEU A 1 16 ? 0.279   7.810   -4.642  1.00 0.00 ? 25 LEU S HB2  1  
ATOM 262   H HB3  . LEU A 1 16 ? 0.041   9.413   -5.322  1.00 0.00 ? 25 LEU S HB3  1  
ATOM 263   H HG   . LEU A 1 16 ? 2.432   9.862   -5.173  1.00 0.00 ? 25 LEU S HG   1  
ATOM 264   H HD11 . LEU A 1 16 ? 2.347   7.663   -3.347  1.00 0.00 ? 25 LEU S HD11 1  
ATOM 265   H HD12 . LEU A 1 16 ? 3.660   8.798   -3.667  1.00 0.00 ? 25 LEU S HD12 1  
ATOM 266   H HD13 . LEU A 1 16 ? 3.514   7.326   -4.626  1.00 0.00 ? 25 LEU S HD13 1  
ATOM 267   H HD21 . LEU A 1 16 ? 1.249   8.325   -7.012  1.00 0.00 ? 25 LEU S HD21 1  
ATOM 268   H HD22 . LEU A 1 16 ? 2.432   7.169   -6.399  1.00 0.00 ? 25 LEU S HD22 1  
ATOM 269   H HD23 . LEU A 1 16 ? 2.968   8.715   -7.055  1.00 0.00 ? 25 LEU S HD23 1  
ATOM 270   N N    . ALA A 1 17 ? -0.220  11.510  -2.215  1.00 0.00 ? 26 ALA S N    1  
ATOM 271   C CA   . ALA A 1 17 ? -0.292  12.973  -2.060  1.00 0.00 ? 26 ALA S CA   1  
ATOM 272   C C    . ALA A 1 17 ? -1.594  13.570  -2.593  1.00 0.00 ? 26 ALA S C    1  
ATOM 273   O O    . ALA A 1 17 ? -1.576  14.557  -3.330  1.00 0.00 ? 26 ALA S O    1  
ATOM 274   C CB   . ALA A 1 17 ? 0.904   13.657  -2.714  1.00 0.00 ? 26 ALA S CB   1  
ATOM 275   H H    . ALA A 1 17 ? -0.631  10.942  -1.528  1.00 0.00 ? 26 ALA S H    1  
ATOM 276   H HA   . ALA A 1 17 ? -0.239  13.181  -1.001  1.00 0.00 ? 26 ALA S HA   1  
ATOM 277   H HB1  . ALA A 1 17 ? 1.794   13.069  -2.542  1.00 0.00 ? 26 ALA S HB1  1  
ATOM 278   H HB2  . ALA A 1 17 ? 1.035   14.639  -2.286  1.00 0.00 ? 26 ALA S HB2  1  
ATOM 279   H HB3  . ALA A 1 17 ? 0.732   13.746  -3.776  1.00 0.00 ? 26 ALA S HB3  1  
ATOM 280   N N    . ARG A 1 18 ? -2.721  12.991  -2.197  1.00 0.00 ? 27 ARG S N    1  
ATOM 281   C CA   . ARG A 1 18 ? -4.027  13.494  -2.616  1.00 0.00 ? 27 ARG S CA   1  
ATOM 282   C C    . ARG A 1 18 ? -5.078  13.189  -1.553  1.00 0.00 ? 27 ARG S C    1  
ATOM 283   O O    . ARG A 1 18 ? -5.105  12.084  -1.019  1.00 0.00 ? 27 ARG S O    1  
ATOM 284   C CB   . ARG A 1 18 ? -4.443  12.877  -3.955  1.00 0.00 ? 27 ARG S CB   1  
ATOM 285   C CG   . ARG A 1 18 ? -5.883  13.178  -4.349  1.00 0.00 ? 27 ARG S CG   1  
ATOM 286   C CD   . ARG A 1 18 ? -6.819  12.051  -3.950  1.00 0.00 ? 27 ARG S CD   1  
ATOM 287   N NE   . ARG A 1 18 ? -8.077  12.094  -4.692  1.00 0.00 ? 27 ARG S NE   1  
ATOM 288   C CZ   . ARG A 1 18 ? -8.218  11.647  -5.939  1.00 0.00 ? 27 ARG S CZ   1  
ATOM 289   N NH1  . ARG A 1 18 ? -7.185  11.124  -6.586  1.00 0.00 ? 27 ARG S NH1  1  
ATOM 290   N NH2  . ARG A 1 18 ? -9.398  11.723  -6.538  1.00 0.00 ? 27 ARG S NH2  1  
ATOM 291   H H    . ARG A 1 18 ? -2.677  12.222  -1.593  1.00 0.00 ? 27 ARG S H    1  
ATOM 292   H HA   . ARG A 1 18 ? -3.948  14.565  -2.731  1.00 0.00 ? 27 ARG S HA   1  
ATOM 293   H HB2  . ARG A 1 18 ? -3.794  13.255  -4.730  1.00 0.00 ? 27 ARG S HB2  1  
ATOM 294   H HB3  . ARG A 1 18 ? -4.329  11.808  -3.894  1.00 0.00 ? 27 ARG S HB3  1  
ATOM 295   H HG2  . ARG A 1 18 ? -6.198  14.080  -3.852  1.00 0.00 ? 27 ARG S HG2  1  
ATOM 296   H HG3  . ARG A 1 18 ? -5.932  13.316  -5.418  1.00 0.00 ? 27 ARG S HG3  1  
ATOM 297   H HD2  . ARG A 1 18 ? -6.330  11.109  -4.144  1.00 0.00 ? 27 ARG S HD2  1  
ATOM 298   H HD3  . ARG A 1 18 ? -7.033  12.136  -2.893  1.00 0.00 ? 27 ARG S HD3  1  
ATOM 299   H HE   . ARG A 1 18 ? -8.857  12.477  -4.239  1.00 0.00 ? 27 ARG S HE   1  
ATOM 300   H HH11 . ARG A 1 18 ? -6.292  11.064  -6.139  1.00 0.00 ? 27 ARG S HH11 1  
ATOM 301   H HH12 . ARG A 1 18 ? -7.299  10.789  -7.521  1.00 0.00 ? 27 ARG S HH12 1  
ATOM 302   H HH21 . ARG A 1 18 ? -10.181 12.117  -6.056  1.00 0.00 ? 27 ARG S HH21 1  
ATOM 303   H HH22 . ARG A 1 18 ? -9.505  11.386  -7.475  1.00 0.00 ? 27 ARG S HH22 1  
ATOM 304   N N    . PRO A 1 19 ? -5.961  14.164  -1.231  1.00 0.00 ? 28 PRO S N    1  
ATOM 305   C CA   . PRO A 1 19 ? -7.021  13.997  -0.233  1.00 0.00 ? 28 PRO S CA   1  
ATOM 306   C C    . PRO A 1 19 ? -7.533  12.558  -0.137  1.00 0.00 ? 28 PRO S C    1  
ATOM 307   O O    . PRO A 1 19 ? -8.564  12.207  -0.711  1.00 0.00 ? 28 PRO S O    1  
ATOM 308   C CB   . PRO A 1 19 ? -8.105  14.925  -0.765  1.00 0.00 ? 28 PRO S CB   1  
ATOM 309   C CG   . PRO A 1 19 ? -7.362  16.050  -1.415  1.00 0.00 ? 28 PRO S CG   1  
ATOM 310   C CD   . PRO A 1 19 ? -6.001  15.518  -1.816  1.00 0.00 ? 28 PRO S CD   1  
ATOM 311   H HA   . PRO A 1 19 ? -6.702  14.332  0.742   1.00 0.00 ? 28 PRO S HA   1  
ATOM 312   H HB2  . PRO A 1 19 ? -8.721  14.394  -1.479  1.00 0.00 ? 28 PRO S HB2  1  
ATOM 313   H HB3  . PRO A 1 19 ? -8.716  15.279  0.056   1.00 0.00 ? 28 PRO S HB3  1  
ATOM 314   H HG2  . PRO A 1 19 ? -7.900  16.385  -2.288  1.00 0.00 ? 28 PRO S HG2  1  
ATOM 315   H HG3  . PRO A 1 19 ? -7.250  16.863  -0.713  1.00 0.00 ? 28 PRO S HG3  1  
ATOM 316   H HD2  . PRO A 1 19 ? -5.916  15.478  -2.890  1.00 0.00 ? 28 PRO S HD2  1  
ATOM 317   H HD3  . PRO A 1 19 ? -5.220  16.139  -1.399  1.00 0.00 ? 28 PRO S HD3  1  
ATOM 318   N N    . LEU A 1 20 ? -6.785  11.737  0.590   1.00 0.00 ? 29 LEU S N    1  
ATOM 319   C CA   . LEU A 1 20 ? -7.120  10.327  0.774   1.00 0.00 ? 29 LEU S CA   1  
ATOM 320   C C    . LEU A 1 20 ? -8.233  10.139  1.800   1.00 0.00 ? 29 LEU S C    1  
ATOM 321   O O    . LEU A 1 20 ? -8.473  11.003  2.643   1.00 0.00 ? 29 LEU S O    1  
ATOM 322   C CB   . LEU A 1 20 ? -5.881  9.539   1.212   1.00 0.00 ? 29 LEU S CB   1  
ATOM 323   C CG   . LEU A 1 20 ? -5.034  10.201  2.302   1.00 0.00 ? 29 LEU S CG   1  
ATOM 324   C CD1  . LEU A 1 20 ? -5.819  10.304  3.600   1.00 0.00 ? 29 LEU S CD1  1  
ATOM 325   C CD2  . LEU A 1 20 ? -3.741  9.427   2.520   1.00 0.00 ? 29 LEU S CD2  1  
ATOM 326   H H    . LEU A 1 20 ? -5.973  12.088  1.000   1.00 0.00 ? 29 LEU S H    1  
ATOM 327   H HA   . LEU A 1 20 ? -7.460  9.946   -0.174  1.00 0.00 ? 29 LEU S HA   1  
ATOM 328   H HB2  . LEU A 1 20 ? -6.206  8.574   1.576   1.00 0.00 ? 29 LEU S HB2  1  
ATOM 329   H HB3  . LEU A 1 20 ? -5.255  9.385   0.345   1.00 0.00 ? 29 LEU S HB3  1  
ATOM 330   H HG   . LEU A 1 20 ? -4.772  11.202  1.993   1.00 0.00 ? 29 LEU S HG   1  
ATOM 331   H HD11 . LEU A 1 20 ? -5.134  10.351  4.433   1.00 0.00 ? 29 LEU S HD11 1  
ATOM 332   H HD12 . LEU A 1 20 ? -6.456  9.437   3.706   1.00 0.00 ? 29 LEU S HD12 1  
ATOM 333   H HD13 . LEU A 1 20 ? -6.427  11.197  3.583   1.00 0.00 ? 29 LEU S HD13 1  
ATOM 334   H HD21 . LEU A 1 20 ? -3.837  8.803   3.395   1.00 0.00 ? 29 LEU S HD21 1  
ATOM 335   H HD22 . LEU A 1 20 ? -2.926  10.121  2.661   1.00 0.00 ? 29 LEU S HD22 1  
ATOM 336   H HD23 . LEU A 1 20 ? -3.541  8.811   1.656   1.00 0.00 ? 29 LEU S HD23 1  
ATOM 337   N N    . PRO A 1 21 ? -8.930  8.989   1.731   1.00 0.00 ? 30 PRO S N    1  
ATOM 338   C CA   . PRO A 1 21 ? -10.026 8.662   2.644   1.00 0.00 ? 30 PRO S CA   1  
ATOM 339   C C    . PRO A 1 21 ? -9.526  8.143   3.984   1.00 0.00 ? 30 PRO S C    1  
ATOM 340   O O    . PRO A 1 21 ? -8.378  8.376   4.362   1.00 0.00 ? 30 PRO S O    1  
ATOM 341   C CB   . PRO A 1 21 ? -10.762 7.564   1.886   1.00 0.00 ? 30 PRO S CB   1  
ATOM 342   C CG   . PRO A 1 21 ? -9.672  6.842   1.191   1.00 0.00 ? 30 PRO S CG   1  
ATOM 343   C CD   . PRO A 1 21 ? -8.704  7.906   0.752   1.00 0.00 ? 30 PRO S CD   1  
ATOM 344   H HA   . PRO A 1 21 ? -10.680 9.497   2.802   1.00 0.00 ? 30 PRO S HA   1  
ATOM 345   H HB2  . PRO A 1 21 ? -11.291 6.924   2.578   1.00 0.00 ? 30 PRO S HB2  1  
ATOM 346   H HB3  . PRO A 1 21 ? -11.452 8.005   1.183   1.00 0.00 ? 30 PRO S HB3  1  
ATOM 347   H HG2  . PRO A 1 21 ? -9.192  6.162   1.881   1.00 0.00 ? 30 PRO S HG2  1  
ATOM 348   H HG3  . PRO A 1 21 ? -10.063 6.309   0.335   1.00 0.00 ? 30 PRO S HG3  1  
ATOM 349   H HD2  . PRO A 1 21 ? -7.689  7.542   0.803   1.00 0.00 ? 30 PRO S HD2  1  
ATOM 350   H HD3  . PRO A 1 21 ? -8.941  8.239   -0.248  1.00 0.00 ? 30 PRO S HD3  1  
ATOM 351   N N    . GLU A 1 22 ? -10.395 7.441   4.700   1.00 0.00 ? 31 GLU S N    1  
ATOM 352   C CA   . GLU A 1 22 ? -10.033 6.896   6.001   1.00 0.00 ? 31 GLU S CA   1  
ATOM 353   C C    . GLU A 1 22 ? -9.537  5.465   5.887   1.00 0.00 ? 31 GLU S C    1  
ATOM 354   O O    . GLU A 1 22 ? -8.553  5.100   6.532   1.00 0.00 ? 31 GLU S O    1  
ATOM 355   C CB   . GLU A 1 22 ? -11.215 6.975   6.971   1.00 0.00 ? 31 GLU S CB   1  
ATOM 356   C CG   . GLU A 1 22 ? -10.898 6.453   8.363   1.00 0.00 ? 31 GLU S CG   1  
ATOM 357   C CD   . GLU A 1 22 ? -12.001 6.744   9.360   1.00 0.00 ? 31 GLU S CD   1  
ATOM 358   O OE1  . GLU A 1 22 ? -12.457 7.906   9.421   1.00 0.00 ? 31 GLU S OE1  1  
ATOM 359   O OE2  . GLU A 1 22 ? -12.410 5.811   10.083  1.00 0.00 ? 31 GLU S OE2  1  
ATOM 360   H H    . GLU A 1 22 ? -11.295 7.294   4.348   1.00 0.00 ? 31 GLU S H    1  
ATOM 361   H HA   . GLU A 1 22 ? -9.221  7.491   6.379   1.00 0.00 ? 31 GLU S HA   1  
ATOM 362   H HB2  . GLU A 1 22 ? -11.524 8.007   7.058   1.00 0.00 ? 31 GLU S HB2  1  
ATOM 363   H HB3  . GLU A 1 22 ? -12.035 6.396   6.570   1.00 0.00 ? 31 GLU S HB3  1  
ATOM 364   H HG2  . GLU A 1 22 ? -10.757 5.384   8.307   1.00 0.00 ? 31 GLU S HG2  1  
ATOM 365   H HG3  . GLU A 1 22 ? -9.986  6.918   8.708   1.00 0.00 ? 31 GLU S HG3  1  
ATOM 366   N N    . GLY A 1 23 ? -10.185 4.658   5.047   1.00 0.00 ? 32 GLY S N    1  
ATOM 367   C CA   . GLY A 1 23 ? -9.730  3.290   4.868   1.00 0.00 ? 32 GLY S CA   1  
ATOM 368   C C    . GLY A 1 23 ? -8.234  3.260   4.629   1.00 0.00 ? 32 GLY S C    1  
ATOM 369   O O    . GLY A 1 23 ? -7.549  2.294   4.969   1.00 0.00 ? 32 GLY S O    1  
ATOM 370   H H    . GLY A 1 23 ? -10.948 4.998   4.536   1.00 0.00 ? 32 GLY S H    1  
ATOM 371   H HA2  . GLY A 1 23 ? -9.963  2.718   5.758   1.00 0.00 ? 32 GLY S HA2  1  
ATOM 372   H HA3  . GLY A 1 23 ? -10.233 2.854   4.020   1.00 0.00 ? 32 GLY S HA3  1  
ATOM 373   N N    . VAL A 1 24 ? -7.734  4.358   4.066   1.00 0.00 ? 33 VAL S N    1  
ATOM 374   C CA   . VAL A 1 24 ? -6.320  4.526   3.795   1.00 0.00 ? 33 VAL S CA   1  
ATOM 375   C C    . VAL A 1 24 ? -5.597  4.926   5.084   1.00 0.00 ? 33 VAL S C    1  
ATOM 376   O O    . VAL A 1 24 ? -5.766  6.041   5.576   1.00 0.00 ? 33 VAL S O    1  
ATOM 377   C CB   . VAL A 1 24 ? -6.111  5.599   2.690   1.00 0.00 ? 33 VAL S CB   1  
ATOM 378   C CG1  . VAL A 1 24 ? -5.075  6.647   3.079   1.00 0.00 ? 33 VAL S CG1  1  
ATOM 379   C CG2  . VAL A 1 24 ? -5.733  4.950   1.371   1.00 0.00 ? 33 VAL S CG2  1  
ATOM 380   H H    . VAL A 1 24 ? -8.341  5.094   3.843   1.00 0.00 ? 33 VAL S H    1  
ATOM 381   H HA   . VAL A 1 24 ? -5.931  3.584   3.444   1.00 0.00 ? 33 VAL S HA   1  
ATOM 382   H HB   . VAL A 1 24 ? -7.051  6.110   2.545   1.00 0.00 ? 33 VAL S HB   1  
ATOM 383   H HG11 . VAL A 1 24 ? -4.785  7.203   2.200   1.00 0.00 ? 33 VAL S HG11 1  
ATOM 384   H HG12 . VAL A 1 24 ? -4.207  6.161   3.500   1.00 0.00 ? 33 VAL S HG12 1  
ATOM 385   H HG13 . VAL A 1 24 ? -5.501  7.320   3.807   1.00 0.00 ? 33 VAL S HG13 1  
ATOM 386   H HG21 . VAL A 1 24 ? -5.941  3.892   1.417   1.00 0.00 ? 33 VAL S HG21 1  
ATOM 387   H HG22 . VAL A 1 24 ? -4.681  5.104   1.183   1.00 0.00 ? 33 VAL S HG22 1  
ATOM 388   H HG23 . VAL A 1 24 ? -6.311  5.397   0.576   1.00 0.00 ? 33 VAL S HG23 1  
ATOM 389   N N    . ASP A 1 25 ? -4.805  4.015   5.637   1.00 0.00 ? 34 ASP S N    1  
ATOM 390   C CA   . ASP A 1 25 ? -4.083  4.300   6.867   1.00 0.00 ? 34 ASP S CA   1  
ATOM 391   C C    . ASP A 1 25 ? -2.723  4.924   6.552   1.00 0.00 ? 34 ASP S C    1  
ATOM 392   O O    . ASP A 1 25 ? -1.933  4.348   5.807   1.00 0.00 ? 34 ASP S O    1  
ATOM 393   C CB   . ASP A 1 25 ? -3.903  3.020   7.684   1.00 0.00 ? 34 ASP S CB   1  
ATOM 394   C CG   . ASP A 1 25 ? -5.222  2.334   7.981   1.00 0.00 ? 34 ASP S CG   1  
ATOM 395   O OD1  . ASP A 1 25 ? -5.923  1.955   7.019   1.00 0.00 ? 34 ASP S OD1  1  
ATOM 396   O OD2  . ASP A 1 25 ? -5.554  2.178   9.173   1.00 0.00 ? 34 ASP S OD2  1  
ATOM 397   H H    . ASP A 1 25 ? -4.706  3.134   5.217   1.00 0.00 ? 34 ASP S H    1  
ATOM 398   H HA   . ASP A 1 25 ? -4.675  5.003   7.436   1.00 0.00 ? 34 ASP S HA   1  
ATOM 399   H HB2  . ASP A 1 25 ? -3.279  2.332   7.130   1.00 0.00 ? 34 ASP S HB2  1  
ATOM 400   H HB3  . ASP A 1 25 ? -3.426  3.263   8.622   1.00 0.00 ? 34 ASP S HB3  1  
ATOM 401   N N    . PRO A 1 26 ? -2.438  6.118   7.103   1.00 0.00 ? 35 PRO S N    1  
ATOM 402   C CA   . PRO A 1 26 ? -1.171  6.824   6.857   1.00 0.00 ? 35 PRO S CA   1  
ATOM 403   C C    . PRO A 1 26 ? 0.062   6.021   7.262   1.00 0.00 ? 35 PRO S C    1  
ATOM 404   O O    . PRO A 1 26 ? 1.107   6.116   6.618   1.00 0.00 ? 35 PRO S O    1  
ATOM 405   C CB   . PRO A 1 26 ? -1.285  8.094   7.716   1.00 0.00 ? 35 PRO S CB   1  
ATOM 406   C CG   . PRO A 1 26 ? -2.374  7.809   8.694   1.00 0.00 ? 35 PRO S CG   1  
ATOM 407   C CD   . PRO A 1 26 ? -3.324  6.884   7.992   1.00 0.00 ? 35 PRO S CD   1  
ATOM 408   H HA   . PRO A 1 26 ? -1.081  7.107   5.818   1.00 0.00 ? 35 PRO S HA   1  
ATOM 409   H HB2  . PRO A 1 26 ? -0.344  8.277   8.216   1.00 0.00 ? 35 PRO S HB2  1  
ATOM 410   H HB3  . PRO A 1 26 ? -1.535  8.935   7.086   1.00 0.00 ? 35 PRO S HB3  1  
ATOM 411   H HG2  . PRO A 1 26 ? -1.963  7.329   9.571   1.00 0.00 ? 35 PRO S HG2  1  
ATOM 412   H HG3  . PRO A 1 26 ? -2.874  8.726   8.965   1.00 0.00 ? 35 PRO S HG3  1  
ATOM 413   H HD2  . PRO A 1 26 ? -3.815  6.235   8.705   1.00 0.00 ? 35 PRO S HD2  1  
ATOM 414   H HD3  . PRO A 1 26 ? -4.050  7.447   7.424   1.00 0.00 ? 35 PRO S HD3  1  
ATOM 415   N N    . LEU A 1 27 ? -0.052  5.247   8.335   1.00 0.00 ? 36 LEU S N    1  
ATOM 416   C CA   . LEU A 1 27 ? 1.079   4.456   8.815   1.00 0.00 ? 36 LEU S CA   1  
ATOM 417   C C    . LEU A 1 27 ? 1.308   3.200   7.968   1.00 0.00 ? 36 LEU S C    1  
ATOM 418   O O    . LEU A 1 27 ? 2.382   2.602   8.024   1.00 0.00 ? 36 LEU S O    1  
ATOM 419   C CB   . LEU A 1 27 ? 0.907   4.097   10.301  1.00 0.00 ? 36 LEU S CB   1  
ATOM 420   C CG   . LEU A 1 27 ? -0.110  2.996   10.633  1.00 0.00 ? 36 LEU S CG   1  
ATOM 421   C CD1  . LEU A 1 27 ? -1.489  3.352   10.104  1.00 0.00 ? 36 LEU S CD1  1  
ATOM 422   C CD2  . LEU A 1 27 ? 0.342   1.655   10.082  1.00 0.00 ? 36 LEU S CD2  1  
ATOM 423   H H    . LEU A 1 27 ? -0.900  5.223   8.820   1.00 0.00 ? 36 LEU S H    1  
ATOM 424   H HA   . LEU A 1 27 ? 1.957   5.079   8.721   1.00 0.00 ? 36 LEU S HA   1  
ATOM 425   H HB2  . LEU A 1 27 ? 1.870   3.782   10.680  1.00 0.00 ? 36 LEU S HB2  1  
ATOM 426   H HB3  . LEU A 1 27 ? 0.612   4.994   10.828  1.00 0.00 ? 36 LEU S HB3  1  
ATOM 427   H HG   . LEU A 1 27 ? -0.184  2.903   11.707  1.00 0.00 ? 36 LEU S HG   1  
ATOM 428   H HD11 . LEU A 1 27 ? -2.212  2.640   10.476  1.00 0.00 ? 36 LEU S HD11 1  
ATOM 429   H HD12 . LEU A 1 27 ? -1.479  3.323   9.025   1.00 0.00 ? 36 LEU S HD12 1  
ATOM 430   H HD13 . LEU A 1 27 ? -1.757  4.344   10.436  1.00 0.00 ? 36 LEU S HD13 1  
ATOM 431   H HD21 . LEU A 1 27 ? 1.406   1.685   9.884   1.00 0.00 ? 36 LEU S HD21 1  
ATOM 432   H HD22 . LEU A 1 27 ? -0.188  1.454   9.165   1.00 0.00 ? 36 LEU S HD22 1  
ATOM 433   H HD23 . LEU A 1 27 ? 0.129   0.878   10.800  1.00 0.00 ? 36 LEU S HD23 1  
ATOM 434   N N    . LYS A 1 28 ? 0.309   2.800   7.183   1.00 0.00 ? 37 LYS S N    1  
ATOM 435   C CA   . LYS A 1 28 ? 0.443   1.615   6.331   1.00 0.00 ? 37 LYS S CA   1  
ATOM 436   C C    . LYS A 1 28 ? -0.239  1.821   4.986   1.00 0.00 ? 37 LYS S C    1  
ATOM 437   O O    . LYS A 1 28 ? -1.415  1.500   4.818   1.00 0.00 ? 37 LYS S O    1  
ATOM 438   C CB   . LYS A 1 28 ? -0.134  0.375   7.020   1.00 0.00 ? 37 LYS S CB   1  
ATOM 439   C CG   . LYS A 1 28 ? -1.586  0.527   7.444   1.00 0.00 ? 37 LYS S CG   1  
ATOM 440   C CD   . LYS A 1 28 ? -1.989  -0.550  8.440   1.00 0.00 ? 37 LYS S CD   1  
ATOM 441   C CE   . LYS A 1 28 ? -3.496  -0.751  8.469   1.00 0.00 ? 37 LYS S CE   1  
ATOM 442   N NZ   . LYS A 1 28 ? -3.897  -2.038  7.836   1.00 0.00 ? 37 LYS S NZ   1  
ATOM 443   H H    . LYS A 1 28 ? -0.528  3.310   7.169   1.00 0.00 ? 37 LYS S H    1  
ATOM 444   H HA   . LYS A 1 28 ? 1.497   1.456   6.160   1.00 0.00 ? 37 LYS S HA   1  
ATOM 445   H HB2  . LYS A 1 28 ? -0.068  -0.462  6.338   1.00 0.00 ? 37 LYS S HB2  1  
ATOM 446   H HB3  . LYS A 1 28 ? 0.455   0.158   7.900   1.00 0.00 ? 37 LYS S HB3  1  
ATOM 447   H HG2  . LYS A 1 28 ? -1.717  1.494   7.907   1.00 0.00 ? 37 LYS S HG2  1  
ATOM 448   H HG3  . LYS A 1 28 ? -2.219  0.453   6.573   1.00 0.00 ? 37 LYS S HG3  1  
ATOM 449   H HD2  . LYS A 1 28 ? -1.519  -1.480  8.158   1.00 0.00 ? 37 LYS S HD2  1  
ATOM 450   H HD3  . LYS A 1 28 ? -1.654  -0.260  9.425   1.00 0.00 ? 37 LYS S HD3  1  
ATOM 451   H HE2  . LYS A 1 28 ? -3.826  -0.746  9.497   1.00 0.00 ? 37 LYS S HE2  1  
ATOM 452   H HE3  . LYS A 1 28 ? -3.965  0.064   7.938   1.00 0.00 ? 37 LYS S HE3  1  
ATOM 453   H HZ1  . LYS A 1 28 ? -3.167  -2.349  7.164   1.00 0.00 ? 37 LYS S HZ1  1  
ATOM 454   H HZ2  . LYS A 1 28 ? -4.795  -1.921  7.327   1.00 0.00 ? 37 LYS S HZ2  1  
ATOM 455   H HZ3  . LYS A 1 28 ? -4.017  -2.771  8.563   1.00 0.00 ? 37 LYS S HZ3  1  
ATOM 456   N N    . LEU A 1 29 ? 0.504   2.363   4.029   1.00 0.00 ? 38 LEU S N    1  
ATOM 457   C CA   . LEU A 1 29 ? -0.033  2.612   2.698   1.00 0.00 ? 38 LEU S CA   1  
ATOM 458   C C    . LEU A 1 29 ? 0.127   1.396   1.789   1.00 0.00 ? 38 LEU S C    1  
ATOM 459   O O    . LEU A 1 29 ? -0.833  0.953   1.158   1.00 0.00 ? 38 LEU S O    1  
ATOM 460   C CB   . LEU A 1 29 ? 0.640   3.833   2.065   1.00 0.00 ? 38 LEU S CB   1  
ATOM 461   C CG   . LEU A 1 29 ? 0.939   4.989   3.024   1.00 0.00 ? 38 LEU S CG   1  
ATOM 462   C CD1  . LEU A 1 29 ? 1.246   6.259   2.245   1.00 0.00 ? 38 LEU S CD1  1  
ATOM 463   C CD2  . LEU A 1 29 ? -0.227  5.220   3.982   1.00 0.00 ? 38 LEU S CD2  1  
ATOM 464   H H    . LEU A 1 29 ? 1.432   2.603   4.221   1.00 0.00 ? 38 LEU S H    1  
ATOM 465   H HA   . LEU A 1 29 ? -1.081  2.814   2.812   1.00 0.00 ? 38 LEU S HA   1  
ATOM 466   H HB2  . LEU A 1 29 ? 1.573   3.512   1.621   1.00 0.00 ? 38 LEU S HB2  1  
ATOM 467   H HB3  . LEU A 1 29 ? -0.004  4.205   1.280   1.00 0.00 ? 38 LEU S HB3  1  
ATOM 468   H HG   . LEU A 1 29 ? 1.811   4.743   3.613   1.00 0.00 ? 38 LEU S HG   1  
ATOM 469   H HD11 . LEU A 1 29 ? 1.902   6.889   2.825   1.00 0.00 ? 38 LEU S HD11 1  
ATOM 470   H HD12 . LEU A 1 29 ? 0.327   6.787   2.041   1.00 0.00 ? 38 LEU S HD12 1  
ATOM 471   H HD13 . LEU A 1 29 ? 1.726   6.000   1.313   1.00 0.00 ? 38 LEU S HD13 1  
ATOM 472   H HD21 . LEU A 1 29 ? -0.538  6.252   3.930   1.00 0.00 ? 38 LEU S HD21 1  
ATOM 473   H HD22 . LEU A 1 29 ? 0.085   4.990   4.990   1.00 0.00 ? 38 LEU S HD22 1  
ATOM 474   H HD23 . LEU A 1 29 ? -1.055  4.582   3.708   1.00 0.00 ? 38 LEU S HD23 1  
ATOM 475   N N    . GLU A 1 30 ? 1.342   0.867   1.717   1.00 0.00 ? 39 GLU S N    1  
ATOM 476   C CA   . GLU A 1 30 ? 1.630   -0.291  0.874   1.00 0.00 ? 39 GLU S CA   1  
ATOM 477   C C    . GLU A 1 30 ? 0.568   -1.382  1.018   1.00 0.00 ? 39 GLU S C    1  
ATOM 478   O O    . GLU A 1 30 ? 0.356   -2.178  0.105   1.00 0.00 ? 39 GLU S O    1  
ATOM 479   C CB   . GLU A 1 30 ? 3.010   -0.861  1.219   1.00 0.00 ? 39 GLU S CB   1  
ATOM 480   C CG   . GLU A 1 30 ? 3.081   -1.512  2.593   1.00 0.00 ? 39 GLU S CG   1  
ATOM 481   C CD   . GLU A 1 30 ? 3.912   -2.780  2.596   1.00 0.00 ? 39 GLU S CD   1  
ATOM 482   O OE1  . GLU A 1 30 ? 3.361   -3.851  2.265   1.00 0.00 ? 39 GLU S OE1  1  
ATOM 483   O OE2  . GLU A 1 30 ? 5.113   -2.701  2.929   1.00 0.00 ? 39 GLU S OE2  1  
ATOM 484   H H    . GLU A 1 30 ? 2.071   1.270   2.236   1.00 0.00 ? 39 GLU S H    1  
ATOM 485   H HA   . GLU A 1 30 ? 1.641   0.045   -0.153  1.00 0.00 ? 39 GLU S HA   1  
ATOM 486   H HB2  . GLU A 1 30 ? 3.273   -1.605  0.480   1.00 0.00 ? 39 GLU S HB2  1  
ATOM 487   H HB3  . GLU A 1 30 ? 3.734   -0.059  1.187   1.00 0.00 ? 39 GLU S HB3  1  
ATOM 488   H HG2  . GLU A 1 30 ? 3.520   -0.811  3.287   1.00 0.00 ? 39 GLU S HG2  1  
ATOM 489   H HG3  . GLU A 1 30 ? 2.080   -1.755  2.917   1.00 0.00 ? 39 GLU S HG3  1  
ATOM 490   N N    . ILE A 1 31 ? -0.085  -1.427  2.175   1.00 0.00 ? 40 ILE S N    1  
ATOM 491   C CA   . ILE A 1 31 ? -1.102  -2.437  2.438   1.00 0.00 ? 40 ILE S CA   1  
ATOM 492   C C    . ILE A 1 31 ? -2.418  -2.157  1.709   1.00 0.00 ? 40 ILE S C    1  
ATOM 493   O O    . ILE A 1 31 ? -3.248  -3.055  1.568   1.00 0.00 ? 40 ILE S O    1  
ATOM 494   C CB   . ILE A 1 31 ? -1.385  -2.563  3.947   1.00 0.00 ? 40 ILE S CB   1  
ATOM 495   C CG1  . ILE A 1 31 ? -2.023  -1.280  4.480   1.00 0.00 ? 40 ILE S CG1  1  
ATOM 496   C CG2  . ILE A 1 31 ? -0.104  -2.877  4.703   1.00 0.00 ? 40 ILE S CG2  1  
ATOM 497   C CD1  . ILE A 1 31 ? -3.535  -1.292  4.436   1.00 0.00 ? 40 ILE S CD1  1  
ATOM 498   H H    . ILE A 1 31 ? 0.136   -0.777  2.874   1.00 0.00 ? 40 ILE S H    1  
ATOM 499   H HA   . ILE A 1 31 ? -0.717  -3.385  2.094   1.00 0.00 ? 40 ILE S HA   1  
ATOM 500   H HB   . ILE A 1 31 ? -2.071  -3.385  4.095   1.00 0.00 ? 40 ILE S HB   1  
ATOM 501   H HG12 . ILE A 1 31 ? -1.724  -1.136  5.508   1.00 0.00 ? 40 ILE S HG12 1  
ATOM 502   H HG13 . ILE A 1 31 ? -1.680  -0.445  3.888   1.00 0.00 ? 40 ILE S HG13 1  
ATOM 503   H HG21 . ILE A 1 31 ? 0.453   -1.965  4.861   1.00 0.00 ? 40 ILE S HG21 1  
ATOM 504   H HG22 . ILE A 1 31 ? 0.494   -3.568  4.127   1.00 0.00 ? 40 ILE S HG22 1  
ATOM 505   H HG23 . ILE A 1 31 ? -0.348  -3.320  5.657   1.00 0.00 ? 40 ILE S HG23 1  
ATOM 506   H HD11 . ILE A 1 31 ? -3.924  -1.444  5.432   1.00 0.00 ? 40 ILE S HD11 1  
ATOM 507   H HD12 . ILE A 1 31 ? -3.870  -2.093  3.793   1.00 0.00 ? 40 ILE S HD12 1  
ATOM 508   H HD13 . ILE A 1 31 ? -3.892  -0.349  4.050   1.00 0.00 ? 40 ILE S HD13 1  
ATOM 509   N N    . TYR A 1 32 ? -2.627  -0.920  1.260   1.00 0.00 ? 41 TYR S N    1  
ATOM 510   C CA   . TYR A 1 32 ? -3.873  -0.586  0.570   1.00 0.00 ? 41 TYR S CA   1  
ATOM 511   C C    . TYR A 1 32 ? -3.669  -0.283  -0.911  1.00 0.00 ? 41 TYR S C    1  
ATOM 512   O O    . TYR A 1 32 ? -4.396  0.530   -1.484  1.00 0.00 ? 41 TYR S O    1  
ATOM 513   C CB   . TYR A 1 32 ? -4.600  0.577   1.264   1.00 0.00 ? 41 TYR S CB   1  
ATOM 514   C CG   . TYR A 1 32 ? -3.812  1.870   1.413   1.00 0.00 ? 41 TYR S CG   1  
ATOM 515   C CD1  . TYR A 1 32 ? -2.999  2.364   0.396   1.00 0.00 ? 41 TYR S CD1  1  
ATOM 516   C CD2  . TYR A 1 32 ? -3.918  2.620   2.580   1.00 0.00 ? 41 TYR S CD2  1  
ATOM 517   C CE1  . TYR A 1 32 ? -2.317  3.559   0.546   1.00 0.00 ? 41 TYR S CE1  1  
ATOM 518   C CE2  . TYR A 1 32 ? -3.246  3.817   2.729   1.00 0.00 ? 41 TYR S CE2  1  
ATOM 519   C CZ   . TYR A 1 32 ? -2.446  4.280   1.709   1.00 0.00 ? 41 TYR S CZ   1  
ATOM 520   O OH   . TYR A 1 32 ? -1.779  5.474   1.849   1.00 0.00 ? 41 TYR S OH   1  
ATOM 521   H H    . TYR A 1 32 ? -1.949  -0.227  1.401   1.00 0.00 ? 41 TYR S H    1  
ATOM 522   H HA   . TYR A 1 32 ? -4.509  -1.456  0.638   1.00 0.00 ? 41 TYR S HA   1  
ATOM 523   H HB2  . TYR A 1 32 ? -5.491  0.810   0.702   1.00 0.00 ? 41 TYR S HB2  1  
ATOM 524   H HB3  . TYR A 1 32 ? -4.890  0.256   2.257   1.00 0.00 ? 41 TYR S HB3  1  
ATOM 525   H HD1  . TYR A 1 32 ? -2.896  1.804   -0.518  1.00 0.00 ? 41 TYR S HD1  1  
ATOM 526   H HD2  . TYR A 1 32 ? -4.540  2.254   3.381   1.00 0.00 ? 41 TYR S HD2  1  
ATOM 527   H HE1  . TYR A 1 32 ? -1.687  3.924   -0.247  1.00 0.00 ? 41 TYR S HE1  1  
ATOM 528   H HE2  . TYR A 1 32 ? -3.344  4.380   3.644   1.00 0.00 ? 41 TYR S HE2  1  
ATOM 529   H HH   . TYR A 1 32 ? -2.345  6.107   2.299   1.00 0.00 ? 41 TYR S HH   1  
ATOM 530   N N    . LEU A 1 33 ? -2.703  -0.947  -1.541  1.00 0.00 ? 42 LEU S N    1  
ATOM 531   C CA   . LEU A 1 33 ? -2.454  -0.739  -2.967  1.00 0.00 ? 42 LEU S CA   1  
ATOM 532   C C    . LEU A 1 33 ? -2.188  -2.062  -3.671  1.00 0.00 ? 42 LEU S C    1  
ATOM 533   O O    . LEU A 1 33 ? -1.272  -2.798  -3.311  1.00 0.00 ? 42 LEU S O    1  
ATOM 534   C CB   . LEU A 1 33 ? -1.279  0.215   -3.187  1.00 0.00 ? 42 LEU S CB   1  
ATOM 535   C CG   . LEU A 1 33 ? -0.178  0.173   -2.126  1.00 0.00 ? 42 LEU S CG   1  
ATOM 536   C CD1  . LEU A 1 33 ? 1.032   -0.596  -2.634  1.00 0.00 ? 42 LEU S CD1  1  
ATOM 537   C CD2  . LEU A 1 33 ? 0.214   1.590   -1.727  1.00 0.00 ? 42 LEU S CD2  1  
ATOM 538   H H    . LEU A 1 33 ? -2.155  -1.600  -1.045  1.00 0.00 ? 42 LEU S H    1  
ATOM 539   H HA   . LEU A 1 33 ? -3.342  -0.299  -3.393  1.00 0.00 ? 42 LEU S HA   1  
ATOM 540   H HB2  . LEU A 1 33 ? -0.830  -0.029  -4.141  1.00 0.00 ? 42 LEU S HB2  1  
ATOM 541   H HB3  . LEU A 1 33 ? -1.666  1.220   -3.242  1.00 0.00 ? 42 LEU S HB3  1  
ATOM 542   H HG   . LEU A 1 33 ? -0.548  -0.331  -1.247  1.00 0.00 ? 42 LEU S HG   1  
ATOM 543   H HD11 . LEU A 1 33 ? 1.368   -1.283  -1.872  1.00 0.00 ? 42 LEU S HD11 1  
ATOM 544   H HD12 . LEU A 1 33 ? 1.826   0.096   -2.872  1.00 0.00 ? 42 LEU S HD12 1  
ATOM 545   H HD13 . LEU A 1 33 ? 0.758   -1.149  -3.520  1.00 0.00 ? 42 LEU S HD13 1  
ATOM 546   H HD21 . LEU A 1 33 ? 1.276   1.630   -1.534  1.00 0.00 ? 42 LEU S HD21 1  
ATOM 547   H HD22 . LEU A 1 33 ? -0.324  1.874   -0.835  1.00 0.00 ? 42 LEU S HD22 1  
ATOM 548   H HD23 . LEU A 1 33 ? -0.034  2.271   -2.529  1.00 0.00 ? 42 LEU S HD23 1  
ATOM 549   N N    . THR A 1 34 ? -3.003  -2.350  -4.682  1.00 0.00 ? 43 THR S N    1  
ATOM 550   C CA   . THR A 1 34 ? -2.869  -3.579  -5.450  1.00 0.00 ? 43 THR S CA   1  
ATOM 551   C C    . THR A 1 34 ? -1.561  -3.598  -6.232  1.00 0.00 ? 43 THR S C    1  
ATOM 552   O O    . THR A 1 34 ? -0.990  -2.559  -6.534  1.00 0.00 ? 43 THR S O    1  
ATOM 553   C CB   . THR A 1 34 ? -4.052  -3.741  -6.412  1.00 0.00 ? 43 THR S CB   1  
ATOM 554   O OG1  . THR A 1 34 ? -4.770  -2.527  -6.537  1.00 0.00 ? 43 THR S OG1  1  
ATOM 555   C CG2  . THR A 1 34 ? -5.030  -4.812  -5.982  1.00 0.00 ? 43 THR S CG2  1  
ATOM 556   H H    . THR A 1 34 ? -3.717  -1.721  -4.914  1.00 0.00 ? 43 THR S H    1  
ATOM 557   H HA   . THR A 1 34 ? -2.869  -4.405  -4.755  1.00 0.00 ? 43 THR S HA   1  
ATOM 558   H HB   . THR A 1 34 ? -3.673  -4.012  -7.388  1.00 0.00 ? 43 THR S HB   1  
ATOM 559   H HG1  . THR A 1 34 ? -4.235  -1.884  -7.008  1.00 0.00 ? 43 THR S HG1  1  
ATOM 560   H HG21 . THR A 1 34 ? -6.027  -4.397  -5.948  1.00 0.00 ? 43 THR S HG21 1  
ATOM 561   H HG22 . THR A 1 34 ? -4.758  -5.176  -5.003  1.00 0.00 ? 43 THR S HG22 1  
ATOM 562   H HG23 . THR A 1 34 ? -5.003  -5.628  -6.689  1.00 0.00 ? 43 THR S HG23 1  
ATOM 563   N N    . ASP A 1 35 ? -1.111  -4.806  -6.547  1.00 0.00 ? 44 ASP S N    1  
ATOM 564   C CA   . ASP A 1 35 ? 0.126   -5.043  -7.292  1.00 0.00 ? 44 ASP S CA   1  
ATOM 565   C C    . ASP A 1 35 ? 0.386   -3.966  -8.338  1.00 0.00 ? 44 ASP S C    1  
ATOM 566   O O    . ASP A 1 35 ? 1.530   -3.609  -8.589  1.00 0.00 ? 44 ASP S O    1  
ATOM 567   C CB   . ASP A 1 35 ? 0.081   -6.419  -7.961  1.00 0.00 ? 44 ASP S CB   1  
ATOM 568   C CG   . ASP A 1 35 ? -0.972  -6.499  -9.052  1.00 0.00 ? 44 ASP S CG   1  
ATOM 569   O OD1  . ASP A 1 35 ? -2.158  -6.704  -8.719  1.00 0.00 ? 44 ASP S OD1  1  
ATOM 570   O OD2  . ASP A 1 35 ? -0.609  -6.355  -10.238 1.00 0.00 ? 44 ASP S OD2  1  
ATOM 571   H H    . ASP A 1 35 ? -1.628  -5.565  -6.263  1.00 0.00 ? 44 ASP S H    1  
ATOM 572   H HA   . ASP A 1 35 ? 0.940   -5.034  -6.582  1.00 0.00 ? 44 ASP S HA   1  
ATOM 573   H HB2  . ASP A 1 35 ? 1.045   -6.632  -8.401  1.00 0.00 ? 44 ASP S HB2  1  
ATOM 574   H HB3  . ASP A 1 35 ? -0.145  -7.168  -7.214  1.00 0.00 ? 44 ASP S HB3  1  
ATOM 575   N N    . GLU A 1 36 ? -0.673  -3.439  -8.936  1.00 0.00 ? 45 GLU S N    1  
ATOM 576   C CA   . GLU A 1 36 ? -0.518  -2.387  -9.930  1.00 0.00 ? 45 GLU S CA   1  
ATOM 577   C C    . GLU A 1 36 ? -0.017  -1.128  -9.244  1.00 0.00 ? 45 GLU S C    1  
ATOM 578   O O    . GLU A 1 36 ? 1.030   -0.582  -9.593  1.00 0.00 ? 45 GLU S O    1  
ATOM 579   C CB   . GLU A 1 36 ? -1.842  -2.105  -10.625 1.00 0.00 ? 45 GLU S CB   1  
ATOM 580   C CG   . GLU A 1 36 ? -2.282  -3.208  -11.576 1.00 0.00 ? 45 GLU S CG   1  
ATOM 581   C CD   . GLU A 1 36 ? -3.787  -3.253  -11.760 1.00 0.00 ? 45 GLU S CD   1  
ATOM 582   O OE1  . GLU A 1 36 ? -4.421  -2.177  -11.735 1.00 0.00 ? 45 GLU S OE1  1  
ATOM 583   O OE2  . GLU A 1 36 ? -4.330  -4.364  -11.929 1.00 0.00 ? 45 GLU S OE2  1  
ATOM 584   H H    . GLU A 1 36 ? -1.571  -3.749  -8.696  1.00 0.00 ? 45 GLU S H    1  
ATOM 585   H HA   . GLU A 1 36 ? 0.212   -2.712  -10.657 1.00 0.00 ? 45 GLU S HA   1  
ATOM 586   H HB2  . GLU A 1 36 ? -2.605  -1.980  -9.873  1.00 0.00 ? 45 GLU S HB2  1  
ATOM 587   H HB3  . GLU A 1 36 ? -1.747  -1.190  -11.186 1.00 0.00 ? 45 GLU S HB3  1  
ATOM 588   H HG2  . GLU A 1 36 ? -1.823  -3.040  -12.539 1.00 0.00 ? 45 GLU S HG2  1  
ATOM 589   H HG3  . GLU A 1 36 ? -1.953  -4.158  -11.182 1.00 0.00 ? 45 GLU S HG3  1  
ATOM 590   N N    . ASP A 1 37 ? -0.762  -0.700  -8.231  1.00 0.00 ? 46 ASP S N    1  
ATOM 591   C CA   . ASP A 1 37 ? -0.404  0.459   -7.441  1.00 0.00 ? 46 ASP S CA   1  
ATOM 592   C C    . ASP A 1 37 ? 0.872   0.152   -6.665  1.00 0.00 ? 46 ASP S C    1  
ATOM 593   O O    . ASP A 1 37 ? 1.708   1.022   -6.423  1.00 0.00 ? 46 ASP S O    1  
ATOM 594   C CB   . ASP A 1 37 ? -1.554  0.775   -6.484  1.00 0.00 ? 46 ASP S CB   1  
ATOM 595   C CG   . ASP A 1 37 ? -1.266  1.952   -5.571  1.00 0.00 ? 46 ASP S CG   1  
ATOM 596   O OD1  . ASP A 1 37 ? -0.086  2.343   -5.452  1.00 0.00 ? 46 ASP S OD1  1  
ATOM 597   O OD2  . ASP A 1 37 ? -2.225  2.486   -4.977  1.00 0.00 ? 46 ASP S OD2  1  
ATOM 598   H H    . ASP A 1 37 ? -1.567  -1.203  -7.986  1.00 0.00 ? 46 ASP S H    1  
ATOM 599   H HA   . ASP A 1 37 ? -0.237  1.296   -8.104  1.00 0.00 ? 46 ASP S HA   1  
ATOM 600   H HB2  . ASP A 1 37 ? -2.436  1.007   -7.064  1.00 0.00 ? 46 ASP S HB2  1  
ATOM 601   H HB3  . ASP A 1 37 ? -1.749  -0.107  -5.874  1.00 0.00 ? 46 ASP S HB3  1  
ATOM 602   N N    . PHE A 1 38 ? 1.000   -1.115  -6.295  1.00 0.00 ? 47 PHE S N    1  
ATOM 603   C CA   . PHE A 1 38 ? 2.145   -1.618  -5.559  1.00 0.00 ? 47 PHE S CA   1  
ATOM 604   C C    . PHE A 1 38 ? 3.386   -1.635  -6.443  1.00 0.00 ? 47 PHE S C    1  
ATOM 605   O O    . PHE A 1 38 ? 4.481   -1.284  -6.004  1.00 0.00 ? 47 PHE S O    1  
ATOM 606   C CB   . PHE A 1 38 ? 1.835   -3.035  -5.071  1.00 0.00 ? 47 PHE S CB   1  
ATOM 607   C CG   . PHE A 1 38 ? 2.054   -3.243  -3.605  1.00 0.00 ? 47 PHE S CG   1  
ATOM 608   C CD1  . PHE A 1 38 ? 3.173   -2.729  -2.972  1.00 0.00 ? 47 PHE S CD1  1  
ATOM 609   C CD2  . PHE A 1 38 ? 1.129   -3.949  -2.858  1.00 0.00 ? 47 PHE S CD2  1  
ATOM 610   C CE1  . PHE A 1 38 ? 3.364   -2.917  -1.617  1.00 0.00 ? 47 PHE S CE1  1  
ATOM 611   C CE2  . PHE A 1 38 ? 1.312   -4.139  -1.505  1.00 0.00 ? 47 PHE S CE2  1  
ATOM 612   C CZ   . PHE A 1 38 ? 2.430   -3.624  -0.883  1.00 0.00 ? 47 PHE S CZ   1  
ATOM 613   H H    . PHE A 1 38 ? 0.293   -1.747  -6.537  1.00 0.00 ? 47 PHE S H    1  
ATOM 614   H HA   . PHE A 1 38 ? 2.317   -0.975  -4.710  1.00 0.00 ? 47 PHE S HA   1  
ATOM 615   H HB2  . PHE A 1 38 ? 0.798   -3.253  -5.279  1.00 0.00 ? 47 PHE S HB2  1  
ATOM 616   H HB3  . PHE A 1 38 ? 2.456   -3.737  -5.605  1.00 0.00 ? 47 PHE S HB3  1  
ATOM 617   H HD1  . PHE A 1 38 ? 3.902   -2.177  -3.547  1.00 0.00 ? 47 PHE S HD1  1  
ATOM 618   H HD2  . PHE A 1 38 ? 0.257   -4.355  -3.345  1.00 0.00 ? 47 PHE S HD2  1  
ATOM 619   H HE1  . PHE A 1 38 ? 4.243   -2.518  -1.133  1.00 0.00 ? 47 PHE S HE1  1  
ATOM 620   H HE2  . PHE A 1 38 ? 0.582   -4.693  -0.936  1.00 0.00 ? 47 PHE S HE2  1  
ATOM 621   H HZ   . PHE A 1 38 ? 2.569   -3.767  0.175   1.00 0.00 ? 47 PHE S HZ   1  
ATOM 622   N N    . GLU A 1 39 ? 3.203   -2.057  -7.689  1.00 0.00 ? 48 GLU S N    1  
ATOM 623   C CA   . GLU A 1 39 ? 4.314   -2.134  -8.636  1.00 0.00 ? 48 GLU S CA   1  
ATOM 624   C C    . GLU A 1 39 ? 4.642   -0.766  -9.226  1.00 0.00 ? 48 GLU S C    1  
ATOM 625   O O    . GLU A 1 39 ? 5.767   -0.522  -9.661  1.00 0.00 ? 48 GLU S O    1  
ATOM 626   C CB   . GLU A 1 39 ? 3.993   -3.119  -9.762  1.00 0.00 ? 48 GLU S CB   1  
ATOM 627   C CG   . GLU A 1 39 ? 4.164   -4.576  -9.365  1.00 0.00 ? 48 GLU S CG   1  
ATOM 628   C CD   . GLU A 1 39 ? 4.639   -5.440  -10.517 1.00 0.00 ? 48 GLU S CD   1  
ATOM 629   O OE1  . GLU A 1 39 ? 4.143   -5.247  -11.647 1.00 0.00 ? 48 GLU S OE1  1  
ATOM 630   O OE2  . GLU A 1 39 ? 5.507   -6.309  -10.289 1.00 0.00 ? 48 GLU S OE2  1  
ATOM 631   H H    . GLU A 1 39 ? 2.296   -2.335  -7.978  1.00 0.00 ? 48 GLU S H    1  
ATOM 632   H HA   . GLU A 1 39 ? 5.179   -2.494  -8.098  1.00 0.00 ? 48 GLU S HA   1  
ATOM 633   H HB2  . GLU A 1 39 ? 2.971   -2.969  -10.076 1.00 0.00 ? 48 GLU S HB2  1  
ATOM 634   H HB3  . GLU A 1 39 ? 4.647   -2.917  -10.596 1.00 0.00 ? 48 GLU S HB3  1  
ATOM 635   H HG2  . GLU A 1 39 ? 4.893   -4.635  -8.568  1.00 0.00 ? 48 GLU S HG2  1  
ATOM 636   H HG3  . GLU A 1 39 ? 3.212   -4.957  -9.017  1.00 0.00 ? 48 GLU S HG3  1  
ATOM 637   N N    . PHE A 1 40 ? 3.657   0.122   -9.246  1.00 0.00 ? 49 PHE S N    1  
ATOM 638   C CA   . PHE A 1 40 ? 3.852   1.459   -9.794  1.00 0.00 ? 49 PHE S CA   1  
ATOM 639   C C    . PHE A 1 40 ? 4.434   2.410   -8.752  1.00 0.00 ? 49 PHE S C    1  
ATOM 640   O O    . PHE A 1 40 ? 5.238   3.282   -9.078  1.00 0.00 ? 49 PHE S O    1  
ATOM 641   C CB   . PHE A 1 40 ? 2.527   2.012   -10.319 1.00 0.00 ? 49 PHE S CB   1  
ATOM 642   C CG   . PHE A 1 40 ? 2.692   3.100   -11.341 1.00 0.00 ? 49 PHE S CG   1  
ATOM 643   C CD1  . PHE A 1 40 ? 2.846   2.792   -12.683 1.00 0.00 ? 49 PHE S CD1  1  
ATOM 644   C CD2  . PHE A 1 40 ? 2.694   4.433   -10.957 1.00 0.00 ? 49 PHE S CD2  1  
ATOM 645   C CE1  . PHE A 1 40 ? 2.998   3.793   -13.624 1.00 0.00 ? 49 PHE S CE1  1  
ATOM 646   C CE2  . PHE A 1 40 ? 2.845   5.437   -11.895 1.00 0.00 ? 49 PHE S CE2  1  
ATOM 647   C CZ   . PHE A 1 40 ? 2.998   5.116   -13.230 1.00 0.00 ? 49 PHE S CZ   1  
ATOM 648   H H    . PHE A 1 40 ? 2.779   -0.127  -8.892  1.00 0.00 ? 49 PHE S H    1  
ATOM 649   H HA   . PHE A 1 40 ? 4.547   1.379   -10.616 1.00 0.00 ? 49 PHE S HA   1  
ATOM 650   H HB2  . PHE A 1 40 ? 1.966   1.210   -10.778 1.00 0.00 ? 49 PHE S HB2  1  
ATOM 651   H HB3  . PHE A 1 40 ? 1.959   2.415   -9.491  1.00 0.00 ? 49 PHE S HB3  1  
ATOM 652   H HD1  . PHE A 1 40 ? 2.846   1.758   -12.993 1.00 0.00 ? 49 PHE S HD1  1  
ATOM 653   H HD2  . PHE A 1 40 ? 2.575   4.684   -9.915  1.00 0.00 ? 49 PHE S HD2  1  
ATOM 654   H HE1  . PHE A 1 40 ? 3.118   3.538   -14.667 1.00 0.00 ? 49 PHE S HE1  1  
ATOM 655   H HE2  . PHE A 1 40 ? 2.845   6.472   -11.585 1.00 0.00 ? 49 PHE S HE2  1  
ATOM 656   H HZ   . PHE A 1 40 ? 3.117   5.899   -13.965 1.00 0.00 ? 49 PHE S HZ   1  
ATOM 657   N N    . ALA A 1 41 ? 4.012   2.248   -7.503  1.00 0.00 ? 50 ALA S N    1  
ATOM 658   C CA   . ALA A 1 41 ? 4.483   3.109   -6.422  1.00 0.00 ? 50 ALA S CA   1  
ATOM 659   C C    . ALA A 1 41 ? 5.576   2.448   -5.584  1.00 0.00 ? 50 ALA S C    1  
ATOM 660   O O    . ALA A 1 41 ? 6.343   3.132   -4.906  1.00 0.00 ? 50 ALA S O    1  
ATOM 661   C CB   . ALA A 1 41 ? 3.316   3.515   -5.538  1.00 0.00 ? 50 ALA S CB   1  
ATOM 662   H H    . ALA A 1 41 ? 3.361   1.543   -7.303  1.00 0.00 ? 50 ALA S H    1  
ATOM 663   H HA   . ALA A 1 41 ? 4.886   4.005   -6.870  1.00 0.00 ? 50 ALA S HA   1  
ATOM 664   H HB1  . ALA A 1 41 ? 3.629   4.301   -4.866  1.00 0.00 ? 50 ALA S HB1  1  
ATOM 665   H HB2  . ALA A 1 41 ? 2.985   2.662   -4.962  1.00 0.00 ? 50 ALA S HB2  1  
ATOM 666   H HB3  . ALA A 1 41 ? 2.503   3.870   -6.153  1.00 0.00 ? 50 ALA S HB3  1  
ATOM 667   N N    . LEU A 1 42 ? 5.640   1.119   -5.609  1.00 0.00 ? 51 LEU S N    1  
ATOM 668   C CA   . LEU A 1 42 ? 6.638   0.399   -4.818  1.00 0.00 ? 51 LEU S CA   1  
ATOM 669   C C    . LEU A 1 42 ? 7.397   -0.648  -5.634  1.00 0.00 ? 51 LEU S C    1  
ATOM 670   O O    . LEU A 1 42 ? 8.392   -1.199  -5.164  1.00 0.00 ? 51 LEU S O    1  
ATOM 671   C CB   . LEU A 1 42 ? 5.968   -0.273  -3.623  1.00 0.00 ? 51 LEU S CB   1  
ATOM 672   C CG   . LEU A 1 42 ? 5.914   0.578   -2.358  1.00 0.00 ? 51 LEU S CG   1  
ATOM 673   C CD1  . LEU A 1 42 ? 4.925   -0.008  -1.363  1.00 0.00 ? 51 LEU S CD1  1  
ATOM 674   C CD2  . LEU A 1 42 ? 7.301   0.695   -1.748  1.00 0.00 ? 51 LEU S CD2  1  
ATOM 675   H H    . LEU A 1 42 ? 4.997   0.617   -6.150  1.00 0.00 ? 51 LEU S H    1  
ATOM 676   H HA   . LEU A 1 42 ? 7.347   1.124   -4.450  1.00 0.00 ? 51 LEU S HA   1  
ATOM 677   H HB2  . LEU A 1 42 ? 4.956   -0.532  -3.902  1.00 0.00 ? 51 LEU S HB2  1  
ATOM 678   H HB3  . LEU A 1 42 ? 6.505   -1.181  -3.396  1.00 0.00 ? 51 LEU S HB3  1  
ATOM 679   H HG   . LEU A 1 42 ? 5.580   1.571   -2.613  1.00 0.00 ? 51 LEU S HG   1  
ATOM 680   H HD11 . LEU A 1 42 ? 4.529   0.781   -0.740  1.00 0.00 ? 51 LEU S HD11 1  
ATOM 681   H HD12 . LEU A 1 42 ? 5.426   -0.738  -0.744  1.00 0.00 ? 51 LEU S HD12 1  
ATOM 682   H HD13 . LEU A 1 42 ? 4.117   -0.485  -1.897  1.00 0.00 ? 51 LEU S HD13 1  
ATOM 683   H HD21 . LEU A 1 42 ? 7.721   1.660   -1.988  1.00 0.00 ? 51 LEU S HD21 1  
ATOM 684   H HD22 . LEU A 1 42 ? 7.934   -0.082  -2.147  1.00 0.00 ? 51 LEU S HD22 1  
ATOM 685   H HD23 . LEU A 1 42 ? 7.235   0.589   -0.678  1.00 0.00 ? 51 LEU S HD23 1  
ATOM 686   N N    . ASP A 1 43 ? 6.930   -0.928  -6.844  1.00 0.00 ? 52 ASP S N    1  
ATOM 687   C CA   . ASP A 1 43 ? 7.576   -1.920  -7.698  1.00 0.00 ? 52 ASP S CA   1  
ATOM 688   C C    . ASP A 1 43 ? 7.525   -3.314  -7.074  1.00 0.00 ? 52 ASP S C    1  
ATOM 689   O O    . ASP A 1 43 ? 8.207   -4.230  -7.535  1.00 0.00 ? 52 ASP S O    1  
ATOM 690   C CB   . ASP A 1 43 ? 9.028   -1.524  -7.973  1.00 0.00 ? 52 ASP S CB   1  
ATOM 691   C CG   . ASP A 1 43 ? 9.135   -0.369  -8.951  1.00 0.00 ? 52 ASP S CG   1  
ATOM 692   O OD1  . ASP A 1 43 ? 8.449   -0.407  -9.994  1.00 0.00 ? 52 ASP S OD1  1  
ATOM 693   O OD2  . ASP A 1 43 ? 9.909   0.573   -8.675  1.00 0.00 ? 52 ASP S OD2  1  
ATOM 694   H H    . ASP A 1 43 ? 6.130   -0.467  -7.171  1.00 0.00 ? 52 ASP S H    1  
ATOM 695   H HA   . ASP A 1 43 ? 7.040   -1.944  -8.634  1.00 0.00 ? 52 ASP S HA   1  
ATOM 696   H HB2  . ASP A 1 43 ? 9.499   -1.227  -7.047  1.00 0.00 ? 52 ASP S HB2  1  
ATOM 697   H HB3  . ASP A 1 43 ? 9.555   -2.373  -8.387  1.00 0.00 ? 52 ASP S HB3  1  
ATOM 698   N N    . MET A 1 44 ? 6.701   -3.484  -6.040  1.00 0.00 ? 53 MET S N    1  
ATOM 699   C CA   . MET A 1 44 ? 6.558   -4.783  -5.386  1.00 0.00 ? 53 MET S CA   1  
ATOM 700   C C    . MET A 1 44 ? 5.082   -5.129  -5.246  1.00 0.00 ? 53 MET S C    1  
ATOM 701   O O    . MET A 1 44 ? 4.236   -4.429  -5.792  1.00 0.00 ? 53 MET S O    1  
ATOM 702   C CB   . MET A 1 44 ? 7.250   -4.788  -4.021  1.00 0.00 ? 53 MET S CB   1  
ATOM 703   C CG   . MET A 1 44 ? 8.357   -5.826  -3.921  1.00 0.00 ? 53 MET S CG   1  
ATOM 704   S SD   . MET A 1 44 ? 9.910   -5.256  -4.640  1.00 0.00 ? 53 MET S SD   1  
ATOM 705   C CE   . MET A 1 44 ? 10.089  -6.402  -6.005  1.00 0.00 ? 53 MET S CE   1  
ATOM 706   H H    . MET A 1 44 ? 6.165   -2.724  -5.717  1.00 0.00 ? 53 MET S H    1  
ATOM 707   H HA   . MET A 1 44 ? 7.027   -5.522  -6.020  1.00 0.00 ? 53 MET S HA   1  
ATOM 708   H HB2  . MET A 1 44 ? 7.678   -3.812  -3.842  1.00 0.00 ? 53 MET S HB2  1  
ATOM 709   H HB3  . MET A 1 44 ? 6.515   -5.001  -3.255  1.00 0.00 ? 53 MET S HB3  1  
ATOM 710   H HG2  . MET A 1 44 ? 8.523   -6.059  -2.882  1.00 0.00 ? 53 MET S HG2  1  
ATOM 711   H HG3  . MET A 1 44 ? 8.043   -6.718  -4.441  1.00 0.00 ? 53 MET S HG3  1  
ATOM 712   H HE1  . MET A 1 44 ? 10.857  -7.125  -5.771  1.00 0.00 ? 53 MET S HE1  1  
ATOM 713   H HE2  . MET A 1 44 ? 10.367  -5.858  -6.897  1.00 0.00 ? 53 MET S HE2  1  
ATOM 714   H HE3  . MET A 1 44 ? 9.153   -6.913  -6.173  1.00 0.00 ? 53 MET S HE3  1  
ATOM 715   N N    . THR A 1 45 ? 4.763   -6.205  -4.528  1.00 0.00 ? 54 THR S N    1  
ATOM 716   C CA   . THR A 1 45 ? 3.370   -6.595  -4.356  1.00 0.00 ? 54 THR S CA   1  
ATOM 717   C C    . THR A 1 45 ? 3.072   -6.922  -2.901  1.00 0.00 ? 54 THR S C    1  
ATOM 718   O O    . THR A 1 45 ? 3.973   -7.256  -2.132  1.00 0.00 ? 54 THR S O    1  
ATOM 719   C CB   . THR A 1 45 ? 3.030   -7.779  -5.267  1.00 0.00 ? 54 THR S CB   1  
ATOM 720   O OG1  . THR A 1 45 ? 1.659   -8.124  -5.158  1.00 0.00 ? 54 THR S OG1  1  
ATOM 721   C CG2  . THR A 1 45 ? 3.842   -9.020  -4.977  1.00 0.00 ? 54 THR S CG2  1  
ATOM 722   H H    . THR A 1 45 ? 5.469   -6.742  -4.099  1.00 0.00 ? 54 THR S H    1  
ATOM 723   H HA   . THR A 1 45 ? 2.761   -5.751  -4.647  1.00 0.00 ? 54 THR S HA   1  
ATOM 724   H HB   . THR A 1 45 ? 3.222   -7.493  -6.291  1.00 0.00 ? 54 THR S HB   1  
ATOM 725   H HG1  . THR A 1 45 ? 1.455   -8.344  -4.249  1.00 0.00 ? 54 THR S HG1  1  
ATOM 726   H HG21 . THR A 1 45 ? 3.366   -9.876  -5.431  1.00 0.00 ? 54 THR S HG21 1  
ATOM 727   H HG22 . THR A 1 45 ? 3.905   -9.169  -3.911  1.00 0.00 ? 54 THR S HG22 1  
ATOM 728   H HG23 . THR A 1 45 ? 4.836   -8.902  -5.384  1.00 0.00 ? 54 THR S HG23 1  
ATOM 729   N N    . ARG A 1 46 ? 1.801   -6.826  -2.527  1.00 0.00 ? 55 ARG S N    1  
ATOM 730   C CA   . ARG A 1 46 ? 1.386   -7.117  -1.159  1.00 0.00 ? 55 ARG S CA   1  
ATOM 731   C C    . ARG A 1 46 ? 1.903   -8.480  -0.706  1.00 0.00 ? 55 ARG S C    1  
ATOM 732   O O    . ARG A 1 46 ? 2.097   -8.712  0.483   1.00 0.00 ? 55 ARG S O    1  
ATOM 733   C CB   . ARG A 1 46 ? -0.140  -7.073  -1.050  1.00 0.00 ? 55 ARG S CB   1  
ATOM 734   C CG   . ARG A 1 46 ? -0.639  -6.510  0.270   1.00 0.00 ? 55 ARG S CG   1  
ATOM 735   C CD   . ARG A 1 46 ? -1.444  -7.538  1.049   1.00 0.00 ? 55 ARG S CD   1  
ATOM 736   N NE   . ARG A 1 46 ? -1.423  -7.275  2.486   1.00 0.00 ? 55 ARG S NE   1  
ATOM 737   C CZ   . ARG A 1 46 ? -2.074  -8.013  3.383   1.00 0.00 ? 55 ARG S CZ   1  
ATOM 738   N NH1  . ARG A 1 46 ? -2.795  -9.058  2.996   1.00 0.00 ? 55 ARG S NH1  1  
ATOM 739   N NH2  . ARG A 1 46 ? -2.002  -7.706  4.672   1.00 0.00 ? 55 ARG S NH2  1  
ATOM 740   H H    . ARG A 1 46 ? 1.127   -6.557  -3.185  1.00 0.00 ? 55 ARG S H    1  
ATOM 741   H HA   . ARG A 1 46 ? 1.805   -6.356  -0.517  1.00 0.00 ? 55 ARG S HA   1  
ATOM 742   H HB2  . ARG A 1 46 ? -0.529  -6.459  -1.850  1.00 0.00 ? 55 ARG S HB2  1  
ATOM 743   H HB3  . ARG A 1 46 ? -0.524  -8.079  -1.158  1.00 0.00 ? 55 ARG S HB3  1  
ATOM 744   H HG2  . ARG A 1 46 ? 0.209   -6.205  0.866   1.00 0.00 ? 55 ARG S HG2  1  
ATOM 745   H HG3  . ARG A 1 46 ? -1.265  -5.653  0.070   1.00 0.00 ? 55 ARG S HG3  1  
ATOM 746   H HD2  . ARG A 1 46 ? -2.467  -7.513  0.704   1.00 0.00 ? 55 ARG S HD2  1  
ATOM 747   H HD3  . ARG A 1 46 ? -1.026  -8.517  0.866   1.00 0.00 ? 55 ARG S HD3  1  
ATOM 748   H HE   . ARG A 1 46 ? -0.899  -6.509  2.799   1.00 0.00 ? 55 ARG S HE   1  
ATOM 749   H HH11 . ARG A 1 46 ? -2.852  -9.297  2.027   1.00 0.00 ? 55 ARG S HH11 1  
ATOM 750   H HH12 . ARG A 1 46 ? -3.280  -9.610  3.676   1.00 0.00 ? 55 ARG S HH12 1  
ATOM 751   H HH21 . ARG A 1 46 ? -1.460  -6.920  4.968   1.00 0.00 ? 55 ARG S HH21 1  
ATOM 752   H HH22 . ARG A 1 46 ? -2.490  -8.260  5.345   1.00 0.00 ? 55 ARG S HH22 1  
ATOM 753   N N    . ASP A 1 47 ? 2.116   -9.375  -1.667  1.00 0.00 ? 56 ASP S N    1  
ATOM 754   C CA   . ASP A 1 47 ? 2.605   -10.720 -1.378  1.00 0.00 ? 56 ASP S CA   1  
ATOM 755   C C    . ASP A 1 47 ? 4.134   -10.784 -1.382  1.00 0.00 ? 56 ASP S C    1  
ATOM 756   O O    . ASP A 1 47 ? 4.716   -11.792 -0.983  1.00 0.00 ? 56 ASP S O    1  
ATOM 757   C CB   . ASP A 1 47 ? 2.044   -11.712 -2.398  1.00 0.00 ? 56 ASP S CB   1  
ATOM 758   C CG   . ASP A 1 47 ? 0.540   -11.863 -2.291  1.00 0.00 ? 56 ASP S CG   1  
ATOM 759   O OD1  . ASP A 1 47 ? 0.057   -12.241 -1.203  1.00 0.00 ? 56 ASP S OD1  1  
ATOM 760   O OD2  . ASP A 1 47 ? -0.155  -11.604 -3.296  1.00 0.00 ? 56 ASP S OD2  1  
ATOM 761   H H    . ASP A 1 47 ? 1.939   -9.125  -2.598  1.00 0.00 ? 56 ASP S H    1  
ATOM 762   H HA   . ASP A 1 47 ? 2.251   -10.993 -0.397  1.00 0.00 ? 56 ASP S HA   1  
ATOM 763   H HB2  . ASP A 1 47 ? 2.283   -11.370 -3.393  1.00 0.00 ? 56 ASP S HB2  1  
ATOM 764   H HB3  . ASP A 1 47 ? 2.498   -12.679 -2.236  1.00 0.00 ? 56 ASP S HB3  1  
ATOM 765   N N    . GLU A 1 48 ? 4.782   -9.709  -1.823  1.00 0.00 ? 57 GLU S N    1  
ATOM 766   C CA   . GLU A 1 48 ? 6.237   -9.660  -1.858  1.00 0.00 ? 57 GLU S CA   1  
ATOM 767   C C    . GLU A 1 48 ? 6.733   -8.983  -0.602  1.00 0.00 ? 57 GLU S C    1  
ATOM 768   O O    . GLU A 1 48 ? 7.512   -9.543  0.168   1.00 0.00 ? 57 GLU S O    1  
ATOM 769   C CB   . GLU A 1 48 ? 6.721   -8.897  -3.092  1.00 0.00 ? 57 GLU S CB   1  
ATOM 770   C CG   . GLU A 1 48 ? 8.176   -9.170  -3.441  1.00 0.00 ? 57 GLU S CG   1  
ATOM 771   C CD   . GLU A 1 48 ? 8.465   -10.649 -3.613  1.00 0.00 ? 57 GLU S CD   1  
ATOM 772   O OE1  . GLU A 1 48 ? 7.594   -11.367 -4.148  1.00 0.00 ? 57 GLU S OE1  1  
ATOM 773   O OE2  . GLU A 1 48 ? 9.563   -11.088 -3.213  1.00 0.00 ? 57 GLU S OE2  1  
ATOM 774   H H    . GLU A 1 48 ? 4.275   -8.919  -2.109  1.00 0.00 ? 57 GLU S H    1  
ATOM 775   H HA   . GLU A 1 48 ? 6.610   -10.673 -1.889  1.00 0.00 ? 57 GLU S HA   1  
ATOM 776   H HB2  . GLU A 1 48 ? 6.112   -9.180  -3.938  1.00 0.00 ? 57 GLU S HB2  1  
ATOM 777   H HB3  . GLU A 1 48 ? 6.609   -7.835  -2.912  1.00 0.00 ? 57 GLU S HB3  1  
ATOM 778   H HG2  . GLU A 1 48 ? 8.412   -8.664  -4.366  1.00 0.00 ? 57 GLU S HG2  1  
ATOM 779   H HG3  . GLU A 1 48 ? 8.801   -8.785  -2.650  1.00 0.00 ? 57 GLU S HG3  1  
ATOM 780   N N    . TYR A 1 49 ? 6.236   -7.775  -0.397  1.00 0.00 ? 58 TYR S N    1  
ATOM 781   C CA   . TYR A 1 49 ? 6.572   -6.994  0.771   1.00 0.00 ? 58 TYR S CA   1  
ATOM 782   C C    . TYR A 1 49 ? 6.080   -7.710  2.019   1.00 0.00 ? 58 TYR S C    1  
ATOM 783   O O    . TYR A 1 49 ? 6.662   -7.581  3.096   1.00 0.00 ? 58 TYR S O    1  
ATOM 784   C CB   . TYR A 1 49 ? 5.924   -5.620  0.657   1.00 0.00 ? 58 TYR S CB   1  
ATOM 785   C CG   . TYR A 1 49 ? 6.807   -4.592  -0.013  1.00 0.00 ? 58 TYR S CG   1  
ATOM 786   C CD1  . TYR A 1 49 ? 7.861   -4.983  -0.830  1.00 0.00 ? 58 TYR S CD1  1  
ATOM 787   C CD2  . TYR A 1 49 ? 6.592   -3.233  0.174   1.00 0.00 ? 58 TYR S CD2  1  
ATOM 788   C CE1  . TYR A 1 49 ? 8.674   -4.052  -1.441  1.00 0.00 ? 58 TYR S CE1  1  
ATOM 789   C CE2  . TYR A 1 49 ? 7.404   -2.295  -0.435  1.00 0.00 ? 58 TYR S CE2  1  
ATOM 790   C CZ   . TYR A 1 49 ? 8.444   -2.710  -1.241  1.00 0.00 ? 58 TYR S CZ   1  
ATOM 791   O OH   . TYR A 1 49 ? 9.254   -1.782  -1.849  1.00 0.00 ? 58 TYR S OH   1  
ATOM 792   H H    . TYR A 1 49 ? 5.601   -7.408  -1.047  1.00 0.00 ? 58 TYR S H    1  
ATOM 793   H HA   . TYR A 1 49 ? 7.645   -6.886  0.817   1.00 0.00 ? 58 TYR S HA   1  
ATOM 794   H HB2  . TYR A 1 49 ? 5.019   -5.709  0.072   1.00 0.00 ? 58 TYR S HB2  1  
ATOM 795   H HB3  . TYR A 1 49 ? 5.675   -5.267  1.640   1.00 0.00 ? 58 TYR S HB3  1  
ATOM 796   H HD1  . TYR A 1 49 ? 8.039   -6.037  -0.985  1.00 0.00 ? 58 TYR S HD1  1  
ATOM 797   H HD2  . TYR A 1 49 ? 5.776   -2.910  0.805   1.00 0.00 ? 58 TYR S HD2  1  
ATOM 798   H HE1  . TYR A 1 49 ? 9.488   -4.377  -2.072  1.00 0.00 ? 58 TYR S HE1  1  
ATOM 799   H HE2  . TYR A 1 49 ? 7.225   -1.245  -0.273  1.00 0.00 ? 58 TYR S HE2  1  
ATOM 800   H HH   . TYR A 1 49 ? 8.983   -1.667  -2.762  1.00 0.00 ? 58 TYR S HH   1  
ATOM 801   N N    . ASN A 1 50 ? 5.003   -8.471  1.861   1.00 0.00 ? 59 ASN S N    1  
ATOM 802   C CA   . ASN A 1 50 ? 4.428   -9.219  2.982   1.00 0.00 ? 59 ASN S CA   1  
ATOM 803   C C    . ASN A 1 50 ? 5.487   -10.070 3.683   1.00 0.00 ? 59 ASN S C    1  
ATOM 804   O O    . ASN A 1 50 ? 5.374   -10.360 4.873   1.00 0.00 ? 59 ASN S O    1  
ATOM 805   C CB   . ASN A 1 50 ? 3.287   -10.119 2.502   1.00 0.00 ? 59 ASN S CB   1  
ATOM 806   C CG   . ASN A 1 50 ? 1.934   -9.652  3.006   1.00 0.00 ? 59 ASN S CG   1  
ATOM 807   O OD1  . ASN A 1 50 ? 1.845   -8.904  3.979   1.00 0.00 ? 59 ASN S OD1  1  
ATOM 808   N ND2  . ASN A 1 50 ? 0.872   -10.095 2.344   1.00 0.00 ? 59 ASN S ND2  1  
ATOM 809   H H    . ASN A 1 50 ? 4.584   -8.530  0.967   1.00 0.00 ? 59 ASN S H    1  
ATOM 810   H HA   . ASN A 1 50 ? 4.036   -8.503  3.689   1.00 0.00 ? 59 ASN S HA   1  
ATOM 811   H HB2  . ASN A 1 50 ? 3.270   -10.126 1.424   1.00 0.00 ? 59 ASN S HB2  1  
ATOM 812   H HB3  . ASN A 1 50 ? 3.454   -11.124 2.860   1.00 0.00 ? 59 ASN S HB3  1  
ATOM 813   H HD21 . ASN A 1 50 ? 1.017   -10.688 1.578   1.00 0.00 ? 59 ASN S HD21 1  
ATOM 814   H HD22 . ASN A 1 50 ? -0.015  -9.809  2.648   1.00 0.00 ? 59 ASN S HD22 1  
ATOM 815   N N    . ALA A 1 51 ? 6.509   -10.480 2.935   1.00 0.00 ? 60 ALA S N    1  
ATOM 816   C CA   . ALA A 1 51 ? 7.574   -11.309 3.490   1.00 0.00 ? 60 ALA S CA   1  
ATOM 817   C C    . ALA A 1 51 ? 8.851   -10.506 3.717   1.00 0.00 ? 60 ALA S C    1  
ATOM 818   O O    . ALA A 1 51 ? 9.589   -10.755 4.670   1.00 0.00 ? 60 ALA S O    1  
ATOM 819   C CB   . ALA A 1 51 ? 7.850   -12.490 2.572   1.00 0.00 ? 60 ALA S CB   1  
ATOM 820   H H    . ALA A 1 51 ? 6.543   -10.224 1.990   1.00 0.00 ? 60 ALA S H    1  
ATOM 821   H HA   . ALA A 1 51 ? 7.233   -11.696 4.439   1.00 0.00 ? 60 ALA S HA   1  
ATOM 822   H HB1  . ALA A 1 51 ? 7.615   -12.217 1.554   1.00 0.00 ? 60 ALA S HB1  1  
ATOM 823   H HB2  . ALA A 1 51 ? 7.240   -13.329 2.872   1.00 0.00 ? 60 ALA S HB2  1  
ATOM 824   H HB3  . ALA A 1 51 ? 8.895   -12.761 2.640   1.00 0.00 ? 60 ALA S HB3  1  
ATOM 825   N N    . LEU A 1 52 ? 9.109   -9.545  2.838   1.00 0.00 ? 61 LEU S N    1  
ATOM 826   C CA   . LEU A 1 52 ? 10.302  -8.713  2.947   1.00 0.00 ? 61 LEU S CA   1  
ATOM 827   C C    . LEU A 1 52 ? 10.303  -7.939  4.263   1.00 0.00 ? 61 LEU S C    1  
ATOM 828   O O    . LEU A 1 52 ? 9.262   -7.790  4.903   1.00 0.00 ? 61 LEU S O    1  
ATOM 829   C CB   . LEU A 1 52 ? 10.378  -7.742  1.767   1.00 0.00 ? 61 LEU S CB   1  
ATOM 830   C CG   . LEU A 1 52 ? 11.260  -8.206  0.605   1.00 0.00 ? 61 LEU S CG   1  
ATOM 831   C CD1  . LEU A 1 52 ? 10.595  -7.899  -0.728  1.00 0.00 ? 61 LEU S CD1  1  
ATOM 832   C CD2  . LEU A 1 52 ? 12.632  -7.551  0.681   1.00 0.00 ? 61 LEU S CD2  1  
ATOM 833   H H    . LEU A 1 52 ? 8.486   -9.394  2.097   1.00 0.00 ? 61 LEU S H    1  
ATOM 834   H HA   . LEU A 1 52 ? 11.164  -9.363  2.924   1.00 0.00 ? 61 LEU S HA   1  
ATOM 835   H HB2  . LEU A 1 52 ? 9.375   -7.590  1.393   1.00 0.00 ? 61 LEU S HB2  1  
ATOM 836   H HB3  . LEU A 1 52 ? 10.759  -6.796  2.127   1.00 0.00 ? 61 LEU S HB3  1  
ATOM 837   H HG   . LEU A 1 52 ? 11.396  -9.276  0.670   1.00 0.00 ? 61 LEU S HG   1  
ATOM 838   H HD11 . LEU A 1 52 ? 9.526   -7.826  -0.590  1.00 0.00 ? 61 LEU S HD11 1  
ATOM 839   H HD12 . LEU A 1 52 ? 10.814  -8.690  -1.431  1.00 0.00 ? 61 LEU S HD12 1  
ATOM 840   H HD13 . LEU A 1 52 ? 10.973  -6.962  -1.113  1.00 0.00 ? 61 LEU S HD13 1  
ATOM 841   H HD21 . LEU A 1 52 ? 12.518  -6.506  0.923   1.00 0.00 ? 61 LEU S HD21 1  
ATOM 842   H HD22 . LEU A 1 52 ? 13.130  -7.648  -0.272  1.00 0.00 ? 61 LEU S HD22 1  
ATOM 843   H HD23 . LEU A 1 52 ? 13.219  -8.037  1.445   1.00 0.00 ? 61 LEU S HD23 1  
ATOM 844   N N    . PRO A 1 53 ? 11.475  -7.433  4.687   1.00 0.00 ? 62 PRO S N    1  
ATOM 845   C CA   . PRO A 1 53 ? 11.593  -6.671  5.933   1.00 0.00 ? 62 PRO S CA   1  
ATOM 846   C C    . PRO A 1 53 ? 10.574  -5.543  6.009   1.00 0.00 ? 62 PRO S C    1  
ATOM 847   O O    . PRO A 1 53 ? 9.943   -5.200  5.011   1.00 0.00 ? 62 PRO S O    1  
ATOM 848   C CB   . PRO A 1 53 ? 13.011  -6.101  5.877   1.00 0.00 ? 62 PRO S CB   1  
ATOM 849   C CG   . PRO A 1 53 ? 13.764  -7.020  4.978   1.00 0.00 ? 62 PRO S CG   1  
ATOM 850   C CD   . PRO A 1 53 ? 12.767  -7.557  3.986   1.00 0.00 ? 62 PRO S CD   1  
ATOM 851   H HA   . PRO A 1 53 ? 11.490  -7.308  6.799   1.00 0.00 ? 62 PRO S HA   1  
ATOM 852   H HB2  . PRO A 1 53 ? 12.980  -5.096  5.481   1.00 0.00 ? 62 PRO S HB2  1  
ATOM 853   H HB3  . PRO A 1 53 ? 13.435  -6.090  6.872   1.00 0.00 ? 62 PRO S HB3  1  
ATOM 854   H HG2  . PRO A 1 53 ? 14.542  -6.472  4.465   1.00 0.00 ? 62 PRO S HG2  1  
ATOM 855   H HG3  . PRO A 1 53 ? 14.192  -7.828  5.555   1.00 0.00 ? 62 PRO S HG3  1  
ATOM 856   H HD2  . PRO A 1 53 ? 12.774  -6.961  3.086   1.00 0.00 ? 62 PRO S HD2  1  
ATOM 857   H HD3  . PRO A 1 53 ? 12.982  -8.592  3.758   1.00 0.00 ? 62 PRO S HD3  1  
ATOM 858   N N    . ALA A 1 54 ? 10.416  -4.973  7.197   1.00 0.00 ? 63 ALA S N    1  
ATOM 859   C CA   . ALA A 1 54 ? 9.470   -3.882  7.400   1.00 0.00 ? 63 ALA S CA   1  
ATOM 860   C C    . ALA A 1 54 ? 10.112  -2.526  7.120   1.00 0.00 ? 63 ALA S C    1  
ATOM 861   O O    . ALA A 1 54 ? 9.425   -1.559  6.794   1.00 0.00 ? 63 ALA S O    1  
ATOM 862   C CB   . ALA A 1 54 ? 8.919   -3.921  8.818   1.00 0.00 ? 63 ALA S CB   1  
ATOM 863   H H    . ALA A 1 54 ? 10.948  -5.291  7.956   1.00 0.00 ? 63 ALA S H    1  
ATOM 864   H HA   . ALA A 1 54 ? 8.647   -4.026  6.716   1.00 0.00 ? 63 ALA S HA   1  
ATOM 865   H HB1  . ALA A 1 54 ? 9.737   -3.900  9.522   1.00 0.00 ? 63 ALA S HB1  1  
ATOM 866   H HB2  . ALA A 1 54 ? 8.348   -4.828  8.956   1.00 0.00 ? 63 ALA S HB2  1  
ATOM 867   H HB3  . ALA A 1 54 ? 8.281   -3.065  8.979   1.00 0.00 ? 63 ALA S HB3  1  
ATOM 868   N N    . TRP A 1 55 ? 11.434  -2.463  7.231   1.00 0.00 ? 64 TRP S N    1  
ATOM 869   C CA   . TRP A 1 55 ? 12.162  -1.242  6.984   1.00 0.00 ? 64 TRP S CA   1  
ATOM 870   C C    . TRP A 1 55 ? 12.554  -1.182  5.516   1.00 0.00 ? 64 TRP S C    1  
ATOM 871   O O    . TRP A 1 55 ? 12.400  -0.155  4.870   1.00 0.00 ? 64 TRP S O    1  
ATOM 872   C CB   . TRP A 1 55 ? 13.407  -1.178  7.880   1.00 0.00 ? 64 TRP S CB   1  
ATOM 873   C CG   . TRP A 1 55 ? 14.670  -1.390  7.113   1.00 0.00 ? 64 TRP S CG   1  
ATOM 874   C CD1  . TRP A 1 55 ? 15.489  -2.477  7.147   1.00 0.00 ? 64 TRP S CD1  1  
ATOM 875   C CD2  . TRP A 1 55 ? 15.222  -0.494  6.153   1.00 0.00 ? 64 TRP S CD2  1  
ATOM 876   N NE1  . TRP A 1 55 ? 16.532  -2.305  6.265   1.00 0.00 ? 64 TRP S NE1  1  
ATOM 877   C CE2  . TRP A 1 55 ? 16.386  -1.090  5.642   1.00 0.00 ? 64 TRP S CE2  1  
ATOM 878   C CE3  . TRP A 1 55 ? 14.835  0.760   5.685   1.00 0.00 ? 64 TRP S CE3  1  
ATOM 879   C CZ2  . TRP A 1 55 ? 17.167  -0.466  4.673   1.00 0.00 ? 64 TRP S CZ2  1  
ATOM 880   C CZ3  . TRP A 1 55 ? 15.605  1.374   4.725   1.00 0.00 ? 64 TRP S CZ3  1  
ATOM 881   C CH2  . TRP A 1 55 ? 16.756  0.763   4.227   1.00 0.00 ? 64 TRP S CH2  1  
ATOM 882   H H    . TRP A 1 55 ? 11.936  -3.257  7.464   1.00 0.00 ? 64 TRP S H    1  
ATOM 883   H HA   . TRP A 1 55 ? 11.512  -0.410  7.212   1.00 0.00 ? 64 TRP S HA   1  
ATOM 884   H HB2  . TRP A 1 55 ? 13.458  -0.206  8.350   1.00 0.00 ? 64 TRP S HB2  1  
ATOM 885   H HB3  . TRP A 1 55 ? 13.340  -1.947  8.638   1.00 0.00 ? 64 TRP S HB3  1  
ATOM 886   H HD1  . TRP A 1 55 ? 15.326  -3.336  7.782   1.00 0.00 ? 64 TRP S HD1  1  
ATOM 887   H HE1  . TRP A 1 55 ? 17.256  -2.946  6.107   1.00 0.00 ? 64 TRP S HE1  1  
ATOM 888   H HE3  . TRP A 1 55 ? 13.947  1.248   6.059   1.00 0.00 ? 64 TRP S HE3  1  
ATOM 889   H HZ2  . TRP A 1 55 ? 18.061  -0.923  4.274   1.00 0.00 ? 64 TRP S HZ2  1  
ATOM 890   H HZ3  . TRP A 1 55 ? 15.320  2.343   4.347   1.00 0.00 ? 64 TRP S HZ3  1  
ATOM 891   H HH2  . TRP A 1 55 ? 17.316  1.280   3.471   1.00 0.00 ? 64 TRP S HH2  1  
ATOM 892   N N    . LYS A 1 56 ? 13.062  -2.301  5.000   1.00 0.00 ? 65 LYS S N    1  
ATOM 893   C CA   . LYS A 1 56 ? 13.473  -2.377  3.607   1.00 0.00 ? 65 LYS S CA   1  
ATOM 894   C C    . LYS A 1 56 ? 12.273  -2.128  2.717   1.00 0.00 ? 65 LYS S C    1  
ATOM 895   O O    . LYS A 1 56 ? 12.346  -1.364  1.754   1.00 0.00 ? 65 LYS S O    1  
ATOM 896   C CB   . LYS A 1 56 ? 14.102  -3.738  3.297   1.00 0.00 ? 65 LYS S CB   1  
ATOM 897   C CG   . LYS A 1 56 ? 15.502  -3.635  2.711   1.00 0.00 ? 65 LYS S CG   1  
ATOM 898   C CD   . LYS A 1 56 ? 16.492  -4.500  3.475   1.00 0.00 ? 65 LYS S CD   1  
ATOM 899   C CE   . LYS A 1 56 ? 17.859  -3.841  3.556   1.00 0.00 ? 65 LYS S CE   1  
ATOM 900   N NZ   . LYS A 1 56 ? 18.806  -4.628  4.394   1.00 0.00 ? 65 LYS S NZ   1  
ATOM 901   H H    . LYS A 1 56 ? 13.158  -3.092  5.569   1.00 0.00 ? 65 LYS S H    1  
ATOM 902   H HA   . LYS A 1 56 ? 14.204  -1.600  3.434   1.00 0.00 ? 65 LYS S HA   1  
ATOM 903   H HB2  . LYS A 1 56 ? 14.159  -4.313  4.212   1.00 0.00 ? 65 LYS S HB2  1  
ATOM 904   H HB3  . LYS A 1 56 ? 13.474  -4.261  2.585   1.00 0.00 ? 65 LYS S HB3  1  
ATOM 905   H HG2  . LYS A 1 56 ? 15.475  -3.963  1.681   1.00 0.00 ? 65 LYS S HG2  1  
ATOM 906   H HG3  . LYS A 1 56 ? 15.825  -2.604  2.758   1.00 0.00 ? 65 LYS S HG3  1  
ATOM 907   H HD2  . LYS A 1 56 ? 16.120  -4.657  4.477   1.00 0.00 ? 65 LYS S HD2  1  
ATOM 908   H HD3  . LYS A 1 56 ? 16.589  -5.451  2.972   1.00 0.00 ? 65 LYS S HD3  1  
ATOM 909   H HE2  . LYS A 1 56 ? 18.263  -3.754  2.559   1.00 0.00 ? 65 LYS S HE2  1  
ATOM 910   H HE3  . LYS A 1 56 ? 17.746  -2.857  3.984   1.00 0.00 ? 65 LYS S HE3  1  
ATOM 911   H HZ1  . LYS A 1 56 ? 19.767  -4.238  4.309   1.00 0.00 ? 65 LYS S HZ1  1  
ATOM 912   H HZ2  . LYS A 1 56 ? 18.817  -5.621  4.083   1.00 0.00 ? 65 LYS S HZ2  1  
ATOM 913   H HZ3  . LYS A 1 56 ? 18.518  -4.590  5.391   1.00 0.00 ? 65 LYS S HZ3  1  
ATOM 914   N N    . GLN A 1 57 ? 11.149  -2.747  3.068   1.00 0.00 ? 66 GLN S N    1  
ATOM 915   C CA   . GLN A 1 57 ? 9.927   -2.549  2.316   1.00 0.00 ? 66 GLN S CA   1  
ATOM 916   C C    . GLN A 1 57 ? 9.562   -1.075  2.382   1.00 0.00 ? 66 GLN S C    1  
ATOM 917   O O    . GLN A 1 57 ? 9.204   -0.464  1.374   1.00 0.00 ? 66 GLN S O    1  
ATOM 918   C CB   . GLN A 1 57 ? 8.795   -3.424  2.861   1.00 0.00 ? 66 GLN S CB   1  
ATOM 919   C CG   . GLN A 1 57 ? 8.358   -3.065  4.271   1.00 0.00 ? 66 GLN S CG   1  
ATOM 920   C CD   . GLN A 1 57 ? 7.159   -3.873  4.739   1.00 0.00 ? 66 GLN S CD   1  
ATOM 921   O OE1  . GLN A 1 57 ? 6.306   -3.367  5.469   1.00 0.00 ? 66 GLN S OE1  1  
ATOM 922   N NE2  . GLN A 1 57 ? 7.084   -5.136  4.322   1.00 0.00 ? 66 GLN S NE2  1  
ATOM 923   H H    . GLN A 1 57 ? 11.141  -3.322  3.862   1.00 0.00 ? 66 GLN S H    1  
ATOM 924   H HA   . GLN A 1 57 ? 10.125  -2.816  1.289   1.00 0.00 ? 66 GLN S HA   1  
ATOM 925   H HB2  . GLN A 1 57 ? 7.940   -3.332  2.211   1.00 0.00 ? 66 GLN S HB2  1  
ATOM 926   H HB3  . GLN A 1 57 ? 9.126   -4.452  2.860   1.00 0.00 ? 66 GLN S HB3  1  
ATOM 927   H HG2  . GLN A 1 57 ? 9.180   -3.246  4.947   1.00 0.00 ? 66 GLN S HG2  1  
ATOM 928   H HG3  . GLN A 1 57 ? 8.098   -2.019  4.297   1.00 0.00 ? 66 GLN S HG3  1  
ATOM 929   H HE21 . GLN A 1 57 ? 7.792   -5.479  3.742   1.00 0.00 ? 66 GLN S HE21 1  
ATOM 930   H HE22 . GLN A 1 57 ? 6.318   -5.672  4.614   1.00 0.00 ? 66 GLN S HE22 1  
ATOM 931   N N    . VAL A 1 58 ? 9.708   -0.496  3.574   1.00 0.00 ? 67 VAL S N    1  
ATOM 932   C CA   . VAL A 1 58 ? 9.445   0.918   3.762   1.00 0.00 ? 67 VAL S CA   1  
ATOM 933   C C    . VAL A 1 58 ? 10.474  1.727   2.980   1.00 0.00 ? 67 VAL S C    1  
ATOM 934   O O    . VAL A 1 58 ? 10.137  2.725   2.345   1.00 0.00 ? 67 VAL S O    1  
ATOM 935   C CB   . VAL A 1 58 ? 9.487   1.320   5.254   1.00 0.00 ? 67 VAL S CB   1  
ATOM 936   C CG1  . VAL A 1 58 ? 9.541   2.834   5.416   1.00 0.00 ? 67 VAL S CG1  1  
ATOM 937   C CG2  . VAL A 1 58 ? 8.283   0.750   5.990   1.00 0.00 ? 67 VAL S CG2  1  
ATOM 938   H H    . VAL A 1 58 ? 10.031  -1.031  4.335   1.00 0.00 ? 67 VAL S H    1  
ATOM 939   H HA   . VAL A 1 58 ? 8.459   1.132   3.374   1.00 0.00 ? 67 VAL S HA   1  
ATOM 940   H HB   . VAL A 1 58 ? 10.381  0.902   5.694   1.00 0.00 ? 67 VAL S HB   1  
ATOM 941   H HG11 . VAL A 1 58 ? 10.561  3.172   5.311   1.00 0.00 ? 67 VAL S HG11 1  
ATOM 942   H HG12 . VAL A 1 58 ? 9.171   3.105   6.393   1.00 0.00 ? 67 VAL S HG12 1  
ATOM 943   H HG13 . VAL A 1 58 ? 8.929   3.298   4.657   1.00 0.00 ? 67 VAL S HG13 1  
ATOM 944   H HG21 . VAL A 1 58 ? 7.427   1.384   5.824   1.00 0.00 ? 67 VAL S HG21 1  
ATOM 945   H HG22 . VAL A 1 58 ? 8.499   0.705   7.049   1.00 0.00 ? 67 VAL S HG22 1  
ATOM 946   H HG23 . VAL A 1 58 ? 8.074   -0.243  5.622   1.00 0.00 ? 67 VAL S HG23 1  
ATOM 947   N N    . ASN A 1 59 ? 11.736  1.276   3.020   1.00 0.00 ? 68 ASN S N    1  
ATOM 948   C CA   . ASN A 1 59 ? 12.817  1.949   2.299   1.00 0.00 ? 68 ASN S CA   1  
ATOM 949   C C    . ASN A 1 59 ? 12.362  2.410   0.915   1.00 0.00 ? 68 ASN S C    1  
ATOM 950   O O    . ASN A 1 59 ? 12.682  3.516   0.478   1.00 0.00 ? 68 ASN S O    1  
ATOM 951   C CB   . ASN A 1 59 ? 14.012  1.008   2.147   1.00 0.00 ? 68 ASN S CB   1  
ATOM 952   C CG   . ASN A 1 59 ? 15.292  1.746   1.807   1.00 0.00 ? 68 ASN S CG   1  
ATOM 953   O OD1  . ASN A 1 59 ? 15.473  2.904   2.182   1.00 0.00 ? 68 ASN S OD1  1  
ATOM 954   N ND2  . ASN A 1 59 ? 16.188  1.076   1.091   1.00 0.00 ? 68 ASN S ND2  1  
ATOM 955   H H    . ASN A 1 59 ? 11.950  0.458   3.552   1.00 0.00 ? 68 ASN S H    1  
ATOM 956   H HA   . ASN A 1 59 ? 13.118  2.811   2.877   1.00 0.00 ? 68 ASN S HA   1  
ATOM 957   H HB2  . ASN A 1 59 ? 14.159  0.469   3.068   1.00 0.00 ? 68 ASN S HB2  1  
ATOM 958   H HB3  . ASN A 1 59 ? 13.805  0.303   1.354   1.00 0.00 ? 68 ASN S HB3  1  
ATOM 959   H HD21 . ASN A 1 59 ? 15.976  0.157   0.826   1.00 0.00 ? 68 ASN S HD21 1  
ATOM 960   H HD22 . ASN A 1 59 ? 17.025  1.529   0.856   1.00 0.00 ? 68 ASN S HD22 1  
ATOM 961   N N    . LEU A 1 60 ? 11.619  1.546   0.231   1.00 0.00 ? 69 LEU S N    1  
ATOM 962   C CA   . LEU A 1 60 ? 11.126  1.851   -1.106  1.00 0.00 ? 69 LEU S CA   1  
ATOM 963   C C    . LEU A 1 60 ? 9.999   2.879   -1.064  1.00 0.00 ? 69 LEU S C    1  
ATOM 964   O O    . LEU A 1 60 ? 10.010  3.850   -1.821  1.00 0.00 ? 69 LEU S O    1  
ATOM 965   C CB   . LEU A 1 60 ? 10.646  0.572   -1.794  1.00 0.00 ? 69 LEU S CB   1  
ATOM 966   C CG   . LEU A 1 60 ? 11.624  -0.023  -2.809  1.00 0.00 ? 69 LEU S CG   1  
ATOM 967   C CD1  . LEU A 1 60 ? 11.960  0.997   -3.885  1.00 0.00 ? 69 LEU S CD1  1  
ATOM 968   C CD2  . LEU A 1 60 ? 12.888  -0.502  -2.112  1.00 0.00 ? 69 LEU S CD2  1  
ATOM 969   H H    . LEU A 1 60 ? 11.402  0.680   0.633   1.00 0.00 ? 69 LEU S H    1  
ATOM 970   H HA   . LEU A 1 60 ? 11.947  2.262   -1.673  1.00 0.00 ? 69 LEU S HA   1  
ATOM 971   H HB2  . LEU A 1 60 ? 10.457  -0.170  -1.030  1.00 0.00 ? 69 LEU S HB2  1  
ATOM 972   H HB3  . LEU A 1 60 ? 9.718   0.786   -2.305  1.00 0.00 ? 69 LEU S HB3  1  
ATOM 973   H HG   . LEU A 1 60 ? 11.161  -0.873  -3.288  1.00 0.00 ? 69 LEU S HG   1  
ATOM 974   H HD11 . LEU A 1 60 ? 12.309  0.485   -4.770  1.00 0.00 ? 69 LEU S HD11 1  
ATOM 975   H HD12 . LEU A 1 60 ? 12.733  1.660   -3.525  1.00 0.00 ? 69 LEU S HD12 1  
ATOM 976   H HD13 . LEU A 1 60 ? 11.078  1.571   -4.127  1.00 0.00 ? 69 LEU S HD13 1  
ATOM 977   H HD21 . LEU A 1 60 ? 13.391  -1.225  -2.737  1.00 0.00 ? 69 LEU S HD21 1  
ATOM 978   H HD22 . LEU A 1 60 ? 12.628  -0.960  -1.169  1.00 0.00 ? 69 LEU S HD22 1  
ATOM 979   H HD23 . LEU A 1 60 ? 13.543  0.339   -1.936  1.00 0.00 ? 69 LEU S HD23 1  
ATOM 980   N N    . LYS A 1 61 ? 9.020   2.662   -0.186  1.00 0.00 ? 70 LYS S N    1  
ATOM 981   C CA   . LYS A 1 61 ? 7.891   3.583   -0.069  1.00 0.00 ? 70 LYS S CA   1  
ATOM 982   C C    . LYS A 1 61 ? 8.372   5.026   0.029   1.00 0.00 ? 70 LYS S C    1  
ATOM 983   O O    . LYS A 1 61 ? 7.979   5.878   -0.769  1.00 0.00 ? 70 LYS S O    1  
ATOM 984   C CB   . LYS A 1 61 ? 7.028   3.243   1.147   1.00 0.00 ? 70 LYS S CB   1  
ATOM 985   C CG   . LYS A 1 61 ? 6.025   2.132   0.889   1.00 0.00 ? 70 LYS S CG   1  
ATOM 986   C CD   . LYS A 1 61 ? 6.446   0.836   1.559   1.00 0.00 ? 70 LYS S CD   1  
ATOM 987   C CE   . LYS A 1 61 ? 5.816   0.690   2.931   1.00 0.00 ? 70 LYS S CE   1  
ATOM 988   N NZ   . LYS A 1 61 ? 6.309   -0.519  3.642   1.00 0.00 ? 70 LYS S NZ   1  
ATOM 989   H H    . LYS A 1 61 ? 9.057   1.868   0.391   1.00 0.00 ? 70 LYS S H    1  
ATOM 990   H HA   . LYS A 1 61 ? 7.293   3.479   -0.961  1.00 0.00 ? 70 LYS S HA   1  
ATOM 991   H HB2  . LYS A 1 61 ? 7.672   2.941   1.963   1.00 0.00 ? 70 LYS S HB2  1  
ATOM 992   H HB3  . LYS A 1 61 ? 6.482   4.127   1.439   1.00 0.00 ? 70 LYS S HB3  1  
ATOM 993   H HG2  . LYS A 1 61 ? 5.064   2.429   1.279   1.00 0.00 ? 70 LYS S HG2  1  
ATOM 994   H HG3  . LYS A 1 61 ? 5.948   1.970   -0.175  1.00 0.00 ? 70 LYS S HG3  1  
ATOM 995   H HD2  . LYS A 1 61 ? 6.139   0.005   0.942   1.00 0.00 ? 70 LYS S HD2  1  
ATOM 996   H HD3  . LYS A 1 61 ? 7.520   0.832   1.664   1.00 0.00 ? 70 LYS S HD3  1  
ATOM 997   H HE2  . LYS A 1 61 ? 6.058   1.563   3.518   1.00 0.00 ? 70 LYS S HE2  1  
ATOM 998   H HE3  . LYS A 1 61 ? 4.745   0.619   2.814   1.00 0.00 ? 70 LYS S HE3  1  
ATOM 999   H HZ1  . LYS A 1 61 ? 7.329   -0.433  3.822   1.00 0.00 ? 70 LYS S HZ1  1  
ATOM 1000  H HZ2  . LYS A 1 61 ? 6.138   -1.368  3.065   1.00 0.00 ? 70 LYS S HZ2  1  
ATOM 1001  H HZ3  . LYS A 1 61 ? 5.815   -0.627  4.551   1.00 0.00 ? 70 LYS S HZ3  1  
ATOM 1002  N N    . LYS A 1 62 ? 9.231   5.294   1.007   1.00 0.00 ? 71 LYS S N    1  
ATOM 1003  C CA   . LYS A 1 62 ? 9.770   6.634   1.200   1.00 0.00 ? 71 LYS S CA   1  
ATOM 1004  C C    . LYS A 1 62 ? 10.541  7.084   -0.036  1.00 0.00 ? 71 LYS S C    1  
ATOM 1005  O O    . LYS A 1 62 ? 10.600  8.274   -0.345  1.00 0.00 ? 71 LYS S O    1  
ATOM 1006  C CB   . LYS A 1 62 ? 10.681  6.670   2.428   1.00 0.00 ? 71 LYS S CB   1  
ATOM 1007  C CG   . LYS A 1 62 ? 9.923   6.738   3.744   1.00 0.00 ? 71 LYS S CG   1  
ATOM 1008  C CD   . LYS A 1 62 ? 10.854  7.031   4.911   1.00 0.00 ? 71 LYS S CD   1  
ATOM 1009  C CE   . LYS A 1 62 ? 11.152  5.776   5.714   1.00 0.00 ? 71 LYS S CE   1  
ATOM 1010  N NZ   . LYS A 1 62 ? 11.718  6.095   7.054   1.00 0.00 ? 71 LYS S NZ   1  
ATOM 1011  H H    . LYS A 1 62 ? 9.512   4.573   1.609   1.00 0.00 ? 71 LYS S H    1  
ATOM 1012  H HA   . LYS A 1 62 ? 8.940   7.306   1.358   1.00 0.00 ? 71 LYS S HA   1  
ATOM 1013  H HB2  . LYS A 1 62 ? 11.294  5.780   2.435   1.00 0.00 ? 71 LYS S HB2  1  
ATOM 1014  H HB3  . LYS A 1 62 ? 11.322  7.537   2.362   1.00 0.00 ? 71 LYS S HB3  1  
ATOM 1015  H HG2  . LYS A 1 62 ? 9.183   7.522   3.682   1.00 0.00 ? 71 LYS S HG2  1  
ATOM 1016  H HG3  . LYS A 1 62 ? 9.433   5.790   3.915   1.00 0.00 ? 71 LYS S HG3  1  
ATOM 1017  H HD2  . LYS A 1 62 ? 11.781  7.429   4.529   1.00 0.00 ? 71 LYS S HD2  1  
ATOM 1018  H HD3  . LYS A 1 62 ? 10.385  7.759   5.557   1.00 0.00 ? 71 LYS S HD3  1  
ATOM 1019  H HE2  . LYS A 1 62 ? 10.234  5.220   5.846   1.00 0.00 ? 71 LYS S HE2  1  
ATOM 1020  H HE3  . LYS A 1 62 ? 11.864  5.173   5.167   1.00 0.00 ? 71 LYS S HE3  1  
ATOM 1021  H HZ1  . LYS A 1 62 ? 12.197  7.019   7.029   1.00 0.00 ? 71 LYS S HZ1  1  
ATOM 1022  H HZ2  . LYS A 1 62 ? 12.406  5.367   7.335   1.00 0.00 ? 71 LYS S HZ2  1  
ATOM 1023  H HZ3  . LYS A 1 62 ? 10.959  6.131   7.764   1.00 0.00 ? 71 LYS S HZ3  1  
ATOM 1024  N N    . ALA A 1 63 ? 11.123  6.121   -0.745  1.00 0.00 ? 72 ALA S N    1  
ATOM 1025  C CA   . ALA A 1 63 ? 11.885  6.415   -1.951  1.00 0.00 ? 72 ALA S CA   1  
ATOM 1026  C C    . ALA A 1 63 ? 10.966  6.839   -3.092  1.00 0.00 ? 72 ALA S C    1  
ATOM 1027  O O    . ALA A 1 63 ? 11.318  7.700   -3.898  1.00 0.00 ? 72 ALA S O    1  
ATOM 1028  C CB   . ALA A 1 63 ? 12.715  5.206   -2.361  1.00 0.00 ? 72 ALA S CB   1  
ATOM 1029  H H    . ALA A 1 63 ? 11.039  5.189   -0.450  1.00 0.00 ? 72 ALA S H    1  
ATOM 1030  H HA   . ALA A 1 63 ? 12.563  7.227   -1.728  1.00 0.00 ? 72 ALA S HA   1  
ATOM 1031  H HB1  . ALA A 1 63 ? 13.698  5.279   -1.920  1.00 0.00 ? 72 ALA S HB1  1  
ATOM 1032  H HB2  . ALA A 1 63 ? 12.805  5.179   -3.437  1.00 0.00 ? 72 ALA S HB2  1  
ATOM 1033  H HB3  . ALA A 1 63 ? 12.232  4.306   -2.016  1.00 0.00 ? 72 ALA S HB3  1  
ATOM 1034  N N    . LYS A 1 64 ? 9.784   6.230   -3.155  1.00 0.00 ? 73 LYS S N    1  
ATOM 1035  C CA   . LYS A 1 64 ? 8.818   6.552   -4.200  1.00 0.00 ? 73 LYS S CA   1  
ATOM 1036  C C    . LYS A 1 64 ? 7.890   7.681   -3.761  1.00 0.00 ? 73 LYS S C    1  
ATOM 1037  O O    . LYS A 1 64 ? 7.352   8.411   -4.593  1.00 0.00 ? 73 LYS S O    1  
ATOM 1038  C CB   . LYS A 1 64 ? 7.999   5.312   -4.572  1.00 0.00 ? 73 LYS S CB   1  
ATOM 1039  C CG   . LYS A 1 64 ? 7.985   5.022   -6.065  1.00 0.00 ? 73 LYS S CG   1  
ATOM 1040  C CD   . LYS A 1 64 ? 9.007   3.958   -6.436  1.00 0.00 ? 73 LYS S CD   1  
ATOM 1041  C CE   . LYS A 1 64 ? 9.813   4.358   -7.662  1.00 0.00 ? 73 LYS S CE   1  
ATOM 1042  N NZ   . LYS A 1 64 ? 9.412   3.582   -8.868  1.00 0.00 ? 73 LYS S NZ   1  
ATOM 1043  H H    . LYS A 1 64 ? 9.557   5.552   -2.485  1.00 0.00 ? 73 LYS S H    1  
ATOM 1044  H HA   . LYS A 1 64 ? 9.371   6.877   -5.069  1.00 0.00 ? 73 LYS S HA   1  
ATOM 1045  H HB2  . LYS A 1 64 ? 8.417   4.453   -4.064  1.00 0.00 ? 73 LYS S HB2  1  
ATOM 1046  H HB3  . LYS A 1 64 ? 6.977   5.455   -4.245  1.00 0.00 ? 73 LYS S HB3  1  
ATOM 1047  H HG2  . LYS A 1 64 ? 7.002   4.677   -6.346  1.00 0.00 ? 73 LYS S HG2  1  
ATOM 1048  H HG3  . LYS A 1 64 ? 8.215   5.932   -6.598  1.00 0.00 ? 73 LYS S HG3  1  
ATOM 1049  H HD2  . LYS A 1 64 ? 9.684   3.816   -5.606  1.00 0.00 ? 73 LYS S HD2  1  
ATOM 1050  H HD3  . LYS A 1 64 ? 8.489   3.032   -6.642  1.00 0.00 ? 73 LYS S HD3  1  
ATOM 1051  H HE2  . LYS A 1 64 ? 9.657   5.410   -7.855  1.00 0.00 ? 73 LYS S HE2  1  
ATOM 1052  H HE3  . LYS A 1 64 ? 10.860  4.182   -7.462  1.00 0.00 ? 73 LYS S HE3  1  
ATOM 1053  H HZ1  . LYS A 1 64 ? 9.005   2.666   -8.585  1.00 0.00 ? 73 LYS S HZ1  1  
ATOM 1054  H HZ2  . LYS A 1 64 ? 10.240  3.409   -9.474  1.00 0.00 ? 73 LYS S HZ2  1  
ATOM 1055  H HZ3  . LYS A 1 64 ? 8.701   4.109   -9.413  1.00 0.00 ? 73 LYS S HZ3  1  
ATOM 1056  N N    . GLY A 1 65 ? 7.719   7.831   -2.451  1.00 0.00 ? 74 GLY S N    1  
ATOM 1057  C CA   . GLY A 1 65 ? 6.868   8.886   -1.934  1.00 0.00 ? 74 GLY S CA   1  
ATOM 1058  C C    . GLY A 1 65 ? 5.553   8.385   -1.360  1.00 0.00 ? 74 GLY S C    1  
ATOM 1059  O O    . GLY A 1 65 ? 4.717   9.185   -0.940  1.00 0.00 ? 74 GLY S O    1  
ATOM 1060  H H    . GLY A 1 65 ? 8.178   7.227   -1.831  1.00 0.00 ? 74 GLY S H    1  
ATOM 1061  H HA2  . GLY A 1 65 ? 7.404   9.411   -1.154  1.00 0.00 ? 74 GLY S HA2  1  
ATOM 1062  H HA3  . GLY A 1 65 ? 6.653   9.581   -2.736  1.00 0.00 ? 74 GLY S HA3  1  
ATOM 1063  N N    . LEU A 1 66 ? 5.357   7.068   -1.334  1.00 0.00 ? 75 LEU S N    1  
ATOM 1064  C CA   . LEU A 1 66 ? 4.122   6.506   -0.796  1.00 0.00 ? 75 LEU S CA   1  
ATOM 1065  C C    . LEU A 1 66 ? 3.981   6.845   0.683   1.00 0.00 ? 75 LEU S C    1  
ATOM 1066  O O    . LEU A 1 66 ? 3.284   7.792   1.045   1.00 0.00 ? 75 LEU S O    1  
ATOM 1067  C CB   . LEU A 1 66 ? 4.071   4.989   -0.995  1.00 0.00 ? 75 LEU S CB   1  
ATOM 1068  C CG   . LEU A 1 66 ? 3.655   4.533   -2.395  1.00 0.00 ? 75 LEU S CG   1  
ATOM 1069  C CD1  . LEU A 1 66 ? 3.616   3.015   -2.474  1.00 0.00 ? 75 LEU S CD1  1  
ATOM 1070  C CD2  . LEU A 1 66 ? 2.301   5.122   -2.772  1.00 0.00 ? 75 LEU S CD2  1  
ATOM 1071  H H    . LEU A 1 66 ? 6.051   6.468   -1.678  1.00 0.00 ? 75 LEU S H    1  
ATOM 1072  H HA   . LEU A 1 66 ? 3.299   6.957   -1.332  1.00 0.00 ? 75 LEU S HA   1  
ATOM 1073  H HB2  . LEU A 1 66 ? 5.050   4.581   -0.778  1.00 0.00 ? 75 LEU S HB2  1  
ATOM 1074  H HB3  . LEU A 1 66 ? 3.365   4.580   -0.286  1.00 0.00 ? 75 LEU S HB3  1  
ATOM 1075  H HG   . LEU A 1 66 ? 4.384   4.884   -3.113  1.00 0.00 ? 75 LEU S HG   1  
ATOM 1076  H HD11 . LEU A 1 66 ? 4.072   2.595   -1.589  1.00 0.00 ? 75 LEU S HD11 1  
ATOM 1077  H HD12 . LEU A 1 66 ? 4.159   2.686   -3.348  1.00 0.00 ? 75 LEU S HD12 1  
ATOM 1078  H HD13 . LEU A 1 66 ? 2.592   2.682   -2.543  1.00 0.00 ? 75 LEU S HD13 1  
ATOM 1079  H HD21 . LEU A 1 66 ? 1.940   5.743   -1.966  1.00 0.00 ? 75 LEU S HD21 1  
ATOM 1080  H HD22 . LEU A 1 66 ? 1.597   4.322   -2.954  1.00 0.00 ? 75 LEU S HD22 1  
ATOM 1081  H HD23 . LEU A 1 66 ? 2.405   5.718   -3.666  1.00 0.00 ? 75 LEU S HD23 1  
ATOM 1082  N N    . PHE A 1 67 ? 4.644   6.066   1.536   1.00 0.00 ? 76 PHE S N    1  
ATOM 1083  C CA   . PHE A 1 67 ? 4.583   6.295   2.981   1.00 0.00 ? 76 PHE S CA   1  
ATOM 1084  C C    . PHE A 1 67 ? 4.796   7.769   3.316   1.00 0.00 ? 76 PHE S C    1  
ATOM 1085  O O    . PHE A 1 67 ? 4.453   8.175   4.448   1.00 0.00 ? 76 PHE S O    1  
ATOM 1086  C CB   . PHE A 1 67 ? 5.619   5.444   3.719   1.00 0.00 ? 76 PHE S CB   1  
ATOM 1087  C CG   . PHE A 1 67 ? 5.013   4.275   4.444   1.00 0.00 ? 76 PHE S CG   1  
ATOM 1088  C CD1  . PHE A 1 67 ? 4.331   3.299   3.744   1.00 0.00 ? 76 PHE S CD1  1  
ATOM 1089  C CD2  . PHE A 1 67 ? 5.120   4.160   5.822   1.00 0.00 ? 76 PHE S CD2  1  
ATOM 1090  C CE1  . PHE A 1 67 ? 3.767   2.224   4.399   1.00 0.00 ? 76 PHE S CE1  1  
ATOM 1091  C CE2  . PHE A 1 67 ? 4.556   3.084   6.485   1.00 0.00 ? 76 PHE S CE2  1  
ATOM 1092  C CZ   . PHE A 1 67 ? 3.879   2.116   5.771   1.00 0.00 ? 76 PHE S CZ   1  
ATOM 1093  O OXT  . PHE A 1 67 ? 5.303   8.507   2.445   1.00 0.00 ? 76 PHE S OXT  1  
ATOM 1094  H H    . PHE A 1 67 ? 5.180   5.321   1.185   1.00 0.00 ? 76 PHE S H    1  
ATOM 1095  H HA   . PHE A 1 67 ? 3.600   6.004   3.313   1.00 0.00 ? 76 PHE S HA   1  
ATOM 1096  H HB2  . PHE A 1 67 ? 6.335   5.059   3.009   1.00 0.00 ? 76 PHE S HB2  1  
ATOM 1097  H HB3  . PHE A 1 67 ? 6.133   6.057   4.445   1.00 0.00 ? 76 PHE S HB3  1  
ATOM 1098  H HD1  . PHE A 1 67 ? 4.240   3.383   2.673   1.00 0.00 ? 76 PHE S HD1  1  
ATOM 1099  H HD2  . PHE A 1 67 ? 5.651   4.917   6.379   1.00 0.00 ? 76 PHE S HD2  1  
ATOM 1100  H HE1  . PHE A 1 67 ? 3.238   1.469   3.838   1.00 0.00 ? 76 PHE S HE1  1  
ATOM 1101  H HE2  . PHE A 1 67 ? 4.641   3.002   7.560   1.00 0.00 ? 76 PHE S HE2  1  
ATOM 1102  H HZ   . PHE A 1 67 ? 3.438   1.273   6.285   1.00 0.00 ? 76 PHE S HZ   1  
ATOM 1103  N N    . MET A 1 1  ? -20.124 -2.876  7.013   1.00 0.00 ? 10 MET S N    2  
ATOM 1104  C CA   . MET A 1 1  ? -18.912 -3.150  6.198   1.00 0.00 ? 10 MET S CA   2  
ATOM 1105  C C    . MET A 1 1  ? -17.652 -3.139  7.059   1.00 0.00 ? 10 MET S C    2  
ATOM 1106  O O    . MET A 1 1  ? -16.656 -3.781  6.726   1.00 0.00 ? 10 MET S O    2  
ATOM 1107  C CB   . MET A 1 1  ? -18.811 -2.092  5.099   1.00 0.00 ? 10 MET S CB   2  
ATOM 1108  C CG   . MET A 1 1  ? -18.642 -0.675  5.627   1.00 0.00 ? 10 MET S CG   2  
ATOM 1109  S SD   . MET A 1 1  ? -20.173 0.275   5.573   1.00 0.00 ? 10 MET S SD   2  
ATOM 1110  C CE   . MET A 1 1  ? -19.538 1.948   5.647   1.00 0.00 ? 10 MET S CE   2  
ATOM 1111  H H1   . MET A 1 1  ? -20.144 -1.857  7.219   1.00 0.00 ? 10 MET S H1   2  
ATOM 1112  H H2   . MET A 1 1  ? -20.051 -3.434  7.888   1.00 0.00 ? 10 MET S H2   2  
ATOM 1113  H H3   . MET A 1 1  ? -20.953 -3.160  6.455   1.00 0.00 ? 10 MET S H3   2  
ATOM 1114  H HA   . MET A 1 1  ? -19.018 -4.124  5.743   1.00 0.00 ? 10 MET S HA   2  
ATOM 1115  H HB2  . MET A 1 1  ? -17.963 -2.320  4.471   1.00 0.00 ? 10 MET S HB2  2  
ATOM 1116  H HB3  . MET A 1 1  ? -19.710 -2.124  4.501   1.00 0.00 ? 10 MET S HB3  2  
ATOM 1117  H HG2  . MET A 1 1  ? -18.304 -0.727  6.652   1.00 0.00 ? 10 MET S HG2  2  
ATOM 1118  H HG3  . MET A 1 1  ? -17.898 -0.169  5.030   1.00 0.00 ? 10 MET S HG3  2  
ATOM 1119  H HE1  . MET A 1 1  ? -18.629 2.014   5.068   1.00 0.00 ? 10 MET S HE1  2  
ATOM 1120  H HE2  . MET A 1 1  ? -19.330 2.209   6.674   1.00 0.00 ? 10 MET S HE2  2  
ATOM 1121  H HE3  . MET A 1 1  ? -20.272 2.630   5.244   1.00 0.00 ? 10 MET S HE3  2  
ATOM 1122  N N    . LEU A 1 2  ? -17.702 -2.405  8.167   1.00 0.00 ? 11 LEU S N    2  
ATOM 1123  C CA   . LEU A 1 2  ? -16.563 -2.312  9.073   1.00 0.00 ? 11 LEU S CA   2  
ATOM 1124  C C    . LEU A 1 2  ? -16.461 -3.559  9.946   1.00 0.00 ? 11 LEU S C    2  
ATOM 1125  O O    . LEU A 1 2  ? -15.366 -3.971  10.330  1.00 0.00 ? 11 LEU S O    2  
ATOM 1126  C CB   . LEU A 1 2  ? -16.687 -1.067  9.953   1.00 0.00 ? 11 LEU S CB   2  
ATOM 1127  C CG   . LEU A 1 2  ? -16.793 0.256   9.190   1.00 0.00 ? 11 LEU S CG   2  
ATOM 1128  C CD1  . LEU A 1 2  ? -17.697 1.228   9.932   1.00 0.00 ? 11 LEU S CD1  2  
ATOM 1129  C CD2  . LEU A 1 2  ? -15.413 0.859   8.981   1.00 0.00 ? 11 LEU S CD2  2  
ATOM 1130  H H    . LEU A 1 2  ? -18.523 -1.914  8.378   1.00 0.00 ? 11 LEU S H    2  
ATOM 1131  H HA   . LEU A 1 2  ? -15.669 -2.231  8.474   1.00 0.00 ? 11 LEU S HA   2  
ATOM 1132  H HB2  . LEU A 1 2  ? -17.567 -1.175  10.572  1.00 0.00 ? 11 LEU S HB2  2  
ATOM 1133  H HB3  . LEU A 1 2  ? -15.822 -1.018  10.595  1.00 0.00 ? 11 LEU S HB3  2  
ATOM 1134  H HG   . LEU A 1 2  ? -17.229 0.069   8.220   1.00 0.00 ? 11 LEU S HG   2  
ATOM 1135  H HD11 . LEU A 1 2  ? -18.269 1.801   9.219   1.00 0.00 ? 11 LEU S HD11 2  
ATOM 1136  H HD12 . LEU A 1 2  ? -17.092 1.897   10.529  1.00 0.00 ? 11 LEU S HD12 2  
ATOM 1137  H HD13 . LEU A 1 2  ? -18.367 0.679   10.575  1.00 0.00 ? 11 LEU S HD13 2  
ATOM 1138  H HD21 . LEU A 1 2  ? -14.889 0.304   8.217   1.00 0.00 ? 11 LEU S HD21 2  
ATOM 1139  H HD22 . LEU A 1 2  ? -14.854 0.811   9.904   1.00 0.00 ? 11 LEU S HD22 2  
ATOM 1140  H HD23 . LEU A 1 2  ? -15.512 1.889   8.674   1.00 0.00 ? 11 LEU S HD23 2  
ATOM 1141  N N    . ALA A 1 3  ? -17.609 -4.155  10.255  1.00 0.00 ? 12 ALA S N    2  
ATOM 1142  C CA   . ALA A 1 3  ? -17.647 -5.354  11.083  1.00 0.00 ? 12 ALA S CA   2  
ATOM 1143  C C    . ALA A 1 3  ? -16.937 -6.518  10.399  1.00 0.00 ? 12 ALA S C    2  
ATOM 1144  O O    . ALA A 1 3  ? -16.233 -7.293  11.045  1.00 0.00 ? 12 ALA S O    2  
ATOM 1145  C CB   . ALA A 1 3  ? -19.089 -5.728  11.403  1.00 0.00 ? 12 ALA S CB   2  
ATOM 1146  H H    . ALA A 1 3  ? -18.448 -3.779  9.920   1.00 0.00 ? 12 ALA S H    2  
ATOM 1147  H HA   . ALA A 1 3  ? -17.143 -5.135  12.013  1.00 0.00 ? 12 ALA S HA   2  
ATOM 1148  H HB1  . ALA A 1 3  ? -19.724 -5.446  10.576  1.00 0.00 ? 12 ALA S HB1  2  
ATOM 1149  H HB2  . ALA A 1 3  ? -19.405 -5.208  12.295  1.00 0.00 ? 12 ALA S HB2  2  
ATOM 1150  H HB3  . ALA A 1 3  ? -19.156 -6.793  11.563  1.00 0.00 ? 12 ALA S HB3  2  
ATOM 1151  N N    . LYS A 1 4  ? -17.127 -6.633  9.089   1.00 0.00 ? 13 LYS S N    2  
ATOM 1152  C CA   . LYS A 1 4  ? -16.503 -7.702  8.318   1.00 0.00 ? 13 LYS S CA   2  
ATOM 1153  C C    . LYS A 1 4  ? -15.167 -7.249  7.742   1.00 0.00 ? 13 LYS S C    2  
ATOM 1154  O O    . LYS A 1 4  ? -14.913 -6.054  7.598   1.00 0.00 ? 13 LYS S O    2  
ATOM 1155  C CB   . LYS A 1 4  ? -17.431 -8.154  7.188   1.00 0.00 ? 13 LYS S CB   2  
ATOM 1156  C CG   . LYS A 1 4  ? -18.823 -8.537  7.660   1.00 0.00 ? 13 LYS S CG   2  
ATOM 1157  C CD   . LYS A 1 4  ? -19.521 -9.445  6.658   1.00 0.00 ? 13 LYS S CD   2  
ATOM 1158  C CE   . LYS A 1 4  ? -20.954 -9.734  7.073   1.00 0.00 ? 13 LYS S CE   2  
ATOM 1159  N NZ   . LYS A 1 4  ? -21.024 -10.427 8.388   1.00 0.00 ? 13 LYS S NZ   2  
ATOM 1160  H H    . LYS A 1 4  ? -17.699 -5.983  8.629   1.00 0.00 ? 13 LYS S H    2  
ATOM 1161  H HA   . LYS A 1 4  ? -16.332 -8.534  8.985   1.00 0.00 ? 13 LYS S HA   2  
ATOM 1162  H HB2  . LYS A 1 4  ? -17.525 -7.351  6.473   1.00 0.00 ? 13 LYS S HB2  2  
ATOM 1163  H HB3  . LYS A 1 4  ? -16.992 -9.011  6.699   1.00 0.00 ? 13 LYS S HB3  2  
ATOM 1164  H HG2  . LYS A 1 4  ? -18.744 -9.055  8.605   1.00 0.00 ? 13 LYS S HG2  2  
ATOM 1165  H HG3  . LYS A 1 4  ? -19.410 -7.639  7.788   1.00 0.00 ? 13 LYS S HG3  2  
ATOM 1166  H HD2  . LYS A 1 4  ? -19.525 -8.961  5.693   1.00 0.00 ? 13 LYS S HD2  2  
ATOM 1167  H HD3  . LYS A 1 4  ? -18.979 -10.376 6.594   1.00 0.00 ? 13 LYS S HD3  2  
ATOM 1168  H HE2  . LYS A 1 4  ? -21.492 -8.799  7.139   1.00 0.00 ? 13 LYS S HE2  2  
ATOM 1169  H HE3  . LYS A 1 4  ? -21.413 -10.358 6.320   1.00 0.00 ? 13 LYS S HE3  2  
ATOM 1170  H HZ1  . LYS A 1 4  ? -20.721 -9.784  9.147   1.00 0.00 ? 13 LYS S HZ1  2  
ATOM 1171  H HZ2  . LYS A 1 4  ? -20.402 -11.262 8.385   1.00 0.00 ? 13 LYS S HZ2  2  
ATOM 1172  H HZ3  . LYS A 1 4  ? -21.999 -10.736 8.578   1.00 0.00 ? 13 LYS S HZ3  2  
ATOM 1173  N N    . LEU A 1 5  ? -14.314 -8.213  7.409   1.00 0.00 ? 14 LEU S N    2  
ATOM 1174  C CA   . LEU A 1 5  ? -13.003 -7.916  6.845   1.00 0.00 ? 14 LEU S CA   2  
ATOM 1175  C C    . LEU A 1 5  ? -13.070 -7.851  5.324   1.00 0.00 ? 14 LEU S C    2  
ATOM 1176  O O    . LEU A 1 5  ? -13.465 -8.815  4.669   1.00 0.00 ? 14 LEU S O    2  
ATOM 1177  C CB   . LEU A 1 5  ? -11.986 -8.973  7.280   1.00 0.00 ? 14 LEU S CB   2  
ATOM 1178  C CG   . LEU A 1 5  ? -11.778 -9.089  8.791   1.00 0.00 ? 14 LEU S CG   2  
ATOM 1179  C CD1  . LEU A 1 5  ? -12.790 -10.049 9.397   1.00 0.00 ? 14 LEU S CD1  2  
ATOM 1180  C CD2  . LEU A 1 5  ? -10.360 -9.542  9.098   1.00 0.00 ? 14 LEU S CD2  2  
ATOM 1181  H H    . LEU A 1 5  ? -14.575 -9.149  7.546   1.00 0.00 ? 14 LEU S H    2  
ATOM 1182  H HA   . LEU A 1 5  ? -12.692 -6.953  7.223   1.00 0.00 ? 14 LEU S HA   2  
ATOM 1183  H HB2  . LEU A 1 5  ? -12.315 -9.933  6.907   1.00 0.00 ? 14 LEU S HB2  2  
ATOM 1184  H HB3  . LEU A 1 5  ? -11.036 -8.735  6.826   1.00 0.00 ? 14 LEU S HB3  2  
ATOM 1185  H HG   . LEU A 1 5  ? -11.926 -8.119  9.243   1.00 0.00 ? 14 LEU S HG   2  
ATOM 1186  H HD11 . LEU A 1 5  ? -13.735 -9.542  9.526   1.00 0.00 ? 14 LEU S HD11 2  
ATOM 1187  H HD12 . LEU A 1 5  ? -12.431 -10.392 10.357  1.00 0.00 ? 14 LEU S HD12 2  
ATOM 1188  H HD13 . LEU A 1 5  ? -12.923 -10.896 8.738   1.00 0.00 ? 14 LEU S HD13 2  
ATOM 1189  H HD21 . LEU A 1 5  ? -10.021 -10.215 8.326   1.00 0.00 ? 14 LEU S HD21 2  
ATOM 1190  H HD22 . LEU A 1 5  ? -10.341 -10.048 10.052  1.00 0.00 ? 14 LEU S HD22 2  
ATOM 1191  H HD23 . LEU A 1 5  ? -9.706  -8.681  9.136   1.00 0.00 ? 14 LEU S HD23 2  
ATOM 1192  N N    . CYS A 1 6  ? -12.679 -6.709  4.767   1.00 0.00 ? 15 CYS S N    2  
ATOM 1193  C CA   . CYS A 1 6  ? -12.696 -6.521  3.321   1.00 0.00 ? 15 CYS S CA   2  
ATOM 1194  C C    . CYS A 1 6  ? -11.457 -5.763  2.856   1.00 0.00 ? 15 CYS S C    2  
ATOM 1195  O O    . CYS A 1 6  ? -11.117 -4.712  3.399   1.00 0.00 ? 15 CYS S O    2  
ATOM 1196  C CB   . CYS A 1 6  ? -13.957 -5.763  2.899   1.00 0.00 ? 15 CYS S CB   2  
ATOM 1197  S SG   . CYS A 1 6  ? -15.498 -6.536  3.446   1.00 0.00 ? 15 CYS S SG   2  
ATOM 1198  H H    . CYS A 1 6  ? -12.374 -5.976  5.341   1.00 0.00 ? 15 CYS S H    2  
ATOM 1199  H HA   . CYS A 1 6  ? -12.701 -7.497  2.860   1.00 0.00 ? 15 CYS S HA   2  
ATOM 1200  H HB2  . CYS A 1 6  ? -13.926 -4.767  3.313   1.00 0.00 ? 15 CYS S HB2  2  
ATOM 1201  H HB3  . CYS A 1 6  ? -13.984 -5.700  1.822   1.00 0.00 ? 15 CYS S HB3  2  
ATOM 1202  H HG   . CYS A 1 6  ? -15.336 -6.953  4.294   1.00 0.00 ? 15 CYS S HG   2  
ATOM 1203  N N    . LYS A 1 7  ? -10.786 -6.304  1.843   1.00 0.00 ? 16 LYS S N    2  
ATOM 1204  C CA   . LYS A 1 7  ? -9.585  -5.678  1.299   1.00 0.00 ? 16 LYS S CA   2  
ATOM 1205  C C    . LYS A 1 7  ? -9.875  -5.043  -0.057  1.00 0.00 ? 16 LYS S C    2  
ATOM 1206  O O    . LYS A 1 7  ? -10.441 -5.684  -0.943  1.00 0.00 ? 16 LYS S O    2  
ATOM 1207  C CB   . LYS A 1 7  ? -8.462  -6.708  1.167   1.00 0.00 ? 16 LYS S CB   2  
ATOM 1208  C CG   . LYS A 1 7  ? -8.270  -7.564  2.409   1.00 0.00 ? 16 LYS S CG   2  
ATOM 1209  C CD   . LYS A 1 7  ? -8.838  -8.965  2.221   1.00 0.00 ? 16 LYS S CD   2  
ATOM 1210  C CE   . LYS A 1 7  ? -7.775  -10.032 2.429   1.00 0.00 ? 16 LYS S CE   2  
ATOM 1211  N NZ   . LYS A 1 7  ? -6.751  -10.017 1.347   1.00 0.00 ? 16 LYS S NZ   2  
ATOM 1212  H H    . LYS A 1 7  ? -11.107 -7.142  1.451   1.00 0.00 ? 16 LYS S H    2  
ATOM 1213  H HA   . LYS A 1 7  ? -9.274  -4.905  1.986   1.00 0.00 ? 16 LYS S HA   2  
ATOM 1214  H HB2  . LYS A 1 7  ? -8.684  -7.361  0.335   1.00 0.00 ? 16 LYS S HB2  2  
ATOM 1215  H HB3  . LYS A 1 7  ? -7.536  -6.189  0.968   1.00 0.00 ? 16 LYS S HB3  2  
ATOM 1216  H HG2  . LYS A 1 7  ? -7.214  -7.641  2.623   1.00 0.00 ? 16 LYS S HG2  2  
ATOM 1217  H HG3  . LYS A 1 7  ? -8.773  -7.091  3.240   1.00 0.00 ? 16 LYS S HG3  2  
ATOM 1218  H HD2  . LYS A 1 7  ? -9.631  -9.119  2.936   1.00 0.00 ? 16 LYS S HD2  2  
ATOM 1219  H HD3  . LYS A 1 7  ? -9.232  -9.052  1.218   1.00 0.00 ? 16 LYS S HD3  2  
ATOM 1220  H HE2  . LYS A 1 7  ? -7.285  -9.855  3.375   1.00 0.00 ? 16 LYS S HE2  2  
ATOM 1221  H HE3  . LYS A 1 7  ? -8.253  -11.000 2.448   1.00 0.00 ? 16 LYS S HE3  2  
ATOM 1222  H HZ1  . LYS A 1 7  ? -5.810  -10.212 1.741   1.00 0.00 ? 16 LYS S HZ1  2  
ATOM 1223  H HZ2  . LYS A 1 7  ? -6.736  -9.086  0.882   1.00 0.00 ? 16 LYS S HZ2  2  
ATOM 1224  H HZ3  . LYS A 1 7  ? -6.974  -10.742 0.635   1.00 0.00 ? 16 LYS S HZ3  2  
ATOM 1225  N N    . THR A 1 8  ? -9.485  -3.783  -0.213  1.00 0.00 ? 17 THR S N    2  
ATOM 1226  C CA   . THR A 1 8  ? -9.708  -3.066  -1.463  1.00 0.00 ? 17 THR S CA   2  
ATOM 1227  C C    . THR A 1 8  ? -8.564  -2.101  -1.757  1.00 0.00 ? 17 THR S C    2  
ATOM 1228  O O    . THR A 1 8  ? -7.925  -1.580  -0.842  1.00 0.00 ? 17 THR S O    2  
ATOM 1229  C CB   . THR A 1 8  ? -11.034 -2.303  -1.410  1.00 0.00 ? 17 THR S CB   2  
ATOM 1230  O OG1  . THR A 1 8  ? -11.107 -1.349  -2.454  1.00 0.00 ? 17 THR S OG1  2  
ATOM 1231  C CG2  . THR A 1 8  ? -11.252 -1.571  -0.104  1.00 0.00 ? 17 THR S CG2  2  
ATOM 1232  H H    . THR A 1 8  ? -9.040  -3.322  0.529   1.00 0.00 ? 17 THR S H    2  
ATOM 1233  H HA   . THR A 1 8  ? -9.757  -3.795  -2.258  1.00 0.00 ? 17 THR S HA   2  
ATOM 1234  H HB   . THR A 1 8  ? -11.847 -3.004  -1.534  1.00 0.00 ? 17 THR S HB   2  
ATOM 1235  H HG1  . THR A 1 8  ? -11.890 -1.513  -2.985  1.00 0.00 ? 17 THR S HG1  2  
ATOM 1236  H HG21 . THR A 1 8  ? -10.324 -1.121  0.216   1.00 0.00 ? 17 THR S HG21 2  
ATOM 1237  H HG22 . THR A 1 8  ? -11.592 -2.268  0.648   1.00 0.00 ? 17 THR S HG22 2  
ATOM 1238  H HG23 . THR A 1 8  ? -11.997 -0.801  -0.243  1.00 0.00 ? 17 THR S HG23 2  
ATOM 1239  N N    . ILE A 1 9  ? -8.313  -1.870  -3.041  1.00 0.00 ? 18 ILE S N    2  
ATOM 1240  C CA   . ILE A 1 9  ? -7.247  -0.973  -3.467  1.00 0.00 ? 18 ILE S CA   2  
ATOM 1241  C C    . ILE A 1 9  ? -7.752  0.460   -3.608  1.00 0.00 ? 18 ILE S C    2  
ATOM 1242  O O    . ILE A 1 9  ? -8.652  0.735   -4.403  1.00 0.00 ? 18 ILE S O    2  
ATOM 1243  C CB   . ILE A 1 9  ? -6.641  -1.425  -4.822  1.00 0.00 ? 18 ILE S CB   2  
ATOM 1244  C CG1  . ILE A 1 9  ? -5.750  -0.334  -5.427  1.00 0.00 ? 18 ILE S CG1  2  
ATOM 1245  C CG2  . ILE A 1 9  ? -7.744  -1.788  -5.802  1.00 0.00 ? 18 ILE S CG2  2  
ATOM 1246  C CD1  . ILE A 1 9  ? -4.713  0.217   -4.477  1.00 0.00 ? 18 ILE S CD1  2  
ATOM 1247  H H    . ILE A 1 9  ? -8.857  -2.320  -3.719  1.00 0.00 ? 18 ILE S H    2  
ATOM 1248  H HA   . ILE A 1 9  ? -6.468  -0.999  -2.721  1.00 0.00 ? 18 ILE S HA   2  
ATOM 1249  H HB   . ILE A 1 9  ? -6.046  -2.310  -4.645  1.00 0.00 ? 18 ILE S HB   2  
ATOM 1250  H HG12 . ILE A 1 9  ? -5.228  -0.741  -6.281  1.00 0.00 ? 18 ILE S HG12 2  
ATOM 1251  H HG13 . ILE A 1 9  ? -6.372  0.487   -5.752  1.00 0.00 ? 18 ILE S HG13 2  
ATOM 1252  H HG21 . ILE A 1 9  ? -7.384  -1.656  -6.811  1.00 0.00 ? 18 ILE S HG21 2  
ATOM 1253  H HG22 . ILE A 1 9  ? -8.596  -1.143  -5.639  1.00 0.00 ? 18 ILE S HG22 2  
ATOM 1254  H HG23 . ILE A 1 9  ? -8.037  -2.816  -5.653  1.00 0.00 ? 18 ILE S HG23 2  
ATOM 1255  H HD11 . ILE A 1 9  ? -3.815  -0.375  -4.545  1.00 0.00 ? 18 ILE S HD11 2  
ATOM 1256  H HD12 . ILE A 1 9  ? -5.093  0.182   -3.466  1.00 0.00 ? 18 ILE S HD12 2  
ATOM 1257  H HD13 . ILE A 1 9  ? -4.492  1.239   -4.741  1.00 0.00 ? 18 ILE S HD13 2  
ATOM 1258  N N    . TYR A 1 10 ? -7.149  1.373   -2.855  1.00 0.00 ? 19 TYR S N    2  
ATOM 1259  C CA   . TYR A 1 10 ? -7.523  2.778   -2.929  1.00 0.00 ? 19 TYR S CA   2  
ATOM 1260  C C    . TYR A 1 10 ? -6.675  3.457   -4.001  1.00 0.00 ? 19 TYR S C    2  
ATOM 1261  O O    . TYR A 1 10 ? -5.500  3.133   -4.165  1.00 0.00 ? 19 TYR S O    2  
ATOM 1262  C CB   . TYR A 1 10 ? -7.347  3.459   -1.562  1.00 0.00 ? 19 TYR S CB   2  
ATOM 1263  C CG   . TYR A 1 10 ? -8.464  3.146   -0.577  1.00 0.00 ? 19 TYR S CG   2  
ATOM 1264  C CD1  . TYR A 1 10 ? -9.300  2.050   -0.771  1.00 0.00 ? 19 TYR S CD1  2  
ATOM 1265  C CD2  . TYR A 1 10 ? -8.690  3.946   0.546   1.00 0.00 ? 19 TYR S CD2  2  
ATOM 1266  C CE1  . TYR A 1 10 ? -10.319 1.760   0.115   1.00 0.00 ? 19 TYR S CE1  2  
ATOM 1267  C CE2  . TYR A 1 10 ? -9.708  3.658   1.433   1.00 0.00 ? 19 TYR S CE2  2  
ATOM 1268  C CZ   . TYR A 1 10 ? -10.519 2.566   1.214   1.00 0.00 ? 19 TYR S CZ   2  
ATOM 1269  O OH   . TYR A 1 10 ? -11.535 2.279   2.097   1.00 0.00 ? 19 TYR S OH   2  
ATOM 1270  H H    . TYR A 1 10 ? -6.423  1.100   -2.254  1.00 0.00 ? 19 TYR S H    2  
ATOM 1271  H HA   . TYR A 1 10 ? -8.562  2.827   -3.221  1.00 0.00 ? 19 TYR S HA   2  
ATOM 1272  H HB2  . TYR A 1 10 ? -6.416  3.132   -1.121  1.00 0.00 ? 19 TYR S HB2  2  
ATOM 1273  H HB3  . TYR A 1 10 ? -7.319  4.531   -1.703  1.00 0.00 ? 19 TYR S HB3  2  
ATOM 1274  H HD1  . TYR A 1 10 ? -9.143  1.417   -1.632  1.00 0.00 ? 19 TYR S HD1  2  
ATOM 1275  H HD2  . TYR A 1 10 ? -8.056  4.802   0.727   1.00 0.00 ? 19 TYR S HD2  2  
ATOM 1276  H HE1  . TYR A 1 10 ? -10.954 0.904   -0.056  1.00 0.00 ? 19 TYR S HE1  2  
ATOM 1277  H HE2  . TYR A 1 10 ? -9.866  4.290   2.293   1.00 0.00 ? 19 TYR S HE2  2  
ATOM 1278  H HH   . TYR A 1 10 ? -11.292 1.516   2.628   1.00 0.00 ? 19 TYR S HH   2  
ATOM 1279  N N    . PRO A 1 11 ? -7.261  4.391   -4.769  1.00 0.00 ? 20 PRO S N    2  
ATOM 1280  C CA   . PRO A 1 11 ? -6.552  5.087   -5.848  1.00 0.00 ? 20 PRO S CA   2  
ATOM 1281  C C    . PRO A 1 11 ? -5.213  5.656   -5.401  1.00 0.00 ? 20 PRO S C    2  
ATOM 1282  O O    . PRO A 1 11 ? -5.153  6.732   -4.807  1.00 0.00 ? 20 PRO S O    2  
ATOM 1283  C CB   . PRO A 1 11 ? -7.514  6.213   -6.256  1.00 0.00 ? 20 PRO S CB   2  
ATOM 1284  C CG   . PRO A 1 11 ? -8.571  6.236   -5.202  1.00 0.00 ? 20 PRO S CG   2  
ATOM 1285  C CD   . PRO A 1 11 ? -8.654  4.835   -4.672  1.00 0.00 ? 20 PRO S CD   2  
ATOM 1286  H HA   . PRO A 1 11 ? -6.391  4.433   -6.692  1.00 0.00 ? 20 PRO S HA   2  
ATOM 1287  H HB2  . PRO A 1 11 ? -6.977  7.150   -6.295  1.00 0.00 ? 20 PRO S HB2  2  
ATOM 1288  H HB3  . PRO A 1 11 ? -7.935  5.993   -7.228  1.00 0.00 ? 20 PRO S HB3  2  
ATOM 1289  H HG2  . PRO A 1 11 ? -8.284  6.917   -4.416  1.00 0.00 ? 20 PRO S HG2  2  
ATOM 1290  H HG3  . PRO A 1 11 ? -9.516  6.532   -5.632  1.00 0.00 ? 20 PRO S HG3  2  
ATOM 1291  H HD2  . PRO A 1 11 ? -8.991  4.833   -3.645  1.00 0.00 ? 20 PRO S HD2  2  
ATOM 1292  H HD3  . PRO A 1 11 ? -9.298  4.227   -5.291  1.00 0.00 ? 20 PRO S HD3  2  
ATOM 1293  N N    . LEU A 1 12 ? -4.140  4.916   -5.693  1.00 0.00 ? 21 LEU S N    2  
ATOM 1294  C CA   . LEU A 1 12 ? -2.784  5.328   -5.327  1.00 0.00 ? 21 LEU S CA   2  
ATOM 1295  C C    . LEU A 1 12 ? -2.582  6.840   -5.430  1.00 0.00 ? 21 LEU S C    2  
ATOM 1296  O O    . LEU A 1 12 ? -1.882  7.431   -4.614  1.00 0.00 ? 21 LEU S O    2  
ATOM 1297  C CB   . LEU A 1 12 ? -1.760  4.631   -6.220  1.00 0.00 ? 21 LEU S CB   2  
ATOM 1298  C CG   . LEU A 1 12 ? -2.151  4.523   -7.697  1.00 0.00 ? 21 LEU S CG   2  
ATOM 1299  C CD1  . LEU A 1 12 ? -1.623  5.718   -8.477  1.00 0.00 ? 21 LEU S CD1  2  
ATOM 1300  C CD2  . LEU A 1 12 ? -1.628  3.224   -8.292  1.00 0.00 ? 21 LEU S CD2  2  
ATOM 1301  H H    . LEU A 1 12 ? -4.266  4.060   -6.163  1.00 0.00 ? 21 LEU S H    2  
ATOM 1302  H HA   . LEU A 1 12 ? -2.614  5.026   -4.307  1.00 0.00 ? 21 LEU S HA   2  
ATOM 1303  H HB2  . LEU A 1 12 ? -0.831  5.181   -6.156  1.00 0.00 ? 21 LEU S HB2  2  
ATOM 1304  H HB3  . LEU A 1 12 ? -1.601  3.636   -5.840  1.00 0.00 ? 21 LEU S HB3  2  
ATOM 1305  H HG   . LEU A 1 12 ? -3.228  4.520   -7.782  1.00 0.00 ? 21 LEU S HG   2  
ATOM 1306  H HD11 . LEU A 1 12 ? -2.385  6.481   -8.526  1.00 0.00 ? 21 LEU S HD11 2  
ATOM 1307  H HD12 . LEU A 1 12 ? -1.359  5.407   -9.476  1.00 0.00 ? 21 LEU S HD12 2  
ATOM 1308  H HD13 . LEU A 1 12 ? -0.749  6.113   -7.981  1.00 0.00 ? 21 LEU S HD13 2  
ATOM 1309  H HD21 . LEU A 1 12 ? -1.358  3.382   -9.326  1.00 0.00 ? 21 LEU S HD21 2  
ATOM 1310  H HD22 . LEU A 1 12 ? -2.396  2.467   -8.233  1.00 0.00 ? 21 LEU S HD22 2  
ATOM 1311  H HD23 . LEU A 1 12 ? -0.759  2.899   -7.740  1.00 0.00 ? 21 LEU S HD23 2  
ATOM 1312  N N    . ALA A 1 13 ? -3.187  7.458   -6.438  1.00 0.00 ? 22 ALA S N    2  
ATOM 1313  C CA   . ALA A 1 13 ? -3.048  8.899   -6.638  1.00 0.00 ? 22 ALA S CA   2  
ATOM 1314  C C    . ALA A 1 13 ? -3.738  9.678   -5.528  1.00 0.00 ? 22 ALA S C    2  
ATOM 1315  O O    . ALA A 1 13 ? -3.151  10.572  -4.917  1.00 0.00 ? 22 ALA S O    2  
ATOM 1316  C CB   . ALA A 1 13 ? -3.609  9.300   -7.993  1.00 0.00 ? 22 ALA S CB   2  
ATOM 1317  H H    . ALA A 1 13 ? -3.732  6.937   -7.064  1.00 0.00 ? 22 ALA S H    2  
ATOM 1318  H HA   . ALA A 1 13 ? -1.993  9.136   -6.628  1.00 0.00 ? 22 ALA S HA   2  
ATOM 1319  H HB1  . ALA A 1 13 ? -3.037  10.125  -8.390  1.00 0.00 ? 22 ALA S HB1  2  
ATOM 1320  H HB2  . ALA A 1 13 ? -4.641  9.597   -7.882  1.00 0.00 ? 22 ALA S HB2  2  
ATOM 1321  H HB3  . ALA A 1 13 ? -3.547  8.461   -8.671  1.00 0.00 ? 22 ALA S HB3  2  
ATOM 1322  N N    . ASP A 1 14 ? -4.991  9.330   -5.276  1.00 0.00 ? 23 ASP S N    2  
ATOM 1323  C CA   . ASP A 1 14 ? -5.790  9.983   -4.245  1.00 0.00 ? 23 ASP S CA   2  
ATOM 1324  C C    . ASP A 1 14 ? -5.115  9.922   -2.875  1.00 0.00 ? 23 ASP S C    2  
ATOM 1325  O O    . ASP A 1 14 ? -5.468  10.673  -1.967  1.00 0.00 ? 23 ASP S O    2  
ATOM 1326  C CB   . ASP A 1 14 ? -7.150  9.305   -4.161  1.00 0.00 ? 23 ASP S CB   2  
ATOM 1327  C CG   . ASP A 1 14 ? -8.287  10.230  -4.548  1.00 0.00 ? 23 ASP S CG   2  
ATOM 1328  O OD1  . ASP A 1 14 ? -8.356  10.624  -5.732  1.00 0.00 ? 23 ASP S OD1  2  
ATOM 1329  O OD2  . ASP A 1 14 ? -9.110  10.560  -3.668  1.00 0.00 ? 23 ASP S OD2  2  
ATOM 1330  H H    . ASP A 1 14 ? -5.395  8.609   -5.801  1.00 0.00 ? 23 ASP S H    2  
ATOM 1331  H HA   . ASP A 1 14 ? -5.928  11.011  -4.529  1.00 0.00 ? 23 ASP S HA   2  
ATOM 1332  H HB2  . ASP A 1 14 ? -7.155  8.456   -4.828  1.00 0.00 ? 23 ASP S HB2  2  
ATOM 1333  H HB3  . ASP A 1 14 ? -7.311  8.965   -3.148  1.00 0.00 ? 23 ASP S HB3  2  
ATOM 1334  N N    . LEU A 1 15 ? -4.174  9.003   -2.724  1.00 0.00 ? 24 LEU S N    2  
ATOM 1335  C CA   . LEU A 1 15 ? -3.480  8.817   -1.453  1.00 0.00 ? 24 LEU S CA   2  
ATOM 1336  C C    . LEU A 1 15 ? -2.000  9.144   -1.554  1.00 0.00 ? 24 LEU S C    2  
ATOM 1337  O O    . LEU A 1 15 ? -1.347  9.432   -0.552  1.00 0.00 ? 24 LEU S O    2  
ATOM 1338  C CB   . LEU A 1 15 ? -3.642  7.372   -0.993  1.00 0.00 ? 24 LEU S CB   2  
ATOM 1339  C CG   . LEU A 1 15 ? -3.561  6.337   -2.122  1.00 0.00 ? 24 LEU S CG   2  
ATOM 1340  C CD1  . LEU A 1 15 ? -2.453  5.334   -1.861  1.00 0.00 ? 24 LEU S CD1  2  
ATOM 1341  C CD2  . LEU A 1 15 ? -4.897  5.640   -2.297  1.00 0.00 ? 24 LEU S CD2  2  
ATOM 1342  H H    . LEU A 1 15 ? -3.956  8.418   -3.477  1.00 0.00 ? 24 LEU S H    2  
ATOM 1343  H HA   . LEU A 1 15 ? -3.929  9.466   -0.728  1.00 0.00 ? 24 LEU S HA   2  
ATOM 1344  H HB2  . LEU A 1 15 ? -2.869  7.157   -0.271  1.00 0.00 ? 24 LEU S HB2  2  
ATOM 1345  H HB3  . LEU A 1 15 ? -4.603  7.274   -0.511  1.00 0.00 ? 24 LEU S HB3  2  
ATOM 1346  H HG   . LEU A 1 15 ? -3.328  6.840   -3.044  1.00 0.00 ? 24 LEU S HG   2  
ATOM 1347  H HD11 . LEU A 1 15 ? -1.697  5.427   -2.627  1.00 0.00 ? 24 LEU S HD11 2  
ATOM 1348  H HD12 . LEU A 1 15 ? -2.859  4.333   -1.879  1.00 0.00 ? 24 LEU S HD12 2  
ATOM 1349  H HD13 . LEU A 1 15 ? -2.012  5.527   -0.898  1.00 0.00 ? 24 LEU S HD13 2  
ATOM 1350  H HD21 . LEU A 1 15 ? -5.645  6.367   -2.575  1.00 0.00 ? 24 LEU S HD21 2  
ATOM 1351  H HD22 . LEU A 1 15 ? -5.181  5.166   -1.369  1.00 0.00 ? 24 LEU S HD22 2  
ATOM 1352  H HD23 . LEU A 1 15 ? -4.813  4.893   -3.071  1.00 0.00 ? 24 LEU S HD23 2  
ATOM 1353  N N    . LEU A 1 16 ? -1.469  9.063   -2.760  1.00 0.00 ? 25 LEU S N    2  
ATOM 1354  C CA   . LEU A 1 16 ? -0.058  9.317   -2.982  1.00 0.00 ? 25 LEU S CA   2  
ATOM 1355  C C    . LEU A 1 16 ? 0.371   10.706  -2.504  1.00 0.00 ? 25 LEU S C    2  
ATOM 1356  O O    . LEU A 1 16 ? 1.559   10.937  -2.270  1.00 0.00 ? 25 LEU S O    2  
ATOM 1357  C CB   . LEU A 1 16 ? 0.279   9.119   -4.458  1.00 0.00 ? 25 LEU S CB   2  
ATOM 1358  C CG   . LEU A 1 16 ? 1.721   9.446   -4.840  1.00 0.00 ? 25 LEU S CG   2  
ATOM 1359  C CD1  . LEU A 1 16 ? 2.677   8.680   -3.942  1.00 0.00 ? 25 LEU S CD1  2  
ATOM 1360  C CD2  . LEU A 1 16 ? 1.973   9.118   -6.304  1.00 0.00 ? 25 LEU S CD2  2  
ATOM 1361  H H    . LEU A 1 16 ? -2.035  8.804   -3.518  1.00 0.00 ? 25 LEU S H    2  
ATOM 1362  H HA   . LEU A 1 16 ? 0.489   8.583   -2.409  1.00 0.00 ? 25 LEU S HA   2  
ATOM 1363  H HB2  . LEU A 1 16 ? 0.092   8.083   -4.703  1.00 0.00 ? 25 LEU S HB2  2  
ATOM 1364  H HB3  . LEU A 1 16 ? -0.380  9.738   -5.045  1.00 0.00 ? 25 LEU S HB3  2  
ATOM 1365  H HG   . LEU A 1 16 ? 1.897   10.501  -4.694  1.00 0.00 ? 25 LEU S HG   2  
ATOM 1366  H HD11 . LEU A 1 16 ? 3.330   8.067   -4.546  1.00 0.00 ? 25 LEU S HD11 2  
ATOM 1367  H HD12 . LEU A 1 16 ? 2.109   8.050   -3.273  1.00 0.00 ? 25 LEU S HD12 2  
ATOM 1368  H HD13 . LEU A 1 16 ? 3.266   9.377   -3.367  1.00 0.00 ? 25 LEU S HD13 2  
ATOM 1369  H HD21 . LEU A 1 16 ? 2.973   8.726   -6.418  1.00 0.00 ? 25 LEU S HD21 2  
ATOM 1370  H HD22 . LEU A 1 16 ? 1.868   10.013  -6.898  1.00 0.00 ? 25 LEU S HD22 2  
ATOM 1371  H HD23 . LEU A 1 16 ? 1.258   8.379   -6.637  1.00 0.00 ? 25 LEU S HD23 2  
ATOM 1372  N N    . ALA A 1 17 ? -0.585  11.626  -2.345  1.00 0.00 ? 26 ALA S N    2  
ATOM 1373  C CA   . ALA A 1 17 ? -0.263  12.986  -1.876  1.00 0.00 ? 26 ALA S CA   2  
ATOM 1374  C C    . ALA A 1 17 ? -1.416  13.970  -2.088  1.00 0.00 ? 26 ALA S C    2  
ATOM 1375  O O    . ALA A 1 17 ? -1.195  15.120  -2.466  1.00 0.00 ? 26 ALA S O    2  
ATOM 1376  C CB   . ALA A 1 17 ? 0.989   13.509  -2.570  1.00 0.00 ? 26 ALA S CB   2  
ATOM 1377  H H    . ALA A 1 17 ? -1.519  11.386  -2.535  1.00 0.00 ? 26 ALA S H    2  
ATOM 1378  H HA   . ALA A 1 17 ? -0.053  12.925  -0.819  1.00 0.00 ? 26 ALA S HA   2  
ATOM 1379  H HB1  . ALA A 1 17 ? 1.015   13.147  -3.588  1.00 0.00 ? 26 ALA S HB1  2  
ATOM 1380  H HB2  . ALA A 1 17 ? 1.864   13.161  -2.041  1.00 0.00 ? 26 ALA S HB2  2  
ATOM 1381  H HB3  . ALA A 1 17 ? 0.974   14.589  -2.572  1.00 0.00 ? 26 ALA S HB3  2  
ATOM 1382  N N    . ARG A 1 18 ? -2.640  13.522  -1.845  1.00 0.00 ? 27 ARG S N    2  
ATOM 1383  C CA   . ARG A 1 18 ? -3.814  14.376  -2.011  1.00 0.00 ? 27 ARG S CA   2  
ATOM 1384  C C    . ARG A 1 18 ? -4.928  13.959  -1.056  1.00 0.00 ? 27 ARG S C    2  
ATOM 1385  O O    . ARG A 1 18 ? -4.974  12.805  -0.641  1.00 0.00 ? 27 ARG S O    2  
ATOM 1386  C CB   . ARG A 1 18 ? -4.311  14.325  -3.457  1.00 0.00 ? 27 ARG S CB   2  
ATOM 1387  C CG   . ARG A 1 18 ? -5.180  13.115  -3.761  1.00 0.00 ? 27 ARG S CG   2  
ATOM 1388  C CD   . ARG A 1 18 ? -6.487  13.513  -4.425  1.00 0.00 ? 27 ARG S CD   2  
ATOM 1389  N NE   . ARG A 1 18 ? -6.333  13.714  -5.864  1.00 0.00 ? 27 ARG S NE   2  
ATOM 1390  C CZ   . ARG A 1 18 ? -7.196  14.397  -6.613  1.00 0.00 ? 27 ARG S CZ   2  
ATOM 1391  N NH1  . ARG A 1 18 ? -8.273  14.946  -6.063  1.00 0.00 ? 27 ARG S NH1  2  
ATOM 1392  N NH2  . ARG A 1 18 ? -6.981  14.533  -7.914  1.00 0.00 ? 27 ARG S NH2  2  
ATOM 1393  H H    . ARG A 1 18 ? -2.761  12.596  -1.544  1.00 0.00 ? 27 ARG S H    2  
ATOM 1394  H HA   . ARG A 1 18 ? -3.520  15.389  -1.778  1.00 0.00 ? 27 ARG S HA   2  
ATOM 1395  H HB2  . ARG A 1 18 ? -4.888  15.216  -3.657  1.00 0.00 ? 27 ARG S HB2  2  
ATOM 1396  H HB3  . ARG A 1 18 ? -3.458  14.305  -4.118  1.00 0.00 ? 27 ARG S HB3  2  
ATOM 1397  H HG2  . ARG A 1 18 ? -4.640  12.453  -4.414  1.00 0.00 ? 27 ARG S HG2  2  
ATOM 1398  H HG3  . ARG A 1 18 ? -5.401  12.602  -2.840  1.00 0.00 ? 27 ARG S HG3  2  
ATOM 1399  H HD2  . ARG A 1 18 ? -7.212  12.731  -4.254  1.00 0.00 ? 27 ARG S HD2  2  
ATOM 1400  H HD3  . ARG A 1 18 ? -6.835  14.433  -3.977  1.00 0.00 ? 27 ARG S HD3  2  
ATOM 1401  H HE   . ARG A 1 18 ? -5.547  13.319  -6.296  1.00 0.00 ? 27 ARG S HE   2  
ATOM 1402  H HH11 . ARG A 1 18 ? -8.441  14.847  -5.083  1.00 0.00 ? 27 ARG S HH11 2  
ATOM 1403  H HH12 . ARG A 1 18 ? -8.917  15.459  -6.631  1.00 0.00 ? 27 ARG S HH12 2  
ATOM 1404  H HH21 . ARG A 1 18 ? -6.172  14.123  -8.333  1.00 0.00 ? 27 ARG S HH21 2  
ATOM 1405  H HH22 . ARG A 1 18 ? -7.630  15.046  -8.477  1.00 0.00 ? 27 ARG S HH22 2  
ATOM 1406  N N    . PRO A 1 19 ? -5.850  14.889  -0.715  1.00 0.00 ? 28 PRO S N    2  
ATOM 1407  C CA   . PRO A 1 19 ? -6.986  14.613  0.173   1.00 0.00 ? 28 PRO S CA   2  
ATOM 1408  C C    . PRO A 1 19 ? -7.530  13.188  0.021   1.00 0.00 ? 28 PRO S C    2  
ATOM 1409  O O    . PRO A 1 19 ? -8.643  12.968  -0.456  1.00 0.00 ? 28 PRO S O    2  
ATOM 1410  C CB   . PRO A 1 19 ? -8.015  15.639  -0.291  1.00 0.00 ? 28 PRO S CB   2  
ATOM 1411  C CG   . PRO A 1 19 ? -7.200  16.819  -0.708  1.00 0.00 ? 28 PRO S CG   2  
ATOM 1412  C CD   . PRO A 1 19 ? -5.872  16.284  -1.196  1.00 0.00 ? 28 PRO S CD   2  
ATOM 1413  H HA   . PRO A 1 19 ? -6.735  14.795  1.207   1.00 0.00 ? 28 PRO S HA   2  
ATOM 1414  H HB2  . PRO A 1 19 ? -8.583  15.235  -1.119  1.00 0.00 ? 28 PRO S HB2  2  
ATOM 1415  H HB3  . PRO A 1 19 ? -8.677  15.886  0.527   1.00 0.00 ? 28 PRO S HB3  2  
ATOM 1416  H HG2  . PRO A 1 19 ? -7.703  17.346  -1.505  1.00 0.00 ? 28 PRO S HG2  2  
ATOM 1417  H HG3  . PRO A 1 19 ? -7.049  17.475  0.137   1.00 0.00 ? 28 PRO S HG3  2  
ATOM 1418  H HD2  . PRO A 1 19 ? -5.827  16.317  -2.275  1.00 0.00 ? 28 PRO S HD2  2  
ATOM 1419  H HD3  . PRO A 1 19 ? -5.058  16.852  -0.766  1.00 0.00 ? 28 PRO S HD3  2  
ATOM 1420  N N    . LEU A 1 20 ? -6.701  12.240  0.429   1.00 0.00 ? 29 LEU S N    2  
ATOM 1421  C CA   . LEU A 1 20 ? -7.008  10.818  0.362   1.00 0.00 ? 29 LEU S CA   2  
ATOM 1422  C C    . LEU A 1 20 ? -8.126  10.407  1.322   1.00 0.00 ? 29 LEU S C    2  
ATOM 1423  O O    . LEU A 1 20 ? -8.411  11.091  2.306   1.00 0.00 ? 29 LEU S O    2  
ATOM 1424  C CB   . LEU A 1 20 ? -5.735  10.028  0.678   1.00 0.00 ? 29 LEU S CB   2  
ATOM 1425  C CG   . LEU A 1 20 ? -5.355  9.927   2.161   1.00 0.00 ? 29 LEU S CG   2  
ATOM 1426  C CD1  . LEU A 1 20 ? -3.957  9.348   2.309   1.00 0.00 ? 29 LEU S CD1  2  
ATOM 1427  C CD2  . LEU A 1 20 ? -5.431  11.291  2.836   1.00 0.00 ? 29 LEU S CD2  2  
ATOM 1428  H H    . LEU A 1 20 ? -5.827  12.510  0.773   1.00 0.00 ? 29 LEU S H    2  
ATOM 1429  H HA   . LEU A 1 20 ? -7.315  10.592  -0.646  1.00 0.00 ? 29 LEU S HA   2  
ATOM 1430  H HB2  . LEU A 1 20 ? -5.849  9.025   0.290   1.00 0.00 ? 29 LEU S HB2  2  
ATOM 1431  H HB3  . LEU A 1 20 ? -4.915  10.506  0.160   1.00 0.00 ? 29 LEU S HB3  2  
ATOM 1432  H HG   . LEU A 1 20 ? -6.047  9.265   2.661   1.00 0.00 ? 29 LEU S HG   2  
ATOM 1433  H HD11 . LEU A 1 20 ? -3.237  10.152  2.351   1.00 0.00 ? 29 LEU S HD11 2  
ATOM 1434  H HD12 . LEU A 1 20 ? -3.739  8.715   1.464   1.00 0.00 ? 29 LEU S HD12 2  
ATOM 1435  H HD13 . LEU A 1 20 ? -3.902  8.769   3.219   1.00 0.00 ? 29 LEU S HD13 2  
ATOM 1436  H HD21 . LEU A 1 20 ? -6.404  11.723  2.672   1.00 0.00 ? 29 LEU S HD21 2  
ATOM 1437  H HD22 . LEU A 1 20 ? -4.673  11.939  2.421   1.00 0.00 ? 29 LEU S HD22 2  
ATOM 1438  H HD23 . LEU A 1 20 ? -5.263  11.176  3.897   1.00 0.00 ? 29 LEU S HD23 2  
ATOM 1439  N N    . PRO A 1 21 ? -8.780  9.266   1.024   1.00 0.00 ? 30 PRO S N    2  
ATOM 1440  C CA   . PRO A 1 21 ? -9.881  8.726   1.835   1.00 0.00 ? 30 PRO S CA   2  
ATOM 1441  C C    . PRO A 1 21 ? -9.461  8.404   3.262   1.00 0.00 ? 30 PRO S C    2  
ATOM 1442  O O    . PRO A 1 21 ? -8.408  8.839   3.726   1.00 0.00 ? 30 PRO S O    2  
ATOM 1443  C CB   . PRO A 1 21 ? -10.273 7.441   1.096   1.00 0.00 ? 30 PRO S CB   2  
ATOM 1444  C CG   . PRO A 1 21 ? -9.080  7.096   0.282   1.00 0.00 ? 30 PRO S CG   2  
ATOM 1445  C CD   . PRO A 1 21 ? -8.498  8.408   -0.139  1.00 0.00 ? 30 PRO S CD   2  
ATOM 1446  H HA   . PRO A 1 21 ? -10.718 9.400   1.853   1.00 0.00 ? 30 PRO S HA   2  
ATOM 1447  H HB2  . PRO A 1 21 ? -10.501 6.664   1.814   1.00 0.00 ? 30 PRO S HB2  2  
ATOM 1448  H HB3  . PRO A 1 21 ? -11.135 7.629   0.474   1.00 0.00 ? 30 PRO S HB3  2  
ATOM 1449  H HG2  . PRO A 1 21 ? -8.370  6.550   0.885   1.00 0.00 ? 30 PRO S HG2  2  
ATOM 1450  H HG3  . PRO A 1 21 ? -9.373  6.518   -0.584  1.00 0.00 ? 30 PRO S HG3  2  
ATOM 1451  H HD2  . PRO A 1 21 ? -7.437  8.316   -0.309  1.00 0.00 ? 30 PRO S HD2  2  
ATOM 1452  H HD3  . PRO A 1 21 ? -8.998  8.780   -1.020  1.00 0.00 ? 30 PRO S HD3  2  
ATOM 1453  N N    . GLU A 1 22 ? -10.296 7.632   3.954   1.00 0.00 ? 31 GLU S N    2  
ATOM 1454  C CA   . GLU A 1 22 ? -10.012 7.246   5.330   1.00 0.00 ? 31 GLU S CA   2  
ATOM 1455  C C    . GLU A 1 22 ? -9.547  5.802   5.406   1.00 0.00 ? 31 GLU S C    2  
ATOM 1456  O O    . GLU A 1 22 ? -8.611  5.490   6.142   1.00 0.00 ? 31 GLU S O    2  
ATOM 1457  C CB   . GLU A 1 22 ? -11.237 7.462   6.220   1.00 0.00 ? 31 GLU S CB   2  
ATOM 1458  C CG   . GLU A 1 22 ? -10.892 7.704   7.681   1.00 0.00 ? 31 GLU S CG   2  
ATOM 1459  C CD   . GLU A 1 22 ? -10.305 6.477   8.351   1.00 0.00 ? 31 GLU S CD   2  
ATOM 1460  O OE1  . GLU A 1 22 ? -10.871 5.377   8.177   1.00 0.00 ? 31 GLU S OE1  2  
ATOM 1461  O OE2  . GLU A 1 22 ? -9.280  6.616   9.051   1.00 0.00 ? 31 GLU S OE2  2  
ATOM 1462  H H    . GLU A 1 22 ? -11.121 7.316   3.529   1.00 0.00 ? 31 GLU S H    2  
ATOM 1463  H HA   . GLU A 1 22 ? -9.203  7.870   5.677   1.00 0.00 ? 31 GLU S HA   2  
ATOM 1464  H HB2  . GLU A 1 22 ? -11.786 8.317   5.854   1.00 0.00 ? 31 GLU S HB2  2  
ATOM 1465  H HB3  . GLU A 1 22 ? -11.867 6.588   6.161   1.00 0.00 ? 31 GLU S HB3  2  
ATOM 1466  H HG2  . GLU A 1 22 ? -10.171 8.506   7.739   1.00 0.00 ? 31 GLU S HG2  2  
ATOM 1467  H HG3  . GLU A 1 22 ? -11.791 7.990   8.207   1.00 0.00 ? 31 GLU S HG3  2  
ATOM 1468  N N    . GLY A 1 23 ? -10.170 4.922   4.621   1.00 0.00 ? 32 GLY S N    2  
ATOM 1469  C CA   . GLY A 1 23 ? -9.747  3.531   4.613   1.00 0.00 ? 32 GLY S CA   2  
ATOM 1470  C C    . GLY A 1 23 ? -8.241  3.443   4.462   1.00 0.00 ? 32 GLY S C    2  
ATOM 1471  O O    . GLY A 1 23 ? -7.601  2.506   4.938   1.00 0.00 ? 32 GLY S O    2  
ATOM 1472  H H    . GLY A 1 23 ? -10.892 5.221   4.030   1.00 0.00 ? 32 GLY S H    2  
ATOM 1473  H HA2  . GLY A 1 23 ? -10.042 3.064   5.544   1.00 0.00 ? 32 GLY S HA2  2  
ATOM 1474  H HA3  . GLY A 1 23 ? -10.218 3.018   3.789   1.00 0.00 ? 32 GLY S HA3  2  
ATOM 1475  N N    . VAL A 1 24 ? -7.686  4.464   3.812   1.00 0.00 ? 33 VAL S N    2  
ATOM 1476  C CA   . VAL A 1 24 ? -6.257  4.579   3.598   1.00 0.00 ? 33 VAL S CA   2  
ATOM 1477  C C    . VAL A 1 24 ? -5.590  5.101   4.870   1.00 0.00 ? 33 VAL S C    2  
ATOM 1478  O O    . VAL A 1 24 ? -5.752  6.269   5.227   1.00 0.00 ? 33 VAL S O    2  
ATOM 1479  C CB   . VAL A 1 24 ? -5.976  5.540   2.410   1.00 0.00 ? 33 VAL S CB   2  
ATOM 1480  C CG1  . VAL A 1 24 ? -4.877  6.547   2.721   1.00 0.00 ? 33 VAL S CG1  2  
ATOM 1481  C CG2  . VAL A 1 24 ? -5.637  4.761   1.155   1.00 0.00 ? 33 VAL S CG2  2  
ATOM 1482  H H    . VAL A 1 24 ? -8.265  5.182   3.482   1.00 0.00 ? 33 VAL S H    2  
ATOM 1483  H HA   . VAL A 1 24 ? -5.867  3.602   3.358   1.00 0.00 ? 33 VAL S HA   2  
ATOM 1484  H HB   . VAL A 1 24 ? -6.882  6.096   2.216   1.00 0.00 ? 33 VAL S HB   2  
ATOM 1485  H HG11 . VAL A 1 24 ? -5.281  7.343   3.331   1.00 0.00 ? 33 VAL S HG11 2  
ATOM 1486  H HG12 . VAL A 1 24 ? -4.498  6.959   1.798   1.00 0.00 ? 33 VAL S HG12 2  
ATOM 1487  H HG13 . VAL A 1 24 ? -4.077  6.058   3.251   1.00 0.00 ? 33 VAL S HG13 2  
ATOM 1488  H HG21 . VAL A 1 24 ? -4.578  4.835   0.962   1.00 0.00 ? 33 VAL S HG21 2  
ATOM 1489  H HG22 . VAL A 1 24 ? -6.186  5.175   0.321   1.00 0.00 ? 33 VAL S HG22 2  
ATOM 1490  H HG23 . VAL A 1 24 ? -5.910  3.725   1.289   1.00 0.00 ? 33 VAL S HG23 2  
ATOM 1491  N N    . ASP A 1 25 ? -4.847  4.243   5.557   1.00 0.00 ? 34 ASP S N    2  
ATOM 1492  C CA   . ASP A 1 25 ? -4.176  4.650   6.781   1.00 0.00 ? 34 ASP S CA   2  
ATOM 1493  C C    . ASP A 1 25 ? -2.792  5.211   6.454   1.00 0.00 ? 34 ASP S C    2  
ATOM 1494  O O    . ASP A 1 25 ? -1.997  4.555   5.783   1.00 0.00 ? 34 ASP S O    2  
ATOM 1495  C CB   . ASP A 1 25 ? -4.057  3.472   7.748   1.00 0.00 ? 34 ASP S CB   2  
ATOM 1496  C CG   . ASP A 1 25 ? -5.323  2.638   7.804   1.00 0.00 ? 34 ASP S CG   2  
ATOM 1497  O OD1  . ASP A 1 25 ? -5.539  1.824   6.880   1.00 0.00 ? 34 ASP S OD1  2  
ATOM 1498  O OD2  . ASP A 1 25 ? -6.098  2.800   8.769   1.00 0.00 ? 34 ASP S OD2  2  
ATOM 1499  H H    . ASP A 1 25 ? -4.747  3.321   5.240   1.00 0.00 ? 34 ASP S H    2  
ATOM 1500  H HA   . ASP A 1 25 ? -4.774  5.427   7.237   1.00 0.00 ? 34 ASP S HA   2  
ATOM 1501  H HB2  . ASP A 1 25 ? -3.243  2.836   7.431   1.00 0.00 ? 34 ASP S HB2  2  
ATOM 1502  H HB3  . ASP A 1 25 ? -3.853  3.848   8.740   1.00 0.00 ? 34 ASP S HB3  2  
ATOM 1503  N N    . PRO A 1 26 ? -2.491  6.440   6.908   1.00 0.00 ? 35 PRO S N    2  
ATOM 1504  C CA   . PRO A 1 26 ? -1.201  7.084   6.639   1.00 0.00 ? 35 PRO S CA   2  
ATOM 1505  C C    . PRO A 1 26 ? -0.010  6.296   7.181   1.00 0.00 ? 35 PRO S C    2  
ATOM 1506  O O    . PRO A 1 26 ? 1.077   6.332   6.605   1.00 0.00 ? 35 PRO S O    2  
ATOM 1507  C CB   . PRO A 1 26 ? -1.312  8.440   7.349   1.00 0.00 ? 35 PRO S CB   2  
ATOM 1508  C CG   . PRO A 1 26 ? -2.427  8.279   8.326   1.00 0.00 ? 35 PRO S CG   2  
ATOM 1509  C CD   . PRO A 1 26 ? -3.379  7.304   7.702   1.00 0.00 ? 35 PRO S CD   2  
ATOM 1510  H HA   . PRO A 1 26 ? -1.064  7.246   5.578   1.00 0.00 ? 35 PRO S HA   2  
ATOM 1511  H HB2  . PRO A 1 26 ? -0.381  8.665   7.848   1.00 0.00 ? 35 PRO S HB2  2  
ATOM 1512  H HB3  . PRO A 1 26 ? -1.534  9.211   6.624   1.00 0.00 ? 35 PRO S HB3  2  
ATOM 1513  H HG2  . PRO A 1 26 ? -2.045  7.890   9.258   1.00 0.00 ? 35 PRO S HG2  2  
ATOM 1514  H HG3  . PRO A 1 26 ? -2.915  9.229   8.487   1.00 0.00 ? 35 PRO S HG3  2  
ATOM 1515  H HD2  . PRO A 1 26 ? -3.892  6.734   8.466   1.00 0.00 ? 35 PRO S HD2  2  
ATOM 1516  H HD3  . PRO A 1 26 ? -4.087  7.816   7.067   1.00 0.00 ? 35 PRO S HD3  2  
ATOM 1517  N N    . LEU A 1 27 ? -0.210  5.600   8.297   1.00 0.00 ? 36 LEU S N    2  
ATOM 1518  C CA   . LEU A 1 27 ? 0.870   4.827   8.906   1.00 0.00 ? 36 LEU S CA   2  
ATOM 1519  C C    . LEU A 1 27 ? 1.133   3.518   8.156   1.00 0.00 ? 36 LEU S C    2  
ATOM 1520  O O    . LEU A 1 27 ? 2.212   2.942   8.275   1.00 0.00 ? 36 LEU S O    2  
ATOM 1521  C CB   . LEU A 1 27 ? 0.587   4.566   10.397  1.00 0.00 ? 36 LEU S CB   2  
ATOM 1522  C CG   . LEU A 1 27 ? -0.454  3.486   10.723  1.00 0.00 ? 36 LEU S CG   2  
ATOM 1523  C CD1  . LEU A 1 27 ? -1.771  3.768   10.022  1.00 0.00 ? 36 LEU S CD1  2  
ATOM 1524  C CD2  . LEU A 1 27 ? 0.065   2.104   10.356  1.00 0.00 ? 36 LEU S CD2  2  
ATOM 1525  H H    . LEU A 1 27 ? -1.091  5.618   8.722   1.00 0.00 ? 36 LEU S H    2  
ATOM 1526  H HA   . LEU A 1 27 ? 1.763   5.431   8.836   1.00 0.00 ? 36 LEU S HA   2  
ATOM 1527  H HB2  . LEU A 1 27 ? 1.518   4.282   10.867  1.00 0.00 ? 36 LEU S HB2  2  
ATOM 1528  H HB3  . LEU A 1 27 ? 0.254   5.495   10.840  1.00 0.00 ? 36 LEU S HB3  2  
ATOM 1529  H HG   . LEU A 1 27 ? -0.641  3.496   11.788  1.00 0.00 ? 36 LEU S HG   2  
ATOM 1530  H HD11 . LEU A 1 27 ? -2.082  4.780   10.233  1.00 0.00 ? 36 LEU S HD11 2  
ATOM 1531  H HD12 . LEU A 1 27 ? -2.524  3.079   10.379  1.00 0.00 ? 36 LEU S HD12 2  
ATOM 1532  H HD13 . LEU A 1 27 ? -1.648  3.644   8.958   1.00 0.00 ? 36 LEU S HD13 2  
ATOM 1533  H HD21 . LEU A 1 27 ? 1.130   2.151   10.178  1.00 0.00 ? 36 LEU S HD21 2  
ATOM 1534  H HD22 . LEU A 1 27 ? -0.434  1.764   9.463   1.00 0.00 ? 36 LEU S HD22 2  
ATOM 1535  H HD23 . LEU A 1 27 ? -0.137  1.417   11.164  1.00 0.00 ? 36 LEU S HD23 2  
ATOM 1536  N N    . LYS A 1 28 ? 0.157   3.057   7.376   1.00 0.00 ? 37 LYS S N    2  
ATOM 1537  C CA   . LYS A 1 28 ? 0.321   1.822   6.606   1.00 0.00 ? 37 LYS S CA   2  
ATOM 1538  C C    . LYS A 1 28 ? -0.268  1.980   5.210   1.00 0.00 ? 37 LYS S C    2  
ATOM 1539  O O    . LYS A 1 28 ? -1.455  1.747   4.992   1.00 0.00 ? 37 LYS S O    2  
ATOM 1540  C CB   . LYS A 1 28 ? -0.326  0.631   7.322   1.00 0.00 ? 37 LYS S CB   2  
ATOM 1541  C CG   . LYS A 1 28 ? -1.801  0.820   7.643   1.00 0.00 ? 37 LYS S CG   2  
ATOM 1542  C CD   . LYS A 1 28 ? -2.376  -0.391  8.363   1.00 0.00 ? 37 LYS S CD   2  
ATOM 1543  C CE   . LYS A 1 28 ? -2.632  -0.099  9.832   1.00 0.00 ? 37 LYS S CE   2  
ATOM 1544  N NZ   . LYS A 1 28 ? -2.562  -1.332  10.666  1.00 0.00 ? 37 LYS S NZ   2  
ATOM 1545  H H    . LYS A 1 28 ? -0.682  3.558   7.306   1.00 0.00 ? 37 LYS S H    2  
ATOM 1546  H HA   . LYS A 1 28 ? 1.380   1.638   6.511   1.00 0.00 ? 37 LYS S HA   2  
ATOM 1547  H HB2  . LYS A 1 28 ? -0.227  -0.243  6.695   1.00 0.00 ? 37 LYS S HB2  2  
ATOM 1548  H HB3  . LYS A 1 28 ? 0.202   0.456   8.250   1.00 0.00 ? 37 LYS S HB3  2  
ATOM 1549  H HG2  . LYS A 1 28 ? -1.916  1.688   8.273   1.00 0.00 ? 37 LYS S HG2  2  
ATOM 1550  H HG3  . LYS A 1 28 ? -2.345  0.969   6.723   1.00 0.00 ? 37 LYS S HG3  2  
ATOM 1551  H HD2  . LYS A 1 28 ? -3.308  -0.669  7.893   1.00 0.00 ? 37 LYS S HD2  2  
ATOM 1552  H HD3  . LYS A 1 28 ? -1.674  -1.210  8.284   1.00 0.00 ? 37 LYS S HD3  2  
ATOM 1553  H HE2  . LYS A 1 28 ? -1.891  0.602   10.183  1.00 0.00 ? 37 LYS S HE2  2  
ATOM 1554  H HE3  . LYS A 1 28 ? -3.615  0.337   9.933   1.00 0.00 ? 37 LYS S HE3  2  
ATOM 1555  H HZ1  . LYS A 1 28 ? -3.520  -1.701  10.839  1.00 0.00 ? 37 LYS S HZ1  2  
ATOM 1556  H HZ2  . LYS A 1 28 ? -2.113  -1.121  11.579  1.00 0.00 ? 37 LYS S HZ2  2  
ATOM 1557  H HZ3  . LYS A 1 28 ? -2.005  -2.063  10.178  1.00 0.00 ? 37 LYS S HZ3  2  
ATOM 1558  N N    . LEU A 1 29 ? 0.569   2.394   4.269   1.00 0.00 ? 38 LEU S N    2  
ATOM 1559  C CA   . LEU A 1 29 ? 0.129   2.600   2.897   1.00 0.00 ? 38 LEU S CA   2  
ATOM 1560  C C    . LEU A 1 29 ? 0.224   1.326   2.067   1.00 0.00 ? 38 LEU S C    2  
ATOM 1561  O O    . LEU A 1 29 ? -0.777  0.848   1.534   1.00 0.00 ? 38 LEU S O    2  
ATOM 1562  C CB   . LEU A 1 29 ? 0.941   3.722   2.247   1.00 0.00 ? 38 LEU S CB   2  
ATOM 1563  C CG   . LEU A 1 29 ? 1.085   5.001   3.084   1.00 0.00 ? 38 LEU S CG   2  
ATOM 1564  C CD1  . LEU A 1 29 ? 1.565   6.150   2.215   1.00 0.00 ? 38 LEU S CD1  2  
ATOM 1565  C CD2  . LEU A 1 29 ? -0.227  5.373   3.769   1.00 0.00 ? 38 LEU S CD2  2  
ATOM 1566  H H    . LEU A 1 29 ? 1.502   2.577   4.504   1.00 0.00 ? 38 LEU S H    2  
ATOM 1567  H HA   . LEU A 1 29 ? -0.901  2.898   2.935   1.00 0.00 ? 38 LEU S HA   2  
ATOM 1568  H HB2  . LEU A 1 29 ? 1.933   3.341   2.040   1.00 0.00 ? 38 LEU S HB2  2  
ATOM 1569  H HB3  . LEU A 1 29 ? 0.471   3.981   1.311   1.00 0.00 ? 38 LEU S HB3  2  
ATOM 1570  H HG   . LEU A 1 29 ? 1.828   4.835   3.853   1.00 0.00 ? 38 LEU S HG   2  
ATOM 1571  H HD11 . LEU A 1 29 ? 2.265   6.751   2.773   1.00 0.00 ? 38 LEU S HD11 2  
ATOM 1572  H HD12 . LEU A 1 29 ? 0.721   6.757   1.923   1.00 0.00 ? 38 LEU S HD12 2  
ATOM 1573  H HD13 . LEU A 1 29 ? 2.047   5.755   1.333   1.00 0.00 ? 38 LEU S HD13 2  
ATOM 1574  H HD21 . LEU A 1 29 ? -0.771  6.070   3.150   1.00 0.00 ? 38 LEU S HD21 2  
ATOM 1575  H HD22 . LEU A 1 29 ? -0.014  5.833   4.721   1.00 0.00 ? 38 LEU S HD22 2  
ATOM 1576  H HD23 . LEU A 1 29 ? -0.823  4.490   3.924   1.00 0.00 ? 38 LEU S HD23 2  
ATOM 1577  N N    . GLU A 1 30 ? 1.433   0.789   1.948   1.00 0.00 ? 39 GLU S N    2  
ATOM 1578  C CA   . GLU A 1 30 ? 1.670   -0.426  1.168   1.00 0.00 ? 39 GLU S CA   2  
ATOM 1579  C C    . GLU A 1 30 ? 0.582   -1.481  1.392   1.00 0.00 ? 39 GLU S C    2  
ATOM 1580  O O    . GLU A 1 30 ? 0.344   -2.324  0.527   1.00 0.00 ? 39 GLU S O    2  
ATOM 1581  C CB   . GLU A 1 30 ? 3.038   -1.017  1.519   1.00 0.00 ? 39 GLU S CB   2  
ATOM 1582  C CG   . GLU A 1 30 ? 3.133   -1.525  2.949   1.00 0.00 ? 39 GLU S CG   2  
ATOM 1583  C CD   . GLU A 1 30 ? 3.895   -2.832  3.053   1.00 0.00 ? 39 GLU S CD   2  
ATOM 1584  O OE1  . GLU A 1 30 ? 3.897   -3.600  2.068   1.00 0.00 ? 39 GLU S OE1  2  
ATOM 1585  O OE2  . GLU A 1 30 ? 4.491   -3.088  4.121   1.00 0.00 ? 39 GLU S OE2  2  
ATOM 1586  H H    . GLU A 1 30 ? 2.194   1.227   2.388   1.00 0.00 ? 39 GLU S H    2  
ATOM 1587  H HA   . GLU A 1 30 ? 1.671   -0.149  0.126   1.00 0.00 ? 39 GLU S HA   2  
ATOM 1588  H HB2  . GLU A 1 30 ? 3.242   -1.843  0.852   1.00 0.00 ? 39 GLU S HB2  2  
ATOM 1589  H HB3  . GLU A 1 30 ? 3.793   -0.255  1.379   1.00 0.00 ? 39 GLU S HB3  2  
ATOM 1590  H HG2  . GLU A 1 30 ? 3.638   -0.783  3.548   1.00 0.00 ? 39 GLU S HG2  2  
ATOM 1591  H HG3  . GLU A 1 30 ? 2.134   -1.676  3.331   1.00 0.00 ? 39 GLU S HG3  2  
ATOM 1592  N N    . ILE A 1 31 ? -0.063  -1.442  2.554   1.00 0.00 ? 40 ILE S N    2  
ATOM 1593  C CA   . ILE A 1 31 ? -1.105  -2.411  2.878   1.00 0.00 ? 40 ILE S CA   2  
ATOM 1594  C C    . ILE A 1 31 ? -2.417  -2.129  2.140   1.00 0.00 ? 40 ILE S C    2  
ATOM 1595  O O    . ILE A 1 31 ? -3.168  -3.056  1.836   1.00 0.00 ? 40 ILE S O    2  
ATOM 1596  C CB   . ILE A 1 31 ? -1.384  -2.458  4.395   1.00 0.00 ? 40 ILE S CB   2  
ATOM 1597  C CG1  . ILE A 1 31 ? -2.007  -1.144  4.870   1.00 0.00 ? 40 ILE S CG1  2  
ATOM 1598  C CG2  . ILE A 1 31 ? -0.101  -2.746  5.160   1.00 0.00 ? 40 ILE S CG2  2  
ATOM 1599  C CD1  . ILE A 1 31 ? -3.511  -1.100  4.720   1.00 0.00 ? 40 ILE S CD1  2  
ATOM 1600  H H    . ILE A 1 31 ? 0.176   -0.759  3.214   1.00 0.00 ? 40 ILE S H    2  
ATOM 1601  H HA   . ILE A 1 31 ? -0.748  -3.385  2.578   1.00 0.00 ? 40 ILE S HA   2  
ATOM 1602  H HB   . ILE A 1 31 ? -2.076  -3.264  4.586   1.00 0.00 ? 40 ILE S HB   2  
ATOM 1603  H HG12 . ILE A 1 31 ? -1.776  -1.000  5.914   1.00 0.00 ? 40 ILE S HG12 2  
ATOM 1604  H HG13 . ILE A 1 31 ? -1.591  -0.329  4.297   1.00 0.00 ? 40 ILE S HG13 2  
ATOM 1605  H HG21 . ILE A 1 31 ? 0.075   -3.813  5.178   1.00 0.00 ? 40 ILE S HG21 2  
ATOM 1606  H HG22 . ILE A 1 31 ? -0.194  -2.380  6.170   1.00 0.00 ? 40 ILE S HG22 2  
ATOM 1607  H HG23 . ILE A 1 31 ? 0.727   -2.254  4.673   1.00 0.00 ? 40 ILE S HG23 2  
ATOM 1608  H HD11 . ILE A 1 31 ? -3.771  -0.438  3.908   1.00 0.00 ? 40 ILE S HD11 2  
ATOM 1609  H HD12 . ILE A 1 31 ? -3.954  -0.736  5.637   1.00 0.00 ? 40 ILE S HD12 2  
ATOM 1610  H HD13 . ILE A 1 31 ? -3.882  -2.092  4.510   1.00 0.00 ? 40 ILE S HD13 2  
ATOM 1611  N N    . TYR A 1 32 ? -2.705  -0.856  1.860   1.00 0.00 ? 41 TYR S N    2  
ATOM 1612  C CA   . TYR A 1 32 ? -3.947  -0.509  1.170   1.00 0.00 ? 41 TYR S CA   2  
ATOM 1613  C C    . TYR A 1 32 ? -3.776  -0.467  -0.341  1.00 0.00 ? 41 TYR S C    2  
ATOM 1614  O O    . TYR A 1 32 ? -4.563  0.173   -1.038  1.00 0.00 ? 41 TYR S O    2  
ATOM 1615  C CB   . TYR A 1 32 ? -4.516  0.829   1.664   1.00 0.00 ? 41 TYR S CB   2  
ATOM 1616  C CG   . TYR A 1 32 ? -3.601  2.037   1.513   1.00 0.00 ? 41 TYR S CG   2  
ATOM 1617  C CD1  . TYR A 1 32 ? -2.844  2.252   0.362   1.00 0.00 ? 41 TYR S CD1  2  
ATOM 1618  C CD2  . TYR A 1 32 ? -3.523  2.985   2.526   1.00 0.00 ? 41 TYR S CD2  2  
ATOM 1619  C CE1  . TYR A 1 32 ? -2.035  3.368   0.236   1.00 0.00 ? 41 TYR S CE1  2  
ATOM 1620  C CE2  . TYR A 1 32 ? -2.724  4.104   2.403   1.00 0.00 ? 41 TYR S CE2  2  
ATOM 1621  C CZ   . TYR A 1 32 ? -1.983  4.291   1.257   1.00 0.00 ? 41 TYR S CZ   2  
ATOM 1622  O OH   . TYR A 1 32 ? -1.187  5.411   1.132   1.00 0.00 ? 41 TYR S OH   2  
ATOM 1623  H H    . TYR A 1 32 ? -2.084  -0.147  2.129   1.00 0.00 ? 41 TYR S H    2  
ATOM 1624  H HA   . TYR A 1 32 ? -4.663  -1.283  1.401   1.00 0.00 ? 41 TYR S HA   2  
ATOM 1625  H HB2  . TYR A 1 32 ? -5.420  1.043   1.112   1.00 0.00 ? 41 TYR S HB2  2  
ATOM 1626  H HB3  . TYR A 1 32 ? -4.764  0.736   2.713   1.00 0.00 ? 41 TYR S HB3  2  
ATOM 1627  H HD1  . TYR A 1 32 ? -2.884  1.534   -0.440  1.00 0.00 ? 41 TYR S HD1  2  
ATOM 1628  H HD2  . TYR A 1 32 ? -4.100  2.837   3.426   1.00 0.00 ? 41 TYR S HD2  2  
ATOM 1629  H HE1  . TYR A 1 32 ? -1.452  3.520   -0.666  1.00 0.00 ? 41 TYR S HE1  2  
ATOM 1630  H HE2  . TYR A 1 32 ? -2.677  4.825   3.205   1.00 0.00 ? 41 TYR S HE2  2  
ATOM 1631  H HH   . TYR A 1 32 ? -0.587  5.301   0.393   1.00 0.00 ? 41 TYR S HH   2  
ATOM 1632  N N    . LEU A 1 33 ? -2.754  -1.141  -0.855  1.00 0.00 ? 42 LEU S N    2  
ATOM 1633  C CA   . LEU A 1 33 ? -2.523  -1.148  -2.291  1.00 0.00 ? 42 LEU S CA   2  
ATOM 1634  C C    . LEU A 1 33 ? -2.221  -2.544  -2.810  1.00 0.00 ? 42 LEU S C    2  
ATOM 1635  O O    . LEU A 1 33 ? -1.348  -3.237  -2.292  1.00 0.00 ? 42 LEU S O    2  
ATOM 1636  C CB   . LEU A 1 33 ? -1.381  -0.205  -2.672  1.00 0.00 ? 42 LEU S CB   2  
ATOM 1637  C CG   . LEU A 1 33 ? -0.242  -0.098  -1.654  1.00 0.00 ? 42 LEU S CG   2  
ATOM 1638  C CD1  . LEU A 1 33 ? 0.972   -0.886  -2.124  1.00 0.00 ? 42 LEU S CD1  2  
ATOM 1639  C CD2  . LEU A 1 33 ? 0.128   1.360   -1.423  1.00 0.00 ? 42 LEU S CD2  2  
ATOM 1640  H H    . LEU A 1 33 ? -2.150  -1.637  -0.263  1.00 0.00 ? 42 LEU S H    2  
ATOM 1641  H HA   . LEU A 1 33 ? -3.425  -0.801  -2.762  1.00 0.00 ? 42 LEU S HA   2  
ATOM 1642  H HB2  . LEU A 1 33 ? -0.962  -0.547  -3.610  1.00 0.00 ? 42 LEU S HB2  2  
ATOM 1643  H HB3  . LEU A 1 33 ? -1.795  0.780   -2.823  1.00 0.00 ? 42 LEU S HB3  2  
ATOM 1644  H HG   . LEU A 1 33 ? -0.565  -0.515  -0.711  1.00 0.00 ? 42 LEU S HG   2  
ATOM 1645  H HD11 . LEU A 1 33 ? 1.317   -1.524  -1.325  1.00 0.00 ? 42 LEU S HD11 2  
ATOM 1646  H HD12 . LEU A 1 33 ? 1.759   -0.203  -2.407  1.00 0.00 ? 42 LEU S HD12 2  
ATOM 1647  H HD13 . LEU A 1 33 ? 0.700   -1.492  -2.976  1.00 0.00 ? 42 LEU S HD13 2  
ATOM 1648  H HD21 . LEU A 1 33 ? 0.956   1.627   -2.064  1.00 0.00 ? 42 LEU S HD21 2  
ATOM 1649  H HD22 . LEU A 1 33 ? 0.410   1.502   -0.391  1.00 0.00 ? 42 LEU S HD22 2  
ATOM 1650  H HD23 . LEU A 1 33 ? -0.722  1.986   -1.653  1.00 0.00 ? 42 LEU S HD23 2  
ATOM 1651  N N    . THR A 1 34 ? -2.941  -2.940  -3.851  1.00 0.00 ? 43 THR S N    2  
ATOM 1652  C CA   . THR A 1 34 ? -2.739  -4.242  -4.460  1.00 0.00 ? 43 THR S CA   2  
ATOM 1653  C C    . THR A 1 34 ? -1.425  -4.258  -5.234  1.00 0.00 ? 43 THR S C    2  
ATOM 1654  O O    . THR A 1 34 ? -0.626  -3.332  -5.128  1.00 0.00 ? 43 THR S O    2  
ATOM 1655  C CB   . THR A 1 34 ? -3.905  -4.583  -5.389  1.00 0.00 ? 43 THR S CB   2  
ATOM 1656  O OG1  . THR A 1 34 ? -3.731  -5.866  -5.966  1.00 0.00 ? 43 THR S OG1  2  
ATOM 1657  C CG2  . THR A 1 34 ? -4.079  -3.592  -6.520  1.00 0.00 ? 43 THR S CG2  2  
ATOM 1658  H H    . THR A 1 34 ? -3.618  -2.334  -4.226  1.00 0.00 ? 43 THR S H    2  
ATOM 1659  H HA   . THR A 1 34 ? -2.690  -4.976  -3.669  1.00 0.00 ? 43 THR S HA   2  
ATOM 1660  H HB   . THR A 1 34 ? -4.820  -4.592  -4.814  1.00 0.00 ? 43 THR S HB   2  
ATOM 1661  H HG1  . THR A 1 34 ? -4.586  -6.226  -6.210  1.00 0.00 ? 43 THR S HG1  2  
ATOM 1662  H HG21 . THR A 1 34 ? -5.116  -3.297  -6.583  1.00 0.00 ? 43 THR S HG21 2  
ATOM 1663  H HG22 . THR A 1 34 ? -3.778  -4.050  -7.450  1.00 0.00 ? 43 THR S HG22 2  
ATOM 1664  H HG23 . THR A 1 34 ? -3.470  -2.720  -6.332  1.00 0.00 ? 43 THR S HG23 2  
ATOM 1665  N N    . ASP A 1 35 ? -1.222  -5.311  -6.008  1.00 0.00 ? 44 ASP S N    2  
ATOM 1666  C CA   . ASP A 1 35 ? -0.019  -5.481  -6.814  1.00 0.00 ? 44 ASP S CA   2  
ATOM 1667  C C    . ASP A 1 35 ? 0.046   -4.425  -7.906  1.00 0.00 ? 44 ASP S C    2  
ATOM 1668  O O    . ASP A 1 35 ? 1.122   -3.950  -8.254  1.00 0.00 ? 44 ASP S O    2  
ATOM 1669  C CB   . ASP A 1 35 ? 0.011   -6.877  -7.437  1.00 0.00 ? 44 ASP S CB   2  
ATOM 1670  C CG   . ASP A 1 35 ? -1.192  -7.141  -8.320  1.00 0.00 ? 44 ASP S CG   2  
ATOM 1671  O OD1  . ASP A 1 35 ? -2.332  -6.975  -7.838  1.00 0.00 ? 44 ASP S OD1  2  
ATOM 1672  O OD2  . ASP A 1 35 ? -0.995  -7.518  -9.496  1.00 0.00 ? 44 ASP S OD2  2  
ATOM 1673  H H    . ASP A 1 35 ? -1.901  -5.991  -6.044  1.00 0.00 ? 44 ASP S H    2  
ATOM 1674  H HA   . ASP A 1 35 ? 0.836   -5.367  -6.167  1.00 0.00 ? 44 ASP S HA   2  
ATOM 1675  H HB2  . ASP A 1 35 ? 0.905   -6.977  -8.038  1.00 0.00 ? 44 ASP S HB2  2  
ATOM 1676  H HB3  . ASP A 1 35 ? 0.026   -7.616  -6.647  1.00 0.00 ? 44 ASP S HB3  2  
ATOM 1677  N N    . GLU A 1 36 ? -1.113  -4.053  -8.434  1.00 0.00 ? 45 GLU S N    2  
ATOM 1678  C CA   . GLU A 1 36 ? -1.172  -3.034  -9.471  1.00 0.00 ? 45 GLU S CA   2  
ATOM 1679  C C    . GLU A 1 36 ? -0.702  -1.711  -8.898  1.00 0.00 ? 45 GLU S C    2  
ATOM 1680  O O    . GLU A 1 36 ? 0.208   -1.075  -9.430  1.00 0.00 ? 45 GLU S O    2  
ATOM 1681  C CB   . GLU A 1 36 ? -2.592  -2.895  -10.007 1.00 0.00 ? 45 GLU S CB   2  
ATOM 1682  C CG   . GLU A 1 36 ? -3.095  -4.131  -10.735 1.00 0.00 ? 45 GLU S CG   2  
ATOM 1683  C CD   . GLU A 1 36 ? -3.834  -3.793  -12.014 1.00 0.00 ? 45 GLU S CD   2  
ATOM 1684  O OE1  . GLU A 1 36 ? -3.327  -2.954  -12.789 1.00 0.00 ? 45 GLU S OE1  2  
ATOM 1685  O OE2  . GLU A 1 36 ? -4.919  -4.367  -12.242 1.00 0.00 ? 45 GLU S OE2  2  
ATOM 1686  H H    . GLU A 1 36 ? -1.943  -4.459  -8.111  1.00 0.00 ? 45 GLU S H    2  
ATOM 1687  H HA   . GLU A 1 36 ? -0.512  -3.329  -10.273 1.00 0.00 ? 45 GLU S HA   2  
ATOM 1688  H HB2  . GLU A 1 36 ? -3.254  -2.694  -9.179  1.00 0.00 ? 45 GLU S HB2  2  
ATOM 1689  H HB3  . GLU A 1 36 ? -2.619  -2.061  -10.689 1.00 0.00 ? 45 GLU S HB3  2  
ATOM 1690  H HG2  . GLU A 1 36 ? -2.251  -4.758  -10.979 1.00 0.00 ? 45 GLU S HG2  2  
ATOM 1691  H HG3  . GLU A 1 36 ? -3.765  -4.670  -10.081 1.00 0.00 ? 45 GLU S HG3  2  
ATOM 1692  N N    . ASP A 1 37 ? -1.312  -1.317  -7.784  1.00 0.00 ? 46 ASP S N    2  
ATOM 1693  C CA   . ASP A 1 37 ? -0.939  -0.092  -7.109  1.00 0.00 ? 46 ASP S CA   2  
ATOM 1694  C C    . ASP A 1 37 ? 0.475   -0.249  -6.572  1.00 0.00 ? 46 ASP S C    2  
ATOM 1695  O O    . ASP A 1 37 ? 1.287   0.673   -6.634  1.00 0.00 ? 46 ASP S O    2  
ATOM 1696  C CB   . ASP A 1 37 ? -1.929  0.200   -5.980  1.00 0.00 ? 46 ASP S CB   2  
ATOM 1697  C CG   . ASP A 1 37 ? -1.536  1.399   -5.138  1.00 0.00 ? 46 ASP S CG   2  
ATOM 1698  O OD1  . ASP A 1 37 ? -0.330  1.711   -5.061  1.00 0.00 ? 46 ASP S OD1  2  
ATOM 1699  O OD2  . ASP A 1 37 ? -2.440  2.030   -4.550  1.00 0.00 ? 46 ASP S OD2  2  
ATOM 1700  H H    . ASP A 1 37 ? -2.012  -1.880  -7.393  1.00 0.00 ? 46 ASP S H    2  
ATOM 1701  H HA   . ASP A 1 37 ? -0.961  0.713   -7.828  1.00 0.00 ? 46 ASP S HA   2  
ATOM 1702  H HB2  . ASP A 1 37 ? -2.901  0.397   -6.412  1.00 0.00 ? 46 ASP S HB2  2  
ATOM 1703  H HB3  . ASP A 1 37 ? -1.997  -0.669  -5.337  1.00 0.00 ? 46 ASP S HB3  2  
ATOM 1704  N N    . PHE A 1 38 ? 0.768   -1.449  -6.077  1.00 0.00 ? 47 PHE S N    2  
ATOM 1705  C CA   . PHE A 1 38 ? 2.090   -1.767  -5.561  1.00 0.00 ? 47 PHE S CA   2  
ATOM 1706  C C    . PHE A 1 38 ? 3.113   -1.614  -6.671  1.00 0.00 ? 47 PHE S C    2  
ATOM 1707  O O    . PHE A 1 38 ? 4.203   -1.084  -6.467  1.00 0.00 ? 47 PHE S O    2  
ATOM 1708  C CB   . PHE A 1 38 ? 2.132   -3.212  -5.057  1.00 0.00 ? 47 PHE S CB   2  
ATOM 1709  C CG   . PHE A 1 38 ? 2.259   -3.351  -3.572  1.00 0.00 ? 47 PHE S CG   2  
ATOM 1710  C CD1  . PHE A 1 38 ? 3.408   -2.939  -2.918  1.00 0.00 ? 47 PHE S CD1  2  
ATOM 1711  C CD2  . PHE A 1 38 ? 1.234   -3.912  -2.833  1.00 0.00 ? 47 PHE S CD2  2  
ATOM 1712  C CE1  . PHE A 1 38 ? 3.529   -3.083  -1.550  1.00 0.00 ? 47 PHE S CE1  2  
ATOM 1713  C CE2  . PHE A 1 38 ? 1.346   -4.056  -1.466  1.00 0.00 ? 47 PHE S CE2  2  
ATOM 1714  C CZ   . PHE A 1 38 ? 2.499   -3.642  -0.823  1.00 0.00 ? 47 PHE S CZ   2  
ATOM 1715  H H    . PHE A 1 38 ? 0.079   -2.146  -6.085  1.00 0.00 ? 47 PHE S H    2  
ATOM 1716  H HA   . PHE A 1 38 ? 2.324   -1.091  -4.753  1.00 0.00 ? 47 PHE S HA   2  
ATOM 1717  H HB2  . PHE A 1 38 ? 1.229   -3.715  -5.357  1.00 0.00 ? 47 PHE S HB2  2  
ATOM 1718  H HB3  . PHE A 1 38 ? 2.977   -3.713  -5.506  1.00 0.00 ? 47 PHE S HB3  2  
ATOM 1719  H HD1  . PHE A 1 38 ? 4.214   -2.501  -3.487  1.00 0.00 ? 47 PHE S HD1  2  
ATOM 1720  H HD2  . PHE A 1 38 ? 0.335   -4.235  -3.335  1.00 0.00 ? 47 PHE S HD2  2  
ATOM 1721  H HE1  . PHE A 1 38 ? 4.432   -2.760  -1.051  1.00 0.00 ? 47 PHE S HE1  2  
ATOM 1722  H HE2  . PHE A 1 38 ? 0.536   -4.496  -0.904  1.00 0.00 ? 47 PHE S HE2  2  
ATOM 1723  H HZ   . PHE A 1 38 ? 2.594   -3.754  0.247   1.00 0.00 ? 47 PHE S HZ   2  
ATOM 1724  N N    . GLU A 1 39 ? 2.745   -2.107  -7.847  1.00 0.00 ? 48 GLU S N    2  
ATOM 1725  C CA   . GLU A 1 39 ? 3.628   -2.053  -9.008  1.00 0.00 ? 48 GLU S CA   2  
ATOM 1726  C C    . GLU A 1 39 ? 4.006   -0.617  -9.372  1.00 0.00 ? 48 GLU S C    2  
ATOM 1727  O O    . GLU A 1 39 ? 5.178   -0.313  -9.585  1.00 0.00 ? 48 GLU S O    2  
ATOM 1728  C CB   . GLU A 1 39 ? 2.963   -2.735  -10.206 1.00 0.00 ? 48 GLU S CB   2  
ATOM 1729  C CG   . GLU A 1 39 ? 3.285   -4.215  -10.316 1.00 0.00 ? 48 GLU S CG   2  
ATOM 1730  C CD   . GLU A 1 39 ? 3.580   -4.643  -11.740 1.00 0.00 ? 48 GLU S CD   2  
ATOM 1731  O OE1  . GLU A 1 39 ? 4.474   -4.037  -12.368 1.00 0.00 ? 48 GLU S OE1  2  
ATOM 1732  O OE2  . GLU A 1 39 ? 2.918   -5.584  -12.227 1.00 0.00 ? 48 GLU S OE2  2  
ATOM 1733  H H    . GLU A 1 39 ? 1.851   -2.536  -7.934  1.00 0.00 ? 48 GLU S H    2  
ATOM 1734  H HA   . GLU A 1 39 ? 4.528   -2.592  -8.756  1.00 0.00 ? 48 GLU S HA   2  
ATOM 1735  H HB2  . GLU A 1 39 ? 1.892   -2.625  -10.120 1.00 0.00 ? 48 GLU S HB2  2  
ATOM 1736  H HB3  . GLU A 1 39 ? 3.296   -2.248  -11.111 1.00 0.00 ? 48 GLU S HB3  2  
ATOM 1737  H HG2  . GLU A 1 39 ? 4.153   -4.430  -9.706  1.00 0.00 ? 48 GLU S HG2  2  
ATOM 1738  H HG3  . GLU A 1 39 ? 2.437   -4.783  -9.953  1.00 0.00 ? 48 GLU S HG3  2  
ATOM 1739  N N    . PHE A 1 40 ? 3.012   0.258   -9.462  1.00 0.00 ? 49 PHE S N    2  
ATOM 1740  C CA   . PHE A 1 40 ? 3.256   1.651   -9.827  1.00 0.00 ? 49 PHE S CA   2  
ATOM 1741  C C    . PHE A 1 40 ? 3.596   2.519   -8.614  1.00 0.00 ? 49 PHE S C    2  
ATOM 1742  O O    . PHE A 1 40 ? 4.068   3.646   -8.769  1.00 0.00 ? 49 PHE S O    2  
ATOM 1743  C CB   . PHE A 1 40 ? 2.034   2.224   -10.550 1.00 0.00 ? 49 PHE S CB   2  
ATOM 1744  C CG   . PHE A 1 40 ? 2.330   2.693   -11.945 1.00 0.00 ? 49 PHE S CG   2  
ATOM 1745  C CD1  . PHE A 1 40 ? 3.014   1.879   -12.835 1.00 0.00 ? 49 PHE S CD1  2  
ATOM 1746  C CD2  . PHE A 1 40 ? 1.927   3.950   -12.367 1.00 0.00 ? 49 PHE S CD2  2  
ATOM 1747  C CE1  . PHE A 1 40 ? 3.288   2.308   -14.118 1.00 0.00 ? 49 PHE S CE1  2  
ATOM 1748  C CE2  . PHE A 1 40 ? 2.198   4.385   -13.651 1.00 0.00 ? 49 PHE S CE2  2  
ATOM 1749  C CZ   . PHE A 1 40 ? 2.881   3.563   -14.528 1.00 0.00 ? 49 PHE S CZ   2  
ATOM 1750  H H    . PHE A 1 40 ? 2.092   -0.041  -9.297  1.00 0.00 ? 49 PHE S H    2  
ATOM 1751  H HA   . PHE A 1 40 ? 4.095   1.667   -10.505 1.00 0.00 ? 49 PHE S HA   2  
ATOM 1752  H HB2  . PHE A 1 40 ? 1.272   1.461   -10.612 1.00 0.00 ? 49 PHE S HB2  2  
ATOM 1753  H HB3  . PHE A 1 40 ? 1.651   3.066   -9.989  1.00 0.00 ? 49 PHE S HB3  2  
ATOM 1754  H HD1  . PHE A 1 40 ? 3.332   0.898   -12.515 1.00 0.00 ? 49 PHE S HD1  2  
ATOM 1755  H HD2  . PHE A 1 40 ? 1.393   4.593   -11.683 1.00 0.00 ? 49 PHE S HD2  2  
ATOM 1756  H HE1  . PHE A 1 40 ? 3.822   1.663   -14.801 1.00 0.00 ? 49 PHE S HE1  2  
ATOM 1757  H HE2  . PHE A 1 40 ? 1.878   5.366   -13.969 1.00 0.00 ? 49 PHE S HE2  2  
ATOM 1758  H HZ   . PHE A 1 40 ? 3.094   3.901   -15.531 1.00 0.00 ? 49 PHE S HZ   2  
ATOM 1759  N N    . ALA A 1 41 ? 3.347   2.009   -7.414  1.00 0.00 ? 50 ALA S N    2  
ATOM 1760  C CA   . ALA A 1 41 ? 3.625   2.770   -6.198  1.00 0.00 ? 50 ALA S CA   2  
ATOM 1761  C C    . ALA A 1 41 ? 4.936   2.348   -5.538  1.00 0.00 ? 50 ALA S C    2  
ATOM 1762  O O    . ALA A 1 41 ? 5.738   3.193   -5.145  1.00 0.00 ? 50 ALA S O    2  
ATOM 1763  C CB   . ALA A 1 41 ? 2.474   2.630   -5.215  1.00 0.00 ? 50 ALA S CB   2  
ATOM 1764  H H    . ALA A 1 41 ? 2.961   1.112   -7.341  1.00 0.00 ? 50 ALA S H    2  
ATOM 1765  H HA   . ALA A 1 41 ? 3.698   3.812   -6.475  1.00 0.00 ? 50 ALA S HA   2  
ATOM 1766  H HB1  . ALA A 1 41 ? 2.514   1.657   -4.749  1.00 0.00 ? 50 ALA S HB1  2  
ATOM 1767  H HB2  . ALA A 1 41 ? 1.537   2.739   -5.741  1.00 0.00 ? 50 ALA S HB2  2  
ATOM 1768  H HB3  . ALA A 1 41 ? 2.552   3.395   -4.458  1.00 0.00 ? 50 ALA S HB3  2  
ATOM 1769  N N    . LEU A 1 42 ? 5.138   1.041   -5.397  1.00 0.00 ? 51 LEU S N    2  
ATOM 1770  C CA   . LEU A 1 42 ? 6.346   0.525   -4.755  1.00 0.00 ? 51 LEU S CA   2  
ATOM 1771  C C    . LEU A 1 42 ? 7.156   -0.380  -5.679  1.00 0.00 ? 51 LEU S C    2  
ATOM 1772  O O    . LEU A 1 42 ? 8.217   -0.871  -5.295  1.00 0.00 ? 51 LEU S O    2  
ATOM 1773  C CB   . LEU A 1 42 ? 5.967   -0.243  -3.490  1.00 0.00 ? 51 LEU S CB   2  
ATOM 1774  C CG   . LEU A 1 42 ? 5.921   0.602   -2.220  1.00 0.00 ? 51 LEU S CG   2  
ATOM 1775  C CD1  . LEU A 1 42 ? 5.016   -0.038  -1.180  1.00 0.00 ? 51 LEU S CD1  2  
ATOM 1776  C CD2  . LEU A 1 42 ? 7.323   0.794   -1.672  1.00 0.00 ? 51 LEU S CD2  2  
ATOM 1777  H H    . LEU A 1 42 ? 4.456   0.413   -5.713  1.00 0.00 ? 51 LEU S H    2  
ATOM 1778  H HA   . LEU A 1 42 ? 6.956   1.370   -4.476  1.00 0.00 ? 51 LEU S HA   2  
ATOM 1779  H HB2  . LEU A 1 42 ? 4.993   -0.685  -3.640  1.00 0.00 ? 51 LEU S HB2  2  
ATOM 1780  H HB3  . LEU A 1 42 ? 6.686   -1.034  -3.344  1.00 0.00 ? 51 LEU S HB3  2  
ATOM 1781  H HG   . LEU A 1 42 ? 5.520   1.574   -2.459  1.00 0.00 ? 51 LEU S HG   2  
ATOM 1782  H HD11 . LEU A 1 42 ? 4.362   0.713   -0.763  1.00 0.00 ? 51 LEU S HD11 2  
ATOM 1783  H HD12 . LEU A 1 42 ? 5.618   -0.466  -0.394  1.00 0.00 ? 51 LEU S HD12 2  
ATOM 1784  H HD13 . LEU A 1 42 ? 4.425   -0.811  -1.644  1.00 0.00 ? 51 LEU S HD13 2  
ATOM 1785  H HD21 . LEU A 1 42 ? 8.040   0.413   -2.381  1.00 0.00 ? 51 LEU S HD21 2  
ATOM 1786  H HD22 . LEU A 1 42 ? 7.421   0.260   -0.740  1.00 0.00 ? 51 LEU S HD22 2  
ATOM 1787  H HD23 . LEU A 1 42 ? 7.504   1.843   -1.507  1.00 0.00 ? 51 LEU S HD23 2  
ATOM 1788  N N    . ASP A 1 43 ? 6.658   -0.609  -6.887  1.00 0.00 ? 52 ASP S N    2  
ATOM 1789  C CA   . ASP A 1 43 ? 7.349   -1.465  -7.841  1.00 0.00 ? 52 ASP S CA   2  
ATOM 1790  C C    . ASP A 1 43 ? 7.477   -2.895  -7.316  1.00 0.00 ? 52 ASP S C    2  
ATOM 1791  O O    . ASP A 1 43 ? 8.225   -3.698  -7.871  1.00 0.00 ? 52 ASP S O    2  
ATOM 1792  C CB   . ASP A 1 43 ? 8.735   -0.902  -8.158  1.00 0.00 ? 52 ASP S CB   2  
ATOM 1793  C CG   . ASP A 1 43 ? 8.685   0.218   -9.180  1.00 0.00 ? 52 ASP S CG   2  
ATOM 1794  O OD1  . ASP A 1 43 ? 8.069   1.264   -8.884  1.00 0.00 ? 52 ASP S OD1  2  
ATOM 1795  O OD2  . ASP A 1 43 ? 9.261   0.049   -10.275 1.00 0.00 ? 52 ASP S OD2  2  
ATOM 1796  H H    . ASP A 1 43 ? 5.805   -0.199  -7.142  1.00 0.00 ? 52 ASP S H    2  
ATOM 1797  H HA   . ASP A 1 43 ? 6.766   -1.484  -8.749  1.00 0.00 ? 52 ASP S HA   2  
ATOM 1798  H HB2  . ASP A 1 43 ? 9.177   -0.515  -7.251  1.00 0.00 ? 52 ASP S HB2  2  
ATOM 1799  H HB3  . ASP A 1 43 ? 9.358   -1.694  -8.551  1.00 0.00 ? 52 ASP S HB3  2  
ATOM 1800  N N    . MET A 1 44 ? 6.734   -3.219  -6.255  1.00 0.00 ? 53 MET S N    2  
ATOM 1801  C CA   . MET A 1 44 ? 6.776   -4.568  -5.691  1.00 0.00 ? 53 MET S CA   2  
ATOM 1802  C C    . MET A 1 44 ? 5.376   -5.175  -5.656  1.00 0.00 ? 53 MET S C    2  
ATOM 1803  O O    . MET A 1 44 ? 4.496   -4.737  -6.394  1.00 0.00 ? 53 MET S O    2  
ATOM 1804  C CB   . MET A 1 44 ? 7.397   -4.558  -4.294  1.00 0.00 ? 53 MET S CB   2  
ATOM 1805  C CG   . MET A 1 44 ? 8.453   -5.636  -4.104  1.00 0.00 ? 53 MET S CG   2  
ATOM 1806  S SD   . MET A 1 44 ? 9.840   -5.459  -5.246  1.00 0.00 ? 53 MET S SD   2  
ATOM 1807  C CE   . MET A 1 44 ? 10.123  -3.691  -5.167  1.00 0.00 ? 53 MET S CE   2  
ATOM 1808  H H    . MET A 1 44 ? 6.142   -2.544  -5.850  1.00 0.00 ? 53 MET S H    2  
ATOM 1809  H HA   . MET A 1 44 ? 7.392   -5.173  -6.341  1.00 0.00 ? 53 MET S HA   2  
ATOM 1810  H HB2  . MET A 1 44 ? 7.858   -3.595  -4.122  1.00 0.00 ? 53 MET S HB2  2  
ATOM 1811  H HB3  . MET A 1 44 ? 6.617   -4.715  -3.561  1.00 0.00 ? 53 MET S HB3  2  
ATOM 1812  H HG2  . MET A 1 44 ? 8.830   -5.585  -3.095  1.00 0.00 ? 53 MET S HG2  2  
ATOM 1813  H HG3  . MET A 1 44 ? 7.996   -6.601  -4.267  1.00 0.00 ? 53 MET S HG3  2  
ATOM 1814  H HE1  . MET A 1 44 ? 11.162  -3.484  -5.377  1.00 0.00 ? 53 MET S HE1  2  
ATOM 1815  H HE2  . MET A 1 44 ? 9.877   -3.330  -4.180  1.00 0.00 ? 53 MET S HE2  2  
ATOM 1816  H HE3  . MET A 1 44 ? 9.503   -3.195  -5.898  1.00 0.00 ? 53 MET S HE3  2  
ATOM 1817  N N    . THR A 1 45 ? 5.164   -6.185  -4.811  1.00 0.00 ? 54 THR S N    2  
ATOM 1818  C CA   . THR A 1 45 ? 3.858   -6.820  -4.719  1.00 0.00 ? 54 THR S CA   2  
ATOM 1819  C C    . THR A 1 45 ? 3.446   -6.994  -3.268  1.00 0.00 ? 54 THR S C    2  
ATOM 1820  O O    . THR A 1 45 ? 4.294   -7.143  -2.387  1.00 0.00 ? 54 THR S O    2  
ATOM 1821  C CB   . THR A 1 45 ? 3.865   -8.177  -5.427  1.00 0.00 ? 54 THR S CB   2  
ATOM 1822  O OG1  . THR A 1 45 ? 4.408   -9.180  -4.590  1.00 0.00 ? 54 THR S OG1  2  
ATOM 1823  C CG2  . THR A 1 45 ? 4.658   -8.178  -6.718  1.00 0.00 ? 54 THR S CG2  2  
ATOM 1824  H H    . THR A 1 45 ? 5.895   -6.508  -4.234  1.00 0.00 ? 54 THR S H    2  
ATOM 1825  H HA   . THR A 1 45 ? 3.142   -6.174  -5.206  1.00 0.00 ? 54 THR S HA   2  
ATOM 1826  H HB   . THR A 1 45 ? 2.847   -8.450  -5.667  1.00 0.00 ? 54 THR S HB   2  
ATOM 1827  H HG1  . THR A 1 45 ? 3.984   -10.021 -4.780  1.00 0.00 ? 54 THR S HG1  2  
ATOM 1828  H HG21 . THR A 1 45 ? 4.238   -8.904  -7.399  1.00 0.00 ? 54 THR S HG21 2  
ATOM 1829  H HG22 . THR A 1 45 ? 5.685   -8.435  -6.509  1.00 0.00 ? 54 THR S HG22 2  
ATOM 1830  H HG23 . THR A 1 45 ? 4.616   -7.197  -7.167  1.00 0.00 ? 54 THR S HG23 2  
ATOM 1831  N N    . ARG A 1 46 ? 2.144   -7.008  -3.020  1.00 0.00 ? 55 ARG S N    2  
ATOM 1832  C CA   . ARG A 1 46 ? 1.640   -7.202  -1.670  1.00 0.00 ? 55 ARG S CA   2  
ATOM 1833  C C    . ARG A 1 46 ? 2.162   -8.521  -1.109  1.00 0.00 ? 55 ARG S C    2  
ATOM 1834  O O    . ARG A 1 46 ? 2.283   -8.688  0.103   1.00 0.00 ? 55 ARG S O    2  
ATOM 1835  C CB   . ARG A 1 46 ? 0.111   -7.194  -1.669  1.00 0.00 ? 55 ARG S CB   2  
ATOM 1836  C CG   . ARG A 1 46 ? -0.499  -7.133  -0.278  1.00 0.00 ? 55 ARG S CG   2  
ATOM 1837  C CD   . ARG A 1 46 ? -2.016  -7.206  -0.334  1.00 0.00 ? 55 ARG S CD   2  
ATOM 1838  N NE   . ARG A 1 46 ? -2.614  -5.910  -0.646  1.00 0.00 ? 55 ARG S NE   2  
ATOM 1839  C CZ   . ARG A 1 46 ? -3.811  -5.761  -1.213  1.00 0.00 ? 55 ARG S CZ   2  
ATOM 1840  N NH1  . ARG A 1 46 ? -4.544  -6.821  -1.529  1.00 0.00 ? 55 ARG S NH1  2  
ATOM 1841  N NH2  . ARG A 1 46 ? -4.277  -4.545  -1.461  1.00 0.00 ? 55 ARG S NH2  2  
ATOM 1842  H H    . ARG A 1 46 ? 1.511   -6.907  -3.761  1.00 0.00 ? 55 ARG S H    2  
ATOM 1843  H HA   . ARG A 1 46 ? 2.001   -6.390  -1.057  1.00 0.00 ? 55 ARG S HA   2  
ATOM 1844  H HB2  . ARG A 1 46 ? -0.234  -6.334  -2.227  1.00 0.00 ? 55 ARG S HB2  2  
ATOM 1845  H HB3  . ARG A 1 46 ? -0.243  -8.094  -2.153  1.00 0.00 ? 55 ARG S HB3  2  
ATOM 1846  H HG2  . ARG A 1 46 ? -0.129  -7.963  0.305   1.00 0.00 ? 55 ARG S HG2  2  
ATOM 1847  H HG3  . ARG A 1 46 ? -0.209  -6.204  0.190   1.00 0.00 ? 55 ARG S HG3  2  
ATOM 1848  H HD2  . ARG A 1 46 ? -2.300  -7.916  -1.098  1.00 0.00 ? 55 ARG S HD2  2  
ATOM 1849  H HD3  . ARG A 1 46 ? -2.383  -7.543  0.624   1.00 0.00 ? 55 ARG S HD3  2  
ATOM 1850  H HE   . ARG A 1 46 ? -2.097  -5.108  -0.422  1.00 0.00 ? 55 ARG S HE   2  
ATOM 1851  H HH11 . ARG A 1 46 ? -4.202  -7.741  -1.342  1.00 0.00 ? 55 ARG S HH11 2  
ATOM 1852  H HH12 . ARG A 1 46 ? -5.441  -6.699  -1.954  1.00 0.00 ? 55 ARG S HH12 2  
ATOM 1853  H HH21 . ARG A 1 46 ? -3.730  -3.742  -1.224  1.00 0.00 ? 55 ARG S HH21 2  
ATOM 1854  H HH22 . ARG A 1 46 ? -5.174  -4.430  -1.888  1.00 0.00 ? 55 ARG S HH22 2  
ATOM 1855  N N    . ASP A 1 47 ? 2.477   -9.450  -2.010  1.00 0.00 ? 56 ASP S N    2  
ATOM 1856  C CA   . ASP A 1 47 ? 2.995   -10.761 -1.634  1.00 0.00 ? 56 ASP S CA   2  
ATOM 1857  C C    . ASP A 1 47 ? 4.524   -10.764 -1.578  1.00 0.00 ? 56 ASP S C    2  
ATOM 1858  O O    . ASP A 1 47 ? 5.129   -11.724 -1.101  1.00 0.00 ? 56 ASP S O    2  
ATOM 1859  C CB   . ASP A 1 47 ? 2.509   -11.823 -2.621  1.00 0.00 ? 56 ASP S CB   2  
ATOM 1860  C CG   . ASP A 1 47 ? 1.000   -11.968 -2.616  1.00 0.00 ? 56 ASP S CG   2  
ATOM 1861  O OD1  . ASP A 1 47 ? 0.319   -11.104 -3.208  1.00 0.00 ? 56 ASP S OD1  2  
ATOM 1862  O OD2  . ASP A 1 47 ? 0.499   -12.946 -2.023  1.00 0.00 ? 56 ASP S OD2  2  
ATOM 1863  H H    . ASP A 1 47 ? 2.361   -9.245  -2.961  1.00 0.00 ? 56 ASP S H    2  
ATOM 1864  H HA   . ASP A 1 47 ? 2.612   -10.995 -0.652  1.00 0.00 ? 56 ASP S HA   2  
ATOM 1865  H HB2  . ASP A 1 47 ? 2.823   -11.550 -3.617  1.00 0.00 ? 56 ASP S HB2  2  
ATOM 1866  H HB3  . ASP A 1 47 ? 2.945   -12.776 -2.358  1.00 0.00 ? 56 ASP S HB3  2  
ATOM 1867  N N    . GLU A 1 48 ? 5.149   -9.686  -2.052  1.00 0.00 ? 57 GLU S N    2  
ATOM 1868  C CA   . GLU A 1 48 ? 6.601   -9.575  -2.032  1.00 0.00 ? 57 GLU S CA   2  
ATOM 1869  C C    . GLU A 1 48 ? 7.011   -8.863  -0.763  1.00 0.00 ? 57 GLU S C    2  
ATOM 1870  O O    . GLU A 1 48 ? 7.781   -9.381  0.045   1.00 0.00 ? 57 GLU S O    2  
ATOM 1871  C CB   . GLU A 1 48 ? 7.102   -8.805  -3.255  1.00 0.00 ? 57 GLU S CB   2  
ATOM 1872  C CG   . GLU A 1 48 ? 8.589   -8.972  -3.514  1.00 0.00 ? 57 GLU S CG   2  
ATOM 1873  C CD   . GLU A 1 48 ? 8.913   -9.110  -4.989  1.00 0.00 ? 57 GLU S CD   2  
ATOM 1874  O OE1  . GLU A 1 48 ? 8.116   -9.741  -5.714  1.00 0.00 ? 57 GLU S OE1  2  
ATOM 1875  O OE2  . GLU A 1 48 ? 9.962   -8.587  -5.418  1.00 0.00 ? 57 GLU S OE2  2  
ATOM 1876  H H    . GLU A 1 48 ? 4.621   -8.936  -2.399  1.00 0.00 ? 57 GLU S H    2  
ATOM 1877  H HA   . GLU A 1 48 ? 7.018   -10.571 -2.035  1.00 0.00 ? 57 GLU S HA   2  
ATOM 1878  H HB2  . GLU A 1 48 ? 6.566   -9.151  -4.129  1.00 0.00 ? 57 GLU S HB2  2  
ATOM 1879  H HB3  . GLU A 1 48 ? 6.897   -7.752  -3.109  1.00 0.00 ? 57 GLU S HB3  2  
ATOM 1880  H HG2  . GLU A 1 48 ? 9.108   -8.107  -3.127  1.00 0.00 ? 57 GLU S HG2  2  
ATOM 1881  H HG3  . GLU A 1 48 ? 8.934   -9.856  -3.000  1.00 0.00 ? 57 GLU S HG3  2  
ATOM 1882  N N    . TYR A 1 49 ? 6.437   -7.685  -0.577  1.00 0.00 ? 58 TYR S N    2  
ATOM 1883  C CA   . TYR A 1 49 ? 6.674   -6.897  0.614   1.00 0.00 ? 58 TYR S CA   2  
ATOM 1884  C C    . TYR A 1 49 ? 6.189   -7.682  1.820   1.00 0.00 ? 58 TYR S C    2  
ATOM 1885  O O    . TYR A 1 49 ? 6.748   -7.583  2.913   1.00 0.00 ? 58 TYR S O    2  
ATOM 1886  C CB   . TYR A 1 49 ? 5.911   -5.582  0.511   1.00 0.00 ? 58 TYR S CB   2  
ATOM 1887  C CG   . TYR A 1 49 ? 6.729   -4.452  -0.066  1.00 0.00 ? 58 TYR S CG   2  
ATOM 1888  C CD1  . TYR A 1 49 ? 7.609   -4.671  -1.117  1.00 0.00 ? 58 TYR S CD1  2  
ATOM 1889  C CD2  . TYR A 1 49 ? 6.633   -3.169  0.455   1.00 0.00 ? 58 TYR S CD2  2  
ATOM 1890  C CE1  . TYR A 1 49 ? 8.368   -3.640  -1.633  1.00 0.00 ? 58 TYR S CE1  2  
ATOM 1891  C CE2  . TYR A 1 49 ? 7.391   -2.137  -0.055  1.00 0.00 ? 58 TYR S CE2  2  
ATOM 1892  C CZ   . TYR A 1 49 ? 8.257   -2.377  -1.099  1.00 0.00 ? 58 TYR S CZ   2  
ATOM 1893  O OH   . TYR A 1 49 ? 9.014   -1.352  -1.611  1.00 0.00 ? 58 TYR S OH   2  
ATOM 1894  H H    . TYR A 1 49 ? 5.802   -7.353  -1.248  1.00 0.00 ? 58 TYR S H    2  
ATOM 1895  H HA   . TYR A 1 49 ? 7.732   -6.703  0.700   1.00 0.00 ? 58 TYR S HA   2  
ATOM 1896  H HB2  . TYR A 1 49 ? 5.052   -5.726  -0.132  1.00 0.00 ? 58 TYR S HB2  2  
ATOM 1897  H HB3  . TYR A 1 49 ? 5.574   -5.293  1.488   1.00 0.00 ? 58 TYR S HB3  2  
ATOM 1898  H HD1  . TYR A 1 49 ? 7.694   -5.663  -1.533  1.00 0.00 ? 58 TYR S HD1  2  
ATOM 1899  H HD2  . TYR A 1 49 ? 5.953   -2.984  1.273   1.00 0.00 ? 58 TYR S HD2  2  
ATOM 1900  H HE1  . TYR A 1 49 ? 9.048   -3.826  -2.452  1.00 0.00 ? 58 TYR S HE1  2  
ATOM 1901  H HE2  . TYR A 1 49 ? 7.304   -1.148  0.368   1.00 0.00 ? 58 TYR S HE2  2  
ATOM 1902  H HH   . TYR A 1 49 ? 9.037   -1.418  -2.568  1.00 0.00 ? 58 TYR S HH   2  
ATOM 1903  N N    . ASN A 1 50 ? 5.142   -8.471  1.606   1.00 0.00 ? 59 ASN S N    2  
ATOM 1904  C CA   . ASN A 1 50 ? 4.570   -9.289  2.675   1.00 0.00 ? 59 ASN S CA   2  
ATOM 1905  C C    . ASN A 1 50 ? 5.632   -10.173 3.326   1.00 0.00 ? 59 ASN S C    2  
ATOM 1906  O O    . ASN A 1 50 ? 5.522   -10.529 4.499   1.00 0.00 ? 59 ASN S O    2  
ATOM 1907  C CB   . ASN A 1 50 ? 3.438   -10.165 2.132   1.00 0.00 ? 59 ASN S CB   2  
ATOM 1908  C CG   . ASN A 1 50 ? 2.070   -9.701  2.596   1.00 0.00 ? 59 ASN S CG   2  
ATOM 1909  O OD1  . ASN A 1 50 ? 1.201   -10.513 2.913   1.00 0.00 ? 59 ASN S OD1  2  
ATOM 1910  N ND2  . ASN A 1 50 ? 1.872   -8.388  2.638   1.00 0.00 ? 59 ASN S ND2  2  
ATOM 1911  H H    . ASN A 1 50 ? 4.744   -8.499  0.701   1.00 0.00 ? 59 ASN S H    2  
ATOM 1912  H HA   . ASN A 1 50 ? 4.168   -8.623  3.422   1.00 0.00 ? 59 ASN S HA   2  
ATOM 1913  H HB2  . ASN A 1 50 ? 3.460   -10.145 1.053   1.00 0.00 ? 59 ASN S HB2  2  
ATOM 1914  H HB3  . ASN A 1 50 ? 3.584   -11.182 2.469   1.00 0.00 ? 59 ASN S HB3  2  
ATOM 1915  H HD21 . ASN A 1 50 ? 2.608   -7.800  2.371   1.00 0.00 ? 59 ASN S HD21 2  
ATOM 1916  H HD22 . ASN A 1 50 ? 0.998   -8.061  2.935   1.00 0.00 ? 59 ASN S HD22 2  
ATOM 1917  N N    . ALA A 1 51 ? 6.655   -10.537 2.556   1.00 0.00 ? 60 ALA S N    2  
ATOM 1918  C CA   . ALA A 1 51 ? 7.725   -11.391 3.063   1.00 0.00 ? 60 ALA S CA   2  
ATOM 1919  C C    . ALA A 1 51 ? 9.024   -10.612 3.252   1.00 0.00 ? 60 ALA S C    2  
ATOM 1920  O O    . ALA A 1 51 ? 9.827   -10.931 4.128   1.00 0.00 ? 60 ALA S O    2  
ATOM 1921  C CB   . ALA A 1 51 ? 7.947   -12.566 2.124   1.00 0.00 ? 60 ALA S CB   2  
ATOM 1922  H H    . ALA A 1 51 ? 6.687   -10.231 1.626   1.00 0.00 ? 60 ALA S H    2  
ATOM 1923  H HA   . ALA A 1 51 ? 7.412   -11.782 4.019   1.00 0.00 ? 60 ALA S HA   2  
ATOM 1924  H HB1  . ALA A 1 51 ? 7.338   -13.399 2.441   1.00 0.00 ? 60 ALA S HB1  2  
ATOM 1925  H HB2  . ALA A 1 51 ? 8.988   -12.853 2.146   1.00 0.00 ? 60 ALA S HB2  2  
ATOM 1926  H HB3  . ALA A 1 51 ? 7.673   -12.282 1.119   1.00 0.00 ? 60 ALA S HB3  2  
ATOM 1927  N N    . LEU A 1 52 ? 9.226   -9.592  2.425   1.00 0.00 ? 61 LEU S N    2  
ATOM 1928  C CA   . LEU A 1 52 ? 10.432  -8.775  2.503   1.00 0.00 ? 61 LEU S CA   2  
ATOM 1929  C C    . LEU A 1 52 ? 10.539  -8.093  3.865   1.00 0.00 ? 61 LEU S C    2  
ATOM 1930  O O    . LEU A 1 52 ? 9.557   -8.009  4.604   1.00 0.00 ? 61 LEU S O    2  
ATOM 1931  C CB   . LEU A 1 52 ? 10.427  -7.723  1.391   1.00 0.00 ? 61 LEU S CB   2  
ATOM 1932  C CG   . LEU A 1 52 ? 11.199  -8.110  0.128   1.00 0.00 ? 61 LEU S CG   2  
ATOM 1933  C CD1  . LEU A 1 52 ? 10.482  -7.603  -1.114  1.00 0.00 ? 61 LEU S CD1  2  
ATOM 1934  C CD2  . LEU A 1 52 ? 12.618  -7.564  0.183   1.00 0.00 ? 61 LEU S CD2  2  
ATOM 1935  H H    . LEU A 1 52 ? 8.551   -9.386  1.744   1.00 0.00 ? 61 LEU S H    2  
ATOM 1936  H HA   . LEU A 1 52 ? 11.283  -9.423  2.369   1.00 0.00 ? 61 LEU S HA   2  
ATOM 1937  H HB2  . LEU A 1 52 ? 9.398   -7.532  1.114   1.00 0.00 ? 61 LEU S HB2  2  
ATOM 1938  H HB3  . LEU A 1 52 ? 10.852  -6.810  1.784   1.00 0.00 ? 61 LEU S HB3  2  
ATOM 1939  H HG   . LEU A 1 52 ? 11.255  -9.187  0.065   1.00 0.00 ? 61 LEU S HG   2  
ATOM 1940  H HD11 . LEU A 1 52 ? 10.954  -8.011  -1.995  1.00 0.00 ? 61 LEU S HD11 2  
ATOM 1941  H HD12 . LEU A 1 52 ? 10.533  -6.524  -1.144  1.00 0.00 ? 61 LEU S HD12 2  
ATOM 1942  H HD13 . LEU A 1 52 ? 9.447   -7.913  -1.083  1.00 0.00 ? 61 LEU S HD13 2  
ATOM 1943  H HD21 . LEU A 1 52 ? 13.088  -7.686  -0.781  1.00 0.00 ? 61 LEU S HD21 2  
ATOM 1944  H HD22 . LEU A 1 52 ? 13.183  -8.105  0.929   1.00 0.00 ? 61 LEU S HD22 2  
ATOM 1945  H HD23 . LEU A 1 52 ? 12.591  -6.517  0.441   1.00 0.00 ? 61 LEU S HD23 2  
ATOM 1946  N N    . PRO A 1 53 ? 11.736  -7.591  4.217   1.00 0.00 ? 62 PRO S N    2  
ATOM 1947  C CA   . PRO A 1 53 ? 11.959  -6.912  5.497   1.00 0.00 ? 62 PRO S CA   2  
ATOM 1948  C C    . PRO A 1 53 ? 10.945  -5.804  5.740   1.00 0.00 ? 62 PRO S C    2  
ATOM 1949  O O    . PRO A 1 53 ? 10.240  -5.386  4.822   1.00 0.00 ? 62 PRO S O    2  
ATOM 1950  C CB   . PRO A 1 53 ? 13.364  -6.323  5.351   1.00 0.00 ? 62 PRO S CB   2  
ATOM 1951  C CG   . PRO A 1 53 ? 14.038  -7.186  4.343   1.00 0.00 ? 62 PRO S CG   2  
ATOM 1952  C CD   . PRO A 1 53 ? 12.961  -7.642  3.396   1.00 0.00 ? 62 PRO S CD   2  
ATOM 1953  H HA   . PRO A 1 53 ? 11.939  -7.607  6.322   1.00 0.00 ? 62 PRO S HA   2  
ATOM 1954  H HB2  . PRO A 1 53 ? 13.294  -5.299  5.012   1.00 0.00 ? 62 PRO S HB2  2  
ATOM 1955  H HB3  . PRO A 1 53 ? 13.872  -6.361  6.305   1.00 0.00 ? 62 PRO S HB3  2  
ATOM 1956  H HG2  . PRO A 1 53 ? 14.786  -6.615  3.813   1.00 0.00 ? 62 PRO S HG2  2  
ATOM 1957  H HG3  . PRO A 1 53 ? 14.491  -8.037  4.833   1.00 0.00 ? 62 PRO S HG3  2  
ATOM 1958  H HD2  . PRO A 1 53 ? 12.889  -6.966  2.557   1.00 0.00 ? 62 PRO S HD2  2  
ATOM 1959  H HD3  . PRO A 1 53 ? 13.156  -8.649  3.058   1.00 0.00 ? 62 PRO S HD3  2  
ATOM 1960  N N    . ALA A 1 54 ? 10.875  -5.330  6.978   1.00 0.00 ? 63 ALA S N    2  
ATOM 1961  C CA   . ALA A 1 54 ? 9.946   -4.267  7.338   1.00 0.00 ? 63 ALA S CA   2  
ATOM 1962  C C    . ALA A 1 54 ? 10.567  -2.891  7.117   1.00 0.00 ? 63 ALA S C    2  
ATOM 1963  O O    . ALA A 1 54 ? 9.864   -1.913  6.868   1.00 0.00 ? 63 ALA S O    2  
ATOM 1964  C CB   . ALA A 1 54 ? 9.504   -4.422  8.785   1.00 0.00 ? 63 ALA S CB   2  
ATOM 1965  H H    . ALA A 1 54 ? 11.464  -5.704  7.667   1.00 0.00 ? 63 ALA S H    2  
ATOM 1966  H HA   . ALA A 1 54 ? 9.073   -4.362  6.708   1.00 0.00 ? 63 ALA S HA   2  
ATOM 1967  H HB1  . ALA A 1 54 ? 8.456   -4.176  8.870   1.00 0.00 ? 63 ALA S HB1  2  
ATOM 1968  H HB2  . ALA A 1 54 ? 10.081  -3.757  9.410   1.00 0.00 ? 63 ALA S HB2  2  
ATOM 1969  H HB3  . ALA A 1 54 ? 9.662   -5.442  9.102   1.00 0.00 ? 63 ALA S HB3  2  
ATOM 1970  N N    . TRP A 1 55 ? 11.892  -2.825  7.184   1.00 0.00 ? 64 TRP S N    2  
ATOM 1971  C CA   . TRP A 1 55 ? 12.602  -1.588  6.981   1.00 0.00 ? 64 TRP S CA   2  
ATOM 1972  C C    . TRP A 1 55 ? 12.932  -1.446  5.506   1.00 0.00 ? 64 TRP S C    2  
ATOM 1973  O O    . TRP A 1 55 ? 12.756  -0.385  4.924   1.00 0.00 ? 64 TRP S O    2  
ATOM 1974  C CB   . TRP A 1 55 ? 13.884  -1.566  7.827   1.00 0.00 ? 64 TRP S CB   2  
ATOM 1975  C CG   . TRP A 1 55 ? 15.117  -1.761  7.005   1.00 0.00 ? 64 TRP S CG   2  
ATOM 1976  C CD1  . TRP A 1 55 ? 15.928  -2.852  6.977   1.00 0.00 ? 64 TRP S CD1  2  
ATOM 1977  C CD2  . TRP A 1 55 ? 15.639  -0.838  6.055   1.00 0.00 ? 64 TRP S CD2  2  
ATOM 1978  N NE1  . TRP A 1 55 ? 16.938  -2.660  6.061   1.00 0.00 ? 64 TRP S NE1  2  
ATOM 1979  C CE2  . TRP A 1 55 ? 16.778  -1.426  5.481   1.00 0.00 ? 64 TRP S CE2  2  
ATOM 1980  C CE3  . TRP A 1 55 ? 15.246  0.432   5.636   1.00 0.00 ? 64 TRP S CE3  2  
ATOM 1981  C CZ2  . TRP A 1 55 ? 17.526  -0.779  4.501   1.00 0.00 ? 64 TRP S CZ2  2  
ATOM 1982  C CZ3  . TRP A 1 55 ? 15.983  1.070   4.668   1.00 0.00 ? 64 TRP S CZ3  2  
ATOM 1983  C CH2  . TRP A 1 55 ? 17.110  0.467   4.108   1.00 0.00 ? 64 TRP S CH2  2  
ATOM 1984  H H    . TRP A 1 55 ? 12.405  -3.629  7.351   1.00 0.00 ? 64 TRP S H    2  
ATOM 1985  H HA   . TRP A 1 55 ? 11.958  -0.774  7.281   1.00 0.00 ? 64 TRP S HA   2  
ATOM 1986  H HB2  . TRP A 1 55 ? 13.963  -0.610  8.330   1.00 0.00 ? 64 TRP S HB2  2  
ATOM 1987  H HB3  . TRP A 1 55 ? 13.840  -2.360  8.561   1.00 0.00 ? 64 TRP S HB3  2  
ATOM 1988  H HD1  . TRP A 1 55 ? 15.786  -3.730  7.590   1.00 0.00 ? 64 TRP S HD1  2  
ATOM 1989  H HE1  . TRP A 1 55 ? 17.651  -3.300  5.856   1.00 0.00 ? 64 TRP S HE1  2  
ATOM 1990  H HE3  . TRP A 1 55 ? 14.376  0.914   6.059   1.00 0.00 ? 64 TRP S HE3  2  
ATOM 1991  H HZ2  . TRP A 1 55 ? 18.401  -1.230  4.056   1.00 0.00 ? 64 TRP S HZ2  2  
ATOM 1992  H HZ3  . TRP A 1 55 ? 15.691  2.051   4.328   1.00 0.00 ? 64 TRP S HZ3  2  
ATOM 1993  H HH2  . TRP A 1 55 ? 17.645  1.003   3.348   1.00 0.00 ? 64 TRP S HH2  2  
ATOM 1994  N N    . LYS A 1 56 ? 13.412  -2.537  4.910   1.00 0.00 ? 65 LYS S N    2  
ATOM 1995  C CA   . LYS A 1 56 ? 13.762  -2.541  3.499   1.00 0.00 ? 65 LYS S CA   2  
ATOM 1996  C C    . LYS A 1 56 ? 12.521  -2.260  2.675   1.00 0.00 ? 65 LYS S C    2  
ATOM 1997  O O    . LYS A 1 56 ? 12.549  -1.456  1.742   1.00 0.00 ? 65 LYS S O    2  
ATOM 1998  C CB   . LYS A 1 56 ? 14.385  -3.876  3.094   1.00 0.00 ? 65 LYS S CB   2  
ATOM 1999  C CG   . LYS A 1 56 ? 15.564  -3.723  2.144   1.00 0.00 ? 65 LYS S CG   2  
ATOM 2000  C CD   . LYS A 1 56 ? 16.770  -4.522  2.611   1.00 0.00 ? 65 LYS S CD   2  
ATOM 2001  C CE   . LYS A 1 56 ? 18.059  -3.736  2.440   1.00 0.00 ? 65 LYS S CE   2  
ATOM 2002  N NZ   . LYS A 1 56 ? 18.649  -3.925  1.085   1.00 0.00 ? 65 LYS S NZ   2  
ATOM 2003  H H    . LYS A 1 56 ? 13.526  -3.358  5.432   1.00 0.00 ? 65 LYS S H    2  
ATOM 2004  H HA   . LYS A 1 56 ? 14.478  -1.749  3.333   1.00 0.00 ? 65 LYS S HA   2  
ATOM 2005  H HB2  . LYS A 1 56 ? 14.730  -4.385  3.985   1.00 0.00 ? 65 LYS S HB2  2  
ATOM 2006  H HB3  . LYS A 1 56 ? 13.632  -4.481  2.606   1.00 0.00 ? 65 LYS S HB3  2  
ATOM 2007  H HG2  . LYS A 1 56 ? 15.270  -4.072  1.164   1.00 0.00 ? 65 LYS S HG2  2  
ATOM 2008  H HG3  . LYS A 1 56 ? 15.835  -2.675  2.093   1.00 0.00 ? 65 LYS S HG3  2  
ATOM 2009  H HD2  . LYS A 1 56 ? 16.647  -4.769  3.654   1.00 0.00 ? 65 LYS S HD2  2  
ATOM 2010  H HD3  . LYS A 1 56 ? 16.833  -5.432  2.029   1.00 0.00 ? 65 LYS S HD3  2  
ATOM 2011  H HE2  . LYS A 1 56 ? 17.848  -2.688  2.587   1.00 0.00 ? 65 LYS S HE2  2  
ATOM 2012  H HE3  . LYS A 1 56 ? 18.769  -4.068  3.183   1.00 0.00 ? 65 LYS S HE3  2  
ATOM 2013  H HZ1  . LYS A 1 56 ? 18.316  -4.818  0.672   1.00 0.00 ? 65 LYS S HZ1  2  
ATOM 2014  H HZ2  . LYS A 1 56 ? 19.688  -3.950  1.149   1.00 0.00 ? 65 LYS S HZ2  2  
ATOM 2015  H HZ3  . LYS A 1 56 ? 18.371  -3.140  0.461   1.00 0.00 ? 65 LYS S HZ3  2  
ATOM 2016  N N    . GLN A 1 57 ? 11.416  -2.900  3.050   1.00 0.00 ? 66 GLN S N    2  
ATOM 2017  C CA   . GLN A 1 57 ? 10.161  -2.675  2.361   1.00 0.00 ? 66 GLN S CA   2  
ATOM 2018  C C    . GLN A 1 57 ? 9.794   -1.208  2.508   1.00 0.00 ? 66 GLN S C    2  
ATOM 2019  O O    . GLN A 1 57 ? 9.345   -0.566  1.560   1.00 0.00 ? 66 GLN S O    2  
ATOM 2020  C CB   . GLN A 1 57 ? 9.057   -3.582  2.910   1.00 0.00 ? 66 GLN S CB   2  
ATOM 2021  C CG   . GLN A 1 57 ? 8.601   -3.231  4.317   1.00 0.00 ? 66 GLN S CG   2  
ATOM 2022  C CD   . GLN A 1 57 ? 7.421   -4.067  4.786   1.00 0.00 ? 66 GLN S CD   2  
ATOM 2023  O OE1  . GLN A 1 57 ? 6.617   -3.614  5.601   1.00 0.00 ? 66 GLN S OE1  2  
ATOM 2024  N NE2  . GLN A 1 57 ? 7.304   -5.294  4.276   1.00 0.00 ? 66 GLN S NE2  2  
ATOM 2025  H H    . GLN A 1 57 ? 11.443  -3.506  3.818   1.00 0.00 ? 66 GLN S H    2  
ATOM 2026  H HA   . GLN A 1 57 ? 10.316  -2.892  1.314   1.00 0.00 ? 66 GLN S HA   2  
ATOM 2027  H HB2  . GLN A 1 57 ? 8.202   -3.522  2.257   1.00 0.00 ? 66 GLN S HB2  2  
ATOM 2028  H HB3  . GLN A 1 57 ? 9.419   -4.598  2.916   1.00 0.00 ? 66 GLN S HB3  2  
ATOM 2029  H HG2  . GLN A 1 57 ? 9.425   -3.386  4.996   1.00 0.00 ? 66 GLN S HG2  2  
ATOM 2030  H HG3  . GLN A 1 57 ? 8.313   -2.188  4.335   1.00 0.00 ? 66 GLN S HG3  2  
ATOM 2031  H HE21 . GLN A 1 57 ? 7.974   -5.598  3.630   1.00 0.00 ? 66 GLN S HE21 2  
ATOM 2032  H HE22 . GLN A 1 57 ? 6.549   -5.844  4.568   1.00 0.00 ? 66 GLN S HE22 2  
ATOM 2033  N N    . VAL A 1 58 ? 10.043  -0.668  3.703   1.00 0.00 ? 67 VAL S N    2  
ATOM 2034  C CA   . VAL A 1 58 ? 9.795   0.738   3.959   1.00 0.00 ? 67 VAL S CA   2  
ATOM 2035  C C    . VAL A 1 58 ? 10.802  1.572   3.174   1.00 0.00 ? 67 VAL S C    2  
ATOM 2036  O O    . VAL A 1 58 ? 10.453  2.609   2.609   1.00 0.00 ? 67 VAL S O    2  
ATOM 2037  C CB   . VAL A 1 58 ? 9.895   1.079   5.463   1.00 0.00 ? 67 VAL S CB   2  
ATOM 2038  C CG1  . VAL A 1 58 ? 9.925   2.586   5.685   1.00 0.00 ? 67 VAL S CG1  2  
ATOM 2039  C CG2  . VAL A 1 58 ? 8.739   0.453   6.228   1.00 0.00 ? 67 VAL S CG2  2  
ATOM 2040  H H    . VAL A 1 58 ? 10.435  -1.224  4.413   1.00 0.00 ? 67 VAL S H    2  
ATOM 2041  H HA   . VAL A 1 58 ? 8.796   0.973   3.616   1.00 0.00 ? 67 VAL S HA   2  
ATOM 2042  H HB   . VAL A 1 58 ? 10.816  0.664   5.846   1.00 0.00 ? 67 VAL S HB   2  
ATOM 2043  H HG11 . VAL A 1 58 ? 9.829   2.797   6.740   1.00 0.00 ? 67 VAL S HG11 2  
ATOM 2044  H HG12 . VAL A 1 58 ? 9.107   3.044   5.149   1.00 0.00 ? 67 VAL S HG12 2  
ATOM 2045  H HG13 . VAL A 1 58 ? 10.862  2.984   5.322   1.00 0.00 ? 67 VAL S HG13 2  
ATOM 2046  H HG21 . VAL A 1 58 ? 7.865   1.081   6.136   1.00 0.00 ? 67 VAL S HG21 2  
ATOM 2047  H HG22 . VAL A 1 58 ? 9.006   0.358   7.270   1.00 0.00 ? 67 VAL S HG22 2  
ATOM 2048  H HG23 . VAL A 1 58 ? 8.526   -0.523  5.820   1.00 0.00 ? 67 VAL S HG23 2  
ATOM 2049  N N    . ASN A 1 59 ? 12.058  1.101   3.133   1.00 0.00 ? 68 ASN S N    2  
ATOM 2050  C CA   . ASN A 1 59 ? 13.119  1.797   2.401   1.00 0.00 ? 68 ASN S CA   2  
ATOM 2051  C C    . ASN A 1 59 ? 12.609  2.343   1.069   1.00 0.00 ? 68 ASN S C    2  
ATOM 2052  O O    . ASN A 1 59 ? 12.921  3.472   0.687   1.00 0.00 ? 68 ASN S O    2  
ATOM 2053  C CB   . ASN A 1 59 ? 14.287  0.846   2.141   1.00 0.00 ? 68 ASN S CB   2  
ATOM 2054  C CG   . ASN A 1 59 ? 15.565  1.583   1.788   1.00 0.00 ? 68 ASN S CG   2  
ATOM 2055  O OD1  . ASN A 1 59 ? 15.760  2.733   2.184   1.00 0.00 ? 68 ASN S OD1  2  
ATOM 2056  N ND2  . ASN A 1 59 ? 16.442  0.925   1.040   1.00 0.00 ? 68 ASN S ND2  2  
ATOM 2057  H H    . ASN A 1 59 ? 12.280  0.254   3.612   1.00 0.00 ? 68 ASN S H    2  
ATOM 2058  H HA   . ASN A 1 59 ? 13.462  2.619   3.011   1.00 0.00 ? 68 ASN S HA   2  
ATOM 2059  H HB2  . ASN A 1 59 ? 14.465  0.252   3.022   1.00 0.00 ? 68 ASN S HB2  2  
ATOM 2060  H HB3  . ASN A 1 59 ? 14.033  0.193   1.318   1.00 0.00 ? 68 ASN S HB3  2  
ATOM 2061  H HD21 . ASN A 1 59 ? 16.218  0.012   0.761   1.00 0.00 ? 68 ASN S HD21 2  
ATOM 2062  H HD22 . ASN A 1 59 ? 17.276  1.377   0.797   1.00 0.00 ? 68 ASN S HD22 2  
ATOM 2063  N N    . LEU A 1 60 ? 11.828  1.530   0.366   1.00 0.00 ? 69 LEU S N    2  
ATOM 2064  C CA   . LEU A 1 60 ? 11.278  1.921   -0.927  1.00 0.00 ? 69 LEU S CA   2  
ATOM 2065  C C    . LEU A 1 60 ? 10.111  2.889   -0.757  1.00 0.00 ? 69 LEU S C    2  
ATOM 2066  O O    . LEU A 1 60 ? 10.046  3.919   -1.422  1.00 0.00 ? 69 LEU S O    2  
ATOM 2067  C CB   . LEU A 1 60 ? 10.816  0.684   -1.697  1.00 0.00 ? 69 LEU S CB   2  
ATOM 2068  C CG   . LEU A 1 60 ? 11.780  0.181   -2.772  1.00 0.00 ? 69 LEU S CG   2  
ATOM 2069  C CD1  . LEU A 1 60 ? 12.189  1.316   -3.700  1.00 0.00 ? 69 LEU S CD1  2  
ATOM 2070  C CD2  . LEU A 1 60 ? 13.004  -0.456  -2.132  1.00 0.00 ? 69 LEU S CD2  2  
ATOM 2071  H H    . LEU A 1 60 ? 11.618  0.641   0.724   1.00 0.00 ? 69 LEU S H    2  
ATOM 2072  H HA   . LEU A 1 60 ? 12.059  2.413   -1.486  1.00 0.00 ? 69 LEU S HA   2  
ATOM 2073  H HB2  . LEU A 1 60 ? 10.660  -0.115  -0.984  1.00 0.00 ? 69 LEU S HB2  2  
ATOM 2074  H HB3  . LEU A 1 60 ? 9.872   0.911   -2.173  1.00 0.00 ? 69 LEU S HB3  2  
ATOM 2075  H HG   . LEU A 1 60 ? 11.281  -0.571  -3.367  1.00 0.00 ? 69 LEU S HG   2  
ATOM 2076  H HD11 . LEU A 1 60 ? 13.054  1.818   -3.295  1.00 0.00 ? 69 LEU S HD11 2  
ATOM 2077  H HD12 . LEU A 1 60 ? 11.374  2.018   -3.791  1.00 0.00 ? 69 LEU S HD12 2  
ATOM 2078  H HD13 . LEU A 1 60 ? 12.428  0.915   -4.675  1.00 0.00 ? 69 LEU S HD13 2  
ATOM 2079  H HD21 . LEU A 1 60 ? 13.268  0.090   -1.240  1.00 0.00 ? 69 LEU S HD21 2  
ATOM 2080  H HD22 . LEU A 1 60 ? 13.829  -0.430  -2.829  1.00 0.00 ? 69 LEU S HD22 2  
ATOM 2081  H HD23 . LEU A 1 60 ? 12.782  -1.481  -1.875  1.00 0.00 ? 69 LEU S HD23 2  
ATOM 2082  N N    . LYS A 1 61 ? 9.187   2.547   0.136   1.00 0.00 ? 70 LYS S N    2  
ATOM 2083  C CA   . LYS A 1 61 ? 8.016   3.382   0.391   1.00 0.00 ? 70 LYS S CA   2  
ATOM 2084  C C    . LYS A 1 61 ? 8.418   4.833   0.645   1.00 0.00 ? 70 LYS S C    2  
ATOM 2085  O O    . LYS A 1 61 ? 7.926   5.748   -0.015  1.00 0.00 ? 70 LYS S O    2  
ATOM 2086  C CB   . LYS A 1 61 ? 7.230   2.832   1.583   1.00 0.00 ? 70 LYS S CB   2  
ATOM 2087  C CG   . LYS A 1 61 ? 6.765   1.399   1.383   1.00 0.00 ? 70 LYS S CG   2  
ATOM 2088  C CD   . LYS A 1 61 ? 6.050   0.860   2.609   1.00 0.00 ? 70 LYS S CD   2  
ATOM 2089  C CE   . LYS A 1 61 ? 6.297   -0.628  2.792   1.00 0.00 ? 70 LYS S CE   2  
ATOM 2090  N NZ   . LYS A 1 61 ? 6.101   -1.055  4.204   1.00 0.00 ? 70 LYS S NZ   2  
ATOM 2091  H H    . LYS A 1 61 ? 9.292   1.710   0.634   1.00 0.00 ? 70 LYS S H    2  
ATOM 2092  H HA   . LYS A 1 61 ? 7.388   3.351   -0.485  1.00 0.00 ? 70 LYS S HA   2  
ATOM 2093  H HB2  . LYS A 1 61 ? 7.860   2.866   2.464   1.00 0.00 ? 70 LYS S HB2  2  
ATOM 2094  H HB3  . LYS A 1 61 ? 6.357   3.453   1.743   1.00 0.00 ? 70 LYS S HB3  2  
ATOM 2095  H HG2  . LYS A 1 61 ? 6.088   1.365   0.543   1.00 0.00 ? 70 LYS S HG2  2  
ATOM 2096  H HG3  . LYS A 1 61 ? 7.625   0.778   1.179   1.00 0.00 ? 70 LYS S HG3  2  
ATOM 2097  H HD2  . LYS A 1 61 ? 6.408   1.385   3.483   1.00 0.00 ? 70 LYS S HD2  2  
ATOM 2098  H HD3  . LYS A 1 61 ? 4.989   1.028   2.495   1.00 0.00 ? 70 LYS S HD3  2  
ATOM 2099  H HE2  . LYS A 1 61 ? 5.610   -1.173  2.162   1.00 0.00 ? 70 LYS S HE2  2  
ATOM 2100  H HE3  . LYS A 1 61 ? 7.311   -0.851  2.495   1.00 0.00 ? 70 LYS S HE3  2  
ATOM 2101  H HZ1  . LYS A 1 61 ? 6.939   -0.814  4.771   1.00 0.00 ? 70 LYS S HZ1  2  
ATOM 2102  H HZ2  . LYS A 1 61 ? 5.948   -2.083  4.249   1.00 0.00 ? 70 LYS S HZ2  2  
ATOM 2103  H HZ3  . LYS A 1 61 ? 5.273   -0.576  4.612   1.00 0.00 ? 70 LYS S HZ3  2  
ATOM 2104  N N    . LYS A 1 62 ? 9.319   5.035   1.597   1.00 0.00 ? 71 LYS S N    2  
ATOM 2105  C CA   . LYS A 1 62 ? 9.790   6.373   1.931   1.00 0.00 ? 71 LYS S CA   2  
ATOM 2106  C C    . LYS A 1 62 ? 10.612  6.965   0.788   1.00 0.00 ? 71 LYS S C    2  
ATOM 2107  O O    . LYS A 1 62 ? 10.693  8.184   0.636   1.00 0.00 ? 71 LYS S O    2  
ATOM 2108  C CB   . LYS A 1 62 ? 10.627  6.338   3.212   1.00 0.00 ? 71 LYS S CB   2  
ATOM 2109  C CG   . LYS A 1 62 ? 9.821   6.006   4.456   1.00 0.00 ? 71 LYS S CG   2  
ATOM 2110  C CD   . LYS A 1 62 ? 10.720  5.806   5.665   1.00 0.00 ? 71 LYS S CD   2  
ATOM 2111  C CE   . LYS A 1 62 ? 10.769  7.051   6.537   1.00 0.00 ? 71 LYS S CE   2  
ATOM 2112  N NZ   . LYS A 1 62 ? 11.979  7.874   6.260   1.00 0.00 ? 71 LYS S NZ   2  
ATOM 2113  H H    . LYS A 1 62 ? 9.677   4.266   2.085   1.00 0.00 ? 71 LYS S H    2  
ATOM 2114  H HA   . LYS A 1 62 ? 8.925   6.998   2.095   1.00 0.00 ? 71 LYS S HA   2  
ATOM 2115  H HB2  . LYS A 1 62 ? 11.401  5.592   3.101   1.00 0.00 ? 71 LYS S HB2  2  
ATOM 2116  H HB3  . LYS A 1 62 ? 11.089  7.304   3.354   1.00 0.00 ? 71 LYS S HB3  2  
ATOM 2117  H HG2  . LYS A 1 62 ? 9.139   6.820   4.659   1.00 0.00 ? 71 LYS S HG2  2  
ATOM 2118  H HG3  . LYS A 1 62 ? 9.261   5.100   4.281   1.00 0.00 ? 71 LYS S HG3  2  
ATOM 2119  H HD2  . LYS A 1 62 ? 10.340  4.983   6.252   1.00 0.00 ? 71 LYS S HD2  2  
ATOM 2120  H HD3  . LYS A 1 62 ? 11.719  5.576   5.325   1.00 0.00 ? 71 LYS S HD3  2  
ATOM 2121  H HE2  . LYS A 1 62 ? 9.887   7.645   6.343   1.00 0.00 ? 71 LYS S HE2  2  
ATOM 2122  H HE3  . LYS A 1 62 ? 10.779  6.746   7.574   1.00 0.00 ? 71 LYS S HE3  2  
ATOM 2123  H HZ1  . LYS A 1 62 ? 12.054  8.643   6.957   1.00 0.00 ? 71 LYS S HZ1  2  
ATOM 2124  H HZ2  . LYS A 1 62 ? 11.919  8.287   5.308   1.00 0.00 ? 71 LYS S HZ2  2  
ATOM 2125  H HZ3  . LYS A 1 62 ? 12.833  7.285   6.319   1.00 0.00 ? 71 LYS S HZ3  2  
ATOM 2126  N N    . ALA A 1 63 ? 11.225  6.095   -0.011  1.00 0.00 ? 72 ALA S N    2  
ATOM 2127  C CA   . ALA A 1 63 ? 12.043  6.534   -1.136  1.00 0.00 ? 72 ALA S CA   2  
ATOM 2128  C C    . ALA A 1 63 ? 11.187  6.840   -2.362  1.00 0.00 ? 72 ALA S C    2  
ATOM 2129  O O    . ALA A 1 63 ? 11.576  7.634   -3.219  1.00 0.00 ? 72 ALA S O    2  
ATOM 2130  C CB   . ALA A 1 63 ? 13.087  5.478   -1.472  1.00 0.00 ? 72 ALA S CB   2  
ATOM 2131  H H    . ALA A 1 63 ? 11.127  5.135   0.162   1.00 0.00 ? 72 ALA S H    2  
ATOM 2132  H HA   . ALA A 1 63 ? 12.563  7.433   -0.838  1.00 0.00 ? 72 ALA S HA   2  
ATOM 2133  H HB1  . ALA A 1 63 ? 13.893  5.527   -0.755  1.00 0.00 ? 72 ALA S HB1  2  
ATOM 2134  H HB2  . ALA A 1 63 ? 13.475  5.657   -2.463  1.00 0.00 ? 72 ALA S HB2  2  
ATOM 2135  H HB3  . ALA A 1 63 ? 12.631  4.499   -1.436  1.00 0.00 ? 72 ALA S HB3  2  
ATOM 2136  N N    . LYS A 1 64 ? 10.019  6.209   -2.439  1.00 0.00 ? 73 LYS S N    2  
ATOM 2137  C CA   . LYS A 1 64 ? 9.109   6.418   -3.561  1.00 0.00 ? 73 LYS S CA   2  
ATOM 2138  C C    . LYS A 1 64 ? 8.148   7.566   -3.271  1.00 0.00 ? 73 LYS S C    2  
ATOM 2139  O O    . LYS A 1 64 ? 7.636   8.208   -4.188  1.00 0.00 ? 73 LYS S O    2  
ATOM 2140  C CB   . LYS A 1 64 ? 8.322   5.138   -3.850  1.00 0.00 ? 73 LYS S CB   2  
ATOM 2141  C CG   . LYS A 1 64 ? 8.945   4.275   -4.935  1.00 0.00 ? 73 LYS S CG   2  
ATOM 2142  C CD   . LYS A 1 64 ? 8.348   4.578   -6.300  1.00 0.00 ? 73 LYS S CD   2  
ATOM 2143  C CE   . LYS A 1 64 ? 9.245   5.503   -7.109  1.00 0.00 ? 73 LYS S CE   2  
ATOM 2144  N NZ   . LYS A 1 64 ? 9.258   5.141   -8.553  1.00 0.00 ? 73 LYS S NZ   2  
ATOM 2145  H H    . LYS A 1 64 ? 9.762   5.589   -1.725  1.00 0.00 ? 73 LYS S H    2  
ATOM 2146  H HA   . LYS A 1 64 ? 9.703   6.670   -4.426  1.00 0.00 ? 73 LYS S HA   2  
ATOM 2147  H HB2  . LYS A 1 64 ? 8.264   4.552   -2.944  1.00 0.00 ? 73 LYS S HB2  2  
ATOM 2148  H HB3  . LYS A 1 64 ? 7.322   5.406   -4.163  1.00 0.00 ? 73 LYS S HB3  2  
ATOM 2149  H HG2  . LYS A 1 64 ? 10.007  4.465   -4.967  1.00 0.00 ? 73 LYS S HG2  2  
ATOM 2150  H HG3  . LYS A 1 64 ? 8.770   3.235   -4.699  1.00 0.00 ? 73 LYS S HG3  2  
ATOM 2151  H HD2  . LYS A 1 64 ? 8.222   3.653   -6.842  1.00 0.00 ? 73 LYS S HD2  2  
ATOM 2152  H HD3  . LYS A 1 64 ? 7.386   5.052   -6.165  1.00 0.00 ? 73 LYS S HD3  2  
ATOM 2153  H HE2  . LYS A 1 64 ? 8.885   6.515   -7.003  1.00 0.00 ? 73 LYS S HE2  2  
ATOM 2154  H HE3  . LYS A 1 64 ? 10.250  5.437   -6.720  1.00 0.00 ? 73 LYS S HE3  2  
ATOM 2155  H HZ1  . LYS A 1 64 ? 8.373   5.446   -9.005  1.00 0.00 ? 73 LYS S HZ1  2  
ATOM 2156  H HZ2  . LYS A 1 64 ? 9.354   4.111   -8.662  1.00 0.00 ? 73 LYS S HZ2  2  
ATOM 2157  H HZ3  . LYS A 1 64 ? 10.056  5.605   -9.029  1.00 0.00 ? 73 LYS S HZ3  2  
ATOM 2158  N N    . GLY A 1 65 ? 7.914   7.824   -1.988  1.00 0.00 ? 74 GLY S N    2  
ATOM 2159  C CA   . GLY A 1 65 ? 7.023   8.898   -1.597  1.00 0.00 ? 74 GLY S CA   2  
ATOM 2160  C C    . GLY A 1 65 ? 5.735   8.405   -0.973  1.00 0.00 ? 74 GLY S C    2  
ATOM 2161  O O    . GLY A 1 65 ? 4.982   9.193   -0.399  1.00 0.00 ? 74 GLY S O    2  
ATOM 2162  H H    . GLY A 1 65 ? 8.353   7.282   -1.300  1.00 0.00 ? 74 GLY S H    2  
ATOM 2163  H HA2  . GLY A 1 65 ? 7.533   9.521   -0.877  1.00 0.00 ? 74 GLY S HA2  2  
ATOM 2164  H HA3  . GLY A 1 65 ? 6.784   9.491   -2.470  1.00 0.00 ? 74 GLY S HA3  2  
ATOM 2165  N N    . LEU A 1 66 ? 5.476   7.104   -1.065  1.00 0.00 ? 75 LEU S N    2  
ATOM 2166  C CA   . LEU A 1 66 ? 4.267   6.540   -0.482  1.00 0.00 ? 75 LEU S CA   2  
ATOM 2167  C C    . LEU A 1 66 ? 4.216   6.844   1.010   1.00 0.00 ? 75 LEU S C    2  
ATOM 2168  O O    . LEU A 1 66 ? 3.580   7.810   1.431   1.00 0.00 ? 75 LEU S O    2  
ATOM 2169  C CB   . LEU A 1 66 ? 4.199   5.028   -0.716  1.00 0.00 ? 75 LEU S CB   2  
ATOM 2170  C CG   . LEU A 1 66 ? 3.665   4.613   -2.088  1.00 0.00 ? 75 LEU S CG   2  
ATOM 2171  C CD1  . LEU A 1 66 ? 3.586   3.098   -2.194  1.00 0.00 ? 75 LEU S CD1  2  
ATOM 2172  C CD2  . LEU A 1 66 ? 2.299   5.241   -2.338  1.00 0.00 ? 75 LEU S CD2  2  
ATOM 2173  H H    . LEU A 1 66 ? 6.109   6.516   -1.525  1.00 0.00 ? 75 LEU S H    2  
ATOM 2174  H HA   . LEU A 1 66 ? 3.419   7.009   -0.961  1.00 0.00 ? 75 LEU S HA   2  
ATOM 2175  H HB2  . LEU A 1 66 ? 5.194   4.617   -0.594  1.00 0.00 ? 75 LEU S HB2  2  
ATOM 2176  H HB3  . LEU A 1 66 ? 3.554   4.599   0.039   1.00 0.00 ? 75 LEU S HB3  2  
ATOM 2177  H HG   . LEU A 1 66 ? 4.341   4.967   -2.853  1.00 0.00 ? 75 LEU S HG   2  
ATOM 2178  H HD11 . LEU A 1 66 ? 3.944   2.787   -3.164  1.00 0.00 ? 75 LEU S HD11 2  
ATOM 2179  H HD12 . LEU A 1 66 ? 2.561   2.781   -2.072  1.00 0.00 ? 75 LEU S HD12 2  
ATOM 2180  H HD13 . LEU A 1 66 ? 4.195   2.650   -1.425  1.00 0.00 ? 75 LEU S HD13 2  
ATOM 2181  H HD21 . LEU A 1 66 ? 2.416   6.299   -2.515  1.00 0.00 ? 75 LEU S HD21 2  
ATOM 2182  H HD22 . LEU A 1 66 ? 1.670   5.088   -1.472  1.00 0.00 ? 75 LEU S HD22 2  
ATOM 2183  H HD23 . LEU A 1 66 ? 1.842   4.779   -3.200  1.00 0.00 ? 75 LEU S HD23 2  
ATOM 2184  N N    . PHE A 1 67 ? 4.895   6.021   1.804   1.00 0.00 ? 76 PHE S N    2  
ATOM 2185  C CA   . PHE A 1 67 ? 4.925   6.218   3.253   1.00 0.00 ? 76 PHE S CA   2  
ATOM 2186  C C    . PHE A 1 67 ? 5.356   7.642   3.603   1.00 0.00 ? 76 PHE S C    2  
ATOM 2187  O O    . PHE A 1 67 ? 6.552   7.954   3.431   1.00 0.00 ? 76 PHE S O    2  
ATOM 2188  C CB   . PHE A 1 67 ? 5.868   5.214   3.916   1.00 0.00 ? 76 PHE S CB   2  
ATOM 2189  C CG   . PHE A 1 67 ? 5.150   4.084   4.596   1.00 0.00 ? 76 PHE S CG   2  
ATOM 2190  C CD1  . PHE A 1 67 ? 4.568   3.076   3.851   1.00 0.00 ? 76 PHE S CD1  2  
ATOM 2191  C CD2  . PHE A 1 67 ? 5.056   4.032   5.980   1.00 0.00 ? 76 PHE S CD2  2  
ATOM 2192  C CE1  . PHE A 1 67 ? 3.905   2.034   4.467   1.00 0.00 ? 76 PHE S CE1  2  
ATOM 2193  C CE2  . PHE A 1 67 ? 4.393   2.991   6.603   1.00 0.00 ? 76 PHE S CE2  2  
ATOM 2194  C CZ   . PHE A 1 67 ? 3.817   1.990   5.845   1.00 0.00 ? 76 PHE S CZ   2  
ATOM 2195  O OXT  . PHE A 1 67 ? 4.492   8.429   4.045   1.00 0.00 ? 76 PHE S OXT  2  
ATOM 2196  H H    . PHE A 1 67 ? 5.390   5.268   1.405   1.00 0.00 ? 76 PHE S H    2  
ATOM 2197  H HA   . PHE A 1 67 ? 3.925   6.059   3.627   1.00 0.00 ? 76 PHE S HA   2  
ATOM 2198  H HB2  . PHE A 1 67 ? 6.519   4.790   3.166   1.00 0.00 ? 76 PHE S HB2  2  
ATOM 2199  H HB3  . PHE A 1 67 ? 6.466   5.724   4.658   1.00 0.00 ? 76 PHE S HB3  2  
ATOM 2200  H HD1  . PHE A 1 67 ? 4.636   3.107   2.774   1.00 0.00 ? 76 PHE S HD1  2  
ATOM 2201  H HD2  . PHE A 1 67 ? 5.507   4.815   6.572   1.00 0.00 ? 76 PHE S HD2  2  
ATOM 2202  H HE1  . PHE A 1 67 ? 3.457   1.254   3.870   1.00 0.00 ? 76 PHE S HE1  2  
ATOM 2203  H HE2  . PHE A 1 67 ? 4.324   2.960   7.681   1.00 0.00 ? 76 PHE S HE2  2  
ATOM 2204  H HZ   . PHE A 1 67 ? 3.298   1.176   6.329   1.00 0.00 ? 76 PHE S HZ   2  
ATOM 2205  N N    . MET A 1 1  ? -20.874 -11.194 9.614   1.00 0.00 ? 10 MET S N    3  
ATOM 2206  C CA   . MET A 1 1  ? -20.178 -10.173 8.787   1.00 0.00 ? 10 MET S CA   3  
ATOM 2207  C C    . MET A 1 1  ? -18.692 -10.107 9.129   1.00 0.00 ? 10 MET S C    3  
ATOM 2208  O O    . MET A 1 1  ? -17.840 -10.127 8.242   1.00 0.00 ? 10 MET S O    3  
ATOM 2209  C CB   . MET A 1 1  ? -20.841 -8.815  9.030   1.00 0.00 ? 10 MET S CB   3  
ATOM 2210  C CG   . MET A 1 1  ? -21.737 -8.365  7.889   1.00 0.00 ? 10 MET S CG   3  
ATOM 2211  S SD   . MET A 1 1  ? -21.993 -6.579  7.868   1.00 0.00 ? 10 MET S SD   3  
ATOM 2212  C CE   . MET A 1 1  ? -22.288 -6.299  6.125   1.00 0.00 ? 10 MET S CE   3  
ATOM 2213  H H1   . MET A 1 1  ? -20.373 -12.097 9.492   1.00 0.00 ? 10 MET S H1   3  
ATOM 2214  H H2   . MET A 1 1  ? -21.857 -11.259 9.276   1.00 0.00 ? 10 MET S H2   3  
ATOM 2215  H H3   . MET A 1 1  ? -20.838 -10.878 10.604  1.00 0.00 ? 10 MET S H3   3  
ATOM 2216  H HA   . MET A 1 1  ? -20.287 -10.442 7.746   1.00 0.00 ? 10 MET S HA   3  
ATOM 2217  H HB2  . MET A 1 1  ? -21.439 -8.874  9.927   1.00 0.00 ? 10 MET S HB2  3  
ATOM 2218  H HB3  . MET A 1 1  ? -20.071 -8.070  9.170   1.00 0.00 ? 10 MET S HB3  3  
ATOM 2219  H HG2  . MET A 1 1  ? -21.282 -8.657  6.954   1.00 0.00 ? 10 MET S HG2  3  
ATOM 2220  H HG3  . MET A 1 1  ? -22.696 -8.850  7.989   1.00 0.00 ? 10 MET S HG3  3  
ATOM 2221  H HE1  . MET A 1 1  ? -21.893 -7.127  5.554   1.00 0.00 ? 10 MET S HE1  3  
ATOM 2222  H HE2  . MET A 1 1  ? -21.799 -5.386  5.820   1.00 0.00 ? 10 MET S HE2  3  
ATOM 2223  H HE3  . MET A 1 1  ? -23.350 -6.215  5.948   1.00 0.00 ? 10 MET S HE3  3  
ATOM 2224  N N    . LEU A 1 2  ? -18.391 -10.025 10.421  1.00 0.00 ? 11 LEU S N    3  
ATOM 2225  C CA   . LEU A 1 2  ? -17.008 -9.954  10.880  1.00 0.00 ? 11 LEU S CA   3  
ATOM 2226  C C    . LEU A 1 2  ? -16.213 -11.172 10.421  1.00 0.00 ? 11 LEU S C    3  
ATOM 2227  O O    . LEU A 1 2  ? -14.995 -11.104 10.258  1.00 0.00 ? 11 LEU S O    3  
ATOM 2228  C CB   . LEU A 1 2  ? -16.961 -9.846  12.407  1.00 0.00 ? 11 LEU S CB   3  
ATOM 2229  C CG   . LEU A 1 2  ? -17.058 -8.424  12.957  1.00 0.00 ? 11 LEU S CG   3  
ATOM 2230  C CD1  . LEU A 1 2  ? -15.978 -7.543  12.352  1.00 0.00 ? 11 LEU S CD1  3  
ATOM 2231  C CD2  . LEU A 1 2  ? -18.437 -7.842  12.687  1.00 0.00 ? 11 LEU S CD2  3  
ATOM 2232  H H    . LEU A 1 2  ? -19.115 -10.012 11.082  1.00 0.00 ? 11 LEU S H    3  
ATOM 2233  H HA   . LEU A 1 2  ? -16.563 -9.067  10.454  1.00 0.00 ? 11 LEU S HA   3  
ATOM 2234  H HB2  . LEU A 1 2  ? -17.779 -10.426 12.811  1.00 0.00 ? 11 LEU S HB2  3  
ATOM 2235  H HB3  . LEU A 1 2  ? -16.033 -10.279 12.747  1.00 0.00 ? 11 LEU S HB3  3  
ATOM 2236  H HG   . LEU A 1 2  ? -16.908 -8.448  14.028  1.00 0.00 ? 11 LEU S HG   3  
ATOM 2237  H HD11 . LEU A 1 2  ? -16.240 -7.302  11.333  1.00 0.00 ? 11 LEU S HD11 3  
ATOM 2238  H HD12 . LEU A 1 2  ? -15.034 -8.067  12.366  1.00 0.00 ? 11 LEU S HD12 3  
ATOM 2239  H HD13 . LEU A 1 2  ? -15.892 -6.631  12.925  1.00 0.00 ? 11 LEU S HD13 3  
ATOM 2240  H HD21 . LEU A 1 2  ? -19.185 -8.611  12.818  1.00 0.00 ? 11 LEU S HD21 3  
ATOM 2241  H HD22 . LEU A 1 2  ? -18.478 -7.468  11.675  1.00 0.00 ? 11 LEU S HD22 3  
ATOM 2242  H HD23 . LEU A 1 2  ? -18.629 -7.034  13.377  1.00 0.00 ? 11 LEU S HD23 3  
ATOM 2243  N N    . ALA A 1 3  ? -16.909 -12.287 10.213  1.00 0.00 ? 12 ALA S N    3  
ATOM 2244  C CA   . ALA A 1 3  ? -16.266 -13.518 9.772   1.00 0.00 ? 12 ALA S CA   3  
ATOM 2245  C C    . ALA A 1 3  ? -15.522 -13.310 8.456   1.00 0.00 ? 12 ALA S C    3  
ATOM 2246  O O    . ALA A 1 3  ? -14.367 -13.712 8.314   1.00 0.00 ? 12 ALA S O    3  
ATOM 2247  C CB   . ALA A 1 3  ? -17.295 -14.629 9.632   1.00 0.00 ? 12 ALA S CB   3  
ATOM 2248  H H    . ALA A 1 3  ? -17.877 -12.279 10.361  1.00 0.00 ? 12 ALA S H    3  
ATOM 2249  H HA   . ALA A 1 3  ? -15.554 -13.812 10.531  1.00 0.00 ? 12 ALA S HA   3  
ATOM 2250  H HB1  . ALA A 1 3  ? -18.206 -14.341 10.135  1.00 0.00 ? 12 ALA S HB1  3  
ATOM 2251  H HB2  . ALA A 1 3  ? -16.910 -15.535 10.077  1.00 0.00 ? 12 ALA S HB2  3  
ATOM 2252  H HB3  . ALA A 1 3  ? -17.500 -14.802 8.586   1.00 0.00 ? 12 ALA S HB3  3  
ATOM 2253  N N    . LYS A 1 4  ? -16.193 -12.682 7.498   1.00 0.00 ? 13 LYS S N    3  
ATOM 2254  C CA   . LYS A 1 4  ? -15.598 -12.420 6.191   1.00 0.00 ? 13 LYS S CA   3  
ATOM 2255  C C    . LYS A 1 4  ? -15.302 -10.934 6.018   1.00 0.00 ? 13 LYS S C    3  
ATOM 2256  O O    . LYS A 1 4  ? -16.159 -10.087 6.267   1.00 0.00 ? 13 LYS S O    3  
ATOM 2257  C CB   . LYS A 1 4  ? -16.529 -12.900 5.077   1.00 0.00 ? 13 LYS S CB   3  
ATOM 2258  C CG   . LYS A 1 4  ? -16.376 -14.377 4.752   1.00 0.00 ? 13 LYS S CG   3  
ATOM 2259  C CD   . LYS A 1 4  ? -16.491 -14.635 3.257   1.00 0.00 ? 13 LYS S CD   3  
ATOM 2260  C CE   . LYS A 1 4  ? -15.126 -14.847 2.622   1.00 0.00 ? 13 LYS S CE   3  
ATOM 2261  N NZ   . LYS A 1 4  ? -14.611 -16.225 2.860   1.00 0.00 ? 13 LYS S NZ   3  
ATOM 2262  H H    . LYS A 1 4  ? -17.111 -12.386 7.671   1.00 0.00 ? 13 LYS S H    3  
ATOM 2263  H HA   . LYS A 1 4  ? -14.669 -12.970 6.136   1.00 0.00 ? 13 LYS S HA   3  
ATOM 2264  H HB2  . LYS A 1 4  ? -17.551 -12.723 5.376   1.00 0.00 ? 13 LYS S HB2  3  
ATOM 2265  H HB3  . LYS A 1 4  ? -16.322 -12.333 4.182   1.00 0.00 ? 13 LYS S HB3  3  
ATOM 2266  H HG2  . LYS A 1 4  ? -15.409 -14.713 5.091   1.00 0.00 ? 13 LYS S HG2  3  
ATOM 2267  H HG3  . LYS A 1 4  ? -17.150 -14.930 5.264   1.00 0.00 ? 13 LYS S HG3  3  
ATOM 2268  H HD2  . LYS A 1 4  ? -17.091 -15.518 3.099   1.00 0.00 ? 13 LYS S HD2  3  
ATOM 2269  H HD3  . LYS A 1 4  ? -16.967 -13.786 2.790   1.00 0.00 ? 13 LYS S HD3  3  
ATOM 2270  H HE2  . LYS A 1 4  ? -15.209 -14.682 1.559   1.00 0.00 ? 13 LYS S HE2  3  
ATOM 2271  H HE3  . LYS A 1 4  ? -14.433 -14.135 3.044   1.00 0.00 ? 13 LYS S HE3  3  
ATOM 2272  H HZ1  . LYS A 1 4  ? -15.373 -16.918 2.728   1.00 0.00 ? 13 LYS S HZ1  3  
ATOM 2273  H HZ2  . LYS A 1 4  ? -14.246 -16.306 3.830   1.00 0.00 ? 13 LYS S HZ2  3  
ATOM 2274  H HZ3  . LYS A 1 4  ? -13.843 -16.439 2.192   1.00 0.00 ? 13 LYS S HZ3  3  
ATOM 2275  N N    . LEU A 1 5  ? -14.081 -10.625 5.590   1.00 0.00 ? 14 LEU S N    3  
ATOM 2276  C CA   . LEU A 1 5  ? -13.672 -9.241  5.382   1.00 0.00 ? 14 LEU S CA   3  
ATOM 2277  C C    . LEU A 1 5  ? -13.332 -8.988  3.917   1.00 0.00 ? 14 LEU S C    3  
ATOM 2278  O O    . LEU A 1 5  ? -12.692 -9.814  3.265   1.00 0.00 ? 14 LEU S O    3  
ATOM 2279  C CB   . LEU A 1 5  ? -12.468 -8.905  6.263   1.00 0.00 ? 14 LEU S CB   3  
ATOM 2280  C CG   . LEU A 1 5  ? -12.796 -8.628  7.731   1.00 0.00 ? 14 LEU S CG   3  
ATOM 2281  C CD1  . LEU A 1 5  ? -11.600 -8.944  8.616   1.00 0.00 ? 14 LEU S CD1  3  
ATOM 2282  C CD2  . LEU A 1 5  ? -13.230 -7.180  7.914   1.00 0.00 ? 14 LEU S CD2  3  
ATOM 2283  H H    . LEU A 1 5  ? -13.441 -11.345 5.409   1.00 0.00 ? 14 LEU S H    3  
ATOM 2284  H HA   . LEU A 1 5  ? -14.500 -8.605  5.661   1.00 0.00 ? 14 LEU S HA   3  
ATOM 2285  H HB2  . LEU A 1 5  ? -11.775 -9.733  6.220   1.00 0.00 ? 14 LEU S HB2  3  
ATOM 2286  H HB3  . LEU A 1 5  ? -11.983 -8.031  5.856   1.00 0.00 ? 14 LEU S HB3  3  
ATOM 2287  H HG   . LEU A 1 5  ? -13.615 -9.264  8.036   1.00 0.00 ? 14 LEU S HG   3  
ATOM 2288  H HD11 . LEU A 1 5  ? -11.051 -8.035  8.817   1.00 0.00 ? 14 LEU S HD11 3  
ATOM 2289  H HD12 . LEU A 1 5  ? -10.956 -9.650  8.111   1.00 0.00 ? 14 LEU S HD12 3  
ATOM 2290  H HD13 . LEU A 1 5  ? -11.943 -9.372  9.546   1.00 0.00 ? 14 LEU S HD13 3  
ATOM 2291  H HD21 . LEU A 1 5  ? -13.604 -6.796  6.977   1.00 0.00 ? 14 LEU S HD21 3  
ATOM 2292  H HD22 . LEU A 1 5  ? -12.384 -6.591  8.235   1.00 0.00 ? 14 LEU S HD22 3  
ATOM 2293  H HD23 . LEU A 1 5  ? -14.008 -7.131  8.661   1.00 0.00 ? 14 LEU S HD23 3  
ATOM 2294  N N    . CYS A 1 6  ? -13.763 -7.839  3.405   1.00 0.00 ? 15 CYS S N    3  
ATOM 2295  C CA   . CYS A 1 6  ? -13.503 -7.476  2.016   1.00 0.00 ? 15 CYS S CA   3  
ATOM 2296  C C    . CYS A 1 6  ? -12.267 -6.588  1.910   1.00 0.00 ? 15 CYS S C    3  
ATOM 2297  O O    . CYS A 1 6  ? -11.813 -6.018  2.901   1.00 0.00 ? 15 CYS S O    3  
ATOM 2298  C CB   . CYS A 1 6  ? -14.714 -6.757  1.421   1.00 0.00 ? 15 CYS S CB   3  
ATOM 2299  S SG   . CYS A 1 6  ? -14.940 -7.037  -0.351  1.00 0.00 ? 15 CYS S SG   3  
ATOM 2300  H H    . CYS A 1 6  ? -14.266 -7.220  3.974   1.00 0.00 ? 15 CYS S H    3  
ATOM 2301  H HA   . CYS A 1 6  ? -13.326 -8.387  1.463   1.00 0.00 ? 15 CYS S HA   3  
ATOM 2302  H HB2  . CYS A 1 6  ? -15.608 -7.098  1.922   1.00 0.00 ? 15 CYS S HB2  3  
ATOM 2303  H HB3  . CYS A 1 6  ? -14.605 -5.694  1.575   1.00 0.00 ? 15 CYS S HB3  3  
ATOM 2304  H HG   . CYS A 1 6  ? -15.495 -6.333  -0.694  1.00 0.00 ? 15 CYS S HG   3  
ATOM 2305  N N    . LYS A 1 7  ? -11.728 -6.476  0.701   1.00 0.00 ? 16 LYS S N    3  
ATOM 2306  C CA   . LYS A 1 7  ? -10.545 -5.657  0.465   1.00 0.00 ? 16 LYS S CA   3  
ATOM 2307  C C    . LYS A 1 7  ? -10.779 -4.679  -0.682  1.00 0.00 ? 16 LYS S C    3  
ATOM 2308  O O    . LYS A 1 7  ? -11.410 -5.023  -1.682  1.00 0.00 ? 16 LYS S O    3  
ATOM 2309  C CB   . LYS A 1 7  ? -9.338  -6.544  0.155   1.00 0.00 ? 16 LYS S CB   3  
ATOM 2310  C CG   . LYS A 1 7  ? -9.196  -7.727  1.098   1.00 0.00 ? 16 LYS S CG   3  
ATOM 2311  C CD   . LYS A 1 7  ? -10.009 -8.919  0.620   1.00 0.00 ? 16 LYS S CD   3  
ATOM 2312  C CE   . LYS A 1 7  ? -9.613  -10.190 1.351   1.00 0.00 ? 16 LYS S CE   3  
ATOM 2313  N NZ   . LYS A 1 7  ? -10.435 -11.356 0.927   1.00 0.00 ? 16 LYS S NZ   3  
ATOM 2314  H H    . LYS A 1 7  ? -12.136 -6.956  -0.050  1.00 0.00 ? 16 LYS S H    3  
ATOM 2315  H HA   . LYS A 1 7  ? -10.346 -5.096  1.365   1.00 0.00 ? 16 LYS S HA   3  
ATOM 2316  H HB2  . LYS A 1 7  ? -9.434  -6.923  -0.853  1.00 0.00 ? 16 LYS S HB2  3  
ATOM 2317  H HB3  . LYS A 1 7  ? -8.442  -5.947  0.221   1.00 0.00 ? 16 LYS S HB3  3  
ATOM 2318  H HG2  . LYS A 1 7  ? -8.155  -8.011  1.148   1.00 0.00 ? 16 LYS S HG2  3  
ATOM 2319  H HG3  . LYS A 1 7  ? -9.540  -7.435  2.079   1.00 0.00 ? 16 LYS S HG3  3  
ATOM 2320  H HD2  . LYS A 1 7  ? -11.056 -8.724  0.801   1.00 0.00 ? 16 LYS S HD2  3  
ATOM 2321  H HD3  . LYS A 1 7  ? -9.844  -9.055  -0.437  1.00 0.00 ? 16 LYS S HD3  3  
ATOM 2322  H HE2  . LYS A 1 7  ? -8.573  -10.401 1.143   1.00 0.00 ? 16 LYS S HE2  3  
ATOM 2323  H HE3  . LYS A 1 7  ? -9.742  -10.037 2.413   1.00 0.00 ? 16 LYS S HE3  3  
ATOM 2324  H HZ1  . LYS A 1 7  ? -10.058 -12.231 1.343   1.00 0.00 ? 16 LYS S HZ1  3  
ATOM 2325  H HZ2  . LYS A 1 7  ? -10.423 -11.443 -0.110  1.00 0.00 ? 16 LYS S HZ2  3  
ATOM 2326  H HZ3  . LYS A 1 7  ? -11.419 -11.232 1.241   1.00 0.00 ? 16 LYS S HZ3  3  
ATOM 2327  N N    . THR A 1 8  ? -10.269 -3.464  -0.529  1.00 0.00 ? 17 THR S N    3  
ATOM 2328  C CA   . THR A 1 8  ? -10.422 -2.436  -1.552  1.00 0.00 ? 17 THR S CA   3  
ATOM 2329  C C    . THR A 1 8  ? -9.176  -1.560  -1.634  1.00 0.00 ? 17 THR S C    3  
ATOM 2330  O O    . THR A 1 8  ? -8.718  -1.021  -0.625  1.00 0.00 ? 17 THR S O    3  
ATOM 2331  C CB   . THR A 1 8  ? -11.649 -1.572  -1.259  1.00 0.00 ? 17 THR S CB   3  
ATOM 2332  O OG1  . THR A 1 8  ? -11.672 -0.432  -2.099  1.00 0.00 ? 17 THR S OG1  3  
ATOM 2333  C CG2  . THR A 1 8  ? -11.713 -1.089  0.174   1.00 0.00 ? 17 THR S CG2  3  
ATOM 2334  H H    . THR A 1 8  ? -9.776  -3.252  0.291   1.00 0.00 ? 17 THR S H    3  
ATOM 2335  H HA   . THR A 1 8  ? -10.560 -2.933  -2.501  1.00 0.00 ? 17 THR S HA   3  
ATOM 2336  H HB   . THR A 1 8  ? -12.539 -2.153  -1.452  1.00 0.00 ? 17 THR S HB   3  
ATOM 2337  H HG1  . THR A 1 8  ? -10.965 0.167   -1.847  1.00 0.00 ? 17 THR S HG1  3  
ATOM 2338  H HG21 . THR A 1 8  ? -10.730 -1.143  0.618   1.00 0.00 ? 17 THR S HG21 3  
ATOM 2339  H HG22 . THR A 1 8  ? -12.397 -1.711  0.733   1.00 0.00 ? 17 THR S HG22 3  
ATOM 2340  H HG23 . THR A 1 8  ? -12.062 -0.065  0.193   1.00 0.00 ? 17 THR S HG23 3  
ATOM 2341  N N    . ILE A 1 9  ? -8.629  -1.428  -2.837  1.00 0.00 ? 18 ILE S N    3  
ATOM 2342  C CA   . ILE A 1 9  ? -7.436  -0.627  -3.052  1.00 0.00 ? 18 ILE S CA   3  
ATOM 2343  C C    . ILE A 1 9  ? -7.794  0.822   -3.364  1.00 0.00 ? 18 ILE S C    3  
ATOM 2344  O O    . ILE A 1 9  ? -8.648  1.095   -4.207  1.00 0.00 ? 18 ILE S O    3  
ATOM 2345  C CB   . ILE A 1 9  ? -6.597  -1.205  -4.212  1.00 0.00 ? 18 ILE S CB   3  
ATOM 2346  C CG1  . ILE A 1 9  ? -5.995  -2.553  -3.811  1.00 0.00 ? 18 ILE S CG1  3  
ATOM 2347  C CG2  . ILE A 1 9  ? -5.506  -0.226  -4.629  1.00 0.00 ? 18 ILE S CG2  3  
ATOM 2348  C CD1  . ILE A 1 9  ? -7.021  -3.579  -3.383  1.00 0.00 ? 18 ILE S CD1  3  
ATOM 2349  H H    . ILE A 1 9  ? -9.030  -1.890  -3.601  1.00 0.00 ? 18 ILE S H    3  
ATOM 2350  H HA   . ILE A 1 9  ? -6.841  -0.661  -2.153  1.00 0.00 ? 18 ILE S HA   3  
ATOM 2351  H HB   . ILE A 1 9  ? -7.252  -1.352  -5.057  1.00 0.00 ? 18 ILE S HB   3  
ATOM 2352  H HG12 . ILE A 1 9  ? -5.459  -2.959  -4.651  1.00 0.00 ? 18 ILE S HG12 3  
ATOM 2353  H HG13 . ILE A 1 9  ? -5.309  -2.405  -2.989  1.00 0.00 ? 18 ILE S HG13 3  
ATOM 2354  H HG21 . ILE A 1 9  ? -5.937  0.554   -5.240  1.00 0.00 ? 18 ILE S HG21 3  
ATOM 2355  H HG22 . ILE A 1 9  ? -4.751  -0.747  -5.195  1.00 0.00 ? 18 ILE S HG22 3  
ATOM 2356  H HG23 . ILE A 1 9  ? -5.060  0.213   -3.750  1.00 0.00 ? 18 ILE S HG23 3  
ATOM 2357  H HD11 . ILE A 1 9  ? -7.876  -3.528  -4.039  1.00 0.00 ? 18 ILE S HD11 3  
ATOM 2358  H HD12 . ILE A 1 9  ? -7.333  -3.376  -2.369  1.00 0.00 ? 18 ILE S HD12 3  
ATOM 2359  H HD13 . ILE A 1 9  ? -6.585  -4.566  -3.434  1.00 0.00 ? 18 ILE S HD13 3  
ATOM 2360  N N    . TYR A 1 10 ? -7.121  1.745   -2.687  1.00 0.00 ? 19 TYR S N    3  
ATOM 2361  C CA   . TYR A 1 10 ? -7.354  3.168   -2.900  1.00 0.00 ? 19 TYR S CA   3  
ATOM 2362  C C    . TYR A 1 10 ? -6.380  3.694   -3.957  1.00 0.00 ? 19 TYR S C    3  
ATOM 2363  O O    . TYR A 1 10 ? -5.211  3.307   -3.975  1.00 0.00 ? 19 TYR S O    3  
ATOM 2364  C CB   . TYR A 1 10 ? -7.209  3.940   -1.576  1.00 0.00 ? 19 TYR S CB   3  
ATOM 2365  C CG   . TYR A 1 10 ? -8.376  3.736   -0.618  1.00 0.00 ? 19 TYR S CG   3  
ATOM 2366  C CD1  . TYR A 1 10 ? -9.223  2.639   -0.756  1.00 0.00 ? 19 TYR S CD1  3  
ATOM 2367  C CD2  . TYR A 1 10 ? -8.641  4.637   0.418   1.00 0.00 ? 19 TYR S CD2  3  
ATOM 2368  C CE1  . TYR A 1 10 ? -10.291 2.446   0.097   1.00 0.00 ? 19 TYR S CE1  3  
ATOM 2369  C CE2  . TYR A 1 10 ? -9.709  4.442   1.273   1.00 0.00 ? 19 TYR S CE2  3  
ATOM 2370  C CZ   . TYR A 1 10 ? -10.530 3.349   1.108   1.00 0.00 ? 19 TYR S CZ   3  
ATOM 2371  O OH   . TYR A 1 10 ? -11.595 3.156   1.957   1.00 0.00 ? 19 TYR S OH   3  
ATOM 2372  H H    . TYR A 1 10 ? -6.444  1.463   -2.037  1.00 0.00 ? 19 TYR S H    3  
ATOM 2373  H HA   . TYR A 1 10 ? -8.362  3.284   -3.267  1.00 0.00 ? 19 TYR S HA   3  
ATOM 2374  H HB2  . TYR A 1 10 ? -6.307  3.614   -1.073  1.00 0.00 ? 19 TYR S HB2  3  
ATOM 2375  H HB3  . TYR A 1 10 ? -7.135  4.998   -1.789  1.00 0.00 ? 19 TYR S HB3  3  
ATOM 2376  H HD1  . TYR A 1 10 ? -9.036  1.928   -1.544  1.00 0.00 ? 19 TYR S HD1  3  
ATOM 2377  H HD2  . TYR A 1 10 ? -8.000  5.498   0.559   1.00 0.00 ? 19 TYR S HD2  3  
ATOM 2378  H HE1  . TYR A 1 10 ? -10.934 1.587   -0.030  1.00 0.00 ? 19 TYR S HE1  3  
ATOM 2379  H HE2  . TYR A 1 10 ? -9.899  5.149   2.068   1.00 0.00 ? 19 TYR S HE2  3  
ATOM 2380  H HH   . TYR A 1 10 ? -11.579 2.258   2.294   1.00 0.00 ? 19 TYR S HH   3  
ATOM 2381  N N    . PRO A 1 11 ? -6.848  4.569   -4.866  1.00 0.00 ? 20 PRO S N    3  
ATOM 2382  C CA   . PRO A 1 11 ? -6.009  5.127   -5.934  1.00 0.00 ? 20 PRO S CA   3  
ATOM 2383  C C    . PRO A 1 11 ? -4.710  5.721   -5.406  1.00 0.00 ? 20 PRO S C    3  
ATOM 2384  O O    . PRO A 1 11 ? -4.715  6.742   -4.718  1.00 0.00 ? 20 PRO S O    3  
ATOM 2385  C CB   . PRO A 1 11 ? -6.889  6.217   -6.564  1.00 0.00 ? 20 PRO S CB   3  
ATOM 2386  C CG   . PRO A 1 11 ? -8.016  6.413   -5.607  1.00 0.00 ? 20 PRO S CG   3  
ATOM 2387  C CD   . PRO A 1 11 ? -8.217  5.086   -4.937  1.00 0.00 ? 20 PRO S CD   3  
ATOM 2388  H HA   . PRO A 1 11 ? -5.778  4.378   -6.679  1.00 0.00 ? 20 PRO S HA   3  
ATOM 2389  H HB2  . PRO A 1 11 ? -6.312  7.125   -6.684  1.00 0.00 ? 20 PRO S HB2  3  
ATOM 2390  H HB3  . PRO A 1 11 ? -7.247  5.883   -7.528  1.00 0.00 ? 20 PRO S HB3  3  
ATOM 2391  H HG2  . PRO A 1 11 ? -7.746  7.162   -4.880  1.00 0.00 ? 20 PRO S HG2  3  
ATOM 2392  H HG3  . PRO A 1 11 ? -8.908  6.706   -6.140  1.00 0.00 ? 20 PRO S HG3  3  
ATOM 2393  H HD2  . PRO A 1 11 ? -8.638  5.218   -3.949  1.00 0.00 ? 20 PRO S HD2  3  
ATOM 2394  H HD3  . PRO A 1 11 ? -8.843  4.445   -5.539  1.00 0.00 ? 20 PRO S HD3  3  
ATOM 2395  N N    . LEU A 1 12 ? -3.599  5.064   -5.730  1.00 0.00 ? 21 LEU S N    3  
ATOM 2396  C CA   . LEU A 1 12 ? -2.279  5.505   -5.287  1.00 0.00 ? 21 LEU S CA   3  
ATOM 2397  C C    . LEU A 1 12 ? -2.102  7.017   -5.407  1.00 0.00 ? 21 LEU S C    3  
ATOM 2398  O O    . LEU A 1 12 ? -1.562  7.650   -4.510  1.00 0.00 ? 21 LEU S O    3  
ATOM 2399  C CB   . LEU A 1 12 ? -1.187  4.803   -6.093  1.00 0.00 ? 21 LEU S CB   3  
ATOM 2400  C CG   . LEU A 1 12 ? -1.405  4.793   -7.608  1.00 0.00 ? 21 LEU S CG   3  
ATOM 2401  C CD1  . LEU A 1 12 ? -0.611  5.911   -8.269  1.00 0.00 ? 21 LEU S CD1  3  
ATOM 2402  C CD2  . LEU A 1 12 ? -1.019  3.444   -8.196  1.00 0.00 ? 21 LEU S CD2  3  
ATOM 2403  H H    . LEU A 1 12 ? -3.668  4.252   -6.277  1.00 0.00 ? 21 LEU S H    3  
ATOM 2404  H HA   . LEU A 1 12 ? -2.172  5.229   -4.250  1.00 0.00 ? 21 LEU S HA   3  
ATOM 2405  H HB2  . LEU A 1 12 ? -0.248  5.298   -5.888  1.00 0.00 ? 21 LEU S HB2  3  
ATOM 2406  H HB3  . LEU A 1 12 ? -1.119  3.780   -5.754  1.00 0.00 ? 21 LEU S HB3  3  
ATOM 2407  H HG   . LEU A 1 12 ? -2.452  4.963   -7.816  1.00 0.00 ? 21 LEU S HG   3  
ATOM 2408  H HD11 . LEU A 1 12 ? -0.482  6.724   -7.569  1.00 0.00 ? 21 LEU S HD11 3  
ATOM 2409  H HD12 . LEU A 1 12 ? -1.143  6.266   -9.138  1.00 0.00 ? 21 LEU S HD12 3  
ATOM 2410  H HD13 . LEU A 1 12 ? 0.357   5.536   -8.568  1.00 0.00 ? 21 LEU S HD13 3  
ATOM 2411  H HD21 . LEU A 1 12 ? -1.589  2.664   -7.712  1.00 0.00 ? 21 LEU S HD21 3  
ATOM 2412  H HD22 . LEU A 1 12 ? 0.035   3.271   -8.038  1.00 0.00 ? 21 LEU S HD22 3  
ATOM 2413  H HD23 . LEU A 1 12 ? -1.230  3.439   -9.255  1.00 0.00 ? 21 LEU S HD23 3  
ATOM 2414  N N    . ALA A 1 13 ? -2.554  7.591   -6.516  1.00 0.00 ? 22 ALA S N    3  
ATOM 2415  C CA   . ALA A 1 13 ? -2.423  9.032   -6.729  1.00 0.00 ? 22 ALA S CA   3  
ATOM 2416  C C    . ALA A 1 13 ? -3.185  9.810   -5.665  1.00 0.00 ? 22 ALA S C    3  
ATOM 2417  O O    . ALA A 1 13 ? -2.618  10.639  -4.952  1.00 0.00 ? 22 ALA S O    3  
ATOM 2418  C CB   . ALA A 1 13 ? -2.919  9.407   -8.118  1.00 0.00 ? 22 ALA S CB   3  
ATOM 2419  H H    . ALA A 1 13 ? -2.984  7.040   -7.204  1.00 0.00 ? 22 ALA S H    3  
ATOM 2420  H HA   . ALA A 1 13 ? -1.375  9.285   -6.667  1.00 0.00 ? 22 ALA S HA   3  
ATOM 2421  H HB1  . ALA A 1 13 ? -3.993  9.295   -8.160  1.00 0.00 ? 22 ALA S HB1  3  
ATOM 2422  H HB2  . ALA A 1 13 ? -2.462  8.760   -8.852  1.00 0.00 ? 22 ALA S HB2  3  
ATOM 2423  H HB3  . ALA A 1 13 ? -2.656  10.434  -8.329  1.00 0.00 ? 22 ALA S HB3  3  
ATOM 2424  N N    . ASP A 1 14 ? -4.472  9.526   -5.572  1.00 0.00 ? 23 ASP S N    3  
ATOM 2425  C CA   . ASP A 1 14 ? -5.357  10.168  -4.610  1.00 0.00 ? 23 ASP S CA   3  
ATOM 2426  C C    . ASP A 1 14 ? -4.777  10.176  -3.195  1.00 0.00 ? 23 ASP S C    3  
ATOM 2427  O O    . ASP A 1 14 ? -5.190  10.975  -2.357  1.00 0.00 ? 23 ASP S O    3  
ATOM 2428  C CB   . ASP A 1 14 ? -6.687  9.425   -4.598  1.00 0.00 ? 23 ASP S CB   3  
ATOM 2429  C CG   . ASP A 1 14 ? -7.822  10.233  -5.195  1.00 0.00 ? 23 ASP S CG   3  
ATOM 2430  O OD1  . ASP A 1 14 ? -7.615  10.850  -6.260  1.00 0.00 ? 23 ASP S OD1  3  
ATOM 2431  O OD2  . ASP A 1 14 ? -8.919  10.248  -4.597  1.00 0.00 ? 23 ASP S OD2  3  
ATOM 2432  H H    . ASP A 1 14 ? -4.849  8.857   -6.176  1.00 0.00 ? 23 ASP S H    3  
ATOM 2433  H HA   . ASP A 1 14 ? -5.525  11.184  -4.931  1.00 0.00 ? 23 ASP S HA   3  
ATOM 2434  H HB2  . ASP A 1 14 ? -6.578  8.517   -5.173  1.00 0.00 ? 23 ASP S HB2  3  
ATOM 2435  H HB3  . ASP A 1 14 ? -6.937  9.172   -3.578  1.00 0.00 ? 23 ASP S HB3  3  
ATOM 2436  N N    . LEU A 1 15 ? -3.848  9.270   -2.921  1.00 0.00 ? 24 LEU S N    3  
ATOM 2437  C CA   . LEU A 1 15 ? -3.251  9.171   -1.591  1.00 0.00 ? 24 LEU S CA   3  
ATOM 2438  C C    . LEU A 1 15 ? -1.765  9.507   -1.605  1.00 0.00 ? 24 LEU S C    3  
ATOM 2439  O O    . LEU A 1 15 ? -1.213  9.972   -0.608  1.00 0.00 ? 24 LEU S O    3  
ATOM 2440  C CB   . LEU A 1 15 ? -3.454  7.763   -1.028  1.00 0.00 ? 24 LEU S CB   3  
ATOM 2441  C CG   . LEU A 1 15 ? -3.418  6.630   -2.059  1.00 0.00 ? 24 LEU S CG   3  
ATOM 2442  C CD1  . LEU A 1 15 ? -2.335  5.624   -1.720  1.00 0.00 ? 24 LEU S CD1  3  
ATOM 2443  C CD2  . LEU A 1 15 ? -4.773  5.949   -2.145  1.00 0.00 ? 24 LEU S CD2  3  
ATOM 2444  H H    . LEU A 1 15 ? -3.570  8.643   -3.621  1.00 0.00 ? 24 LEU S H    3  
ATOM 2445  H HA   . LEU A 1 15 ? -3.757  9.876   -0.951  1.00 0.00 ? 24 LEU S HA   3  
ATOM 2446  H HB2  . LEU A 1 15 ? -2.682  7.579   -0.293  1.00 0.00 ? 24 LEU S HB2  3  
ATOM 2447  H HB3  . LEU A 1 15 ? -4.411  7.735   -0.529  1.00 0.00 ? 24 LEU S HB3  3  
ATOM 2448  H HG   . LEU A 1 15 ? -3.190  7.038   -3.030  1.00 0.00 ? 24 LEU S HG   3  
ATOM 2449  H HD11 . LEU A 1 15 ? -1.425  5.884   -2.242  1.00 0.00 ? 24 LEU S HD11 3  
ATOM 2450  H HD12 . LEU A 1 15 ? -2.654  4.638   -2.022  1.00 0.00 ? 24 LEU S HD12 3  
ATOM 2451  H HD13 . LEU A 1 15 ? -2.157  5.635   -0.658  1.00 0.00 ? 24 LEU S HD13 3  
ATOM 2452  H HD21 . LEU A 1 15 ? -4.978  5.436   -1.217  1.00 0.00 ? 24 LEU S HD21 3  
ATOM 2453  H HD22 . LEU A 1 15 ? -4.766  5.238   -2.955  1.00 0.00 ? 24 LEU S HD22 3  
ATOM 2454  H HD23 . LEU A 1 15 ? -5.537  6.691   -2.322  1.00 0.00 ? 24 LEU S HD23 3  
ATOM 2455  N N    . LEU A 1 16 ? -1.120  9.252   -2.731  1.00 0.00 ? 25 LEU S N    3  
ATOM 2456  C CA   . LEU A 1 16 ? 0.309   9.511   -2.869  1.00 0.00 ? 25 LEU S CA   3  
ATOM 2457  C C    . LEU A 1 16 ? 0.635   10.996  -2.717  1.00 0.00 ? 25 LEU S C    3  
ATOM 2458  O O    . LEU A 1 16 ? 1.786   11.364  -2.487  1.00 0.00 ? 25 LEU S O    3  
ATOM 2459  C CB   . LEU A 1 16 ? 0.805   9.000   -4.220  1.00 0.00 ? 25 LEU S CB   3  
ATOM 2460  C CG   . LEU A 1 16 ? 2.324   8.955   -4.378  1.00 0.00 ? 25 LEU S CG   3  
ATOM 2461  C CD1  . LEU A 1 16 ? 2.828   7.538   -4.157  1.00 0.00 ? 25 LEU S CD1  3  
ATOM 2462  C CD2  . LEU A 1 16 ? 2.737   9.468   -5.749  1.00 0.00 ? 25 LEU S CD2  3  
ATOM 2463  H H    . LEU A 1 16 ? -1.617  8.869   -3.489  1.00 0.00 ? 25 LEU S H    3  
ATOM 2464  H HA   . LEU A 1 16 ? 0.816   8.966   -2.087  1.00 0.00 ? 25 LEU S HA   3  
ATOM 2465  H HB2  . LEU A 1 16 ? 0.422   7.998   -4.360  1.00 0.00 ? 25 LEU S HB2  3  
ATOM 2466  H HB3  . LEU A 1 16 ? 0.400   9.635   -4.994  1.00 0.00 ? 25 LEU S HB3  3  
ATOM 2467  H HG   . LEU A 1 16 ? 2.776   9.591   -3.630  1.00 0.00 ? 25 LEU S HG   3  
ATOM 2468  H HD11 . LEU A 1 16 ? 1.998   6.903   -3.882  1.00 0.00 ? 25 LEU S HD11 3  
ATOM 2469  H HD12 . LEU A 1 16 ? 3.561   7.536   -3.364  1.00 0.00 ? 25 LEU S HD12 3  
ATOM 2470  H HD13 . LEU A 1 16 ? 3.278   7.168   -5.066  1.00 0.00 ? 25 LEU S HD13 3  
ATOM 2471  H HD21 . LEU A 1 16 ? 3.585   8.900   -6.106  1.00 0.00 ? 25 LEU S HD21 3  
ATOM 2472  H HD22 . LEU A 1 16 ? 3.006   10.511  -5.678  1.00 0.00 ? 25 LEU S HD22 3  
ATOM 2473  H HD23 . LEU A 1 16 ? 1.913   9.355   -6.440  1.00 0.00 ? 25 LEU S HD23 3  
ATOM 2474  N N    . ALA A 1 17 ? -0.382  11.844  -2.844  1.00 0.00 ? 26 ALA S N    3  
ATOM 2475  C CA   . ALA A 1 17 ? -0.192  13.289  -2.717  1.00 0.00 ? 26 ALA S CA   3  
ATOM 2476  C C    . ALA A 1 17 ? -1.496  14.034  -2.982  1.00 0.00 ? 26 ALA S C    3  
ATOM 2477  O O    . ALA A 1 17 ? -1.518  15.049  -3.678  1.00 0.00 ? 26 ALA S O    3  
ATOM 2478  C CB   . ALA A 1 17 ? 0.894   13.768  -3.670  1.00 0.00 ? 26 ALA S CB   3  
ATOM 2479  H H    . ALA A 1 17 ? -1.278  11.491  -3.026  1.00 0.00 ? 26 ALA S H    3  
ATOM 2480  H HA   . ALA A 1 17 ? 0.129   13.495  -1.707  1.00 0.00 ? 26 ALA S HA   3  
ATOM 2481  H HB1  . ALA A 1 17 ? 0.777   14.828  -3.844  1.00 0.00 ? 26 ALA S HB1  3  
ATOM 2482  H HB2  . ALA A 1 17 ? 0.810   13.239  -4.608  1.00 0.00 ? 26 ALA S HB2  3  
ATOM 2483  H HB3  . ALA A 1 17 ? 1.863   13.581  -3.235  1.00 0.00 ? 26 ALA S HB3  3  
ATOM 2484  N N    . ARG A 1 18 ? -2.582  13.511  -2.429  1.00 0.00 ? 27 ARG S N    3  
ATOM 2485  C CA   . ARG A 1 18 ? -3.901  14.107  -2.606  1.00 0.00 ? 27 ARG S CA   3  
ATOM 2486  C C    . ARG A 1 18 ? -4.774  13.824  -1.386  1.00 0.00 ? 27 ARG S C    3  
ATOM 2487  O O    . ARG A 1 18 ? -4.694  12.742  -0.811  1.00 0.00 ? 27 ARG S O    3  
ATOM 2488  C CB   . ARG A 1 18 ? -4.544  13.527  -3.875  1.00 0.00 ? 27 ARG S CB   3  
ATOM 2489  C CG   . ARG A 1 18 ? -6.022  13.851  -4.052  1.00 0.00 ? 27 ARG S CG   3  
ATOM 2490  C CD   . ARG A 1 18 ? -6.917  12.885  -3.289  1.00 0.00 ? 27 ARG S CD   3  
ATOM 2491  N NE   . ARG A 1 18 ? -8.292  13.375  -3.195  1.00 0.00 ? 27 ARG S NE   3  
ATOM 2492  C CZ   . ARG A 1 18 ? -9.132  13.433  -4.227  1.00 0.00 ? 27 ARG S CZ   3  
ATOM 2493  N NH1  . ARG A 1 18 ? -8.745  13.034  -5.431  1.00 0.00 ? 27 ARG S NH1  3  
ATOM 2494  N NH2  . ARG A 1 18 ? -10.363 13.891  -4.052  1.00 0.00 ? 27 ARG S NH2  3  
ATOM 2495  H H    . ARG A 1 18 ? -2.497  12.696  -1.893  1.00 0.00 ? 27 ARG S H    3  
ATOM 2496  H HA   . ARG A 1 18 ? -3.780  15.173  -2.719  1.00 0.00 ? 27 ARG S HA   3  
ATOM 2497  H HB2  . ARG A 1 18 ? -4.016  13.914  -4.733  1.00 0.00 ? 27 ARG S HB2  3  
ATOM 2498  H HB3  . ARG A 1 18 ? -4.434  12.456  -3.857  1.00 0.00 ? 27 ARG S HB3  3  
ATOM 2499  H HG2  . ARG A 1 18 ? -6.207  14.849  -3.701  1.00 0.00 ? 27 ARG S HG2  3  
ATOM 2500  H HG3  . ARG A 1 18 ? -6.261  13.787  -5.105  1.00 0.00 ? 27 ARG S HG3  3  
ATOM 2501  H HD2  . ARG A 1 18 ? -6.920  11.936  -3.801  1.00 0.00 ? 27 ARG S HD2  3  
ATOM 2502  H HD3  . ARG A 1 18 ? -6.528  12.752  -2.292  1.00 0.00 ? 27 ARG S HD3  3  
ATOM 2503  H HE   . ARG A 1 18 ? -8.606  13.675  -2.317  1.00 0.00 ? 27 ARG S HE   3  
ATOM 2504  H HH11 . ARG A 1 18 ? -7.817  12.688  -5.570  1.00 0.00 ? 27 ARG S HH11 3  
ATOM 2505  H HH12 . ARG A 1 18 ? -9.380  13.081  -6.202  1.00 0.00 ? 27 ARG S HH12 3  
ATOM 2506  H HH21 . ARG A 1 18 ? -10.662 14.192  -3.146  1.00 0.00 ? 27 ARG S HH21 3  
ATOM 2507  H HH22 . ARG A 1 18 ? -10.996 13.934  -4.826  1.00 0.00 ? 27 ARG S HH22 3  
ATOM 2508  N N    . PRO A 1 19 ? -5.628  14.783  -0.973  1.00 0.00 ? 28 PRO S N    3  
ATOM 2509  C CA   . PRO A 1 19 ? -6.517  14.594  0.180   1.00 0.00 ? 28 PRO S CA   3  
ATOM 2510  C C    . PRO A 1 19 ? -7.271  13.267  0.099   1.00 0.00 ? 28 PRO S C    3  
ATOM 2511  O O    . PRO A 1 19 ? -8.412  13.208  -0.359  1.00 0.00 ? 28 PRO S O    3  
ATOM 2512  C CB   . PRO A 1 19 ? -7.484  15.774  0.074   1.00 0.00 ? 28 PRO S CB   3  
ATOM 2513  C CG   . PRO A 1 19 ? -6.701  16.832  -0.622  1.00 0.00 ? 28 PRO S CG   3  
ATOM 2514  C CD   . PRO A 1 19 ? -5.800  16.114  -1.590  1.00 0.00 ? 28 PRO S CD   3  
ATOM 2515  H HA   . PRO A 1 19 ? -5.976  14.645  1.112   1.00 0.00 ? 28 PRO S HA   3  
ATOM 2516  H HB2  . PRO A 1 19 ? -8.355  15.481  -0.499  1.00 0.00 ? 28 PRO S HB2  3  
ATOM 2517  H HB3  . PRO A 1 19 ? -7.782  16.090  1.065   1.00 0.00 ? 28 PRO S HB3  3  
ATOM 2518  H HG2  . PRO A 1 19 ? -7.370  17.496  -1.152  1.00 0.00 ? 28 PRO S HG2  3  
ATOM 2519  H HG3  . PRO A 1 19 ? -6.114  17.387  0.096   1.00 0.00 ? 28 PRO S HG3  3  
ATOM 2520  H HD2  . PRO A 1 19 ? -6.276  16.037  -2.554  1.00 0.00 ? 28 PRO S HD2  3  
ATOM 2521  H HD3  . PRO A 1 19 ? -4.852  16.626  -1.674  1.00 0.00 ? 28 PRO S HD3  3  
ATOM 2522  N N    . LEU A 1 20 ? -6.602  12.204  0.530   1.00 0.00 ? 29 LEU S N    3  
ATOM 2523  C CA   . LEU A 1 20 ? -7.167  10.860  0.500   1.00 0.00 ? 29 LEU S CA   3  
ATOM 2524  C C    . LEU A 1 20 ? -8.114  10.612  1.670   1.00 0.00 ? 29 LEU S C    3  
ATOM 2525  O O    . LEU A 1 20 ? -8.032  11.274  2.704   1.00 0.00 ? 29 LEU S O    3  
ATOM 2526  C CB   . LEU A 1 20 ? -6.041  9.820   0.536   1.00 0.00 ? 29 LEU S CB   3  
ATOM 2527  C CG   . LEU A 1 20 ? -4.873  10.150  1.477   1.00 0.00 ? 29 LEU S CG   3  
ATOM 2528  C CD1  . LEU A 1 20 ? -5.384  10.633  2.827   1.00 0.00 ? 29 LEU S CD1  3  
ATOM 2529  C CD2  . LEU A 1 20 ? -3.969  8.937   1.657   1.00 0.00 ? 29 LEU S CD2  3  
ATOM 2530  H H    . LEU A 1 20 ? -5.690  12.327  0.864   1.00 0.00 ? 29 LEU S H    3  
ATOM 2531  H HA   . LEU A 1 20 ? -7.714  10.748  -0.422  1.00 0.00 ? 29 LEU S HA   3  
ATOM 2532  H HB2  . LEU A 1 20 ? -6.465  8.871   0.842   1.00 0.00 ? 29 LEU S HB2  3  
ATOM 2533  H HB3  . LEU A 1 20 ? -5.648  9.713   -0.466  1.00 0.00 ? 29 LEU S HB3  3  
ATOM 2534  H HG   . LEU A 1 20 ? -4.284  10.942  1.041   1.00 0.00 ? 29 LEU S HG   3  
ATOM 2535  H HD11 . LEU A 1 20 ? -4.585  10.592  3.550   1.00 0.00 ? 29 LEU S HD11 3  
ATOM 2536  H HD12 . LEU A 1 20 ? -6.196  10.000  3.152   1.00 0.00 ? 29 LEU S HD12 3  
ATOM 2537  H HD13 . LEU A 1 20 ? -5.736  11.650  2.735   1.00 0.00 ? 29 LEU S HD13 3  
ATOM 2538  H HD21 . LEU A 1 20 ? -3.095  9.046   1.035   1.00 0.00 ? 29 LEU S HD21 3  
ATOM 2539  H HD22 . LEU A 1 20 ? -4.505  8.044   1.377   1.00 0.00 ? 29 LEU S HD22 3  
ATOM 2540  H HD23 . LEU A 1 20 ? -3.667  8.865   2.693   1.00 0.00 ? 29 LEU S HD23 3  
ATOM 2541  N N    . PRO A 1 21 ? -9.021  9.631   1.517   1.00 0.00 ? 30 PRO S N    3  
ATOM 2542  C CA   . PRO A 1 21 ? -9.982  9.270   2.563   1.00 0.00 ? 30 PRO S CA   3  
ATOM 2543  C C    . PRO A 1 21 ? -9.285  8.702   3.788   1.00 0.00 ? 30 PRO S C    3  
ATOM 2544  O O    . PRO A 1 21 ? -8.081  8.884   3.968   1.00 0.00 ? 30 PRO S O    3  
ATOM 2545  C CB   . PRO A 1 21 ? -10.852 8.199   1.895   1.00 0.00 ? 30 PRO S CB   3  
ATOM 2546  C CG   . PRO A 1 21 ? -9.991  7.636   0.821   1.00 0.00 ? 30 PRO S CG   3  
ATOM 2547  C CD   . PRO A 1 21 ? -9.171  8.787   0.320   1.00 0.00 ? 30 PRO S CD   3  
ATOM 2548  H HA   . PRO A 1 21 ? -10.592 10.110  2.854   1.00 0.00 ? 30 PRO S HA   3  
ATOM 2549  H HB2  . PRO A 1 21 ? -11.124 7.445   2.619   1.00 0.00 ? 30 PRO S HB2  3  
ATOM 2550  H HB3  . PRO A 1 21 ? -11.742 8.657   1.486   1.00 0.00 ? 30 PRO S HB3  3  
ATOM 2551  H HG2  . PRO A 1 21 ? -9.348  6.869   1.232   1.00 0.00 ? 30 PRO S HG2  3  
ATOM 2552  H HG3  . PRO A 1 21 ? -10.604 7.235   0.025   1.00 0.00 ? 30 PRO S HG3  3  
ATOM 2553  H HD2  . PRO A 1 21 ? -8.210  8.443   -0.036  1.00 0.00 ? 30 PRO S HD2  3  
ATOM 2554  H HD3  . PRO A 1 21 ? -9.701  9.316   -0.457  1.00 0.00 ? 30 PRO S HD3  3  
ATOM 2555  N N    . GLU A 1 22 ? -10.041 8.013   4.629   1.00 0.00 ? 31 GLU S N    3  
ATOM 2556  C CA   . GLU A 1 22 ? -9.478  7.423   5.836   1.00 0.00 ? 31 GLU S CA   3  
ATOM 2557  C C    . GLU A 1 22 ? -9.218  5.938   5.661   1.00 0.00 ? 31 GLU S C    3  
ATOM 2558  O O    . GLU A 1 22 ? -8.423  5.358   6.402   1.00 0.00 ? 31 GLU S O    3  
ATOM 2559  C CB   . GLU A 1 22 ? -10.394 7.668   7.038   1.00 0.00 ? 31 GLU S CB   3  
ATOM 2560  C CG   . GLU A 1 22 ? -9.842  7.118   8.344   1.00 0.00 ? 31 GLU S CG   3  
ATOM 2561  C CD   . GLU A 1 22 ? -9.929  8.116   9.481   1.00 0.00 ? 31 GLU S CD   3  
ATOM 2562  O OE1  . GLU A 1 22 ? -9.594  9.301   9.258   1.00 0.00 ? 31 GLU S OE1  3  
ATOM 2563  O OE2  . GLU A 1 22 ? -10.331 7.718   10.593  1.00 0.00 ? 31 GLU S OE2  3  
ATOM 2564  H H    . GLU A 1 22 ? -10.994 7.902   4.434   1.00 0.00 ? 31 GLU S H    3  
ATOM 2565  H HA   . GLU A 1 22 ? -8.527  7.900   6.012   1.00 0.00 ? 31 GLU S HA   3  
ATOM 2566  H HB2  . GLU A 1 22 ? -10.540 8.731   7.153   1.00 0.00 ? 31 GLU S HB2  3  
ATOM 2567  H HB3  . GLU A 1 22 ? -11.348 7.198   6.849   1.00 0.00 ? 31 GLU S HB3  3  
ATOM 2568  H HG2  . GLU A 1 22 ? -10.406 6.237   8.616   1.00 0.00 ? 31 GLU S HG2  3  
ATOM 2569  H HG3  . GLU A 1 22 ? -8.806  6.849   8.198   1.00 0.00 ? 31 GLU S HG3  3  
ATOM 2570  N N    . GLY A 1 23 ? -9.851  5.323   4.666   1.00 0.00 ? 32 GLY S N    3  
ATOM 2571  C CA   . GLY A 1 23 ? -9.606  3.914   4.425   1.00 0.00 ? 32 GLY S CA   3  
ATOM 2572  C C    . GLY A 1 23 ? -8.117  3.648   4.328   1.00 0.00 ? 32 GLY S C    3  
ATOM 2573  O O    . GLY A 1 23 ? -7.647  2.550   4.629   1.00 0.00 ? 32 GLY S O    3  
ATOM 2574  H H    . GLY A 1 23 ? -10.454 5.827   4.083   1.00 0.00 ? 32 GLY S H    3  
ATOM 2575  H HA2  . GLY A 1 23 ? -10.020 3.339   5.243   1.00 0.00 ? 32 GLY S HA2  3  
ATOM 2576  H HA3  . GLY A 1 23 ? -10.082 3.619   3.504   1.00 0.00 ? 32 GLY S HA3  3  
ATOM 2577  N N    . VAL A 1 24 ? -7.378  4.684   3.930   1.00 0.00 ? 33 VAL S N    3  
ATOM 2578  C CA   . VAL A 1 24 ? -5.931  4.602   3.815   1.00 0.00 ? 33 VAL S CA   3  
ATOM 2579  C C    . VAL A 1 24 ? -5.283  4.839   5.168   1.00 0.00 ? 33 VAL S C    3  
ATOM 2580  O O    . VAL A 1 24 ? -5.264  5.965   5.661   1.00 0.00 ? 33 VAL S O    3  
ATOM 2581  C CB   . VAL A 1 24 ? -5.369  5.658   2.844   1.00 0.00 ? 33 VAL S CB   3  
ATOM 2582  C CG1  . VAL A 1 24 ? -5.692  5.309   1.404   1.00 0.00 ? 33 VAL S CG1  3  
ATOM 2583  C CG2  . VAL A 1 24 ? -5.888  7.045   3.201   1.00 0.00 ? 33 VAL S CG2  3  
ATOM 2584  H H    . VAL A 1 24 ? -7.819  5.532   3.724   1.00 0.00 ? 33 VAL S H    3  
ATOM 2585  H HA   . VAL A 1 24 ? -5.670  3.620   3.454   1.00 0.00 ? 33 VAL S HA   3  
ATOM 2586  H HB   . VAL A 1 24 ? -4.296  5.671   2.948   1.00 0.00 ? 33 VAL S HB   3  
ATOM 2587  H HG11 . VAL A 1 24 ? -4.776  5.078   0.881   1.00 0.00 ? 33 VAL S HG11 3  
ATOM 2588  H HG12 . VAL A 1 24 ? -6.175  6.151   0.930   1.00 0.00 ? 33 VAL S HG12 3  
ATOM 2589  H HG13 . VAL A 1 24 ? -6.349  4.453   1.378   1.00 0.00 ? 33 VAL S HG13 3  
ATOM 2590  H HG21 . VAL A 1 24 ? -5.058  7.674   3.487   1.00 0.00 ? 33 VAL S HG21 3  
ATOM 2591  H HG22 . VAL A 1 24 ? -6.581  6.970   4.025   1.00 0.00 ? 33 VAL S HG22 3  
ATOM 2592  H HG23 . VAL A 1 24 ? -6.388  7.474   2.347   1.00 0.00 ? 33 VAL S HG23 3  
ATOM 2593  N N    . ASP A 1 25 ? -4.734  3.790   5.758   1.00 0.00 ? 34 ASP S N    3  
ATOM 2594  C CA   . ASP A 1 25 ? -4.072  3.930   7.041   1.00 0.00 ? 34 ASP S CA   3  
ATOM 2595  C C    . ASP A 1 25 ? -2.687  4.539   6.824   1.00 0.00 ? 34 ASP S C    3  
ATOM 2596  O O    . ASP A 1 25 ? -1.807  3.897   6.253   1.00 0.00 ? 34 ASP S O    3  
ATOM 2597  C CB   . ASP A 1 25 ? -3.966  2.577   7.743   1.00 0.00 ? 34 ASP S CB   3  
ATOM 2598  C CG   . ASP A 1 25 ? -5.277  2.148   8.373   1.00 0.00 ? 34 ASP S CG   3  
ATOM 2599  O OD1  . ASP A 1 25 ? -6.088  3.034   8.715   1.00 0.00 ? 34 ASP S OD1  3  
ATOM 2600  O OD2  . ASP A 1 25 ? -5.493  0.927   8.520   1.00 0.00 ? 34 ASP S OD2  3  
ATOM 2601  H H    . ASP A 1 25 ? -4.761  2.914   5.318   1.00 0.00 ? 34 ASP S H    3  
ATOM 2602  H HA   . ASP A 1 25 ? -4.670  4.602   7.643   1.00 0.00 ? 34 ASP S HA   3  
ATOM 2603  H HB2  . ASP A 1 25 ? -3.672  1.827   7.022   1.00 0.00 ? 34 ASP S HB2  3  
ATOM 2604  H HB3  . ASP A 1 25 ? -3.218  2.640   8.521   1.00 0.00 ? 34 ASP S HB3  3  
ATOM 2605  N N    . PRO A 1 26 ? -2.481  5.799   7.248   1.00 0.00 ? 35 PRO S N    3  
ATOM 2606  C CA   . PRO A 1 26 ? -1.206  6.500   7.061   1.00 0.00 ? 35 PRO S CA   3  
ATOM 2607  C C    . PRO A 1 26 ? 0.008   5.713   7.559   1.00 0.00 ? 35 PRO S C    3  
ATOM 2608  O O    . PRO A 1 26 ? 1.133   5.976   7.140   1.00 0.00 ? 35 PRO S O    3  
ATOM 2609  C CB   . PRO A 1 26 ? -1.373  7.796   7.873   1.00 0.00 ? 35 PRO S CB   3  
ATOM 2610  C CG   . PRO A 1 26 ? -2.603  7.599   8.692   1.00 0.00 ? 35 PRO S CG   3  
ATOM 2611  C CD   . PRO A 1 26 ? -3.470  6.658   7.913   1.00 0.00 ? 35 PRO S CD   3  
ATOM 2612  H HA   . PRO A 1 26 ? -1.060  6.750   6.019   1.00 0.00 ? 35 PRO S HA   3  
ATOM 2613  H HB2  . PRO A 1 26 ? -0.503  7.945   8.498   1.00 0.00 ? 35 PRO S HB2  3  
ATOM 2614  H HB3  . PRO A 1 26 ? -1.481  8.631   7.195   1.00 0.00 ? 35 PRO S HB3  3  
ATOM 2615  H HG2  . PRO A 1 26 ? -2.342  7.164   9.645   1.00 0.00 ? 35 PRO S HG2  3  
ATOM 2616  H HG3  . PRO A 1 26 ? -3.107  8.544   8.833   1.00 0.00 ? 35 PRO S HG3  3  
ATOM 2617  H HD2  . PRO A 1 26 ? -4.100  6.086   8.579   1.00 0.00 ? 35 PRO S HD2  3  
ATOM 2618  H HD3  . PRO A 1 26 ? -4.064  7.196   7.188   1.00 0.00 ? 35 PRO S HD3  3  
ATOM 2619  N N    . LEU A 1 27 ? -0.215  4.755   8.454   1.00 0.00 ? 36 LEU S N    3  
ATOM 2620  C CA   . LEU A 1 27 ? 0.886   3.956   8.993   1.00 0.00 ? 36 LEU S CA   3  
ATOM 2621  C C    . LEU A 1 27 ? 1.064   2.641   8.229   1.00 0.00 ? 36 LEU S C    3  
ATOM 2622  O O    . LEU A 1 27 ? 1.930   1.838   8.566   1.00 0.00 ? 36 LEU S O    3  
ATOM 2623  C CB   . LEU A 1 27 ? 0.675   3.676   10.487  1.00 0.00 ? 36 LEU S CB   3  
ATOM 2624  C CG   . LEU A 1 27 ? -0.691  3.097   10.876  1.00 0.00 ? 36 LEU S CG   3  
ATOM 2625  C CD1  . LEU A 1 27 ? -1.707  4.209   11.089  1.00 0.00 ? 36 LEU S CD1  3  
ATOM 2626  C CD2  . LEU A 1 27 ? -1.179  2.117   9.821   1.00 0.00 ? 36 LEU S CD2  3  
ATOM 2627  H H    . LEU A 1 27 ? -1.130  4.586   8.761   1.00 0.00 ? 36 LEU S H    3  
ATOM 2628  H HA   . LEU A 1 27 ? 1.789   4.538   8.880   1.00 0.00 ? 36 LEU S HA   3  
ATOM 2629  H HB2  . LEU A 1 27 ? 1.438   2.981   10.811  1.00 0.00 ? 36 LEU S HB2  3  
ATOM 2630  H HB3  . LEU A 1 27 ? 0.810   4.606   11.026  1.00 0.00 ? 36 LEU S HB3  3  
ATOM 2631  H HG   . LEU A 1 27 ? -0.590  2.560   11.808  1.00 0.00 ? 36 LEU S HG   3  
ATOM 2632  H HD11 . LEU A 1 27 ? -1.195  5.157   11.162  1.00 0.00 ? 36 LEU S HD11 3  
ATOM 2633  H HD12 . LEU A 1 27 ? -2.255  4.026   12.002  1.00 0.00 ? 36 LEU S HD12 3  
ATOM 2634  H HD13 . LEU A 1 27 ? -2.395  4.234   10.257  1.00 0.00 ? 36 LEU S HD13 3  
ATOM 2635  H HD21 . LEU A 1 27 ? -2.121  1.693   10.130  1.00 0.00 ? 36 LEU S HD21 3  
ATOM 2636  H HD22 . LEU A 1 27 ? -0.449  1.329   9.698   1.00 0.00 ? 36 LEU S HD22 3  
ATOM 2637  H HD23 . LEU A 1 27 ? -1.304  2.635   8.880   1.00 0.00 ? 36 LEU S HD23 3  
ATOM 2638  N N    . LYS A 1 28 ? 0.245   2.429   7.200   1.00 0.00 ? 37 LYS S N    3  
ATOM 2639  C CA   . LYS A 1 28 ? 0.323   1.218   6.385   1.00 0.00 ? 37 LYS S CA   3  
ATOM 2640  C C    . LYS A 1 28 ? -0.316  1.460   5.020   1.00 0.00 ? 37 LYS S C    3  
ATOM 2641  O O    . LYS A 1 28 ? -1.494  1.178   4.810   1.00 0.00 ? 37 LYS S O    3  
ATOM 2642  C CB   . LYS A 1 28 ? -0.341  0.027   7.095   1.00 0.00 ? 37 LYS S CB   3  
ATOM 2643  C CG   . LYS A 1 28 ? -1.838  0.182   7.321   1.00 0.00 ? 37 LYS S CG   3  
ATOM 2644  C CD   . LYS A 1 28 ? -2.400  -0.978  8.129   1.00 0.00 ? 37 LYS S CD   3  
ATOM 2645  C CE   . LYS A 1 28 ? -1.971  -0.910  9.586   1.00 0.00 ? 37 LYS S CE   3  
ATOM 2646  N NZ   . LYS A 1 28 ? -2.062  -2.238  10.254  1.00 0.00 ? 37 LYS S NZ   3  
ATOM 2647  H H    . LYS A 1 28 ? -0.426  3.108   6.977   1.00 0.00 ? 37 LYS S H    3  
ATOM 2648  H HA   . LYS A 1 28 ? 1.369   0.993   6.236   1.00 0.00 ? 37 LYS S HA   3  
ATOM 2649  H HB2  . LYS A 1 28 ? -0.183  -0.861  6.500   1.00 0.00 ? 37 LYS S HB2  3  
ATOM 2650  H HB3  . LYS A 1 28 ? 0.134   -0.107  8.058   1.00 0.00 ? 37 LYS S HB3  3  
ATOM 2651  H HG2  . LYS A 1 28 ? -2.019  1.099   7.853   1.00 0.00 ? 37 LYS S HG2  3  
ATOM 2652  H HG3  . LYS A 1 28 ? -2.338  0.215   6.367   1.00 0.00 ? 37 LYS S HG3  3  
ATOM 2653  H HD2  . LYS A 1 28 ? -3.478  -0.946  8.082   1.00 0.00 ? 37 LYS S HD2  3  
ATOM 2654  H HD3  . LYS A 1 28 ? -2.047  -1.906  7.703   1.00 0.00 ? 37 LYS S HD3  3  
ATOM 2655  H HE2  . LYS A 1 28 ? -0.949  -0.565  9.632   1.00 0.00 ? 37 LYS S HE2  3  
ATOM 2656  H HE3  . LYS A 1 28 ? -2.609  -0.212  10.104  1.00 0.00 ? 37 LYS S HE3  3  
ATOM 2657  H HZ1  . LYS A 1 28 ? -3.047  -2.436  10.520  1.00 0.00 ? 37 LYS S HZ1  3  
ATOM 2658  H HZ2  . LYS A 1 28 ? -1.473  -2.248  11.111  1.00 0.00 ? 37 LYS S HZ2  3  
ATOM 2659  H HZ3  . LYS A 1 28 ? -1.732  -2.986  9.612   1.00 0.00 ? 37 LYS S HZ3  3  
ATOM 2660  N N    . LEU A 1 29 ? 0.467   2.010   4.100   1.00 0.00 ? 38 LEU S N    3  
ATOM 2661  C CA   . LEU A 1 29 ? -0.025  2.315   2.763   1.00 0.00 ? 38 LEU S CA   3  
ATOM 2662  C C    . LEU A 1 29 ? 0.113   1.124   1.823   1.00 0.00 ? 38 LEU S C    3  
ATOM 2663  O O    . LEU A 1 29 ? -0.858  0.711   1.188   1.00 0.00 ? 38 LEU S O    3  
ATOM 2664  C CB   . LEU A 1 29 ? 0.710   3.533   2.196   1.00 0.00 ? 38 LEU S CB   3  
ATOM 2665  C CG   . LEU A 1 29 ? 0.752   4.771   3.109   1.00 0.00 ? 38 LEU S CG   3  
ATOM 2666  C CD1  . LEU A 1 29 ? 0.943   6.035   2.283   1.00 0.00 ? 38 LEU S CD1  3  
ATOM 2667  C CD2  . LEU A 1 29 ? -0.508  4.891   3.964   1.00 0.00 ? 38 LEU S CD2  3  
ATOM 2668  H H    . LEU A 1 29 ? 1.396   2.229   4.329   1.00 0.00 ? 38 LEU S H    3  
ATOM 2669  H HA   . LEU A 1 29 ? -1.069  2.555   2.855   1.00 0.00 ? 38 LEU S HA   3  
ATOM 2670  H HB2  . LEU A 1 29 ? 1.729   3.239   1.982   1.00 0.00 ? 38 LEU S HB2  3  
ATOM 2671  H HB3  . LEU A 1 29 ? 0.234   3.814   1.267   1.00 0.00 ? 38 LEU S HB3  3  
ATOM 2672  H HG   . LEU A 1 29 ? 1.600   4.685   3.774   1.00 0.00 ? 38 LEU S HG   3  
ATOM 2673  H HD11 . LEU A 1 29 ? 1.665   6.672   2.765   1.00 0.00 ? 38 LEU S HD11 3  
ATOM 2674  H HD12 . LEU A 1 29 ? -0.000  6.558   2.204   1.00 0.00 ? 38 LEU S HD12 3  
ATOM 2675  H HD13 . LEU A 1 29 ? 1.293   5.773   1.296   1.00 0.00 ? 38 LEU S HD13 3  
ATOM 2676  H HD21 . LEU A 1 29 ? -1.275  5.405   3.407   1.00 0.00 ? 38 LEU S HD21 3  
ATOM 2677  H HD22 . LEU A 1 29 ? -0.280  5.448   4.858   1.00 0.00 ? 38 LEU S HD22 3  
ATOM 2678  H HD23 . LEU A 1 29 ? -0.859  3.908   4.238   1.00 0.00 ? 38 LEU S HD23 3  
ATOM 2679  N N    . GLU A 1 30 ? 1.322   0.579   1.731   1.00 0.00 ? 39 GLU S N    3  
ATOM 2680  C CA   . GLU A 1 30 ? 1.589   -0.565  0.858   1.00 0.00 ? 39 GLU S CA   3  
ATOM 2681  C C    . GLU A 1 30 ? 0.498   -1.641  0.956   1.00 0.00 ? 39 GLU S C    3  
ATOM 2682  O O    . GLU A 1 30 ? 0.323   -2.439  0.037   1.00 0.00 ? 39 GLU S O    3  
ATOM 2683  C CB   . GLU A 1 30 ? 2.949   -1.176  1.207   1.00 0.00 ? 39 GLU S CB   3  
ATOM 2684  C CG   . GLU A 1 30 ? 2.956   -1.955  2.515   1.00 0.00 ? 39 GLU S CG   3  
ATOM 2685  C CD   . GLU A 1 30 ? 4.304   -2.580  2.815   1.00 0.00 ? 39 GLU S CD   3  
ATOM 2686  O OE1  . GLU A 1 30 ? 5.326   -2.042  2.341   1.00 0.00 ? 39 GLU S OE1  3  
ATOM 2687  O OE2  . GLU A 1 30 ? 4.337   -3.605  3.526   1.00 0.00 ? 39 GLU S OE2  3  
ATOM 2688  H H    . GLU A 1 30 ? 2.058   0.961   2.258   1.00 0.00 ? 39 GLU S H    3  
ATOM 2689  H HA   . GLU A 1 30 ? 1.624   -0.202  -0.157  1.00 0.00 ? 39 GLU S HA   3  
ATOM 2690  H HB2  . GLU A 1 30 ? 3.244   -1.848  0.413   1.00 0.00 ? 39 GLU S HB2  3  
ATOM 2691  H HB3  . GLU A 1 30 ? 3.678   -0.381  1.286   1.00 0.00 ? 39 GLU S HB3  3  
ATOM 2692  H HG2  . GLU A 1 30 ? 2.699   -1.284  3.320   1.00 0.00 ? 39 GLU S HG2  3  
ATOM 2693  H HG3  . GLU A 1 30 ? 2.216   -2.741  2.453   1.00 0.00 ? 39 GLU S HG3  3  
ATOM 2694  N N    . ILE A 1 31 ? -0.214  -1.674  2.079   1.00 0.00 ? 40 ILE S N    3  
ATOM 2695  C CA   . ILE A 1 31 ? -1.259  -2.673  2.294   1.00 0.00 ? 40 ILE S CA   3  
ATOM 2696  C C    . ILE A 1 31 ? -2.542  -2.375  1.514   1.00 0.00 ? 40 ILE S C    3  
ATOM 2697  O O    . ILE A 1 31 ? -3.242  -3.299  1.103   1.00 0.00 ? 40 ILE S O    3  
ATOM 2698  C CB   . ILE A 1 31 ? -1.607  -2.796  3.788   1.00 0.00 ? 40 ILE S CB   3  
ATOM 2699  C CG1  . ILE A 1 31 ? -2.113  -1.458  4.327   1.00 0.00 ? 40 ILE S CG1  3  
ATOM 2700  C CG2  . ILE A 1 31 ? -0.397  -3.272  4.578   1.00 0.00 ? 40 ILE S CG2  3  
ATOM 2701  C CD1  . ILE A 1 31 ? -3.618  -1.385  4.454   1.00 0.00 ? 40 ILE S CD1  3  
ATOM 2702  H H    . ILE A 1 31 ? -0.017  -1.029  2.790   1.00 0.00 ? 40 ILE S H    3  
ATOM 2703  H HA   . ILE A 1 31 ? -0.871  -3.625  1.966   1.00 0.00 ? 40 ILE S HA   3  
ATOM 2704  H HB   . ILE A 1 31 ? -2.388  -3.536  3.894   1.00 0.00 ? 40 ILE S HB   3  
ATOM 2705  H HG12 . ILE A 1 31 ? -1.691  -1.288  5.307   1.00 0.00 ? 40 ILE S HG12 3  
ATOM 2706  H HG13 . ILE A 1 31 ? -1.797  -0.667  3.662   1.00 0.00 ? 40 ILE S HG13 3  
ATOM 2707  H HG21 . ILE A 1 31 ? 0.107   -2.419  5.012   1.00 0.00 ? 40 ILE S HG21 3  
ATOM 2708  H HG22 . ILE A 1 31 ? 0.281   -3.792  3.918   1.00 0.00 ? 40 ILE S HG22 3  
ATOM 2709  H HG23 . ILE A 1 31 ? -0.719  -3.940  5.364   1.00 0.00 ? 40 ILE S HG23 3  
ATOM 2710  H HD11 . ILE A 1 31 ? -4.026  -2.384  4.471   1.00 0.00 ? 40 ILE S HD11 3  
ATOM 2711  H HD12 . ILE A 1 31 ? -4.024  -0.847  3.610   1.00 0.00 ? 40 ILE S HD12 3  
ATOM 2712  H HD13 . ILE A 1 31 ? -3.880  -0.874  5.368   1.00 0.00 ? 40 ILE S HD13 3  
ATOM 2713  N N    . TYR A 1 32 ? -2.870  -1.097  1.328   1.00 0.00 ? 41 TYR S N    3  
ATOM 2714  C CA   . TYR A 1 32 ? -4.096  -0.736  0.614   1.00 0.00 ? 41 TYR S CA   3  
ATOM 2715  C C    . TYR A 1 32 ? -3.875  -0.575  -0.885  1.00 0.00 ? 41 TYR S C    3  
ATOM 2716  O O    . TYR A 1 32 ? -4.621  0.143   -1.551  1.00 0.00 ? 41 TYR S O    3  
ATOM 2717  C CB   . TYR A 1 32 ? -4.720  0.540   1.191   1.00 0.00 ? 41 TYR S CB   3  
ATOM 2718  C CG   . TYR A 1 32 ? -3.820  1.762   1.200   1.00 0.00 ? 41 TYR S CG   3  
ATOM 2719  C CD1  . TYR A 1 32 ? -3.055  2.125   0.093   1.00 0.00 ? 41 TYR S CD1  3  
ATOM 2720  C CD2  . TYR A 1 32 ? -3.761  2.573   2.325   1.00 0.00 ? 41 TYR S CD2  3  
ATOM 2721  C CE1  . TYR A 1 32 ? -2.261  3.258   0.114   1.00 0.00 ? 41 TYR S CE1  3  
ATOM 2722  C CE2  . TYR A 1 32 ? -2.968  3.702   2.354   1.00 0.00 ? 41 TYR S CE2  3  
ATOM 2723  C CZ   . TYR A 1 32 ? -2.222  4.041   1.247   1.00 0.00 ? 41 TYR S CZ   3  
ATOM 2724  O OH   . TYR A 1 32 ? -1.438  5.169   1.272   1.00 0.00 ? 41 TYR S OH   3  
ATOM 2725  H H    . TYR A 1 32 ? -2.293  -0.391  1.687   1.00 0.00 ? 41 TYR S H    3  
ATOM 2726  H HA   . TYR A 1 32 ? -4.798  -1.545  0.759   1.00 0.00 ? 41 TYR S HA   3  
ATOM 2727  H HB2  . TYR A 1 32 ? -5.596  0.789   0.611   1.00 0.00 ? 41 TYR S HB2  3  
ATOM 2728  H HB3  . TYR A 1 32 ? -5.019  0.345   2.213   1.00 0.00 ? 41 TYR S HB3  3  
ATOM 2729  H HD1  . TYR A 1 32 ? -3.085  1.516   -0.793  1.00 0.00 ? 41 TYR S HD1  3  
ATOM 2730  H HD2  . TYR A 1 32 ? -4.343  2.306   3.194   1.00 0.00 ? 41 TYR S HD2  3  
ATOM 2731  H HE1  . TYR A 1 32 ? -1.672  3.523   -0.754  1.00 0.00 ? 41 TYR S HE1  3  
ATOM 2732  H HE2  . TYR A 1 32 ? -2.936  4.316   3.242   1.00 0.00 ? 41 TYR S HE2  3  
ATOM 2733  H HH   . TYR A 1 32 ? -1.994  5.945   1.369   1.00 0.00 ? 41 TYR S HH   3  
ATOM 2734  N N    . LEU A 1 33 ? -2.861  -1.244  -1.425  1.00 0.00 ? 42 LEU S N    3  
ATOM 2735  C CA   . LEU A 1 33 ? -2.584  -1.153  -2.852  1.00 0.00 ? 42 LEU S CA   3  
ATOM 2736  C C    . LEU A 1 33 ? -2.308  -2.522  -3.449  1.00 0.00 ? 42 LEU S C    3  
ATOM 2737  O O    . LEU A 1 33 ? -1.390  -3.222  -3.029  1.00 0.00 ? 42 LEU S O    3  
ATOM 2738  C CB   . LEU A 1 33 ? -1.394  -0.227  -3.120  1.00 0.00 ? 42 LEU S CB   3  
ATOM 2739  C CG   . LEU A 1 33 ? -0.308  -0.209  -2.040  1.00 0.00 ? 42 LEU S CG   3  
ATOM 2740  C CD1  . LEU A 1 33 ? 0.923   -0.966  -2.510  1.00 0.00 ? 42 LEU S CD1  3  
ATOM 2741  C CD2  . LEU A 1 33 ? 0.055   1.223   -1.675  1.00 0.00 ? 42 LEU S CD2  3  
ATOM 2742  H H    . LEU A 1 33 ? -2.293  -1.812  -0.856  1.00 0.00 ? 42 LEU S H    3  
ATOM 2743  H HA   . LEU A 1 33 ? -3.458  -0.741  -3.331  1.00 0.00 ? 42 LEU S HA   3  
ATOM 2744  H HB2  . LEU A 1 33 ? -0.937  -0.534  -4.052  1.00 0.00 ? 42 LEU S HB2  3  
ATOM 2745  H HB3  . LEU A 1 33 ? -1.772  0.776   -3.244  1.00 0.00 ? 42 LEU S HB3  3  
ATOM 2746  H HG   . LEU A 1 33 ? -0.680  -0.698  -1.151  1.00 0.00 ? 42 LEU S HG   3  
ATOM 2747  H HD11 . LEU A 1 33 ? 0.643   -1.655  -3.291  1.00 0.00 ? 42 LEU S HD11 3  
ATOM 2748  H HD12 . LEU A 1 33 ? 1.348   -1.514  -1.681  1.00 0.00 ? 42 LEU S HD12 3  
ATOM 2749  H HD13 . LEU A 1 33 ? 1.652   -0.267  -2.891  1.00 0.00 ? 42 LEU S HD13 3  
ATOM 2750  H HD21 . LEU A 1 33 ? 0.378   1.261   -0.645  1.00 0.00 ? 42 LEU S HD21 3  
ATOM 2751  H HD22 . LEU A 1 33 ? -0.809  1.857   -1.804  1.00 0.00 ? 42 LEU S HD22 3  
ATOM 2752  H HD23 . LEU A 1 33 ? 0.853   1.566   -2.316  1.00 0.00 ? 42 LEU S HD23 3  
ATOM 2753  N N    . THR A 1 34 ? -3.105  -2.889  -4.449  1.00 0.00 ? 43 THR S N    3  
ATOM 2754  C CA   . THR A 1 34 ? -2.931  -4.169  -5.122  1.00 0.00 ? 43 THR S CA   3  
ATOM 2755  C C    . THR A 1 34 ? -1.540  -4.238  -5.739  1.00 0.00 ? 43 THR S C    3  
ATOM 2756  O O    . THR A 1 34 ? -0.733  -3.343  -5.537  1.00 0.00 ? 43 THR S O    3  
ATOM 2757  C CB   . THR A 1 34 ? -3.998  -4.356  -6.202  1.00 0.00 ? 43 THR S CB   3  
ATOM 2758  O OG1  . THR A 1 34 ? -4.486  -3.105  -6.649  1.00 0.00 ? 43 THR S OG1  3  
ATOM 2759  C CG2  . THR A 1 34 ? -5.186  -5.171  -5.736  1.00 0.00 ? 43 THR S CG2  3  
ATOM 2760  H H    . THR A 1 34 ? -3.813  -2.282  -4.748  1.00 0.00 ? 43 THR S H    3  
ATOM 2761  H HA   . THR A 1 34 ? -3.028  -4.952  -4.384  1.00 0.00 ? 43 THR S HA   3  
ATOM 2762  H HB   . THR A 1 34 ? -3.557  -4.868  -7.046  1.00 0.00 ? 43 THR S HB   3  
ATOM 2763  H HG1  . THR A 1 34 ? -5.006  -3.228  -7.446  1.00 0.00 ? 43 THR S HG1  3  
ATOM 2764  H HG21 . THR A 1 34 ? -6.091  -4.596  -5.869  1.00 0.00 ? 43 THR S HG21 3  
ATOM 2765  H HG22 . THR A 1 34 ? -5.066  -5.415  -4.690  1.00 0.00 ? 43 THR S HG22 3  
ATOM 2766  H HG23 . THR A 1 34 ? -5.247  -6.081  -6.313  1.00 0.00 ? 43 THR S HG23 3  
ATOM 2767  N N    . ASP A 1 35 ? -1.281  -5.299  -6.491  1.00 0.00 ? 44 ASP S N    3  
ATOM 2768  C CA   . ASP A 1 35 ? 0.003   -5.503  -7.148  1.00 0.00 ? 44 ASP S CA   3  
ATOM 2769  C C    . ASP A 1 35 ? 0.278   -4.392  -8.146  1.00 0.00 ? 44 ASP S C    3  
ATOM 2770  O O    . ASP A 1 35 ? 1.402   -3.911  -8.254  1.00 0.00 ? 44 ASP S O    3  
ATOM 2771  C CB   . ASP A 1 35 ? 0.023   -6.858  -7.857  1.00 0.00 ? 44 ASP S CB   3  
ATOM 2772  C CG   . ASP A 1 35 ? -1.046  -6.968  -8.925  1.00 0.00 ? 44 ASP S CG   3  
ATOM 2773  O OD1  . ASP A 1 35 ? -2.243  -6.875  -8.579  1.00 0.00 ? 44 ASP S OD1  3  
ATOM 2774  O OD2  . ASP A 1 35 ? -0.688  -7.148  -10.109 1.00 0.00 ? 44 ASP S OD2  3  
ATOM 2775  H H    . ASP A 1 35 ? -1.969  -5.955  -6.608  1.00 0.00 ? 44 ASP S H    3  
ATOM 2776  H HA   . ASP A 1 35 ? 0.770   -5.492  -6.390  1.00 0.00 ? 44 ASP S HA   3  
ATOM 2777  H HB2  . ASP A 1 35 ? 0.989   -6.998  -8.326  1.00 0.00 ? 44 ASP S HB2  3  
ATOM 2778  H HB3  . ASP A 1 35 ? -0.138  -7.642  -7.129  1.00 0.00 ? 44 ASP S HB3  3  
ATOM 2779  N N    . GLU A 1 36 ? -0.756  -3.978  -8.869  1.00 0.00 ? 45 GLU S N    3  
ATOM 2780  C CA   . GLU A 1 36 ? -0.611  -2.906  -9.842  1.00 0.00 ? 45 GLU S CA   3  
ATOM 2781  C C    . GLU A 1 36 ? -0.231  -1.623  -9.127  1.00 0.00 ? 45 GLU S C    3  
ATOM 2782  O O    . GLU A 1 36 ? 0.789   -1.005  -9.428  1.00 0.00 ? 45 GLU S O    3  
ATOM 2783  C CB   . GLU A 1 36 ? -1.904  -2.703  -10.616 1.00 0.00 ? 45 GLU S CB   3  
ATOM 2784  C CG   . GLU A 1 36 ? -2.421  -3.964  -11.288 1.00 0.00 ? 45 GLU S CG   3  
ATOM 2785  C CD   . GLU A 1 36 ? -2.097  -4.009  -12.769 1.00 0.00 ? 45 GLU S CD   3  
ATOM 2786  O OE1  . GLU A 1 36 ? -2.145  -2.945  -13.420 1.00 0.00 ? 45 GLU S OE1  3  
ATOM 2787  O OE2  . GLU A 1 36 ? -1.795  -5.109  -13.277 1.00 0.00 ? 45 GLU S OE2  3  
ATOM 2788  H H    . GLU A 1 36 ? -1.635  -4.392  -8.735  1.00 0.00 ? 45 GLU S H    3  
ATOM 2789  H HA   . GLU A 1 36 ? 0.178   -3.178  -10.527 1.00 0.00 ? 45 GLU S HA   3  
ATOM 2790  H HB2  . GLU A 1 36 ? -2.661  -2.346  -9.932  1.00 0.00 ? 45 GLU S HB2  3  
ATOM 2791  H HB3  . GLU A 1 36 ? -1.735  -1.956  -11.374 1.00 0.00 ? 45 GLU S HB3  3  
ATOM 2792  H HG2  . GLU A 1 36 ? -1.974  -4.821  -10.811 1.00 0.00 ? 45 GLU S HG2  3  
ATOM 2793  H HG3  . GLU A 1 36 ? -3.495  -4.006  -11.168 1.00 0.00 ? 45 GLU S HG3  3  
ATOM 2794  N N    . ASP A 1 37 ? -1.047  -1.245  -8.145  1.00 0.00 ? 46 ASP S N    3  
ATOM 2795  C CA   . ASP A 1 37 ? -0.783  -0.063  -7.355  1.00 0.00 ? 46 ASP S CA   3  
ATOM 2796  C C    . ASP A 1 37 ? 0.528   -0.263  -6.607  1.00 0.00 ? 46 ASP S C    3  
ATOM 2797  O O    . ASP A 1 37 ? 1.304   0.670   -6.414  1.00 0.00 ? 46 ASP S O    3  
ATOM 2798  C CB   . ASP A 1 37 ? -1.934  0.172   -6.379  1.00 0.00 ? 46 ASP S CB   3  
ATOM 2799  C CG   . ASP A 1 37 ? -1.745  1.426   -5.551  1.00 0.00 ? 46 ASP S CG   3  
ATOM 2800  O OD1  . ASP A 1 37 ? -0.638  1.616   -5.004  1.00 0.00 ? 46 ASP S OD1  3  
ATOM 2801  O OD2  . ASP A 1 37 ? -2.703  2.220   -5.449  1.00 0.00 ? 46 ASP S OD2  3  
ATOM 2802  H H    . ASP A 1 37 ? -1.829  -1.793  -7.928  1.00 0.00 ? 46 ASP S H    3  
ATOM 2803  H HA   . ASP A 1 37 ? -0.691  0.782   -8.021  1.00 0.00 ? 46 ASP S HA   3  
ATOM 2804  H HB2  . ASP A 1 37 ? -2.854  0.270   -6.939  1.00 0.00 ? 46 ASP S HB2  3  
ATOM 2805  H HB3  . ASP A 1 37 ? -2.010  -0.680  -5.713  1.00 0.00 ? 46 ASP S HB3  3  
ATOM 2806  N N    . PHE A 1 38 ? 0.765   -1.512  -6.220  1.00 0.00 ? 47 PHE S N    3  
ATOM 2807  C CA   . PHE A 1 38 ? 1.981   -1.899  -5.523  1.00 0.00 ? 47 PHE S CA   3  
ATOM 2808  C C    . PHE A 1 38 ? 3.175   -1.672  -6.423  1.00 0.00 ? 47 PHE S C    3  
ATOM 2809  O O    . PHE A 1 38 ? 4.185   -1.099  -6.016  1.00 0.00 ? 47 PHE S O    3  
ATOM 2810  C CB   . PHE A 1 38 ? 1.918   -3.384  -5.158  1.00 0.00 ? 47 PHE S CB   3  
ATOM 2811  C CG   . PHE A 1 38 ? 2.001   -3.664  -3.691  1.00 0.00 ? 47 PHE S CG   3  
ATOM 2812  C CD1  . PHE A 1 38 ? 3.062   -3.195  -2.939  1.00 0.00 ? 47 PHE S CD1  3  
ATOM 2813  C CD2  . PHE A 1 38 ? 1.015   -4.406  -3.065  1.00 0.00 ? 47 PHE S CD2  3  
ATOM 2814  C CE1  . PHE A 1 38 ? 3.139   -3.460  -1.588  1.00 0.00 ? 47 PHE S CE1  3  
ATOM 2815  C CE2  . PHE A 1 38 ? 1.084   -4.675  -1.716  1.00 0.00 ? 47 PHE S CE2  3  
ATOM 2816  C CZ   . PHE A 1 38 ? 2.148   -4.201  -0.972  1.00 0.00 ? 47 PHE S CZ   3  
ATOM 2817  H H    . PHE A 1 38 ? 0.105   -2.204  -6.432  1.00 0.00 ? 47 PHE S H    3  
ATOM 2818  H HA   . PHE A 1 38 ? 2.077   -1.305  -4.630  1.00 0.00 ? 47 PHE S HA   3  
ATOM 2819  H HB2  . PHE A 1 38 ? 0.991   -3.795  -5.516  1.00 0.00 ? 47 PHE S HB2  3  
ATOM 2820  H HB3  . PHE A 1 38 ? 2.734   -3.898  -5.639  1.00 0.00 ? 47 PHE S HB3  3  
ATOM 2821  H HD1  . PHE A 1 38 ? 3.838   -2.615  -3.419  1.00 0.00 ? 47 PHE S HD1  3  
ATOM 2822  H HD2  . PHE A 1 38 ? 0.183   -4.776  -3.646  1.00 0.00 ? 47 PHE S HD2  3  
ATOM 2823  H HE1  . PHE A 1 38 ? 3.971   -3.089  -1.014  1.00 0.00 ? 47 PHE S HE1  3  
ATOM 2824  H HE2  . PHE A 1 38 ? 0.306   -5.255  -1.243  1.00 0.00 ? 47 PHE S HE2  3  
ATOM 2825  H HZ   . PHE A 1 38 ? 2.207   -4.409  0.085   1.00 0.00 ? 47 PHE S HZ   3  
ATOM 2826  N N    . GLU A 1 39 ? 3.047   -2.149  -7.654  1.00 0.00 ? 48 GLU S N    3  
ATOM 2827  C CA   . GLU A 1 39 ? 4.121   -2.022  -8.630  1.00 0.00 ? 48 GLU S CA   3  
ATOM 2828  C C    . GLU A 1 39 ? 4.492   -0.559  -8.869  1.00 0.00 ? 48 GLU S C    3  
ATOM 2829  O O    . GLU A 1 39 ? 5.668   -0.225  -9.009  1.00 0.00 ? 48 GLU S O    3  
ATOM 2830  C CB   . GLU A 1 39 ? 3.721   -2.687  -9.947  1.00 0.00 ? 48 GLU S CB   3  
ATOM 2831  C CG   . GLU A 1 39 ? 3.910   -4.195  -9.944  1.00 0.00 ? 48 GLU S CG   3  
ATOM 2832  C CD   . GLU A 1 39 ? 4.243   -4.742  -11.319 1.00 0.00 ? 48 GLU S CD   3  
ATOM 2833  O OE1  . GLU A 1 39 ? 5.159   -4.196  -11.970 1.00 0.00 ? 48 GLU S OE1  3  
ATOM 2834  O OE2  . GLU A 1 39 ? 3.589   -5.716  -11.745 1.00 0.00 ? 48 GLU S OE2  3  
ATOM 2835  H H    . GLU A 1 39 ? 2.202   -2.614  -7.909  1.00 0.00 ? 48 GLU S H    3  
ATOM 2836  H HA   . GLU A 1 39 ? 4.986   -2.536  -8.232  1.00 0.00 ? 48 GLU S HA   3  
ATOM 2837  H HB2  . GLU A 1 39 ? 2.679   -2.476  -10.140 1.00 0.00 ? 48 GLU S HB2  3  
ATOM 2838  H HB3  . GLU A 1 39 ? 4.319   -2.271  -10.744 1.00 0.00 ? 48 GLU S HB3  3  
ATOM 2839  H HG2  . GLU A 1 39 ? 4.719   -4.443  -9.269  1.00 0.00 ? 48 GLU S HG2  3  
ATOM 2840  H HG3  . GLU A 1 39 ? 2.995   -4.661  -9.598  1.00 0.00 ? 48 GLU S HG3  3  
ATOM 2841  N N    . PHE A 1 40 ? 3.486   0.305   -8.925  1.00 0.00 ? 49 PHE S N    3  
ATOM 2842  C CA   . PHE A 1 40 ? 3.715   1.729   -9.164  1.00 0.00 ? 49 PHE S CA   3  
ATOM 2843  C C    . PHE A 1 40 ? 3.857   2.519   -7.861  1.00 0.00 ? 49 PHE S C    3  
ATOM 2844  O O    . PHE A 1 40 ? 4.238   3.689   -7.884  1.00 0.00 ? 49 PHE S O    3  
ATOM 2845  C CB   . PHE A 1 40 ? 2.572   2.311   -9.997  1.00 0.00 ? 49 PHE S CB   3  
ATOM 2846  C CG   . PHE A 1 40 ? 3.004   3.417   -10.917 1.00 0.00 ? 49 PHE S CG   3  
ATOM 2847  C CD1  . PHE A 1 40 ? 3.207   4.699   -10.433 1.00 0.00 ? 49 PHE S CD1  3  
ATOM 2848  C CD2  . PHE A 1 40 ? 3.205   3.174   -12.267 1.00 0.00 ? 49 PHE S CD2  3  
ATOM 2849  C CE1  . PHE A 1 40 ? 3.604   5.718   -11.278 1.00 0.00 ? 49 PHE S CE1  3  
ATOM 2850  C CE2  . PHE A 1 40 ? 3.601   4.190   -13.117 1.00 0.00 ? 49 PHE S CE2  3  
ATOM 2851  C CZ   . PHE A 1 40 ? 3.801   5.463   -12.621 1.00 0.00 ? 49 PHE S CZ   3  
ATOM 2852  H H    . PHE A 1 40 ? 2.569   -0.019  -8.814  1.00 0.00 ? 49 PHE S H    3  
ATOM 2853  H HA   . PHE A 1 40 ? 4.633   1.822   -9.723  1.00 0.00 ? 49 PHE S HA   3  
ATOM 2854  H HB2  . PHE A 1 40 ? 2.142   1.525   -10.603 1.00 0.00 ? 49 PHE S HB2  3  
ATOM 2855  H HB3  . PHE A 1 40 ? 1.816   2.704   -9.333  1.00 0.00 ? 49 PHE S HB3  3  
ATOM 2856  H HD1  . PHE A 1 40 ? 3.054   4.899   -9.383  1.00 0.00 ? 49 PHE S HD1  3  
ATOM 2857  H HD2  . PHE A 1 40 ? 3.049   2.178   -12.656 1.00 0.00 ? 49 PHE S HD2  3  
ATOM 2858  H HE1  . PHE A 1 40 ? 3.759   6.714   -10.888 1.00 0.00 ? 49 PHE S HE1  3  
ATOM 2859  H HE2  . PHE A 1 40 ? 3.755   3.988   -14.166 1.00 0.00 ? 49 PHE S HE2  3  
ATOM 2860  H HZ   . PHE A 1 40 ? 4.111   6.258   -13.283 1.00 0.00 ? 49 PHE S HZ   3  
ATOM 2861  N N    . ALA A 1 41 ? 3.540   1.894   -6.732  1.00 0.00 ? 50 ALA S N    3  
ATOM 2862  C CA   . ALA A 1 41 ? 3.630   2.573   -5.442  1.00 0.00 ? 50 ALA S CA   3  
ATOM 2863  C C    . ALA A 1 41 ? 4.909   2.211   -4.693  1.00 0.00 ? 50 ALA S C    3  
ATOM 2864  O O    . ALA A 1 41 ? 5.518   3.064   -4.050  1.00 0.00 ? 50 ALA S O    3  
ATOM 2865  C CB   . ALA A 1 41 ? 2.414   2.249   -4.586  1.00 0.00 ? 50 ALA S CB   3  
ATOM 2866  H H    . ALA A 1 41 ? 3.231   0.964   -6.765  1.00 0.00 ? 50 ALA S H    3  
ATOM 2867  H HA   . ALA A 1 41 ? 3.629   3.637   -5.630  1.00 0.00 ? 50 ALA S HA   3  
ATOM 2868  H HB1  . ALA A 1 41 ? 2.453   2.826   -3.675  1.00 0.00 ? 50 ALA S HB1  3  
ATOM 2869  H HB2  . ALA A 1 41 ? 2.413   1.196   -4.346  1.00 0.00 ? 50 ALA S HB2  3  
ATOM 2870  H HB3  . ALA A 1 41 ? 1.515   2.495   -5.131  1.00 0.00 ? 50 ALA S HB3  3  
ATOM 2871  N N    . LEU A 1 42 ? 5.306   0.946   -4.763  1.00 0.00 ? 51 LEU S N    3  
ATOM 2872  C CA   . LEU A 1 42 ? 6.508   0.492   -4.067  1.00 0.00 ? 51 LEU S CA   3  
ATOM 2873  C C    . LEU A 1 42 ? 7.360   -0.434  -4.933  1.00 0.00 ? 51 LEU S C    3  
ATOM 2874  O O    . LEU A 1 42 ? 8.362   -0.977  -4.466  1.00 0.00 ? 51 LEU S O    3  
ATOM 2875  C CB   . LEU A 1 42 ? 6.119   -0.238  -2.783  1.00 0.00 ? 51 LEU S CB   3  
ATOM 2876  C CG   . LEU A 1 42 ? 5.907   0.660   -1.564  1.00 0.00 ? 51 LEU S CG   3  
ATOM 2877  C CD1  . LEU A 1 42 ? 4.599   0.320   -0.875  1.00 0.00 ? 51 LEU S CD1  3  
ATOM 2878  C CD2  . LEU A 1 42 ? 7.064   0.525   -0.593  1.00 0.00 ? 51 LEU S CD2  3  
ATOM 2879  H H    . LEU A 1 42 ? 4.776   0.302   -5.278  1.00 0.00 ? 51 LEU S H    3  
ATOM 2880  H HA   . LEU A 1 42 ? 7.091   1.362   -3.810  1.00 0.00 ? 51 LEU S HA   3  
ATOM 2881  H HB2  . LEU A 1 42 ? 5.205   -0.783  -2.969  1.00 0.00 ? 51 LEU S HB2  3  
ATOM 2882  H HB3  . LEU A 1 42 ? 6.899   -0.949  -2.548  1.00 0.00 ? 51 LEU S HB3  3  
ATOM 2883  H HG   . LEU A 1 42 ? 5.857   1.688   -1.887  1.00 0.00 ? 51 LEU S HG   3  
ATOM 2884  H HD11 . LEU A 1 42 ? 3.776   0.522   -1.542  1.00 0.00 ? 51 LEU S HD11 3  
ATOM 2885  H HD12 . LEU A 1 42 ? 4.499   0.922   0.015   1.00 0.00 ? 51 LEU S HD12 3  
ATOM 2886  H HD13 . LEU A 1 42 ? 4.598   -0.725  -0.605  1.00 0.00 ? 51 LEU S HD13 3  
ATOM 2887  H HD21 . LEU A 1 42 ? 6.794   -0.164  0.195   1.00 0.00 ? 51 LEU S HD21 3  
ATOM 2888  H HD22 . LEU A 1 42 ? 7.287   1.485   -0.166  1.00 0.00 ? 51 LEU S HD22 3  
ATOM 2889  H HD23 . LEU A 1 42 ? 7.931   0.152   -1.115  1.00 0.00 ? 51 LEU S HD23 3  
ATOM 2890  N N    . ASP A 1 43 ? 6.964   -0.627  -6.185  1.00 0.00 ? 52 ASP S N    3  
ATOM 2891  C CA   . ASP A 1 43 ? 7.699   -1.502  -7.086  1.00 0.00 ? 52 ASP S CA   3  
ATOM 2892  C C    . ASP A 1 43 ? 7.740   -2.936  -6.555  1.00 0.00 ? 52 ASP S C    3  
ATOM 2893  O O    . ASP A 1 43 ? 8.501   -3.766  -7.056  1.00 0.00 ? 52 ASP S O    3  
ATOM 2894  C CB   . ASP A 1 43 ? 9.124   -0.980  -7.286  1.00 0.00 ? 52 ASP S CB   3  
ATOM 2895  C CG   . ASP A 1 43 ? 9.194   0.125   -8.322  1.00 0.00 ? 52 ASP S CG   3  
ATOM 2896  O OD1  . ASP A 1 43 ? 8.542   1.171   -8.118  1.00 0.00 ? 52 ASP S OD1  3  
ATOM 2897  O OD2  . ASP A 1 43 ? 9.902   -0.054  -9.334  1.00 0.00 ? 52 ASP S OD2  3  
ATOM 2898  H H    . ASP A 1 43 ? 6.155   -0.180  -6.511  1.00 0.00 ? 52 ASP S H    3  
ATOM 2899  H HA   . ASP A 1 43 ? 7.190   -1.500  -8.038  1.00 0.00 ? 52 ASP S HA   3  
ATOM 2900  H HB2  . ASP A 1 43 ? 9.495   -0.594  -6.347  1.00 0.00 ? 52 ASP S HB2  3  
ATOM 2901  H HB3  . ASP A 1 43 ? 9.757   -1.795  -7.612  1.00 0.00 ? 52 ASP S HB3  3  
ATOM 2902  N N    . MET A 1 44 ? 6.908   -3.234  -5.554  1.00 0.00 ? 53 MET S N    3  
ATOM 2903  C CA   . MET A 1 44 ? 6.852   -4.580  -4.987  1.00 0.00 ? 53 MET S CA   3  
ATOM 2904  C C    . MET A 1 44 ? 5.410   -5.076  -4.959  1.00 0.00 ? 53 MET S C    3  
ATOM 2905  O O    . MET A 1 44 ? 4.545   -4.474  -5.588  1.00 0.00 ? 53 MET S O    3  
ATOM 2906  C CB   . MET A 1 44 ? 7.459   -4.609  -3.586  1.00 0.00 ? 53 MET S CB   3  
ATOM 2907  C CG   . MET A 1 44 ? 8.486   -5.716  -3.404  1.00 0.00 ? 53 MET S CG   3  
ATOM 2908  S SD   . MET A 1 44 ? 10.177  -5.147  -3.666  1.00 0.00 ? 53 MET S SD   3  
ATOM 2909  C CE   . MET A 1 44 ? 10.844  -6.503  -4.626  1.00 0.00 ? 53 MET S CE   3  
ATOM 2910  H H    . MET A 1 44 ? 6.311   -2.536  -5.196  1.00 0.00 ? 53 MET S H    3  
ATOM 2911  H HA   . MET A 1 44 ? 7.425   -5.231  -5.631  1.00 0.00 ? 53 MET S HA   3  
ATOM 2912  H HB2  . MET A 1 44 ? 7.945   -3.661  -3.397  1.00 0.00 ? 53 MET S HB2  3  
ATOM 2913  H HB3  . MET A 1 44 ? 6.671   -4.754  -2.861  1.00 0.00 ? 53 MET S HB3  3  
ATOM 2914  H HG2  . MET A 1 44 ? 8.404   -6.105  -2.402  1.00 0.00 ? 53 MET S HG2  3  
ATOM 2915  H HG3  . MET A 1 44 ? 8.273   -6.503  -4.113  1.00 0.00 ? 53 MET S HG3  3  
ATOM 2916  H HE1  . MET A 1 44 ? 11.210  -7.270  -3.959  1.00 0.00 ? 53 MET S HE1  3  
ATOM 2917  H HE2  . MET A 1 44 ? 11.656  -6.143  -5.241  1.00 0.00 ? 53 MET S HE2  3  
ATOM 2918  H HE3  . MET A 1 44 ? 10.070  -6.914  -5.257  1.00 0.00 ? 53 MET S HE3  3  
ATOM 2919  N N    . THR A 1 45 ? 5.143   -6.165  -4.238  1.00 0.00 ? 54 THR S N    3  
ATOM 2920  C CA   . THR A 1 45 ? 3.786   -6.694  -4.165  1.00 0.00 ? 54 THR S CA   3  
ATOM 2921  C C    . THR A 1 45 ? 3.404   -7.014  -2.728  1.00 0.00 ? 54 THR S C    3  
ATOM 2922  O O    . THR A 1 45 ? 4.248   -6.993  -1.830  1.00 0.00 ? 54 THR S O    3  
ATOM 2923  C CB   . THR A 1 45 ? 3.639   -7.938  -5.045  1.00 0.00 ? 54 THR S CB   3  
ATOM 2924  O OG1  . THR A 1 45 ? 2.474   -8.665  -4.697  1.00 0.00 ? 54 THR S OG1  3  
ATOM 2925  C CG2  . THR A 1 45 ? 4.814   -8.885  -4.949  1.00 0.00 ? 54 THR S CG2  3  
ATOM 2926  H H    . THR A 1 45 ? 5.862   -6.619  -3.741  1.00 0.00 ? 54 THR S H    3  
ATOM 2927  H HA   . THR A 1 45 ? 3.118   -5.928  -4.535  1.00 0.00 ? 54 THR S HA   3  
ATOM 2928  H HB   . THR A 1 45 ? 3.549   -7.627  -6.074  1.00 0.00 ? 54 THR S HB   3  
ATOM 2929  H HG1  . THR A 1 45 ? 2.199   -9.205  -5.440  1.00 0.00 ? 54 THR S HG1  3  
ATOM 2930  H HG21 . THR A 1 45 ? 4.754   -9.440  -4.025  1.00 0.00 ? 54 THR S HG21 3  
ATOM 2931  H HG22 . THR A 1 45 ? 5.733   -8.320  -4.970  1.00 0.00 ? 54 THR S HG22 3  
ATOM 2932  H HG23 . THR A 1 45 ? 4.792   -9.570  -5.784  1.00 0.00 ? 54 THR S HG23 3  
ATOM 2933  N N    . ARG A 1 46 ? 2.131   -7.325  -2.514  1.00 0.00 ? 55 ARG S N    3  
ATOM 2934  C CA   . ARG A 1 46 ? 1.646   -7.663  -1.184  1.00 0.00 ? 55 ARG S CA   3  
ATOM 2935  C C    . ARG A 1 46 ? 2.207   -9.009  -0.741  1.00 0.00 ? 55 ARG S C    3  
ATOM 2936  O O    . ARG A 1 46 ? 2.392   -9.251  0.450   1.00 0.00 ? 55 ARG S O    3  
ATOM 2937  C CB   . ARG A 1 46 ? 0.117   -7.705  -1.168  1.00 0.00 ? 55 ARG S CB   3  
ATOM 2938  C CG   . ARG A 1 46 ? -0.488  -7.286  0.161   1.00 0.00 ? 55 ARG S CG   3  
ATOM 2939  C CD   . ARG A 1 46 ? -1.943  -6.873  0.008   1.00 0.00 ? 55 ARG S CD   3  
ATOM 2940  N NE   . ARG A 1 46 ? -2.576  -6.610  1.299   1.00 0.00 ? 55 ARG S NE   3  
ATOM 2941  C CZ   . ARG A 1 46 ? -3.865  -6.310  1.445   1.00 0.00 ? 55 ARG S CZ   3  
ATOM 2942  N NH1  . ARG A 1 46 ? -4.659  -6.231  0.385   1.00 0.00 ? 55 ARG S NH1  3  
ATOM 2943  N NH2  . ARG A 1 46 ? -4.361  -6.088  2.655   1.00 0.00 ? 55 ARG S NH2  3  
ATOM 2944  H H    . ARG A 1 46 ? 1.507   -7.334  -3.269  1.00 0.00 ? 55 ARG S H    3  
ATOM 2945  H HA   . ARG A 1 46 ? 1.986   -6.899  -0.501  1.00 0.00 ? 55 ARG S HA   3  
ATOM 2946  H HB2  . ARG A 1 46 ? -0.258  -7.041  -1.934  1.00 0.00 ? 55 ARG S HB2  3  
ATOM 2947  H HB3  . ARG A 1 46 ? -0.207  -8.714  -1.386  1.00 0.00 ? 55 ARG S HB3  3  
ATOM 2948  H HG2  . ARG A 1 46 ? -0.431  -8.118  0.848   1.00 0.00 ? 55 ARG S HG2  3  
ATOM 2949  H HG3  . ARG A 1 46 ? 0.075   -6.453  0.555   1.00 0.00 ? 55 ARG S HG3  3  
ATOM 2950  H HD2  . ARG A 1 46 ? -1.987  -5.978  -0.593  1.00 0.00 ? 55 ARG S HD2  3  
ATOM 2951  H HD3  . ARG A 1 46 ? -2.478  -7.666  -0.490  1.00 0.00 ? 55 ARG S HD3  3  
ATOM 2952  H HE   . ARG A 1 46 ? -2.012  -6.660  2.098   1.00 0.00 ? 55 ARG S HE   3  
ATOM 2953  H HH11 . ARG A 1 46 ? -4.292  -6.398  -0.530  1.00 0.00 ? 55 ARG S HH11 3  
ATOM 2954  H HH12 . ARG A 1 46 ? -5.626  -6.005  0.500   1.00 0.00 ? 55 ARG S HH12 3  
ATOM 2955  H HH21 . ARG A 1 46 ? -3.766  -6.146  3.457   1.00 0.00 ? 55 ARG S HH21 3  
ATOM 2956  H HH22 . ARG A 1 46 ? -5.329  -5.862  2.763   1.00 0.00 ? 55 ARG S HH22 3  
ATOM 2957  N N    . ASP A 1 47 ? 2.470   -9.882  -1.710  1.00 0.00 ? 56 ASP S N    3  
ATOM 2958  C CA   . ASP A 1 47 ? 3.003   -11.212 -1.428  1.00 0.00 ? 56 ASP S CA   3  
ATOM 2959  C C    . ASP A 1 47 ? 4.530   -11.209 -1.351  1.00 0.00 ? 56 ASP S C    3  
ATOM 2960  O O    . ASP A 1 47 ? 5.135   -12.199 -0.936  1.00 0.00 ? 56 ASP S O    3  
ATOM 2961  C CB   . ASP A 1 47 ? 2.544   -12.202 -2.499  1.00 0.00 ? 56 ASP S CB   3  
ATOM 2962  C CG   . ASP A 1 47 ? 3.047   -11.835 -3.880  1.00 0.00 ? 56 ASP S CG   3  
ATOM 2963  O OD1  . ASP A 1 47 ? 4.190   -12.212 -4.215  1.00 0.00 ? 56 ASP S OD1  3  
ATOM 2964  O OD2  . ASP A 1 47 ? 2.300   -11.168 -4.627  1.00 0.00 ? 56 ASP S OD2  3  
ATOM 2965  H H    . ASP A 1 47 ? 2.296   -9.629  -2.640  1.00 0.00 ? 56 ASP S H    3  
ATOM 2966  H HA   . ASP A 1 47 ? 2.611   -11.527 -0.472  1.00 0.00 ? 56 ASP S HA   3  
ATOM 2967  H HB2  . ASP A 1 47 ? 2.912   -13.187 -2.252  1.00 0.00 ? 56 ASP S HB2  3  
ATOM 2968  H HB3  . ASP A 1 47 ? 1.464   -12.222 -2.522  1.00 0.00 ? 56 ASP S HB3  3  
ATOM 2969  N N    . GLU A 1 48 ? 5.155   -10.098 -1.735  1.00 0.00 ? 57 GLU S N    3  
ATOM 2970  C CA   . GLU A 1 48 ? 6.607   -9.989  -1.685  1.00 0.00 ? 57 GLU S CA   3  
ATOM 2971  C C    . GLU A 1 48 ? 7.004   -9.317  -0.394  1.00 0.00 ? 57 GLU S C    3  
ATOM 2972  O O    . GLU A 1 48 ? 7.702   -9.889  0.444   1.00 0.00 ? 57 GLU S O    3  
ATOM 2973  C CB   . GLU A 1 48 ? 7.123   -9.180  -2.873  1.00 0.00 ? 57 GLU S CB   3  
ATOM 2974  C CG   . GLU A 1 48 ? 8.640   -9.131  -2.961  1.00 0.00 ? 57 GLU S CG   3  
ATOM 2975  C CD   . GLU A 1 48 ? 9.172   -9.745  -4.240  1.00 0.00 ? 57 GLU S CD   3  
ATOM 2976  O OE1  . GLU A 1 48 ? 8.916   -9.179  -5.323  1.00 0.00 ? 57 GLU S OE1  3  
ATOM 2977  O OE2  . GLU A 1 48 ? 9.844   -10.795 -4.158  1.00 0.00 ? 57 GLU S OE2  3  
ATOM 2978  H H    . GLU A 1 48 ? 4.629   -9.325  -2.036  1.00 0.00 ? 57 GLU S H    3  
ATOM 2979  H HA   . GLU A 1 48 ? 7.025   -10.984 -1.716  1.00 0.00 ? 57 GLU S HA   3  
ATOM 2980  H HB2  . GLU A 1 48 ? 6.746   -9.626  -3.779  1.00 0.00 ? 57 GLU S HB2  3  
ATOM 2981  H HB3  . GLU A 1 48 ? 6.751   -8.166  -2.792  1.00 0.00 ? 57 GLU S HB3  3  
ATOM 2982  H HG2  . GLU A 1 48 ? 8.956   -8.098  -2.918  1.00 0.00 ? 57 GLU S HG2  3  
ATOM 2983  H HG3  . GLU A 1 48 ? 9.054   -9.668  -2.121  1.00 0.00 ? 57 GLU S HG3  3  
ATOM 2984  N N    . TYR A 1 49 ? 6.514   -8.102  -0.237  1.00 0.00 ? 58 TYR S N    3  
ATOM 2985  C CA   . TYR A 1 49 ? 6.755   -7.321  0.956   1.00 0.00 ? 58 TYR S CA   3  
ATOM 2986  C C    . TYR A 1 49 ? 6.284   -8.095  2.173   1.00 0.00 ? 58 TYR S C    3  
ATOM 2987  O O    . TYR A 1 49 ? 6.863   -8.001  3.256   1.00 0.00 ? 58 TYR S O    3  
ATOM 2988  C CB   . TYR A 1 49 ? 5.993   -6.008  0.853   1.00 0.00 ? 58 TYR S CB   3  
ATOM 2989  C CG   . TYR A 1 49 ? 6.756   -4.886  0.181   1.00 0.00 ? 58 TYR S CG   3  
ATOM 2990  C CD1  . TYR A 1 49 ? 8.065   -5.052  -0.262  1.00 0.00 ? 58 TYR S CD1  3  
ATOM 2991  C CD2  . TYR A 1 49 ? 6.150   -3.658  -0.022  1.00 0.00 ? 58 TYR S CD2  3  
ATOM 2992  C CE1  . TYR A 1 49 ? 8.742   -4.025  -0.887  1.00 0.00 ? 58 TYR S CE1  3  
ATOM 2993  C CE2  . TYR A 1 49 ? 6.819   -2.628  -0.645  1.00 0.00 ? 58 TYR S CE2  3  
ATOM 2994  C CZ   . TYR A 1 49 ? 8.115   -2.815  -1.078  1.00 0.00 ? 58 TYR S CZ   3  
ATOM 2995  O OH   . TYR A 1 49 ? 8.784   -1.789  -1.705  1.00 0.00 ? 58 TYR S OH   3  
ATOM 2996  H H    . TYR A 1 49 ? 5.943   -7.725  -0.939  1.00 0.00 ? 58 TYR S H    3  
ATOM 2997  H HA   . TYR A 1 49 ? 7.811   -7.128  1.040   1.00 0.00 ? 58 TYR S HA   3  
ATOM 2998  H HB2  . TYR A 1 49 ? 5.092   -6.176  0.278   1.00 0.00 ? 58 TYR S HB2  3  
ATOM 2999  H HB3  . TYR A 1 49 ? 5.720   -5.687  1.841   1.00 0.00 ? 58 TYR S HB3  3  
ATOM 3000  H HD1  . TYR A 1 49 ? 8.557   -6.000  -0.115  1.00 0.00 ? 58 TYR S HD1  3  
ATOM 3001  H HD2  . TYR A 1 49 ? 5.137   -3.510  0.321   1.00 0.00 ? 58 TYR S HD2  3  
ATOM 3002  H HE1  . TYR A 1 49 ? 9.758   -4.172  -1.223  1.00 0.00 ? 58 TYR S HE1  3  
ATOM 3003  H HE2  . TYR A 1 49 ? 6.324   -1.684  -0.797  1.00 0.00 ? 58 TYR S HE2  3  
ATOM 3004  H HH   . TYR A 1 49 ? 9.729   -1.886  -1.560  1.00 0.00 ? 58 TYR S HH   3  
ATOM 3005  N N    . ASN A 1 50 ? 5.224   -8.867  1.973   1.00 0.00 ? 59 ASN S N    3  
ATOM 3006  C CA   . ASN A 1 50 ? 4.653   -9.679  3.048   1.00 0.00 ? 59 ASN S CA   3  
ATOM 3007  C C    . ASN A 1 50 ? 5.735   -10.460 3.795   1.00 0.00 ? 59 ASN S C    3  
ATOM 3008  O O    . ASN A 1 50 ? 5.580   -10.774 4.976   1.00 0.00 ? 59 ASN S O    3  
ATOM 3009  C CB   . ASN A 1 50 ? 3.613   -10.653 2.489   1.00 0.00 ? 59 ASN S CB   3  
ATOM 3010  C CG   . ASN A 1 50 ? 2.201   -10.308 2.926   1.00 0.00 ? 59 ASN S CG   3  
ATOM 3011  O OD1  . ASN A 1 50 ? 1.398   -11.194 3.224   1.00 0.00 ? 59 ASN S OD1  3  
ATOM 3012  N ND2  . ASN A 1 50 ? 1.890   -9.017  2.966   1.00 0.00 ? 59 ASN S ND2  3  
ATOM 3013  H H    . ASN A 1 50 ? 4.813   -8.888  1.070   1.00 0.00 ? 59 ASN S H    3  
ATOM 3014  H HA   . ASN A 1 50 ? 4.167   -9.011  3.742   1.00 0.00 ? 59 ASN S HA   3  
ATOM 3015  H HB2  . ASN A 1 50 ? 3.653   -10.634 1.412   1.00 0.00 ? 59 ASN S HB2  3  
ATOM 3016  H HB3  . ASN A 1 50 ? 3.841   -11.651 2.833   1.00 0.00 ? 59 ASN S HB3  3  
ATOM 3017  H HD21 . ASN A 1 50 ? 2.579   -8.367  2.716   1.00 0.00 ? 59 ASN S HD21 3  
ATOM 3018  H HD22 . ASN A 1 50 ? 0.984   -8.768  3.246   1.00 0.00 ? 59 ASN S HD22 3  
ATOM 3019  N N    . ALA A 1 51 ? 6.823   -10.780 3.100   1.00 0.00 ? 60 ALA S N    3  
ATOM 3020  C CA   . ALA A 1 51 ? 7.919   -11.536 3.703   1.00 0.00 ? 60 ALA S CA   3  
ATOM 3021  C C    . ALA A 1 51 ? 9.211   -10.727 3.739   1.00 0.00 ? 60 ALA S C    3  
ATOM 3022  O O    . ALA A 1 51 ? 10.040  -10.908 4.631   1.00 0.00 ? 60 ALA S O    3  
ATOM 3023  C CB   . ALA A 1 51 ? 8.134   -12.839 2.948   1.00 0.00 ? 60 ALA S CB   3  
ATOM 3024  H H    . ALA A 1 51 ? 6.889   -10.511 2.160   1.00 0.00 ? 60 ALA S H    3  
ATOM 3025  H HA   . ALA A 1 51 ? 7.633   -11.781 4.716   1.00 0.00 ? 60 ALA S HA   3  
ATOM 3026  H HB1  . ALA A 1 51 ? 8.859   -12.683 2.162   1.00 0.00 ? 60 ALA S HB1  3  
ATOM 3027  H HB2  . ALA A 1 51 ? 7.200   -13.164 2.515   1.00 0.00 ? 60 ALA S HB2  3  
ATOM 3028  H HB3  . ALA A 1 51 ? 8.497   -13.594 3.630   1.00 0.00 ? 60 ALA S HB3  3  
ATOM 3029  N N    . LEU A 1 52 ? 9.381   -9.835  2.768   1.00 0.00 ? 61 LEU S N    3  
ATOM 3030  C CA   . LEU A 1 52 ? 10.579  -9.007  2.698   1.00 0.00 ? 61 LEU S CA   3  
ATOM 3031  C C    . LEU A 1 52 ? 10.711  -8.136  3.946   1.00 0.00 ? 61 LEU S C    3  
ATOM 3032  O O    . LEU A 1 52 ? 9.741   -7.941  4.679   1.00 0.00 ? 61 LEU S O    3  
ATOM 3033  C CB   . LEU A 1 52 ? 10.538  -8.125  1.446   1.00 0.00 ? 61 LEU S CB   3  
ATOM 3034  C CG   . LEU A 1 52 ? 11.286  -8.684  0.235   1.00 0.00 ? 61 LEU S CG   3  
ATOM 3035  C CD1  . LEU A 1 52 ? 10.712  -8.118  -1.054  1.00 0.00 ? 61 LEU S CD1  3  
ATOM 3036  C CD2  . LEU A 1 52 ? 12.772  -8.378  0.336   1.00 0.00 ? 61 LEU S CD2  3  
ATOM 3037  H H    . LEU A 1 52 ? 8.688   -9.734  2.084   1.00 0.00 ? 61 LEU S H    3  
ATOM 3038  H HA   . LEU A 1 52 ? 11.435  -9.663  2.638   1.00 0.00 ? 61 LEU S HA   3  
ATOM 3039  H HB2  . LEU A 1 52 ? 9.502   -7.986  1.169   1.00 0.00 ? 61 LEU S HB2  3  
ATOM 3040  H HB3  . LEU A 1 52 ? 10.964  -7.163  1.693   1.00 0.00 ? 61 LEU S HB3  3  
ATOM 3041  H HG   . LEU A 1 52 ? 11.166  -9.759  0.210   1.00 0.00 ? 61 LEU S HG   3  
ATOM 3042  H HD11 . LEU A 1 52 ? 10.939  -8.785  -1.874  1.00 0.00 ? 61 LEU S HD11 3  
ATOM 3043  H HD12 . LEU A 1 52 ? 11.147  -7.149  -1.247  1.00 0.00 ? 61 LEU S HD12 3  
ATOM 3044  H HD13 . LEU A 1 52 ? 9.640   -8.021  -0.959  1.00 0.00 ? 61 LEU S HD13 3  
ATOM 3045  H HD21 . LEU A 1 52 ? 12.911  -7.318  0.488   1.00 0.00 ? 61 LEU S HD21 3  
ATOM 3046  H HD22 . LEU A 1 52 ? 13.265  -8.677  -0.577  1.00 0.00 ? 61 LEU S HD22 3  
ATOM 3047  H HD23 . LEU A 1 52 ? 13.196  -8.920  1.168   1.00 0.00 ? 61 LEU S HD23 3  
ATOM 3048  N N    . PRO A 1 53 ? 11.917  -7.599  4.206   1.00 0.00 ? 62 PRO S N    3  
ATOM 3049  C CA   . PRO A 1 53 ? 12.162  -6.748  5.374   1.00 0.00 ? 62 PRO S CA   3  
ATOM 3050  C C    . PRO A 1 53 ? 11.164  -5.600  5.464   1.00 0.00 ? 62 PRO S C    3  
ATOM 3051  O O    . PRO A 1 53 ? 10.749  -5.046  4.445   1.00 0.00 ? 62 PRO S O    3  
ATOM 3052  C CB   . PRO A 1 53 ? 13.576  -6.215  5.140   1.00 0.00 ? 62 PRO S CB   3  
ATOM 3053  C CG   . PRO A 1 53 ? 14.223  -7.233  4.265   1.00 0.00 ? 62 PRO S CG   3  
ATOM 3054  C CD   . PRO A 1 53 ? 13.130  -7.776  3.387   1.00 0.00 ? 62 PRO S CD   3  
ATOM 3055  H HA   . PRO A 1 53 ? 12.136  -7.318  6.291   1.00 0.00 ? 62 PRO S HA   3  
ATOM 3056  H HB2  . PRO A 1 53 ? 13.525  -5.251  4.654   1.00 0.00 ? 62 PRO S HB2  3  
ATOM 3057  H HB3  . PRO A 1 53 ? 14.092  -6.123  6.085   1.00 0.00 ? 62 PRO S HB3  3  
ATOM 3058  H HG2  . PRO A 1 53 ? 14.990  -6.767  3.664   1.00 0.00 ? 62 PRO S HG2  3  
ATOM 3059  H HG3  . PRO A 1 53 ? 14.644  -8.023  4.870   1.00 0.00 ? 62 PRO S HG3  3  
ATOM 3060  H HD2  . PRO A 1 53 ? 13.063  -7.204  2.472   1.00 0.00 ? 62 PRO S HD2  3  
ATOM 3061  H HD3  . PRO A 1 53 ? 13.301  -8.821  3.171   1.00 0.00 ? 62 PRO S HD3  3  
ATOM 3062  N N    . ALA A 1 54 ? 10.779  -5.254  6.684   1.00 0.00 ? 63 ALA S N    3  
ATOM 3063  C CA   . ALA A 1 54 ? 9.822   -4.178  6.907   1.00 0.00 ? 63 ALA S CA   3  
ATOM 3064  C C    . ALA A 1 54 ? 10.440  -2.809  6.640   1.00 0.00 ? 63 ALA S C    3  
ATOM 3065  O O    . ALA A 1 54 ? 9.725   -1.827  6.449   1.00 0.00 ? 63 ALA S O    3  
ATOM 3066  C CB   . ALA A 1 54 ? 9.282   -4.243  8.327   1.00 0.00 ? 63 ALA S CB   3  
ATOM 3067  H H    . ALA A 1 54 ? 11.141  -5.738  7.455   1.00 0.00 ? 63 ALA S H    3  
ATOM 3068  H HA   . ALA A 1 54 ? 8.996   -4.327  6.231   1.00 0.00 ? 63 ALA S HA   3  
ATOM 3069  H HB1  . ALA A 1 54 ? 8.227   -4.012  8.322   1.00 0.00 ? 63 ALA S HB1  3  
ATOM 3070  H HB2  . ALA A 1 54 ? 9.804   -3.526  8.944   1.00 0.00 ? 63 ALA S HB2  3  
ATOM 3071  H HB3  . ALA A 1 54 ? 9.431   -5.236  8.724   1.00 0.00 ? 63 ALA S HB3  3  
ATOM 3072  N N    . TRP A 1 55 ? 11.765  -2.745  6.605   1.00 0.00 ? 64 TRP S N    3  
ATOM 3073  C CA   . TRP A 1 55 ? 12.458  -1.507  6.351   1.00 0.00 ? 64 TRP S CA   3  
ATOM 3074  C C    . TRP A 1 55 ? 12.681  -1.362  4.857   1.00 0.00 ? 64 TRP S C    3  
ATOM 3075  O O    . TRP A 1 55 ? 12.475  -0.297  4.296   1.00 0.00 ? 64 TRP S O    3  
ATOM 3076  C CB   . TRP A 1 55 ? 13.797  -1.481  7.109   1.00 0.00 ? 64 TRP S CB   3  
ATOM 3077  C CG   . TRP A 1 55 ? 14.975  -1.729  6.222   1.00 0.00 ? 64 TRP S CG   3  
ATOM 3078  C CD1  . TRP A 1 55 ? 15.778  -2.828  6.199   1.00 0.00 ? 64 TRP S CD1  3  
ATOM 3079  C CD2  . TRP A 1 55 ? 15.450  -0.856  5.202   1.00 0.00 ? 64 TRP S CD2  3  
ATOM 3080  N NE1  . TRP A 1 55 ? 16.735  -2.688  5.221   1.00 0.00 ? 64 TRP S NE1  3  
ATOM 3081  C CE2  . TRP A 1 55 ? 16.550  -1.482  4.591   1.00 0.00 ? 64 TRP S CE2  3  
ATOM 3082  C CE3  . TRP A 1 55 ? 15.044  0.399   4.747   1.00 0.00 ? 64 TRP S CE3  3  
ATOM 3083  C CZ2  . TRP A 1 55 ? 17.246  -0.890  3.542   1.00 0.00 ? 64 TRP S CZ2  3  
ATOM 3084  C CZ3  . TRP A 1 55 ? 15.732  0.981   3.709   1.00 0.00 ? 64 TRP S CZ3  3  
ATOM 3085  C CH2  . TRP A 1 55 ? 16.819  0.339   3.115   1.00 0.00 ? 64 TRP S CH2  3  
ATOM 3086  H H    . TRP A 1 55 ? 12.289  -3.548  6.731   1.00 0.00 ? 64 TRP S H    3  
ATOM 3087  H HA   . TRP A 1 55 ? 11.835  -0.696  6.696   1.00 0.00 ? 64 TRP S HA   3  
ATOM 3088  H HB2  . TRP A 1 55 ? 13.923  -0.511  7.570   1.00 0.00 ? 64 TRP S HB2  3  
ATOM 3089  H HB3  . TRP A 1 55 ? 13.785  -2.247  7.875   1.00 0.00 ? 64 TRP S HB3  3  
ATOM 3090  H HD1  . TRP A 1 55 ? 15.665  -3.674  6.860   1.00 0.00 ? 64 TRP S HD1  3  
ATOM 3091  H HE1  . TRP A 1 55 ? 17.431  -3.342  5.005   1.00 0.00 ? 64 TRP S HE1  3  
ATOM 3092  H HE3  . TRP A 1 55 ? 14.206  0.910   5.194   1.00 0.00 ? 64 TRP S HE3  3  
ATOM 3093  H HZ2  . TRP A 1 55 ? 18.090  -1.373  3.071   1.00 0.00 ? 64 TRP S HZ2  3  
ATOM 3094  H HZ3  . TRP A 1 55 ? 15.428  1.947   3.339   1.00 0.00 ? 64 TRP S HZ3  3  
ATOM 3095  H HH2  . TRP A 1 55 ? 17.314  0.833   2.301   1.00 0.00 ? 64 TRP S HH2  3  
ATOM 3096  N N    . LYS A 1 56 ? 13.103  -2.455  4.220   1.00 0.00 ? 65 LYS S N    3  
ATOM 3097  C CA   . LYS A 1 56 ? 13.347  -2.444  2.787   1.00 0.00 ? 65 LYS S CA   3  
ATOM 3098  C C    . LYS A 1 56 ? 12.062  -2.106  2.059   1.00 0.00 ? 65 LYS S C    3  
ATOM 3099  O O    . LYS A 1 56 ? 12.057  -1.294  1.136   1.00 0.00 ? 65 LYS S O    3  
ATOM 3100  C CB   . LYS A 1 56 ? 13.895  -3.788  2.310   1.00 0.00 ? 65 LYS S CB   3  
ATOM 3101  C CG   . LYS A 1 56 ? 14.935  -3.649  1.209   1.00 0.00 ? 65 LYS S CG   3  
ATOM 3102  C CD   . LYS A 1 56 ? 16.335  -3.944  1.721   1.00 0.00 ? 65 LYS S CD   3  
ATOM 3103  C CE   . LYS A 1 56 ? 17.397  -3.335  0.818   1.00 0.00 ? 65 LYS S CE   3  
ATOM 3104  N NZ   . LYS A 1 56 ? 17.271  -1.853  0.723   1.00 0.00 ? 65 LYS S NZ   3  
ATOM 3105  H H    . LYS A 1 56 ? 13.246  -3.281  4.723   1.00 0.00 ? 65 LYS S H    3  
ATOM 3106  H HA   . LYS A 1 56 ? 14.075  -1.672  2.582   1.00 0.00 ? 65 LYS S HA   3  
ATOM 3107  H HB2  . LYS A 1 56 ? 14.353  -4.298  3.149   1.00 0.00 ? 65 LYS S HB2  3  
ATOM 3108  H HB3  . LYS A 1 56 ? 13.076  -4.387  1.932   1.00 0.00 ? 65 LYS S HB3  3  
ATOM 3109  H HG2  . LYS A 1 56 ? 14.698  -4.342  0.413   1.00 0.00 ? 65 LYS S HG2  3  
ATOM 3110  H HG3  . LYS A 1 56 ? 14.906  -2.634  0.831   1.00 0.00 ? 65 LYS S HG3  3  
ATOM 3111  H HD2  . LYS A 1 56 ? 16.441  -3.532  2.712   1.00 0.00 ? 65 LYS S HD2  3  
ATOM 3112  H HD3  . LYS A 1 56 ? 16.476  -5.015  1.755   1.00 0.00 ? 65 LYS S HD3  3  
ATOM 3113  H HE2  . LYS A 1 56 ? 18.372  -3.578  1.215   1.00 0.00 ? 65 LYS S HE2  3  
ATOM 3114  H HE3  . LYS A 1 56 ? 17.298  -3.759  -0.170  1.00 0.00 ? 65 LYS S HE3  3  
ATOM 3115  H HZ1  . LYS A 1 56 ? 18.134  -1.397  1.082   1.00 0.00 ? 65 LYS S HZ1  3  
ATOM 3116  H HZ2  . LYS A 1 56 ? 16.459  -1.525  1.283   1.00 0.00 ? 65 LYS S HZ2  3  
ATOM 3117  H HZ3  . LYS A 1 56 ? 17.130  -1.569  -0.268  1.00 0.00 ? 65 LYS S HZ3  3  
ATOM 3118  N N    . GLN A 1 57 ? 10.959  -2.702  2.506   1.00 0.00 ? 66 GLN S N    3  
ATOM 3119  C CA   . GLN A 1 57 ? 9.674   -2.406  1.906   1.00 0.00 ? 66 GLN S CA   3  
ATOM 3120  C C    . GLN A 1 57 ? 9.377   -0.935  2.138   1.00 0.00 ? 66 GLN S C    3  
ATOM 3121  O O    . GLN A 1 57 ? 8.905   -0.233  1.244   1.00 0.00 ? 66 GLN S O    3  
ATOM 3122  C CB   . GLN A 1 57 ? 8.564   -3.292  2.480   1.00 0.00 ? 66 GLN S CB   3  
ATOM 3123  C CG   . GLN A 1 57 ? 8.366   -3.150  3.979   1.00 0.00 ? 66 GLN S CG   3  
ATOM 3124  C CD   . GLN A 1 57 ? 7.300   -4.090  4.512   1.00 0.00 ? 66 GLN S CD   3  
ATOM 3125  O OE1  . GLN A 1 57 ? 6.433   -3.687  5.286   1.00 0.00 ? 66 GLN S OE1  3  
ATOM 3126  N NE2  . GLN A 1 57 ? 7.358   -5.353  4.097   1.00 0.00 ? 66 GLN S NE2  3  
ATOM 3127  H H    . GLN A 1 57 ? 11.010  -3.319  3.267   1.00 0.00 ? 66 GLN S H    3  
ATOM 3128  H HA   . GLN A 1 57 ? 9.760   -2.581  0.846   1.00 0.00 ? 66 GLN S HA   3  
ATOM 3129  H HB2  . GLN A 1 57 ? 7.634   -3.042  1.992   1.00 0.00 ? 66 GLN S HB2  3  
ATOM 3130  H HB3  . GLN A 1 57 ? 8.803   -4.323  2.267   1.00 0.00 ? 66 GLN S HB3  3  
ATOM 3131  H HG2  . GLN A 1 57 ? 9.300   -3.368  4.477   1.00 0.00 ? 66 GLN S HG2  3  
ATOM 3132  H HG3  . GLN A 1 57 ? 8.069   -2.132  4.195   1.00 0.00 ? 66 GLN S HG3  3  
ATOM 3133  H HE21 . GLN A 1 57 ? 8.076   -5.607  3.479   1.00 0.00 ? 66 GLN S HE21 3  
ATOM 3134  H HE22 . GLN A 1 57 ? 6.683   -5.979  4.427   1.00 0.00 ? 66 GLN S HE22 3  
ATOM 3135  N N    . VAL A 1 58 ? 9.722   -0.460  3.335   1.00 0.00 ? 67 VAL S N    3  
ATOM 3136  C CA   . VAL A 1 58 ? 9.550   0.944   3.660   1.00 0.00 ? 67 VAL S CA   3  
ATOM 3137  C C    . VAL A 1 58 ? 10.490  1.763   2.783   1.00 0.00 ? 67 VAL S C    3  
ATOM 3138  O O    . VAL A 1 58 ? 10.120  2.827   2.287   1.00 0.00 ? 67 VAL S O    3  
ATOM 3139  C CB   . VAL A 1 58 ? 9.838   1.232   5.150   1.00 0.00 ? 67 VAL S CB   3  
ATOM 3140  C CG1  . VAL A 1 58 ? 9.902   2.730   5.415   1.00 0.00 ? 67 VAL S CG1  3  
ATOM 3141  C CG2  . VAL A 1 58 ? 8.782   0.581   6.028   1.00 0.00 ? 67 VAL S CG2  3  
ATOM 3142  H H    . VAL A 1 58 ? 10.133  -1.060  3.997   1.00 0.00 ? 67 VAL S H    3  
ATOM 3143  H HA   . VAL A 1 58 ? 8.528   1.220   3.443   1.00 0.00 ? 67 VAL S HA   3  
ATOM 3144  H HB   . VAL A 1 58 ? 10.796  0.803   5.401   1.00 0.00 ? 67 VAL S HB   3  
ATOM 3145  H HG11 . VAL A 1 58 ? 10.763  3.149   4.913   1.00 0.00 ? 67 VAL S HG11 3  
ATOM 3146  H HG12 . VAL A 1 58 ? 9.985   2.905   6.478   1.00 0.00 ? 67 VAL S HG12 3  
ATOM 3147  H HG13 . VAL A 1 58 ? 9.004   3.201   5.041   1.00 0.00 ? 67 VAL S HG13 3  
ATOM 3148  H HG21 . VAL A 1 58 ? 7.982   1.282   6.209   1.00 0.00 ? 67 VAL S HG21 3  
ATOM 3149  H HG22 . VAL A 1 58 ? 9.225   0.290   6.970   1.00 0.00 ? 67 VAL S HG22 3  
ATOM 3150  H HG23 . VAL A 1 58 ? 8.387   -0.292  5.530   1.00 0.00 ? 67 VAL S HG23 3  
ATOM 3151  N N    . ASN A 1 59 ? 11.709  1.245   2.582   1.00 0.00 ? 68 ASN S N    3  
ATOM 3152  C CA   . ASN A 1 59 ? 12.702  1.918   1.745   1.00 0.00 ? 68 ASN S CA   3  
ATOM 3153  C C    . ASN A 1 59 ? 12.072  2.485   0.472   1.00 0.00 ? 68 ASN S C    3  
ATOM 3154  O O    . ASN A 1 59 ? 12.278  3.649   0.127   1.00 0.00 ? 68 ASN S O    3  
ATOM 3155  C CB   . ASN A 1 59 ? 13.812  0.940   1.356   1.00 0.00 ? 68 ASN S CB   3  
ATOM 3156  C CG   . ASN A 1 59 ? 15.077  1.645   0.907   1.00 0.00 ? 68 ASN S CG   3  
ATOM 3157  O OD1  . ASN A 1 59 ? 15.319  2.798   1.263   1.00 0.00 ? 68 ASN S OD1  3  
ATOM 3158  N ND2  . ASN A 1 59 ? 15.893  0.953   0.120   1.00 0.00 ? 68 ASN S ND2  3  
ATOM 3159  H H    . ASN A 1 59 ? 11.951  0.374   3.011   1.00 0.00 ? 68 ASN S H    3  
ATOM 3160  H HA   . ASN A 1 59 ? 13.131  2.728   2.316   1.00 0.00 ? 68 ASN S HA   3  
ATOM 3161  H HB2  . ASN A 1 59 ? 14.046  0.315   2.203   1.00 0.00 ? 68 ASN S HB2  3  
ATOM 3162  H HB3  . ASN A 1 59 ? 13.464  0.319   0.545   1.00 0.00 ? 68 ASN S HB3  3  
ATOM 3163  H HD21 . ASN A 1 59 ? 15.635  0.039   -0.122  1.00 0.00 ? 68 ASN S HD21 3  
ATOM 3164  H HD22 . ASN A 1 59 ? 16.718  1.384   -0.184  1.00 0.00 ? 68 ASN S HD22 3  
ATOM 3165  N N    . LEU A 1 60 ? 11.309  1.647   -0.225  1.00 0.00 ? 69 LEU S N    3  
ATOM 3166  C CA   . LEU A 1 60 ? 10.659  2.053   -1.463  1.00 0.00 ? 69 LEU S CA   3  
ATOM 3167  C C    . LEU A 1 60 ? 9.582   3.098   -1.199  1.00 0.00 ? 69 LEU S C    3  
ATOM 3168  O O    . LEU A 1 60 ? 9.408   4.031   -1.984  1.00 0.00 ? 69 LEU S O    3  
ATOM 3169  C CB   . LEU A 1 60 ? 10.047  0.838   -2.159  1.00 0.00 ? 69 LEU S CB   3  
ATOM 3170  C CG   . LEU A 1 60 ? 10.898  0.229   -3.273  1.00 0.00 ? 69 LEU S CG   3  
ATOM 3171  C CD1  . LEU A 1 60 ? 11.052  1.211   -4.425  1.00 0.00 ? 69 LEU S CD1  3  
ATOM 3172  C CD2  . LEU A 1 60 ? 12.260  -0.185  -2.737  1.00 0.00 ? 69 LEU S CD2  3  
ATOM 3173  H H    . LEU A 1 60 ? 11.184  0.729   0.099   1.00 0.00 ? 69 LEU S H    3  
ATOM 3174  H HA   . LEU A 1 60 ? 11.410  2.484   -2.108  1.00 0.00 ? 69 LEU S HA   3  
ATOM 3175  H HB2  . LEU A 1 60 ? 9.872   0.076   -1.412  1.00 0.00 ? 69 LEU S HB2  3  
ATOM 3176  H HB3  . LEU A 1 60 ? 9.095   1.130   -2.583  1.00 0.00 ? 69 LEU S HB3  3  
ATOM 3177  H HG   . LEU A 1 60 ? 10.404  -0.654  -3.651  1.00 0.00 ? 69 LEU S HG   3  
ATOM 3178  H HD11 . LEU A 1 60 ? 10.943  2.218   -4.056  1.00 0.00 ? 69 LEU S HD11 3  
ATOM 3179  H HD12 . LEU A 1 60 ? 10.291  1.015   -5.168  1.00 0.00 ? 69 LEU S HD12 3  
ATOM 3180  H HD13 . LEU A 1 60 ? 12.028  1.094   -4.870  1.00 0.00 ? 69 LEU S HD13 3  
ATOM 3181  H HD21 . LEU A 1 60 ? 12.131  -0.794  -1.856  1.00 0.00 ? 69 LEU S HD21 3  
ATOM 3182  H HD22 . LEU A 1 60 ? 12.830  0.697   -2.485  1.00 0.00 ? 69 LEU S HD22 3  
ATOM 3183  H HD23 . LEU A 1 60 ? 12.787  -0.750  -3.491  1.00 0.00 ? 69 LEU S HD23 3  
ATOM 3184  N N    . LYS A 1 61 ? 8.858   2.939   -0.097  1.00 0.00 ? 70 LYS S N    3  
ATOM 3185  C CA   . LYS A 1 61 ? 7.797   3.878   0.251   1.00 0.00 ? 70 LYS S CA   3  
ATOM 3186  C C    . LYS A 1 61 ? 8.336   5.299   0.304   1.00 0.00 ? 70 LYS S C    3  
ATOM 3187  O O    . LYS A 1 61 ? 7.947   6.148   -0.492  1.00 0.00 ? 70 LYS S O    3  
ATOM 3188  C CB   . LYS A 1 61 ? 7.168   3.523   1.596   1.00 0.00 ? 70 LYS S CB   3  
ATOM 3189  C CG   . LYS A 1 61 ? 5.937   2.632   1.490   1.00 0.00 ? 70 LYS S CG   3  
ATOM 3190  C CD   . LYS A 1 61 ? 6.171   1.272   2.127   1.00 0.00 ? 70 LYS S CD   3  
ATOM 3191  C CE   . LYS A 1 61 ? 5.787   1.272   3.597   1.00 0.00 ? 70 LYS S CE   3  
ATOM 3192  N NZ   . LYS A 1 61 ? 5.309   -0.066  4.047   1.00 0.00 ? 70 LYS S NZ   3  
ATOM 3193  H H    . LYS A 1 61 ? 9.037   2.174   0.491   1.00 0.00 ? 70 LYS S H    3  
ATOM 3194  H HA   . LYS A 1 61 ? 7.041   3.820   -0.518  1.00 0.00 ? 70 LYS S HA   3  
ATOM 3195  H HB2  . LYS A 1 61 ? 7.901   3.020   2.211   1.00 0.00 ? 70 LYS S HB2  3  
ATOM 3196  H HB3  . LYS A 1 61 ? 6.876   4.442   2.079   1.00 0.00 ? 70 LYS S HB3  3  
ATOM 3197  H HG2  . LYS A 1 61 ? 5.112   3.115   1.991   1.00 0.00 ? 70 LYS S HG2  3  
ATOM 3198  H HG3  . LYS A 1 61 ? 5.695   2.495   0.446   1.00 0.00 ? 70 LYS S HG3  3  
ATOM 3199  H HD2  . LYS A 1 61 ? 5.574   0.536   1.611   1.00 0.00 ? 70 LYS S HD2  3  
ATOM 3200  H HD3  . LYS A 1 61 ? 7.217   1.018   2.036   1.00 0.00 ? 70 LYS S HD3  3  
ATOM 3201  H HE2  . LYS A 1 61 ? 6.651   1.550   4.182   1.00 0.00 ? 70 LYS S HE2  3  
ATOM 3202  H HE3  . LYS A 1 61 ? 5.001   1.995   3.750   1.00 0.00 ? 70 LYS S HE3  3  
ATOM 3203  H HZ1  . LYS A 1 61 ? 5.292   -0.108  5.087   1.00 0.00 ? 70 LYS S HZ1  3  
ATOM 3204  H HZ2  . LYS A 1 61 ? 5.943   -0.809  3.690   1.00 0.00 ? 70 LYS S HZ2  3  
ATOM 3205  H HZ3  . LYS A 1 61 ? 4.351   -0.242  3.689   1.00 0.00 ? 70 LYS S HZ3  3  
ATOM 3206  N N    . LYS A 1 62 ? 9.236   5.550   1.250   1.00 0.00 ? 71 LYS S N    3  
ATOM 3207  C CA   . LYS A 1 62 ? 9.831   6.873   1.406   1.00 0.00 ? 71 LYS S CA   3  
ATOM 3208  C C    . LYS A 1 62 ? 10.363  7.385   0.071   1.00 0.00 ? 71 LYS S C    3  
ATOM 3209  O O    . LYS A 1 62 ? 10.409  8.593   -0.168  1.00 0.00 ? 71 LYS S O    3  
ATOM 3210  C CB   . LYS A 1 62 ? 10.956  6.829   2.441   1.00 0.00 ? 71 LYS S CB   3  
ATOM 3211  C CG   . LYS A 1 62 ? 10.509  6.303   3.796   1.00 0.00 ? 71 LYS S CG   3  
ATOM 3212  C CD   . LYS A 1 62 ? 11.587  6.486   4.853   1.00 0.00 ? 71 LYS S CD   3  
ATOM 3213  C CE   . LYS A 1 62 ? 11.176  7.515   5.895   1.00 0.00 ? 71 LYS S CE   3  
ATOM 3214  N NZ   . LYS A 1 62 ? 12.245  7.740   6.906   1.00 0.00 ? 71 LYS S NZ   3  
ATOM 3215  H H    . LYS A 1 62 ? 9.508   4.828   1.856   1.00 0.00 ? 71 LYS S H    3  
ATOM 3216  H HA   . LYS A 1 62 ? 9.058   7.542   1.753   1.00 0.00 ? 71 LYS S HA   3  
ATOM 3217  H HB2  . LYS A 1 62 ? 11.744  6.190   2.072   1.00 0.00 ? 71 LYS S HB2  3  
ATOM 3218  H HB3  . LYS A 1 62 ? 11.344  7.827   2.576   1.00 0.00 ? 71 LYS S HB3  3  
ATOM 3219  H HG2  . LYS A 1 62 ? 9.623   6.837   4.103   1.00 0.00 ? 71 LYS S HG2  3  
ATOM 3220  H HG3  . LYS A 1 62 ? 10.282  5.251   3.705   1.00 0.00 ? 71 LYS S HG3  3  
ATOM 3221  H HD2  . LYS A 1 62 ? 11.761  5.541   5.346   1.00 0.00 ? 71 LYS S HD2  3  
ATOM 3222  H HD3  . LYS A 1 62 ? 12.498  6.817   4.374   1.00 0.00 ? 71 LYS S HD3  3  
ATOM 3223  H HE2  . LYS A 1 62 ? 10.964  8.450   5.396   1.00 0.00 ? 71 LYS S HE2  3  
ATOM 3224  H HE3  . LYS A 1 62 ? 10.284  7.163   6.397   1.00 0.00 ? 71 LYS S HE3  3  
ATOM 3225  H HZ1  . LYS A 1 62 ? 13.155  7.910   6.432   1.00 0.00 ? 71 LYS S HZ1  3  
ATOM 3226  H HZ2  . LYS A 1 62 ? 12.337  6.905   7.520   1.00 0.00 ? 71 LYS S HZ2  3  
ATOM 3227  H HZ3  . LYS A 1 62 ? 12.013  8.564   7.495   1.00 0.00 ? 71 LYS S HZ3  3  
ATOM 3228  N N    . ALA A 1 63 ? 10.754  6.459   -0.797  1.00 0.00 ? 72 ALA S N    3  
ATOM 3229  C CA   . ALA A 1 63 ? 11.272  6.815   -2.112  1.00 0.00 ? 72 ALA S CA   3  
ATOM 3230  C C    . ALA A 1 63 ? 10.143  7.212   -3.059  1.00 0.00 ? 72 ALA S C    3  
ATOM 3231  O O    . ALA A 1 63 ? 10.351  7.984   -3.995  1.00 0.00 ? 72 ALA S O    3  
ATOM 3232  C CB   . ALA A 1 63 ? 12.071  5.657   -2.693  1.00 0.00 ? 72 ALA S CB   3  
ATOM 3233  H H    . ALA A 1 63 ? 10.688  5.511   -0.551  1.00 0.00 ? 72 ALA S H    3  
ATOM 3234  H HA   . ALA A 1 63 ? 11.938  7.656   -1.989  1.00 0.00 ? 72 ALA S HA   3  
ATOM 3235  H HB1  . ALA A 1 63 ? 12.924  5.457   -2.063  1.00 0.00 ? 72 ALA S HB1  3  
ATOM 3236  H HB2  . ALA A 1 63 ? 12.409  5.917   -3.686  1.00 0.00 ? 72 ALA S HB2  3  
ATOM 3237  H HB3  . ALA A 1 63 ? 11.445  4.778   -2.743  1.00 0.00 ? 72 ALA S HB3  3  
ATOM 3238  N N    . LYS A 1 64 ? 8.947   6.679   -2.813  1.00 0.00 ? 73 LYS S N    3  
ATOM 3239  C CA   . LYS A 1 64 ? 7.790   6.984   -3.650  1.00 0.00 ? 73 LYS S CA   3  
ATOM 3240  C C    . LYS A 1 64 ? 6.893   8.030   -2.991  1.00 0.00 ? 73 LYS S C    3  
ATOM 3241  O O    . LYS A 1 64 ? 6.179   8.766   -3.672  1.00 0.00 ? 73 LYS S O    3  
ATOM 3242  C CB   . LYS A 1 64 ? 6.995   5.709   -3.937  1.00 0.00 ? 73 LYS S CB   3  
ATOM 3243  C CG   . LYS A 1 64 ? 7.691   4.771   -4.911  1.00 0.00 ? 73 LYS S CG   3  
ATOM 3244  C CD   . LYS A 1 64 ? 7.152   4.933   -6.323  1.00 0.00 ? 73 LYS S CD   3  
ATOM 3245  C CE   . LYS A 1 64 ? 8.070   5.799   -7.171  1.00 0.00 ? 73 LYS S CE   3  
ATOM 3246  N NZ   . LYS A 1 64 ? 9.390   5.152   -7.400  1.00 0.00 ? 73 LYS S NZ   3  
ATOM 3247  H H    . LYS A 1 64 ? 8.841   6.069   -2.053  1.00 0.00 ? 73 LYS S H    3  
ATOM 3248  H HA   . LYS A 1 64 ? 8.157   7.384   -4.584  1.00 0.00 ? 73 LYS S HA   3  
ATOM 3249  H HB2  . LYS A 1 64 ? 6.837   5.179   -3.008  1.00 0.00 ? 73 LYS S HB2  3  
ATOM 3250  H HB3  . LYS A 1 64 ? 6.036   5.982   -4.355  1.00 0.00 ? 73 LYS S HB3  3  
ATOM 3251  H HG2  . LYS A 1 64 ? 8.748   4.990   -4.912  1.00 0.00 ? 73 LYS S HG2  3  
ATOM 3252  H HG3  . LYS A 1 64 ? 7.534   3.751   -4.589  1.00 0.00 ? 73 LYS S HG3  3  
ATOM 3253  H HD2  . LYS A 1 64 ? 7.068   3.960   -6.781  1.00 0.00 ? 73 LYS S HD2  3  
ATOM 3254  H HD3  . LYS A 1 64 ? 6.177   5.396   -6.276  1.00 0.00 ? 73 LYS S HD3  3  
ATOM 3255  H HE2  . LYS A 1 64 ? 7.596   5.976   -8.126  1.00 0.00 ? 73 LYS S HE2  3  
ATOM 3256  H HE3  . LYS A 1 64 ? 8.222   6.741   -6.666  1.00 0.00 ? 73 LYS S HE3  3  
ATOM 3257  H HZ1  . LYS A 1 64 ? 9.577   4.447   -6.659  1.00 0.00 ? 73 LYS S HZ1  3  
ATOM 3258  H HZ2  . LYS A 1 64 ? 10.147  5.866   -7.382  1.00 0.00 ? 73 LYS S HZ2  3  
ATOM 3259  H HZ3  . LYS A 1 64 ? 9.401   4.676   -8.325  1.00 0.00 ? 73 LYS S HZ3  3  
ATOM 3260  N N    . GLY A 1 65 ? 6.950   8.108   -1.664  1.00 0.00 ? 74 GLY S N    3  
ATOM 3261  C CA   . GLY A 1 65 ? 6.158   9.084   -0.941  1.00 0.00 ? 74 GLY S CA   3  
ATOM 3262  C C    . GLY A 1 65 ? 5.026   8.487   -0.127  1.00 0.00 ? 74 GLY S C    3  
ATOM 3263  O O    . GLY A 1 65 ? 4.291   9.223   0.533   1.00 0.00 ? 74 GLY S O    3  
ATOM 3264  H H    . GLY A 1 65 ? 7.549   7.509   -1.173  1.00 0.00 ? 74 GLY S H    3  
ATOM 3265  H HA2  . GLY A 1 65 ? 6.810   9.615   -0.264  1.00 0.00 ? 74 GLY S HA2  3  
ATOM 3266  H HA3  . GLY A 1 65 ? 5.742   9.789   -1.651  1.00 0.00 ? 74 GLY S HA3  3  
ATOM 3267  N N    . LEU A 1 66 ? 4.876   7.167   -0.146  1.00 0.00 ? 75 LEU S N    3  
ATOM 3268  C CA   . LEU A 1 66 ? 3.816   6.535   0.630   1.00 0.00 ? 75 LEU S CA   3  
ATOM 3269  C C    . LEU A 1 66 ? 4.073   6.739   2.120   1.00 0.00 ? 75 LEU S C    3  
ATOM 3270  O O    . LEU A 1 66 ? 3.550   7.677   2.721   1.00 0.00 ? 75 LEU S O    3  
ATOM 3271  C CB   . LEU A 1 66 ? 3.696   5.044   0.297   1.00 0.00 ? 75 LEU S CB   3  
ATOM 3272  C CG   . LEU A 1 66 ? 3.710   4.718   -1.197  1.00 0.00 ? 75 LEU S CG   3  
ATOM 3273  C CD1  . LEU A 1 66 ? 3.513   3.227   -1.422  1.00 0.00 ? 75 LEU S CD1  3  
ATOM 3274  C CD2  . LEU A 1 66 ? 2.637   5.516   -1.925  1.00 0.00 ? 75 LEU S CD2  3  
ATOM 3275  H H    . LEU A 1 66 ? 5.489   6.614   -0.675  1.00 0.00 ? 75 LEU S H    3  
ATOM 3276  H HA   . LEU A 1 66 ? 2.889   7.026   0.374   1.00 0.00 ? 75 LEU S HA   3  
ATOM 3277  H HB2  . LEU A 1 66 ? 4.510   4.517   0.773   1.00 0.00 ? 75 LEU S HB2  3  
ATOM 3278  H HB3  . LEU A 1 66 ? 2.765   4.681   0.709   1.00 0.00 ? 75 LEU S HB3  3  
ATOM 3279  H HG   . LEU A 1 66 ? 4.671   4.994   -1.610  1.00 0.00 ? 75 LEU S HG   3  
ATOM 3280  H HD11 . LEU A 1 66 ? 4.157   2.895   -2.222  1.00 0.00 ? 75 LEU S HD11 3  
ATOM 3281  H HD12 . LEU A 1 66 ? 2.484   3.036   -1.685  1.00 0.00 ? 75 LEU S HD12 3  
ATOM 3282  H HD13 . LEU A 1 66 ? 3.759   2.693   -0.516  1.00 0.00 ? 75 LEU S HD13 3  
ATOM 3283  H HD21 . LEU A 1 66 ? 2.663   5.279   -2.978  1.00 0.00 ? 75 LEU S HD21 3  
ATOM 3284  H HD22 . LEU A 1 66 ? 2.818   6.573   -1.790  1.00 0.00 ? 75 LEU S HD22 3  
ATOM 3285  H HD23 . LEU A 1 66 ? 1.666   5.265   -1.523  1.00 0.00 ? 75 LEU S HD23 3  
ATOM 3286  N N    . PHE A 1 67 ? 4.894   5.877   2.714   1.00 0.00 ? 76 PHE S N    3  
ATOM 3287  C CA   . PHE A 1 67 ? 5.210   6.008   4.136   1.00 0.00 ? 76 PHE S CA   3  
ATOM 3288  C C    . PHE A 1 67 ? 5.912   7.335   4.411   1.00 0.00 ? 76 PHE S C    3  
ATOM 3289  O O    . PHE A 1 67 ? 6.264   7.585   5.582   1.00 0.00 ? 76 PHE S O    3  
ATOM 3290  C CB   . PHE A 1 67 ? 6.088   4.849   4.625   1.00 0.00 ? 76 PHE S CB   3  
ATOM 3291  C CG   . PHE A 1 67 ? 5.353   3.797   5.409   1.00 0.00 ? 76 PHE S CG   3  
ATOM 3292  C CD1  . PHE A 1 67 ? 3.970   3.696   5.361   1.00 0.00 ? 76 PHE S CD1  3  
ATOM 3293  C CD2  . PHE A 1 67 ? 6.057   2.899   6.192   1.00 0.00 ? 76 PHE S CD2  3  
ATOM 3294  C CE1  . PHE A 1 67 ? 3.308   2.721   6.081   1.00 0.00 ? 76 PHE S CE1  3  
ATOM 3295  C CE2  . PHE A 1 67 ? 5.402   1.920   6.912   1.00 0.00 ? 76 PHE S CE2  3  
ATOM 3296  C CZ   . PHE A 1 67 ? 4.026   1.832   6.856   1.00 0.00 ? 76 PHE S CZ   3  
ATOM 3297  O OXT  . PHE A 1 67 ? 6.104   8.110   3.451   1.00 0.00 ? 76 PHE S OXT  3  
ATOM 3298  H H    . PHE A 1 67 ? 5.298   5.152   2.186   1.00 0.00 ? 76 PHE S H    3  
ATOM 3299  H HA   . PHE A 1 67 ? 4.283   5.995   4.679   1.00 0.00 ? 76 PHE S HA   3  
ATOM 3300  H HB2  . PHE A 1 67 ? 6.538   4.365   3.779   1.00 0.00 ? 76 PHE S HB2  3  
ATOM 3301  H HB3  . PHE A 1 67 ? 6.870   5.244   5.258   1.00 0.00 ? 76 PHE S HB3  3  
ATOM 3302  H HD1  . PHE A 1 67 ? 3.407   4.388   4.754   1.00 0.00 ? 76 PHE S HD1  3  
ATOM 3303  H HD2  . PHE A 1 67 ? 7.134   2.970   6.239   1.00 0.00 ? 76 PHE S HD2  3  
ATOM 3304  H HE1  . PHE A 1 67 ? 2.231   2.659   6.038   1.00 0.00 ? 76 PHE S HE1  3  
ATOM 3305  H HE2  . PHE A 1 67 ? 5.964   1.226   7.516   1.00 0.00 ? 76 PHE S HE2  3  
ATOM 3306  H HZ   . PHE A 1 67 ? 3.513   1.065   7.417   1.00 0.00 ? 76 PHE S HZ   3  
ATOM 3307  N N    . MET A 1 1  ? -23.077 -5.234  4.357   1.00 0.00 ? 10 MET S N    4  
ATOM 3308  C CA   . MET A 1 1  ? -22.389 -4.594  3.205   1.00 0.00 ? 10 MET S CA   4  
ATOM 3309  C C    . MET A 1 1  ? -21.722 -3.284  3.616   1.00 0.00 ? 10 MET S C    4  
ATOM 3310  O O    . MET A 1 1  ? -20.725 -2.872  3.025   1.00 0.00 ? 10 MET S O    4  
ATOM 3311  C CB   . MET A 1 1  ? -23.415 -4.343  2.098   1.00 0.00 ? 10 MET S CB   4  
ATOM 3312  C CG   . MET A 1 1  ? -24.542 -3.408  2.508   1.00 0.00 ? 10 MET S CG   4  
ATOM 3313  S SD   . MET A 1 1  ? -26.098 -4.273  2.790   1.00 0.00 ? 10 MET S SD   4  
ATOM 3314  C CE   . MET A 1 1  ? -26.809 -3.275  4.096   1.00 0.00 ? 10 MET S CE   4  
ATOM 3315  H H1   . MET A 1 1  ? -22.460 -5.138  5.188   1.00 0.00 ? 10 MET S H1   4  
ATOM 3316  H H2   . MET A 1 1  ? -23.232 -6.234  4.118   1.00 0.00 ? 10 MET S H2   4  
ATOM 3317  H H3   . MET A 1 1  ? -23.979 -4.739  4.503   1.00 0.00 ? 10 MET S H3   4  
ATOM 3318  H HA   . MET A 1 1  ? -21.632 -5.272  2.839   1.00 0.00 ? 10 MET S HA   4  
ATOM 3319  H HB2  . MET A 1 1  ? -22.909 -3.909  1.247   1.00 0.00 ? 10 MET S HB2  4  
ATOM 3320  H HB3  . MET A 1 1  ? -23.848 -5.287  1.803   1.00 0.00 ? 10 MET S HB3  4  
ATOM 3321  H HG2  . MET A 1 1  ? -24.258 -2.903  3.419   1.00 0.00 ? 10 MET S HG2  4  
ATOM 3322  H HG3  . MET A 1 1  ? -24.688 -2.678  1.726   1.00 0.00 ? 10 MET S HG3  4  
ATOM 3323  H HE1  . MET A 1 1  ? -27.340 -3.912  4.787   1.00 0.00 ? 10 MET S HE1  4  
ATOM 3324  H HE2  . MET A 1 1  ? -27.495 -2.559  3.667   1.00 0.00 ? 10 MET S HE2  4  
ATOM 3325  H HE3  . MET A 1 1  ? -26.023 -2.751  4.617   1.00 0.00 ? 10 MET S HE3  4  
ATOM 3326  N N    . LEU A 1 2  ? -22.280 -2.634  4.633   1.00 0.00 ? 11 LEU S N    4  
ATOM 3327  C CA   . LEU A 1 2  ? -21.738 -1.371  5.121   1.00 0.00 ? 11 LEU S CA   4  
ATOM 3328  C C    . LEU A 1 2  ? -20.998 -1.572  6.439   1.00 0.00 ? 11 LEU S C    4  
ATOM 3329  O O    . LEU A 1 2  ? -20.026 -0.874  6.730   1.00 0.00 ? 11 LEU S O    4  
ATOM 3330  C CB   . LEU A 1 2  ? -22.858 -0.346  5.303   1.00 0.00 ? 11 LEU S CB   4  
ATOM 3331  C CG   . LEU A 1 2  ? -23.310 0.353   4.019   1.00 0.00 ? 11 LEU S CG   4  
ATOM 3332  C CD1  . LEU A 1 2  ? -24.714 0.914   4.184   1.00 0.00 ? 11 LEU S CD1  4  
ATOM 3333  C CD2  . LEU A 1 2  ? -22.334 1.456   3.643   1.00 0.00 ? 11 LEU S CD2  4  
ATOM 3334  H H    . LEU A 1 2  ? -23.074 -3.012  5.063   1.00 0.00 ? 11 LEU S H    4  
ATOM 3335  H HA   . LEU A 1 2  ? -21.040 -1.003  4.383   1.00 0.00 ? 11 LEU S HA   4  
ATOM 3336  H HB2  . LEU A 1 2  ? -23.711 -0.850  5.734   1.00 0.00 ? 11 LEU S HB2  4  
ATOM 3337  H HB3  . LEU A 1 2  ? -22.519 0.407   5.996   1.00 0.00 ? 11 LEU S HB3  4  
ATOM 3338  H HG   . LEU A 1 2  ? -23.331 -0.367  3.214   1.00 0.00 ? 11 LEU S HG   4  
ATOM 3339  H HD11 . LEU A 1 2  ? -25.010 1.416   3.274   1.00 0.00 ? 11 LEU S HD11 4  
ATOM 3340  H HD12 . LEU A 1 2  ? -24.726 1.619   5.003   1.00 0.00 ? 11 LEU S HD12 4  
ATOM 3341  H HD13 . LEU A 1 2  ? -25.403 0.109   4.392   1.00 0.00 ? 11 LEU S HD13 4  
ATOM 3342  H HD21 . LEU A 1 2  ? -21.370 1.251   4.086   1.00 0.00 ? 11 LEU S HD21 4  
ATOM 3343  H HD22 . LEU A 1 2  ? -22.703 2.403   4.005   1.00 0.00 ? 11 LEU S HD22 4  
ATOM 3344  H HD23 . LEU A 1 2  ? -22.233 1.496   2.567   1.00 0.00 ? 11 LEU S HD23 4  
ATOM 3345  N N    . ALA A 1 3  ? -21.465 -2.529  7.234   1.00 0.00 ? 12 ALA S N    4  
ATOM 3346  C CA   . ALA A 1 3  ? -20.849 -2.822  8.522   1.00 0.00 ? 12 ALA S CA   4  
ATOM 3347  C C    . ALA A 1 3  ? -19.559 -3.618  8.347   1.00 0.00 ? 12 ALA S C    4  
ATOM 3348  O O    . ALA A 1 3  ? -18.531 -3.294  8.941   1.00 0.00 ? 12 ALA S O    4  
ATOM 3349  C CB   . ALA A 1 3  ? -21.823 -3.580  9.411   1.00 0.00 ? 12 ALA S CB   4  
ATOM 3350  H H    . ALA A 1 3  ? -22.242 -3.051  6.947   1.00 0.00 ? 12 ALA S H    4  
ATOM 3351  H HA   . ALA A 1 3  ? -20.616 -1.882  9.003   1.00 0.00 ? 12 ALA S HA   4  
ATOM 3352  H HB1  . ALA A 1 3  ? -22.778 -3.079  9.408   1.00 0.00 ? 12 ALA S HB1  4  
ATOM 3353  H HB2  . ALA A 1 3  ? -21.437 -3.615  10.420  1.00 0.00 ? 12 ALA S HB2  4  
ATOM 3354  H HB3  . ALA A 1 3  ? -21.943 -4.587  9.038   1.00 0.00 ? 12 ALA S HB3  4  
ATOM 3355  N N    . LYS A 1 4  ? -19.622 -4.664  7.527   1.00 0.00 ? 13 LYS S N    4  
ATOM 3356  C CA   . LYS A 1 4  ? -18.460 -5.507  7.274   1.00 0.00 ? 13 LYS S CA   4  
ATOM 3357  C C    . LYS A 1 4  ? -17.404 -4.753  6.474   1.00 0.00 ? 13 LYS S C    4  
ATOM 3358  O O    . LYS A 1 4  ? -17.724 -3.849  5.702   1.00 0.00 ? 13 LYS S O    4  
ATOM 3359  C CB   . LYS A 1 4  ? -18.877 -6.774  6.524   1.00 0.00 ? 13 LYS S CB   4  
ATOM 3360  C CG   . LYS A 1 4  ? -19.694 -7.738  7.367   1.00 0.00 ? 13 LYS S CG   4  
ATOM 3361  C CD   . LYS A 1 4  ? -18.856 -8.361  8.473   1.00 0.00 ? 13 LYS S CD   4  
ATOM 3362  C CE   . LYS A 1 4  ? -19.644 -8.487  9.767   1.00 0.00 ? 13 LYS S CE   4  
ATOM 3363  N NZ   . LYS A 1 4  ? -18.944 -7.835  10.910  1.00 0.00 ? 13 LYS S NZ   4  
ATOM 3364  H H    . LYS A 1 4  ? -20.471 -4.873  7.083   1.00 0.00 ? 13 LYS S H    4  
ATOM 3365  H HA   . LYS A 1 4  ? -18.039 -5.786  8.228   1.00 0.00 ? 13 LYS S HA   4  
ATOM 3366  H HB2  . LYS A 1 4  ? -19.467 -6.492  5.664   1.00 0.00 ? 13 LYS S HB2  4  
ATOM 3367  H HB3  . LYS A 1 4  ? -17.988 -7.287  6.187   1.00 0.00 ? 13 LYS S HB3  4  
ATOM 3368  H HG2  . LYS A 1 4  ? -20.519 -7.202  7.812   1.00 0.00 ? 13 LYS S HG2  4  
ATOM 3369  H HG3  . LYS A 1 4  ? -20.075 -8.525  6.729   1.00 0.00 ? 13 LYS S HG3  4  
ATOM 3370  H HD2  . LYS A 1 4  ? -18.538 -9.343  8.161   1.00 0.00 ? 13 LYS S HD2  4  
ATOM 3371  H HD3  . LYS A 1 4  ? -17.991 -7.738  8.648   1.00 0.00 ? 13 LYS S HD3  4  
ATOM 3372  H HE2  . LYS A 1 4  ? -20.609 -8.022  9.636   1.00 0.00 ? 13 LYS S HE2  4  
ATOM 3373  H HE3  . LYS A 1 4  ? -19.779 -9.536  9.990   1.00 0.00 ? 13 LYS S HE3  4  
ATOM 3374  H HZ1  . LYS A 1 4  ? -18.397 -8.541  11.443  1.00 0.00 ? 13 LYS S HZ1  4  
ATOM 3375  H HZ2  . LYS A 1 4  ? -19.636 -7.394  11.547  1.00 0.00 ? 13 LYS S HZ2  4  
ATOM 3376  H HZ3  . LYS A 1 4  ? -18.295 -7.103  10.560  1.00 0.00 ? 13 LYS S HZ3  4  
ATOM 3377  N N    . LEU A 1 5  ? -16.145 -5.130  6.662   1.00 0.00 ? 14 LEU S N    4  
ATOM 3378  C CA   . LEU A 1 5  ? -15.040 -4.490  5.958   1.00 0.00 ? 14 LEU S CA   4  
ATOM 3379  C C    . LEU A 1 5  ? -14.940 -5.000  4.524   1.00 0.00 ? 14 LEU S C    4  
ATOM 3380  O O    . LEU A 1 5  ? -15.172 -6.179  4.258   1.00 0.00 ? 14 LEU S O    4  
ATOM 3381  C CB   . LEU A 1 5  ? -13.723 -4.739  6.694   1.00 0.00 ? 14 LEU S CB   4  
ATOM 3382  C CG   . LEU A 1 5  ? -13.611 -4.076  8.068   1.00 0.00 ? 14 LEU S CG   4  
ATOM 3383  C CD1  . LEU A 1 5  ? -13.863 -2.580  7.960   1.00 0.00 ? 14 LEU S CD1  4  
ATOM 3384  C CD2  . LEU A 1 5  ? -14.587 -4.714  9.046   1.00 0.00 ? 14 LEU S CD2  4  
ATOM 3385  H H    . LEU A 1 5  ? -15.952 -5.857  7.291   1.00 0.00 ? 14 LEU S H    4  
ATOM 3386  H HA   . LEU A 1 5  ? -15.233 -3.426  5.935   1.00 0.00 ? 14 LEU S HA   4  
ATOM 3387  H HB2  . LEU A 1 5  ? -13.603 -5.807  6.821   1.00 0.00 ? 14 LEU S HB2  4  
ATOM 3388  H HB3  . LEU A 1 5  ? -12.915 -4.375  6.078   1.00 0.00 ? 14 LEU S HB3  4  
ATOM 3389  H HG   . LEU A 1 5  ? -12.612 -4.219  8.450   1.00 0.00 ? 14 LEU S HG   4  
ATOM 3390  H HD11 . LEU A 1 5  ? -13.728 -2.122  8.929   1.00 0.00 ? 14 LEU S HD11 4  
ATOM 3391  H HD12 . LEU A 1 5  ? -14.874 -2.409  7.619   1.00 0.00 ? 14 LEU S HD12 4  
ATOM 3392  H HD13 . LEU A 1 5  ? -13.168 -2.148  7.256   1.00 0.00 ? 14 LEU S HD13 4  
ATOM 3393  H HD21 . LEU A 1 5  ? -15.574 -4.301  8.892   1.00 0.00 ? 14 LEU S HD21 4  
ATOM 3394  H HD22 . LEU A 1 5  ? -14.267 -4.511  10.057  1.00 0.00 ? 14 LEU S HD22 4  
ATOM 3395  H HD23 . LEU A 1 5  ? -14.614 -5.781  8.884   1.00 0.00 ? 14 LEU S HD23 4  
ATOM 3396  N N    . CYS A 1 6  ? -14.594 -4.105  3.605   1.00 0.00 ? 15 CYS S N    4  
ATOM 3397  C CA   . CYS A 1 6  ? -14.464 -4.465  2.197   1.00 0.00 ? 15 CYS S CA   4  
ATOM 3398  C C    . CYS A 1 6  ? -13.027 -4.282  1.720   1.00 0.00 ? 15 CYS S C    4  
ATOM 3399  O O    . CYS A 1 6  ? -12.355 -3.320  2.094   1.00 0.00 ? 15 CYS S O    4  
ATOM 3400  C CB   . CYS A 1 6  ? -15.408 -3.618  1.343   1.00 0.00 ? 15 CYS S CB   4  
ATOM 3401  S SG   . CYS A 1 6  ? -15.994 -4.447  -0.153  1.00 0.00 ? 15 CYS S SG   4  
ATOM 3402  H H    . CYS A 1 6  ? -14.422 -3.181  3.880   1.00 0.00 ? 15 CYS S H    4  
ATOM 3403  H HA   . CYS A 1 6  ? -14.734 -5.505  2.095   1.00 0.00 ? 15 CYS S HA   4  
ATOM 3404  H HB2  . CYS A 1 6  ? -16.274 -3.354  1.931   1.00 0.00 ? 15 CYS S HB2  4  
ATOM 3405  H HB3  . CYS A 1 6  ? -14.897 -2.716  1.041   1.00 0.00 ? 15 CYS S HB3  4  
ATOM 3406  H HG   . CYS A 1 6  ? -16.584 -3.846  -0.613  1.00 0.00 ? 15 CYS S HG   4  
ATOM 3407  N N    . LYS A 1 7  ? -12.561 -5.210  0.892   1.00 0.00 ? 16 LYS S N    4  
ATOM 3408  C CA   . LYS A 1 7  ? -11.203 -5.150  0.362   1.00 0.00 ? 16 LYS S CA   4  
ATOM 3409  C C    . LYS A 1 7  ? -11.175 -4.422  -0.979  1.00 0.00 ? 16 LYS S C    4  
ATOM 3410  O O    . LYS A 1 7  ? -11.635 -4.949  -1.990  1.00 0.00 ? 16 LYS S O    4  
ATOM 3411  C CB   . LYS A 1 7  ? -10.635 -6.561  0.199   1.00 0.00 ? 16 LYS S CB   4  
ATOM 3412  C CG   . LYS A 1 7  ? -10.489 -7.315  1.510   1.00 0.00 ? 16 LYS S CG   4  
ATOM 3413  C CD   . LYS A 1 7  ? -11.741 -8.115  1.836   1.00 0.00 ? 16 LYS S CD   4  
ATOM 3414  C CE   . LYS A 1 7  ? -11.959 -9.240  0.836   1.00 0.00 ? 16 LYS S CE   4  
ATOM 3415  N NZ   . LYS A 1 7  ? -13.374 -9.308  0.378   1.00 0.00 ? 16 LYS S NZ   4  
ATOM 3416  H H    . LYS A 1 7  ? -13.144 -5.953  0.629   1.00 0.00 ? 16 LYS S H    4  
ATOM 3417  H HA   . LYS A 1 7  ? -10.595 -4.606  1.069   1.00 0.00 ? 16 LYS S HA   4  
ATOM 3418  H HB2  . LYS A 1 7  ? -11.289 -7.128  -0.446  1.00 0.00 ? 16 LYS S HB2  4  
ATOM 3419  H HB3  . LYS A 1 7  ? -9.661  -6.494  -0.263  1.00 0.00 ? 16 LYS S HB3  4  
ATOM 3420  H HG2  . LYS A 1 7  ? -9.652  -7.992  1.435   1.00 0.00 ? 16 LYS S HG2  4  
ATOM 3421  H HG3  . LYS A 1 7  ? -10.311 -6.604  2.305   1.00 0.00 ? 16 LYS S HG3  4  
ATOM 3422  H HD2  . LYS A 1 7  ? -11.638 -8.540  2.822   1.00 0.00 ? 16 LYS S HD2  4  
ATOM 3423  H HD3  . LYS A 1 7  ? -12.595 -7.454  1.813   1.00 0.00 ? 16 LYS S HD3  4  
ATOM 3424  H HE2  . LYS A 1 7  ? -11.322 -9.076  -0.019  1.00 0.00 ? 16 LYS S HE2  4  
ATOM 3425  H HE3  . LYS A 1 7  ? -11.697 -10.176 1.305   1.00 0.00 ? 16 LYS S HE3  4  
ATOM 3426  H HZ1  . LYS A 1 7  ? -14.001 -8.874  1.085   1.00 0.00 ? 16 LYS S HZ1  4  
ATOM 3427  H HZ2  . LYS A 1 7  ? -13.658 -10.299 0.238   1.00 0.00 ? 16 LYS S HZ2  4  
ATOM 3428  H HZ3  . LYS A 1 7  ? -13.484 -8.799  -0.523  1.00 0.00 ? 16 LYS S HZ3  4  
ATOM 3429  N N    . THR A 1 8  ? -10.635 -3.209  -0.975  1.00 0.00 ? 17 THR S N    4  
ATOM 3430  C CA   . THR A 1 8  ? -10.550 -2.408  -2.192  1.00 0.00 ? 17 THR S CA   4  
ATOM 3431  C C    . THR A 1 8  ? -9.300  -1.533  -2.186  1.00 0.00 ? 17 THR S C    4  
ATOM 3432  O O    . THR A 1 8  ? -8.876  -1.042  -1.139  1.00 0.00 ? 17 THR S O    4  
ATOM 3433  C CB   . THR A 1 8  ? -11.796 -1.537  -2.342  1.00 0.00 ? 17 THR S CB   4  
ATOM 3434  O OG1  . THR A 1 8  ? -12.970 -2.327  -2.290  1.00 0.00 ? 17 THR S OG1  4  
ATOM 3435  C CG2  . THR A 1 8  ? -11.827 -0.754  -3.636  1.00 0.00 ? 17 THR S CG2  4  
ATOM 3436  H H    . THR A 1 8  ? -10.286 -2.841  -0.136  1.00 0.00 ? 17 THR S H    4  
ATOM 3437  H HA   . THR A 1 8  ? -10.493 -3.087  -3.030  1.00 0.00 ? 17 THR S HA   4  
ATOM 3438  H HB   . THR A 1 8  ? -11.828 -0.828  -1.527  1.00 0.00 ? 17 THR S HB   4  
ATOM 3439  H HG1  . THR A 1 8  ? -13.009 -2.790  -1.449  1.00 0.00 ? 17 THR S HG1  4  
ATOM 3440  H HG21 . THR A 1 8  ? -12.853 -0.555  -3.913  1.00 0.00 ? 17 THR S HG21 4  
ATOM 3441  H HG22 . THR A 1 8  ? -11.350 -1.329  -4.417  1.00 0.00 ? 17 THR S HG22 4  
ATOM 3442  H HG23 . THR A 1 8  ? -11.302 0.181   -3.505  1.00 0.00 ? 17 THR S HG23 4  
ATOM 3443  N N    . ILE A 1 9  ? -8.713  -1.347  -3.363  1.00 0.00 ? 18 ILE S N    4  
ATOM 3444  C CA   . ILE A 1 9  ? -7.512  -0.540  -3.505  1.00 0.00 ? 18 ILE S CA   4  
ATOM 3445  C C    . ILE A 1 9  ? -7.854  0.923   -3.762  1.00 0.00 ? 18 ILE S C    4  
ATOM 3446  O O    . ILE A 1 9  ? -8.682  1.236   -4.618  1.00 0.00 ? 18 ILE S O    4  
ATOM 3447  C CB   . ILE A 1 9  ? -6.645  -1.055  -4.670  1.00 0.00 ? 18 ILE S CB   4  
ATOM 3448  C CG1  . ILE A 1 9  ? -6.204  -2.496  -4.412  1.00 0.00 ? 18 ILE S CG1  4  
ATOM 3449  C CG2  . ILE A 1 9  ? -5.437  -0.152  -4.885  1.00 0.00 ? 18 ILE S CG2  4  
ATOM 3450  C CD1  . ILE A 1 9  ? -7.337  -3.500  -4.459  1.00 0.00 ? 18 ILE S CD1  4  
ATOM 3451  H H    . ILE A 1 9  ? -9.090  -1.771  -4.160  1.00 0.00 ? 18 ILE S H    4  
ATOM 3452  H HA   . ILE A 1 9  ? -6.940  -0.618  -2.592  1.00 0.00 ? 18 ILE S HA   4  
ATOM 3453  H HB   . ILE A 1 9  ? -7.242  -1.027  -5.569  1.00 0.00 ? 18 ILE S HB   4  
ATOM 3454  H HG12 . ILE A 1 9  ? -5.487  -2.778  -5.161  1.00 0.00 ? 18 ILE S HG12 4  
ATOM 3455  H HG13 . ILE A 1 9  ? -5.744  -2.557  -3.437  1.00 0.00 ? 18 ILE S HG13 4  
ATOM 3456  H HG21 . ILE A 1 9  ? -5.731  0.708   -5.466  1.00 0.00 ? 18 ILE S HG21 4  
ATOM 3457  H HG22 . ILE A 1 9  ? -4.668  -0.696  -5.410  1.00 0.00 ? 18 ILE S HG22 4  
ATOM 3458  H HG23 . ILE A 1 9  ? -5.059  0.173   -3.927  1.00 0.00 ? 18 ILE S HG23 4  
ATOM 3459  H HD11 . ILE A 1 9  ? -8.045  -3.208  -5.220  1.00 0.00 ? 18 ILE S HD11 4  
ATOM 3460  H HD12 . ILE A 1 9  ? -7.830  -3.530  -3.500  1.00 0.00 ? 18 ILE S HD12 4  
ATOM 3461  H HD13 . ILE A 1 9  ? -6.939  -4.477  -4.691  1.00 0.00 ? 18 ILE S HD13 4  
ATOM 3462  N N    . TYR A 1 10 ? -7.193  1.814   -3.035  1.00 0.00 ? 19 TYR S N    4  
ATOM 3463  C CA   . TYR A 1 10 ? -7.410  3.244   -3.204  1.00 0.00 ? 19 TYR S CA   4  
ATOM 3464  C C    . TYR A 1 10 ? -6.427  3.780   -4.246  1.00 0.00 ? 19 TYR S C    4  
ATOM 3465  O O    . TYR A 1 10 ? -5.282  3.335   -4.309  1.00 0.00 ? 19 TYR S O    4  
ATOM 3466  C CB   . TYR A 1 10 ? -7.257  3.974   -1.858  1.00 0.00 ? 19 TYR S CB   4  
ATOM 3467  C CG   . TYR A 1 10 ? -8.392  3.695   -0.879  1.00 0.00 ? 19 TYR S CG   4  
ATOM 3468  C CD1  . TYR A 1 10 ? -9.306  2.670   -1.119  1.00 0.00 ? 19 TYR S CD1  4  
ATOM 3469  C CD2  . TYR A 1 10 ? -8.556  4.454   0.284   1.00 0.00 ? 19 TYR S CD2  4  
ATOM 3470  C CE1  . TYR A 1 10 ? -10.340 2.410   -0.241  1.00 0.00 ? 19 TYR S CE1  4  
ATOM 3471  C CE2  . TYR A 1 10 ? -9.592  4.193   1.162   1.00 0.00 ? 19 TYR S CE2  4  
ATOM 3472  C CZ   . TYR A 1 10 ? -10.479 3.173   0.895   1.00 0.00 ? 19 TYR S CZ   4  
ATOM 3473  O OH   . TYR A 1 10 ? -11.510 2.916   1.770   1.00 0.00 ? 19 TYR S OH   4  
ATOM 3474  H H    . TYR A 1 10 ? -6.533  1.503   -2.381  1.00 0.00 ? 19 TYR S H    4  
ATOM 3475  H HA   . TYR A 1 10 ? -8.415  3.383   -3.571  1.00 0.00 ? 19 TYR S HA   4  
ATOM 3476  H HB2  . TYR A 1 10 ? -6.334  3.664   -1.390  1.00 0.00 ? 19 TYR S HB2  4  
ATOM 3477  H HB3  . TYR A 1 10 ? -7.228  5.041   -2.036  1.00 0.00 ? 19 TYR S HB3  4  
ATOM 3478  H HD1  . TYR A 1 10 ? -9.199  2.069   -2.007  1.00 0.00 ? 19 TYR S HD1  4  
ATOM 3479  H HD2  . TYR A 1 10 ? -7.865  5.257   0.501   1.00 0.00 ? 19 TYR S HD2  4  
ATOM 3480  H HE1  . TYR A 1 10 ? -11.035 1.611   -0.449  1.00 0.00 ? 19 TYR S HE1  4  
ATOM 3481  H HE2  . TYR A 1 10 ? -9.703  4.791   2.055   1.00 0.00 ? 19 TYR S HE2  4  
ATOM 3482  H HH   . TYR A 1 10 ? -12.324 2.792   1.277   1.00 0.00 ? 19 TYR S HH   4  
ATOM 3483  N N    . PRO A 1 11 ? -6.865  4.724   -5.098  1.00 0.00 ? 20 PRO S N    4  
ATOM 3484  C CA   . PRO A 1 11 ? -6.018  5.291   -6.154  1.00 0.00 ? 20 PRO S CA   4  
ATOM 3485  C C    . PRO A 1 11 ? -4.673  5.787   -5.632  1.00 0.00 ? 20 PRO S C    4  
ATOM 3486  O O    . PRO A 1 11 ? -4.608  6.778   -4.905  1.00 0.00 ? 20 PRO S O    4  
ATOM 3487  C CB   . PRO A 1 11 ? -6.849  6.461   -6.707  1.00 0.00 ? 20 PRO S CB   4  
ATOM 3488  C CG   . PRO A 1 11 ? -7.975  6.645   -5.744  1.00 0.00 ? 20 PRO S CG   4  
ATOM 3489  C CD   . PRO A 1 11 ? -8.213  5.301   -5.121  1.00 0.00 ? 20 PRO S CD   4  
ATOM 3490  H HA   . PRO A 1 11 ? -5.845  4.572   -6.942  1.00 0.00 ? 20 PRO S HA   4  
ATOM 3491  H HB2  . PRO A 1 11 ? -6.231  7.349   -6.761  1.00 0.00 ? 20 PRO S HB2  4  
ATOM 3492  H HB3  . PRO A 1 11 ? -7.213  6.209   -7.693  1.00 0.00 ? 20 PRO S HB3  4  
ATOM 3493  H HG2  . PRO A 1 11 ? -7.695  7.364   -4.990  1.00 0.00 ? 20 PRO S HG2  4  
ATOM 3494  H HG3  . PRO A 1 11 ? -8.857  6.976   -6.270  1.00 0.00 ? 20 PRO S HG3  4  
ATOM 3495  H HD2  . PRO A 1 11 ? -8.607  5.410   -4.120  1.00 0.00 ? 20 PRO S HD2  4  
ATOM 3496  H HD3  . PRO A 1 11 ? -8.877  4.709   -5.733  1.00 0.00 ? 20 PRO S HD3  4  
ATOM 3497  N N    . LEU A 1 12 ? -3.601  5.088   -6.011  1.00 0.00 ? 21 LEU S N    4  
ATOM 3498  C CA   . LEU A 1 12 ? -2.251  5.452   -5.584  1.00 0.00 ? 21 LEU S CA   4  
ATOM 3499  C C    . LEU A 1 12 ? -2.011  6.956   -5.677  1.00 0.00 ? 21 LEU S C    4  
ATOM 3500  O O    . LEU A 1 12 ? -1.356  7.543   -4.819  1.00 0.00 ? 21 LEU S O    4  
ATOM 3501  C CB   . LEU A 1 12 ? -1.209  4.731   -6.434  1.00 0.00 ? 21 LEU S CB   4  
ATOM 3502  C CG   . LEU A 1 12 ? -1.437  4.811   -7.944  1.00 0.00 ? 21 LEU S CG   4  
ATOM 3503  C CD1  . LEU A 1 12 ? -0.731  6.025   -8.527  1.00 0.00 ? 21 LEU S CD1  4  
ATOM 3504  C CD2  . LEU A 1 12 ? -0.957  3.537   -8.623  1.00 0.00 ? 21 LEU S CD2  4  
ATOM 3505  H H    . LEU A 1 12 ? -3.723  4.303   -6.589  1.00 0.00 ? 21 LEU S H    4  
ATOM 3506  H HA   . LEU A 1 12 ? -2.135  5.143   -4.559  1.00 0.00 ? 21 LEU S HA   4  
ATOM 3507  H HB2  . LEU A 1 12 ? -0.243  5.162   -6.212  1.00 0.00 ? 21 LEU S HB2  4  
ATOM 3508  H HB3  . LEU A 1 12 ? -1.196  3.691   -6.147  1.00 0.00 ? 21 LEU S HB3  4  
ATOM 3509  H HG   . LEU A 1 12 ? -2.495  4.916   -8.137  1.00 0.00 ? 21 LEU S HG   4  
ATOM 3510  H HD11 . LEU A 1 12 ? -0.569  6.756   -7.747  1.00 0.00 ? 21 LEU S HD11 4  
ATOM 3511  H HD12 . LEU A 1 12 ? -1.341  6.458   -9.305  1.00 0.00 ? 21 LEU S HD12 4  
ATOM 3512  H HD13 . LEU A 1 12 ? 0.221   5.724   -8.939  1.00 0.00 ? 21 LEU S HD13 4  
ATOM 3513  H HD21 . LEU A 1 12 ? -0.974  2.723   -7.913  1.00 0.00 ? 21 LEU S HD21 4  
ATOM 3514  H HD22 . LEU A 1 12 ? 0.050   3.679   -8.984  1.00 0.00 ? 21 LEU S HD22 4  
ATOM 3515  H HD23 . LEU A 1 12 ? -1.608  3.305   -9.453  1.00 0.00 ? 21 LEU S HD23 4  
ATOM 3516  N N    . ALA A 1 13 ? -2.535  7.573   -6.726  1.00 0.00 ? 22 ALA S N    4  
ATOM 3517  C CA   . ALA A 1 13 ? -2.363  9.005   -6.923  1.00 0.00 ? 22 ALA S CA   4  
ATOM 3518  C C    . ALA A 1 13 ? -2.935  9.791   -5.749  1.00 0.00 ? 22 ALA S C    4  
ATOM 3519  O O    . ALA A 1 13 ? -2.290  10.697  -5.220  1.00 0.00 ? 22 ALA S O    4  
ATOM 3520  C CB   . ALA A 1 13 ? -3.020  9.442   -8.223  1.00 0.00 ? 22 ALA S CB   4  
ATOM 3521  H H    . ALA A 1 13 ? -3.046  7.054   -7.382  1.00 0.00 ? 22 ALA S H    4  
ATOM 3522  H HA   . ALA A 1 13 ? -1.304  9.206   -6.996  1.00 0.00 ? 22 ALA S HA   4  
ATOM 3523  H HB1  . ALA A 1 13 ? -2.406  10.189  -8.704  1.00 0.00 ? 22 ALA S HB1  4  
ATOM 3524  H HB2  . ALA A 1 13 ? -3.994  9.858   -8.013  1.00 0.00 ? 22 ALA S HB2  4  
ATOM 3525  H HB3  . ALA A 1 13 ? -3.126  8.589   -8.877  1.00 0.00 ? 22 ALA S HB3  4  
ATOM 3526  N N    . ASP A 1 14 ? -4.151  9.440   -5.354  1.00 0.00 ? 23 ASP S N    4  
ATOM 3527  C CA   . ASP A 1 14 ? -4.823  10.114  -4.252  1.00 0.00 ? 23 ASP S CA   4  
ATOM 3528  C C    . ASP A 1 14 ? -4.064  9.952   -2.937  1.00 0.00 ? 23 ASP S C    4  
ATOM 3529  O O    . ASP A 1 14 ? -3.992  10.883  -2.135  1.00 0.00 ? 23 ASP S O    4  
ATOM 3530  C CB   . ASP A 1 14 ? -6.246  9.579   -4.096  1.00 0.00 ? 23 ASP S CB   4  
ATOM 3531  C CG   . ASP A 1 14 ? -7.239  10.303  -4.984  1.00 0.00 ? 23 ASP S CG   4  
ATOM 3532  O OD1  . ASP A 1 14 ? -6.804  10.923  -5.978  1.00 0.00 ? 23 ASP S OD1  4  
ATOM 3533  O OD2  . ASP A 1 14 ? -8.450  10.250  -4.687  1.00 0.00 ? 23 ASP S OD2  4  
ATOM 3534  H H    . ASP A 1 14 ? -4.613  8.712   -5.821  1.00 0.00 ? 23 ASP S H    4  
ATOM 3535  H HA   . ASP A 1 14 ? -4.869  11.161  -4.496  1.00 0.00 ? 23 ASP S HA   4  
ATOM 3536  H HB2  . ASP A 1 14 ? -6.258  8.530   -4.357  1.00 0.00 ? 23 ASP S HB2  4  
ATOM 3537  H HB3  . ASP A 1 14 ? -6.558  9.694   -3.068  1.00 0.00 ? 23 ASP S HB3  4  
ATOM 3538  N N    . LEU A 1 15 ? -3.515  8.767   -2.715  1.00 0.00 ? 24 LEU S N    4  
ATOM 3539  C CA   . LEU A 1 15 ? -2.777  8.488   -1.483  1.00 0.00 ? 24 LEU S CA   4  
ATOM 3540  C C    . LEU A 1 15 ? -1.328  8.946   -1.576  1.00 0.00 ? 24 LEU S C    4  
ATOM 3541  O O    . LEU A 1 15 ? -0.650  9.098   -0.561  1.00 0.00 ? 24 LEU S O    4  
ATOM 3542  C CB   . LEU A 1 15 ? -2.806  6.992   -1.170  1.00 0.00 ? 24 LEU S CB   4  
ATOM 3543  C CG   . LEU A 1 15 ? -2.670  6.074   -2.389  1.00 0.00 ? 24 LEU S CG   4  
ATOM 3544  C CD1  . LEU A 1 15 ? -1.526  5.078   -2.213  1.00 0.00 ? 24 LEU S CD1  4  
ATOM 3545  C CD2  . LEU A 1 15 ? -3.981  5.349   -2.648  1.00 0.00 ? 24 LEU S CD2  4  
ATOM 3546  H H    . LEU A 1 15 ? -3.613  8.060   -3.387  1.00 0.00 ? 24 LEU S H    4  
ATOM 3547  H HA   . LEU A 1 15 ? -3.260  9.023   -0.680  1.00 0.00 ? 24 LEU S HA   4  
ATOM 3548  H HB2  . LEU A 1 15 ? -1.995  6.778   -0.488  1.00 0.00 ? 24 LEU S HB2  4  
ATOM 3549  H HB3  . LEU A 1 15 ? -3.737  6.764   -0.677  1.00 0.00 ? 24 LEU S HB3  4  
ATOM 3550  H HG   . LEU A 1 15 ? -2.448  6.674   -3.254  1.00 0.00 ? 24 LEU S HG   4  
ATOM 3551  H HD11 . LEU A 1 15 ? -1.008  5.281   -1.286  1.00 0.00 ? 24 LEU S HD11 4  
ATOM 3552  H HD12 . LEU A 1 15 ? -0.836  5.172   -3.037  1.00 0.00 ? 24 LEU S HD12 4  
ATOM 3553  H HD13 . LEU A 1 15 ? -1.924  4.070   -2.190  1.00 0.00 ? 24 LEU S HD13 4  
ATOM 3554  H HD21 . LEU A 1 15 ? -4.217  4.719   -1.805  1.00 0.00 ? 24 LEU S HD21 4  
ATOM 3555  H HD22 . LEU A 1 15 ? -3.885  4.747   -3.536  1.00 0.00 ? 24 LEU S HD22 4  
ATOM 3556  H HD23 . LEU A 1 15 ? -4.770  6.076   -2.788  1.00 0.00 ? 24 LEU S HD23 4  
ATOM 3557  N N    . LEU A 1 16 ? -0.848  9.132   -2.796  1.00 0.00 ? 25 LEU S N    4  
ATOM 3558  C CA   . LEU A 1 16 ? 0.527   9.531   -3.014  1.00 0.00 ? 25 LEU S CA   4  
ATOM 3559  C C    . LEU A 1 16 ? 0.735   11.041  -2.883  1.00 0.00 ? 25 LEU S C    4  
ATOM 3560  O O    . LEU A 1 16 ? 1.875   11.503  -2.855  1.00 0.00 ? 25 LEU S O    4  
ATOM 3561  C CB   . LEU A 1 16 ? 0.977   9.046   -4.388  1.00 0.00 ? 25 LEU S CB   4  
ATOM 3562  C CG   . LEU A 1 16 ? 2.480   9.131   -4.642  1.00 0.00 ? 25 LEU S CG   4  
ATOM 3563  C CD1  . LEU A 1 16 ? 3.219   8.207   -3.688  1.00 0.00 ? 25 LEU S CD1  4  
ATOM 3564  C CD2  . LEU A 1 16 ? 2.798   8.783   -6.088  1.00 0.00 ? 25 LEU S CD2  4  
ATOM 3565  H H    . LEU A 1 16 ? -1.423  8.971   -3.570  1.00 0.00 ? 25 LEU S H    4  
ATOM 3566  H HA   . LEU A 1 16 ? 1.129   9.039   -2.267  1.00 0.00 ? 25 LEU S HA   4  
ATOM 3567  H HB2  . LEU A 1 16 ? 0.675   8.011   -4.488  1.00 0.00 ? 25 LEU S HB2  4  
ATOM 3568  H HB3  . LEU A 1 16 ? 0.470   9.628   -5.140  1.00 0.00 ? 25 LEU S HB3  4  
ATOM 3569  H HG   . LEU A 1 16 ? 2.814   10.142  -4.455  1.00 0.00 ? 25 LEU S HG   4  
ATOM 3570  H HD11 . LEU A 1 16 ? 4.015   8.752   -3.205  1.00 0.00 ? 25 LEU S HD11 4  
ATOM 3571  H HD12 . LEU A 1 16 ? 3.631   7.375   -4.239  1.00 0.00 ? 25 LEU S HD12 4  
ATOM 3572  H HD13 . LEU A 1 16 ? 2.529   7.839   -2.941  1.00 0.00 ? 25 LEU S HD13 4  
ATOM 3573  H HD21 . LEU A 1 16 ? 3.633   9.380   -6.426  1.00 0.00 ? 25 LEU S HD21 4  
ATOM 3574  H HD22 . LEU A 1 16 ? 1.937   8.987   -6.707  1.00 0.00 ? 25 LEU S HD22 4  
ATOM 3575  H HD23 . LEU A 1 16 ? 3.052   7.735   -6.160  1.00 0.00 ? 25 LEU S HD23 4  
ATOM 3576  N N    . ALA A 1 17 ? -0.350  11.816  -2.792  1.00 0.00 ? 26 ALA S N    4  
ATOM 3577  C CA   . ALA A 1 17 ? -0.215  13.272  -2.654  1.00 0.00 ? 26 ALA S CA   4  
ATOM 3578  C C    . ALA A 1 17 ? -1.554  14.009  -2.729  1.00 0.00 ? 26 ALA S C    4  
ATOM 3579  O O    . ALA A 1 17 ? -1.630  15.103  -3.288  1.00 0.00 ? 26 ALA S O    4  
ATOM 3580  C CB   . ALA A 1 17 ? 0.737   13.815  -3.715  1.00 0.00 ? 26 ALA S CB   4  
ATOM 3581  H H    . ALA A 1 17 ? -1.243  11.406  -2.811  1.00 0.00 ? 26 ALA S H    4  
ATOM 3582  H HA   . ALA A 1 17 ? 0.229   13.465  -1.689  1.00 0.00 ? 26 ALA S HA   4  
ATOM 3583  H HB1  . ALA A 1 17 ? 0.225   14.543  -4.325  1.00 0.00 ? 26 ALA S HB1  4  
ATOM 3584  H HB2  . ALA A 1 17 ? 1.085   13.004  -4.339  1.00 0.00 ? 26 ALA S HB2  4  
ATOM 3585  H HB3  . ALA A 1 17 ? 1.583   14.284  -3.232  1.00 0.00 ? 26 ALA S HB3  4  
ATOM 3586  N N    . ARG A 1 18 ? -2.603  13.429  -2.159  1.00 0.00 ? 27 ARG S N    4  
ATOM 3587  C CA   . ARG A 1 18 ? -3.915  14.075  -2.171  1.00 0.00 ? 27 ARG S CA   4  
ATOM 3588  C C    . ARG A 1 18 ? -4.737  13.683  -0.945  1.00 0.00 ? 27 ARG S C    4  
ATOM 3589  O O    . ARG A 1 18 ? -4.619  12.564  -0.451  1.00 0.00 ? 27 ARG S O    4  
ATOM 3590  C CB   . ARG A 1 18 ? -4.671  13.729  -3.467  1.00 0.00 ? 27 ARG S CB   4  
ATOM 3591  C CG   . ARG A 1 18 ? -5.944  12.905  -3.273  1.00 0.00 ? 27 ARG S CG   4  
ATOM 3592  C CD   . ARG A 1 18 ? -7.129  13.774  -2.890  1.00 0.00 ? 27 ARG S CD   4  
ATOM 3593  N NE   . ARG A 1 18 ? -8.372  13.296  -3.494  1.00 0.00 ? 27 ARG S NE   4  
ATOM 3594  C CZ   . ARG A 1 18 ? -9.461  14.046  -3.641  1.00 0.00 ? 27 ARG S CZ   4  
ATOM 3595  N NH1  . ARG A 1 18 ? -9.468  15.307  -3.229  1.00 0.00 ? 27 ARG S NH1  4  
ATOM 3596  N NH2  . ARG A 1 18 ? -10.547 13.533  -4.202  1.00 0.00 ? 27 ARG S NH2  4  
ATOM 3597  H H    . ARG A 1 18 ? -2.495  12.563  -1.713  1.00 0.00 ? 27 ARG S H    4  
ATOM 3598  H HA   . ARG A 1 18 ? -3.751  15.143  -2.143  1.00 0.00 ? 27 ARG S HA   4  
ATOM 3599  H HB2  . ARG A 1 18 ? -4.945  14.649  -3.962  1.00 0.00 ? 27 ARG S HB2  4  
ATOM 3600  H HB3  . ARG A 1 18 ? -4.008  13.173  -4.113  1.00 0.00 ? 27 ARG S HB3  4  
ATOM 3601  H HG2  . ARG A 1 18 ? -6.173  12.397  -4.194  1.00 0.00 ? 27 ARG S HG2  4  
ATOM 3602  H HG3  . ARG A 1 18 ? -5.776  12.176  -2.493  1.00 0.00 ? 27 ARG S HG3  4  
ATOM 3603  H HD2  . ARG A 1 18 ? -7.236  13.765  -1.816  1.00 0.00 ? 27 ARG S HD2  4  
ATOM 3604  H HD3  . ARG A 1 18 ? -6.941  14.781  -3.229  1.00 0.00 ? 27 ARG S HD3  4  
ATOM 3605  H HE   . ARG A 1 18 ? -8.394  12.367  -3.807  1.00 0.00 ? 27 ARG S HE   4  
ATOM 3606  H HH11 . ARG A 1 18 ? -8.653  15.700  -2.804  1.00 0.00 ? 27 ARG S HH11 4  
ATOM 3607  H HH12 . ARG A 1 18 ? -10.290 15.865  -3.342  1.00 0.00 ? 27 ARG S HH12 4  
ATOM 3608  H HH21 . ARG A 1 18 ? -10.547 12.583  -4.514  1.00 0.00 ? 27 ARG S HH21 4  
ATOM 3609  H HH22 . ARG A 1 18 ? -11.367 14.095  -4.313  1.00 0.00 ? 27 ARG S HH22 4  
ATOM 3610  N N    . PRO A 1 19 ? -5.593  14.598  -0.450  1.00 0.00 ? 28 PRO S N    4  
ATOM 3611  C CA   . PRO A 1 19 ? -6.455  14.336  0.708   1.00 0.00 ? 28 PRO S CA   4  
ATOM 3612  C C    . PRO A 1 19 ? -7.222  13.020  0.567   1.00 0.00 ? 28 PRO S C    4  
ATOM 3613  O O    . PRO A 1 19 ? -8.420  13.005  0.281   1.00 0.00 ? 28 PRO S O    4  
ATOM 3614  C CB   . PRO A 1 19 ? -7.420  15.521  0.710   1.00 0.00 ? 28 PRO S CB   4  
ATOM 3615  C CG   . PRO A 1 19 ? -6.668  16.620  0.043   1.00 0.00 ? 28 PRO S CG   4  
ATOM 3616  C CD   . PRO A 1 19 ? -5.798  15.958  -0.991  1.00 0.00 ? 28 PRO S CD   4  
ATOM 3617  H HA   . PRO A 1 19 ? -5.889  14.325  1.627   1.00 0.00 ? 28 PRO S HA   4  
ATOM 3618  H HB2  . PRO A 1 19 ? -8.315  15.263  0.158   1.00 0.00 ? 28 PRO S HB2  4  
ATOM 3619  H HB3  . PRO A 1 19 ? -7.677  15.780  1.729   1.00 0.00 ? 28 PRO S HB3  4  
ATOM 3620  H HG2  . PRO A 1 19 ? -7.357  17.304  -0.428  1.00 0.00 ? 28 PRO S HG2  4  
ATOM 3621  H HG3  . PRO A 1 19 ? -6.057  17.140  0.767   1.00 0.00 ? 28 PRO S HG3  4  
ATOM 3622  H HD2  . PRO A 1 19 ? -6.306  15.924  -1.942  1.00 0.00 ? 28 PRO S HD2  4  
ATOM 3623  H HD3  . PRO A 1 19 ? -4.857  16.481  -1.081  1.00 0.00 ? 28 PRO S HD3  4  
ATOM 3624  N N    . LEU A 1 20 ? -6.504  11.922  0.771   1.00 0.00 ? 29 LEU S N    4  
ATOM 3625  C CA   . LEU A 1 20 ? -7.073  10.585  0.677   1.00 0.00 ? 29 LEU S CA   4  
ATOM 3626  C C    . LEU A 1 20 ? -7.970  10.276  1.874   1.00 0.00 ? 29 LEU S C    4  
ATOM 3627  O O    . LEU A 1 20 ? -7.840  10.885  2.936   1.00 0.00 ? 29 LEU S O    4  
ATOM 3628  C CB   . LEU A 1 20 ? -5.944  9.549   0.584   1.00 0.00 ? 29 LEU S CB   4  
ATOM 3629  C CG   . LEU A 1 20 ? -5.250  9.208   1.910   1.00 0.00 ? 29 LEU S CG   4  
ATOM 3630  C CD1  . LEU A 1 20 ? -4.080  8.269   1.673   1.00 0.00 ? 29 LEU S CD1  4  
ATOM 3631  C CD2  . LEU A 1 20 ? -4.781  10.473  2.615   1.00 0.00 ? 29 LEU S CD2  4  
ATOM 3632  H H    . LEU A 1 20 ? -5.557  12.016  0.987   1.00 0.00 ? 29 LEU S H    4  
ATOM 3633  H HA   . LEU A 1 20 ? -7.665  10.538  -0.225  1.00 0.00 ? 29 LEU S HA   4  
ATOM 3634  H HB2  . LEU A 1 20 ? -6.353  8.637   0.173   1.00 0.00 ? 29 LEU S HB2  4  
ATOM 3635  H HB3  . LEU A 1 20 ? -5.194  9.929   -0.098  1.00 0.00 ? 29 LEU S HB3  4  
ATOM 3636  H HG   . LEU A 1 20 ? -5.956  8.707   2.556   1.00 0.00 ? 29 LEU S HG   4  
ATOM 3637  H HD11 . LEU A 1 20 ? -3.261  8.818   1.233   1.00 0.00 ? 29 LEU S HD11 4  
ATOM 3638  H HD12 . LEU A 1 20 ? -4.383  7.477   1.005   1.00 0.00 ? 29 LEU S HD12 4  
ATOM 3639  H HD13 . LEU A 1 20 ? -3.762  7.845   2.614   1.00 0.00 ? 29 LEU S HD13 4  
ATOM 3640  H HD21 . LEU A 1 20 ? -5.629  11.111  2.811   1.00 0.00 ? 29 LEU S HD21 4  
ATOM 3641  H HD22 . LEU A 1 20 ? -4.076  10.994  1.985   1.00 0.00 ? 29 LEU S HD22 4  
ATOM 3642  H HD23 . LEU A 1 20 ? -4.305  10.209  3.547   1.00 0.00 ? 29 LEU S HD23 4  
ATOM 3643  N N    . PRO A 1 21 ? -8.902  9.321   1.708   1.00 0.00 ? 30 PRO S N    4  
ATOM 3644  C CA   . PRO A 1 21 ? -9.835  8.924   2.768   1.00 0.00 ? 30 PRO S CA   4  
ATOM 3645  C C    . PRO A 1 21 ? -9.128  8.258   3.939   1.00 0.00 ? 30 PRO S C    4  
ATOM 3646  O O    . PRO A 1 21 ? -7.912  8.378   4.093   1.00 0.00 ? 30 PRO S O    4  
ATOM 3647  C CB   . PRO A 1 21 ? -10.770 7.931   2.070   1.00 0.00 ? 30 PRO S CB   4  
ATOM 3648  C CG   . PRO A 1 21 ? -9.972  7.404   0.931   1.00 0.00 ? 30 PRO S CG   4  
ATOM 3649  C CD   . PRO A 1 21 ? -9.122  8.549   0.470   1.00 0.00 ? 30 PRO S CD   4  
ATOM 3650  H HA   . PRO A 1 21 ? -10.406 9.766   3.128   1.00 0.00 ? 30 PRO S HA   4  
ATOM 3651  H HB2  . PRO A 1 21 ? -11.045 7.144   2.756   1.00 0.00 ? 30 PRO S HB2  4  
ATOM 3652  H HB3  . PRO A 1 21 ? -11.655 8.446   1.726   1.00 0.00 ? 30 PRO S HB3  4  
ATOM 3653  H HG2  . PRO A 1 21 ? -9.349  6.588   1.266   1.00 0.00 ? 30 PRO S HG2  4  
ATOM 3654  H HG3  . PRO A 1 21 ? -10.631 7.081   0.136   1.00 0.00 ? 30 PRO S HG3  4  
ATOM 3655  H HD2  . PRO A 1 21 ? -8.186  8.186   0.068   1.00 0.00 ? 30 PRO S HD2  4  
ATOM 3656  H HD3  . PRO A 1 21 ? -9.648  9.138   -0.263  1.00 0.00 ? 30 PRO S HD3  4  
ATOM 3657  N N    . GLU A 1 22 ? -9.896  7.562   4.766   1.00 0.00 ? 31 GLU S N    4  
ATOM 3658  C CA   . GLU A 1 22 ? -9.339  6.883   5.931   1.00 0.00 ? 31 GLU S CA   4  
ATOM 3659  C C    . GLU A 1 22 ? -9.182  5.392   5.695   1.00 0.00 ? 31 GLU S C    4  
ATOM 3660  O O    . GLU A 1 22 ? -8.494  4.717   6.462   1.00 0.00 ? 31 GLU S O    4  
ATOM 3661  C CB   . GLU A 1 22 ? -10.200 7.139   7.168   1.00 0.00 ? 31 GLU S CB   4  
ATOM 3662  C CG   . GLU A 1 22 ? -9.644  6.510   8.437   1.00 0.00 ? 31 GLU S CG   4  
ATOM 3663  C CD   . GLU A 1 22 ? -8.272  7.045   8.799   1.00 0.00 ? 31 GLU S CD   4  
ATOM 3664  O OE1  . GLU A 1 22 ? -7.270  6.495   8.293   1.00 0.00 ? 31 GLU S OE1  4  
ATOM 3665  O OE2  . GLU A 1 22 ? -8.200  8.011   9.585   1.00 0.00 ? 31 GLU S OE2  4  
ATOM 3666  H H    . GLU A 1 22 ? -10.859 7.509   4.592   1.00 0.00 ? 31 GLU S H    4  
ATOM 3667  H HA   . GLU A 1 22 ? -8.348  7.286   6.097   1.00 0.00 ? 31 GLU S HA   4  
ATOM 3668  H HB2  . GLU A 1 22 ? -10.277 8.204   7.325   1.00 0.00 ? 31 GLU S HB2  4  
ATOM 3669  H HB3  . GLU A 1 22 ? -11.186 6.736   6.996   1.00 0.00 ? 31 GLU S HB3  4  
ATOM 3670  H HG2  . GLU A 1 22 ? -10.321 6.718   9.253   1.00 0.00 ? 31 GLU S HG2  4  
ATOM 3671  H HG3  . GLU A 1 22 ? -9.572  5.442   8.292   1.00 0.00 ? 31 GLU S HG3  4  
ATOM 3672  N N    . GLY A 1 23 ? -9.769  4.873   4.615   1.00 0.00 ? 32 GLY S N    4  
ATOM 3673  C CA   . GLY A 1 23 ? -9.593  3.463   4.320   1.00 0.00 ? 32 GLY S CA   4  
ATOM 3674  C C    . GLY A 1 23 ? -8.118  3.119   4.351   1.00 0.00 ? 32 GLY S C    4  
ATOM 3675  O O    . GLY A 1 23 ? -7.724  1.992   4.652   1.00 0.00 ? 32 GLY S O    4  
ATOM 3676  H H    . GLY A 1 23 ? -10.278 5.448   4.007   1.00 0.00 ? 32 GLY S H    4  
ATOM 3677  H HA2  . GLY A 1 23 ? -10.118 2.873   5.062   1.00 0.00 ? 32 GLY S HA2  4  
ATOM 3678  H HA3  . GLY A 1 23 ? -9.989  3.245   3.341   1.00 0.00 ? 32 GLY S HA3  4  
ATOM 3679  N N    . VAL A 1 24 ? -7.307  4.141   4.074   1.00 0.00 ? 33 VAL S N    4  
ATOM 3680  C CA   . VAL A 1 24 ? -5.862  4.032   4.095   1.00 0.00 ? 33 VAL S CA   4  
ATOM 3681  C C    . VAL A 1 24 ? -5.359  4.096   5.528   1.00 0.00 ? 33 VAL S C    4  
ATOM 3682  O O    . VAL A 1 24 ? -6.013  4.670   6.399   1.00 0.00 ? 33 VAL S O    4  
ATOM 3683  C CB   . VAL A 1 24 ? -5.206  5.196   3.329   1.00 0.00 ? 33 VAL S CB   4  
ATOM 3684  C CG1  . VAL A 1 24 ? -5.383  5.042   1.832   1.00 0.00 ? 33 VAL S CG1  4  
ATOM 3685  C CG2  . VAL A 1 24 ? -5.776  6.524   3.805   1.00 0.00 ? 33 VAL S CG2  4  
ATOM 3686  H H    . VAL A 1 24 ? -7.703  5.013   3.871   1.00 0.00 ? 33 VAL S H    4  
ATOM 3687  H HA   . VAL A 1 24 ? -5.571  3.098   3.641   1.00 0.00 ? 33 VAL S HA   4  
ATOM 3688  H HB   . VAL A 1 24 ? -4.149  5.192   3.547   1.00 0.00 ? 33 VAL S HB   4  
ATOM 3689  H HG11 . VAL A 1 24 ? -6.318  5.487   1.535   1.00 0.00 ? 33 VAL S HG11 4  
ATOM 3690  H HG12 . VAL A 1 24 ? -5.382  3.996   1.574   1.00 0.00 ? 33 VAL S HG12 4  
ATOM 3691  H HG13 . VAL A 1 24 ? -4.571  5.541   1.324   1.00 0.00 ? 33 VAL S HG13 4  
ATOM 3692  H HG21 . VAL A 1 24 ? -6.302  6.379   4.737   1.00 0.00 ? 33 VAL S HG21 4  
ATOM 3693  H HG22 . VAL A 1 24 ? -6.459  6.909   3.062   1.00 0.00 ? 33 VAL S HG22 4  
ATOM 3694  H HG23 . VAL A 1 24 ? -4.971  7.229   3.953   1.00 0.00 ? 33 VAL S HG23 4  
ATOM 3695  N N    . ASP A 1 25 ? -4.186  3.537   5.763   1.00 0.00 ? 34 ASP S N    4  
ATOM 3696  C CA   . ASP A 1 25 ? -3.591  3.571   7.087   1.00 0.00 ? 34 ASP S CA   4  
ATOM 3697  C C    . ASP A 1 25 ? -2.188  4.176   6.998   1.00 0.00 ? 34 ASP S C    4  
ATOM 3698  O O    . ASP A 1 25 ? -1.252  3.514   6.550   1.00 0.00 ? 34 ASP S O    4  
ATOM 3699  C CB   . ASP A 1 25 ? -3.532  2.165   7.685   1.00 0.00 ? 34 ASP S CB   4  
ATOM 3700  C CG   . ASP A 1 25 ? -4.868  1.452   7.614   1.00 0.00 ? 34 ASP S CG   4  
ATOM 3701  O OD1  . ASP A 1 25 ? -5.406  1.308   6.496   1.00 0.00 ? 34 ASP S OD1  4  
ATOM 3702  O OD2  . ASP A 1 25 ? -5.377  1.037   8.677   1.00 0.00 ? 34 ASP S OD2  4  
ATOM 3703  H H    . ASP A 1 25 ? -3.699  3.113   5.028   1.00 0.00 ? 34 ASP S H    4  
ATOM 3704  H HA   . ASP A 1 25 ? -4.218  4.202   7.708   1.00 0.00 ? 34 ASP S HA   4  
ATOM 3705  H HB2  . ASP A 1 25 ? -2.803  1.579   7.144   1.00 0.00 ? 34 ASP S HB2  4  
ATOM 3706  H HB3  . ASP A 1 25 ? -3.237  2.236   8.724   1.00 0.00 ? 34 ASP S HB3  4  
ATOM 3707  N N    . PRO A 1 26 ? -2.026  5.452   7.395   1.00 0.00 ? 35 PRO S N    4  
ATOM 3708  C CA   . PRO A 1 26 ? -0.741  6.149   7.326   1.00 0.00 ? 35 PRO S CA   4  
ATOM 3709  C C    . PRO A 1 26 ? 0.441   5.313   7.824   1.00 0.00 ? 35 PRO S C    4  
ATOM 3710  O O    . PRO A 1 26 ? 1.514   5.328   7.221   1.00 0.00 ? 35 PRO S O    4  
ATOM 3711  C CB   . PRO A 1 26 ? -0.940  7.387   8.220   1.00 0.00 ? 35 PRO S CB   4  
ATOM 3712  C CG   . PRO A 1 26 ? -2.309  7.258   8.812   1.00 0.00 ? 35 PRO S CG   4  
ATOM 3713  C CD   . PRO A 1 26 ? -3.078  6.332   7.915   1.00 0.00 ? 35 PRO S CD   4  
ATOM 3714  H HA   . PRO A 1 26 ? -0.538  6.474   6.314   1.00 0.00 ? 35 PRO S HA   4  
ATOM 3715  H HB2  . PRO A 1 26 ? -0.182  7.400   8.992   1.00 0.00 ? 35 PRO S HB2  4  
ATOM 3716  H HB3  . PRO A 1 26 ? -0.858  8.282   7.617   1.00 0.00 ? 35 PRO S HB3  4  
ATOM 3717  H HG2  . PRO A 1 26 ? -2.240  6.842   9.806   1.00 0.00 ? 35 PRO S HG2  4  
ATOM 3718  H HG3  . PRO A 1 26 ? -2.785  8.229   8.844   1.00 0.00 ? 35 PRO S HG3  4  
ATOM 3719  H HD2  . PRO A 1 26 ? -3.807  5.776   8.486   1.00 0.00 ? 35 PRO S HD2  4  
ATOM 3720  H HD3  . PRO A 1 26 ? -3.553  6.883   7.116   1.00 0.00 ? 35 PRO S HD3  4  
ATOM 3721  N N    . LEU A 1 27 ? 0.248   4.593   8.926   1.00 0.00 ? 36 LEU S N    4  
ATOM 3722  C CA   . LEU A 1 27 ? 1.315   3.766   9.490   1.00 0.00 ? 36 LEU S CA   4  
ATOM 3723  C C    . LEU A 1 27 ? 1.692   2.622   8.547   1.00 0.00 ? 36 LEU S C    4  
ATOM 3724  O O    . LEU A 1 27 ? 2.739   1.995   8.705   1.00 0.00 ? 36 LEU S O    4  
ATOM 3725  C CB   . LEU A 1 27 ? 0.918   3.211   10.868  1.00 0.00 ? 36 LEU S CB   4  
ATOM 3726  C CG   . LEU A 1 27 ? -0.510  2.663   10.997  1.00 0.00 ? 36 LEU S CG   4  
ATOM 3727  C CD1  . LEU A 1 27 ? -1.475  3.761   11.420  1.00 0.00 ? 36 LEU S CD1  4  
ATOM 3728  C CD2  . LEU A 1 27 ? -0.968  2.014   9.700   1.00 0.00 ? 36 LEU S CD2  4  
ATOM 3729  H H    . LEU A 1 27 ? -0.622  4.619   9.367   1.00 0.00 ? 36 LEU S H    4  
ATOM 3730  H HA   . LEU A 1 27 ? 2.182   4.400   9.611   1.00 0.00 ? 36 LEU S HA   4  
ATOM 3731  H HB2  . LEU A 1 27 ? 1.605   2.415   11.117  1.00 0.00 ? 36 LEU S HB2  4  
ATOM 3732  H HB3  . LEU A 1 27 ? 1.039   4.006   11.594  1.00 0.00 ? 36 LEU S HB3  4  
ATOM 3733  H HG   . LEU A 1 27 ? -0.521  1.905   11.767  1.00 0.00 ? 36 LEU S HG   4  
ATOM 3734  H HD11 . LEU A 1 27 ? -2.092  4.044   10.579  1.00 0.00 ? 36 LEU S HD11 4  
ATOM 3735  H HD12 . LEU A 1 27 ? -0.917  4.620   11.763  1.00 0.00 ? 36 LEU S HD12 4  
ATOM 3736  H HD13 . LEU A 1 27 ? -2.104  3.398   12.221  1.00 0.00 ? 36 LEU S HD13 4  
ATOM 3737  H HD21 . LEU A 1 27 ? -1.178  2.779   8.967   1.00 0.00 ? 36 LEU S HD21 4  
ATOM 3738  H HD22 . LEU A 1 27 ? -1.861  1.435   9.882   1.00 0.00 ? 36 LEU S HD22 4  
ATOM 3739  H HD23 . LEU A 1 27 ? -0.189  1.366   9.328   1.00 0.00 ? 36 LEU S HD23 4  
ATOM 3740  N N    . LYS A 1 28 ? 0.838   2.364   7.558   1.00 0.00 ? 37 LYS S N    4  
ATOM 3741  C CA   . LYS A 1 28 ? 1.081   1.310   6.580   1.00 0.00 ? 37 LYS S CA   4  
ATOM 3742  C C    . LYS A 1 28 ? 0.233   1.551   5.334   1.00 0.00 ? 37 LYS S C    4  
ATOM 3743  O O    . LYS A 1 28 ? -0.947  1.204   5.295   1.00 0.00 ? 37 LYS S O    4  
ATOM 3744  C CB   . LYS A 1 28 ? 0.784   -0.069  7.179   1.00 0.00 ? 37 LYS S CB   4  
ATOM 3745  C CG   . LYS A 1 28 ? -0.678  -0.286  7.536   1.00 0.00 ? 37 LYS S CG   4  
ATOM 3746  C CD   . LYS A 1 28 ? -0.828  -1.110  8.805   1.00 0.00 ? 37 LYS S CD   4  
ATOM 3747  C CE   . LYS A 1 28 ? -2.209  -1.739  8.899   1.00 0.00 ? 37 LYS S CE   4  
ATOM 3748  N NZ   . LYS A 1 28 ? -2.533  -2.164  10.289  1.00 0.00 ? 37 LYS S NZ   4  
ATOM 3749  H H    . LYS A 1 28 ? 0.025   2.902   7.478   1.00 0.00 ? 37 LYS S H    4  
ATOM 3750  H HA   . LYS A 1 28 ? 2.122   1.354   6.303   1.00 0.00 ? 37 LYS S HA   4  
ATOM 3751  H HB2  . LYS A 1 28 ? 1.073   -0.829  6.465   1.00 0.00 ? 37 LYS S HB2  4  
ATOM 3752  H HB3  . LYS A 1 28 ? 1.373   -0.191  8.078   1.00 0.00 ? 37 LYS S HB3  4  
ATOM 3753  H HG2  . LYS A 1 28 ? -1.150  0.671   7.681   1.00 0.00 ? 37 LYS S HG2  4  
ATOM 3754  H HG3  . LYS A 1 28 ? -1.159  -0.807  6.724   1.00 0.00 ? 37 LYS S HG3  4  
ATOM 3755  H HD2  . LYS A 1 28 ? -0.085  -1.894  8.805   1.00 0.00 ? 37 LYS S HD2  4  
ATOM 3756  H HD3  . LYS A 1 28 ? -0.675  -0.470  9.661   1.00 0.00 ? 37 LYS S HD3  4  
ATOM 3757  H HE2  . LYS A 1 28 ? -2.941  -1.019  8.572   1.00 0.00 ? 37 LYS S HE2  4  
ATOM 3758  H HE3  . LYS A 1 28 ? -2.240  -2.604  8.250   1.00 0.00 ? 37 LYS S HE3  4  
ATOM 3759  H HZ1  . LYS A 1 28 ? -3.092  -3.040  10.273  1.00 0.00 ? 37 LYS S HZ1  4  
ATOM 3760  H HZ2  . LYS A 1 28 ? -3.084  -1.423  10.769  1.00 0.00 ? 37 LYS S HZ2  4  
ATOM 3761  H HZ3  . LYS A 1 28 ? -1.658  -2.334  10.824  1.00 0.00 ? 37 LYS S HZ3  4  
ATOM 3762  N N    . LEU A 1 29 ? 0.835   2.182   4.329   1.00 0.00 ? 38 LEU S N    4  
ATOM 3763  C CA   . LEU A 1 29 ? 0.125   2.504   3.096   1.00 0.00 ? 38 LEU S CA   4  
ATOM 3764  C C    . LEU A 1 29 ? 0.021   1.308   2.156   1.00 0.00 ? 38 LEU S C    4  
ATOM 3765  O O    . LEU A 1 29 ? -1.070  0.962   1.705   1.00 0.00 ? 38 LEU S O    4  
ATOM 3766  C CB   . LEU A 1 29 ? 0.800   3.676   2.380   1.00 0.00 ? 38 LEU S CB   4  
ATOM 3767  C CG   . LEU A 1 29 ? 0.970   4.952   3.215   1.00 0.00 ? 38 LEU S CG   4  
ATOM 3768  C CD1  . LEU A 1 29 ? 1.079   6.167   2.308   1.00 0.00 ? 38 LEU S CD1  4  
ATOM 3769  C CD2  . LEU A 1 29 ? -0.185  5.126   4.192   1.00 0.00 ? 38 LEU S CD2  4  
ATOM 3770  H H    . LEU A 1 29 ? 1.771   2.455   4.426   1.00 0.00 ? 38 LEU S H    4  
ATOM 3771  H HA   . LEU A 1 29 ? -0.867  2.801   3.376   1.00 0.00 ? 38 LEU S HA   4  
ATOM 3772  H HB2  . LEU A 1 29 ? 1.780   3.353   2.055   1.00 0.00 ? 38 LEU S HB2  4  
ATOM 3773  H HB3  . LEU A 1 29 ? 0.212   3.922   1.507   1.00 0.00 ? 38 LEU S HB3  4  
ATOM 3774  H HG   . LEU A 1 29 ? 1.884   4.879   3.787   1.00 0.00 ? 38 LEU S HG   4  
ATOM 3775  H HD11 . LEU A 1 29 ? 1.739   6.893   2.756   1.00 0.00 ? 38 LEU S HD11 4  
ATOM 3776  H HD12 . LEU A 1 29 ? 0.100   6.604   2.174   1.00 0.00 ? 38 LEU S HD12 4  
ATOM 3777  H HD13 . LEU A 1 29 ? 1.470   5.865   1.348   1.00 0.00 ? 38 LEU S HD13 4  
ATOM 3778  H HD21 . LEU A 1 29 ? -1.077  4.686   3.777   1.00 0.00 ? 38 LEU S HD21 4  
ATOM 3779  H HD22 . LEU A 1 29 ? -0.352  6.179   4.367   1.00 0.00 ? 38 LEU S HD22 4  
ATOM 3780  H HD23 . LEU A 1 29 ? 0.056   4.640   5.125   1.00 0.00 ? 38 LEU S HD23 4  
ATOM 3781  N N    . GLU A 1 30 ? 1.162   0.692   1.854   1.00 0.00 ? 39 GLU S N    4  
ATOM 3782  C CA   . GLU A 1 30 ? 1.211   -0.466  0.951   1.00 0.00 ? 39 GLU S CA   4  
ATOM 3783  C C    . GLU A 1 30 ? 0.006   -1.400  1.118   1.00 0.00 ? 39 GLU S C    4  
ATOM 3784  O O    . GLU A 1 30 ? -0.390  -2.086  0.178   1.00 0.00 ? 39 GLU S O    4  
ATOM 3785  C CB   . GLU A 1 30 ? 2.497   -1.259  1.187   1.00 0.00 ? 39 GLU S CB   4  
ATOM 3786  C CG   . GLU A 1 30 ? 2.579   -1.889  2.568   1.00 0.00 ? 39 GLU S CG   4  
ATOM 3787  C CD   . GLU A 1 30 ? 2.750   -0.861  3.669   1.00 0.00 ? 39 GLU S CD   4  
ATOM 3788  O OE1  . GLU A 1 30 ? 3.895   -0.416  3.896   1.00 0.00 ? 39 GLU S OE1  4  
ATOM 3789  O OE2  . GLU A 1 30 ? 1.738   -0.499  4.306   1.00 0.00 ? 39 GLU S OE2  4  
ATOM 3790  H H    . GLU A 1 30 ? 2.001   1.032   2.235   1.00 0.00 ? 39 GLU S H    4  
ATOM 3791  H HA   . GLU A 1 30 ? 1.218   -0.092  -0.060  1.00 0.00 ? 39 GLU S HA   4  
ATOM 3792  H HB2  . GLU A 1 30 ? 2.559   -2.048  0.451   1.00 0.00 ? 39 GLU S HB2  4  
ATOM 3793  H HB3  . GLU A 1 30 ? 3.341   -0.597  1.066   1.00 0.00 ? 39 GLU S HB3  4  
ATOM 3794  H HG2  . GLU A 1 30 ? 1.671   -2.442  2.752   1.00 0.00 ? 39 GLU S HG2  4  
ATOM 3795  H HG3  . GLU A 1 30 ? 3.423   -2.563  2.593   1.00 0.00 ? 39 GLU S HG3  4  
ATOM 3796  N N    . ILE A 1 31 ? -0.552  -1.441  2.321   1.00 0.00 ? 40 ILE S N    4  
ATOM 3797  C CA   . ILE A 1 31 ? -1.688  -2.312  2.611   1.00 0.00 ? 40 ILE S CA   4  
ATOM 3798  C C    . ILE A 1 31 ? -2.906  -2.040  1.721   1.00 0.00 ? 40 ILE S C    4  
ATOM 3799  O O    . ILE A 1 31 ? -3.716  -2.940  1.501   1.00 0.00 ? 40 ILE S O    4  
ATOM 3800  C CB   . ILE A 1 31 ? -2.114  -2.194  4.086   1.00 0.00 ? 40 ILE S CB   4  
ATOM 3801  C CG1  . ILE A 1 31 ? -2.626  -0.785  4.384   1.00 0.00 ? 40 ILE S CG1  4  
ATOM 3802  C CG2  . ILE A 1 31 ? -0.955  -2.552  5.002   1.00 0.00 ? 40 ILE S CG2  4  
ATOM 3803  C CD1  . ILE A 1 31 ? -4.107  -0.618  4.146   1.00 0.00 ? 40 ILE S CD1  4  
ATOM 3804  H H    . ILE A 1 31 ? -0.181  -0.890  3.040   1.00 0.00 ? 40 ILE S H    4  
ATOM 3805  H HA   . ILE A 1 31 ? -1.365  -3.329  2.444   1.00 0.00 ? 40 ILE S HA   4  
ATOM 3806  H HB   . ILE A 1 31 ? -2.910  -2.903  4.263   1.00 0.00 ? 40 ILE S HB   4  
ATOM 3807  H HG12 . ILE A 1 31 ? -2.430  -0.548  5.418   1.00 0.00 ? 40 ILE S HG12 4  
ATOM 3808  H HG13 . ILE A 1 31 ? -2.105  -0.079  3.753   1.00 0.00 ? 40 ILE S HG13 4  
ATOM 3809  H HG21 . ILE A 1 31 ? -0.396  -3.371  4.575   1.00 0.00 ? 40 ILE S HG21 4  
ATOM 3810  H HG22 . ILE A 1 31 ? -1.335  -2.840  5.970   1.00 0.00 ? 40 ILE S HG22 4  
ATOM 3811  H HG23 . ILE A 1 31 ? -0.306  -1.694  5.112   1.00 0.00 ? 40 ILE S HG23 4  
ATOM 3812  H HD11 . ILE A 1 31 ? -4.607  -1.560  4.316   1.00 0.00 ? 40 ILE S HD11 4  
ATOM 3813  H HD12 . ILE A 1 31 ? -4.273  -0.300  3.128   1.00 0.00 ? 40 ILE S HD12 4  
ATOM 3814  H HD13 . ILE A 1 31 ? -4.500  0.125   4.823   1.00 0.00 ? 40 ILE S HD13 4  
ATOM 3815  N N    . TYR A 1 32 ? -3.062  -0.811  1.223   1.00 0.00 ? 41 TYR S N    4  
ATOM 3816  C CA   . TYR A 1 32 ? -4.224  -0.495  0.385   1.00 0.00 ? 41 TYR S CA   4  
ATOM 3817  C C    . TYR A 1 32 ? -3.876  -0.341  -1.090  1.00 0.00 ? 41 TYR S C    4  
ATOM 3818  O O    . TYR A 1 32 ? -4.508  0.443   -1.800  1.00 0.00 ? 41 TYR S O    4  
ATOM 3819  C CB   . TYR A 1 32 ? -4.952  0.762   0.881   1.00 0.00 ? 41 TYR S CB   4  
ATOM 3820  C CG   . TYR A 1 32 ? -4.077  1.972   1.115   1.00 0.00 ? 41 TYR S CG   4  
ATOM 3821  C CD1  . TYR A 1 32 ? -3.739  2.826   0.073   1.00 0.00 ? 41 TYR S CD1  4  
ATOM 3822  C CD2  . TYR A 1 32 ? -3.623  2.283   2.388   1.00 0.00 ? 41 TYR S CD2  4  
ATOM 3823  C CE1  . TYR A 1 32 ? -2.965  3.948   0.298   1.00 0.00 ? 41 TYR S CE1  4  
ATOM 3824  C CE2  . TYR A 1 32 ? -2.857  3.403   2.617   1.00 0.00 ? 41 TYR S CE2  4  
ATOM 3825  C CZ   . TYR A 1 32 ? -2.528  4.232   1.571   1.00 0.00 ? 41 TYR S CZ   4  
ATOM 3826  O OH   . TYR A 1 32 ? -1.763  5.354   1.797   1.00 0.00 ? 41 TYR S OH   4  
ATOM 3827  H H    . TYR A 1 32 ? -2.405  -0.111  1.431   1.00 0.00 ? 41 TYR S H    4  
ATOM 3828  H HA   . TYR A 1 32 ? -4.907  -1.326  0.473   1.00 0.00 ? 41 TYR S HA   4  
ATOM 3829  H HB2  . TYR A 1 32 ? -5.698  1.041   0.151   1.00 0.00 ? 41 TYR S HB2  4  
ATOM 3830  H HB3  . TYR A 1 32 ? -5.444  0.532   1.810   1.00 0.00 ? 41 TYR S HB3  4  
ATOM 3831  H HD1  . TYR A 1 32 ? -4.083  2.601   -0.925  1.00 0.00 ? 41 TYR S HD1  4  
ATOM 3832  H HD2  . TYR A 1 32 ? -3.874  1.634   3.209   1.00 0.00 ? 41 TYR S HD2  4  
ATOM 3833  H HE1  . TYR A 1 32 ? -2.712  4.602   -0.516  1.00 0.00 ? 41 TYR S HE1  4  
ATOM 3834  H HE2  . TYR A 1 32 ? -2.520  3.625   3.615   1.00 0.00 ? 41 TYR S HE2  4  
ATOM 3835  H HH   . TYR A 1 32 ? -2.254  6.136   1.535   1.00 0.00 ? 41 TYR S HH   4  
ATOM 3836  N N    . LEU A 1 33 ? -2.895  -1.101  -1.568  1.00 0.00 ? 42 LEU S N    4  
ATOM 3837  C CA   . LEU A 1 33 ? -2.522  -1.039  -2.977  1.00 0.00 ? 42 LEU S CA   4  
ATOM 3838  C C    . LEU A 1 33 ? -2.250  -2.428  -3.533  1.00 0.00 ? 42 LEU S C    4  
ATOM 3839  O O    . LEU A 1 33 ? -1.308  -3.097  -3.113  1.00 0.00 ? 42 LEU S O    4  
ATOM 3840  C CB   . LEU A 1 33 ? -1.298  -0.149  -3.190  1.00 0.00 ? 42 LEU S CB   4  
ATOM 3841  C CG   . LEU A 1 33 ? -0.275  -0.144  -2.055  1.00 0.00 ? 42 LEU S CG   4  
ATOM 3842  C CD1  . LEU A 1 33 ? 0.738   -1.260  -2.253  1.00 0.00 ? 42 LEU S CD1  4  
ATOM 3843  C CD2  . LEU A 1 33 ? 0.424   1.207   -1.977  1.00 0.00 ? 42 LEU S CD2  4  
ATOM 3844  H H    . LEU A 1 33 ? -2.430  -1.728  -0.970  1.00 0.00 ? 42 LEU S H    4  
ATOM 3845  H HA   . LEU A 1 33 ? -3.356  -0.615  -3.515  1.00 0.00 ? 42 LEU S HA   4  
ATOM 3846  H HB2  . LEU A 1 33 ? -0.797  -0.481  -4.090  1.00 0.00 ? 42 LEU S HB2  4  
ATOM 3847  H HB3  . LEU A 1 33 ? -1.641  0.863   -3.345  1.00 0.00 ? 42 LEU S HB3  4  
ATOM 3848  H HG   . LEU A 1 33 ? -0.782  -0.315  -1.116  1.00 0.00 ? 42 LEU S HG   4  
ATOM 3849  H HD11 . LEU A 1 33 ? 1.647   -1.023  -1.719  1.00 0.00 ? 42 LEU S HD11 4  
ATOM 3850  H HD12 . LEU A 1 33 ? 0.957   -1.362  -3.305  1.00 0.00 ? 42 LEU S HD12 4  
ATOM 3851  H HD13 . LEU A 1 33 ? 0.332   -2.188  -1.879  1.00 0.00 ? 42 LEU S HD13 4  
ATOM 3852  H HD21 . LEU A 1 33 ? -0.132  1.935   -2.551  1.00 0.00 ? 42 LEU S HD21 4  
ATOM 3853  H HD22 . LEU A 1 33 ? 1.423   1.120   -2.376  1.00 0.00 ? 42 LEU S HD22 4  
ATOM 3854  H HD23 . LEU A 1 33 ? 0.474   1.527   -0.947  1.00 0.00 ? 42 LEU S HD23 4  
ATOM 3855  N N    . THR A 1 34 ? -3.068  -2.851  -4.492  1.00 0.00 ? 43 THR S N    4  
ATOM 3856  C CA   . THR A 1 34 ? -2.886  -4.158  -5.112  1.00 0.00 ? 43 THR S CA   4  
ATOM 3857  C C    . THR A 1 34 ? -1.509  -4.233  -5.763  1.00 0.00 ? 43 THR S C    4  
ATOM 3858  O O    . THR A 1 34 ? -0.684  -3.352  -5.563  1.00 0.00 ? 43 THR S O    4  
ATOM 3859  C CB   . THR A 1 34 ? -3.981  -4.421  -6.151  1.00 0.00 ? 43 THR S CB   4  
ATOM 3860  O OG1  . THR A 1 34 ? -3.736  -5.629  -6.848  1.00 0.00 ? 43 THR S OG1  4  
ATOM 3861  C CG2  . THR A 1 34 ? -4.111  -3.316  -7.178  1.00 0.00 ? 43 THR S CG2  4  
ATOM 3862  H H    . THR A 1 34 ? -3.799  -2.269  -4.794  1.00 0.00 ? 43 THR S H    4  
ATOM 3863  H HA   . THR A 1 34 ? -2.948  -4.906  -4.335  1.00 0.00 ? 43 THR S HA   4  
ATOM 3864  H HB   . THR A 1 34 ? -4.930  -4.513  -5.642  1.00 0.00 ? 43 THR S HB   4  
ATOM 3865  H HG1  . THR A 1 34 ? -3.905  -6.375  -6.267  1.00 0.00 ? 43 THR S HG1  4  
ATOM 3866  H HG21 . THR A 1 34 ? -5.155  -3.081  -7.322  1.00 0.00 ? 43 THR S HG21 4  
ATOM 3867  H HG22 . THR A 1 34 ? -3.684  -3.642  -8.114  1.00 0.00 ? 43 THR S HG22 4  
ATOM 3868  H HG23 . THR A 1 34 ? -3.588  -2.438  -6.829  1.00 0.00 ? 43 THR S HG23 4  
ATOM 3869  N N    . ASP A 1 35 ? -1.279  -5.285  -6.537  1.00 0.00 ? 44 ASP S N    4  
ATOM 3870  C CA   . ASP A 1 35 ? -0.012  -5.496  -7.225  1.00 0.00 ? 44 ASP S CA   4  
ATOM 3871  C C    . ASP A 1 35 ? 0.235   -4.399  -8.246  1.00 0.00 ? 44 ASP S C    4  
ATOM 3872  O O    . ASP A 1 35 ? 1.359   -3.938  -8.412  1.00 0.00 ? 44 ASP S O    4  
ATOM 3873  C CB   . ASP A 1 35 ? -0.005  -6.862  -7.913  1.00 0.00 ? 44 ASP S CB   4  
ATOM 3874  C CG   . ASP A 1 35 ? -1.250  -7.097  -8.744  1.00 0.00 ? 44 ASP S CG   4  
ATOM 3875  O OD1  . ASP A 1 35 ? -1.308  -6.588  -9.883  1.00 0.00 ? 44 ASP S OD1  4  
ATOM 3876  O OD2  . ASP A 1 35 ? -2.167  -7.790  -8.256  1.00 0.00 ? 44 ASP S OD2  4  
ATOM 3877  H H    . ASP A 1 35 ? -1.980  -5.932  -6.651  1.00 0.00 ? 44 ASP S H    4  
ATOM 3878  H HA   . ASP A 1 35 ? 0.775   -5.471  -6.486  1.00 0.00 ? 44 ASP S HA   4  
ATOM 3879  H HB2  . ASP A 1 35 ? 0.857   -6.926  -8.564  1.00 0.00 ? 44 ASP S HB2  4  
ATOM 3880  H HB3  . ASP A 1 35 ? 0.057   -7.636  -7.161  1.00 0.00 ? 44 ASP S HB3  4  
ATOM 3881  N N    . GLU A 1 36 ? -0.826  -3.975  -8.922  1.00 0.00 ? 45 GLU S N    4  
ATOM 3882  C CA   . GLU A 1 36 ? -0.710  -2.915  -9.909  1.00 0.00 ? 45 GLU S CA   4  
ATOM 3883  C C    . GLU A 1 36 ? -0.330  -1.621  -9.214  1.00 0.00 ? 45 GLU S C    4  
ATOM 3884  O O    . GLU A 1 36 ? 0.668   -0.985  -9.556  1.00 0.00 ? 45 GLU S O    4  
ATOM 3885  C CB   . GLU A 1 36 ? -2.022  -2.732  -10.659 1.00 0.00 ? 45 GLU S CB   4  
ATOM 3886  C CG   . GLU A 1 36 ? -2.549  -4.007  -11.295 1.00 0.00 ? 45 GLU S CG   4  
ATOM 3887  C CD   . GLU A 1 36 ? -3.953  -3.848  -11.844 1.00 0.00 ? 45 GLU S CD   4  
ATOM 3888  O OE1  . GLU A 1 36 ? -4.874  -3.569  -11.046 1.00 0.00 ? 45 GLU S OE1  4  
ATOM 3889  O OE2  . GLU A 1 36 ? -4.133  -4.001  -13.070 1.00 0.00 ? 45 GLU S OE2  4  
ATOM 3890  H H    . GLU A 1 36 ? -1.704  -4.373  -8.741  1.00 0.00 ? 45 GLU S H    4  
ATOM 3891  H HA   . GLU A 1 36 ? 0.069   -3.187  -10.606 1.00 0.00 ? 45 GLU S HA   4  
ATOM 3892  H HB2  . GLU A 1 36 ? -2.762  -2.364  -9.967  1.00 0.00 ? 45 GLU S HB2  4  
ATOM 3893  H HB3  . GLU A 1 36 ? -1.871  -2.000  -11.437 1.00 0.00 ? 45 GLU S HB3  4  
ATOM 3894  H HG2  . GLU A 1 36 ? -1.893  -4.289  -12.105 1.00 0.00 ? 45 GLU S HG2  4  
ATOM 3895  H HG3  . GLU A 1 36 ? -2.555  -4.790  -10.551 1.00 0.00 ? 45 GLU S HG3  4  
ATOM 3896  N N    . ASP A 1 37 ? -1.117  -1.254  -8.206  1.00 0.00 ? 46 ASP S N    4  
ATOM 3897  C CA   . ASP A 1 37 ? -0.848  -0.061  -7.433  1.00 0.00 ? 46 ASP S CA   4  
ATOM 3898  C C    . ASP A 1 37 ? 0.474   -0.243  -6.698  1.00 0.00 ? 46 ASP S C    4  
ATOM 3899  O O    . ASP A 1 37 ? 1.215   0.709   -6.470  1.00 0.00 ? 46 ASP S O    4  
ATOM 3900  C CB   . ASP A 1 37 ? -1.993  0.185   -6.450  1.00 0.00 ? 46 ASP S CB   4  
ATOM 3901  C CG   . ASP A 1 37 ? -1.804  1.451   -5.642  1.00 0.00 ? 46 ASP S CG   4  
ATOM 3902  O OD1  . ASP A 1 37 ? -0.670  1.699   -5.180  1.00 0.00 ? 46 ASP S OD1  4  
ATOM 3903  O OD2  . ASP A 1 37 ? -2.790  2.197   -5.468  1.00 0.00 ? 46 ASP S OD2  4  
ATOM 3904  H H    . ASP A 1 37 ? -1.881  -1.814  -7.961  1.00 0.00 ? 46 ASP S H    4  
ATOM 3905  H HA   . ASP A 1 37 ? -0.767  0.774   -8.112  1.00 0.00 ? 46 ASP S HA   4  
ATOM 3906  H HB2  . ASP A 1 37 ? -2.917  0.273   -7.004  1.00 0.00 ? 46 ASP S HB2  4  
ATOM 3907  H HB3  . ASP A 1 37 ? -2.062  -0.654  -5.770  1.00 0.00 ? 46 ASP S HB3  4  
ATOM 3908  N N    . PHE A 1 38 ? 0.767   -1.498  -6.364  1.00 0.00 ? 47 PHE S N    4  
ATOM 3909  C CA   . PHE A 1 38 ? 2.004   -1.858  -5.689  1.00 0.00 ? 47 PHE S CA   4  
ATOM 3910  C C    . PHE A 1 38 ? 3.174   -1.661  -6.631  1.00 0.00 ? 47 PHE S C    4  
ATOM 3911  O O    . PHE A 1 38 ? 4.203   -1.097  -6.261  1.00 0.00 ? 47 PHE S O    4  
ATOM 3912  C CB   . PHE A 1 38 ? 1.971   -3.330  -5.268  1.00 0.00 ? 47 PHE S CB   4  
ATOM 3913  C CG   . PHE A 1 38 ? 2.018   -3.557  -3.790  1.00 0.00 ? 47 PHE S CG   4  
ATOM 3914  C CD1  . PHE A 1 38 ? 3.022   -3.000  -3.021  1.00 0.00 ? 47 PHE S CD1  4  
ATOM 3915  C CD2  . PHE A 1 38 ? 1.059   -4.339  -3.171  1.00 0.00 ? 47 PHE S CD2  4  
ATOM 3916  C CE1  . PHE A 1 38 ? 3.069   -3.219  -1.659  1.00 0.00 ? 47 PHE S CE1  4  
ATOM 3917  C CE2  . PHE A 1 38 ? 1.099   -4.562  -1.812  1.00 0.00 ? 47 PHE S CE2  4  
ATOM 3918  C CZ   . PHE A 1 38 ? 2.106   -4.001  -1.053  1.00 0.00 ? 47 PHE S CZ   4  
ATOM 3919  H H    . PHE A 1 38 ? 0.137   -2.210  -6.600  1.00 0.00 ? 47 PHE S H    4  
ATOM 3920  H HA   . PHE A 1 38 ? 2.126   -1.231  -4.820  1.00 0.00 ? 47 PHE S HA   4  
ATOM 3921  H HB2  . PHE A 1 38 ? 1.067   -3.780  -5.640  1.00 0.00 ? 47 PHE S HB2  4  
ATOM 3922  H HB3  . PHE A 1 38 ? 2.817   -3.835  -5.706  1.00 0.00 ? 47 PHE S HB3  4  
ATOM 3923  H HD1  . PHE A 1 38 ? 3.774   -2.387  -3.494  1.00 0.00 ? 47 PHE S HD1  4  
ATOM 3924  H HD2  . PHE A 1 38 ? 0.272   -4.779  -3.766  1.00 0.00 ? 47 PHE S HD2  4  
ATOM 3925  H HE1  . PHE A 1 38 ? 3.858   -2.781  -1.072  1.00 0.00 ? 47 PHE S HE1  4  
ATOM 3926  H HE2  . PHE A 1 38 ? 0.344   -5.173  -1.344  1.00 0.00 ? 47 PHE S HE2  4  
ATOM 3927  H HZ   . PHE A 1 38 ? 2.141   -4.174  0.013   1.00 0.00 ? 47 PHE S HZ   4  
ATOM 3928  N N    . GLU A 1 39 ? 3.008   -2.164  -7.846  1.00 0.00 ? 48 GLU S N    4  
ATOM 3929  C CA   . GLU A 1 39 ? 4.059   -2.080  -8.852  1.00 0.00 ? 48 GLU S CA   4  
ATOM 3930  C C    . GLU A 1 39 ? 4.435   -0.633  -9.173  1.00 0.00 ? 48 GLU S C    4  
ATOM 3931  O O    . GLU A 1 39 ? 5.617   -0.301  -9.269  1.00 0.00 ? 48 GLU S O    4  
ATOM 3932  C CB   . GLU A 1 39 ? 3.625   -2.803  -10.130 1.00 0.00 ? 48 GLU S CB   4  
ATOM 3933  C CG   . GLU A 1 39 ? 3.850   -4.306  -10.083 1.00 0.00 ? 48 GLU S CG   4  
ATOM 3934  C CD   . GLU A 1 39 ? 4.202   -4.884  -11.439 1.00 0.00 ? 48 GLU S CD   4  
ATOM 3935  O OE1  . GLU A 1 39 ? 4.978   -4.240  -12.176 1.00 0.00 ? 48 GLU S OE1  4  
ATOM 3936  O OE2  . GLU A 1 39 ? 3.702   -5.980  -11.765 1.00 0.00 ? 48 GLU S OE2  4  
ATOM 3937  H H    . GLU A 1 39 ? 2.152   -2.627  -8.066  1.00 0.00 ? 48 GLU S H    4  
ATOM 3938  H HA   . GLU A 1 39 ? 4.930   -2.578  -8.453  1.00 0.00 ? 48 GLU S HA   4  
ATOM 3939  H HB2  . GLU A 1 39 ? 2.573   -2.622  -10.292 1.00 0.00 ? 48 GLU S HB2  4  
ATOM 3940  H HB3  . GLU A 1 39 ? 4.184   -2.402  -10.962 1.00 0.00 ? 48 GLU S HB3  4  
ATOM 3941  H HG2  . GLU A 1 39 ? 4.661   -4.515  -9.398  1.00 0.00 ? 48 GLU S HG2  4  
ATOM 3942  H HG3  . GLU A 1 39 ? 2.945   -4.781  -9.728  1.00 0.00 ? 48 GLU S HG3  4  
ATOM 3943  N N    . PHE A 1 40 ? 3.435   0.219   -9.359  1.00 0.00 ? 49 PHE S N    4  
ATOM 3944  C CA   . PHE A 1 40 ? 3.682   1.619   -9.697  1.00 0.00 ? 49 PHE S CA   4  
ATOM 3945  C C    . PHE A 1 40 ? 3.924   2.486   -8.461  1.00 0.00 ? 49 PHE S C    4  
ATOM 3946  O O    . PHE A 1 40 ? 4.435   3.601   -8.574  1.00 0.00 ? 49 PHE S O    4  
ATOM 3947  C CB   . PHE A 1 40 ? 2.507   2.181   -10.501 1.00 0.00 ? 49 PHE S CB   4  
ATOM 3948  C CG   . PHE A 1 40 ? 2.925   2.854   -11.778 1.00 0.00 ? 49 PHE S CG   4  
ATOM 3949  C CD1  . PHE A 1 40 ? 3.715   2.188   -12.701 1.00 0.00 ? 49 PHE S CD1  4  
ATOM 3950  C CD2  . PHE A 1 40 ? 2.527   4.152   -12.054 1.00 0.00 ? 49 PHE S CD2  4  
ATOM 3951  C CE1  . PHE A 1 40 ? 4.101   2.803   -13.876 1.00 0.00 ? 49 PHE S CE1  4  
ATOM 3952  C CE2  . PHE A 1 40 ? 2.910   4.773   -13.228 1.00 0.00 ? 49 PHE S CE2  4  
ATOM 3953  C CZ   . PHE A 1 40 ? 3.699   4.097   -14.139 1.00 0.00 ? 49 PHE S CZ   4  
ATOM 3954  H H    . PHE A 1 40 ? 2.511   -0.101  -9.287  1.00 0.00 ? 49 PHE S H    4  
ATOM 3955  H HA   . PHE A 1 40 ? 4.567   1.652   -10.315 1.00 0.00 ? 49 PHE S HA   4  
ATOM 3956  H HB2  . PHE A 1 40 ? 1.836   1.372   -10.757 1.00 0.00 ? 49 PHE S HB2  4  
ATOM 3957  H HB3  . PHE A 1 40 ? 1.979   2.907   -9.899  1.00 0.00 ? 49 PHE S HB3  4  
ATOM 3958  H HD1  . PHE A 1 40 ? 4.030   1.174   -12.496 1.00 0.00 ? 49 PHE S HD1  4  
ATOM 3959  H HD2  . PHE A 1 40 ? 1.912   4.680   -11.342 1.00 0.00 ? 49 PHE S HD2  4  
ATOM 3960  H HE1  . PHE A 1 40 ? 4.717   2.273   -14.587 1.00 0.00 ? 49 PHE S HE1  4  
ATOM 3961  H HE2  . PHE A 1 40 ? 2.594   5.786   -13.432 1.00 0.00 ? 49 PHE S HE2  4  
ATOM 3962  H HZ   . PHE A 1 40 ? 3.999   4.582   -15.058 1.00 0.00 ? 49 PHE S HZ   4  
ATOM 3963  N N    . ALA A 1 41 ? 3.547   1.993   -7.285  1.00 0.00 ? 50 ALA S N    4  
ATOM 3964  C CA   . ALA A 1 41 ? 3.724   2.759   -6.056  1.00 0.00 ? 50 ALA S CA   4  
ATOM 3965  C C    . ALA A 1 41 ? 4.953   2.318   -5.266  1.00 0.00 ? 50 ALA S C    4  
ATOM 3966  O O    . ALA A 1 41 ? 5.709   3.150   -4.767  1.00 0.00 ? 50 ALA S O    4  
ATOM 3967  C CB   . ALA A 1 41 ? 2.480   2.659   -5.188  1.00 0.00 ? 50 ALA S CB   4  
ATOM 3968  H H    . ALA A 1 41 ? 3.132   1.105   -7.245  1.00 0.00 ? 50 ALA S H    4  
ATOM 3969  H HA   . ALA A 1 41 ? 3.849   3.796   -6.332  1.00 0.00 ? 50 ALA S HA   4  
ATOM 3970  H HB1  . ALA A 1 41 ? 2.517   3.415   -4.420  1.00 0.00 ? 50 ALA S HB1  4  
ATOM 3971  H HB2  . ALA A 1 41 ? 2.438   1.682   -4.731  1.00 0.00 ? 50 ALA S HB2  4  
ATOM 3972  H HB3  . ALA A 1 41 ? 1.601   2.810   -5.798  1.00 0.00 ? 50 ALA S HB3  4  
ATOM 3973  N N    . LEU A 1 42 ? 5.138   1.009   -5.130  1.00 0.00 ? 51 LEU S N    4  
ATOM 3974  C CA   . LEU A 1 42 ? 6.269   0.479   -4.373  1.00 0.00 ? 51 LEU S CA   4  
ATOM 3975  C C    . LEU A 1 42 ? 7.137   -0.459  -5.210  1.00 0.00 ? 51 LEU S C    4  
ATOM 3976  O O    . LEU A 1 42 ? 8.185   -0.913  -4.752  1.00 0.00 ? 51 LEU S O    4  
ATOM 3977  C CB   . LEU A 1 42 ? 5.761   -0.261  -3.135  1.00 0.00 ? 51 LEU S CB   4  
ATOM 3978  C CG   . LEU A 1 42 ? 5.615   0.601   -1.883  1.00 0.00 ? 51 LEU S CG   4  
ATOM 3979  C CD1  . LEU A 1 42 ? 4.471   0.098   -1.017  1.00 0.00 ? 51 LEU S CD1  4  
ATOM 3980  C CD2  . LEU A 1 42 ? 6.916   0.613   -1.097  1.00 0.00 ? 51 LEU S CD2  4  
ATOM 3981  H H    . LEU A 1 42 ? 4.495   0.389   -5.533  1.00 0.00 ? 51 LEU S H    4  
ATOM 3982  H HA   . LEU A 1 42 ? 6.871   1.314   -4.054  1.00 0.00 ? 51 LEU S HA   4  
ATOM 3983  H HB2  . LEU A 1 42 ? 4.797   -0.688  -3.368  1.00 0.00 ? 51 LEU S HB2  4  
ATOM 3984  H HB3  . LEU A 1 42 ? 6.449   -1.063  -2.914  1.00 0.00 ? 51 LEU S HB3  4  
ATOM 3985  H HG   . LEU A 1 42 ? 5.392   1.616   -2.174  1.00 0.00 ? 51 LEU S HG   4  
ATOM 3986  H HD11 . LEU A 1 42 ? 3.802   -0.502  -1.617  1.00 0.00 ? 51 LEU S HD11 4  
ATOM 3987  H HD12 . LEU A 1 42 ? 3.929   0.939   -0.609  1.00 0.00 ? 51 LEU S HD12 4  
ATOM 3988  H HD13 . LEU A 1 42 ? 4.866   -0.500  -0.210  1.00 0.00 ? 51 LEU S HD13 4  
ATOM 3989  H HD21 . LEU A 1 42 ? 6.821   -0.030  -0.236  1.00 0.00 ? 51 LEU S HD21 4  
ATOM 3990  H HD22 . LEU A 1 42 ? 7.129   1.617   -0.776  1.00 0.00 ? 51 LEU S HD22 4  
ATOM 3991  H HD23 . LEU A 1 42 ? 7.717   0.256   -1.724  1.00 0.00 ? 51 LEU S HD23 4  
ATOM 3992  N N    . ASP A 1 43 ? 6.700   -0.758  -6.428  1.00 0.00 ? 52 ASP S N    4  
ATOM 3993  C CA   . ASP A 1 43 ? 7.446   -1.652  -7.303  1.00 0.00 ? 52 ASP S CA   4  
ATOM 3994  C C    . ASP A 1 43 ? 7.549   -3.056  -6.704  1.00 0.00 ? 52 ASP S C    4  
ATOM 3995  O O    . ASP A 1 43 ? 8.335   -3.879  -7.173  1.00 0.00 ? 52 ASP S O    4  
ATOM 3996  C CB   . ASP A 1 43 ? 8.846   -1.094  -7.566  1.00 0.00 ? 52 ASP S CB   4  
ATOM 3997  C CG   . ASP A 1 43 ? 8.808   0.291   -8.182  1.00 0.00 ? 52 ASP S CG   4  
ATOM 3998  O OD1  . ASP A 1 43 ? 8.391   1.240   -7.486  1.00 0.00 ? 52 ASP S OD1  4  
ATOM 3999  O OD2  . ASP A 1 43 ? 9.197   0.427   -9.362  1.00 0.00 ? 52 ASP S OD2  4  
ATOM 4000  H H    . ASP A 1 43 ? 5.854   -0.377  -6.745  1.00 0.00 ? 52 ASP S H    4  
ATOM 4001  H HA   . ASP A 1 43 ? 6.915   -1.716  -8.240  1.00 0.00 ? 52 ASP S HA   4  
ATOM 4002  H HB2  . ASP A 1 43 ? 9.386   -1.036  -6.631  1.00 0.00 ? 52 ASP S HB2  4  
ATOM 4003  H HB3  . ASP A 1 43 ? 9.370   -1.756  -8.242  1.00 0.00 ? 52 ASP S HB3  4  
ATOM 4004  N N    . MET A 1 44 ? 6.746   -3.333  -5.674  1.00 0.00 ? 53 MET S N    4  
ATOM 4005  C CA   . MET A 1 44 ? 6.758   -4.651  -5.040  1.00 0.00 ? 53 MET S CA   4  
ATOM 4006  C C    . MET A 1 44 ? 5.369   -5.280  -5.088  1.00 0.00 ? 53 MET S C    4  
ATOM 4007  O O    . MET A 1 44 ? 4.522   -4.853  -5.869  1.00 0.00 ? 53 MET S O    4  
ATOM 4008  C CB   . MET A 1 44 ? 7.250   -4.556  -3.596  1.00 0.00 ? 53 MET S CB   4  
ATOM 4009  C CG   . MET A 1 44 ? 8.172   -5.699  -3.204  1.00 0.00 ? 53 MET S CG   4  
ATOM 4010  S SD   . MET A 1 44 ? 9.916   -5.238  -3.269  1.00 0.00 ? 53 MET S SD   4  
ATOM 4011  C CE   . MET A 1 44 ? 10.568  -6.532  -4.323  1.00 0.00 ? 53 MET S CE   4  
ATOM 4012  H H    . MET A 1 44 ? 6.129   -2.642  -5.340  1.00 0.00 ? 53 MET S H    4  
ATOM 4013  H HA   . MET A 1 44 ? 7.436   -5.278  -5.599  1.00 0.00 ? 53 MET S HA   4  
ATOM 4014  H HB2  . MET A 1 44 ? 7.786   -3.625  -3.469  1.00 0.00 ? 53 MET S HB2  4  
ATOM 4015  H HB3  . MET A 1 44 ? 6.395   -4.567  -2.932  1.00 0.00 ? 53 MET S HB3  4  
ATOM 4016  H HG2  . MET A 1 44 ? 7.934   -6.011  -2.200  1.00 0.00 ? 53 MET S HG2  4  
ATOM 4017  H HG3  . MET A 1 44 ? 8.008   -6.522  -3.882  1.00 0.00 ? 53 MET S HG3  4  
ATOM 4018  H HE1  . MET A 1 44 ? 9.804   -6.849  -5.017  1.00 0.00 ? 53 MET S HE1  4  
ATOM 4019  H HE2  . MET A 1 44 ? 10.873  -7.370  -3.715  1.00 0.00 ? 53 MET S HE2  4  
ATOM 4020  H HE3  . MET A 1 44 ? 11.419  -6.156  -4.870  1.00 0.00 ? 53 MET S HE3  4  
ATOM 4021  N N    . THR A 1 45 ? 5.130   -6.297  -4.260  1.00 0.00 ? 54 THR S N    4  
ATOM 4022  C CA   . THR A 1 45 ? 3.832   -6.958  -4.236  1.00 0.00 ? 54 THR S CA   4  
ATOM 4023  C C    . THR A 1 45 ? 3.346   -7.143  -2.804  1.00 0.00 ? 54 THR S C    4  
ATOM 4024  O O    . THR A 1 45 ? 4.143   -7.140  -1.865  1.00 0.00 ? 54 THR S O    4  
ATOM 4025  C CB   . THR A 1 45 ? 3.898   -8.314  -4.947  1.00 0.00 ? 54 THR S CB   4  
ATOM 4026  O OG1  . THR A 1 45 ? 4.316   -9.333  -4.055  1.00 0.00 ? 54 THR S OG1  4  
ATOM 4027  C CG2  . THR A 1 45 ? 4.838   -8.330  -6.135  1.00 0.00 ? 54 THR S CG2  4  
ATOM 4028  H H    . THR A 1 45 ? 5.836   -6.607  -3.648  1.00 0.00 ? 54 THR S H    4  
ATOM 4029  H HA   . THR A 1 45 ? 3.131   -6.324  -4.760  1.00 0.00 ? 54 THR S HA   4  
ATOM 4030  H HB   . THR A 1 45 ? 2.911   -8.566  -5.307  1.00 0.00 ? 54 THR S HB   4  
ATOM 4031  H HG1  . THR A 1 45 ? 3.597   -9.954  -3.918  1.00 0.00 ? 54 THR S HG1  4  
ATOM 4032  H HG21 . THR A 1 45 ? 5.790   -7.910  -5.844  1.00 0.00 ? 54 THR S HG21 4  
ATOM 4033  H HG22 . THR A 1 45 ? 4.415   -7.742  -6.936  1.00 0.00 ? 54 THR S HG22 4  
ATOM 4034  H HG23 . THR A 1 45 ? 4.980   -9.346  -6.468  1.00 0.00 ? 54 THR S HG23 4  
ATOM 4035  N N    . ARG A 1 46 ? 2.043   -7.327  -2.642  1.00 0.00 ? 55 ARG S N    4  
ATOM 4036  C CA   . ARG A 1 46 ? 1.471   -7.539  -1.321  1.00 0.00 ? 55 ARG S CA   4  
ATOM 4037  C C    . ARG A 1 46 ? 2.013   -8.832  -0.723  1.00 0.00 ? 55 ARG S C    4  
ATOM 4038  O O    . ARG A 1 46 ? 2.170   -8.953  0.490   1.00 0.00 ? 55 ARG S O    4  
ATOM 4039  C CB   . ARG A 1 46 ? -0.056  -7.601  -1.402  1.00 0.00 ? 55 ARG S CB   4  
ATOM 4040  C CG   . ARG A 1 46 ? -0.745  -7.348  -0.071  1.00 0.00 ? 55 ARG S CG   4  
ATOM 4041  C CD   . ARG A 1 46 ? -2.257  -7.314  -0.226  1.00 0.00 ? 55 ARG S CD   4  
ATOM 4042  N NE   . ARG A 1 46 ? -2.730  -6.026  -0.725  1.00 0.00 ? 55 ARG S NE   4  
ATOM 4043  C CZ   . ARG A 1 46 ? -3.926  -5.837  -1.278  1.00 0.00 ? 55 ARG S CZ   4  
ATOM 4044  N NH1  . ARG A 1 46 ? -4.774  -6.851  -1.401  1.00 0.00 ? 55 ARG S NH1  4  
ATOM 4045  N NH2  . ARG A 1 46 ? -4.276  -4.633  -1.705  1.00 0.00 ? 55 ARG S NH2  4  
ATOM 4046  H H    . ARG A 1 46 ? 1.457   -7.337  -3.427  1.00 0.00 ? 55 ARG S H    4  
ATOM 4047  H HA   . ARG A 1 46 ? 1.762   -6.711  -0.692  1.00 0.00 ? 55 ARG S HA   4  
ATOM 4048  H HB2  . ARG A 1 46 ? -0.398  -6.857  -2.108  1.00 0.00 ? 55 ARG S HB2  4  
ATOM 4049  H HB3  . ARG A 1 46 ? -0.347  -8.581  -1.753  1.00 0.00 ? 55 ARG S HB3  4  
ATOM 4050  H HG2  . ARG A 1 46 ? -0.481  -8.137  0.616   1.00 0.00 ? 55 ARG S HG2  4  
ATOM 4051  H HG3  . ARG A 1 46 ? -0.411  -6.399  0.322   1.00 0.00 ? 55 ARG S HG3  4  
ATOM 4052  H HD2  . ARG A 1 46 ? -2.553  -8.088  -0.918  1.00 0.00 ? 55 ARG S HD2  4  
ATOM 4053  H HD3  . ARG A 1 46 ? -2.709  -7.503  0.738   1.00 0.00 ? 55 ARG S HD3  4  
ATOM 4054  H HE   . ARG A 1 46 ? -2.123  -5.260  -0.646  1.00 0.00 ? 55 ARG S HE   4  
ATOM 4055  H HH11 . ARG A 1 46 ? -4.517  -7.762  -1.080  1.00 0.00 ? 55 ARG S HH11 4  
ATOM 4056  H HH12 . ARG A 1 46 ? -5.671  -6.703  -1.816  1.00 0.00 ? 55 ARG S HH12 4  
ATOM 4057  H HH21 . ARG A 1 46 ? -3.641  -3.865  -1.614  1.00 0.00 ? 55 ARG S HH21 4  
ATOM 4058  H HH22 . ARG A 1 46 ? -5.175  -4.491  -2.122  1.00 0.00 ? 55 ARG S HH22 4  
ATOM 4059  N N    . ASP A 1 47 ? 2.301   -9.792  -1.597  1.00 0.00 ? 56 ASP S N    4  
ATOM 4060  C CA   . ASP A 1 47 ? 2.830   -11.088 -1.187  1.00 0.00 ? 56 ASP S CA   4  
ATOM 4061  C C    . ASP A 1 47 ? 4.360   -11.077 -1.118  1.00 0.00 ? 56 ASP S C    4  
ATOM 4062  O O    . ASP A 1 47 ? 4.969   -12.029 -0.632  1.00 0.00 ? 56 ASP S O    4  
ATOM 4063  C CB   . ASP A 1 47 ? 2.365   -12.179 -2.153  1.00 0.00 ? 56 ASP S CB   4  
ATOM 4064  C CG   . ASP A 1 47 ? 0.967   -12.672 -1.838  1.00 0.00 ? 56 ASP S CG   4  
ATOM 4065  O OD1  . ASP A 1 47 ? 0.144   -11.860 -1.365  1.00 0.00 ? 56 ASP S OD1  4  
ATOM 4066  O OD2  . ASP A 1 47 ? 0.694   -13.869 -2.065  1.00 0.00 ? 56 ASP S OD2  4  
ATOM 4067  H H    . ASP A 1 47 ? 2.155   -9.624  -2.550  1.00 0.00 ? 56 ASP S H    4  
ATOM 4068  H HA   . ASP A 1 47 ? 2.443   -11.307 -0.204  1.00 0.00 ? 56 ASP S HA   4  
ATOM 4069  H HB2  . ASP A 1 47 ? 2.371   -11.787 -3.159  1.00 0.00 ? 56 ASP S HB2  4  
ATOM 4070  H HB3  . ASP A 1 47 ? 3.045   -13.016 -2.094  1.00 0.00 ? 56 ASP S HB3  4  
ATOM 4071  N N    . GLU A 1 48 ? 4.976   -9.997  -1.595  1.00 0.00 ? 57 GLU S N    4  
ATOM 4072  C CA   . GLU A 1 48 ? 6.428   -9.879  -1.573  1.00 0.00 ? 57 GLU S CA   4  
ATOM 4073  C C    . GLU A 1 48 ? 6.841   -9.175  -0.303  1.00 0.00 ? 57 GLU S C    4  
ATOM 4074  O O    . GLU A 1 48 ? 7.574   -9.716  0.525   1.00 0.00 ? 57 GLU S O    4  
ATOM 4075  C CB   . GLU A 1 48 ? 6.916   -9.088  -2.785  1.00 0.00 ? 57 GLU S CB   4  
ATOM 4076  C CG   . GLU A 1 48 ? 8.425   -9.123  -2.968  1.00 0.00 ? 57 GLU S CG   4  
ATOM 4077  C CD   . GLU A 1 48 ? 8.832   -9.431  -4.396  1.00 0.00 ? 57 GLU S CD   4  
ATOM 4078  O OE1  . GLU A 1 48 ? 8.480   -8.642  -5.298  1.00 0.00 ? 57 GLU S OE1  4  
ATOM 4079  O OE2  . GLU A 1 48 ? 9.501   -10.463 -4.613  1.00 0.00 ? 57 GLU S OE2  4  
ATOM 4080  H H    . GLU A 1 48 ? 4.446   -9.253  -1.955  1.00 0.00 ? 57 GLU S H    4  
ATOM 4081  H HA   . GLU A 1 48 ? 6.854   -10.871 -1.590  1.00 0.00 ? 57 GLU S HA   4  
ATOM 4082  H HB2  . GLU A 1 48 ? 6.457   -9.496  -3.673  1.00 0.00 ? 57 GLU S HB2  4  
ATOM 4083  H HB3  . GLU A 1 48 ? 6.611   -8.055  -2.670  1.00 0.00 ? 57 GLU S HB3  4  
ATOM 4084  H HG2  . GLU A 1 48 ? 8.830   -8.161  -2.695  1.00 0.00 ? 57 GLU S HG2  4  
ATOM 4085  H HG3  . GLU A 1 48 ? 8.836   -9.883  -2.320  1.00 0.00 ? 57 GLU S HG3  4  
ATOM 4086  N N    . TYR A 1 49 ? 6.324   -7.971  -0.152  1.00 0.00 ? 58 TYR S N    4  
ATOM 4087  C CA   . TYR A 1 49 ? 6.578   -7.168  1.020   1.00 0.00 ? 58 TYR S CA   4  
ATOM 4088  C C    . TYR A 1 49 ? 6.079   -7.901  2.252   1.00 0.00 ? 58 TYR S C    4  
ATOM 4089  O O    . TYR A 1 49 ? 6.654   -7.795  3.336   1.00 0.00 ? 58 TYR S O    4  
ATOM 4090  C CB   . TYR A 1 49 ? 5.853   -5.838  0.880   1.00 0.00 ? 58 TYR S CB   4  
ATOM 4091  C CG   . TYR A 1 49 ? 6.655   -4.736  0.217   1.00 0.00 ? 58 TYR S CG   4  
ATOM 4092  C CD1  . TYR A 1 49 ? 8.013   -4.877  -0.062  1.00 0.00 ? 58 TYR S CD1  4  
ATOM 4093  C CD2  . TYR A 1 49 ? 6.038   -3.552  -0.146  1.00 0.00 ? 58 TYR S CD2  4  
ATOM 4094  C CE1  . TYR A 1 49 ? 8.724   -3.865  -0.679  1.00 0.00 ? 58 TYR S CE1  4  
ATOM 4095  C CE2  . TYR A 1 49 ? 6.739   -2.540  -0.765  1.00 0.00 ? 58 TYR S CE2  4  
ATOM 4096  C CZ   . TYR A 1 49 ? 8.082   -2.699  -1.029  1.00 0.00 ? 58 TYR S CZ   4  
ATOM 4097  O OH   . TYR A 1 49 ? 8.783   -1.689  -1.647  1.00 0.00 ? 58 TYR S OH   4  
ATOM 4098  H H    . TYR A 1 49 ? 5.726   -7.622  -0.846  1.00 0.00 ? 58 TYR S H    4  
ATOM 4099  H HA   . TYR A 1 49 ? 7.637   -7.004  1.109   1.00 0.00 ? 58 TYR S HA   4  
ATOM 4100  H HB2  . TYR A 1 49 ? 4.965   -5.993  0.280   1.00 0.00 ? 58 TYR S HB2  4  
ATOM 4101  H HB3  . TYR A 1 49 ? 5.556   -5.501  1.854   1.00 0.00 ? 58 TYR S HB3  4  
ATOM 4102  H HD1  . TYR A 1 49 ? 8.519   -5.789  0.208   1.00 0.00 ? 58 TYR S HD1  4  
ATOM 4103  H HD2  . TYR A 1 49 ? 4.988   -3.424  0.069   1.00 0.00 ? 58 TYR S HD2  4  
ATOM 4104  H HE1  . TYR A 1 49 ? 9.776   -3.992  -0.886  1.00 0.00 ? 58 TYR S HE1  4  
ATOM 4105  H HE2  . TYR A 1 49 ? 6.234   -1.632  -1.040  1.00 0.00 ? 58 TYR S HE2  4  
ATOM 4106  H HH   . TYR A 1 49 ? 9.676   -1.656  -1.294  1.00 0.00 ? 58 TYR S HH   4  
ATOM 4107  N N    . ASN A 1 50 ? 4.998   -8.652  2.068   1.00 0.00 ? 59 ASN S N    4  
ATOM 4108  C CA   . ASN A 1 50 ? 4.405   -9.422  3.160   1.00 0.00 ? 59 ASN S CA   4  
ATOM 4109  C C    . ASN A 1 50 ? 5.458   -10.260 3.886   1.00 0.00 ? 59 ASN S C    4  
ATOM 4110  O O    . ASN A 1 50 ? 5.291   -10.605 5.056   1.00 0.00 ? 59 ASN S O    4  
ATOM 4111  C CB   . ASN A 1 50 ? 3.296   -10.335 2.632   1.00 0.00 ? 59 ASN S CB   4  
ATOM 4112  C CG   . ASN A 1 50 ? 1.912   -9.858  3.031   1.00 0.00 ? 59 ASN S CG   4  
ATOM 4113  O OD1  . ASN A 1 50 ? 1.039   -10.659 3.364   1.00 0.00 ? 59 ASN S OD1  4  
ATOM 4114  N ND2  . ASN A 1 50 ? 1.705   -8.546  3.000   1.00 0.00 ? 59 ASN S ND2  4  
ATOM 4115  H H    . ASN A 1 50 ? 4.591   -8.688  1.167   1.00 0.00 ? 59 ASN S H    4  
ATOM 4116  H HA   . ASN A 1 50 ? 3.977   -8.722  3.862   1.00 0.00 ? 59 ASN S HA   4  
ATOM 4117  H HB2  . ASN A 1 50 ? 3.348   -10.372 1.555   1.00 0.00 ? 59 ASN S HB2  4  
ATOM 4118  H HB3  . ASN A 1 50 ? 3.439   -11.331 3.027   1.00 0.00 ? 59 ASN S HB3  4  
ATOM 4119  H HD21 . ASN A 1 50 ? 2.446   -7.966  2.724   1.00 0.00 ? 59 ASN S HD21 4  
ATOM 4120  H HD22 . ASN A 1 50 ? 0.819   -8.210  3.254   1.00 0.00 ? 59 ASN S HD22 4  
ATOM 4121  N N    . ALA A 1 51 ? 6.541   -10.587 3.184   1.00 0.00 ? 60 ALA S N    4  
ATOM 4122  C CA   . ALA A 1 51 ? 7.613   -11.389 3.765   1.00 0.00 ? 60 ALA S CA   4  
ATOM 4123  C C    . ALA A 1 51 ? 8.910   -10.591 3.865   1.00 0.00 ? 60 ALA S C    4  
ATOM 4124  O O    . ALA A 1 51 ? 9.684   -10.764 4.806   1.00 0.00 ? 60 ALA S O    4  
ATOM 4125  C CB   . ALA A 1 51 ? 7.832   -12.651 2.945   1.00 0.00 ? 60 ALA S CB   4  
ATOM 4126  H H    . ALA A 1 51 ? 6.619   -10.287 2.255   1.00 0.00 ? 60 ALA S H    4  
ATOM 4127  H HA   . ALA A 1 51 ? 7.308   -11.682 4.759   1.00 0.00 ? 60 ALA S HA   4  
ATOM 4128  H HB1  . ALA A 1 51 ? 7.077   -13.380 3.199   1.00 0.00 ? 60 ALA S HB1  4  
ATOM 4129  H HB2  . ALA A 1 51 ? 8.809   -13.055 3.161   1.00 0.00 ? 60 ALA S HB2  4  
ATOM 4130  H HB3  . ALA A 1 51 ? 7.763   -12.414 1.894   1.00 0.00 ? 60 ALA S HB3  4  
ATOM 4131  N N    . LEU A 1 52 ? 9.141   -9.718  2.891   1.00 0.00 ? 61 LEU S N    4  
ATOM 4132  C CA   . LEU A 1 52 ? 10.345  -8.895  2.872   1.00 0.00 ? 61 LEU S CA   4  
ATOM 4133  C C    . LEU A 1 52 ? 10.406  -8.003  4.110   1.00 0.00 ? 61 LEU S C    4  
ATOM 4134  O O    . LEU A 1 52 ? 9.395   -7.781  4.774   1.00 0.00 ? 61 LEU S O    4  
ATOM 4135  C CB   . LEU A 1 52 ? 10.378  -8.036  1.606   1.00 0.00 ? 61 LEU S CB   4  
ATOM 4136  C CG   . LEU A 1 52 ? 11.257  -8.580  0.476   1.00 0.00 ? 61 LEU S CG   4  
ATOM 4137  C CD1  . LEU A 1 52 ? 10.498  -8.579  -0.843  1.00 0.00 ? 61 LEU S CD1  4  
ATOM 4138  C CD2  . LEU A 1 52 ? 12.536  -7.765  0.352   1.00 0.00 ? 61 LEU S CD2  4  
ATOM 4139  H H    . LEU A 1 52 ? 8.486   -9.624  2.168   1.00 0.00 ? 61 LEU S H    4  
ATOM 4140  H HA   . LEU A 1 52 ? 11.200  -9.555  2.873   1.00 0.00 ? 61 LEU S HA   4  
ATOM 4141  H HB2  . LEU A 1 52 ? 9.365   -7.944  1.234   1.00 0.00 ? 61 LEU S HB2  4  
ATOM 4142  H HB3  . LEU A 1 52 ? 10.737  -7.051  1.871   1.00 0.00 ? 61 LEU S HB3  4  
ATOM 4143  H HG   . LEU A 1 52 ? 11.531  -9.601  0.701   1.00 0.00 ? 61 LEU S HG   4  
ATOM 4144  H HD11 . LEU A 1 52 ? 9.440   -8.675  -0.648  1.00 0.00 ? 61 LEU S HD11 4  
ATOM 4145  H HD12 . LEU A 1 52 ? 10.828  -9.411  -1.448  1.00 0.00 ? 61 LEU S HD12 4  
ATOM 4146  H HD13 . LEU A 1 52 ? 10.686  -7.655  -1.367  1.00 0.00 ? 61 LEU S HD13 4  
ATOM 4147  H HD21 . LEU A 1 52 ? 12.347  -6.748  0.664   1.00 0.00 ? 61 LEU S HD21 4  
ATOM 4148  H HD22 . LEU A 1 52 ? 12.870  -7.770  -0.675  1.00 0.00 ? 61 LEU S HD22 4  
ATOM 4149  H HD23 . LEU A 1 52 ? 13.300  -8.198  0.982   1.00 0.00 ? 61 LEU S HD23 4  
ATOM 4150  N N    . PRO A 1 53 ? 11.600  -7.478  4.440   1.00 0.00 ? 62 PRO S N    4  
ATOM 4151  C CA   . PRO A 1 53 ? 11.781  -6.607  5.604   1.00 0.00 ? 62 PRO S CA   4  
ATOM 4152  C C    . PRO A 1 53 ? 10.752  -5.485  5.649   1.00 0.00 ? 62 PRO S C    4  
ATOM 4153  O O    . PRO A 1 53 ? 10.162  -5.129  4.628   1.00 0.00 ? 62 PRO S O    4  
ATOM 4154  C CB   . PRO A 1 53 ? 13.185  -6.039  5.410   1.00 0.00 ? 62 PRO S CB   4  
ATOM 4155  C CG   . PRO A 1 53 ? 13.900  -7.059  4.594   1.00 0.00 ? 62 PRO S CG   4  
ATOM 4156  C CD   . PRO A 1 53 ? 12.862  -7.689  3.703   1.00 0.00 ? 62 PRO S CD   4  
ATOM 4157  H HA   . PRO A 1 53 ? 11.740  -7.169  6.528   1.00 0.00 ? 62 PRO S HA   4  
ATOM 4158  H HB2  . PRO A 1 53 ? 13.122  -5.090  4.893   1.00 0.00 ? 62 PRO S HB2  4  
ATOM 4159  H HB3  . PRO A 1 53 ? 13.658  -5.902  6.372   1.00 0.00 ? 62 PRO S HB3  4  
ATOM 4160  H HG2  . PRO A 1 53 ? 14.664  -6.581  3.996   1.00 0.00 ? 62 PRO S HG2  4  
ATOM 4161  H HG3  . PRO A 1 53 ? 14.340  -7.805  5.241   1.00 0.00 ? 62 PRO S HG3  4  
ATOM 4162  H HD2  . PRO A 1 53 ? 12.835  -7.190  2.745   1.00 0.00 ? 62 PRO S HD2  4  
ATOM 4163  H HD3  . PRO A 1 53 ? 13.062  -8.743  3.577   1.00 0.00 ? 62 PRO S HD3  4  
ATOM 4164  N N    . ALA A 1 54 ? 10.536  -4.933  6.837   1.00 0.00 ? 63 ALA S N    4  
ATOM 4165  C CA   . ALA A 1 54 ? 9.574   -3.854  7.015   1.00 0.00 ? 63 ALA S CA   4  
ATOM 4166  C C    . ALA A 1 54 ? 10.211  -2.487  6.778   1.00 0.00 ? 63 ALA S C    4  
ATOM 4167  O O    . ALA A 1 54 ? 9.512   -1.501  6.550   1.00 0.00 ? 63 ALA S O    4  
ATOM 4168  C CB   . ALA A 1 54 ? 8.968   -3.917  8.409   1.00 0.00 ? 63 ALA S CB   4  
ATOM 4169  H H    . ALA A 1 54 ? 11.035  -5.262  7.615   1.00 0.00 ? 63 ALA S H    4  
ATOM 4170  H HA   . ALA A 1 54 ? 8.778   -3.998  6.300   1.00 0.00 ? 63 ALA S HA   4  
ATOM 4171  H HB1  . ALA A 1 54 ? 8.242   -4.716  8.451   1.00 0.00 ? 63 ALA S HB1  4  
ATOM 4172  H HB2  . ALA A 1 54 ? 8.485   -2.978  8.635   1.00 0.00 ? 63 ALA S HB2  4  
ATOM 4173  H HB3  . ALA A 1 54 ? 9.750   -4.102  9.133   1.00 0.00 ? 63 ALA S HB3  4  
ATOM 4174  N N    . TRP A 1 55 ? 11.538  -2.432  6.815   1.00 0.00 ? 64 TRP S N    4  
ATOM 4175  C CA   . TRP A 1 55 ? 12.254  -1.200  6.598   1.00 0.00 ? 64 TRP S CA   4  
ATOM 4176  C C    . TRP A 1 55 ? 12.556  -1.053  5.117   1.00 0.00 ? 64 TRP S C    4  
ATOM 4177  O O    . TRP A 1 55 ? 12.378  0.012   4.544   1.00 0.00 ? 64 TRP S O    4  
ATOM 4178  C CB   . TRP A 1 55 ? 13.550  -1.189  7.420   1.00 0.00 ? 64 TRP S CB   4  
ATOM 4179  C CG   . TRP A 1 55 ? 14.767  -1.352  6.571   1.00 0.00 ? 64 TRP S CG   4  
ATOM 4180  C CD1  . TRP A 1 55 ? 15.585  -2.438  6.500   1.00 0.00 ? 64 TRP S CD1  4  
ATOM 4181  C CD2  . TRP A 1 55 ? 15.264  -0.404  5.634   1.00 0.00 ? 64 TRP S CD2  4  
ATOM 4182  N NE1  . TRP A 1 55 ? 16.577  -2.215  5.572   1.00 0.00 ? 64 TRP S NE1  4  
ATOM 4183  C CE2  . TRP A 1 55 ? 16.397  -0.968  5.025   1.00 0.00 ? 64 TRP S CE2  4  
ATOM 4184  C CE3  . TRP A 1 55 ? 14.853  0.874   5.257   1.00 0.00 ? 64 TRP S CE3  4  
ATOM 4185  C CZ2  . TRP A 1 55 ? 17.122  -0.290  4.048   1.00 0.00 ? 64 TRP S CZ2  4  
ATOM 4186  C CZ3  . TRP A 1 55 ? 15.568  1.541   4.291   1.00 0.00 ? 64 TRP S CZ3  4  
ATOM 4187  C CH2  . TRP A 1 55 ? 16.689  0.961   3.695   1.00 0.00 ? 64 TRP S CH2  4  
ATOM 4188  H H    . TRP A 1 55 ? 12.049  -3.240  6.972   1.00 0.00 ? 64 TRP S H    4  
ATOM 4189  H HA   . TRP A 1 55 ? 11.622  -0.384  6.913   1.00 0.00 ? 64 TRP S HA   4  
ATOM 4190  H HB2  . TRP A 1 55 ? 13.631  -0.245  7.944   1.00 0.00 ? 64 TRP S HB2  4  
ATOM 4191  H HB3  . TRP A 1 55 ? 13.527  -2.001  8.136   1.00 0.00 ? 64 TRP S HB3  4  
ATOM 4192  H HD1  . TRP A 1 55 ? 15.459  -3.332  7.092   1.00 0.00 ? 64 TRP S HD1  4  
ATOM 4193  H HE1  . TRP A 1 55 ? 17.292  -2.844  5.338   1.00 0.00 ? 64 TRP S HE1  4  
ATOM 4194  H HE3  . TRP A 1 55 ? 13.988  1.338   5.707   1.00 0.00 ? 64 TRP S HE3  4  
ATOM 4195  H HZ2  . TRP A 1 55 ? 17.990  -0.724  3.576   1.00 0.00 ? 64 TRP S HZ2  4  
ATOM 4196  H HZ3  . TRP A 1 55 ? 15.261  2.528   3.982   1.00 0.00 ? 64 TRP S HZ3  4  
ATOM 4197  H HH2  . TRP A 1 55 ? 17.204  1.520   2.938   1.00 0.00 ? 64 TRP S HH2  4  
ATOM 4198  N N    . LYS A 1 56 ? 13.017  -2.145  4.503   1.00 0.00 ? 65 LYS S N    4  
ATOM 4199  C CA   . LYS A 1 56 ? 13.339  -2.138  3.085   1.00 0.00 ? 65 LYS S CA   4  
ATOM 4200  C C    . LYS A 1 56 ? 12.086  -1.827  2.291   1.00 0.00 ? 65 LYS S C    4  
ATOM 4201  O O    . LYS A 1 56 ? 12.097  -0.986  1.394   1.00 0.00 ? 65 LYS S O    4  
ATOM 4202  C CB   . LYS A 1 56 ? 13.931  -3.481  2.653   1.00 0.00 ? 65 LYS S CB   4  
ATOM 4203  C CG   . LYS A 1 56 ? 15.289  -3.349  1.980   1.00 0.00 ? 65 LYS S CG   4  
ATOM 4204  C CD   . LYS A 1 56 ? 16.279  -4.370  2.518   1.00 0.00 ? 65 LYS S CD   4  
ATOM 4205  C CE   . LYS A 1 56 ? 17.707  -4.015  2.136   1.00 0.00 ? 65 LYS S CE   4  
ATOM 4206  N NZ   . LYS A 1 56 ? 18.518  -5.226  1.832   1.00 0.00 ? 65 LYS S NZ   4  
ATOM 4207  H H    . LYS A 1 56 ? 13.135  -2.969  5.015   1.00 0.00 ? 65 LYS S H    4  
ATOM 4208  H HA   . LYS A 1 56 ? 14.064  -1.356  2.912   1.00 0.00 ? 65 LYS S HA   4  
ATOM 4209  H HB2  . LYS A 1 56 ? 14.045  -4.108  3.527   1.00 0.00 ? 65 LYS S HB2  4  
ATOM 4210  H HB3  . LYS A 1 56 ? 13.253  -3.957  1.957   1.00 0.00 ? 65 LYS S HB3  4  
ATOM 4211  H HG2  . LYS A 1 56 ? 15.170  -3.503  0.918   1.00 0.00 ? 65 LYS S HG2  4  
ATOM 4212  H HG3  . LYS A 1 56 ? 15.674  -2.354  2.163   1.00 0.00 ? 65 LYS S HG3  4  
ATOM 4213  H HD2  . LYS A 1 56 ? 16.202  -4.400  3.594   1.00 0.00 ? 65 LYS S HD2  4  
ATOM 4214  H HD3  . LYS A 1 56 ? 16.037  -5.341  2.110   1.00 0.00 ? 65 LYS S HD3  4  
ATOM 4215  H HE2  . LYS A 1 56 ? 17.686  -3.380  1.263   1.00 0.00 ? 65 LYS S HE2  4  
ATOM 4216  H HE3  . LYS A 1 56 ? 18.165  -3.482  2.958   1.00 0.00 ? 65 LYS S HE3  4  
ATOM 4217  H HZ1  . LYS A 1 56 ? 18.109  -6.057  2.305   1.00 0.00 ? 65 LYS S HZ1  4  
ATOM 4218  H HZ2  . LYS A 1 56 ? 19.495  -5.095  2.165   1.00 0.00 ? 65 LYS S HZ2  4  
ATOM 4219  H HZ3  . LYS A 1 56 ? 18.535  -5.398  0.807   1.00 0.00 ? 65 LYS S HZ3  4  
ATOM 4220  N N    . GLN A 1 57 ? 10.987  -2.484  2.659   1.00 0.00 ? 66 GLN S N    4  
ATOM 4221  C CA   . GLN A 1 57 ? 9.722   -2.233  1.999   1.00 0.00 ? 66 GLN S CA   4  
ATOM 4222  C C    . GLN A 1 57 ? 9.361   -0.772  2.207   1.00 0.00 ? 66 GLN S C    4  
ATOM 4223  O O    . GLN A 1 57 ? 8.898   -0.095  1.290   1.00 0.00 ? 66 GLN S O    4  
ATOM 4224  C CB   . GLN A 1 57 ? 8.623   -3.151  2.536   1.00 0.00 ? 66 GLN S CB   4  
ATOM 4225  C CG   . GLN A 1 57 ? 8.286   -2.921  3.999   1.00 0.00 ? 66 GLN S CG   4  
ATOM 4226  C CD   . GLN A 1 57 ? 7.131   -3.785  4.473   1.00 0.00 ? 66 GLN S CD   4  
ATOM 4227  O OE1  . GLN A 1 57 ? 6.252   -3.318  5.197   1.00 0.00 ? 66 GLN S OE1  4  
ATOM 4228  N NE2  . GLN A 1 57 ? 7.127   -5.052  4.068   1.00 0.00 ? 66 GLN S NE2  4  
ATOM 4229  H H    . GLN A 1 57 ? 11.029  -3.120  3.402   1.00 0.00 ? 66 GLN S H    4  
ATOM 4230  H HA   . GLN A 1 57 ? 9.859   -2.413  0.945   1.00 0.00 ? 66 GLN S HA   4  
ATOM 4231  H HB2  . GLN A 1 57 ? 7.727   -2.998  1.955   1.00 0.00 ? 66 GLN S HB2  4  
ATOM 4232  H HB3  . GLN A 1 57 ? 8.945   -4.176  2.421   1.00 0.00 ? 66 GLN S HB3  4  
ATOM 4233  H HG2  . GLN A 1 57 ? 9.157   -3.149  4.595   1.00 0.00 ? 66 GLN S HG2  4  
ATOM 4234  H HG3  . GLN A 1 57 ? 8.018   -1.881  4.133   1.00 0.00 ? 66 GLN S HG3  4  
ATOM 4235  H HE21 . GLN A 1 57 ? 7.858   -5.360  3.493   1.00 0.00 ? 66 GLN S HE21 4  
ATOM 4236  H HE22 . GLN A 1 57 ? 6.391   -5.629  4.363   1.00 0.00 ? 66 GLN S HE22 4  
ATOM 4237  N N    . VAL A 1 58 ? 9.633   -0.278  3.416   1.00 0.00 ? 67 VAL S N    4  
ATOM 4238  C CA   . VAL A 1 58 ? 9.392   1.116   3.731   1.00 0.00 ? 67 VAL S CA   4  
ATOM 4239  C C    . VAL A 1 58 ? 10.348  1.979   2.918   1.00 0.00 ? 67 VAL S C    4  
ATOM 4240  O O    . VAL A 1 58 ? 9.963   3.020   2.386   1.00 0.00 ? 67 VAL S O    4  
ATOM 4241  C CB   . VAL A 1 58 ? 9.571   1.405   5.241   1.00 0.00 ? 67 VAL S CB   4  
ATOM 4242  C CG1  . VAL A 1 58 ? 9.758   2.896   5.498   1.00 0.00 ? 67 VAL S CG1  4  
ATOM 4243  C CG2  . VAL A 1 58 ? 8.382   0.876   6.026   1.00 0.00 ? 67 VAL S CG2  4  
ATOM 4244  H H    . VAL A 1 58 ? 10.037  -0.862  4.098   1.00 0.00 ? 67 VAL S H    4  
ATOM 4245  H HA   . VAL A 1 58 ? 8.378   1.356   3.451   1.00 0.00 ? 67 VAL S HA   4  
ATOM 4246  H HB   . VAL A 1 58 ? 10.458  0.891   5.581   1.00 0.00 ? 67 VAL S HB   4  
ATOM 4247  H HG11 . VAL A 1 58 ? 8.939   3.443   5.055   1.00 0.00 ? 67 VAL S HG11 4  
ATOM 4248  H HG12 . VAL A 1 58 ? 10.689  3.224   5.060   1.00 0.00 ? 67 VAL S HG12 4  
ATOM 4249  H HG13 . VAL A 1 58 ? 9.777   3.076   6.564   1.00 0.00 ? 67 VAL S HG13 4  
ATOM 4250  H HG21 . VAL A 1 58 ? 7.653   1.661   6.147   1.00 0.00 ? 67 VAL S HG21 4  
ATOM 4251  H HG22 . VAL A 1 58 ? 8.714   0.540   6.997   1.00 0.00 ? 67 VAL S HG22 4  
ATOM 4252  H HG23 . VAL A 1 58 ? 7.938   0.049   5.493   1.00 0.00 ? 67 VAL S HG23 4  
ATOM 4253  N N    . ASN A 1 59 ? 11.604  1.526   2.811   1.00 0.00 ? 68 ASN S N    4  
ATOM 4254  C CA   . ASN A 1 59 ? 12.615  2.251   2.043   1.00 0.00 ? 68 ASN S CA   4  
ATOM 4255  C C    . ASN A 1 59 ? 12.055  2.737   0.708   1.00 0.00 ? 68 ASN S C    4  
ATOM 4256  O O    . ASN A 1 59 ? 12.412  3.813   0.226   1.00 0.00 ? 68 ASN S O    4  
ATOM 4257  C CB   . ASN A 1 59 ? 13.822  1.349   1.783   1.00 0.00 ? 68 ASN S CB   4  
ATOM 4258  C CG   . ASN A 1 59 ? 15.072  2.139   1.444   1.00 0.00 ? 68 ASN S CG   4  
ATOM 4259  O OD1  . ASN A 1 59 ? 15.224  3.290   1.855   1.00 0.00 ? 68 ASN S OD1  4  
ATOM 4260  N ND2  . ASN A 1 59 ? 15.974  1.522   0.689   1.00 0.00 ? 68 ASN S ND2  4  
ATOM 4261  H H    . ASN A 1 59 ? 11.858  0.673   3.262   1.00 0.00 ? 68 ASN S H    4  
ATOM 4262  H HA   . ASN A 1 59 ? 12.931  3.103   2.625   1.00 0.00 ? 68 ASN S HA   4  
ATOM 4263  H HB2  . ASN A 1 59 ? 14.018  0.755   2.662   1.00 0.00 ? 68 ASN S HB2  4  
ATOM 4264  H HB3  . ASN A 1 59 ? 13.600  0.692   0.954   1.00 0.00 ? 68 ASN S HB3  4  
ATOM 4265  H HD21 . ASN A 1 59 ? 15.787  0.605   0.398   1.00 0.00 ? 68 ASN S HD21 4  
ATOM 4266  H HD22 . ASN A 1 59 ? 16.792  2.011   0.455   1.00 0.00 ? 68 ASN S HD22 4  
ATOM 4267  N N    . LEU A 1 60 ? 11.183  1.931   0.110   1.00 0.00 ? 69 LEU S N    4  
ATOM 4268  C CA   . LEU A 1 60 ? 10.584  2.270   -1.176  1.00 0.00 ? 69 LEU S CA   4  
ATOM 4269  C C    . LEU A 1 60 ? 9.463   3.295   -1.027  1.00 0.00 ? 69 LEU S C    4  
ATOM 4270  O O    . LEU A 1 60 ? 9.425   4.288   -1.754  1.00 0.00 ? 69 LEU S O    4  
ATOM 4271  C CB   . LEU A 1 60 ? 10.051  1.012   -1.863  1.00 0.00 ? 69 LEU S CB   4  
ATOM 4272  C CG   . LEU A 1 60 ? 11.059  0.287   -2.756  1.00 0.00 ? 69 LEU S CG   4  
ATOM 4273  C CD1  . LEU A 1 60 ? 11.377  1.120   -3.988  1.00 0.00 ? 69 LEU S CD1  4  
ATOM 4274  C CD2  . LEU A 1 60 ? 12.328  -0.029  -1.981  1.00 0.00 ? 69 LEU S CD2  4  
ATOM 4275  H H    . LEU A 1 60 ? 10.943  1.082   0.539   1.00 0.00 ? 69 LEU S H    4  
ATOM 4276  H HA   . LEU A 1 60 ? 11.360  2.697   -1.794  1.00 0.00 ? 69 LEU S HA   4  
ATOM 4277  H HB2  . LEU A 1 60 ? 9.718   0.324   -1.097  1.00 0.00 ? 69 LEU S HB2  4  
ATOM 4278  H HB3  . LEU A 1 60 ? 9.202   1.292   -2.470  1.00 0.00 ? 69 LEU S HB3  4  
ATOM 4279  H HG   . LEU A 1 60 ? 10.627  -0.647  -3.088  1.00 0.00 ? 69 LEU S HG   4  
ATOM 4280  H HD11 . LEU A 1 60 ? 12.245  1.732   -3.793  1.00 0.00 ? 69 LEU S HD11 4  
ATOM 4281  H HD12 . LEU A 1 60 ? 10.534  1.756   -4.219  1.00 0.00 ? 69 LEU S HD12 4  
ATOM 4282  H HD13 . LEU A 1 60 ? 11.575  0.468   -4.823  1.00 0.00 ? 69 LEU S HD13 4  
ATOM 4283  H HD21 . LEU A 1 60 ? 13.111  -0.308  -2.670  1.00 0.00 ? 69 LEU S HD21 4  
ATOM 4284  H HD22 . LEU A 1 60 ? 12.140  -0.846  -1.299  1.00 0.00 ? 69 LEU S HD22 4  
ATOM 4285  H HD23 . LEU A 1 60 ? 12.634  0.842   -1.422  1.00 0.00 ? 69 LEU S HD23 4  
ATOM 4286  N N    . LYS A 1 61 ? 8.544   3.055   -0.093  1.00 0.00 ? 70 LYS S N    4  
ATOM 4287  C CA   . LYS A 1 61 ? 7.425   3.970   0.118   1.00 0.00 ? 70 LYS S CA   4  
ATOM 4288  C C    . LYS A 1 61 ? 7.931   5.393   0.328   1.00 0.00 ? 70 LYS S C    4  
ATOM 4289  O O    . LYS A 1 61 ? 7.469   6.329   -0.323  1.00 0.00 ? 70 LYS S O    4  
ATOM 4290  C CB   . LYS A 1 61 ? 6.565   3.528   1.310   1.00 0.00 ? 70 LYS S CB   4  
ATOM 4291  C CG   . LYS A 1 61 ? 5.322   2.746   0.898   1.00 0.00 ? 70 LYS S CG   4  
ATOM 4292  C CD   . LYS A 1 61 ? 4.999   1.610   1.860   1.00 0.00 ? 70 LYS S CD   4  
ATOM 4293  C CE   . LYS A 1 61 ? 6.208   0.730   2.132   1.00 0.00 ? 70 LYS S CE   4  
ATOM 4294  N NZ   . LYS A 1 61 ? 5.859   -0.718  2.124   1.00 0.00 ? 70 LYS S NZ   4  
ATOM 4295  H H    . LYS A 1 61 ? 8.615   2.245   0.455   1.00 0.00 ? 70 LYS S H    4  
ATOM 4296  H HA   . LYS A 1 61 ? 6.818   3.953   -0.775  1.00 0.00 ? 70 LYS S HA   4  
ATOM 4297  H HB2  . LYS A 1 61 ? 7.160   2.909   1.965   1.00 0.00 ? 70 LYS S HB2  4  
ATOM 4298  H HB3  . LYS A 1 61 ? 6.244   4.407   1.850   1.00 0.00 ? 70 LYS S HB3  4  
ATOM 4299  H HG2  . LYS A 1 61 ? 4.480   3.420   0.877   1.00 0.00 ? 70 LYS S HG2  4  
ATOM 4300  H HG3  . LYS A 1 61 ? 5.477   2.337   -0.088  1.00 0.00 ? 70 LYS S HG3  4  
ATOM 4301  H HD2  . LYS A 1 61 ? 4.653   2.030   2.789   1.00 0.00 ? 70 LYS S HD2  4  
ATOM 4302  H HD3  . LYS A 1 61 ? 4.216   1.005   1.428   1.00 0.00 ? 70 LYS S HD3  4  
ATOM 4303  H HE2  . LYS A 1 61 ? 6.952   0.918   1.377   1.00 0.00 ? 70 LYS S HE2  4  
ATOM 4304  H HE3  . LYS A 1 61 ? 6.609   0.987   3.099   1.00 0.00 ? 70 LYS S HE3  4  
ATOM 4305  H HZ1  . LYS A 1 61 ? 6.086   -1.137  1.199   1.00 0.00 ? 70 LYS S HZ1  4  
ATOM 4306  H HZ2  . LYS A 1 61 ? 4.843   -0.842  2.309   1.00 0.00 ? 70 LYS S HZ2  4  
ATOM 4307  H HZ3  . LYS A 1 61 ? 6.396   -1.220  2.859   1.00 0.00 ? 70 LYS S HZ3  4  
ATOM 4308  N N    . LYS A 1 62 ? 8.899   5.546   1.224   1.00 0.00 ? 71 LYS S N    4  
ATOM 4309  C CA   . LYS A 1 62 ? 9.480   6.852   1.501   1.00 0.00 ? 71 LYS S CA   4  
ATOM 4310  C C    . LYS A 1 62 ? 10.241  7.365   0.281   1.00 0.00 ? 71 LYS S C    4  
ATOM 4311  O O    . LYS A 1 62 ? 10.370  8.572   0.079   1.00 0.00 ? 71 LYS S O    4  
ATOM 4312  C CB   . LYS A 1 62 ? 10.417  6.776   2.707   1.00 0.00 ? 71 LYS S CB   4  
ATOM 4313  C CG   . LYS A 1 62 ? 9.760   6.201   3.952   1.00 0.00 ? 71 LYS S CG   4  
ATOM 4314  C CD   . LYS A 1 62 ? 10.737  6.136   5.115   1.00 0.00 ? 71 LYS S CD   4  
ATOM 4315  C CE   . LYS A 1 62 ? 10.629  7.367   6.001   1.00 0.00 ? 71 LYS S CE   4  
ATOM 4316  N NZ   . LYS A 1 62 ? 11.570  8.441   5.575   1.00 0.00 ? 71 LYS S NZ   4  
ATOM 4317  H H    . LYS A 1 62 ? 9.238   4.760   1.702   1.00 0.00 ? 71 LYS S H    4  
ATOM 4318  H HA   . LYS A 1 62 ? 8.674   7.535   1.722   1.00 0.00 ? 71 LYS S HA   4  
ATOM 4319  H HB2  . LYS A 1 62 ? 11.263  6.154   2.453   1.00 0.00 ? 71 LYS S HB2  4  
ATOM 4320  H HB3  . LYS A 1 62 ? 10.769  7.770   2.939   1.00 0.00 ? 71 LYS S HB3  4  
ATOM 4321  H HG2  . LYS A 1 62 ? 8.927   6.828   4.229   1.00 0.00 ? 71 LYS S HG2  4  
ATOM 4322  H HG3  . LYS A 1 62 ? 9.408   5.204   3.733   1.00 0.00 ? 71 LYS S HG3  4  
ATOM 4323  H HD2  . LYS A 1 62 ? 10.519  5.260   5.706   1.00 0.00 ? 71 LYS S HD2  4  
ATOM 4324  H HD3  . LYS A 1 62 ? 11.743  6.070   4.726   1.00 0.00 ? 71 LYS S HD3  4  
ATOM 4325  H HE2  . LYS A 1 62 ? 9.619   7.744   5.949   1.00 0.00 ? 71 LYS S HE2  4  
ATOM 4326  H HE3  . LYS A 1 62 ? 10.857  7.082   7.020   1.00 0.00 ? 71 LYS S HE3  4  
ATOM 4327  H HZ1  . LYS A 1 62 ? 11.468  9.272   6.194   1.00 0.00 ? 71 LYS S HZ1  4  
ATOM 4328  H HZ2  . LYS A 1 62 ? 11.369  8.723   4.595   1.00 0.00 ? 71 LYS S HZ2  4  
ATOM 4329  H HZ3  . LYS A 1 62 ? 12.551  8.100   5.632   1.00 0.00 ? 71 LYS S HZ3  4  
ATOM 4330  N N    . ALA A 1 63 ? 10.744  6.435   -0.527  1.00 0.00 ? 72 ALA S N    4  
ATOM 4331  C CA   . ALA A 1 63 ? 11.494  6.786   -1.726  1.00 0.00 ? 72 ALA S CA   4  
ATOM 4332  C C    . ALA A 1 63 ? 10.562  7.186   -2.866  1.00 0.00 ? 72 ALA S C    4  
ATOM 4333  O O    . ALA A 1 63 ? 10.921  8.004   -3.714  1.00 0.00 ? 72 ALA S O    4  
ATOM 4334  C CB   . ALA A 1 63 ? 12.383  5.628   -2.152  1.00 0.00 ? 72 ALA S CB   4  
ATOM 4335  H H    . ALA A 1 63 ? 10.610  5.487   -0.311  1.00 0.00 ? 72 ALA S H    4  
ATOM 4336  H HA   . ALA A 1 63 ? 12.131  7.626   -1.487  1.00 0.00 ? 72 ALA S HA   4  
ATOM 4337  H HB1  . ALA A 1 63 ? 12.476  5.620   -3.228  1.00 0.00 ? 72 ALA S HB1  4  
ATOM 4338  H HB2  . ALA A 1 63 ? 11.942  4.697   -1.822  1.00 0.00 ? 72 ALA S HB2  4  
ATOM 4339  H HB3  . ALA A 1 63 ? 13.360  5.740   -1.706  1.00 0.00 ? 72 ALA S HB3  4  
ATOM 4340  N N    . LYS A 1 64 ? 9.365   6.605   -2.887  1.00 0.00 ? 73 LYS S N    4  
ATOM 4341  C CA   . LYS A 1 64 ? 8.392   6.912   -3.931  1.00 0.00 ? 73 LYS S CA   4  
ATOM 4342  C C    . LYS A 1 64 ? 7.433   8.005   -3.477  1.00 0.00 ? 73 LYS S C    4  
ATOM 4343  O O    . LYS A 1 64 ? 6.874   8.732   -4.298  1.00 0.00 ? 73 LYS S O    4  
ATOM 4344  C CB   . LYS A 1 64 ? 7.609   5.659   -4.323  1.00 0.00 ? 73 LYS S CB   4  
ATOM 4345  C CG   . LYS A 1 64 ? 7.099   5.691   -5.756  1.00 0.00 ? 73 LYS S CG   4  
ATOM 4346  C CD   . LYS A 1 64 ? 8.230   5.514   -6.755  1.00 0.00 ? 73 LYS S CD   4  
ATOM 4347  C CE   . LYS A 1 64 ? 8.273   4.097   -7.303  1.00 0.00 ? 73 LYS S CE   4  
ATOM 4348  N NZ   . LYS A 1 64 ? 9.419   3.896   -8.233  1.00 0.00 ? 73 LYS S NZ   4  
ATOM 4349  H H    . LYS A 1 64 ? 9.131   5.961   -2.186  1.00 0.00 ? 73 LYS S H    4  
ATOM 4350  H HA   . LYS A 1 64 ? 8.938   7.267   -4.793  1.00 0.00 ? 73 LYS S HA   4  
ATOM 4351  H HB2  . LYS A 1 64 ? 8.250   4.796   -4.212  1.00 0.00 ? 73 LYS S HB2  4  
ATOM 4352  H HB3  . LYS A 1 64 ? 6.759   5.557   -3.663  1.00 0.00 ? 73 LYS S HB3  4  
ATOM 4353  H HG2  . LYS A 1 64 ? 6.383   4.896   -5.892  1.00 0.00 ? 73 LYS S HG2  4  
ATOM 4354  H HG3  . LYS A 1 64 ? 6.619   6.643   -5.934  1.00 0.00 ? 73 LYS S HG3  4  
ATOM 4355  H HD2  . LYS A 1 64 ? 8.085   6.201   -7.575  1.00 0.00 ? 73 LYS S HD2  4  
ATOM 4356  H HD3  . LYS A 1 64 ? 9.168   5.730   -6.264  1.00 0.00 ? 73 LYS S HD3  4  
ATOM 4357  H HE2  . LYS A 1 64 ? 8.366   3.408   -6.477  1.00 0.00 ? 73 LYS S HE2  4  
ATOM 4358  H HE3  . LYS A 1 64 ? 7.352   3.901   -7.832  1.00 0.00 ? 73 LYS S HE3  4  
ATOM 4359  H HZ1  . LYS A 1 64 ? 10.314  3.895   -7.702  1.00 0.00 ? 73 LYS S HZ1  4  
ATOM 4360  H HZ2  . LYS A 1 64 ? 9.446   4.660   -8.938  1.00 0.00 ? 73 LYS S HZ2  4  
ATOM 4361  H HZ3  . LYS A 1 64 ? 9.323   2.986   -8.727  1.00 0.00 ? 73 LYS S HZ3  4  
ATOM 4362  N N    . GLY A 1 65 ? 7.257   8.129   -2.165  1.00 0.00 ? 74 GLY S N    4  
ATOM 4363  C CA   . GLY A 1 65 ? 6.376   9.150   -1.633  1.00 0.00 ? 74 GLY S CA   4  
ATOM 4364  C C    . GLY A 1 65 ? 5.113   8.598   -0.999  1.00 0.00 ? 74 GLY S C    4  
ATOM 4365  O O    . GLY A 1 65 ? 4.354   9.349   -0.385  1.00 0.00 ? 74 GLY S O    4  
ATOM 4366  H H    . GLY A 1 65 ? 7.735   7.531   -1.555  1.00 0.00 ? 74 GLY S H    4  
ATOM 4367  H HA2  . GLY A 1 65 ? 6.915   9.710   -0.882  1.00 0.00 ? 74 GLY S HA2  4  
ATOM 4368  H HA3  . GLY A 1 65 ? 6.097   9.820   -2.435  1.00 0.00 ? 74 GLY S HA3  4  
ATOM 4369  N N    . LEU A 1 66 ? 4.875   7.292   -1.130  1.00 0.00 ? 75 LEU S N    4  
ATOM 4370  C CA   . LEU A 1 66 ? 3.681   6.691   -0.539  1.00 0.00 ? 75 LEU S CA   4  
ATOM 4371  C C    . LEU A 1 66 ? 3.580   7.073   0.930   1.00 0.00 ? 75 LEU S C    4  
ATOM 4372  O O    . LEU A 1 66 ? 2.913   8.048   1.278   1.00 0.00 ? 75 LEU S O    4  
ATOM 4373  C CB   . LEU A 1 66 ? 3.689   5.168   -0.688  1.00 0.00 ? 75 LEU S CB   4  
ATOM 4374  C CG   . LEU A 1 66 ? 3.526   4.659   -2.121  1.00 0.00 ? 75 LEU S CG   4  
ATOM 4375  C CD1  . LEU A 1 66 ? 3.475   3.140   -2.142  1.00 0.00 ? 75 LEU S CD1  4  
ATOM 4376  C CD2  . LEU A 1 66 ? 2.271   5.243   -2.759  1.00 0.00 ? 75 LEU S CD2  4  
ATOM 4377  H H    . LEU A 1 66 ? 5.508   6.730   -1.624  1.00 0.00 ? 75 LEU S H    4  
ATOM 4378  H HA   . LEU A 1 66 ? 2.823   7.093   -1.057  1.00 0.00 ? 75 LEU S HA   4  
ATOM 4379  H HB2  . LEU A 1 66 ? 4.624   4.787   -0.288  1.00 0.00 ? 75 LEU S HB2  4  
ATOM 4380  H HB3  . LEU A 1 66 ? 2.877   4.769   -0.098  1.00 0.00 ? 75 LEU S HB3  4  
ATOM 4381  H HG   . LEU A 1 66 ? 4.379   4.972   -2.708  1.00 0.00 ? 75 LEU S HG   4  
ATOM 4382  H HD11 . LEU A 1 66 ? 3.993   2.774   -3.015  1.00 0.00 ? 75 LEU S HD11 4  
ATOM 4383  H HD12 . LEU A 1 66 ? 2.446   2.815   -2.171  1.00 0.00 ? 75 LEU S HD12 4  
ATOM 4384  H HD13 . LEU A 1 66 ? 3.950   2.754   -1.253  1.00 0.00 ? 75 LEU S HD13 4  
ATOM 4385  H HD21 . LEU A 1 66 ? 1.773   5.889   -2.051  1.00 0.00 ? 75 LEU S HD21 4  
ATOM 4386  H HD22 . LEU A 1 66 ? 1.605   4.443   -3.045  1.00 0.00 ? 75 LEU S HD22 4  
ATOM 4387  H HD23 . LEU A 1 66 ? 2.544   5.813   -3.635  1.00 0.00 ? 75 LEU S HD23 4  
ATOM 4388  N N    . PHE A 1 67 ? 4.251   6.306   1.791   1.00 0.00 ? 76 PHE S N    4  
ATOM 4389  C CA   . PHE A 1 67 ? 4.239   6.578   3.230   1.00 0.00 ? 76 PHE S CA   4  
ATOM 4390  C C    . PHE A 1 67 ? 4.261   8.078   3.524   1.00 0.00 ? 76 PHE S C    4  
ATOM 4391  O O    . PHE A 1 67 ? 4.982   8.809   2.811   1.00 0.00 ? 76 PHE S O    4  
ATOM 4392  C CB   . PHE A 1 67 ? 5.429   5.908   3.912   1.00 0.00 ? 76 PHE S CB   4  
ATOM 4393  C CG   . PHE A 1 67 ? 5.075   4.601   4.551   1.00 0.00 ? 76 PHE S CG   4  
ATOM 4394  C CD1  . PHE A 1 67 ? 3.926   4.480   5.313   1.00 0.00 ? 76 PHE S CD1  4  
ATOM 4395  C CD2  . PHE A 1 67 ? 5.882   3.493   4.380   1.00 0.00 ? 76 PHE S CD2  4  
ATOM 4396  C CE1  . PHE A 1 67 ? 3.589   3.277   5.893   1.00 0.00 ? 76 PHE S CE1  4  
ATOM 4397  C CE2  . PHE A 1 67 ? 5.552   2.286   4.958   1.00 0.00 ? 76 PHE S CE2  4  
ATOM 4398  C CZ   . PHE A 1 67 ? 4.403   2.175   5.717   1.00 0.00 ? 76 PHE S CZ   4  
ATOM 4399  O OXT  . PHE A 1 67 ? 3.556   8.507   4.461   1.00 0.00 ? 76 PHE S OXT  4  
ATOM 4400  H H    . PHE A 1 67 ? 4.765   5.536   1.449   1.00 0.00 ? 76 PHE S H    4  
ATOM 4401  H HA   . PHE A 1 67 ? 3.333   6.158   3.631   1.00 0.00 ? 76 PHE S HA   4  
ATOM 4402  H HB2  . PHE A 1 67 ? 6.203   5.729   3.183   1.00 0.00 ? 76 PHE S HB2  4  
ATOM 4403  H HB3  . PHE A 1 67 ? 5.811   6.562   4.683   1.00 0.00 ? 76 PHE S HB3  4  
ATOM 4404  H HD1  . PHE A 1 67 ? 3.290   5.341   5.452   1.00 0.00 ? 76 PHE S HD1  4  
ATOM 4405  H HD2  . PHE A 1 67 ? 6.782   3.579   3.788   1.00 0.00 ? 76 PHE S HD2  4  
ATOM 4406  H HE1  . PHE A 1 67 ? 2.689   3.196   6.484   1.00 0.00 ? 76 PHE S HE1  4  
ATOM 4407  H HE2  . PHE A 1 67 ? 6.187   1.431   4.811   1.00 0.00 ? 76 PHE S HE2  4  
ATOM 4408  H HZ   . PHE A 1 67 ? 4.143   1.231   6.171   1.00 0.00 ? 76 PHE S HZ   4  
ATOM 4409  N N    . MET A 1 1  ? -25.388 -8.011  -1.865  1.00 0.00 ? 10 MET S N    5  
ATOM 4410  C CA   . MET A 1 1  ? -24.529 -6.911  -1.352  1.00 0.00 ? 10 MET S CA   5  
ATOM 4411  C C    . MET A 1 1  ? -23.589 -7.407  -0.257  1.00 0.00 ? 10 MET S C    5  
ATOM 4412  O O    . MET A 1 1  ? -22.370 -7.268  -0.360  1.00 0.00 ? 10 MET S O    5  
ATOM 4413  C CB   . MET A 1 1  ? -25.432 -5.801  -0.808  1.00 0.00 ? 10 MET S CB   5  
ATOM 4414  C CG   . MET A 1 1  ? -24.907 -4.401  -1.079  1.00 0.00 ? 10 MET S CG   5  
ATOM 4415  S SD   . MET A 1 1  ? -26.150 -3.127  -0.792  1.00 0.00 ? 10 MET S SD   5  
ATOM 4416  C CE   . MET A 1 1  ? -27.284 -3.449  -2.141  1.00 0.00 ? 10 MET S CE   5  
ATOM 4417  H H1   . MET A 1 1  ? -24.792 -8.856  -1.968  1.00 0.00 ? 10 MET S H1   5  
ATOM 4418  H H2   . MET A 1 1  ? -25.774 -7.707  -2.781  1.00 0.00 ? 10 MET S H2   5  
ATOM 4419  H H3   . MET A 1 1  ? -26.145 -8.170  -1.171  1.00 0.00 ? 10 MET S H3   5  
ATOM 4420  H HA   . MET A 1 1  ? -23.942 -6.522  -2.171  1.00 0.00 ? 10 MET S HA   5  
ATOM 4421  H HB2  . MET A 1 1  ? -26.407 -5.892  -1.263  1.00 0.00 ? 10 MET S HB2  5  
ATOM 4422  H HB3  . MET A 1 1  ? -25.530 -5.925  0.261   1.00 0.00 ? 10 MET S HB3  5  
ATOM 4423  H HG2  . MET A 1 1  ? -24.065 -4.215  -0.429  1.00 0.00 ? 10 MET S HG2  5  
ATOM 4424  H HG3  . MET A 1 1  ? -24.584 -4.346  -2.108  1.00 0.00 ? 10 MET S HG3  5  
ATOM 4425  H HE1  . MET A 1 1  ? -28.300 -3.355  -1.787  1.00 0.00 ? 10 MET S HE1  5  
ATOM 4426  H HE2  . MET A 1 1  ? -27.125 -4.449  -2.515  1.00 0.00 ? 10 MET S HE2  5  
ATOM 4427  H HE3  . MET A 1 1  ? -27.112 -2.736  -2.935  1.00 0.00 ? 10 MET S HE3  5  
ATOM 4428  N N    . LEU A 1 2  ? -24.165 -7.989  0.790   1.00 0.00 ? 11 LEU S N    5  
ATOM 4429  C CA   . LEU A 1 2  ? -23.378 -8.506  1.905   1.00 0.00 ? 11 LEU S CA   5  
ATOM 4430  C C    . LEU A 1 2  ? -22.804 -9.879  1.572   1.00 0.00 ? 11 LEU S C    5  
ATOM 4431  O O    . LEU A 1 2  ? -21.722 -10.239 2.036   1.00 0.00 ? 11 LEU S O    5  
ATOM 4432  C CB   . LEU A 1 2  ? -24.240 -8.593  3.166   1.00 0.00 ? 11 LEU S CB   5  
ATOM 4433  C CG   . LEU A 1 2  ? -24.270 -7.324  4.018   1.00 0.00 ? 11 LEU S CG   5  
ATOM 4434  C CD1  . LEU A 1 2  ? -22.909 -7.073  4.650   1.00 0.00 ? 11 LEU S CD1  5  
ATOM 4435  C CD2  . LEU A 1 2  ? -24.698 -6.130  3.179   1.00 0.00 ? 11 LEU S CD2  5  
ATOM 4436  H H    . LEU A 1 2  ? -25.141 -8.070  0.814   1.00 0.00 ? 11 LEU S H    5  
ATOM 4437  H HA   . LEU A 1 2  ? -22.564 -7.822  2.082   1.00 0.00 ? 11 LEU S HA   5  
ATOM 4438  H HB2  . LEU A 1 2  ? -25.253 -8.828  2.870   1.00 0.00 ? 11 LEU S HB2  5  
ATOM 4439  H HB3  . LEU A 1 2  ? -23.866 -9.400  3.777   1.00 0.00 ? 11 LEU S HB3  5  
ATOM 4440  H HG   . LEU A 1 2  ? -24.989 -7.450  4.815   1.00 0.00 ? 11 LEU S HG   5  
ATOM 4441  H HD11 . LEU A 1 2  ? -23.042 -6.674  5.646   1.00 0.00 ? 11 LEU S HD11 5  
ATOM 4442  H HD12 . LEU A 1 2  ? -22.358 -6.365  4.050   1.00 0.00 ? 11 LEU S HD12 5  
ATOM 4443  H HD13 . LEU A 1 2  ? -22.362 -8.003  4.706   1.00 0.00 ? 11 LEU S HD13 5  
ATOM 4444  H HD21 . LEU A 1 2  ? -24.477 -5.217  3.712   1.00 0.00 ? 11 LEU S HD21 5  
ATOM 4445  H HD22 . LEU A 1 2  ? -25.760 -6.188  2.987   1.00 0.00 ? 11 LEU S HD22 5  
ATOM 4446  H HD23 . LEU A 1 2  ? -24.162 -6.139  2.242   1.00 0.00 ? 11 LEU S HD23 5  
ATOM 4447  N N    . ALA A 1 3  ? -23.535 -10.643 0.767   1.00 0.00 ? 12 ALA S N    5  
ATOM 4448  C CA   . ALA A 1 3  ? -23.097 -11.976 0.372   1.00 0.00 ? 12 ALA S CA   5  
ATOM 4449  C C    . ALA A 1 3  ? -21.910 -11.907 -0.582  1.00 0.00 ? 12 ALA S C    5  
ATOM 4450  O O    . ALA A 1 3  ? -21.066 -12.802 -0.605  1.00 0.00 ? 12 ALA S O    5  
ATOM 4451  C CB   . ALA A 1 3  ? -24.246 -12.740 -0.268  1.00 0.00 ? 12 ALA S CB   5  
ATOM 4452  H H    . ALA A 1 3  ? -24.388 -10.300 0.429   1.00 0.00 ? 12 ALA S H    5  
ATOM 4453  H HA   . ALA A 1 3  ? -22.798 -12.505 1.265   1.00 0.00 ? 12 ALA S HA   5  
ATOM 4454  H HB1  . ALA A 1 3  ? -24.933 -12.042 -0.724  1.00 0.00 ? 12 ALA S HB1  5  
ATOM 4455  H HB2  . ALA A 1 3  ? -24.764 -13.312 0.489   1.00 0.00 ? 12 ALA S HB2  5  
ATOM 4456  H HB3  . ALA A 1 3  ? -23.859 -13.407 -1.023  1.00 0.00 ? 12 ALA S HB3  5  
ATOM 4457  N N    . LYS A 1 4  ? -21.852 -10.838 -1.369  1.00 0.00 ? 13 LYS S N    5  
ATOM 4458  C CA   . LYS A 1 4  ? -20.768 -10.652 -2.327  1.00 0.00 ? 13 LYS S CA   5  
ATOM 4459  C C    . LYS A 1 4  ? -19.690 -9.735  -1.760  1.00 0.00 ? 13 LYS S C    5  
ATOM 4460  O O    . LYS A 1 4  ? -19.941 -8.561  -1.487  1.00 0.00 ? 13 LYS S O    5  
ATOM 4461  C CB   . LYS A 1 4  ? -21.309 -10.074 -3.635  1.00 0.00 ? 13 LYS S CB   5  
ATOM 4462  C CG   . LYS A 1 4  ? -22.412 -10.912 -4.263  1.00 0.00 ? 13 LYS S CG   5  
ATOM 4463  C CD   . LYS A 1 4  ? -21.876 -11.797 -5.378  1.00 0.00 ? 13 LYS S CD   5  
ATOM 4464  C CE   . LYS A 1 4  ? -22.308 -11.294 -6.747  1.00 0.00 ? 13 LYS S CE   5  
ATOM 4465  N NZ   . LYS A 1 4  ? -21.312 -11.628 -7.802  1.00 0.00 ? 13 LYS S NZ   5  
ATOM 4466  H H    . LYS A 1 4  ? -22.555 -10.157 -1.307  1.00 0.00 ? 13 LYS S H    5  
ATOM 4467  H HA   . LYS A 1 4  ? -20.333 -11.620 -2.526  1.00 0.00 ? 13 LYS S HA   5  
ATOM 4468  H HB2  . LYS A 1 4  ? -21.703 -9.087  -3.443  1.00 0.00 ? 13 LYS S HB2  5  
ATOM 4469  H HB3  . LYS A 1 4  ? -20.498 -9.997  -4.344  1.00 0.00 ? 13 LYS S HB3  5  
ATOM 4470  H HG2  . LYS A 1 4  ? -22.851 -11.538 -3.501  1.00 0.00 ? 13 LYS S HG2  5  
ATOM 4471  H HG3  . LYS A 1 4  ? -23.165 -10.253 -4.669  1.00 0.00 ? 13 LYS S HG3  5  
ATOM 4472  H HD2  . LYS A 1 4  ? -20.797 -11.804 -5.334  1.00 0.00 ? 13 LYS S HD2  5  
ATOM 4473  H HD3  . LYS A 1 4  ? -22.250 -12.801 -5.239  1.00 0.00 ? 13 LYS S HD3  5  
ATOM 4474  H HE2  . LYS A 1 4  ? -23.254 -11.751 -7.002  1.00 0.00 ? 13 LYS S HE2  5  
ATOM 4475  H HE3  . LYS A 1 4  ? -22.426 -10.222 -6.701  1.00 0.00 ? 13 LYS S HE3  5  
ATOM 4476  H HZ1  . LYS A 1 4  ? -20.695 -10.810 -7.983  1.00 0.00 ? 13 LYS S HZ1  5  
ATOM 4477  H HZ2  . LYS A 1 4  ? -21.798 -11.884 -8.684  1.00 0.00 ? 13 LYS S HZ2  5  
ATOM 4478  H HZ3  . LYS A 1 4  ? -20.723 -12.430 -7.499  1.00 0.00 ? 13 LYS S HZ3  5  
ATOM 4479  N N    . LEU A 1 5  ? -18.490 -10.278 -1.585  1.00 0.00 ? 14 LEU S N    5  
ATOM 4480  C CA   . LEU A 1 5  ? -17.372 -9.508  -1.051  1.00 0.00 ? 14 LEU S CA   5  
ATOM 4481  C C    . LEU A 1 5  ? -16.724 -8.665  -2.145  1.00 0.00 ? 14 LEU S C    5  
ATOM 4482  O O    . LEU A 1 5  ? -16.311 -9.188  -3.181  1.00 0.00 ? 14 LEU S O    5  
ATOM 4483  C CB   . LEU A 1 5  ? -16.333 -10.442 -0.427  1.00 0.00 ? 14 LEU S CB   5  
ATOM 4484  C CG   . LEU A 1 5  ? -16.909 -11.582 0.417   1.00 0.00 ? 14 LEU S CG   5  
ATOM 4485  C CD1  . LEU A 1 5  ? -15.936 -12.749 0.473   1.00 0.00 ? 14 LEU S CD1  5  
ATOM 4486  C CD2  . LEU A 1 5  ? -17.238 -11.090 1.818   1.00 0.00 ? 14 LEU S CD2  5  
ATOM 4487  H H    . LEU A 1 5  ? -18.351 -11.219 -1.822  1.00 0.00 ? 14 LEU S H    5  
ATOM 4488  H HA   . LEU A 1 5  ? -17.759 -8.851  -0.286  1.00 0.00 ? 14 LEU S HA   5  
ATOM 4489  H HB2  . LEU A 1 5  ? -15.743 -10.873 -1.223  1.00 0.00 ? 14 LEU S HB2  5  
ATOM 4490  H HB3  . LEU A 1 5  ? -15.683 -9.854  0.202   1.00 0.00 ? 14 LEU S HB3  5  
ATOM 4491  H HG   . LEU A 1 5  ? -17.824 -11.931 -0.039  1.00 0.00 ? 14 LEU S HG   5  
ATOM 4492  H HD11 . LEU A 1 5  ? -15.092 -12.485 1.093   1.00 0.00 ? 14 LEU S HD11 5  
ATOM 4493  H HD12 . LEU A 1 5  ? -15.592 -12.978 -0.525  1.00 0.00 ? 14 LEU S HD12 5  
ATOM 4494  H HD13 . LEU A 1 5  ? -16.433 -13.612 0.891   1.00 0.00 ? 14 LEU S HD13 5  
ATOM 4495  H HD21 . LEU A 1 5  ? -16.324 -10.966 2.380   1.00 0.00 ? 14 LEU S HD21 5  
ATOM 4496  H HD22 . LEU A 1 5  ? -17.870 -11.812 2.314   1.00 0.00 ? 14 LEU S HD22 5  
ATOM 4497  H HD23 . LEU A 1 5  ? -17.754 -10.144 1.756   1.00 0.00 ? 14 LEU S HD23 5  
ATOM 4498  N N    . CYS A 1 6  ? -16.639 -7.360  -1.910  1.00 0.00 ? 15 CYS S N    5  
ATOM 4499  C CA   . CYS A 1 6  ? -16.043 -6.446  -2.877  1.00 0.00 ? 15 CYS S CA   5  
ATOM 4500  C C    . CYS A 1 6  ? -14.873 -5.684  -2.264  1.00 0.00 ? 15 CYS S C    5  
ATOM 4501  O O    . CYS A 1 6  ? -15.054 -4.879  -1.350  1.00 0.00 ? 15 CYS S O    5  
ATOM 4502  C CB   . CYS A 1 6  ? -17.094 -5.460  -3.392  1.00 0.00 ? 15 CYS S CB   5  
ATOM 4503  S SG   . CYS A 1 6  ? -16.923 -5.047  -5.144  1.00 0.00 ? 15 CYS S SG   5  
ATOM 4504  H H    . CYS A 1 6  ? -16.989 -7.003  -1.066  1.00 0.00 ? 15 CYS S H    5  
ATOM 4505  H HA   . CYS A 1 6  ? -15.678 -7.034  -3.707  1.00 0.00 ? 15 CYS S HA   5  
ATOM 4506  H HB2  . CYS A 1 6  ? -18.076 -5.887  -3.252  1.00 0.00 ? 15 CYS S HB2  5  
ATOM 4507  H HB3  . CYS A 1 6  ? -17.023 -4.542  -2.828  1.00 0.00 ? 15 CYS S HB3  5  
ATOM 4508  H HG   . CYS A 1 6  ? -16.971 -5.862  -5.646  1.00 0.00 ? 15 CYS S HG   5  
ATOM 4509  N N    . LYS A 1 7  ? -13.674 -5.940  -2.776  1.00 0.00 ? 16 LYS S N    5  
ATOM 4510  C CA   . LYS A 1 7  ? -12.471 -5.277  -2.284  1.00 0.00 ? 16 LYS S CA   5  
ATOM 4511  C C    . LYS A 1 7  ? -11.877 -4.373  -3.358  1.00 0.00 ? 16 LYS S C    5  
ATOM 4512  O O    . LYS A 1 7  ? -11.560 -4.827  -4.459  1.00 0.00 ? 16 LYS S O    5  
ATOM 4513  C CB   . LYS A 1 7  ? -11.436 -6.312  -1.842  1.00 0.00 ? 16 LYS S CB   5  
ATOM 4514  C CG   . LYS A 1 7  ? -11.875 -7.140  -0.646  1.00 0.00 ? 16 LYS S CG   5  
ATOM 4515  C CD   . LYS A 1 7  ? -11.037 -8.399  -0.501  1.00 0.00 ? 16 LYS S CD   5  
ATOM 4516  C CE   . LYS A 1 7  ? -10.740 -8.707  0.958   1.00 0.00 ? 16 LYS S CE   5  
ATOM 4517  N NZ   . LYS A 1 7  ? -9.372  -9.265  1.140   1.00 0.00 ? 16 LYS S NZ   5  
ATOM 4518  H H    . LYS A 1 7  ? -13.595 -6.590  -3.506  1.00 0.00 ? 16 LYS S H    5  
ATOM 4519  H HA   . LYS A 1 7  ? -12.749 -4.673  -1.434  1.00 0.00 ? 16 LYS S HA   5  
ATOM 4520  H HB2  . LYS A 1 7  ? -11.242 -6.985  -2.666  1.00 0.00 ? 16 LYS S HB2  5  
ATOM 4521  H HB3  . LYS A 1 7  ? -10.520 -5.802  -1.583  1.00 0.00 ? 16 LYS S HB3  5  
ATOM 4522  H HG2  . LYS A 1 7  ? -11.770 -6.545  0.248   1.00 0.00 ? 16 LYS S HG2  5  
ATOM 4523  H HG3  . LYS A 1 7  ? -12.911 -7.419  -0.775  1.00 0.00 ? 16 LYS S HG3  5  
ATOM 4524  H HD2  . LYS A 1 7  ? -11.576 -9.231  -0.930  1.00 0.00 ? 16 LYS S HD2  5  
ATOM 4525  H HD3  . LYS A 1 7  ? -10.104 -8.262  -1.028  1.00 0.00 ? 16 LYS S HD3  5  
ATOM 4526  H HE2  . LYS A 1 7  ? -10.825 -7.795  1.529   1.00 0.00 ? 16 LYS S HE2  5  
ATOM 4527  H HE3  . LYS A 1 7  ? -11.463 -9.424  1.317   1.00 0.00 ? 16 LYS S HE3  5  
ATOM 4528  H HZ1  . LYS A 1 7  ? -9.059  -9.738  0.267   1.00 0.00 ? 16 LYS S HZ1  5  
ATOM 4529  H HZ2  . LYS A 1 7  ? -9.369  -9.959  1.916   1.00 0.00 ? 16 LYS S HZ2  5  
ATOM 4530  H HZ3  . LYS A 1 7  ? -8.701  -8.504  1.367   1.00 0.00 ? 16 LYS S HZ3  5  
ATOM 4531  N N    . THR A 1 8  ? -11.732 -3.091  -3.037  1.00 0.00 ? 17 THR S N    5  
ATOM 4532  C CA   . THR A 1 8  ? -11.182 -2.126  -3.982  1.00 0.00 ? 17 THR S CA   5  
ATOM 4533  C C    . THR A 1 8  ? -9.981  -1.396  -3.389  1.00 0.00 ? 17 THR S C    5  
ATOM 4534  O O    . THR A 1 8  ? -9.963  -1.063  -2.204  1.00 0.00 ? 17 THR S O    5  
ATOM 4535  C CB   . THR A 1 8  ? -12.254 -1.114  -4.389  1.00 0.00 ? 17 THR S CB   5  
ATOM 4536  O OG1  . THR A 1 8  ? -11.723 -0.157  -5.288  1.00 0.00 ? 17 THR S OG1  5  
ATOM 4537  C CG2  . THR A 1 8  ? -12.847 -0.365  -3.218  1.00 0.00 ? 17 THR S CG2  5  
ATOM 4538  H H    . THR A 1 8  ? -12.006 -2.787  -2.146  1.00 0.00 ? 17 THR S H    5  
ATOM 4539  H HA   . THR A 1 8  ? -10.861 -2.668  -4.858  1.00 0.00 ? 17 THR S HA   5  
ATOM 4540  H HB   . THR A 1 8  ? -13.057 -1.638  -4.889  1.00 0.00 ? 17 THR S HB   5  
ATOM 4541  H HG1  . THR A 1 8  ? -11.049 0.362   -4.842  1.00 0.00 ? 17 THR S HG1  5  
ATOM 4542  H HG21 . THR A 1 8  ? -12.899 0.689   -3.453  1.00 0.00 ? 17 THR S HG21 5  
ATOM 4543  H HG22 . THR A 1 8  ? -12.227 -0.507  -2.346  1.00 0.00 ? 17 THR S HG22 5  
ATOM 4544  H HG23 . THR A 1 8  ? -13.841 -0.736  -3.019  1.00 0.00 ? 17 THR S HG23 5  
ATOM 4545  N N    . ILE A 1 9  ? -8.976  -1.156  -4.225  1.00 0.00 ? 18 ILE S N    5  
ATOM 4546  C CA   . ILE A 1 9  ? -7.766  -0.474  -3.803  1.00 0.00 ? 18 ILE S CA   5  
ATOM 4547  C C    . ILE A 1 9  ? -7.896  1.038   -3.972  1.00 0.00 ? 18 ILE S C    5  
ATOM 4548  O O    . ILE A 1 9  ? -8.603  1.516   -4.858  1.00 0.00 ? 18 ILE S O    5  
ATOM 4549  C CB   . ILE A 1 9  ? -6.567  -0.976  -4.630  1.00 0.00 ? 18 ILE S CB   5  
ATOM 4550  C CG1  . ILE A 1 9  ? -6.295  -2.444  -4.308  1.00 0.00 ? 18 ILE S CG1  5  
ATOM 4551  C CG2  . ILE A 1 9  ? -5.331  -0.122  -4.382  1.00 0.00 ? 18 ILE S CG2  5  
ATOM 4552  C CD1  . ILE A 1 9  ? -5.789  -2.677  -2.901  1.00 0.00 ? 18 ILE S CD1  5  
ATOM 4553  H H    . ILE A 1 9  ? -9.045  -1.454  -5.155  1.00 0.00 ? 18 ILE S H    5  
ATOM 4554  H HA   . ILE A 1 9  ? -7.589  -0.705  -2.764  1.00 0.00 ? 18 ILE S HA   5  
ATOM 4555  H HB   . ILE A 1 9  ? -6.824  -0.890  -5.674  1.00 0.00 ? 18 ILE S HB   5  
ATOM 4556  H HG12 . ILE A 1 9  ? -7.210  -3.006  -4.426  1.00 0.00 ? 18 ILE S HG12 5  
ATOM 4557  H HG13 . ILE A 1 9  ? -5.556  -2.822  -4.995  1.00 0.00 ? 18 ILE S HG13 5  
ATOM 4558  H HG21 . ILE A 1 9  ? -5.240  0.080   -3.327  1.00 0.00 ? 18 ILE S HG21 5  
ATOM 4559  H HG22 . ILE A 1 9  ? -5.425  0.809   -4.921  1.00 0.00 ? 18 ILE S HG22 5  
ATOM 4560  H HG23 . ILE A 1 9  ? -4.454  -0.650  -4.727  1.00 0.00 ? 18 ILE S HG23 5  
ATOM 4561  H HD11 . ILE A 1 9  ? -6.613  -2.966  -2.264  1.00 0.00 ? 18 ILE S HD11 5  
ATOM 4562  H HD12 . ILE A 1 9  ? -5.345  -1.769  -2.523  1.00 0.00 ? 18 ILE S HD12 5  
ATOM 4563  H HD13 . ILE A 1 9  ? -5.048  -3.464  -2.908  1.00 0.00 ? 18 ILE S HD13 5  
ATOM 4564  N N    . TYR A 1 10 ? -7.197  1.785   -3.120  1.00 0.00 ? 19 TYR S N    5  
ATOM 4565  C CA   . TYR A 1 10 ? -7.226  3.240   -3.184  1.00 0.00 ? 19 TYR S CA   5  
ATOM 4566  C C    . TYR A 1 10 ? -6.117  3.732   -4.118  1.00 0.00 ? 19 TYR S C    5  
ATOM 4567  O O    . TYR A 1 10 ? -4.971  3.299   -4.003  1.00 0.00 ? 19 TYR S O    5  
ATOM 4568  C CB   . TYR A 1 10 ? -7.069  3.842   -1.774  1.00 0.00 ? 19 TYR S CB   5  
ATOM 4569  C CG   . TYR A 1 10 ? -8.260  3.589   -0.860  1.00 0.00 ? 19 TYR S CG   5  
ATOM 4570  C CD1  . TYR A 1 10 ? -9.009  2.418   -0.973  1.00 0.00 ? 19 TYR S CD1  5  
ATOM 4571  C CD2  . TYR A 1 10 ? -8.649  4.517   0.112   1.00 0.00 ? 19 TYR S CD2  5  
ATOM 4572  C CE1  . TYR A 1 10 ? -10.096 2.181   -0.157  1.00 0.00 ? 19 TYR S CE1  5  
ATOM 4573  C CE2  . TYR A 1 10 ? -9.739  4.280   0.926   1.00 0.00 ? 19 TYR S CE2  5  
ATOM 4574  C CZ   . TYR A 1 10 ? -10.459 3.113   0.787   1.00 0.00 ? 19 TYR S CZ   5  
ATOM 4575  O OH   . TYR A 1 10 ? -11.545 2.878   1.597   1.00 0.00 ? 19 TYR S OH   5  
ATOM 4576  H H    . TYR A 1 10 ? -6.645  1.344   -2.437  1.00 0.00 ? 19 TYR S H    5  
ATOM 4577  H HA   . TYR A 1 10 ? -8.183  3.533   -3.590  1.00 0.00 ? 19 TYR S HA   5  
ATOM 4578  H HB2  . TYR A 1 10 ? -6.195  3.413   -1.304  1.00 0.00 ? 19 TYR S HB2  5  
ATOM 4579  H HB3  . TYR A 1 10 ? -6.938  4.912   -1.860  1.00 0.00 ? 19 TYR S HB3  5  
ATOM 4580  H HD1  . TYR A 1 10 ? -8.726  1.683   -1.707  1.00 0.00 ? 19 TYR S HD1  5  
ATOM 4581  H HD2  . TYR A 1 10 ? -8.087  5.436   0.230   1.00 0.00 ? 19 TYR S HD2  5  
ATOM 4582  H HE1  . TYR A 1 10 ? -10.662 1.266   -0.265  1.00 0.00 ? 19 TYR S HE1  5  
ATOM 4583  H HE2  . TYR A 1 10 ? -10.025 5.009   1.671   1.00 0.00 ? 19 TYR S HE2  5  
ATOM 4584  H HH   . TYR A 1 10 ? -11.561 1.952   1.852   1.00 0.00 ? 19 TYR S HH   5  
ATOM 4585  N N    . PRO A 1 11 ? -6.443  4.622   -5.079  1.00 0.00 ? 20 PRO S N    5  
ATOM 4586  C CA   . PRO A 1 11 ? -5.467  5.142   -6.045  1.00 0.00 ? 20 PRO S CA   5  
ATOM 4587  C C    . PRO A 1 11 ? -4.208  5.685   -5.378  1.00 0.00 ? 20 PRO S C    5  
ATOM 4588  O O    . PRO A 1 11 ? -4.223  6.760   -4.778  1.00 0.00 ? 20 PRO S O    5  
ATOM 4589  C CB   . PRO A 1 11 ? -6.223  6.268   -6.770  1.00 0.00 ? 20 PRO S CB   5  
ATOM 4590  C CG   . PRO A 1 11 ? -7.481  6.478   -5.995  1.00 0.00 ? 20 PRO S CG   5  
ATOM 4591  C CD   . PRO A 1 11 ? -7.781  5.174   -5.315  1.00 0.00 ? 20 PRO S CD   5  
ATOM 4592  H HA   . PRO A 1 11 ? -5.186  4.382   -6.759  1.00 0.00 ? 20 PRO S HA   5  
ATOM 4593  H HB2  . PRO A 1 11 ? -5.615  7.162   -6.779  1.00 0.00 ? 20 PRO S HB2  5  
ATOM 4594  H HB3  . PRO A 1 11 ? -6.435  5.962   -7.785  1.00 0.00 ? 20 PRO S HB3  5  
ATOM 4595  H HG2  . PRO A 1 11 ? -7.333  7.254   -5.262  1.00 0.00 ? 20 PRO S HG2  5  
ATOM 4596  H HG3  . PRO A 1 11 ? -8.285  6.744   -6.666  1.00 0.00 ? 20 PRO S HG3  5  
ATOM 4597  H HD2  . PRO A 1 11 ? -8.303  5.343   -4.384  1.00 0.00 ? 20 PRO S HD2  5  
ATOM 4598  H HD3  . PRO A 1 11 ? -8.356  4.530   -5.965  1.00 0.00 ? 20 PRO S HD3  5  
ATOM 4599  N N    . LEU A 1 12 ? -3.117  4.925   -5.486  1.00 0.00 ? 21 LEU S N    5  
ATOM 4600  C CA   . LEU A 1 12 ? -1.832  5.306   -4.895  1.00 0.00 ? 21 LEU S CA   5  
ATOM 4601  C C    . LEU A 1 12 ? -1.543  6.795   -5.061  1.00 0.00 ? 21 LEU S C    5  
ATOM 4602  O O    . LEU A 1 12 ? -0.980  7.430   -4.170  1.00 0.00 ? 21 LEU S O    5  
ATOM 4603  C CB   . LEU A 1 12 ? -0.699  4.497   -5.525  1.00 0.00 ? 21 LEU S CB   5  
ATOM 4604  C CG   . LEU A 1 12 ? -0.684  4.485   -7.058  1.00 0.00 ? 21 LEU S CG   5  
ATOM 4605  C CD1  . LEU A 1 12 ? 0.525   5.245   -7.588  1.00 0.00 ? 21 LEU S CD1  5  
ATOM 4606  C CD2  . LEU A 1 12 ? -0.686  3.056   -7.583  1.00 0.00 ? 21 LEU S CD2  5  
ATOM 4607  H H    . LEU A 1 12 ? -3.178  4.080   -5.978  1.00 0.00 ? 21 LEU S H    5  
ATOM 4608  H HA   . LEU A 1 12 ? -1.875  5.077   -3.843  1.00 0.00 ? 21 LEU S HA   5  
ATOM 4609  H HB2  . LEU A 1 12 ? 0.239   4.910   -5.178  1.00 0.00 ? 21 LEU S HB2  5  
ATOM 4610  H HB3  . LEU A 1 12 ? -0.776  3.478   -5.178  1.00 0.00 ? 21 LEU S HB3  5  
ATOM 4611  H HG   . LEU A 1 12 ? -1.573  4.977   -7.423  1.00 0.00 ? 21 LEU S HG   5  
ATOM 4612  H HD11 . LEU A 1 12 ? 0.909   5.894   -6.817  1.00 0.00 ? 21 LEU S HD11 5  
ATOM 4613  H HD12 . LEU A 1 12 ? 0.231   5.835   -8.444  1.00 0.00 ? 21 LEU S HD12 5  
ATOM 4614  H HD13 . LEU A 1 12 ? 1.290   4.542   -7.883  1.00 0.00 ? 21 LEU S HD13 5  
ATOM 4615  H HD21 . LEU A 1 12 ? -0.158  3.018   -8.525  1.00 0.00 ? 21 LEU S HD21 5  
ATOM 4616  H HD22 . LEU A 1 12 ? -1.705  2.728   -7.728  1.00 0.00 ? 21 LEU S HD22 5  
ATOM 4617  H HD23 . LEU A 1 12 ? -0.198  2.409   -6.869  1.00 0.00 ? 21 LEU S HD23 5  
ATOM 4618  N N    . ALA A 1 13 ? -1.925  7.345   -6.206  1.00 0.00 ? 22 ALA S N    5  
ATOM 4619  C CA   . ALA A 1 13 ? -1.698  8.757   -6.476  1.00 0.00 ? 22 ALA S CA   5  
ATOM 4620  C C    . ALA A 1 13 ? -2.475  9.625   -5.498  1.00 0.00 ? 22 ALA S C    5  
ATOM 4621  O O    . ALA A 1 13 ? -1.959  10.612  -4.973  1.00 0.00 ? 22 ALA S O    5  
ATOM 4622  C CB   . ALA A 1 13 ? -2.089  9.090   -7.908  1.00 0.00 ? 22 ALA S CB   5  
ATOM 4623  H H    . ALA A 1 13 ? -2.369  6.792   -6.881  1.00 0.00 ? 22 ALA S H    5  
ATOM 4624  H HA   . ALA A 1 13 ? -0.642  8.955   -6.360  1.00 0.00 ? 22 ALA S HA   5  
ATOM 4625  H HB1  . ALA A 1 13 ? -1.928  10.142  -8.090  1.00 0.00 ? 22 ALA S HB1  5  
ATOM 4626  H HB2  . ALA A 1 13 ? -3.134  8.856   -8.058  1.00 0.00 ? 22 ALA S HB2  5  
ATOM 4627  H HB3  . ALA A 1 13 ? -1.489  8.508   -8.590  1.00 0.00 ? 22 ALA S HB3  5  
ATOM 4628  N N    . ASP A 1 14 ? -3.725  9.248   -5.264  1.00 0.00 ? 23 ASP S N    5  
ATOM 4629  C CA   . ASP A 1 14 ? -4.594  9.987   -4.361  1.00 0.00 ? 23 ASP S CA   5  
ATOM 4630  C C    . ASP A 1 14 ? -4.113  9.905   -2.915  1.00 0.00 ? 23 ASP S C    5  
ATOM 4631  O O    . ASP A 1 14 ? -4.264  10.857  -2.150  1.00 0.00 ? 23 ASP S O    5  
ATOM 4632  C CB   . ASP A 1 14 ? -6.022  9.448   -4.455  1.00 0.00 ? 23 ASP S CB   5  
ATOM 4633  C CG   . ASP A 1 14 ? -6.819  10.104  -5.565  1.00 0.00 ? 23 ASP S CG   5  
ATOM 4634  O OD1  . ASP A 1 14 ? -6.202  10.549  -6.557  1.00 0.00 ? 23 ASP S OD1  5  
ATOM 4635  O OD2  . ASP A 1 14 ? -8.060  10.172  -5.444  1.00 0.00 ? 23 ASP S OD2  5  
ATOM 4636  H H    . ASP A 1 14 ? -4.076  8.454   -5.719  1.00 0.00 ? 23 ASP S H    5  
ATOM 4637  H HA   . ASP A 1 14 ? -4.589  11.019  -4.671  1.00 0.00 ? 23 ASP S HA   5  
ATOM 4638  H HB2  . ASP A 1 14 ? -5.982  8.385   -4.645  1.00 0.00 ? 23 ASP S HB2  5  
ATOM 4639  H HB3  . ASP A 1 14 ? -6.530  9.624   -3.516  1.00 0.00 ? 23 ASP S HB3  5  
ATOM 4640  N N    . LEU A 1 15 ? -3.554  8.763   -2.537  1.00 0.00 ? 24 LEU S N    5  
ATOM 4641  C CA   . LEU A 1 15 ? -3.079  8.569   -1.170  1.00 0.00 ? 24 LEU S CA   5  
ATOM 4642  C C    . LEU A 1 15 ? -1.635  9.009   -0.993  1.00 0.00 ? 24 LEU S C    5  
ATOM 4643  O O    . LEU A 1 15 ? -1.144  9.092   0.133   1.00 0.00 ? 24 LEU S O    5  
ATOM 4644  C CB   . LEU A 1 15 ? -3.195  7.103   -0.762  1.00 0.00 ? 24 LEU S CB   5  
ATOM 4645  C CG   . LEU A 1 15 ? -2.784  6.100   -1.840  1.00 0.00 ? 24 LEU S CG   5  
ATOM 4646  C CD1  . LEU A 1 15 ? -1.781  5.084   -1.299  1.00 0.00 ? 24 LEU S CD1  5  
ATOM 4647  C CD2  . LEU A 1 15 ? -4.010  5.403   -2.406  1.00 0.00 ? 24 LEU S CD2  5  
ATOM 4648  H H    . LEU A 1 15 ? -3.471  8.032   -3.185  1.00 0.00 ? 24 LEU S H    5  
ATOM 4649  H HA   . LEU A 1 15 ? -3.702  9.159   -0.520  1.00 0.00 ? 24 LEU S HA   5  
ATOM 4650  H HB2  . LEU A 1 15 ? -2.566  6.953   0.102   1.00 0.00 ? 24 LEU S HB2  5  
ATOM 4651  H HB3  . LEU A 1 15 ? -4.219  6.905   -0.483  1.00 0.00 ? 24 LEU S HB3  5  
ATOM 4652  H HG   . LEU A 1 15 ? -2.305  6.631   -2.647  1.00 0.00 ? 24 LEU S HG   5  
ATOM 4653  H HD11 . LEU A 1 15 ? -2.036  4.096   -1.658  1.00 0.00 ? 24 LEU S HD11 5  
ATOM 4654  H HD12 . LEU A 1 15 ? -1.808  5.090   -0.221  1.00 0.00 ? 24 LEU S HD12 5  
ATOM 4655  H HD13 . LEU A 1 15 ? -0.789  5.344   -1.634  1.00 0.00 ? 24 LEU S HD13 5  
ATOM 4656  H HD21 . LEU A 1 15 ? -4.682  6.139   -2.818  1.00 0.00 ? 24 LEU S HD21 5  
ATOM 4657  H HD22 . LEU A 1 15 ? -4.512  4.857   -1.622  1.00 0.00 ? 24 LEU S HD22 5  
ATOM 4658  H HD23 . LEU A 1 15 ? -3.704  4.719   -3.180  1.00 0.00 ? 24 LEU S HD23 5  
ATOM 4659  N N    . LEU A 1 16 ? -0.943  9.263   -2.092  1.00 0.00 ? 25 LEU S N    5  
ATOM 4660  C CA   . LEU A 1 16 ? 0.452   9.659   -2.012  1.00 0.00 ? 25 LEU S CA   5  
ATOM 4661  C C    . LEU A 1 16 ? 0.659   11.126  -2.380  1.00 0.00 ? 25 LEU S C    5  
ATOM 4662  O O    . LEU A 1 16 ? 1.794   11.566  -2.558  1.00 0.00 ? 25 LEU S O    5  
ATOM 4663  C CB   . LEU A 1 16 ? 1.301   8.745   -2.900  1.00 0.00 ? 25 LEU S CB   5  
ATOM 4664  C CG   . LEU A 1 16 ? 1.230   9.031   -4.403  1.00 0.00 ? 25 LEU S CG   5  
ATOM 4665  C CD1  . LEU A 1 16 ? 2.207   10.132  -4.788  1.00 0.00 ? 25 LEU S CD1  5  
ATOM 4666  C CD2  . LEU A 1 16 ? 1.517   7.767   -5.198  1.00 0.00 ? 25 LEU S CD2  5  
ATOM 4667  H H    . LEU A 1 16 ? -1.370  9.166   -2.972  1.00 0.00 ? 25 LEU S H    5  
ATOM 4668  H HA   . LEU A 1 16 ? 0.766   9.522   -0.988  1.00 0.00 ? 25 LEU S HA   5  
ATOM 4669  H HB2  . LEU A 1 16 ? 2.330   8.828   -2.587  1.00 0.00 ? 25 LEU S HB2  5  
ATOM 4670  H HB3  . LEU A 1 16 ? 0.973   7.725   -2.737  1.00 0.00 ? 25 LEU S HB3  5  
ATOM 4671  H HG   . LEU A 1 16 ? 0.233   9.366   -4.653  1.00 0.00 ? 25 LEU S HG   5  
ATOM 4672  H HD11 . LEU A 1 16 ? 2.584   9.946   -5.782  1.00 0.00 ? 25 LEU S HD11 5  
ATOM 4673  H HD12 . LEU A 1 16 ? 3.027   10.145  -4.087  1.00 0.00 ? 25 LEU S HD12 5  
ATOM 4674  H HD13 . LEU A 1 16 ? 1.700   11.086  -4.766  1.00 0.00 ? 25 LEU S HD13 5  
ATOM 4675  H HD21 . LEU A 1 16 ? 0.887   7.741   -6.075  1.00 0.00 ? 25 LEU S HD21 5  
ATOM 4676  H HD22 . LEU A 1 16 ? 1.312   6.901   -4.584  1.00 0.00 ? 25 LEU S HD22 5  
ATOM 4677  H HD23 . LEU A 1 16 ? 2.553   7.758   -5.499  1.00 0.00 ? 25 LEU S HD23 5  
ATOM 4678  N N    . ALA A 1 17 ? -0.429  11.895  -2.478  1.00 0.00 ? 26 ALA S N    5  
ATOM 4679  C CA   . ALA A 1 17 ? -0.300  13.319  -2.814  1.00 0.00 ? 26 ALA S CA   5  
ATOM 4680  C C    . ALA A 1 17 ? -1.640  14.045  -2.974  1.00 0.00 ? 26 ALA S C    5  
ATOM 4681  O O    . ALA A 1 17 ? -1.692  15.111  -3.589  1.00 0.00 ? 26 ALA S O    5  
ATOM 4682  C CB   . ALA A 1 17 ? 0.523   13.483  -4.083  1.00 0.00 ? 26 ALA S CB   5  
ATOM 4683  H H    . ALA A 1 17 ? -1.316  11.504  -2.313  1.00 0.00 ? 26 ALA S H    5  
ATOM 4684  H HA   . ALA A 1 17 ? 0.248   13.790  -2.011  1.00 0.00 ? 26 ALA S HA   5  
ATOM 4685  H HB1  . ALA A 1 17 ? 0.339   12.647  -4.741  1.00 0.00 ? 26 ALA S HB1  5  
ATOM 4686  H HB2  . ALA A 1 17 ? 1.573   13.517  -3.831  1.00 0.00 ? 26 ALA S HB2  5  
ATOM 4687  H HB3  . ALA A 1 17 ? 0.241   14.400  -4.578  1.00 0.00 ? 26 ALA S HB3  5  
ATOM 4688  N N    . ARG A 1 18 ? -2.722  13.496  -2.425  1.00 0.00 ? 27 ARG S N    5  
ATOM 4689  C CA   . ARG A 1 18 ? -4.027  14.147  -2.538  1.00 0.00 ? 27 ARG S CA   5  
ATOM 4690  C C    . ARG A 1 18 ? -4.920  13.819  -1.342  1.00 0.00 ? 27 ARG S C    5  
ATOM 4691  O O    . ARG A 1 18 ? -4.762  12.774  -0.716  1.00 0.00 ? 27 ARG S O    5  
ATOM 4692  C CB   . ARG A 1 18 ? -4.710  13.752  -3.860  1.00 0.00 ? 27 ARG S CB   5  
ATOM 4693  C CG   . ARG A 1 18 ? -5.936  12.852  -3.716  1.00 0.00 ? 27 ARG S CG   5  
ATOM 4694  C CD   . ARG A 1 18 ? -7.228  13.653  -3.698  1.00 0.00 ? 27 ARG S CD   5  
ATOM 4695  N NE   . ARG A 1 18 ? -8.117  13.275  -4.794  1.00 0.00 ? 27 ARG S NE   5  
ATOM 4696  C CZ   . ARG A 1 18 ? -9.427  13.514  -4.809  1.00 0.00 ? 27 ARG S CZ   5  
ATOM 4697  N NH1  . ARG A 1 18 ? -10.010 14.120  -3.782  1.00 0.00 ? 27 ARG S NH1  5  
ATOM 4698  N NH2  . ARG A 1 18 ? -10.156 13.144  -5.853  1.00 0.00 ? 27 ARG S NH2  5  
ATOM 4699  H H    . ARG A 1 18 ? -2.645  12.653  -1.936  1.00 0.00 ? 27 ARG S H    5  
ATOM 4700  H HA   . ARG A 1 18 ? -3.855  15.214  -2.546  1.00 0.00 ? 27 ARG S HA   5  
ATOM 4701  H HB2  . ARG A 1 18 ? -5.018  14.654  -4.369  1.00 0.00 ? 27 ARG S HB2  5  
ATOM 4702  H HB3  . ARG A 1 18 ? -3.987  13.238  -4.477  1.00 0.00 ? 27 ARG S HB3  5  
ATOM 4703  H HG2  . ARG A 1 18 ? -5.967  12.172  -4.550  1.00 0.00 ? 27 ARG S HG2  5  
ATOM 4704  H HG3  . ARG A 1 18 ? -5.856  12.288  -2.800  1.00 0.00 ? 27 ARG S HG3  5  
ATOM 4705  H HD2  . ARG A 1 18 ? -7.732  13.474  -2.759  1.00 0.00 ? 27 ARG S HD2  5  
ATOM 4706  H HD3  . ARG A 1 18 ? -6.988  14.702  -3.785  1.00 0.00 ? 27 ARG S HD3  5  
ATOM 4707  H HE   . ARG A 1 18 ? -7.714  12.821  -5.565  1.00 0.00 ? 27 ARG S HE   5  
ATOM 4708  H HH11 . ARG A 1 18 ? -9.467  14.401  -2.991  1.00 0.00 ? 27 ARG S HH11 5  
ATOM 4709  H HH12 . ARG A 1 18 ? -10.993 14.297  -3.800  1.00 0.00 ? 27 ARG S HH12 5  
ATOM 4710  H HH21 . ARG A 1 18 ? -9.722  12.686  -6.628  1.00 0.00 ? 27 ARG S HH21 5  
ATOM 4711  H HH22 . ARG A 1 18 ? -11.139 13.323  -5.863  1.00 0.00 ? 27 ARG S HH22 5  
ATOM 4712  N N    . PRO A 1 19 ? -5.884  14.707  -1.025  1.00 0.00 ? 28 PRO S N    5  
ATOM 4713  C CA   . PRO A 1 19 ? -6.825  14.505  0.082   1.00 0.00 ? 28 PRO S CA   5  
ATOM 4714  C C    . PRO A 1 19 ? -7.495  13.131  0.015   1.00 0.00 ? 28 PRO S C    5  
ATOM 4715  O O    . PRO A 1 19 ? -8.652  13.001  -0.382  1.00 0.00 ? 28 PRO S O    5  
ATOM 4716  C CB   . PRO A 1 19 ? -7.867  15.621  -0.105  1.00 0.00 ? 28 PRO S CB   5  
ATOM 4717  C CG   . PRO A 1 19 ? -7.605  16.192  -1.461  1.00 0.00 ? 28 PRO S CG   5  
ATOM 4718  C CD   . PRO A 1 19 ? -6.145  15.970  -1.726  1.00 0.00 ? 28 PRO S CD   5  
ATOM 4719  H HA   . PRO A 1 19 ? -6.338  14.618  1.040   1.00 0.00 ? 28 PRO S HA   5  
ATOM 4720  H HB2  . PRO A 1 19 ? -8.862  15.201  -0.042  1.00 0.00 ? 28 PRO S HB2  5  
ATOM 4721  H HB3  . PRO A 1 19 ? -7.735  16.369  0.667   1.00 0.00 ? 28 PRO S HB3  5  
ATOM 4722  H HG2  . PRO A 1 19 ? -8.202  15.678  -2.197  1.00 0.00 ? 28 PRO S HG2  5  
ATOM 4723  H HG3  . PRO A 1 19 ? -7.829  17.248  -1.464  1.00 0.00 ? 28 PRO S HG3  5  
ATOM 4724  H HD2  . PRO A 1 19 ? -5.960  15.873  -2.786  1.00 0.00 ? 28 PRO S HD2  5  
ATOM 4725  H HD3  . PRO A 1 19 ? -5.557  16.773  -1.307  1.00 0.00 ? 28 PRO S HD3  5  
ATOM 4726  N N    . LEU A 1 20 ? -6.733  12.115  0.401   1.00 0.00 ? 29 LEU S N    5  
ATOM 4727  C CA   . LEU A 1 20 ? -7.196  10.733  0.393   1.00 0.00 ? 29 LEU S CA   5  
ATOM 4728  C C    . LEU A 1 20 ? -8.168  10.447  1.540   1.00 0.00 ? 29 LEU S C    5  
ATOM 4729  O O    . LEU A 1 20 ? -8.098  11.068  2.599   1.00 0.00 ? 29 LEU S O    5  
ATOM 4730  C CB   . LEU A 1 20 ? -5.992  9.790   0.489   1.00 0.00 ? 29 LEU S CB   5  
ATOM 4731  C CG   . LEU A 1 20 ? -5.361  9.663   1.884   1.00 0.00 ? 29 LEU S CG   5  
ATOM 4732  C CD1  . LEU A 1 20 ? -4.175  8.709   1.851   1.00 0.00 ? 29 LEU S CD1  5  
ATOM 4733  C CD2  . LEU A 1 20 ? -4.927  11.023  2.410   1.00 0.00 ? 29 LEU S CD2  5  
ATOM 4734  H H    . LEU A 1 20 ? -5.818  12.301  0.688   1.00 0.00 ? 29 LEU S H    5  
ATOM 4735  H HA   . LEU A 1 20 ? -7.701  10.558  -0.544  1.00 0.00 ? 29 LEU S HA   5  
ATOM 4736  H HB2  . LEU A 1 20 ? -6.307  8.806   0.169   1.00 0.00 ? 29 LEU S HB2  5  
ATOM 4737  H HB3  . LEU A 1 20 ? -5.234  10.148  -0.193  1.00 0.00 ? 29 LEU S HB3  5  
ATOM 4738  H HG   . LEU A 1 20 ? -6.094  9.261   2.567   1.00 0.00 ? 29 LEU S HG   5  
ATOM 4739  H HD11 . LEU A 1 20 ? -4.455  7.805   1.331   1.00 0.00 ? 29 LEU S HD11 5  
ATOM 4740  H HD12 . LEU A 1 20 ? -3.880  8.468   2.862   1.00 0.00 ? 29 LEU S HD12 5  
ATOM 4741  H HD13 . LEU A 1 20 ? -3.348  9.179   1.340   1.00 0.00 ? 29 LEU S HD13 5  
ATOM 4742  H HD21 . LEU A 1 20 ? -5.797  11.640  2.577   1.00 0.00 ? 29 LEU S HD21 5  
ATOM 4743  H HD22 . LEU A 1 20 ? -4.279  11.498  1.689   1.00 0.00 ? 29 LEU S HD22 5  
ATOM 4744  H HD23 . LEU A 1 20 ? -4.394  10.894  3.342   1.00 0.00 ? 29 LEU S HD23 5  
ATOM 4745  N N    . PRO A 1 21 ? -9.084  9.482   1.330   1.00 0.00 ? 30 PRO S N    5  
ATOM 4746  C CA   . PRO A 1 21 ? -10.073 9.084   2.338   1.00 0.00 ? 30 PRO S CA   5  
ATOM 4747  C C    . PRO A 1 21 ? -9.416  8.496   3.577   1.00 0.00 ? 30 PRO S C    5  
ATOM 4748  O O    . PRO A 1 21 ? -8.227  8.707   3.819   1.00 0.00 ? 30 PRO S O    5  
ATOM 4749  C CB   . PRO A 1 21 ? -10.915 8.023   1.618   1.00 0.00 ? 30 PRO S CB   5  
ATOM 4750  C CG   . PRO A 1 21 ? -10.033 7.513   0.535   1.00 0.00 ? 30 PRO S CG   5  
ATOM 4751  C CD   . PRO A 1 21 ? -9.217  8.690   0.093   1.00 0.00 ? 30 PRO S CD   5  
ATOM 4752  H HA   . PRO A 1 21 ? -10.702 9.913   2.628   1.00 0.00 ? 30 PRO S HA   5  
ATOM 4753  H HB2  . PRO A 1 21 ? -11.184 7.238   2.310   1.00 0.00 ? 30 PRO S HB2  5  
ATOM 4754  H HB3  . PRO A 1 21 ? -11.809 8.480   1.215   1.00 0.00 ? 30 PRO S HB3  5  
ATOM 4755  H HG2  . PRO A 1 21 ? -9.389  6.734   0.921   1.00 0.00 ? 30 PRO S HG2  5  
ATOM 4756  H HG3  . PRO A 1 21 ? -10.631 7.141   -0.286  1.00 0.00 ? 30 PRO S HG3  5  
ATOM 4757  H HD2  . PRO A 1 21 ? -8.250  8.368   -0.268  1.00 0.00 ? 30 PRO S HD2  5  
ATOM 4758  H HD3  . PRO A 1 21 ? -9.742  9.250   -0.664  1.00 0.00 ? 30 PRO S HD3  5  
ATOM 4759  N N    . GLU A 1 22 ? -10.192 7.764   4.364   1.00 0.00 ? 31 GLU S N    5  
ATOM 4760  C CA   . GLU A 1 22 ? -9.671  7.158   5.583   1.00 0.00 ? 31 GLU S CA   5  
ATOM 4761  C C    . GLU A 1 22 ? -9.402  5.673   5.411   1.00 0.00 ? 31 GLU S C    5  
ATOM 4762  O O    . GLU A 1 22 ? -8.651  5.090   6.194   1.00 0.00 ? 31 GLU S O    5  
ATOM 4763  C CB   . GLU A 1 22 ? -10.623 7.395   6.757   1.00 0.00 ? 31 GLU S CB   5  
ATOM 4764  C CG   . GLU A 1 22 ? -10.093 6.883   8.085   1.00 0.00 ? 31 GLU S CG   5  
ATOM 4765  C CD   . GLU A 1 22 ? -8.894  7.670   8.576   1.00 0.00 ? 31 GLU S CD   5  
ATOM 4766  O OE1  . GLU A 1 22 ? -7.801  7.513   7.990   1.00 0.00 ? 31 GLU S OE1  5  
ATOM 4767  O OE2  . GLU A 1 22 ? -9.046  8.441   9.546   1.00 0.00 ? 31 GLU S OE2  5  
ATOM 4768  H H    . GLU A 1 22 ? -11.132 7.637   4.126   1.00 0.00 ? 31 GLU S H    5  
ATOM 4769  H HA   . GLU A 1 22 ? -8.724  7.631   5.796   1.00 0.00 ? 31 GLU S HA   5  
ATOM 4770  H HB2  . GLU A 1 22 ? -10.804 8.455   6.850   1.00 0.00 ? 31 GLU S HB2  5  
ATOM 4771  H HB3  . GLU A 1 22 ? -11.560 6.897   6.551   1.00 0.00 ? 31 GLU S HB3  5  
ATOM 4772  H HG2  . GLU A 1 22 ? -10.877 6.955   8.823   1.00 0.00 ? 31 GLU S HG2  5  
ATOM 4773  H HG3  . GLU A 1 22 ? -9.804  5.849   7.968   1.00 0.00 ? 31 GLU S HG3  5  
ATOM 4774  N N    . GLY A 1 23 ? -9.970  5.059   4.374   1.00 0.00 ? 32 GLY S N    5  
ATOM 4775  C CA   . GLY A 1 23 ? -9.698  3.652   4.141   1.00 0.00 ? 32 GLY S CA   5  
ATOM 4776  C C    . GLY A 1 23 ? -8.201  3.407   4.155   1.00 0.00 ? 32 GLY S C    5  
ATOM 4777  O O    . GLY A 1 23 ? -7.728  2.326   4.504   1.00 0.00 ? 32 GLY S O    5  
ATOM 4778  H H    . GLY A 1 23 ? -10.536 5.565   3.755   1.00 0.00 ? 32 GLY S H    5  
ATOM 4779  H HA2  . GLY A 1 23 ? -10.165 3.065   4.922   1.00 0.00 ? 32 GLY S HA2  5  
ATOM 4780  H HA3  . GLY A 1 23 ? -10.096 3.362   3.183   1.00 0.00 ? 32 GLY S HA3  5  
ATOM 4781  N N    . VAL A 1 24 ? -7.463  4.459   3.801   1.00 0.00 ? 33 VAL S N    5  
ATOM 4782  C CA   . VAL A 1 24 ? -6.013  4.439   3.788   1.00 0.00 ? 33 VAL S CA   5  
ATOM 4783  C C    . VAL A 1 24 ? -5.472  4.662   5.191   1.00 0.00 ? 33 VAL S C    5  
ATOM 4784  O O    . VAL A 1 24 ? -5.804  5.658   5.834   1.00 0.00 ? 33 VAL S O    5  
ATOM 4785  C CB   . VAL A 1 24 ? -5.450  5.567   2.902   1.00 0.00 ? 33 VAL S CB   5  
ATOM 4786  C CG1  . VAL A 1 24 ? -5.737  5.317   1.434   1.00 0.00 ? 33 VAL S CG1  5  
ATOM 4787  C CG2  . VAL A 1 24 ? -6.018  6.909   3.340   1.00 0.00 ? 33 VAL S CG2  5  
ATOM 4788  H H    . VAL A 1 24 ? -7.918  5.292   3.558   1.00 0.00 ? 33 VAL S H    5  
ATOM 4789  H HA   . VAL A 1 24 ? -5.677  3.488   3.407   1.00 0.00 ? 33 VAL S HA   5  
ATOM 4790  H HB   . VAL A 1 24 ? -4.379  5.599   3.034   1.00 0.00 ? 33 VAL S HB   5  
ATOM 4791  H HG11 . VAL A 1 24 ? -4.859  5.555   0.854   1.00 0.00 ? 33 VAL S HG11 5  
ATOM 4792  H HG12 . VAL A 1 24 ? -6.556  5.944   1.118   1.00 0.00 ? 33 VAL S HG12 5  
ATOM 4793  H HG13 . VAL A 1 24 ? -5.996  4.280   1.288   1.00 0.00 ? 33 VAL S HG13 5  
ATOM 4794  H HG21 . VAL A 1 24 ? -6.790  6.754   4.079   1.00 0.00 ? 33 VAL S HG21 5  
ATOM 4795  H HG22 . VAL A 1 24 ? -6.438  7.420   2.486   1.00 0.00 ? 33 VAL S HG22 5  
ATOM 4796  H HG23 . VAL A 1 24 ? -5.231  7.511   3.768   1.00 0.00 ? 33 VAL S HG23 5  
ATOM 4797  N N    . ASP A 1 25 ? -4.619  3.766   5.661   1.00 0.00 ? 34 ASP S N    5  
ATOM 4798  C CA   . ASP A 1 25 ? -4.031  3.929   6.977   1.00 0.00 ? 34 ASP S CA   5  
ATOM 4799  C C    . ASP A 1 25 ? -2.670  4.607   6.830   1.00 0.00 ? 34 ASP S C    5  
ATOM 4800  O O    . ASP A 1 25 ? -1.704  3.978   6.401   1.00 0.00 ? 34 ASP S O    5  
ATOM 4801  C CB   . ASP A 1 25 ? -3.888  2.575   7.674   1.00 0.00 ? 34 ASP S CB   5  
ATOM 4802  C CG   . ASP A 1 25 ? -5.222  2.016   8.128   1.00 0.00 ? 34 ASP S CG   5  
ATOM 4803  O OD1  . ASP A 1 25 ? -5.907  1.372   7.305   1.00 0.00 ? 34 ASP S OD1  5  
ATOM 4804  O OD2  . ASP A 1 25 ? -5.581  2.221   9.307   1.00 0.00 ? 34 ASP S OD2  5  
ATOM 4805  H H    . ASP A 1 25 ? -4.360  3.001   5.108   1.00 0.00 ? 34 ASP S H    5  
ATOM 4806  H HA   . ASP A 1 25 ? -4.693  4.565   7.552   1.00 0.00 ? 34 ASP S HA   5  
ATOM 4807  H HB2  . ASP A 1 25 ? -3.440  1.871   6.988   1.00 0.00 ? 34 ASP S HB2  5  
ATOM 4808  H HB3  . ASP A 1 25 ? -3.251  2.690   8.540   1.00 0.00 ? 34 ASP S HB3  5  
ATOM 4809  N N    . PRO A 1 26 ? -2.580  5.913   7.148   1.00 0.00 ? 35 PRO S N    5  
ATOM 4810  C CA   . PRO A 1 26 ? -1.343  6.683   7.016   1.00 0.00 ? 35 PRO S CA   5  
ATOM 4811  C C    . PRO A 1 26 ? -0.091  5.910   7.436   1.00 0.00 ? 35 PRO S C    5  
ATOM 4812  O O    . PRO A 1 26 ? 0.934   5.966   6.757   1.00 0.00 ? 35 PRO S O    5  
ATOM 4813  C CB   . PRO A 1 26 ? -1.561  7.896   7.936   1.00 0.00 ? 35 PRO S CB   5  
ATOM 4814  C CG   . PRO A 1 26 ? -2.951  7.766   8.486   1.00 0.00 ? 35 PRO S CG   5  
ATOM 4815  C CD   . PRO A 1 26 ? -3.671  6.761   7.631   1.00 0.00 ? 35 PRO S CD   5  
ATOM 4816  H HA   . PRO A 1 26 ? -1.215  7.028   5.998   1.00 0.00 ? 35 PRO S HA   5  
ATOM 4817  H HB2  . PRO A 1 26 ? -0.828  7.881   8.729   1.00 0.00 ? 35 PRO S HB2  5  
ATOM 4818  H HB3  . PRO A 1 26 ? -1.455  8.804   7.360   1.00 0.00 ? 35 PRO S HB3  5  
ATOM 4819  H HG2  . PRO A 1 26 ? -2.907  7.418   9.507   1.00 0.00 ? 35 PRO S HG2  5  
ATOM 4820  H HG3  . PRO A 1 26 ? -3.451  8.721   8.439   1.00 0.00 ? 35 PRO S HG3  5  
ATOM 4821  H HD2  . PRO A 1 26 ? -4.372  6.196   8.227   1.00 0.00 ? 35 PRO S HD2  5  
ATOM 4822  H HD3  . PRO A 1 26 ? -4.174  7.253   6.810   1.00 0.00 ? 35 PRO S HD3  5  
ATOM 4823  N N    . LEU A 1 27 ? -0.169  5.206   8.560   1.00 0.00 ? 36 LEU S N    5  
ATOM 4824  C CA   . LEU A 1 27 ? 0.978   4.451   9.055   1.00 0.00 ? 36 LEU S CA   5  
ATOM 4825  C C    . LEU A 1 27 ? 1.241   3.195   8.218   1.00 0.00 ? 36 LEU S C    5  
ATOM 4826  O O    . LEU A 1 27 ? 2.351   2.666   8.226   1.00 0.00 ? 36 LEU S O    5  
ATOM 4827  C CB   . LEU A 1 27 ? 0.807   4.101   10.545  1.00 0.00 ? 36 LEU S CB   5  
ATOM 4828  C CG   . LEU A 1 27 ? -0.190  2.983   10.879  1.00 0.00 ? 36 LEU S CG   5  
ATOM 4829  C CD1  . LEU A 1 27 ? -1.568  3.293   10.317  1.00 0.00 ? 36 LEU S CD1  5  
ATOM 4830  C CD2  . LEU A 1 27 ? 0.307   1.643   10.366  1.00 0.00 ? 36 LEU S CD2  5  
ATOM 4831  H H    . LEU A 1 27 ? -1.003  5.208   9.069   1.00 0.00 ? 36 LEU S H    5  
ATOM 4832  H HA   . LEU A 1 27 ? 1.840   5.095   8.959   1.00 0.00 ? 36 LEU S HA   5  
ATOM 4833  H HB2  . LEU A 1 27 ? 1.773   3.809   10.932  1.00 0.00 ? 36 LEU S HB2  5  
ATOM 4834  H HB3  . LEU A 1 27 ? 0.490   4.997   11.061  1.00 0.00 ? 36 LEU S HB3  5  
ATOM 4835  H HG   . LEU A 1 27 ? -0.284  2.912   11.954  1.00 0.00 ? 36 LEU S HG   5  
ATOM 4836  H HD11 . LEU A 1 27 ? -1.892  4.262   10.670  1.00 0.00 ? 36 LEU S HD11 5  
ATOM 4837  H HD12 . LEU A 1 27 ? -2.268  2.539   10.644  1.00 0.00 ? 36 LEU S HD12 5  
ATOM 4838  H HD13 . LEU A 1 27 ? -1.523  3.299   9.239   1.00 0.00 ? 36 LEU S HD13 5  
ATOM 4839  H HD21 . LEU A 1 27 ? 0.101   0.877   11.097  1.00 0.00 ? 36 LEU S HD21 5  
ATOM 4840  H HD22 . LEU A 1 27 ? 1.373   1.697   10.189  1.00 0.00 ? 36 LEU S HD22 5  
ATOM 4841  H HD23 . LEU A 1 27 ? -0.198  1.409   9.445   1.00 0.00 ? 36 LEU S HD23 5  
ATOM 4842  N N    . LYS A 1 28 ? 0.227   2.726   7.492   1.00 0.00 ? 37 LYS S N    5  
ATOM 4843  C CA   . LYS A 1 28 ? 0.378   1.541   6.648   1.00 0.00 ? 37 LYS S CA   5  
ATOM 4844  C C    . LYS A 1 28 ? -0.330  1.736   5.309   1.00 0.00 ? 37 LYS S C    5  
ATOM 4845  O O    . LYS A 1 28 ? -1.527  1.476   5.188   1.00 0.00 ? 37 LYS S O    5  
ATOM 4846  C CB   . LYS A 1 28 ? -0.167  0.293   7.348   1.00 0.00 ? 37 LYS S CB   5  
ATOM 4847  C CG   . LYS A 1 28 ? -1.610  0.430   7.806   1.00 0.00 ? 37 LYS S CG   5  
ATOM 4848  C CD   . LYS A 1 28 ? -1.949  -0.581  8.891   1.00 0.00 ? 37 LYS S CD   5  
ATOM 4849  C CE   . LYS A 1 28 ? -1.778  -2.008  8.398   1.00 0.00 ? 37 LYS S CE   5  
ATOM 4850  N NZ   . LYS A 1 28 ? -1.190  -2.892  9.443   1.00 0.00 ? 37 LYS S NZ   5  
ATOM 4851  H H    . LYS A 1 28 ? -0.635  3.191   7.515   1.00 0.00 ? 37 LYS S H    5  
ATOM 4852  H HA   . LYS A 1 28 ? 1.429   1.405   6.463   1.00 0.00 ? 37 LYS S HA   5  
ATOM 4853  H HB2  . LYS A 1 28 ? -0.105  -0.543  6.667   1.00 0.00 ? 37 LYS S HB2  5  
ATOM 4854  H HB3  . LYS A 1 28 ? 0.445   0.086   8.216   1.00 0.00 ? 37 LYS S HB3  5  
ATOM 4855  H HG2  . LYS A 1 28 ? -1.759  1.425   8.198   1.00 0.00 ? 37 LYS S HG2  5  
ATOM 4856  H HG3  . LYS A 1 28 ? -2.265  0.273   6.962   1.00 0.00 ? 37 LYS S HG3  5  
ATOM 4857  H HD2  . LYS A 1 28 ? -1.294  -0.422  9.734   1.00 0.00 ? 37 LYS S HD2  5  
ATOM 4858  H HD3  . LYS A 1 28 ? -2.974  -0.434  9.198   1.00 0.00 ? 37 LYS S HD3  5  
ATOM 4859  H HE2  . LYS A 1 28 ? -2.746  -2.396  8.116   1.00 0.00 ? 37 LYS S HE2  5  
ATOM 4860  H HE3  . LYS A 1 28 ? -1.130  -2.003  7.535   1.00 0.00 ? 37 LYS S HE3  5  
ATOM 4861  H HZ1  . LYS A 1 28 ? -1.726  -2.802  10.330  1.00 0.00 ? 37 LYS S HZ1  5  
ATOM 4862  H HZ2  . LYS A 1 28 ? -0.200  -2.624  9.619   1.00 0.00 ? 37 LYS S HZ2  5  
ATOM 4863  H HZ3  . LYS A 1 28 ? -1.219  -3.882  9.133   1.00 0.00 ? 37 LYS S HZ3  5  
ATOM 4864  N N    . LEU A 1 29 ? 0.411   2.211   4.311   1.00 0.00 ? 38 LEU S N    5  
ATOM 4865  C CA   . LEU A 1 29 ? -0.159  2.452   2.991   1.00 0.00 ? 38 LEU S CA   5  
ATOM 4866  C C    . LEU A 1 29 ? -0.099  1.213   2.097   1.00 0.00 ? 38 LEU S C    5  
ATOM 4867  O O    . LEU A 1 29 ? -1.097  0.829   1.489   1.00 0.00 ? 38 LEU S O    5  
ATOM 4868  C CB   . LEU A 1 29 ? 0.543   3.629   2.311   1.00 0.00 ? 38 LEU S CB   5  
ATOM 4869  C CG   . LEU A 1 29 ? 0.653   4.916   3.148   1.00 0.00 ? 38 LEU S CG   5  
ATOM 4870  C CD1  . LEU A 1 29 ? 0.886   6.112   2.239   1.00 0.00 ? 38 LEU S CD1  5  
ATOM 4871  C CD2  . LEU A 1 29 ? -0.593  5.144   4.002   1.00 0.00 ? 38 LEU S CD2  5  
ATOM 4872  H H    . LEU A 1 29 ? 1.359   2.410   4.468   1.00 0.00 ? 38 LEU S H    5  
ATOM 4873  H HA   . LEU A 1 29 ? -1.191  2.708   3.133   1.00 0.00 ? 38 LEU S HA   5  
ATOM 4874  H HB2  . LEU A 1 29 ? 1.544   3.316   2.046   1.00 0.00 ? 38 LEU S HB2  5  
ATOM 4875  H HB3  . LEU A 1 29 ? 0.005   3.865   1.404   1.00 0.00 ? 38 LEU S HB3  5  
ATOM 4876  H HG   . LEU A 1 29 ? 1.503   4.833   3.810   1.00 0.00 ? 38 LEU S HG   5  
ATOM 4877  H HD11 . LEU A 1 29 ? 1.670   5.880   1.534   1.00 0.00 ? 38 LEU S HD11 5  
ATOM 4878  H HD12 . LEU A 1 29 ? 1.176   6.965   2.835   1.00 0.00 ? 38 LEU S HD12 5  
ATOM 4879  H HD13 . LEU A 1 29 ? -0.024  6.339   1.704   1.00 0.00 ? 38 LEU S HD13 5  
ATOM 4880  H HD21 . LEU A 1 29 ? -1.094  4.206   4.182   1.00 0.00 ? 38 LEU S HD21 5  
ATOM 4881  H HD22 . LEU A 1 29 ? -1.262  5.818   3.489   1.00 0.00 ? 38 LEU S HD22 5  
ATOM 4882  H HD23 . LEU A 1 29 ? -0.304  5.580   4.947   1.00 0.00 ? 38 LEU S HD23 5  
ATOM 4883  N N    . GLU A 1 30 ? 1.080   0.608   2.006   1.00 0.00 ? 39 GLU S N    5  
ATOM 4884  C CA   . GLU A 1 30 ? 1.280   -0.574  1.168   1.00 0.00 ? 39 GLU S CA   5  
ATOM 4885  C C    . GLU A 1 30 ? 0.223   -1.653  1.410   1.00 0.00 ? 39 GLU S C    5  
ATOM 4886  O O    . GLU A 1 30 ? 0.034   -2.538  0.574   1.00 0.00 ? 39 GLU S O    5  
ATOM 4887  C CB   . GLU A 1 30 ? 2.670   -1.153  1.417   1.00 0.00 ? 39 GLU S CB   5  
ATOM 4888  C CG   . GLU A 1 30 ? 2.999   -1.330  2.891   1.00 0.00 ? 39 GLU S CG   5  
ATOM 4889  C CD   . GLU A 1 30 ? 3.528   -2.713  3.211   1.00 0.00 ? 39 GLU S CD   5  
ATOM 4890  O OE1  . GLU A 1 30 ? 3.016   -3.694  2.632   1.00 0.00 ? 39 GLU S OE1  5  
ATOM 4891  O OE2  . GLU A 1 30 ? 4.455   -2.816  4.042   1.00 0.00 ? 39 GLU S OE2  5  
ATOM 4892  H H    . GLU A 1 30 ? 1.842   0.969   2.503   1.00 0.00 ? 39 GLU S H    5  
ATOM 4893  H HA   . GLU A 1 30 ? 1.220   -0.258  0.140   1.00 0.00 ? 39 GLU S HA   5  
ATOM 4894  H HB2  . GLU A 1 30 ? 2.738   -2.120  0.936   1.00 0.00 ? 39 GLU S HB2  5  
ATOM 4895  H HB3  . GLU A 1 30 ? 3.406   -0.491  0.983   1.00 0.00 ? 39 GLU S HB3  5  
ATOM 4896  H HG2  . GLU A 1 30 ? 3.745   -0.601  3.170   1.00 0.00 ? 39 GLU S HG2  5  
ATOM 4897  H HG3  . GLU A 1 30 ? 2.101   -1.160  3.468   1.00 0.00 ? 39 GLU S HG3  5  
ATOM 4898  N N    . ILE A 1 31 ? -0.448  -1.597  2.554   1.00 0.00 ? 40 ILE S N    5  
ATOM 4899  C CA   . ILE A 1 31 ? -1.459  -2.594  2.891   1.00 0.00 ? 40 ILE S CA   5  
ATOM 4900  C C    . ILE A 1 31 ? -2.735  -2.447  2.062   1.00 0.00 ? 40 ILE S C    5  
ATOM 4901  O O    . ILE A 1 31 ? -3.400  -3.442  1.771   1.00 0.00 ? 40 ILE S O    5  
ATOM 4902  C CB   . ILE A 1 31 ? -1.832  -2.529  4.383   1.00 0.00 ? 40 ILE S CB   5  
ATOM 4903  C CG1  . ILE A 1 31 ? -2.256  -1.111  4.765   1.00 0.00 ? 40 ILE S CG1  5  
ATOM 4904  C CG2  . ILE A 1 31 ? -0.664  -2.992  5.243   1.00 0.00 ? 40 ILE S CG2  5  
ATOM 4905  C CD1  . ILE A 1 31 ? -3.646  -1.034  5.354   1.00 0.00 ? 40 ILE S CD1  5  
ATOM 4906  H H    . ILE A 1 31 ? -0.247  -0.885  3.194   1.00 0.00 ? 40 ILE S H    5  
ATOM 4907  H HA   . ILE A 1 31 ? -1.035  -3.567  2.698   1.00 0.00 ? 40 ILE S HA   5  
ATOM 4908  H HB   . ILE A 1 31 ? -2.659  -3.203  4.553   1.00 0.00 ? 40 ILE S HB   5  
ATOM 4909  H HG12 . ILE A 1 31 ? -1.567  -0.720  5.494   1.00 0.00 ? 40 ILE S HG12 5  
ATOM 4910  H HG13 . ILE A 1 31 ? -2.234  -0.485  3.885   1.00 0.00 ? 40 ILE S HG13 5  
ATOM 4911  H HG21 . ILE A 1 31 ? -1.040  -3.436  6.152   1.00 0.00 ? 40 ILE S HG21 5  
ATOM 4912  H HG22 . ILE A 1 31 ? -0.040  -2.147  5.486   1.00 0.00 ? 40 ILE S HG22 5  
ATOM 4913  H HG23 . ILE A 1 31 ? -0.085  -3.724  4.698   1.00 0.00 ? 40 ILE S HG23 5  
ATOM 4914  H HD11 . ILE A 1 31 ? -3.599  -1.230  6.415   1.00 0.00 ? 40 ILE S HD11 5  
ATOM 4915  H HD12 . ILE A 1 31 ? -4.281  -1.768  4.880   1.00 0.00 ? 40 ILE S HD12 5  
ATOM 4916  H HD13 . ILE A 1 31 ? -4.053  -0.046  5.189   1.00 0.00 ? 40 ILE S HD13 5  
ATOM 4917  N N    . TYR A 1 32 ? -3.096  -1.217  1.694   1.00 0.00 ? 41 TYR S N    5  
ATOM 4918  C CA   . TYR A 1 32 ? -4.316  -1.004  0.919   1.00 0.00 ? 41 TYR S CA   5  
ATOM 4919  C C    . TYR A 1 32 ? -4.046  -0.803  -0.566  1.00 0.00 ? 41 TYR S C    5  
ATOM 4920  O O    . TYR A 1 32 ? -4.769  -0.067  -1.235  1.00 0.00 ? 41 TYR S O    5  
ATOM 4921  C CB   . TYR A 1 32 ? -5.130  0.173   1.469   1.00 0.00 ? 41 TYR S CB   5  
ATOM 4922  C CG   . TYR A 1 32 ? -4.400  1.490   1.546   1.00 0.00 ? 41 TYR S CG   5  
ATOM 4923  C CD1  . TYR A 1 32 ? -4.235  2.284   0.423   1.00 0.00 ? 41 TYR S CD1  5  
ATOM 4924  C CD2  . TYR A 1 32 ? -3.907  1.956   2.758   1.00 0.00 ? 41 TYR S CD2  5  
ATOM 4925  C CE1  . TYR A 1 32 ? -3.600  3.503   0.505   1.00 0.00 ? 41 TYR S CE1  5  
ATOM 4926  C CE2  . TYR A 1 32 ? -3.267  3.172   2.845   1.00 0.00 ? 41 TYR S CE2  5  
ATOM 4927  C CZ   . TYR A 1 32 ? -3.116  3.943   1.716   1.00 0.00 ? 41 TYR S CZ   5  
ATOM 4928  O OH   . TYR A 1 32 ? -2.485  5.163   1.802   1.00 0.00 ? 41 TYR S OH   5  
ATOM 4929  H H    . TYR A 1 32 ? -2.547  -0.450  1.958   1.00 0.00 ? 41 TYR S H    5  
ATOM 4930  H HA   . TYR A 1 32 ? -4.916  -1.897  1.023   1.00 0.00 ? 41 TYR S HA   5  
ATOM 4931  H HB2  . TYR A 1 32 ? -5.997  0.321   0.841   1.00 0.00 ? 41 TYR S HB2  5  
ATOM 4932  H HB3  . TYR A 1 32 ? -5.458  -0.069  2.463   1.00 0.00 ? 41 TYR S HB3  5  
ATOM 4933  H HD1  . TYR A 1 32 ? -4.613  1.939   -0.526  1.00 0.00 ? 41 TYR S HD1  5  
ATOM 4934  H HD2  . TYR A 1 32 ? -4.025  1.348   3.642   1.00 0.00 ? 41 TYR S HD2  5  
ATOM 4935  H HE1  . TYR A 1 32 ? -3.487  4.107   -0.376  1.00 0.00 ? 41 TYR S HE1  5  
ATOM 4936  H HE2  . TYR A 1 32 ? -2.890  3.517   3.795   1.00 0.00 ? 41 TYR S HE2  5  
ATOM 4937  H HH   . TYR A 1 32 ? -1.539  5.041   1.703   1.00 0.00 ? 41 TYR S HH   5  
ATOM 4938  N N    . LEU A 1 33 ? -3.026  -1.474  -1.095  1.00 0.00 ? 42 LEU S N    5  
ATOM 4939  C CA   . LEU A 1 33 ? -2.721  -1.364  -2.516  1.00 0.00 ? 42 LEU S CA   5  
ATOM 4940  C C    . LEU A 1 33 ? -2.374  -2.720  -3.107  1.00 0.00 ? 42 LEU S C    5  
ATOM 4941  O O    . LEU A 1 33 ? -1.456  -3.391  -2.641  1.00 0.00 ? 42 LEU S O    5  
ATOM 4942  C CB   . LEU A 1 33 ? -1.576  -0.381  -2.769  1.00 0.00 ? 42 LEU S CB   5  
ATOM 4943  C CG   . LEU A 1 33 ? -0.501  -0.306  -1.682  1.00 0.00 ? 42 LEU S CG   5  
ATOM 4944  C CD1  . LEU A 1 33 ? 0.734   -1.093  -2.098  1.00 0.00 ? 42 LEU S CD1  5  
ATOM 4945  C CD2  . LEU A 1 33 ? -0.140  1.146   -1.397  1.00 0.00 ? 42 LEU S CD2  5  
ATOM 4946  H H    . LEU A 1 33 ? -2.484  -2.069  -0.527  1.00 0.00 ? 42 LEU S H    5  
ATOM 4947  H HA   . LEU A 1 33 ? -3.605  -0.997  -3.007  1.00 0.00 ? 42 LEU S HA   5  
ATOM 4948  H HB2  . LEU A 1 33 ? -1.094  -0.664  -3.696  1.00 0.00 ? 42 LEU S HB2  5  
ATOM 4949  H HB3  . LEU A 1 33 ? -2.002  0.602   -2.897  1.00 0.00 ? 42 LEU S HB3  5  
ATOM 4950  H HG   . LEU A 1 33 ? -0.884  -0.742  -0.771  1.00 0.00 ? 42 LEU S HG   5  
ATOM 4951  H HD11 . LEU A 1 33 ? 1.018   -1.764  -1.301  1.00 0.00 ? 42 LEU S HD11 5  
ATOM 4952  H HD12 . LEU A 1 33 ? 1.547   -0.410  -2.299  1.00 0.00 ? 42 LEU S HD12 5  
ATOM 4953  H HD13 . LEU A 1 33 ? 0.516   -1.662  -2.989  1.00 0.00 ? 42 LEU S HD13 5  
ATOM 4954  H HD21 . LEU A 1 33 ? 0.710   1.430   -2.001  1.00 0.00 ? 42 LEU S HD21 5  
ATOM 4955  H HD22 . LEU A 1 33 ? 0.107   1.258   -0.353  1.00 0.00 ? 42 LEU S HD22 5  
ATOM 4956  H HD23 . LEU A 1 33 ? -0.980  1.780   -1.638  1.00 0.00 ? 42 LEU S HD23 5  
ATOM 4957  N N    . THR A 1 34 ? -3.109  -3.115  -4.144  1.00 0.00 ? 43 THR S N    5  
ATOM 4958  C CA   . THR A 1 34 ? -2.858  -4.392  -4.798  1.00 0.00 ? 43 THR S CA   5  
ATOM 4959  C C    . THR A 1 34 ? -1.504  -4.363  -5.501  1.00 0.00 ? 43 THR S C    5  
ATOM 4960  O O    . THR A 1 34 ? -0.780  -3.379  -5.420  1.00 0.00 ? 43 THR S O    5  
ATOM 4961  C CB   . THR A 1 34 ? -3.962  -4.711  -5.810  1.00 0.00 ? 43 THR S CB   5  
ATOM 4962  O OG1  . THR A 1 34 ? -4.291  -3.565  -6.575  1.00 0.00 ? 43 THR S OG1  5  
ATOM 4963  C CG2  . THR A 1 34 ? -5.235  -5.221  -5.168  1.00 0.00 ? 43 THR S CG2  5  
ATOM 4964  H H    . THR A 1 34 ? -3.831  -2.533  -4.475  1.00 0.00 ? 43 THR S H    5  
ATOM 4965  H HA   . THR A 1 34 ? -2.841  -5.159  -4.039  1.00 0.00 ? 43 THR S HA   5  
ATOM 4966  H HB   . THR A 1 34 ? -3.606  -5.476  -6.486  1.00 0.00 ? 43 THR S HB   5  
ATOM 4967  H HG1  . THR A 1 34 ? -4.979  -3.788  -7.206  1.00 0.00 ? 43 THR S HG1  5  
ATOM 4968  H HG21 . THR A 1 34 ? -6.084  -4.703  -5.591  1.00 0.00 ? 43 THR S HG21 5  
ATOM 4969  H HG22 . THR A 1 34 ? -5.198  -5.042  -4.104  1.00 0.00 ? 43 THR S HG22 5  
ATOM 4970  H HG23 . THR A 1 34 ? -5.332  -6.281  -5.352  1.00 0.00 ? 43 THR S HG23 5  
ATOM 4971  N N    . ASP A 1 35 ? -1.183  -5.449  -6.190  1.00 0.00 ? 44 ASP S N    5  
ATOM 4972  C CA   . ASP A 1 35 ? 0.069   -5.575  -6.920  1.00 0.00 ? 44 ASP S CA   5  
ATOM 4973  C C    . ASP A 1 35 ? 0.168   -4.506  -7.994  1.00 0.00 ? 44 ASP S C    5  
ATOM 4974  O O    . ASP A 1 35 ? 1.252   -4.009  -8.289  1.00 0.00 ? 44 ASP S O    5  
ATOM 4975  C CB   . ASP A 1 35 ? 0.178   -6.964  -7.551  1.00 0.00 ? 44 ASP S CB   5  
ATOM 4976  C CG   . ASP A 1 35 ? -0.995  -7.278  -8.460  1.00 0.00 ? 44 ASP S CG   5  
ATOM 4977  O OD1  . ASP A 1 35 ? -2.144  -6.988  -8.067  1.00 0.00 ? 44 ASP S OD1  5  
ATOM 4978  O OD2  . ASP A 1 35 ? -0.763  -7.815  -9.564  1.00 0.00 ? 44 ASP S OD2  5  
ATOM 4979  H H    . ASP A 1 35 ? -1.807  -6.178  -6.213  1.00 0.00 ? 44 ASP S H    5  
ATOM 4980  H HA   . ASP A 1 35 ? 0.879   -5.444  -6.219  1.00 0.00 ? 44 ASP S HA   5  
ATOM 4981  H HB2  . ASP A 1 35 ? 1.086   -7.017  -8.137  1.00 0.00 ? 44 ASP S HB2  5  
ATOM 4982  H HB3  . ASP A 1 35 ? 0.213   -7.708  -6.767  1.00 0.00 ? 44 ASP S HB3  5  
ATOM 4983  N N    . GLU A 1 36 ? -0.974  -4.143  -8.566  1.00 0.00 ? 45 GLU S N    5  
ATOM 4984  C CA   . GLU A 1 36 ? -1.007  -3.113  -9.591  1.00 0.00 ? 45 GLU S CA   5  
ATOM 4985  C C    . GLU A 1 36 ? -0.626  -1.781  -8.970  1.00 0.00 ? 45 GLU S C    5  
ATOM 4986  O O    . GLU A 1 36 ? 0.273   -1.091  -9.449  1.00 0.00 ? 45 GLU S O    5  
ATOM 4987  C CB   . GLU A 1 36 ? -2.396  -3.018  -10.212 1.00 0.00 ? 45 GLU S CB   5  
ATOM 4988  C CG   . GLU A 1 36 ? -2.790  -4.244  -11.020 1.00 0.00 ? 45 GLU S CG   5  
ATOM 4989  C CD   . GLU A 1 36 ? -2.589  -4.050  -12.511 1.00 0.00 ? 45 GLU S CD   5  
ATOM 4990  O OE1  . GLU A 1 36 ? -1.693  -3.269  -12.892 1.00 0.00 ? 45 GLU S OE1  5  
ATOM 4991  O OE2  . GLU A 1 36 ? -3.326  -4.683  -13.296 1.00 0.00 ? 45 GLU S OE2  5  
ATOM 4992  H H    . GLU A 1 36 ? -1.810  -4.566  -8.281  1.00 0.00 ? 45 GLU S H    5  
ATOM 4993  H HA   . GLU A 1 36 ? -0.288  -3.370  -10.354 1.00 0.00 ? 45 GLU S HA   5  
ATOM 4994  H HB2  . GLU A 1 36 ? -3.118  -2.883  -9.422  1.00 0.00 ? 45 GLU S HB2  5  
ATOM 4995  H HB3  . GLU A 1 36 ? -2.423  -2.159  -10.864 1.00 0.00 ? 45 GLU S HB3  5  
ATOM 4996  H HG2  . GLU A 1 36 ? -2.189  -5.081  -10.696 1.00 0.00 ? 45 GLU S HG2  5  
ATOM 4997  H HG3  . GLU A 1 36 ? -3.833  -4.459  -10.837 1.00 0.00 ? 45 GLU S HG3  5  
ATOM 4998  N N    . ASP A 1 37 ? -1.298  -1.446  -7.873  1.00 0.00 ? 46 ASP S N    5  
ATOM 4999  C CA   . ASP A 1 37 ? -1.013  -0.222  -7.154  1.00 0.00 ? 46 ASP S CA   5  
ATOM 5000  C C    . ASP A 1 37 ? 0.385   -0.323  -6.564  1.00 0.00 ? 46 ASP S C    5  
ATOM 5001  O O    . ASP A 1 37 ? 1.150   0.641   -6.557  1.00 0.00 ? 46 ASP S O    5  
ATOM 5002  C CB   . ASP A 1 37 ? -2.048  -0.022  -6.049  1.00 0.00 ? 46 ASP S CB   5  
ATOM 5003  C CG   . ASP A 1 37 ? -1.781  1.220   -5.225  1.00 0.00 ? 46 ASP S CG   5  
ATOM 5004  O OD1  . ASP A 1 37 ? -0.667  1.338   -4.673  1.00 0.00 ? 46 ASP S OD1  5  
ATOM 5005  O OD2  . ASP A 1 37 ? -2.687  2.075   -5.130  1.00 0.00 ? 46 ASP S OD2  5  
ATOM 5006  H H    . ASP A 1 37 ? -1.985  -2.050  -7.522  1.00 0.00 ? 46 ASP S H    5  
ATOM 5007  H HA   . ASP A 1 37 ? -1.055  0.604   -7.847  1.00 0.00 ? 46 ASP S HA   5  
ATOM 5008  H HB2  . ASP A 1 37 ? -3.028  0.070   -6.498  1.00 0.00 ? 46 ASP S HB2  5  
ATOM 5009  H HB3  . ASP A 1 37 ? -2.034  -0.890  -5.394  1.00 0.00 ? 46 ASP S HB3  5  
ATOM 5010  N N    . PHE A 1 38 ? 0.712   -1.526  -6.102  1.00 0.00 ? 47 PHE S N    5  
ATOM 5011  C CA   . PHE A 1 38 ? 2.018   -1.816  -5.540  1.00 0.00 ? 47 PHE S CA   5  
ATOM 5012  C C    . PHE A 1 38 ? 3.078   -1.608  -6.601  1.00 0.00 ? 47 PHE S C    5  
ATOM 5013  O O    . PHE A 1 38 ? 4.128   -1.027  -6.349  1.00 0.00 ? 47 PHE S O    5  
ATOM 5014  C CB   . PHE A 1 38 ? 2.075   -3.271  -5.072  1.00 0.00 ? 47 PHE S CB   5  
ATOM 5015  C CG   . PHE A 1 38 ? 2.183   -3.449  -3.590  1.00 0.00 ? 47 PHE S CG   5  
ATOM 5016  C CD1  . PHE A 1 38 ? 3.312   -3.037  -2.903  1.00 0.00 ? 47 PHE S CD1  5  
ATOM 5017  C CD2  . PHE A 1 38 ? 1.152   -4.041  -2.889  1.00 0.00 ? 47 PHE S CD2  5  
ATOM 5018  C CE1  . PHE A 1 38 ? 3.405   -3.214  -1.537  1.00 0.00 ? 47 PHE S CE1  5  
ATOM 5019  C CE2  . PHE A 1 38 ? 1.238   -4.220  -1.525  1.00 0.00 ? 47 PHE S CE2  5  
ATOM 5020  C CZ   . PHE A 1 38 ? 2.367   -3.806  -0.848  1.00 0.00 ? 47 PHE S CZ   5  
ATOM 5021  H H    . PHE A 1 38 ? 0.056   -2.249  -6.167  1.00 0.00 ? 47 PHE S H    5  
ATOM 5022  H HA   . PHE A 1 38 ? 2.198   -1.154  -4.706  1.00 0.00 ? 47 PHE S HA   5  
ATOM 5023  H HB2  . PHE A 1 38 ? 1.182   -3.778  -5.397  1.00 0.00 ? 47 PHE S HB2  5  
ATOM 5024  H HB3  . PHE A 1 38 ? 2.931   -3.747  -5.521  1.00 0.00 ? 47 PHE S HB3  5  
ATOM 5025  H HD1  . PHE A 1 38 ? 4.122   -2.573  -3.444  1.00 0.00 ? 47 PHE S HD1  5  
ATOM 5026  H HD2  . PHE A 1 38 ? 0.270   -4.368  -3.420  1.00 0.00 ? 47 PHE S HD2  5  
ATOM 5027  H HE1  . PHE A 1 38 ? 4.291   -2.894  -1.011  1.00 0.00 ? 47 PHE S HE1  5  
ATOM 5028  H HE2  . PHE A 1 38 ? 0.424   -4.684  -0.993  1.00 0.00 ? 47 PHE S HE2  5  
ATOM 5029  H HZ   . PHE A 1 38 ? 2.435   -3.940  0.219   1.00 0.00 ? 47 PHE S HZ   5  
ATOM 5030  N N    . GLU A 1 39 ? 2.788   -2.115  -7.792  1.00 0.00 ? 48 GLU S N    5  
ATOM 5031  C CA   . GLU A 1 39 ? 3.719   -2.012  -8.909  1.00 0.00 ? 48 GLU S CA   5  
ATOM 5032  C C    . GLU A 1 39 ? 4.060   -0.555  -9.228  1.00 0.00 ? 48 GLU S C    5  
ATOM 5033  O O    . GLU A 1 39 ? 5.227   -0.212  -9.421  1.00 0.00 ? 48 GLU S O    5  
ATOM 5034  C CB   . GLU A 1 39 ? 3.137   -2.695  -10.147 1.00 0.00 ? 48 GLU S CB   5  
ATOM 5035  C CG   . GLU A 1 39 ? 3.476   -4.173  -10.240 1.00 0.00 ? 48 GLU S CG   5  
ATOM 5036  C CD   . GLU A 1 39 ? 3.796   -4.608  -11.658 1.00 0.00 ? 48 GLU S CD   5  
ATOM 5037  O OE1  . GLU A 1 39 ? 4.810   -4.134  -12.211 1.00 0.00 ? 48 GLU S OE1  5  
ATOM 5038  O OE2  . GLU A 1 39 ? 3.028   -5.422  -12.214 1.00 0.00 ? 48 GLU S OE2  5  
ATOM 5039  H H    . GLU A 1 39 ? 1.921   -2.589  -7.920  1.00 0.00 ? 48 GLU S H    5  
ATOM 5040  H HA   . GLU A 1 39 ? 4.627   -2.522  -8.624  1.00 0.00 ? 48 GLU S HA   5  
ATOM 5041  H HB2  . GLU A 1 39 ? 2.062   -2.594  -10.128 1.00 0.00 ? 48 GLU S HB2  5  
ATOM 5042  H HB3  . GLU A 1 39 ? 3.521   -2.203  -11.029 1.00 0.00 ? 48 GLU S HB3  5  
ATOM 5043  H HG2  . GLU A 1 39 ? 4.338   -4.372  -9.616  1.00 0.00 ? 48 GLU S HG2  5  
ATOM 5044  H HG3  . GLU A 1 39 ? 2.630   -4.746  -9.883  1.00 0.00 ? 48 GLU S HG3  5  
ATOM 5045  N N    . PHE A 1 40 ? 3.042   0.294   -9.299  1.00 0.00 ? 49 PHE S N    5  
ATOM 5046  C CA   . PHE A 1 40 ? 3.246   1.705   -9.618  1.00 0.00 ? 49 PHE S CA   5  
ATOM 5047  C C    . PHE A 1 40 ? 3.532   2.548   -8.374  1.00 0.00 ? 49 PHE S C    5  
ATOM 5048  O O    . PHE A 1 40 ? 3.978   3.690   -8.486  1.00 0.00 ? 49 PHE S O    5  
ATOM 5049  C CB   . PHE A 1 40 ? 2.018   2.259   -10.347 1.00 0.00 ? 49 PHE S CB   5  
ATOM 5050  C CG   . PHE A 1 40 ? 2.277   2.597   -11.787 1.00 0.00 ? 49 PHE S CG   5  
ATOM 5051  C CD1  . PHE A 1 40 ? 3.427   3.274   -12.158 1.00 0.00 ? 49 PHE S CD1  5  
ATOM 5052  C CD2  . PHE A 1 40 ? 1.368   2.235   -12.769 1.00 0.00 ? 49 PHE S CD2  5  
ATOM 5053  C CE1  . PHE A 1 40 ? 3.667   3.586   -13.483 1.00 0.00 ? 49 PHE S CE1  5  
ATOM 5054  C CE2  . PHE A 1 40 ? 1.603   2.543   -14.095 1.00 0.00 ? 49 PHE S CE2  5  
ATOM 5055  C CZ   . PHE A 1 40 ? 2.754   3.220   -14.454 1.00 0.00 ? 49 PHE S CZ   5  
ATOM 5056  H H    . PHE A 1 40 ? 2.132   -0.037  -9.148  1.00 0.00 ? 49 PHE S H    5  
ATOM 5057  H HA   . PHE A 1 40 ? 4.095   1.770   -10.280 1.00 0.00 ? 49 PHE S HA   5  
ATOM 5058  H HB2  . PHE A 1 40 ? 1.227   1.522   -10.316 1.00 0.00 ? 49 PHE S HB2  5  
ATOM 5059  H HB3  . PHE A 1 40 ? 1.685   3.160   -9.848  1.00 0.00 ? 49 PHE S HB3  5  
ATOM 5060  H HD1  . PHE A 1 40 ? 4.142   3.560   -11.401 1.00 0.00 ? 49 PHE S HD1  5  
ATOM 5061  H HD2  . PHE A 1 40 ? 0.468   1.707   -12.491 1.00 0.00 ? 49 PHE S HD2  5  
ATOM 5062  H HE1  . PHE A 1 40 ? 4.567   4.114   -13.759 1.00 0.00 ? 49 PHE S HE1  5  
ATOM 5063  H HE2  . PHE A 1 40 ? 0.888   2.257   -14.852 1.00 0.00 ? 49 PHE S HE2  5  
ATOM 5064  H HZ   . PHE A 1 40 ? 2.939   3.462   -15.489 1.00 0.00 ? 49 PHE S HZ   5  
ATOM 5065  N N    . ALA A 1 41 ? 3.266   1.998   -7.195  1.00 0.00 ? 50 ALA S N    5  
ATOM 5066  C CA   . ALA A 1 41 ? 3.492   2.731   -5.952  1.00 0.00 ? 50 ALA S CA   5  
ATOM 5067  C C    . ALA A 1 41 ? 4.796   2.324   -5.272  1.00 0.00 ? 50 ALA S C    5  
ATOM 5068  O O    . ALA A 1 41 ? 5.541   3.176   -4.785  1.00 0.00 ? 50 ALA S O    5  
ATOM 5069  C CB   . ALA A 1 41 ? 2.319   2.531   -5.002  1.00 0.00 ? 50 ALA S CB   5  
ATOM 5070  H H    . ALA A 1 41 ? 2.901   1.089   -7.156  1.00 0.00 ? 50 ALA S H    5  
ATOM 5071  H HA   . ALA A 1 41 ? 3.543   3.782   -6.196  1.00 0.00 ? 50 ALA S HA   5  
ATOM 5072  H HB1  . ALA A 1 41 ? 2.357   3.275   -4.221  1.00 0.00 ? 50 ALA S HB1  5  
ATOM 5073  H HB2  . ALA A 1 41 ? 2.375   1.545   -4.564  1.00 0.00 ? 50 ALA S HB2  5  
ATOM 5074  H HB3  . ALA A 1 41 ? 1.393   2.630   -5.549  1.00 0.00 ? 50 ALA S HB3  5  
ATOM 5075  N N    . LEU A 1 42 ? 5.059   1.024   -5.220  1.00 0.00 ? 51 LEU S N    5  
ATOM 5076  C CA   . LEU A 1 42 ? 6.266   0.514   -4.575  1.00 0.00 ? 51 LEU S CA   5  
ATOM 5077  C C    . LEU A 1 42 ? 7.091   -0.383  -5.496  1.00 0.00 ? 51 LEU S C    5  
ATOM 5078  O O    . LEU A 1 42 ? 8.182   -0.818  -5.128  1.00 0.00 ? 51 LEU S O    5  
ATOM 5079  C CB   . LEU A 1 42 ? 5.888   -0.265  -3.316  1.00 0.00 ? 51 LEU S CB   5  
ATOM 5080  C CG   . LEU A 1 42 ? 5.837   0.565   -2.036  1.00 0.00 ? 51 LEU S CG   5  
ATOM 5081  C CD1  . LEU A 1 42 ? 4.903   -0.074  -1.019  1.00 0.00 ? 51 LEU S CD1  5  
ATOM 5082  C CD2  . LEU A 1 42 ? 7.237   0.719   -1.468  1.00 0.00 ? 51 LEU S CD2  5  
ATOM 5083  H H    . LEU A 1 42 ? 4.421   0.392   -5.611  1.00 0.00 ? 51 LEU S H    5  
ATOM 5084  H HA   . LEU A 1 42 ? 6.869   1.361   -4.287  1.00 0.00 ? 51 LEU S HA   5  
ATOM 5085  H HB2  . LEU A 1 42 ? 4.916   -0.709  -3.473  1.00 0.00 ? 51 LEU S HB2  5  
ATOM 5086  H HB3  . LEU A 1 42 ? 6.609   -1.057  -3.175  1.00 0.00 ? 51 LEU S HB3  5  
ATOM 5087  H HG   . LEU A 1 42 ? 5.458   1.549   -2.262  1.00 0.00 ? 51 LEU S HG   5  
ATOM 5088  H HD11 . LEU A 1 42 ? 4.666   -1.079  -1.332  1.00 0.00 ? 51 LEU S HD11 5  
ATOM 5089  H HD12 . LEU A 1 42 ? 3.995   0.506   -0.950  1.00 0.00 ? 51 LEU S HD12 5  
ATOM 5090  H HD13 . LEU A 1 42 ? 5.386   -0.102  -0.055  1.00 0.00 ? 51 LEU S HD13 5  
ATOM 5091  H HD21 . LEU A 1 42 ? 7.228   0.474   -0.416  1.00 0.00 ? 51 LEU S HD21 5  
ATOM 5092  H HD22 . LEU A 1 42 ? 7.566   1.737   -1.599  1.00 0.00 ? 51 LEU S HD22 5  
ATOM 5093  H HD23 . LEU A 1 42 ? 7.909   0.053   -1.984  1.00 0.00 ? 51 LEU S HD23 5  
ATOM 5094  N N    . ASP A 1 43 ? 6.572   -0.668  -6.684  1.00 0.00 ? 52 ASP S N    5  
ATOM 5095  C CA   . ASP A 1 43 ? 7.274   -1.526  -7.631  1.00 0.00 ? 52 ASP S CA   5  
ATOM 5096  C C    . ASP A 1 43 ? 7.411   -2.951  -7.094  1.00 0.00 ? 52 ASP S C    5  
ATOM 5097  O O    . ASP A 1 43 ? 8.165   -3.753  -7.643  1.00 0.00 ? 52 ASP S O    5  
ATOM 5098  C CB   . ASP A 1 43 ? 8.658   -0.952  -7.942  1.00 0.00 ? 52 ASP S CB   5  
ATOM 5099  C CG   . ASP A 1 43 ? 8.605   0.513   -8.328  1.00 0.00 ? 52 ASP S CG   5  
ATOM 5100  O OD1  . ASP A 1 43 ? 7.662   0.902   -9.049  1.00 0.00 ? 52 ASP S OD1  5  
ATOM 5101  O OD2  . ASP A 1 43 ? 9.505   1.270   -7.910  1.00 0.00 ? 52 ASP S OD2  5  
ATOM 5102  H H    . ASP A 1 43 ? 5.696   -0.305  -6.930  1.00 0.00 ? 52 ASP S H    5  
ATOM 5103  H HA   . ASP A 1 43 ? 6.696   -1.554  -8.541  1.00 0.00 ? 52 ASP S HA   5  
ATOM 5104  H HB2  . ASP A 1 43 ? 9.288   -1.052  -7.068  1.00 0.00 ? 52 ASP S HB2  5  
ATOM 5105  H HB3  . ASP A 1 43 ? 9.095   -1.507  -8.763  1.00 0.00 ? 52 ASP S HB3  5  
ATOM 5106  N N    . MET A 1 44 ? 6.669   -3.273  -6.031  1.00 0.00 ? 53 MET S N    5  
ATOM 5107  C CA   . MET A 1 44 ? 6.716   -4.617  -5.456  1.00 0.00 ? 53 MET S CA   5  
ATOM 5108  C C    . MET A 1 44 ? 5.314   -5.223  -5.397  1.00 0.00 ? 53 MET S C    5  
ATOM 5109  O O    . MET A 1 44 ? 4.427   -4.792  -6.128  1.00 0.00 ? 53 MET S O    5  
ATOM 5110  C CB   . MET A 1 44 ? 7.355   -4.594  -4.066  1.00 0.00 ? 53 MET S CB   5  
ATOM 5111  C CG   . MET A 1 44 ? 8.507   -5.579  -3.926  1.00 0.00 ? 53 MET S CG   5  
ATOM 5112  S SD   . MET A 1 44 ? 10.089  -4.872  -4.422  1.00 0.00 ? 53 MET S SD   5  
ATOM 5113  C CE   . MET A 1 44 ? 10.541  -5.966  -5.767  1.00 0.00 ? 53 MET S CE   5  
ATOM 5114  H H    . MET A 1 44 ? 6.072   -2.597  -5.631  1.00 0.00 ? 53 MET S H    5  
ATOM 5115  H HA   . MET A 1 44 ? 7.324   -5.229  -6.108  1.00 0.00 ? 53 MET S HA   5  
ATOM 5116  H HB2  . MET A 1 44 ? 7.733   -3.598  -3.871  1.00 0.00 ? 53 MET S HB2  5  
ATOM 5117  H HB3  . MET A 1 44 ? 6.605   -4.839  -3.328  1.00 0.00 ? 53 MET S HB3  5  
ATOM 5118  H HG2  . MET A 1 44 ? 8.574   -5.890  -2.896  1.00 0.00 ? 53 MET S HG2  5  
ATOM 5119  H HG3  . MET A 1 44 ? 8.302   -6.439  -4.546  1.00 0.00 ? 53 MET S HG3  5  
ATOM 5120  H HE1  . MET A 1 44 ? 10.078  -6.930  -5.618  1.00 0.00 ? 53 MET S HE1  5  
ATOM 5121  H HE2  . MET A 1 44 ? 11.614  -6.083  -5.790  1.00 0.00 ? 53 MET S HE2  5  
ATOM 5122  H HE3  . MET A 1 44 ? 10.203  -5.545  -6.702  1.00 0.00 ? 53 MET S HE3  5  
ATOM 5123  N N    . THR A 1 45 ? 5.109   -6.225  -4.539  1.00 0.00 ? 54 THR S N    5  
ATOM 5124  C CA   . THR A 1 45 ? 3.799   -6.853  -4.426  1.00 0.00 ? 54 THR S CA   5  
ATOM 5125  C C    . THR A 1 45 ? 3.407   -7.011  -2.965  1.00 0.00 ? 54 THR S C    5  
ATOM 5126  O O    . THR A 1 45 ? 4.270   -7.126  -2.095  1.00 0.00 ? 54 THR S O    5  
ATOM 5127  C CB   . THR A 1 45 ? 3.785   -8.218  -5.124  1.00 0.00 ? 54 THR S CB   5  
ATOM 5128  O OG1  . THR A 1 45 ? 4.253   -9.233  -4.255  1.00 0.00 ? 54 THR S OG1  5  
ATOM 5129  C CG2  . THR A 1 45 ? 4.634   -8.261  -6.378  1.00 0.00 ? 54 THR S CG2  5  
ATOM 5130  H H    . THR A 1 45 ? 5.844   -6.546  -3.967  1.00 0.00 ? 54 THR S H    5  
ATOM 5131  H HA   . THR A 1 45 ? 3.080   -6.206  -4.907  1.00 0.00 ? 54 THR S HA   5  
ATOM 5132  H HB   . THR A 1 45 ? 2.769   -8.454  -5.404  1.00 0.00 ? 54 THR S HB   5  
ATOM 5133  H HG1  . THR A 1 45 ? 4.162   -10.088 -4.682  1.00 0.00 ? 54 THR S HG1  5  
ATOM 5134  H HG21 . THR A 1 45 ? 4.135   -8.856  -7.128  1.00 0.00 ? 54 THR S HG21 5  
ATOM 5135  H HG22 . THR A 1 45 ? 5.593   -8.701  -6.149  1.00 0.00 ? 54 THR S HG22 5  
ATOM 5136  H HG23 . THR A 1 45 ? 4.777   -7.258  -6.751  1.00 0.00 ? 54 THR S HG23 5  
ATOM 5137  N N    . ARG A 1 46 ? 2.108   -7.047  -2.695  1.00 0.00 ? 55 ARG S N    5  
ATOM 5138  C CA   . ARG A 1 46 ? 1.635   -7.227  -1.331  1.00 0.00 ? 55 ARG S CA   5  
ATOM 5139  C C    . ARG A 1 46 ? 2.107   -8.575  -0.797  1.00 0.00 ? 55 ARG S C    5  
ATOM 5140  O O    . ARG A 1 46 ? 2.257   -8.758  0.409   1.00 0.00 ? 55 ARG S O    5  
ATOM 5141  C CB   . ARG A 1 46 ? 0.110   -7.139  -1.267  1.00 0.00 ? 55 ARG S CB   5  
ATOM 5142  C CG   . ARG A 1 46 ? -0.425  -7.020  0.153   1.00 0.00 ? 55 ARG S CG   5  
ATOM 5143  C CD   . ARG A 1 46 ? -1.455  -5.905  0.283   1.00 0.00 ? 55 ARG S CD   5  
ATOM 5144  N NE   . ARG A 1 46 ? -2.403  -5.895  -0.831  1.00 0.00 ? 55 ARG S NE   5  
ATOM 5145  C CZ   . ARG A 1 46 ? -3.724  -6.015  -0.692  1.00 0.00 ? 55 ARG S CZ   5  
ATOM 5146  N NH1  . ARG A 1 46 ? -4.272  -6.148  0.510   1.00 0.00 ? 55 ARG S NH1  5  
ATOM 5147  N NH2  . ARG A 1 46 ? -4.502  -5.998  -1.767  1.00 0.00 ? 55 ARG S NH2  5  
ATOM 5148  H H    . ARG A 1 46 ? 1.459   -6.972  -3.427  1.00 0.00 ? 55 ARG S H    5  
ATOM 5149  H HA   . ARG A 1 46 ? 2.062   -6.441  -0.725  1.00 0.00 ? 55 ARG S HA   5  
ATOM 5150  H HB2  . ARG A 1 46 ? -0.214  -6.277  -1.831  1.00 0.00 ? 55 ARG S HB2  5  
ATOM 5151  H HB3  . ARG A 1 46 ? -0.310  -8.032  -1.712  1.00 0.00 ? 55 ARG S HB3  5  
ATOM 5152  H HG2  . ARG A 1 46 ? -0.888  -7.953  0.432   1.00 0.00 ? 55 ARG S HG2  5  
ATOM 5153  H HG3  . ARG A 1 46 ? 0.398   -6.813  0.819   1.00 0.00 ? 55 ARG S HG3  5  
ATOM 5154  H HD2  . ARG A 1 46 ? -1.996  -6.043  1.205   1.00 0.00 ? 55 ARG S HD2  5  
ATOM 5155  H HD3  . ARG A 1 46 ? -0.939  -4.958  0.311   1.00 0.00 ? 55 ARG S HD3  5  
ATOM 5156  H HE   . ARG A 1 46 ? -2.035  -5.794  -1.733  1.00 0.00 ? 55 ARG S HE   5  
ATOM 5157  H HH11 . ARG A 1 46 ? -3.697  -6.158  1.326   1.00 0.00 ? 55 ARG S HH11 5  
ATOM 5158  H HH12 . ARG A 1 46 ? -5.264  -6.235  0.598   1.00 0.00 ? 55 ARG S HH12 5  
ATOM 5159  H HH21 . ARG A 1 46 ? -4.097  -5.897  -2.675  1.00 0.00 ? 55 ARG S HH21 5  
ATOM 5160  H HH22 . ARG A 1 46 ? -5.492  -6.089  -1.667  1.00 0.00 ? 55 ARG S HH22 5  
ATOM 5161  N N    . ASP A 1 47 ? 2.347   -9.510  -1.714  1.00 0.00 ? 56 ASP S N    5  
ATOM 5162  C CA   . ASP A 1 47 ? 2.813   -10.847 -1.361  1.00 0.00 ? 56 ASP S CA   5  
ATOM 5163  C C    . ASP A 1 47 ? 4.341   -10.916 -1.346  1.00 0.00 ? 56 ASP S C    5  
ATOM 5164  O O    . ASP A 1 47 ? 4.919   -11.904 -0.893  1.00 0.00 ? 56 ASP S O    5  
ATOM 5165  C CB   . ASP A 1 47 ? 2.256   -11.879 -2.342  1.00 0.00 ? 56 ASP S CB   5  
ATOM 5166  C CG   . ASP A 1 47 ? 1.886   -13.183 -1.662  1.00 0.00 ? 56 ASP S CG   5  
ATOM 5167  O OD1  . ASP A 1 47 ? 1.502   -13.145 -0.475  1.00 0.00 ? 56 ASP S OD1  5  
ATOM 5168  O OD2  . ASP A 1 47 ? 1.984   -14.242 -2.318  1.00 0.00 ? 56 ASP S OD2  5  
ATOM 5169  H H    . ASP A 1 47 ? 2.214   -9.293  -2.660  1.00 0.00 ? 56 ASP S H    5  
ATOM 5170  H HA   . ASP A 1 47 ? 2.446   -11.071 -0.370  1.00 0.00 ? 56 ASP S HA   5  
ATOM 5171  H HB2  . ASP A 1 47 ? 1.371   -11.478 -2.814  1.00 0.00 ? 56 ASP S HB2  5  
ATOM 5172  H HB3  . ASP A 1 47 ? 2.999   -12.086 -3.097  1.00 0.00 ? 56 ASP S HB3  5  
ATOM 5173  N N    . GLU A 1 48 ? 4.994   -9.858  -1.828  1.00 0.00 ? 57 GLU S N    5  
ATOM 5174  C CA   . GLU A 1 48 ? 6.448   -9.804  -1.850  1.00 0.00 ? 57 GLU S CA   5  
ATOM 5175  C C    . GLU A 1 48 ? 6.922   -9.095  -0.601  1.00 0.00 ? 57 GLU S C    5  
ATOM 5176  O O    . GLU A 1 48 ? 7.703   -9.629  0.186   1.00 0.00 ? 57 GLU S O    5  
ATOM 5177  C CB   . GLU A 1 48 ? 6.943   -9.060  -3.091  1.00 0.00 ? 57 GLU S CB   5  
ATOM 5178  C CG   . GLU A 1 48 ? 8.431   -9.227  -3.349  1.00 0.00 ? 57 GLU S CG   5  
ATOM 5179  C CD   . GLU A 1 48 ? 8.738   -10.406 -4.250  1.00 0.00 ? 57 GLU S CD   5  
ATOM 5180  O OE1  . GLU A 1 48 ? 7.924   -10.690 -5.154  1.00 0.00 ? 57 GLU S OE1  5  
ATOM 5181  O OE2  . GLU A 1 48 ? 9.790   -11.047 -4.052  1.00 0.00 ? 57 GLU S OE2  5  
ATOM 5182  H H    . GLU A 1 48 ? 4.486   -9.085  -2.156  1.00 0.00 ? 57 GLU S H    5  
ATOM 5183  H HA   . GLU A 1 48 ? 6.830   -10.814 -1.855  1.00 0.00 ? 57 GLU S HA   5  
ATOM 5184  H HB2  . GLU A 1 48 ? 6.406   -9.428  -3.952  1.00 0.00 ? 57 GLU S HB2  5  
ATOM 5185  H HB3  . GLU A 1 48 ? 6.735   -8.004  -2.968  1.00 0.00 ? 57 GLU S HB3  5  
ATOM 5186  H HG2  . GLU A 1 48 ? 8.806   -8.329  -3.817  1.00 0.00 ? 57 GLU S HG2  5  
ATOM 5187  H HG3  . GLU A 1 48 ? 8.932   -9.375  -2.404  1.00 0.00 ? 57 GLU S HG3  5  
ATOM 5188  N N    . TYR A 1 49 ? 6.392   -7.899  -0.411  1.00 0.00 ? 58 TYR S N    5  
ATOM 5189  C CA   . TYR A 1 49 ? 6.694   -7.103  0.758   1.00 0.00 ? 58 TYR S CA   5  
ATOM 5190  C C    . TYR A 1 49 ? 6.226   -7.846  1.993   1.00 0.00 ? 58 TYR S C    5  
ATOM 5191  O O    . TYR A 1 49 ? 6.828   -7.753  3.063   1.00 0.00 ? 58 TYR S O    5  
ATOM 5192  C CB   . TYR A 1 49 ? 5.976   -5.763  0.653   1.00 0.00 ? 58 TYR S CB   5  
ATOM 5193  C CG   . TYR A 1 49 ? 6.805   -4.679  0.005   1.00 0.00 ? 58 TYR S CG   5  
ATOM 5194  C CD1  . TYR A 1 49 ? 7.941   -4.988  -0.733  1.00 0.00 ? 58 TYR S CD1  5  
ATOM 5195  C CD2  . TYR A 1 49 ? 6.453   -3.345  0.138   1.00 0.00 ? 58 TYR S CD2  5  
ATOM 5196  C CE1  . TYR A 1 49 ? 8.703   -3.999  -1.317  1.00 0.00 ? 58 TYR S CE1  5  
ATOM 5197  C CE2  . TYR A 1 49 ? 7.211   -2.350  -0.446  1.00 0.00 ? 58 TYR S CE2  5  
ATOM 5198  C CZ   . TYR A 1 49 ? 8.335   -2.681  -1.171  1.00 0.00 ? 58 TYR S CZ   5  
ATOM 5199  O OH   . TYR A 1 49 ? 9.094   -1.695  -1.753  1.00 0.00 ? 58 TYR S OH   5  
ATOM 5200  H H    . TYR A 1 49 ? 5.749   -7.555  -1.067  1.00 0.00 ? 58 TYR S H    5  
ATOM 5201  H HA   . TYR A 1 49 ? 7.760   -6.945  0.807   1.00 0.00 ? 58 TYR S HA   5  
ATOM 5202  H HB2  . TYR A 1 49 ? 5.083   -5.892  0.058   1.00 0.00 ? 58 TYR S HB2  5  
ATOM 5203  H HB3  . TYR A 1 49 ? 5.699   -5.435  1.637   1.00 0.00 ? 58 TYR S HB3  5  
ATOM 5204  H HD1  . TYR A 1 49 ? 8.229   -6.023  -0.847  1.00 0.00 ? 58 TYR S HD1  5  
ATOM 5205  H HD2  . TYR A 1 49 ? 5.571   -3.084  0.708   1.00 0.00 ? 58 TYR S HD2  5  
ATOM 5206  H HE1  . TYR A 1 49 ? 9.585   -4.258  -1.885  1.00 0.00 ? 58 TYR S HE1  5  
ATOM 5207  H HE2  . TYR A 1 49 ? 6.921   -1.322  -0.328  1.00 0.00 ? 58 TYR S HE2  5  
ATOM 5208  H HH   . TYR A 1 49 ? 9.013   -1.749  -2.709  1.00 0.00 ? 58 TYR S HH   5  
ATOM 5209  N N    . ASN A 1 50 ? 5.144   -8.595  1.826   1.00 0.00 ? 59 ASN S N    5  
ATOM 5210  C CA   . ASN A 1 50 ? 4.579   -9.378  2.925   1.00 0.00 ? 59 ASN S CA   5  
ATOM 5211  C C    . ASN A 1 50 ? 5.647   -10.244 3.595   1.00 0.00 ? 59 ASN S C    5  
ATOM 5212  O O    . ASN A 1 50 ? 5.523   -10.600 4.767   1.00 0.00 ? 59 ASN S O    5  
ATOM 5213  C CB   . ASN A 1 50 ? 3.439   -10.268 2.420   1.00 0.00 ? 59 ASN S CB   5  
ATOM 5214  C CG   . ASN A 1 50 ? 2.078   -9.784  2.880   1.00 0.00 ? 59 ASN S CG   5  
ATOM 5215  O OD1  . ASN A 1 50 ? 1.973   -8.969  3.797   1.00 0.00 ? 59 ASN S OD1  5  
ATOM 5216  N ND2  . ASN A 1 50 ? 1.026   -10.284 2.243   1.00 0.00 ? 59 ASN S ND2  5  
ATOM 5217  H H    . ASN A 1 50 ? 4.716   -8.621  0.934   1.00 0.00 ? 59 ASN S H    5  
ATOM 5218  H HA   . ASN A 1 50 ? 4.186   -8.686  3.655   1.00 0.00 ? 59 ASN S HA   5  
ATOM 5219  H HB2  . ASN A 1 50 ? 3.452   -10.281 1.342   1.00 0.00 ? 59 ASN S HB2  5  
ATOM 5220  H HB3  . ASN A 1 50 ? 3.585   -11.273 2.787   1.00 0.00 ? 59 ASN S HB3  5  
ATOM 5221  H HD21 . ASN A 1 50 ? 1.185   -10.928 1.521   1.00 0.00 ? 59 ASN S HD21 5  
ATOM 5222  H HD22 . ASN A 1 50 ? 0.134   -9.988  2.519   1.00 0.00 ? 59 ASN S HD22 5  
ATOM 5223  N N    . ALA A 1 51 ? 6.690   -10.586 2.843   1.00 0.00 ? 60 ALA S N    5  
ATOM 5224  C CA   . ALA A 1 51 ? 7.770   -11.417 3.368   1.00 0.00 ? 60 ALA S CA   5  
ATOM 5225  C C    . ALA A 1 51 ? 9.078   -10.638 3.472   1.00 0.00 ? 60 ALA S C    5  
ATOM 5226  O O    . ALA A 1 51 ? 9.890   -10.889 4.362   1.00 0.00 ? 60 ALA S O    5  
ATOM 5227  C CB   . ALA A 1 51 ? 7.957   -12.649 2.495   1.00 0.00 ? 60 ALA S CB   5  
ATOM 5228  H H    . ALA A 1 51 ? 6.734   -10.278 1.914   1.00 0.00 ? 60 ALA S H    5  
ATOM 5229  H HA   . ALA A 1 51 ? 7.483   -11.748 4.357   1.00 0.00 ? 60 ALA S HA   5  
ATOM 5230  H HB1  . ALA A 1 51 ? 8.087   -12.344 1.467   1.00 0.00 ? 60 ALA S HB1  5  
ATOM 5231  H HB2  . ALA A 1 51 ? 7.088   -13.282 2.577   1.00 0.00 ? 60 ALA S HB2  5  
ATOM 5232  H HB3  . ALA A 1 51 ? 8.831   -13.193 2.823   1.00 0.00 ? 60 ALA S HB3  5  
ATOM 5233  N N    . LEU A 1 52 ? 9.281   -9.695  2.557   1.00 0.00 ? 61 LEU S N    5  
ATOM 5234  C CA   . LEU A 1 52 ? 10.495  -8.886  2.551   1.00 0.00 ? 61 LEU S CA   5  
ATOM 5235  C C    . LEU A 1 52 ? 10.624  -8.092  3.849   1.00 0.00 ? 61 LEU S C    5  
ATOM 5236  O O    . LEU A 1 52 ? 9.680   -8.018  4.636   1.00 0.00 ? 61 LEU S O    5  
ATOM 5237  C CB   . LEU A 1 52 ? 10.487  -7.932  1.355   1.00 0.00 ? 61 LEU S CB   5  
ATOM 5238  C CG   . LEU A 1 52 ? 11.227  -8.439  0.115   1.00 0.00 ? 61 LEU S CG   5  
ATOM 5239  C CD1  . LEU A 1 52 ? 10.549  -7.944  -1.152  1.00 0.00 ? 61 LEU S CD1  5  
ATOM 5240  C CD2  . LEU A 1 52 ? 12.685  -7.999  0.146   1.00 0.00 ? 61 LEU S CD2  5  
ATOM 5241  H H    . LEU A 1 52 ? 8.598   -9.541  1.871   1.00 0.00 ? 61 LEU S H    5  
ATOM 5242  H HA   . LEU A 1 52 ? 11.338  -9.554  2.463   1.00 0.00 ? 61 LEU S HA   5  
ATOM 5243  H HB2  . LEU A 1 52 ? 9.458   -7.746  1.079   1.00 0.00 ? 61 LEU S HB2  5  
ATOM 5244  H HB3  . LEU A 1 52 ? 10.936  -6.997  1.660   1.00 0.00 ? 61 LEU S HB3  5  
ATOM 5245  H HG   . LEU A 1 52 ? 11.203  -9.519  0.107   1.00 0.00 ? 61 LEU S HG   5  
ATOM 5246  H HD11 . LEU A 1 52 ? 10.854  -8.558  -1.987  1.00 0.00 ? 61 LEU S HD11 5  
ATOM 5247  H HD12 . LEU A 1 52 ? 10.834  -6.920  -1.337  1.00 0.00 ? 61 LEU S HD12 5  
ATOM 5248  H HD13 . LEU A 1 52 ? 9.477   -8.006  -1.033  1.00 0.00 ? 61 LEU S HD13 5  
ATOM 5249  H HD21 . LEU A 1 52 ? 13.142  -8.204  -0.810  1.00 0.00 ? 61 LEU S HD21 5  
ATOM 5250  H HD22 . LEU A 1 52 ? 13.207  -8.542  0.919   1.00 0.00 ? 61 LEU S HD22 5  
ATOM 5251  H HD23 . LEU A 1 52 ? 12.737  -6.941  0.352   1.00 0.00 ? 61 LEU S HD23 5  
ATOM 5252  N N    . PRO A 1 53 ? 11.800  -7.486  4.094   1.00 0.00 ? 62 PRO S N    5  
ATOM 5253  C CA   . PRO A 1 53 ? 12.038  -6.699  5.305   1.00 0.00 ? 62 PRO S CA   5  
ATOM 5254  C C    . PRO A 1 53 ? 10.994  -5.608  5.492   1.00 0.00 ? 62 PRO S C    5  
ATOM 5255  O O    . PRO A 1 53 ? 10.307  -5.224  4.545   1.00 0.00 ? 62 PRO S O    5  
ATOM 5256  C CB   . PRO A 1 53 ? 13.416  -6.075  5.072   1.00 0.00 ? 62 PRO S CB   5  
ATOM 5257  C CG   . PRO A 1 53 ? 14.080  -6.964  4.078   1.00 0.00 ? 62 PRO S CG   5  
ATOM 5258  C CD   . PRO A 1 53 ? 12.982  -7.518  3.213   1.00 0.00 ? 62 PRO S CD   5  
ATOM 5259  H HA   . PRO A 1 53 ? 12.066  -7.324  6.185   1.00 0.00 ? 62 PRO S HA   5  
ATOM 5260  H HB2  . PRO A 1 53 ? 13.298  -5.071  4.686   1.00 0.00 ? 62 PRO S HB2  5  
ATOM 5261  H HB3  . PRO A 1 53 ? 13.964  -6.048  6.004   1.00 0.00 ? 62 PRO S HB3  5  
ATOM 5262  H HG2  . PRO A 1 53 ? 14.773  -6.388  3.482   1.00 0.00 ? 62 PRO S HG2  5  
ATOM 5263  H HG3  . PRO A 1 53 ? 14.596  -7.765  4.589   1.00 0.00 ? 62 PRO S HG3  5  
ATOM 5264  H HD2  . PRO A 1 53 ? 12.832  -6.890  2.346   1.00 0.00 ? 62 PRO S HD2  5  
ATOM 5265  H HD3  . PRO A 1 53 ? 13.211  -8.531  2.912   1.00 0.00 ? 62 PRO S HD3  5  
ATOM 5266  N N    . ALA A 1 54 ? 10.878  -5.113  6.717   1.00 0.00 ? 63 ALA S N    5  
ATOM 5267  C CA   . ALA A 1 54 ? 9.916   -4.064  7.026   1.00 0.00 ? 63 ALA S CA   5  
ATOM 5268  C C    . ALA A 1 54 ? 10.514  -2.679  6.794   1.00 0.00 ? 63 ALA S C    5  
ATOM 5269  O O    . ALA A 1 54 ? 9.792   -1.717  6.544   1.00 0.00 ? 63 ALA S O    5  
ATOM 5270  C CB   . ALA A 1 54 ? 9.435   -4.198  8.462   1.00 0.00 ? 63 ALA S CB   5  
ATOM 5271  H H    . ALA A 1 54 ? 11.453  -5.459  7.430   1.00 0.00 ? 63 ALA S H    5  
ATOM 5272  H HA   . ALA A 1 54 ? 9.065   -4.190  6.374   1.00 0.00 ? 63 ALA S HA   5  
ATOM 5273  H HB1  . ALA A 1 54 ? 9.317   -5.244  8.705   1.00 0.00 ? 63 ALA S HB1  5  
ATOM 5274  H HB2  . ALA A 1 54 ? 8.486   -3.694  8.573   1.00 0.00 ? 63 ALA S HB2  5  
ATOM 5275  H HB3  . ALA A 1 54 ? 10.159  -3.753  9.127   1.00 0.00 ? 63 ALA S HB3  5  
ATOM 5276  N N    . TRP A 1 55 ? 11.838  -2.586  6.857   1.00 0.00 ? 64 TRP S N    5  
ATOM 5277  C CA   . TRP A 1 55 ? 12.521  -1.337  6.643   1.00 0.00 ? 64 TRP S CA   5  
ATOM 5278  C C    . TRP A 1 55 ? 12.855  -1.203  5.168   1.00 0.00 ? 64 TRP S C    5  
ATOM 5279  O O    . TRP A 1 55 ? 12.646  -0.158  4.569   1.00 0.00 ? 64 TRP S O    5  
ATOM 5280  C CB   . TRP A 1 55 ? 13.796  -1.274  7.500   1.00 0.00 ? 64 TRP S CB   5  
ATOM 5281  C CG   . TRP A 1 55 ? 15.040  -1.454  6.695   1.00 0.00 ? 64 TRP S CG   5  
ATOM 5282  C CD1  . TRP A 1 55 ? 15.880  -2.525  6.699   1.00 0.00 ? 64 TRP S CD1  5  
ATOM 5283  C CD2  . TRP A 1 55 ? 15.551  -0.540  5.730   1.00 0.00 ? 64 TRP S CD2  5  
ATOM 5284  N NE1  . TRP A 1 55 ? 16.895  -2.326  5.791   1.00 0.00 ? 64 TRP S NE1  5  
ATOM 5285  C CE2  . TRP A 1 55 ? 16.710  -1.109  5.182   1.00 0.00 ? 64 TRP S CE2  5  
ATOM 5286  C CE3  . TRP A 1 55 ? 15.130  0.711   5.282   1.00 0.00 ? 64 TRP S CE3  5  
ATOM 5287  C CZ2  . TRP A 1 55 ? 17.454  -0.465  4.197   1.00 0.00 ? 64 TRP S CZ2  5  
ATOM 5288  C CZ3  . TRP A 1 55 ? 15.863  1.347   4.307   1.00 0.00 ? 64 TRP S CZ3  5  
ATOM 5289  C CH2  . TRP A 1 55 ? 17.009  0.760   3.774   1.00 0.00 ? 64 TRP S CH2  5  
ATOM 5290  H H    . TRP A 1 55 ? 12.368  -3.379  7.024   1.00 0.00 ? 64 TRP S H    5  
ATOM 5291  H HA   . TRP A 1 55 ? 11.857  -0.534  6.928   1.00 0.00 ? 64 TRP S HA   5  
ATOM 5292  H HB2  . TRP A 1 55 ? 13.850  -0.310  7.988   1.00 0.00 ? 64 TRP S HB2  5  
ATOM 5293  H HB3  . TRP A 1 55 ? 13.761  -2.056  8.247   1.00 0.00 ? 64 TRP S HB3  5  
ATOM 5294  H HD1  . TRP A 1 55 ? 15.754  -3.394  7.328   1.00 0.00 ? 64 TRP S HD1  5  
ATOM 5295  H HE1  . TRP A 1 55 ? 17.628  -2.952  5.608   1.00 0.00 ? 64 TRP S HE1  5  
ATOM 5296  H HE3  . TRP A 1 55 ? 14.244  1.180   5.684   1.00 0.00 ? 64 TRP S HE3  5  
ATOM 5297  H HZ2  . TRP A 1 55 ? 18.343  -0.904  3.772   1.00 0.00 ? 64 TRP S HZ2  5  
ATOM 5298  H HZ3  . TRP A 1 55 ? 15.551  2.313   3.943   1.00 0.00 ? 64 TRP S HZ3  5  
ATOM 5299  H HH2  . TRP A 1 55 ? 17.540  1.291   3.007   1.00 0.00 ? 64 TRP S HH2  5  
ATOM 5300  N N    . LYS A 1 56 ? 13.376  -2.288  4.590   1.00 0.00 ? 65 LYS S N    5  
ATOM 5301  C CA   . LYS A 1 56 ? 13.734  -2.298  3.181   1.00 0.00 ? 65 LYS S CA   5  
ATOM 5302  C C    . LYS A 1 56 ? 12.493  -2.047  2.347   1.00 0.00 ? 65 LYS S C    5  
ATOM 5303  O O    . LYS A 1 56 ? 12.522  -1.275  1.389   1.00 0.00 ? 65 LYS S O    5  
ATOM 5304  C CB   . LYS A 1 56 ? 14.383  -3.626  2.790   1.00 0.00 ? 65 LYS S CB   5  
ATOM 5305  C CG   . LYS A 1 56 ? 15.506  -3.467  1.779   1.00 0.00 ? 65 LYS S CG   5  
ATOM 5306  C CD   . LYS A 1 56 ? 16.692  -4.358  2.113   1.00 0.00 ? 65 LYS S CD   5  
ATOM 5307  C CE   . LYS A 1 56 ? 17.733  -3.615  2.935   1.00 0.00 ? 65 LYS S CE   5  
ATOM 5308  N NZ   . LYS A 1 56 ? 18.462  -4.525  3.861   1.00 0.00 ? 65 LYS S NZ   5  
ATOM 5309  H H    . LYS A 1 56 ? 13.514  -3.096  5.123   1.00 0.00 ? 65 LYS S H    5  
ATOM 5310  H HA   . LYS A 1 56 ? 14.437  -1.496  3.012   1.00 0.00 ? 65 LYS S HA   5  
ATOM 5311  H HB2  . LYS A 1 56 ? 14.786  -4.093  3.680   1.00 0.00 ? 65 LYS S HB2  5  
ATOM 5312  H HB3  . LYS A 1 56 ? 13.626  -4.271  2.360   1.00 0.00 ? 65 LYS S HB3  5  
ATOM 5313  H HG2  . LYS A 1 56 ? 15.136  -3.732  0.799   1.00 0.00 ? 65 LYS S HG2  5  
ATOM 5314  H HG3  . LYS A 1 56 ? 15.832  -2.435  1.778   1.00 0.00 ? 65 LYS S HG3  5  
ATOM 5315  H HD2  . LYS A 1 56 ? 16.342  -5.210  2.679   1.00 0.00 ? 65 LYS S HD2  5  
ATOM 5316  H HD3  . LYS A 1 56 ? 17.146  -4.696  1.194   1.00 0.00 ? 65 LYS S HD3  5  
ATOM 5317  H HE2  . LYS A 1 56 ? 18.443  -3.159  2.261   1.00 0.00 ? 65 LYS S HE2  5  
ATOM 5318  H HE3  . LYS A 1 56 ? 17.238  -2.850  3.511   1.00 0.00 ? 65 LYS S HE3  5  
ATOM 5319  H HZ1  . LYS A 1 56 ? 18.818  -5.354  3.342   1.00 0.00 ? 65 LYS S HZ1  5  
ATOM 5320  H HZ2  . LYS A 1 56 ? 17.827  -4.848  4.618   1.00 0.00 ? 65 LYS S HZ2  5  
ATOM 5321  H HZ3  . LYS A 1 56 ? 19.269  -4.027  4.290   1.00 0.00 ? 65 LYS S HZ3  5  
ATOM 5322  N N    . GLN A 1 57 ? 11.389  -2.674  2.741   1.00 0.00 ? 66 GLN S N    5  
ATOM 5323  C CA   . GLN A 1 57 ? 10.135  -2.472  2.042   1.00 0.00 ? 66 GLN S CA   5  
ATOM 5324  C C    . GLN A 1 57 ? 9.745   -1.010  2.185   1.00 0.00 ? 66 GLN S C    5  
ATOM 5325  O O    . GLN A 1 57 ? 9.308   -0.375  1.225   1.00 0.00 ? 66 GLN S O    5  
ATOM 5326  C CB   . GLN A 1 57 ? 9.039   -3.394  2.586   1.00 0.00 ? 66 GLN S CB   5  
ATOM 5327  C CG   . GLN A 1 57 ? 8.592   -3.063  4.000   1.00 0.00 ? 66 GLN S CG   5  
ATOM 5328  C CD   . GLN A 1 57 ? 7.422   -3.912  4.463   1.00 0.00 ? 66 GLN S CD   5  
ATOM 5329  O OE1  . GLN A 1 57 ? 6.568   -3.448  5.218   1.00 0.00 ? 66 GLN S OE1  5  
ATOM 5330  N NE2  . GLN A 1 57 ? 7.371   -5.168  4.015   1.00 0.00 ? 66 GLN S NE2  5  
ATOM 5331  H H    . GLN A 1 57 ? 11.416  -3.256  3.529   1.00 0.00 ? 66 GLN S H    5  
ATOM 5332  H HA   . GLN A 1 57 ? 10.302  -2.690  0.999   1.00 0.00 ? 66 GLN S HA   5  
ATOM 5333  H HB2  . GLN A 1 57 ? 8.178   -3.328  1.937   1.00 0.00 ? 66 GLN S HB2  5  
ATOM 5334  H HB3  . GLN A 1 57 ? 9.406   -4.408  2.576   1.00 0.00 ? 66 GLN S HB3  5  
ATOM 5335  H HG2  . GLN A 1 57 ? 9.423   -3.224  4.671   1.00 0.00 ? 66 GLN S HG2  5  
ATOM 5336  H HG3  . GLN A 1 57 ? 8.299   -2.022  4.035   1.00 0.00 ? 66 GLN S HG3  5  
ATOM 5337  H HE21 . GLN A 1 57 ? 8.081   -5.478  3.417   1.00 0.00 ? 66 GLN S HE21 5  
ATOM 5338  H HE22 . GLN A 1 57 ? 6.624   -5.730  4.305   1.00 0.00 ? 66 GLN S HE22 5  
ATOM 5339  N N    . VAL A 1 58 ? 9.959   -0.467  3.385   1.00 0.00 ? 67 VAL S N    5  
ATOM 5340  C CA   . VAL A 1 58 ? 9.681   0.938   3.634   1.00 0.00 ? 67 VAL S CA   5  
ATOM 5341  C C    . VAL A 1 58 ? 10.665  1.787   2.839   1.00 0.00 ? 67 VAL S C    5  
ATOM 5342  O O    . VAL A 1 58 ? 10.287  2.809   2.267   1.00 0.00 ? 67 VAL S O    5  
ATOM 5343  C CB   . VAL A 1 58 ? 9.764   1.292   5.134   1.00 0.00 ? 67 VAL S CB   5  
ATOM 5344  C CG1  . VAL A 1 58 ? 9.661   2.796   5.347   1.00 0.00 ? 67 VAL S CG1  5  
ATOM 5345  C CG2  . VAL A 1 58 ? 8.670   0.574   5.907   1.00 0.00 ? 67 VAL S CG2  5  
ATOM 5346  H H    . VAL A 1 58 ? 10.345  -1.016  4.105   1.00 0.00 ? 67 VAL S H    5  
ATOM 5347  H HA   . VAL A 1 58 ? 8.683   1.147   3.286   1.00 0.00 ? 67 VAL S HA   5  
ATOM 5348  H HB   . VAL A 1 58 ? 10.720  0.961   5.512   1.00 0.00 ? 67 VAL S HB   5  
ATOM 5349  H HG11 . VAL A 1 58 ? 10.443  3.295   4.793   1.00 0.00 ? 67 VAL S HG11 5  
ATOM 5350  H HG12 . VAL A 1 58 ? 9.766   3.020   6.399   1.00 0.00 ? 67 VAL S HG12 5  
ATOM 5351  H HG13 . VAL A 1 58 ? 8.697   3.143   5.003   1.00 0.00 ? 67 VAL S HG13 5  
ATOM 5352  H HG21 . VAL A 1 58 ? 8.422   -0.350  5.406   1.00 0.00 ? 67 VAL S HG21 5  
ATOM 5353  H HG22 . VAL A 1 58 ? 7.793   1.202   5.958   1.00 0.00 ? 67 VAL S HG22 5  
ATOM 5354  H HG23 . VAL A 1 58 ? 9.017   0.360   6.907   1.00 0.00 ? 67 VAL S HG23 5  
ATOM 5355  N N    . ASN A 1 59 ? 11.930  1.345   2.788   1.00 0.00 ? 68 ASN S N    5  
ATOM 5356  C CA   . ASN A 1 59 ? 12.956  2.064   2.032   1.00 0.00 ? 68 ASN S CA   5  
ATOM 5357  C C    . ASN A 1 59 ? 12.403  2.543   0.689   1.00 0.00 ? 68 ASN S C    5  
ATOM 5358  O O    . ASN A 1 59 ? 12.660  3.667   0.258   1.00 0.00 ? 68 ASN S O    5  
ATOM 5359  C CB   . ASN A 1 59 ? 14.161  1.156   1.786   1.00 0.00 ? 68 ASN S CB   5  
ATOM 5360  C CG   . ASN A 1 59 ? 15.417  1.937   1.452   1.00 0.00 ? 68 ASN S CG   5  
ATOM 5361  O OD1  . ASN A 1 59 ? 15.562  3.098   1.839   1.00 0.00 ? 68 ASN S OD1  5  
ATOM 5362  N ND2  . ASN A 1 59 ? 16.334  1.304   0.730   1.00 0.00 ? 68 ASN S ND2  5  
ATOM 5363  H H    . ASN A 1 59 ? 12.181  0.503   3.265   1.00 0.00 ? 68 ASN S H    5  
ATOM 5364  H HA   . ASN A 1 59 ? 13.266  2.919   2.612   1.00 0.00 ? 68 ASN S HA   5  
ATOM 5365  H HB2  . ASN A 1 59 ? 14.345  0.566   2.668   1.00 0.00 ? 68 ASN S HB2  5  
ATOM 5366  H HB3  . ASN A 1 59 ? 13.941  0.498   0.957   1.00 0.00 ? 68 ASN S HB3  5  
ATOM 5367  H HD21 . ASN A 1 59 ? 16.151  0.381   0.457   1.00 0.00 ? 68 ASN S HD21 5  
ATOM 5368  H HD22 . ASN A 1 59 ? 17.156  1.784   0.500   1.00 0.00 ? 68 ASN S HD22 5  
ATOM 5369  N N    . LEU A 1 60 ? 11.639  1.670   0.040   1.00 0.00 ? 69 LEU S N    5  
ATOM 5370  C CA   . LEU A 1 60 ? 11.042  1.980   -1.253  1.00 0.00 ? 69 LEU S CA   5  
ATOM 5371  C C    . LEU A 1 60 ? 9.894   2.974   -1.105  1.00 0.00 ? 69 LEU S C    5  
ATOM 5372  O O    . LEU A 1 60 ? 9.819   3.960   -1.840  1.00 0.00 ? 69 LEU S O    5  
ATOM 5373  C CB   . LEU A 1 60 ? 10.540  0.700   -1.920  1.00 0.00 ? 69 LEU S CB   5  
ATOM 5374  C CG   . LEU A 1 60 ? 11.518  0.053   -2.904  1.00 0.00 ? 69 LEU S CG   5  
ATOM 5375  C CD1  . LEU A 1 60 ? 11.968  1.058   -3.952  1.00 0.00 ? 69 LEU S CD1  5  
ATOM 5376  C CD2  . LEU A 1 60 ? 12.717  -0.519  -2.161  1.00 0.00 ? 69 LEU S CD2  5  
ATOM 5377  H H    . LEU A 1 60 ? 11.473  0.792   0.440   1.00 0.00 ? 69 LEU S H    5  
ATOM 5378  H HA   . LEU A 1 60 ? 11.807  2.422   -1.873  1.00 0.00 ? 69 LEU S HA   5  
ATOM 5379  H HB2  . LEU A 1 60 ? 10.315  -0.017  -1.144  1.00 0.00 ? 69 LEU S HB2  5  
ATOM 5380  H HB3  . LEU A 1 60 ? 9.628   0.930   -2.455  1.00 0.00 ? 69 LEU S HB3  5  
ATOM 5381  H HG   . LEU A 1 60 ? 11.019  -0.759  -3.412  1.00 0.00 ? 69 LEU S HG   5  
ATOM 5382  H HD11 . LEU A 1 60 ? 12.104  0.555   -4.898  1.00 0.00 ? 69 LEU S HD11 5  
ATOM 5383  H HD12 . LEU A 1 60 ? 12.900  1.508   -3.644  1.00 0.00 ? 69 LEU S HD12 5  
ATOM 5384  H HD13 . LEU A 1 60 ? 11.216  1.827   -4.059  1.00 0.00 ? 69 LEU S HD13 5  
ATOM 5385  H HD21 . LEU A 1 60 ? 13.052  -1.418  -2.657  1.00 0.00 ? 69 LEU S HD21 5  
ATOM 5386  H HD22 . LEU A 1 60 ? 12.432  -0.754  -1.146  1.00 0.00 ? 69 LEU S HD22 5  
ATOM 5387  H HD23 . LEU A 1 60 ? 13.515  0.207   -2.153  1.00 0.00 ? 69 LEU S HD23 5  
ATOM 5388  N N    . LYS A 1 61 ? 8.997   2.711   -0.156  1.00 0.00 ? 70 LYS S N    5  
ATOM 5389  C CA   . LYS A 1 61 ? 7.854   3.592   0.071   1.00 0.00 ? 70 LYS S CA   5  
ATOM 5390  C C    . LYS A 1 61 ? 8.306   5.042   0.182   1.00 0.00 ? 70 LYS S C    5  
ATOM 5391  O O    . LYS A 1 61 ? 7.923   5.887   -0.624  1.00 0.00 ? 70 LYS S O    5  
ATOM 5392  C CB   . LYS A 1 61 ? 7.097   3.192   1.340   1.00 0.00 ? 70 LYS S CB   5  
ATOM 5393  C CG   . LYS A 1 61 ? 5.858   2.348   1.078   1.00 0.00 ? 70 LYS S CG   5  
ATOM 5394  C CD   . LYS A 1 61 ? 5.558   1.419   2.241   1.00 0.00 ? 70 LYS S CD   5  
ATOM 5395  C CE   . LYS A 1 61 ? 6.570   0.294   2.354   1.00 0.00 ? 70 LYS S CE   5  
ATOM 5396  N NZ   . LYS A 1 61 ? 5.931   -1.048  2.295   1.00 0.00 ? 70 LYS S NZ   5  
ATOM 5397  H H    . LYS A 1 61 ? 9.104   1.910   0.399   1.00 0.00 ? 70 LYS S H    5  
ATOM 5398  H HA   . LYS A 1 61 ? 7.191   3.499   -0.777  1.00 0.00 ? 70 LYS S HA   5  
ATOM 5399  H HB2  . LYS A 1 61 ? 7.758   2.632   1.986   1.00 0.00 ? 70 LYS S HB2  5  
ATOM 5400  H HB3  . LYS A 1 61 ? 6.788   4.093   1.848   1.00 0.00 ? 70 LYS S HB3  5  
ATOM 5401  H HG2  . LYS A 1 61 ? 5.015   3.001   0.933   1.00 0.00 ? 70 LYS S HG2  5  
ATOM 5402  H HG3  . LYS A 1 61 ? 6.012   1.762   0.191   1.00 0.00 ? 70 LYS S HG3  5  
ATOM 5403  H HD2  . LYS A 1 61 ? 5.588   1.991   3.150   1.00 0.00 ? 70 LYS S HD2  5  
ATOM 5404  H HD3  . LYS A 1 61 ? 4.573   0.996   2.110   1.00 0.00 ? 70 LYS S HD3  5  
ATOM 5405  H HE2  . LYS A 1 61 ? 7.280   0.383   1.550   1.00 0.00 ? 70 LYS S HE2  5  
ATOM 5406  H HE3  . LYS A 1 61 ? 7.082   0.391   3.299   1.00 0.00 ? 70 LYS S HE3  5  
ATOM 5407  H HZ1  . LYS A 1 61 ? 5.140   -1.040  1.621   1.00 0.00 ? 70 LYS S HZ1  5  
ATOM 5408  H HZ2  . LYS A 1 61 ? 5.572   -1.314  3.233   1.00 0.00 ? 70 LYS S HZ2  5  
ATOM 5409  H HZ3  . LYS A 1 61 ? 6.624   -1.758  1.988   1.00 0.00 ? 70 LYS S HZ3  5  
ATOM 5410  N N    . LYS A 1 62 ? 9.130   5.321   1.189   1.00 0.00 ? 71 LYS S N    5  
ATOM 5411  C CA   . LYS A 1 62 ? 9.643   6.668   1.410   1.00 0.00 ? 71 LYS S CA   5  
ATOM 5412  C C    . LYS A 1 62 ? 10.195  7.257   0.115   1.00 0.00 ? 71 LYS S C    5  
ATOM 5413  O O    . LYS A 1 62 ? 9.987   8.433   -0.181  1.00 0.00 ? 71 LYS S O    5  
ATOM 5414  C CB   . LYS A 1 62 ? 10.733  6.651   2.482   1.00 0.00 ? 71 LYS S CB   5  
ATOM 5415  C CG   . LYS A 1 62 ? 10.265  6.088   3.815   1.00 0.00 ? 71 LYS S CG   5  
ATOM 5416  C CD   . LYS A 1 62 ? 11.408  5.992   4.813   1.00 0.00 ? 71 LYS S CD   5  
ATOM 5417  C CE   . LYS A 1 62 ? 12.393  4.901   4.427   1.00 0.00 ? 71 LYS S CE   5  
ATOM 5418  N NZ   . LYS A 1 62 ? 13.588  5.454   3.729   1.00 0.00 ? 71 LYS S NZ   5  
ATOM 5419  H H    . LYS A 1 62 ? 9.400   4.601   1.796   1.00 0.00 ? 71 LYS S H    5  
ATOM 5420  H HA   . LYS A 1 62 ? 8.825   7.284   1.752   1.00 0.00 ? 71 LYS S HA   5  
ATOM 5421  H HB2  . LYS A 1 62 ? 11.558  6.048   2.132   1.00 0.00 ? 71 LYS S HB2  5  
ATOM 5422  H HB3  . LYS A 1 62 ? 11.081  7.660   2.645   1.00 0.00 ? 71 LYS S HB3  5  
ATOM 5423  H HG2  . LYS A 1 62 ? 9.502   6.736   4.219   1.00 0.00 ? 71 LYS S HG2  5  
ATOM 5424  H HG3  . LYS A 1 62 ? 9.854   5.103   3.655   1.00 0.00 ? 71 LYS S HG3  5  
ATOM 5425  H HD2  . LYS A 1 62 ? 11.927  6.938   4.842   1.00 0.00 ? 71 LYS S HD2  5  
ATOM 5426  H HD3  . LYS A 1 62 ? 11.002  5.770   5.789   1.00 0.00 ? 71 LYS S HD3  5  
ATOM 5427  H HE2  . LYS A 1 62 ? 12.716  4.391   5.324   1.00 0.00 ? 71 LYS S HE2  5  
ATOM 5428  H HE3  . LYS A 1 62 ? 11.897  4.199   3.771   1.00 0.00 ? 71 LYS S HE3  5  
ATOM 5429  H HZ1  . LYS A 1 62 ? 13.305  6.232   3.099   1.00 0.00 ? 71 LYS S HZ1  5  
ATOM 5430  H HZ2  . LYS A 1 62 ? 14.045  4.711   3.163   1.00 0.00 ? 71 LYS S HZ2  5  
ATOM 5431  H HZ3  . LYS A 1 62 ? 14.272  5.816   4.424   1.00 0.00 ? 71 LYS S HZ3  5  
ATOM 5432  N N    . ALA A 1 63 ? 10.893  6.428   -0.655  1.00 0.00 ? 72 ALA S N    5  
ATOM 5433  C CA   . ALA A 1 63 ? 11.466  6.865   -1.922  1.00 0.00 ? 72 ALA S CA   5  
ATOM 5434  C C    . ALA A 1 63 ? 10.373  7.289   -2.897  1.00 0.00 ? 72 ALA S C    5  
ATOM 5435  O O    . ALA A 1 63 ? 10.565  8.201   -3.703  1.00 0.00 ? 72 ALA S O    5  
ATOM 5436  C CB   . ALA A 1 63 ? 12.317  5.760   -2.528  1.00 0.00 ? 72 ALA S CB   5  
ATOM 5437  H H    . ALA A 1 63 ? 11.022  5.499   -0.367  1.00 0.00 ? 72 ALA S H    5  
ATOM 5438  H HA   . ALA A 1 63 ? 12.106  7.714   -1.723  1.00 0.00 ? 72 ALA S HA   5  
ATOM 5439  H HB1  . ALA A 1 63 ? 13.015  5.397   -1.788  1.00 0.00 ? 72 ALA S HB1  5  
ATOM 5440  H HB2  . ALA A 1 63 ? 12.860  6.149   -3.376  1.00 0.00 ? 72 ALA S HB2  5  
ATOM 5441  H HB3  . ALA A 1 63 ? 11.679  4.950   -2.849  1.00 0.00 ? 72 ALA S HB3  5  
ATOM 5442  N N    . LYS A 1 64 ? 9.224   6.624   -2.818  1.00 0.00 ? 73 LYS S N    5  
ATOM 5443  C CA   . LYS A 1 64 ? 8.098   6.932   -3.692  1.00 0.00 ? 73 LYS S CA   5  
ATOM 5444  C C    . LYS A 1 64 ? 7.194   7.989   -3.062  1.00 0.00 ? 73 LYS S C    5  
ATOM 5445  O O    . LYS A 1 64 ? 6.497   8.722   -3.763  1.00 0.00 ? 73 LYS S O    5  
ATOM 5446  C CB   . LYS A 1 64 ? 7.295   5.666   -3.989  1.00 0.00 ? 73 LYS S CB   5  
ATOM 5447  C CG   . LYS A 1 64 ? 8.096   4.599   -4.714  1.00 0.00 ? 73 LYS S CG   5  
ATOM 5448  C CD   . LYS A 1 64 ? 8.050   4.798   -6.221  1.00 0.00 ? 73 LYS S CD   5  
ATOM 5449  C CE   . LYS A 1 64 ? 9.285   5.528   -6.722  1.00 0.00 ? 73 LYS S CE   5  
ATOM 5450  N NZ   . LYS A 1 64 ? 9.212   5.801   -8.184  1.00 0.00 ? 73 LYS S NZ   5  
ATOM 5451  H H    . LYS A 1 64 ? 9.132   5.908   -2.154  1.00 0.00 ? 73 LYS S H    5  
ATOM 5452  H HA   . LYS A 1 64 ? 8.495   7.322   -4.617  1.00 0.00 ? 73 LYS S HA   5  
ATOM 5453  H HB2  . LYS A 1 64 ? 6.942   5.250   -3.056  1.00 0.00 ? 73 LYS S HB2  5  
ATOM 5454  H HB3  . LYS A 1 64 ? 6.444   5.928   -4.603  1.00 0.00 ? 73 LYS S HB3  5  
ATOM 5455  H HG2  . LYS A 1 64 ? 9.124   4.649   -4.387  1.00 0.00 ? 73 LYS S HG2  5  
ATOM 5456  H HG3  . LYS A 1 64 ? 7.687   3.629   -4.474  1.00 0.00 ? 73 LYS S HG3  5  
ATOM 5457  H HD2  . LYS A 1 64 ? 7.995   3.833   -6.700  1.00 0.00 ? 73 LYS S HD2  5  
ATOM 5458  H HD3  . LYS A 1 64 ? 7.173   5.377   -6.470  1.00 0.00 ? 73 LYS S HD3  5  
ATOM 5459  H HE2  . LYS A 1 64 ? 9.372   6.467   -6.194  1.00 0.00 ? 73 LYS S HE2  5  
ATOM 5460  H HE3  . LYS A 1 64 ? 10.155  4.920   -6.521  1.00 0.00 ? 73 LYS S HE3  5  
ATOM 5461  H HZ1  . LYS A 1 64 ? 8.385   6.394   -8.396  1.00 0.00 ? 73 LYS S HZ1  5  
ATOM 5462  H HZ2  . LYS A 1 64 ? 9.131   4.908   -8.711  1.00 0.00 ? 73 LYS S HZ2  5  
ATOM 5463  H HZ3  . LYS A 1 64 ? 10.070  6.298   -8.498  1.00 0.00 ? 73 LYS S HZ3  5  
ATOM 5464  N N    . GLY A 1 65 ? 7.220   8.068   -1.735  1.00 0.00 ? 74 GLY S N    5  
ATOM 5465  C CA   . GLY A 1 65 ? 6.410   9.044   -1.032  1.00 0.00 ? 74 GLY S CA   5  
ATOM 5466  C C    . GLY A 1 65 ? 5.090   8.484   -0.543  1.00 0.00 ? 74 GLY S C    5  
ATOM 5467  O O    . GLY A 1 65 ? 4.060   9.154   -0.622  1.00 0.00 ? 74 GLY S O    5  
ATOM 5468  H H    . GLY A 1 65 ? 7.801   7.463   -1.228  1.00 0.00 ? 74 GLY S H    5  
ATOM 5469  H HA2  . GLY A 1 65 ? 6.967   9.401   -0.177  1.00 0.00 ? 74 GLY S HA2  5  
ATOM 5470  H HA3  . GLY A 1 65 ? 6.213   9.875   -1.695  1.00 0.00 ? 74 GLY S HA3  5  
ATOM 5471  N N    . LEU A 1 66 ? 5.117   7.262   -0.021  1.00 0.00 ? 75 LEU S N    5  
ATOM 5472  C CA   . LEU A 1 66 ? 3.907   6.634   0.497   1.00 0.00 ? 75 LEU S CA   5  
ATOM 5473  C C    . LEU A 1 66 ? 3.955   6.567   2.019   1.00 0.00 ? 75 LEU S C    5  
ATOM 5474  O O    . LEU A 1 66 ? 3.341   7.390   2.698   1.00 0.00 ? 75 LEU S O    5  
ATOM 5475  C CB   . LEU A 1 66 ? 3.718   5.235   -0.090  1.00 0.00 ? 75 LEU S CB   5  
ATOM 5476  C CG   . LEU A 1 66 ? 4.022   5.118   -1.583  1.00 0.00 ? 75 LEU S CG   5  
ATOM 5477  C CD1  . LEU A 1 66 ? 4.349   3.680   -1.949  1.00 0.00 ? 75 LEU S CD1  5  
ATOM 5478  C CD2  . LEU A 1 66 ? 2.847   5.625   -2.404  1.00 0.00 ? 75 LEU S CD2  5  
ATOM 5479  H H    . LEU A 1 66 ? 5.967   6.778   0.027   1.00 0.00 ? 75 LEU S H    5  
ATOM 5480  H HA   . LEU A 1 66 ? 3.068   7.250   0.207   1.00 0.00 ? 75 LEU S HA   5  
ATOM 5481  H HB2  . LEU A 1 66 ? 4.359   4.549   0.447   1.00 0.00 ? 75 LEU S HB2  5  
ATOM 5482  H HB3  . LEU A 1 66 ? 2.690   4.939   0.067   1.00 0.00 ? 75 LEU S HB3  5  
ATOM 5483  H HG   . LEU A 1 66 ? 4.884   5.726   -1.818  1.00 0.00 ? 75 LEU S HG   5  
ATOM 5484  H HD11 . LEU A 1 66 ? 3.816   3.011   -1.289  1.00 0.00 ? 75 LEU S HD11 5  
ATOM 5485  H HD12 . LEU A 1 66 ? 5.412   3.516   -1.848  1.00 0.00 ? 75 LEU S HD12 5  
ATOM 5486  H HD13 . LEU A 1 66 ? 4.051   3.492   -2.970  1.00 0.00 ? 75 LEU S HD13 5  
ATOM 5487  H HD21 . LEU A 1 66 ? 3.064   5.506   -3.456  1.00 0.00 ? 75 LEU S HD21 5  
ATOM 5488  H HD22 . LEU A 1 66 ? 2.679   6.670   -2.187  1.00 0.00 ? 75 LEU S HD22 5  
ATOM 5489  H HD23 . LEU A 1 66 ? 1.963   5.058   -2.153  1.00 0.00 ? 75 LEU S HD23 5  
ATOM 5490  N N    . PHE A 1 67 ? 4.685   5.592   2.557   1.00 0.00 ? 76 PHE S N    5  
ATOM 5491  C CA   . PHE A 1 67 ? 4.787   5.456   4.013   1.00 0.00 ? 76 PHE S CA   5  
ATOM 5492  C C    . PHE A 1 67 ? 5.226   6.768   4.657   1.00 0.00 ? 76 PHE S C    5  
ATOM 5493  O O    . PHE A 1 67 ? 4.639   7.142   5.695   1.00 0.00 ? 76 PHE S O    5  
ATOM 5494  C CB   . PHE A 1 67 ? 5.755   4.337   4.405   1.00 0.00 ? 76 PHE S CB   5  
ATOM 5495  C CG   . PHE A 1 67 ? 5.098   3.229   5.172   1.00 0.00 ? 76 PHE S CG   5  
ATOM 5496  C CD1  . PHE A 1 67 ? 4.077   2.495   4.595   1.00 0.00 ? 76 PHE S CD1  5  
ATOM 5497  C CD2  . PHE A 1 67 ? 5.497   2.918   6.461   1.00 0.00 ? 76 PHE S CD2  5  
ATOM 5498  C CE1  . PHE A 1 67 ? 3.468   1.470   5.280   1.00 0.00 ? 76 PHE S CE1  5  
ATOM 5499  C CE2  . PHE A 1 67 ? 4.889   1.890   7.157   1.00 0.00 ? 76 PHE S CE2  5  
ATOM 5500  C CZ   . PHE A 1 67 ? 3.874   1.164   6.566   1.00 0.00 ? 76 PHE S CZ   5  
ATOM 5501  O OXT  . PHE A 1 67 ? 6.153   7.409   4.119   1.00 0.00 ? 76 PHE S OXT  5  
ATOM 5502  H H    . PHE A 1 67 ? 5.158   4.957   1.968   1.00 0.00 ? 76 PHE S H    5  
ATOM 5503  H HA   . PHE A 1 67 ? 3.807   5.203   4.381   1.00 0.00 ? 76 PHE S HA   5  
ATOM 5504  H HB2  . PHE A 1 67 ? 6.185   3.912   3.515   1.00 0.00 ? 76 PHE S HB2  5  
ATOM 5505  H HB3  . PHE A 1 67 ? 6.543   4.748   5.020   1.00 0.00 ? 76 PHE S HB3  5  
ATOM 5506  H HD1  . PHE A 1 67 ? 3.759   2.732   3.590   1.00 0.00 ? 76 PHE S HD1  5  
ATOM 5507  H HD2  . PHE A 1 67 ? 6.292   3.485   6.923   1.00 0.00 ? 76 PHE S HD2  5  
ATOM 5508  H HE1  . PHE A 1 67 ? 2.677   0.908   4.812   1.00 0.00 ? 76 PHE S HE1  5  
ATOM 5509  H HE2  . PHE A 1 67 ? 5.203   1.655   8.164   1.00 0.00 ? 76 PHE S HE2  5  
ATOM 5510  H HZ   . PHE A 1 67 ? 3.397   0.362   7.106   1.00 0.00 ? 76 PHE S HZ   5  
ATOM 5511  N N    . MET A 1 1  ? -17.076 -4.743  14.713  1.00 0.00 ? 10 MET S N    6  
ATOM 5512  C CA   . MET A 1 1  ? -16.624 -3.429  14.188  1.00 0.00 ? 10 MET S CA   6  
ATOM 5513  C C    . MET A 1 1  ? -15.133 -3.449  13.861  1.00 0.00 ? 10 MET S C    6  
ATOM 5514  O O    . MET A 1 1  ? -14.727 -3.109  12.750  1.00 0.00 ? 10 MET S O    6  
ATOM 5515  C CB   . MET A 1 1  ? -16.920 -2.358  15.239  1.00 0.00 ? 10 MET S CB   6  
ATOM 5516  C CG   . MET A 1 1  ? -18.304 -1.743  15.107  1.00 0.00 ? 10 MET S CG   6  
ATOM 5517  S SD   . MET A 1 1  ? -18.375 -0.457  13.845  1.00 0.00 ? 10 MET S SD   6  
ATOM 5518  C CE   . MET A 1 1  ? -20.144 -0.205  13.718  1.00 0.00 ? 10 MET S CE   6  
ATOM 5519  H H1   . MET A 1 1  ? -16.634 -5.485  14.132  1.00 0.00 ? 10 MET S H1   6  
ATOM 5520  H H2   . MET A 1 1  ? -18.113 -4.774  14.638  1.00 0.00 ? 10 MET S H2   6  
ATOM 5521  H H3   . MET A 1 1  ? -16.768 -4.813  15.703  1.00 0.00 ? 10 MET S H3   6  
ATOM 5522  H HA   . MET A 1 1  ? -17.179 -3.209  13.289  1.00 0.00 ? 10 MET S HA   6  
ATOM 5523  H HB2  . MET A 1 1  ? -16.838 -2.801  16.220  1.00 0.00 ? 10 MET S HB2  6  
ATOM 5524  H HB3  . MET A 1 1  ? -16.188 -1.568  15.148  1.00 0.00 ? 10 MET S HB3  6  
ATOM 5525  H HG2  . MET A 1 1  ? -19.005 -2.522  14.846  1.00 0.00 ? 10 MET S HG2  6  
ATOM 5526  H HG3  . MET A 1 1  ? -18.583 -1.313  16.058  1.00 0.00 ? 10 MET S HG3  6  
ATOM 5527  H HE1  . MET A 1 1  ? -20.556 -0.046  14.704  1.00 0.00 ? 10 MET S HE1  6  
ATOM 5528  H HE2  . MET A 1 1  ? -20.600 -1.077  13.272  1.00 0.00 ? 10 MET S HE2  6  
ATOM 5529  H HE3  . MET A 1 1  ? -20.340 0.659   13.101  1.00 0.00 ? 10 MET S HE3  6  
ATOM 5530  N N    . LEU A 1 2  ? -14.324 -3.848  14.838  1.00 0.00 ? 11 LEU S N    6  
ATOM 5531  C CA   . LEU A 1 2  ? -12.879 -3.911  14.653  1.00 0.00 ? 11 LEU S CA   6  
ATOM 5532  C C    . LEU A 1 2  ? -12.431 -5.337  14.350  1.00 0.00 ? 11 LEU S C    6  
ATOM 5533  O O    . LEU A 1 2  ? -11.451 -5.553  13.638  1.00 0.00 ? 11 LEU S O    6  
ATOM 5534  C CB   . LEU A 1 2  ? -12.162 -3.394  15.903  1.00 0.00 ? 11 LEU S CB   6  
ATOM 5535  C CG   . LEU A 1 2  ? -11.919 -1.884  15.931  1.00 0.00 ? 11 LEU S CG   6  
ATOM 5536  C CD1  . LEU A 1 2  ? -11.724 -1.401  17.360  1.00 0.00 ? 11 LEU S CD1  6  
ATOM 5537  C CD2  . LEU A 1 2  ? -10.714 -1.523  15.075  1.00 0.00 ? 11 LEU S CD2  6  
ATOM 5538  H H    . LEU A 1 2  ? -14.708 -4.104  15.701  1.00 0.00 ? 11 LEU S H    6  
ATOM 5539  H HA   . LEU A 1 2  ? -12.624 -3.279  13.816  1.00 0.00 ? 11 LEU S HA   6  
ATOM 5540  H HB2  . LEU A 1 2  ? -12.753 -3.659  16.768  1.00 0.00 ? 11 LEU S HB2  6  
ATOM 5541  H HB3  . LEU A 1 2  ? -11.206 -3.890  15.974  1.00 0.00 ? 11 LEU S HB3  6  
ATOM 5542  H HG   . LEU A 1 2  ? -12.783 -1.378  15.524  1.00 0.00 ? 11 LEU S HG   6  
ATOM 5543  H HD11 . LEU A 1 2  ? -10.688 -1.522  17.642  1.00 0.00 ? 11 LEU S HD11 6  
ATOM 5544  H HD12 . LEU A 1 2  ? -12.348 -1.980  18.024  1.00 0.00 ? 11 LEU S HD12 6  
ATOM 5545  H HD13 . LEU A 1 2  ? -11.994 -0.358  17.428  1.00 0.00 ? 11 LEU S HD13 6  
ATOM 5546  H HD21 . LEU A 1 2  ? -10.705 -0.458  14.896  1.00 0.00 ? 11 LEU S HD21 6  
ATOM 5547  H HD22 . LEU A 1 2  ? -10.775 -2.045  14.131  1.00 0.00 ? 11 LEU S HD22 6  
ATOM 5548  H HD23 . LEU A 1 2  ? -9.809  -1.810  15.588  1.00 0.00 ? 11 LEU S HD23 6  
ATOM 5549  N N    . ALA A 1 3  ? -13.156 -6.308  14.895  1.00 0.00 ? 12 ALA S N    6  
ATOM 5550  C CA   . ALA A 1 3  ? -12.834 -7.714  14.683  1.00 0.00 ? 12 ALA S CA   6  
ATOM 5551  C C    . ALA A 1 3  ? -12.872 -8.068  13.201  1.00 0.00 ? 12 ALA S C    6  
ATOM 5552  O O    . ALA A 1 3  ? -12.009 -8.790  12.701  1.00 0.00 ? 12 ALA S O    6  
ATOM 5553  C CB   . ALA A 1 3  ? -13.794 -8.600  15.463  1.00 0.00 ? 12 ALA S CB   6  
ATOM 5554  H H    . ALA A 1 3  ? -13.927 -6.074  15.454  1.00 0.00 ? 12 ALA S H    6  
ATOM 5555  H HA   . ALA A 1 3  ? -11.836 -7.888  15.058  1.00 0.00 ? 12 ALA S HA   6  
ATOM 5556  H HB1  . ALA A 1 3  ? -13.450 -8.693  16.482  1.00 0.00 ? 12 ALA S HB1  6  
ATOM 5557  H HB2  . ALA A 1 3  ? -13.833 -9.577  15.005  1.00 0.00 ? 12 ALA S HB2  6  
ATOM 5558  H HB3  . ALA A 1 3  ? -14.779 -8.158  15.454  1.00 0.00 ? 12 ALA S HB3  6  
ATOM 5559  N N    . LYS A 1 4  ? -13.879 -7.555  12.500  1.00 0.00 ? 13 LYS S N    6  
ATOM 5560  C CA   . LYS A 1 4  ? -14.030 -7.819  11.073  1.00 0.00 ? 13 LYS S CA   6  
ATOM 5561  C C    . LYS A 1 4  ? -13.347 -6.734  10.245  1.00 0.00 ? 13 LYS S C    6  
ATOM 5562  O O    . LYS A 1 4  ? -13.653 -5.550  10.384  1.00 0.00 ? 13 LYS S O    6  
ATOM 5563  C CB   . LYS A 1 4  ? -15.511 -7.906  10.703  1.00 0.00 ? 13 LYS S CB   6  
ATOM 5564  C CG   . LYS A 1 4  ? -16.284 -8.927  11.521  1.00 0.00 ? 13 LYS S CG   6  
ATOM 5565  C CD   . LYS A 1 4  ? -17.367 -9.602  10.692  1.00 0.00 ? 13 LYS S CD   6  
ATOM 5566  C CE   . LYS A 1 4  ? -18.644 -9.799  11.494  1.00 0.00 ? 13 LYS S CE   6  
ATOM 5567  N NZ   . LYS A 1 4  ? -19.691 -8.805  11.130  1.00 0.00 ? 13 LYS S NZ   6  
ATOM 5568  H H    . LYS A 1 4  ? -14.536 -6.987  12.953  1.00 0.00 ? 13 LYS S H    6  
ATOM 5569  H HA   . LYS A 1 4  ? -13.558 -8.767  10.860  1.00 0.00 ? 13 LYS S HA   6  
ATOM 5570  H HB2  . LYS A 1 4  ? -15.966 -6.937  10.853  1.00 0.00 ? 13 LYS S HB2  6  
ATOM 5571  H HB3  . LYS A 1 4  ? -15.594 -8.173  9.660   1.00 0.00 ? 13 LYS S HB3  6  
ATOM 5572  H HG2  . LYS A 1 4  ? -15.600 -9.680  11.880  1.00 0.00 ? 13 LYS S HG2  6  
ATOM 5573  H HG3  . LYS A 1 4  ? -16.745 -8.428  12.361  1.00 0.00 ? 13 LYS S HG3  6  
ATOM 5574  H HD2  . LYS A 1 4  ? -17.586 -8.984  9.834   1.00 0.00 ? 13 LYS S HD2  6  
ATOM 5575  H HD3  . LYS A 1 4  ? -17.007 -10.565 10.363  1.00 0.00 ? 13 LYS S HD3  6  
ATOM 5576  H HE2  . LYS A 1 4  ? -19.023 -10.792 11.304  1.00 0.00 ? 13 LYS S HE2  6  
ATOM 5577  H HE3  . LYS A 1 4  ? -18.413 -9.697  12.545  1.00 0.00 ? 13 LYS S HE3  6  
ATOM 5578  H HZ1  . LYS A 1 4  ? -19.251 -7.963  10.704  1.00 0.00 ? 13 LYS S HZ1  6  
ATOM 5579  H HZ2  . LYS A 1 4  ? -20.221 -8.516  11.976  1.00 0.00 ? 13 LYS S HZ2  6  
ATOM 5580  H HZ3  . LYS A 1 4  ? -20.353 -9.219  10.444  1.00 0.00 ? 13 LYS S HZ3  6  
ATOM 5581  N N    . LEU A 1 5  ? -12.423 -7.147  9.385   1.00 0.00 ? 14 LEU S N    6  
ATOM 5582  C CA   . LEU A 1 5  ? -11.697 -6.211  8.533   1.00 0.00 ? 14 LEU S CA   6  
ATOM 5583  C C    . LEU A 1 5  ? -11.951 -6.509  7.059   1.00 0.00 ? 14 LEU S C    6  
ATOM 5584  O O    . LEU A 1 5  ? -12.340 -7.619  6.697   1.00 0.00 ? 14 LEU S O    6  
ATOM 5585  C CB   . LEU A 1 5  ? -10.196 -6.280  8.828   1.00 0.00 ? 14 LEU S CB   6  
ATOM 5586  C CG   . LEU A 1 5  ? -9.821  -6.163  10.308  1.00 0.00 ? 14 LEU S CG   6  
ATOM 5587  C CD1  . LEU A 1 5  ? -8.728  -7.160  10.663  1.00 0.00 ? 14 LEU S CD1  6  
ATOM 5588  C CD2  . LEU A 1 5  ? -9.379  -4.745  10.635  1.00 0.00 ? 14 LEU S CD2  6  
ATOM 5589  H H    . LEU A 1 5  ? -12.224 -8.105  9.321   1.00 0.00 ? 14 LEU S H    6  
ATOM 5590  H HA   . LEU A 1 5  ? -12.054 -5.217  8.755   1.00 0.00 ? 14 LEU S HA   6  
ATOM 5591  H HB2  . LEU A 1 5  ? -9.822  -7.221  8.454   1.00 0.00 ? 14 LEU S HB2  6  
ATOM 5592  H HB3  . LEU A 1 5  ? -9.710  -5.479  8.291   1.00 0.00 ? 14 LEU S HB3  6  
ATOM 5593  H HG   . LEU A 1 5  ? -10.688 -6.391  10.911  1.00 0.00 ? 14 LEU S HG   6  
ATOM 5594  H HD11 . LEU A 1 5  ? -8.087  -6.735  11.423  1.00 0.00 ? 14 LEU S HD11 6  
ATOM 5595  H HD12 . LEU A 1 5  ? -8.143  -7.381  9.782   1.00 0.00 ? 14 LEU S HD12 6  
ATOM 5596  H HD13 . LEU A 1 5  ? -9.175  -8.068  11.036  1.00 0.00 ? 14 LEU S HD13 6  
ATOM 5597  H HD21 . LEU A 1 5  ? -8.932  -4.295  9.760   1.00 0.00 ? 14 LEU S HD21 6  
ATOM 5598  H HD22 . LEU A 1 5  ? -8.655  -4.769  11.437  1.00 0.00 ? 14 LEU S HD22 6  
ATOM 5599  H HD23 . LEU A 1 5  ? -10.235 -4.162  10.940  1.00 0.00 ? 14 LEU S HD23 6  
ATOM 5600  N N    . CYS A 1 6  ? -11.729 -5.509  6.212   1.00 0.00 ? 15 CYS S N    6  
ATOM 5601  C CA   . CYS A 1 6  ? -11.932 -5.662  4.776   1.00 0.00 ? 15 CYS S CA   6  
ATOM 5602  C C    . CYS A 1 6  ? -10.705 -5.199  3.999   1.00 0.00 ? 15 CYS S C    6  
ATOM 5603  O O    . CYS A 1 6  ? -9.952  -4.342  4.461   1.00 0.00 ? 15 CYS S O    6  
ATOM 5604  C CB   . CYS A 1 6  ? -13.163 -4.871  4.328   1.00 0.00 ? 15 CYS S CB   6  
ATOM 5605  S SG   . CYS A 1 6  ? -14.180 -5.721  3.097   1.00 0.00 ? 15 CYS S SG   6  
ATOM 5606  H H    . CYS A 1 6  ? -11.419 -4.648  6.561   1.00 0.00 ? 15 CYS S H    6  
ATOM 5607  H HA   . CYS A 1 6  ? -12.098 -6.710  4.575   1.00 0.00 ? 15 CYS S HA   6  
ATOM 5608  H HB2  . CYS A 1 6  ? -13.787 -4.672  5.187   1.00 0.00 ? 15 CYS S HB2  6  
ATOM 5609  H HB3  . CYS A 1 6  ? -12.843 -3.934  3.898   1.00 0.00 ? 15 CYS S HB3  6  
ATOM 5610  H HG   . CYS A 1 6  ? -14.872 -5.119  2.818   1.00 0.00 ? 15 CYS S HG   6  
ATOM 5611  N N    . LYS A 1 7  ? -10.509 -5.772  2.815   1.00 0.00 ? 16 LYS S N    6  
ATOM 5612  C CA   . LYS A 1 7  ? -9.372  -5.420  1.972   1.00 0.00 ? 16 LYS S CA   6  
ATOM 5613  C C    . LYS A 1 7  ? -9.840  -4.771  0.672   1.00 0.00 ? 16 LYS S C    6  
ATOM 5614  O O    . LYS A 1 7  ? -10.640 -5.345  -0.067  1.00 0.00 ? 16 LYS S O    6  
ATOM 5615  C CB   . LYS A 1 7  ? -8.538  -6.665  1.663   1.00 0.00 ? 16 LYS S CB   6  
ATOM 5616  C CG   . LYS A 1 7  ? -7.964  -7.334  2.902   1.00 0.00 ? 16 LYS S CG   6  
ATOM 5617  C CD   . LYS A 1 7  ? -6.478  -7.052  3.052   1.00 0.00 ? 16 LYS S CD   6  
ATOM 5618  C CE   . LYS A 1 7  ? -5.790  -8.113  3.897   1.00 0.00 ? 16 LYS S CE   6  
ATOM 5619  N NZ   . LYS A 1 7  ? -4.529  -8.594  3.266   1.00 0.00 ? 16 LYS S NZ   6  
ATOM 5620  H H    . LYS A 1 7  ? -11.144 -6.450  2.501   1.00 0.00 ? 16 LYS S H    6  
ATOM 5621  H HA   . LYS A 1 7  ? -8.763  -4.713  2.515   1.00 0.00 ? 16 LYS S HA   6  
ATOM 5622  H HB2  . LYS A 1 7  ? -9.160  -7.382  1.149   1.00 0.00 ? 16 LYS S HB2  6  
ATOM 5623  H HB3  . LYS A 1 7  ? -7.718  -6.383  1.019   1.00 0.00 ? 16 LYS S HB3  6  
ATOM 5624  H HG2  . LYS A 1 7  ? -8.481  -6.961  3.774   1.00 0.00 ? 16 LYS S HG2  6  
ATOM 5625  H HG3  . LYS A 1 7  ? -8.113  -8.401  2.824   1.00 0.00 ? 16 LYS S HG3  6  
ATOM 5626  H HD2  . LYS A 1 7  ? -6.023  -7.036  2.073   1.00 0.00 ? 16 LYS S HD2  6  
ATOM 5627  H HD3  . LYS A 1 7  ? -6.349  -6.090  3.526   1.00 0.00 ? 16 LYS S HD3  6  
ATOM 5628  H HE2  . LYS A 1 7  ? -5.558  -7.692  4.865   1.00 0.00 ? 16 LYS S HE2  6  
ATOM 5629  H HE3  . LYS A 1 7  ? -6.462  -8.950  4.021   1.00 0.00 ? 16 LYS S HE3  6  
ATOM 5630  H HZ1  . LYS A 1 7  ? -4.404  -9.611  3.447   1.00 0.00 ? 16 LYS S HZ1  6  
ATOM 5631  H HZ2  . LYS A 1 7  ? -3.715  -8.079  3.657   1.00 0.00 ? 16 LYS S HZ2  6  
ATOM 5632  H HZ3  . LYS A 1 7  ? -4.563  -8.438  2.238   1.00 0.00 ? 16 LYS S HZ3  6  
ATOM 5633  N N    . THR A 1 8  ? -9.334  -3.572  0.397   1.00 0.00 ? 17 THR S N    6  
ATOM 5634  C CA   . THR A 1 8  ? -9.702  -2.846  -0.814  1.00 0.00 ? 17 THR S CA   6  
ATOM 5635  C C    . THR A 1 8  ? -8.586  -1.897  -1.241  1.00 0.00 ? 17 THR S C    6  
ATOM 5636  O O    . THR A 1 8  ? -7.909  -1.301  -0.404  1.00 0.00 ? 17 THR S O    6  
ATOM 5637  C CB   . THR A 1 8  ? -10.994 -2.061  -0.588  1.00 0.00 ? 17 THR S CB   6  
ATOM 5638  O OG1  . THR A 1 8  ? -11.976 -2.877  0.027   1.00 0.00 ? 17 THR S OG1  6  
ATOM 5639  C CG2  . THR A 1 8  ? -11.591 -1.510  -1.865  1.00 0.00 ? 17 THR S CG2  6  
ATOM 5640  H H    . THR A 1 8  ? -8.700  -3.166  1.025   1.00 0.00 ? 17 THR S H    6  
ATOM 5641  H HA   . THR A 1 8  ? -9.863  -3.571  -1.597  1.00 0.00 ? 17 THR S HA   6  
ATOM 5642  H HB   . THR A 1 8  ? -10.787 -1.227  0.067   1.00 0.00 ? 17 THR S HB   6  
ATOM 5643  H HG1  . THR A 1 8  ? -12.401 -2.389  0.736   1.00 0.00 ? 17 THR S HG1  6  
ATOM 5644  H HG21 . THR A 1 8  ? -11.075 -1.930  -2.715  1.00 0.00 ? 17 THR S HG21 6  
ATOM 5645  H HG22 . THR A 1 8  ? -11.489 -0.435  -1.875  1.00 0.00 ? 17 THR S HG22 6  
ATOM 5646  H HG23 . THR A 1 8  ? -12.639 -1.771  -1.915  1.00 0.00 ? 17 THR S HG23 6  
ATOM 5647  N N    . ILE A 1 9  ? -8.400  -1.762  -2.551  1.00 0.00 ? 18 ILE S N    6  
ATOM 5648  C CA   . ILE A 1 9  ? -7.368  -0.889  -3.090  1.00 0.00 ? 18 ILE S CA   6  
ATOM 5649  C C    . ILE A 1 9  ? -7.896  0.522   -3.311  1.00 0.00 ? 18 ILE S C    6  
ATOM 5650  O O    . ILE A 1 9  ? -8.926  0.719   -3.956  1.00 0.00 ? 18 ILE S O    6  
ATOM 5651  C CB   . ILE A 1 9  ? -6.827  -1.425  -4.429  1.00 0.00 ? 18 ILE S CB   6  
ATOM 5652  C CG1  . ILE A 1 9  ? -6.359  -2.868  -4.273  1.00 0.00 ? 18 ILE S CG1  6  
ATOM 5653  C CG2  . ILE A 1 9  ? -5.692  -0.546  -4.938  1.00 0.00 ? 18 ILE S CG2  6  
ATOM 5654  C CD1  . ILE A 1 9  ? -7.481  -3.882  -4.342  1.00 0.00 ? 18 ILE S CD1  6  
ATOM 5655  H H    . ILE A 1 9  ? -8.967  -2.265  -3.170  1.00 0.00 ? 18 ILE S H    6  
ATOM 5656  H HA   . ILE A 1 9  ? -6.553  -0.854  -2.384  1.00 0.00 ? 18 ILE S HA   6  
ATOM 5657  H HB   . ILE A 1 9  ? -7.628  -1.390  -5.153  1.00 0.00 ? 18 ILE S HB   6  
ATOM 5658  H HG12 . ILE A 1 9  ? -5.662  -3.092  -5.060  1.00 0.00 ? 18 ILE S HG12 6  
ATOM 5659  H HG13 . ILE A 1 9  ? -5.867  -2.981  -3.317  1.00 0.00 ? 18 ILE S HG13 6  
ATOM 5660  H HG21 . ILE A 1 9  ? -5.000  -1.148  -5.507  1.00 0.00 ? 18 ILE S HG21 6  
ATOM 5661  H HG22 . ILE A 1 9  ? -5.179  -0.099  -4.099  1.00 0.00 ? 18 ILE S HG22 6  
ATOM 5662  H HG23 . ILE A 1 9  ? -6.096  0.231   -5.570  1.00 0.00 ? 18 ILE S HG23 6  
ATOM 5663  H HD11 . ILE A 1 9  ? -7.696  -4.251  -3.350  1.00 0.00 ? 18 ILE S HD11 6  
ATOM 5664  H HD12 . ILE A 1 9  ? -7.183  -4.705  -4.974  1.00 0.00 ? 18 ILE S HD12 6  
ATOM 5665  H HD13 . ILE A 1 9  ? -8.364  -3.415  -4.752  1.00 0.00 ? 18 ILE S HD13 6  
ATOM 5666  N N    . TYR A 1 10 ? -7.171  1.502   -2.787  1.00 0.00 ? 19 TYR S N    6  
ATOM 5667  C CA   . TYR A 1 10 ? -7.549  2.896   -2.941  1.00 0.00 ? 19 TYR S CA   6  
ATOM 5668  C C    . TYR A 1 10 ? -6.728  3.526   -4.065  1.00 0.00 ? 19 TYR S C    6  
ATOM 5669  O O    . TYR A 1 10 ? -5.660  3.025   -4.416  1.00 0.00 ? 19 TYR S O    6  
ATOM 5670  C CB   . TYR A 1 10 ? -7.372  3.647   -1.608  1.00 0.00 ? 19 TYR S CB   6  
ATOM 5671  C CG   . TYR A 1 10 ? -8.479  3.356   -0.601  1.00 0.00 ? 19 TYR S CG   6  
ATOM 5672  C CD1  . TYR A 1 10 ? -9.399  2.338   -0.835  1.00 0.00 ? 19 TYR S CD1  6  
ATOM 5673  C CD2  . TYR A 1 10 ? -8.615  4.097   0.577   1.00 0.00 ? 19 TYR S CD2  6  
ATOM 5674  C CE1  . TYR A 1 10 ? -10.415 2.066   0.059   1.00 0.00 ? 19 TYR S CE1  6  
ATOM 5675  C CE2  . TYR A 1 10 ? -9.632  3.825   1.473   1.00 0.00 ? 19 TYR S CE2  6  
ATOM 5676  C CZ   . TYR A 1 10 ? -10.528 2.812   1.210   1.00 0.00 ? 19 TYR S CZ   6  
ATOM 5677  O OH   . TYR A 1 10 ? -11.543 2.542   2.098   1.00 0.00 ? 19 TYR S OH   6  
ATOM 5678  H H    . TYR A 1 10 ? -6.354  1.282   -2.299  1.00 0.00 ? 19 TYR S H    6  
ATOM 5679  H HA   . TYR A 1 10 ? -8.591  2.921   -3.221  1.00 0.00 ? 19 TYR S HA   6  
ATOM 5680  H HB2  . TYR A 1 10 ? -6.430  3.361   -1.161  1.00 0.00 ? 19 TYR S HB2  6  
ATOM 5681  H HB3  . TYR A 1 10 ? -7.368  4.712   -1.801  1.00 0.00 ? 19 TYR S HB3  6  
ATOM 5682  H HD1  . TYR A 1 10 ? -9.310  1.750   -1.735  1.00 0.00 ? 19 TYR S HD1  6  
ATOM 5683  H HD2  . TYR A 1 10 ? -7.915  4.893   0.794   1.00 0.00 ? 19 TYR S HD2  6  
ATOM 5684  H HE1  . TYR A 1 10 ? -11.115 1.272   -0.146  1.00 0.00 ? 19 TYR S HE1  6  
ATOM 5685  H HE2  . TYR A 1 10 ? -9.721  4.410   2.377   1.00 0.00 ? 19 TYR S HE2  6  
ATOM 5686  H HH   . TYR A 1 10 ? -11.656 1.592   2.178   1.00 0.00 ? 19 TYR S HH   6  
ATOM 5687  N N    . PRO A 1 11 ? -7.228  4.614   -4.670  1.00 0.00 ? 20 PRO S N    6  
ATOM 5688  C CA   . PRO A 1 11 ? -6.551  5.290   -5.781  1.00 0.00 ? 20 PRO S CA   6  
ATOM 5689  C C    . PRO A 1 11 ? -5.079  5.572   -5.495  1.00 0.00 ? 20 PRO S C    6  
ATOM 5690  O O    . PRO A 1 11 ? -4.746  6.524   -4.790  1.00 0.00 ? 20 PRO S O    6  
ATOM 5691  C CB   . PRO A 1 11 ? -7.333  6.602   -5.952  1.00 0.00 ? 20 PRO S CB   6  
ATOM 5692  C CG   . PRO A 1 11 ? -8.275  6.672   -4.794  1.00 0.00 ? 20 PRO S CG   6  
ATOM 5693  C CD   . PRO A 1 11 ? -8.499  5.258   -4.341  1.00 0.00 ? 20 PRO S CD   6  
ATOM 5694  H HA   . PRO A 1 11 ? -6.626  4.709   -6.690  1.00 0.00 ? 20 PRO S HA   6  
ATOM 5695  H HB2  . PRO A 1 11 ? -6.644  7.435   -5.946  1.00 0.00 ? 20 PRO S HB2  6  
ATOM 5696  H HB3  . PRO A 1 11 ? -7.868  6.581   -6.891  1.00 0.00 ? 20 PRO S HB3  6  
ATOM 5697  H HG2  . PRO A 1 11 ? -7.831  7.252   -3.999  1.00 0.00 ? 20 PRO S HG2  6  
ATOM 5698  H HG3  . PRO A 1 11 ? -9.208  7.117   -5.106  1.00 0.00 ? 20 PRO S HG3  6  
ATOM 5699  H HD2  . PRO A 1 11 ? -8.686  5.226   -3.275  1.00 0.00 ? 20 PRO S HD2  6  
ATOM 5700  H HD3  . PRO A 1 11 ? -9.313  4.803   -4.884  1.00 0.00 ? 20 PRO S HD3  6  
ATOM 5701  N N    . LEU A 1 12 ? -4.204  4.729   -6.046  1.00 0.00 ? 21 LEU S N    6  
ATOM 5702  C CA   . LEU A 1 12 ? -2.760  4.868   -5.859  1.00 0.00 ? 21 LEU S CA   6  
ATOM 5703  C C    . LEU A 1 12 ? -2.305  6.325   -5.881  1.00 0.00 ? 21 LEU S C    6  
ATOM 5704  O O    . LEU A 1 12 ? -1.360  6.699   -5.189  1.00 0.00 ? 21 LEU S O    6  
ATOM 5705  C CB   . LEU A 1 12 ? -2.008  4.091   -6.936  1.00 0.00 ? 21 LEU S CB   6  
ATOM 5706  C CG   . LEU A 1 12 ? -1.951  4.763   -8.309  1.00 0.00 ? 21 LEU S CG   6  
ATOM 5707  C CD1  . LEU A 1 12 ? -0.730  5.665   -8.409  1.00 0.00 ? 21 LEU S CD1  6  
ATOM 5708  C CD2  . LEU A 1 12 ? -1.934  3.717   -9.415  1.00 0.00 ? 21 LEU S CD2  6  
ATOM 5709  H H    . LEU A 1 12 ? -4.538  3.984   -6.592  1.00 0.00 ? 21 LEU S H    6  
ATOM 5710  H HA   . LEU A 1 12 ? -2.517  4.446   -4.899  1.00 0.00 ? 21 LEU S HA   6  
ATOM 5711  H HB2  . LEU A 1 12 ? -0.997  3.941   -6.586  1.00 0.00 ? 21 LEU S HB2  6  
ATOM 5712  H HB3  . LEU A 1 12 ? -2.481  3.126   -7.053  1.00 0.00 ? 21 LEU S HB3  6  
ATOM 5713  H HG   . LEU A 1 12 ? -2.830  5.375   -8.441  1.00 0.00 ? 21 LEU S HG   6  
ATOM 5714  H HD11 . LEU A 1 12 ? 0.098   5.211   -7.886  1.00 0.00 ? 21 LEU S HD11 6  
ATOM 5715  H HD12 . LEU A 1 12 ? -0.955  6.624   -7.966  1.00 0.00 ? 21 LEU S HD12 6  
ATOM 5716  H HD13 . LEU A 1 12 ? -0.468  5.802   -9.449  1.00 0.00 ? 21 LEU S HD13 6  
ATOM 5717  H HD21 . LEU A 1 12 ? -2.351  2.794   -9.043  1.00 0.00 ? 21 LEU S HD21 6  
ATOM 5718  H HD22 . LEU A 1 12 ? -0.917  3.549   -9.735  1.00 0.00 ? 21 LEU S HD22 6  
ATOM 5719  H HD23 . LEU A 1 12 ? -2.521  4.068   -10.250 1.00 0.00 ? 21 LEU S HD23 6  
ATOM 5720  N N    . ALA A 1 13 ? -2.971  7.140   -6.687  1.00 0.00 ? 22 ALA S N    6  
ATOM 5721  C CA   . ALA A 1 13 ? -2.617  8.547   -6.793  1.00 0.00 ? 22 ALA S CA   6  
ATOM 5722  C C    . ALA A 1 13 ? -2.964  9.292   -5.514  1.00 0.00 ? 22 ALA S C    6  
ATOM 5723  O O    . ALA A 1 13 ? -2.184  10.108  -5.023  1.00 0.00 ? 22 ALA S O    6  
ATOM 5724  C CB   . ALA A 1 13 ? -3.323  9.180   -7.983  1.00 0.00 ? 22 ALA S CB   6  
ATOM 5725  H H    . ALA A 1 13 ? -3.714  6.788   -7.220  1.00 0.00 ? 22 ALA S H    6  
ATOM 5726  H HA   . ALA A 1 13 ? -1.551  8.612   -6.960  1.00 0.00 ? 22 ALA S HA   6  
ATOM 5727  H HB1  . ALA A 1 13 ? -2.938  10.176  -8.143  1.00 0.00 ? 22 ALA S HB1  6  
ATOM 5728  H HB2  . ALA A 1 13 ? -4.384  9.232   -7.786  1.00 0.00 ? 22 ALA S HB2  6  
ATOM 5729  H HB3  . ALA A 1 13 ? -3.150  8.582   -8.866  1.00 0.00 ? 22 ALA S HB3  6  
ATOM 5730  N N    . ASP A 1 14 ? -4.145  9.005   -4.981  1.00 0.00 ? 23 ASP S N    6  
ATOM 5731  C CA   . ASP A 1 14 ? -4.613  9.651   -3.765  1.00 0.00 ? 23 ASP S CA   6  
ATOM 5732  C C    . ASP A 1 14 ? -3.772  9.263   -2.551  1.00 0.00 ? 23 ASP S C    6  
ATOM 5733  O O    . ASP A 1 14 ? -3.647  10.041  -1.606  1.00 0.00 ? 23 ASP S O    6  
ATOM 5734  C CB   . ASP A 1 14 ? -6.082  9.304   -3.517  1.00 0.00 ? 23 ASP S CB   6  
ATOM 5735  C CG   . ASP A 1 14 ? -7.008  10.465  -3.825  1.00 0.00 ? 23 ASP S CG   6  
ATOM 5736  O OD1  . ASP A 1 14 ? -6.876  11.056  -4.917  1.00 0.00 ? 23 ASP S OD1  6  
ATOM 5737  O OD2  . ASP A 1 14 ? -7.866  10.781  -2.975  1.00 0.00 ? 23 ASP S OD2  6  
ATOM 5738  H H    . ASP A 1 14 ? -4.721  8.348   -5.425  1.00 0.00 ? 23 ASP S H    6  
ATOM 5739  H HA   . ASP A 1 14 ? -4.528  10.711  -3.912  1.00 0.00 ? 23 ASP S HA   6  
ATOM 5740  H HB2  . ASP A 1 14 ? -6.357  8.472   -4.147  1.00 0.00 ? 23 ASP S HB2  6  
ATOM 5741  H HB3  . ASP A 1 14 ? -6.213  9.027   -2.479  1.00 0.00 ? 23 ASP S HB3  6  
ATOM 5742  N N    . LEU A 1 15 ? -3.199  8.066   -2.574  1.00 0.00 ? 24 LEU S N    6  
ATOM 5743  C CA   . LEU A 1 15 ? -2.382  7.605   -1.452  1.00 0.00 ? 24 LEU S CA   6  
ATOM 5744  C C    . LEU A 1 15 ? -0.926  8.006   -1.616  1.00 0.00 ? 24 LEU S C    6  
ATOM 5745  O O    . LEU A 1 15 ? -0.160  8.012   -0.653  1.00 0.00 ? 24 LEU S O    6  
ATOM 5746  C CB   . LEU A 1 15 ? -2.462  6.087   -1.303  1.00 0.00 ? 24 LEU S CB   6  
ATOM 5747  C CG   . LEU A 1 15 ? -2.571  5.305   -2.617  1.00 0.00 ? 24 LEU S CG   6  
ATOM 5748  C CD1  . LEU A 1 15 ? -1.557  4.169   -2.670  1.00 0.00 ? 24 LEU S CD1  6  
ATOM 5749  C CD2  . LEU A 1 15 ? -3.983  4.771   -2.791  1.00 0.00 ? 24 LEU S CD2  6  
ATOM 5750  H H    . LEU A 1 15 ? -3.329  7.481   -3.354  1.00 0.00 ? 24 LEU S H    6  
ATOM 5751  H HA   . LEU A 1 15 ? -2.767  8.062   -0.558  1.00 0.00 ? 24 LEU S HA   6  
ATOM 5752  H HB2  . LEU A 1 15 ? -1.571  5.760   -0.788  1.00 0.00 ? 24 LEU S HB2  6  
ATOM 5753  H HB3  . LEU A 1 15 ? -3.320  5.850   -0.693  1.00 0.00 ? 24 LEU S HB3  6  
ATOM 5754  H HG   . LEU A 1 15 ? -2.363  5.968   -3.438  1.00 0.00 ? 24 LEU S HG   6  
ATOM 5755  H HD11 . LEU A 1 15 ? -0.746  4.375   -1.988  1.00 0.00 ? 24 LEU S HD11 6  
ATOM 5756  H HD12 . LEU A 1 15 ? -1.168  4.080   -3.672  1.00 0.00 ? 24 LEU S HD12 6  
ATOM 5757  H HD13 . LEU A 1 15 ? -2.039  3.243   -2.389  1.00 0.00 ? 24 LEU S HD13 6  
ATOM 5758  H HD21 . LEU A 1 15 ? -4.222  4.112   -1.970  1.00 0.00 ? 24 LEU S HD21 6  
ATOM 5759  H HD22 . LEU A 1 15 ? -4.048  4.230   -3.719  1.00 0.00 ? 24 LEU S HD22 6  
ATOM 5760  H HD23 . LEU A 1 15 ? -4.679  5.597   -2.803  1.00 0.00 ? 24 LEU S HD23 6  
ATOM 5761  N N    . LEU A 1 16 ? -0.541  8.308   -2.843  1.00 0.00 ? 25 LEU S N    6  
ATOM 5762  C CA   . LEU A 1 16 ? 0.827   8.675   -3.139  1.00 0.00 ? 25 LEU S CA   6  
ATOM 5763  C C    . LEU A 1 16 ? 1.187   10.067  -2.618  1.00 0.00 ? 25 LEU S C    6  
ATOM 5764  O O    . LEU A 1 16 ? 2.364   10.355  -2.404  1.00 0.00 ? 25 LEU S O    6  
ATOM 5765  C CB   . LEU A 1 16 ? 1.049   8.577   -4.640  1.00 0.00 ? 25 LEU S CB   6  
ATOM 5766  C CG   . LEU A 1 16 ? 2.511   8.561   -5.082  1.00 0.00 ? 25 LEU S CG   6  
ATOM 5767  C CD1  . LEU A 1 16 ? 2.955   7.137   -5.370  1.00 0.00 ? 25 LEU S CD1  6  
ATOM 5768  C CD2  . LEU A 1 16 ? 2.708   9.443   -6.306  1.00 0.00 ? 25 LEU S CD2  6  
ATOM 5769  H H    . LEU A 1 16 ? -1.190  8.264   -3.577  1.00 0.00 ? 25 LEU S H    6  
ATOM 5770  H HA   . LEU A 1 16 ? 1.467   7.955   -2.652  1.00 0.00 ? 25 LEU S HA   6  
ATOM 5771  H HB2  . LEU A 1 16 ? 0.579   7.662   -4.980  1.00 0.00 ? 25 LEU S HB2  6  
ATOM 5772  H HB3  . LEU A 1 16 ? 0.556   9.413   -5.112  1.00 0.00 ? 25 LEU S HB3  6  
ATOM 5773  H HG   . LEU A 1 16 ? 3.127   8.950   -4.285  1.00 0.00 ? 25 LEU S HG   6  
ATOM 5774  H HD11 . LEU A 1 16 ? 3.914   6.958   -4.906  1.00 0.00 ? 25 LEU S HD11 6  
ATOM 5775  H HD12 . LEU A 1 16 ? 3.039   6.992   -6.436  1.00 0.00 ? 25 LEU S HD12 6  
ATOM 5776  H HD13 . LEU A 1 16 ? 2.228   6.447   -4.967  1.00 0.00 ? 25 LEU S HD13 6  
ATOM 5777  H HD21 . LEU A 1 16 ? 2.988   10.437  -5.992  1.00 0.00 ? 25 LEU S HD21 6  
ATOM 5778  H HD22 . LEU A 1 16 ? 1.787   9.488   -6.869  1.00 0.00 ? 25 LEU S HD22 6  
ATOM 5779  H HD23 . LEU A 1 16 ? 3.488   9.028   -6.927  1.00 0.00 ? 25 LEU S HD23 6  
ATOM 5780  N N    . ALA A 1 17 ? 0.182   10.925  -2.396  1.00 0.00 ? 26 ALA S N    6  
ATOM 5781  C CA   . ALA A 1 17 ? 0.445   12.280  -1.881  1.00 0.00 ? 26 ALA S CA   6  
ATOM 5782  C C    . ALA A 1 17 ? -0.737  13.237  -2.069  1.00 0.00 ? 26 ALA S C    6  
ATOM 5783  O O    . ALA A 1 17 ? -0.558  14.361  -2.540  1.00 0.00 ? 26 ALA S O    6  
ATOM 5784  C CB   . ALA A 1 17 ? 1.689   12.872  -2.537  1.00 0.00 ? 26 ALA S CB   6  
ATOM 5785  H H    . ALA A 1 17 ? -0.742  10.639  -2.568  1.00 0.00 ? 26 ALA S H    6  
ATOM 5786  H HA   . ALA A 1 17 ? 0.646   12.191  -0.823  1.00 0.00 ? 26 ALA S HA   6  
ATOM 5787  H HB1  . ALA A 1 17 ? 2.565   12.573  -1.982  1.00 0.00 ? 26 ALA S HB1  6  
ATOM 5788  H HB2  . ALA A 1 17 ? 1.616   13.949  -2.541  1.00 0.00 ? 26 ALA S HB2  6  
ATOM 5789  H HB3  . ALA A 1 17 ? 1.766   12.514  -3.552  1.00 0.00 ? 26 ALA S HB3  6  
ATOM 5790  N N    . ARG A 1 18 ? -1.935  12.811  -1.688  1.00 0.00 ? 27 ARG S N    6  
ATOM 5791  C CA   . ARG A 1 18 ? -3.116  13.667  -1.810  1.00 0.00 ? 27 ARG S CA   6  
ATOM 5792  C C    . ARG A 1 18 ? -4.148  13.329  -0.739  1.00 0.00 ? 27 ARG S C    6  
ATOM 5793  O O    . ARG A 1 18 ? -4.189  12.200  -0.258  1.00 0.00 ? 27 ARG S O    6  
ATOM 5794  C CB   . ARG A 1 18 ? -3.734  13.544  -3.214  1.00 0.00 ? 27 ARG S CB   6  
ATOM 5795  C CG   . ARG A 1 18 ? -5.100  12.862  -3.254  1.00 0.00 ? 27 ARG S CG   6  
ATOM 5796  C CD   . ARG A 1 18 ? -6.240  13.853  -3.080  1.00 0.00 ? 27 ARG S CD   6  
ATOM 5797  N NE   . ARG A 1 18 ? -7.248  13.710  -4.132  1.00 0.00 ? 27 ARG S NE   6  
ATOM 5798  C CZ   . ARG A 1 18 ? -8.549  13.939  -3.958  1.00 0.00 ? 27 ARG S CZ   6  
ATOM 5799  N NH1  . ARG A 1 18 ? -9.018  14.315  -2.773  1.00 0.00 ? 27 ARG S NH1  6  
ATOM 5800  N NH2  . ARG A 1 18 ? -9.386  13.790  -4.974  1.00 0.00 ? 27 ARG S NH2  6  
ATOM 5801  H H    . ARG A 1 18 ? -2.028  11.914  -1.304  1.00 0.00 ? 27 ARG S H    6  
ATOM 5802  H HA   . ARG A 1 18 ? -2.792  14.688  -1.662  1.00 0.00 ? 27 ARG S HA   6  
ATOM 5803  H HB2  . ARG A 1 18 ? -3.844  14.533  -3.630  1.00 0.00 ? 27 ARG S HB2  6  
ATOM 5804  H HB3  . ARG A 1 18 ? -3.058  12.978  -3.839  1.00 0.00 ? 27 ARG S HB3  6  
ATOM 5805  H HG2  . ARG A 1 18 ? -5.215  12.371  -4.204  1.00 0.00 ? 27 ARG S HG2  6  
ATOM 5806  H HG3  . ARG A 1 18 ? -5.151  12.126  -2.466  1.00 0.00 ? 27 ARG S HG3  6  
ATOM 5807  H HD2  . ARG A 1 18 ? -6.705  13.681  -2.120  1.00 0.00 ? 27 ARG S HD2  6  
ATOM 5808  H HD3  . ARG A 1 18 ? -5.838  14.855  -3.114  1.00 0.00 ? 27 ARG S HD3  6  
ATOM 5809  H HE   . ARG A 1 18 ? -6.936  13.430  -5.017  1.00 0.00 ? 27 ARG S HE   6  
ATOM 5810  H HH11 . ARG A 1 18 ? -8.397  14.430  -2.001  1.00 0.00 ? 27 ARG S HH11 6  
ATOM 5811  H HH12 . ARG A 1 18 ? -9.997  14.486  -2.655  1.00 0.00 ? 27 ARG S HH12 6  
ATOM 5812  H HH21 . ARG A 1 18 ? -9.042  13.507  -5.870  1.00 0.00 ? 27 ARG S HH21 6  
ATOM 5813  H HH22 . ARG A 1 18 ? -10.363 13.962  -4.846  1.00 0.00 ? 27 ARG S HH22 6  
ATOM 5814  N N    . PRO A 1 19 ? -5.005  14.304  -0.366  1.00 0.00 ? 28 PRO S N    6  
ATOM 5815  C CA   . PRO A 1 19 ? -6.060  14.108  0.633   1.00 0.00 ? 28 PRO S CA   6  
ATOM 5816  C C    . PRO A 1 19 ? -6.799  12.780  0.440   1.00 0.00 ? 28 PRO S C    6  
ATOM 5817  O O    . PRO A 1 19 ? -7.954  12.742  0.016   1.00 0.00 ? 28 PRO S O    6  
ATOM 5818  C CB   . PRO A 1 19 ? -7.011  15.298  0.407   1.00 0.00 ? 28 PRO S CB   6  
ATOM 5819  C CG   . PRO A 1 19 ? -6.475  16.040  -0.780  1.00 0.00 ? 28 PRO S CG   6  
ATOM 5820  C CD   . PRO A 1 19 ? -5.025  15.669  -0.896  1.00 0.00 ? 28 PRO S CD   6  
ATOM 5821  H HA   . PRO A 1 19 ? -5.662  14.149  1.637   1.00 0.00 ? 28 PRO S HA   6  
ATOM 5822  H HB2  . PRO A 1 19 ? -8.010  14.930  0.218   1.00 0.00 ? 28 PRO S HB2  6  
ATOM 5823  H HB3  . PRO A 1 19 ? -7.015  15.925  1.290   1.00 0.00 ? 28 PRO S HB3  6  
ATOM 5824  H HG2  . PRO A 1 19 ? -7.009  15.743  -1.669  1.00 0.00 ? 28 PRO S HG2  6  
ATOM 5825  H HG3  . PRO A 1 19 ? -6.576  17.104  -0.621  1.00 0.00 ? 28 PRO S HG3  6  
ATOM 5826  H HD2  . PRO A 1 19 ? -4.706  15.693  -1.927  1.00 0.00 ? 28 PRO S HD2  6  
ATOM 5827  H HD3  . PRO A 1 19 ? -4.416  16.328  -0.292  1.00 0.00 ? 28 PRO S HD3  6  
ATOM 5828  N N    . LEU A 1 20 ? -6.098  11.699  0.754   1.00 0.00 ? 29 LEU S N    6  
ATOM 5829  C CA   . LEU A 1 20 ? -6.628  10.346  0.630   1.00 0.00 ? 29 LEU S CA   6  
ATOM 5830  C C    . LEU A 1 20 ? -7.696  10.059  1.687   1.00 0.00 ? 29 LEU S C    6  
ATOM 5831  O O    . LEU A 1 20 ? -7.670  10.618  2.783   1.00 0.00 ? 29 LEU S O    6  
ATOM 5832  C CB   . LEU A 1 20 ? -5.492  9.317   0.749   1.00 0.00 ? 29 LEU S CB   6  
ATOM 5833  C CG   . LEU A 1 20 ? -4.352  9.695   1.709   1.00 0.00 ? 29 LEU S CG   6  
ATOM 5834  C CD1  . LEU A 1 20 ? -4.884  9.883   3.121   1.00 0.00 ? 29 LEU S CD1  6  
ATOM 5835  C CD2  . LEU A 1 20 ? -3.252  8.642   1.687   1.00 0.00 ? 29 LEU S CD2  6  
ATOM 5836  H H    . LEU A 1 20 ? -5.185  11.822  1.071   1.00 0.00 ? 29 LEU S H    6  
ATOM 5837  H HA   . LEU A 1 20 ? -7.075  10.256  -0.347  1.00 0.00 ? 29 LEU S HA   6  
ATOM 5838  H HB2  . LEU A 1 20 ? -5.919  8.382   1.084   1.00 0.00 ? 29 LEU S HB2  6  
ATOM 5839  H HB3  . LEU A 1 20 ? -5.069  9.167   -0.233  1.00 0.00 ? 29 LEU S HB3  6  
ATOM 5840  H HG   . LEU A 1 20 ? -3.918  10.630  1.391   1.00 0.00 ? 29 LEU S HG   6  
ATOM 5841  H HD11 . LEU A 1 20 ? -5.142  10.920  3.274   1.00 0.00 ? 29 LEU S HD11 6  
ATOM 5842  H HD12 . LEU A 1 20 ? -4.126  9.592   3.833   1.00 0.00 ? 29 LEU S HD12 6  
ATOM 5843  H HD13 . LEU A 1 20 ? -5.763  9.269   3.259   1.00 0.00 ? 29 LEU S HD13 6  
ATOM 5844  H HD21 . LEU A 1 20 ? -3.616  7.751   1.197   1.00 0.00 ? 29 LEU S HD21 6  
ATOM 5845  H HD22 . LEU A 1 20 ? -2.962  8.403   2.699   1.00 0.00 ? 29 LEU S HD22 6  
ATOM 5846  H HD23 . LEU A 1 20 ? -2.398  9.027   1.148   1.00 0.00 ? 29 LEU S HD23 6  
ATOM 5847  N N    . PRO A 1 21 ? -8.661  9.180   1.350   1.00 0.00 ? 30 PRO S N    6  
ATOM 5848  C CA   . PRO A 1 21 ? -9.764  8.807   2.247   1.00 0.00 ? 30 PRO S CA   6  
ATOM 5849  C C    . PRO A 1 21 ? -9.290  8.291   3.598   1.00 0.00 ? 30 PRO S C    6  
ATOM 5850  O O    . PRO A 1 21 ? -8.137  8.486   3.983   1.00 0.00 ? 30 PRO S O    6  
ATOM 5851  C CB   . PRO A 1 21 ? -10.505 7.701   1.481   1.00 0.00 ? 30 PRO S CB   6  
ATOM 5852  C CG   . PRO A 1 21 ? -9.571  7.277   0.399   1.00 0.00 ? 30 PRO S CG   6  
ATOM 5853  C CD   . PRO A 1 21 ? -8.760  8.488   0.058   1.00 0.00 ? 30 PRO S CD   6  
ATOM 5854  H HA   . PRO A 1 21 ? -10.431 9.637   2.404   1.00 0.00 ? 30 PRO S HA   6  
ATOM 5855  H HB2  . PRO A 1 21 ? -10.726 6.882   2.153   1.00 0.00 ? 30 PRO S HB2  6  
ATOM 5856  H HB3  . PRO A 1 21 ? -11.421 8.097   1.075   1.00 0.00 ? 30 PRO S HB3  6  
ATOM 5857  H HG2  . PRO A 1 21 ? -8.930  6.488   0.759   1.00 0.00 ? 30 PRO S HG2  6  
ATOM 5858  H HG3  . PRO A 1 21 ? -10.134 6.946   -0.463  1.00 0.00 ? 30 PRO S HG3  6  
ATOM 5859  H HD2  . PRO A 1 21 ? -7.783  8.201   -0.306  1.00 0.00 ? 30 PRO S HD2  6  
ATOM 5860  H HD3  . PRO A 1 21 ? -9.277  9.100   -0.666  1.00 0.00 ? 30 PRO S HD3  6  
ATOM 5861  N N    . GLU A 1 22 ? -10.197 7.639   4.326   1.00 0.00 ? 31 GLU S N    6  
ATOM 5862  C CA   . GLU A 1 22 ? -9.875  7.106   5.645   1.00 0.00 ? 31 GLU S CA   6  
ATOM 5863  C C    . GLU A 1 22 ? -9.512  5.634   5.586   1.00 0.00 ? 31 GLU S C    6  
ATOM 5864  O O    . GLU A 1 22 ? -8.570  5.210   6.255   1.00 0.00 ? 31 GLU S O    6  
ATOM 5865  C CB   . GLU A 1 22 ? -11.033 7.329   6.620   1.00 0.00 ? 31 GLU S CB   6  
ATOM 5866  C CG   . GLU A 1 22 ? -10.625 7.232   8.080   1.00 0.00 ? 31 GLU S CG   6  
ATOM 5867  C CD   . GLU A 1 22 ? -9.766  8.400   8.523   1.00 0.00 ? 31 GLU S CD   6  
ATOM 5868  O OE1  . GLU A 1 22 ? -8.592  8.466   8.104   1.00 0.00 ? 31 GLU S OE1  6  
ATOM 5869  O OE2  . GLU A 1 22 ? -10.268 9.248   9.290   1.00 0.00 ? 31 GLU S OE2  6  
ATOM 5870  H H    . GLU A 1 22 ? -11.102 7.524   3.969   1.00 0.00 ? 31 GLU S H    6  
ATOM 5871  H HA   . GLU A 1 22 ? -9.007  7.638   5.999   1.00 0.00 ? 31 GLU S HA   6  
ATOM 5872  H HB2  . GLU A 1 22 ? -11.449 8.311   6.448   1.00 0.00 ? 31 GLU S HB2  6  
ATOM 5873  H HB3  . GLU A 1 22 ? -11.796 6.587   6.431   1.00 0.00 ? 31 GLU S HB3  6  
ATOM 5874  H HG2  . GLU A 1 22 ? -11.517 7.210   8.690   1.00 0.00 ? 31 GLU S HG2  6  
ATOM 5875  H HG3  . GLU A 1 22 ? -10.069 6.318   8.226   1.00 0.00 ? 31 GLU S HG3  6  
ATOM 5876  N N    . GLY A 1 23 ? -10.218 4.853   4.762   1.00 0.00 ? 32 GLY S N    6  
ATOM 5877  C CA   . GLY A 1 23 ? -9.867  3.445   4.638   1.00 0.00 ? 32 GLY S CA   6  
ATOM 5878  C C    . GLY A 1 23 ? -8.366  3.310   4.489   1.00 0.00 ? 32 GLY S C    6  
ATOM 5879  O O    . GLY A 1 23 ? -7.759  2.327   4.914   1.00 0.00 ? 32 GLY S O    6  
ATOM 5880  H H    . GLY A 1 23 ? -10.942 5.236   4.225   1.00 0.00 ? 32 GLY S H    6  
ATOM 5881  H HA2  . GLY A 1 23 ? -10.194 2.914   5.522   1.00 0.00 ? 32 GLY S HA2  6  
ATOM 5882  H HA3  . GLY A 1 23 ? -10.350 3.030   3.766   1.00 0.00 ? 32 GLY S HA3  6  
ATOM 5883  N N    . VAL A 1 24 ? -7.782  4.359   3.914   1.00 0.00 ? 33 VAL S N    6  
ATOM 5884  C CA   . VAL A 1 24 ? -6.354  4.472   3.719   1.00 0.00 ? 33 VAL S CA   6  
ATOM 5885  C C    . VAL A 1 24 ? -5.689  4.808   5.056   1.00 0.00 ? 33 VAL S C    6  
ATOM 5886  O O    . VAL A 1 24 ? -6.119  5.730   5.749   1.00 0.00 ? 33 VAL S O    6  
ATOM 5887  C CB   . VAL A 1 24 ? -6.069  5.592   2.684   1.00 0.00 ? 33 VAL S CB   6  
ATOM 5888  C CG1  . VAL A 1 24 ? -5.146  6.667   3.242   1.00 0.00 ? 33 VAL S CG1  6  
ATOM 5889  C CG2  . VAL A 1 24 ? -5.511  5.021   1.394   1.00 0.00 ? 33 VAL S CG2  6  
ATOM 5890  H H    . VAL A 1 24 ? -8.344  5.110   3.634   1.00 0.00 ? 33 VAL S H    6  
ATOM 5891  H HA   . VAL A 1 24 ? -5.975  3.534   3.343   1.00 0.00 ? 33 VAL S HA   6  
ATOM 5892  H HB   . VAL A 1 24 ? -7.011  6.066   2.450   1.00 0.00 ? 33 VAL S HB   6  
ATOM 5893  H HG11 . VAL A 1 24 ? -5.560  7.059   4.158   1.00 0.00 ? 33 VAL S HG11 6  
ATOM 5894  H HG12 . VAL A 1 24 ? -5.059  7.464   2.523   1.00 0.00 ? 33 VAL S HG12 6  
ATOM 5895  H HG13 . VAL A 1 24 ? -4.172  6.246   3.435   1.00 0.00 ? 33 VAL S HG13 6  
ATOM 5896  H HG21 . VAL A 1 24 ? -5.577  3.943   1.416   1.00 0.00 ? 33 VAL S HG21 6  
ATOM 5897  H HG22 . VAL A 1 24 ? -4.481  5.321   1.284   1.00 0.00 ? 33 VAL S HG22 6  
ATOM 5898  H HG23 . VAL A 1 24 ? -6.085  5.400   0.559   1.00 0.00 ? 33 VAL S HG23 6  
ATOM 5899  N N    . ASP A 1 25 ? -4.648  4.073   5.423   1.00 0.00 ? 34 ASP S N    6  
ATOM 5900  C CA   . ASP A 1 25 ? -3.958  4.332   6.680   1.00 0.00 ? 34 ASP S CA   6  
ATOM 5901  C C    . ASP A 1 25 ? -2.718  5.191   6.439   1.00 0.00 ? 34 ASP S C    6  
ATOM 5902  O O    . ASP A 1 25 ? -2.009  5.001   5.453   1.00 0.00 ? 34 ASP S O    6  
ATOM 5903  C CB   . ASP A 1 25 ? -3.567  3.018   7.359   1.00 0.00 ? 34 ASP S CB   6  
ATOM 5904  C CG   . ASP A 1 25 ? -4.770  2.153   7.680   1.00 0.00 ? 34 ASP S CG   6  
ATOM 5905  O OD1  . ASP A 1 25 ? -5.417  2.400   8.720   1.00 0.00 ? 34 ASP S OD1  6  
ATOM 5906  O OD2  . ASP A 1 25 ? -5.066  1.232   6.892   1.00 0.00 ? 34 ASP S OD2  6  
ATOM 5907  H H    . ASP A 1 25 ? -4.340  3.349   4.842   1.00 0.00 ? 34 ASP S H    6  
ATOM 5908  H HA   . ASP A 1 25 ? -4.643  4.873   7.320   1.00 0.00 ? 34 ASP S HA   6  
ATOM 5909  H HB2  . ASP A 1 25 ? -2.912  2.460   6.705   1.00 0.00 ? 34 ASP S HB2  6  
ATOM 5910  H HB3  . ASP A 1 25 ? -3.046  3.237   8.283   1.00 0.00 ? 34 ASP S HB3  6  
ATOM 5911  N N    . PRO A 1 26 ? -2.450  6.165   7.326   1.00 0.00 ? 35 PRO S N    6  
ATOM 5912  C CA   . PRO A 1 26 ? -1.301  7.067   7.185   1.00 0.00 ? 35 PRO S CA   6  
ATOM 5913  C C    . PRO A 1 26 ? 0.022   6.467   7.663   1.00 0.00 ? 35 PRO S C    6  
ATOM 5914  O O    . PRO A 1 26 ? 1.079   7.073   7.484   1.00 0.00 ? 35 PRO S O    6  
ATOM 5915  C CB   . PRO A 1 26 ? -1.694  8.245   8.072   1.00 0.00 ? 35 PRO S CB   6  
ATOM 5916  C CG   . PRO A 1 26 ? -2.509  7.630   9.157   1.00 0.00 ? 35 PRO S CG   6  
ATOM 5917  C CD   . PRO A 1 26 ? -3.254  6.484   8.523   1.00 0.00 ? 35 PRO S CD   6  
ATOM 5918  H HA   . PRO A 1 26 ? -1.192  7.406   6.165   1.00 0.00 ? 35 PRO S HA   6  
ATOM 5919  H HB2  . PRO A 1 26 ? -0.803  8.719   8.462   1.00 0.00 ? 35 PRO S HB2  6  
ATOM 5920  H HB3  . PRO A 1 26 ? -2.271  8.956   7.498   1.00 0.00 ? 35 PRO S HB3  6  
ATOM 5921  H HG2  . PRO A 1 26 ? -1.861  7.268   9.941   1.00 0.00 ? 35 PRO S HG2  6  
ATOM 5922  H HG3  . PRO A 1 26 ? -3.204  8.357   9.549   1.00 0.00 ? 35 PRO S HG3  6  
ATOM 5923  H HD2  . PRO A 1 26 ? -3.293  5.640   9.196   1.00 0.00 ? 35 PRO S HD2  6  
ATOM 5924  H HD3  . PRO A 1 26 ? -4.252  6.793   8.243   1.00 0.00 ? 35 PRO S HD3  6  
ATOM 5925  N N    . LEU A 1 27 ? -0.025  5.285   8.276   1.00 0.00 ? 36 LEU S N    6  
ATOM 5926  C CA   . LEU A 1 27 ? 1.194   4.645   8.771   1.00 0.00 ? 36 LEU S CA   6  
ATOM 5927  C C    . LEU A 1 27 ? 1.490   3.339   8.030   1.00 0.00 ? 36 LEU S C    6  
ATOM 5928  O O    . LEU A 1 27 ? 2.362   2.572   8.440   1.00 0.00 ? 36 LEU S O    6  
ATOM 5929  C CB   . LEU A 1 27 ? 1.094   4.381   10.279  1.00 0.00 ? 36 LEU S CB   6  
ATOM 5930  C CG   . LEU A 1 27 ? -0.164  3.641   10.744  1.00 0.00 ? 36 LEU S CG   6  
ATOM 5931  C CD1  . LEU A 1 27 ? -1.346  4.594   10.834  1.00 0.00 ? 36 LEU S CD1  6  
ATOM 5932  C CD2  . LEU A 1 27 ? -0.481  2.481   9.813   1.00 0.00 ? 36 LEU S CD2  6  
ATOM 5933  H H    . LEU A 1 27 ? -0.890  4.840   8.402   1.00 0.00 ? 36 LEU S H    6  
ATOM 5934  H HA   . LEU A 1 27 ? 2.011   5.327   8.594   1.00 0.00 ? 36 LEU S HA   6  
ATOM 5935  H HB2  . LEU A 1 27 ? 1.957   3.800   10.576  1.00 0.00 ? 36 LEU S HB2  6  
ATOM 5936  H HB3  . LEU A 1 27 ? 1.130   5.335   10.790  1.00 0.00 ? 36 LEU S HB3  6  
ATOM 5937  H HG   . LEU A 1 27 ? 0.011   3.237   11.731  1.00 0.00 ? 36 LEU S HG   6  
ATOM 5938  H HD11 . LEU A 1 27 ? -0.992  5.613   10.788  1.00 0.00 ? 36 LEU S HD11 6  
ATOM 5939  H HD12 . LEU A 1 27 ? -1.866  4.436   11.767  1.00 0.00 ? 36 LEU S HD12 6  
ATOM 5940  H HD13 . LEU A 1 27 ? -2.021  4.409   10.011  1.00 0.00 ? 36 LEU S HD13 6  
ATOM 5941  H HD21 . LEU A 1 27 ? -0.819  2.869   8.863   1.00 0.00 ? 36 LEU S HD21 6  
ATOM 5942  H HD22 . LEU A 1 27 ? -1.254  1.866   10.249  1.00 0.00 ? 36 LEU S HD22 6  
ATOM 5943  H HD23 . LEU A 1 27 ? 0.410   1.888   9.659   1.00 0.00 ? 36 LEU S HD23 6  
ATOM 5944  N N    . LYS A 1 28 ? 0.768   3.089   6.940   1.00 0.00 ? 37 LYS S N    6  
ATOM 5945  C CA   . LYS A 1 28 ? 0.965   1.877   6.147   1.00 0.00 ? 37 LYS S CA   6  
ATOM 5946  C C    . LYS A 1 28 ? 0.140   1.938   4.865   1.00 0.00 ? 37 LYS S C    6  
ATOM 5947  O O    . LYS A 1 28 ? -1.037  1.583   4.850   1.00 0.00 ? 37 LYS S O    6  
ATOM 5948  C CB   . LYS A 1 28 ? 0.601   0.630   6.960   1.00 0.00 ? 37 LYS S CB   6  
ATOM 5949  C CG   . LYS A 1 28 ? -0.869  0.546   7.343   1.00 0.00 ? 37 LYS S CG   6  
ATOM 5950  C CD   . LYS A 1 28 ? -1.092  -0.437  8.482   1.00 0.00 ? 37 LYS S CD   6  
ATOM 5951  C CE   . LYS A 1 28 ? -2.476  -1.060  8.416   1.00 0.00 ? 37 LYS S CE   6  
ATOM 5952  N NZ   . LYS A 1 28 ? -3.492  -0.229  9.117   1.00 0.00 ? 37 LYS S NZ   6  
ATOM 5953  H H    . LYS A 1 28 ? 0.088   3.737   6.658   1.00 0.00 ? 37 LYS S H    6  
ATOM 5954  H HA   . LYS A 1 28 ? 2.010   1.827   5.881   1.00 0.00 ? 37 LYS S HA   6  
ATOM 5955  H HB2  . LYS A 1 28 ? 0.844   -0.247  6.377   1.00 0.00 ? 37 LYS S HB2  6  
ATOM 5956  H HB3  . LYS A 1 28 ? 1.187   0.623   7.868   1.00 0.00 ? 37 LYS S HB3  6  
ATOM 5957  H HG2  . LYS A 1 28 ? -1.208  1.522   7.651   1.00 0.00 ? 37 LYS S HG2  6  
ATOM 5958  H HG3  . LYS A 1 28 ? -1.435  0.222   6.487   1.00 0.00 ? 37 LYS S HG3  6  
ATOM 5959  H HD2  . LYS A 1 28 ? -0.351  -1.222  8.418   1.00 0.00 ? 37 LYS S HD2  6  
ATOM 5960  H HD3  . LYS A 1 28 ? -0.985  0.083   9.422   1.00 0.00 ? 37 LYS S HD3  6  
ATOM 5961  H HE2  . LYS A 1 28 ? -2.761  -1.163  7.380   1.00 0.00 ? 37 LYS S HE2  6  
ATOM 5962  H HE3  . LYS A 1 28 ? -2.440  -2.036  8.877   1.00 0.00 ? 37 LYS S HE3  6  
ATOM 5963  H HZ1  . LYS A 1 28 ? -3.218  0.774   9.084   1.00 0.00 ? 37 LYS S HZ1  6  
ATOM 5964  H HZ2  . LYS A 1 28 ? -3.569  -0.523  10.113  1.00 0.00 ? 37 LYS S HZ2  6  
ATOM 5965  H HZ3  . LYS A 1 28 ? -4.420  -0.338  8.662   1.00 0.00 ? 37 LYS S HZ3  6  
ATOM 5966  N N    . LEU A 1 29 ? 0.765   2.413   3.794   1.00 0.00 ? 38 LEU S N    6  
ATOM 5967  C CA   . LEU A 1 29 ? 0.088   2.546   2.510   1.00 0.00 ? 38 LEU S CA   6  
ATOM 5968  C C    . LEU A 1 29 ? 0.169   1.268   1.684   1.00 0.00 ? 38 LEU S C    6  
ATOM 5969  O O    . LEU A 1 29 ? -0.840  0.790   1.167   1.00 0.00 ? 38 LEU S O    6  
ATOM 5970  C CB   . LEU A 1 29 ? 0.681   3.723   1.731   1.00 0.00 ? 38 LEU S CB   6  
ATOM 5971  C CG   . LEU A 1 29 ? 1.023   4.955   2.578   1.00 0.00 ? 38 LEU S CG   6  
ATOM 5972  C CD1  . LEU A 1 29 ? 1.105   6.199   1.708   1.00 0.00 ? 38 LEU S CD1  6  
ATOM 5973  C CD2  . LEU A 1 29 ? 0.001   5.153   3.694   1.00 0.00 ? 38 LEU S CD2  6  
ATOM 5974  H H    . LEU A 1 29 ? 1.701   2.695   3.871   1.00 0.00 ? 38 LEU S H    6  
ATOM 5975  H HA   . LEU A 1 29 ? -0.947  2.753   2.714   1.00 0.00 ? 38 LEU S HA   6  
ATOM 5976  H HB2  . LEU A 1 29 ? 1.586   3.384   1.245   1.00 0.00 ? 38 LEU S HB2  6  
ATOM 5977  H HB3  . LEU A 1 29 ? -0.027  4.021   0.971   1.00 0.00 ? 38 LEU S HB3  6  
ATOM 5978  H HG   . LEU A 1 29 ? 1.990   4.808   3.036   1.00 0.00 ? 38 LEU S HG   6  
ATOM 5979  H HD11 . LEU A 1 29 ? 1.688   6.952   2.215   1.00 0.00 ? 38 LEU S HD11 6  
ATOM 5980  H HD12 . LEU A 1 29 ? 0.111   6.578   1.522   1.00 0.00 ? 38 LEU S HD12 6  
ATOM 5981  H HD13 . LEU A 1 29 ? 1.578   5.951   0.769   1.00 0.00 ? 38 LEU S HD13 6  
ATOM 5982  H HD21 . LEU A 1 29 ? -0.265  6.197   3.762   1.00 0.00 ? 38 LEU S HD21 6  
ATOM 5983  H HD22 . LEU A 1 29 ? 0.426   4.830   4.631   1.00 0.00 ? 38 LEU S HD22 6  
ATOM 5984  H HD23 . LEU A 1 29 ? -0.887  4.570   3.482   1.00 0.00 ? 38 LEU S HD23 6  
ATOM 5985  N N    . GLU A 1 30 ? 1.374   0.726   1.557   1.00 0.00 ? 39 GLU S N    6  
ATOM 5986  C CA   . GLU A 1 30 ? 1.607   -0.495  0.785   1.00 0.00 ? 39 GLU S CA   6  
ATOM 5987  C C    . GLU A 1 30 ? 0.489   -1.533  0.963   1.00 0.00 ? 39 GLU S C    6  
ATOM 5988  O O    . GLU A 1 30 ? 0.259   -2.356  0.078   1.00 0.00 ? 39 GLU S O    6  
ATOM 5989  C CB   . GLU A 1 30 ? 2.950   -1.114  1.184   1.00 0.00 ? 39 GLU S CB   6  
ATOM 5990  C CG   . GLU A 1 30 ? 2.937   -1.783  2.551   1.00 0.00 ? 39 GLU S CG   6  
ATOM 5991  C CD   . GLU A 1 30 ? 4.332   -2.005  3.104   1.00 0.00 ? 39 GLU S CD   6  
ATOM 5992  O OE1  . GLU A 1 30 ? 5.092   -1.021  3.208   1.00 0.00 ? 39 GLU S OE1  6  
ATOM 5993  O OE2  . GLU A 1 30 ? 4.661   -3.164  3.433   1.00 0.00 ? 39 GLU S OE2  6  
ATOM 5994  H H    . GLU A 1 30 ? 2.139   1.169   1.985   1.00 0.00 ? 39 GLU S H    6  
ATOM 5995  H HA   . GLU A 1 30 ? 1.654   -0.218  -0.256  1.00 0.00 ? 39 GLU S HA   6  
ATOM 5996  H HB2  . GLU A 1 30 ? 3.224   -1.855  0.448   1.00 0.00 ? 39 GLU S HB2  6  
ATOM 5997  H HB3  . GLU A 1 30 ? 3.699   -0.336  1.198   1.00 0.00 ? 39 GLU S HB3  6  
ATOM 5998  H HG2  . GLU A 1 30 ? 2.389   -1.158  3.240   1.00 0.00 ? 39 GLU S HG2  6  
ATOM 5999  H HG3  . GLU A 1 30 ? 2.442   -2.739  2.464   1.00 0.00 ? 39 GLU S HG3  6  
ATOM 6000  N N    . ILE A 1 31 ? -0.181  -1.511  2.113   1.00 0.00 ? 40 ILE S N    6  
ATOM 6001  C CA   . ILE A 1 31 ? -1.243  -2.478  2.390   1.00 0.00 ? 40 ILE S CA   6  
ATOM 6002  C C    . ILE A 1 31 ? -2.532  -2.202  1.611   1.00 0.00 ? 40 ILE S C    6  
ATOM 6003  O O    . ILE A 1 31 ? -3.215  -3.140  1.203   1.00 0.00 ? 40 ILE S O    6  
ATOM 6004  C CB   . ILE A 1 31 ? -1.573  -2.540  3.894   1.00 0.00 ? 40 ILE S CB   6  
ATOM 6005  C CG1  . ILE A 1 31 ? -2.160  -1.213  4.375   1.00 0.00 ? 40 ILE S CG1  6  
ATOM 6006  C CG2  . ILE A 1 31 ? -0.329  -2.897  4.696   1.00 0.00 ? 40 ILE S CG2  6  
ATOM 6007  C CD1  . ILE A 1 31 ? -3.651  -1.091  4.145   1.00 0.00 ? 40 ILE S CD1  6  
ATOM 6008  H H    . ILE A 1 31 ? 0.055   -0.850  2.794   1.00 0.00 ? 40 ILE S H    6  
ATOM 6009  H HA   . ILE A 1 31 ? -0.873  -3.450  2.098   1.00 0.00 ? 40 ILE S HA   6  
ATOM 6010  H HB   . ILE A 1 31 ? -2.302  -3.324  4.045   1.00 0.00 ? 40 ILE S HB   6  
ATOM 6011  H HG12 . ILE A 1 31 ? -1.983  -1.116  5.434   1.00 0.00 ? 40 ILE S HG12 6  
ATOM 6012  H HG13 . ILE A 1 31 ? -1.675  -0.402  3.856   1.00 0.00 ? 40 ILE S HG13 6  
ATOM 6013  H HG21 . ILE A 1 31 ? -0.366  -2.401  5.656   1.00 0.00 ? 40 ILE S HG21 6  
ATOM 6014  H HG22 . ILE A 1 31 ? 0.549   -2.575  4.159   1.00 0.00 ? 40 ILE S HG22 6  
ATOM 6015  H HG23 . ILE A 1 31 ? -0.290  -3.965  4.845   1.00 0.00 ? 40 ILE S HG23 6  
ATOM 6016  H HD11 . ILE A 1 31 ? -3.852  -0.204  3.565   1.00 0.00 ? 40 ILE S HD11 6  
ATOM 6017  H HD12 . ILE A 1 31 ? -4.158  -1.022  5.097   1.00 0.00 ? 40 ILE S HD12 6  
ATOM 6018  H HD13 . ILE A 1 31 ? -4.005  -1.960  3.610   1.00 0.00 ? 40 ILE S HD13 6  
ATOM 6019  N N    . TYR A 1 32 ? -2.885  -0.930  1.416   1.00 0.00 ? 41 TYR S N    6  
ATOM 6020  C CA   . TYR A 1 32 ? -4.120  -0.607  0.697   1.00 0.00 ? 41 TYR S CA   6  
ATOM 6021  C C    . TYR A 1 32 ? -3.906  -0.470  -0.805  1.00 0.00 ? 41 TYR S C    6  
ATOM 6022  O O    . TYR A 1 32 ? -4.651  0.244   -1.478  1.00 0.00 ? 41 TYR S O    6  
ATOM 6023  C CB   . TYR A 1 32 ? -4.792  0.655   1.255   1.00 0.00 ? 41 TYR S CB   6  
ATOM 6024  C CG   . TYR A 1 32 ? -3.922  1.895   1.335   1.00 0.00 ? 41 TYR S CG   6  
ATOM 6025  C CD1  . TYR A 1 32 ? -3.222  2.374   0.234   1.00 0.00 ? 41 TYR S CD1  6  
ATOM 6026  C CD2  . TYR A 1 32 ? -3.839  2.611   2.523   1.00 0.00 ? 41 TYR S CD2  6  
ATOM 6027  C CE1  . TYR A 1 32 ? -2.465  3.531   0.319   1.00 0.00 ? 41 TYR S CE1  6  
ATOM 6028  C CE2  . TYR A 1 32 ? -3.081  3.762   2.614   1.00 0.00 ? 41 TYR S CE2  6  
ATOM 6029  C CZ   . TYR A 1 32 ? -2.401  4.217   1.509   1.00 0.00 ? 41 TYR S CZ   6  
ATOM 6030  O OH   . TYR A 1 32 ? -1.657  5.369   1.590   1.00 0.00 ? 41 TYR S OH   6  
ATOM 6031  H H    . TYR A 1 32 ? -2.324  -0.209  1.768   1.00 0.00 ? 41 TYR S H    6  
ATOM 6032  H HA   . TYR A 1 32 ? -4.795  -1.436  0.853   1.00 0.00 ? 41 TYR S HA   6  
ATOM 6033  H HB2  . TYR A 1 32 ? -5.638  0.898   0.629   1.00 0.00 ? 41 TYR S HB2  6  
ATOM 6034  H HB3  . TYR A 1 32 ? -5.147  0.442   2.253   1.00 0.00 ? 41 TYR S HB3  6  
ATOM 6035  H HD1  . TYR A 1 32 ? -3.273  1.836   -0.700  1.00 0.00 ? 41 TYR S HD1  6  
ATOM 6036  H HD2  . TYR A 1 32 ? -4.370  2.250   3.388   1.00 0.00 ? 41 TYR S HD2  6  
ATOM 6037  H HE1  . TYR A 1 32 ? -1.926  3.892   -0.543  1.00 0.00 ? 41 TYR S HE1  6  
ATOM 6038  H HE2  . TYR A 1 32 ? -3.030  4.302   3.548   1.00 0.00 ? 41 TYR S HE2  6  
ATOM 6039  H HH   . TYR A 1 32 ? -2.144  6.029   2.089   1.00 0.00 ? 41 TYR S HH   6  
ATOM 6040  N N    . LEU A 1 33 ? -2.907  -1.165  -1.341  1.00 0.00 ? 42 LEU S N    6  
ATOM 6041  C CA   . LEU A 1 33 ? -2.642  -1.113  -2.773  1.00 0.00 ? 42 LEU S CA   6  
ATOM 6042  C C    . LEU A 1 33 ? -2.306  -2.490  -3.320  1.00 0.00 ? 42 LEU S C    6  
ATOM 6043  O O    . LEU A 1 33 ? -1.318  -3.098  -2.915  1.00 0.00 ? 42 LEU S O    6  
ATOM 6044  C CB   . LEU A 1 33 ? -1.500  -0.146  -3.085  1.00 0.00 ? 42 LEU S CB   6  
ATOM 6045  C CG   . LEU A 1 33 ? -0.393  -0.069  -2.031  1.00 0.00 ? 42 LEU S CG   6  
ATOM 6046  C CD1  . LEU A 1 33 ? 0.854   -0.798  -2.515  1.00 0.00 ? 42 LEU S CD1  6  
ATOM 6047  C CD2  . LEU A 1 33 ? -0.071  1.382   -1.703  1.00 0.00 ? 42 LEU S CD2  6  
ATOM 6048  H H    . LEU A 1 33 ? -2.347  -1.732  -0.768  1.00 0.00 ? 42 LEU S H    6  
ATOM 6049  H HA   . LEU A 1 33 ? -3.540  -0.759  -3.258  1.00 0.00 ? 42 LEU S HA   6  
ATOM 6050  H HB2  . LEU A 1 33 ? -1.055  -0.449  -4.023  1.00 0.00 ? 42 LEU S HB2  6  
ATOM 6051  H HB3  . LEU A 1 33 ? -1.922  0.839   -3.210  1.00 0.00 ? 42 LEU S HB3  6  
ATOM 6052  H HG   . LEU A 1 33 ? -0.729  -0.551  -1.125  1.00 0.00 ? 42 LEU S HG   6  
ATOM 6053  H HD11 . LEU A 1 33 ? 1.623   -0.078  -2.756  1.00 0.00 ? 42 LEU S HD11 6  
ATOM 6054  H HD12 . LEU A 1 33 ? 0.613   -1.375  -3.395  1.00 0.00 ? 42 LEU S HD12 6  
ATOM 6055  H HD13 . LEU A 1 33 ? 1.209   -1.458  -1.738  1.00 0.00 ? 42 LEU S HD13 6  
ATOM 6056  H HD21 . LEU A 1 33 ? -0.283  2.001   -2.564  1.00 0.00 ? 42 LEU S HD21 6  
ATOM 6057  H HD22 . LEU A 1 33 ? 0.973   1.471   -1.444  1.00 0.00 ? 42 LEU S HD22 6  
ATOM 6058  H HD23 . LEU A 1 33 ? -0.678  1.706   -0.870  1.00 0.00 ? 42 LEU S HD23 6  
ATOM 6059  N N    . THR A 1 34 ? -3.115  -2.978  -4.256  1.00 0.00 ? 43 THR S N    6  
ATOM 6060  C CA   . THR A 1 34 ? -2.861  -4.279  -4.859  1.00 0.00 ? 43 THR S CA   6  
ATOM 6061  C C    . THR A 1 34 ? -1.497  -4.275  -5.543  1.00 0.00 ? 43 THR S C    6  
ATOM 6062  O O    . THR A 1 34 ? -0.708  -3.362  -5.339  1.00 0.00 ? 43 THR S O    6  
ATOM 6063  C CB   . THR A 1 34 ? -3.959  -4.639  -5.866  1.00 0.00 ? 43 THR S CB   6  
ATOM 6064  O OG1  . THR A 1 34 ? -3.682  -5.878  -6.494  1.00 0.00 ? 43 THR S OG1  6  
ATOM 6065  C CG2  . THR A 1 34 ? -4.136  -3.601  -6.954  1.00 0.00 ? 43 THR S CG2  6  
ATOM 6066  H H    . THR A 1 34 ? -3.886  -2.447  -4.553  1.00 0.00 ? 43 THR S H    6  
ATOM 6067  H HA   . THR A 1 34 ? -2.852  -5.015  -4.069  1.00 0.00 ? 43 THR S HA   6  
ATOM 6068  H HB   . THR A 1 34 ? -4.897  -4.731  -5.341  1.00 0.00 ? 43 THR S HB   6  
ATOM 6069  H HG1  . THR A 1 34 ? -4.504  -6.351  -6.642  1.00 0.00 ? 43 THR S HG1  6  
ATOM 6070  H HG21 . THR A 1 34 ? -5.188  -3.455  -7.145  1.00 0.00 ? 43 THR S HG21 6  
ATOM 6071  H HG22 . THR A 1 34 ? -3.649  -3.941  -7.858  1.00 0.00 ? 43 THR S HG22 6  
ATOM 6072  H HG23 . THR A 1 34 ? -3.694  -2.667  -6.638  1.00 0.00 ? 43 THR S HG23 6  
ATOM 6073  N N    . ASP A 1 35 ? -1.241  -5.290  -6.357  1.00 0.00 ? 44 ASP S N    6  
ATOM 6074  C CA   . ASP A 1 35 ? 0.013   -5.421  -7.083  1.00 0.00 ? 44 ASP S CA   6  
ATOM 6075  C C    . ASP A 1 35 ? 0.151   -4.309  -8.106  1.00 0.00 ? 44 ASP S C    6  
ATOM 6076  O O    . ASP A 1 35 ? 1.230   -3.757  -8.292  1.00 0.00 ? 44 ASP S O    6  
ATOM 6077  C CB   . ASP A 1 35 ? 0.084   -6.782  -7.779  1.00 0.00 ? 44 ASP S CB   6  
ATOM 6078  C CG   . ASP A 1 35 ? -1.071  -7.001  -8.736  1.00 0.00 ? 44 ASP S CG   6  
ATOM 6079  O OD1  . ASP A 1 35 ? -2.166  -6.459  -8.479  1.00 0.00 ? 44 ASP S OD1  6  
ATOM 6080  O OD2  . ASP A 1 35 ? -0.879  -7.715  -9.743  1.00 0.00 ? 44 ASP S OD2  6  
ATOM 6081  H H    . ASP A 1 35 ? -1.917  -5.963  -6.477  1.00 0.00 ? 44 ASP S H    6  
ATOM 6082  H HA   . ASP A 1 35 ? 0.821   -5.346  -6.371  1.00 0.00 ? 44 ASP S HA   6  
ATOM 6083  H HB2  . ASP A 1 35 ? 1.007   -6.846  -8.336  1.00 0.00 ? 44 ASP S HB2  6  
ATOM 6084  H HB3  . ASP A 1 35 ? 0.062   -7.563  -7.031  1.00 0.00 ? 44 ASP S HB3  6  
ATOM 6085  N N    . GLU A 1 36 ? -0.955  -3.972  -8.760  1.00 0.00 ? 45 GLU S N    6  
ATOM 6086  C CA   . GLU A 1 36 ? -0.948  -2.906  -9.747  1.00 0.00 ? 45 GLU S CA   6  
ATOM 6087  C C    . GLU A 1 36 ? -0.647  -1.587  -9.061  1.00 0.00 ? 45 GLU S C    6  
ATOM 6088  O O    . GLU A 1 36 ? 0.300   -0.887  -9.418  1.00 0.00 ? 45 GLU S O    6  
ATOM 6089  C CB   . GLU A 1 36 ? -2.292  -2.823  -10.459 1.00 0.00 ? 45 GLU S CB   6  
ATOM 6090  C CG   . GLU A 1 36 ? -2.719  -4.126  -11.117 1.00 0.00 ? 45 GLU S CG   6  
ATOM 6091  C CD   . GLU A 1 36 ? -1.949  -4.414  -12.392 1.00 0.00 ? 45 GLU S CD   6  
ATOM 6092  O OE1  . GLU A 1 36 ? -1.739  -3.473  -13.185 1.00 0.00 ? 45 GLU S OE1  6  
ATOM 6093  O OE2  . GLU A 1 36 ? -1.558  -5.582  -12.597 1.00 0.00 ? 45 GLU S OE2  6  
ATOM 6094  H H    . GLU A 1 36 ? -1.793  -4.441  -8.563  1.00 0.00 ? 45 GLU S H    6  
ATOM 6095  H HA   . GLU A 1 36 ? -0.172  -3.117  -10.468 1.00 0.00 ? 45 GLU S HA   6  
ATOM 6096  H HB2  . GLU A 1 36 ? -3.044  -2.542  -9.740  1.00 0.00 ? 45 GLU S HB2  6  
ATOM 6097  H HB3  . GLU A 1 36 ? -2.231  -2.061  -11.221 1.00 0.00 ? 45 GLU S HB3  6  
ATOM 6098  H HG2  . GLU A 1 36 ? -2.551  -4.936  -10.424 1.00 0.00 ? 45 GLU S HG2  6  
ATOM 6099  H HG3  . GLU A 1 36 ? -3.770  -4.066  -11.355 1.00 0.00 ? 45 GLU S HG3  6  
ATOM 6100  N N    . ASP A 1 37 ? -1.444  -1.268  -8.043  1.00 0.00 ? 46 ASP S N    6  
ATOM 6101  C CA   . ASP A 1 37 ? -1.239  -0.057  -7.277  1.00 0.00 ? 46 ASP S CA   6  
ATOM 6102  C C    . ASP A 1 37 ? 0.120   -0.136  -6.592  1.00 0.00 ? 46 ASP S C    6  
ATOM 6103  O O    . ASP A 1 37 ? 0.790   0.873   -6.388  1.00 0.00 ? 46 ASP S O    6  
ATOM 6104  C CB   . ASP A 1 37 ? -2.363  0.108   -6.254  1.00 0.00 ? 46 ASP S CB   6  
ATOM 6105  C CG   . ASP A 1 37 ? -2.251  1.401   -5.472  1.00 0.00 ? 46 ASP S CG   6  
ATOM 6106  O OD1  . ASP A 1 37 ? -1.122  1.763   -5.082  1.00 0.00 ? 46 ASP S OD1  6  
ATOM 6107  O OD2  . ASP A 1 37 ? -3.294  2.050   -5.247  1.00 0.00 ? 46 ASP S OD2  6  
ATOM 6108  H H    . ASP A 1 37 ? -2.165  -1.877  -7.784  1.00 0.00 ? 46 ASP S H    6  
ATOM 6109  H HA   . ASP A 1 37 ? -1.245  0.780   -7.959  1.00 0.00 ? 46 ASP S HA   6  
ATOM 6110  H HB2  . ASP A 1 37 ? -3.312  0.109   -6.772  1.00 0.00 ? 46 ASP S HB2  6  
ATOM 6111  H HB3  . ASP A 1 37 ? -2.337  -0.721  -5.560  1.00 0.00 ? 46 ASP S HB3  6  
ATOM 6112  N N    . PHE A 1 38 ? 0.528   -1.365  -6.280  1.00 0.00 ? 47 PHE S N    6  
ATOM 6113  C CA   . PHE A 1 38 ? 1.818   -1.620  -5.661  1.00 0.00 ? 47 PHE S CA   6  
ATOM 6114  C C    . PHE A 1 38 ? 2.921   -1.312  -6.650  1.00 0.00 ? 47 PHE S C    6  
ATOM 6115  O O    . PHE A 1 38 ? 3.892   -0.630  -6.334  1.00 0.00 ? 47 PHE S O    6  
ATOM 6116  C CB   . PHE A 1 38 ? 1.938   -3.090  -5.258  1.00 0.00 ? 47 PHE S CB   6  
ATOM 6117  C CG   . PHE A 1 38 ? 2.064   -3.324  -3.786  1.00 0.00 ? 47 PHE S CG   6  
ATOM 6118  C CD1  . PHE A 1 38 ? 3.133   -2.808  -3.077  1.00 0.00 ? 47 PHE S CD1  6  
ATOM 6119  C CD2  . PHE A 1 38 ? 1.115   -4.071  -3.115  1.00 0.00 ? 47 PHE S CD2  6  
ATOM 6120  C CE1  . PHE A 1 38 ? 3.252   -3.034  -1.722  1.00 0.00 ? 47 PHE S CE1  6  
ATOM 6121  C CE2  . PHE A 1 38 ? 1.224   -4.299  -1.761  1.00 0.00 ? 47 PHE S CE2  6  
ATOM 6122  C CZ   . PHE A 1 38 ? 2.295   -3.781  -1.061  1.00 0.00 ? 47 PHE S CZ   6  
ATOM 6123  H H    . PHE A 1 38 ? -0.048  -2.127  -6.499  1.00 0.00 ? 47 PHE S H    6  
ATOM 6124  H HA   . PHE A 1 38 ? 1.922   -0.992  -4.790  1.00 0.00 ? 47 PHE S HA   6  
ATOM 6125  H HB2  . PHE A 1 38 ? 1.068   -3.622  -5.603  1.00 0.00 ? 47 PHE S HB2  6  
ATOM 6126  H HB3  . PHE A 1 38 ? 2.812   -3.509  -5.732  1.00 0.00 ? 47 PHE S HB3  6  
ATOM 6127  H HD1  . PHE A 1 38 ? 3.879   -2.224  -3.594  1.00 0.00 ? 47 PHE S HD1  6  
ATOM 6128  H HD2  . PHE A 1 38 ? 0.277   -4.478  -3.662  1.00 0.00 ? 47 PHE S HD2  6  
ATOM 6129  H HE1  . PHE A 1 38 ? 4.091   -2.630  -1.180  1.00 0.00 ? 47 PHE S HE1  6  
ATOM 6130  H HE2  . PHE A 1 38 ? 0.476   -4.882  -1.252  1.00 0.00 ? 47 PHE S HE2  6  
ATOM 6131  H HZ   . PHE A 1 38 ? 2.382   -3.959  0.001   1.00 0.00 ? 47 PHE S HZ   6  
ATOM 6132  N N    . GLU A 1 39 ? 2.760   -1.849  -7.852  1.00 0.00 ? 48 GLU S N    6  
ATOM 6133  C CA   . GLU A 1 39 ? 3.752   -1.659  -8.905  1.00 0.00 ? 48 GLU S CA   6  
ATOM 6134  C C    . GLU A 1 39 ? 4.004   -0.177  -9.179  1.00 0.00 ? 48 GLU S C    6  
ATOM 6135  O O    . GLU A 1 39 ? 5.149   0.274   -9.191  1.00 0.00 ? 48 GLU S O    6  
ATOM 6136  C CB   . GLU A 1 39 ? 3.307   -2.365  -10.185 1.00 0.00 ? 48 GLU S CB   6  
ATOM 6137  C CG   . GLU A 1 39 ? 3.586   -3.861  -10.182 1.00 0.00 ? 48 GLU S CG   6  
ATOM 6138  C CD   . GLU A 1 39 ? 3.935   -4.396  -11.557 1.00 0.00 ? 48 GLU S CD   6  
ATOM 6139  O OE1  . GLU A 1 39 ? 3.060   -4.355  -12.449 1.00 0.00 ? 48 GLU S OE1  6  
ATOM 6140  O OE2  . GLU A 1 39 ? 5.081   -4.853  -11.743 1.00 0.00 ? 48 GLU S OE2  6  
ATOM 6141  H H    . GLU A 1 39 ? 1.952   -2.403  -8.032  1.00 0.00 ? 48 GLU S H    6  
ATOM 6142  H HA   . GLU A 1 39 ? 4.675   -2.106  -8.565  1.00 0.00 ? 48 GLU S HA   6  
ATOM 6143  H HB2  . GLU A 1 39 ? 2.244   -2.220  -10.313 1.00 0.00 ? 48 GLU S HB2  6  
ATOM 6144  H HB3  . GLU A 1 39 ? 3.825   -1.927  -11.025 1.00 0.00 ? 48 GLU S HB3  6  
ATOM 6145  H HG2  . GLU A 1 39 ? 4.417   -4.055  -9.515  1.00 0.00 ? 48 GLU S HG2  6  
ATOM 6146  H HG3  . GLU A 1 39 ? 2.706   -4.379  -9.822  1.00 0.00 ? 48 GLU S HG3  6  
ATOM 6147  N N    . PHE A 1 40 ? 2.933   0.571   -9.410  1.00 0.00 ? 49 PHE S N    6  
ATOM 6148  C CA   . PHE A 1 40 ? 3.050   1.998   -9.699  1.00 0.00 ? 49 PHE S CA   6  
ATOM 6149  C C    . PHE A 1 40 ? 3.355   2.818   -8.445  1.00 0.00 ? 49 PHE S C    6  
ATOM 6150  O O    . PHE A 1 40 ? 3.745   3.981   -8.542  1.00 0.00 ? 49 PHE S O    6  
ATOM 6151  C CB   . PHE A 1 40 ? 1.763   2.508   -10.354 1.00 0.00 ? 49 PHE S CB   6  
ATOM 6152  C CG   . PHE A 1 40 ? 2.006   3.387   -11.550 1.00 0.00 ? 49 PHE S CG   6  
ATOM 6153  C CD1  . PHE A 1 40 ? 2.625   4.618   -11.407 1.00 0.00 ? 49 PHE S CD1  6  
ATOM 6154  C CD2  . PHE A 1 40 ? 1.614   2.981   -12.815 1.00 0.00 ? 49 PHE S CD2  6  
ATOM 6155  C CE1  . PHE A 1 40 ? 2.850   5.428   -12.504 1.00 0.00 ? 49 PHE S CE1  6  
ATOM 6156  C CE2  . PHE A 1 40 ? 1.837   3.787   -13.916 1.00 0.00 ? 49 PHE S CE2  6  
ATOM 6157  C CZ   . PHE A 1 40 ? 2.456   5.011   -13.760 1.00 0.00 ? 49 PHE S CZ   6  
ATOM 6158  H H    . PHE A 1 40 ? 2.046   0.157   -9.397  1.00 0.00 ? 49 PHE S H    6  
ATOM 6159  H HA   . PHE A 1 40 ? 3.865   2.122   -10.397 1.00 0.00 ? 49 PHE S HA   6  
ATOM 6160  H HB2  . PHE A 1 40 ? 1.173   1.662   -10.679 1.00 0.00 ? 49 PHE S HB2  6  
ATOM 6161  H HB3  . PHE A 1 40 ? 1.199   3.078   -9.629  1.00 0.00 ? 49 PHE S HB3  6  
ATOM 6162  H HD1  . PHE A 1 40 ? 2.935   4.944   -10.424 1.00 0.00 ? 49 PHE S HD1  6  
ATOM 6163  H HD2  . PHE A 1 40 ? 1.129   2.023   -12.938 1.00 0.00 ? 49 PHE S HD2  6  
ATOM 6164  H HE1  . PHE A 1 40 ? 3.334   6.385   -12.378 1.00 0.00 ? 49 PHE S HE1  6  
ATOM 6165  H HE2  . PHE A 1 40 ? 1.527   3.458   -14.897 1.00 0.00 ? 49 PHE S HE2  6  
ATOM 6166  H HZ   . PHE A 1 40 ? 2.630   5.642   -14.620 1.00 0.00 ? 49 PHE S HZ   6  
ATOM 6167  N N    . ALA A 1 41 ? 3.167   2.223   -7.269  1.00 0.00 ? 50 ALA S N    6  
ATOM 6168  C CA   . ALA A 1 41 ? 3.418   2.932   -6.015  1.00 0.00 ? 50 ALA S CA   6  
ATOM 6169  C C    . ALA A 1 41 ? 4.768   2.565   -5.399  1.00 0.00 ? 50 ALA S C    6  
ATOM 6170  O O    . ALA A 1 41 ? 5.630   3.426   -5.216  1.00 0.00 ? 50 ALA S O    6  
ATOM 6171  C CB   . ALA A 1 41 ? 2.295   2.658   -5.025  1.00 0.00 ? 50 ALA S CB   6  
ATOM 6172  H H    . ALA A 1 41 ? 2.846   1.298   -7.240  1.00 0.00 ? 50 ALA S H    6  
ATOM 6173  H HA   . ALA A 1 41 ? 3.413   3.991   -6.231  1.00 0.00 ? 50 ALA S HA   6  
ATOM 6174  H HB1  . ALA A 1 41 ? 2.353   1.632   -4.691  1.00 0.00 ? 50 ALA S HB1  6  
ATOM 6175  H HB2  . ALA A 1 41 ? 1.343   2.827   -5.505  1.00 0.00 ? 50 ALA S HB2  6  
ATOM 6176  H HB3  . ALA A 1 41 ? 2.392   3.318   -4.178  1.00 0.00 ? 50 ALA S HB3  6  
ATOM 6177  N N    . LEU A 1 42 ? 4.937   1.290   -5.064  1.00 0.00 ? 51 LEU S N    6  
ATOM 6178  C CA   . LEU A 1 42 ? 6.176   0.815   -4.448  1.00 0.00 ? 51 LEU S CA   6  
ATOM 6179  C C    . LEU A 1 42 ? 7.001   -0.037  -5.412  1.00 0.00 ? 51 LEU S C    6  
ATOM 6180  O O    . LEU A 1 42 ? 8.150   -0.372  -5.123  1.00 0.00 ? 51 LEU S O    6  
ATOM 6181  C CB   . LEU A 1 42 ? 5.855   -0.012  -3.204  1.00 0.00 ? 51 LEU S CB   6  
ATOM 6182  C CG   . LEU A 1 42 ? 5.690   0.782   -1.908  1.00 0.00 ? 51 LEU S CG   6  
ATOM 6183  C CD1  . LEU A 1 42 ? 4.667   0.108   -1.006  1.00 0.00 ? 51 LEU S CD1  6  
ATOM 6184  C CD2  . LEU A 1 42 ? 7.028   0.916   -1.196  1.00 0.00 ? 51 LEU S CD2  6  
ATOM 6185  H H    . LEU A 1 42 ? 4.210   0.654   -5.222  1.00 0.00 ? 51 LEU S H    6  
ATOM 6186  H HA   . LEU A 1 42 ? 6.757   1.675   -4.156  1.00 0.00 ? 51 LEU S HA   6  
ATOM 6187  H HB2  . LEU A 1 42 ? 4.938   -0.553  -3.387  1.00 0.00 ? 51 LEU S HB2  6  
ATOM 6188  H HB3  . LEU A 1 42 ? 6.650   -0.729  -3.059  1.00 0.00 ? 51 LEU S HB3  6  
ATOM 6189  H HG   . LEU A 1 42 ? 5.331   1.775   -2.137  1.00 0.00 ? 51 LEU S HG   6  
ATOM 6190  H HD11 . LEU A 1 42 ? 3.949   0.838   -0.664  1.00 0.00 ? 51 LEU S HD11 6  
ATOM 6191  H HD12 . LEU A 1 42 ? 5.170   -0.328  -0.154  1.00 0.00 ? 51 LEU S HD12 6  
ATOM 6192  H HD13 . LEU A 1 42 ? 4.156   -0.668  -1.556  1.00 0.00 ? 51 LEU S HD13 6  
ATOM 6193  H HD21 . LEU A 1 42 ? 7.194   1.951   -0.937  1.00 0.00 ? 51 LEU S HD21 6  
ATOM 6194  H HD22 . LEU A 1 42 ? 7.819   0.577   -1.848  1.00 0.00 ? 51 LEU S HD22 6  
ATOM 6195  H HD23 . LEU A 1 42 ? 7.019   0.317   -0.298  1.00 0.00 ? 51 LEU S HD23 6  
ATOM 6196  N N    . ASP A 1 43 ? 6.409   -0.404  -6.542  1.00 0.00 ? 52 ASP S N    6  
ATOM 6197  C CA   . ASP A 1 43 ? 7.092   -1.234  -7.526  1.00 0.00 ? 52 ASP S CA   6  
ATOM 6198  C C    . ASP A 1 43 ? 7.273   -2.660  -7.007  1.00 0.00 ? 52 ASP S C    6  
ATOM 6199  O O    . ASP A 1 43 ? 8.026   -3.445  -7.582  1.00 0.00 ? 52 ASP S O    6  
ATOM 6200  C CB   . ASP A 1 43 ? 8.454   -0.634  -7.888  1.00 0.00 ? 52 ASP S CB   6  
ATOM 6201  C CG   . ASP A 1 43 ? 8.376   0.858   -8.152  1.00 0.00 ? 52 ASP S CG   6  
ATOM 6202  O OD1  . ASP A 1 43 ? 7.685   1.255   -9.114  1.00 0.00 ? 52 ASP S OD1  6  
ATOM 6203  O OD2  . ASP A 1 43 ? 9.004   1.629   -7.396  1.00 0.00 ? 52 ASP S OD2  6  
ATOM 6204  H H    . ASP A 1 43 ? 5.487   -0.120  -6.716  1.00 0.00 ? 52 ASP S H    6  
ATOM 6205  H HA   . ASP A 1 43 ? 6.478   -1.265  -8.414  1.00 0.00 ? 52 ASP S HA   6  
ATOM 6206  H HB2  . ASP A 1 43 ? 9.143   -0.800  -7.071  1.00 0.00 ? 52 ASP S HB2  6  
ATOM 6207  H HB3  . ASP A 1 43 ? 8.829   -1.119  -8.778  1.00 0.00 ? 52 ASP S HB3  6  
ATOM 6208  N N    . MET A 1 44 ? 6.570   -2.997  -5.923  1.00 0.00 ? 53 MET S N    6  
ATOM 6209  C CA   . MET A 1 44 ? 6.654   -4.340  -5.348  1.00 0.00 ? 53 MET S CA   6  
ATOM 6210  C C    . MET A 1 44 ? 5.279   -5.005  -5.336  1.00 0.00 ? 53 MET S C    6  
ATOM 6211  O O    . MET A 1 44 ? 4.390   -4.594  -6.073  1.00 0.00 ? 53 MET S O    6  
ATOM 6212  C CB   . MET A 1 44 ? 7.238   -4.286  -3.935  1.00 0.00 ? 53 MET S CB   6  
ATOM 6213  C CG   . MET A 1 44 ? 8.329   -5.317  -3.701  1.00 0.00 ? 53 MET S CG   6  
ATOM 6214  S SD   . MET A 1 44 ? 9.985   -4.645  -3.944  1.00 0.00 ? 53 MET S SD   6  
ATOM 6215  C CE   . MET A 1 44 ? 10.779  -6.010  -4.788  1.00 0.00 ? 53 MET S CE   6  
ATOM 6216  H H    . MET A 1 44 ? 5.977   -2.330  -5.504  1.00 0.00 ? 53 MET S H    6  
ATOM 6217  H HA   . MET A 1 44 ? 7.312   -4.923  -5.975  1.00 0.00 ? 53 MET S HA   6  
ATOM 6218  H HB2  . MET A 1 44 ? 7.657   -3.303  -3.767  1.00 0.00 ? 53 MET S HB2  6  
ATOM 6219  H HB3  . MET A 1 44 ? 6.445   -4.462  -3.221  1.00 0.00 ? 53 MET S HB3  6  
ATOM 6220  H HG2  . MET A 1 44 ? 8.249   -5.683  -2.690  1.00 0.00 ? 53 MET S HG2  6  
ATOM 6221  H HG3  . MET A 1 44 ? 8.184   -6.137  -4.389  1.00 0.00 ? 53 MET S HG3  6  
ATOM 6222  H HE1  . MET A 1 44 ? 11.823  -5.778  -4.945  1.00 0.00 ? 53 MET S HE1  6  
ATOM 6223  H HE2  . MET A 1 44 ? 10.301  -6.172  -5.742  1.00 0.00 ? 53 MET S HE2  6  
ATOM 6224  H HE3  . MET A 1 44 ? 10.697  -6.904  -4.187  1.00 0.00 ? 53 MET S HE3  6  
ATOM 6225  N N    . THR A 1 45 ? 5.102   -6.033  -4.504  1.00 0.00 ? 54 THR S N    6  
ATOM 6226  C CA   . THR A 1 45 ? 3.820   -6.721  -4.427  1.00 0.00 ? 54 THR S CA   6  
ATOM 6227  C C    . THR A 1 45 ? 3.407   -6.925  -2.975  1.00 0.00 ? 54 THR S C    6  
ATOM 6228  O O    . THR A 1 45 ? 4.257   -6.995  -2.087  1.00 0.00 ? 54 THR S O    6  
ATOM 6229  C CB   . THR A 1 45 ? 3.880   -8.071  -5.152  1.00 0.00 ? 54 THR S CB   6  
ATOM 6230  O OG1  . THR A 1 45 ? 4.312   -9.097  -4.277  1.00 0.00 ? 54 THR S OG1  6  
ATOM 6231  C CG2  . THR A 1 45 ? 4.803   -8.074  -6.352  1.00 0.00 ? 54 THR S CG2  6  
ATOM 6232  H H    . THR A 1 45 ? 5.841   -6.330  -3.926  1.00 0.00 ? 54 THR S H    6  
ATOM 6233  H HA   . THR A 1 45 ? 3.083   -6.097  -4.912  1.00 0.00 ? 54 THR S HA   6  
ATOM 6234  H HB   . THR A 1 45 ? 2.887   -8.323  -5.500  1.00 0.00 ? 54 THR S HB   6  
ATOM 6235  H HG1  . THR A 1 45 ? 3.610   -9.743  -4.168  1.00 0.00 ? 54 THR S HG1  6  
ATOM 6236  H HG21 . THR A 1 45 ? 5.818   -7.899  -6.025  1.00 0.00 ? 54 THR S HG21 6  
ATOM 6237  H HG22 . THR A 1 45 ? 4.506   -7.293  -7.037  1.00 0.00 ? 54 THR S HG22 6  
ATOM 6238  H HG23 . THR A 1 45 ? 4.745   -9.031  -6.850  1.00 0.00 ? 54 THR S HG23 6  
ATOM 6239  N N    . ARG A 1 46 ? 2.106   -7.042  -2.735  1.00 0.00 ? 55 ARG S N    6  
ATOM 6240  C CA   . ARG A 1 46 ? 1.610   -7.264  -1.385  1.00 0.00 ? 55 ARG S CA   6  
ATOM 6241  C C    . ARG A 1 46 ? 2.145   -8.586  -0.848  1.00 0.00 ? 55 ARG S C    6  
ATOM 6242  O O    . ARG A 1 46 ? 2.341   -8.747  0.354   1.00 0.00 ? 55 ARG S O    6  
ATOM 6243  C CB   . ARG A 1 46 ? 0.080   -7.275  -1.364  1.00 0.00 ? 55 ARG S CB   6  
ATOM 6244  C CG   . ARG A 1 46 ? -0.504  -7.037  0.021   1.00 0.00 ? 55 ARG S CG   6  
ATOM 6245  C CD   . ARG A 1 46 ? -1.537  -5.920  0.017   1.00 0.00 ? 55 ARG S CD   6  
ATOM 6246  N NE   . ARG A 1 46 ? -2.440  -6.007  -1.129  1.00 0.00 ? 55 ARG S NE   6  
ATOM 6247  C CZ   . ARG A 1 46 ? -3.528  -6.772  -1.161  1.00 0.00 ? 55 ARG S CZ   6  
ATOM 6248  N NH1  . ARG A 1 46 ? -3.850  -7.530  -0.118  1.00 0.00 ? 55 ARG S NH1  6  
ATOM 6249  N NH2  . ARG A 1 46 ? -4.300  -6.781  -2.240  1.00 0.00 ? 55 ARG S NH2  6  
ATOM 6250  H H    . ARG A 1 46 ? 1.472   -6.995  -3.481  1.00 0.00 ? 55 ARG S H    6  
ATOM 6251  H HA   . ARG A 1 46 ? 1.969   -6.460  -0.760  1.00 0.00 ? 55 ARG S HA   6  
ATOM 6252  H HB2  . ARG A 1 46 ? -0.285  -6.500  -2.026  1.00 0.00 ? 55 ARG S HB2  6  
ATOM 6253  H HB3  . ARG A 1 46 ? -0.267  -8.236  -1.717  1.00 0.00 ? 55 ARG S HB3  6  
ATOM 6254  H HG2  . ARG A 1 46 ? -0.975  -7.946  0.362   1.00 0.00 ? 55 ARG S HG2  6  
ATOM 6255  H HG3  . ARG A 1 46 ? 0.295   -6.771  0.697   1.00 0.00 ? 55 ARG S HG3  6  
ATOM 6256  H HD2  . ARG A 1 46 ? -2.119  -5.982  0.925   1.00 0.00 ? 55 ARG S HD2  6  
ATOM 6257  H HD3  . ARG A 1 46 ? -1.023  -4.972  -0.013  1.00 0.00 ? 55 ARG S HD3  6  
ATOM 6258  H HE   . ARG A 1 46 ? -2.224  -5.464  -1.915  1.00 0.00 ? 55 ARG S HE   6  
ATOM 6259  H HH11 . ARG A 1 46 ? -3.273  -7.530  0.698   1.00 0.00 ? 55 ARG S HH11 6  
ATOM 6260  H HH12 . ARG A 1 46 ? -4.670  -8.099  -0.150  1.00 0.00 ? 55 ARG S HH12 6  
ATOM 6261  H HH21 . ARG A 1 46 ? -4.062  -6.215  -3.029  1.00 0.00 ? 55 ARG S HH21 6  
ATOM 6262  H HH22 . ARG A 1 46 ? -5.118  -7.356  -2.265  1.00 0.00 ? 55 ARG S HH22 6  
ATOM 6263  N N    . ASP A 1 47 ? 2.380   -9.525  -1.763  1.00 0.00 ? 56 ASP S N    6  
ATOM 6264  C CA   . ASP A 1 47 ? 2.894   -10.844 -1.412  1.00 0.00 ? 56 ASP S CA   6  
ATOM 6265  C C    . ASP A 1 47 ? 4.424   -10.868 -1.412  1.00 0.00 ? 56 ASP S C    6  
ATOM 6266  O O    . ASP A 1 47 ? 5.034   -11.846 -0.980  1.00 0.00 ? 56 ASP S O    6  
ATOM 6267  C CB   . ASP A 1 47 ? 2.361   -11.896 -2.385  1.00 0.00 ? 56 ASP S CB   6  
ATOM 6268  C CG   . ASP A 1 47 ? 0.851   -11.850 -2.518  1.00 0.00 ? 56 ASP S CG   6  
ATOM 6269  O OD1  . ASP A 1 47 ? 0.167   -11.727 -1.481  1.00 0.00 ? 56 ASP S OD1  6  
ATOM 6270  O OD2  . ASP A 1 47 ? 0.355   -11.936 -3.662  1.00 0.00 ? 56 ASP S OD2  6  
ATOM 6271  H H    . ASP A 1 47 ? 2.202   -9.325  -2.704  1.00 0.00 ? 56 ASP S H    6  
ATOM 6272  H HA   . ASP A 1 47 ? 2.546   -11.080 -0.417  1.00 0.00 ? 56 ASP S HA   6  
ATOM 6273  H HB2  . ASP A 1 47 ? 2.794   -11.728 -3.360  1.00 0.00 ? 56 ASP S HB2  6  
ATOM 6274  H HB3  . ASP A 1 47 ? 2.643   -12.878 -2.034  1.00 0.00 ? 56 ASP S HB3  6  
ATOM 6275  N N    . GLU A 1 48 ? 5.044   -9.790  -1.891  1.00 0.00 ? 57 GLU S N    6  
ATOM 6276  C CA   . GLU A 1 48 ? 6.497   -9.704  -1.932  1.00 0.00 ? 57 GLU S CA   6  
ATOM 6277  C C    . GLU A 1 48 ? 6.979   -9.029  -0.670  1.00 0.00 ? 57 GLU S C    6  
ATOM 6278  O O    . GLU A 1 48 ? 7.735   -9.597  0.118   1.00 0.00 ? 57 GLU S O    6  
ATOM 6279  C CB   . GLU A 1 48 ? 6.951   -8.906  -3.154  1.00 0.00 ? 57 GLU S CB   6  
ATOM 6280  C CG   . GLU A 1 48 ? 8.454   -8.943  -3.381  1.00 0.00 ? 57 GLU S CG   6  
ATOM 6281  C CD   . GLU A 1 48 ? 8.847   -9.852  -4.530  1.00 0.00 ? 57 GLU S CD   6  
ATOM 6282  O OE1  . GLU A 1 48 ? 8.060   -10.763 -4.862  1.00 0.00 ? 57 GLU S OE1  6  
ATOM 6283  O OE2  . GLU A 1 48 ? 9.943   -9.653  -5.094  1.00 0.00 ? 57 GLU S OE2  6  
ATOM 6284  H H    . GLU A 1 48 ? 4.516   -9.026  -2.206  1.00 0.00 ? 57 GLU S H    6  
ATOM 6285  H HA   . GLU A 1 48 ? 6.899   -10.705 -1.981  1.00 0.00 ? 57 GLU S HA   6  
ATOM 6286  H HB2  . GLU A 1 48 ? 6.465   -9.309  -4.030  1.00 0.00 ? 57 GLU S HB2  6  
ATOM 6287  H HB3  . GLU A 1 48 ? 6.651   -7.872  -3.024  1.00 0.00 ? 57 GLU S HB3  6  
ATOM 6288  H HG2  . GLU A 1 48 ? 8.796   -7.943  -3.601  1.00 0.00 ? 57 GLU S HG2  6  
ATOM 6289  H HG3  . GLU A 1 48 ? 8.931   -9.297  -2.479  1.00 0.00 ? 57 GLU S HG3  6  
ATOM 6290  N N    . TYR A 1 49 ? 6.490   -7.819  -0.476  1.00 0.00 ? 58 TYR S N    6  
ATOM 6291  C CA   . TYR A 1 49 ? 6.808   -7.043  0.702   1.00 0.00 ? 58 TYR S CA   6  
ATOM 6292  C C    . TYR A 1 49 ? 6.332   -7.785  1.939   1.00 0.00 ? 58 TYR S C    6  
ATOM 6293  O O    . TYR A 1 49 ? 6.934   -7.695  3.009   1.00 0.00 ? 58 TYR S O    6  
ATOM 6294  C CB   . TYR A 1 49 ? 6.117   -5.687  0.608   1.00 0.00 ? 58 TYR S CB   6  
ATOM 6295  C CG   . TYR A 1 49 ? 6.934   -4.598  -0.059  1.00 0.00 ? 58 TYR S CG   6  
ATOM 6296  C CD1  . TYR A 1 49 ? 8.259   -4.801  -0.445  1.00 0.00 ? 58 TYR S CD1  6  
ATOM 6297  C CD2  . TYR A 1 49 ? 6.366   -3.359  -0.314  1.00 0.00 ? 58 TYR S CD2  6  
ATOM 6298  C CE1  . TYR A 1 49 ? 8.983   -3.800  -1.062  1.00 0.00 ? 58 TYR S CE1  6  
ATOM 6299  C CE2  . TYR A 1 49 ? 7.085   -2.357  -0.929  1.00 0.00 ? 58 TYR S CE2  6  
ATOM 6300  C CZ   . TYR A 1 49 ? 8.392   -2.580  -1.302  1.00 0.00 ? 58 TYR S CZ   6  
ATOM 6301  O OH   . TYR A 1 49 ? 9.109   -1.582  -1.918  1.00 0.00 ? 58 TYR S OH   6  
ATOM 6302  H H    . TYR A 1 49 ? 5.869   -7.446  -1.135  1.00 0.00 ? 58 TYR S H    6  
ATOM 6303  H HA   . TYR A 1 49 ? 7.873   -6.910  0.753   1.00 0.00 ? 58 TYR S HA   6  
ATOM 6304  H HB2  . TYR A 1 49 ? 5.208   -5.806  0.033   1.00 0.00 ? 58 TYR S HB2  6  
ATOM 6305  H HB3  . TYR A 1 49 ? 5.862   -5.362  1.597   1.00 0.00 ? 58 TYR S HB3  6  
ATOM 6306  H HD1  . TYR A 1 49 ? 8.723   -5.755  -0.261  1.00 0.00 ? 58 TYR S HD1  6  
ATOM 6307  H HD2  . TYR A 1 49 ? 5.343   -3.182  -0.017  1.00 0.00 ? 58 TYR S HD2  6  
ATOM 6308  H HE1  . TYR A 1 49 ? 10.008  -3.977  -1.353  1.00 0.00 ? 58 TYR S HE1  6  
ATOM 6309  H HE2  . TYR A 1 49 ? 6.621   -1.403  -1.119  1.00 0.00 ? 58 TYR S HE2  6  
ATOM 6310  H HH   . TYR A 1 49 ? 10.018  -1.604  -1.610  1.00 0.00 ? 58 TYR S HH   6  
ATOM 6311  N N    . ASN A 1 50 ? 5.238   -8.522  1.774   1.00 0.00 ? 59 ASN S N    6  
ATOM 6312  C CA   . ASN A 1 50 ? 4.661   -9.297  2.874   1.00 0.00 ? 59 ASN S CA   6  
ATOM 6313  C C    . ASN A 1 50 ? 5.722   -10.131 3.592   1.00 0.00 ? 59 ASN S C    6  
ATOM 6314  O O    . ASN A 1 50 ? 5.581   -10.443 4.774   1.00 0.00 ? 59 ASN S O    6  
ATOM 6315  C CB   . ASN A 1 50 ? 3.553   -10.218 2.355   1.00 0.00 ? 59 ASN S CB   6  
ATOM 6316  C CG   . ASN A 1 50 ? 2.178   -9.807  2.849   1.00 0.00 ? 59 ASN S CG   6  
ATOM 6317  O OD1  . ASN A 1 50 ? 1.349   -10.653 3.186   1.00 0.00 ? 59 ASN S OD1  6  
ATOM 6318  N ND2  . ASN A 1 50 ? 1.928   -8.504  2.893   1.00 0.00 ? 59 ASN S ND2  6  
ATOM 6319  H H    . ASN A 1 50 ? 4.807   -8.543  0.883   1.00 0.00 ? 59 ASN S H    6  
ATOM 6320  H HA   . ASN A 1 50 ? 4.233   -8.600  3.578   1.00 0.00 ? 59 ASN S HA   6  
ATOM 6321  H HB2  . ASN A 1 50 ? 3.551   -10.198 1.277   1.00 0.00 ? 59 ASN S HB2  6  
ATOM 6322  H HB3  . ASN A 1 50 ? 3.746   -11.227 2.690   1.00 0.00 ? 59 ASN S HB3  6  
ATOM 6323  H HD21 . ASN A 1 50 ? 2.634   -7.887  2.609   1.00 0.00 ? 59 ASN S HD21 6  
ATOM 6324  H HD22 . ASN A 1 50 ? 1.047   -8.212  3.209   1.00 0.00 ? 59 ASN S HD22 6  
ATOM 6325  N N    . ALA A 1 51 ? 6.779   -10.498 2.872   1.00 0.00 ? 60 ALA S N    6  
ATOM 6326  C CA   . ALA A 1 51 ? 7.851   -11.304 3.448   1.00 0.00 ? 60 ALA S CA   6  
ATOM 6327  C C    . ALA A 1 51 ? 9.128   -10.490 3.628   1.00 0.00 ? 60 ALA S C    6  
ATOM 6328  O O    . ALA A 1 51 ? 9.897   -10.726 4.561   1.00 0.00 ? 60 ALA S O    6  
ATOM 6329  C CB   . ALA A 1 51 ? 8.119   -12.522 2.574   1.00 0.00 ? 60 ALA S CB   6  
ATOM 6330  H H    . ALA A 1 51 ? 6.836   -10.227 1.931   1.00 0.00 ? 60 ALA S H    6  
ATOM 6331  H HA   . ALA A 1 51 ? 7.520   -11.653 4.414   1.00 0.00 ? 60 ALA S HA   6  
ATOM 6332  H HB1  . ALA A 1 51 ? 9.165   -12.785 2.637   1.00 0.00 ? 60 ALA S HB1  6  
ATOM 6333  H HB2  . ALA A 1 51 ? 7.866   -12.293 1.550   1.00 0.00 ? 60 ALA S HB2  6  
ATOM 6334  H HB3  . ALA A 1 51 ? 7.519   -13.351 2.917   1.00 0.00 ? 60 ALA S HB3  6  
ATOM 6335  N N    . LEU A 1 52 ? 9.350   -9.533  2.735   1.00 0.00 ? 61 LEU S N    6  
ATOM 6336  C CA   . LEU A 1 52 ? 10.535  -8.688  2.801   1.00 0.00 ? 61 LEU S CA   6  
ATOM 6337  C C    . LEU A 1 52 ? 10.567  -7.901  4.109   1.00 0.00 ? 61 LEU S C    6  
ATOM 6338  O O    . LEU A 1 52 ? 9.540   -7.738  4.767   1.00 0.00 ? 61 LEU S O    6  
ATOM 6339  C CB   . LEU A 1 52 ? 10.562  -7.725  1.611   1.00 0.00 ? 61 LEU S CB   6  
ATOM 6340  C CG   . LEU A 1 52 ? 11.489  -8.138  0.464   1.00 0.00 ? 61 LEU S CG   6  
ATOM 6341  C CD1  . LEU A 1 52 ? 10.786  -7.984  -0.874  1.00 0.00 ? 61 LEU S CD1  6  
ATOM 6342  C CD2  . LEU A 1 52 ? 12.772  -7.321  0.490   1.00 0.00 ? 61 LEU S CD2  6  
ATOM 6343  H H    . LEU A 1 52 ? 8.699   -9.393  2.014   1.00 0.00 ? 61 LEU S H    6  
ATOM 6344  H HA   . LEU A 1 52 ? 11.403  -9.327  2.756   1.00 0.00 ? 61 LEU S HA   6  
ATOM 6345  H HB2  . LEU A 1 52 ? 9.557   -7.643  1.221   1.00 0.00 ? 61 LEU S HB2  6  
ATOM 6346  H HB3  . LEU A 1 52 ? 10.874  -6.752  1.967   1.00 0.00 ? 61 LEU S HB3  6  
ATOM 6347  H HG   . LEU A 1 52 ? 11.754  -9.179  0.583   1.00 0.00 ? 61 LEU S HG   6  
ATOM 6348  H HD11 . LEU A 1 52 ? 10.491  -6.954  -1.011  1.00 0.00 ? 61 LEU S HD11 6  
ATOM 6349  H HD12 . LEU A 1 52 ? 9.909   -8.614  -0.895  1.00 0.00 ? 61 LEU S HD12 6  
ATOM 6350  H HD13 . LEU A 1 52 ? 11.456  -8.276  -1.671  1.00 0.00 ? 61 LEU S HD13 6  
ATOM 6351  H HD21 . LEU A 1 52 ? 13.143  -7.203  -0.518  1.00 0.00 ? 61 LEU S HD21 6  
ATOM 6352  H HD22 . LEU A 1 52 ? 13.512  -7.827  1.090   1.00 0.00 ? 61 LEU S HD22 6  
ATOM 6353  H HD23 . LEU A 1 52 ? 12.570  -6.348  0.914   1.00 0.00 ? 61 LEU S HD23 6  
ATOM 6354  N N    . PRO A 1 53 ? 11.750  -7.405  4.507   1.00 0.00 ? 62 PRO S N    6  
ATOM 6355  C CA   . PRO A 1 53 ? 11.900  -6.634  5.745   1.00 0.00 ? 62 PRO S CA   6  
ATOM 6356  C C    . PRO A 1 53 ? 10.928  -5.461  5.808   1.00 0.00 ? 62 PRO S C    6  
ATOM 6357  O O    . PRO A 1 53 ? 10.683  -4.787  4.807   1.00 0.00 ? 62 PRO S O    6  
ATOM 6358  C CB   . PRO A 1 53 ? 13.346  -6.135  5.690   1.00 0.00 ? 62 PRO S CB   6  
ATOM 6359  C CG   . PRO A 1 53 ? 14.048  -7.100  4.796   1.00 0.00 ? 62 PRO S CG   6  
ATOM 6360  C CD   . PRO A 1 53 ? 13.028  -7.549  3.787   1.00 0.00 ? 62 PRO S CD   6  
ATOM 6361  H HA   . PRO A 1 53 ? 11.765  -7.257  6.616   1.00 0.00 ? 62 PRO S HA   6  
ATOM 6362  H HB2  . PRO A 1 53 ? 13.369  -5.133  5.287   1.00 0.00 ? 62 PRO S HB2  6  
ATOM 6363  H HB3  . PRO A 1 53 ? 13.770  -6.142  6.683   1.00 0.00 ? 62 PRO S HB3  6  
ATOM 6364  H HG2  . PRO A 1 53 ? 14.874  -6.609  4.300   1.00 0.00 ? 62 PRO S HG2  6  
ATOM 6365  H HG3  . PRO A 1 53 ? 14.402  -7.944  5.372   1.00 0.00 ? 62 PRO S HG3  6  
ATOM 6366  H HD2  . PRO A 1 53 ? 13.053  -6.911  2.915   1.00 0.00 ? 62 PRO S HD2  6  
ATOM 6367  H HD3  . PRO A 1 53 ? 13.199  -8.580  3.509   1.00 0.00 ? 62 PRO S HD3  6  
ATOM 6368  N N    . ALA A 1 54 ? 10.367  -5.235  6.989   1.00 0.00 ? 63 ALA S N    6  
ATOM 6369  C CA   . ALA A 1 54 ? 9.407   -4.156  7.186   1.00 0.00 ? 63 ALA S CA   6  
ATOM 6370  C C    . ALA A 1 54 ? 10.036  -2.782  6.962   1.00 0.00 ? 63 ALA S C    6  
ATOM 6371  O O    . ALA A 1 54 ? 9.328   -1.799  6.756   1.00 0.00 ? 63 ALA S O    6  
ATOM 6372  C CB   . ALA A 1 54 ? 8.811   -4.236  8.582   1.00 0.00 ? 63 ALA S CB   6  
ATOM 6373  H H    . ALA A 1 54 ? 10.595  -5.814  7.745   1.00 0.00 ? 63 ALA S H    6  
ATOM 6374  H HA   . ALA A 1 54 ? 8.608   -4.292  6.476   1.00 0.00 ? 63 ALA S HA   6  
ATOM 6375  H HB1  . ALA A 1 54 ? 8.931   -5.238  8.968   1.00 0.00 ? 63 ALA S HB1  6  
ATOM 6376  H HB2  . ALA A 1 54 ? 7.761   -3.992  8.540   1.00 0.00 ? 63 ALA S HB2  6  
ATOM 6377  H HB3  . ALA A 1 54 ? 9.319   -3.538  9.232   1.00 0.00 ? 63 ALA S HB3  6  
ATOM 6378  N N    . TRP A 1 55 ? 11.361  -2.717  6.987   1.00 0.00 ? 64 TRP S N    6  
ATOM 6379  C CA   . TRP A 1 55 ? 12.061  -1.474  6.785   1.00 0.00 ? 64 TRP S CA   6  
ATOM 6380  C C    . TRP A 1 55 ? 12.348  -1.296  5.306   1.00 0.00 ? 64 TRP S C    6  
ATOM 6381  O O    . TRP A 1 55 ? 12.207  -0.205  4.770   1.00 0.00 ? 64 TRP S O    6  
ATOM 6382  C CB   . TRP A 1 55 ? 13.360  -1.463  7.603   1.00 0.00 ? 64 TRP S CB   6  
ATOM 6383  C CG   . TRP A 1 55 ? 14.580  -1.617  6.757   1.00 0.00 ? 64 TRP S CG   6  
ATOM 6384  C CD1  . TRP A 1 55 ? 15.405  -2.699  6.684   1.00 0.00 ? 64 TRP S CD1  6  
ATOM 6385  C CD2  . TRP A 1 55 ? 15.087  -0.657  5.836   1.00 0.00 ? 64 TRP S CD2  6  
ATOM 6386  N NE1  . TRP A 1 55 ? 16.406  -2.462  5.769   1.00 0.00 ? 64 TRP S NE1  6  
ATOM 6387  C CE2  . TRP A 1 55 ? 16.227  -1.210  5.233   1.00 0.00 ? 64 TRP S CE2  6  
ATOM 6388  C CE3  . TRP A 1 55 ? 14.677  0.624   5.469   1.00 0.00 ? 64 TRP S CE3  6  
ATOM 6389  C CZ2  . TRP A 1 55 ? 16.962  -0.520  4.273   1.00 0.00 ? 64 TRP S CZ2  6  
ATOM 6390  C CZ3  . TRP A 1 55 ? 15.401  1.304   4.518   1.00 0.00 ? 64 TRP S CZ3  6  
ATOM 6391  C CH2  . TRP A 1 55 ? 16.529  0.734   3.929   1.00 0.00 ? 64 TRP S CH2  6  
ATOM 6392  H H    . TRP A 1 55 ? 11.880  -3.519  7.127   1.00 0.00 ? 64 TRP S H    6  
ATOM 6393  H HA   . TRP A 1 55 ? 11.422  -0.671  7.119   1.00 0.00 ? 64 TRP S HA   6  
ATOM 6394  H HB2  . TRP A 1 55 ? 13.437  -0.523  8.135   1.00 0.00 ? 64 TRP S HB2  6  
ATOM 6395  H HB3  . TRP A 1 55 ? 13.339  -2.278  8.315   1.00 0.00 ? 64 TRP S HB3  6  
ATOM 6396  H HD1  . TRP A 1 55 ? 15.275  -3.599  7.265   1.00 0.00 ? 64 TRP S HD1  6  
ATOM 6397  H HE1  . TRP A 1 55 ? 17.124  -3.087  5.535   1.00 0.00 ? 64 TRP S HE1  6  
ATOM 6398  H HE3  . TRP A 1 55 ? 13.805  1.083   5.914   1.00 0.00 ? 64 TRP S HE3  6  
ATOM 6399  H HZ2  . TRP A 1 55 ? 17.837  -0.947  3.806   1.00 0.00 ? 64 TRP S HZ2  6  
ATOM 6400  H HZ3  . TRP A 1 55 ? 15.096  2.293   4.216   1.00 0.00 ? 64 TRP S HZ3  6  
ATOM 6401  H HH2  . TRP A 1 55 ? 17.053  1.302   3.185   1.00 0.00 ? 64 TRP S HH2  6  
ATOM 6402  N N    . LYS A 1 56 ? 12.750  -2.383  4.651   1.00 0.00 ? 65 LYS S N    6  
ATOM 6403  C CA   . LYS A 1 56 ? 13.048  -2.340  3.229   1.00 0.00 ? 65 LYS S CA   6  
ATOM 6404  C C    . LYS A 1 56 ? 11.798  -1.945  2.465   1.00 0.00 ? 65 LYS S C    6  
ATOM 6405  O O    . LYS A 1 56 ? 11.848  -1.119  1.554   1.00 0.00 ? 65 LYS S O    6  
ATOM 6406  C CB   . LYS A 1 56 ? 13.580  -3.685  2.736   1.00 0.00 ? 65 LYS S CB   6  
ATOM 6407  C CG   . LYS A 1 56 ? 15.005  -3.607  2.213   1.00 0.00 ? 65 LYS S CG   6  
ATOM 6408  C CD   . LYS A 1 56 ? 15.945  -4.495  3.014   1.00 0.00 ? 65 LYS S CD   6  
ATOM 6409  C CE   . LYS A 1 56 ? 17.382  -4.008  2.921   1.00 0.00 ? 65 LYS S CE   6  
ATOM 6410  N NZ   . LYS A 1 56 ? 18.354  -5.068  3.311   1.00 0.00 ? 65 LYS S NZ   6  
ATOM 6411  H H    . LYS A 1 56 ? 12.839  -3.230  5.133   1.00 0.00 ? 65 LYS S H    6  
ATOM 6412  H HA   . LYS A 1 56 ? 13.802  -1.582  3.073   1.00 0.00 ? 65 LYS S HA   6  
ATOM 6413  H HB2  . LYS A 1 56 ? 13.555  -4.393  3.555   1.00 0.00 ? 65 LYS S HB2  6  
ATOM 6414  H HB3  . LYS A 1 56 ? 12.945  -4.044  1.935   1.00 0.00 ? 65 LYS S HB3  6  
ATOM 6415  H HG2  . LYS A 1 56 ? 15.018  -3.924  1.181   1.00 0.00 ? 65 LYS S HG2  6  
ATOM 6416  H HG3  . LYS A 1 56 ? 15.347  -2.581  2.285   1.00 0.00 ? 65 LYS S HG3  6  
ATOM 6417  H HD2  . LYS A 1 56 ? 15.639  -4.487  4.049   1.00 0.00 ? 65 LYS S HD2  6  
ATOM 6418  H HD3  . LYS A 1 56 ? 15.890  -5.503  2.627   1.00 0.00 ? 65 LYS S HD3  6  
ATOM 6419  H HE2  . LYS A 1 56 ? 17.582  -3.707  1.905   1.00 0.00 ? 65 LYS S HE2  6  
ATOM 6420  H HE3  . LYS A 1 56 ? 17.504  -3.161  3.579   1.00 0.00 ? 65 LYS S HE3  6  
ATOM 6421  H HZ1  . LYS A 1 56 ? 19.279  -4.886  2.870   1.00 0.00 ? 65 LYS S HZ1  6  
ATOM 6422  H HZ2  . LYS A 1 56 ? 18.012  -6.000  2.998   1.00 0.00 ? 65 LYS S HZ2  6  
ATOM 6423  H HZ3  . LYS A 1 56 ? 18.472  -5.083  4.343   1.00 0.00 ? 65 LYS S HZ3  6  
ATOM 6424  N N    . GLN A 1 57 ? 10.661  -2.510  2.869   1.00 0.00 ? 66 GLN S N    6  
ATOM 6425  C CA   . GLN A 1 57 ? 9.404   -2.167  2.236   1.00 0.00 ? 66 GLN S CA   6  
ATOM 6426  C C    . GLN A 1 57 ? 9.127   -0.696  2.497   1.00 0.00 ? 66 GLN S C    6  
ATOM 6427  O O    . GLN A 1 57 ? 8.694   0.035   1.607   1.00 0.00 ? 66 GLN S O    6  
ATOM 6428  C CB   . GLN A 1 57 ? 8.259   -3.041  2.752   1.00 0.00 ? 66 GLN S CB   6  
ATOM 6429  C CG   . GLN A 1 57 ? 8.071   -2.997  4.258   1.00 0.00 ? 66 GLN S CG   6  
ATOM 6430  C CD   . GLN A 1 57 ? 7.009   -3.971  4.730   1.00 0.00 ? 66 GLN S CD   6  
ATOM 6431  O OE1  . GLN A 1 57 ? 6.089   -3.599  5.460   1.00 0.00 ? 66 GLN S OE1  6  
ATOM 6432  N NE2  . GLN A 1 57 ? 7.132   -5.228  4.314   1.00 0.00 ? 66 GLN S NE2  6  
ATOM 6433  H H    . GLN A 1 57 ? 10.672  -3.139  3.621   1.00 0.00 ? 66 GLN S H    6  
ATOM 6434  H HA   . GLN A 1 57 ? 9.518   -2.317  1.174   1.00 0.00 ? 66 GLN S HA   6  
ATOM 6435  H HB2  . GLN A 1 57 ? 7.340   -2.720  2.287   1.00 0.00 ? 66 GLN S HB2  6  
ATOM 6436  H HB3  . GLN A 1 57 ? 8.456   -4.063  2.466   1.00 0.00 ? 66 GLN S HB3  6  
ATOM 6437  H HG2  . GLN A 1 57 ? 9.007   -3.249  4.734   1.00 0.00 ? 66 GLN S HG2  6  
ATOM 6438  H HG3  . GLN A 1 57 ? 7.775   -1.997  4.542   1.00 0.00 ? 66 GLN S HG3  6  
ATOM 6439  H HE21 . GLN A 1 57 ? 7.888   -5.453  3.734   1.00 0.00 ? 66 GLN S HE21 6  
ATOM 6440  H HE22 . GLN A 1 57 ? 6.460   -5.880  4.604   1.00 0.00 ? 66 GLN S HE22 6  
ATOM 6441  N N    . VAL A 1 58 ? 9.440   -0.256  3.717   1.00 0.00 ? 67 VAL S N    6  
ATOM 6442  C CA   . VAL A 1 58 ? 9.283   1.142   4.071   1.00 0.00 ? 67 VAL S CA   6  
ATOM 6443  C C    . VAL A 1 58 ? 10.280  1.960   3.259   1.00 0.00 ? 67 VAL S C    6  
ATOM 6444  O O    . VAL A 1 58 ? 9.959   3.040   2.766   1.00 0.00 ? 67 VAL S O    6  
ATOM 6445  C CB   . VAL A 1 58 ? 9.514   1.393   5.579   1.00 0.00 ? 67 VAL S CB   6  
ATOM 6446  C CG1  . VAL A 1 58 ? 9.522   2.885   5.886   1.00 0.00 ? 67 VAL S CG1  6  
ATOM 6447  C CG2  . VAL A 1 58 ? 8.456   0.683   6.411   1.00 0.00 ? 67 VAL S CG2  6  
ATOM 6448  H H    . VAL A 1 58 ? 9.818   -0.879  4.375   1.00 0.00 ? 67 VAL S H    6  
ATOM 6449  H HA   . VAL A 1 58 ? 8.279   1.447   3.814   1.00 0.00 ? 67 VAL S HA   6  
ATOM 6450  H HB   . VAL A 1 58 ? 10.480  0.990   5.846   1.00 0.00 ? 67 VAL S HB   6  
ATOM 6451  H HG11 . VAL A 1 58 ? 9.022   3.419   5.090   1.00 0.00 ? 67 VAL S HG11 6  
ATOM 6452  H HG12 . VAL A 1 58 ? 10.543  3.229   5.963   1.00 0.00 ? 67 VAL S HG12 6  
ATOM 6453  H HG13 . VAL A 1 58 ? 9.008   3.065   6.818   1.00 0.00 ? 67 VAL S HG13 6  
ATOM 6454  H HG21 . VAL A 1 58 ? 8.016   -0.114  5.831   1.00 0.00 ? 67 VAL S HG21 6  
ATOM 6455  H HG22 . VAL A 1 58 ? 7.689   1.388   6.697   1.00 0.00 ? 67 VAL S HG22 6  
ATOM 6456  H HG23 . VAL A 1 58 ? 8.914   0.274   7.298   1.00 0.00 ? 67 VAL S HG23 6  
ATOM 6457  N N    . ASN A 1 59 ? 11.500  1.421   3.117   1.00 0.00 ? 68 ASN S N    6  
ATOM 6458  C CA   . ASN A 1 59 ? 12.549  2.092   2.350   1.00 0.00 ? 68 ASN S CA   6  
ATOM 6459  C C    . ASN A 1 59 ? 12.004  2.666   1.043   1.00 0.00 ? 68 ASN S C    6  
ATOM 6460  O O    . ASN A 1 59 ? 12.193  3.844   0.743   1.00 0.00 ? 68 ASN S O    6  
ATOM 6461  C CB   . ASN A 1 59 ? 13.677  1.112   2.031   1.00 0.00 ? 68 ASN S CB   6  
ATOM 6462  C CG   . ASN A 1 59 ? 14.962  1.817   1.645   1.00 0.00 ? 68 ASN S CG   6  
ATOM 6463  O OD1  . ASN A 1 59 ? 15.217  2.943   2.071   1.00 0.00 ? 68 ASN S OD1  6  
ATOM 6464  N ND2  . ASN A 1 59 ? 15.780  1.158   0.832   1.00 0.00 ? 68 ASN S ND2  6  
ATOM 6465  H H    . ASN A 1 59 ? 11.699  0.539   3.542   1.00 0.00 ? 68 ASN S H    6  
ATOM 6466  H HA   . ASN A 1 59 ? 12.943  2.898   2.951   1.00 0.00 ? 68 ASN S HA   6  
ATOM 6467  H HB2  . ASN A 1 59 ? 13.868  0.494   2.895   1.00 0.00 ? 68 ASN S HB2  6  
ATOM 6468  H HB3  . ASN A 1 59 ? 13.373  0.482   1.207   1.00 0.00 ? 68 ASN S HB3  6  
ATOM 6469  H HD21 . ASN A 1 59 ? 15.511  0.265   0.531   1.00 0.00 ? 68 ASN S HD21 6  
ATOM 6470  H HD22 . ASN A 1 59 ? 16.617  1.591   0.567   1.00 0.00 ? 68 ASN S HD22 6  
ATOM 6471  N N    . LEU A 1 60 ? 11.336  1.817   0.269   1.00 0.00 ? 69 LEU S N    6  
ATOM 6472  C CA   . LEU A 1 60 ? 10.772  2.228   -1.010  1.00 0.00 ? 69 LEU S CA   6  
ATOM 6473  C C    . LEU A 1 60 ? 9.633   3.224   -0.822  1.00 0.00 ? 69 LEU S C    6  
ATOM 6474  O O    . LEU A 1 60 ? 9.462   4.138   -1.627  1.00 0.00 ? 69 LEU S O    6  
ATOM 6475  C CB   . LEU A 1 60 ? 10.271  1.009   -1.785  1.00 0.00 ? 69 LEU S CB   6  
ATOM 6476  C CG   . LEU A 1 60 ? 11.340  0.279   -2.602  1.00 0.00 ? 69 LEU S CG   6  
ATOM 6477  C CD1  . LEU A 1 60 ? 11.835  1.157   -3.740  1.00 0.00 ? 69 LEU S CD1  6  
ATOM 6478  C CD2  . LEU A 1 60 ? 12.496  -0.142  -1.708  1.00 0.00 ? 69 LEU S CD2  6  
ATOM 6479  H H    . LEU A 1 60 ? 11.227  0.888   0.562   1.00 0.00 ? 69 LEU S H    6  
ATOM 6480  H HA   . LEU A 1 60 ? 11.557  2.703   -1.579  1.00 0.00 ? 69 LEU S HA   6  
ATOM 6481  H HB2  . LEU A 1 60 ? 9.847   0.311   -1.078  1.00 0.00 ? 69 LEU S HB2  6  
ATOM 6482  H HB3  . LEU A 1 60 ? 9.494   1.335   -2.463  1.00 0.00 ? 69 LEU S HB3  6  
ATOM 6483  H HG   . LEU A 1 60 ? 10.908  -0.612  -3.033  1.00 0.00 ? 69 LEU S HG   6  
ATOM 6484  H HD11 . LEU A 1 60 ? 12.013  0.548   -4.613  1.00 0.00 ? 69 LEU S HD11 6  
ATOM 6485  H HD12 . LEU A 1 60 ? 12.751  1.644   -3.446  1.00 0.00 ? 69 LEU S HD12 6  
ATOM 6486  H HD13 . LEU A 1 60 ? 11.088  1.904   -3.969  1.00 0.00 ? 69 LEU S HD13 6  
ATOM 6487  H HD21 . LEU A 1 60 ? 13.152  0.702   -1.547  1.00 0.00 ? 69 LEU S HD21 6  
ATOM 6488  H HD22 . LEU A 1 60 ? 13.046  -0.940  -2.183  1.00 0.00 ? 69 LEU S HD22 6  
ATOM 6489  H HD23 . LEU A 1 60 ? 12.111  -0.484  -0.759  1.00 0.00 ? 69 LEU S HD23 6  
ATOM 6490  N N    . LYS A 1 61 ? 8.851   3.046   0.241   1.00 0.00 ? 70 LYS S N    6  
ATOM 6491  C CA   . LYS A 1 61 ? 7.731   3.941   0.515   1.00 0.00 ? 70 LYS S CA   6  
ATOM 6492  C C    . LYS A 1 61 ? 8.196   5.392   0.542   1.00 0.00 ? 70 LYS S C    6  
ATOM 6493  O O    . LYS A 1 61 ? 7.750   6.214   -0.257  1.00 0.00 ? 70 LYS S O    6  
ATOM 6494  C CB   . LYS A 1 61 ? 7.069   3.589   1.851   1.00 0.00 ? 70 LYS S CB   6  
ATOM 6495  C CG   . LYS A 1 61 ? 6.436   2.211   1.881   1.00 0.00 ? 70 LYS S CG   6  
ATOM 6496  C CD   . LYS A 1 61 ? 4.962   2.268   1.513   1.00 0.00 ? 70 LYS S CD   6  
ATOM 6497  C CE   . LYS A 1 61 ? 4.095   2.543   2.729   1.00 0.00 ? 70 LYS S CE   6  
ATOM 6498  N NZ   . LYS A 1 61 ? 4.017   1.362   3.633   1.00 0.00 ? 70 LYS S NZ   6  
ATOM 6499  H H    . LYS A 1 61 ? 9.032   2.299   0.849   1.00 0.00 ? 70 LYS S H    6  
ATOM 6500  H HA   . LYS A 1 61 ? 7.008   3.821   -0.278  1.00 0.00 ? 70 LYS S HA   6  
ATOM 6501  H HB2  . LYS A 1 61 ? 7.817   3.632   2.631   1.00 0.00 ? 70 LYS S HB2  6  
ATOM 6502  H HB3  . LYS A 1 61 ? 6.298   4.321   2.057   1.00 0.00 ? 70 LYS S HB3  6  
ATOM 6503  H HG2  . LYS A 1 61 ? 6.948   1.575   1.177   1.00 0.00 ? 70 LYS S HG2  6  
ATOM 6504  H HG3  . LYS A 1 61 ? 6.532   1.803   2.876   1.00 0.00 ? 70 LYS S HG3  6  
ATOM 6505  H HD2  . LYS A 1 61 ? 4.810   3.055   0.790   1.00 0.00 ? 70 LYS S HD2  6  
ATOM 6506  H HD3  . LYS A 1 61 ? 4.674   1.322   1.085   1.00 0.00 ? 70 LYS S HD3  6  
ATOM 6507  H HE2  . LYS A 1 61 ? 4.513   3.374   3.272   1.00 0.00 ? 70 LYS S HE2  6  
ATOM 6508  H HE3  . LYS A 1 61 ? 3.099   2.798   2.395   1.00 0.00 ? 70 LYS S HE3  6  
ATOM 6509  H HZ1  . LYS A 1 61 ? 3.416   1.580   4.455   1.00 0.00 ? 70 LYS S HZ1  6  
ATOM 6510  H HZ2  . LYS A 1 61 ? 4.966   1.108   3.970   1.00 0.00 ? 70 LYS S HZ2  6  
ATOM 6511  H HZ3  . LYS A 1 61 ? 3.611   0.550   3.128   1.00 0.00 ? 70 LYS S HZ3  6  
ATOM 6512  N N    . LYS A 1 62 ? 9.101   5.695   1.466   1.00 0.00 ? 71 LYS S N    6  
ATOM 6513  C CA   . LYS A 1 62 ? 9.633   7.045   1.599   1.00 0.00 ? 71 LYS S CA   6  
ATOM 6514  C C    . LYS A 1 62 ? 10.430  7.442   0.361   1.00 0.00 ? 71 LYS S C    6  
ATOM 6515  O O    . LYS A 1 62 ? 10.510  8.620   0.014   1.00 0.00 ? 71 LYS S O    6  
ATOM 6516  C CB   . LYS A 1 62 ? 10.516  7.144   2.845   1.00 0.00 ? 71 LYS S CB   6  
ATOM 6517  C CG   . LYS A 1 62 ? 9.837   6.643   4.109   1.00 0.00 ? 71 LYS S CG   6  
ATOM 6518  C CD   . LYS A 1 62 ? 10.799  6.624   5.287   1.00 0.00 ? 71 LYS S CD   6  
ATOM 6519  C CE   . LYS A 1 62 ? 10.091  6.963   6.590   1.00 0.00 ? 71 LYS S CE   6  
ATOM 6520  N NZ   . LYS A 1 62 ? 9.804   8.420   6.703   1.00 0.00 ? 71 LYS S NZ   6  
ATOM 6521  H H    . LYS A 1 62 ? 9.420   4.993   2.071   1.00 0.00 ? 71 LYS S H    6  
ATOM 6522  H HA   . LYS A 1 62 ? 8.798   7.722   1.708   1.00 0.00 ? 71 LYS S HA   6  
ATOM 6523  H HB2  . LYS A 1 62 ? 11.410  6.558   2.685   1.00 0.00 ? 71 LYS S HB2  6  
ATOM 6524  H HB3  . LYS A 1 62 ? 10.794  8.177   2.995   1.00 0.00 ? 71 LYS S HB3  6  
ATOM 6525  H HG2  . LYS A 1 62 ? 9.009   7.294   4.344   1.00 0.00 ? 71 LYS S HG2  6  
ATOM 6526  H HG3  . LYS A 1 62 ? 9.472   5.641   3.938   1.00 0.00 ? 71 LYS S HG3  6  
ATOM 6527  H HD2  . LYS A 1 62 ? 11.232  5.640   5.370   1.00 0.00 ? 71 LYS S HD2  6  
ATOM 6528  H HD3  . LYS A 1 62 ? 11.579  7.351   5.113   1.00 0.00 ? 71 LYS S HD3  6  
ATOM 6529  H HE2  . LYS A 1 62 ? 9.158   6.418   6.631   1.00 0.00 ? 71 LYS S HE2  6  
ATOM 6530  H HE3  . LYS A 1 62 ? 10.722  6.662   7.416   1.00 0.00 ? 71 LYS S HE3  6  
ATOM 6531  H HZ1  . LYS A 1 62 ? 8.851   8.625   6.341   1.00 0.00 ? 71 LYS S HZ1  6  
ATOM 6532  H HZ2  . LYS A 1 62 ? 10.498  8.964   6.154   1.00 0.00 ? 71 LYS S HZ2  6  
ATOM 6533  H HZ3  . LYS A 1 62 ? 9.856   8.718   7.698   1.00 0.00 ? 71 LYS S HZ3  6  
ATOM 6534  N N    . ALA A 1 63 ? 11.016  6.452   -0.305  1.00 0.00 ? 72 ALA S N    6  
ATOM 6535  C CA   . ALA A 1 63 ? 11.805  6.700   -1.506  1.00 0.00 ? 72 ALA S CA   6  
ATOM 6536  C C    . ALA A 1 63 ? 10.906  7.037   -2.692  1.00 0.00 ? 72 ALA S C    6  
ATOM 6537  O O    . ALA A 1 63 ? 11.266  7.846   -3.546  1.00 0.00 ? 72 ALA S O    6  
ATOM 6538  C CB   . ALA A 1 63 ? 12.674  5.494   -1.824  1.00 0.00 ? 72 ALA S CB   6  
ATOM 6539  H H    . ALA A 1 63 ? 10.916  5.532   0.019   1.00 0.00 ? 72 ALA S H    6  
ATOM 6540  H HA   . ALA A 1 63 ? 12.454  7.542   -1.310  1.00 0.00 ? 72 ALA S HA   6  
ATOM 6541  H HB1  . ALA A 1 63 ? 12.059  4.608   -1.873  1.00 0.00 ? 72 ALA S HB1  6  
ATOM 6542  H HB2  . ALA A 1 63 ? 13.419  5.372   -1.052  1.00 0.00 ? 72 ALA S HB2  6  
ATOM 6543  H HB3  . ALA A 1 63 ? 13.165  5.644   -2.775  1.00 0.00 ? 72 ALA S HB3  6  
ATOM 6544  N N    . LYS A 1 64 ? 9.733   6.414   -2.735  1.00 0.00 ? 73 LYS S N    6  
ATOM 6545  C CA   . LYS A 1 64 ? 8.778   6.652   -3.811  1.00 0.00 ? 73 LYS S CA   6  
ATOM 6546  C C    . LYS A 1 64 ? 7.831   7.789   -3.448  1.00 0.00 ? 73 LYS S C    6  
ATOM 6547  O O    . LYS A 1 64 ? 7.281   8.458   -4.323  1.00 0.00 ? 73 LYS S O    6  
ATOM 6548  C CB   . LYS A 1 64 ? 7.979   5.381   -4.108  1.00 0.00 ? 73 LYS S CB   6  
ATOM 6549  C CG   . LYS A 1 64 ? 8.487   4.612   -5.314  1.00 0.00 ? 73 LYS S CG   6  
ATOM 6550  C CD   . LYS A 1 64 ? 9.948   4.217   -5.153  1.00 0.00 ? 73 LYS S CD   6  
ATOM 6551  C CE   . LYS A 1 64 ? 10.804  4.769   -6.282  1.00 0.00 ? 73 LYS S CE   6  
ATOM 6552  N NZ   . LYS A 1 64 ? 10.390  4.230   -7.608  1.00 0.00 ? 73 LYS S NZ   6  
ATOM 6553  H H    . LYS A 1 64 ? 9.500   5.782   -2.021  1.00 0.00 ? 73 LYS S H    6  
ATOM 6554  H HA   . LYS A 1 64 ? 9.337   6.931   -4.694  1.00 0.00 ? 73 LYS S HA   6  
ATOM 6555  H HB2  . LYS A 1 64 ? 8.027   4.730   -3.245  1.00 0.00 ? 73 LYS S HB2  6  
ATOM 6556  H HB3  . LYS A 1 64 ? 6.948   5.652   -4.289  1.00 0.00 ? 73 LYS S HB3  6  
ATOM 6557  H HG2  . LYS A 1 64 ? 7.895   3.716   -5.432  1.00 0.00 ? 73 LYS S HG2  6  
ATOM 6558  H HG3  . LYS A 1 64 ? 8.384   5.231   -6.194  1.00 0.00 ? 73 LYS S HG3  6  
ATOM 6559  H HD2  . LYS A 1 64 ? 10.315  4.607   -4.215  1.00 0.00 ? 73 LYS S HD2  6  
ATOM 6560  H HD3  . LYS A 1 64 ? 10.022  3.140   -5.151  1.00 0.00 ? 73 LYS S HD3  6  
ATOM 6561  H HE2  . LYS A 1 64 ? 10.710  5.846   -6.296  1.00 0.00 ? 73 LYS S HE2  6  
ATOM 6562  H HE3  . LYS A 1 64 ? 11.834  4.502   -6.100  1.00 0.00 ? 73 LYS S HE3  6  
ATOM 6563  H HZ1  . LYS A 1 64 ? 9.374   4.006   -7.600  1.00 0.00 ? 73 LYS S HZ1  6  
ATOM 6564  H HZ2  . LYS A 1 64 ? 10.923  3.364   -7.822  1.00 0.00 ? 73 LYS S HZ2  6  
ATOM 6565  H HZ3  . LYS A 1 64 ? 10.574  4.932   -8.352  1.00 0.00 ? 73 LYS S HZ3  6  
ATOM 6566  N N    . GLY A 1 65 ? 7.648   8.005   -2.149  1.00 0.00 ? 74 GLY S N    6  
ATOM 6567  C CA   . GLY A 1 65 ? 6.772   9.062   -1.690  1.00 0.00 ? 74 GLY S CA   6  
ATOM 6568  C C    . GLY A 1 65 ? 5.444   8.551   -1.166  1.00 0.00 ? 74 GLY S C    6  
ATOM 6569  O O    . GLY A 1 65 ? 4.563   9.343   -0.832  1.00 0.00 ? 74 GLY S O    6  
ATOM 6570  H H    . GLY A 1 65 ? 8.115   7.443   -1.497  1.00 0.00 ? 74 GLY S H    6  
ATOM 6571  H HA2  . GLY A 1 65 ? 7.269   9.601   -0.895  1.00 0.00 ? 74 GLY S HA2  6  
ATOM 6572  H HA3  . GLY A 1 65 ? 6.584   9.742   -2.511  1.00 0.00 ? 74 GLY S HA3  6  
ATOM 6573  N N    . LEU A 1 66 ? 5.291   7.230   -1.085  1.00 0.00 ? 75 LEU S N    6  
ATOM 6574  C CA   . LEU A 1 66 ? 4.051   6.650   -0.585  1.00 0.00 ? 75 LEU S CA   6  
ATOM 6575  C C    . LEU A 1 66 ? 3.767   7.146   0.826   1.00 0.00 ? 75 LEU S C    6  
ATOM 6576  O O    . LEU A 1 66 ? 3.055   8.133   1.007   1.00 0.00 ? 75 LEU S O    6  
ATOM 6577  C CB   . LEU A 1 66 ? 4.109   5.115   -0.601  1.00 0.00 ? 75 LEU S CB   6  
ATOM 6578  C CG   . LEU A 1 66 ? 4.050   4.452   -1.986  1.00 0.00 ? 75 LEU S CG   6  
ATOM 6579  C CD1  . LEU A 1 66 ? 3.304   3.130   -1.898  1.00 0.00 ? 75 LEU S CD1  6  
ATOM 6580  C CD2  . LEU A 1 66 ? 3.386   5.361   -3.011  1.00 0.00 ? 75 LEU S CD2  6  
ATOM 6581  H H    . LEU A 1 66 ? 6.023   6.640   -1.358  1.00 0.00 ? 75 LEU S H    6  
ATOM 6582  H HA   . LEU A 1 66 ? 3.250   6.979   -1.231  1.00 0.00 ? 75 LEU S HA   6  
ATOM 6583  H HB2  . LEU A 1 66 ? 5.027   4.805   -0.115  1.00 0.00 ? 75 LEU S HB2  6  
ATOM 6584  H HB3  . LEU A 1 66 ? 3.275   4.747   -0.019  1.00 0.00 ? 75 LEU S HB3  6  
ATOM 6585  H HG   . LEU A 1 66 ? 5.056   4.244   -2.321  1.00 0.00 ? 75 LEU S HG   6  
ATOM 6586  H HD11 . LEU A 1 66 ? 3.604   2.490   -2.715  1.00 0.00 ? 75 LEU S HD11 6  
ATOM 6587  H HD12 . LEU A 1 66 ? 2.241   3.315   -1.958  1.00 0.00 ? 75 LEU S HD12 6  
ATOM 6588  H HD13 . LEU A 1 66 ? 3.533   2.651   -0.960  1.00 0.00 ? 75 LEU S HD13 6  
ATOM 6589  H HD21 . LEU A 1 66 ? 3.876   6.323   -3.015  1.00 0.00 ? 75 LEU S HD21 6  
ATOM 6590  H HD22 . LEU A 1 66 ? 2.343   5.488   -2.754  1.00 0.00 ? 75 LEU S HD22 6  
ATOM 6591  H HD23 . LEU A 1 66 ? 3.463   4.915   -3.991  1.00 0.00 ? 75 LEU S HD23 6  
ATOM 6592  N N    . PHE A 1 67 ? 4.327   6.451   1.822   1.00 0.00 ? 76 PHE S N    6  
ATOM 6593  C CA   . PHE A 1 67 ? 4.137   6.814   3.235   1.00 0.00 ? 76 PHE S CA   6  
ATOM 6594  C C    . PHE A 1 67 ? 3.802   8.295   3.412   1.00 0.00 ? 76 PHE S C    6  
ATOM 6595  O O    . PHE A 1 67 ? 2.844   8.599   4.153   1.00 0.00 ? 76 PHE S O    6  
ATOM 6596  C CB   . PHE A 1 67 ? 5.387   6.481   4.046   1.00 0.00 ? 76 PHE S CB   6  
ATOM 6597  C CG   . PHE A 1 67 ? 5.323   5.138   4.705   1.00 0.00 ? 76 PHE S CG   6  
ATOM 6598  C CD1  . PHE A 1 67 ? 4.183   4.731   5.383   1.00 0.00 ? 76 PHE S CD1  6  
ATOM 6599  C CD2  . PHE A 1 67 ? 6.398   4.275   4.635   1.00 0.00 ? 76 PHE S CD2  6  
ATOM 6600  C CE1  . PHE A 1 67 ? 4.122   3.485   5.978   1.00 0.00 ? 76 PHE S CE1  6  
ATOM 6601  C CE2  . PHE A 1 67 ? 6.346   3.032   5.225   1.00 0.00 ? 76 PHE S CE2  6  
ATOM 6602  C CZ   . PHE A 1 67 ? 5.207   2.633   5.897   1.00 0.00 ? 76 PHE S CZ   6  
ATOM 6603  O OXT  . PHE A 1 67 ? 4.504   9.135   2.811   1.00 0.00 ? 76 PHE S OXT  6  
ATOM 6604  H H    . PHE A 1 67 ? 4.881   5.663   1.598   1.00 0.00 ? 76 PHE S H    6  
ATOM 6605  H HA   . PHE A 1 67 ? 3.317   6.226   3.611   1.00 0.00 ? 76 PHE S HA   6  
ATOM 6606  H HB2  . PHE A 1 67 ? 6.247   6.491   3.394   1.00 0.00 ? 76 PHE S HB2  6  
ATOM 6607  H HB3  . PHE A 1 67 ? 5.517   7.225   4.820   1.00 0.00 ? 76 PHE S HB3  6  
ATOM 6608  H HD1  . PHE A 1 67 ? 3.335   5.398   5.442   1.00 0.00 ? 76 PHE S HD1  6  
ATOM 6609  H HD2  . PHE A 1 67 ? 7.290   4.586   4.115   1.00 0.00 ? 76 PHE S HD2  6  
ATOM 6610  H HE1  . PHE A 1 67 ? 3.229   3.178   6.503   1.00 0.00 ? 76 PHE S HE1  6  
ATOM 6611  H HE2  . PHE A 1 67 ? 7.193   2.371   5.154   1.00 0.00 ? 76 PHE S HE2  6  
ATOM 6612  H HZ   . PHE A 1 67 ? 5.165   1.658   6.361   1.00 0.00 ? 76 PHE S HZ   6  
ATOM 6613  N N    . MET A 1 1  ? -20.977 -8.790  2.423   1.00 0.00 ? 10 MET S N    7  
ATOM 6614  C CA   . MET A 1 1  ? -19.574 -8.889  2.902   1.00 0.00 ? 10 MET S CA   7  
ATOM 6615  C C    . MET A 1 1  ? -19.358 -10.156 3.725   1.00 0.00 ? 10 MET S C    7  
ATOM 6616  O O    . MET A 1 1  ? -18.245 -10.678 3.796   1.00 0.00 ? 10 MET S O    7  
ATOM 6617  C CB   . MET A 1 1  ? -19.255 -7.652  3.745   1.00 0.00 ? 10 MET S CB   7  
ATOM 6618  C CG   . MET A 1 1  ? -20.116 -7.525  4.993   1.00 0.00 ? 10 MET S CG   7  
ATOM 6619  S SD   . MET A 1 1  ? -19.170 -7.010  6.440   1.00 0.00 ? 10 MET S SD   7  
ATOM 6620  C CE   . MET A 1 1  ? -18.887 -5.282  6.063   1.00 0.00 ? 10 MET S CE   7  
ATOM 6621  H H1   . MET A 1 1  ? -21.264 -9.730  2.083   1.00 0.00 ? 10 MET S H1   7  
ATOM 6622  H H2   . MET A 1 1  ? -20.999 -8.090  1.654   1.00 0.00 ? 10 MET S H2   7  
ATOM 6623  H H3   . MET A 1 1  ? -21.567 -8.488  3.225   1.00 0.00 ? 10 MET S H3   7  
ATOM 6624  H HA   . MET A 1 1  ? -18.920 -8.911  2.045   1.00 0.00 ? 10 MET S HA   7  
ATOM 6625  H HB2  . MET A 1 1  ? -18.220 -7.696  4.049   1.00 0.00 ? 10 MET S HB2  7  
ATOM 6626  H HB3  . MET A 1 1  ? -19.407 -6.770  3.140   1.00 0.00 ? 10 MET S HB3  7  
ATOM 6627  H HG2  . MET A 1 1  ? -20.888 -6.793  4.808   1.00 0.00 ? 10 MET S HG2  7  
ATOM 6628  H HG3  . MET A 1 1  ? -20.570 -8.482  5.200   1.00 0.00 ? 10 MET S HG3  7  
ATOM 6629  H HE1  . MET A 1 1  ? -18.392 -5.199  5.105   1.00 0.00 ? 10 MET S HE1  7  
ATOM 6630  H HE2  . MET A 1 1  ? -18.264 -4.844  6.829   1.00 0.00 ? 10 MET S HE2  7  
ATOM 6631  H HE3  . MET A 1 1  ? -19.832 -4.762  6.025   1.00 0.00 ? 10 MET S HE3  7  
ATOM 6632  N N    . LEU A 1 2  ? -20.427 -10.648 4.343   1.00 0.00 ? 11 LEU S N    7  
ATOM 6633  C CA   . LEU A 1 2  ? -20.350 -11.854 5.159   1.00 0.00 ? 11 LEU S CA   7  
ATOM 6634  C C    . LEU A 1 2  ? -20.260 -13.099 4.282   1.00 0.00 ? 11 LEU S C    7  
ATOM 6635  O O    . LEU A 1 2  ? -19.643 -14.094 4.661   1.00 0.00 ? 11 LEU S O    7  
ATOM 6636  C CB   . LEU A 1 2  ? -21.569 -11.952 6.079   1.00 0.00 ? 11 LEU S CB   7  
ATOM 6637  C CG   . LEU A 1 2  ? -21.409 -11.268 7.439   1.00 0.00 ? 11 LEU S CG   7  
ATOM 6638  C CD1  . LEU A 1 2  ? -20.321 -11.950 8.255   1.00 0.00 ? 11 LEU S CD1  7  
ATOM 6639  C CD2  . LEU A 1 2  ? -21.096 -9.790  7.259   1.00 0.00 ? 11 LEU S CD2  7  
ATOM 6640  H H    . LEU A 1 2  ? -21.288 -10.189 4.249   1.00 0.00 ? 11 LEU S H    7  
ATOM 6641  H HA   . LEU A 1 2  ? -19.457 -11.789 5.763   1.00 0.00 ? 11 LEU S HA   7  
ATOM 6642  H HB2  . LEU A 1 2  ? -22.413 -11.506 5.573   1.00 0.00 ? 11 LEU S HB2  7  
ATOM 6643  H HB3  . LEU A 1 2  ? -21.782 -12.996 6.250   1.00 0.00 ? 11 LEU S HB3  7  
ATOM 6644  H HG   . LEU A 1 2  ? -22.337 -11.350 7.986   1.00 0.00 ? 11 LEU S HG   7  
ATOM 6645  H HD11 . LEU A 1 2  ? -20.543 -13.003 8.339   1.00 0.00 ? 11 LEU S HD11 7  
ATOM 6646  H HD12 . LEU A 1 2  ? -20.282 -11.510 9.240   1.00 0.00 ? 11 LEU S HD12 7  
ATOM 6647  H HD13 . LEU A 1 2  ? -19.369 -11.820 7.763   1.00 0.00 ? 11 LEU S HD13 7  
ATOM 6648  H HD21 . LEU A 1 2  ? -21.194 -9.283  8.206   1.00 0.00 ? 11 LEU S HD21 7  
ATOM 6649  H HD22 . LEU A 1 2  ? -21.785 -9.360  6.547   1.00 0.00 ? 11 LEU S HD22 7  
ATOM 6650  H HD23 . LEU A 1 2  ? -20.085 -9.679  6.894   1.00 0.00 ? 11 LEU S HD23 7  
ATOM 6651  N N    . ALA A 1 3  ? -20.882 -13.035 3.108   1.00 0.00 ? 12 ALA S N    7  
ATOM 6652  C CA   . ALA A 1 3  ? -20.874 -14.157 2.178   1.00 0.00 ? 12 ALA S CA   7  
ATOM 6653  C C    . ALA A 1 3  ? -19.635 -14.124 1.288   1.00 0.00 ? 12 ALA S C    7  
ATOM 6654  O O    . ALA A 1 3  ? -19.010 -15.155 1.039   1.00 0.00 ? 12 ALA S O    7  
ATOM 6655  C CB   . ALA A 1 3  ? -22.135 -14.145 1.327   1.00 0.00 ? 12 ALA S CB   7  
ATOM 6656  H H    . ALA A 1 3  ? -21.358 -12.215 2.864   1.00 0.00 ? 12 ALA S H    7  
ATOM 6657  H HA   . ALA A 1 3  ? -20.866 -15.069 2.755   1.00 0.00 ? 12 ALA S HA   7  
ATOM 6658  H HB1  . ALA A 1 3  ? -22.938 -14.623 1.869   1.00 0.00 ? 12 ALA S HB1  7  
ATOM 6659  H HB2  . ALA A 1 3  ? -21.953 -14.679 0.407   1.00 0.00 ? 12 ALA S HB2  7  
ATOM 6660  H HB3  . ALA A 1 3  ? -22.408 -13.125 1.104   1.00 0.00 ? 12 ALA S HB3  7  
ATOM 6661  N N    . LYS A 1 4  ? -19.286 -12.934 0.813   1.00 0.00 ? 13 LYS S N    7  
ATOM 6662  C CA   . LYS A 1 4  ? -18.122 -12.767 -0.051  1.00 0.00 ? 13 LYS S CA   7  
ATOM 6663  C C    . LYS A 1 4  ? -17.170 -11.718 0.514   1.00 0.00 ? 13 LYS S C    7  
ATOM 6664  O O    . LYS A 1 4  ? -17.587 -10.806 1.227   1.00 0.00 ? 13 LYS S O    7  
ATOM 6665  C CB   . LYS A 1 4  ? -18.561 -12.369 -1.461  1.00 0.00 ? 13 LYS S CB   7  
ATOM 6666  C CG   . LYS A 1 4  ? -19.394 -13.431 -2.161  1.00 0.00 ? 13 LYS S CG   7  
ATOM 6667  C CD   . LYS A 1 4  ? -20.583 -12.823 -2.891  1.00 0.00 ? 13 LYS S CD   7  
ATOM 6668  C CE   . LYS A 1 4  ? -20.451 -12.976 -4.398  1.00 0.00 ? 13 LYS S CE   7  
ATOM 6669  N NZ   . LYS A 1 4  ? -21.677 -12.525 -5.111  1.00 0.00 ? 13 LYS S NZ   7  
ATOM 6670  H H    . LYS A 1 4  ? -19.824 -12.149 1.045   1.00 0.00 ? 13 LYS S H    7  
ATOM 6671  H HA   . LYS A 1 4  ? -17.606 -13.714 -0.099  1.00 0.00 ? 13 LYS S HA   7  
ATOM 6672  H HB2  . LYS A 1 4  ? -19.146 -11.463 -1.401  1.00 0.00 ? 13 LYS S HB2  7  
ATOM 6673  H HB3  . LYS A 1 4  ? -17.681 -12.180 -2.058  1.00 0.00 ? 13 LYS S HB3  7  
ATOM 6674  H HG2  . LYS A 1 4  ? -18.772 -13.949 -2.875  1.00 0.00 ? 13 LYS S HG2  7  
ATOM 6675  H HG3  . LYS A 1 4  ? -19.757 -14.133 -1.423  1.00 0.00 ? 13 LYS S HG3  7  
ATOM 6676  H HD2  . LYS A 1 4  ? -21.484 -13.322 -2.567  1.00 0.00 ? 13 LYS S HD2  7  
ATOM 6677  H HD3  . LYS A 1 4  ? -20.645 -11.773 -2.649  1.00 0.00 ? 13 LYS S HD3  7  
ATOM 6678  H HE2  . LYS A 1 4  ? -19.612 -12.386 -4.735  1.00 0.00 ? 13 LYS S HE2  7  
ATOM 6679  H HE3  . LYS A 1 4  ? -20.272 -14.016 -4.627  1.00 0.00 ? 13 LYS S HE3  7  
ATOM 6680  H HZ1  . LYS A 1 4  ? -21.904 -11.545 -4.849  1.00 0.00 ? 13 LYS S HZ1  7  
ATOM 6681  H HZ2  . LYS A 1 4  ? -22.481 -13.136 -4.861  1.00 0.00 ? 13 LYS S HZ2  7  
ATOM 6682  H HZ3  . LYS A 1 4  ? -21.530 -12.571 -6.140  1.00 0.00 ? 13 LYS S HZ3  7  
ATOM 6683  N N    . LEU A 1 5  ? -15.888 -11.854 0.190   1.00 0.00 ? 14 LEU S N    7  
ATOM 6684  C CA   . LEU A 1 5  ? -14.876 -10.917 0.663   1.00 0.00 ? 14 LEU S CA   7  
ATOM 6685  C C    . LEU A 1 5  ? -13.972 -10.466 -0.479  1.00 0.00 ? 14 LEU S C    7  
ATOM 6686  O O    . LEU A 1 5  ? -13.284 -11.278 -1.097  1.00 0.00 ? 14 LEU S O    7  
ATOM 6687  C CB   . LEU A 1 5  ? -14.036 -11.559 1.769   1.00 0.00 ? 14 LEU S CB   7  
ATOM 6688  C CG   . LEU A 1 5  ? -14.841 -12.234 2.885   1.00 0.00 ? 14 LEU S CG   7  
ATOM 6689  C CD1  . LEU A 1 5  ? -14.281 -13.614 3.192   1.00 0.00 ? 14 LEU S CD1  7  
ATOM 6690  C CD2  . LEU A 1 5  ? -14.845 -11.369 4.138   1.00 0.00 ? 14 LEU S CD2  7  
ATOM 6691  H H    . LEU A 1 5  ? -15.616 -12.601 -0.383  1.00 0.00 ? 14 LEU S H    7  
ATOM 6692  H HA   . LEU A 1 5  ? -15.385 -10.055 1.066   1.00 0.00 ? 14 LEU S HA   7  
ATOM 6693  H HB2  . LEU A 1 5  ? -13.394 -12.301 1.317   1.00 0.00 ? 14 LEU S HB2  7  
ATOM 6694  H HB3  . LEU A 1 5  ? -13.418 -10.794 2.213   1.00 0.00 ? 14 LEU S HB3  7  
ATOM 6695  H HG   . LEU A 1 5  ? -15.864 -12.354 2.559   1.00 0.00 ? 14 LEU S HG   7  
ATOM 6696  H HD11 . LEU A 1 5  ? -14.690 -14.331 2.493   1.00 0.00 ? 14 LEU S HD11 7  
ATOM 6697  H HD12 . LEU A 1 5  ? -14.550 -13.897 4.197   1.00 0.00 ? 14 LEU S HD12 7  
ATOM 6698  H HD13 . LEU A 1 5  ? -13.206 -13.596 3.098   1.00 0.00 ? 14 LEU S HD13 7  
ATOM 6699  H HD21 . LEU A 1 5  ? -14.631 -10.345 3.869   1.00 0.00 ? 14 LEU S HD21 7  
ATOM 6700  H HD22 . LEU A 1 5  ? -14.091 -11.727 4.824   1.00 0.00 ? 14 LEU S HD22 7  
ATOM 6701  H HD23 . LEU A 1 5  ? -15.815 -11.423 4.608   1.00 0.00 ? 14 LEU S HD23 7  
ATOM 6702  N N    . CYS A 1 6  ? -13.981 -9.165  -0.755  1.00 0.00 ? 15 CYS S N    7  
ATOM 6703  C CA   . CYS A 1 6  ? -13.163 -8.606  -1.824  1.00 0.00 ? 15 CYS S CA   7  
ATOM 6704  C C    . CYS A 1 6  ? -12.422 -7.361  -1.348  1.00 0.00 ? 15 CYS S C    7  
ATOM 6705  O O    . CYS A 1 6  ? -13.021 -6.457  -0.766  1.00 0.00 ? 15 CYS S O    7  
ATOM 6706  C CB   . CYS A 1 6  ? -14.032 -8.265  -3.037  1.00 0.00 ? 15 CYS S CB   7  
ATOM 6707  S SG   . CYS A 1 6  ? -14.733 -9.707  -3.872  1.00 0.00 ? 15 CYS S SG   7  
ATOM 6708  H H    . CYS A 1 6  ? -14.551 -8.568  -0.227  1.00 0.00 ? 15 CYS S H    7  
ATOM 6709  H HA   . CYS A 1 6  ? -12.437 -9.353  -2.113  1.00 0.00 ? 15 CYS S HA   7  
ATOM 6710  H HB2  . CYS A 1 6  ? -14.852 -7.640  -2.717  1.00 0.00 ? 15 CYS S HB2  7  
ATOM 6711  H HB3  . CYS A 1 6  ? -13.434 -7.724  -3.757  1.00 0.00 ? 15 CYS S HB3  7  
ATOM 6712  H HG   . CYS A 1 6  ? -14.741 -10.436 -3.246  1.00 0.00 ? 15 CYS S HG   7  
ATOM 6713  N N    . LYS A 1 7  ? -11.118 -7.321  -1.600  1.00 0.00 ? 16 LYS S N    7  
ATOM 6714  C CA   . LYS A 1 7  ? -10.296 -6.187  -1.198  1.00 0.00 ? 16 LYS S CA   7  
ATOM 6715  C C    . LYS A 1 7  ? -10.486 -5.012  -2.152  1.00 0.00 ? 16 LYS S C    7  
ATOM 6716  O O    . LYS A 1 7  ? -10.719 -5.201  -3.346  1.00 0.00 ? 16 LYS S O    7  
ATOM 6717  C CB   . LYS A 1 7  ? -8.821  -6.589  -1.153  1.00 0.00 ? 16 LYS S CB   7  
ATOM 6718  C CG   . LYS A 1 7  ? -8.555  -7.836  -0.327  1.00 0.00 ? 16 LYS S CG   7  
ATOM 6719  C CD   . LYS A 1 7  ? -7.269  -7.714  0.471   1.00 0.00 ? 16 LYS S CD   7  
ATOM 6720  C CE   . LYS A 1 7  ? -6.639  -9.074  0.728   1.00 0.00 ? 16 LYS S CE   7  
ATOM 6721  N NZ   . LYS A 1 7  ? -5.507  -8.989  1.690   1.00 0.00 ? 16 LYS S NZ   7  
ATOM 6722  H H    . LYS A 1 7  ? -10.699 -8.073  -2.069  1.00 0.00 ? 16 LYS S H    7  
ATOM 6723  H HA   . LYS A 1 7  ? -10.608 -5.885  -0.209  1.00 0.00 ? 16 LYS S HA   7  
ATOM 6724  H HB2  . LYS A 1 7  ? -8.478  -6.770  -2.162  1.00 0.00 ? 16 LYS S HB2  7  
ATOM 6725  H HB3  . LYS A 1 7  ? -8.251  -5.774  -0.730  1.00 0.00 ? 16 LYS S HB3  7  
ATOM 6726  H HG2  . LYS A 1 7  ? -9.377  -7.987  0.356   1.00 0.00 ? 16 LYS S HG2  7  
ATOM 6727  H HG3  . LYS A 1 7  ? -8.478  -8.685  -0.992  1.00 0.00 ? 16 LYS S HG3  7  
ATOM 6728  H HD2  . LYS A 1 7  ? -6.569  -7.105  -0.082  1.00 0.00 ? 16 LYS S HD2  7  
ATOM 6729  H HD3  . LYS A 1 7  ? -7.487  -7.244  1.419   1.00 0.00 ? 16 LYS S HD3  7  
ATOM 6730  H HE2  . LYS A 1 7  ? -7.393  -9.735  1.129   1.00 0.00 ? 16 LYS S HE2  7  
ATOM 6731  H HE3  . LYS A 1 7  ? -6.276  -9.471  -0.210  1.00 0.00 ? 16 LYS S HE3  7  
ATOM 6732  H HZ1  . LYS A 1 7  ? -4.605  -8.925  1.176   1.00 0.00 ? 16 LYS S HZ1  7  
ATOM 6733  H HZ2  . LYS A 1 7  ? -5.489  -9.834  2.297   1.00 0.00 ? 16 LYS S HZ2  7  
ATOM 6734  H HZ3  . LYS A 1 7  ? -5.611  -8.146  2.291   1.00 0.00 ? 16 LYS S HZ3  7  
ATOM 6735  N N    . THR A 1 8  ? -10.385 -3.800  -1.617  1.00 0.00 ? 17 THR S N    7  
ATOM 6736  C CA   . THR A 1 8  ? -10.547 -2.595  -2.422  1.00 0.00 ? 17 THR S CA   7  
ATOM 6737  C C    . THR A 1 8  ? -9.329  -1.685  -2.292  1.00 0.00 ? 17 THR S C    7  
ATOM 6738  O O    . THR A 1 8  ? -9.028  -1.185  -1.208  1.00 0.00 ? 17 THR S O    7  
ATOM 6739  C CB   . THR A 1 8  ? -11.808 -1.840  -2.000  1.00 0.00 ? 17 THR S CB   7  
ATOM 6740  O OG1  . THR A 1 8  ? -11.896 -0.596  -2.671  1.00 0.00 ? 17 THR S OG1  7  
ATOM 6741  C CG2  . THR A 1 8  ? -11.872 -1.565  -0.514  1.00 0.00 ? 17 THR S CG2  7  
ATOM 6742  H H    . THR A 1 8  ? -10.199 -3.714  -0.659  1.00 0.00 ? 17 THR S H    7  
ATOM 6743  H HA   . THR A 1 8  ? -10.647 -2.896  -3.455  1.00 0.00 ? 17 THR S HA   7  
ATOM 6744  H HB   . THR A 1 8  ? -12.675 -2.430  -2.264  1.00 0.00 ? 17 THR S HB   7  
ATOM 6745  H HG1  . THR A 1 8  ? -12.207 -0.737  -3.568  1.00 0.00 ? 17 THR S HG1  7  
ATOM 6746  H HG21 . THR A 1 8  ? -11.959 -0.501  -0.347  1.00 0.00 ? 17 THR S HG21 7  
ATOM 6747  H HG22 . THR A 1 8  ? -10.972 -1.930  -0.041  1.00 0.00 ? 17 THR S HG22 7  
ATOM 6748  H HG23 . THR A 1 8  ? -12.729 -2.068  -0.090  1.00 0.00 ? 17 THR S HG23 7  
ATOM 6749  N N    . ILE A 1 9  ? -8.628  -1.483  -3.402  1.00 0.00 ? 18 ILE S N    7  
ATOM 6750  C CA   . ILE A 1 9  ? -7.442  -0.647  -3.419  1.00 0.00 ? 18 ILE S CA   7  
ATOM 6751  C C    . ILE A 1 9  ? -7.794  0.807   -3.709  1.00 0.00 ? 18 ILE S C    7  
ATOM 6752  O O    . ILE A 1 9  ? -8.561  1.101   -4.628  1.00 0.00 ? 18 ILE S O    7  
ATOM 6753  C CB   . ILE A 1 9  ? -6.447  -1.138  -4.488  1.00 0.00 ? 18 ILE S CB   7  
ATOM 6754  C CG1  . ILE A 1 9  ? -5.947  -2.544  -4.151  1.00 0.00 ? 18 ILE S CG1  7  
ATOM 6755  C CG2  . ILE A 1 9  ? -5.280  -0.169  -4.626  1.00 0.00 ? 18 ILE S CG2  7  
ATOM 6756  C CD1  . ILE A 1 9  ? -7.038  -3.591  -4.113  1.00 0.00 ? 18 ILE S CD1  7  
ATOM 6757  H H    . ILE A 1 9  ? -8.907  -1.919  -4.233  1.00 0.00 ? 18 ILE S H    7  
ATOM 6758  H HA   . ILE A 1 9  ? -6.966  -0.713  -2.451  1.00 0.00 ? 18 ILE S HA   7  
ATOM 6759  H HB   . ILE A 1 9  ? -6.964  -1.169  -5.436  1.00 0.00 ? 18 ILE S HB   7  
ATOM 6760  H HG12 . ILE A 1 9  ? -5.233  -2.848  -4.895  1.00 0.00 ? 18 ILE S HG12 7  
ATOM 6761  H HG13 . ILE A 1 9  ? -5.468  -2.527  -3.182  1.00 0.00 ? 18 ILE S HG13 7  
ATOM 6762  H HG21 . ILE A 1 9  ? -5.569  0.656   -5.260  1.00 0.00 ? 18 ILE S HG21 7  
ATOM 6763  H HG22 . ILE A 1 9  ? -4.435  -0.679  -5.065  1.00 0.00 ? 18 ILE S HG22 7  
ATOM 6764  H HG23 . ILE A 1 9  ? -5.006  0.206   -3.651  1.00 0.00 ? 18 ILE S HG23 7  
ATOM 6765  H HD11 . ILE A 1 9  ? -6.604  -4.570  -4.249  1.00 0.00 ? 18 ILE S HD11 7  
ATOM 6766  H HD12 . ILE A 1 9  ? -7.749  -3.400  -4.904  1.00 0.00 ? 18 ILE S HD12 7  
ATOM 6767  H HD13 . ILE A 1 9  ? -7.544  -3.552  -3.159  1.00 0.00 ? 18 ILE S HD13 7  
ATOM 6768  N N    . TYR A 1 10 ? -7.212  1.715   -2.935  1.00 0.00 ? 19 TYR S N    7  
ATOM 6769  C CA   . TYR A 1 10 ? -7.444  3.138   -3.125  1.00 0.00 ? 19 TYR S CA   7  
ATOM 6770  C C    . TYR A 1 10 ? -6.404  3.682   -4.107  1.00 0.00 ? 19 TYR S C    7  
ATOM 6771  O O    . TYR A 1 10 ? -5.251  3.252   -4.091  1.00 0.00 ? 19 TYR S O    7  
ATOM 6772  C CB   . TYR A 1 10 ? -7.388  3.880   -1.774  1.00 0.00 ? 19 TYR S CB   7  
ATOM 6773  C CG   . TYR A 1 10 ? -8.583  3.599   -0.868  1.00 0.00 ? 19 TYR S CG   7  
ATOM 6774  C CD1  . TYR A 1 10 ? -9.319  2.422   -1.004  1.00 0.00 ? 19 TYR S CD1  7  
ATOM 6775  C CD2  . TYR A 1 10 ? -8.985  4.507   0.117   1.00 0.00 ? 19 TYR S CD2  7  
ATOM 6776  C CE1  . TYR A 1 10 ? -10.409 2.161   -0.196  1.00 0.00 ? 19 TYR S CE1  7  
ATOM 6777  C CE2  . TYR A 1 10 ? -10.074 4.244   0.925   1.00 0.00 ? 19 TYR S CE2  7  
ATOM 6778  C CZ   . TYR A 1 10 ? -10.783 3.074   0.765   1.00 0.00 ? 19 TYR S CZ   7  
ATOM 6779  O OH   . TYR A 1 10 ? -11.868 2.815   1.570   1.00 0.00 ? 19 TYR S OH   7  
ATOM 6780  H H    . TYR A 1 10 ? -6.598  1.420   -2.231  1.00 0.00 ? 19 TYR S H    7  
ATOM 6781  H HA   . TYR A 1 10 ? -8.428  3.259   -3.556  1.00 0.00 ? 19 TYR S HA   7  
ATOM 6782  H HB2  . TYR A 1 10 ? -6.494  3.580   -1.244  1.00 0.00 ? 19 TYR S HB2  7  
ATOM 6783  H HB3  . TYR A 1 10 ? -7.354  4.944   -1.957  1.00 0.00 ? 19 TYR S HB3  7  
ATOM 6784  H HD1  . TYR A 1 10 ? -9.030  1.705   -1.753  1.00 0.00 ? 19 TYR S HD1  7  
ATOM 6785  H HD2  . TYR A 1 10 ? -8.432  5.427   0.256   1.00 0.00 ? 19 TYR S HD2  7  
ATOM 6786  H HE1  . TYR A 1 10 ? -10.965 1.243   -0.319  1.00 0.00 ? 19 TYR S HE1  7  
ATOM 6787  H HE2  . TYR A 1 10 ? -10.371 4.958   1.676   1.00 0.00 ? 19 TYR S HE2  7  
ATOM 6788  H HH   . TYR A 1 10 ? -11.570 2.663   2.470   1.00 0.00 ? 19 TYR S HH   7  
ATOM 6789  N N    . PRO A 1 11 ? -6.794  4.615   -4.993  1.00 0.00 ? 20 PRO S N    7  
ATOM 6790  C CA   . PRO A 1 11 ? -5.884  5.186   -5.995  1.00 0.00 ? 20 PRO S CA   7  
ATOM 6791  C C    . PRO A 1 11 ? -4.609  5.746   -5.381  1.00 0.00 ? 20 PRO S C    7  
ATOM 6792  O O    . PRO A 1 11 ? -4.629  6.791   -4.730  1.00 0.00 ? 20 PRO S O    7  
ATOM 6793  C CB   . PRO A 1 11 ? -6.708  6.305   -6.647  1.00 0.00 ? 20 PRO S CB   7  
ATOM 6794  C CG   . PRO A 1 11 ? -7.859  6.523   -5.727  1.00 0.00 ? 20 PRO S CG   7  
ATOM 6795  C CD   . PRO A 1 11 ? -8.140  5.185   -5.106  1.00 0.00 ? 20 PRO S CD   7  
ATOM 6796  H HA   . PRO A 1 11 ? -5.621  4.452   -6.744  1.00 0.00 ? 20 PRO S HA   7  
ATOM 6797  H HB2  . PRO A 1 11 ? -6.102  7.196   -6.738  1.00 0.00 ? 20 PRO S HB2  7  
ATOM 6798  H HB3  . PRO A 1 11 ? -7.042  5.986   -7.626  1.00 0.00 ? 20 PRO S HB3  7  
ATOM 6799  H HG2  . PRO A 1 11 ? -7.584  7.238   -4.967  1.00 0.00 ? 20 PRO S HG2  7  
ATOM 6800  H HG3  . PRO A 1 11 ? -8.718  6.869   -6.282  1.00 0.00 ? 20 PRO S HG3  7  
ATOM 6801  H HD2  . PRO A 1 11 ? -8.598  5.304   -4.133  1.00 0.00 ? 20 PRO S HD2  7  
ATOM 6802  H HD3  . PRO A 1 11 ? -8.762  4.584   -5.754  1.00 0.00 ? 20 PRO S HD3  7  
ATOM 6803  N N    . LEU A 1 12 ? -3.500  5.037   -5.589  1.00 0.00 ? 21 LEU S N    7  
ATOM 6804  C CA   . LEU A 1 12 ? -2.201  5.444   -5.059  1.00 0.00 ? 21 LEU S CA   7  
ATOM 6805  C C    . LEU A 1 12 ? -1.996  6.958   -5.118  1.00 0.00 ? 21 LEU S C    7  
ATOM 6806  O O    . LEU A 1 12 ? -1.545  7.561   -4.152  1.00 0.00 ? 21 LEU S O    7  
ATOM 6807  C CB   . LEU A 1 12 ? -1.074  4.754   -5.828  1.00 0.00 ? 21 LEU S CB   7  
ATOM 6808  C CG   . LEU A 1 12 ? -1.249  4.727   -7.348  1.00 0.00 ? 21 LEU S CG   7  
ATOM 6809  C CD1  . LEU A 1 12 ? -0.524  5.901   -7.988  1.00 0.00 ? 21 LEU S CD1  7  
ATOM 6810  C CD2  . LEU A 1 12 ? -0.743  3.411   -7.920  1.00 0.00 ? 21 LEU S CD2  7  
ATOM 6811  H H    . LEU A 1 12 ? -3.557  4.207   -6.115  1.00 0.00 ? 21 LEU S H    7  
ATOM 6812  H HA   . LEU A 1 12 ? -2.156  5.130   -4.028  1.00 0.00 ? 21 LEU S HA   7  
ATOM 6813  H HB2  . LEU A 1 12 ? -0.150  5.268   -5.602  1.00 0.00 ? 21 LEU S HB2  7  
ATOM 6814  H HB3  . LEU A 1 12 ? -0.998  3.735   -5.477  1.00 0.00 ? 21 LEU S HB3  7  
ATOM 6815  H HG   . LEU A 1 12 ? -2.299  4.814   -7.585  1.00 0.00 ? 21 LEU S HG   7  
ATOM 6816  H HD11 . LEU A 1 12 ? -1.104  6.271   -8.820  1.00 0.00 ? 21 LEU S HD11 7  
ATOM 6817  H HD12 . LEU A 1 12 ? 0.445   5.576   -8.340  1.00 0.00 ? 21 LEU S HD12 7  
ATOM 6818  H HD13 . LEU A 1 12 ? -0.397  6.687   -7.259  1.00 0.00 ? 21 LEU S HD13 7  
ATOM 6819  H HD21 . LEU A 1 12 ? -1.537  2.679   -7.896  1.00 0.00 ? 21 LEU S HD21 7  
ATOM 6820  H HD22 . LEU A 1 12 ? 0.090   3.057   -7.330  1.00 0.00 ? 21 LEU S HD22 7  
ATOM 6821  H HD23 . LEU A 1 12 ? -0.422  3.561   -8.941  1.00 0.00 ? 21 LEU S HD23 7  
ATOM 6822  N N    . ALA A 1 13 ? -2.327  7.567   -6.253  1.00 0.00 ? 22 ALA S N    7  
ATOM 6823  C CA   . ALA A 1 13 ? -2.161  9.010   -6.419  1.00 0.00 ? 22 ALA S CA   7  
ATOM 6824  C C    . ALA A 1 13 ? -2.943  9.776   -5.359  1.00 0.00 ? 22 ALA S C    7  
ATOM 6825  O O    . ALA A 1 13 ? -2.369  10.468  -4.519  1.00 0.00 ? 22 ALA S O    7  
ATOM 6826  C CB   . ALA A 1 13 ? -2.601  9.435   -7.811  1.00 0.00 ? 22 ALA S CB   7  
ATOM 6827  H H    . ALA A 1 13 ? -2.688  7.036   -6.994  1.00 0.00 ? 22 ALA S H    7  
ATOM 6828  H HA   . ALA A 1 13 ? -1.110  9.240   -6.312  1.00 0.00 ? 22 ALA S HA   7  
ATOM 6829  H HB1  . ALA A 1 13 ? -3.610  9.817   -7.769  1.00 0.00 ? 22 ALA S HB1  7  
ATOM 6830  H HB2  . ALA A 1 13 ? -2.565  8.584   -8.476  1.00 0.00 ? 22 ALA S HB2  7  
ATOM 6831  H HB3  . ALA A 1 13 ? -1.939  10.205  -8.178  1.00 0.00 ? 22 ALA S HB3  7  
ATOM 6832  N N    . ASP A 1 14 ? -4.260  9.634   -5.412  1.00 0.00 ? 23 ASP S N    7  
ATOM 6833  C CA   . ASP A 1 14 ? -5.165  10.287  -4.478  1.00 0.00 ? 23 ASP S CA   7  
ATOM 6834  C C    . ASP A 1 14 ? -4.690  10.193  -3.025  1.00 0.00 ? 23 ASP S C    7  
ATOM 6835  O O    . ASP A 1 14 ? -5.123  10.969  -2.177  1.00 0.00 ? 23 ASP S O    7  
ATOM 6836  C CB   . ASP A 1 14 ? -6.537  9.637   -4.590  1.00 0.00 ? 23 ASP S CB   7  
ATOM 6837  C CG   . ASP A 1 14 ? -7.557  10.537  -5.258  1.00 0.00 ? 23 ASP S CG   7  
ATOM 6838  O OD1  . ASP A 1 14 ? -7.152  11.392  -6.072  1.00 0.00 ? 23 ASP S OD1  7  
ATOM 6839  O OD2  . ASP A 1 14 ? -8.762  10.385  -4.967  1.00 0.00 ? 23 ASP S OD2  7  
ATOM 6840  H H    . ASP A 1 14 ? -4.641  9.069   -6.110  1.00 0.00 ? 23 ASP S H    7  
ATOM 6841  H HA   . ASP A 1 14 ? -5.248  11.326  -4.758  1.00 0.00 ? 23 ASP S HA   7  
ATOM 6842  H HB2  . ASP A 1 14 ? -6.446  8.735   -5.176  1.00 0.00 ? 23 ASP S HB2  7  
ATOM 6843  H HB3  . ASP A 1 14 ? -6.888  9.387   -3.600  1.00 0.00 ? 23 ASP S HB3  7  
ATOM 6844  N N    . LEU A 1 15 ? -3.827  9.232   -2.734  1.00 0.00 ? 24 LEU S N    7  
ATOM 6845  C CA   . LEU A 1 15 ? -3.338  9.044   -1.370  1.00 0.00 ? 24 LEU S CA   7  
ATOM 6846  C C    . LEU A 1 15 ? -1.843  9.307   -1.261  1.00 0.00 ? 24 LEU S C    7  
ATOM 6847  O O    . LEU A 1 15 ? -1.336  9.596   -0.177  1.00 0.00 ? 24 LEU S O    7  
ATOM 6848  C CB   . LEU A 1 15 ? -3.659  7.627   -0.889  1.00 0.00 ? 24 LEU S CB   7  
ATOM 6849  C CG   . LEU A 1 15 ? -3.639  6.543   -1.975  1.00 0.00 ? 24 LEU S CG   7  
ATOM 6850  C CD1  . LEU A 1 15 ? -2.662  5.440   -1.621  1.00 0.00 ? 24 LEU S CD1  7  
ATOM 6851  C CD2  . LEU A 1 15 ? -5.033  5.978   -2.181  1.00 0.00 ? 24 LEU S CD2  7  
ATOM 6852  H H    . LEU A 1 15 ? -3.528  8.626   -3.439  1.00 0.00 ? 24 LEU S H    7  
ATOM 6853  H HA   . LEU A 1 15 ? -3.853  9.748   -0.737  1.00 0.00 ? 24 LEU S HA   7  
ATOM 6854  H HB2  . LEU A 1 15 ? -2.940  7.359   -0.128  1.00 0.00 ? 24 LEU S HB2  7  
ATOM 6855  H HB3  . LEU A 1 15 ? -4.641  7.638   -0.441  1.00 0.00 ? 24 LEU S HB3  7  
ATOM 6856  H HG   . LEU A 1 15 ? -3.314  6.977   -2.906  1.00 0.00 ? 24 LEU S HG   7  
ATOM 6857  H HD11 . LEU A 1 15 ? -1.735  5.595   -2.151  1.00 0.00 ? 24 LEU S HD11 7  
ATOM 6858  H HD12 . LEU A 1 15 ? -3.084  4.484   -1.901  1.00 0.00 ? 24 LEU S HD12 7  
ATOM 6859  H HD13 . LEU A 1 15 ? -2.477  5.454   -0.562  1.00 0.00 ? 24 LEU S HD13 7  
ATOM 6860  H HD21 . LEU A 1 15 ? -4.966  5.047   -2.719  1.00 0.00 ? 24 LEU S HD21 7  
ATOM 6861  H HD22 . LEU A 1 15 ? -5.627  6.681   -2.745  1.00 0.00 ? 24 LEU S HD22 7  
ATOM 6862  H HD23 . LEU A 1 15 ? -5.497  5.806   -1.219  1.00 0.00 ? 24 LEU S HD23 7  
ATOM 6863  N N    . LEU A 1 16 ? -1.137  9.201   -2.374  1.00 0.00 ? 25 LEU S N    7  
ATOM 6864  C CA   . LEU A 1 16 ? 0.303   9.424   -2.377  1.00 0.00 ? 25 LEU S CA   7  
ATOM 6865  C C    . LEU A 1 16 ? 0.646   10.910  -2.249  1.00 0.00 ? 25 LEU S C    7  
ATOM 6866  O O    . LEU A 1 16 ? 1.812   11.269  -2.085  1.00 0.00 ? 25 LEU S O    7  
ATOM 6867  C CB   . LEU A 1 16 ? 0.922   8.846   -3.645  1.00 0.00 ? 25 LEU S CB   7  
ATOM 6868  C CG   . LEU A 1 16 ? 2.421   8.568   -3.561  1.00 0.00 ? 25 LEU S CG   7  
ATOM 6869  C CD1  . LEU A 1 16 ? 2.692   7.092   -3.787  1.00 0.00 ? 25 LEU S CD1  7  
ATOM 6870  C CD2  . LEU A 1 16 ? 3.187   9.412   -4.570  1.00 0.00 ? 25 LEU S CD2  7  
ATOM 6871  H H    . LEU A 1 16 ? -1.592  8.958   -3.211  1.00 0.00 ? 25 LEU S H    7  
ATOM 6872  H HA   . LEU A 1 16 ? 0.714   8.904   -1.524  1.00 0.00 ? 25 LEU S HA   7  
ATOM 6873  H HB2  . LEU A 1 16 ? 0.417   7.916   -3.868  1.00 0.00 ? 25 LEU S HB2  7  
ATOM 6874  H HB3  . LEU A 1 16 ? 0.746   9.537   -4.456  1.00 0.00 ? 25 LEU S HB3  7  
ATOM 6875  H HG   . LEU A 1 16 ? 2.774   8.825   -2.572  1.00 0.00 ? 25 LEU S HG   7  
ATOM 6876  H HD11 . LEU A 1 16 ? 3.470   6.763   -3.117  1.00 0.00 ? 25 LEU S HD11 7  
ATOM 6877  H HD12 . LEU A 1 16 ? 3.001   6.934   -4.809  1.00 0.00 ? 25 LEU S HD12 7  
ATOM 6878  H HD13 . LEU A 1 16 ? 1.786   6.532   -3.593  1.00 0.00 ? 25 LEU S HD13 7  
ATOM 6879  H HD21 . LEU A 1 16 ? 2.825   10.429  -4.536  1.00 0.00 ? 25 LEU S HD21 7  
ATOM 6880  H HD22 . LEU A 1 16 ? 3.040   9.010   -5.561  1.00 0.00 ? 25 LEU S HD22 7  
ATOM 6881  H HD23 . LEU A 1 16 ? 4.239   9.398   -4.327  1.00 0.00 ? 25 LEU S HD23 7  
ATOM 6882  N N    . ALA A 1 17 ? -0.369  11.772  -2.322  1.00 0.00 ? 26 ALA S N    7  
ATOM 6883  C CA   . ALA A 1 17 ? -0.156  13.215  -2.206  1.00 0.00 ? 26 ALA S CA   7  
ATOM 6884  C C    . ALA A 1 17 ? -1.435  13.989  -2.517  1.00 0.00 ? 26 ALA S C    7  
ATOM 6885  O O    . ALA A 1 17 ? -1.403  15.023  -3.185  1.00 0.00 ? 26 ALA S O    7  
ATOM 6886  C CB   . ALA A 1 17 ? 0.966   13.664  -3.135  1.00 0.00 ? 26 ALA S CB   7  
ATOM 6887  H H    . ALA A 1 17 ? -1.279  11.430  -2.449  1.00 0.00 ? 26 ALA S H    7  
ATOM 6888  H HA   . ALA A 1 17 ? 0.144   13.429  -1.191  1.00 0.00 ? 26 ALA S HA   7  
ATOM 6889  H HB1  . ALA A 1 17 ? 0.895   14.730  -3.297  1.00 0.00 ? 26 ALA S HB1  7  
ATOM 6890  H HB2  . ALA A 1 17 ? 0.879   13.151  -4.080  1.00 0.00 ? 26 ALA S HB2  7  
ATOM 6891  H HB3  . ALA A 1 17 ? 1.920   13.432  -2.683  1.00 0.00 ? 26 ALA S HB3  7  
ATOM 6892  N N    . ARG A 1 18 ? -2.560  13.477  -2.033  1.00 0.00 ? 27 ARG S N    7  
ATOM 6893  C CA   . ARG A 1 18 ? -3.855  14.109  -2.262  1.00 0.00 ? 27 ARG S CA   7  
ATOM 6894  C C    . ARG A 1 18 ? -4.803  13.816  -1.104  1.00 0.00 ? 27 ARG S C    7  
ATOM 6895  O O    . ARG A 1 18 ? -4.819  12.700  -0.595  1.00 0.00 ? 27 ARG S O    7  
ATOM 6896  C CB   . ARG A 1 18 ? -4.445  13.581  -3.576  1.00 0.00 ? 27 ARG S CB   7  
ATOM 6897  C CG   . ARG A 1 18 ? -5.897  13.971  -3.828  1.00 0.00 ? 27 ARG S CG   7  
ATOM 6898  C CD   . ARG A 1 18 ? -6.880  13.003  -3.187  1.00 0.00 ? 27 ARG S CD   7  
ATOM 6899  N NE   . ARG A 1 18 ? -8.235  13.171  -3.714  1.00 0.00 ? 27 ARG S NE   7  
ATOM 6900  C CZ   . ARG A 1 18 ? -8.993  14.243  -3.493  1.00 0.00 ? 27 ARG S CZ   7  
ATOM 6901  N NH1  . ARG A 1 18 ? -8.548  15.236  -2.737  1.00 0.00 ? 27 ARG S NH1  7  
ATOM 6902  N NH2  . ARG A 1 18 ? -10.207 14.317  -4.024  1.00 0.00 ? 27 ARG S NH2  7  
ATOM 6903  H H    . ARG A 1 18 ? -2.520  12.648  -1.513  1.00 0.00 ? 27 ARG S H    7  
ATOM 6904  H HA   . ARG A 1 18 ? -3.703  15.174  -2.340  1.00 0.00 ? 27 ARG S HA   7  
ATOM 6905  H HB2  . ARG A 1 18 ? -3.854  13.960  -4.395  1.00 0.00 ? 27 ARG S HB2  7  
ATOM 6906  H HB3  . ARG A 1 18 ? -4.381  12.506  -3.573  1.00 0.00 ? 27 ARG S HB3  7  
ATOM 6907  H HG2  . ARG A 1 18 ? -6.066  14.950  -3.423  1.00 0.00 ? 27 ARG S HG2  7  
ATOM 6908  H HG3  . ARG A 1 18 ? -6.067  13.980  -4.896  1.00 0.00 ? 27 ARG S HG3  7  
ATOM 6909  H HD2  . ARG A 1 18 ? -6.552  11.993  -3.388  1.00 0.00 ? 27 ARG S HD2  7  
ATOM 6910  H HD3  . ARG A 1 18 ? -6.895  13.173  -2.120  1.00 0.00 ? 27 ARG S HD3  7  
ATOM 6911  H HE   . ARG A 1 18 ? -8.598  12.450  -4.267  1.00 0.00 ? 27 ARG S HE   7  
ATOM 6912  H HH11 . ARG A 1 18 ? -7.638  15.183  -2.328  1.00 0.00 ? 27 ARG S HH11 7  
ATOM 6913  H HH12 . ARG A 1 18 ? -9.122  16.038  -2.577  1.00 0.00 ? 27 ARG S HH12 7  
ATOM 6914  H HH21 . ARG A 1 18 ? -10.550 13.568  -4.591  1.00 0.00 ? 27 ARG S HH21 7  
ATOM 6915  H HH22 . ARG A 1 18 ? -10.776 15.121  -3.858  1.00 0.00 ? 27 ARG S HH22 7  
ATOM 6916  N N    . PRO A 1 19 ? -5.616  14.805  -0.672  1.00 0.00 ? 28 PRO S N    7  
ATOM 6917  C CA   . PRO A 1 19 ? -6.575  14.617  0.420   1.00 0.00 ? 28 PRO S CA   7  
ATOM 6918  C C    . PRO A 1 19 ? -7.271  13.256  0.345   1.00 0.00 ? 28 PRO S C    7  
ATOM 6919  O O    . PRO A 1 19 ? -8.378  13.128  -0.180  1.00 0.00 ? 28 PRO S O    7  
ATOM 6920  C CB   . PRO A 1 19 ? -7.570  15.752  0.201   1.00 0.00 ? 28 PRO S CB   7  
ATOM 6921  C CG   . PRO A 1 19 ? -6.757  16.846  -0.406  1.00 0.00 ? 28 PRO S CG   7  
ATOM 6922  C CD   . PRO A 1 19 ? -5.672  16.178  -1.217  1.00 0.00 ? 28 PRO S CD   7  
ATOM 6923  H HA   . PRO A 1 19 ? -6.103  14.727  1.386   1.00 0.00 ? 28 PRO S HA   7  
ATOM 6924  H HB2  . PRO A 1 19 ? -8.356  15.422  -0.464  1.00 0.00 ? 28 PRO S HB2  7  
ATOM 6925  H HB3  . PRO A 1 19 ? -7.991  16.054  1.150   1.00 0.00 ? 28 PRO S HB3  7  
ATOM 6926  H HG2  . PRO A 1 19 ? -7.382  17.452  -1.047  1.00 0.00 ? 28 PRO S HG2  7  
ATOM 6927  H HG3  . PRO A 1 19 ? -6.322  17.453  0.373   1.00 0.00 ? 28 PRO S HG3  7  
ATOM 6928  H HD2  . PRO A 1 19 ? -5.937  16.171  -2.261  1.00 0.00 ? 28 PRO S HD2  7  
ATOM 6929  H HD3  . PRO A 1 19 ? -4.728  16.688  -1.071  1.00 0.00 ? 28 PRO S HD3  7  
ATOM 6930  N N    . LEU A 1 20 ? -6.580  12.249  0.865   1.00 0.00 ? 29 LEU S N    7  
ATOM 6931  C CA   . LEU A 1 20 ? -7.068  10.874  0.870   1.00 0.00 ? 29 LEU S CA   7  
ATOM 6932  C C    . LEU A 1 20 ? -8.105  10.634  1.960   1.00 0.00 ? 29 LEU S C    7  
ATOM 6933  O O    . LEU A 1 20 ? -8.191  11.379  2.935   1.00 0.00 ? 29 LEU S O    7  
ATOM 6934  C CB   . LEU A 1 20 ? -5.900  9.904   1.059   1.00 0.00 ? 29 LEU S CB   7  
ATOM 6935  C CG   . LEU A 1 20 ? -4.934  10.258  2.197   1.00 0.00 ? 29 LEU S CG   7  
ATOM 6936  C CD1  . LEU A 1 20 ? -5.620  10.103  3.547   1.00 0.00 ? 29 LEU S CD1  7  
ATOM 6937  C CD2  . LEU A 1 20 ? -3.682  9.393   2.128   1.00 0.00 ? 29 LEU S CD2  7  
ATOM 6938  H H    . LEU A 1 20 ? -5.701  12.440  1.243   1.00 0.00 ? 29 LEU S H    7  
ATOM 6939  H HA   . LEU A 1 20 ? -7.523  10.682  -0.091  1.00 0.00 ? 29 LEU S HA   7  
ATOM 6940  H HB2  . LEU A 1 20 ? -6.306  8.921   1.253   1.00 0.00 ? 29 LEU S HB2  7  
ATOM 6941  H HB3  . LEU A 1 20 ? -5.338  9.870   0.139   1.00 0.00 ? 29 LEU S HB3  7  
ATOM 6942  H HG   . LEU A 1 20 ? -4.630  11.288  2.098   1.00 0.00 ? 29 LEU S HG   7  
ATOM 6943  H HD11 . LEU A 1 20 ? -5.967  11.068  3.886   1.00 0.00 ? 29 LEU S HD11 7  
ATOM 6944  H HD12 . LEU A 1 20 ? -4.919  9.701   4.263   1.00 0.00 ? 29 LEU S HD12 7  
ATOM 6945  H HD13 . LEU A 1 20 ? -6.460  9.433   3.449   1.00 0.00 ? 29 LEU S HD13 7  
ATOM 6946  H HD21 . LEU A 1 20 ? -3.537  8.890   3.073   1.00 0.00 ? 29 LEU S HD21 7  
ATOM 6947  H HD22 . LEU A 1 20 ? -2.826  10.017  1.919   1.00 0.00 ? 29 LEU S HD22 7  
ATOM 6948  H HD23 . LEU A 1 20 ? -3.792  8.660   1.344   1.00 0.00 ? 29 LEU S HD23 7  
ATOM 6949  N N    . PRO A 1 21 ? -8.917  9.576   1.786   1.00 0.00 ? 30 PRO S N    7  
ATOM 6950  C CA   . PRO A 1 21 ? -9.971  9.209   2.721   1.00 0.00 ? 30 PRO S CA   7  
ATOM 6951  C C    . PRO A 1 21 ? -9.499  8.244   3.794   1.00 0.00 ? 30 PRO S C    7  
ATOM 6952  O O    . PRO A 1 21 ? -8.301  8.078   4.019   1.00 0.00 ? 30 PRO S O    7  
ATOM 6953  C CB   . PRO A 1 21 ? -10.969 8.511   1.807   1.00 0.00 ? 30 PRO S CB   7  
ATOM 6954  C CG   . PRO A 1 21 ? -10.112 7.798   0.820   1.00 0.00 ? 30 PRO S CG   7  
ATOM 6955  C CD   . PRO A 1 21 ? -8.882  8.651   0.635   1.00 0.00 ? 30 PRO S CD   7  
ATOM 6956  H HA   . PRO A 1 21 ? -10.428 10.067  3.174   1.00 0.00 ? 30 PRO S HA   7  
ATOM 6957  H HB2  . PRO A 1 21 ? -11.572 7.822   2.381   1.00 0.00 ? 30 PRO S HB2  7  
ATOM 6958  H HB3  . PRO A 1 21 ? -11.596 9.243   1.325   1.00 0.00 ? 30 PRO S HB3  7  
ATOM 6959  H HG2  . PRO A 1 21 ? -9.839  6.825   1.208   1.00 0.00 ? 30 PRO S HG2  7  
ATOM 6960  H HG3  . PRO A 1 21 ? -10.641 7.695   -0.118  1.00 0.00 ? 30 PRO S HG3  7  
ATOM 6961  H HD2  . PRO A 1 21 ? -7.992  8.041   0.659   1.00 0.00 ? 30 PRO S HD2  7  
ATOM 6962  H HD3  . PRO A 1 21 ? -8.946  9.195   -0.292  1.00 0.00 ? 30 PRO S HD3  7  
ATOM 6963  N N    . GLU A 1 22 ? -10.460 7.591   4.435   1.00 0.00 ? 31 GLU S N    7  
ATOM 6964  C CA   . GLU A 1 22 ? -10.152 6.617   5.466   1.00 0.00 ? 31 GLU S CA   7  
ATOM 6965  C C    . GLU A 1 22 ? -9.818  5.294   4.816   1.00 0.00 ? 31 GLU S C    7  
ATOM 6966  O O    . GLU A 1 22 ? -9.626  5.234   3.603   1.00 0.00 ? 31 GLU S O    7  
ATOM 6967  C CB   . GLU A 1 22 ? -11.316 6.469   6.450   1.00 0.00 ? 31 GLU S CB   7  
ATOM 6968  C CG   . GLU A 1 22 ? -10.883 6.096   7.858   1.00 0.00 ? 31 GLU S CG   7  
ATOM 6969  C CD   . GLU A 1 22 ? -11.680 6.822   8.924   1.00 0.00 ? 31 GLU S CD   7  
ATOM 6970  O OE1  . GLU A 1 22 ? -12.902 6.579   9.019   1.00 0.00 ? 31 GLU S OE1  7  
ATOM 6971  O OE2  . GLU A 1 22 ? -11.085 7.632   9.664   1.00 0.00 ? 31 GLU S OE2  7  
ATOM 6972  H H    . GLU A 1 22 ? -11.392 7.758   4.192   1.00 0.00 ? 31 GLU S H    7  
ATOM 6973  H HA   . GLU A 1 22 ? -9.266  6.959   5.991   1.00 0.00 ? 31 GLU S HA   7  
ATOM 6974  H HB2  . GLU A 1 22 ? -11.853 7.405   6.496   1.00 0.00 ? 31 GLU S HB2  7  
ATOM 6975  H HB3  . GLU A 1 22 ? -11.982 5.700   6.086   1.00 0.00 ? 31 GLU S HB3  7  
ATOM 6976  H HG2  . GLU A 1 22 ? -11.016 5.034   7.993   1.00 0.00 ? 31 GLU S HG2  7  
ATOM 6977  H HG3  . GLU A 1 22 ? -9.839  6.345   7.978   1.00 0.00 ? 31 GLU S HG3  7  
ATOM 6978  N N    . GLY A 1 23 ? -9.662  4.244   5.613   1.00 0.00 ? 32 GLY S N    7  
ATOM 6979  C CA   . GLY A 1 23 ? -9.254  2.978   5.040   1.00 0.00 ? 32 GLY S CA   7  
ATOM 6980  C C    . GLY A 1 23 ? -7.878  3.133   4.412   1.00 0.00 ? 32 GLY S C    7  
ATOM 6981  O O    . GLY A 1 23 ? -7.296  2.183   3.889   1.00 0.00 ? 32 GLY S O    7  
ATOM 6982  H H    . GLY A 1 23 ? -9.763  4.341   6.583   1.00 0.00 ? 32 GLY S H    7  
ATOM 6983  H HA2  . GLY A 1 23 ? -9.218  2.224   5.816   1.00 0.00 ? 32 GLY S HA2  7  
ATOM 6984  H HA3  . GLY A 1 23 ? -9.961  2.682   4.277   1.00 0.00 ? 32 GLY S HA3  7  
ATOM 6985  N N    . VAL A 1 24 ? -7.370  4.369   4.489   1.00 0.00 ? 33 VAL S N    7  
ATOM 6986  C CA   . VAL A 1 24 ? -6.079  4.745   3.971   1.00 0.00 ? 33 VAL S CA   7  
ATOM 6987  C C    . VAL A 1 24 ? -5.289  5.414   5.087   1.00 0.00 ? 33 VAL S C    7  
ATOM 6988  O O    . VAL A 1 24 ? -5.591  6.539   5.482   1.00 0.00 ? 33 VAL S O    7  
ATOM 6989  C CB   . VAL A 1 24 ? -6.244  5.730   2.777   1.00 0.00 ? 33 VAL S CB   7  
ATOM 6990  C CG1  . VAL A 1 24 ? -5.279  6.907   2.858   1.00 0.00 ? 33 VAL S CG1  7  
ATOM 6991  C CG2  . VAL A 1 24 ? -6.074  5.011   1.456   1.00 0.00 ? 33 VAL S CG2  7  
ATOM 6992  H H    . VAL A 1 24 ? -7.896  5.062   4.929   1.00 0.00 ? 33 VAL S H    7  
ATOM 6993  H HA   . VAL A 1 24 ? -5.565  3.861   3.636   1.00 0.00 ? 33 VAL S HA   7  
ATOM 6994  H HB   . VAL A 1 24 ? -7.248  6.125   2.811   1.00 0.00 ? 33 VAL S HB   7  
ATOM 6995  H HG11 . VAL A 1 24 ? -5.219  7.384   1.890   1.00 0.00 ? 33 VAL S HG11 7  
ATOM 6996  H HG12 . VAL A 1 24 ? -4.301  6.555   3.150   1.00 0.00 ? 33 VAL S HG12 7  
ATOM 6997  H HG13 . VAL A 1 24 ? -5.641  7.618   3.585   1.00 0.00 ? 33 VAL S HG13 7  
ATOM 6998  H HG21 . VAL A 1 24 ? -6.590  5.566   0.685   1.00 0.00 ? 33 VAL S HG21 7  
ATOM 6999  H HG22 . VAL A 1 24 ? -6.490  4.019   1.528   1.00 0.00 ? 33 VAL S HG22 7  
ATOM 7000  H HG23 . VAL A 1 24 ? -5.023  4.950   1.215   1.00 0.00 ? 33 VAL S HG23 7  
ATOM 7001  N N    . ASP A 1 25 ? -4.285  4.726   5.598   1.00 0.00 ? 34 ASP S N    7  
ATOM 7002  C CA   . ASP A 1 25 ? -3.475  5.283   6.663   1.00 0.00 ? 34 ASP S CA   7  
ATOM 7003  C C    . ASP A 1 25 ? -2.085  5.612   6.121   1.00 0.00 ? 34 ASP S C    7  
ATOM 7004  O O    . ASP A 1 25 ? -1.400  4.733   5.603   1.00 0.00 ? 34 ASP S O    7  
ATOM 7005  C CB   . ASP A 1 25 ? -3.373  4.303   7.832   1.00 0.00 ? 34 ASP S CB   7  
ATOM 7006  C CG   . ASP A 1 25 ? -4.496  4.483   8.836   1.00 0.00 ? 34 ASP S CG   7  
ATOM 7007  O OD1  . ASP A 1 25 ? -4.969  5.628   8.995   1.00 0.00 ? 34 ASP S OD1  7  
ATOM 7008  O OD2  . ASP A 1 25 ? -4.899  3.481   9.462   1.00 0.00 ? 34 ASP S OD2  7  
ATOM 7009  H H    . ASP A 1 25 ? -4.084  3.832   5.252   1.00 0.00 ? 34 ASP S H    7  
ATOM 7010  H HA   . ASP A 1 25 ? -3.965  6.191   6.998   1.00 0.00 ? 34 ASP S HA   7  
ATOM 7011  H HB2  . ASP A 1 25 ? -3.420  3.293   7.451   1.00 0.00 ? 34 ASP S HB2  7  
ATOM 7012  H HB3  . ASP A 1 25 ? -2.430  4.452   8.340   1.00 0.00 ? 34 ASP S HB3  7  
ATOM 7013  N N    . PRO A 1 26 ? -1.652  6.881   6.210   1.00 0.00 ? 35 PRO S N    7  
ATOM 7014  C CA   . PRO A 1 26 ? -0.343  7.316   5.698   1.00 0.00 ? 35 PRO S CA   7  
ATOM 7015  C C    . PRO A 1 26 ? 0.827   6.499   6.244   1.00 0.00 ? 35 PRO S C    7  
ATOM 7016  O O    . PRO A 1 26 ? 1.907   6.481   5.653   1.00 0.00 ? 35 PRO S O    7  
ATOM 7017  C CB   . PRO A 1 26 ? -0.236  8.776   6.163   1.00 0.00 ? 35 PRO S CB   7  
ATOM 7018  C CG   . PRO A 1 26 ? -1.284  8.924   7.211   1.00 0.00 ? 35 PRO S CG   7  
ATOM 7019  C CD   . PRO A 1 26 ? -2.392  8.003   6.800   1.00 0.00 ? 35 PRO S CD   7  
ATOM 7020  H HA   . PRO A 1 26 ? -0.322  7.282   4.617   1.00 0.00 ? 35 PRO S HA   7  
ATOM 7021  H HB2  . PRO A 1 26 ? 0.752   8.958   6.564   1.00 0.00 ? 35 PRO S HB2  7  
ATOM 7022  H HB3  . PRO A 1 26 ? -0.419  9.435   5.326   1.00 0.00 ? 35 PRO S HB3  7  
ATOM 7023  H HG2  . PRO A 1 26 ? -0.887  8.625   8.170   1.00 0.00 ? 35 PRO S HG2  7  
ATOM 7024  H HG3  . PRO A 1 26 ? -1.635  9.945   7.244   1.00 0.00 ? 35 PRO S HG3  7  
ATOM 7025  H HD2  . PRO A 1 26 ? -2.962  7.686   7.664   1.00 0.00 ? 35 PRO S HD2  7  
ATOM 7026  H HD3  . PRO A 1 26 ? -3.031  8.475   6.068   1.00 0.00 ? 35 PRO S HD3  7  
ATOM 7027  N N    . LEU A 1 27 ? 0.617   5.828   7.371   1.00 0.00 ? 36 LEU S N    7  
ATOM 7028  C CA   . LEU A 1 27 ? 1.670   5.020   7.982   1.00 0.00 ? 36 LEU S CA   7  
ATOM 7029  C C    . LEU A 1 27 ? 1.492   3.542   7.650   1.00 0.00 ? 36 LEU S C    7  
ATOM 7030  O O    . LEU A 1 27 ? 2.002   2.672   8.356   1.00 0.00 ? 36 LEU S O    7  
ATOM 7031  C CB   . LEU A 1 27 ? 1.696   5.224   9.500   1.00 0.00 ? 36 LEU S CB   7  
ATOM 7032  C CG   . LEU A 1 27 ? 0.337   5.495   10.144  1.00 0.00 ? 36 LEU S CG   7  
ATOM 7033  C CD1  . LEU A 1 27 ? 0.347   5.084   11.609  1.00 0.00 ? 36 LEU S CD1  7  
ATOM 7034  C CD2  . LEU A 1 27 ? -0.026  6.967   9.999   1.00 0.00 ? 36 LEU S CD2  7  
ATOM 7035  H H    . LEU A 1 27 ? -0.261  5.878   7.802   1.00 0.00 ? 36 LEU S H    7  
ATOM 7036  H HA   . LEU A 1 27 ? 2.614   5.351   7.572   1.00 0.00 ? 36 LEU S HA   7  
ATOM 7037  H HB2  . LEU A 1 27 ? 2.114   4.335   9.953   1.00 0.00 ? 36 LEU S HB2  7  
ATOM 7038  H HB3  . LEU A 1 27 ? 2.344   6.060   9.718   1.00 0.00 ? 36 LEU S HB3  7  
ATOM 7039  H HG   . LEU A 1 27 ? -0.419  4.911   9.637   1.00 0.00 ? 36 LEU S HG   7  
ATOM 7040  H HD11 . LEU A 1 27 ? 0.310   4.006   11.681  1.00 0.00 ? 36 LEU S HD11 7  
ATOM 7041  H HD12 . LEU A 1 27 ? -0.513  5.507   12.107  1.00 0.00 ? 36 LEU S HD12 7  
ATOM 7042  H HD13 . LEU A 1 27 ? 1.250   5.445   12.079  1.00 0.00 ? 36 LEU S HD13 7  
ATOM 7043  H HD21 . LEU A 1 27 ? 0.747   7.474   9.434   1.00 0.00 ? 36 LEU S HD21 7  
ATOM 7044  H HD22 . LEU A 1 27 ? -0.111  7.418   10.977  1.00 0.00 ? 36 LEU S HD22 7  
ATOM 7045  H HD23 . LEU A 1 27 ? -0.968  7.057   9.478   1.00 0.00 ? 36 LEU S HD23 7  
ATOM 7046  N N    . LYS A 1 28 ? 0.778   3.262   6.564   1.00 0.00 ? 37 LYS S N    7  
ATOM 7047  C CA   . LYS A 1 28 ? 0.548   1.885   6.132   1.00 0.00 ? 37 LYS S CA   7  
ATOM 7048  C C    . LYS A 1 28 ? -0.262  1.846   4.840   1.00 0.00 ? 37 LYS S C    7  
ATOM 7049  O O    . LYS A 1 28 ? -1.458  1.552   4.855   1.00 0.00 ? 37 LYS S O    7  
ATOM 7050  C CB   . LYS A 1 28 ? -0.170  1.094   7.227   1.00 0.00 ? 37 LYS S CB   7  
ATOM 7051  C CG   . LYS A 1 28 ? -1.424  1.776   7.746   1.00 0.00 ? 37 LYS S CG   7  
ATOM 7052  C CD   . LYS A 1 28 ? -2.332  0.797   8.473   1.00 0.00 ? 37 LYS S CD   7  
ATOM 7053  C CE   . LYS A 1 28 ? -1.696  0.302   9.763   1.00 0.00 ? 37 LYS S CE   7  
ATOM 7054  N NZ   . LYS A 1 28 ? -2.538  -0.722  10.441  1.00 0.00 ? 37 LYS S NZ   7  
ATOM 7055  H H    . LYS A 1 28 ? 0.403   3.998   6.035   1.00 0.00 ? 37 LYS S H    7  
ATOM 7056  H HA   . LYS A 1 28 ? 1.513   1.433   5.949   1.00 0.00 ? 37 LYS S HA   7  
ATOM 7057  H HB2  . LYS A 1 28 ? -0.449  0.128   6.833   1.00 0.00 ? 37 LYS S HB2  7  
ATOM 7058  H HB3  . LYS A 1 28 ? 0.508   0.954   8.058   1.00 0.00 ? 37 LYS S HB3  7  
ATOM 7059  H HG2  . LYS A 1 28 ? -1.139  2.563   8.428   1.00 0.00 ? 37 LYS S HG2  7  
ATOM 7060  H HG3  . LYS A 1 28 ? -1.962  2.198   6.910   1.00 0.00 ? 37 LYS S HG3  7  
ATOM 7061  H HD2  . LYS A 1 28 ? -3.263  1.289   8.708   1.00 0.00 ? 37 LYS S HD2  7  
ATOM 7062  H HD3  . LYS A 1 28 ? -2.522  -0.049  7.829   1.00 0.00 ? 37 LYS S HD3  7  
ATOM 7063  H HE2  . LYS A 1 28 ? -0.735  -0.131  9.532   1.00 0.00 ? 37 LYS S HE2  7  
ATOM 7064  H HE3  . LYS A 1 28 ? -1.563  1.142   10.428  1.00 0.00 ? 37 LYS S HE3  7  
ATOM 7065  H HZ1  . LYS A 1 28 ? -3.344  -0.266  10.916  1.00 0.00 ? 37 LYS S HZ1  7  
ATOM 7066  H HZ2  . LYS A 1 28 ? -1.976  -1.236  11.150  1.00 0.00 ? 37 LYS S HZ2  7  
ATOM 7067  H HZ3  . LYS A 1 28 ? -2.902  -1.404  9.744   1.00 0.00 ? 37 LYS S HZ3  7  
ATOM 7068  N N    . LEU A 1 29 ? 0.394   2.146   3.721   1.00 0.00 ? 38 LEU S N    7  
ATOM 7069  C CA   . LEU A 1 29 ? -0.278  2.148   2.424   1.00 0.00 ? 38 LEU S CA   7  
ATOM 7070  C C    . LEU A 1 29 ? -0.260  0.768   1.780   1.00 0.00 ? 38 LEU S C    7  
ATOM 7071  O O    . LEU A 1 29 ? -1.248  0.339   1.183   1.00 0.00 ? 38 LEU S O    7  
ATOM 7072  C CB   . LEU A 1 29 ? 0.369   3.167   1.479   1.00 0.00 ? 38 LEU S CB   7  
ATOM 7073  C CG   . LEU A 1 29 ? 0.681   4.544   2.081   1.00 0.00 ? 38 LEU S CG   7  
ATOM 7074  C CD1  . LEU A 1 29 ? 0.572   5.624   1.015   1.00 0.00 ? 38 LEU S CD1  7  
ATOM 7075  C CD2  . LEU A 1 29 ? -0.241  4.862   3.253   1.00 0.00 ? 38 LEU S CD2  7  
ATOM 7076  H H    . LEU A 1 29 ? 1.345   2.376   3.769   1.00 0.00 ? 38 LEU S H    7  
ATOM 7077  H HA   . LEU A 1 29 ? -1.301  2.429   2.593   1.00 0.00 ? 38 LEU S HA   7  
ATOM 7078  H HB2  . LEU A 1 29 ? 1.294   2.744   1.112   1.00 0.00 ? 38 LEU S HB2  7  
ATOM 7079  H HB3  . LEU A 1 29 ? -0.296  3.313   0.639   1.00 0.00 ? 38 LEU S HB3  7  
ATOM 7080  H HG   . LEU A 1 29 ? 1.697   4.543   2.447   1.00 0.00 ? 38 LEU S HG   7  
ATOM 7081  H HD11 . LEU A 1 29 ? 1.549   5.837   0.619   1.00 0.00 ? 38 LEU S HD11 7  
ATOM 7082  H HD12 . LEU A 1 29 ? 0.157   6.521   1.451   1.00 0.00 ? 38 LEU S HD12 7  
ATOM 7083  H HD13 . LEU A 1 29 ? -0.070  5.280   0.218   1.00 0.00 ? 38 LEU S HD13 7  
ATOM 7084  H HD21 . LEU A 1 29 ? -1.146  4.272   3.176   1.00 0.00 ? 38 LEU S HD21 7  
ATOM 7085  H HD22 . LEU A 1 29 ? -0.496  5.910   3.235   1.00 0.00 ? 38 LEU S HD22 7  
ATOM 7086  H HD23 . LEU A 1 29 ? 0.262   4.629   4.177   1.00 0.00 ? 38 LEU S HD23 7  
ATOM 7087  N N    . GLU A 1 30 ? 0.867   0.077   1.897   1.00 0.00 ? 39 GLU S N    7  
ATOM 7088  C CA   . GLU A 1 30 ? 1.015   -1.255  1.318   1.00 0.00 ? 39 GLU S CA   7  
ATOM 7089  C C    . GLU A 1 30 ? -0.159  -2.165  1.679   1.00 0.00 ? 39 GLU S C    7  
ATOM 7090  O O    . GLU A 1 30 ? -0.420  -3.155  0.994   1.00 0.00 ? 39 GLU S O    7  
ATOM 7091  C CB   . GLU A 1 30 ? 2.327   -1.895  1.779   1.00 0.00 ? 39 GLU S CB   7  
ATOM 7092  C CG   . GLU A 1 30 ? 2.670   -1.609  3.233   1.00 0.00 ? 39 GLU S CG   7  
ATOM 7093  C CD   . GLU A 1 30 ? 3.750   -2.530  3.769   1.00 0.00 ? 39 GLU S CD   7  
ATOM 7094  O OE1  . GLU A 1 30 ? 3.619   -3.760  3.601   1.00 0.00 ? 39 GLU S OE1  7  
ATOM 7095  O OE2  . GLU A 1 30 ? 4.726   -2.021  4.357   1.00 0.00 ? 39 GLU S OE2  7  
ATOM 7096  H H    . GLU A 1 30 ? 1.622   0.473   2.379   1.00 0.00 ? 39 GLU S H    7  
ATOM 7097  H HA   . GLU A 1 30 ? 1.045   -1.140  0.246   1.00 0.00 ? 39 GLU S HA   7  
ATOM 7098  H HB2  . GLU A 1 30 ? 2.254   -2.967  1.655   1.00 0.00 ? 39 GLU S HB2  7  
ATOM 7099  H HB3  . GLU A 1 30 ? 3.132   -1.522  1.161   1.00 0.00 ? 39 GLU S HB3  7  
ATOM 7100  H HG2  . GLU A 1 30 ? 3.016   -0.590  3.315   1.00 0.00 ? 39 GLU S HG2  7  
ATOM 7101  H HG3  . GLU A 1 30 ? 1.780   -1.737  3.832   1.00 0.00 ? 39 GLU S HG3  7  
ATOM 7102  N N    . ILE A 1 31 ? -0.857  -1.837  2.762   1.00 0.00 ? 40 ILE S N    7  
ATOM 7103  C CA   . ILE A 1 31 ? -1.989  -2.637  3.212   1.00 0.00 ? 40 ILE S CA   7  
ATOM 7104  C C    . ILE A 1 31 ? -3.269  -2.338  2.428   1.00 0.00 ? 40 ILE S C    7  
ATOM 7105  O O    . ILE A 1 31 ? -4.283  -3.008  2.625   1.00 0.00 ? 40 ILE S O    7  
ATOM 7106  C CB   . ILE A 1 31 ? -2.265  -2.418  4.711   1.00 0.00 ? 40 ILE S CB   7  
ATOM 7107  C CG1  . ILE A 1 31 ? -2.600  -0.950  4.986   1.00 0.00 ? 40 ILE S CG1  7  
ATOM 7108  C CG2  . ILE A 1 31 ? -1.069  -2.861  5.542   1.00 0.00 ? 40 ILE S CG2  7  
ATOM 7109  C CD1  . ILE A 1 31 ? -4.066  -0.708  5.274   1.00 0.00 ? 40 ILE S CD1  7  
ATOM 7110  H H    . ILE A 1 31 ? -0.599  -1.046  3.278   1.00 0.00 ? 40 ILE S H    7  
ATOM 7111  H HA   . ILE A 1 31 ? -1.733  -3.676  3.070   1.00 0.00 ? 40 ILE S HA   7  
ATOM 7112  H HB   . ILE A 1 31 ? -3.110  -3.030  4.992   1.00 0.00 ? 40 ILE S HB   7  
ATOM 7113  H HG12 . ILE A 1 31 ? -2.035  -0.609  5.840   1.00 0.00 ? 40 ILE S HG12 7  
ATOM 7114  H HG13 . ILE A 1 31 ? -2.329  -0.358  4.122   1.00 0.00 ? 40 ILE S HG13 7  
ATOM 7115  H HG21 . ILE A 1 31 ? -1.412  -3.255  6.486   1.00 0.00 ? 40 ILE S HG21 7  
ATOM 7116  H HG22 . ILE A 1 31 ? -0.421  -2.014  5.719   1.00 0.00 ? 40 ILE S HG22 7  
ATOM 7117  H HG23 . ILE A 1 31 ? -0.523  -3.624  5.009   1.00 0.00 ? 40 ILE S HG23 7  
ATOM 7118  H HD11 . ILE A 1 31 ? -4.162  -0.003  6.085   1.00 0.00 ? 40 ILE S HD11 7  
ATOM 7119  H HD12 . ILE A 1 31 ? -4.537  -1.640  5.549   1.00 0.00 ? 40 ILE S HD12 7  
ATOM 7120  H HD13 . ILE A 1 31 ? -4.545  -0.310  4.391   1.00 0.00 ? 40 ILE S HD13 7  
ATOM 7121  N N    . TYR A 1 32 ? -3.237  -1.341  1.542   1.00 0.00 ? 41 TYR S N    7  
ATOM 7122  C CA   . TYR A 1 32 ? -4.427  -1.002  0.762   1.00 0.00 ? 41 TYR S CA   7  
ATOM 7123  C C    . TYR A 1 32 ? -4.130  -0.857  -0.727  1.00 0.00 ? 41 TYR S C    7  
ATOM 7124  O O    . TYR A 1 32 ? -4.899  -0.227  -1.455  1.00 0.00 ? 41 TYR S O    7  
ATOM 7125  C CB   . TYR A 1 32 ? -5.092  0.276   1.294   1.00 0.00 ? 41 TYR S CB   7  
ATOM 7126  C CG   . TYR A 1 32 ? -4.225  1.524   1.287   1.00 0.00 ? 41 TYR S CG   7  
ATOM 7127  C CD1  . TYR A 1 32 ? -3.478  1.898   0.172   1.00 0.00 ? 41 TYR S CD1  7  
ATOM 7128  C CD2  . TYR A 1 32 ? -4.191  2.352   2.400   1.00 0.00 ? 41 TYR S CD2  7  
ATOM 7129  C CE1  . TYR A 1 32 ? -2.718  3.053   0.178   1.00 0.00 ? 41 TYR S CE1  7  
ATOM 7130  C CE2  . TYR A 1 32 ? -3.442  3.511   2.409   1.00 0.00 ? 41 TYR S CE2  7  
ATOM 7131  C CZ   . TYR A 1 32 ? -2.708  3.855   1.299   1.00 0.00 ? 41 TYR S CZ   7  
ATOM 7132  O OH   . TYR A 1 32 ? -1.973  5.013   1.307   1.00 0.00 ? 41 TYR S OH   7  
ATOM 7133  H H    . TYR A 1 32 ? -2.412  -0.829  1.414   1.00 0.00 ? 41 TYR S H    7  
ATOM 7134  H HA   . TYR A 1 32 ? -5.127  -1.816  0.880   1.00 0.00 ? 41 TYR S HA   7  
ATOM 7135  H HB2  . TYR A 1 32 ? -5.964  0.487   0.693   1.00 0.00 ? 41 TYR S HB2  7  
ATOM 7136  H HB3  . TYR A 1 32 ? -5.404  0.102   2.314   1.00 0.00 ? 41 TYR S HB3  7  
ATOM 7137  H HD1  . TYR A 1 32 ? -3.486  1.275   -0.704  1.00 0.00 ? 41 TYR S HD1  7  
ATOM 7138  H HD2  . TYR A 1 32 ? -4.760  2.080   3.274   1.00 0.00 ? 41 TYR S HD2  7  
ATOM 7139  H HE1  . TYR A 1 32 ? -2.137  3.324   -0.692  1.00 0.00 ? 41 TYR S HE1  7  
ATOM 7140  H HE2  . TYR A 1 32 ? -3.431  4.139   3.288   1.00 0.00 ? 41 TYR S HE2  7  
ATOM 7141  H HH   . TYR A 1 32 ? -2.549  5.759   1.490   1.00 0.00 ? 41 TYR S HH   7  
ATOM 7142  N N    . LEU A 1 33 ? -3.030  -1.442  -1.188  1.00 0.00 ? 42 LEU S N    7  
ATOM 7143  C CA   . LEU A 1 33 ? -2.680  -1.360  -2.604  1.00 0.00 ? 42 LEU S CA   7  
ATOM 7144  C C    . LEU A 1 33 ? -2.386  -2.732  -3.186  1.00 0.00 ? 42 LEU S C    7  
ATOM 7145  O O    . LEU A 1 33 ? -1.629  -3.512  -2.612  1.00 0.00 ? 42 LEU S O    7  
ATOM 7146  C CB   . LEU A 1 33 ? -1.474  -0.445  -2.831  1.00 0.00 ? 42 LEU S CB   7  
ATOM 7147  C CG   . LEU A 1 33 ? -0.409  -0.459  -1.728  1.00 0.00 ? 42 LEU S CG   7  
ATOM 7148  C CD1  . LEU A 1 33 ? 0.872   -1.113  -2.230  1.00 0.00 ? 42 LEU S CD1  7  
ATOM 7149  C CD2  . LEU A 1 33 ? -0.130  0.957   -1.241  1.00 0.00 ? 42 LEU S CD2  7  
ATOM 7150  H H    . LEU A 1 33 ? -2.453  -1.941  -0.574  1.00 0.00 ? 42 LEU S H    7  
ATOM 7151  H HA   . LEU A 1 33 ? -3.528  -0.945  -3.123  1.00 0.00 ? 42 LEU S HA   7  
ATOM 7152  H HB2  . LEU A 1 33 ? -1.001  -0.741  -3.758  1.00 0.00 ? 42 LEU S HB2  7  
ATOM 7153  H HB3  . LEU A 1 33 ? -1.837  0.565   -2.942  1.00 0.00 ? 42 LEU S HB3  7  
ATOM 7154  H HG   . LEU A 1 33 ? -0.772  -1.036  -0.890  1.00 0.00 ? 42 LEU S HG   7  
ATOM 7155  H HD11 . LEU A 1 33 ? 1.641   -0.363  -2.342  1.00 0.00 ? 42 LEU S HD11 7  
ATOM 7156  H HD12 . LEU A 1 33 ? 0.687   -1.583  -3.183  1.00 0.00 ? 42 LEU S HD12 7  
ATOM 7157  H HD13 . LEU A 1 33 ? 1.198   -1.859  -1.520  1.00 0.00 ? 42 LEU S HD13 7  
ATOM 7158  H HD21 . LEU A 1 33 ? 0.673   0.937   -0.519  1.00 0.00 ? 42 LEU S HD21 7  
ATOM 7159  H HD22 . LEU A 1 33 ? -1.019  1.362   -0.782  1.00 0.00 ? 42 LEU S HD22 7  
ATOM 7160  H HD23 . LEU A 1 33 ? 0.156   1.575   -2.078  1.00 0.00 ? 42 LEU S HD23 7  
ATOM 7161  N N    . THR A 1 34 ? -2.985  -3.012  -4.338  1.00 0.00 ? 43 THR S N    7  
ATOM 7162  C CA   . THR A 1 34 ? -2.774  -4.284  -5.011  1.00 0.00 ? 43 THR S CA   7  
ATOM 7163  C C    . THR A 1 34 ? -1.392  -4.321  -5.658  1.00 0.00 ? 43 THR S C    7  
ATOM 7164  O O    . THR A 1 34 ? -0.594  -3.404  -5.484  1.00 0.00 ? 43 THR S O    7  
ATOM 7165  C CB   . THR A 1 34 ? -3.859  -4.523  -6.065  1.00 0.00 ? 43 THR S CB   7  
ATOM 7166  O OG1  . THR A 1 34 ? -3.623  -5.730  -6.766  1.00 0.00 ? 43 THR S OG1  7  
ATOM 7167  C CG2  . THR A 1 34 ? -3.957  -3.411  -7.087  1.00 0.00 ? 43 THR S CG2  7  
ATOM 7168  H H    . THR A 1 34 ? -3.575  -2.343  -4.747  1.00 0.00 ? 43 THR S H    7  
ATOM 7169  H HA   . THR A 1 34 ? -2.830  -5.064  -4.266  1.00 0.00 ? 43 THR S HA   7  
ATOM 7170  H HB   . THR A 1 34 ? -4.815  -4.602  -5.570  1.00 0.00 ? 43 THR S HB   7  
ATOM 7171  H HG1  . THR A 1 34 ? -4.448  -6.210  -6.865  1.00 0.00 ? 43 THR S HG1  7  
ATOM 7172  H HG21 . THR A 1 34 ? -3.002  -3.283  -7.574  1.00 0.00 ? 43 THR S HG21 7  
ATOM 7173  H HG22 . THR A 1 34 ? -4.237  -2.491  -6.595  1.00 0.00 ? 43 THR S HG22 7  
ATOM 7174  H HG23 . THR A 1 34 ? -4.704  -3.665  -7.824  1.00 0.00 ? 43 THR S HG23 7  
ATOM 7175  N N    . ASP A 1 35 ? -1.132  -5.385  -6.401  1.00 0.00 ? 44 ASP S N    7  
ATOM 7176  C CA   . ASP A 1 35 ? 0.137   -5.584  -7.091  1.00 0.00 ? 44 ASP S CA   7  
ATOM 7177  C C    . ASP A 1 35 ? 0.387   -4.477  -8.101  1.00 0.00 ? 44 ASP S C    7  
ATOM 7178  O O    . ASP A 1 35 ? 1.527   -4.082  -8.327  1.00 0.00 ? 44 ASP S O    7  
ATOM 7179  C CB   . ASP A 1 35 ? 0.151   -6.943  -7.793  1.00 0.00 ? 44 ASP S CB   7  
ATOM 7180  C CG   . ASP A 1 35 ? -1.064  -7.148  -8.678  1.00 0.00 ? 44 ASP S CG   7  
ATOM 7181  O OD1  . ASP A 1 35 ? -1.027  -6.706  -9.847  1.00 0.00 ? 44 ASP S OD1  7  
ATOM 7182  O OD2  . ASP A 1 35 ? -2.049  -7.748  -8.203  1.00 0.00 ? 44 ASP S OD2  7  
ATOM 7183  H H    . ASP A 1 35 ? -1.815  -6.056  -6.491  1.00 0.00 ? 44 ASP S H    7  
ATOM 7184  H HA   . ASP A 1 35 ? 0.924   -5.566  -6.351  1.00 0.00 ? 44 ASP S HA   7  
ATOM 7185  H HB2  . ASP A 1 35 ? 1.038   -7.014  -8.409  1.00 0.00 ? 44 ASP S HB2  7  
ATOM 7186  H HB3  . ASP A 1 35 ? 0.168   -7.727  -7.048  1.00 0.00 ? 44 ASP S HB3  7  
ATOM 7187  N N    . GLU A 1 36 ? -0.684  -3.973  -8.699  1.00 0.00 ? 45 GLU S N    7  
ATOM 7188  C CA   . GLU A 1 36 ? -0.560  -2.896  -9.669  1.00 0.00 ? 45 GLU S CA   7  
ATOM 7189  C C    . GLU A 1 36 ? -0.142  -1.625  -8.948  1.00 0.00 ? 45 GLU S C    7  
ATOM 7190  O O    . GLU A 1 36 ? 0.871   -1.010  -9.283  1.00 0.00 ? 45 GLU S O    7  
ATOM 7191  C CB   . GLU A 1 36 ? -1.880  -2.669  -10.394 1.00 0.00 ? 45 GLU S CB   7  
ATOM 7192  C CG   . GLU A 1 36 ? -2.404  -3.902  -11.112 1.00 0.00 ? 45 GLU S CG   7  
ATOM 7193  C CD   . GLU A 1 36 ? -2.174  -3.846  -12.610 1.00 0.00 ? 45 GLU S CD   7  
ATOM 7194  O OE1  . GLU A 1 36 ? -2.142  -2.727  -13.163 1.00 0.00 ? 45 GLU S OE1  7  
ATOM 7195  O OE2  . GLU A 1 36 ? -2.026  -4.921  -13.228 1.00 0.00 ? 45 GLU S OE2  7  
ATOM 7196  H H    . GLU A 1 36 ? -1.571  -4.321  -8.475  1.00 0.00 ? 45 GLU S H    7  
ATOM 7197  H HA   . GLU A 1 36 ? 0.201   -3.168  -10.383 1.00 0.00 ? 45 GLU S HA   7  
ATOM 7198  H HB2  . GLU A 1 36 ? -2.619  -2.356  -9.672  1.00 0.00 ? 45 GLU S HB2  7  
ATOM 7199  H HB3  . GLU A 1 36 ? -1.742  -1.884  -11.120 1.00 0.00 ? 45 GLU S HB3  7  
ATOM 7200  H HG2  . GLU A 1 36 ? -1.902  -4.773  -10.719 1.00 0.00 ? 45 GLU S HG2  7  
ATOM 7201  H HG3  . GLU A 1 36 ? -3.466  -3.987  -10.927 1.00 0.00 ? 45 GLU S HG3  7  
ATOM 7202  N N    . ASP A 1 37 ? -0.913  -1.264  -7.929  1.00 0.00 ? 46 ASP S N    7  
ATOM 7203  C CA   . ASP A 1 37 ? -0.611  -0.099  -7.123  1.00 0.00 ? 46 ASP S CA   7  
ATOM 7204  C C    . ASP A 1 37 ? 0.721   -0.323  -6.417  1.00 0.00 ? 46 ASP S C    7  
ATOM 7205  O O    . ASP A 1 37 ? 1.474   0.615   -6.154  1.00 0.00 ? 46 ASP S O    7  
ATOM 7206  C CB   . ASP A 1 37 ? -1.737  0.130   -6.114  1.00 0.00 ? 46 ASP S CB   7  
ATOM 7207  C CG   . ASP A 1 37 ? -1.481  1.317   -5.207  1.00 0.00 ? 46 ASP S CG   7  
ATOM 7208  O OD1  . ASP A 1 37 ? -0.349  1.449   -4.698  1.00 0.00 ? 46 ASP S OD1  7  
ATOM 7209  O OD2  . ASP A 1 37 ? -2.419  2.117   -5.001  1.00 0.00 ? 46 ASP S OD2  7  
ATOM 7210  H H    . ASP A 1 37 ? -1.689  -1.813  -7.692  1.00 0.00 ? 46 ASP S H    7  
ATOM 7211  H HA   . ASP A 1 37 ? -0.530  0.757   -7.778  1.00 0.00 ? 46 ASP S HA   7  
ATOM 7212  H HB2  . ASP A 1 37 ? -2.657  0.308   -6.653  1.00 0.00 ? 46 ASP S HB2  7  
ATOM 7213  H HB3  . ASP A 1 37 ? -1.848  -0.758  -5.504  1.00 0.00 ? 46 ASP S HB3  7  
ATOM 7214  N N    . PHE A 1 38 ? 1.011   -1.596  -6.149  1.00 0.00 ? 47 PHE S N    7  
ATOM 7215  C CA   . PHE A 1 38 ? 2.257   -1.994  -5.512  1.00 0.00 ? 47 PHE S CA   7  
ATOM 7216  C C    . PHE A 1 38 ? 3.400   -1.833  -6.493  1.00 0.00 ? 47 PHE S C    7  
ATOM 7217  O O    . PHE A 1 38 ? 4.445   -1.274  -6.169  1.00 0.00 ? 47 PHE S O    7  
ATOM 7218  C CB   . PHE A 1 38 ? 2.189   -3.463  -5.085  1.00 0.00 ? 47 PHE S CB   7  
ATOM 7219  C CG   . PHE A 1 38 ? 2.178   -3.681  -3.604  1.00 0.00 ? 47 PHE S CG   7  
ATOM 7220  C CD1  . PHE A 1 38 ? 3.321   -3.483  -2.850  1.00 0.00 ? 47 PHE S CD1  7  
ATOM 7221  C CD2  . PHE A 1 38 ? 1.024   -4.101  -2.970  1.00 0.00 ? 47 PHE S CD2  7  
ATOM 7222  C CE1  . PHE A 1 38 ? 3.312   -3.696  -1.486  1.00 0.00 ? 47 PHE S CE1  7  
ATOM 7223  C CE2  . PHE A 1 38 ? 1.005   -4.318  -1.609  1.00 0.00 ? 47 PHE S CE2  7  
ATOM 7224  C CZ   . PHE A 1 38 ? 2.153   -4.115  -0.864  1.00 0.00 ? 47 PHE S CZ   7  
ATOM 7225  H H    . PHE A 1 38 ? 0.374   -2.291  -6.408  1.00 0.00 ? 47 PHE S H    7  
ATOM 7226  H HA   . PHE A 1 38 ? 2.424   -1.369  -4.648  1.00 0.00 ? 47 PHE S HA   7  
ATOM 7227  H HB2  . PHE A 1 38 ? 1.293   -3.903  -5.488  1.00 0.00 ? 47 PHE S HB2  7  
ATOM 7228  H HB3  . PHE A 1 38 ? 3.046   -3.982  -5.486  1.00 0.00 ? 47 PHE S HB3  7  
ATOM 7229  H HD1  . PHE A 1 38 ? 4.227   -3.155  -3.338  1.00 0.00 ? 47 PHE S HD1  7  
ATOM 7230  H HD2  . PHE A 1 38 ? 0.128   -4.261  -3.553  1.00 0.00 ? 47 PHE S HD2  7  
ATOM 7231  H HE1  . PHE A 1 38 ? 4.210   -3.542  -0.909  1.00 0.00 ? 47 PHE S HE1  7  
ATOM 7232  H HE2  . PHE A 1 38 ? 0.095   -4.647  -1.129  1.00 0.00 ? 47 PHE S HE2  7  
ATOM 7233  H HZ   . PHE A 1 38 ? 2.144   -4.281  0.202   1.00 0.00 ? 47 PHE S HZ   7  
ATOM 7234  N N    . GLU A 1 39 ? 3.191   -2.357  -7.695  1.00 0.00 ? 48 GLU S N    7  
ATOM 7235  C CA   . GLU A 1 39 ? 4.209   -2.302  -8.740  1.00 0.00 ? 48 GLU S CA   7  
ATOM 7236  C C    . GLU A 1 39 ? 4.476   -0.870  -9.194  1.00 0.00 ? 48 GLU S C    7  
ATOM 7237  O O    . GLU A 1 39 ? 5.614   -0.506  -9.488  1.00 0.00 ? 48 GLU S O    7  
ATOM 7238  C CB   . GLU A 1 39 ? 3.783   -3.156  -9.936  1.00 0.00 ? 48 GLU S CB   7  
ATOM 7239  C CG   . GLU A 1 39 ? 4.101   -4.634  -9.772  1.00 0.00 ? 48 GLU S CG   7  
ATOM 7240  C CD   . GLU A 1 39 ? 5.248   -5.085  -10.655 1.00 0.00 ? 48 GLU S CD   7  
ATOM 7241  O OE1  . GLU A 1 39 ? 5.168   -4.881  -11.884 1.00 0.00 ? 48 GLU S OE1  7  
ATOM 7242  O OE2  . GLU A 1 39 ? 6.227   -5.642  -10.116 1.00 0.00 ? 48 GLU S OE2  7  
ATOM 7243  H H    . GLU A 1 39 ? 2.324   -2.808  -7.881  1.00 0.00 ? 48 GLU S H    7  
ATOM 7244  H HA   . GLU A 1 39 ? 5.121   -2.710  -8.331  1.00 0.00 ? 48 GLU S HA   7  
ATOM 7245  H HB2  . GLU A 1 39 ? 2.717   -3.052  -10.076 1.00 0.00 ? 48 GLU S HB2  7  
ATOM 7246  H HB3  . GLU A 1 39 ? 4.292   -2.796  -10.819 1.00 0.00 ? 48 GLU S HB3  7  
ATOM 7247  H HG2  . GLU A 1 39 ? 4.367   -4.820  -8.740  1.00 0.00 ? 48 GLU S HG2  7  
ATOM 7248  H HG3  . GLU A 1 39 ? 3.219   -5.208  -10.030 1.00 0.00 ? 48 GLU S HG3  7  
ATOM 7249  N N    . PHE A 1 40 ? 3.422   -0.069  -9.263  1.00 0.00 ? 49 PHE S N    7  
ATOM 7250  C CA   . PHE A 1 40 ? 3.543   1.316   -9.702  1.00 0.00 ? 49 PHE S CA   7  
ATOM 7251  C C    . PHE A 1 40 ? 4.431   2.142   -8.772  1.00 0.00 ? 49 PHE S C    7  
ATOM 7252  O O    . PHE A 1 40 ? 5.331   2.847   -9.229  1.00 0.00 ? 49 PHE S O    7  
ATOM 7253  C CB   . PHE A 1 40 ? 2.160   1.960   -9.801  1.00 0.00 ? 49 PHE S CB   7  
ATOM 7254  C CG   . PHE A 1 40 ? 2.146   3.226   -10.610 1.00 0.00 ? 49 PHE S CG   7  
ATOM 7255  C CD1  . PHE A 1 40 ? 2.571   4.423   -10.056 1.00 0.00 ? 49 PHE S CD1  7  
ATOM 7256  C CD2  . PHE A 1 40 ? 1.710   3.217   -11.926 1.00 0.00 ? 49 PHE S CD2  7  
ATOM 7257  C CE1  . PHE A 1 40 ? 2.561   5.589   -10.800 1.00 0.00 ? 49 PHE S CE1  7  
ATOM 7258  C CE2  . PHE A 1 40 ? 1.698   4.379   -12.674 1.00 0.00 ? 49 PHE S CE2  7  
ATOM 7259  C CZ   . PHE A 1 40 ? 2.124   5.567   -12.110 1.00 0.00 ? 49 PHE S CZ   7  
ATOM 7260  H H    . PHE A 1 40 ? 2.539   -0.420  -9.027  1.00 0.00 ? 49 PHE S H    7  
ATOM 7261  H HA   . PHE A 1 40 ? 3.990   1.309   -10.684 1.00 0.00 ? 49 PHE S HA   7  
ATOM 7262  H HB2  . PHE A 1 40 ? 1.477   1.262   -10.263 1.00 0.00 ? 49 PHE S HB2  7  
ATOM 7263  H HB3  . PHE A 1 40 ? 1.809   2.197   -8.805  1.00 0.00 ? 49 PHE S HB3  7  
ATOM 7264  H HD1  . PHE A 1 40 ? 2.913   4.440   -9.032  1.00 0.00 ? 49 PHE S HD1  7  
ATOM 7265  H HD2  . PHE A 1 40 ? 1.377   2.290   -12.368 1.00 0.00 ? 49 PHE S HD2  7  
ATOM 7266  H HE1  . PHE A 1 40 ? 2.895   6.515   -10.356 1.00 0.00 ? 49 PHE S HE1  7  
ATOM 7267  H HE2  . PHE A 1 40 ? 1.356   4.361   -13.698 1.00 0.00 ? 49 PHE S HE2  7  
ATOM 7268  H HZ   . PHE A 1 40 ? 2.116   6.475   -12.692 1.00 0.00 ? 49 PHE S HZ   7  
ATOM 7269  N N    . ALA A 1 41 ? 4.160   2.081   -7.472  1.00 0.00 ? 50 ALA S N    7  
ATOM 7270  C CA   . ALA A 1 41 ? 4.925   2.859   -6.499  1.00 0.00 ? 50 ALA S CA   7  
ATOM 7271  C C    . ALA A 1 41 ? 5.991   2.034   -5.776  1.00 0.00 ? 50 ALA S C    7  
ATOM 7272  O O    . ALA A 1 41 ? 7.121   2.490   -5.604  1.00 0.00 ? 50 ALA S O    7  
ATOM 7273  C CB   . ALA A 1 41 ? 3.981   3.489   -5.487  1.00 0.00 ? 50 ALA S CB   7  
ATOM 7274  H H    . ALA A 1 41 ? 3.417   1.521   -7.162  1.00 0.00 ? 50 ALA S H    7  
ATOM 7275  H HA   . ALA A 1 41 ? 5.414   3.659   -7.033  1.00 0.00 ? 50 ALA S HA   7  
ATOM 7276  H HB1  . ALA A 1 41 ? 4.466   4.337   -5.024  1.00 0.00 ? 50 ALA S HB1  7  
ATOM 7277  H HB2  . ALA A 1 41 ? 3.729   2.763   -4.728  1.00 0.00 ? 50 ALA S HB2  7  
ATOM 7278  H HB3  . ALA A 1 41 ? 3.082   3.816   -5.987  1.00 0.00 ? 50 ALA S HB3  7  
ATOM 7279  N N    . LEU A 1 42 ? 5.624   0.839   -5.326  1.00 0.00 ? 51 LEU S N    7  
ATOM 7280  C CA   . LEU A 1 42 ? 6.553   -0.014  -4.589  1.00 0.00 ? 51 LEU S CA   7  
ATOM 7281  C C    . LEU A 1 42 ? 7.351   -0.937  -5.513  1.00 0.00 ? 51 LEU S C    7  
ATOM 7282  O O    . LEU A 1 42 ? 8.386   -1.472  -5.116  1.00 0.00 ? 51 LEU S O    7  
ATOM 7283  C CB   . LEU A 1 42 ? 5.791   -0.843  -3.551  1.00 0.00 ? 51 LEU S CB   7  
ATOM 7284  C CG   . LEU A 1 42 ? 5.458   -0.114  -2.242  1.00 0.00 ? 51 LEU S CG   7  
ATOM 7285  C CD1  . LEU A 1 42 ? 4.904   1.272   -2.514  1.00 0.00 ? 51 LEU S CD1  7  
ATOM 7286  C CD2  . LEU A 1 42 ? 4.471   -0.922  -1.418  1.00 0.00 ? 51 LEU S CD2  7  
ATOM 7287  H H    . LEU A 1 42 ? 4.703   0.536   -5.469  1.00 0.00 ? 51 LEU S H    7  
ATOM 7288  H HA   . LEU A 1 42 ? 7.245   0.633   -4.071  1.00 0.00 ? 51 LEU S HA   7  
ATOM 7289  H HB2  . LEU A 1 42 ? 4.866   -1.176  -3.997  1.00 0.00 ? 51 LEU S HB2  7  
ATOM 7290  H HB3  . LEU A 1 42 ? 6.387   -1.711  -3.309  1.00 0.00 ? 51 LEU S HB3  7  
ATOM 7291  H HG   . LEU A 1 42 ? 6.359   0.004   -1.660  1.00 0.00 ? 51 LEU S HG   7  
ATOM 7292  H HD11 . LEU A 1 42 ? 5.715   1.986   -2.513  1.00 0.00 ? 51 LEU S HD11 7  
ATOM 7293  H HD12 . LEU A 1 42 ? 4.195   1.530   -1.741  1.00 0.00 ? 51 LEU S HD12 7  
ATOM 7294  H HD13 . LEU A 1 42 ? 4.412   1.282   -3.472  1.00 0.00 ? 51 LEU S HD13 7  
ATOM 7295  H HD21 . LEU A 1 42 ? 4.946   -1.827  -1.074  1.00 0.00 ? 51 LEU S HD21 7  
ATOM 7296  H HD22 . LEU A 1 42 ? 3.615   -1.174  -2.026  1.00 0.00 ? 51 LEU S HD22 7  
ATOM 7297  H HD23 . LEU A 1 42 ? 4.149   -0.340  -0.567  1.00 0.00 ? 51 LEU S HD23 7  
ATOM 7298  N N    . ASP A 1 43 ? 6.873   -1.123  -6.738  1.00 0.00 ? 52 ASP S N    7  
ATOM 7299  C CA   . ASP A 1 43 ? 7.558   -1.987  -7.697  1.00 0.00 ? 52 ASP S CA   7  
ATOM 7300  C C    . ASP A 1 43 ? 7.654   -3.425  -7.185  1.00 0.00 ? 52 ASP S C    7  
ATOM 7301  O O    . ASP A 1 43 ? 8.460   -4.212  -7.677  1.00 0.00 ? 52 ASP S O    7  
ATOM 7302  C CB   . ASP A 1 43 ? 8.959   -1.446  -7.988  1.00 0.00 ? 52 ASP S CB   7  
ATOM 7303  C CG   . ASP A 1 43 ? 8.947   0.026   -8.347  1.00 0.00 ? 52 ASP S CG   7  
ATOM 7304  O OD1  . ASP A 1 43 ? 8.334   0.381   -9.376  1.00 0.00 ? 52 ASP S OD1  7  
ATOM 7305  O OD2  . ASP A 1 43 ? 9.549   0.826   -7.600  1.00 0.00 ? 52 ASP S OD2  7  
ATOM 7306  H H    . ASP A 1 43 ? 6.043   -0.675  -7.007  1.00 0.00 ? 52 ASP S H    7  
ATOM 7307  H HA   . ASP A 1 43 ? 6.986   -1.983  -8.611  1.00 0.00 ? 52 ASP S HA   7  
ATOM 7308  H HB2  . ASP A 1 43 ? 9.578   -1.577  -7.111  1.00 0.00 ? 52 ASP S HB2  7  
ATOM 7309  H HB3  . ASP A 1 43 ? 9.387   -1.997  -8.813  1.00 0.00 ? 52 ASP S HB3  7  
ATOM 7310  N N    . MET A 1 44 ? 6.825   -3.763  -6.199  1.00 0.00 ? 53 MET S N    7  
ATOM 7311  C CA   . MET A 1 44 ? 6.822   -5.109  -5.632  1.00 0.00 ? 53 MET S CA   7  
ATOM 7312  C C    . MET A 1 44 ? 5.398   -5.656  -5.565  1.00 0.00 ? 53 MET S C    7  
ATOM 7313  O O    . MET A 1 44 ? 4.520   -5.190  -6.288  1.00 0.00 ? 53 MET S O    7  
ATOM 7314  C CB   . MET A 1 44 ? 7.465   -5.102  -4.244  1.00 0.00 ? 53 MET S CB   7  
ATOM 7315  C CG   . MET A 1 44 ? 8.553   -6.151  -4.079  1.00 0.00 ? 53 MET S CG   7  
ATOM 7316  S SD   . MET A 1 44 ? 9.931   -5.907  -5.217  1.00 0.00 ? 53 MET S SD   7  
ATOM 7317  C CE   . MET A 1 44 ? 10.639  -4.392  -4.576  1.00 0.00 ? 53 MET S CE   7  
ATOM 7318  H H    . MET A 1 44 ? 6.200   -3.097  -5.846  1.00 0.00 ? 53 MET S H    7  
ATOM 7319  H HA   . MET A 1 44 ? 7.405   -5.742  -6.285  1.00 0.00 ? 53 MET S HA   7  
ATOM 7320  H HB2  . MET A 1 44 ? 7.902   -4.129  -4.069  1.00 0.00 ? 53 MET S HB2  7  
ATOM 7321  H HB3  . MET A 1 44 ? 6.700   -5.286  -3.502  1.00 0.00 ? 53 MET S HB3  7  
ATOM 7322  H HG2  . MET A 1 44 ? 8.927   -6.106  -3.070  1.00 0.00 ? 53 MET S HG2  7  
ATOM 7323  H HG3  . MET A 1 44 ? 8.124   -7.125  -4.260  1.00 0.00 ? 53 MET S HG3  7  
ATOM 7324  H HE1  . MET A 1 44 ? 11.231  -3.918  -5.345  1.00 0.00 ? 53 MET S HE1  7  
ATOM 7325  H HE2  . MET A 1 44 ? 11.268  -4.620  -3.727  1.00 0.00 ? 53 MET S HE2  7  
ATOM 7326  H HE3  . MET A 1 44 ? 9.847   -3.726  -4.269  1.00 0.00 ? 53 MET S HE3  7  
ATOM 7327  N N    . THR A 1 45 ? 5.164   -6.643  -4.700  1.00 0.00 ? 54 THR S N    7  
ATOM 7328  C CA   . THR A 1 45 ? 3.835   -7.222  -4.564  1.00 0.00 ? 54 THR S CA   7  
ATOM 7329  C C    . THR A 1 45 ? 3.457   -7.349  -3.097  1.00 0.00 ? 54 THR S C    7  
ATOM 7330  O O    . THR A 1 45 ? 4.326   -7.478  -2.234  1.00 0.00 ? 54 THR S O    7  
ATOM 7331  C CB   . THR A 1 45 ? 3.771   -8.593  -5.242  1.00 0.00 ? 54 THR S CB   7  
ATOM 7332  O OG1  . THR A 1 45 ? 4.294   -9.600  -4.394  1.00 0.00 ? 54 THR S OG1  7  
ATOM 7333  C CG2  . THR A 1 45 ? 4.531   -8.655  -6.549  1.00 0.00 ? 54 THR S CG2  7  
ATOM 7334  H H    . THR A 1 45 ? 5.893   -6.986  -4.136  1.00 0.00 ? 54 THR S H    7  
ATOM 7335  H HA   . THR A 1 45 ? 3.133   -6.558  -5.047  1.00 0.00 ? 54 THR S HA   7  
ATOM 7336  H HB   . THR A 1 45 ? 2.736   -8.831  -5.451  1.00 0.00 ? 54 THR S HB   7  
ATOM 7337  H HG1  . THR A 1 45 ? 3.585   -10.186 -4.117  1.00 0.00 ? 54 THR S HG1  7  
ATOM 7338  H HG21 . THR A 1 45 ? 4.602   -9.681  -6.878  1.00 0.00 ? 54 THR S HG21 7  
ATOM 7339  H HG22 . THR A 1 45 ? 5.524   -8.253  -6.408  1.00 0.00 ? 54 THR S HG22 7  
ATOM 7340  H HG23 . THR A 1 45 ? 4.011   -8.073  -7.296  1.00 0.00 ? 54 THR S HG23 7  
ATOM 7341  N N    . ARG A 1 46 ? 2.162   -7.335  -2.811  1.00 0.00 ? 55 ARG S N    7  
ATOM 7342  C CA   . ARG A 1 46 ? 1.695   -7.474  -1.439  1.00 0.00 ? 55 ARG S CA   7  
ATOM 7343  C C    . ARG A 1 46 ? 2.221   -8.777  -0.842  1.00 0.00 ? 55 ARG S C    7  
ATOM 7344  O O    . ARG A 1 46 ? 2.386   -8.894  0.370   1.00 0.00 ? 55 ARG S O    7  
ATOM 7345  C CB   . ARG A 1 46 ? 0.167   -7.448  -1.385  1.00 0.00 ? 55 ARG S CB   7  
ATOM 7346  C CG   . ARG A 1 46 ? -0.391  -7.520  0.028   1.00 0.00 ? 55 ARG S CG   7  
ATOM 7347  C CD   . ARG A 1 46 ? -0.084  -6.254  0.812   1.00 0.00 ? 55 ARG S CD   7  
ATOM 7348  N NE   . ARG A 1 46 ? 0.140   -6.529  2.230   1.00 0.00 ? 55 ARG S NE   7  
ATOM 7349  C CZ   . ARG A 1 46 ? -0.839  -6.713  3.112   1.00 0.00 ? 55 ARG S CZ   7  
ATOM 7350  N NH1  . ARG A 1 46 ? -2.107  -6.656  2.730   1.00 0.00 ? 55 ARG S NH1  7  
ATOM 7351  N NH2  . ARG A 1 46 ? -0.546  -6.958  4.384   1.00 0.00 ? 55 ARG S NH2  7  
ATOM 7352  H H    . ARG A 1 46 ? 1.508   -7.246  -3.537  1.00 0.00 ? 55 ARG S H    7  
ATOM 7353  H HA   . ARG A 1 46 ? 2.086   -6.644  -0.869  1.00 0.00 ? 55 ARG S HA   7  
ATOM 7354  H HB2  . ARG A 1 46 ? -0.184  -6.534  -1.843  1.00 0.00 ? 55 ARG S HB2  7  
ATOM 7355  H HB3  . ARG A 1 46 ? -0.217  -8.293  -1.943  1.00 0.00 ? 55 ARG S HB3  7  
ATOM 7356  H HG2  . ARG A 1 46 ? -1.463  -7.648  -0.024  1.00 0.00 ? 55 ARG S HG2  7  
ATOM 7357  H HG3  . ARG A 1 46 ? 0.050   -8.365  0.537   1.00 0.00 ? 55 ARG S HG3  7  
ATOM 7358  H HD2  . ARG A 1 46 ? 0.803   -5.797  0.400   1.00 0.00 ? 55 ARG S HD2  7  
ATOM 7359  H HD3  . ARG A 1 46 ? -0.917  -5.574  0.713   1.00 0.00 ? 55 ARG S HD3  7  
ATOM 7360  H HE   . ARG A 1 46 ? 1.069   -6.578  2.540   1.00 0.00 ? 55 ARG S HE   7  
ATOM 7361  H HH11 . ARG A 1 46 ? -2.336  -6.473  1.775   1.00 0.00 ? 55 ARG S HH11 7  
ATOM 7362  H HH12 . ARG A 1 46 ? -2.838  -6.796  3.399   1.00 0.00 ? 55 ARG S HH12 7  
ATOM 7363  H HH21 . ARG A 1 46 ? 0.408   -7.004  4.678   1.00 0.00 ? 55 ARG S HH21 7  
ATOM 7364  H HH22 . ARG A 1 46 ? -1.282  -7.097  5.046   1.00 0.00 ? 55 ARG S HH22 7  
ATOM 7365  N N    . ASP A 1 47 ? 2.487   -9.749  -1.714  1.00 0.00 ? 56 ASP S N    7  
ATOM 7366  C CA   . ASP A 1 47 ? 2.997   -11.049 -1.297  1.00 0.00 ? 56 ASP S CA   7  
ATOM 7367  C C    . ASP A 1 47 ? 4.527   -11.075 -1.286  1.00 0.00 ? 56 ASP S C    7  
ATOM 7368  O O    . ASP A 1 47 ? 5.132   -12.025 -0.787  1.00 0.00 ? 56 ASP S O    7  
ATOM 7369  C CB   . ASP A 1 47 ? 2.463   -12.147 -2.222  1.00 0.00 ? 56 ASP S CB   7  
ATOM 7370  C CG   . ASP A 1 47 ? 1.644   -13.183 -1.476  1.00 0.00 ? 56 ASP S CG   7  
ATOM 7371  O OD1  . ASP A 1 47 ? 0.541   -12.841 -1.004  1.00 0.00 ? 56 ASP S OD1  7  
ATOM 7372  O OD2  . ASP A 1 47 ? 2.107   -14.338 -1.367  1.00 0.00 ? 56 ASP S OD2  7  
ATOM 7373  H H    . ASP A 1 47 ? 2.335   -9.585  -2.668  1.00 0.00 ? 56 ASP S H    7  
ATOM 7374  H HA   . ASP A 1 47 ? 2.642   -11.236 -0.294  1.00 0.00 ? 56 ASP S HA   7  
ATOM 7375  H HB2  . ASP A 1 47 ? 1.836   -11.697 -2.978  1.00 0.00 ? 56 ASP S HB2  7  
ATOM 7376  H HB3  . ASP A 1 47 ? 3.293   -12.646 -2.699  1.00 0.00 ? 56 ASP S HB3  7  
ATOM 7377  N N    . GLU A 1 48 ? 5.152   -10.028 -1.822  1.00 0.00 ? 57 GLU S N    7  
ATOM 7378  C CA   . GLU A 1 48 ? 6.608   -9.943  -1.849  1.00 0.00 ? 57 GLU S CA   7  
ATOM 7379  C C    . GLU A 1 48 ? 7.069   -9.145  -0.648  1.00 0.00 ? 57 GLU S C    7  
ATOM 7380  O O    . GLU A 1 48 ? 7.879   -9.606  0.155   1.00 0.00 ? 57 GLU S O    7  
ATOM 7381  C CB   . GLU A 1 48 ? 7.089   -9.281  -3.142  1.00 0.00 ? 57 GLU S CB   7  
ATOM 7382  C CG   . GLU A 1 48 ? 8.532   -9.606  -3.492  1.00 0.00 ? 57 GLU S CG   7  
ATOM 7383  C CD   . GLU A 1 48 ? 8.768   -9.672  -4.988  1.00 0.00 ? 57 GLU S CD   7  
ATOM 7384  O OE1  . GLU A 1 48 ? 8.126   -8.896  -5.725  1.00 0.00 ? 57 GLU S OE1  7  
ATOM 7385  O OE2  . GLU A 1 48 ? 9.596   -10.501 -5.421  1.00 0.00 ? 57 GLU S OE2  7  
ATOM 7386  H H    . GLU A 1 48 ? 4.628   -9.284  -2.186  1.00 0.00 ? 57 GLU S H    7  
ATOM 7387  H HA   . GLU A 1 48 ? 7.007   -10.945 -1.786  1.00 0.00 ? 57 GLU S HA   7  
ATOM 7388  H HB2  . GLU A 1 48 ? 6.462   -9.612  -3.958  1.00 0.00 ? 57 GLU S HB2  7  
ATOM 7389  H HB3  . GLU A 1 48 ? 6.997   -8.209  -3.038  1.00 0.00 ? 57 GLU S HB3  7  
ATOM 7390  H HG2  . GLU A 1 48 ? 9.170   -8.839  -3.076  1.00 0.00 ? 57 GLU S HG2  7  
ATOM 7391  H HG3  . GLU A 1 48 ? 8.788   -10.561 -3.057  1.00 0.00 ? 57 GLU S HG3  7  
ATOM 7392  N N    . TYR A 1 49 ? 6.499   -7.958  -0.516  1.00 0.00 ? 58 TYR S N    7  
ATOM 7393  C CA   . TYR A 1 49 ? 6.791   -7.092  0.607   1.00 0.00 ? 58 TYR S CA   7  
ATOM 7394  C C    . TYR A 1 49 ? 6.331   -7.775  1.887   1.00 0.00 ? 58 TYR S C    7  
ATOM 7395  O O    . TYR A 1 49 ? 6.914   -7.584  2.953   1.00 0.00 ? 58 TYR S O    7  
ATOM 7396  C CB   . TYR A 1 49 ? 6.054   -5.768  0.433   1.00 0.00 ? 58 TYR S CB   7  
ATOM 7397  C CG   . TYR A 1 49 ? 6.868   -4.695  -0.257  1.00 0.00 ? 58 TYR S CG   7  
ATOM 7398  C CD1  . TYR A 1 49 ? 7.924   -5.023  -1.098  1.00 0.00 ? 58 TYR S CD1  7  
ATOM 7399  C CD2  . TYR A 1 49 ? 6.586   -3.351  -0.054  1.00 0.00 ? 58 TYR S CD2  7  
ATOM 7400  C CE1  . TYR A 1 49 ? 8.675   -4.041  -1.717  1.00 0.00 ? 58 TYR S CE1  7  
ATOM 7401  C CE2  . TYR A 1 49 ? 7.331   -2.364  -0.671  1.00 0.00 ? 58 TYR S CE2  7  
ATOM 7402  C CZ   . TYR A 1 49 ? 8.373   -2.715  -1.501  1.00 0.00 ? 58 TYR S CZ   7  
ATOM 7403  O OH   . TYR A 1 49 ? 9.119   -1.734  -2.116  1.00 0.00 ? 58 TYR S OH   7  
ATOM 7404  H H    . TYR A 1 49 ? 5.836   -7.672  -1.178  1.00 0.00 ? 58 TYR S H    7  
ATOM 7405  H HA   . TYR A 1 49 ? 7.853   -6.917  0.647   1.00 0.00 ? 58 TYR S HA   7  
ATOM 7406  H HB2  . TYR A 1 49 ? 5.168   -5.938  -0.162  1.00 0.00 ? 58 TYR S HB2  7  
ATOM 7407  H HB3  . TYR A 1 49 ? 5.761   -5.402  1.399   1.00 0.00 ? 58 TYR S HB3  7  
ATOM 7408  H HD1  . TYR A 1 49 ? 8.157   -6.063  -1.266  1.00 0.00 ? 58 TYR S HD1  7  
ATOM 7409  H HD2  . TYR A 1 49 ? 5.768   -3.079  0.597   1.00 0.00 ? 58 TYR S HD2  7  
ATOM 7410  H HE1  . TYR A 1 49 ? 9.492   -4.317  -2.368  1.00 0.00 ? 58 TYR S HE1  7  
ATOM 7411  H HE2  . TYR A 1 49 ? 7.095   -1.325  -0.499  1.00 0.00 ? 58 TYR S HE2  7  
ATOM 7412  H HH   . TYR A 1 49 ? 8.542   -1.173  -2.637  1.00 0.00 ? 58 TYR S HH   7  
ATOM 7413  N N    . ASN A 1 50 ? 5.280   -8.580  1.765   1.00 0.00 ? 59 ASN S N    7  
ATOM 7414  C CA   . ASN A 1 50 ? 4.735   -9.305  2.914   1.00 0.00 ? 59 ASN S CA   7  
ATOM 7415  C C    . ASN A 1 50 ? 5.824   -10.098 3.638   1.00 0.00 ? 59 ASN S C    7  
ATOM 7416  O O    . ASN A 1 50 ? 5.737   -10.328 4.843   1.00 0.00 ? 59 ASN S O    7  
ATOM 7417  C CB   . ASN A 1 50 ? 3.619   -10.253 2.469   1.00 0.00 ? 59 ASN S CB   7  
ATOM 7418  C CG   . ASN A 1 50 ? 2.247   -9.778  2.908   1.00 0.00 ? 59 ASN S CG   7  
ATOM 7419  O OD1  . ASN A 1 50 ? 2.122   -8.960  3.819   1.00 0.00 ? 59 ASN S OD1  7  
ATOM 7420  N ND2  . ASN A 1 50 ? 1.208   -10.291 2.259   1.00 0.00 ? 59 ASN S ND2  7  
ATOM 7421  H H    . ASN A 1 50 ? 4.860   -8.689  0.879   1.00 0.00 ? 59 ASN S H    7  
ATOM 7422  H HA   . ASN A 1 50 ? 4.324   -8.577  3.598   1.00 0.00 ? 59 ASN S HA   7  
ATOM 7423  H HB2  . ASN A 1 50 ? 3.627   -10.330 1.393   1.00 0.00 ? 59 ASN S HB2  7  
ATOM 7424  H HB3  . ASN A 1 50 ? 3.793   -11.231 2.895   1.00 0.00 ? 59 ASN S HB3  7  
ATOM 7425  H HD21 . ASN A 1 50 ? 1.383   -10.939 1.545   1.00 0.00 ? 59 ASN S HD21 7  
ATOM 7426  H HD22 . ASN A 1 50 ? 0.310   -10.003 2.523   1.00 0.00 ? 59 ASN S HD22 7  
ATOM 7427  N N    . ALA A 1 51 ? 6.841   -10.520 2.893   1.00 0.00 ? 60 ALA S N    7  
ATOM 7428  C CA   . ALA A 1 51 ? 7.937   -11.294 3.468   1.00 0.00 ? 60 ALA S CA   7  
ATOM 7429  C C    . ALA A 1 51 ? 9.196   -10.449 3.631   1.00 0.00 ? 60 ALA S C    7  
ATOM 7430  O O    . ALA A 1 51 ? 9.973   -10.652 4.565   1.00 0.00 ? 60 ALA S O    7  
ATOM 7431  C CB   . ALA A 1 51 ? 8.229   -12.512 2.603   1.00 0.00 ? 60 ALA S CB   7  
ATOM 7432  H H    . ALA A 1 51 ? 6.854   -10.311 1.935   1.00 0.00 ? 60 ALA S H    7  
ATOM 7433  H HA   . ALA A 1 51 ? 7.622   -11.643 4.440   1.00 0.00 ? 60 ALA S HA   7  
ATOM 7434  H HB1  . ALA A 1 51 ? 7.962   -12.298 1.579   1.00 0.00 ? 60 ALA S HB1  7  
ATOM 7435  H HB2  . ALA A 1 51 ? 7.650   -13.353 2.958   1.00 0.00 ? 60 ALA S HB2  7  
ATOM 7436  H HB3  . ALA A 1 51 ? 9.281   -12.750 2.660   1.00 0.00 ? 60 ALA S HB3  7  
ATOM 7437  N N    . LEU A 1 52 ? 9.394   -9.503  2.721   1.00 0.00 ? 61 LEU S N    7  
ATOM 7438  C CA   . LEU A 1 52 ? 10.562  -8.631  2.766   1.00 0.00 ? 61 LEU S CA   7  
ATOM 7439  C C    . LEU A 1 52 ? 10.585  -7.819  4.060   1.00 0.00 ? 61 LEU S C    7  
ATOM 7440  O O    . LEU A 1 52 ? 9.553   -7.641  4.707   1.00 0.00 ? 61 LEU S O    7  
ATOM 7441  C CB   . LEU A 1 52 ? 10.564  -7.691  1.559   1.00 0.00 ? 61 LEU S CB   7  
ATOM 7442  C CG   . LEU A 1 52 ? 11.443  -8.137  0.390   1.00 0.00 ? 61 LEU S CG   7  
ATOM 7443  C CD1  . LEU A 1 52 ? 10.795  -7.772  -0.936  1.00 0.00 ? 61 LEU S CD1  7  
ATOM 7444  C CD2  . LEU A 1 52 ? 12.829  -7.518  0.495   1.00 0.00 ? 61 LEU S CD2  7  
ATOM 7445  H H    . LEU A 1 52 ? 8.742   -9.392  1.998   1.00 0.00 ? 61 LEU S H    7  
ATOM 7446  H HA   . LEU A 1 52 ? 11.444  -9.254  2.728   1.00 0.00 ? 61 LEU S HA   7  
ATOM 7447  H HB2  . LEU A 1 52 ? 9.547   -7.600  1.203   1.00 0.00 ? 61 LEU S HB2  7  
ATOM 7448  H HB3  . LEU A 1 52 ? 10.904  -6.717  1.887   1.00 0.00 ? 61 LEU S HB3  7  
ATOM 7449  H HG   . LEU A 1 52 ? 11.553  -9.212  0.421   1.00 0.00 ? 61 LEU S HG   7  
ATOM 7450  H HD11 . LEU A 1 52 ? 10.183  -8.591  -1.277  1.00 0.00 ? 61 LEU S HD11 7  
ATOM 7451  H HD12 . LEU A 1 52 ? 11.562  -7.566  -1.668  1.00 0.00 ? 61 LEU S HD12 7  
ATOM 7452  H HD13 . LEU A 1 52 ? 10.180  -6.893  -0.805  1.00 0.00 ? 61 LEU S HD13 7  
ATOM 7453  H HD21 . LEU A 1 52 ? 12.740  -6.489  0.813   1.00 0.00 ? 61 LEU S HD21 7  
ATOM 7454  H HD22 . LEU A 1 52 ? 13.316  -7.557  -0.469  1.00 0.00 ? 61 LEU S HD22 7  
ATOM 7455  H HD23 . LEU A 1 52 ? 13.415  -8.068  1.216   1.00 0.00 ? 61 LEU S HD23 7  
ATOM 7456  N N    . PRO A 1 53 ? 11.767  -7.313  4.455   1.00 0.00 ? 62 PRO S N    7  
ATOM 7457  C CA   . PRO A 1 53 ? 11.912  -6.514  5.675   1.00 0.00 ? 62 PRO S CA   7  
ATOM 7458  C C    . PRO A 1 53 ? 10.931  -5.349  5.713   1.00 0.00 ? 62 PRO S C    7  
ATOM 7459  O O    . PRO A 1 53 ? 10.648  -4.731  4.688   1.00 0.00 ? 62 PRO S O    7  
ATOM 7460  C CB   . PRO A 1 53 ? 13.354  -6.004  5.603   1.00 0.00 ? 62 PRO S CB   7  
ATOM 7461  C CG   . PRO A 1 53 ? 14.062  -6.993  4.745   1.00 0.00 ? 62 PRO S CG   7  
ATOM 7462  C CD   . PRO A 1 53 ? 13.048  -7.471  3.743   1.00 0.00 ? 62 PRO S CD   7  
ATOM 7463  H HA   . PRO A 1 53 ? 11.784  -7.119  6.561   1.00 0.00 ? 62 PRO S HA   7  
ATOM 7464  H HB2  . PRO A 1 53 ? 13.367  -5.016  5.163   1.00 0.00 ? 62 PRO S HB2  7  
ATOM 7465  H HB3  . PRO A 1 53 ? 13.776  -5.971  6.597   1.00 0.00 ? 62 PRO S HB3  7  
ATOM 7466  H HG2  . PRO A 1 53 ? 14.891  -6.515  4.240   1.00 0.00 ? 62 PRO S HG2  7  
ATOM 7467  H HG3  . PRO A 1 53 ? 14.412  -7.819  5.347   1.00 0.00 ? 62 PRO S HG3  7  
ATOM 7468  H HD2  . PRO A 1 53 ? 13.076  -6.855  2.855   1.00 0.00 ? 62 PRO S HD2  7  
ATOM 7469  H HD3  . PRO A 1 53 ? 13.224  -8.508  3.492   1.00 0.00 ? 62 PRO S HD3  7  
ATOM 7470  N N    . ALA A 1 54 ? 10.409  -5.061  6.900   1.00 0.00 ? 63 ALA S N    7  
ATOM 7471  C CA   . ALA A 1 54 ? 9.449   -3.978  7.072   1.00 0.00 ? 63 ALA S CA   7  
ATOM 7472  C C    . ALA A 1 54 ? 10.064  -2.616  6.762   1.00 0.00 ? 63 ALA S C    7  
ATOM 7473  O O    . ALA A 1 54 ? 9.347   -1.643  6.521   1.00 0.00 ? 63 ALA S O    7  
ATOM 7474  C CB   . ALA A 1 54 ? 8.896   -3.992  8.489   1.00 0.00 ? 63 ALA S CB   7  
ATOM 7475  H H    . ALA A 1 54 ? 10.671  -5.597  7.678   1.00 0.00 ? 63 ALA S H    7  
ATOM 7476  H HA   . ALA A 1 54 ? 8.631   -4.152  6.397   1.00 0.00 ? 63 ALA S HA   7  
ATOM 7477  H HB1  . ALA A 1 54 ? 7.856   -3.699  8.473   1.00 0.00 ? 63 ALA S HB1  7  
ATOM 7478  H HB2  . ALA A 1 54 ? 9.455   -3.299  9.101   1.00 0.00 ? 63 ALA S HB2  7  
ATOM 7479  H HB3  . ALA A 1 54 ? 8.982   -4.987  8.900   1.00 0.00 ? 63 ALA S HB3  7  
ATOM 7480  N N    . TRP A 1 55 ? 11.388  -2.547  6.752   1.00 0.00 ? 64 TRP S N    7  
ATOM 7481  C CA   . TRP A 1 55 ? 12.078  -1.315  6.471   1.00 0.00 ? 64 TRP S CA   7  
ATOM 7482  C C    . TRP A 1 55 ? 12.308  -1.196  4.974   1.00 0.00 ? 64 TRP S C    7  
ATOM 7483  O O    . TRP A 1 55 ? 12.137  -0.130  4.402   1.00 0.00 ? 64 TRP S O    7  
ATOM 7484  C CB   . TRP A 1 55 ? 13.410  -1.274  7.233   1.00 0.00 ? 64 TRP S CB   7  
ATOM 7485  C CG   . TRP A 1 55 ? 14.591  -1.443  6.337   1.00 0.00 ? 64 TRP S CG   7  
ATOM 7486  C CD1  . TRP A 1 55 ? 15.412  -2.523  6.244   1.00 0.00 ? 64 TRP S CD1  7  
ATOM 7487  C CD2  . TRP A 1 55 ? 15.048  -0.499  5.377   1.00 0.00 ? 64 TRP S CD2  7  
ATOM 7488  N NE1  . TRP A 1 55 ? 16.366  -2.302  5.277   1.00 0.00 ? 64 TRP S NE1  7  
ATOM 7489  C CE2  . TRP A 1 55 ? 16.158  -1.062  4.728   1.00 0.00 ? 64 TRP S CE2  7  
ATOM 7490  C CE3  . TRP A 1 55 ? 14.615  0.774   5.007   1.00 0.00 ? 64 TRP S CE3  7  
ATOM 7491  C CZ2  . TRP A 1 55 ? 16.841  -0.387  3.721   1.00 0.00 ? 64 TRP S CZ2  7  
ATOM 7492  C CZ3  . TRP A 1 55 ? 15.289  1.437   4.011   1.00 0.00 ? 64 TRP S CZ3  7  
ATOM 7493  C CH2  . TRP A 1 55 ? 16.389  0.860   3.376   1.00 0.00 ? 64 TRP S CH2  7  
ATOM 7494  H H    . TRP A 1 55 ? 11.914  -3.342  6.921   1.00 0.00 ? 64 TRP S H    7  
ATOM 7495  H HA   . TRP A 1 55 ? 11.454  -0.497  6.798   1.00 0.00 ? 64 TRP S HA   7  
ATOM 7496  H HB2  . TRP A 1 55 ? 13.503  -0.320  7.735   1.00 0.00 ? 64 TRP S HB2  7  
ATOM 7497  H HB3  . TRP A 1 55 ? 13.426  -2.071  7.967   1.00 0.00 ? 64 TRP S HB3  7  
ATOM 7498  H HD1  . TRP A 1 55 ? 15.314  -3.413  6.848   1.00 0.00 ? 64 TRP S HD1  7  
ATOM 7499  H HE1  . TRP A 1 55 ? 17.074  -2.930  5.021   1.00 0.00 ? 64 TRP S HE1  7  
ATOM 7500  H HE3  . TRP A 1 55 ? 13.766  1.236   5.488   1.00 0.00 ? 64 TRP S HE3  7  
ATOM 7501  H HZ2  . TRP A 1 55 ? 17.694  -0.821  3.217   1.00 0.00 ? 64 TRP S HZ2  7  
ATOM 7502  H HZ3  . TRP A 1 55 ? 14.967  2.420   3.711   1.00 0.00 ? 64 TRP S HZ3  7  
ATOM 7503  H HH2  . TRP A 1 55 ? 16.872  1.415   2.597   1.00 0.00 ? 64 TRP S HH2  7  
ATOM 7504  N N    . LYS A 1 56 ? 12.697  -2.305  4.350   1.00 0.00 ? 65 LYS S N    7  
ATOM 7505  C CA   . LYS A 1 56 ? 12.944  -2.321  2.914   1.00 0.00 ? 65 LYS S CA   7  
ATOM 7506  C C    . LYS A 1 56 ? 11.653  -2.029  2.169   1.00 0.00 ? 65 LYS S C    7  
ATOM 7507  O O    . LYS A 1 56 ? 11.653  -1.310  1.170   1.00 0.00 ? 65 LYS S O    7  
ATOM 7508  C CB   . LYS A 1 56 ? 13.530  -3.663  2.475   1.00 0.00 ? 65 LYS S CB   7  
ATOM 7509  C CG   . LYS A 1 56 ? 14.920  -3.538  1.874   1.00 0.00 ? 65 LYS S CG   7  
ATOM 7510  C CD   . LYS A 1 56 ? 15.929  -4.405  2.609   1.00 0.00 ? 65 LYS S CD   7  
ATOM 7511  C CE   . LYS A 1 56 ? 17.338  -3.848  2.482   1.00 0.00 ? 65 LYS S CE   7  
ATOM 7512  N NZ   . LYS A 1 56 ? 18.364  -4.817  2.960   1.00 0.00 ? 65 LYS S NZ   7  
ATOM 7513  H H    . LYS A 1 56 ? 12.814  -3.130  4.864   1.00 0.00 ? 65 LYS S H    7  
ATOM 7514  H HA   . LYS A 1 56 ? 13.658  -1.533  2.693   1.00 0.00 ? 65 LYS S HA   7  
ATOM 7515  H HB2  . LYS A 1 56 ? 13.588  -4.318  3.336   1.00 0.00 ? 65 LYS S HB2  7  
ATOM 7516  H HB3  . LYS A 1 56 ? 12.878  -4.106  1.735   1.00 0.00 ? 65 LYS S HB3  7  
ATOM 7517  H HG2  . LYS A 1 56 ? 14.884  -3.846  0.838   1.00 0.00 ? 65 LYS S HG2  7  
ATOM 7518  H HG3  . LYS A 1 56 ? 15.235  -2.503  1.935   1.00 0.00 ? 65 LYS S HG3  7  
ATOM 7519  H HD2  . LYS A 1 56 ? 15.663  -4.445  3.654   1.00 0.00 ? 65 LYS S HD2  7  
ATOM 7520  H HD3  . LYS A 1 56 ? 15.906  -5.401  2.191   1.00 0.00 ? 65 LYS S HD3  7  
ATOM 7521  H HE2  . LYS A 1 56 ? 17.530  -3.619  1.444   1.00 0.00 ? 65 LYS S HE2  7  
ATOM 7522  H HE3  . LYS A 1 56 ? 17.408  -2.944  3.068   1.00 0.00 ? 65 LYS S HE3  7  
ATOM 7523  H HZ1  . LYS A 1 56 ? 17.975  -5.397  3.731   1.00 0.00 ? 65 LYS S HZ1  7  
ATOM 7524  H HZ2  . LYS A 1 56 ? 19.200  -4.306  3.313   1.00 0.00 ? 65 LYS S HZ2  7  
ATOM 7525  H HZ3  . LYS A 1 56 ? 18.655  -5.443  2.184   1.00 0.00 ? 65 LYS S HZ3  7  
ATOM 7526  N N    . GLN A 1 57 ? 10.538  -2.555  2.672   1.00 0.00 ? 66 GLN S N    7  
ATOM 7527  C CA   . GLN A 1 57 ? 9.259   -2.284  2.044   1.00 0.00 ? 66 GLN S CA   7  
ATOM 7528  C C    . GLN A 1 57 ? 8.990   -0.797  2.166   1.00 0.00 ? 66 GLN S C    7  
ATOM 7529  O O    . GLN A 1 57 ? 8.556   -0.150  1.212   1.00 0.00 ? 66 GLN S O    7  
ATOM 7530  C CB   . GLN A 1 57 ? 8.120   -3.108  2.658   1.00 0.00 ? 66 GLN S CB   7  
ATOM 7531  C CG   . GLN A 1 57 ? 8.045   -3.061  4.172   1.00 0.00 ? 66 GLN S CG   7  
ATOM 7532  C CD   . GLN A 1 57 ? 7.039   -4.056  4.720   1.00 0.00 ? 66 GLN S CD   7  
ATOM 7533  O OE1  . GLN A 1 57 ? 6.157   -3.700  5.499   1.00 0.00 ? 66 GLN S OE1  7  
ATOM 7534  N NE2  . GLN A 1 57 ? 7.172   -5.313  4.310   1.00 0.00 ? 66 GLN S NE2  7  
ATOM 7535  H H    . GLN A 1 57 ? 10.580  -3.098  3.484   1.00 0.00 ? 66 GLN S H    7  
ATOM 7536  H HA   . GLN A 1 57 ? 9.352   -2.531  0.996   1.00 0.00 ? 66 GLN S HA   7  
ATOM 7537  H HB2  . GLN A 1 57 ? 7.184   -2.743  2.266   1.00 0.00 ? 66 GLN S HB2  7  
ATOM 7538  H HB3  . GLN A 1 57 ? 8.244   -4.139  2.358   1.00 0.00 ? 66 GLN S HB3  7  
ATOM 7539  H HG2  . GLN A 1 57 ? 9.018   -3.292  4.580   1.00 0.00 ? 66 GLN S HG2  7  
ATOM 7540  H HG3  . GLN A 1 57 ? 7.751   -2.068  4.477   1.00 0.00 ? 66 GLN S HG3  7  
ATOM 7541  H HE21 . GLN A 1 57 ? 7.899   -5.525  3.688   1.00 0.00 ? 66 GLN S HE21 7  
ATOM 7542  H HE22 . GLN A 1 57 ? 6.539   -5.980  4.647   1.00 0.00 ? 66 GLN S HE22 7  
ATOM 7543  N N    . VAL A 1 58 ? 9.314   -0.242  3.335   1.00 0.00 ? 67 VAL S N    7  
ATOM 7544  C CA   . VAL A 1 58 ? 9.166   1.186   3.546   1.00 0.00 ? 67 VAL S CA   7  
ATOM 7545  C C    . VAL A 1 58 ? 10.218  1.911   2.715   1.00 0.00 ? 67 VAL S C    7  
ATOM 7546  O O    . VAL A 1 58 ? 9.963   2.984   2.173   1.00 0.00 ? 67 VAL S O    7  
ATOM 7547  C CB   . VAL A 1 58 ? 9.313   1.581   5.031   1.00 0.00 ? 67 VAL S CB   7  
ATOM 7548  C CG1  . VAL A 1 58 ? 9.057   3.072   5.219   1.00 0.00 ? 67 VAL S CG1  7  
ATOM 7549  C CG2  . VAL A 1 58 ? 8.366   0.762   5.894   1.00 0.00 ? 67 VAL S CG2  7  
ATOM 7550  H H    . VAL A 1 58 ? 9.697   -0.801  4.051   1.00 0.00 ? 67 VAL S H    7  
ATOM 7551  H HA   . VAL A 1 58 ? 8.183   1.478   3.205   1.00 0.00 ? 67 VAL S HA   7  
ATOM 7552  H HB   . VAL A 1 58 ? 10.325  1.369   5.342   1.00 0.00 ? 67 VAL S HB   7  
ATOM 7553  H HG11 . VAL A 1 58 ? 9.961   3.555   5.560   1.00 0.00 ? 67 VAL S HG11 7  
ATOM 7554  H HG12 . VAL A 1 58 ? 8.275   3.220   5.952   1.00 0.00 ? 67 VAL S HG12 7  
ATOM 7555  H HG13 . VAL A 1 58 ? 8.751   3.507   4.280   1.00 0.00 ? 67 VAL S HG13 7  
ATOM 7556  H HG21 . VAL A 1 58 ? 8.847   0.523   6.830   1.00 0.00 ? 67 VAL S HG21 7  
ATOM 7557  H HG22 . VAL A 1 58 ? 8.107   -0.151  5.378   1.00 0.00 ? 67 VAL S HG22 7  
ATOM 7558  H HG23 . VAL A 1 58 ? 7.468   1.333   6.087   1.00 0.00 ? 67 VAL S HG23 7  
ATOM 7559  N N    . ASN A 1 59 ? 11.405  1.299   2.605   1.00 0.00 ? 68 ASN S N    7  
ATOM 7560  C CA   . ASN A 1 59 ? 12.505  1.867   1.825   1.00 0.00 ? 68 ASN S CA   7  
ATOM 7561  C C    . ASN A 1 59 ? 12.019  2.436   0.487   1.00 0.00 ? 68 ASN S C    7  
ATOM 7562  O O    . ASN A 1 59 ? 12.131  3.638   0.236   1.00 0.00 ? 68 ASN S O    7  
ATOM 7563  C CB   . ASN A 1 59 ? 13.555  0.785   1.562   1.00 0.00 ? 68 ASN S CB   7  
ATOM 7564  C CG   . ASN A 1 59 ? 14.809  1.317   0.899   1.00 0.00 ? 68 ASN S CG   7  
ATOM 7565  O OD1  . ASN A 1 59 ? 15.393  0.658   0.039   1.00 0.00 ? 68 ASN S OD1  7  
ATOM 7566  N ND2  . ASN A 1 59 ? 15.232  2.510   1.289   1.00 0.00 ? 68 ASN S ND2  7  
ATOM 7567  H H    . ASN A 1 59 ? 11.552  0.429   3.070   1.00 0.00 ? 68 ASN S H    7  
ATOM 7568  H HA   . ASN A 1 59 ? 12.951  2.659   2.404   1.00 0.00 ? 68 ASN S HA   7  
ATOM 7569  H HB2  . ASN A 1 59 ? 13.833  0.331   2.498   1.00 0.00 ? 68 ASN S HB2  7  
ATOM 7570  H HB3  . ASN A 1 59 ? 13.129  0.033   0.919   1.00 0.00 ? 68 ASN S HB3  7  
ATOM 7571  H HD21 . ASN A 1 59 ? 14.721  2.985   1.974   1.00 0.00 ? 68 ASN S HD21 7  
ATOM 7572  H HD22 . ASN A 1 59 ? 16.047  2.860   0.883   1.00 0.00 ? 68 ASN S HD22 7  
ATOM 7573  N N    . LEU A 1 60 ? 11.484  1.567   -0.366  1.00 0.00 ? 69 LEU S N    7  
ATOM 7574  C CA   . LEU A 1 60 ? 10.991  1.987   -1.673  1.00 0.00 ? 69 LEU S CA   7  
ATOM 7575  C C    . LEU A 1 60 ? 9.730   2.825   -1.525  1.00 0.00 ? 69 LEU S C    7  
ATOM 7576  O O    . LEU A 1 60 ? 9.466   3.721   -2.326  1.00 0.00 ? 69 LEU S O    7  
ATOM 7577  C CB   . LEU A 1 60 ? 10.712  0.765   -2.553  1.00 0.00 ? 69 LEU S CB   7  
ATOM 7578  C CG   . LEU A 1 60 ? 11.425  0.766   -3.907  1.00 0.00 ? 69 LEU S CG   7  
ATOM 7579  C CD1  . LEU A 1 60 ? 12.931  0.689   -3.716  1.00 0.00 ? 69 LEU S CD1  7  
ATOM 7580  C CD2  . LEU A 1 60 ? 10.934  -0.389  -4.767  1.00 0.00 ? 69 LEU S CD2  7  
ATOM 7581  H H    . LEU A 1 60 ? 11.416  0.622   -0.112  1.00 0.00 ? 69 LEU S H    7  
ATOM 7582  H HA   . LEU A 1 60 ? 11.757  2.588   -2.139  1.00 0.00 ? 69 LEU S HA   7  
ATOM 7583  H HB2  . LEU A 1 60 ? 11.017  -0.121  -2.009  1.00 0.00 ? 69 LEU S HB2  7  
ATOM 7584  H HB3  . LEU A 1 60 ? 9.647   0.709   -2.733  1.00 0.00 ? 69 LEU S HB3  7  
ATOM 7585  H HG   . LEU A 1 60 ? 11.200  1.688   -4.423  1.00 0.00 ? 69 LEU S HG   7  
ATOM 7586  H HD11 . LEU A 1 60 ? 13.368  0.133   -4.532  1.00 0.00 ? 69 LEU S HD11 7  
ATOM 7587  H HD12 . LEU A 1 60 ? 13.152  0.191   -2.784  1.00 0.00 ? 69 LEU S HD12 7  
ATOM 7588  H HD13 . LEU A 1 60 ? 13.343  1.687   -3.699  1.00 0.00 ? 69 LEU S HD13 7  
ATOM 7589  H HD21 . LEU A 1 60 ? 10.122  -0.050  -5.394  1.00 0.00 ? 69 LEU S HD21 7  
ATOM 7590  H HD22 . LEU A 1 60 ? 10.586  -1.190  -4.130  1.00 0.00 ? 69 LEU S HD22 7  
ATOM 7591  H HD23 . LEU A 1 60 ? 11.743  -0.746  -5.385  1.00 0.00 ? 69 LEU S HD23 7  
ATOM 7592  N N    . LYS A 1 61 ? 8.958   2.524   -0.492  1.00 0.00 ? 70 LYS S N    7  
ATOM 7593  C CA   . LYS A 1 61 ? 7.723   3.242   -0.226  1.00 0.00 ? 70 LYS S CA   7  
ATOM 7594  C C    . LYS A 1 61 ? 8.010   4.689   0.160   1.00 0.00 ? 70 LYS S C    7  
ATOM 7595  O O    . LYS A 1 61 ? 7.225   5.589   -0.136  1.00 0.00 ? 70 LYS S O    7  
ATOM 7596  C CB   . LYS A 1 61 ? 6.943   2.534   0.880   1.00 0.00 ? 70 LYS S CB   7  
ATOM 7597  C CG   . LYS A 1 61 ? 5.793   1.693   0.353   1.00 0.00 ? 70 LYS S CG   7  
ATOM 7598  C CD   . LYS A 1 61 ? 4.954   1.098   1.471   1.00 0.00 ? 70 LYS S CD   7  
ATOM 7599  C CE   . LYS A 1 61 ? 5.558   -0.192  2.001   1.00 0.00 ? 70 LYS S CE   7  
ATOM 7600  N NZ   . LYS A 1 61 ? 6.082   -0.032  3.386   1.00 0.00 ? 70 LYS S NZ   7  
ATOM 7601  H H    . LYS A 1 61 ? 9.225   1.797   0.108   1.00 0.00 ? 70 LYS S H    7  
ATOM 7602  H HA   . LYS A 1 61 ? 7.134   3.233   -1.132  1.00 0.00 ? 70 LYS S HA   7  
ATOM 7603  H HB2  . LYS A 1 61 ? 7.619   1.882   1.419   1.00 0.00 ? 70 LYS S HB2  7  
ATOM 7604  H HB3  . LYS A 1 61 ? 6.546   3.274   1.559   1.00 0.00 ? 70 LYS S HB3  7  
ATOM 7605  H HG2  . LYS A 1 61 ? 5.164   2.312   -0.264  1.00 0.00 ? 70 LYS S HG2  7  
ATOM 7606  H HG3  . LYS A 1 61 ? 6.202   0.893   -0.238  1.00 0.00 ? 70 LYS S HG3  7  
ATOM 7607  H HD2  . LYS A 1 61 ? 4.886   1.810   2.273   1.00 0.00 ? 70 LYS S HD2  7  
ATOM 7608  H HD3  . LYS A 1 61 ? 3.964   0.890   1.089   1.00 0.00 ? 70 LYS S HD3  7  
ATOM 7609  H HE2  . LYS A 1 61 ? 4.798   -0.958  2.001   1.00 0.00 ? 70 LYS S HE2  7  
ATOM 7610  H HE3  . LYS A 1 61 ? 6.368   -0.491  1.351   1.00 0.00 ? 70 LYS S HE3  7  
ATOM 7611  H HZ1  . LYS A 1 61 ? 6.913   -0.640  3.523   1.00 0.00 ? 70 LYS S HZ1  7  
ATOM 7612  H HZ2  . LYS A 1 61 ? 5.352   -0.298  4.076   1.00 0.00 ? 70 LYS S HZ2  7  
ATOM 7613  H HZ3  . LYS A 1 61 ? 6.357   0.955   3.552   1.00 0.00 ? 70 LYS S HZ3  7  
ATOM 7614  N N    . LYS A 1 62 ? 9.145   4.906   0.815   1.00 0.00 ? 71 LYS S N    7  
ATOM 7615  C CA   . LYS A 1 62 ? 9.539   6.243   1.236   1.00 0.00 ? 71 LYS S CA   7  
ATOM 7616  C C    . LYS A 1 62 ? 9.960   7.074   0.033   1.00 0.00 ? 71 LYS S C    7  
ATOM 7617  O O    . LYS A 1 62 ? 9.726   8.282   -0.007  1.00 0.00 ? 71 LYS S O    7  
ATOM 7618  C CB   . LYS A 1 62 ? 10.677  6.171   2.253   1.00 0.00 ? 71 LYS S CB   7  
ATOM 7619  C CG   . LYS A 1 62 ? 10.217  5.735   3.632   1.00 0.00 ? 71 LYS S CG   7  
ATOM 7620  C CD   . LYS A 1 62 ? 11.261  6.045   4.696   1.00 0.00 ? 71 LYS S CD   7  
ATOM 7621  C CE   . LYS A 1 62 ? 10.657  6.800   5.869   1.00 0.00 ? 71 LYS S CE   7  
ATOM 7622  N NZ   . LYS A 1 62 ? 11.703  7.428   6.721   1.00 0.00 ? 71 LYS S NZ   7  
ATOM 7623  H H    . LYS A 1 62 ? 9.733   4.149   1.018   1.00 0.00 ? 71 LYS S H    7  
ATOM 7624  H HA   . LYS A 1 62 ? 8.682   6.711   1.698   1.00 0.00 ? 71 LYS S HA   7  
ATOM 7625  H HB2  . LYS A 1 62 ? 11.416  5.468   1.902   1.00 0.00 ? 71 LYS S HB2  7  
ATOM 7626  H HB3  . LYS A 1 62 ? 11.129  7.148   2.339   1.00 0.00 ? 71 LYS S HB3  7  
ATOM 7627  H HG2  . LYS A 1 62 ? 9.302   6.251   3.878   1.00 0.00 ? 71 LYS S HG2  7  
ATOM 7628  H HG3  . LYS A 1 62 ? 10.037  4.671   3.616   1.00 0.00 ? 71 LYS S HG3  7  
ATOM 7629  H HD2  . LYS A 1 62 ? 11.680  5.119   5.056   1.00 0.00 ? 71 LYS S HD2  7  
ATOM 7630  H HD3  . LYS A 1 62 ? 12.041  6.648   4.254   1.00 0.00 ? 71 LYS S HD3  7  
ATOM 7631  H HE2  . LYS A 1 62 ? 10.005  7.573   5.485   1.00 0.00 ? 71 LYS S HE2  7  
ATOM 7632  H HE3  . LYS A 1 62 ? 10.082  6.107   6.469   1.00 0.00 ? 71 LYS S HE3  7  
ATOM 7633  H HZ1  . LYS A 1 62 ? 11.858  8.415   6.430   1.00 0.00 ? 71 LYS S HZ1  7  
ATOM 7634  H HZ2  . LYS A 1 62 ? 12.598  6.907   6.631   1.00 0.00 ? 71 LYS S HZ2  7  
ATOM 7635  H HZ3  . LYS A 1 62 ? 11.406  7.417   7.719   1.00 0.00 ? 71 LYS S HZ3  7  
ATOM 7636  N N    . ALA A 1 63 ? 10.568  6.417   -0.955  1.00 0.00 ? 72 ALA S N    7  
ATOM 7637  C CA   . ALA A 1 63 ? 11.002  7.102   -2.169  1.00 0.00 ? 72 ALA S CA   7  
ATOM 7638  C C    . ALA A 1 63 ? 9.891   8.006   -2.692  1.00 0.00 ? 72 ALA S C    7  
ATOM 7639  O O    . ALA A 1 63 ? 10.149  9.053   -3.287  1.00 0.00 ? 72 ALA S O    7  
ATOM 7640  C CB   . ALA A 1 63 ? 11.410  6.091   -3.230  1.00 0.00 ? 72 ALA S CB   7  
ATOM 7641  H H    . ALA A 1 63 ? 10.717  5.450   -0.868  1.00 0.00 ? 72 ALA S H    7  
ATOM 7642  H HA   . ALA A 1 63 ? 11.864  7.706   -1.925  1.00 0.00 ? 72 ALA S HA   7  
ATOM 7643  H HB1  . ALA A 1 63 ? 11.647  5.149   -2.757  1.00 0.00 ? 72 ALA S HB1  7  
ATOM 7644  H HB2  . ALA A 1 63 ? 12.277  6.456   -3.760  1.00 0.00 ? 72 ALA S HB2  7  
ATOM 7645  H HB3  . ALA A 1 63 ? 10.596  5.949   -3.925  1.00 0.00 ? 72 ALA S HB3  7  
ATOM 7646  N N    . LYS A 1 64 ? 8.650   7.596   -2.444  1.00 0.00 ? 73 LYS S N    7  
ATOM 7647  C CA   . LYS A 1 64 ? 7.485   8.360   -2.862  1.00 0.00 ? 73 LYS S CA   7  
ATOM 7648  C C    . LYS A 1 64 ? 6.770   8.945   -1.644  1.00 0.00 ? 73 LYS S C    7  
ATOM 7649  O O    . LYS A 1 64 ? 6.080   9.960   -1.744  1.00 0.00 ? 73 LYS S O    7  
ATOM 7650  C CB   . LYS A 1 64 ? 6.525   7.475   -3.661  1.00 0.00 ? 73 LYS S CB   7  
ATOM 7651  C CG   . LYS A 1 64 ? 6.583   7.718   -5.161  1.00 0.00 ? 73 LYS S CG   7  
ATOM 7652  C CD   . LYS A 1 64 ? 5.904   6.598   -5.932  1.00 0.00 ? 73 LYS S CD   7  
ATOM 7653  C CE   . LYS A 1 64 ? 6.661   6.256   -7.206  1.00 0.00 ? 73 LYS S CE   7  
ATOM 7654  N NZ   . LYS A 1 64 ? 7.501   5.036   -7.047  1.00 0.00 ? 73 LYS S NZ   7  
ATOM 7655  H H    . LYS A 1 64 ? 8.517   6.757   -1.954  1.00 0.00 ? 73 LYS S H    7  
ATOM 7656  H HA   . LYS A 1 64 ? 7.826   9.171   -3.490  1.00 0.00 ? 73 LYS S HA   7  
ATOM 7657  H HB2  . LYS A 1 64 ? 6.771   6.438   -3.477  1.00 0.00 ? 73 LYS S HB2  7  
ATOM 7658  H HB3  . LYS A 1 64 ? 5.513   7.664   -3.327  1.00 0.00 ? 73 LYS S HB3  7  
ATOM 7659  H HG2  . LYS A 1 64 ? 6.086   8.649   -5.385  1.00 0.00 ? 73 LYS S HG2  7  
ATOM 7660  H HG3  . LYS A 1 64 ? 7.618   7.778   -5.466  1.00 0.00 ? 73 LYS S HG3  7  
ATOM 7661  H HD2  . LYS A 1 64 ? 5.859   5.720   -5.306  1.00 0.00 ? 73 LYS S HD2  7  
ATOM 7662  H HD3  . LYS A 1 64 ? 4.903   6.909   -6.192  1.00 0.00 ? 73 LYS S HD3  7  
ATOM 7663  H HE2  . LYS A 1 64 ? 5.949   6.090   -7.999  1.00 0.00 ? 73 LYS S HE2  7  
ATOM 7664  H HE3  . LYS A 1 64 ? 7.299   7.090   -7.464  1.00 0.00 ? 73 LYS S HE3  7  
ATOM 7665  H HZ1  . LYS A 1 64 ? 8.500   5.263   -7.227  1.00 0.00 ? 73 LYS S HZ1  7  
ATOM 7666  H HZ2  . LYS A 1 64 ? 7.196   4.303   -7.719  1.00 0.00 ? 73 LYS S HZ2  7  
ATOM 7667  H HZ3  . LYS A 1 64 ? 7.413   4.663   -6.080  1.00 0.00 ? 73 LYS S HZ3  7  
ATOM 7668  N N    . GLY A 1 65 ? 6.948   8.299   -0.493  1.00 0.00 ? 74 GLY S N    7  
ATOM 7669  C CA   . GLY A 1 65 ? 6.323   8.767   0.730   1.00 0.00 ? 74 GLY S CA   7  
ATOM 7670  C C    . GLY A 1 65 ? 5.048   8.023   1.060   1.00 0.00 ? 74 GLY S C    7  
ATOM 7671  O O    . GLY A 1 65 ? 4.018   8.634   1.341   1.00 0.00 ? 74 GLY S O    7  
ATOM 7672  H H    . GLY A 1 65 ? 7.510   7.498   -0.472  1.00 0.00 ? 74 GLY S H    7  
ATOM 7673  H HA2  . GLY A 1 65 ? 7.019   8.628   1.546   1.00 0.00 ? 74 GLY S HA2  7  
ATOM 7674  H HA3  . GLY A 1 65 ? 6.099   9.819   0.631   1.00 0.00 ? 74 GLY S HA3  7  
ATOM 7675  N N    . LEU A 1 66 ? 5.115   6.697   1.024   1.00 0.00 ? 75 LEU S N    7  
ATOM 7676  C CA   . LEU A 1 66 ? 3.955   5.870   1.319   1.00 0.00 ? 75 LEU S CA   7  
ATOM 7677  C C    . LEU A 1 66 ? 4.050   5.252   2.717   1.00 0.00 ? 75 LEU S C    7  
ATOM 7678  O O    . LEU A 1 66 ? 3.517   5.800   3.680   1.00 0.00 ? 75 LEU S O    7  
ATOM 7679  C CB   . LEU A 1 66 ? 3.809   4.772   0.262   1.00 0.00 ? 75 LEU S CB   7  
ATOM 7680  C CG   . LEU A 1 66 ? 3.604   5.270   -1.171  1.00 0.00 ? 75 LEU S CG   7  
ATOM 7681  C CD1  . LEU A 1 66 ? 4.505   4.511   -2.133  1.00 0.00 ? 75 LEU S CD1  7  
ATOM 7682  C CD2  . LEU A 1 66 ? 2.146   5.130   -1.586  1.00 0.00 ? 75 LEU S CD2  7  
ATOM 7683  H H    . LEU A 1 66 ? 5.964   6.267   0.791   1.00 0.00 ? 75 LEU S H    7  
ATOM 7684  H HA   . LEU A 1 66 ? 3.087   6.508   1.285   1.00 0.00 ? 75 LEU S HA   7  
ATOM 7685  H HB2  . LEU A 1 66 ? 4.704   4.170   0.285   1.00 0.00 ? 75 LEU S HB2  7  
ATOM 7686  H HB3  . LEU A 1 66 ? 2.965   4.152   0.532   1.00 0.00 ? 75 LEU S HB3  7  
ATOM 7687  H HG   . LEU A 1 66 ? 3.868   6.316   -1.223  1.00 0.00 ? 75 LEU S HG   7  
ATOM 7688  H HD11 . LEU A 1 66 ? 4.018   3.596   -2.436  1.00 0.00 ? 75 LEU S HD11 7  
ATOM 7689  H HD12 . LEU A 1 66 ? 5.438   4.277   -1.643  1.00 0.00 ? 75 LEU S HD12 7  
ATOM 7690  H HD13 . LEU A 1 66 ? 4.698   5.120   -3.003  1.00 0.00 ? 75 LEU S HD13 7  
ATOM 7691  H HD21 . LEU A 1 66 ? 2.092   4.818   -2.619  1.00 0.00 ? 75 LEU S HD21 7  
ATOM 7692  H HD22 . LEU A 1 66 ? 1.646   6.081   -1.471  1.00 0.00 ? 75 LEU S HD22 7  
ATOM 7693  H HD23 . LEU A 1 66 ? 1.663   4.391   -0.962  1.00 0.00 ? 75 LEU S HD23 7  
ATOM 7694  N N    . PHE A 1 67 ? 4.729   4.105   2.817   1.00 0.00 ? 76 PHE S N    7  
ATOM 7695  C CA   . PHE A 1 67 ? 4.891   3.405   4.095   1.00 0.00 ? 76 PHE S CA   7  
ATOM 7696  C C    . PHE A 1 67 ? 3.594   3.392   4.899   1.00 0.00 ? 76 PHE S C    7  
ATOM 7697  O O    . PHE A 1 67 ? 2.522   3.610   4.297   1.00 0.00 ? 76 PHE S O    7  
ATOM 7698  C CB   . PHE A 1 67 ? 6.001   4.048   4.917   1.00 0.00 ? 76 PHE S CB   7  
ATOM 7699  C CG   . PHE A 1 67 ? 5.769   5.500   5.192   1.00 0.00 ? 76 PHE S CG   7  
ATOM 7700  C CD1  . PHE A 1 67 ? 5.050   5.903   6.305   1.00 0.00 ? 76 PHE S CD1  7  
ATOM 7701  C CD2  . PHE A 1 67 ? 6.268   6.461   4.333   1.00 0.00 ? 76 PHE S CD2  7  
ATOM 7702  C CE1  . PHE A 1 67 ? 4.834   7.242   6.557   1.00 0.00 ? 76 PHE S CE1  7  
ATOM 7703  C CE2  . PHE A 1 67 ? 6.057   7.799   4.576   1.00 0.00 ? 76 PHE S CE2  7  
ATOM 7704  C CZ   . PHE A 1 67 ? 5.340   8.192   5.690   1.00 0.00 ? 76 PHE S CZ   7  
ATOM 7705  O OXT  . PHE A 1 67 ? 3.664   3.159   6.123   1.00 0.00 ? 76 PHE S OXT  7  
ATOM 7706  H H    . PHE A 1 67 ? 5.131   3.718   2.011   1.00 0.00 ? 76 PHE S H    7  
ATOM 7707  H HA   . PHE A 1 67 ? 5.167   2.386   3.880   1.00 0.00 ? 76 PHE S HA   7  
ATOM 7708  H HB2  . PHE A 1 67 ? 6.084   3.538   5.865   1.00 0.00 ? 76 PHE S HB2  7  
ATOM 7709  H HB3  . PHE A 1 67 ? 6.932   3.957   4.380   1.00 0.00 ? 76 PHE S HB3  7  
ATOM 7710  H HD1  . PHE A 1 67 ? 4.658   5.158   6.981   1.00 0.00 ? 76 PHE S HD1  7  
ATOM 7711  H HD2  . PHE A 1 67 ? 6.828   6.154   3.461   1.00 0.00 ? 76 PHE S HD2  7  
ATOM 7712  H HE1  . PHE A 1 67 ? 4.268   7.546   7.428   1.00 0.00 ? 76 PHE S HE1  7  
ATOM 7713  H HE2  . PHE A 1 67 ? 6.450   8.539   3.895   1.00 0.00 ? 76 PHE S HE2  7  
ATOM 7714  H HZ   . PHE A 1 67 ? 5.178   9.236   5.883   1.00 0.00 ? 76 PHE S HZ   7  
ATOM 7715  N N    . MET A 1 1  ? -21.613 -10.258 -5.321  1.00 0.00 ? 10 MET S N    8  
ATOM 7716  C CA   . MET A 1 1  ? -20.792 -9.565  -4.295  1.00 0.00 ? 10 MET S CA   8  
ATOM 7717  C C    . MET A 1 1  ? -20.682 -10.397 -3.022  1.00 0.00 ? 10 MET S C    8  
ATOM 7718  O O    . MET A 1 1  ? -19.582 -10.692 -2.554  1.00 0.00 ? 10 MET S O    8  
ATOM 7719  C CB   . MET A 1 1  ? -21.439 -8.213  -3.987  1.00 0.00 ? 10 MET S CB   8  
ATOM 7720  C CG   . MET A 1 1  ? -20.523 -7.256  -3.239  1.00 0.00 ? 10 MET S CG   8  
ATOM 7721  S SD   . MET A 1 1  ? -21.388 -5.791  -2.641  1.00 0.00 ? 10 MET S SD   8  
ATOM 7722  C CE   . MET A 1 1  ? -20.338 -4.492  -3.288  1.00 0.00 ? 10 MET S CE   8  
ATOM 7723  H H1   . MET A 1 1  ? -21.796 -9.584  -6.090  1.00 0.00 ? 10 MET S H1   8  
ATOM 7724  H H2   . MET A 1 1  ? -22.500 -10.560 -4.867  1.00 0.00 ? 10 MET S H2   8  
ATOM 7725  H H3   . MET A 1 1  ? -21.069 -11.076 -5.663  1.00 0.00 ? 10 MET S H3   8  
ATOM 7726  H HA   . MET A 1 1  ? -19.803 -9.403  -4.696  1.00 0.00 ? 10 MET S HA   8  
ATOM 7727  H HB2  . MET A 1 1  ? -21.730 -7.745  -4.915  1.00 0.00 ? 10 MET S HB2  8  
ATOM 7728  H HB3  . MET A 1 1  ? -22.321 -8.376  -3.385  1.00 0.00 ? 10 MET S HB3  8  
ATOM 7729  H HG2  . MET A 1 1  ? -20.097 -7.774  -2.393  1.00 0.00 ? 10 MET S HG2  8  
ATOM 7730  H HG3  . MET A 1 1  ? -19.732 -6.944  -3.905  1.00 0.00 ? 10 MET S HG3  8  
ATOM 7731  H HE1  . MET A 1 1  ? -19.925 -4.801  -4.237  1.00 0.00 ? 10 MET S HE1  8  
ATOM 7732  H HE2  . MET A 1 1  ? -19.536 -4.298  -2.592  1.00 0.00 ? 10 MET S HE2  8  
ATOM 7733  H HE3  . MET A 1 1  ? -20.921 -3.593  -3.426  1.00 0.00 ? 10 MET S HE3  8  
ATOM 7734  N N    . LEU A 1 2  ? -21.829 -10.773 -2.465  1.00 0.00 ? 11 LEU S N    8  
ATOM 7735  C CA   . LEU A 1 2  ? -21.862 -11.573 -1.245  1.00 0.00 ? 11 LEU S CA   8  
ATOM 7736  C C    . LEU A 1 2  ? -21.185 -12.923 -1.460  1.00 0.00 ? 11 LEU S C    8  
ATOM 7737  O O    . LEU A 1 2  ? -20.611 -13.495 -0.534  1.00 0.00 ? 11 LEU S O    8  
ATOM 7738  C CB   . LEU A 1 2  ? -23.305 -11.779 -0.784  1.00 0.00 ? 11 LEU S CB   8  
ATOM 7739  C CG   . LEU A 1 2  ? -23.930 -10.585 -0.059  1.00 0.00 ? 11 LEU S CG   8  
ATOM 7740  C CD1  . LEU A 1 2  ? -23.075 -10.178 1.131   1.00 0.00 ? 11 LEU S CD1  8  
ATOM 7741  C CD2  . LEU A 1 2  ? -24.106 -9.415  -1.015  1.00 0.00 ? 11 LEU S CD2  8  
ATOM 7742  H H    . LEU A 1 2  ? -22.673 -10.506 -2.884  1.00 0.00 ? 11 LEU S H    8  
ATOM 7743  H HA   . LEU A 1 2  ? -21.322 -11.032 -0.482  1.00 0.00 ? 11 LEU S HA   8  
ATOM 7744  H HB2  . LEU A 1 2  ? -23.909 -12.003 -1.650  1.00 0.00 ? 11 LEU S HB2  8  
ATOM 7745  H HB3  . LEU A 1 2  ? -23.330 -12.628 -0.118  1.00 0.00 ? 11 LEU S HB3  8  
ATOM 7746  H HG   . LEU A 1 2  ? -24.905 -10.867 0.311   1.00 0.00 ? 11 LEU S HG   8  
ATOM 7747  H HD11 . LEU A 1 2  ? -23.716 -9.866  1.943   1.00 0.00 ? 11 LEU S HD11 8  
ATOM 7748  H HD12 . LEU A 1 2  ? -22.430 -9.359  0.848   1.00 0.00 ? 11 LEU S HD12 8  
ATOM 7749  H HD13 . LEU A 1 2  ? -22.475 -11.017 1.448   1.00 0.00 ? 11 LEU S HD13 8  
ATOM 7750  H HD21 . LEU A 1 2  ? -24.733 -9.719  -1.843  1.00 0.00 ? 11 LEU S HD21 8  
ATOM 7751  H HD22 . LEU A 1 2  ? -23.142 -9.107  -1.389  1.00 0.00 ? 11 LEU S HD22 8  
ATOM 7752  H HD23 . LEU A 1 2  ? -24.572 -8.592  -0.495  1.00 0.00 ? 11 LEU S HD23 8  
ATOM 7753  N N    . ALA A 1 3  ? -21.258 -13.427 -2.688  1.00 0.00 ? 12 ALA S N    8  
ATOM 7754  C CA   . ALA A 1 3  ? -20.653 -14.711 -3.023  1.00 0.00 ? 12 ALA S CA   8  
ATOM 7755  C C    . ALA A 1 3  ? -19.211 -14.538 -3.485  1.00 0.00 ? 12 ALA S C    8  
ATOM 7756  O O    . ALA A 1 3  ? -18.375 -15.420 -3.291  1.00 0.00 ? 12 ALA S O    8  
ATOM 7757  C CB   . ALA A 1 3  ? -21.471 -15.416 -4.094  1.00 0.00 ? 12 ALA S CB   8  
ATOM 7758  H H    . ALA A 1 3  ? -21.729 -12.925 -3.385  1.00 0.00 ? 12 ALA S H    8  
ATOM 7759  H HA   . ALA A 1 3  ? -20.664 -15.325 -2.134  1.00 0.00 ? 12 ALA S HA   8  
ATOM 7760  H HB1  . ALA A 1 3  ? -22.504 -15.468 -3.782  1.00 0.00 ? 12 ALA S HB1  8  
ATOM 7761  H HB2  . ALA A 1 3  ? -21.089 -16.414 -4.242  1.00 0.00 ? 12 ALA S HB2  8  
ATOM 7762  H HB3  . ALA A 1 3  ? -21.404 -14.864 -5.021  1.00 0.00 ? 12 ALA S HB3  8  
ATOM 7763  N N    . LYS A 1 4  ? -18.925 -13.392 -4.099  1.00 0.00 ? 13 LYS S N    8  
ATOM 7764  C CA   . LYS A 1 4  ? -17.582 -13.103 -4.589  1.00 0.00 ? 13 LYS S CA   8  
ATOM 7765  C C    . LYS A 1 4  ? -16.755 -12.383 -3.528  1.00 0.00 ? 13 LYS S C    8  
ATOM 7766  O O    . LYS A 1 4  ? -17.298 -11.684 -2.673  1.00 0.00 ? 13 LYS S O    8  
ATOM 7767  C CB   . LYS A 1 4  ? -17.655 -12.253 -5.860  1.00 0.00 ? 13 LYS S CB   8  
ATOM 7768  C CG   . LYS A 1 4  ? -17.944 -13.060 -7.116  1.00 0.00 ? 13 LYS S CG   8  
ATOM 7769  C CD   . LYS A 1 4  ? -17.594 -12.278 -8.372  1.00 0.00 ? 13 LYS S CD   8  
ATOM 7770  C CE   . LYS A 1 4  ? -17.539 -13.183 -9.592  1.00 0.00 ? 13 LYS S CE   8  
ATOM 7771  N NZ   . LYS A 1 4  ? -17.874 -12.449 -10.843 1.00 0.00 ? 13 LYS S NZ   8  
ATOM 7772  H H    . LYS A 1 4  ? -19.634 -12.727 -4.225  1.00 0.00 ? 13 LYS S H    8  
ATOM 7773  H HA   . LYS A 1 4  ? -17.105 -14.044 -4.824  1.00 0.00 ? 13 LYS S HA   8  
ATOM 7774  H HB2  . LYS A 1 4  ? -18.435 -11.517 -5.742  1.00 0.00 ? 13 LYS S HB2  8  
ATOM 7775  H HB3  . LYS A 1 4  ? -16.710 -11.747 -5.994  1.00 0.00 ? 13 LYS S HB3  8  
ATOM 7776  H HG2  . LYS A 1 4  ? -17.359 -13.967 -7.093  1.00 0.00 ? 13 LYS S HG2  8  
ATOM 7777  H HG3  . LYS A 1 4  ? -18.996 -13.308 -7.137  1.00 0.00 ? 13 LYS S HG3  8  
ATOM 7778  H HD2  . LYS A 1 4  ? -18.345 -11.520 -8.533  1.00 0.00 ? 13 LYS S HD2  8  
ATOM 7779  H HD3  . LYS A 1 4  ? -16.630 -11.811 -8.236  1.00 0.00 ? 13 LYS S HD3  8  
ATOM 7780  H HE2  . LYS A 1 4  ? -16.541 -13.588 -9.679  1.00 0.00 ? 13 LYS S HE2  8  
ATOM 7781  H HE3  . LYS A 1 4  ? -18.244 -13.990 -9.458  1.00 0.00 ? 13 LYS S HE3  8  
ATOM 7782  H HZ1  . LYS A 1 4  ? -18.453 -11.612 -10.623 1.00 0.00 ? 13 LYS S HZ1  8  
ATOM 7783  H HZ2  . LYS A 1 4  ? -18.407 -13.066 -11.488 1.00 0.00 ? 13 LYS S HZ2  8  
ATOM 7784  H HZ3  . LYS A 1 4  ? -17.004 -12.137 -11.320 1.00 0.00 ? 13 LYS S HZ3  8  
ATOM 7785  N N    . LEU A 1 5  ? -15.440 -12.559 -3.591  1.00 0.00 ? 14 LEU S N    8  
ATOM 7786  C CA   . LEU A 1 5  ? -14.536 -11.926 -2.637  1.00 0.00 ? 14 LEU S CA   8  
ATOM 7787  C C    . LEU A 1 5  ? -13.388 -11.225 -3.354  1.00 0.00 ? 14 LEU S C    8  
ATOM 7788  O O    . LEU A 1 5  ? -12.647 -11.847 -4.115  1.00 0.00 ? 14 LEU S O    8  
ATOM 7789  C CB   . LEU A 1 5  ? -13.983 -12.965 -1.660  1.00 0.00 ? 14 LEU S CB   8  
ATOM 7790  C CG   . LEU A 1 5  ? -14.997 -13.521 -0.658  1.00 0.00 ? 14 LEU S CG   8  
ATOM 7791  C CD1  . LEU A 1 5  ? -15.678 -12.387 0.095   1.00 0.00 ? 14 LEU S CD1  8  
ATOM 7792  C CD2  . LEU A 1 5  ? -16.025 -14.388 -1.367  1.00 0.00 ? 14 LEU S CD2  8  
ATOM 7793  H H    . LEU A 1 5  ? -15.065 -13.128 -4.297  1.00 0.00 ? 14 LEU S H    8  
ATOM 7794  H HA   . LEU A 1 5  ? -15.101 -11.191 -2.083  1.00 0.00 ? 14 LEU S HA   8  
ATOM 7795  H HB2  . LEU A 1 5  ? -13.585 -13.791 -2.233  1.00 0.00 ? 14 LEU S HB2  8  
ATOM 7796  H HB3  . LEU A 1 5  ? -13.175 -12.512 -1.105  1.00 0.00 ? 14 LEU S HB3  8  
ATOM 7797  H HG   . LEU A 1 5  ? -14.480 -14.135 0.065   1.00 0.00 ? 14 LEU S HG   8  
ATOM 7798  H HD11 . LEU A 1 5  ? -15.842 -12.685 1.120   1.00 0.00 ? 14 LEU S HD11 8  
ATOM 7799  H HD12 . LEU A 1 5  ? -16.627 -12.166 -0.371  1.00 0.00 ? 14 LEU S HD12 8  
ATOM 7800  H HD13 . LEU A 1 5  ? -15.051 -11.509 0.070   1.00 0.00 ? 14 LEU S HD13 8  
ATOM 7801  H HD21 . LEU A 1 5  ? -16.942 -13.828 -1.497  1.00 0.00 ? 14 LEU S HD21 8  
ATOM 7802  H HD22 . LEU A 1 5  ? -16.225 -15.268 -0.773  1.00 0.00 ? 14 LEU S HD22 8  
ATOM 7803  H HD23 . LEU A 1 5  ? -15.645 -14.684 -2.332  1.00 0.00 ? 14 LEU S HD23 8  
ATOM 7804  N N    . CYS A 1 6  ? -13.244 -9.928  -3.105  1.00 0.00 ? 15 CYS S N    8  
ATOM 7805  C CA   . CYS A 1 6  ? -12.183 -9.143  -3.727  1.00 0.00 ? 15 CYS S CA   8  
ATOM 7806  C C    . CYS A 1 6  ? -11.698 -8.039  -2.791  1.00 0.00 ? 15 CYS S C    8  
ATOM 7807  O O    . CYS A 1 6  ? -12.482 -7.459  -2.041  1.00 0.00 ? 15 CYS S O    8  
ATOM 7808  C CB   . CYS A 1 6  ? -12.675 -8.536  -5.043  1.00 0.00 ? 15 CYS S CB   8  
ATOM 7809  S SG   . CYS A 1 6  ? -11.369 -7.788  -6.044  1.00 0.00 ? 15 CYS S SG   8  
ATOM 7810  H H    . CYS A 1 6  ? -13.865 -9.487  -2.487  1.00 0.00 ? 15 CYS S H    8  
ATOM 7811  H HA   . CYS A 1 6  ? -11.358 -9.809  -3.934  1.00 0.00 ? 15 CYS S HA   8  
ATOM 7812  H HB2  . CYS A 1 6  ? -13.138 -9.309  -5.636  1.00 0.00 ? 15 CYS S HB2  8  
ATOM 7813  H HB3  . CYS A 1 6  ? -13.404 -7.770  -4.826  1.00 0.00 ? 15 CYS S HB3  8  
ATOM 7814  H HG   . CYS A 1 6  ? -11.017 -7.038  -5.559  1.00 0.00 ? 15 CYS S HG   8  
ATOM 7815  N N    . LYS A 1 7  ? -10.402 -7.751  -2.846  1.00 0.00 ? 16 LYS S N    8  
ATOM 7816  C CA   . LYS A 1 7  ? -9.811  -6.715  -2.005  1.00 0.00 ? 16 LYS S CA   8  
ATOM 7817  C C    . LYS A 1 7  ? -10.164 -5.327  -2.529  1.00 0.00 ? 16 LYS S C    8  
ATOM 7818  O O    . LYS A 1 7  ? -10.549 -5.170  -3.688  1.00 0.00 ? 16 LYS S O    8  
ATOM 7819  C CB   . LYS A 1 7  ? -8.291  -6.879  -1.949  1.00 0.00 ? 16 LYS S CB   8  
ATOM 7820  C CG   . LYS A 1 7  ? -7.841  -8.120  -1.196  1.00 0.00 ? 16 LYS S CG   8  
ATOM 7821  C CD   . LYS A 1 7  ? -8.206  -8.039  0.277   1.00 0.00 ? 16 LYS S CD   8  
ATOM 7822  C CE   . LYS A 1 7  ? -7.459  -9.082  1.094   1.00 0.00 ? 16 LYS S CE   8  
ATOM 7823  N NZ   . LYS A 1 7  ? -7.454  -8.751  2.545   1.00 0.00 ? 16 LYS S NZ   8  
ATOM 7824  H H    . LYS A 1 7  ? -9.826  -8.248  -3.466  1.00 0.00 ? 16 LYS S H    8  
ATOM 7825  H HA   . LYS A 1 7  ? -10.215 -6.825  -1.010  1.00 0.00 ? 16 LYS S HA   8  
ATOM 7826  H HB2  . LYS A 1 7  ? -7.910  -6.939  -2.957  1.00 0.00 ? 16 LYS S HB2  8  
ATOM 7827  H HB3  . LYS A 1 7  ? -7.865  -6.014  -1.462  1.00 0.00 ? 16 LYS S HB3  8  
ATOM 7828  H HG2  . LYS A 1 7  ? -8.320  -8.986  -1.627  1.00 0.00 ? 16 LYS S HG2  8  
ATOM 7829  H HG3  . LYS A 1 7  ? -6.769  -8.215  -1.287  1.00 0.00 ? 16 LYS S HG3  8  
ATOM 7830  H HD2  . LYS A 1 7  ? -7.953  -7.057  0.648   1.00 0.00 ? 16 LYS S HD2  8  
ATOM 7831  H HD3  . LYS A 1 7  ? -9.269  -8.203  0.384   1.00 0.00 ? 16 LYS S HD3  8  
ATOM 7832  H HE2  . LYS A 1 7  ? -7.938  -10.040 0.955   1.00 0.00 ? 16 LYS S HE2  8  
ATOM 7833  H HE3  . LYS A 1 7  ? -6.440  -9.134  0.741   1.00 0.00 ? 16 LYS S HE3  8  
ATOM 7834  H HZ1  . LYS A 1 7  ? -7.521  -9.620  3.112   1.00 0.00 ? 16 LYS S HZ1  8  
ATOM 7835  H HZ2  . LYS A 1 7  ? -8.261  -8.136  2.775   1.00 0.00 ? 16 LYS S HZ2  8  
ATOM 7836  H HZ3  . LYS A 1 7  ? -6.573  -8.255  2.796   1.00 0.00 ? 16 LYS S HZ3  8  
ATOM 7837  N N    . THR A 1 8  ? -10.034 -4.320  -1.670  1.00 0.00 ? 17 THR S N    8  
ATOM 7838  C CA   . THR A 1 8  ? -10.342 -2.947  -2.053  1.00 0.00 ? 17 THR S CA   8  
ATOM 7839  C C    . THR A 1 8  ? -9.079  -2.100  -2.130  1.00 0.00 ? 17 THR S C    8  
ATOM 7840  O O    . THR A 1 8  ? -8.453  -1.796  -1.115  1.00 0.00 ? 17 THR S O    8  
ATOM 7841  C CB   . THR A 1 8  ? -11.328 -2.327  -1.061  1.00 0.00 ? 17 THR S CB   8  
ATOM 7842  O OG1  . THR A 1 8  ? -11.433 -0.930  -1.267  1.00 0.00 ? 17 THR S OG1  8  
ATOM 7843  C CG2  . THR A 1 8  ? -10.943 -2.552  0.384   1.00 0.00 ? 17 THR S CG2  8  
ATOM 7844  H H    . THR A 1 8  ? -9.724  -4.505  -0.759  1.00 0.00 ? 17 THR S H    8  
ATOM 7845  H HA   . THR A 1 8  ? -10.798 -2.971  -3.031  1.00 0.00 ? 17 THR S HA   8  
ATOM 7846  H HB   . THR A 1 8  ? -12.303 -2.767  -1.215  1.00 0.00 ? 17 THR S HB   8  
ATOM 7847  H HG1  . THR A 1 8  ? -11.756 -0.760  -2.155  1.00 0.00 ? 17 THR S HG1  8  
ATOM 7848  H HG21 . THR A 1 8  ? -9.883  -2.389  0.504   1.00 0.00 ? 17 THR S HG21 8  
ATOM 7849  H HG22 . THR A 1 8  ? -11.186 -3.565  0.670   1.00 0.00 ? 17 THR S HG22 8  
ATOM 7850  H HG23 . THR A 1 8  ? -11.486 -1.860  1.014   1.00 0.00 ? 17 THR S HG23 8  
ATOM 7851  N N    . ILE A 1 9  ? -8.718  -1.720  -3.349  1.00 0.00 ? 18 ILE S N    8  
ATOM 7852  C CA   . ILE A 1 9  ? -7.539  -0.908  -3.589  1.00 0.00 ? 18 ILE S CA   8  
ATOM 7853  C C    . ILE A 1 9  ? -7.901  0.578   -3.642  1.00 0.00 ? 18 ILE S C    8  
ATOM 7854  O O    . ILE A 1 9  ? -8.773  0.982   -4.411  1.00 0.00 ? 18 ILE S O    8  
ATOM 7855  C CB   . ILE A 1 9  ? -6.859  -1.324  -4.911  1.00 0.00 ? 18 ILE S CB   8  
ATOM 7856  C CG1  . ILE A 1 9  ? -5.498  -0.646  -5.058  1.00 0.00 ? 18 ILE S CG1  8  
ATOM 7857  C CG2  . ILE A 1 9  ? -7.752  -1.002  -6.102  1.00 0.00 ? 18 ILE S CG2  8  
ATOM 7858  C CD1  . ILE A 1 9  ? -5.577  0.845   -5.259  1.00 0.00 ? 18 ILE S CD1  8  
ATOM 7859  H H    . ILE A 1 9  ? -9.259  -1.999  -4.113  1.00 0.00 ? 18 ILE S H    8  
ATOM 7860  H HA   . ILE A 1 9  ? -6.844  -1.075  -2.778  1.00 0.00 ? 18 ILE S HA   8  
ATOM 7861  H HB   . ILE A 1 9  ? -6.714  -2.395  -4.888  1.00 0.00 ? 18 ILE S HB   8  
ATOM 7862  H HG12 . ILE A 1 9  ? -4.922  -0.824  -4.167  1.00 0.00 ? 18 ILE S HG12 8  
ATOM 7863  H HG13 . ILE A 1 9  ? -4.981  -1.071  -5.906  1.00 0.00 ? 18 ILE S HG13 8  
ATOM 7864  H HG21 . ILE A 1 9  ? -7.824  0.069   -6.220  1.00 0.00 ? 18 ILE S HG21 8  
ATOM 7865  H HG22 . ILE A 1 9  ? -8.737  -1.414  -5.936  1.00 0.00 ? 18 ILE S HG22 8  
ATOM 7866  H HG23 . ILE A 1 9  ? -7.327  -1.435  -6.997  1.00 0.00 ? 18 ILE S HG23 8  
ATOM 7867  H HD11 . ILE A 1 9  ? -4.822  1.157   -5.963  1.00 0.00 ? 18 ILE S HD11 8  
ATOM 7868  H HD12 . ILE A 1 9  ? -5.414  1.335   -4.313  1.00 0.00 ? 18 ILE S HD12 8  
ATOM 7869  H HD13 . ILE A 1 9  ? -6.556  1.107   -5.637  1.00 0.00 ? 18 ILE S HD13 8  
ATOM 7870  N N    . TYR A 1 10 ? -7.217  1.387   -2.835  1.00 0.00 ? 19 TYR S N    8  
ATOM 7871  C CA   . TYR A 1 10 ? -7.465  2.826   -2.815  1.00 0.00 ? 19 TYR S CA   8  
ATOM 7872  C C    . TYR A 1 10 ? -6.558  3.512   -3.840  1.00 0.00 ? 19 TYR S C    8  
ATOM 7873  O O    . TYR A 1 10 ? -5.360  3.242   -3.890  1.00 0.00 ? 19 TYR S O    8  
ATOM 7874  C CB   . TYR A 1 10 ? -7.238  3.396   -1.404  1.00 0.00 ? 19 TYR S CB   8  
ATOM 7875  C CG   . TYR A 1 10 ? -8.336  3.034   -0.413  1.00 0.00 ? 19 TYR S CG   8  
ATOM 7876  C CD1  . TYR A 1 10 ? -9.117  1.899   -0.600  1.00 0.00 ? 19 TYR S CD1  8  
ATOM 7877  C CD2  . TYR A 1 10 ? -8.598  3.828   0.707   1.00 0.00 ? 19 TYR S CD2  8  
ATOM 7878  C CE1  . TYR A 1 10 ? -10.118 1.562   0.291   1.00 0.00 ? 19 TYR S CE1  8  
ATOM 7879  C CE2  . TYR A 1 10 ? -9.598  3.493   1.598   1.00 0.00 ? 19 TYR S CE2  8  
ATOM 7880  C CZ   . TYR A 1 10 ? -10.354 2.361   1.387   1.00 0.00 ? 19 TYR S CZ   8  
ATOM 7881  O OH   . TYR A 1 10 ? -11.351 2.029   2.274   1.00 0.00 ? 19 TYR S OH   8  
ATOM 7882  H H    . TYR A 1 10 ? -6.525  1.011   -2.251  1.00 0.00 ? 19 TYR S H    8  
ATOM 7883  H HA   . TYR A 1 10 ? -8.494  2.983   -3.099  1.00 0.00 ? 19 TYR S HA   8  
ATOM 7884  H HB2  . TYR A 1 10 ? -6.303  3.014   -1.015  1.00 0.00 ? 19 TYR S HB2  8  
ATOM 7885  H HB3  . TYR A 1 10 ? -7.185  4.475   -1.464  1.00 0.00 ? 19 TYR S HB3  8  
ATOM 7886  H HD1  . TYR A 1 10 ? -8.934  1.270   -1.456  1.00 0.00 ? 19 TYR S HD1  8  
ATOM 7887  H HD2  . TYR A 1 10 ? -8.009  4.717   0.885   1.00 0.00 ? 19 TYR S HD2  8  
ATOM 7888  H HE1  . TYR A 1 10 ? -10.711 0.675   0.125   1.00 0.00 ? 19 TYR S HE1  8  
ATOM 7889  H HE2  . TYR A 1 10 ? -9.782  4.120   2.456   1.00 0.00 ? 19 TYR S HE2  8  
ATOM 7890  H HH   . TYR A 1 10 ? -11.093 1.247   2.769   1.00 0.00 ? 19 TYR S HH   8  
ATOM 7891  N N    . PRO A 1 11 ? -7.116  4.399   -4.687  1.00 0.00 ? 20 PRO S N    8  
ATOM 7892  C CA   . PRO A 1 11 ? -6.363  5.102   -5.728  1.00 0.00 ? 20 PRO S CA   8  
ATOM 7893  C C    . PRO A 1 11 ? -4.958  5.506   -5.290  1.00 0.00 ? 20 PRO S C    8  
ATOM 7894  O O    . PRO A 1 11 ? -4.786  6.392   -4.452  1.00 0.00 ? 20 PRO S O    8  
ATOM 7895  C CB   . PRO A 1 11 ? -7.219  6.345   -6.023  1.00 0.00 ? 20 PRO S CB   8  
ATOM 7896  C CG   . PRO A 1 11 ? -8.442  6.225   -5.162  1.00 0.00 ? 20 PRO S CG   8  
ATOM 7897  C CD   . PRO A 1 11 ? -8.525  4.790   -4.722  1.00 0.00 ? 20 PRO S CD   8  
ATOM 7898  H HA   . PRO A 1 11 ? -6.289  4.502   -6.624  1.00 0.00 ? 20 PRO S HA   8  
ATOM 7899  H HB2  . PRO A 1 11 ? -6.656  7.235   -5.780  1.00 0.00 ? 20 PRO S HB2  8  
ATOM 7900  H HB3  . PRO A 1 11 ? -7.481  6.357   -7.073  1.00 0.00 ? 20 PRO S HB3  8  
ATOM 7901  H HG2  . PRO A 1 11 ? -8.342  6.871   -4.303  1.00 0.00 ? 20 PRO S HG2  8  
ATOM 7902  H HG3  . PRO A 1 11 ? -9.318  6.493   -5.732  1.00 0.00 ? 20 PRO S HG3  8  
ATOM 7903  H HD2  . PRO A 1 11 ? -8.975  4.718   -3.742  1.00 0.00 ? 20 PRO S HD2  8  
ATOM 7904  H HD3  . PRO A 1 11 ? -9.074  4.201   -5.443  1.00 0.00 ? 20 PRO S HD3  8  
ATOM 7905  N N    . LEU A 1 12 ? -3.953  4.843   -5.869  1.00 0.00 ? 21 LEU S N    8  
ATOM 7906  C CA   . LEU A 1 12 ? -2.552  5.119   -5.552  1.00 0.00 ? 21 LEU S CA   8  
ATOM 7907  C C    . LEU A 1 12 ? -2.278  6.618   -5.454  1.00 0.00 ? 21 LEU S C    8  
ATOM 7908  O O    . LEU A 1 12 ? -1.398  7.048   -4.712  1.00 0.00 ? 21 LEU S O    8  
ATOM 7909  C CB   . LEU A 1 12 ? -1.638  4.497   -6.610  1.00 0.00 ? 21 LEU S CB   8  
ATOM 7910  C CG   . LEU A 1 12 ? -1.673  5.178   -7.980  1.00 0.00 ? 21 LEU S CG   8  
ATOM 7911  C CD1  . LEU A 1 12 ? -0.510  6.147   -8.124  1.00 0.00 ? 21 LEU S CD1  8  
ATOM 7912  C CD2  . LEU A 1 12 ? -1.645  4.141   -9.092  1.00 0.00 ? 21 LEU S CD2  8  
ATOM 7913  H H    . LEU A 1 12 ? -4.159  4.144   -6.525  1.00 0.00 ? 21 LEU S H    8  
ATOM 7914  H HA   . LEU A 1 12 ? -2.336  4.664   -4.596  1.00 0.00 ? 21 LEU S HA   8  
ATOM 7915  H HB2  . LEU A 1 12 ? -0.622  4.532   -6.238  1.00 0.00 ? 21 LEU S HB2  8  
ATOM 7916  H HB3  . LEU A 1 12 ? -1.925  3.464   -6.739  1.00 0.00 ? 21 LEU S HB3  8  
ATOM 7917  H HG   . LEU A 1 12 ? -2.590  5.742   -8.070  1.00 0.00 ? 21 LEU S HG   8  
ATOM 7918  H HD11 . LEU A 1 12 ? -0.839  7.027   -8.659  1.00 0.00 ? 21 LEU S HD11 8  
ATOM 7919  H HD12 . LEU A 1 12 ? 0.289   5.671   -8.673  1.00 0.00 ? 21 LEU S HD12 8  
ATOM 7920  H HD13 . LEU A 1 12 ? -0.155  6.433   -7.144  1.00 0.00 ? 21 LEU S HD13 8  
ATOM 7921  H HD21 . LEU A 1 12 ? -2.047  3.207   -8.725  1.00 0.00 ? 21 LEU S HD21 8  
ATOM 7922  H HD22 . LEU A 1 12 ? -0.626  3.990   -9.418  1.00 0.00 ? 21 LEU S HD22 8  
ATOM 7923  H HD23 . LEU A 1 12 ? -2.241  4.487   -9.923  1.00 0.00 ? 21 LEU S HD23 8  
ATOM 7924  N N    . ALA A 1 13 ? -3.037  7.412   -6.199  1.00 0.00 ? 22 ALA S N    8  
ATOM 7925  C CA   . ALA A 1 13 ? -2.862  8.856   -6.170  1.00 0.00 ? 22 ALA S CA   8  
ATOM 7926  C C    . ALA A 1 13 ? -3.213  9.396   -4.793  1.00 0.00 ? 22 ALA S C    8  
ATOM 7927  O O    . ALA A 1 13 ? -2.474  10.193  -4.216  1.00 0.00 ? 22 ALA S O    8  
ATOM 7928  C CB   . ALA A 1 13 ? -3.715  9.519   -7.241  1.00 0.00 ? 22 ALA S CB   8  
ATOM 7929  H H    . ALA A 1 13 ? -3.730  7.021   -6.772  1.00 0.00 ? 22 ALA S H    8  
ATOM 7930  H HA   . ALA A 1 13 ? -1.822  9.073   -6.377  1.00 0.00 ? 22 ALA S HA   8  
ATOM 7931  H HB1  . ALA A 1 13 ? -3.573  10.590  -7.201  1.00 0.00 ? 22 ALA S HB1  8  
ATOM 7932  H HB2  . ALA A 1 13 ? -4.755  9.289   -7.065  1.00 0.00 ? 22 ALA S HB2  8  
ATOM 7933  H HB3  . ALA A 1 13 ? -3.424  9.152   -8.214  1.00 0.00 ? 22 ALA S HB3  8  
ATOM 7934  N N    . ASP A 1 14 ? -4.344  8.937   -4.266  1.00 0.00 ? 23 ASP S N    8  
ATOM 7935  C CA   . ASP A 1 14 ? -4.807  9.351   -2.946  1.00 0.00 ? 23 ASP S CA   8  
ATOM 7936  C C    . ASP A 1 14 ? -3.722  9.140   -1.895  1.00 0.00 ? 23 ASP S C    8  
ATOM 7937  O O    . ASP A 1 14 ? -3.520  9.972   -1.013  1.00 0.00 ? 23 ASP S O    8  
ATOM 7938  C CB   . ASP A 1 14 ? -6.054  8.550   -2.559  1.00 0.00 ? 23 ASP S CB   8  
ATOM 7939  C CG   . ASP A 1 14 ? -7.304  9.035   -3.269  1.00 0.00 ? 23 ASP S CG   8  
ATOM 7940  O OD1  . ASP A 1 14 ? -7.362  8.921   -4.510  1.00 0.00 ? 23 ASP S OD1  8  
ATOM 7941  O OD2  . ASP A 1 14 ? -8.226  9.525   -2.583  1.00 0.00 ? 23 ASP S OD2  8  
ATOM 7942  H H    . ASP A 1 14 ? -4.879  8.294   -4.776  1.00 0.00 ? 23 ASP S H    8  
ATOM 7943  H HA   . ASP A 1 14 ? -5.058  10.398  -2.986  1.00 0.00 ? 23 ASP S HA   8  
ATOM 7944  H HB2  . ASP A 1 14 ? -5.899  7.512   -2.817  1.00 0.00 ? 23 ASP S HB2  8  
ATOM 7945  H HB3  . ASP A 1 14 ? -6.212  8.632   -1.493  1.00 0.00 ? 23 ASP S HB3  8  
ATOM 7946  N N    . LEU A 1 15 ? -3.034  8.012   -2.000  1.00 0.00 ? 24 LEU S N    8  
ATOM 7947  C CA   . LEU A 1 15 ? -1.972  7.664   -1.062  1.00 0.00 ? 24 LEU S CA   8  
ATOM 7948  C C    . LEU A 1 15 ? -0.630  8.233   -1.498  1.00 0.00 ? 24 LEU S C    8  
ATOM 7949  O O    . LEU A 1 15 ? 0.348   8.174   -0.753  1.00 0.00 ? 24 LEU S O    8  
ATOM 7950  C CB   . LEU A 1 15 ? -1.869  6.143   -0.934  1.00 0.00 ? 24 LEU S CB   8  
ATOM 7951  C CG   . LEU A 1 15 ? -2.208  5.357   -2.204  1.00 0.00 ? 24 LEU S CG   8  
ATOM 7952  C CD1  . LEU A 1 15 ? -1.368  4.089   -2.314  1.00 0.00 ? 24 LEU S CD1  8  
ATOM 7953  C CD2  . LEU A 1 15 ? -3.690  5.022   -2.223  1.00 0.00 ? 24 LEU S CD2  8  
ATOM 7954  H H    . LEU A 1 15 ? -3.246  7.394   -2.729  1.00 0.00 ? 24 LEU S H    8  
ATOM 7955  H HA   . LEU A 1 15 ? -2.231  8.079   -0.100  1.00 0.00 ? 24 LEU S HA   8  
ATOM 7956  H HB2  . LEU A 1 15 ? -0.862  5.895   -0.635  1.00 0.00 ? 24 LEU S HB2  8  
ATOM 7957  H HB3  . LEU A 1 15 ? -2.546  5.829   -0.157  1.00 0.00 ? 24 LEU S HB3  8  
ATOM 7958  H HG   . LEU A 1 15 ? -1.993  5.968   -3.064  1.00 0.00 ? 24 LEU S HG   8  
ATOM 7959  H HD11 . LEU A 1 15 ? -0.925  4.035   -3.295  1.00 0.00 ? 24 LEU S HD11 8  
ATOM 7960  H HD12 . LEU A 1 15 ? -2.000  3.223   -2.155  1.00 0.00 ? 24 LEU S HD12 8  
ATOM 7961  H HD13 . LEU A 1 15 ? -0.589  4.105   -1.566  1.00 0.00 ? 24 LEU S HD13 8  
ATOM 7962  H HD21 . LEU A 1 15 ? -3.889  4.222   -1.525  1.00 0.00 ? 24 LEU S HD21 8  
ATOM 7963  H HD22 . LEU A 1 15 ? -3.974  4.713   -3.215  1.00 0.00 ? 24 LEU S HD22 8  
ATOM 7964  H HD23 . LEU A 1 15 ? -4.258  5.896   -1.941  1.00 0.00 ? 24 LEU S HD23 8  
ATOM 7965  N N    . LEU A 1 16 ? -0.575  8.765   -2.712  1.00 0.00 ? 25 LEU S N    8  
ATOM 7966  C CA   . LEU A 1 16 ? 0.656   9.314   -3.236  1.00 0.00 ? 25 LEU S CA   8  
ATOM 7967  C C    . LEU A 1 16 ? 0.591   10.834  -3.391  1.00 0.00 ? 25 LEU S C    8  
ATOM 7968  O O    . LEU A 1 16 ? 1.146   11.392  -4.337  1.00 0.00 ? 25 LEU S O    8  
ATOM 7969  C CB   . LEU A 1 16 ? 0.983   8.638   -4.564  1.00 0.00 ? 25 LEU S CB   8  
ATOM 7970  C CG   . LEU A 1 16 ? 2.464   8.641   -4.944  1.00 0.00 ? 25 LEU S CG   8  
ATOM 7971  C CD1  . LEU A 1 16 ? 3.300   8.123   -3.785  1.00 0.00 ? 25 LEU S CD1  8  
ATOM 7972  C CD2  . LEU A 1 16 ? 2.697   7.804   -6.194  1.00 0.00 ? 25 LEU S CD2  8  
ATOM 7973  H H    . LEU A 1 16 ? -1.373  8.770   -3.270  1.00 0.00 ? 25 LEU S H    8  
ATOM 7974  H HA   . LEU A 1 16 ? 1.439   9.080   -2.531  1.00 0.00 ? 25 LEU S HA   8  
ATOM 7975  H HB2  . LEU A 1 16 ? 0.651   7.607   -4.500  1.00 0.00 ? 25 LEU S HB2  8  
ATOM 7976  H HB3  . LEU A 1 16 ? 0.428   9.131   -5.346  1.00 0.00 ? 25 LEU S HB3  8  
ATOM 7977  H HG   . LEU A 1 16 ? 2.774   9.655   -5.154  1.00 0.00 ? 25 LEU S HG   8  
ATOM 7978  H HD11 . LEU A 1 16 ? 2.650   7.656   -3.058  1.00 0.00 ? 25 LEU S HD11 8  
ATOM 7979  H HD12 . LEU A 1 16 ? 3.824   8.945   -3.324  1.00 0.00 ? 25 LEU S HD12 8  
ATOM 7980  H HD13 . LEU A 1 16 ? 4.013   7.399   -4.147  1.00 0.00 ? 25 LEU S HD13 8  
ATOM 7981  H HD21 . LEU A 1 16 ? 1.819   7.212   -6.400  1.00 0.00 ? 25 LEU S HD21 8  
ATOM 7982  H HD22 . LEU A 1 16 ? 3.544   7.152   -6.037  1.00 0.00 ? 25 LEU S HD22 8  
ATOM 7983  H HD23 . LEU A 1 16 ? 2.895   8.457   -7.031  1.00 0.00 ? 25 LEU S HD23 8  
ATOM 7984  N N    . ALA A 1 17 ? -0.064  11.493  -2.427  1.00 0.00 ? 26 ALA S N    8  
ATOM 7985  C CA   . ALA A 1 17 ? -0.185  12.961  -2.398  1.00 0.00 ? 26 ALA S CA   8  
ATOM 7986  C C    . ALA A 1 17 ? -1.504  13.473  -2.978  1.00 0.00 ? 26 ALA S C    8  
ATOM 7987  O O    . ALA A 1 17 ? -1.516  14.421  -3.764  1.00 0.00 ? 26 ALA S O    8  
ATOM 7988  C CB   . ALA A 1 17 ? 0.991   13.624  -3.109  1.00 0.00 ? 26 ALA S CB   8  
ATOM 7989  H H    . ALA A 1 17 ? -0.461  10.973  -1.694  1.00 0.00 ? 26 ALA S H    8  
ATOM 7990  H HA   . ALA A 1 17 ? -0.140  13.260  -1.361  1.00 0.00 ? 26 ALA S HA   8  
ATOM 7991  H HB1  . ALA A 1 17 ? 1.881   13.029  -2.966  1.00 0.00 ? 26 ALA S HB1  8  
ATOM 7992  H HB2  . ALA A 1 17 ? 1.148   14.611  -2.700  1.00 0.00 ? 26 ALA S HB2  8  
ATOM 7993  H HB3  . ALA A 1 17 ? 0.775   13.703  -4.165  1.00 0.00 ? 26 ALA S HB3  8  
ATOM 7994  N N    . ARG A 1 18 ? -2.614  12.869  -2.570  1.00 0.00 ? 27 ARG S N    8  
ATOM 7995  C CA   . ARG A 1 18 ? -3.930  13.299  -3.034  1.00 0.00 ? 27 ARG S CA   8  
ATOM 7996  C C    . ARG A 1 18 ? -4.995  13.009  -1.979  1.00 0.00 ? 27 ARG S C    8  
ATOM 7997  O O    . ARG A 1 18 ? -4.999  11.930  -1.393  1.00 0.00 ? 27 ARG S O    8  
ATOM 7998  C CB   . ARG A 1 18 ? -4.295  12.605  -4.351  1.00 0.00 ? 27 ARG S CB   8  
ATOM 7999  C CG   . ARG A 1 18 ? -5.730  12.851  -4.793  1.00 0.00 ? 27 ARG S CG   8  
ATOM 8000  C CD   . ARG A 1 18 ? -6.647  11.721  -4.365  1.00 0.00 ? 27 ARG S CD   8  
ATOM 8001  N NE   . ARG A 1 18 ? -7.895  11.709  -5.125  1.00 0.00 ? 27 ARG S NE   8  
ATOM 8002  C CZ   . ARG A 1 18 ? -8.005  11.229  -6.361  1.00 0.00 ? 27 ARG S CZ   8  
ATOM 8003  N NH1  . ARG A 1 18 ? -6.948  10.717  -6.980  1.00 0.00 ? 27 ARG S NH1  8  
ATOM 8004  N NH2  . ARG A 1 18 ? -9.177  11.258  -6.981  1.00 0.00 ? 27 ARG S NH2  8  
ATOM 8005  H H    . ARG A 1 18 ? -2.549  12.132  -1.926  1.00 0.00 ? 27 ARG S H    8  
ATOM 8006  H HA   . ARG A 1 18 ? -3.886  14.365  -3.201  1.00 0.00 ? 27 ARG S HA   8  
ATOM 8007  H HB2  . ARG A 1 18 ? -3.635  12.962  -5.128  1.00 0.00 ? 27 ARG S HB2  8  
ATOM 8008  H HB3  . ARG A 1 18 ? -4.157  11.545  -4.233  1.00 0.00 ? 27 ARG S HB3  8  
ATOM 8009  H HG2  . ARG A 1 18 ? -6.081  13.766  -4.346  1.00 0.00 ? 27 ARG S HG2  8  
ATOM 8010  H HG3  . ARG A 1 18 ? -5.757  12.939  -5.869  1.00 0.00 ? 27 ARG S HG3  8  
ATOM 8011  H HD2  . ARG A 1 18 ? -6.135  10.783  -4.516  1.00 0.00 ? 27 ARG S HD2  8  
ATOM 8012  H HD3  . ARG A 1 18 ? -6.879  11.841  -3.315  1.00 0.00 ? 27 ARG S HD3  8  
ATOM 8013  H HE   . ARG A 1 18 ? -8.692  12.079  -4.692  1.00 0.00 ? 27 ARG S HE   8  
ATOM 8014  H HH11 . ARG A 1 18 ? -6.061  10.691  -6.517  1.00 0.00 ? 27 ARG S HH11 8  
ATOM 8015  H HH12 . ARG A 1 18 ? -7.036  10.358  -7.908  1.00 0.00 ? 27 ARG S HH12 8  
ATOM 8016  H HH21 . ARG A 1 18 ? -9.977  11.641  -6.520  1.00 0.00 ? 27 ARG S HH21 8  
ATOM 8017  H HH22 . ARG A 1 18 ? -9.260  10.897  -7.910  1.00 0.00 ? 27 ARG S HH22 8  
ATOM 8018  N N    . PRO A 1 19 ? -5.918  13.967  -1.728  1.00 0.00 ? 28 PRO S N    8  
ATOM 8019  C CA   . PRO A 1 19 ? -6.996  13.808  -0.746  1.00 0.00 ? 28 PRO S CA   8  
ATOM 8020  C C    . PRO A 1 19 ? -7.487  12.366  -0.619  1.00 0.00 ? 28 PRO S C    8  
ATOM 8021  O O    . PRO A 1 19 ? -8.487  11.976  -1.221  1.00 0.00 ? 28 PRO S O    8  
ATOM 8022  C CB   . PRO A 1 19 ? -8.087  14.702  -1.324  1.00 0.00 ? 28 PRO S CB   8  
ATOM 8023  C CG   . PRO A 1 19 ? -7.351  15.822  -1.988  1.00 0.00 ? 28 PRO S CG   8  
ATOM 8024  C CD   . PRO A 1 19 ? -5.989  15.290  -2.379  1.00 0.00 ? 28 PRO S CD   8  
ATOM 8025  H HA   . PRO A 1 19 ? -6.704  14.178  0.225   1.00 0.00 ? 28 PRO S HA   8  
ATOM 8026  H HB2  . PRO A 1 19 ? -8.678  14.138  -2.036  1.00 0.00 ? 28 PRO S HB2  8  
ATOM 8027  H HB3  . PRO A 1 19 ? -8.720  15.065  -0.525  1.00 0.00 ? 28 PRO S HB3  8  
ATOM 8028  H HG2  . PRO A 1 19 ? -7.890  16.141  -2.866  1.00 0.00 ? 28 PRO S HG2  8  
ATOM 8029  H HG3  . PRO A 1 19 ? -7.244  16.646  -1.297  1.00 0.00 ? 28 PRO S HG3  8  
ATOM 8030  H HD2  . PRO A 1 19 ? -5.916  15.197  -3.451  1.00 0.00 ? 28 PRO S HD2  8  
ATOM 8031  H HD3  . PRO A 1 19 ? -5.212  15.943  -2.005  1.00 0.00 ? 28 PRO S HD3  8  
ATOM 8032  N N    . LEU A 1 20 ? -6.756  11.585  0.168   1.00 0.00 ? 29 LEU S N    8  
ATOM 8033  C CA   . LEU A 1 20 ? -7.078  10.178  0.390   1.00 0.00 ? 29 LEU S CA   8  
ATOM 8034  C C    . LEU A 1 20 ? -8.218  10.003  1.389   1.00 0.00 ? 29 LEU S C    8  
ATOM 8035  O O    . LEU A 1 20 ? -8.490  10.885  2.202   1.00 0.00 ? 29 LEU S O    8  
ATOM 8036  C CB   . LEU A 1 20 ? -5.843  9.418   0.890   1.00 0.00 ? 29 LEU S CB   8  
ATOM 8037  C CG   . LEU A 1 20 ? -5.034  10.122  1.985   1.00 0.00 ? 29 LEU S CG   8  
ATOM 8038  C CD1  . LEU A 1 20 ? -5.830  10.182  3.279   1.00 0.00 ? 29 LEU S CD1  8  
ATOM 8039  C CD2  . LEU A 1 20 ? -3.704  9.414   2.205   1.00 0.00 ? 29 LEU S CD2  8  
ATOM 8040  H H    . LEU A 1 20 ? -5.969  11.965  0.599   1.00 0.00 ? 29 LEU S H    8  
ATOM 8041  H HA   . LEU A 1 20 ? -7.384  9.759   -0.556  1.00 0.00 ? 29 LEU S HA   8  
ATOM 8042  H HB2  . LEU A 1 20 ? -6.171  8.462   1.276   1.00 0.00 ? 29 LEU S HB2  8  
ATOM 8043  H HB3  . LEU A 1 20 ? -5.191  9.242   0.050   1.00 0.00 ? 29 LEU S HB3  8  
ATOM 8044  H HG   . LEU A 1 20 ? -4.823  11.134  1.676   1.00 0.00 ? 29 LEU S HG   8  
ATOM 8045  H HD11 . LEU A 1 20 ? -6.478  9.321   3.344   1.00 0.00 ? 29 LEU S HD11 8  
ATOM 8046  H HD12 . LEU A 1 20 ? -6.426  11.083  3.292   1.00 0.00 ? 29 LEU S HD12 8  
ATOM 8047  H HD13 . LEU A 1 20 ? -5.152  10.187  4.118   1.00 0.00 ? 29 LEU S HD13 8  
ATOM 8048  H HD21 . LEU A 1 20 ? -2.917  10.148  2.289   1.00 0.00 ? 29 LEU S HD21 8  
ATOM 8049  H HD22 . LEU A 1 20 ? -3.500  8.762   1.370   1.00 0.00 ? 29 LEU S HD22 8  
ATOM 8050  H HD23 . LEU A 1 20 ? -3.751  8.832   3.114   1.00 0.00 ? 29 LEU S HD23 8  
ATOM 8051  N N    . PRO A 1 21 ? -8.894  8.840   1.335   1.00 0.00 ? 30 PRO S N    8  
ATOM 8052  C CA   . PRO A 1 21 ? -10.007 8.520   2.230   1.00 0.00 ? 30 PRO S CA   8  
ATOM 8053  C C    . PRO A 1 21 ? -9.529  8.093   3.609   1.00 0.00 ? 30 PRO S C    8  
ATOM 8054  O O    . PRO A 1 21 ? -8.406  8.397   4.009   1.00 0.00 ? 30 PRO S O    8  
ATOM 8055  C CB   . PRO A 1 21 ? -10.683 7.357   1.510   1.00 0.00 ? 30 PRO S CB   8  
ATOM 8056  C CG   . PRO A 1 21 ? -9.552  6.650   0.865   1.00 0.00 ? 30 PRO S CG   8  
ATOM 8057  C CD   . PRO A 1 21 ? -8.623  7.734   0.394   1.00 0.00 ? 30 PRO S CD   8  
ATOM 8058  H HA   . PRO A 1 21 ? -10.696 9.340   2.325   1.00 0.00 ? 30 PRO S HA   8  
ATOM 8059  H HB2  . PRO A 1 21 ? -11.194 6.726   2.225   1.00 0.00 ? 30 PRO S HB2  8  
ATOM 8060  H HB3  . PRO A 1 21 ? -11.380 7.735   0.781   1.00 0.00 ? 30 PRO S HB3  8  
ATOM 8061  H HG2  . PRO A 1 21 ? -9.057  6.021   1.590   1.00 0.00 ? 30 PRO S HG2  8  
ATOM 8062  H HG3  . PRO A 1 21 ? -9.907  6.066   0.027   1.00 0.00 ? 30 PRO S HG3  8  
ATOM 8063  H HD2  . PRO A 1 21 ? -7.596  7.408   0.462   1.00 0.00 ? 30 PRO S HD2  8  
ATOM 8064  H HD3  . PRO A 1 21 ? -8.866  8.023   -0.618  1.00 0.00 ? 30 PRO S HD3  8  
ATOM 8065  N N    . GLU A 1 22 ? -10.387 7.388   4.336   1.00 0.00 ? 31 GLU S N    8  
ATOM 8066  C CA   . GLU A 1 22 ? -10.038 6.928   5.673   1.00 0.00 ? 31 GLU S CA   8  
ATOM 8067  C C    . GLU A 1 22 ? -9.489  5.514   5.652   1.00 0.00 ? 31 GLU S C    8  
ATOM 8068  O O    . GLU A 1 22 ? -8.517  5.218   6.348   1.00 0.00 ? 31 GLU S O    8  
ATOM 8069  C CB   . GLU A 1 22 ? -11.242 7.022   6.613   1.00 0.00 ? 31 GLU S CB   8  
ATOM 8070  C CG   . GLU A 1 22 ? -10.918 6.659   8.053   1.00 0.00 ? 31 GLU S CG   8  
ATOM 8071  C CD   . GLU A 1 22 ? -11.592 7.577   9.051   1.00 0.00 ? 31 GLU S CD   8  
ATOM 8072  O OE1  . GLU A 1 22 ? -11.809 8.760   8.718   1.00 0.00 ? 31 GLU S OE1  8  
ATOM 8073  O OE2  . GLU A 1 22 ? -11.904 7.113   10.168  1.00 0.00 ? 31 GLU S OE2  8  
ATOM 8074  H H    . GLU A 1 22 ? -11.269 7.181   3.966   1.00 0.00 ? 31 GLU S H    8  
ATOM 8075  H HA   . GLU A 1 22 ? -9.256  7.573   6.033   1.00 0.00 ? 31 GLU S HA   8  
ATOM 8076  H HB2  . GLU A 1 22 ? -11.620 8.035   6.596   1.00 0.00 ? 31 GLU S HB2  8  
ATOM 8077  H HB3  . GLU A 1 22 ? -12.013 6.353   6.260   1.00 0.00 ? 31 GLU S HB3  8  
ATOM 8078  H HG2  . GLU A 1 22 ? -11.247 5.646   8.237   1.00 0.00 ? 31 GLU S HG2  8  
ATOM 8079  H HG3  . GLU A 1 22 ? -9.848  6.721   8.194   1.00 0.00 ? 31 GLU S HG3  8  
ATOM 8080  N N    . GLY A 1 23 ? -10.079 4.641   4.836   1.00 0.00 ? 32 GLY S N    8  
ATOM 8081  C CA   . GLY A 1 23 ? -9.568  3.284   4.744   1.00 0.00 ? 32 GLY S CA   8  
ATOM 8082  C C    . GLY A 1 23 ? -8.067  3.295   4.524   1.00 0.00 ? 32 GLY S C    8  
ATOM 8083  O O    . GLY A 1 23 ? -7.360  2.353   4.879   1.00 0.00 ? 32 GLY S O    8  
ATOM 8084  H H    . GLY A 1 23 ? -10.833 4.926   4.280   1.00 0.00 ? 32 GLY S H    8  
ATOM 8085  H HA2  . GLY A 1 23 ? -9.792  2.757   5.663   1.00 0.00 ? 32 GLY S HA2  8  
ATOM 8086  H HA3  . GLY A 1 23 ? -10.042 2.778   3.916   1.00 0.00 ? 32 GLY S HA3  8  
ATOM 8087  N N    . VAL A 1 24 ? -7.591  4.401   3.951   1.00 0.00 ? 33 VAL S N    8  
ATOM 8088  C CA   . VAL A 1 24 ? -6.182  4.608   3.687   1.00 0.00 ? 33 VAL S CA   8  
ATOM 8089  C C    . VAL A 1 24 ? -5.490  5.164   4.935   1.00 0.00 ? 33 VAL S C    8  
ATOM 8090  O O    . VAL A 1 24 ? -5.753  6.296   5.342   1.00 0.00 ? 33 VAL S O    8  
ATOM 8091  C CB   . VAL A 1 24 ? -6.006  5.588   2.493   1.00 0.00 ? 33 VAL S CB   8  
ATOM 8092  C CG1  . VAL A 1 24 ? -4.979  6.674   2.781   1.00 0.00 ? 33 VAL S CG1  8  
ATOM 8093  C CG2  . VAL A 1 24 ? -5.640  4.837   1.223   1.00 0.00 ? 33 VAL S CG2  8  
ATOM 8094  H H    . VAL A 1 24 ? -8.218  5.114   3.711   1.00 0.00 ? 33 VAL S H    8  
ATOM 8095  H HA   . VAL A 1 24 ? -5.745  3.659   3.425   1.00 0.00 ? 33 VAL S HA   8  
ATOM 8096  H HB   . VAL A 1 24 ? -6.956  6.074   2.324   1.00 0.00 ? 33 VAL S HB   8  
ATOM 8097  H HG11 . VAL A 1 24 ? -5.402  7.395   3.463   1.00 0.00 ? 33 VAL S HG11 8  
ATOM 8098  H HG12 . VAL A 1 24 ? -4.712  7.165   1.858   1.00 0.00 ? 33 VAL S HG12 8  
ATOM 8099  H HG13 . VAL A 1 24 ? -4.097  6.232   3.220   1.00 0.00 ? 33 VAL S HG13 8  
ATOM 8100  H HG21 . VAL A 1 24 ? -6.276  5.173   0.416   1.00 0.00 ? 33 VAL S HG21 8  
ATOM 8101  H HG22 . VAL A 1 24 ? -5.781  3.777   1.376   1.00 0.00 ? 33 VAL S HG22 8  
ATOM 8102  H HG23 . VAL A 1 24 ? -4.611  5.035   0.973   1.00 0.00 ? 33 VAL S HG23 8  
ATOM 8103  N N    . ASP A 1 25 ? -4.607  4.375   5.544   1.00 0.00 ? 34 ASP S N    8  
ATOM 8104  C CA   . ASP A 1 25 ? -3.899  4.825   6.734   1.00 0.00 ? 34 ASP S CA   8  
ATOM 8105  C C    . ASP A 1 25 ? -2.524  5.376   6.348   1.00 0.00 ? 34 ASP S C    8  
ATOM 8106  O O    . ASP A 1 25 ? -1.724  4.673   5.734   1.00 0.00 ? 34 ASP S O    8  
ATOM 8107  C CB   . ASP A 1 25 ? -3.745  3.678   7.738   1.00 0.00 ? 34 ASP S CB   8  
ATOM 8108  C CG   . ASP A 1 25 ? -4.954  2.761   7.765   1.00 0.00 ? 34 ASP S CG   8  
ATOM 8109  O OD1  . ASP A 1 25 ? -5.960  3.123   8.412   1.00 0.00 ? 34 ASP S OD1  8  
ATOM 8110  O OD2  . ASP A 1 25 ? -4.895  1.681   7.139   1.00 0.00 ? 34 ASP S OD2  8  
ATOM 8111  H H    . ASP A 1 25 ? -4.423  3.481   5.188   1.00 0.00 ? 34 ASP S H    8  
ATOM 8112  H HA   . ASP A 1 25 ? -4.485  5.614   7.183   1.00 0.00 ? 34 ASP S HA   8  
ATOM 8113  H HB2  . ASP A 1 25 ? -2.878  3.090   7.474   1.00 0.00 ? 34 ASP S HB2  8  
ATOM 8114  H HB3  . ASP A 1 25 ? -3.610  4.092   8.728   1.00 0.00 ? 34 ASP S HB3  8  
ATOM 8115  N N    . PRO A 1 26 ? -2.235  6.647   6.685   1.00 0.00 ? 35 PRO S N    8  
ATOM 8116  C CA   . PRO A 1 26 ? -0.956  7.289   6.349   1.00 0.00 ? 35 PRO S CA   8  
ATOM 8117  C C    . PRO A 1 26 ? 0.263   6.520   6.856   1.00 0.00 ? 35 PRO S C    8  
ATOM 8118  O O    . PRO A 1 26 ? 1.350   6.626   6.289   1.00 0.00 ? 35 PRO S O    8  
ATOM 8119  C CB   . PRO A 1 26 ? -1.040  8.663   7.034   1.00 0.00 ? 35 PRO S CB   8  
ATOM 8120  C CG   . PRO A 1 26 ? -2.174  8.558   7.997   1.00 0.00 ? 35 PRO S CG   8  
ATOM 8121  C CD   . PRO A 1 26 ? -3.129  7.565   7.406   1.00 0.00 ? 35 PRO S CD   8  
ATOM 8122  H HA   . PRO A 1 26 ? -0.863  7.429   5.282   1.00 0.00 ? 35 PRO S HA   8  
ATOM 8123  H HB2  . PRO A 1 26 ? -0.109  8.867   7.545   1.00 0.00 ? 35 PRO S HB2  8  
ATOM 8124  H HB3  . PRO A 1 26 ? -1.224  9.424   6.291   1.00 0.00 ? 35 PRO S HB3  8  
ATOM 8125  H HG2  . PRO A 1 26 ? -1.814  8.207   8.953   1.00 0.00 ? 35 PRO S HG2  8  
ATOM 8126  H HG3  . PRO A 1 26 ? -2.654  9.519   8.105   1.00 0.00 ? 35 PRO S HG3  8  
ATOM 8127  H HD2  . PRO A 1 26 ? -3.669  7.048   8.186   1.00 0.00 ? 35 PRO S HD2  8  
ATOM 8128  H HD3  . PRO A 1 26 ? -3.811  8.052   6.725   1.00 0.00 ? 35 PRO S HD3  8  
ATOM 8129  N N    . LEU A 1 27 ? 0.088   5.763   7.934   1.00 0.00 ? 36 LEU S N    8  
ATOM 8130  C CA   . LEU A 1 27 ? 1.194   5.004   8.513   1.00 0.00 ? 36 LEU S CA   8  
ATOM 8131  C C    . LEU A 1 27 ? 1.454   3.688   7.769   1.00 0.00 ? 36 LEU S C    8  
ATOM 8132  O O    . LEU A 1 27 ? 2.458   3.023   8.024   1.00 0.00 ? 36 LEU S O    8  
ATOM 8133  C CB   . LEU A 1 27 ? 0.946   4.743   10.005  1.00 0.00 ? 36 LEU S CB   8  
ATOM 8134  C CG   . LEU A 1 27 ? -0.037  3.616   10.345  1.00 0.00 ? 36 LEU S CG   8  
ATOM 8135  C CD1  . LEU A 1 27 ? -1.328  3.769   9.559   1.00 0.00 ? 36 LEU S CD1  8  
ATOM 8136  C CD2  . LEU A 1 27 ? 0.591   2.256   10.080  1.00 0.00 ? 36 LEU S CD2  8  
ATOM 8137  H H    . LEU A 1 27 ? -0.794  5.729   8.355   1.00 0.00 ? 36 LEU S H    8  
ATOM 8138  H HA   . LEU A 1 27 ? 2.079   5.617   8.420   1.00 0.00 ? 36 LEU S HA   8  
ATOM 8139  H HB2  . LEU A 1 27 ? 1.896   4.507   10.466  1.00 0.00 ? 36 LEU S HB2  8  
ATOM 8140  H HB3  . LEU A 1 27 ? 0.572   5.657   10.447  1.00 0.00 ? 36 LEU S HB3  8  
ATOM 8141  H HG   . LEU A 1 27 ? -0.281  3.671   11.395  1.00 0.00 ? 36 LEU S HG   8  
ATOM 8142  H HD11 . LEU A 1 27 ? -1.810  4.695   9.837   1.00 0.00 ? 36 LEU S HD11 8  
ATOM 8143  H HD12 . LEU A 1 27 ? -1.984  2.941   9.779   1.00 0.00 ? 36 LEU S HD12 8  
ATOM 8144  H HD13 . LEU A 1 27 ? -1.107  3.783   8.502   1.00 0.00 ? 36 LEU S HD13 8  
ATOM 8145  H HD21 . LEU A 1 27 ? 1.657   2.370   9.936   1.00 0.00 ? 36 LEU S HD21 8  
ATOM 8146  H HD22 . LEU A 1 27 ? 0.151   1.828   9.194   1.00 0.00 ? 36 LEU S HD22 8  
ATOM 8147  H HD23 . LEU A 1 27 ? 0.409   1.606   10.922  1.00 0.00 ? 36 LEU S HD23 8  
ATOM 8148  N N    . LYS A 1 28 ? 0.562   3.309   6.856   1.00 0.00 ? 37 LYS S N    8  
ATOM 8149  C CA   . LYS A 1 28 ? 0.737   2.068   6.099   1.00 0.00 ? 37 LYS S CA   8  
ATOM 8150  C C    . LYS A 1 28 ? -0.031  2.102   4.782   1.00 0.00 ? 37 LYS S C    8  
ATOM 8151  O O    . LYS A 1 28 ? -1.186  1.682   4.716   1.00 0.00 ? 37 LYS S O    8  
ATOM 8152  C CB   . LYS A 1 28 ? 0.282   0.863   6.927   1.00 0.00 ? 37 LYS S CB   8  
ATOM 8153  C CG   . LYS A 1 28 ? -1.155  0.961   7.422   1.00 0.00 ? 37 LYS S CG   8  
ATOM 8154  C CD   . LYS A 1 28 ? -1.457  -0.104  8.464   1.00 0.00 ? 37 LYS S CD   8  
ATOM 8155  C CE   . LYS A 1 28 ? -2.247  0.467   9.632   1.00 0.00 ? 37 LYS S CE   8  
ATOM 8156  N NZ   . LYS A 1 28 ? -2.892  -0.603  10.442  1.00 0.00 ? 37 LYS S NZ   8  
ATOM 8157  H H    . LYS A 1 28 ? -0.222  3.871   6.683   1.00 0.00 ? 37 LYS S H    8  
ATOM 8158  H HA   . LYS A 1 28 ? 1.788   1.961   5.882   1.00 0.00 ? 37 LYS S HA   8  
ATOM 8159  H HB2  . LYS A 1 28 ? 0.368   -0.027  6.320   1.00 0.00 ? 37 LYS S HB2  8  
ATOM 8160  H HB3  . LYS A 1 28 ? 0.931   0.766   7.786   1.00 0.00 ? 37 LYS S HB3  8  
ATOM 8161  H HG2  . LYS A 1 28 ? -1.309  1.935   7.861   1.00 0.00 ? 37 LYS S HG2  8  
ATOM 8162  H HG3  . LYS A 1 28 ? -1.826  0.833   6.585   1.00 0.00 ? 37 LYS S HG3  8  
ATOM 8163  H HD2  . LYS A 1 28 ? -2.036  -0.891  8.004   1.00 0.00 ? 37 LYS S HD2  8  
ATOM 8164  H HD3  . LYS A 1 28 ? -0.526  -0.507  8.833   1.00 0.00 ? 37 LYS S HD3  8  
ATOM 8165  H HE2  . LYS A 1 28 ? -1.575  1.027   10.264  1.00 0.00 ? 37 LYS S HE2  8  
ATOM 8166  H HE3  . LYS A 1 28 ? -3.011  1.126   9.246   1.00 0.00 ? 37 LYS S HE3  8  
ATOM 8167  H HZ1  . LYS A 1 28 ? -3.070  -1.440  9.851   1.00 0.00 ? 37 LYS S HZ1  8  
ATOM 8168  H HZ2  . LYS A 1 28 ? -3.798  -0.265  10.826  1.00 0.00 ? 37 LYS S HZ2  8  
ATOM 8169  H HZ3  . LYS A 1 28 ? -2.275  -0.876  11.233  1.00 0.00 ? 37 LYS S HZ3  8  
ATOM 8170  N N    . LEU A 1 29 ? 0.612   2.601   3.733   1.00 0.00 ? 38 LEU S N    8  
ATOM 8171  C CA   . LEU A 1 29 ? -0.028  2.677   2.426   1.00 0.00 ? 38 LEU S CA   8  
ATOM 8172  C C    . LEU A 1 29 ? 0.169   1.394   1.626   1.00 0.00 ? 38 LEU S C    8  
ATOM 8173  O O    . LEU A 1 29 ? -0.737  0.943   0.928   1.00 0.00 ? 38 LEU S O    8  
ATOM 8174  C CB   . LEU A 1 29 ? 0.485   3.883   1.630   1.00 0.00 ? 38 LEU S CB   8  
ATOM 8175  C CG   . LEU A 1 29 ? 0.775   5.151   2.447   1.00 0.00 ? 38 LEU S CG   8  
ATOM 8176  C CD1  . LEU A 1 29 ? 0.662   6.385   1.565   1.00 0.00 ? 38 LEU S CD1  8  
ATOM 8177  C CD2  . LEU A 1 29 ? -0.155  5.271   3.650   1.00 0.00 ? 38 LEU S CD2  8  
ATOM 8178  H H    . LEU A 1 29 ? 1.533   2.921   3.838   1.00 0.00 ? 38 LEU S H    8  
ATOM 8179  H HA   . LEU A 1 29 ? -1.080  2.800   2.600   1.00 0.00 ? 38 LEU S HA   8  
ATOM 8180  H HB2  . LEU A 1 29 ? 1.398   3.589   1.132   1.00 0.00 ? 38 LEU S HB2  8  
ATOM 8181  H HB3  . LEU A 1 29 ? -0.253  4.129   0.880   1.00 0.00 ? 38 LEU S HB3  8  
ATOM 8182  H HG   . LEU A 1 29 ? 1.786   5.103   2.811   1.00 0.00 ? 38 LEU S HG   8  
ATOM 8183  H HD11 . LEU A 1 29 ? -0.291  6.863   1.734   1.00 0.00 ? 38 LEU S HD11 8  
ATOM 8184  H HD12 . LEU A 1 29 ? 0.740   6.095   0.528   1.00 0.00 ? 38 LEU S HD12 8  
ATOM 8185  H HD13 . LEU A 1 29 ? 1.457   7.074   1.807   1.00 0.00 ? 38 LEU S HD13 8  
ATOM 8186  H HD21 . LEU A 1 29 ? -0.539  6.278   3.710   1.00 0.00 ? 38 LEU S HD21 8  
ATOM 8187  H HD22 . LEU A 1 29 ? 0.394   5.042   4.552   1.00 0.00 ? 38 LEU S HD22 8  
ATOM 8188  H HD23 . LEU A 1 29 ? -0.977  4.579   3.546   1.00 0.00 ? 38 LEU S HD23 8  
ATOM 8189  N N    . GLU A 1 30 ? 1.359   0.815   1.727   1.00 0.00 ? 39 GLU S N    8  
ATOM 8190  C CA   . GLU A 1 30 ? 1.678   -0.412  1.006   1.00 0.00 ? 39 GLU S CA   8  
ATOM 8191  C C    . GLU A 1 30 ? 0.661   -1.520  1.287   1.00 0.00 ? 39 GLU S C    8  
ATOM 8192  O O    . GLU A 1 30 ? 0.557   -2.481  0.528   1.00 0.00 ? 39 GLU S O    8  
ATOM 8193  C CB   . GLU A 1 30 ? 3.086   -0.889  1.374   1.00 0.00 ? 39 GLU S CB   8  
ATOM 8194  C CG   . GLU A 1 30 ? 3.181   -1.521  2.757   1.00 0.00 ? 39 GLU S CG   8  
ATOM 8195  C CD   . GLU A 1 30 ? 2.752   -0.578  3.863   1.00 0.00 ? 39 GLU S CD   8  
ATOM 8196  O OE1  . GLU A 1 30 ? 2.979   0.643   3.726   1.00 0.00 ? 39 GLU S OE1  8  
ATOM 8197  O OE2  . GLU A 1 30 ? 2.189   -1.059  4.869   1.00 0.00 ? 39 GLU S OE2  8  
ATOM 8198  H H    . GLU A 1 30 ? 2.043   1.227   2.296   1.00 0.00 ? 39 GLU S H    8  
ATOM 8199  H HA   . GLU A 1 30 ? 1.655   -0.185  -0.049  1.00 0.00 ? 39 GLU S HA   8  
ATOM 8200  H HB2  . GLU A 1 30 ? 3.408   -1.622  0.646   1.00 0.00 ? 39 GLU S HB2  8  
ATOM 8201  H HB3  . GLU A 1 30 ? 3.759   -0.043  1.342   1.00 0.00 ? 39 GLU S HB3  8  
ATOM 8202  H HG2  . GLU A 1 30 ? 2.547   -2.393  2.783   1.00 0.00 ? 39 GLU S HG2  8  
ATOM 8203  H HG3  . GLU A 1 30 ? 4.205   -1.816  2.932   1.00 0.00 ? 39 GLU S HG3  8  
ATOM 8204  N N    . ILE A 1 31 ? -0.075  -1.396  2.389   1.00 0.00 ? 40 ILE S N    8  
ATOM 8205  C CA   . ILE A 1 31 ? -1.057  -2.409  2.760   1.00 0.00 ? 40 ILE S CA   8  
ATOM 8206  C C    . ILE A 1 31 ? -2.396  -2.218  2.046   1.00 0.00 ? 40 ILE S C    8  
ATOM 8207  O O    . ILE A 1 31 ? -3.148  -3.179  1.880   1.00 0.00 ? 40 ILE S O    8  
ATOM 8208  C CB   . ILE A 1 31 ? -1.303  -2.421  4.281   1.00 0.00 ? 40 ILE S CB   8  
ATOM 8209  C CG1  . ILE A 1 31 ? -1.853  -1.071  4.743   1.00 0.00 ? 40 ILE S CG1  8  
ATOM 8210  C CG2  . ILE A 1 31 ? -0.020  -2.765  5.024   1.00 0.00 ? 40 ILE S CG2  8  
ATOM 8211  C CD1  . ILE A 1 31 ? -3.333  -1.097  5.053   1.00 0.00 ? 40 ILE S CD1  8  
ATOM 8212  H H    . ILE A 1 31 ? 0.055   -0.620  2.971   1.00 0.00 ? 40 ILE S H    8  
ATOM 8213  H HA   . ILE A 1 31 ? -0.654  -3.371  2.482   1.00 0.00 ? 40 ILE S HA   8  
ATOM 8214  H HB   . ILE A 1 31 ? -2.029  -3.190  4.496   1.00 0.00 ? 40 ILE S HB   8  
ATOM 8215  H HG12 . ILE A 1 31 ? -1.333  -0.766  5.639   1.00 0.00 ? 40 ILE S HG12 8  
ATOM 8216  H HG13 . ILE A 1 31 ? -1.688  -0.338  3.968   1.00 0.00 ? 40 ILE S HG13 8  
ATOM 8217  H HG21 . ILE A 1 31 ? 0.139   -2.051  5.819   1.00 0.00 ? 40 ILE S HG21 8  
ATOM 8218  H HG22 . ILE A 1 31 ? 0.815   -2.731  4.338   1.00 0.00 ? 40 ILE S HG22 8  
ATOM 8219  H HG23 . ILE A 1 31 ? -0.100  -3.757  5.442   1.00 0.00 ? 40 ILE S HG23 8  
ATOM 8220  H HD11 . ILE A 1 31 ? -3.618  -2.088  5.372   1.00 0.00 ? 40 ILE S HD11 8  
ATOM 8221  H HD12 . ILE A 1 31 ? -3.891  -0.828  4.169   1.00 0.00 ? 40 ILE S HD12 8  
ATOM 8222  H HD13 . ILE A 1 31 ? -3.548  -0.391  5.842   1.00 0.00 ? 40 ILE S HD13 8  
ATOM 8223  N N    . TYR A 1 32 ? -2.709  -0.989  1.637   1.00 0.00 ? 41 TYR S N    8  
ATOM 8224  C CA   . TYR A 1 32 ? -3.981  -0.734  0.963   1.00 0.00 ? 41 TYR S CA   8  
ATOM 8225  C C    . TYR A 1 32 ? -3.819  -0.542  -0.539  1.00 0.00 ? 41 TYR S C    8  
ATOM 8226  O O    . TYR A 1 32 ? -4.606  0.168   -1.165  1.00 0.00 ? 41 TYR S O    8  
ATOM 8227  C CB   . TYR A 1 32 ? -4.711  0.465   1.581   1.00 0.00 ? 41 TYR S CB   8  
ATOM 8228  C CG   . TYR A 1 32 ? -3.936  1.769   1.623   1.00 0.00 ? 41 TYR S CG   8  
ATOM 8229  C CD1  . TYR A 1 32 ? -3.313  2.292   0.494   1.00 0.00 ? 41 TYR S CD1  8  
ATOM 8230  C CD2  . TYR A 1 32 ? -3.866  2.500   2.803   1.00 0.00 ? 41 TYR S CD2  8  
ATOM 8231  C CE1  . TYR A 1 32 ? -2.640  3.498   0.549   1.00 0.00 ? 41 TYR S CE1  8  
ATOM 8232  C CE2  . TYR A 1 32 ? -3.203  3.711   2.858   1.00 0.00 ? 41 TYR S CE2  8  
ATOM 8233  C CZ   . TYR A 1 32 ? -2.592  4.202   1.730   1.00 0.00 ? 41 TYR S CZ   8  
ATOM 8234  O OH   . TYR A 1 32 ? -1.938  5.410   1.777   1.00 0.00 ? 41 TYR S OH   8  
ATOM 8235  H H    . TYR A 1 32 ? -2.087  -0.250  1.799   1.00 0.00 ? 41 TYR S H    8  
ATOM 8236  H HA   . TYR A 1 32 ? -4.595  -1.610  1.113   1.00 0.00 ? 41 TYR S HA   8  
ATOM 8237  H HB2  . TYR A 1 32 ? -5.613  0.647   1.016   1.00 0.00 ? 41 TYR S HB2  8  
ATOM 8238  H HB3  . TYR A 1 32 ? -4.979  0.216   2.595   1.00 0.00 ? 41 TYR S HB3  8  
ATOM 8239  H HD1  . TYR A 1 32 ? -3.350  1.746   -0.432  1.00 0.00 ? 41 TYR S HD1  8  
ATOM 8240  H HD2  . TYR A 1 32 ? -4.340  2.111   3.689   1.00 0.00 ? 41 TYR S HD2  8  
ATOM 8241  H HE1  . TYR A 1 32 ? -2.159  3.888   -0.330  1.00 0.00 ? 41 TYR S HE1  8  
ATOM 8242  H HE2  . TYR A 1 32 ? -3.159  4.260   3.784   1.00 0.00 ? 41 TYR S HE2  8  
ATOM 8243  H HH   . TYR A 1 32 ? -2.578  6.115   1.906   1.00 0.00 ? 41 TYR S HH   8  
ATOM 8244  N N    . LEU A 1 33 ? -2.818  -1.188  -1.123  1.00 0.00 ? 42 LEU S N    8  
ATOM 8245  C CA   . LEU A 1 33 ? -2.598  -1.080  -2.560  1.00 0.00 ? 42 LEU S CA   8  
ATOM 8246  C C    . LEU A 1 33 ? -2.304  -2.439  -3.172  1.00 0.00 ? 42 LEU S C    8  
ATOM 8247  O O    . LEU A 1 33 ? -1.299  -3.068  -2.852  1.00 0.00 ? 42 LEU S O    8  
ATOM 8248  C CB   . LEU A 1 33 ? -1.451  -0.119  -2.871  1.00 0.00 ? 42 LEU S CB   8  
ATOM 8249  C CG   . LEU A 1 33 ? -0.321  -0.076  -1.840  1.00 0.00 ? 42 LEU S CG   8  
ATOM 8250  C CD1  . LEU A 1 33 ? 0.783   -1.052  -2.217  1.00 0.00 ? 42 LEU S CD1  8  
ATOM 8251  C CD2  . LEU A 1 33 ? 0.231   1.338   -1.721  1.00 0.00 ? 42 LEU S CD2  8  
ATOM 8252  H H    . LEU A 1 33 ? -2.224  -1.756  -0.585  1.00 0.00 ? 42 LEU S H    8  
ATOM 8253  H HA   . LEU A 1 33 ? -3.503  -0.694  -2.999  1.00 0.00 ? 42 LEU S HA   8  
ATOM 8254  H HB2  . LEU A 1 33 ? -1.024  -0.405  -3.823  1.00 0.00 ? 42 LEU S HB2  8  
ATOM 8255  H HB3  . LEU A 1 33 ? -1.862  0.875   -2.967  1.00 0.00 ? 42 LEU S HB3  8  
ATOM 8256  H HG   . LEU A 1 33 ? -0.708  -0.366  -0.875  1.00 0.00 ? 42 LEU S HG   8  
ATOM 8257  H HD11 . LEU A 1 33 ? 1.745   -0.606  -2.013  1.00 0.00 ? 42 LEU S HD11 8  
ATOM 8258  H HD12 . LEU A 1 33 ? 0.712   -1.287  -3.270  1.00 0.00 ? 42 LEU S HD12 8  
ATOM 8259  H HD13 . LEU A 1 33 ? 0.675   -1.957  -1.639  1.00 0.00 ? 42 LEU S HD13 8  
ATOM 8260  H HD21 . LEU A 1 33 ? -0.397  1.915   -1.060  1.00 0.00 ? 42 LEU S HD21 8  
ATOM 8261  H HD22 . LEU A 1 33 ? 0.247   1.801   -2.697  1.00 0.00 ? 42 LEU S HD22 8  
ATOM 8262  H HD23 . LEU A 1 33 ? 1.235   1.300   -1.325  1.00 0.00 ? 42 LEU S HD23 8  
ATOM 8263  N N    . THR A 1 34 ? -3.178  -2.884  -4.069  1.00 0.00 ? 43 THR S N    8  
ATOM 8264  C CA   . THR A 1 34 ? -2.988  -4.162  -4.733  1.00 0.00 ? 43 THR S CA   8  
ATOM 8265  C C    . THR A 1 34 ? -1.670  -4.158  -5.499  1.00 0.00 ? 43 THR S C    8  
ATOM 8266  O O    . THR A 1 34 ? -0.931  -3.185  -5.455  1.00 0.00 ? 43 THR S O    8  
ATOM 8267  C CB   . THR A 1 34 ? -4.150  -4.446  -5.687  1.00 0.00 ? 43 THR S CB   8  
ATOM 8268  O OG1  . THR A 1 34 ? -4.413  -3.320  -6.505  1.00 0.00 ? 43 THR S OG1  8  
ATOM 8269  C CG2  . THR A 1 34 ? -5.436  -4.804  -4.973  1.00 0.00 ? 43 THR S CG2  8  
ATOM 8270  H H    . THR A 1 34 ? -3.962  -2.338  -4.293  1.00 0.00 ? 43 THR S H    8  
ATOM 8271  H HA   . THR A 1 34 ? -2.953  -4.931  -3.976  1.00 0.00 ? 43 THR S HA   8  
ATOM 8272  H HB   . THR A 1 34 ? -3.884  -5.276  -6.326  1.00 0.00 ? 43 THR S HB   8  
ATOM 8273  H HG1  . THR A 1 34 ? -5.041  -3.562  -7.191  1.00 0.00 ? 43 THR S HG1  8  
ATOM 8274  H HG21 . THR A 1 34 ? -5.571  -5.877  -4.991  1.00 0.00 ? 43 THR S HG21 8  
ATOM 8275  H HG22 . THR A 1 34 ? -6.268  -4.328  -5.469  1.00 0.00 ? 43 THR S HG22 8  
ATOM 8276  H HG23 . THR A 1 34 ? -5.385  -4.466  -3.948  1.00 0.00 ? 43 THR S HG23 8  
ATOM 8277  N N    . ASP A 1 35 ? -1.392  -5.254  -6.188  1.00 0.00 ? 44 ASP S N    8  
ATOM 8278  C CA   . ASP A 1 35 ? -0.168  -5.413  -6.965  1.00 0.00 ? 44 ASP S CA   8  
ATOM 8279  C C    . ASP A 1 35 ? -0.043  -4.328  -8.022  1.00 0.00 ? 44 ASP S C    8  
ATOM 8280  O O    . ASP A 1 35 ? 1.053   -3.862  -8.312  1.00 0.00 ? 44 ASP S O    8  
ATOM 8281  C CB   . ASP A 1 35 ? -0.138  -6.792  -7.628  1.00 0.00 ? 44 ASP S CB   8  
ATOM 8282  C CG   . ASP A 1 35 ? -1.342  -7.033  -8.515  1.00 0.00 ? 44 ASP S CG   8  
ATOM 8283  O OD1  . ASP A 1 35 ? -2.478  -6.992  -7.998  1.00 0.00 ? 44 ASP S OD1  8  
ATOM 8284  O OD2  . ASP A 1 35 ? -1.149  -7.265  -9.727  1.00 0.00 ? 44 ASP S OD2  8  
ATOM 8285  H H    . ASP A 1 35 ? -2.025  -5.973  -6.171  1.00 0.00 ? 44 ASP S H    8  
ATOM 8286  H HA   . ASP A 1 35 ? 0.668   -5.334  -6.286  1.00 0.00 ? 44 ASP S HA   8  
ATOM 8287  H HB2  . ASP A 1 35 ? 0.755   -6.873  -8.232  1.00 0.00 ? 44 ASP S HB2  8  
ATOM 8288  H HB3  . ASP A 1 35 ? -0.120  -7.552  -6.858  1.00 0.00 ? 44 ASP S HB3  8  
ATOM 8289  N N    . GLU A 1 36 ? -1.171  -3.924  -8.591  1.00 0.00 ? 45 GLU S N    8  
ATOM 8290  C CA   . GLU A 1 36 ? -1.164  -2.880  -9.603  1.00 0.00 ? 45 GLU S CA   8  
ATOM 8291  C C    . GLU A 1 36 ? -0.734  -1.569  -8.969  1.00 0.00 ? 45 GLU S C    8  
ATOM 8292  O O    . GLU A 1 36 ? 0.226   -0.936  -9.405  1.00 0.00 ? 45 GLU S O    8  
ATOM 8293  C CB   . GLU A 1 36 ? -2.544  -2.724  -10.225 1.00 0.00 ? 45 GLU S CB   8  
ATOM 8294  C CG   . GLU A 1 36 ? -3.034  -3.970  -10.946 1.00 0.00 ? 45 GLU S CG   8  
ATOM 8295  C CD   . GLU A 1 36 ? -3.542  -3.676  -12.344 1.00 0.00 ? 45 GLU S CD   8  
ATOM 8296  O OE1  . GLU A 1 36 ? -2.711  -3.364  -13.224 1.00 0.00 ? 45 GLU S OE1  8  
ATOM 8297  O OE2  . GLU A 1 36 ? -4.770  -3.755  -12.559 1.00 0.00 ? 45 GLU S OE2  8  
ATOM 8298  H H    . GLU A 1 36 ? -2.021  -4.326  -8.319  1.00 0.00 ? 45 GLU S H    8  
ATOM 8299  H HA   . GLU A 1 36 ? -0.452  -3.153  -10.368 1.00 0.00 ? 45 GLU S HA   8  
ATOM 8300  H HB2  . GLU A 1 36 ? -3.247  -2.483  -9.444  1.00 0.00 ? 45 GLU S HB2  8  
ATOM 8301  H HB3  . GLU A 1 36 ? -2.510  -1.911  -10.932 1.00 0.00 ? 45 GLU S HB3  8  
ATOM 8302  H HG2  . GLU A 1 36 ? -2.217  -4.673  -11.018 1.00 0.00 ? 45 GLU S HG2  8  
ATOM 8303  H HG3  . GLU A 1 36 ? -3.837  -4.409  -10.372 1.00 0.00 ? 45 GLU S HG3  8  
ATOM 8304  N N    . ASP A 1 37 ? -1.439  -1.187  -7.909  1.00 0.00 ? 46 ASP S N    8  
ATOM 8305  C CA   . ASP A 1 37 ? -1.120  0.022   -7.179  1.00 0.00 ? 46 ASP S CA   8  
ATOM 8306  C C    . ASP A 1 37 ? 0.262   -0.131  -6.560  1.00 0.00 ? 46 ASP S C    8  
ATOM 8307  O O    . ASP A 1 37 ? 1.036   0.820   -6.475  1.00 0.00 ? 46 ASP S O    8  
ATOM 8308  C CB   . ASP A 1 37 ? -2.175  0.252   -6.098  1.00 0.00 ? 46 ASP S CB   8  
ATOM 8309  C CG   . ASP A 1 37 ? -1.904  1.497   -5.276  1.00 0.00 ? 46 ASP S CG   8  
ATOM 8310  O OD1  . ASP A 1 37 ? -0.754  1.675   -4.824  1.00 0.00 ? 46 ASP S OD1  8  
ATOM 8311  O OD2  . ASP A 1 37 ? -2.846  2.294   -5.081  1.00 0.00 ? 46 ASP S OD2  8  
ATOM 8312  H H    . ASP A 1 37 ? -2.176  -1.749  -7.592  1.00 0.00 ? 46 ASP S H    8  
ATOM 8313  H HA   . ASP A 1 37 ? -1.119  0.852   -7.870  1.00 0.00 ? 46 ASP S HA   8  
ATOM 8314  H HB2  . ASP A 1 37 ? -3.141  0.360   -6.570  1.00 0.00 ? 46 ASP S HB2  8  
ATOM 8315  H HB3  . ASP A 1 37 ? -2.193  -0.609  -5.436  1.00 0.00 ? 46 ASP S HB3  8  
ATOM 8316  N N    . PHE A 1 38 ? 0.560   -1.362  -6.159  1.00 0.00 ? 47 PHE S N    8  
ATOM 8317  C CA   . PHE A 1 38 ? 1.843   -1.708  -5.575  1.00 0.00 ? 47 PHE S CA   8  
ATOM 8318  C C    . PHE A 1 38 ? 2.936   -1.527  -6.608  1.00 0.00 ? 47 PHE S C    8  
ATOM 8319  O O    . PHE A 1 38 ? 3.987   -0.946  -6.336  1.00 0.00 ? 47 PHE S O    8  
ATOM 8320  C CB   . PHE A 1 38 ? 1.831   -3.172  -5.127  1.00 0.00 ? 47 PHE S CB   8  
ATOM 8321  C CG   . PHE A 1 38 ? 2.030   -3.380  -3.659  1.00 0.00 ? 47 PHE S CG   8  
ATOM 8322  C CD1  . PHE A 1 38 ? 3.119   -2.832  -3.004  1.00 0.00 ? 47 PHE S CD1  8  
ATOM 8323  C CD2  . PHE A 1 38 ? 1.129   -4.139  -2.936  1.00 0.00 ? 47 PHE S CD2  8  
ATOM 8324  C CE1  . PHE A 1 38 ? 3.301   -3.038  -1.650  1.00 0.00 ? 47 PHE S CE1  8  
ATOM 8325  C CE2  . PHE A 1 38 ? 1.303   -4.348  -1.586  1.00 0.00 ? 47 PHE S CE2  8  
ATOM 8326  C CZ   . PHE A 1 38 ? 2.392   -3.795  -0.940  1.00 0.00 ? 47 PHE S CZ   8  
ATOM 8327  H H    . PHE A 1 38 ? -0.104  -2.071  -6.282  1.00 0.00 ? 47 PHE S H    8  
ATOM 8328  H HA   . PHE A 1 38 ? 2.029   -1.067  -4.728  1.00 0.00 ? 47 PHE S HA   8  
ATOM 8329  H HB2  . PHE A 1 38 ? 0.885   -3.612  -5.392  1.00 0.00 ? 47 PHE S HB2  8  
ATOM 8330  H HB3  . PHE A 1 38 ? 2.617   -3.701  -5.644  1.00 0.00 ? 47 PHE S HB3  8  
ATOM 8331  H HD1  . PHE A 1 38 ? 3.829   -2.239  -3.560  1.00 0.00 ? 47 PHE S HD1  8  
ATOM 8332  H HD2  . PHE A 1 38 ? 0.277   -4.571  -3.440  1.00 0.00 ? 47 PHE S HD2  8  
ATOM 8333  H HE1  . PHE A 1 38 ? 4.155   -2.609  -1.149  1.00 0.00 ? 47 PHE S HE1  8  
ATOM 8334  H HE2  . PHE A 1 38 ? 0.590   -4.943  -1.037  1.00 0.00 ? 47 PHE S HE2  8  
ATOM 8335  H HZ   . PHE A 1 38 ? 2.531   -3.955  0.119   1.00 0.00 ? 47 PHE S HZ   8  
ATOM 8336  N N    . GLU A 1 39 ? 2.677   -2.055  -7.798  1.00 0.00 ? 48 GLU S N    8  
ATOM 8337  C CA   . GLU A 1 39 ? 3.640   -1.981  -8.890  1.00 0.00 ? 48 GLU S CA   8  
ATOM 8338  C C    . GLU A 1 39 ? 3.984   -0.535  -9.242  1.00 0.00 ? 48 GLU S C    8  
ATOM 8339  O O    . GLU A 1 39 ? 5.155   -0.170  -9.333  1.00 0.00 ? 48 GLU S O    8  
ATOM 8340  C CB   . GLU A 1 39 ? 3.096   -2.701  -10.125 1.00 0.00 ? 48 GLU S CB   8  
ATOM 8341  C CG   . GLU A 1 39 ? 3.446   -4.180  -10.171 1.00 0.00 ? 48 GLU S CG   8  
ATOM 8342  C CD   . GLU A 1 39 ? 3.850   -4.641  -11.557 1.00 0.00 ? 48 GLU S CD   8  
ATOM 8343  O OE1  . GLU A 1 39 ? 4.960   -4.282  -12.002 1.00 0.00 ? 48 GLU S OE1  8  
ATOM 8344  O OE2  . GLU A 1 39 ? 3.055   -5.360  -12.199 1.00 0.00 ? 48 GLU S OE2  8  
ATOM 8345  H H    . GLU A 1 39 ? 1.809   -2.523  -7.941  1.00 0.00 ? 48 GLU S H    8  
ATOM 8346  H HA   . GLU A 1 39 ? 4.542   -2.480  -8.565  1.00 0.00 ? 48 GLU S HA   8  
ATOM 8347  H HB2  . GLU A 1 39 ? 2.020   -2.608  -10.138 1.00 0.00 ? 48 GLU S HB2  8  
ATOM 8348  H HB3  . GLU A 1 39 ? 3.499   -2.231  -11.009 1.00 0.00 ? 48 GLU S HB3  8  
ATOM 8349  H HG2  . GLU A 1 39 ? 4.270   -4.363  -9.494  1.00 0.00 ? 48 GLU S HG2  8  
ATOM 8350  H HG3  . GLU A 1 39 ? 2.583   -4.751  -9.855  1.00 0.00 ? 48 GLU S HG3  8  
ATOM 8351  N N    . PHE A 1 40 ? 2.959   0.281   -9.453  1.00 0.00 ? 49 PHE S N    8  
ATOM 8352  C CA   . PHE A 1 40 ? 3.162   1.680   -9.815  1.00 0.00 ? 49 PHE S CA   8  
ATOM 8353  C C    . PHE A 1 40 ? 3.545   2.539   -8.609  1.00 0.00 ? 49 PHE S C    8  
ATOM 8354  O O    . PHE A 1 40 ? 4.020   3.662   -8.774  1.00 0.00 ? 49 PHE S O    8  
ATOM 8355  C CB   . PHE A 1 40 ? 1.897   2.238   -10.474 1.00 0.00 ? 49 PHE S CB   8  
ATOM 8356  C CG   . PHE A 1 40 ? 2.082   2.579   -11.924 1.00 0.00 ? 49 PHE S CG   8  
ATOM 8357  C CD1  . PHE A 1 40 ? 2.877   3.648   -12.303 1.00 0.00 ? 49 PHE S CD1  8  
ATOM 8358  C CD2  . PHE A 1 40 ? 1.459   1.830   -12.909 1.00 0.00 ? 49 PHE S CD2  8  
ATOM 8359  C CE1  . PHE A 1 40 ? 3.048   3.964   -13.638 1.00 0.00 ? 49 PHE S CE1  8  
ATOM 8360  C CE2  . PHE A 1 40 ? 1.626   2.140   -14.246 1.00 0.00 ? 49 PHE S CE2  8  
ATOM 8361  C CZ   . PHE A 1 40 ? 2.422   3.208   -14.610 1.00 0.00 ? 49 PHE S CZ   8  
ATOM 8362  H H    . PHE A 1 40 ? 2.045   -0.067  -9.378  1.00 0.00 ? 49 PHE S H    8  
ATOM 8363  H HA   . PHE A 1 40 ? 3.968   1.716   -10.531 1.00 0.00 ? 49 PHE S HA   8  
ATOM 8364  H HB2  . PHE A 1 40 ? 1.108   1.504   -10.401 1.00 0.00 ? 49 PHE S HB2  8  
ATOM 8365  H HB3  . PHE A 1 40 ? 1.596   3.139   -9.955  1.00 0.00 ? 49 PHE S HB3  8  
ATOM 8366  H HD1  . PHE A 1 40 ? 3.367   4.239   -11.544 1.00 0.00 ? 49 PHE S HD1  8  
ATOM 8367  H HD2  . PHE A 1 40 ? 0.835   0.994   -12.625 1.00 0.00 ? 49 PHE S HD2  8  
ATOM 8368  H HE1  . PHE A 1 40 ? 3.671   4.799   -13.920 1.00 0.00 ? 49 PHE S HE1  8  
ATOM 8369  H HE2  . PHE A 1 40 ? 1.136   1.547   -15.005 1.00 0.00 ? 49 PHE S HE2  8  
ATOM 8370  H HZ   . PHE A 1 40 ? 2.554   3.453   -15.654 1.00 0.00 ? 49 PHE S HZ   8  
ATOM 8371  N N    . ALA A 1 41 ? 3.328   2.026   -7.401  1.00 0.00 ? 50 ALA S N    8  
ATOM 8372  C CA   . ALA A 1 41 ? 3.650   2.785   -6.196  1.00 0.00 ? 50 ALA S CA   8  
ATOM 8373  C C    . ALA A 1 41 ? 4.976   2.355   -5.571  1.00 0.00 ? 50 ALA S C    8  
ATOM 8374  O O    . ALA A 1 41 ? 5.901   3.158   -5.450  1.00 0.00 ? 50 ALA S O    8  
ATOM 8375  C CB   . ALA A 1 41 ? 2.526   2.655   -5.179  1.00 0.00 ? 50 ALA S CB   8  
ATOM 8376  H H    . ALA A 1 41 ? 2.937   1.131   -7.318  1.00 0.00 ? 50 ALA S H    8  
ATOM 8377  H HA   . ALA A 1 41 ? 3.722   3.826   -6.475  1.00 0.00 ? 50 ALA S HA   8  
ATOM 8378  H HB1  . ALA A 1 41 ? 2.672   3.374   -4.387  1.00 0.00 ? 50 ALA S HB1  8  
ATOM 8379  H HB2  . ALA A 1 41 ? 2.529   1.658   -4.763  1.00 0.00 ? 50 ALA S HB2  8  
ATOM 8380  H HB3  . ALA A 1 41 ? 1.580   2.841   -5.663  1.00 0.00 ? 50 ALA S HB3  8  
ATOM 8381  N N    . LEU A 1 42 ? 5.058   1.094   -5.156  1.00 0.00 ? 51 LEU S N    8  
ATOM 8382  C CA   . LEU A 1 42 ? 6.269   0.580   -4.520  1.00 0.00 ? 51 LEU S CA   8  
ATOM 8383  C C    . LEU A 1 42 ? 7.050   -0.362  -5.434  1.00 0.00 ? 51 LEU S C    8  
ATOM 8384  O O    . LEU A 1 42 ? 8.123   -0.841  -5.066  1.00 0.00 ? 51 LEU S O    8  
ATOM 8385  C CB   . LEU A 1 42 ? 5.907   -0.149  -3.225  1.00 0.00 ? 51 LEU S CB   8  
ATOM 8386  C CG   . LEU A 1 42 ? 5.780   0.748   -1.994  1.00 0.00 ? 51 LEU S CG   8  
ATOM 8387  C CD1  . LEU A 1 42 ? 4.733   0.203   -1.034  1.00 0.00 ? 51 LEU S CD1  8  
ATOM 8388  C CD2  . LEU A 1 42 ? 7.130   0.893   -1.304  1.00 0.00 ? 51 LEU S CD2  8  
ATOM 8389  H H    . LEU A 1 42 ? 4.284   0.502   -5.264  1.00 0.00 ? 51 LEU S H    8  
ATOM 8390  H HA   . LEU A 1 42 ? 6.897   1.423   -4.276  1.00 0.00 ? 51 LEU S HA   8  
ATOM 8391  H HB2  . LEU A 1 42 ? 4.964   -0.656  -3.374  1.00 0.00 ? 51 LEU S HB2  8  
ATOM 8392  H HB3  . LEU A 1 42 ? 6.666   -0.890  -3.026  1.00 0.00 ? 51 LEU S HB3  8  
ATOM 8393  H HG   . LEU A 1 42 ? 5.460   1.726   -2.309  1.00 0.00 ? 51 LEU S HG   8  
ATOM 8394  H HD11 . LEU A 1 42 ? 3.969   0.948   -0.876  1.00 0.00 ? 51 LEU S HD11 8  
ATOM 8395  H HD12 . LEU A 1 42 ? 5.199   -0.039  -0.090  1.00 0.00 ? 51 LEU S HD12 8  
ATOM 8396  H HD13 . LEU A 1 42 ? 4.287   -0.685  -1.452  1.00 0.00 ? 51 LEU S HD13 8  
ATOM 8397  H HD21 . LEU A 1 42 ? 7.894   0.423   -1.906  1.00 0.00 ? 51 LEU S HD21 8  
ATOM 8398  H HD22 . LEU A 1 42 ? 7.092   0.418   -0.336  1.00 0.00 ? 51 LEU S HD22 8  
ATOM 8399  H HD23 . LEU A 1 42 ? 7.361   1.941   -1.181  1.00 0.00 ? 51 LEU S HD23 8  
ATOM 8400  N N    . ASP A 1 43 ? 6.514   -0.629  -6.618  1.00 0.00 ? 52 ASP S N    8  
ATOM 8401  C CA   . ASP A 1 43 ? 7.172   -1.519  -7.566  1.00 0.00 ? 52 ASP S CA   8  
ATOM 8402  C C    . ASP A 1 43 ? 7.265   -2.945  -7.018  1.00 0.00 ? 52 ASP S C    8  
ATOM 8403  O O    . ASP A 1 43 ? 7.985   -3.777  -7.568  1.00 0.00 ? 52 ASP S O    8  
ATOM 8404  C CB   . ASP A 1 43 ? 8.571   -0.999  -7.901  1.00 0.00 ? 52 ASP S CB   8  
ATOM 8405  C CG   . ASP A 1 43 ? 8.557   0.448   -8.350  1.00 0.00 ? 52 ASP S CG   8  
ATOM 8406  O OD1  . ASP A 1 43 ? 8.378   0.692   -9.561  1.00 0.00 ? 52 ASP S OD1  8  
ATOM 8407  O OD2  . ASP A 1 43 ? 8.725   1.338   -7.490  1.00 0.00 ? 52 ASP S OD2  8  
ATOM 8408  H H    . ASP A 1 43 ? 5.655   -0.225  -6.861  1.00 0.00 ? 52 ASP S H    8  
ATOM 8409  H HA   . ASP A 1 43 ? 6.581   -1.535  -8.467  1.00 0.00 ? 52 ASP S HA   8  
ATOM 8410  H HB2  . ASP A 1 43 ? 9.198   -1.080  -7.023  1.00 0.00 ? 52 ASP S HB2  8  
ATOM 8411  H HB3  . ASP A 1 43 ? 8.991   -1.602  -8.697  1.00 0.00 ? 52 ASP S HB3  8  
ATOM 8412  N N    . MET A 1 44 ? 6.524   -3.231  -5.947  1.00 0.00 ? 53 MET S N    8  
ATOM 8413  C CA   . MET A 1 44 ? 6.531   -4.571  -5.361  1.00 0.00 ? 53 MET S CA   8  
ATOM 8414  C C    . MET A 1 44 ? 5.117   -5.138  -5.316  1.00 0.00 ? 53 MET S C    8  
ATOM 8415  O O    . MET A 1 44 ? 4.232   -4.644  -6.011  1.00 0.00 ? 53 MET S O    8  
ATOM 8416  C CB   . MET A 1 44 ? 7.152   -4.554  -3.965  1.00 0.00 ? 53 MET S CB   8  
ATOM 8417  C CG   . MET A 1 44 ? 8.352   -5.480  -3.837  1.00 0.00 ? 53 MET S CG   8  
ATOM 8418  S SD   . MET A 1 44 ? 9.904   -4.672  -4.271  1.00 0.00 ? 53 MET S SD   8  
ATOM 8419  C CE   . MET A 1 44 ? 10.244  -5.426  -5.860  1.00 0.00 ? 53 MET S CE   8  
ATOM 8420  H H    . MET A 1 44 ? 5.955   -2.531  -5.548  1.00 0.00 ? 53 MET S H    8  
ATOM 8421  H HA   . MET A 1 44 ? 7.130   -5.202  -6.002  1.00 0.00 ? 53 MET S HA   8  
ATOM 8422  H HB2  . MET A 1 44 ? 7.475   -3.546  -3.737  1.00 0.00 ? 53 MET S HB2  8  
ATOM 8423  H HB3  . MET A 1 44 ? 6.408   -4.860  -3.243  1.00 0.00 ? 53 MET S HB3  8  
ATOM 8424  H HG2  . MET A 1 44 ? 8.418   -5.830  -2.820  1.00 0.00 ? 53 MET S HG2  8  
ATOM 8425  H HG3  . MET A 1 44 ? 8.208   -6.325  -4.497  1.00 0.00 ? 53 MET S HG3  8  
ATOM 8426  H HE1  . MET A 1 44 ? 10.357  -4.654  -6.608  1.00 0.00 ? 53 MET S HE1  8  
ATOM 8427  H HE2  . MET A 1 44 ? 9.424   -6.074  -6.134  1.00 0.00 ? 53 MET S HE2  8  
ATOM 8428  H HE3  . MET A 1 44 ? 11.155  -6.002  -5.798  1.00 0.00 ? 53 MET S HE3  8  
ATOM 8429  N N    . THR A 1 45 ? 4.896   -6.179  -4.513  1.00 0.00 ? 54 THR S N    8  
ATOM 8430  C CA   . THR A 1 45 ? 3.573   -6.780  -4.414  1.00 0.00 ? 54 THR S CA   8  
ATOM 8431  C C    . THR A 1 45 ? 3.185   -7.013  -2.961  1.00 0.00 ? 54 THR S C    8  
ATOM 8432  O O    . THR A 1 45 ? 4.047   -7.104  -2.087  1.00 0.00 ? 54 THR S O    8  
ATOM 8433  C CB   . THR A 1 45 ? 3.523   -8.096  -5.192  1.00 0.00 ? 54 THR S CB   8  
ATOM 8434  O OG1  . THR A 1 45 ? 4.293   -9.090  -4.544  1.00 0.00 ? 54 THR S OG1  8  
ATOM 8435  C CG2  . THR A 1 45 ? 4.035   -7.972  -6.610  1.00 0.00 ? 54 THR S CG2  8  
ATOM 8436  H H    . THR A 1 45 ? 5.632   -6.546  -3.973  1.00 0.00 ? 54 THR S H    8  
ATOM 8437  H HA   . THR A 1 45 ? 2.865   -6.091  -4.852  1.00 0.00 ? 54 THR S HA   8  
ATOM 8438  H HB   . THR A 1 45 ? 2.499   -8.437  -5.239  1.00 0.00 ? 54 THR S HB   8  
ATOM 8439  H HG1  . THR A 1 45 ? 3.722   -9.622  -3.983  1.00 0.00 ? 54 THR S HG1  8  
ATOM 8440  H HG21 . THR A 1 45 ? 4.314   -8.949  -6.978  1.00 0.00 ? 54 THR S HG21 8  
ATOM 8441  H HG22 . THR A 1 45 ? 4.897   -7.322  -6.626  1.00 0.00 ? 54 THR S HG22 8  
ATOM 8442  H HG23 . THR A 1 45 ? 3.260   -7.558  -7.238  1.00 0.00 ? 54 THR S HG23 8  
ATOM 8443  N N    . ARG A 1 46 ? 1.886   -7.125  -2.708  1.00 0.00 ? 55 ARG S N    8  
ATOM 8444  C CA   . ARG A 1 46 ? 1.400   -7.370  -1.358  1.00 0.00 ? 55 ARG S CA   8  
ATOM 8445  C C    . ARG A 1 46 ? 1.914   -8.710  -0.852  1.00 0.00 ? 55 ARG S C    8  
ATOM 8446  O O    . ARG A 1 46 ? 2.114   -8.896  0.346   1.00 0.00 ? 55 ARG S O    8  
ATOM 8447  C CB   . ARG A 1 46 ? -0.131  -7.348  -1.329  1.00 0.00 ? 55 ARG S CB   8  
ATOM 8448  C CG   . ARG A 1 46 ? -0.708  -6.964  0.023   1.00 0.00 ? 55 ARG S CG   8  
ATOM 8449  C CD   . ARG A 1 46 ? -2.054  -6.273  -0.122  1.00 0.00 ? 55 ARG S CD   8  
ATOM 8450  N NE   . ARG A 1 46 ? -2.451  -5.585  1.105   1.00 0.00 ? 55 ARG S NE   8  
ATOM 8451  C CZ   . ARG A 1 46 ? -2.853  -6.209  2.209   1.00 0.00 ? 55 ARG S CZ   8  
ATOM 8452  N NH1  . ARG A 1 46 ? -2.913  -7.534  2.246   1.00 0.00 ? 55 ARG S NH1  8  
ATOM 8453  N NH2  . ARG A 1 46 ? -3.196  -5.507  3.280   1.00 0.00 ? 55 ARG S NH2  8  
ATOM 8454  H H    . ARG A 1 46 ? 1.245   -7.056  -3.446  1.00 0.00 ? 55 ARG S H    8  
ATOM 8455  H HA   . ARG A 1 46 ? 1.777   -6.585  -0.719  1.00 0.00 ? 55 ARG S HA   8  
ATOM 8456  H HB2  . ARG A 1 46 ? -0.484  -6.636  -2.064  1.00 0.00 ? 55 ARG S HB2  8  
ATOM 8457  H HB3  . ARG A 1 46 ? -0.497  -8.333  -1.586  1.00 0.00 ? 55 ARG S HB3  8  
ATOM 8458  H HG2  . ARG A 1 46 ? -0.835  -7.857  0.616   1.00 0.00 ? 55 ARG S HG2  8  
ATOM 8459  H HG3  . ARG A 1 46 ? -0.021  -6.293  0.519   1.00 0.00 ? 55 ARG S HG3  8  
ATOM 8460  H HD2  . ARG A 1 46 ? -1.991  -5.553  -0.923  1.00 0.00 ? 55 ARG S HD2  8  
ATOM 8461  H HD3  . ARG A 1 46 ? -2.801  -7.016  -0.364  1.00 0.00 ? 55 ARG S HD3  8  
ATOM 8462  H HE   . ARG A 1 46 ? -2.417  -4.605  1.104   1.00 0.00 ? 55 ARG S HE   8  
ATOM 8463  H HH11 . ARG A 1 46 ? -2.658  -8.071  1.442   1.00 0.00 ? 55 ARG S HH11 8  
ATOM 8464  H HH12 . ARG A 1 46 ? -3.217  -7.998  3.079   1.00 0.00 ? 55 ARG S HH12 8  
ATOM 8465  H HH21 . ARG A 1 46 ? -3.152  -4.507  3.258   1.00 0.00 ? 55 ARG S HH21 8  
ATOM 8466  H HH22 . ARG A 1 46 ? -3.498  -5.975  4.110   1.00 0.00 ? 55 ARG S HH22 8  
ATOM 8467  N N    . ASP A 1 47 ? 2.130   -9.638  -1.780  1.00 0.00 ? 56 ASP S N    8  
ATOM 8468  C CA   . ASP A 1 47 ? 2.627   -10.969 -1.446  1.00 0.00 ? 56 ASP S CA   8  
ATOM 8469  C C    . ASP A 1 47 ? 4.157   -11.005 -1.422  1.00 0.00 ? 56 ASP S C    8  
ATOM 8470  O O    . ASP A 1 47 ? 4.750   -11.994 -0.990  1.00 0.00 ? 56 ASP S O    8  
ATOM 8471  C CB   . ASP A 1 47 ? 2.093   -12.007 -2.438  1.00 0.00 ? 56 ASP S CB   8  
ATOM 8472  C CG   . ASP A 1 47 ? 2.285   -11.587 -3.881  1.00 0.00 ? 56 ASP S CG   8  
ATOM 8473  O OD1  . ASP A 1 47 ? 1.673   -10.580 -4.294  1.00 0.00 ? 56 ASP S OD1  8  
ATOM 8474  O OD2  . ASP A 1 47 ? 3.049   -12.266 -4.600  1.00 0.00 ? 56 ASP S OD2  8  
ATOM 8475  H H    . ASP A 1 47 ? 1.953   -9.421  -2.719  1.00 0.00 ? 56 ASP S H    8  
ATOM 8476  H HA   . ASP A 1 47 ? 2.264   -11.214 -0.459  1.00 0.00 ? 56 ASP S HA   8  
ATOM 8477  H HB2  . ASP A 1 47 ? 2.611   -12.941 -2.283  1.00 0.00 ? 56 ASP S HB2  8  
ATOM 8478  H HB3  . ASP A 1 47 ? 1.037   -12.152 -2.261  1.00 0.00 ? 56 ASP S HB3  8  
ATOM 8479  N N    . GLU A 1 48 ? 4.794   -9.925  -1.872  1.00 0.00 ? 57 GLU S N    8  
ATOM 8480  C CA   . GLU A 1 48 ? 6.248   -9.848  -1.880  1.00 0.00 ? 57 GLU S CA   8  
ATOM 8481  C C    . GLU A 1 48 ? 6.703   -9.147  -0.622  1.00 0.00 ? 57 GLU S C    8  
ATOM 8482  O O    . GLU A 1 48 ? 7.428   -9.709  0.201   1.00 0.00 ? 57 GLU S O    8  
ATOM 8483  C CB   . GLU A 1 48 ? 6.738   -9.085  -3.111  1.00 0.00 ? 57 GLU S CB   8  
ATOM 8484  C CG   . GLU A 1 48 ? 8.251   -9.073  -3.255  1.00 0.00 ? 57 GLU S CG   8  
ATOM 8485  C CD   . GLU A 1 48 ? 8.718   -9.687  -4.562  1.00 0.00 ? 57 GLU S CD   8  
ATOM 8486  O OE1  . GLU A 1 48 ? 8.192   -10.756 -4.937  1.00 0.00 ? 57 GLU S OE1  8  
ATOM 8487  O OE2  . GLU A 1 48 ? 9.611   -9.100  -5.208  1.00 0.00 ? 57 GLU S OE2  8  
ATOM 8488  H H    . GLU A 1 48 ? 4.276   -9.151  -2.183  1.00 0.00 ? 57 GLU S H    8  
ATOM 8489  H HA   . GLU A 1 48 ? 6.643   -10.853 -1.894  1.00 0.00 ? 57 GLU S HA   8  
ATOM 8490  H HB2  . GLU A 1 48 ? 6.318   -9.544  -3.993  1.00 0.00 ? 57 GLU S HB2  8  
ATOM 8491  H HB3  . GLU A 1 48 ? 6.395   -8.060  -3.044  1.00 0.00 ? 57 GLU S HB3  8  
ATOM 8492  H HG2  . GLU A 1 48 ? 8.596   -8.051  -3.214  1.00 0.00 ? 57 GLU S HG2  8  
ATOM 8493  H HG3  . GLU A 1 48 ? 8.682   -9.632  -2.437  1.00 0.00 ? 57 GLU S HG3  8  
ATOM 8494  N N    . TYR A 1 49 ? 6.228   -7.923  -0.465  1.00 0.00 ? 58 TYR S N    8  
ATOM 8495  C CA   . TYR A 1 49 ? 6.524   -7.130  0.709   1.00 0.00 ? 58 TYR S CA   8  
ATOM 8496  C C    . TYR A 1 49 ? 6.035   -7.869  1.945   1.00 0.00 ? 58 TYR S C    8  
ATOM 8497  O O    . TYR A 1 49 ? 6.601   -7.735  3.031   1.00 0.00 ? 58 TYR S O    8  
ATOM 8498  C CB   . TYR A 1 49 ? 5.817   -5.783  0.597   1.00 0.00 ? 58 TYR S CB   8  
ATOM 8499  C CG   . TYR A 1 49 ? 6.647   -4.689  -0.042  1.00 0.00 ? 58 TYR S CG   8  
ATOM 8500  C CD1  . TYR A 1 49 ? 7.877   -4.960  -0.637  1.00 0.00 ? 58 TYR S CD1  8  
ATOM 8501  C CD2  . TYR A 1 49 ? 6.199   -3.378  -0.042  1.00 0.00 ? 58 TYR S CD2  8  
ATOM 8502  C CE1  . TYR A 1 49 ? 8.628   -3.953  -1.213  1.00 0.00 ? 58 TYR S CE1  8  
ATOM 8503  C CE2  . TYR A 1 49 ? 6.944   -2.369  -0.616  1.00 0.00 ? 58 TYR S CE2  8  
ATOM 8504  C CZ   . TYR A 1 49 ? 8.157   -2.660  -1.199  1.00 0.00 ? 58 TYR S CZ   8  
ATOM 8505  O OH   . TYR A 1 49 ? 8.901   -1.654  -1.771  1.00 0.00 ? 58 TYR S OH   8  
ATOM 8506  H H    . TYR A 1 49 ? 5.629   -7.555  -1.147  1.00 0.00 ? 58 TYR S H    8  
ATOM 8507  H HA   . TYR A 1 49 ? 7.589   -6.981  0.772   1.00 0.00 ? 58 TYR S HA   8  
ATOM 8508  H HB2  . TYR A 1 49 ? 4.929   -5.910  -0.007  1.00 0.00 ? 58 TYR S HB2  8  
ATOM 8509  H HB3  . TYR A 1 49 ? 5.528   -5.460  1.579   1.00 0.00 ? 58 TYR S HB3  8  
ATOM 8510  H HD1  . TYR A 1 49 ? 8.244   -5.974  -0.649  1.00 0.00 ? 58 TYR S HD1  8  
ATOM 8511  H HD2  . TYR A 1 49 ? 5.248   -3.150  0.416   1.00 0.00 ? 58 TYR S HD2  8  
ATOM 8512  H HE1  . TYR A 1 49 ? 9.578   -4.184  -1.670  1.00 0.00 ? 58 TYR S HE1  8  
ATOM 8513  H HE2  . TYR A 1 49 ? 6.574   -1.359  -0.604  1.00 0.00 ? 58 TYR S HE2  8  
ATOM 8514  H HH   . TYR A 1 49 ? 8.642   -1.546  -2.688  1.00 0.00 ? 58 TYR S HH   8  
ATOM 8515  N N    . ASN A 1 50 ? 4.981   -8.655  1.765   1.00 0.00 ? 59 ASN S N    8  
ATOM 8516  C CA   . ASN A 1 50 ? 4.407   -9.431  2.865   1.00 0.00 ? 59 ASN S CA   8  
ATOM 8517  C C    . ASN A 1 50 ? 5.481   -10.247 3.586   1.00 0.00 ? 59 ASN S C    8  
ATOM 8518  O O    . ASN A 1 50 ? 5.342   -10.562 4.767   1.00 0.00 ? 59 ASN S O    8  
ATOM 8519  C CB   . ASN A 1 50 ? 3.311   -10.367 2.349   1.00 0.00 ? 59 ASN S CB   8  
ATOM 8520  C CG   . ASN A 1 50 ? 1.929   -9.950  2.817   1.00 0.00 ? 59 ASN S CG   8  
ATOM 8521  O OD1  . ASN A 1 50 ? 1.787   -9.241  3.813   1.00 0.00 ? 59 ASN S OD1  8  
ATOM 8522  N ND2  . ASN A 1 50 ? 0.903   -10.391 2.101   1.00 0.00 ? 59 ASN S ND2  8  
ATOM 8523  H H    . ASN A 1 50 ? 4.578   -8.716  0.864   1.00 0.00 ? 59 ASN S H    8  
ATOM 8524  H HA   . ASN A 1 50 ? 3.972   -8.735  3.566   1.00 0.00 ? 59 ASN S HA   8  
ATOM 8525  H HB2  . ASN A 1 50 ? 3.323   -10.367 1.271   1.00 0.00 ? 59 ASN S HB2  8  
ATOM 8526  H HB3  . ASN A 1 50 ? 3.504   -11.368 2.706   1.00 0.00 ? 59 ASN S HB3  8  
ATOM 8527  H HD21 . ASN A 1 50 ? 1.091   -10.954 1.320   1.00 0.00 ? 59 ASN S HD21 8  
ATOM 8528  H HD22 . ASN A 1 50 ? -0.001  -10.138 2.381   1.00 0.00 ? 59 ASN S HD22 8  
ATOM 8529  N N    . ALA A 1 51 ? 6.547   -10.591 2.866   1.00 0.00 ? 60 ALA S N    8  
ATOM 8530  C CA   . ALA A 1 51 ? 7.633   -11.378 3.440   1.00 0.00 ? 60 ALA S CA   8  
ATOM 8531  C C    . ALA A 1 51 ? 8.936   -10.585 3.482   1.00 0.00 ? 60 ALA S C    8  
ATOM 8532  O O    . ALA A 1 51 ? 9.752   -10.765 4.385   1.00 0.00 ? 60 ALA S O    8  
ATOM 8533  C CB   . ALA A 1 51 ? 7.823   -12.664 2.651   1.00 0.00 ? 60 ALA S CB   8  
ATOM 8534  H H    . ALA A 1 51 ? 6.599   -10.315 1.928   1.00 0.00 ? 60 ALA S H    8  
ATOM 8535  H HA   . ALA A 1 51 ? 7.354   -11.643 4.449   1.00 0.00 ? 60 ALA S HA   8  
ATOM 8536  H HB1  . ALA A 1 51 ? 6.916   -12.894 2.112   1.00 0.00 ? 60 ALA S HB1  8  
ATOM 8537  H HB2  . ALA A 1 51 ? 8.054   -13.472 3.329   1.00 0.00 ? 60 ALA S HB2  8  
ATOM 8538  H HB3  . ALA A 1 51 ? 8.635   -12.540 1.951   1.00 0.00 ? 60 ALA S HB3  8  
ATOM 8539  N N    . LEU A 1 52 ? 9.126   -9.710  2.501   1.00 0.00 ? 61 LEU S N    8  
ATOM 8540  C CA   . LEU A 1 52 ? 10.329  -8.895  2.429   1.00 0.00 ? 61 LEU S CA   8  
ATOM 8541  C C    . LEU A 1 52 ? 10.458  -8.008  3.663   1.00 0.00 ? 61 LEU S C    8  
ATOM 8542  O O    . LEU A 1 52 ? 9.456   -7.603  4.254   1.00 0.00 ? 61 LEU S O    8  
ATOM 8543  C CB   . LEU A 1 52 ? 10.309  -8.030  1.165   1.00 0.00 ? 61 LEU S CB   8  
ATOM 8544  C CG   . LEU A 1 52 ? 10.978  -8.654  -0.061  1.00 0.00 ? 61 LEU S CG   8  
ATOM 8545  C CD1  . LEU A 1 52 ? 10.338  -8.132  -1.338  1.00 0.00 ? 61 LEU S CD1  8  
ATOM 8546  C CD2  . LEU A 1 52 ? 12.472  -8.368  -0.061  1.00 0.00 ? 61 LEU S CD2  8  
ATOM 8547  H H    . LEU A 1 52 ? 8.443   -9.612  1.810   1.00 0.00 ? 61 LEU S H    8  
ATOM 8548  H HA   . LEU A 1 52 ? 11.179  -9.559  2.386   1.00 0.00 ? 61 LEU S HA   8  
ATOM 8549  H HB2  . LEU A 1 52 ? 9.278   -7.822  0.918   1.00 0.00 ? 61 LEU S HB2  8  
ATOM 8550  H HB3  . LEU A 1 52 ? 10.808  -7.096  1.385   1.00 0.00 ? 61 LEU S HB3  8  
ATOM 8551  H HG   . LEU A 1 52 ? 10.842  -9.724  -0.034  1.00 0.00 ? 61 LEU S HG   8  
ATOM 8552  H HD11 . LEU A 1 52 ? 10.563  -8.802  -2.154  1.00 0.00 ? 61 LEU S HD11 8  
ATOM 8553  H HD12 . LEU A 1 52 ? 10.729  -7.150  -1.561  1.00 0.00 ? 61 LEU S HD12 8  
ATOM 8554  H HD13 . LEU A 1 52 ? 9.268   -8.071  -1.205  1.00 0.00 ? 61 LEU S HD13 8  
ATOM 8555  H HD21 . LEU A 1 52 ? 12.853  -8.437  -1.068  1.00 0.00 ? 61 LEU S HD21 8  
ATOM 8556  H HD22 . LEU A 1 52 ? 12.977  -9.090  0.565   1.00 0.00 ? 61 LEU S HD22 8  
ATOM 8557  H HD23 . LEU A 1 52 ? 12.649  -7.374  0.324   1.00 0.00 ? 61 LEU S HD23 8  
ATOM 8558  N N    . PRO A 1 53 ? 11.699  -7.697  4.070   1.00 0.00 ? 62 PRO S N    8  
ATOM 8559  C CA   . PRO A 1 53 ? 11.973  -6.858  5.237   1.00 0.00 ? 62 PRO S CA   8  
ATOM 8560  C C    . PRO A 1 53 ? 11.043  -5.650  5.309   1.00 0.00 ? 62 PRO S C    8  
ATOM 8561  O O    . PRO A 1 53 ? 10.900  -4.900  4.343   1.00 0.00 ? 62 PRO S O    8  
ATOM 8562  C CB   . PRO A 1 53 ? 13.433  -6.414  5.043   1.00 0.00 ? 62 PRO S CB   8  
ATOM 8563  C CG   . PRO A 1 53 ? 13.900  -7.037  3.760   1.00 0.00 ? 62 PRO S CG   8  
ATOM 8564  C CD   . PRO A 1 53 ? 12.937  -8.139  3.428   1.00 0.00 ? 62 PRO S CD   8  
ATOM 8565  H HA   . PRO A 1 53 ? 11.888  -7.425  6.152   1.00 0.00 ? 62 PRO S HA   8  
ATOM 8566  H HB2  . PRO A 1 53 ? 13.476  -5.336  4.989   1.00 0.00 ? 62 PRO S HB2  8  
ATOM 8567  H HB3  . PRO A 1 53 ? 14.024  -6.758  5.881   1.00 0.00 ? 62 PRO S HB3  8  
ATOM 8568  H HG2  . PRO A 1 53 ? 13.901  -6.296  2.974   1.00 0.00 ? 62 PRO S HG2  8  
ATOM 8569  H HG3  . PRO A 1 53 ? 14.895  -7.439  3.894   1.00 0.00 ? 62 PRO S HG3  8  
ATOM 8570  H HD2  . PRO A 1 53 ? 12.809  -8.219  2.359   1.00 0.00 ? 62 PRO S HD2  8  
ATOM 8571  H HD3  . PRO A 1 53 ? 13.271  -9.079  3.841   1.00 0.00 ? 62 PRO S HD3  8  
ATOM 8572  N N    . ALA A 1 54 ? 10.406  -5.477  6.462   1.00 0.00 ? 63 ALA S N    8  
ATOM 8573  C CA   . ALA A 1 54 ? 9.474   -4.373  6.669   1.00 0.00 ? 63 ALA S CA   8  
ATOM 8574  C C    . ALA A 1 54 ? 10.164  -3.014  6.587   1.00 0.00 ? 63 ALA S C    8  
ATOM 8575  O O    . ALA A 1 54 ? 9.505   -1.987  6.435   1.00 0.00 ? 63 ALA S O    8  
ATOM 8576  C CB   . ALA A 1 54 ? 8.775   -4.527  8.011   1.00 0.00 ? 63 ALA S CB   8  
ATOM 8577  H H    . ALA A 1 54 ? 10.557  -6.115  7.190   1.00 0.00 ? 63 ALA S H    8  
ATOM 8578  H HA   . ALA A 1 54 ? 8.722   -4.429  5.899   1.00 0.00 ? 63 ALA S HA   8  
ATOM 8579  H HB1  . ALA A 1 54 ? 8.823   -5.559  8.327   1.00 0.00 ? 63 ALA S HB1  8  
ATOM 8580  H HB2  . ALA A 1 54 ? 7.742   -4.227  7.916   1.00 0.00 ? 63 ALA S HB2  8  
ATOM 8581  H HB3  . ALA A 1 54 ? 9.264   -3.904  8.746   1.00 0.00 ? 63 ALA S HB3  8  
ATOM 8582  N N    . TRP A 1 55 ? 11.488  -3.007  6.670   1.00 0.00 ? 64 TRP S N    8  
ATOM 8583  C CA   . TRP A 1 55 ? 12.246  -1.783  6.593   1.00 0.00 ? 64 TRP S CA   8  
ATOM 8584  C C    . TRP A 1 55 ? 12.603  -1.512  5.144   1.00 0.00 ? 64 TRP S C    8  
ATOM 8585  O O    . TRP A 1 55 ? 12.503  -0.386  4.673   1.00 0.00 ? 64 TRP S O    8  
ATOM 8586  C CB   . TRP A 1 55 ? 13.512  -1.887  7.458   1.00 0.00 ? 64 TRP S CB   8  
ATOM 8587  C CG   . TRP A 1 55 ? 14.755  -2.052  6.646   1.00 0.00 ? 64 TRP S CG   8  
ATOM 8588  C CD1  . TRP A 1 55 ? 15.532  -3.165  6.539   1.00 0.00 ? 64 TRP S CD1  8  
ATOM 8589  C CD2  . TRP A 1 55 ? 15.333  -1.067  5.795   1.00 0.00 ? 64 TRP S CD2  8  
ATOM 8590  N NE1  . TRP A 1 55 ? 16.572  -2.926  5.671   1.00 0.00 ? 64 TRP S NE1  8  
ATOM 8591  C CE2  . TRP A 1 55 ? 16.468  -1.641  5.200   1.00 0.00 ? 64 TRP S CE2  8  
ATOM 8592  C CE3  . TRP A 1 55 ? 14.995  0.249   5.486   1.00 0.00 ? 64 TRP S CE3  8  
ATOM 8593  C CZ2  . TRP A 1 55 ? 17.265  -0.936  4.301   1.00 0.00 ? 64 TRP S CZ2  8  
ATOM 8594  C CZ3  . TRP A 1 55 ? 15.780  0.944   4.596   1.00 0.00 ? 64 TRP S CZ3  8  
ATOM 8595  C CH2  . TRP A 1 55 ? 16.901  0.354   4.013   1.00 0.00 ? 64 TRP S CH2  8  
ATOM 8596  H H    . TRP A 1 55 ? 11.971  -3.841  6.762   1.00 0.00 ? 64 TRP S H    8  
ATOM 8597  H HA   . TRP A 1 55 ? 11.626  -0.979  6.963   1.00 0.00 ? 64 TRP S HA   8  
ATOM 8598  H HB2  . TRP A 1 55 ? 13.615  -0.986  8.049   1.00 0.00 ? 64 TRP S HB2  8  
ATOM 8599  H HB3  . TRP A 1 55 ? 13.423  -2.743  8.116   1.00 0.00 ? 64 TRP S HB3  8  
ATOM 8600  H HD1  . TRP A 1 55 ? 15.344  -4.088  7.067   1.00 0.00 ? 64 TRP S HD1  8  
ATOM 8601  H HE1  . TRP A 1 55 ? 17.271  -3.569  5.426   1.00 0.00 ? 64 TRP S HE1  8  
ATOM 8602  H HE3  . TRP A 1 55 ? 14.129  0.723   5.927   1.00 0.00 ? 64 TRP S HE3  8  
ATOM 8603  H HZ2  . TRP A 1 55 ? 18.136  -1.378  3.839   1.00 0.00 ? 64 TRP S HZ2  8  
ATOM 8604  H HZ3  . TRP A 1 55 ? 15.529  1.961   4.340   1.00 0.00 ? 64 TRP S HZ3  8  
ATOM 8605  H HH2  . TRP A 1 55 ? 17.474  0.937   3.317   1.00 0.00 ? 64 TRP S HH2  8  
ATOM 8606  N N    . LYS A 1 56 ? 13.018  -2.565  4.443   1.00 0.00 ? 65 LYS S N    8  
ATOM 8607  C CA   . LYS A 1 56 ? 13.386  -2.449  3.044   1.00 0.00 ? 65 LYS S CA   8  
ATOM 8608  C C    . LYS A 1 56 ? 12.187  -1.985  2.243   1.00 0.00 ? 65 LYS S C    8  
ATOM 8609  O O    . LYS A 1 56 ? 12.293  -1.078  1.417   1.00 0.00 ? 65 LYS S O    8  
ATOM 8610  C CB   . LYS A 1 56 ? 13.914  -3.778  2.506   1.00 0.00 ? 65 LYS S CB   8  
ATOM 8611  C CG   . LYS A 1 56 ? 15.158  -3.622  1.646   1.00 0.00 ? 65 LYS S CG   8  
ATOM 8612  C CD   . LYS A 1 56 ? 16.200  -4.678  1.976   1.00 0.00 ? 65 LYS S CD   8  
ATOM 8613  C CE   . LYS A 1 56 ? 17.612  -4.154  1.754   1.00 0.00 ? 65 LYS S CE   8  
ATOM 8614  N NZ   . LYS A 1 56 ? 18.576  -5.255  1.482   1.00 0.00 ? 65 LYS S NZ   8  
ATOM 8615  H H    . LYS A 1 56 ? 13.068  -3.439  4.877   1.00 0.00 ? 65 LYS S H    8  
ATOM 8616  H HA   . LYS A 1 56 ? 14.163  -1.702  2.967   1.00 0.00 ? 65 LYS S HA   8  
ATOM 8617  H HB2  . LYS A 1 56 ? 14.156  -4.421  3.342   1.00 0.00 ? 65 LYS S HB2  8  
ATOM 8618  H HB3  . LYS A 1 56 ? 13.143  -4.247  1.906   1.00 0.00 ? 65 LYS S HB3  8  
ATOM 8619  H HG2  . LYS A 1 56 ? 14.881  -3.717  0.605   1.00 0.00 ? 65 LYS S HG2  8  
ATOM 8620  H HG3  . LYS A 1 56 ? 15.582  -2.640  1.822   1.00 0.00 ? 65 LYS S HG3  8  
ATOM 8621  H HD2  . LYS A 1 56 ? 16.094  -4.965  3.011   1.00 0.00 ? 65 LYS S HD2  8  
ATOM 8622  H HD3  . LYS A 1 56 ? 16.042  -5.537  1.342   1.00 0.00 ? 65 LYS S HD3  8  
ATOM 8623  H HE2  . LYS A 1 56 ? 17.603  -3.480  0.911   1.00 0.00 ? 65 LYS S HE2  8  
ATOM 8624  H HE3  . LYS A 1 56 ? 17.927  -3.620  2.637   1.00 0.00 ? 65 LYS S HE3  8  
ATOM 8625  H HZ1  . LYS A 1 56 ? 19.426  -4.878  1.015   1.00 0.00 ? 65 LYS S HZ1  8  
ATOM 8626  H HZ2  . LYS A 1 56 ? 18.140  -5.968  0.862   1.00 0.00 ? 65 LYS S HZ2  8  
ATOM 8627  H HZ3  . LYS A 1 56 ? 18.858  -5.712  2.373   1.00 0.00 ? 65 LYS S HZ3  8  
ATOM 8628  N N    . GLN A 1 57 ? 11.025  -2.577  2.519   1.00 0.00 ? 66 GLN S N    8  
ATOM 8629  C CA   . GLN A 1 57 ? 9.813   -2.165  1.843   1.00 0.00 ? 66 GLN S CA   8  
ATOM 8630  C C    . GLN A 1 57 ? 9.582   -0.699  2.160   1.00 0.00 ? 66 GLN S C    8  
ATOM 8631  O O    . GLN A 1 57 ? 9.313   0.111   1.272   1.00 0.00 ? 66 GLN S O    8  
ATOM 8632  C CB   . GLN A 1 57 ? 8.613   -3.016  2.266   1.00 0.00 ? 66 GLN S CB   8  
ATOM 8633  C CG   . GLN A 1 57 ? 8.353   -3.022  3.761   1.00 0.00 ? 66 GLN S CG   8  
ATOM 8634  C CD   . GLN A 1 57 ? 7.175   -3.903  4.135   1.00 0.00 ? 66 GLN S CD   8  
ATOM 8635  O OE1  . GLN A 1 57 ? 6.269   -3.477  4.849   1.00 0.00 ? 66 GLN S OE1  8  
ATOM 8636  N NE2  . GLN A 1 57 ? 7.184   -5.141  3.650   1.00 0.00 ? 66 GLN S NE2  8  
ATOM 8637  H H    . GLN A 1 57 ? 10.986  -3.271  3.210   1.00 0.00 ? 66 GLN S H    8  
ATOM 8638  H HA   . GLN A 1 57 ? 9.974   -2.273  0.781   1.00 0.00 ? 66 GLN S HA   8  
ATOM 8639  H HB2  . GLN A 1 57 ? 7.730   -2.639  1.773   1.00 0.00 ? 66 GLN S HB2  8  
ATOM 8640  H HB3  . GLN A 1 57 ? 8.783   -4.033  1.948   1.00 0.00 ? 66 GLN S HB3  8  
ATOM 8641  H HG2  . GLN A 1 57 ? 9.235   -3.390  4.268   1.00 0.00 ? 66 GLN S HG2  8  
ATOM 8642  H HG3  . GLN A 1 57 ? 8.146   -2.012  4.085   1.00 0.00 ? 66 GLN S HG3  8  
ATOM 8643  H HE21 . GLN A 1 57 ? 7.939   -5.412  3.087   1.00 0.00 ? 66 GLN S HE21 8  
ATOM 8644  H HE22 . GLN A 1 57 ? 6.438   -5.732  3.876   1.00 0.00 ? 66 GLN S HE22 8  
ATOM 8645  N N    . VAL A 1 58 ? 9.762   -0.354  3.436   1.00 0.00 ? 67 VAL S N    8  
ATOM 8646  C CA   . VAL A 1 58 ? 9.648   1.021   3.874   1.00 0.00 ? 67 VAL S CA   8  
ATOM 8647  C C    . VAL A 1 58 ? 10.686  1.848   3.128   1.00 0.00 ? 67 VAL S C    8  
ATOM 8648  O O    . VAL A 1 58 ? 10.392  2.944   2.650   1.00 0.00 ? 67 VAL S O    8  
ATOM 8649  C CB   . VAL A 1 58 ? 9.862   1.150   5.400   1.00 0.00 ? 67 VAL S CB   8  
ATOM 8650  C CG1  . VAL A 1 58 ? 10.070  2.604   5.814   1.00 0.00 ? 67 VAL S CG1  8  
ATOM 8651  C CG2  . VAL A 1 58 ? 8.689   0.541   6.150   1.00 0.00 ? 67 VAL S CG2  8  
ATOM 8652  H H    . VAL A 1 58 ? 10.020  -1.039  4.087   1.00 0.00 ? 67 VAL S H    8  
ATOM 8653  H HA   . VAL A 1 58 ? 8.658   1.379   3.626   1.00 0.00 ? 67 VAL S HA   8  
ATOM 8654  H HB   . VAL A 1 58 ? 10.753  0.597   5.664   1.00 0.00 ? 67 VAL S HB   8  
ATOM 8655  H HG11 . VAL A 1 58 ? 11.070  2.727   6.204   1.00 0.00 ? 67 VAL S HG11 8  
ATOM 8656  H HG12 . VAL A 1 58 ? 9.352   2.868   6.575   1.00 0.00 ? 67 VAL S HG12 8  
ATOM 8657  H HG13 . VAL A 1 58 ? 9.938   3.245   4.957   1.00 0.00 ? 67 VAL S HG13 8  
ATOM 8658  H HG21 . VAL A 1 58 ? 7.907   1.277   6.257   1.00 0.00 ? 67 VAL S HG21 8  
ATOM 8659  H HG22 . VAL A 1 58 ? 9.014   0.216   7.126   1.00 0.00 ? 67 VAL S HG22 8  
ATOM 8660  H HG23 . VAL A 1 58 ? 8.310   -0.306  5.597   1.00 0.00 ? 67 VAL S HG23 8  
ATOM 8661  N N    . ASN A 1 59 ? 11.904  1.300   3.011   1.00 0.00 ? 68 ASN S N    8  
ATOM 8662  C CA   . ASN A 1 59 ? 12.974  1.985   2.290   1.00 0.00 ? 68 ASN S CA   8  
ATOM 8663  C C    . ASN A 1 59 ? 12.458  2.528   0.960   1.00 0.00 ? 68 ASN S C    8  
ATOM 8664  O O    . ASN A 1 59 ? 12.903  3.571   0.483   1.00 0.00 ? 68 ASN S O    8  
ATOM 8665  C CB   . ASN A 1 59 ? 14.138  1.028   2.026   1.00 0.00 ? 68 ASN S CB   8  
ATOM 8666  C CG   . ASN A 1 59 ? 15.447  1.759   1.794   1.00 0.00 ? 68 ASN S CG   8  
ATOM 8667  O OD1  . ASN A 1 59 ? 15.649  2.868   2.288   1.00 0.00 ? 68 ASN S OD1  8  
ATOM 8668  N ND2  . ASN A 1 59 ? 16.344  1.138   1.037   1.00 0.00 ? 68 ASN S ND2  8  
ATOM 8669  H H    . ASN A 1 59 ? 12.084  0.401   3.411   1.00 0.00 ? 68 ASN S H    8  
ATOM 8670  H HA   . ASN A 1 59 ? 13.320  2.807   2.899   1.00 0.00 ? 68 ASN S HA   8  
ATOM 8671  H HB2  . ASN A 1 59 ? 14.255  0.372   2.873   1.00 0.00 ? 68 ASN S HB2  8  
ATOM 8672  H HB3  . ASN A 1 59 ? 13.916  0.440   1.149   1.00 0.00 ? 68 ASN S HB3  8  
ATOM 8673  H HD21 . ASN A 1 59 ? 16.115  0.256   0.675   1.00 0.00 ? 68 ASN S HD21 8  
ATOM 8674  H HD22 . ASN A 1 59 ? 17.199  1.587   0.870   1.00 0.00 ? 68 ASN S HD22 8  
ATOM 8675  N N    . LEU A 1 60 ? 11.510  1.803   0.372   1.00 0.00 ? 69 LEU S N    8  
ATOM 8676  C CA   . LEU A 1 60 ? 10.923  2.195   -0.902  1.00 0.00 ? 69 LEU S CA   8  
ATOM 8677  C C    . LEU A 1 60 ? 9.785   3.189   -0.699  1.00 0.00 ? 69 LEU S C    8  
ATOM 8678  O O    . LEU A 1 60 ? 9.683   4.180   -1.423  1.00 0.00 ? 69 LEU S O    8  
ATOM 8679  C CB   . LEU A 1 60 ? 10.405  0.964   -1.650  1.00 0.00 ? 69 LEU S CB   8  
ATOM 8680  C CG   . LEU A 1 60 ? 11.453  0.218   -2.476  1.00 0.00 ? 69 LEU S CG   8  
ATOM 8681  C CD1  . LEU A 1 60 ? 11.957  1.092   -3.614  1.00 0.00 ? 69 LEU S CD1  8  
ATOM 8682  C CD2  . LEU A 1 60 ? 12.607  -0.228  -1.593  1.00 0.00 ? 69 LEU S CD2  8  
ATOM 8683  H H    . LEU A 1 60 ? 11.201  0.981   0.806   1.00 0.00 ? 69 LEU S H    8  
ATOM 8684  H HA   . LEU A 1 60 ? 11.693  2.664   -1.493  1.00 0.00 ? 69 LEU S HA   8  
ATOM 8685  H HB2  . LEU A 1 60 ? 9.991   0.277   -0.925  1.00 0.00 ? 69 LEU S HB2  8  
ATOM 8686  H HB3  . LEU A 1 60 ? 9.615   1.281   -2.317  1.00 0.00 ? 69 LEU S HB3  8  
ATOM 8687  H HG   . LEU A 1 60 ? 11.000  -0.663  -2.908  1.00 0.00 ? 69 LEU S HG   8  
ATOM 8688  H HD11 . LEU A 1 60 ? 11.149  1.707   -3.980  1.00 0.00 ? 69 LEU S HD11 8  
ATOM 8689  H HD12 . LEU A 1 60 ? 12.324  0.467   -4.413  1.00 0.00 ? 69 LEU S HD12 8  
ATOM 8690  H HD13 . LEU A 1 60 ? 12.755  1.724   -3.255  1.00 0.00 ? 69 LEU S HD13 8  
ATOM 8691  H HD21 . LEU A 1 60 ? 12.973  0.614   -1.024  1.00 0.00 ? 69 LEU S HD21 8  
ATOM 8692  H HD22 . LEU A 1 60 ? 13.404  -0.618  -2.210  1.00 0.00 ? 69 LEU S HD22 8  
ATOM 8693  H HD23 . LEU A 1 60 ? 12.267  -0.998  -0.917  1.00 0.00 ? 69 LEU S HD23 8  
ATOM 8694  N N    . LYS A 1 61 ? 8.928   2.925   0.287   1.00 0.00 ? 70 LYS S N    8  
ATOM 8695  C CA   . LYS A 1 61 ? 7.802   3.812   0.563   1.00 0.00 ? 70 LYS S CA   8  
ATOM 8696  C C    . LYS A 1 61 ? 8.291   5.235   0.826   1.00 0.00 ? 70 LYS S C    8  
ATOM 8697  O O    . LYS A 1 61 ? 7.819   6.185   0.205   1.00 0.00 ? 70 LYS S O    8  
ATOM 8698  C CB   . LYS A 1 61 ? 6.971   3.305   1.751   1.00 0.00 ? 70 LYS S CB   8  
ATOM 8699  C CG   . LYS A 1 61 ? 6.594   1.836   1.656   1.00 0.00 ? 70 LYS S CG   8  
ATOM 8700  C CD   . LYS A 1 61 ? 5.763   1.395   2.850   1.00 0.00 ? 70 LYS S CD   8  
ATOM 8701  C CE   . LYS A 1 61 ? 6.179   0.017   3.341   1.00 0.00 ? 70 LYS S CE   8  
ATOM 8702  N NZ   . LYS A 1 61 ? 5.614   -0.287  4.685   1.00 0.00 ? 70 LYS S NZ   8  
ATOM 8703  H H    . LYS A 1 61 ? 9.055   2.123   0.832   1.00 0.00 ? 70 LYS S H    8  
ATOM 8704  H HA   . LYS A 1 61 ? 7.178   3.824   -0.316  1.00 0.00 ? 70 LYS S HA   8  
ATOM 8705  H HB2  . LYS A 1 61 ? 7.527   3.453   2.666   1.00 0.00 ? 70 LYS S HB2  8  
ATOM 8706  H HB3  . LYS A 1 61 ? 6.057   3.880   1.801   1.00 0.00 ? 70 LYS S HB3  8  
ATOM 8707  H HG2  . LYS A 1 61 ? 6.018   1.682   0.757   1.00 0.00 ? 70 LYS S HG2  8  
ATOM 8708  H HG3  . LYS A 1 61 ? 7.495   1.246   1.617   1.00 0.00 ? 70 LYS S HG3  8  
ATOM 8709  H HD2  . LYS A 1 61 ? 5.894   2.106   3.651   1.00 0.00 ? 70 LYS S HD2  8  
ATOM 8710  H HD3  . LYS A 1 61 ? 4.723   1.364   2.558   1.00 0.00 ? 70 LYS S HD3  8  
ATOM 8711  H HE2  . LYS A 1 61 ? 5.831   -0.723  2.637   1.00 0.00 ? 70 LYS S HE2  8  
ATOM 8712  H HE3  . LYS A 1 61 ? 7.258   -0.020  3.396   1.00 0.00 ? 70 LYS S HE3  8  
ATOM 8713  H HZ1  . LYS A 1 61 ? 5.273   -1.269  4.715   1.00 0.00 ? 70 LYS S HZ1  8  
ATOM 8714  H HZ2  . LYS A 1 61 ? 4.820   0.352   4.893   1.00 0.00 ? 70 LYS S HZ2  8  
ATOM 8715  H HZ3  . LYS A 1 61 ? 6.343   -0.165  5.417   1.00 0.00 ? 70 LYS S HZ3  8  
ATOM 8716  N N    . LYS A 1 62 ? 9.246   5.375   1.737   1.00 0.00 ? 71 LYS S N    8  
ATOM 8717  C CA   . LYS A 1 62 ? 9.797   6.686   2.062   1.00 0.00 ? 71 LYS S CA   8  
ATOM 8718  C C    . LYS A 1 62 ? 10.641  7.220   0.908   1.00 0.00 ? 71 LYS S C    8  
ATOM 8719  O O    . LYS A 1 62 ? 10.731  8.430   0.701   1.00 0.00 ? 71 LYS S O    8  
ATOM 8720  C CB   . LYS A 1 62 ? 10.643  6.610   3.334   1.00 0.00 ? 71 LYS S CB   8  
ATOM 8721  C CG   . LYS A 1 62 ? 9.886   6.056   4.527   1.00 0.00 ? 71 LYS S CG   8  
ATOM 8722  C CD   . LYS A 1 62 ? 10.762  6.007   5.771   1.00 0.00 ? 71 LYS S CD   8  
ATOM 8723  C CE   . LYS A 1 62 ? 10.001  6.459   7.009   1.00 0.00 ? 71 LYS S CE   8  
ATOM 8724  N NZ   . LYS A 1 62 ? 9.842   5.355   7.996   1.00 0.00 ? 71 LYS S NZ   8  
ATOM 8725  H H    . LYS A 1 62 ? 9.594   4.582   2.195   1.00 0.00 ? 71 LYS S H    8  
ATOM 8726  H HA   . LYS A 1 62 ? 8.970   7.359   2.229   1.00 0.00 ? 71 LYS S HA   8  
ATOM 8727  H HB2  . LYS A 1 62 ? 11.496  5.976   3.148   1.00 0.00 ? 71 LYS S HB2  8  
ATOM 8728  H HB3  . LYS A 1 62 ? 10.988  7.602   3.582   1.00 0.00 ? 71 LYS S HB3  8  
ATOM 8729  H HG2  . LYS A 1 62 ? 9.032   6.684   4.725   1.00 0.00 ? 71 LYS S HG2  8  
ATOM 8730  H HG3  . LYS A 1 62 ? 9.554   5.057   4.292   1.00 0.00 ? 71 LYS S HG3  8  
ATOM 8731  H HD2  . LYS A 1 62 ? 11.102  4.994   5.920   1.00 0.00 ? 71 LYS S HD2  8  
ATOM 8732  H HD3  . LYS A 1 62 ? 11.613  6.657   5.626   1.00 0.00 ? 71 LYS S HD3  8  
ATOM 8733  H HE2  . LYS A 1 62 ? 10.546  7.269   7.475   1.00 0.00 ? 71 LYS S HE2  8  
ATOM 8734  H HE3  . LYS A 1 62 ? 9.022   6.807   6.709   1.00 0.00 ? 71 LYS S HE3  8  
ATOM 8735  H HZ1  . LYS A 1 62 ? 10.762  4.904   8.179   1.00 0.00 ? 71 LYS S HZ1  8  
ATOM 8736  H HZ2  . LYS A 1 62 ? 9.182   4.639   7.629   1.00 0.00 ? 71 LYS S HZ2  8  
ATOM 8737  H HZ3  . LYS A 1 62 ? 9.468   5.728   8.892   1.00 0.00 ? 71 LYS S HZ3  8  
ATOM 8738  N N    . ALA A 1 63 ? 11.258  6.311   0.160   1.00 0.00 ? 72 ALA S N    8  
ATOM 8739  C CA   . ALA A 1 63 ? 12.094  6.689   -0.973  1.00 0.00 ? 72 ALA S CA   8  
ATOM 8740  C C    . ALA A 1 63 ? 11.314  7.541   -1.971  1.00 0.00 ? 72 ALA S C    8  
ATOM 8741  O O    . ALA A 1 63 ? 11.881  8.406   -2.638  1.00 0.00 ? 72 ALA S O    8  
ATOM 8742  C CB   . ALA A 1 63 ? 12.652  5.450   -1.655  1.00 0.00 ? 72 ALA S CB   8  
ATOM 8743  H H    . ALA A 1 63 ? 11.148  5.360   0.375   1.00 0.00 ? 72 ALA S H    8  
ATOM 8744  H HA   . ALA A 1 63 ? 12.924  7.268   -0.594  1.00 0.00 ? 72 ALA S HA   8  
ATOM 8745  H HB1  . ALA A 1 63 ? 12.878  5.677   -2.687  1.00 0.00 ? 72 ALA S HB1  8  
ATOM 8746  H HB2  . ALA A 1 63 ? 11.923  4.656   -1.611  1.00 0.00 ? 72 ALA S HB2  8  
ATOM 8747  H HB3  . ALA A 1 63 ? 13.557  5.138   -1.151  1.00 0.00 ? 72 ALA S HB3  8  
ATOM 8748  N N    . LYS A 1 64 ? 10.012  7.290   -2.065  1.00 0.00 ? 73 LYS S N    8  
ATOM 8749  C CA   . LYS A 1 64 ? 9.155   8.038   -2.980  1.00 0.00 ? 73 LYS S CA   8  
ATOM 8750  C C    . LYS A 1 64 ? 8.095   8.829   -2.216  1.00 0.00 ? 73 LYS S C    8  
ATOM 8751  O O    . LYS A 1 64 ? 7.100   9.267   -2.794  1.00 0.00 ? 73 LYS S O    8  
ATOM 8752  C CB   . LYS A 1 64 ? 8.480   7.086   -3.969  1.00 0.00 ? 73 LYS S CB   8  
ATOM 8753  C CG   . LYS A 1 64 ? 8.019   7.768   -5.247  1.00 0.00 ? 73 LYS S CG   8  
ATOM 8754  C CD   . LYS A 1 64 ? 7.429   6.770   -6.233  1.00 0.00 ? 73 LYS S CD   8  
ATOM 8755  C CE   . LYS A 1 64 ? 6.031   7.175   -6.670  1.00 0.00 ? 73 LYS S CE   8  
ATOM 8756  N NZ   . LYS A 1 64 ? 5.275   6.028   -7.243  1.00 0.00 ? 73 LYS S NZ   8  
ATOM 8757  H H    . LYS A 1 64 ? 9.618   6.590   -1.504  1.00 0.00 ? 73 LYS S H    8  
ATOM 8758  H HA   . LYS A 1 64 ? 9.778   8.729   -3.527  1.00 0.00 ? 73 LYS S HA   8  
ATOM 8759  H HB2  . LYS A 1 64 ? 9.181   6.306   -4.235  1.00 0.00 ? 73 LYS S HB2  8  
ATOM 8760  H HB3  . LYS A 1 64 ? 7.618   6.641   -3.492  1.00 0.00 ? 73 LYS S HB3  8  
ATOM 8761  H HG2  . LYS A 1 64 ? 7.267   8.503   -5.000  1.00 0.00 ? 73 LYS S HG2  8  
ATOM 8762  H HG3  . LYS A 1 64 ? 8.864   8.258   -5.707  1.00 0.00 ? 73 LYS S HG3  8  
ATOM 8763  H HD2  . LYS A 1 64 ? 8.067   6.720   -7.103  1.00 0.00 ? 73 LYS S HD2  8  
ATOM 8764  H HD3  . LYS A 1 64 ? 7.384   5.798   -5.762  1.00 0.00 ? 73 LYS S HD3  8  
ATOM 8765  H HE2  . LYS A 1 64 ? 5.496   7.553   -5.812  1.00 0.00 ? 73 LYS S HE2  8  
ATOM 8766  H HE3  . LYS A 1 64 ? 6.111   7.952   -7.415  1.00 0.00 ? 73 LYS S HE3  8  
ATOM 8767  H HZ1  . LYS A 1 64 ? 4.877   5.443   -6.481  1.00 0.00 ? 73 LYS S HZ1  8  
ATOM 8768  H HZ2  . LYS A 1 64 ? 5.907   5.438   -7.823  1.00 0.00 ? 73 LYS S HZ2  8  
ATOM 8769  H HZ3  . LYS A 1 64 ? 4.499   6.374   -7.841  1.00 0.00 ? 73 LYS S HZ3  8  
ATOM 8770  N N    . GLY A 1 65 ? 8.316   9.011   -0.917  1.00 0.00 ? 74 GLY S N    8  
ATOM 8771  C CA   . GLY A 1 65 ? 7.374   9.750   -0.098  1.00 0.00 ? 74 GLY S CA   8  
ATOM 8772  C C    . GLY A 1 65 ? 6.027   9.065   0.018   1.00 0.00 ? 74 GLY S C    8  
ATOM 8773  O O    . GLY A 1 65 ? 5.055   9.674   0.465   1.00 0.00 ? 74 GLY S O    8  
ATOM 8774  H H    . GLY A 1 65 ? 9.126   8.641   -0.510  1.00 0.00 ? 74 GLY S H    8  
ATOM 8775  H HA2  . GLY A 1 65 ? 7.790   9.858   0.893   1.00 0.00 ? 74 GLY S HA2  8  
ATOM 8776  H HA3  . GLY A 1 65 ? 7.232   10.732  -0.530  1.00 0.00 ? 74 GLY S HA3  8  
ATOM 8777  N N    . LEU A 1 66 ? 5.965   7.796   -0.375  1.00 0.00 ? 75 LEU S N    8  
ATOM 8778  C CA   . LEU A 1 66 ? 4.723   7.038   -0.296  1.00 0.00 ? 75 LEU S CA   8  
ATOM 8779  C C    . LEU A 1 66 ? 4.152   7.087   1.114   1.00 0.00 ? 75 LEU S C    8  
ATOM 8780  O O    . LEU A 1 66 ? 3.407   8.003   1.460   1.00 0.00 ? 75 LEU S O    8  
ATOM 8781  C CB   . LEU A 1 66 ? 4.955   5.584   -0.709  1.00 0.00 ? 75 LEU S CB   8  
ATOM 8782  C CG   . LEU A 1 66 ? 5.064   5.356   -2.216  1.00 0.00 ? 75 LEU S CG   8  
ATOM 8783  C CD1  . LEU A 1 66 ? 5.914   4.132   -2.511  1.00 0.00 ? 75 LEU S CD1  8  
ATOM 8784  C CD2  . LEU A 1 66 ? 3.676   5.208   -2.829  1.00 0.00 ? 75 LEU S CD2  8  
ATOM 8785  H H    . LEU A 1 66 ? 6.771   7.358   -0.716  1.00 0.00 ? 75 LEU S H    8  
ATOM 8786  H HA   . LEU A 1 66 ? 4.015   7.488   -0.976  1.00 0.00 ? 75 LEU S HA   8  
ATOM 8787  H HB2  . LEU A 1 66 ? 5.867   5.235   -0.230  1.00 0.00 ? 75 LEU S HB2  8  
ATOM 8788  H HB3  . LEU A 1 66 ? 4.127   4.994   -0.339  1.00 0.00 ? 75 LEU S HB3  8  
ATOM 8789  H HG   . LEU A 1 66 ? 5.542   6.211   -2.670  1.00 0.00 ? 75 LEU S HG   8  
ATOM 8790  H HD11 . LEU A 1 66 ? 5.913   3.480   -1.650  1.00 0.00 ? 75 LEU S HD11 8  
ATOM 8791  H HD12 . LEU A 1 66 ? 6.925   4.439   -2.731  1.00 0.00 ? 75 LEU S HD12 8  
ATOM 8792  H HD13 . LEU A 1 66 ? 5.504   3.607   -3.360  1.00 0.00 ? 75 LEU S HD13 8  
ATOM 8793  H HD21 . LEU A 1 66 ? 3.716   5.458   -3.878  1.00 0.00 ? 75 LEU S HD21 8  
ATOM 8794  H HD22 . LEU A 1 66 ? 2.987   5.872   -2.327  1.00 0.00 ? 75 LEU S HD22 8  
ATOM 8795  H HD23 . LEU A 1 66 ? 3.340   4.189   -2.715  1.00 0.00 ? 75 LEU S HD23 8  
ATOM 8796  N N    . PHE A 1 67 ? 4.506   6.097   1.926   1.00 0.00 ? 76 PHE S N    8  
ATOM 8797  C CA   . PHE A 1 67 ? 4.021   6.039   3.296   1.00 0.00 ? 76 PHE S CA   8  
ATOM 8798  C C    . PHE A 1 67 ? 4.909   6.863   4.228   1.00 0.00 ? 76 PHE S C    8  
ATOM 8799  O O    . PHE A 1 67 ? 4.428   7.247   5.316   1.00 0.00 ? 76 PHE S O    8  
ATOM 8800  C CB   . PHE A 1 67 ? 3.911   4.580   3.763   1.00 0.00 ? 76 PHE S CB   8  
ATOM 8801  C CG   . PHE A 1 67 ? 4.932   4.176   4.780   1.00 0.00 ? 76 PHE S CG   8  
ATOM 8802  C CD1  . PHE A 1 67 ? 6.272   4.374   4.534   1.00 0.00 ? 76 PHE S CD1  8  
ATOM 8803  C CD2  . PHE A 1 67 ? 4.545   3.601   5.978   1.00 0.00 ? 76 PHE S CD2  8  
ATOM 8804  C CE1  . PHE A 1 67 ? 7.218   4.010   5.458   1.00 0.00 ? 76 PHE S CE1  8  
ATOM 8805  C CE2  . PHE A 1 67 ? 5.487   3.229   6.915   1.00 0.00 ? 76 PHE S CE2  8  
ATOM 8806  C CZ   . PHE A 1 67 ? 6.830   3.433   6.655   1.00 0.00 ? 76 PHE S CZ   8  
ATOM 8807  O OXT  . PHE A 1 67 ? 6.076   7.115   3.863   1.00 0.00 ? 76 PHE S OXT  8  
ATOM 8808  H H    . PHE A 1 67 ? 5.104   5.391   1.595   1.00 0.00 ? 76 PHE S H    8  
ATOM 8809  H HA   . PHE A 1 67 ? 3.043   6.470   3.301   1.00 0.00 ? 76 PHE S HA   8  
ATOM 8810  H HB2  . PHE A 1 67 ? 2.937   4.423   4.199   1.00 0.00 ? 76 PHE S HB2  8  
ATOM 8811  H HB3  . PHE A 1 67 ? 4.022   3.930   2.907   1.00 0.00 ? 76 PHE S HB3  8  
ATOM 8812  H HD1  . PHE A 1 67 ? 6.576   4.828   3.604   1.00 0.00 ? 76 PHE S HD1  8  
ATOM 8813  H HD2  . PHE A 1 67 ? 3.497   3.442   6.175   1.00 0.00 ? 76 PHE S HD2  8  
ATOM 8814  H HE1  . PHE A 1 67 ? 8.259   4.173   5.240   1.00 0.00 ? 76 PHE S HE1  8  
ATOM 8815  H HE2  . PHE A 1 67 ? 5.172   2.783   7.849   1.00 0.00 ? 76 PHE S HE2  8  
ATOM 8816  H HZ   . PHE A 1 67 ? 7.573   3.146   7.384   1.00 0.00 ? 76 PHE S HZ   8  
ATOM 8817  N N    . MET A 1 1  ? -17.541 -17.099 0.224   1.00 0.00 ? 10 MET S N    9  
ATOM 8818  C CA   . MET A 1 1  ? -16.581 -16.175 0.882   1.00 0.00 ? 10 MET S CA   9  
ATOM 8819  C C    . MET A 1 1  ? -15.144 -16.505 0.491   1.00 0.00 ? 10 MET S C    9  
ATOM 8820  O O    . MET A 1 1  ? -14.426 -15.660 -0.045  1.00 0.00 ? 10 MET S O    9  
ATOM 8821  C CB   . MET A 1 1  ? -16.756 -16.288 2.397   1.00 0.00 ? 10 MET S CB   9  
ATOM 8822  C CG   . MET A 1 1  ? -16.678 -14.953 3.121   1.00 0.00 ? 10 MET S CG   9  
ATOM 8823  S SD   . MET A 1 1  ? -17.807 -14.855 4.522   1.00 0.00 ? 10 MET S SD   9  
ATOM 8824  C CE   . MET A 1 1  ? -17.655 -13.125 4.958   1.00 0.00 ? 10 MET S CE   9  
ATOM 8825  H H1   . MET A 1 1  ? -18.458 -17.000 0.705   1.00 0.00 ? 10 MET S H1   9  
ATOM 8826  H H2   . MET A 1 1  ? -17.168 -18.067 0.323   1.00 0.00 ? 10 MET S H2   9  
ATOM 8827  H H3   . MET A 1 1  ? -17.613 -16.824 -0.776  1.00 0.00 ? 10 MET S H3   9  
ATOM 8828  H HA   . MET A 1 1  ? -16.808 -15.166 0.572   1.00 0.00 ? 10 MET S HA   9  
ATOM 8829  H HB2  . MET A 1 1  ? -17.720 -16.729 2.604   1.00 0.00 ? 10 MET S HB2  9  
ATOM 8830  H HB3  . MET A 1 1  ? -15.984 -16.933 2.791   1.00 0.00 ? 10 MET S HB3  9  
ATOM 8831  H HG2  . MET A 1 1  ? -15.669 -14.813 3.479   1.00 0.00 ? 10 MET S HG2  9  
ATOM 8832  H HG3  . MET A 1 1  ? -16.923 -14.166 2.422   1.00 0.00 ? 10 MET S HG3  9  
ATOM 8833  H HE1  . MET A 1 1  ? -18.634 -12.716 5.157   1.00 0.00 ? 10 MET S HE1  9  
ATOM 8834  H HE2  . MET A 1 1  ? -17.199 -12.586 4.141   1.00 0.00 ? 10 MET S HE2  9  
ATOM 8835  H HE3  . MET A 1 1  ? -17.040 -13.028 5.840   1.00 0.00 ? 10 MET S HE3  9  
ATOM 8836  N N    . LEU A 1 2  ? -14.729 -17.739 0.764   1.00 0.00 ? 11 LEU S N    9  
ATOM 8837  C CA   . LEU A 1 2  ? -13.376 -18.178 0.441   1.00 0.00 ? 11 LEU S CA   9  
ATOM 8838  C C    . LEU A 1 2  ? -13.225 -18.415 -1.059  1.00 0.00 ? 11 LEU S C    9  
ATOM 8839  O O    . LEU A 1 2  ? -12.199 -18.078 -1.649  1.00 0.00 ? 11 LEU S O    9  
ATOM 8840  C CB   . LEU A 1 2  ? -13.037 -19.458 1.208   1.00 0.00 ? 11 LEU S CB   9  
ATOM 8841  C CG   . LEU A 1 2  ? -12.949 -19.300 2.727   1.00 0.00 ? 11 LEU S CG   9  
ATOM 8842  C CD1  . LEU A 1 2  ? -12.814 -20.656 3.398   1.00 0.00 ? 11 LEU S CD1  9  
ATOM 8843  C CD2  . LEU A 1 2  ? -11.781 -18.399 3.100   1.00 0.00 ? 11 LEU S CD2  9  
ATOM 8844  H H    . LEU A 1 2  ? -15.347 -18.366 1.193   1.00 0.00 ? 11 LEU S H    9  
ATOM 8845  H HA   . LEU A 1 2  ? -12.694 -17.398 0.742   1.00 0.00 ? 11 LEU S HA   9  
ATOM 8846  H HB2  . LEU A 1 2  ? -13.794 -20.196 0.987   1.00 0.00 ? 11 LEU S HB2  9  
ATOM 8847  H HB3  . LEU A 1 2  ? -12.087 -19.824 0.852   1.00 0.00 ? 11 LEU S HB3  9  
ATOM 8848  H HG   . LEU A 1 2  ? -13.857 -18.838 3.087   1.00 0.00 ? 11 LEU S HG   9  
ATOM 8849  H HD11 . LEU A 1 2  ? -13.366 -20.656 4.326   1.00 0.00 ? 11 LEU S HD11 9  
ATOM 8850  H HD12 . LEU A 1 2  ? -11.771 -20.856 3.600   1.00 0.00 ? 11 LEU S HD12 9  
ATOM 8851  H HD13 . LEU A 1 2  ? -13.207 -21.422 2.745   1.00 0.00 ? 11 LEU S HD13 9  
ATOM 8852  H HD21 . LEU A 1 2  ? -11.969 -17.398 2.739   1.00 0.00 ? 11 LEU S HD21 9  
ATOM 8853  H HD22 . LEU A 1 2  ? -10.875 -18.780 2.653   1.00 0.00 ? 11 LEU S HD22 9  
ATOM 8854  H HD23 . LEU A 1 2  ? -11.671 -18.379 4.175   1.00 0.00 ? 11 LEU S HD23 9  
ATOM 8855  N N    . ALA A 1 3  ? -14.253 -18.998 -1.668  1.00 0.00 ? 12 ALA S N    9  
ATOM 8856  C CA   . ALA A 1 3  ? -14.233 -19.280 -3.098  1.00 0.00 ? 12 ALA S CA   9  
ATOM 8857  C C    . ALA A 1 3  ? -14.231 -17.991 -3.911  1.00 0.00 ? 12 ALA S C    9  
ATOM 8858  O O    . ALA A 1 3  ? -13.599 -17.912 -4.965  1.00 0.00 ? 12 ALA S O    9  
ATOM 8859  C CB   . ALA A 1 3  ? -15.424 -20.146 -3.480  1.00 0.00 ? 12 ALA S CB   9  
ATOM 8860  H H    . ALA A 1 3  ? -15.042 -19.244 -1.142  1.00 0.00 ? 12 ALA S H    9  
ATOM 8861  H HA   . ALA A 1 3  ? -13.331 -19.833 -3.316  1.00 0.00 ? 12 ALA S HA   9  
ATOM 8862  H HB1  . ALA A 1 3  ? -15.568 -20.106 -4.550  1.00 0.00 ? 12 ALA S HB1  9  
ATOM 8863  H HB2  . ALA A 1 3  ? -16.310 -19.779 -2.984  1.00 0.00 ? 12 ALA S HB2  9  
ATOM 8864  H HB3  . ALA A 1 3  ? -15.239 -21.166 -3.178  1.00 0.00 ? 12 ALA S HB3  9  
ATOM 8865  N N    . LYS A 1 4  ? -14.939 -16.981 -3.416  1.00 0.00 ? 13 LYS S N    9  
ATOM 8866  C CA   . LYS A 1 4  ? -15.019 -15.695 -4.098  1.00 0.00 ? 13 LYS S CA   9  
ATOM 8867  C C    . LYS A 1 4  ? -13.704 -14.931 -3.970  1.00 0.00 ? 13 LYS S C    9  
ATOM 8868  O O    . LYS A 1 4  ? -12.994 -15.059 -2.972  1.00 0.00 ? 13 LYS S O    9  
ATOM 8869  C CB   . LYS A 1 4  ? -16.165 -14.859 -3.525  1.00 0.00 ? 13 LYS S CB   9  
ATOM 8870  C CG   . LYS A 1 4  ? -17.519 -15.545 -3.616  1.00 0.00 ? 13 LYS S CG   9  
ATOM 8871  C CD   . LYS A 1 4  ? -18.583 -14.613 -4.174  1.00 0.00 ? 13 LYS S CD   9  
ATOM 8872  C CE   . LYS A 1 4  ? -19.848 -15.370 -4.546  1.00 0.00 ? 13 LYS S CE   9  
ATOM 8873  N NZ   . LYS A 1 4  ? -20.985 -14.448 -4.821  1.00 0.00 ? 13 LYS S NZ   9  
ATOM 8874  H H    . LYS A 1 4  ? -15.420 -17.105 -2.571  1.00 0.00 ? 13 LYS S H    9  
ATOM 8875  H HA   . LYS A 1 4  ? -15.209 -15.884 -5.143  1.00 0.00 ? 13 LYS S HA   9  
ATOM 8876  H HB2  . LYS A 1 4  ? -15.960 -14.652 -2.486  1.00 0.00 ? 13 LYS S HB2  9  
ATOM 8877  H HB3  . LYS A 1 4  ? -16.219 -13.926 -4.065  1.00 0.00 ? 13 LYS S HB3  9  
ATOM 8878  H HG2  . LYS A 1 4  ? -17.434 -16.404 -4.264  1.00 0.00 ? 13 LYS S HG2  9  
ATOM 8879  H HG3  . LYS A 1 4  ? -17.816 -15.865 -2.627  1.00 0.00 ? 13 LYS S HG3  9  
ATOM 8880  H HD2  . LYS A 1 4  ? -18.826 -13.872 -3.427  1.00 0.00 ? 13 LYS S HD2  9  
ATOM 8881  H HD3  . LYS A 1 4  ? -18.194 -14.125 -5.055  1.00 0.00 ? 13 LYS S HD3  9  
ATOM 8882  H HE2  . LYS A 1 4  ? -19.653 -15.960 -5.429  1.00 0.00 ? 13 LYS S HE2  9  
ATOM 8883  H HE3  . LYS A 1 4  ? -20.114 -16.023 -3.729  1.00 0.00 ? 13 LYS S HE3  9  
ATOM 8884  H HZ1  . LYS A 1 4  ? -21.755 -14.963 -5.295  1.00 0.00 ? 13 LYS S HZ1  9  
ATOM 8885  H HZ2  . LYS A 1 4  ? -20.674 -13.669 -5.435  1.00 0.00 ? 13 LYS S HZ2  9  
ATOM 8886  H HZ3  . LYS A 1 4  ? -21.346 -14.050 -3.931  1.00 0.00 ? 13 LYS S HZ3  9  
ATOM 8887  N N    . LEU A 1 5  ? -13.383 -14.137 -4.988  1.00 0.00 ? 14 LEU S N    9  
ATOM 8888  C CA   . LEU A 1 5  ? -12.153 -13.355 -4.988  1.00 0.00 ? 14 LEU S CA   9  
ATOM 8889  C C    . LEU A 1 5  ? -12.427 -11.909 -5.392  1.00 0.00 ? 14 LEU S C    9  
ATOM 8890  O O    . LEU A 1 5  ? -12.671 -11.616 -6.562  1.00 0.00 ? 14 LEU S O    9  
ATOM 8891  C CB   . LEU A 1 5  ? -11.130 -13.977 -5.941  1.00 0.00 ? 14 LEU S CB   9  
ATOM 8892  C CG   . LEU A 1 5  ? -10.645 -15.374 -5.547  1.00 0.00 ? 14 LEU S CG   9  
ATOM 8893  C CD1  . LEU A 1 5  ? -9.641  -15.895 -6.564  1.00 0.00 ? 14 LEU S CD1  9  
ATOM 8894  C CD2  . LEU A 1 5  ? -10.033 -15.352 -4.154  1.00 0.00 ? 14 LEU S CD2  9  
ATOM 8895  H H    . LEU A 1 5  ? -13.989 -14.079 -5.756  1.00 0.00 ? 14 LEU S H    9  
ATOM 8896  H HA   . LEU A 1 5  ? -11.753 -13.367 -3.986  1.00 0.00 ? 14 LEU S HA   9  
ATOM 8897  H HB2  . LEU A 1 5  ? -11.573 -14.035 -6.923  1.00 0.00 ? 14 LEU S HB2  9  
ATOM 8898  H HB3  . LEU A 1 5  ? -10.271 -13.323 -5.988  1.00 0.00 ? 14 LEU S HB3  9  
ATOM 8899  H HG   . LEU A 1 5  ? -11.488 -16.049 -5.533  1.00 0.00 ? 14 LEU S HG   9  
ATOM 8900  H HD11 . LEU A 1 5  ? -9.143  -15.064 -7.038  1.00 0.00 ? 14 LEU S HD11 9  
ATOM 8901  H HD12 . LEU A 1 5  ? -10.157 -16.479 -7.311  1.00 0.00 ? 14 LEU S HD12 9  
ATOM 8902  H HD13 . LEU A 1 5  ? -8.911  -16.515 -6.064  1.00 0.00 ? 14 LEU S HD13 9  
ATOM 8903  H HD21 . LEU A 1 5  ? -9.463  -14.443 -4.026  1.00 0.00 ? 14 LEU S HD21 9  
ATOM 8904  H HD22 . LEU A 1 5  ? -9.383  -16.205 -4.034  1.00 0.00 ? 14 LEU S HD22 9  
ATOM 8905  H HD23 . LEU A 1 5  ? -10.820 -15.390 -3.416  1.00 0.00 ? 14 LEU S HD23 9  
ATOM 8906  N N    . CYS A 1 6  ? -12.380 -11.009 -4.415  1.00 0.00 ? 15 CYS S N    9  
ATOM 8907  C CA   . CYS A 1 6  ? -12.619 -9.593  -4.665  1.00 0.00 ? 15 CYS S CA   9  
ATOM 8908  C C    . CYS A 1 6  ? -11.380 -8.768  -4.334  1.00 0.00 ? 15 CYS S C    9  
ATOM 8909  O O    . CYS A 1 6  ? -10.724 -8.997  -3.319  1.00 0.00 ? 15 CYS S O    9  
ATOM 8910  C CB   . CYS A 1 6  ? -13.809 -9.100  -3.840  1.00 0.00 ? 15 CYS S CB   9  
ATOM 8911  S SG   . CYS A 1 6  ? -14.353 -7.426  -4.255  1.00 0.00 ? 15 CYS S SG   9  
ATOM 8912  H H    . CYS A 1 6  ? -12.177 -11.304 -3.502  1.00 0.00 ? 15 CYS S H    9  
ATOM 8913  H HA   . CYS A 1 6  ? -12.846 -9.475  -5.715  1.00 0.00 ? 15 CYS S HA   9  
ATOM 8914  H HB2  . CYS A 1 6  ? -14.646 -9.764  -3.996  1.00 0.00 ? 15 CYS S HB2  9  
ATOM 8915  H HB3  . CYS A 1 6  ? -13.540 -9.109  -2.794  1.00 0.00 ? 15 CYS S HB3  9  
ATOM 8916  H HG   . CYS A 1 6  ? -13.582 -6.854  -4.251  1.00 0.00 ? 15 CYS S HG   9  
ATOM 8917  N N    . LYS A 1 7  ? -11.062 -7.809  -5.199  1.00 0.00 ? 16 LYS S N    9  
ATOM 8918  C CA   . LYS A 1 7  ? -9.899  -6.955  -4.993  1.00 0.00 ? 16 LYS S CA   9  
ATOM 8919  C C    . LYS A 1 7  ? -10.237 -5.490  -5.257  1.00 0.00 ? 16 LYS S C    9  
ATOM 8920  O O    . LYS A 1 7  ? -10.465 -5.090  -6.398  1.00 0.00 ? 16 LYS S O    9  
ATOM 8921  C CB   . LYS A 1 7  ? -8.751  -7.397  -5.904  1.00 0.00 ? 16 LYS S CB   9  
ATOM 8922  C CG   . LYS A 1 7  ? -8.104  -8.702  -5.474  1.00 0.00 ? 16 LYS S CG   9  
ATOM 8923  C CD   . LYS A 1 7  ? -6.996  -8.468  -4.459  1.00 0.00 ? 16 LYS S CD   9  
ATOM 8924  C CE   . LYS A 1 7  ? -6.679  -9.732  -3.677  1.00 0.00 ? 16 LYS S CE   9  
ATOM 8925  N NZ   . LYS A 1 7  ? -5.469  -10.423 -4.202  1.00 0.00 ? 16 LYS S NZ   9  
ATOM 8926  H H    . LYS A 1 7  ? -11.623 -7.674  -5.992  1.00 0.00 ? 16 LYS S H    9  
ATOM 8927  H HA   . LYS A 1 7  ? -9.589  -7.059  -3.965  1.00 0.00 ? 16 LYS S HA   9  
ATOM 8928  H HB2  . LYS A 1 7  ? -9.130  -7.520  -6.907  1.00 0.00 ? 16 LYS S HB2  9  
ATOM 8929  H HB3  . LYS A 1 7  ? -7.993  -6.627  -5.907  1.00 0.00 ? 16 LYS S HB3  9  
ATOM 8930  H HG2  . LYS A 1 7  ? -8.855  -9.337  -5.031  1.00 0.00 ? 16 LYS S HG2  9  
ATOM 8931  H HG3  . LYS A 1 7  ? -7.685  -9.188  -6.344  1.00 0.00 ? 16 LYS S HG3  9  
ATOM 8932  H HD2  . LYS A 1 7  ? -6.107  -8.146  -4.979  1.00 0.00 ? 16 LYS S HD2  9  
ATOM 8933  H HD3  . LYS A 1 7  ? -7.311  -7.697  -3.770  1.00 0.00 ? 16 LYS S HD3  9  
ATOM 8934  H HE2  . LYS A 1 7  ? -6.513  -9.467  -2.644  1.00 0.00 ? 16 LYS S HE2  9  
ATOM 8935  H HE3  . LYS A 1 7  ? -7.525  -10.402 -3.744  1.00 0.00 ? 16 LYS S HE3  9  
ATOM 8936  H HZ1  . LYS A 1 7  ? -4.815  -9.730  -4.618  1.00 0.00 ? 16 LYS S HZ1  9  
ATOM 8937  H HZ2  . LYS A 1 7  ? -5.740  -11.111 -4.933  1.00 0.00 ? 16 LYS S HZ2  9  
ATOM 8938  H HZ3  . LYS A 1 7  ? -4.982  -10.925 -3.432  1.00 0.00 ? 16 LYS S HZ3  9  
ATOM 8939  N N    . THR A 1 8  ? -10.261 -4.695  -4.191  1.00 0.00 ? 17 THR S N    9  
ATOM 8940  C CA   . THR A 1 8  ? -10.564 -3.272  -4.301  1.00 0.00 ? 17 THR S CA   9  
ATOM 8941  C C    . THR A 1 8  ? -9.602  -2.455  -3.445  1.00 0.00 ? 17 THR S C    9  
ATOM 8942  O O    . THR A 1 8  ? -9.648  -2.514  -2.216  1.00 0.00 ? 17 THR S O    9  
ATOM 8943  C CB   . THR A 1 8  ? -12.006 -3.000  -3.875  1.00 0.00 ? 17 THR S CB   9  
ATOM 8944  O OG1  . THR A 1 8  ? -12.910 -3.789  -4.631  1.00 0.00 ? 17 THR S OG1  9  
ATOM 8945  C CG2  . THR A 1 8  ? -12.416 -1.552  -4.037  1.00 0.00 ? 17 THR S CG2  9  
ATOM 8946  H H    . THR A 1 8  ? -10.066 -5.074  -3.309  1.00 0.00 ? 17 THR S H    9  
ATOM 8947  H HA   . THR A 1 8  ? -10.440 -2.987  -5.336  1.00 0.00 ? 17 THR S HA   9  
ATOM 8948  H HB   . THR A 1 8  ? -12.118 -3.261  -2.832  1.00 0.00 ? 17 THR S HB   9  
ATOM 8949  H HG1  . THR A 1 8  ? -13.585 -4.149  -4.049  1.00 0.00 ? 17 THR S HG1  9  
ATOM 8950  H HG21 . THR A 1 8  ? -11.647 -0.913  -3.630  1.00 0.00 ? 17 THR S HG21 9  
ATOM 8951  H HG22 . THR A 1 8  ? -13.343 -1.380  -3.511  1.00 0.00 ? 17 THR S HG22 9  
ATOM 8952  H HG23 . THR A 1 8  ? -12.550 -1.332  -5.086  1.00 0.00 ? 17 THR S HG23 9  
ATOM 8953  N N    . ILE A 1 9  ? -8.726  -1.700  -4.101  1.00 0.00 ? 18 ILE S N    9  
ATOM 8954  C CA   . ILE A 1 9  ? -7.745  -0.882  -3.399  1.00 0.00 ? 18 ILE S CA   9  
ATOM 8955  C C    . ILE A 1 9  ? -7.987  0.609   -3.644  1.00 0.00 ? 18 ILE S C    9  
ATOM 8956  O O    . ILE A 1 9  ? -8.710  0.986   -4.568  1.00 0.00 ? 18 ILE S O    9  
ATOM 8957  C CB   . ILE A 1 9  ? -6.312  -1.272  -3.831  1.00 0.00 ? 18 ILE S CB   9  
ATOM 8958  C CG1  . ILE A 1 9  ? -5.356  -1.176  -2.644  1.00 0.00 ? 18 ILE S CG1  9  
ATOM 8959  C CG2  . ILE A 1 9  ? -5.824  -0.412  -4.993  1.00 0.00 ? 18 ILE S CG2  9  
ATOM 8960  C CD1  . ILE A 1 9  ? -5.569  -2.259  -1.609  1.00 0.00 ? 18 ILE S CD1  9  
ATOM 8961  H H    . ILE A 1 9  ? -8.730  -1.702  -5.080  1.00 0.00 ? 18 ILE S H    9  
ATOM 8962  H HA   . ILE A 1 9  ? -7.845  -1.081  -2.342  1.00 0.00 ? 18 ILE S HA   9  
ATOM 8963  H HB   . ILE A 1 9  ? -6.338  -2.296  -4.172  1.00 0.00 ? 18 ILE S HB   9  
ATOM 8964  H HG12 . ILE A 1 9  ? -4.342  -1.257  -3.000  1.00 0.00 ? 18 ILE S HG12 9  
ATOM 8965  H HG13 . ILE A 1 9  ? -5.488  -0.223  -2.158  1.00 0.00 ? 18 ILE S HG13 9  
ATOM 8966  H HG21 . ILE A 1 9  ? -5.179  -0.999  -5.630  1.00 0.00 ? 18 ILE S HG21 9  
ATOM 8967  H HG22 . ILE A 1 9  ? -5.273  0.435   -4.609  1.00 0.00 ? 18 ILE S HG22 9  
ATOM 8968  H HG23 . ILE A 1 9  ? -6.670  -0.061  -5.565  1.00 0.00 ? 18 ILE S HG23 9  
ATOM 8969  H HD11 . ILE A 1 9  ? -4.625  -2.731  -1.379  1.00 0.00 ? 18 ILE S HD11 9  
ATOM 8970  H HD12 . ILE A 1 9  ? -6.256  -2.998  -1.995  1.00 0.00 ? 18 ILE S HD12 9  
ATOM 8971  H HD13 . ILE A 1 9  ? -5.980  -1.822  -0.709  1.00 0.00 ? 18 ILE S HD13 9  
ATOM 8972  N N    . TYR A 1 10 ? -7.378  1.456   -2.815  1.00 0.00 ? 19 TYR S N    9  
ATOM 8973  C CA   . TYR A 1 10 ? -7.529  2.901   -2.951  1.00 0.00 ? 19 TYR S CA   9  
ATOM 8974  C C    . TYR A 1 10 ? -6.443  3.460   -3.882  1.00 0.00 ? 19 TYR S C    9  
ATOM 8975  O O    . TYR A 1 10 ? -5.255  3.213   -3.676  1.00 0.00 ? 19 TYR S O    9  
ATOM 8976  C CB   . TYR A 1 10 ? -7.476  3.572   -1.566  1.00 0.00 ? 19 TYR S CB   9  
ATOM 8977  C CG   . TYR A 1 10 ? -8.609  3.154   -0.633  1.00 0.00 ? 19 TYR S CG   9  
ATOM 8978  C CD1  . TYR A 1 10 ? -9.551  2.207   -1.032  1.00 0.00 ? 19 TYR S CD1  9  
ATOM 8979  C CD2  . TYR A 1 10 ? -8.743  3.704   0.647   1.00 0.00 ? 19 TYR S CD2  9  
ATOM 8980  C CE1  . TYR A 1 10 ? -10.582 1.824   -0.194  1.00 0.00 ? 19 TYR S CE1  9  
ATOM 8981  C CE2  . TYR A 1 10 ? -9.773  3.320   1.482   1.00 0.00 ? 19 TYR S CE2  9  
ATOM 8982  C CZ   . TYR A 1 10 ? -10.687 2.383   1.059   1.00 0.00 ? 19 TYR S CZ   9  
ATOM 8983  O OH   . TYR A 1 10 ? -11.713 2.002   1.894   1.00 0.00 ? 19 TYR S OH   9  
ATOM 8984  H H    . TYR A 1 10 ? -6.814  1.099   -2.098  1.00 0.00 ? 19 TYR S H    9  
ATOM 8985  H HA   . TYR A 1 10 ? -8.496  3.085   -3.392  1.00 0.00 ? 19 TYR S HA   9  
ATOM 8986  H HB2  . TYR A 1 10 ? -6.541  3.316   -1.085  1.00 0.00 ? 19 TYR S HB2  9  
ATOM 8987  H HB3  . TYR A 1 10 ? -7.530  4.645   -1.692  1.00 0.00 ? 19 TYR S HB3  9  
ATOM 8988  H HD1  . TYR A 1 10 ? -9.472  1.767   -2.013  1.00 0.00 ? 19 TYR S HD1  9  
ATOM 8989  H HD2  . TYR A 1 10 ? -8.033  4.443   0.994   1.00 0.00 ? 19 TYR S HD2  9  
ATOM 8990  H HE1  . TYR A 1 10 ? -11.299 1.088   -0.526  1.00 0.00 ? 19 TYR S HE1  9  
ATOM 8991  H HE2  . TYR A 1 10 ? -9.856  3.759   2.463   1.00 0.00 ? 19 TYR S HE2  9  
ATOM 8992  H HH   . TYR A 1 10 ? -11.793 1.044   1.889   1.00 0.00 ? 19 TYR S HH   9  
ATOM 8993  N N    . PRO A 1 11 ? -6.842  4.199   -4.943  1.00 0.00 ? 20 PRO S N    9  
ATOM 8994  C CA   . PRO A 1 11 ? -5.910  4.769   -5.928  1.00 0.00 ? 20 PRO S CA   9  
ATOM 8995  C C    . PRO A 1 11 ? -4.669  5.404   -5.301  1.00 0.00 ? 20 PRO S C    9  
ATOM 8996  O O    . PRO A 1 11 ? -4.764  6.158   -4.335  1.00 0.00 ? 20 PRO S O    9  
ATOM 8997  C CB   . PRO A 1 11 ? -6.746  5.832   -6.661  1.00 0.00 ? 20 PRO S CB   9  
ATOM 8998  C CG   . PRO A 1 11 ? -8.097  5.827   -6.014  1.00 0.00 ? 20 PRO S CG   9  
ATOM 8999  C CD   . PRO A 1 11 ? -8.230  4.520   -5.288  1.00 0.00 ? 20 PRO S CD   9  
ATOM 9000  H HA   . PRO A 1 11 ? -5.594  4.017   -6.636  1.00 0.00 ? 20 PRO S HA   9  
ATOM 9001  H HB2  . PRO A 1 11 ? -6.269  6.798   -6.559  1.00 0.00 ? 20 PRO S HB2  9  
ATOM 9002  H HB3  . PRO A 1 11 ? -6.815  5.571   -7.709  1.00 0.00 ? 20 PRO S HB3  9  
ATOM 9003  H HG2  . PRO A 1 11 ? -8.169  6.648   -5.317  1.00 0.00 ? 20 PRO S HG2  9  
ATOM 9004  H HG3  . PRO A 1 11 ? -8.863  5.914   -6.770  1.00 0.00 ? 20 PRO S HG3  9  
ATOM 9005  H HD2  . PRO A 1 11 ? -8.833  4.643   -4.399  1.00 0.00 ? 20 PRO S HD2  9  
ATOM 9006  H HD3  . PRO A 1 11 ? -8.652  3.766   -5.937  1.00 0.00 ? 20 PRO S HD3  9  
ATOM 9007  N N    . LEU A 1 12 ? -3.505  5.088   -5.871  1.00 0.00 ? 21 LEU S N    9  
ATOM 9008  C CA   . LEU A 1 12 ? -2.227  5.611   -5.386  1.00 0.00 ? 21 LEU S CA   9  
ATOM 9009  C C    . LEU A 1 12 ? -2.259  7.126   -5.201  1.00 0.00 ? 21 LEU S C    9  
ATOM 9010  O O    . LEU A 1 12 ? -1.740  7.640   -4.217  1.00 0.00 ? 21 LEU S O    9  
ATOM 9011  C CB   . LEU A 1 12 ? -1.095  5.235   -6.341  1.00 0.00 ? 21 LEU S CB   9  
ATOM 9012  C CG   . LEU A 1 12 ? -1.158  5.886   -7.727  1.00 0.00 ? 21 LEU S CG   9  
ATOM 9013  C CD1  . LEU A 1 12 ? -0.168  7.036   -7.821  1.00 0.00 ? 21 LEU S CD1  9  
ATOM 9014  C CD2  . LEU A 1 12 ? -0.882  4.856   -8.812  1.00 0.00 ? 21 LEU S CD2  9  
ATOM 9015  H H    . LEU A 1 12 ? -3.501  4.479   -6.637  1.00 0.00 ? 21 LEU S H    9  
ATOM 9016  H HA   . LEU A 1 12 ? -2.034  5.155   -4.428  1.00 0.00 ? 21 LEU S HA   9  
ATOM 9017  H HB2  . LEU A 1 12 ? -0.160  5.517   -5.877  1.00 0.00 ? 21 LEU S HB2  9  
ATOM 9018  H HB3  . LEU A 1 12 ? -1.106  4.165   -6.473  1.00 0.00 ? 21 LEU S HB3  9  
ATOM 9019  H HG   . LEU A 1 12 ? -2.149  6.284   -7.888  1.00 0.00 ? 21 LEU S HG   9  
ATOM 9020  H HD11 . LEU A 1 12 ? -0.303  7.552   -8.761  1.00 0.00 ? 21 LEU S HD11 9  
ATOM 9021  H HD12 . LEU A 1 12 ? 0.839   6.649   -7.765  1.00 0.00 ? 21 LEU S HD12 9  
ATOM 9022  H HD13 . LEU A 1 12 ? -0.336  7.723   -7.006  1.00 0.00 ? 21 LEU S HD13 9  
ATOM 9023  H HD21 . LEU A 1 12 ? -0.252  4.075   -8.416  1.00 0.00 ? 21 LEU S HD21 9  
ATOM 9024  H HD22 . LEU A 1 12 ? -0.385  5.333   -9.645  1.00 0.00 ? 21 LEU S HD22 9  
ATOM 9025  H HD23 . LEU A 1 12 ? -1.816  4.429   -9.149  1.00 0.00 ? 21 LEU S HD23 9  
ATOM 9026  N N    . ALA A 1 13 ? -2.863  7.842   -6.143  1.00 0.00 ? 22 ALA S N    9  
ATOM 9027  C CA   . ALA A 1 13 ? -2.940  9.293   -6.041  1.00 0.00 ? 22 ALA S CA   9  
ATOM 9028  C C    . ALA A 1 13 ? -3.803  9.683   -4.856  1.00 0.00 ? 22 ALA S C    9  
ATOM 9029  O O    . ALA A 1 13 ? -3.442  10.554  -4.065  1.00 0.00 ? 22 ALA S O    9  
ATOM 9030  C CB   . ALA A 1 13 ? -3.489  9.893   -7.327  1.00 0.00 ? 22 ALA S CB   9  
ATOM 9031  H H    . ALA A 1 13 ? -3.267  7.390   -6.912  1.00 0.00 ? 22 ALA S H    9  
ATOM 9032  H HA   . ALA A 1 13 ? -1.941  9.676   -5.880  1.00 0.00 ? 22 ALA S HA   9  
ATOM 9033  H HB1  . ALA A 1 13 ? -4.567  9.828   -7.323  1.00 0.00 ? 22 ALA S HB1  9  
ATOM 9034  H HB2  . ALA A 1 13 ? -3.098  9.349   -8.173  1.00 0.00 ? 22 ALA S HB2  9  
ATOM 9035  H HB3  . ALA A 1 13 ? -3.192  10.929  -7.396  1.00 0.00 ? 22 ALA S HB3  9  
ATOM 9036  N N    . ASP A 1 14 ? -4.943  9.011   -4.731  1.00 0.00 ? 23 ASP S N    9  
ATOM 9037  C CA   . ASP A 1 14 ? -5.870  9.257   -3.636  1.00 0.00 ? 23 ASP S CA   9  
ATOM 9038  C C    . ASP A 1 14 ? -5.137  9.327   -2.298  1.00 0.00 ? 23 ASP S C    9  
ATOM 9039  O O    . ASP A 1 14 ? -5.603  9.974   -1.366  1.00 0.00 ? 23 ASP S O    9  
ATOM 9040  C CB   . ASP A 1 14 ? -6.930  8.154   -3.589  1.00 0.00 ? 23 ASP S CB   9  
ATOM 9041  C CG   . ASP A 1 14 ? -8.326  8.683   -3.856  1.00 0.00 ? 23 ASP S CG   9  
ATOM 9042  O OD1  . ASP A 1 14 ? -8.702  8.795   -5.041  1.00 0.00 ? 23 ASP S OD1  9  
ATOM 9043  O OD2  . ASP A 1 14 ? -9.042  8.984   -2.878  1.00 0.00 ? 23 ASP S OD2  9  
ATOM 9044  H H    . ASP A 1 14 ? -5.161  8.325   -5.391  1.00 0.00 ? 23 ASP S H    9  
ATOM 9045  H HA   . ASP A 1 14 ? -6.353  10.196  -3.820  1.00 0.00 ? 23 ASP S HA   9  
ATOM 9046  H HB2  . ASP A 1 14 ? -6.697  7.411   -4.338  1.00 0.00 ? 23 ASP S HB2  9  
ATOM 9047  H HB3  . ASP A 1 14 ? -6.918  7.692   -2.611  1.00 0.00 ? 23 ASP S HB3  9  
ATOM 9048  N N    . LEU A 1 15 ? -3.997  8.648   -2.215  1.00 0.00 ? 24 LEU S N    9  
ATOM 9049  C CA   . LEU A 1 15 ? -3.203  8.619   -0.986  1.00 0.00 ? 24 LEU S CA   9  
ATOM 9050  C C    . LEU A 1 15 ? -1.865  9.317   -1.170  1.00 0.00 ? 24 LEU S C    9  
ATOM 9051  O O    . LEU A 1 15 ? -1.289  9.837   -0.213  1.00 0.00 ? 24 LEU S O    9  
ATOM 9052  C CB   . LEU A 1 15 ? -2.947  7.174   -0.562  1.00 0.00 ? 24 LEU S CB   9  
ATOM 9053  C CG   . LEU A 1 15 ? -2.815  6.181   -1.721  1.00 0.00 ? 24 LEU S CG   9  
ATOM 9054  C CD1  . LEU A 1 15 ? -1.625  5.254   -1.530  1.00 0.00 ? 24 LEU S CD1  9  
ATOM 9055  C CD2  . LEU A 1 15 ? -4.100  5.395   -1.871  1.00 0.00 ? 24 LEU S CD2  9  
ATOM 9056  H H    . LEU A 1 15 ? -3.684  8.144   -2.995  1.00 0.00 ? 24 LEU S H    9  
ATOM 9057  H HA   . LEU A 1 15 ? -3.761  9.121   -0.211  1.00 0.00 ? 24 LEU S HA   9  
ATOM 9058  H HB2  . LEU A 1 15 ? -2.034  7.148   0.014   1.00 0.00 ? 24 LEU S HB2  9  
ATOM 9059  H HB3  . LEU A 1 15 ? -3.762  6.855   0.068   1.00 0.00 ? 24 LEU S HB3  9  
ATOM 9060  H HG   . LEU A 1 15 ? -2.655  6.728   -2.633  1.00 0.00 ? 24 LEU S HG   9  
ATOM 9061  H HD11 . LEU A 1 15 ? -1.116  5.121   -2.473  1.00 0.00 ? 24 LEU S HD11 9  
ATOM 9062  H HD12 . LEU A 1 15 ? -1.969  4.296   -1.169  1.00 0.00 ? 24 LEU S HD12 9  
ATOM 9063  H HD13 . LEU A 1 15 ? -0.944  5.685   -0.812  1.00 0.00 ? 24 LEU S HD13 9  
ATOM 9064  H HD21 . LEU A 1 15 ? -4.906  6.076   -2.099  1.00 0.00 ? 24 LEU S HD21 9  
ATOM 9065  H HD22 . LEU A 1 15 ? -4.314  4.876   -0.952  1.00 0.00 ? 24 LEU S HD22 9  
ATOM 9066  H HD23 . LEU A 1 15 ? -3.991  4.682   -2.674  1.00 0.00 ? 24 LEU S HD23 9  
ATOM 9067  N N    . LEU A 1 16 ? -1.361  9.304   -2.395  1.00 0.00 ? 25 LEU S N    9  
ATOM 9068  C CA   . LEU A 1 16 ? -0.076  9.907   -2.700  1.00 0.00 ? 25 LEU S CA   9  
ATOM 9069  C C    . LEU A 1 16 ? -0.133  11.434  -2.684  1.00 0.00 ? 25 LEU S C    9  
ATOM 9070  O O    . LEU A 1 16 ? 0.373   12.091  -3.595  1.00 0.00 ? 25 LEU S O    9  
ATOM 9071  C CB   . LEU A 1 16 ? 0.424   9.398   -4.050  1.00 0.00 ? 25 LEU S CB   9  
ATOM 9072  C CG   . LEU A 1 16 ? 1.888   9.710   -4.355  1.00 0.00 ? 25 LEU S CG   9  
ATOM 9073  C CD1  . LEU A 1 16 ? 2.776   9.221   -3.221  1.00 0.00 ? 25 LEU S CD1  9  
ATOM 9074  C CD2  . LEU A 1 16 ? 2.304   9.080   -5.676  1.00 0.00 ? 25 LEU S CD2  9  
ATOM 9075  H H    . LEU A 1 16 ? -1.856  8.855   -3.109  1.00 0.00 ? 25 LEU S H    9  
ATOM 9076  H HA   . LEU A 1 16 ? 0.619   9.588   -1.938  1.00 0.00 ? 25 LEU S HA   9  
ATOM 9077  H HB2  . LEU A 1 16 ? 0.293   8.325   -4.067  1.00 0.00 ? 25 LEU S HB2  9  
ATOM 9078  H HB3  . LEU A 1 16 ? -0.186  9.835   -4.826  1.00 0.00 ? 25 LEU S HB3  9  
ATOM 9079  H HG   . LEU A 1 16 ? 2.014   10.781  -4.438  1.00 0.00 ? 25 LEU S HG   9  
ATOM 9080  H HD11 . LEU A 1 16 ? 3.128   10.065  -2.648  1.00 0.00 ? 25 LEU S HD11 9  
ATOM 9081  H HD12 . LEU A 1 16 ? 3.620   8.685   -3.628  1.00 0.00 ? 25 LEU S HD12 9  
ATOM 9082  H HD13 . LEU A 1 16 ? 2.208   8.561   -2.579  1.00 0.00 ? 25 LEU S HD13 9  
ATOM 9083  H HD21 . LEU A 1 16 ? 3.330   8.751   -5.610  1.00 0.00 ? 25 LEU S HD21 9  
ATOM 9084  H HD22 . LEU A 1 16 ? 2.209   9.807   -6.467  1.00 0.00 ? 25 LEU S HD22 9  
ATOM 9085  H HD23 . LEU A 1 16 ? 1.667   8.233   -5.887  1.00 0.00 ? 25 LEU S HD23 9  
ATOM 9086  N N    . ALA A 1 17 ? -0.732  11.982  -1.627  1.00 0.00 ? 26 ALA S N    9  
ATOM 9087  C CA   . ALA A 1 17 ? -0.847  13.438  -1.437  1.00 0.00 ? 26 ALA S CA   9  
ATOM 9088  C C    . ALA A 1 17 ? -2.175  13.982  -1.951  1.00 0.00 ? 26 ALA S C    9  
ATOM 9089  O O    . ALA A 1 17 ? -2.214  14.999  -2.645  1.00 0.00 ? 26 ALA S O    9  
ATOM 9090  C CB   . ALA A 1 17 ? 0.315   14.176  -2.088  1.00 0.00 ? 26 ALA S CB   9  
ATOM 9091  H H    . ALA A 1 17 ? -1.098  11.387  -0.941  1.00 0.00 ? 26 ALA S H    9  
ATOM 9092  H HA   . ALA A 1 17 ? -0.797  13.625  -0.373  1.00 0.00 ? 26 ALA S HA   9  
ATOM 9093  H HB1  . ALA A 1 17 ? 0.096   14.342  -3.133  1.00 0.00 ? 26 ALA S HB1  9  
ATOM 9094  H HB2  . ALA A 1 17 ? 1.215   13.584  -1.999  1.00 0.00 ? 26 ALA S HB2  9  
ATOM 9095  H HB3  . ALA A 1 17 ? 0.461   15.126  -1.595  1.00 0.00 ? 26 ALA S HB3  9  
ATOM 9096  N N    . ARG A 1 18 ? -3.261  13.311  -1.594  1.00 0.00 ? 27 ARG S N    9  
ATOM 9097  C CA   . ARG A 1 18 ? -4.592  13.736  -2.005  1.00 0.00 ? 27 ARG S CA   9  
ATOM 9098  C C    . ARG A 1 18 ? -5.628  13.316  -0.971  1.00 0.00 ? 27 ARG S C    9  
ATOM 9099  O O    . ARG A 1 18 ? -5.562  12.202  -0.462  1.00 0.00 ? 27 ARG S O    9  
ATOM 9100  C CB   . ARG A 1 18 ? -4.948  13.126  -3.363  1.00 0.00 ? 27 ARG S CB   9  
ATOM 9101  C CG   . ARG A 1 18 ? -6.382  13.391  -3.790  1.00 0.00 ? 27 ARG S CG   9  
ATOM 9102  C CD   . ARG A 1 18 ? -7.338  12.349  -3.239  1.00 0.00 ? 27 ARG S CD   9  
ATOM 9103  N NE   . ARG A 1 18 ? -8.315  11.914  -4.237  1.00 0.00 ? 27 ARG S NE   9  
ATOM 9104  C CZ   . ARG A 1 18 ? -8.000  11.416  -5.434  1.00 0.00 ? 27 ARG S CZ   9  
ATOM 9105  N NH1  . ARG A 1 18 ? -6.729  11.256  -5.792  1.00 0.00 ? 27 ARG S NH1  9  
ATOM 9106  N NH2  . ARG A 1 18 ? -8.961  11.068  -6.276  1.00 0.00 ? 27 ARG S NH2  9  
ATOM 9107  H H    . ARG A 1 18 ? -3.166  12.515  -1.031  1.00 0.00 ? 27 ARG S H    9  
ATOM 9108  H HA   . ARG A 1 18 ? -4.590  14.813  -2.089  1.00 0.00 ? 27 ARG S HA   9  
ATOM 9109  H HB2  . ARG A 1 18 ? -4.289  13.536  -4.114  1.00 0.00 ? 27 ARG S HB2  9  
ATOM 9110  H HB3  . ARG A 1 18 ? -4.803  12.059  -3.312  1.00 0.00 ? 27 ARG S HB3  9  
ATOM 9111  H HG2  . ARG A 1 18 ? -6.680  14.356  -3.421  1.00 0.00 ? 27 ARG S HG2  9  
ATOM 9112  H HG3  . ARG A 1 18 ? -6.434  13.379  -4.869  1.00 0.00 ? 27 ARG S HG3  9  
ATOM 9113  H HD2  . ARG A 1 18 ? -6.768  11.495  -2.905  1.00 0.00 ? 27 ARG S HD2  9  
ATOM 9114  H HD3  . ARG A 1 18 ? -7.865  12.778  -2.399  1.00 0.00 ? 27 ARG S HD3  9  
ATOM 9115  H HE   . ARG A 1 18 ? -9.263  12.005  -4.006  1.00 0.00 ? 27 ARG S HE   9  
ATOM 9116  H HH11 . ARG A 1 18 ? -5.994  11.508  -5.165  1.00 0.00 ? 27 ARG S HH11 9  
ATOM 9117  H HH12 . ARG A 1 18 ? -6.509  10.882  -6.693  1.00 0.00 ? 27 ARG S HH12 9  
ATOM 9118  H HH21 . ARG A 1 18 ? -9.920  11.179  -6.013  1.00 0.00 ? 27 ARG S HH21 9  
ATOM 9119  H HH22 . ARG A 1 18 ? -8.729  10.695  -7.175  1.00 0.00 ? 27 ARG S HH22 9  
ATOM 9120  N N    . PRO A 1 19 ? -6.610  14.193  -0.653  1.00 0.00 ? 28 PRO S N    9  
ATOM 9121  C CA   . PRO A 1 19 ? -7.667  13.887  0.311   1.00 0.00 ? 28 PRO S CA   9  
ATOM 9122  C C    . PRO A 1 19 ? -8.086  12.415  0.280   1.00 0.00 ? 28 PRO S C    9  
ATOM 9123  O O    . PRO A 1 19 ? -9.099  12.047  -0.314  1.00 0.00 ? 28 PRO S O    9  
ATOM 9124  C CB   . PRO A 1 19 ? -8.805  14.786  -0.159  1.00 0.00 ? 28 PRO S CB   9  
ATOM 9125  C CG   . PRO A 1 19 ? -8.122  15.998  -0.703  1.00 0.00 ? 28 PRO S CG   9  
ATOM 9126  C CD   . PRO A 1 19 ? -6.772  15.550  -1.216  1.00 0.00 ? 28 PRO S CD   9  
ATOM 9127  H HA   . PRO A 1 19 ? -7.380  14.159  1.315   1.00 0.00 ? 28 PRO S HA   9  
ATOM 9128  H HB2  . PRO A 1 19 ? -9.379  14.277  -0.922  1.00 0.00 ? 28 PRO S HB2  9  
ATOM 9129  H HB3  . PRO A 1 19 ? -9.442  15.035  0.678   1.00 0.00 ? 28 PRO S HB3  9  
ATOM 9130  H HG2  . PRO A 1 19 ? -8.707  16.414  -1.509  1.00 0.00 ? 28 PRO S HG2  9  
ATOM 9131  H HG3  . PRO A 1 19 ? -7.999  16.729  0.083   1.00 0.00 ? 28 PRO S HG3  9  
ATOM 9132  H HD2  . PRO A 1 19 ? -6.771  15.525  -2.293  1.00 0.00 ? 28 PRO S HD2  9  
ATOM 9133  H HD3  . PRO A 1 19 ? -5.996  16.210  -0.853  1.00 0.00 ? 28 PRO S HD3  9  
ATOM 9134  N N    . LEU A 1 20 ? -7.272  11.589  0.927   1.00 0.00 ? 29 LEU S N    9  
ATOM 9135  C CA   . LEU A 1 20 ? -7.504  10.150  0.996   1.00 0.00 ? 29 LEU S CA   9  
ATOM 9136  C C    . LEU A 1 20 ? -8.620  9.800   1.974   1.00 0.00 ? 29 LEU S C    9  
ATOM 9137  O O    . LEU A 1 20 ? -8.944  10.570  2.877   1.00 0.00 ? 29 LEU S O    9  
ATOM 9138  C CB   . LEU A 1 20 ? -6.220  9.408   1.406   1.00 0.00 ? 29 LEU S CB   9  
ATOM 9139  C CG   . LEU A 1 20 ? -5.414  10.018  2.567   1.00 0.00 ? 29 LEU S CG   9  
ATOM 9140  C CD1  . LEU A 1 20 ? -4.419  11.047  2.052   1.00 0.00 ? 29 LEU S CD1  9  
ATOM 9141  C CD2  . LEU A 1 20 ? -6.331  10.632  3.618   1.00 0.00 ? 29 LEU S CD2  9  
ATOM 9142  H H    . LEU A 1 20 ? -6.482  11.963  1.358   1.00 0.00 ? 29 LEU S H    9  
ATOM 9143  H HA   . LEU A 1 20 ? -7.794  9.818   0.010   1.00 0.00 ? 29 LEU S HA   9  
ATOM 9144  H HB2  . LEU A 1 20 ? -6.493  8.401   1.688   1.00 0.00 ? 29 LEU S HB2  9  
ATOM 9145  H HB3  . LEU A 1 20 ? -5.573  9.355   0.546   1.00 0.00 ? 29 LEU S HB3  9  
ATOM 9146  H HG   . LEU A 1 20 ? -4.849  9.229   3.045   1.00 0.00 ? 29 LEU S HG   9  
ATOM 9147  H HD11 . LEU A 1 20 ? -4.749  12.037  2.328   1.00 0.00 ? 29 LEU S HD11 9  
ATOM 9148  H HD12 . LEU A 1 20 ? -4.351  10.976  0.976   1.00 0.00 ? 29 LEU S HD12 9  
ATOM 9149  H HD13 . LEU A 1 20 ? -3.448  10.856  2.486   1.00 0.00 ? 29 LEU S HD13 9  
ATOM 9150  H HD21 . LEU A 1 20 ? -6.825  11.498  3.204   1.00 0.00 ? 29 LEU S HD21 9  
ATOM 9151  H HD22 . LEU A 1 20 ? -5.747  10.926  4.476   1.00 0.00 ? 29 LEU S HD22 9  
ATOM 9152  H HD23 . LEU A 1 20 ? -7.071  9.906   3.918   1.00 0.00 ? 29 LEU S HD23 9  
ATOM 9153  N N    . PRO A 1 21 ? -9.220  8.609   1.794   1.00 0.00 ? 30 PRO S N    9  
ATOM 9154  C CA   . PRO A 1 21 ? -10.306 8.119   2.647   1.00 0.00 ? 30 PRO S CA   9  
ATOM 9155  C C    . PRO A 1 21 ? -9.791  7.576   3.970   1.00 0.00 ? 30 PRO S C    9  
ATOM 9156  O O    . PRO A 1 21 ? -8.691  7.915   4.406   1.00 0.00 ? 30 PRO S O    9  
ATOM 9157  C CB   . PRO A 1 21 ? -10.904 7.000   1.801   1.00 0.00 ? 30 PRO S CB   9  
ATOM 9158  C CG   . PRO A 1 21 ? -9.733  6.446   1.083   1.00 0.00 ? 30 PRO S CG   9  
ATOM 9159  C CD   . PRO A 1 21 ? -8.885  7.635   0.735   1.00 0.00 ? 30 PRO S CD   9  
ATOM 9160  H HA   . PRO A 1 21 ? -11.048 8.875   2.830   1.00 0.00 ? 30 PRO S HA   9  
ATOM 9161  H HB2  . PRO A 1 21 ? -11.371 6.261   2.439   1.00 0.00 ? 30 PRO S HB2  9  
ATOM 9162  H HB3  . PRO A 1 21 ? -11.627 7.410   1.116   1.00 0.00 ? 30 PRO S HB3  9  
ATOM 9163  H HG2  . PRO A 1 21 ? -9.190  5.777   1.735   1.00 0.00 ? 30 PRO S HG2  9  
ATOM 9164  H HG3  . PRO A 1 21 ? -10.053 5.935   0.187   1.00 0.00 ? 30 PRO S HG3  9  
ATOM 9165  H HD2  . PRO A 1 21 ? -7.836  7.374   0.765   1.00 0.00 ? 30 PRO S HD2  9  
ATOM 9166  H HD3  . PRO A 1 21 ? -9.155  8.018   -0.238  1.00 0.00 ? 30 PRO S HD3  9  
ATOM 9167  N N    . GLU A 1 22 ? -10.592 6.735   4.610   1.00 0.00 ? 31 GLU S N    9  
ATOM 9168  C CA   . GLU A 1 22 ? -10.206 6.158   5.888   1.00 0.00 ? 31 GLU S CA   9  
ATOM 9169  C C    . GLU A 1 22 ? -9.482  4.834   5.713   1.00 0.00 ? 31 GLU S C    9  
ATOM 9170  O O    . GLU A 1 22 ? -8.472  4.591   6.373   1.00 0.00 ? 31 GLU S O    9  
ATOM 9171  C CB   . GLU A 1 22 ? -11.422 5.989   6.801   1.00 0.00 ? 31 GLU S CB   9  
ATOM 9172  C CG   . GLU A 1 22 ? -11.077 5.461   8.183   1.00 0.00 ? 31 GLU S CG   9  
ATOM 9173  C CD   . GLU A 1 22 ? -11.062 6.553   9.235   1.00 0.00 ? 31 GLU S CD   9  
ATOM 9174  O OE1  . GLU A 1 22 ? -10.016 7.215   9.389   1.00 0.00 ? 31 GLU S OE1  9  
ATOM 9175  O OE2  . GLU A 1 22 ? -12.100 6.745   9.905   1.00 0.00 ? 31 GLU S OE2  9  
ATOM 9176  H H    . GLU A 1 22 ? -11.460 6.507   4.218   1.00 0.00 ? 31 GLU S H    9  
ATOM 9177  H HA   . GLU A 1 22 ? -9.515  6.843   6.343   1.00 0.00 ? 31 GLU S HA   9  
ATOM 9178  H HB2  . GLU A 1 22 ? -11.908 6.947   6.914   1.00 0.00 ? 31 GLU S HB2  9  
ATOM 9179  H HB3  . GLU A 1 22 ? -12.112 5.297   6.337   1.00 0.00 ? 31 GLU S HB3  9  
ATOM 9180  H HG2  . GLU A 1 22 ? -11.811 4.721   8.465   1.00 0.00 ? 31 GLU S HG2  9  
ATOM 9181  H HG3  . GLU A 1 22 ? -10.099 5.004   8.146   1.00 0.00 ? 31 GLU S HG3  9  
ATOM 9182  N N    . GLY A 1 23 ? -9.968  3.989   4.808   1.00 0.00 ? 32 GLY S N    9  
ATOM 9183  C CA   . GLY A 1 23 ? -9.294  2.723   4.573   1.00 0.00 ? 32 GLY S CA   9  
ATOM 9184  C C    . GLY A 1 23 ? -7.810  2.943   4.349   1.00 0.00 ? 32 GLY S C    9  
ATOM 9185  O O    . GLY A 1 23 ? -6.990  2.055   4.587   1.00 0.00 ? 32 GLY S O    9  
ATOM 9186  H H    . GLY A 1 23 ? -10.763 4.232   4.288   1.00 0.00 ? 32 GLY S H    9  
ATOM 9187  H HA2  . GLY A 1 23 ? -9.435  2.080   5.432   1.00 0.00 ? 32 GLY S HA2  9  
ATOM 9188  H HA3  . GLY A 1 23 ? -9.718  2.249   3.699   1.00 0.00 ? 32 GLY S HA3  9  
ATOM 9189  N N    . VAL A 1 24 ? -7.475  4.157   3.908   1.00 0.00 ? 33 VAL S N    9  
ATOM 9190  C CA   . VAL A 1 24 ? -6.098  4.546   3.665   1.00 0.00 ? 33 VAL S CA   9  
ATOM 9191  C C    . VAL A 1 24 ? -5.468  5.085   4.954   1.00 0.00 ? 33 VAL S C    9  
ATOM 9192  O O    . VAL A 1 24 ? -5.791  6.184   5.403   1.00 0.00 ? 33 VAL S O    9  
ATOM 9193  C CB   . VAL A 1 24 ? -6.039  5.625   2.547   1.00 0.00 ? 33 VAL S CB   9  
ATOM 9194  C CG1  . VAL A 1 24 ? -5.078  6.757   2.882   1.00 0.00 ? 33 VAL S CG1  9  
ATOM 9195  C CG2  . VAL A 1 24 ? -5.676  4.997   1.213   1.00 0.00 ? 33 VAL S CG2  9  
ATOM 9196  H H    . VAL A 1 24 ? -8.180  4.817   3.753   1.00 0.00 ? 33 VAL S H    9  
ATOM 9197  H HA   . VAL A 1 24 ? -5.551  3.676   3.336   1.00 0.00 ? 33 VAL S HA   9  
ATOM 9198  H HB   . VAL A 1 24 ? -7.025  6.052   2.451   1.00 0.00 ? 33 VAL S HB   9  
ATOM 9199  H HG11 . VAL A 1 24 ? -4.171  6.352   3.304   1.00 0.00 ? 33 VAL S HG11 9  
ATOM 9200  H HG12 . VAL A 1 24 ? -5.542  7.424   3.594   1.00 0.00 ? 33 VAL S HG12 9  
ATOM 9201  H HG13 . VAL A 1 24 ? -4.842  7.304   1.981   1.00 0.00 ? 33 VAL S HG13 9  
ATOM 9202  H HG21 . VAL A 1 24 ? -4.707  5.351   0.903   1.00 0.00 ? 33 VAL S HG21 9  
ATOM 9203  H HG22 . VAL A 1 24 ? -6.413  5.277   0.474   1.00 0.00 ? 33 VAL S HG22 9  
ATOM 9204  H HG23 . VAL A 1 24 ? -5.654  3.922   1.313   1.00 0.00 ? 33 VAL S HG23 9  
ATOM 9205  N N    . ASP A 1 25 ? -4.567  4.306   5.542   1.00 0.00 ? 34 ASP S N    9  
ATOM 9206  C CA   . ASP A 1 25 ? -3.891  4.711   6.769   1.00 0.00 ? 34 ASP S CA   9  
ATOM 9207  C C    . ASP A 1 25 ? -2.545  5.372   6.444   1.00 0.00 ? 34 ASP S C    9  
ATOM 9208  O O    . ASP A 1 25 ? -1.667  4.745   5.854   1.00 0.00 ? 34 ASP S O    9  
ATOM 9209  C CB   . ASP A 1 25 ? -3.674  3.499   7.677   1.00 0.00 ? 34 ASP S CB   9  
ATOM 9210  C CG   . ASP A 1 25 ? -4.918  2.639   7.799   1.00 0.00 ? 34 ASP S CG   9  
ATOM 9211  O OD1  . ASP A 1 25 ? -5.983  3.182   8.163   1.00 0.00 ? 34 ASP S OD1  9  
ATOM 9212  O OD2  . ASP A 1 25 ? -4.828  1.422   7.531   1.00 0.00 ? 34 ASP S OD2  9  
ATOM 9213  H H    . ASP A 1 25 ? -4.355  3.438   5.144   1.00 0.00 ? 34 ASP S H    9  
ATOM 9214  H HA   . ASP A 1 25 ? -4.527  5.423   7.274   1.00 0.00 ? 34 ASP S HA   9  
ATOM 9215  H HB2  . ASP A 1 25 ? -2.878  2.890   7.272   1.00 0.00 ? 34 ASP S HB2  9  
ATOM 9216  H HB3  . ASP A 1 25 ? -3.398  3.840   8.665   1.00 0.00 ? 34 ASP S HB3  9  
ATOM 9217  N N    . PRO A 1 26 ? -2.364  6.654   6.810   1.00 0.00 ? 35 PRO S N    9  
ATOM 9218  C CA   . PRO A 1 26 ? -1.122  7.389   6.531   1.00 0.00 ? 35 PRO S CA   9  
ATOM 9219  C C    . PRO A 1 26 ? 0.120   6.748   7.154   1.00 0.00 ? 35 PRO S C    9  
ATOM 9220  O O    . PRO A 1 26 ? 1.240   6.999   6.709   1.00 0.00 ? 35 PRO S O    9  
ATOM 9221  C CB   . PRO A 1 26 ? -1.371  8.775   7.142   1.00 0.00 ? 35 PRO S CB   9  
ATOM 9222  C CG   . PRO A 1 26 ? -2.507  8.588   8.090   1.00 0.00 ? 35 PRO S CG   9  
ATOM 9223  C CD   . PRO A 1 26 ? -3.351  7.494   7.509   1.00 0.00 ? 35 PRO S CD   9  
ATOM 9224  H HA   . PRO A 1 26 ? -0.967  7.492   5.468   1.00 0.00 ? 35 PRO S HA   9  
ATOM 9225  H HB2  . PRO A 1 26 ? -0.480  9.110   7.656   1.00 0.00 ? 35 PRO S HB2  9  
ATOM 9226  H HB3  . PRO A 1 26 ? -1.625  9.476   6.358   1.00 0.00 ? 35 PRO S HB3  9  
ATOM 9227  H HG2  . PRO A 1 26 ? -2.131  8.298   9.060   1.00 0.00 ? 35 PRO S HG2  9  
ATOM 9228  H HG3  . PRO A 1 26 ? -3.077  9.503   8.164   1.00 0.00 ? 35 PRO S HG3  9  
ATOM 9229  H HD2  . PRO A 1 26 ? -3.845  6.940   8.293   1.00 0.00 ? 35 PRO S HD2  9  
ATOM 9230  H HD3  . PRO A 1 26 ? -4.073  7.900   6.814   1.00 0.00 ? 35 PRO S HD3  9  
ATOM 9231  N N    . LEU A 1 27 ? -0.076  5.932   8.183   1.00 0.00 ? 36 LEU S N    9  
ATOM 9232  C CA   . LEU A 1 27 ? 1.043   5.274   8.857   1.00 0.00 ? 36 LEU S CA   9  
ATOM 9233  C C    . LEU A 1 27 ? 1.690   4.204   7.972   1.00 0.00 ? 36 LEU S C    9  
ATOM 9234  O O    . LEU A 1 27 ? 2.766   3.696   8.289   1.00 0.00 ? 36 LEU S O    9  
ATOM 9235  C CB   . LEU A 1 27 ? 0.590   4.652   10.187  1.00 0.00 ? 36 LEU S CB   9  
ATOM 9236  C CG   . LEU A 1 27 ? -0.708  3.832   10.153  1.00 0.00 ? 36 LEU S CG   9  
ATOM 9237  C CD1  . LEU A 1 27 ? -1.902  4.701   10.513  1.00 0.00 ? 36 LEU S CD1  9  
ATOM 9238  C CD2  . LEU A 1 27 ? -0.908  3.172   8.793   1.00 0.00 ? 36 LEU S CD2  9  
ATOM 9239  H H    . LEU A 1 27 ? -0.986  5.774   8.499   1.00 0.00 ? 36 LEU S H    9  
ATOM 9240  H HA   . LEU A 1 27 ? 1.781   6.033   9.068   1.00 0.00 ? 36 LEU S HA   9  
ATOM 9241  H HB2  . LEU A 1 27 ? 1.384   4.007   10.540  1.00 0.00 ? 36 LEU S HB2  9  
ATOM 9242  H HB3  . LEU A 1 27 ? 0.460   5.454   10.903  1.00 0.00 ? 36 LEU S HB3  9  
ATOM 9243  H HG   . LEU A 1 27 ? -0.641  3.048   10.894  1.00 0.00 ? 36 LEU S HG   9  
ATOM 9244  H HD11 . LEU A 1 27 ? -2.645  4.102   11.016  1.00 0.00 ? 36 LEU S HD11 9  
ATOM 9245  H HD12 . LEU A 1 27 ? -2.327  5.123   9.615   1.00 0.00 ? 36 LEU S HD12 9  
ATOM 9246  H HD13 . LEU A 1 27 ? -1.581  5.499   11.168  1.00 0.00 ? 36 LEU S HD13 9  
ATOM 9247  H HD21 . LEU A 1 27 ? -1.120  3.925   8.050   1.00 0.00 ? 36 LEU S HD21 9  
ATOM 9248  H HD22 . LEU A 1 27 ? -1.733  2.478   8.848   1.00 0.00 ? 36 LEU S HD22 9  
ATOM 9249  H HD23 . LEU A 1 27 ? -0.009  2.641   8.517   1.00 0.00 ? 36 LEU S HD23 9  
ATOM 9250  N N    . LYS A 1 28 ? 1.032   3.865   6.867   1.00 0.00 ? 37 LYS S N    9  
ATOM 9251  C CA   . LYS A 1 28 ? 1.547   2.858   5.943   1.00 0.00 ? 37 LYS S CA   9  
ATOM 9252  C C    . LYS A 1 28 ? 0.664   2.776   4.702   1.00 0.00 ? 37 LYS S C    9  
ATOM 9253  O O    . LYS A 1 28 ? -0.503  2.398   4.782   1.00 0.00 ? 37 LYS S O    9  
ATOM 9254  C CB   . LYS A 1 28 ? 1.647   1.490   6.632   1.00 0.00 ? 37 LYS S CB   9  
ATOM 9255  C CG   . LYS A 1 28 ? 0.316   0.766   6.781   1.00 0.00 ? 37 LYS S CG   9  
ATOM 9256  C CD   . LYS A 1 28 ? 0.380   -0.300  7.864   1.00 0.00 ? 37 LYS S CD   9  
ATOM 9257  C CE   . LYS A 1 28 ? 0.134   0.289   9.244   1.00 0.00 ? 37 LYS S CE   9  
ATOM 9258  N NZ   . LYS A 1 28 ? 0.251   -0.737  10.317  1.00 0.00 ? 37 LYS S NZ   9  
ATOM 9259  H H    . LYS A 1 28 ? 0.180   4.301   6.664   1.00 0.00 ? 37 LYS S H    9  
ATOM 9260  H HA   . LYS A 1 28 ? 2.536   3.171   5.642   1.00 0.00 ? 37 LYS S HA   9  
ATOM 9261  H HB2  . LYS A 1 28 ? 2.308   0.859   6.054   1.00 0.00 ? 37 LYS S HB2  9  
ATOM 9262  H HB3  . LYS A 1 28 ? 2.067   1.629   7.619   1.00 0.00 ? 37 LYS S HB3  9  
ATOM 9263  H HG2  . LYS A 1 28 ? -0.449  1.483   7.038   1.00 0.00 ? 37 LYS S HG2  9  
ATOM 9264  H HG3  . LYS A 1 28 ? 0.068   0.295   5.841   1.00 0.00 ? 37 LYS S HG3  9  
ATOM 9265  H HD2  . LYS A 1 28 ? -0.374  -1.048  7.665   1.00 0.00 ? 37 LYS S HD2  9  
ATOM 9266  H HD3  . LYS A 1 28 ? 1.358   -0.758  7.846   1.00 0.00 ? 37 LYS S HD3  9  
ATOM 9267  H HE2  . LYS A 1 28 ? 0.861   1.068   9.423   1.00 0.00 ? 37 LYS S HE2  9  
ATOM 9268  H HE3  . LYS A 1 28 ? -0.859  0.713   9.269   1.00 0.00 ? 37 LYS S HE3  9  
ATOM 9269  H HZ1  . LYS A 1 28 ? 0.065   -0.307  11.244  1.00 0.00 ? 37 LYS S HZ1  9  
ATOM 9270  H HZ2  . LYS A 1 28 ? 1.210   -1.142  10.319  1.00 0.00 ? 37 LYS S HZ2  9  
ATOM 9271  H HZ3  . LYS A 1 28 ? -0.435  -1.502  10.157  1.00 0.00 ? 37 LYS S HZ3  9  
ATOM 9272  N N    . LEU A 1 29 ? 1.219   3.166   3.561   1.00 0.00 ? 38 LEU S N    9  
ATOM 9273  C CA   . LEU A 1 29 ? 0.473   3.168   2.308   1.00 0.00 ? 38 LEU S CA   9  
ATOM 9274  C C    . LEU A 1 29 ? 0.548   1.832   1.572   1.00 0.00 ? 38 LEU S C    9  
ATOM 9275  O O    . LEU A 1 29 ? -0.443  1.373   1.006   1.00 0.00 ? 38 LEU S O    9  
ATOM 9276  C CB   . LEU A 1 29 ? 0.967   4.306   1.420   1.00 0.00 ? 38 LEU S CB   9  
ATOM 9277  C CG   . LEU A 1 29 ? 0.912   5.685   2.085   1.00 0.00 ? 38 LEU S CG   9  
ATOM 9278  C CD1  . LEU A 1 29 ? 2.310   6.234   2.317   1.00 0.00 ? 38 LEU S CD1  9  
ATOM 9279  C CD2  . LEU A 1 29 ? 0.081   6.649   1.252   1.00 0.00 ? 38 LEU S CD2  9  
ATOM 9280  H H    . LEU A 1 29 ? 2.148   3.482   3.565   1.00 0.00 ? 38 LEU S H    9  
ATOM 9281  H HA   . LEU A 1 29 ? -0.553  3.350   2.553   1.00 0.00 ? 38 LEU S HA   9  
ATOM 9282  H HB2  . LEU A 1 29 ? 1.991   4.098   1.136   1.00 0.00 ? 38 LEU S HB2  9  
ATOM 9283  H HB3  . LEU A 1 29 ? 0.357   4.333   0.528   1.00 0.00 ? 38 LEU S HB3  9  
ATOM 9284  H HG   . LEU A 1 29 ? 0.439   5.586   3.050   1.00 0.00 ? 38 LEU S HG   9  
ATOM 9285  H HD11 . LEU A 1 29 ? 2.476   7.078   1.664   1.00 0.00 ? 38 LEU S HD11 9  
ATOM 9286  H HD12 . LEU A 1 29 ? 3.037   5.466   2.107   1.00 0.00 ? 38 LEU S HD12 9  
ATOM 9287  H HD13 . LEU A 1 29 ? 2.405   6.552   3.344   1.00 0.00 ? 38 LEU S HD13 9  
ATOM 9288  H HD21 . LEU A 1 29 ? 0.203   7.651   1.634   1.00 0.00 ? 38 LEU S HD21 9  
ATOM 9289  H HD22 . LEU A 1 29 ? -0.958  6.365   1.308   1.00 0.00 ? 38 LEU S HD22 9  
ATOM 9290  H HD23 . LEU A 1 29 ? 0.410   6.611   0.224   1.00 0.00 ? 38 LEU S HD23 9  
ATOM 9291  N N    . GLU A 1 30 ? 1.725   1.220   1.577   1.00 0.00 ? 39 GLU S N    9  
ATOM 9292  C CA   . GLU A 1 30 ? 1.941   -0.061  0.900   1.00 0.00 ? 39 GLU S CA   9  
ATOM 9293  C C    . GLU A 1 30 ? 0.778   -1.031  1.110   1.00 0.00 ? 39 GLU S C    9  
ATOM 9294  O O    . GLU A 1 30 ? 0.533   -1.905  0.280   1.00 0.00 ? 39 GLU S O    9  
ATOM 9295  C CB   . GLU A 1 30 ? 3.234   -0.701  1.402   1.00 0.00 ? 39 GLU S CB   9  
ATOM 9296  C CG   . GLU A 1 30 ? 3.194   -1.055  2.881   1.00 0.00 ? 39 GLU S CG   9  
ATOM 9297  C CD   . GLU A 1 30 ? 3.626   -2.485  3.158   1.00 0.00 ? 39 GLU S CD   9  
ATOM 9298  O OE1  . GLU A 1 30 ? 3.543   -3.320  2.235   1.00 0.00 ? 39 GLU S OE1  9  
ATOM 9299  O OE2  . GLU A 1 30 ? 4.047   -2.765  4.299   1.00 0.00 ? 39 GLU S OE2  9  
ATOM 9300  H H    . GLU A 1 30 ? 2.475   1.643   2.041   1.00 0.00 ? 39 GLU S H    9  
ATOM 9301  H HA   . GLU A 1 30 ? 2.040   0.137   -0.155  1.00 0.00 ? 39 GLU S HA   9  
ATOM 9302  H HB2  . GLU A 1 30 ? 3.416   -1.607  0.840   1.00 0.00 ? 39 GLU S HB2  9  
ATOM 9303  H HB3  . GLU A 1 30 ? 4.052   -0.012  1.240   1.00 0.00 ? 39 GLU S HB3  9  
ATOM 9304  H HG2  . GLU A 1 30 ? 3.852   -0.387  3.412   1.00 0.00 ? 39 GLU S HG2  9  
ATOM 9305  H HG3  . GLU A 1 30 ? 2.184   -0.925  3.240   1.00 0.00 ? 39 GLU S HG3  9  
ATOM 9306  N N    . ILE A 1 31 ? 0.079   -0.894  2.231   1.00 0.00 ? 40 ILE S N    9  
ATOM 9307  C CA   . ILE A 1 31 ? -1.033  -1.783  2.544   1.00 0.00 ? 40 ILE S CA   9  
ATOM 9308  C C    . ILE A 1 31 ? -2.256  -1.541  1.660   1.00 0.00 ? 40 ILE S C    9  
ATOM 9309  O O    . ILE A 1 31 ? -2.987  -2.482  1.352   1.00 0.00 ? 40 ILE S O    9  
ATOM 9310  C CB   . ILE A 1 31 ? -1.454  -1.659  4.020   1.00 0.00 ? 40 ILE S CB   9  
ATOM 9311  C CG1  . ILE A 1 31 ? -1.939  -0.242  4.317   1.00 0.00 ? 40 ILE S CG1  9  
ATOM 9312  C CG2  . ILE A 1 31 ? -0.296  -2.035  4.933   1.00 0.00 ? 40 ILE S CG2  9  
ATOM 9313  C CD1  . ILE A 1 31 ? -2.550  -0.085  5.692   1.00 0.00 ? 40 ILE S CD1  9  
ATOM 9314  H H    . ILE A 1 31 ? 0.328   -0.194  2.869   1.00 0.00 ? 40 ILE S H    9  
ATOM 9315  H HA   . ILE A 1 31 ? -0.692  -2.796  2.384   1.00 0.00 ? 40 ILE S HA   9  
ATOM 9316  H HB   . ILE A 1 31 ? -2.260  -2.354  4.201   1.00 0.00 ? 40 ILE S HB   9  
ATOM 9317  H HG12 . ILE A 1 31 ? -1.105  0.437   4.245   1.00 0.00 ? 40 ILE S HG12 9  
ATOM 9318  H HG13 . ILE A 1 31 ? -2.686  0.035   3.588   1.00 0.00 ? 40 ILE S HG13 9  
ATOM 9319  H HG21 . ILE A 1 31 ? 0.511   -1.329  4.800   1.00 0.00 ? 40 ILE S HG21 9  
ATOM 9320  H HG22 . ILE A 1 31 ? 0.050   -3.027  4.685   1.00 0.00 ? 40 ILE S HG22 9  
ATOM 9321  H HG23 . ILE A 1 31 ? -0.626  -2.015  5.959   1.00 0.00 ? 40 ILE S HG23 9  
ATOM 9322  H HD11 . ILE A 1 31 ? -3.615  0.057   5.599   1.00 0.00 ? 40 ILE S HD11 9  
ATOM 9323  H HD12 . ILE A 1 31 ? -2.114  0.771   6.185   1.00 0.00 ? 40 ILE S HD12 9  
ATOM 9324  H HD13 . ILE A 1 31 ? -2.355  -0.974  6.276   1.00 0.00 ? 40 ILE S HD13 9  
ATOM 9325  N N    . TYR A 1 32 ? -2.502  -0.290  1.261   1.00 0.00 ? 41 TYR S N    9  
ATOM 9326  C CA   . TYR A 1 32 ? -3.671  -0.001  0.431   1.00 0.00 ? 41 TYR S CA   9  
ATOM 9327  C C    . TYR A 1 32 ? -3.322  0.272   -1.030  1.00 0.00 ? 41 TYR S C    9  
ATOM 9328  O O    . TYR A 1 32 ? -3.892  1.169   -1.652  1.00 0.00 ? 41 TYR S O    9  
ATOM 9329  C CB   . TYR A 1 32 ? -4.498  1.158   0.994   1.00 0.00 ? 41 TYR S CB   9  
ATOM 9330  C CG   . TYR A 1 32 ? -3.706  2.311   1.573   1.00 0.00 ? 41 TYR S CG   9  
ATOM 9331  C CD1  . TYR A 1 32 ? -3.233  3.339   0.765   1.00 0.00 ? 41 TYR S CD1  9  
ATOM 9332  C CD2  . TYR A 1 32 ? -3.468  2.389   2.935   1.00 0.00 ? 41 TYR S CD2  9  
ATOM 9333  C CE1  . TYR A 1 32 ? -2.544  4.409   1.304   1.00 0.00 ? 41 TYR S CE1  9  
ATOM 9334  C CE2  . TYR A 1 32 ? -2.787  3.457   3.479   1.00 0.00 ? 41 TYR S CE2  9  
ATOM 9335  C CZ   . TYR A 1 32 ? -2.330  4.465   2.663   1.00 0.00 ? 41 TYR S CZ   9  
ATOM 9336  O OH   . TYR A 1 32 ? -1.656  5.533   3.208   1.00 0.00 ? 41 TYR S OH   9  
ATOM 9337  H H    . TYR A 1 32 ? -1.906  0.437   1.537   1.00 0.00 ? 41 TYR S H    9  
ATOM 9338  H HA   . TYR A 1 32 ? -4.291  -0.885  0.454   1.00 0.00 ? 41 TYR S HA   9  
ATOM 9339  H HB2  . TYR A 1 32 ? -5.117  1.559   0.205   1.00 0.00 ? 41 TYR S HB2  9  
ATOM 9340  H HB3  . TYR A 1 32 ? -5.139  0.775   1.779   1.00 0.00 ? 41 TYR S HB3  9  
ATOM 9341  H HD1  . TYR A 1 32 ? -3.401  3.293   -0.298  1.00 0.00 ? 41 TYR S HD1  9  
ATOM 9342  H HD2  . TYR A 1 32 ? -3.827  1.601   3.576   1.00 0.00 ? 41 TYR S HD2  9  
ATOM 9343  H HE1  . TYR A 1 32 ? -2.185  5.199   0.660   1.00 0.00 ? 41 TYR S HE1  9  
ATOM 9344  H HE2  . TYR A 1 32 ? -2.611  3.495   4.541   1.00 0.00 ? 41 TYR S HE2  9  
ATOM 9345  H HH   . TYR A 1 32 ? -2.232  5.996   3.819   1.00 0.00 ? 41 TYR S HH   9  
ATOM 9346  N N    . LEU A 1 33 ? -2.423  -0.527  -1.594  1.00 0.00 ? 42 LEU S N    9  
ATOM 9347  C CA   . LEU A 1 33 ? -2.065  -0.380  -3.002  1.00 0.00 ? 42 LEU S CA   9  
ATOM 9348  C C    . LEU A 1 33 ? -1.939  -1.750  -3.650  1.00 0.00 ? 42 LEU S C    9  
ATOM 9349  O O    . LEU A 1 33 ? -1.078  -2.543  -3.285  1.00 0.00 ? 42 LEU S O    9  
ATOM 9350  C CB   . LEU A 1 33 ? -0.771  0.416   -3.176  1.00 0.00 ? 42 LEU S CB   9  
ATOM 9351  C CG   . LEU A 1 33 ? 0.261   0.288   -2.053  1.00 0.00 ? 42 LEU S CG   9  
ATOM 9352  C CD1  . LEU A 1 33 ? 1.350   -0.703  -2.434  1.00 0.00 ? 42 LEU S CD1  9  
ATOM 9353  C CD2  . LEU A 1 33 ? 0.859   1.655   -1.744  1.00 0.00 ? 42 LEU S CD2  9  
ATOM 9354  H H    . LEU A 1 33 ? -2.015  -1.252  -1.066  1.00 0.00 ? 42 LEU S H    9  
ATOM 9355  H HA   . LEU A 1 33 ? -2.870  0.154   -3.485  1.00 0.00 ? 42 LEU S HA   9  
ATOM 9356  H HB2  . LEU A 1 33 ? -0.302  0.089   -4.094  1.00 0.00 ? 42 LEU S HB2  9  
ATOM 9357  H HB3  . LEU A 1 33 ? -1.032  1.457   -3.281  1.00 0.00 ? 42 LEU S HB3  9  
ATOM 9358  H HG   . LEU A 1 33 ? -0.226  -0.075  -1.160  1.00 0.00 ? 42 LEU S HG   9  
ATOM 9359  H HD11 . LEU A 1 33 ? 1.335   -1.535  -1.746  1.00 0.00 ? 42 LEU S HD11 9  
ATOM 9360  H HD12 . LEU A 1 33 ? 2.314   -0.217  -2.389  1.00 0.00 ? 42 LEU S HD12 9  
ATOM 9361  H HD13 . LEU A 1 33 ? 1.176   -1.062  -3.436  1.00 0.00 ? 42 LEU S HD13 9  
ATOM 9362  H HD21 . LEU A 1 33 ? 0.747   2.299   -2.606  1.00 0.00 ? 42 LEU S HD21 9  
ATOM 9363  H HD22 . LEU A 1 33 ? 1.909   1.546   -1.514  1.00 0.00 ? 42 LEU S HD22 9  
ATOM 9364  H HD23 . LEU A 1 33 ? 0.348   2.091   -0.902  1.00 0.00 ? 42 LEU S HD23 9  
ATOM 9365  N N    . THR A 1 34 ? -2.817  -2.020  -4.611  1.00 0.00 ? 43 THR S N    9  
ATOM 9366  C CA   . THR A 1 34 ? -2.818  -3.298  -5.312  1.00 0.00 ? 43 THR S CA   9  
ATOM 9367  C C    . THR A 1 34 ? -1.542  -3.482  -6.126  1.00 0.00 ? 43 THR S C    9  
ATOM 9368  O O    . THR A 1 34 ? -0.883  -2.518  -6.488  1.00 0.00 ? 43 THR S O    9  
ATOM 9369  C CB   . THR A 1 34 ? -4.040  -3.399  -6.227  1.00 0.00 ? 43 THR S CB   9  
ATOM 9370  O OG1  . THR A 1 34 ? -4.124  -4.688  -6.809  1.00 0.00 ? 43 THR S OG1  9  
ATOM 9371  C CG2  . THR A 1 34 ? -4.032  -2.386  -7.353  1.00 0.00 ? 43 THR S CG2  9  
ATOM 9372  H H    . THR A 1 34 ? -3.488  -1.345  -4.850  1.00 0.00 ? 43 THR S H    9  
ATOM 9373  H HA   . THR A 1 34 ? -2.872  -4.081  -4.570  1.00 0.00 ? 43 THR S HA   9  
ATOM 9374  H HB   . THR A 1 34 ? -4.932  -3.233  -5.640  1.00 0.00 ? 43 THR S HB   9  
ATOM 9375  H HG1  . THR A 1 34 ? -4.964  -4.779  -7.266  1.00 0.00 ? 43 THR S HG1  9  
ATOM 9376  H HG21 . THR A 1 34 ? -5.048  -2.167  -7.647  1.00 0.00 ? 43 THR S HG21 9  
ATOM 9377  H HG22 . THR A 1 34 ? -3.493  -2.790  -8.197  1.00 0.00 ? 43 THR S HG22 9  
ATOM 9378  H HG23 . THR A 1 34 ? -3.551  -1.479  -7.018  1.00 0.00 ? 43 THR S HG23 9  
ATOM 9379  N N    . ASP A 1 35 ? -1.214  -4.741  -6.398  1.00 0.00 ? 44 ASP S N    9  
ATOM 9380  C CA   . ASP A 1 35 ? -0.024  -5.122  -7.166  1.00 0.00 ? 44 ASP S CA   9  
ATOM 9381  C C    . ASP A 1 35 ? 0.319   -4.101  -8.243  1.00 0.00 ? 44 ASP S C    9  
ATOM 9382  O O    . ASP A 1 35 ? 1.488   -3.848  -8.511  1.00 0.00 ? 44 ASP S O    9  
ATOM 9383  C CB   . ASP A 1 35 ? -0.229  -6.498  -7.802  1.00 0.00 ? 44 ASP S CB   9  
ATOM 9384  C CG   . ASP A 1 35 ? -1.448  -6.538  -8.703  1.00 0.00 ? 44 ASP S CG   9  
ATOM 9385  O OD1  . ASP A 1 35 ? -2.558  -6.799  -8.189  1.00 0.00 ? 44 ASP S OD1  9  
ATOM 9386  O OD2  . ASP A 1 35 ? -1.295  -6.314  -9.921  1.00 0.00 ? 44 ASP S OD2  9  
ATOM 9387  H H    . ASP A 1 35 ? -1.790  -5.439  -6.067  1.00 0.00 ? 44 ASP S H    9  
ATOM 9388  H HA   . ASP A 1 35 ? 0.803   -5.183  -6.474  1.00 0.00 ? 44 ASP S HA   9  
ATOM 9389  H HB2  . ASP A 1 35 ? 0.640   -6.746  -8.395  1.00 0.00 ? 44 ASP S HB2  9  
ATOM 9390  H HB3  . ASP A 1 35 ? -0.355  -7.233  -7.022  1.00 0.00 ? 44 ASP S HB3  9  
ATOM 9391  N N    . GLU A 1 36 ? -0.699  -3.503  -8.851  1.00 0.00 ? 45 GLU S N    9  
ATOM 9392  C CA   . GLU A 1 36 ? -0.469  -2.496  -9.876  1.00 0.00 ? 45 GLU S CA   9  
ATOM 9393  C C    . GLU A 1 36 ? 0.134   -1.260  -9.230  1.00 0.00 ? 45 GLU S C    9  
ATOM 9394  O O    . GLU A 1 36 ? 1.182   -0.767  -9.647  1.00 0.00 ? 45 GLU S O    9  
ATOM 9395  C CB   . GLU A 1 36 ? -1.773  -2.135  -10.576 1.00 0.00 ? 45 GLU S CB   9  
ATOM 9396  C CG   . GLU A 1 36 ? -2.325  -3.245  -11.455 1.00 0.00 ? 45 GLU S CG   9  
ATOM 9397  C CD   . GLU A 1 36 ? -2.989  -2.719  -12.713 1.00 0.00 ? 45 GLU S CD   9  
ATOM 9398  O OE1  . GLU A 1 36 ? -3.898  -1.871  -12.595 1.00 0.00 ? 45 GLU S OE1  9  
ATOM 9399  O OE2  . GLU A 1 36 ? -2.596  -3.154  -13.815 1.00 0.00 ? 45 GLU S OE2  9  
ATOM 9400  H H    . GLU A 1 36 ? -1.617  -3.732  -8.595  1.00 0.00 ? 45 GLU S H    9  
ATOM 9401  H HA   . GLU A 1 36 ? 0.229   -2.899  -10.596 1.00 0.00 ? 45 GLU S HA   9  
ATOM 9402  H HB2  . GLU A 1 36 ? -2.510  -1.893  -9.827  1.00 0.00 ? 45 GLU S HB2  9  
ATOM 9403  H HB3  . GLU A 1 36 ? -1.601  -1.266  -11.193 1.00 0.00 ? 45 GLU S HB3  9  
ATOM 9404  H HG2  . GLU A 1 36 ? -1.514  -3.898  -11.740 1.00 0.00 ? 45 GLU S HG2  9  
ATOM 9405  H HG3  . GLU A 1 36 ? -3.055  -3.805  -10.888 1.00 0.00 ? 45 GLU S HG3  9  
ATOM 9406  N N    . ASP A 1 37 ? -0.529  -0.792  -8.180  1.00 0.00 ? 46 ASP S N    9  
ATOM 9407  C CA   . ASP A 1 37 ? -0.069  0.352   -7.421  1.00 0.00 ? 46 ASP S CA   9  
ATOM 9408  C C    . ASP A 1 37 ? 1.202   -0.027  -6.672  1.00 0.00 ? 46 ASP S C    9  
ATOM 9409  O O    . ASP A 1 37 ? 2.109   0.784   -6.492  1.00 0.00 ? 46 ASP S O    9  
ATOM 9410  C CB   . ASP A 1 37 ? -1.161  0.764   -6.437  1.00 0.00 ? 46 ASP S CB   9  
ATOM 9411  C CG   . ASP A 1 37 ? -0.786  1.985   -5.626  1.00 0.00 ? 46 ASP S CG   9  
ATOM 9412  O OD1  . ASP A 1 37 ? 0.414   2.332   -5.586  1.00 0.00 ? 46 ASP S OD1  9  
ATOM 9413  O OD2  . ASP A 1 37 ? -1.696  2.601   -5.031  1.00 0.00 ? 46 ASP S OD2  9  
ATOM 9414  H H    . ASP A 1 37 ? -1.341  -1.253  -7.882  1.00 0.00 ? 46 ASP S H    9  
ATOM 9415  H HA   . ASP A 1 37 ? 0.135   1.164   -8.104  1.00 0.00 ? 46 ASP S HA   9  
ATOM 9416  H HB2  . ASP A 1 37 ? -2.064  0.985   -6.988  1.00 0.00 ? 46 ASP S HB2  9  
ATOM 9417  H HB3  . ASP A 1 37 ? -1.349  -0.065  -5.759  1.00 0.00 ? 46 ASP S HB3  9  
ATOM 9418  N N    . PHE A 1 38 ? 1.247   -1.286  -6.256  1.00 0.00 ? 47 PHE S N    9  
ATOM 9419  C CA   . PHE A 1 38 ? 2.381   -1.840  -5.540  1.00 0.00 ? 47 PHE S CA   9  
ATOM 9420  C C    . PHE A 1 38 ? 3.573   -1.967  -6.472  1.00 0.00 ? 47 PHE S C    9  
ATOM 9421  O O    . PHE A 1 38 ? 4.712   -1.707  -6.085  1.00 0.00 ? 47 PHE S O    9  
ATOM 9422  C CB   . PHE A 1 38 ? 2.003   -3.216  -4.986  1.00 0.00 ? 47 PHE S CB   9  
ATOM 9423  C CG   . PHE A 1 38 ? 2.162   -3.340  -3.503  1.00 0.00 ? 47 PHE S CG   9  
ATOM 9424  C CD1  . PHE A 1 38 ? 3.317   -2.907  -2.873  1.00 0.00 ? 47 PHE S CD1  9  
ATOM 9425  C CD2  . PHE A 1 38 ? 1.149   -3.885  -2.737  1.00 0.00 ? 47 PHE S CD2  9  
ATOM 9426  C CE1  . PHE A 1 38 ? 3.454   -3.014  -1.504  1.00 0.00 ? 47 PHE S CE1  9  
ATOM 9427  C CE2  . PHE A 1 38 ? 1.279   -3.996  -1.371  1.00 0.00 ? 47 PHE S CE2  9  
ATOM 9428  C CZ   . PHE A 1 38 ? 2.432   -3.558  -0.752  1.00 0.00 ? 47 PHE S CZ   9  
ATOM 9429  H H    . PHE A 1 38 ? 0.488   -1.871  -6.449  1.00 0.00 ? 47 PHE S H    9  
ATOM 9430  H HA   . PHE A 1 38 ? 2.629   -1.179  -4.726  1.00 0.00 ? 47 PHE S HA   9  
ATOM 9431  H HB2  . PHE A 1 38 ? 0.966   -3.414  -5.220  1.00 0.00 ? 47 PHE S HB2  9  
ATOM 9432  H HB3  . PHE A 1 38 ? 2.619   -3.968  -5.452  1.00 0.00 ? 47 PHE S HB3  9  
ATOM 9433  H HD1  . PHE A 1 38 ? 4.115   -2.478  -3.463  1.00 0.00 ? 47 PHE S HD1  9  
ATOM 9434  H HD2  . PHE A 1 38 ? 0.248   -4.230  -3.221  1.00 0.00 ? 47 PHE S HD2  9  
ATOM 9435  H HE1  . PHE A 1 38 ? 4.358   -2.674  -1.023  1.00 0.00 ? 47 PHE S HE1  9  
ATOM 9436  H HE2  . PHE A 1 38 ? 0.478   -4.424  -0.786  1.00 0.00 ? 47 PHE S HE2  9  
ATOM 9437  H HZ   . PHE A 1 38 ? 2.531   -3.639  0.317   1.00 0.00 ? 47 PHE S HZ   9  
ATOM 9438  N N    . GLU A 1 39 ? 3.297   -2.377  -7.706  1.00 0.00 ? 48 GLU S N    9  
ATOM 9439  C CA   . GLU A 1 39 ? 4.349   -2.550  -8.703  1.00 0.00 ? 48 GLU S CA   9  
ATOM 9440  C C    . GLU A 1 39 ? 4.758   -1.213  -9.315  1.00 0.00 ? 48 GLU S C    9  
ATOM 9441  O O    . GLU A 1 39 ? 5.899   -1.039  -9.746  1.00 0.00 ? 48 GLU S O    9  
ATOM 9442  C CB   . GLU A 1 39 ? 3.890   -3.506  -9.805  1.00 0.00 ? 48 GLU S CB   9  
ATOM 9443  C CG   . GLU A 1 39 ? 3.889   -4.966  -9.382  1.00 0.00 ? 48 GLU S CG   9  
ATOM 9444  C CD   . GLU A 1 39 ? 4.779   -5.827  -10.258 1.00 0.00 ? 48 GLU S CD   9  
ATOM 9445  O OE1  . GLU A 1 39 ? 4.533   -5.882  -11.482 1.00 0.00 ? 48 GLU S OE1  9  
ATOM 9446  O OE2  . GLU A 1 39 ? 5.720   -6.447  -9.721  1.00 0.00 ? 48 GLU S OE2  9  
ATOM 9447  H H    . GLU A 1 39 ? 2.357   -2.576  -7.950  1.00 0.00 ? 48 GLU S H    9  
ATOM 9448  H HA   . GLU A 1 39 ? 5.207   -2.978  -8.207  1.00 0.00 ? 48 GLU S HA   9  
ATOM 9449  H HB2  . GLU A 1 39 ? 2.886   -3.238  -10.102 1.00 0.00 ? 48 GLU S HB2  9  
ATOM 9450  H HB3  . GLU A 1 39 ? 4.547   -3.399  -10.654 1.00 0.00 ? 48 GLU S HB3  9  
ATOM 9451  H HG2  . GLU A 1 39 ? 4.242   -5.033  -8.362  1.00 0.00 ? 48 GLU S HG2  9  
ATOM 9452  H HG3  . GLU A 1 39 ? 2.876   -5.344  -9.440  1.00 0.00 ? 48 GLU S HG3  9  
ATOM 9453  N N    . PHE A 1 40 ? 3.823   -0.272  -9.363  1.00 0.00 ? 49 PHE S N    9  
ATOM 9454  C CA   . PHE A 1 40 ? 4.095   1.042   -9.937  1.00 0.00 ? 49 PHE S CA   9  
ATOM 9455  C C    . PHE A 1 40 ? 4.602   2.019   -8.880  1.00 0.00 ? 49 PHE S C    9  
ATOM 9456  O O    . PHE A 1 40 ? 5.383   2.922   -9.185  1.00 0.00 ? 49 PHE S O    9  
ATOM 9457  C CB   . PHE A 1 40 ? 2.832   1.599   -10.596 1.00 0.00 ? 49 PHE S CB   9  
ATOM 9458  C CG   . PHE A 1 40 ? 3.104   2.705   -11.575 1.00 0.00 ? 49 PHE S CG   9  
ATOM 9459  C CD1  . PHE A 1 40 ? 3.481   2.418   -12.878 1.00 0.00 ? 49 PHE S CD1  9  
ATOM 9460  C CD2  . PHE A 1 40 ? 2.984   4.032   -11.192 1.00 0.00 ? 49 PHE S CD2  9  
ATOM 9461  C CE1  . PHE A 1 40 ? 3.731   3.434   -13.780 1.00 0.00 ? 49 PHE S CE1  9  
ATOM 9462  C CE2  . PHE A 1 40 ? 3.233   5.051   -12.090 1.00 0.00 ? 49 PHE S CE2  9  
ATOM 9463  C CZ   . PHE A 1 40 ? 3.607   4.753   -13.387 1.00 0.00 ? 49 PHE S CZ   9  
ATOM 9464  H H    . PHE A 1 40 ? 2.929   -0.467  -9.012  1.00 0.00 ? 49 PHE S H    9  
ATOM 9465  H HA   . PHE A 1 40 ? 4.856   0.920   -10.691 1.00 0.00 ? 49 PHE S HA   9  
ATOM 9466  H HB2  . PHE A 1 40 ? 2.330   0.803   -11.128 1.00 0.00 ? 49 PHE S HB2  9  
ATOM 9467  H HB3  . PHE A 1 40 ? 2.175   1.986   -9.829  1.00 0.00 ? 49 PHE S HB3  9  
ATOM 9468  H HD1  . PHE A 1 40 ? 3.578   1.388   -13.186 1.00 0.00 ? 49 PHE S HD1  9  
ATOM 9469  H HD2  . PHE A 1 40 ? 2.692   4.266   -10.179 1.00 0.00 ? 49 PHE S HD2  9  
ATOM 9470  H HE1  . PHE A 1 40 ? 4.024   3.198   -14.792 1.00 0.00 ? 49 PHE S HE1  9  
ATOM 9471  H HE2  . PHE A 1 40 ? 3.134   6.082   -11.780 1.00 0.00 ? 49 PHE S HE2  9  
ATOM 9472  H HZ   . PHE A 1 40 ? 3.803   5.548   -14.090 1.00 0.00 ? 49 PHE S HZ   9  
ATOM 9473  N N    . ALA A 1 41 ? 4.146   1.848   -7.644  1.00 0.00 ? 50 ALA S N    9  
ATOM 9474  C CA   . ALA A 1 41 ? 4.551   2.733   -6.556  1.00 0.00 ? 50 ALA S CA   9  
ATOM 9475  C C    . ALA A 1 41 ? 5.645   2.118   -5.685  1.00 0.00 ? 50 ALA S C    9  
ATOM 9476  O O    . ALA A 1 41 ? 6.356   2.833   -4.981  1.00 0.00 ? 50 ALA S O    9  
ATOM 9477  C CB   . ALA A 1 41 ? 3.346   3.096   -5.703  1.00 0.00 ? 50 ALA S CB   9  
ATOM 9478  H H    . ALA A 1 41 ? 3.518   1.121   -7.461  1.00 0.00 ? 50 ALA S H    9  
ATOM 9479  H HA   . ALA A 1 41 ? 4.930   3.644   -6.997  1.00 0.00 ? 50 ALA S HA   9  
ATOM 9480  H HB1  . ALA A 1 41 ? 2.516   3.357   -6.345  1.00 0.00 ? 50 ALA S HB1  9  
ATOM 9481  H HB2  . ALA A 1 41 ? 3.591   3.938   -5.072  1.00 0.00 ? 50 ALA S HB2  9  
ATOM 9482  H HB3  . ALA A 1 41 ? 3.073   2.252   -5.087  1.00 0.00 ? 50 ALA S HB3  9  
ATOM 9483  N N    . LEU A 1 42 ? 5.771   0.793   -5.714  1.00 0.00 ? 51 LEU S N    9  
ATOM 9484  C CA   . LEU A 1 42 ? 6.778   0.117   -4.900  1.00 0.00 ? 51 LEU S CA   9  
ATOM 9485  C C    . LEU A 1 42 ? 7.534   -0.966  -5.668  1.00 0.00 ? 51 LEU S C    9  
ATOM 9486  O O    . LEU A 1 42 ? 8.472   -1.561  -5.140  1.00 0.00 ? 51 LEU S O    9  
ATOM 9487  C CB   . LEU A 1 42 ? 6.120   -0.492  -3.663  1.00 0.00 ? 51 LEU S CB   9  
ATOM 9488  C CG   . LEU A 1 42 ? 6.079   0.429   -2.449  1.00 0.00 ? 51 LEU S CG   9  
ATOM 9489  C CD1  . LEU A 1 42 ? 5.065   -0.067  -1.428  1.00 0.00 ? 51 LEU S CD1  9  
ATOM 9490  C CD2  . LEU A 1 42 ? 7.462   0.539   -1.828  1.00 0.00 ? 51 LEU S CD2  9  
ATOM 9491  H H    . LEU A 1 42 ? 5.169   0.264   -6.280  1.00 0.00 ? 51 LEU S H    9  
ATOM 9492  H HA   . LEU A 1 42 ? 7.488   0.863   -4.576  1.00 0.00 ? 51 LEU S HA   9  
ATOM 9493  H HB2  . LEU A 1 42 ? 5.108   -0.769  -3.917  1.00 0.00 ? 51 LEU S HB2  9  
ATOM 9494  H HB3  . LEU A 1 42 ? 6.664   -1.385  -3.391  1.00 0.00 ? 51 LEU S HB3  9  
ATOM 9495  H HG   . LEU A 1 42 ? 5.777   1.415   -2.766  1.00 0.00 ? 51 LEU S HG   9  
ATOM 9496  H HD11 . LEU A 1 42 ? 4.502   0.772   -1.045  1.00 0.00 ? 51 LEU S HD11 9  
ATOM 9497  H HD12 . LEU A 1 42 ? 5.582   -0.552  -0.614  1.00 0.00 ? 51 LEU S HD12 9  
ATOM 9498  H HD13 . LEU A 1 42 ? 4.393   -0.766  -1.899  1.00 0.00 ? 51 LEU S HD13 9  
ATOM 9499  H HD21 . LEU A 1 42 ? 7.913   1.475   -2.118  1.00 0.00 ? 51 LEU S HD21 9  
ATOM 9500  H HD22 . LEU A 1 42 ? 8.074   -0.279  -2.174  1.00 0.00 ? 51 LEU S HD22 9  
ATOM 9501  H HD23 . LEU A 1 42 ? 7.379   0.494   -0.755  1.00 0.00 ? 51 LEU S HD23 9  
ATOM 9502  N N    . ASP A 1 43 ? 7.126   -1.230  -6.904  1.00 0.00 ? 52 ASP S N    9  
ATOM 9503  C CA   . ASP A 1 43 ? 7.781   -2.251  -7.712  1.00 0.00 ? 52 ASP S CA   9  
ATOM 9504  C C    . ASP A 1 43 ? 7.672   -3.631  -7.061  1.00 0.00 ? 52 ASP S C    9  
ATOM 9505  O O    . ASP A 1 43 ? 8.352   -4.571  -7.474  1.00 0.00 ? 52 ASP S O    9  
ATOM 9506  C CB   . ASP A 1 43 ? 9.253   -1.894  -7.927  1.00 0.00 ? 52 ASP S CB   9  
ATOM 9507  C CG   . ASP A 1 43 ? 9.460   -1.012  -9.143  1.00 0.00 ? 52 ASP S CG   9  
ATOM 9508  O OD1  . ASP A 1 43 ? 9.604   -1.559  -10.256 1.00 0.00 ? 52 ASP S OD1  9  
ATOM 9509  O OD2  . ASP A 1 43 ? 9.477   0.226   -8.982  1.00 0.00 ? 52 ASP S OD2  9  
ATOM 9510  H H    . ASP A 1 43 ? 6.372   -0.733  -7.282  1.00 0.00 ? 52 ASP S H    9  
ATOM 9511  H HA   . ASP A 1 43 ? 7.287   -2.282  -8.669  1.00 0.00 ? 52 ASP S HA   9  
ATOM 9512  H HB2  . ASP A 1 43 ? 9.620   -1.367  -7.057  1.00 0.00 ? 52 ASP S HB2  9  
ATOM 9513  H HB3  . ASP A 1 43 ? 9.821   -2.804  -8.064  1.00 0.00 ? 52 ASP S HB3  9  
ATOM 9514  N N    . MET A 1 44 ? 6.804   -3.758  -6.056  1.00 0.00 ? 53 MET S N    9  
ATOM 9515  C CA   . MET A 1 44 ? 6.609   -5.038  -5.381  1.00 0.00 ? 53 MET S CA   9  
ATOM 9516  C C    . MET A 1 44 ? 5.123   -5.349  -5.268  1.00 0.00 ? 53 MET S C    9  
ATOM 9517  O O    . MET A 1 44 ? 4.309   -4.710  -5.930  1.00 0.00 ? 53 MET S O    9  
ATOM 9518  C CB   . MET A 1 44 ? 7.267   -5.036  -4.002  1.00 0.00 ? 53 MET S CB   9  
ATOM 9519  C CG   . MET A 1 44 ? 8.276   -6.160  -3.820  1.00 0.00 ? 53 MET S CG   9  
ATOM 9520  S SD   . MET A 1 44 ? 9.703   -5.992  -4.909  1.00 0.00 ? 53 MET S SD   9  
ATOM 9521  C CE   . MET A 1 44 ? 10.480  -4.529  -4.229  1.00 0.00 ? 53 MET S CE   9  
ATOM 9522  H H    . MET A 1 44 ? 6.275   -2.979  -5.771  1.00 0.00 ? 53 MET S H    9  
ATOM 9523  H HA   . MET A 1 44 ? 7.072   -5.802  -5.990  1.00 0.00 ? 53 MET S HA   9  
ATOM 9524  H HB2  . MET A 1 44 ? 7.778   -4.093  -3.859  1.00 0.00 ? 53 MET S HB2  9  
ATOM 9525  H HB3  . MET A 1 44 ? 6.501   -5.142  -3.246  1.00 0.00 ? 53 MET S HB3  9  
ATOM 9526  H HG2  . MET A 1 44 ? 8.620   -6.160  -2.799  1.00 0.00 ? 53 MET S HG2  9  
ATOM 9527  H HG3  . MET A 1 44 ? 7.788   -7.099  -4.033  1.00 0.00 ? 53 MET S HG3  9  
ATOM 9528  H HE1  . MET A 1 44 ? 9.735   -3.764  -4.071  1.00 0.00 ? 53 MET S HE1  9  
ATOM 9529  H HE2  . MET A 1 44 ? 11.229  -4.165  -4.918  1.00 0.00 ? 53 MET S HE2  9  
ATOM 9530  H HE3  . MET A 1 44 ? 10.949  -4.776  -3.286  1.00 0.00 ? 53 MET S HE3  9  
ATOM 9531  N N    . THR A 1 45 ? 4.764   -6.328  -4.441  1.00 0.00 ? 54 THR S N    9  
ATOM 9532  C CA   . THR A 1 45 ? 3.363   -6.691  -4.273  1.00 0.00 ? 54 THR S CA   9  
ATOM 9533  C C    . THR A 1 45 ? 3.012   -6.840  -2.800  1.00 0.00 ? 54 THR S C    9  
ATOM 9534  O O    . THR A 1 45 ? 3.895   -7.009  -1.959  1.00 0.00 ? 54 THR S O    9  
ATOM 9535  C CB   . THR A 1 45 ? 3.053   -7.992  -5.016  1.00 0.00 ? 54 THR S CB   9  
ATOM 9536  O OG1  . THR A 1 45 ? 3.527   -9.111  -4.288  1.00 0.00 ? 54 THR S OG1  9  
ATOM 9537  C CG2  . THR A 1 45 ? 3.666   -8.052  -6.399  1.00 0.00 ? 54 THR S CG2  9  
ATOM 9538  H H    . THR A 1 45 ? 5.448   -6.814  -3.928  1.00 0.00 ? 54 THR S H    9  
ATOM 9539  H HA   . THR A 1 45 ? 2.763   -5.898  -4.693  1.00 0.00 ? 54 THR S HA   9  
ATOM 9540  H HB   . THR A 1 45 ? 1.982   -8.087  -5.125  1.00 0.00 ? 54 THR S HB   9  
ATOM 9541  H HG1  . THR A 1 45 ? 3.279   -9.919  -4.743  1.00 0.00 ? 54 THR S HG1  9  
ATOM 9542  H HG21 . THR A 1 45 ? 3.258   -8.895  -6.937  1.00 0.00 ? 54 THR S HG21 9  
ATOM 9543  H HG22 . THR A 1 45 ? 4.737   -8.163  -6.315  1.00 0.00 ? 54 THR S HG22 9  
ATOM 9544  H HG23 . THR A 1 45 ? 3.440   -7.141  -6.933  1.00 0.00 ? 54 THR S HG23 9  
ATOM 9545  N N    . ARG A 1 46 ? 1.722   -6.805  -2.493  1.00 0.00 ? 55 ARG S N    9  
ATOM 9546  C CA   . ARG A 1 46 ? 1.274   -6.969  -1.118  1.00 0.00 ? 55 ARG S CA   9  
ATOM 9547  C C    . ARG A 1 46 ? 1.687   -8.342  -0.602  1.00 0.00 ? 55 ARG S C    9  
ATOM 9548  O O    . ARG A 1 46 ? 1.867   -8.538  0.598   1.00 0.00 ? 55 ARG S O    9  
ATOM 9549  C CB   . ARG A 1 46 ? -0.243  -6.802  -1.019  1.00 0.00 ? 55 ARG S CB   9  
ATOM 9550  C CG   . ARG A 1 46 ? -0.727  -6.473  0.384   1.00 0.00 ? 55 ARG S CG   9  
ATOM 9551  C CD   . ARG A 1 46 ? -2.245  -6.465  0.465   1.00 0.00 ? 55 ARG S CD   9  
ATOM 9552  N NE   . ARG A 1 46 ? -2.734  -5.505  1.451   1.00 0.00 ? 55 ARG S NE   9  
ATOM 9553  C CZ   . ARG A 1 46 ? -3.944  -5.560  2.005   1.00 0.00 ? 55 ARG S CZ   9  
ATOM 9554  N NH1  . ARG A 1 46 ? -4.792  -6.526  1.669   1.00 0.00 ? 55 ARG S NH1  9  
ATOM 9555  N NH2  . ARG A 1 46 ? -4.306  -4.649  2.897   1.00 0.00 ? 55 ARG S NH2  9  
ATOM 9556  H H    . ARG A 1 46 ? 1.058   -6.689  -3.205  1.00 0.00 ? 55 ARG S H    9  
ATOM 9557  H HA   . ARG A 1 46 ? 1.756   -6.213  -0.516  1.00 0.00 ? 55 ARG S HA   9  
ATOM 9558  H HB2  . ARG A 1 46 ? -0.549  -6.004  -1.680  1.00 0.00 ? 55 ARG S HB2  9  
ATOM 9559  H HB3  . ARG A 1 46 ? -0.717  -7.722  -1.333  1.00 0.00 ? 55 ARG S HB3  9  
ATOM 9560  H HG2  . ARG A 1 46 ? -0.344  -7.214  1.070   1.00 0.00 ? 55 ARG S HG2  9  
ATOM 9561  H HG3  . ARG A 1 46 ? -0.355  -5.497  0.662   1.00 0.00 ? 55 ARG S HG3  9  
ATOM 9562  H HD2  . ARG A 1 46 ? -2.643  -6.206  -0.505  1.00 0.00 ? 55 ARG S HD2  9  
ATOM 9563  H HD3  . ARG A 1 46 ? -2.582  -7.453  0.740   1.00 0.00 ? 55 ARG S HD3  9  
ATOM 9564  H HE   . ARG A 1 46 ? -2.129  -4.781  1.715   1.00 0.00 ? 55 ARG S HE   9  
ATOM 9565  H HH11 . ARG A 1 46 ? -4.525  -7.216  0.997   1.00 0.00 ? 55 ARG S HH11 9  
ATOM 9566  H HH12 . ARG A 1 46 ? -5.697  -6.561  2.090   1.00 0.00 ? 55 ARG S HH12 9  
ATOM 9567  H HH21 . ARG A 1 46 ? -3.672  -3.918  3.151   1.00 0.00 ? 55 ARG S HH21 9  
ATOM 9568  H HH22 . ARG A 1 46 ? -5.214  -4.688  3.313   1.00 0.00 ? 55 ARG S HH22 9  
ATOM 9569  N N    . ASP A 1 47 ? 1.848   -9.283  -1.530  1.00 0.00 ? 56 ASP S N    9  
ATOM 9570  C CA   . ASP A 1 47 ? 2.251   -10.643 -1.197  1.00 0.00 ? 56 ASP S CA   9  
ATOM 9571  C C    . ASP A 1 47 ? 3.775   -10.786 -1.211  1.00 0.00 ? 56 ASP S C    9  
ATOM 9572  O O    . ASP A 1 47 ? 4.311   -11.809 -0.786  1.00 0.00 ? 56 ASP S O    9  
ATOM 9573  C CB   . ASP A 1 47 ? 1.627   -11.636 -2.179  1.00 0.00 ? 56 ASP S CB   9  
ATOM 9574  C CG   . ASP A 1 47 ? 0.140   -11.821 -1.948  1.00 0.00 ? 56 ASP S CG   9  
ATOM 9575  O OD1  . ASP A 1 47 ? -0.648  -11.002 -2.467  1.00 0.00 ? 56 ASP S OD1  9  
ATOM 9576  O OD2  . ASP A 1 47 ? -0.238  -12.784 -1.247  1.00 0.00 ? 56 ASP S OD2  9  
ATOM 9577  H H    . ASP A 1 47 ? 1.696   -9.053  -2.470  1.00 0.00 ? 56 ASP S H    9  
ATOM 9578  H HA   . ASP A 1 47 ? 1.891   -10.862 -0.203  1.00 0.00 ? 56 ASP S HA   9  
ATOM 9579  H HB2  . ASP A 1 47 ? 1.773   -11.277 -3.187  1.00 0.00 ? 56 ASP S HB2  9  
ATOM 9580  H HB3  . ASP A 1 47 ? 2.112   -12.596 -2.069  1.00 0.00 ? 56 ASP S HB3  9  
ATOM 9581  N N    . GLU A 1 48 ? 4.468   -9.754  -1.690  1.00 0.00 ? 57 GLU S N    9  
ATOM 9582  C CA   . GLU A 1 48 ? 5.923   -9.770  -1.743  1.00 0.00 ? 57 GLU S CA   9  
ATOM 9583  C C    . GLU A 1 48 ? 6.463   -9.088  -0.504  1.00 0.00 ? 57 GLU S C    9  
ATOM 9584  O O    . GLU A 1 48 ? 7.216   -9.671  0.275   1.00 0.00 ? 57 GLU S O    9  
ATOM 9585  C CB   . GLU A 1 48 ? 6.422   -9.051  -2.998  1.00 0.00 ? 57 GLU S CB   9  
ATOM 9586  C CG   . GLU A 1 48 ? 7.756   -9.571  -3.507  1.00 0.00 ? 57 GLU S CG   9  
ATOM 9587  C CD   . GLU A 1 48 ? 7.732   -11.059 -3.792  1.00 0.00 ? 57 GLU S CD   9  
ATOM 9588  O OE1  . GLU A 1 48 ? 7.397   -11.440 -4.934  1.00 0.00 ? 57 GLU S OE1  9  
ATOM 9589  O OE2  . GLU A 1 48 ? 8.046   -11.845 -2.873  1.00 0.00 ? 57 GLU S OE2  9  
ATOM 9590  H H    . GLU A 1 48 ? 3.994   -8.952  -1.996  1.00 0.00 ? 57 GLU S H    9  
ATOM 9591  H HA   . GLU A 1 48 ? 6.253   -10.798 -1.757  1.00 0.00 ? 57 GLU S HA   9  
ATOM 9592  H HB2  . GLU A 1 48 ? 5.689   -9.177  -3.785  1.00 0.00 ? 57 GLU S HB2  9  
ATOM 9593  H HB3  . GLU A 1 48 ? 6.529   -7.997  -2.777  1.00 0.00 ? 57 GLU S HB3  9  
ATOM 9594  H HG2  . GLU A 1 48 ? 8.008   -9.050  -4.418  1.00 0.00 ? 57 GLU S HG2  9  
ATOM 9595  H HG3  . GLU A 1 48 ? 8.512   -9.375  -2.761  1.00 0.00 ? 57 GLU S HG3  9  
ATOM 9596  N N    . TYR A 1 49 ? 6.029   -7.852  -0.317  1.00 0.00 ? 58 TYR S N    9  
ATOM 9597  C CA   . TYR A 1 49 ? 6.411   -7.071  0.840   1.00 0.00 ? 58 TYR S CA   9  
ATOM 9598  C C    . TYR A 1 49 ? 5.892   -7.753  2.098   1.00 0.00 ? 58 TYR S C    9  
ATOM 9599  O O    . TYR A 1 49 ? 6.490   -7.646  3.169   1.00 0.00 ? 58 TYR S O    9  
ATOM 9600  C CB   . TYR A 1 49 ? 5.824   -5.669  0.719   1.00 0.00 ? 58 TYR S CB   9  
ATOM 9601  C CG   . TYR A 1 49 ? 6.754   -4.676  0.054   1.00 0.00 ? 58 TYR S CG   9  
ATOM 9602  C CD1  . TYR A 1 49 ? 7.814   -5.108  -0.734  1.00 0.00 ? 58 TYR S CD1  9  
ATOM 9603  C CD2  . TYR A 1 49 ? 6.582   -3.308  0.228   1.00 0.00 ? 58 TYR S CD2  9  
ATOM 9604  C CE1  . TYR A 1 49 ? 8.674   -4.209  -1.330  1.00 0.00 ? 58 TYR S CE1  9  
ATOM 9605  C CE2  . TYR A 1 49 ? 7.442   -2.402  -0.365  1.00 0.00 ? 58 TYR S CE2  9  
ATOM 9606  C CZ   . TYR A 1 49 ? 8.484   -2.859  -1.142  1.00 0.00 ? 58 TYR S CZ   9  
ATOM 9607  O OH   . TYR A 1 49 ? 9.344   -1.964  -1.734  1.00 0.00 ? 58 TYR S OH   9  
ATOM 9608  H H    . TYR A 1 49 ? 5.405   -7.463  -0.967  1.00 0.00 ? 58 TYR S H    9  
ATOM 9609  H HA   . TYR A 1 49 ? 7.488   -7.014  0.877   1.00 0.00 ? 58 TYR S HA   9  
ATOM 9610  H HB2  . TYR A 1 49 ? 4.920   -5.720  0.126   1.00 0.00 ? 58 TYR S HB2  9  
ATOM 9611  H HB3  . TYR A 1 49 ? 5.581   -5.305  1.699   1.00 0.00 ? 58 TYR S HB3  9  
ATOM 9612  H HD1  . TYR A 1 49 ? 7.960   -6.168  -0.880  1.00 0.00 ? 58 TYR S HD1  9  
ATOM 9613  H HD2  . TYR A 1 49 ? 5.762   -2.952  0.836   1.00 0.00 ? 58 TYR S HD2  9  
ATOM 9614  H HE1  . TYR A 1 49 ? 9.491   -4.567  -1.939  1.00 0.00 ? 58 TYR S HE1  9  
ATOM 9615  H HE2  . TYR A 1 49 ? 7.294   -1.345  -0.218  1.00 0.00 ? 58 TYR S HE2  9  
ATOM 9616  H HH   . TYR A 1 49 ? 9.136   -1.888  -2.667  1.00 0.00 ? 58 TYR S HH   9  
ATOM 9617  N N    . ASN A 1 50 ? 4.775   -8.458  1.957   1.00 0.00 ? 59 ASN S N    9  
ATOM 9618  C CA   . ASN A 1 50 ? 4.172   -9.167  3.085   1.00 0.00 ? 59 ASN S CA   9  
ATOM 9619  C C    . ASN A 1 50 ? 5.197   -10.053 3.796   1.00 0.00 ? 59 ASN S C    9  
ATOM 9620  O O    . ASN A 1 50 ? 5.093   -10.293 4.999   1.00 0.00 ? 59 ASN S O    9  
ATOM 9621  C CB   . ASN A 1 50 ? 2.995   -10.024 2.613   1.00 0.00 ? 59 ASN S CB   9  
ATOM 9622  C CG   . ASN A 1 50 ? 1.660   -9.503  3.112   1.00 0.00 ? 59 ASN S CG   9  
ATOM 9623  O OD1  . ASN A 1 50 ? 0.778   -10.277 3.480   1.00 0.00 ? 59 ASN S OD1  9  
ATOM 9624  N ND2  . ASN A 1 50 ? 1.506   -8.183  3.126   1.00 0.00 ? 59 ASN S ND2  9  
ATOM 9625  H H    . ASN A 1 50 ? 4.347   -8.501  1.068   1.00 0.00 ? 59 ASN S H    9  
ATOM 9626  H HA   . ASN A 1 50 ? 3.810   -8.429  3.783   1.00 0.00 ? 59 ASN S HA   9  
ATOM 9627  H HB2  . ASN A 1 50 ? 2.978   -10.039 1.536   1.00 0.00 ? 59 ASN S HB2  9  
ATOM 9628  H HB3  . ASN A 1 50 ? 3.124   -11.033 2.978   1.00 0.00 ? 59 ASN S HB3  9  
ATOM 9629  H HD21 . ASN A 1 50 ? 2.250   -7.626  2.819   1.00 0.00 ? 59 ASN S HD21 9  
ATOM 9630  H HD22 . ASN A 1 50 ? 0.652   -7.822  3.443   1.00 0.00 ? 59 ASN S HD22 9  
ATOM 9631  N N    . ALA A 1 51 ? 6.179   -10.544 3.044   1.00 0.00 ? 60 ALA S N    9  
ATOM 9632  C CA   . ALA A 1 51 ? 7.210   -11.412 3.605   1.00 0.00 ? 60 ALA S CA   9  
ATOM 9633  C C    . ALA A 1 51 ? 8.550   -10.693 3.718   1.00 0.00 ? 60 ALA S C    9  
ATOM 9634  O O    . ALA A 1 51 ? 9.320   -10.942 4.646   1.00 0.00 ? 60 ALA S O    9  
ATOM 9635  C CB   . ALA A 1 51 ? 7.354   -12.668 2.761   1.00 0.00 ? 60 ALA S CB   9  
ATOM 9636  H H    . ALA A 1 51 ? 6.206   -10.324 2.089   1.00 0.00 ? 60 ALA S H    9  
ATOM 9637  H HA   . ALA A 1 51 ? 6.889   -11.710 4.593   1.00 0.00 ? 60 ALA S HA   9  
ATOM 9638  H HB1  . ALA A 1 51 ? 7.681   -12.398 1.767   1.00 0.00 ? 60 ALA S HB1  9  
ATOM 9639  H HB2  . ALA A 1 51 ? 6.401   -13.173 2.701   1.00 0.00 ? 60 ALA S HB2  9  
ATOM 9640  H HB3  . ALA A 1 51 ? 8.083   -13.325 3.214   1.00 0.00 ? 60 ALA S HB3  9  
ATOM 9641  N N    . LEU A 1 52 ? 8.826   -9.804  2.770   1.00 0.00 ? 61 LEU S N    9  
ATOM 9642  C CA   . LEU A 1 52 ? 10.074  -9.058  2.765   1.00 0.00 ? 61 LEU S CA   9  
ATOM 9643  C C    . LEU A 1 52 ? 10.208  -8.212  4.028   1.00 0.00 ? 61 LEU S C    9  
ATOM 9644  O O    . LEU A 1 52 ? 9.220   -7.931  4.708   1.00 0.00 ? 61 LEU S O    9  
ATOM 9645  C CB   . LEU A 1 52 ? 10.152  -8.163  1.526   1.00 0.00 ? 61 LEU S CB   9  
ATOM 9646  C CG   . LEU A 1 52 ? 10.911  -8.767  0.339   1.00 0.00 ? 61 LEU S CG   9  
ATOM 9647  C CD1  . LEU A 1 52 ? 10.046  -8.758  -0.914  1.00 0.00 ? 61 LEU S CD1  9  
ATOM 9648  C CD2  . LEU A 1 52 ? 12.210  -8.015  0.093   1.00 0.00 ? 61 LEU S CD2  9  
ATOM 9649  H H    . LEU A 1 52 ? 8.178   -9.650  2.057   1.00 0.00 ? 61 LEU S H    9  
ATOM 9650  H HA   . LEU A 1 52 ? 10.887  -9.769  2.736   1.00 0.00 ? 61 LEU S HA   9  
ATOM 9651  H HB2  . LEU A 1 52 ? 9.144   -7.941  1.207   1.00 0.00 ? 61 LEU S HB2  9  
ATOM 9652  H HB3  . LEU A 1 52 ? 10.638  -7.237  1.803   1.00 0.00 ? 61 LEU S HB3  9  
ATOM 9653  H HG   . LEU A 1 52 ? 11.157  -9.794  0.565   1.00 0.00 ? 61 LEU S HG   9  
ATOM 9654  H HD11 . LEU A 1 52 ? 10.320  -7.918  -1.534  1.00 0.00 ? 61 LEU S HD11 9  
ATOM 9655  H HD12 . LEU A 1 52 ? 9.006   -8.675  -0.632  1.00 0.00 ? 61 LEU S HD12 9  
ATOM 9656  H HD13 . LEU A 1 52 ? 10.198  -9.675  -1.462  1.00 0.00 ? 61 LEU S HD13 9  
ATOM 9657  H HD21 . LEU A 1 52 ? 13.010  -8.485  0.646   1.00 0.00 ? 61 LEU S HD21 9  
ATOM 9658  H HD22 . LEU A 1 52 ? 12.102  -6.991  0.420   1.00 0.00 ? 61 LEU S HD22 9  
ATOM 9659  H HD23 . LEU A 1 52 ? 12.443  -8.033  -0.961  1.00 0.00 ? 61 LEU S HD23 9  
ATOM 9660  N N    . PRO A 1 53 ? 11.441  -7.799  4.359   1.00 0.00 ? 62 PRO S N    9  
ATOM 9661  C CA   . PRO A 1 53 ? 11.719  -6.986  5.541   1.00 0.00 ? 62 PRO S CA   9  
ATOM 9662  C C    . PRO A 1 53 ? 10.710  -5.855  5.711   1.00 0.00 ? 62 PRO S C    9  
ATOM 9663  O O    . PRO A 1 53 ? 10.051  -5.454  4.753   1.00 0.00 ? 62 PRO S O    9  
ATOM 9664  C CB   . PRO A 1 53 ? 13.129  -6.426  5.292   1.00 0.00 ? 62 PRO S CB   9  
ATOM 9665  C CG   . PRO A 1 53 ? 13.563  -6.946  3.955   1.00 0.00 ? 62 PRO S CG   9  
ATOM 9666  C CD   . PRO A 1 53 ? 12.660  -8.096  3.607   1.00 0.00 ? 62 PRO S CD   9  
ATOM 9667  H HA   . PRO A 1 53 ? 11.727  -7.591  6.438   1.00 0.00 ? 62 PRO S HA   9  
ATOM 9668  H HB2  . PRO A 1 53 ? 13.091  -5.345  5.295   1.00 0.00 ? 62 PRO S HB2  9  
ATOM 9669  H HB3  . PRO A 1 53 ? 13.792  -6.766  6.077   1.00 0.00 ? 62 PRO S HB3  9  
ATOM 9670  H HG2  . PRO A 1 53 ? 13.469  -6.166  3.214   1.00 0.00 ? 62 PRO S HG2  9  
ATOM 9671  H HG3  . PRO A 1 53 ? 14.590  -7.283  4.013   1.00 0.00 ? 62 PRO S HG3  9  
ATOM 9672  H HD2  . PRO A 1 53 ? 12.461  -8.112  2.545   1.00 0.00 ? 62 PRO S HD2  9  
ATOM 9673  H HD3  . PRO A 1 53 ? 13.090  -9.033  3.927   1.00 0.00 ? 62 PRO S HD3  9  
ATOM 9674  N N    . ALA A 1 54 ? 10.582  -5.359  6.937   1.00 0.00 ? 63 ALA S N    9  
ATOM 9675  C CA   . ALA A 1 54 ? 9.636   -4.289  7.234   1.00 0.00 ? 63 ALA S CA   9  
ATOM 9676  C C    . ALA A 1 54 ? 10.249  -2.906  7.020   1.00 0.00 ? 63 ALA S C    9  
ATOM 9677  O O    . ALA A 1 54 ? 9.537   -1.948  6.728   1.00 0.00 ? 63 ALA S O    9  
ATOM 9678  C CB   . ALA A 1 54 ? 9.127   -4.422  8.661   1.00 0.00 ? 63 ALA S CB   9  
ATOM 9679  H H    . ALA A 1 54 ? 11.127  -5.729  7.663   1.00 0.00 ? 63 ALA S H    9  
ATOM 9680  H HA   . ALA A 1 54 ? 8.793   -4.399  6.569   1.00 0.00 ? 63 ALA S HA   9  
ATOM 9681  H HB1  . ALA A 1 54 ? 8.120   -4.034  8.720   1.00 0.00 ? 63 ALA S HB1  9  
ATOM 9682  H HB2  . ALA A 1 54 ? 9.769   -3.863  9.326   1.00 0.00 ? 63 ALA S HB2  9  
ATOM 9683  H HB3  . ALA A 1 54 ? 9.129   -5.463  8.947   1.00 0.00 ? 63 ALA S HB3  9  
ATOM 9684  N N    . TRP A 1 55 ? 11.566  -2.805  7.147   1.00 0.00 ? 64 TRP S N    9  
ATOM 9685  C CA   . TRP A 1 55 ? 12.248  -1.551  6.955   1.00 0.00 ? 64 TRP S CA   9  
ATOM 9686  C C    . TRP A 1 55 ? 12.651  -1.423  5.498   1.00 0.00 ? 64 TRP S C    9  
ATOM 9687  O O    . TRP A 1 55 ? 12.456  -0.384  4.880   1.00 0.00 ? 64 TRP S O    9  
ATOM 9688  C CB   . TRP A 1 55 ? 13.477  -1.470  7.872   1.00 0.00 ? 64 TRP S CB   9  
ATOM 9689  C CG   . TRP A 1 55 ? 14.761  -1.594  7.122   1.00 0.00 ? 64 TRP S CG   9  
ATOM 9690  C CD1  . TRP A 1 55 ? 15.631  -2.639  7.142   1.00 0.00 ? 64 TRP S CD1  9  
ATOM 9691  C CD2  . TRP A 1 55 ? 15.286  -0.642  6.204   1.00 0.00 ? 64 TRP S CD2  9  
ATOM 9692  N NE1  . TRP A 1 55 ? 16.685  -2.387  6.290   1.00 0.00 ? 64 TRP S NE1  9  
ATOM 9693  C CE2  . TRP A 1 55 ? 16.489  -1.162  5.700   1.00 0.00 ? 64 TRP S CE2  9  
ATOM 9694  C CE3  . TRP A 1 55 ? 14.846  0.606   5.762   1.00 0.00 ? 64 TRP S CE3  9  
ATOM 9695  C CZ2  . TRP A 1 55 ? 17.258  -0.471  4.768   1.00 0.00 ? 64 TRP S CZ2  9  
ATOM 9696  C CZ3  . TRP A 1 55 ? 15.604  1.287   4.840   1.00 0.00 ? 64 TRP S CZ3  9  
ATOM 9697  C CH2  . TRP A 1 55 ? 16.796  0.749   4.351   1.00 0.00 ? 64 TRP S CH2  9  
ATOM 9698  H H    . TRP A 1 55 ? 12.094  -3.591  7.349   1.00 0.00 ? 64 TRP S H    9  
ATOM 9699  H HA   . TRP A 1 55 ? 11.565  -0.753  7.204   1.00 0.00 ? 64 TRP S HA   9  
ATOM 9700  H HB2  . TRP A 1 55 ? 13.478  -0.517  8.386   1.00 0.00 ? 64 TRP S HB2  9  
ATOM 9701  H HB3  . TRP A 1 55 ? 13.432  -2.272  8.599   1.00 0.00 ? 64 TRP S HB3  9  
ATOM 9702  H HD1  . TRP A 1 55 ? 15.500  -3.524  7.746   1.00 0.00 ? 64 TRP S HD1  9  
ATOM 9703  H HE1  . TRP A 1 55 ? 17.443  -2.984  6.130   1.00 0.00 ? 64 TRP S HE1  9  
ATOM 9704  H HE3  . TRP A 1 55 ? 13.928  1.036   6.131   1.00 0.00 ? 64 TRP S HE3  9  
ATOM 9705  H HZ2  . TRP A 1 55 ? 18.181  -0.872  4.376   1.00 0.00 ? 64 TRP S HZ2  9  
ATOM 9706  H HZ3  . TRP A 1 55 ? 15.278  2.250   4.483   1.00 0.00 ? 64 TRP S HZ3  9  
ATOM 9707  H HH2  . TRP A 1 55 ? 17.344  1.317   3.623   1.00 0.00 ? 64 TRP S HH2  9  
ATOM 9708  N N    . LYS A 1 56 ? 13.217  -2.502  4.956   1.00 0.00 ? 65 LYS S N    9  
ATOM 9709  C CA   . LYS A 1 56 ? 13.642  -2.516  3.566   1.00 0.00 ? 65 LYS S CA   9  
ATOM 9710  C C    . LYS A 1 56 ? 12.441  -2.285  2.672   1.00 0.00 ? 65 LYS S C    9  
ATOM 9711  O O    . LYS A 1 56 ? 12.510  -1.527  1.704   1.00 0.00 ? 65 LYS S O    9  
ATOM 9712  C CB   . LYS A 1 56 ? 14.324  -3.841  3.217   1.00 0.00 ? 65 LYS S CB   9  
ATOM 9713  C CG   . LYS A 1 56 ? 15.720  -3.660  2.641   1.00 0.00 ? 65 LYS S CG   9  
ATOM 9714  C CD   . LYS A 1 56 ? 16.735  -4.549  3.343   1.00 0.00 ? 65 LYS S CD   9  
ATOM 9715  C CE   . LYS A 1 56 ? 18.136  -3.965  3.263   1.00 0.00 ? 65 LYS S CE   9  
ATOM 9716  N NZ   . LYS A 1 56 ? 19.181  -5.026  3.253   1.00 0.00 ? 65 LYS S NZ   9  
ATOM 9717  H H    . LYS A 1 56 ? 13.341  -3.304  5.502   1.00 0.00 ? 65 LYS S H    9  
ATOM 9718  H HA   . LYS A 1 56 ? 14.344  -1.707  3.425   1.00 0.00 ? 65 LYS S HA   9  
ATOM 9719  H HB2  . LYS A 1 56 ? 14.400  -4.442  4.115   1.00 0.00 ? 65 LYS S HB2  9  
ATOM 9720  H HB3  . LYS A 1 56 ? 13.721  -4.365  2.487   1.00 0.00 ? 65 LYS S HB3  9  
ATOM 9721  H HG2  . LYS A 1 56 ? 15.700  -3.915  1.590   1.00 0.00 ? 65 LYS S HG2  9  
ATOM 9722  H HG3  . LYS A 1 56 ? 16.016  -2.626  2.760   1.00 0.00 ? 65 LYS S HG3  9  
ATOM 9723  H HD2  . LYS A 1 56 ? 16.457  -4.647  4.382   1.00 0.00 ? 65 LYS S HD2  9  
ATOM 9724  H HD3  . LYS A 1 56 ? 16.733  -5.522  2.873   1.00 0.00 ? 65 LYS S HD3  9  
ATOM 9725  H HE2  . LYS A 1 56 ? 18.218  -3.383  2.356   1.00 0.00 ? 65 LYS S HE2  9  
ATOM 9726  H HE3  . LYS A 1 56 ? 18.294  -3.324  4.117   1.00 0.00 ? 65 LYS S HE3  9  
ATOM 9727  H HZ1  . LYS A 1 56 ? 18.818  -5.880  2.785   1.00 0.00 ? 65 LYS S HZ1  9  
ATOM 9728  H HZ2  . LYS A 1 56 ? 19.457  -5.265  4.227   1.00 0.00 ? 65 LYS S HZ2  9  
ATOM 9729  H HZ3  . LYS A 1 56 ? 20.022  -4.694  2.739   1.00 0.00 ? 65 LYS S HZ3  9  
ATOM 9730  N N    . GLN A 1 57 ? 11.320  -2.911  3.024   1.00 0.00 ? 66 GLN S N    9  
ATOM 9731  C CA   . GLN A 1 57 ? 10.102  -2.723  2.265   1.00 0.00 ? 66 GLN S CA   9  
ATOM 9732  C C    . GLN A 1 57 ? 9.714   -1.256  2.345   1.00 0.00 ? 66 GLN S C    9  
ATOM 9733  O O    . GLN A 1 57 ? 9.388   -0.633  1.335   1.00 0.00 ? 66 GLN S O    9  
ATOM 9734  C CB   . GLN A 1 57 ? 8.976   -3.621  2.784   1.00 0.00 ? 66 GLN S CB   9  
ATOM 9735  C CG   . GLN A 1 57 ? 8.472   -3.250  4.168   1.00 0.00 ? 66 GLN S CG   9  
ATOM 9736  C CD   . GLN A 1 57 ? 7.229   -4.026  4.569   1.00 0.00 ? 66 GLN S CD   9  
ATOM 9737  O OE1  . GLN A 1 57 ? 6.345   -3.494  5.242   1.00 0.00 ? 66 GLN S OE1  9  
ATOM 9738  N NE2  . GLN A 1 57 ? 7.154   -5.289  4.161   1.00 0.00 ? 66 GLN S NE2  9  
ATOM 9739  H H    . GLN A 1 57 ? 11.312  -3.481  3.822   1.00 0.00 ? 66 GLN S H    9  
ATOM 9740  H HA   . GLN A 1 57 ? 10.313  -2.972  1.236   1.00 0.00 ? 66 GLN S HA   9  
ATOM 9741  H HB2  . GLN A 1 57 ? 8.145   -3.568  2.099   1.00 0.00 ? 66 GLN S HB2  9  
ATOM 9742  H HB3  . GLN A 1 57 ? 9.335   -4.640  2.818   1.00 0.00 ? 66 GLN S HB3  9  
ATOM 9743  H HG2  . GLN A 1 57 ? 9.251   -3.450  4.886   1.00 0.00 ? 66 GLN S HG2  9  
ATOM 9744  H HG3  . GLN A 1 57 ? 8.238   -2.195  4.177   1.00 0.00 ? 66 GLN S HG3  9  
ATOM 9745  H HE21 . GLN A 1 57 ? 7.891   -5.651  3.628   1.00 0.00 ? 66 GLN S HE21 9  
ATOM 9746  H HE22 . GLN A 1 57 ? 6.360   -5.807  4.409   1.00 0.00 ? 66 GLN S HE22 9  
ATOM 9747  N N    . VAL A 1 58 ? 9.807   -0.693  3.553   1.00 0.00 ? 67 VAL S N    9  
ATOM 9748  C CA   . VAL A 1 58 ? 9.516   0.718   3.750   1.00 0.00 ? 67 VAL S CA   9  
ATOM 9749  C C    . VAL A 1 58 ? 10.548  1.541   2.991   1.00 0.00 ? 67 VAL S C    9  
ATOM 9750  O O    . VAL A 1 58 ? 10.212  2.549   2.367   1.00 0.00 ? 67 VAL S O    9  
ATOM 9751  C CB   . VAL A 1 58 ? 9.529   1.119   5.241   1.00 0.00 ? 67 VAL S CB   9  
ATOM 9752  C CG1  . VAL A 1 58 ? 9.337   2.624   5.404   1.00 0.00 ? 67 VAL S CG1  9  
ATOM 9753  C CG2  . VAL A 1 58 ? 8.455   0.362   6.006   1.00 0.00 ? 67 VAL S CG2  9  
ATOM 9754  H H    . VAL A 1 58 ? 10.109  -1.232  4.317   1.00 0.00 ? 67 VAL S H    9  
ATOM 9755  H HA   . VAL A 1 58 ? 8.535   0.924   3.344   1.00 0.00 ? 67 VAL S HA   9  
ATOM 9756  H HB   . VAL A 1 58 ? 10.490  0.855   5.657   1.00 0.00 ? 67 VAL S HB   9  
ATOM 9757  H HG11 . VAL A 1 58 ? 9.226   3.080   4.431   1.00 0.00 ? 67 VAL S HG11 9  
ATOM 9758  H HG12 . VAL A 1 58 ? 10.199  3.044   5.900   1.00 0.00 ? 67 VAL S HG12 9  
ATOM 9759  H HG13 . VAL A 1 58 ? 8.453   2.815   5.995   1.00 0.00 ? 67 VAL S HG13 9  
ATOM 9760  H HG21 . VAL A 1 58 ? 8.225   -0.558  5.487   1.00 0.00 ? 67 VAL S HG21 9  
ATOM 9761  H HG22 . VAL A 1 58 ? 7.566   0.970   6.073   1.00 0.00 ? 67 VAL S HG22 9  
ATOM 9762  H HG23 . VAL A 1 58 ? 8.812   0.136   6.999   1.00 0.00 ? 67 VAL S HG23 9  
ATOM 9763  N N    . ASN A 1 59 ? 11.812  1.095   3.037   1.00 0.00 ? 68 ASN S N    9  
ATOM 9764  C CA   . ASN A 1 59 ? 12.891  1.788   2.333   1.00 0.00 ? 68 ASN S CA   9  
ATOM 9765  C C    . ASN A 1 59 ? 12.444  2.237   0.942   1.00 0.00 ? 68 ASN S C    9  
ATOM 9766  O O    . ASN A 1 59 ? 12.692  3.374   0.534   1.00 0.00 ? 68 ASN S O    9  
ATOM 9767  C CB   . ASN A 1 59 ? 14.107  0.872   2.200   1.00 0.00 ? 68 ASN S CB   9  
ATOM 9768  C CG   . ASN A 1 59 ? 15.378  1.641   1.896   1.00 0.00 ? 68 ASN S CG   9  
ATOM 9769  O OD1  . ASN A 1 59 ? 15.538  2.789   2.311   1.00 0.00 ? 68 ASN S OD1  9  
ATOM 9770  N ND2  . ASN A 1 59 ? 16.292  1.011   1.167   1.00 0.00 ? 68 ASN S ND2  9  
ATOM 9771  H H    . ASN A 1 59 ? 12.026  0.270   3.558   1.00 0.00 ? 68 ASN S H    9  
ATOM 9772  H HA   . ASN A 1 59 ? 13.165  2.656   2.913   1.00 0.00 ? 68 ASN S HA   9  
ATOM 9773  H HB2  . ASN A 1 59 ? 14.246  0.327   3.120   1.00 0.00 ? 68 ASN S HB2  9  
ATOM 9774  H HB3  . ASN A 1 59 ? 13.933  0.170   1.397   1.00 0.00 ? 68 ASN S HB3  9  
ATOM 9775  H HD21 . ASN A 1 59 ? 16.098  0.097   0.870   1.00 0.00 ? 68 ASN S HD21 9  
ATOM 9776  H HD22 . ASN A 1 59 ? 17.123  1.484   0.955   1.00 0.00 ? 68 ASN S HD22 9  
ATOM 9777  N N    . LEU A 1 60 ? 11.786  1.335   0.218   1.00 0.00 ? 69 LEU S N    9  
ATOM 9778  C CA   . LEU A 1 60 ? 11.310  1.638   -1.126  1.00 0.00 ? 69 LEU S CA   9  
ATOM 9779  C C    . LEU A 1 60 ? 10.024  2.456   -1.086  1.00 0.00 ? 69 LEU S C    9  
ATOM 9780  O O    . LEU A 1 60 ? 9.769   3.263   -1.980  1.00 0.00 ? 69 LEU S O    9  
ATOM 9781  C CB   . LEU A 1 60 ? 11.088  0.346   -1.919  1.00 0.00 ? 69 LEU S CB   9  
ATOM 9782  C CG   . LEU A 1 60 ? 11.563  0.389   -3.373  1.00 0.00 ? 69 LEU S CG   9  
ATOM 9783  C CD1  . LEU A 1 60 ? 13.002  0.878   -3.457  1.00 0.00 ? 69 LEU S CD1  9  
ATOM 9784  C CD2  . LEU A 1 60 ? 11.430  -0.983  -4.017  1.00 0.00 ? 69 LEU S CD2  9  
ATOM 9785  H H    . LEU A 1 60 ? 11.617  0.447   0.597   1.00 0.00 ? 69 LEU S H    9  
ATOM 9786  H HA   . LEU A 1 60 ? 12.072  2.220   -1.618  1.00 0.00 ? 69 LEU S HA   9  
ATOM 9787  H HB2  . LEU A 1 60 ? 11.611  -0.456  -1.413  1.00 0.00 ? 69 LEU S HB2  9  
ATOM 9788  H HB3  . LEU A 1 60 ? 10.031  0.124   -1.916  1.00 0.00 ? 69 LEU S HB3  9  
ATOM 9789  H HG   . LEU A 1 60 ? 10.944  1.079   -3.926  1.00 0.00 ? 69 LEU S HG   9  
ATOM 9790  H HD11 . LEU A 1 60 ? 13.424  0.594   -4.410  1.00 0.00 ? 69 LEU S HD11 9  
ATOM 9791  H HD12 . LEU A 1 60 ? 13.579  0.432   -2.661  1.00 0.00 ? 69 LEU S HD12 9  
ATOM 9792  H HD13 . LEU A 1 60 ? 13.023  1.953   -3.358  1.00 0.00 ? 69 LEU S HD13 9  
ATOM 9793  H HD21 . LEU A 1 60 ? 11.971  -1.710  -3.428  1.00 0.00 ? 69 LEU S HD21 9  
ATOM 9794  H HD22 . LEU A 1 60 ? 11.839  -0.954  -5.016  1.00 0.00 ? 69 LEU S HD22 9  
ATOM 9795  H HD23 . LEU A 1 60 ? 10.387  -1.259  -4.062  1.00 0.00 ? 69 LEU S HD23 9  
ATOM 9796  N N    . LYS A 1 61 ? 9.219   2.259   -0.043  1.00 0.00 ? 70 LYS S N    9  
ATOM 9797  C CA   . LYS A 1 61 ? 7.973   3.003   0.093   1.00 0.00 ? 70 LYS S CA   9  
ATOM 9798  C C    . LYS A 1 61 ? 8.259   4.501   0.070   1.00 0.00 ? 70 LYS S C    9  
ATOM 9799  O O    . LYS A 1 61 ? 7.650   5.250   -0.693  1.00 0.00 ? 70 LYS S O    9  
ATOM 9800  C CB   . LYS A 1 61 ? 7.250   2.621   1.393   1.00 0.00 ? 70 LYS S CB   9  
ATOM 9801  C CG   . LYS A 1 61 ? 6.786   1.173   1.445   1.00 0.00 ? 70 LYS S CG   9  
ATOM 9802  C CD   . LYS A 1 61 ? 6.140   0.844   2.783   1.00 0.00 ? 70 LYS S CD   9  
ATOM 9803  C CE   . LYS A 1 61 ? 6.315   -0.622  3.149   1.00 0.00 ? 70 LYS S CE   9  
ATOM 9804  N NZ   . LYS A 1 61 ? 6.005   -0.872  4.585   1.00 0.00 ? 70 LYS S NZ   9  
ATOM 9805  H H    . LYS A 1 61 ? 9.473   1.612   0.648   1.00 0.00 ? 70 LYS S H    9  
ATOM 9806  H HA   . LYS A 1 61 ? 7.342   2.756   -0.747  1.00 0.00 ? 70 LYS S HA   9  
ATOM 9807  H HB2  . LYS A 1 61 ? 7.920   2.790   2.226   1.00 0.00 ? 70 LYS S HB2  9  
ATOM 9808  H HB3  . LYS A 1 61 ? 6.376   3.255   1.507   1.00 0.00 ? 70 LYS S HB3  9  
ATOM 9809  H HG2  . LYS A 1 61 ? 6.065   1.008   0.658   1.00 0.00 ? 70 LYS S HG2  9  
ATOM 9810  H HG3  . LYS A 1 61 ? 7.637   0.529   1.297   1.00 0.00 ? 70 LYS S HG3  9  
ATOM 9811  H HD2  . LYS A 1 61 ? 6.599   1.446   3.549   1.00 0.00 ? 70 LYS S HD2  9  
ATOM 9812  H HD3  . LYS A 1 61 ? 5.085   1.070   2.727   1.00 0.00 ? 70 LYS S HD3  9  
ATOM 9813  H HE2  . LYS A 1 61 ? 5.652   -1.213  2.536   1.00 0.00 ? 70 LYS S HE2  9  
ATOM 9814  H HE3  . LYS A 1 61 ? 7.337   -0.908  2.954   1.00 0.00 ? 70 LYS S HE3  9  
ATOM 9815  H HZ1  . LYS A 1 61 ? 6.627   -1.614  4.962   1.00 0.00 ? 70 LYS S HZ1  9  
ATOM 9816  H HZ2  . LYS A 1 61 ? 5.018   -1.178  4.691   1.00 0.00 ? 70 LYS S HZ2  9  
ATOM 9817  H HZ3  . LYS A 1 61 ? 6.147   -0.004  5.138   1.00 0.00 ? 70 LYS S HZ3  9  
ATOM 9818  N N    . LYS A 1 62 ? 9.202   4.927   0.907   1.00 0.00 ? 71 LYS S N    9  
ATOM 9819  C CA   . LYS A 1 62 ? 9.584   6.333   0.983   1.00 0.00 ? 71 LYS S CA   9  
ATOM 9820  C C    . LYS A 1 62 ? 10.147  6.812   -0.351  1.00 0.00 ? 71 LYS S C    9  
ATOM 9821  O O    . LYS A 1 62 ? 9.836   7.910   -0.810  1.00 0.00 ? 71 LYS S O    9  
ATOM 9822  C CB   . LYS A 1 62 ? 10.627  6.545   2.084   1.00 0.00 ? 71 LYS S CB   9  
ATOM 9823  C CG   . LYS A 1 62 ? 10.143  6.161   3.472   1.00 0.00 ? 71 LYS S CG   9  
ATOM 9824  C CD   . LYS A 1 62 ? 11.308  5.939   4.426   1.00 0.00 ? 71 LYS S CD   9  
ATOM 9825  C CE   . LYS A 1 62 ? 11.038  6.556   5.789   1.00 0.00 ? 71 LYS S CE   9  
ATOM 9826  N NZ   . LYS A 1 62 ? 11.942  7.706   6.066   1.00 0.00 ? 71 LYS S NZ   9  
ATOM 9827  H H    . LYS A 1 62 ? 9.653   4.278   1.485   1.00 0.00 ? 71 LYS S H    9  
ATOM 9828  H HA   . LYS A 1 62 ? 8.700   6.907   1.217   1.00 0.00 ? 71 LYS S HA   9  
ATOM 9829  H HB2  . LYS A 1 62 ? 11.500  5.951   1.854   1.00 0.00 ? 71 LYS S HB2  9  
ATOM 9830  H HB3  . LYS A 1 62 ? 10.907  7.588   2.100   1.00 0.00 ? 71 LYS S HB3  9  
ATOM 9831  H HG2  . LYS A 1 62 ? 9.521   6.955   3.857   1.00 0.00 ? 71 LYS S HG2  9  
ATOM 9832  H HG3  . LYS A 1 62 ? 9.567   5.250   3.403   1.00 0.00 ? 71 LYS S HG3  9  
ATOM 9833  H HD2  . LYS A 1 62 ? 11.464  4.877   4.546   1.00 0.00 ? 71 LYS S HD2  9  
ATOM 9834  H HD3  . LYS A 1 62 ? 12.194  6.390   4.005   1.00 0.00 ? 71 LYS S HD3  9  
ATOM 9835  H HE2  . LYS A 1 62 ? 10.013  6.899   5.821   1.00 0.00 ? 71 LYS S HE2  9  
ATOM 9836  H HE3  . LYS A 1 62 ? 11.189  5.799   6.547   1.00 0.00 ? 71 LYS S HE3  9  
ATOM 9837  H HZ1  . LYS A 1 62 ? 12.887  7.520   5.674   1.00 0.00 ? 71 LYS S HZ1  9  
ATOM 9838  H HZ2  . LYS A 1 62 ? 12.026  7.856   7.092   1.00 0.00 ? 71 LYS S HZ2  9  
ATOM 9839  H HZ3  . LYS A 1 62 ? 11.563  8.571   5.632   1.00 0.00 ? 71 LYS S HZ3  9  
ATOM 9840  N N    . ALA A 1 63 ? 10.985  5.979   -0.965  1.00 0.00 ? 72 ALA S N    9  
ATOM 9841  C CA   . ALA A 1 63 ? 11.604  6.314   -2.246  1.00 0.00 ? 72 ALA S CA   9  
ATOM 9842  C C    . ALA A 1 63 ? 10.582  6.859   -3.243  1.00 0.00 ? 72 ALA S C    9  
ATOM 9843  O O    . ALA A 1 63 ? 10.895  7.739   -4.044  1.00 0.00 ? 72 ALA S O    9  
ATOM 9844  C CB   . ALA A 1 63 ? 12.306  5.095   -2.824  1.00 0.00 ? 72 ALA S CB   9  
ATOM 9845  H H    . ALA A 1 63 ? 11.197  5.119   -0.544  1.00 0.00 ? 72 ALA S H    9  
ATOM 9846  H HA   . ALA A 1 63 ? 12.350  7.073   -2.064  1.00 0.00 ? 72 ALA S HA   9  
ATOM 9847  H HB1  . ALA A 1 63 ? 13.230  5.399   -3.291  1.00 0.00 ? 72 ALA S HB1  9  
ATOM 9848  H HB2  . ALA A 1 63 ? 11.668  4.627   -3.559  1.00 0.00 ? 72 ALA S HB2  9  
ATOM 9849  H HB3  . ALA A 1 63 ? 12.515  4.391   -2.031  1.00 0.00 ? 72 ALA S HB3  9  
ATOM 9850  N N    . LYS A 1 64 ? 9.363   6.331   -3.190  1.00 0.00 ? 73 LYS S N    9  
ATOM 9851  C CA   . LYS A 1 64 ? 8.304   6.772   -4.093  1.00 0.00 ? 73 LYS S CA   9  
ATOM 9852  C C    . LYS A 1 64 ? 7.513   7.933   -3.495  1.00 0.00 ? 73 LYS S C    9  
ATOM 9853  O O    . LYS A 1 64 ? 6.848   8.677   -4.217  1.00 0.00 ? 73 LYS S O    9  
ATOM 9854  C CB   . LYS A 1 64 ? 7.364   5.610   -4.421  1.00 0.00 ? 73 LYS S CB   9  
ATOM 9855  C CG   . LYS A 1 64 ? 6.889   5.610   -5.865  1.00 0.00 ? 73 LYS S CG   9  
ATOM 9856  C CD   . LYS A 1 64 ? 8.048   5.445   -6.836  1.00 0.00 ? 73 LYS S CD   9  
ATOM 9857  C CE   . LYS A 1 64 ? 8.101   4.039   -7.415  1.00 0.00 ? 73 LYS S CE   9  
ATOM 9858  N NZ   . LYS A 1 64 ? 7.724   4.016   -8.854  1.00 0.00 ? 73 LYS S NZ   9  
ATOM 9859  H H    . LYS A 1 64 ? 9.170   5.633   -2.531  1.00 0.00 ? 73 LYS S H    9  
ATOM 9860  H HA   . LYS A 1 64 ? 8.772   7.109   -5.006  1.00 0.00 ? 73 LYS S HA   9  
ATOM 9861  H HB2  . LYS A 1 64 ? 7.881   4.680   -4.233  1.00 0.00 ? 73 LYS S HB2  9  
ATOM 9862  H HB3  . LYS A 1 64 ? 6.497   5.672   -3.778  1.00 0.00 ? 73 LYS S HB3  9  
ATOM 9863  H HG2  . LYS A 1 64 ? 6.196   4.794   -6.005  1.00 0.00 ? 73 LYS S HG2  9  
ATOM 9864  H HG3  . LYS A 1 64 ? 6.390   6.546   -6.069  1.00 0.00 ? 73 LYS S HG3  9  
ATOM 9865  H HD2  . LYS A 1 64 ? 7.930   6.150   -7.644  1.00 0.00 ? 73 LYS S HD2  9  
ATOM 9866  H HD3  . LYS A 1 64 ? 8.973   5.645   -6.313  1.00 0.00 ? 73 LYS S HD3  9  
ATOM 9867  H HE2  . LYS A 1 64 ? 9.107   3.660   -7.309  1.00 0.00 ? 73 LYS S HE2  9  
ATOM 9868  H HE3  . LYS A 1 64 ? 7.419   3.409   -6.862  1.00 0.00 ? 73 LYS S HE3  9  
ATOM 9869  H HZ1  . LYS A 1 64 ? 7.168   4.862   -9.092  1.00 0.00 ? 73 LYS S HZ1  9  
ATOM 9870  H HZ2  . LYS A 1 64 ? 7.156   3.171   -9.061  1.00 0.00 ? 73 LYS S HZ2  9  
ATOM 9871  H HZ3  . LYS A 1 64 ? 8.579   3.998   -9.448  1.00 0.00 ? 73 LYS S HZ3  9  
ATOM 9872  N N    . GLY A 1 65 ? 7.590   8.087   -2.178  1.00 0.00 ? 74 GLY S N    9  
ATOM 9873  C CA   . GLY A 1 65 ? 6.879   9.166   -1.516  1.00 0.00 ? 74 GLY S CA   9  
ATOM 9874  C C    . GLY A 1 65 ? 5.736   8.678   -0.645  1.00 0.00 ? 74 GLY S C    9  
ATOM 9875  O O    . GLY A 1 65 ? 4.871   9.463   -0.254  1.00 0.00 ? 74 GLY S O    9  
ATOM 9876  H H    . GLY A 1 65 ? 8.135   7.468   -1.651  1.00 0.00 ? 74 GLY S H    9  
ATOM 9877  H HA2  . GLY A 1 65 ? 7.576   9.709   -0.895  1.00 0.00 ? 74 GLY S HA2  9  
ATOM 9878  H HA3  . GLY A 1 65 ? 6.483   9.836   -2.268  1.00 0.00 ? 74 GLY S HA3  9  
ATOM 9879  N N    . LEU A 1 66 ? 5.734   7.388   -0.327  1.00 0.00 ? 75 LEU S N    9  
ATOM 9880  C CA   . LEU A 1 66 ? 4.694   6.814   0.518   1.00 0.00 ? 75 LEU S CA   9  
ATOM 9881  C C    . LEU A 1 66 ? 5.261   6.489   1.894   1.00 0.00 ? 75 LEU S C    9  
ATOM 9882  O O    . LEU A 1 66 ? 4.920   7.134   2.884   1.00 0.00 ? 75 LEU S O    9  
ATOM 9883  C CB   . LEU A 1 66 ? 4.105   5.541   -0.108  1.00 0.00 ? 75 LEU S CB   9  
ATOM 9884  C CG   . LEU A 1 66 ? 4.315   5.378   -1.617  1.00 0.00 ? 75 LEU S CG   9  
ATOM 9885  C CD1  . LEU A 1 66 ? 4.533   3.915   -1.968  1.00 0.00 ? 75 LEU S CD1  9  
ATOM 9886  C CD2  . LEU A 1 66 ? 3.127   5.944   -2.385  1.00 0.00 ? 75 LEU S CD2  9  
ATOM 9887  H H    . LEU A 1 66 ? 6.455   6.811   -0.657  1.00 0.00 ? 75 LEU S H    9  
ATOM 9888  H HA   . LEU A 1 66 ? 3.913   7.551   0.626   1.00 0.00 ? 75 LEU S HA   9  
ATOM 9889  H HB2  . LEU A 1 66 ? 4.544   4.686   0.391   1.00 0.00 ? 75 LEU S HB2  9  
ATOM 9890  H HB3  . LEU A 1 66 ? 3.038   5.537   0.082   1.00 0.00 ? 75 LEU S HB3  9  
ATOM 9891  H HG   . LEU A 1 66 ? 5.198   5.926   -1.915  1.00 0.00 ? 75 LEU S HG   9  
ATOM 9892  H HD11 . LEU A 1 66 ? 5.592   3.706   -2.003  1.00 0.00 ? 75 LEU S HD11 9  
ATOM 9893  H HD12 . LEU A 1 66 ? 4.093   3.707   -2.933  1.00 0.00 ? 75 LEU S HD12 9  
ATOM 9894  H HD13 . LEU A 1 66 ? 4.066   3.292   -1.220  1.00 0.00 ? 75 LEU S HD13 9  
ATOM 9895  H HD21 . LEU A 1 66 ? 2.777   5.214   -3.100  1.00 0.00 ? 75 LEU S HD21 9  
ATOM 9896  H HD22 . LEU A 1 66 ? 3.430   6.840   -2.907  1.00 0.00 ? 75 LEU S HD22 9  
ATOM 9897  H HD23 . LEU A 1 66 ? 2.330   6.183   -1.695  1.00 0.00 ? 75 LEU S HD23 9  
ATOM 9898  N N    . PHE A 1 67 ? 6.135   5.480   1.923   1.00 0.00 ? 76 PHE S N    9  
ATOM 9899  C CA   . PHE A 1 67 ? 6.806   5.013   3.147   1.00 0.00 ? 76 PHE S CA   9  
ATOM 9900  C C    . PHE A 1 67 ? 6.087   3.807   3.753   1.00 0.00 ? 76 PHE S C    9  
ATOM 9901  O O    . PHE A 1 67 ? 6.589   3.269   4.763   1.00 0.00 ? 76 PHE S O    9  
ATOM 9902  C CB   . PHE A 1 67 ? 6.944   6.139   4.188   1.00 0.00 ? 76 PHE S CB   9  
ATOM 9903  C CG   . PHE A 1 67 ? 5.961   6.057   5.325   1.00 0.00 ? 76 PHE S CG   9  
ATOM 9904  C CD1  . PHE A 1 67 ? 4.654   5.644   5.109   1.00 0.00 ? 76 PHE S CD1  9  
ATOM 9905  C CD2  . PHE A 1 67 ? 6.349   6.379   6.613   1.00 0.00 ? 76 PHE S CD2  9  
ATOM 9906  C CE1  . PHE A 1 67 ? 3.759   5.552   6.148   1.00 0.00 ? 76 PHE S CE1  9  
ATOM 9907  C CE2  . PHE A 1 67 ? 5.458   6.291   7.662   1.00 0.00 ? 76 PHE S CE2  9  
ATOM 9908  C CZ   . PHE A 1 67 ? 4.162   5.876   7.431   1.00 0.00 ? 76 PHE S CZ   9  
ATOM 9909  O OXT  . PHE A 1 67 ? 5.027   3.420   3.220   1.00 0.00 ? 76 PHE S OXT  9  
ATOM 9910  H H    . PHE A 1 67 ? 6.340   5.028   1.077   1.00 0.00 ? 76 PHE S H    9  
ATOM 9911  H HA   . PHE A 1 67 ? 7.797   4.695   2.858   1.00 0.00 ? 76 PHE S HA   9  
ATOM 9912  H HB2  . PHE A 1 67 ? 7.936   6.094   4.614   1.00 0.00 ? 76 PHE S HB2  9  
ATOM 9913  H HB3  . PHE A 1 67 ? 6.816   7.094   3.702   1.00 0.00 ? 76 PHE S HB3  9  
ATOM 9914  H HD1  . PHE A 1 67 ? 4.337   5.390   4.107   1.00 0.00 ? 76 PHE S HD1  9  
ATOM 9915  H HD2  . PHE A 1 67 ? 7.364   6.703   6.794   1.00 0.00 ? 76 PHE S HD2  9  
ATOM 9916  H HE1  . PHE A 1 67 ? 2.747   5.217   5.959   1.00 0.00 ? 76 PHE S HE1  9  
ATOM 9917  H HE2  . PHE A 1 67 ? 5.775   6.544   8.661   1.00 0.00 ? 76 PHE S HE2  9  
ATOM 9918  H HZ   . PHE A 1 67 ? 3.467   5.806   8.250   1.00 0.00 ? 76 PHE S HZ   9  
ATOM 9919  N N    . MET A 1 1  ? -16.250 -1.182  8.013   1.00 0.00 ? 10 MET S N    10 
ATOM 9920  C CA   . MET A 1 1  ? -14.787 -0.939  8.109   1.00 0.00 ? 10 MET S CA   10 
ATOM 9921  C C    . MET A 1 1  ? -14.115 -1.968  9.013   1.00 0.00 ? 10 MET S C    10 
ATOM 9922  O O    . MET A 1 1  ? -13.233 -2.710  8.581   1.00 0.00 ? 10 MET S O    10 
ATOM 9923  C CB   . MET A 1 1  ? -14.560 0.474   8.652   1.00 0.00 ? 10 MET S CB   10 
ATOM 9924  C CG   . MET A 1 1  ? -13.582 1.293   7.827   1.00 0.00 ? 10 MET S CG   10 
ATOM 9925  S SD   . MET A 1 1  ? -12.156 1.851   8.782   1.00 0.00 ? 10 MET S SD   10 
ATOM 9926  C CE   . MET A 1 1  ? -11.004 0.513   8.481   1.00 0.00 ? 10 MET S CE   10 
ATOM 9927  H H1   . MET A 1 1  ? -16.686 -0.329  7.608   1.00 0.00 ? 10 MET S H1   10 
ATOM 9928  H H2   . MET A 1 1  ? -16.603 -1.366  8.974   1.00 0.00 ? 10 MET S H2   10 
ATOM 9929  H H3   . MET A 1 1  ? -16.395 -2.005  7.394   1.00 0.00 ? 10 MET S H3   10 
ATOM 9930  H HA   . MET A 1 1  ? -14.361 -1.011  7.119   1.00 0.00 ? 10 MET S HA   10 
ATOM 9931  H HB2  . MET A 1 1  ? -15.508 0.994   8.669   1.00 0.00 ? 10 MET S HB2  10 
ATOM 9932  H HB3  . MET A 1 1  ? -14.182 0.405   9.661   1.00 0.00 ? 10 MET S HB3  10 
ATOM 9933  H HG2  . MET A 1 1  ? -13.230 0.689   7.005   1.00 0.00 ? 10 MET S HG2  10 
ATOM 9934  H HG3  . MET A 1 1  ? -14.097 2.160   7.438   1.00 0.00 ? 10 MET S HG3  10 
ATOM 9935  H HE1  . MET A 1 1  ? -10.151 0.617   9.136   1.00 0.00 ? 10 MET S HE1  10 
ATOM 9936  H HE2  . MET A 1 1  ? -10.674 0.546   7.454   1.00 0.00 ? 10 MET S HE2  10 
ATOM 9937  H HE3  . MET A 1 1  ? -11.491 -0.433  8.671   1.00 0.00 ? 10 MET S HE3  10 
ATOM 9938  N N    . LEU A 1 2  ? -14.539 -2.006  10.273  1.00 0.00 ? 11 LEU S N    10 
ATOM 9939  C CA   . LEU A 1 2  ? -13.981 -2.944  11.240  1.00 0.00 ? 11 LEU S CA   10 
ATOM 9940  C C    . LEU A 1 2  ? -14.930 -4.115  11.473  1.00 0.00 ? 11 LEU S C    10 
ATOM 9941  O O    . LEU A 1 2  ? -14.495 -5.234  11.746  1.00 0.00 ? 11 LEU S O    10 
ATOM 9942  C CB   . LEU A 1 2  ? -13.694 -2.233  12.565  1.00 0.00 ? 11 LEU S CB   10 
ATOM 9943  C CG   . LEU A 1 2  ? -12.593 -1.173  12.506  1.00 0.00 ? 11 LEU S CG   10 
ATOM 9944  C CD1  . LEU A 1 2  ? -12.883 -0.047  13.485  1.00 0.00 ? 11 LEU S CD1  10 
ATOM 9945  C CD2  . LEU A 1 2  ? -11.236 -1.798  12.797  1.00 0.00 ? 11 LEU S CD2  10 
ATOM 9946  H H    . LEU A 1 2  ? -15.245 -1.389  10.559  1.00 0.00 ? 11 LEU S H    10 
ATOM 9947  H HA   . LEU A 1 2  ? -13.053 -3.322  10.836  1.00 0.00 ? 11 LEU S HA   10 
ATOM 9948  H HB2  . LEU A 1 2  ? -14.605 -1.758  12.897  1.00 0.00 ? 11 LEU S HB2  10 
ATOM 9949  H HB3  . LEU A 1 2  ? -13.408 -2.977  13.293  1.00 0.00 ? 11 LEU S HB3  10 
ATOM 9950  H HG   . LEU A 1 2  ? -12.560 -0.751  11.512  1.00 0.00 ? 11 LEU S HG   10 
ATOM 9951  H HD11 . LEU A 1 2  ? -13.485 0.707   12.999  1.00 0.00 ? 11 LEU S HD11 10 
ATOM 9952  H HD12 . LEU A 1 2  ? -11.954 0.393   13.815  1.00 0.00 ? 11 LEU S HD12 10 
ATOM 9953  H HD13 . LEU A 1 2  ? -13.417 -0.440  14.337  1.00 0.00 ? 11 LEU S HD13 10 
ATOM 9954  H HD21 . LEU A 1 2  ? -10.944 -2.426  11.967  1.00 0.00 ? 11 LEU S HD21 10 
ATOM 9955  H HD22 . LEU A 1 2  ? -11.300 -2.396  13.694  1.00 0.00 ? 11 LEU S HD22 10 
ATOM 9956  H HD23 . LEU A 1 2  ? -10.503 -1.019  12.934  1.00 0.00 ? 11 LEU S HD23 10 
ATOM 9957  N N    . ALA A 1 3  ? -16.227 -3.849  11.364  1.00 0.00 ? 12 ALA S N    10 
ATOM 9958  C CA   . ALA A 1 3  ? -17.238 -4.881  11.562  1.00 0.00 ? 12 ALA S CA   10 
ATOM 9959  C C    . ALA A 1 3  ? -17.132 -5.965  10.498  1.00 0.00 ? 12 ALA S C    10 
ATOM 9960  O O    . ALA A 1 3  ? -17.161 -7.158  10.805  1.00 0.00 ? 12 ALA S O    10 
ATOM 9961  C CB   . ALA A 1 3  ? -18.629 -4.264  11.554  1.00 0.00 ? 12 ALA S CB   10 
ATOM 9962  H H    . ALA A 1 3  ? -16.512 -2.938  11.143  1.00 0.00 ? 12 ALA S H    10 
ATOM 9963  H HA   . ALA A 1 3  ? -17.074 -5.326  12.534  1.00 0.00 ? 12 ALA S HA   10 
ATOM 9964  H HB1  . ALA A 1 3  ? -18.851 -3.890  10.566  1.00 0.00 ? 12 ALA S HB1  10 
ATOM 9965  H HB2  . ALA A 1 3  ? -18.666 -3.451  12.265  1.00 0.00 ? 12 ALA S HB2  10 
ATOM 9966  H HB3  . ALA A 1 3  ? -19.356 -5.014  11.828  1.00 0.00 ? 12 ALA S HB3  10 
ATOM 9967  N N    . LYS A 1 4  ? -17.009 -5.546  9.242   1.00 0.00 ? 13 LYS S N    10 
ATOM 9968  C CA   . LYS A 1 4  ? -16.898 -6.483  8.130   1.00 0.00 ? 13 LYS S CA   10 
ATOM 9969  C C    . LYS A 1 4  ? -15.493 -6.466  7.540   1.00 0.00 ? 13 LYS S C    10 
ATOM 9970  O O    . LYS A 1 4  ? -14.738 -5.514  7.737   1.00 0.00 ? 13 LYS S O    10 
ATOM 9971  C CB   . LYS A 1 4  ? -17.923 -6.143  7.046   1.00 0.00 ? 13 LYS S CB   10 
ATOM 9972  C CG   . LYS A 1 4  ? -19.358 -6.142  7.545   1.00 0.00 ? 13 LYS S CG   10 
ATOM 9973  C CD   . LYS A 1 4  ? -20.342 -5.898  6.411   1.00 0.00 ? 13 LYS S CD   10 
ATOM 9974  C CE   . LYS A 1 4  ? -21.565 -5.134  6.890   1.00 0.00 ? 13 LYS S CE   10 
ATOM 9975  N NZ   . LYS A 1 4  ? -22.040 -4.152  5.874   1.00 0.00 ? 13 LYS S NZ   10 
ATOM 9976  H H    . LYS A 1 4  ? -16.991 -4.583  9.059   1.00 0.00 ? 13 LYS S H    10 
ATOM 9977  H HA   . LYS A 1 4  ? -17.104 -7.473  8.509   1.00 0.00 ? 13 LYS S HA   10 
ATOM 9978  H HB2  . LYS A 1 4  ? -17.701 -5.162  6.652   1.00 0.00 ? 13 LYS S HB2  10 
ATOM 9979  H HB3  . LYS A 1 4  ? -17.842 -6.869  6.250   1.00 0.00 ? 13 LYS S HB3  10 
ATOM 9980  H HG2  . LYS A 1 4  ? -19.575 -7.100  7.994   1.00 0.00 ? 13 LYS S HG2  10 
ATOM 9981  H HG3  . LYS A 1 4  ? -19.471 -5.362  8.283   1.00 0.00 ? 13 LYS S HG3  10 
ATOM 9982  H HD2  . LYS A 1 4  ? -19.851 -5.325  5.640   1.00 0.00 ? 13 LYS S HD2  10 
ATOM 9983  H HD3  . LYS A 1 4  ? -20.656 -6.850  6.010   1.00 0.00 ? 13 LYS S HD3  10 
ATOM 9984  H HE2  . LYS A 1 4  ? -22.358 -5.839  7.092   1.00 0.00 ? 13 LYS S HE2  10 
ATOM 9985  H HE3  . LYS A 1 4  ? -21.313 -4.607  7.798   1.00 0.00 ? 13 LYS S HE3  10 
ATOM 9986  H HZ1  . LYS A 1 4  ? -22.824 -3.590  6.261   1.00 0.00 ? 13 LYS S HZ1  10 
ATOM 9987  H HZ2  . LYS A 1 4  ? -22.370 -4.650  5.023   1.00 0.00 ? 13 LYS S HZ2  10 
ATOM 9988  H HZ3  . LYS A 1 4  ? -21.266 -3.510  5.609   1.00 0.00 ? 13 LYS S HZ3  10 
ATOM 9989  N N    . LEU A 1 5  ? -15.146 -7.524  6.815   1.00 0.00 ? 14 LEU S N    10 
ATOM 9990  C CA   . LEU A 1 5  ? -13.831 -7.631  6.195   1.00 0.00 ? 14 LEU S CA   10 
ATOM 9991  C C    . LEU A 1 5  ? -13.936 -7.529  4.677   1.00 0.00 ? 14 LEU S C    10 
ATOM 9992  O O    . LEU A 1 5  ? -14.522 -8.393  4.025   1.00 0.00 ? 14 LEU S O    10 
ATOM 9993  C CB   . LEU A 1 5  ? -13.165 -8.953  6.583   1.00 0.00 ? 14 LEU S CB   10 
ATOM 9994  C CG   . LEU A 1 5  ? -13.183 -9.272  8.079   1.00 0.00 ? 14 LEU S CG   10 
ATOM 9995  C CD1  . LEU A 1 5  ? -14.561 -9.752  8.506   1.00 0.00 ? 14 LEU S CD1  10 
ATOM 9996  C CD2  . LEU A 1 5  ? -12.126 -10.314 8.412   1.00 0.00 ? 14 LEU S CD2  10 
ATOM 9997  H H    . LEU A 1 5  ? -15.792 -8.252  6.694   1.00 0.00 ? 14 LEU S H    10 
ATOM 9998  H HA   . LEU A 1 5  ? -13.226 -6.813  6.558   1.00 0.00 ? 14 LEU S HA   10 
ATOM 9999  H HB2  . LEU A 1 5  ? -13.670 -9.752  6.060   1.00 0.00 ? 14 LEU S HB2  10 
ATOM 10000 H HB3  . LEU A 1 5  ? -12.137 -8.924  6.256   1.00 0.00 ? 14 LEU S HB3  10 
ATOM 10001 H HG   . LEU A 1 5  ? -12.955 -8.373  8.635   1.00 0.00 ? 14 LEU S HG   10 
ATOM 10002 H HD11 . LEU A 1 5  ? -14.471 -10.364 9.390   1.00 0.00 ? 14 LEU S HD11 10 
ATOM 10003 H HD12 . LEU A 1 5  ? -15.002 -10.333 7.710   1.00 0.00 ? 14 LEU S HD12 10 
ATOM 10004 H HD13 . LEU A 1 5  ? -15.189 -8.899  8.721   1.00 0.00 ? 14 LEU S HD13 10 
ATOM 10005 H HD21 . LEU A 1 5  ? -12.422 -11.270 8.007   1.00 0.00 ? 14 LEU S HD21 10 
ATOM 10006 H HD22 . LEU A 1 5  ? -12.024 -10.394 9.485   1.00 0.00 ? 14 LEU S HD22 10 
ATOM 10007 H HD23 . LEU A 1 5  ? -11.180 -10.019 7.983   1.00 0.00 ? 14 LEU S HD23 10 
ATOM 10008 N N    . CYS A 1 6  ? -13.365 -6.465  4.119   1.00 0.00 ? 15 CYS S N    10 
ATOM 10009 C CA   . CYS A 1 6  ? -13.396 -6.249  2.678   1.00 0.00 ? 15 CYS S CA   10 
ATOM 10010 C C    . CYS A 1 6  ? -12.047 -5.745  2.172   1.00 0.00 ? 15 CYS S C    10 
ATOM 10011 O O    . CYS A 1 6  ? -11.475 -4.811  2.731   1.00 0.00 ? 15 CYS S O    10 
ATOM 10012 C CB   . CYS A 1 6  ? -14.495 -5.250  2.313   1.00 0.00 ? 15 CYS S CB   10 
ATOM 10013 S SG   . CYS A 1 6  ? -15.340 -5.615  0.758   1.00 0.00 ? 15 CYS S SG   10 
ATOM 10014 H H    . CYS A 1 6  ? -12.913 -5.810  4.691   1.00 0.00 ? 15 CYS S H    10 
ATOM 10015 H HA   . CYS A 1 6  ? -13.612 -7.196  2.206   1.00 0.00 ? 15 CYS S HA   10 
ATOM 10016 H HB2  . CYS A 1 6  ? -15.239 -5.244  3.096   1.00 0.00 ? 15 CYS S HB2  10 
ATOM 10017 H HB3  . CYS A 1 6  ? -14.062 -4.265  2.229   1.00 0.00 ? 15 CYS S HB3  10 
ATOM 10018 H HG   . CYS A 1 6  ? -14.841 -6.299  0.303   1.00 0.00 ? 15 CYS S HG   10 
ATOM 10019 N N    . LYS A 1 7  ? -11.546 -6.373  1.113   1.00 0.00 ? 16 LYS S N    10 
ATOM 10020 C CA   . LYS A 1 7  ? -10.265 -5.987  0.532   1.00 0.00 ? 16 LYS S CA   10 
ATOM 10021 C C    . LYS A 1 7  ? -10.468 -5.061  -0.661  1.00 0.00 ? 16 LYS S C    10 
ATOM 10022 O O    . LYS A 1 7  ? -11.004 -5.468  -1.692  1.00 0.00 ? 16 LYS S O    10 
ATOM 10023 C CB   . LYS A 1 7  ? -9.484  -7.229  0.101   1.00 0.00 ? 16 LYS S CB   10 
ATOM 10024 C CG   . LYS A 1 7  ? -8.987  -8.069  1.265   1.00 0.00 ? 16 LYS S CG   10 
ATOM 10025 C CD   . LYS A 1 7  ? -10.026 -9.087  1.702   1.00 0.00 ? 16 LYS S CD   10 
ATOM 10026 C CE   . LYS A 1 7  ? -9.578  -9.846  2.941   1.00 0.00 ? 16 LYS S CE   10 
ATOM 10027 N NZ   . LYS A 1 7  ? -8.413  -10.730 2.659   1.00 0.00 ? 16 LYS S NZ   10 
ATOM 10028 H H    . LYS A 1 7  ? -12.050 -7.111  0.712   1.00 0.00 ? 16 LYS S H    10 
ATOM 10029 H HA   . LYS A 1 7  ? -9.703  -5.463  1.289   1.00 0.00 ? 16 LYS S HA   10 
ATOM 10030 H HB2  . LYS A 1 7  ? -10.122 -7.847  -0.514  1.00 0.00 ? 16 LYS S HB2  10 
ATOM 10031 H HB3  . LYS A 1 7  ? -8.628  -6.918  -0.482  1.00 0.00 ? 16 LYS S HB3  10 
ATOM 10032 H HG2  . LYS A 1 7  ? -8.092  -8.593  0.963   1.00 0.00 ? 16 LYS S HG2  10 
ATOM 10033 H HG3  . LYS A 1 7  ? -8.761  -7.417  2.096   1.00 0.00 ? 16 LYS S HG3  10 
ATOM 10034 H HD2  . LYS A 1 7  ? -10.950 -8.572  1.923   1.00 0.00 ? 16 LYS S HD2  10 
ATOM 10035 H HD3  . LYS A 1 7  ? -10.188 -9.791  0.899   1.00 0.00 ? 16 LYS S HD3  10 
ATOM 10036 H HE2  . LYS A 1 7  ? -9.300  -9.133  3.703   1.00 0.00 ? 16 LYS S HE2  10 
ATOM 10037 H HE3  . LYS A 1 7  ? -10.401 -10.449 3.296   1.00 0.00 ? 16 LYS S HE3  10 
ATOM 10038 H HZ1  . LYS A 1 7  ? -7.766  -10.740 3.473   1.00 0.00 ? 16 LYS S HZ1  10 
ATOM 10039 H HZ2  . LYS A 1 7  ? -7.899  -10.388 1.822   1.00 0.00 ? 16 LYS S HZ2  10 
ATOM 10040 H HZ3  . LYS A 1 7  ? -8.738  -11.701 2.478   1.00 0.00 ? 16 LYS S HZ3  10 
ATOM 10041 N N    . THR A 1 8  ? -10.037 -3.812  -0.516  1.00 0.00 ? 17 THR S N    10 
ATOM 10042 C CA   . THR A 1 8  ? -10.175 -2.829  -1.583  1.00 0.00 ? 17 THR S CA   10 
ATOM 10043 C C    . THR A 1 8  ? -8.947  -1.926  -1.656  1.00 0.00 ? 17 THR S C    10 
ATOM 10044 O O    . THR A 1 8  ? -8.475  -1.418  -0.640  1.00 0.00 ? 17 THR S O    10 
ATOM 10045 C CB   . THR A 1 8  ? -11.430 -1.983  -1.367  1.00 0.00 ? 17 THR S CB   10 
ATOM 10046 O OG1  . THR A 1 8  ? -11.436 -0.863  -2.235  1.00 0.00 ? 17 THR S OG1  10 
ATOM 10047 C CG2  . THR A 1 8  ? -11.569 -1.467  0.049   1.00 0.00 ? 17 THR S CG2  10 
ATOM 10048 H H    . THR A 1 8  ? -9.619  -3.545  0.330   1.00 0.00 ? 17 THR S H    10 
ATOM 10049 H HA   . THR A 1 8  ? -10.268 -3.363  -2.517  1.00 0.00 ? 17 THR S HA   10 
ATOM 10050 H HB   . THR A 1 8  ? -12.300 -2.585  -1.586  1.00 0.00 ? 17 THR S HB   10 
ATOM 10051 H HG1  . THR A 1 8  ? -12.311 -0.757  -2.616  1.00 0.00 ? 17 THR S HG1  10 
ATOM 10052 H HG21 . THR A 1 8  ? -10.759 -0.785  0.263   1.00 0.00 ? 17 THR S HG21 10 
ATOM 10053 H HG22 . THR A 1 8  ? -11.532 -2.296  0.739   1.00 0.00 ? 17 THR S HG22 10 
ATOM 10054 H HG23 . THR A 1 8  ? -12.512 -0.951  0.154   1.00 0.00 ? 17 THR S HG23 10 
ATOM 10055 N N    . ILE A 1 9  ? -8.437  -1.733  -2.868  1.00 0.00 ? 18 ILE S N    10 
ATOM 10056 C CA   . ILE A 1 9  ? -7.265  -0.896  -3.082  1.00 0.00 ? 18 ILE S CA   10 
ATOM 10057 C C    . ILE A 1 9  ? -7.668  0.557   -3.331  1.00 0.00 ? 18 ILE S C    10 
ATOM 10058 O O    . ILE A 1 9  ? -8.488  0.844   -4.203  1.00 0.00 ? 18 ILE S O    10 
ATOM 10059 C CB   . ILE A 1 9  ? -6.429  -1.409  -4.278  1.00 0.00 ? 18 ILE S CB   10 
ATOM 10060 C CG1  . ILE A 1 9  ? -5.300  -0.426  -4.623  1.00 0.00 ? 18 ILE S CG1  10 
ATOM 10061 C CG2  . ILE A 1 9  ? -7.323  -1.660  -5.486  1.00 0.00 ? 18 ILE S CG2  10 
ATOM 10062 C CD1  . ILE A 1 9  ? -5.713  0.697   -5.548  1.00 0.00 ? 18 ILE S CD1  10 
ATOM 10063 H H    . ILE A 1 9  ? -8.856  -2.168  -3.638  1.00 0.00 ? 18 ILE S H    10 
ATOM 10064 H HA   . ILE A 1 9  ? -6.653  -0.943  -2.194  1.00 0.00 ? 18 ILE S HA   10 
ATOM 10065 H HB   . ILE A 1 9  ? -5.992  -2.355  -3.993  1.00 0.00 ? 18 ILE S HB   10 
ATOM 10066 H HG12 . ILE A 1 9  ? -4.936  0.021   -3.713  1.00 0.00 ? 18 ILE S HG12 10 
ATOM 10067 H HG13 . ILE A 1 9  ? -4.496  -0.967  -5.098  1.00 0.00 ? 18 ILE S HG13 10 
ATOM 10068 H HG21 . ILE A 1 9  ? -8.007  -0.834  -5.605  1.00 0.00 ? 18 ILE S HG21 10 
ATOM 10069 H HG22 . ILE A 1 9  ? -7.880  -2.574  -5.340  1.00 0.00 ? 18 ILE S HG22 10 
ATOM 10070 H HG23 . ILE A 1 9  ? -6.710  -1.749  -6.372  1.00 0.00 ? 18 ILE S HG23 10 
ATOM 10071 H HD11 . ILE A 1 9  ? -6.788  0.736   -5.614  1.00 0.00 ? 18 ILE S HD11 10 
ATOM 10072 H HD12 . ILE A 1 9  ? -5.298  0.524   -6.529  1.00 0.00 ? 18 ILE S HD12 10 
ATOM 10073 H HD13 . ILE A 1 9  ? -5.342  1.632   -5.160  1.00 0.00 ? 18 ILE S HD13 10 
ATOM 10074 N N    . TYR A 1 10 ? -7.074  1.468   -2.567  1.00 0.00 ? 19 TYR S N    10 
ATOM 10075 C CA   . TYR A 1 10 ? -7.357  2.890   -2.717  1.00 0.00 ? 19 TYR S CA   10 
ATOM 10076 C C    . TYR A 1 10 ? -6.391  3.500   -3.733  1.00 0.00 ? 19 TYR S C    10 
ATOM 10077 O O    . TYR A 1 10 ? -5.197  3.199   -3.716  1.00 0.00 ? 19 TYR S O    10 
ATOM 10078 C CB   . TYR A 1 10 ? -7.252  3.604   -1.360  1.00 0.00 ? 19 TYR S CB   10 
ATOM 10079 C CG   . TYR A 1 10 ? -8.468  3.401   -0.467  1.00 0.00 ? 19 TYR S CG   10 
ATOM 10080 C CD1  . TYR A 1 10 ? -9.415  2.424   -0.760  1.00 0.00 ? 19 TYR S CD1  10 
ATOM 10081 C CD2  . TYR A 1 10 ? -8.671  4.187   0.668   1.00 0.00 ? 19 TYR S CD2  10 
ATOM 10082 C CE1  . TYR A 1 10 ? -10.524 2.238   0.043   1.00 0.00 ? 19 TYR S CE1  10 
ATOM 10083 C CE2  . TYR A 1 10 ? -9.778  4.002   1.473   1.00 0.00 ? 19 TYR S CE2  10 
ATOM 10084 C CZ   . TYR A 1 10 ? -10.700 3.029   1.156   1.00 0.00 ? 19 TYR S CZ   10 
ATOM 10085 O OH   . TYR A 1 10 ? -11.804 2.844   1.958   1.00 0.00 ? 19 TYR S OH   10 
ATOM 10086 H H    . TYR A 1 10 ? -6.422  1.179   -1.896  1.00 0.00 ? 19 TYR S H    10 
ATOM 10087 H HA   . TYR A 1 10 ? -8.365  2.988   -3.092  1.00 0.00 ? 19 TYR S HA   10 
ATOM 10088 H HB2  . TYR A 1 10 ? -6.388  3.230   -0.830  1.00 0.00 ? 19 TYR S HB2  10 
ATOM 10089 H HB3  . TYR A 1 10 ? -7.137  4.666   -1.529  1.00 0.00 ? 19 TYR S HB3  10 
ATOM 10090 H HD1  . TYR A 1 10 ? -9.276  1.804   -1.633  1.00 0.00 ? 19 TYR S HD1  10 
ATOM 10091 H HD2  . TYR A 1 10 ? -7.951  4.952   0.924   1.00 0.00 ? 19 TYR S HD2  10 
ATOM 10092 H HE1  . TYR A 1 10 ? -11.246 1.474   -0.204  1.00 0.00 ? 19 TYR S HE1  10 
ATOM 10093 H HE2  . TYR A 1 10 ? -9.918  4.622   2.345   1.00 0.00 ? 19 TYR S HE2  10 
ATOM 10094 H HH   . TYR A 1 10 ? -11.728 2.005   2.417   1.00 0.00 ? 19 TYR S HH   10 
ATOM 10095 N N    . PRO A 1 11 ? -6.890  4.359   -4.643  1.00 0.00 ? 20 PRO S N    10 
ATOM 10096 C CA   . PRO A 1 11 ? -6.065  4.992   -5.676  1.00 0.00 ? 20 PRO S CA   10 
ATOM 10097 C C    . PRO A 1 11 ? -4.770  5.568   -5.122  1.00 0.00 ? 20 PRO S C    10 
ATOM 10098 O O    . PRO A 1 11 ? -4.777  6.564   -4.400  1.00 0.00 ? 20 PRO S O    10 
ATOM 10099 C CB   . PRO A 1 11 ? -6.963  6.110   -6.233  1.00 0.00 ? 20 PRO S CB   10 
ATOM 10100 C CG   . PRO A 1 11 ? -8.150  6.161   -5.328  1.00 0.00 ? 20 PRO S CG   10 
ATOM 10101 C CD   . PRO A 1 11 ? -8.288  4.783   -4.750  1.00 0.00 ? 20 PRO S CD   10 
ATOM 10102 H HA   . PRO A 1 11 ? -5.831  4.295   -6.467  1.00 0.00 ? 20 PRO S HA   10 
ATOM 10103 H HB2  . PRO A 1 11 ? -6.422  7.046   -6.223  1.00 0.00 ? 20 PRO S HB2  10 
ATOM 10104 H HB3  . PRO A 1 11 ? -7.253  5.869   -7.246  1.00 0.00 ? 20 PRO S HB3  10 
ATOM 10105 H HG2  . PRO A 1 11 ? -7.975  6.880   -4.543  1.00 0.00 ? 20 PRO S HG2  10 
ATOM 10106 H HG3  . PRO A 1 11 ? -9.033  6.422   -5.892  1.00 0.00 ? 20 PRO S HG3  10 
ATOM 10107 H HD2  . PRO A 1 11 ? -8.761  4.821   -3.778  1.00 0.00 ? 20 PRO S HD2  10 
ATOM 10108 H HD3  . PRO A 1 11 ? -8.838  4.139   -5.421  1.00 0.00 ? 20 PRO S HD3  10 
ATOM 10109 N N    . LEU A 1 12 ? -3.657  4.924   -5.464  1.00 0.00 ? 21 LEU S N    10 
ATOM 10110 C CA   . LEU A 1 12 ? -2.343  5.360   -5.003  1.00 0.00 ? 21 LEU S CA   10 
ATOM 10111 C C    . LEU A 1 12 ? -2.161  6.870   -5.142  1.00 0.00 ? 21 LEU S C    10 
ATOM 10112 O O    . LEU A 1 12 ? -1.513  7.497   -4.311  1.00 0.00 ? 21 LEU S O    10 
ATOM 10113 C CB   . LEU A 1 12 ? -1.240  4.644   -5.780  1.00 0.00 ? 21 LEU S CB   10 
ATOM 10114 C CG   . LEU A 1 12 ? -1.460  4.559   -7.293  1.00 0.00 ? 21 LEU S CG   10 
ATOM 10115 C CD1  . LEU A 1 12 ? -0.723  5.684   -8.002  1.00 0.00 ? 21 LEU S CD1  10 
ATOM 10116 C CD2  . LEU A 1 12 ? -1.009  3.207   -7.824  1.00 0.00 ? 21 LEU S CD2  10 
ATOM 10117 H H    . LEU A 1 12 ? -3.721  4.129   -6.039  1.00 0.00 ? 21 LEU S H    10 
ATOM 10118 H HA   . LEU A 1 12 ? -2.258  5.098   -3.962  1.00 0.00 ? 21 LEU S HA   10 
ATOM 10119 H HB2  . LEU A 1 12 ? -0.309  5.166   -5.602  1.00 0.00 ? 21 LEU S HB2  10 
ATOM 10120 H HB3  . LEU A 1 12 ? -1.151  3.639   -5.394  1.00 0.00 ? 21 LEU S HB3  10 
ATOM 10121 H HG   . LEU A 1 12 ? -2.514  4.668   -7.503  1.00 0.00 ? 21 LEU S HG   10 
ATOM 10122 H HD11 . LEU A 1 12 ? 0.341   5.554   -7.875  1.00 0.00 ? 21 LEU S HD11 10 
ATOM 10123 H HD12 . LEU A 1 12 ? -1.023  6.633   -7.580  1.00 0.00 ? 21 LEU S HD12 10 
ATOM 10124 H HD13 . LEU A 1 12 ? -0.965  5.667   -9.054  1.00 0.00 ? 21 LEU S HD13 10 
ATOM 10125 H HD21 . LEU A 1 12 ? -0.602  3.328   -8.818  1.00 0.00 ? 21 LEU S HD21 10 
ATOM 10126 H HD22 . LEU A 1 12 ? -1.853  2.534   -7.860  1.00 0.00 ? 21 LEU S HD22 10 
ATOM 10127 H HD23 . LEU A 1 12 ? -0.250  2.799   -7.173  1.00 0.00 ? 21 LEU S HD23 10 
ATOM 10128 N N    . ALA A 1 13 ? -2.727  7.447   -6.197  1.00 0.00 ? 22 ALA S N    10 
ATOM 10129 C CA   . ALA A 1 13 ? -2.607  8.884   -6.436  1.00 0.00 ? 22 ALA S CA   10 
ATOM 10130 C C    . ALA A 1 13 ? -3.345  9.685   -5.371  1.00 0.00 ? 22 ALA S C    10 
ATOM 10131 O O    . ALA A 1 13 ? -2.789  10.600  -4.764  1.00 0.00 ? 22 ALA S O    10 
ATOM 10132 C CB   . ALA A 1 13 ? -3.132  9.234   -7.819  1.00 0.00 ? 22 ALA S CB   10 
ATOM 10133 H H    . ALA A 1 13 ? -3.234  6.897   -6.832  1.00 0.00 ? 22 ALA S H    10 
ATOM 10134 H HA   . ALA A 1 13 ? -1.558  9.140   -6.400  1.00 0.00 ? 22 ALA S HA   10 
ATOM 10135 H HB1  . ALA A 1 13 ? -4.044  8.686   -8.008  1.00 0.00 ? 22 ALA S HB1  10 
ATOM 10136 H HB2  . ALA A 1 13 ? -2.394  8.972   -8.563  1.00 0.00 ? 22 ALA S HB2  10 
ATOM 10137 H HB3  . ALA A 1 13 ? -3.333  10.295  -7.871  1.00 0.00 ? 22 ALA S HB3  10 
ATOM 10138 N N    . ASP A 1 14 ? -4.602  9.328   -5.154  1.00 0.00 ? 23 ASP S N    10 
ATOM 10139 C CA   . ASP A 1 14 ? -5.445  9.996   -4.168  1.00 0.00 ? 23 ASP S CA   10 
ATOM 10140 C C    . ASP A 1 14 ? -4.808  9.999   -2.779  1.00 0.00 ? 23 ASP S C    10 
ATOM 10141 O O    . ASP A 1 14 ? -5.203  10.768  -1.907  1.00 0.00 ? 23 ASP S O    10 
ATOM 10142 C CB   . ASP A 1 14 ? -6.793  9.288   -4.100  1.00 0.00 ? 23 ASP S CB   10 
ATOM 10143 C CG   . ASP A 1 14 ? -7.941  10.175  -4.539  1.00 0.00 ? 23 ASP S CG   10 
ATOM 10144 O OD1  . ASP A 1 14 ? -8.052  10.444  -5.754  1.00 0.00 ? 23 ASP S OD1  10 
ATOM 10145 O OD2  . ASP A 1 14 ? -8.729  10.601  -3.669  1.00 0.00 ? 23 ASP S OD2  10 
ATOM 10146 H H    . ASP A 1 14 ? -4.979  8.589   -5.675  1.00 0.00 ? 23 ASP S H    10 
ATOM 10147 H HA   . ASP A 1 14 ? -5.600  11.010  -4.491  1.00 0.00 ? 23 ASP S HA   10 
ATOM 10148 H HB2  . ASP A 1 14 ? -6.760  8.421   -4.743  1.00 0.00 ? 23 ASP S HB2  10 
ATOM 10149 H HB3  . ASP A 1 14 ? -6.970  8.970   -3.081  1.00 0.00 ? 23 ASP S HB3  10 
ATOM 10150 N N    . LEU A 1 15 ? -3.849  9.113   -2.574  1.00 0.00 ? 24 LEU S N    10 
ATOM 10151 C CA   . LEU A 1 15 ? -3.179  8.990   -1.282  1.00 0.00 ? 24 LEU S CA   10 
ATOM 10152 C C    . LEU A 1 15 ? -1.707  9.346   -1.373  1.00 0.00 ? 24 LEU S C    10 
ATOM 10153 O O    . LEU A 1 15 ? -1.087  9.730   -0.380  1.00 0.00 ? 24 LEU S O    10 
ATOM 10154 C CB   . LEU A 1 15 ? -3.320  7.562   -0.768  1.00 0.00 ? 24 LEU S CB   10 
ATOM 10155 C CG   . LEU A 1 15 ? -3.140  6.481   -1.838  1.00 0.00 ? 24 LEU S CG   10 
ATOM 10156 C CD1  . LEU A 1 15 ? -1.812  5.775   -1.672  1.00 0.00 ? 24 LEU S CD1  10 
ATOM 10157 C CD2  . LEU A 1 15 ? -4.288  5.495   -1.782  1.00 0.00 ? 24 LEU S CD2  10 
ATOM 10158 H H    . LEU A 1 15 ? -3.594  8.514   -3.301  1.00 0.00 ? 24 LEU S H    10 
ATOM 10159 H HA   . LEU A 1 15 ? -3.656  9.661   -0.590  1.00 0.00 ? 24 LEU S HA   10 
ATOM 10160 H HB2  . LEU A 1 15 ? -2.581  7.407   0.005   1.00 0.00 ? 24 LEU S HB2  10 
ATOM 10161 H HB3  . LEU A 1 15 ? -4.302  7.452   -0.335  1.00 0.00 ? 24 LEU S HB3  10 
ATOM 10162 H HG   . LEU A 1 15 ? -3.145  6.935   -2.811  1.00 0.00 ? 24 LEU S HG   10 
ATOM 10163 H HD11 . LEU A 1 15 ? -1.891  4.769   -2.059  1.00 0.00 ? 24 LEU S HD11 10 
ATOM 10164 H HD12 . LEU A 1 15 ? -1.551  5.741   -0.629  1.00 0.00 ? 24 LEU S HD12 10 
ATOM 10165 H HD13 . LEU A 1 15 ? -1.049  6.309   -2.219  1.00 0.00 ? 24 LEU S HD13 10 
ATOM 10166 H HD21 . LEU A 1 15 ? -4.367  4.987   -2.729  1.00 0.00 ? 24 LEU S HD21 10 
ATOM 10167 H HD22 . LEU A 1 15 ? -5.204  6.029   -1.580  1.00 0.00 ? 24 LEU S HD22 10 
ATOM 10168 H HD23 . LEU A 1 15 ? -4.107  4.776   -0.998  1.00 0.00 ? 24 LEU S HD23 10 
ATOM 10169 N N    . LEU A 1 16 ? -1.146  9.191   -2.557  1.00 0.00 ? 25 LEU S N    10 
ATOM 10170 C CA   . LEU A 1 16 ? 0.264   9.472   -2.770  1.00 0.00 ? 25 LEU S CA   10 
ATOM 10171 C C    . LEU A 1 16 ? 0.644   10.880  -2.316  1.00 0.00 ? 25 LEU S C    10 
ATOM 10172 O O    . LEU A 1 16 ? 1.821   11.162  -2.092  1.00 0.00 ? 25 LEU S O    10 
ATOM 10173 C CB   . LEU A 1 16 ? 0.627   9.266   -4.239  1.00 0.00 ? 25 LEU S CB   10 
ATOM 10174 C CG   . LEU A 1 16 ? 2.092   9.524   -4.580  1.00 0.00 ? 25 LEU S CG   10 
ATOM 10175 C CD1  . LEU A 1 16 ? 2.989   8.684   -3.685  1.00 0.00 ? 25 LEU S CD1  10 
ATOM 10176 C CD2  . LEU A 1 16 ? 2.360   9.223   -6.048  1.00 0.00 ? 25 LEU S CD2  10 
ATOM 10177 H H    . LEU A 1 16 ? -1.689  8.864   -3.309  1.00 0.00 ? 25 LEU S H    10 
ATOM 10178 H HA   . LEU A 1 16 ? 0.824   8.763   -2.179  1.00 0.00 ? 25 LEU S HA   10 
ATOM 10179 H HB2  . LEU A 1 16 ? 0.396   8.241   -4.498  1.00 0.00 ? 25 LEU S HB2  10 
ATOM 10180 H HB3  . LEU A 1 16 ? 0.016   9.922   -4.838  1.00 0.00 ? 25 LEU S HB3  10 
ATOM 10181 H HG   . LEU A 1 16 ? 2.321   10.564  -4.402  1.00 0.00 ? 25 LEU S HG   10 
ATOM 10182 H HD11 . LEU A 1 16 ? 3.528   9.329   -3.008  1.00 0.00 ? 25 LEU S HD11 10 
ATOM 10183 H HD12 . LEU A 1 16 ? 3.689   8.130   -4.291  1.00 0.00 ? 25 LEU S HD12 10 
ATOM 10184 H HD13 . LEU A 1 16 ? 2.380   7.994   -3.117  1.00 0.00 ? 25 LEU S HD13 10 
ATOM 10185 H HD21 . LEU A 1 16 ? 3.366   8.849   -6.161  1.00 0.00 ? 25 LEU S HD21 10 
ATOM 10186 H HD22 . LEU A 1 16 ? 2.245   10.127  -6.628  1.00 0.00 ? 25 LEU S HD22 10 
ATOM 10187 H HD23 . LEU A 1 16 ? 1.658   8.480   -6.397  1.00 0.00 ? 25 LEU S HD23 10 
ATOM 10188 N N    . ALA A 1 17 ? -0.350  11.760  -2.165  1.00 0.00 ? 26 ALA S N    10 
ATOM 10189 C CA   . ALA A 1 17 ? -0.082  13.136  -1.716  1.00 0.00 ? 26 ALA S CA   10 
ATOM 10190 C C    . ALA A 1 17 ? -1.282  14.067  -1.903  1.00 0.00 ? 26 ALA S C    10 
ATOM 10191 O O    . ALA A 1 17 ? -1.124  15.217  -2.311  1.00 0.00 ? 26 ALA S O    10 
ATOM 10192 C CB   . ALA A 1 17 ? 1.126   13.709  -2.448  1.00 0.00 ? 26 ALA S CB   10 
ATOM 10193 H H    . ALA A 1 17 ? -1.276  11.477  -2.345  1.00 0.00 ? 26 ALA S H    10 
ATOM 10194 H HA   . ALA A 1 17 ? 0.160   13.096  -0.665  1.00 0.00 ? 26 ALA S HA   10 
ATOM 10195 H HB1  . ALA A 1 17 ? 1.130   13.355  -3.469  1.00 0.00 ? 26 ALA S HB1  10 
ATOM 10196 H HB2  . ALA A 1 17 ? 2.031   13.391  -1.953  1.00 0.00 ? 26 ALA S HB2  10 
ATOM 10197 H HB3  . ALA A 1 17 ? 1.073   14.788  -2.442  1.00 0.00 ? 26 ALA S HB3  10 
ATOM 10198 N N    . ARG A 1 18 ? -2.479  13.578  -1.600  1.00 0.00 ? 27 ARG S N    10 
ATOM 10199 C CA   . ARG A 1 18 ? -3.687  14.388  -1.736  1.00 0.00 ? 27 ARG S CA   10 
ATOM 10200 C C    . ARG A 1 18 ? -4.748  13.956  -0.726  1.00 0.00 ? 27 ARG S C    10 
ATOM 10201 O O    . ARG A 1 18 ? -4.741  12.813  -0.277  1.00 0.00 ? 27 ARG S O    10 
ATOM 10202 C CB   . ARG A 1 18 ? -4.233  14.306  -3.165  1.00 0.00 ? 27 ARG S CB   10 
ATOM 10203 C CG   . ARG A 1 18 ? -5.298  13.239  -3.365  1.00 0.00 ? 27 ARG S CG   10 
ATOM 10204 C CD   . ARG A 1 18 ? -6.651  13.849  -3.689  1.00 0.00 ? 27 ARG S CD   10 
ATOM 10205 N NE   . ARG A 1 18 ? -6.957  13.775  -5.115  1.00 0.00 ? 27 ARG S NE   10 
ATOM 10206 C CZ   . ARG A 1 18 ? -8.022  14.345  -5.677  1.00 0.00 ? 27 ARG S CZ   10 
ATOM 10207 N NH1  . ARG A 1 18 ? -8.881  15.035  -4.936  1.00 0.00 ? 27 ARG S NH1  10 
ATOM 10208 N NH2  . ARG A 1 18 ? -8.227  14.227  -6.981  1.00 0.00 ? 27 ARG S NH2  10 
ATOM 10209 H H    . ARG A 1 18 ? -2.555  12.658  -1.275  1.00 0.00 ? 27 ARG S H    10 
ATOM 10210 H HA   . ARG A 1 18 ? -3.415  15.413  -1.527  1.00 0.00 ? 27 ARG S HA   10 
ATOM 10211 H HB2  . ARG A 1 18 ? -4.660  15.263  -3.428  1.00 0.00 ? 27 ARG S HB2  10 
ATOM 10212 H HB3  . ARG A 1 18 ? -3.414  14.094  -3.836  1.00 0.00 ? 27 ARG S HB3  10 
ATOM 10213 H HG2  . ARG A 1 18 ? -4.999  12.600  -4.171  1.00 0.00 ? 27 ARG S HG2  10 
ATOM 10214 H HG3  . ARG A 1 18 ? -5.387  12.660  -2.463  1.00 0.00 ? 27 ARG S HG3  10 
ATOM 10215 H HD2  . ARG A 1 18 ? -7.410  13.313  -3.139  1.00 0.00 ? 27 ARG S HD2  10 
ATOM 10216 H HD3  . ARG A 1 18 ? -6.647  14.886  -3.383  1.00 0.00 ? 27 ARG S HD3  10 
ATOM 10217 H HE   . ARG A 1 18 ? -6.339  13.273  -5.686  1.00 0.00 ? 27 ARG S HE   10 
ATOM 10218 H HH11 . ARG A 1 18 ? -8.732  15.128  -3.951  1.00 0.00 ? 27 ARG S HH11 10 
ATOM 10219 H HH12 . ARG A 1 18 ? -9.679  15.461  -5.363  1.00 0.00 ? 27 ARG S HH12 10 
ATOM 10220 H HH21 . ARG A 1 18 ? -7.581  13.709  -7.544  1.00 0.00 ? 27 ARG S HH21 10 
ATOM 10221 H HH22 . ARG A 1 18 ? -9.025  14.654  -7.403  1.00 0.00 ? 27 ARG S HH22 10 
ATOM 10222 N N    . PRO A 1 19 ? -5.680  14.864  -0.370  1.00 0.00 ? 28 PRO S N    10 
ATOM 10223 C CA   . PRO A 1 19 ? -6.768  14.586  0.573   1.00 0.00 ? 28 PRO S CA   10 
ATOM 10224 C C    . PRO A 1 19 ? -7.363  13.183  0.404   1.00 0.00 ? 28 PRO S C    10 
ATOM 10225 O O    . PRO A 1 19 ? -8.497  13.014  -0.044  1.00 0.00 ? 28 PRO S O    10 
ATOM 10226 C CB   . PRO A 1 19 ? -7.818  15.666  0.251   1.00 0.00 ? 28 PRO S CB   10 
ATOM 10227 C CG   . PRO A 1 19 ? -7.248  16.485  -0.869  1.00 0.00 ? 28 PRO S CG   10 
ATOM 10228 C CD   . PRO A 1 19 ? -5.767  16.235  -0.873  1.00 0.00 ? 28 PRO S CD   10 
ATOM 10229 H HA   . PRO A 1 19 ? -6.436  14.705  1.595   1.00 0.00 ? 28 PRO S HA   10 
ATOM 10230 H HB2  . PRO A 1 19 ? -8.744  15.191  -0.048  1.00 0.00 ? 28 PRO S HB2  10 
ATOM 10231 H HB3  . PRO A 1 19 ? -7.989  16.273  1.131   1.00 0.00 ? 28 PRO S HB3  10 
ATOM 10232 H HG2  . PRO A 1 19 ? -7.680  16.173  -1.807  1.00 0.00 ? 28 PRO S HG2  10 
ATOM 10233 H HG3  . PRO A 1 19 ? -7.449  17.531  -0.694  1.00 0.00 ? 28 PRO S HG3  10 
ATOM 10234 H HD2  . PRO A 1 19 ? -5.371  16.307  -1.878  1.00 0.00 ? 28 PRO S HD2  10 
ATOM 10235 H HD3  . PRO A 1 19 ? -5.262  16.924  -0.211  1.00 0.00 ? 28 PRO S HD3  10 
ATOM 10236 N N    . LEU A 1 20 ? -6.567  12.188  0.775   1.00 0.00 ? 29 LEU S N    10 
ATOM 10237 C CA   . LEU A 1 20 ? -6.956  10.784  0.692   1.00 0.00 ? 29 LEU S CA   10 
ATOM 10238 C C    . LEU A 1 20 ? -8.050  10.431  1.697   1.00 0.00 ? 29 LEU S C    10 
ATOM 10239 O O    . LEU A 1 20 ? -8.238  11.117  2.702   1.00 0.00 ? 29 LEU S O    10 
ATOM 10240 C CB   . LEU A 1 20 ? -5.737  9.893   0.945   1.00 0.00 ? 29 LEU S CB   10 
ATOM 10241 C CG   . LEU A 1 20 ? -4.882  10.280  2.158   1.00 0.00 ? 29 LEU S CG   10 
ATOM 10242 C CD1  . LEU A 1 20 ? -5.600  9.922   3.449   1.00 0.00 ? 29 LEU S CD1  10 
ATOM 10243 C CD2  . LEU A 1 20 ? -3.521  9.599   2.094   1.00 0.00 ? 29 LEU S CD2  10 
ATOM 10244 H H    . LEU A 1 20 ? -5.678  12.409  1.110   1.00 0.00 ? 29 LEU S H    10 
ATOM 10245 H HA   . LEU A 1 20 ? -7.323  10.598  -0.305  1.00 0.00 ? 29 LEU S HA   10 
ATOM 10246 H HB2  . LEU A 1 20 ? -6.083  8.878   1.086   1.00 0.00 ? 29 LEU S HB2  10 
ATOM 10247 H HB3  . LEU A 1 20 ? -5.111  9.925   0.069   1.00 0.00 ? 29 LEU S HB3  10 
ATOM 10248 H HG   . LEU A 1 20 ? -4.720  11.346  2.155   1.00 0.00 ? 29 LEU S HG   10 
ATOM 10249 H HD11 . LEU A 1 20 ? -6.313  9.137   3.258   1.00 0.00 ? 29 LEU S HD11 10 
ATOM 10250 H HD12 . LEU A 1 20 ? -6.117  10.793  3.827   1.00 0.00 ? 29 LEU S HD12 10 
ATOM 10251 H HD13 . LEU A 1 20 ? -4.881  9.585   4.181   1.00 0.00 ? 29 LEU S HD13 10 
ATOM 10252 H HD21 . LEU A 1 20 ? -3.530  8.848   1.319   1.00 0.00 ? 29 LEU S HD21 10 
ATOM 10253 H HD22 . LEU A 1 20 ? -3.305  9.133   3.045   1.00 0.00 ? 29 LEU S HD22 10 
ATOM 10254 H HD23 . LEU A 1 20 ? -2.762  10.334  1.874   1.00 0.00 ? 29 LEU S HD23 10 
ATOM 10255 N N    . PRO A 1 21 ? -8.791  9.341   1.420   1.00 0.00 ? 30 PRO S N    10 
ATOM 10256 C CA   . PRO A 1 21 ? -9.886  8.868   2.279   1.00 0.00 ? 30 PRO S CA   10 
ATOM 10257 C C    . PRO A 1 21 ? -9.410  8.389   3.644   1.00 0.00 ? 30 PRO S C    10 
ATOM 10258 O O    . PRO A 1 21 ? -8.288  8.677   4.061   1.00 0.00 ? 30 PRO S O    10 
ATOM 10259 C CB   . PRO A 1 21 ? -10.476 7.698   1.486   1.00 0.00 ? 30 PRO S CB   10 
ATOM 10260 C CG   . PRO A 1 21 ? -9.359  7.237   0.624   1.00 0.00 ? 30 PRO S CG   10 
ATOM 10261 C CD   . PRO A 1 21 ? -8.625  8.482   0.234   1.00 0.00 ? 30 PRO S CD   10 
ATOM 10262 H HA   . PRO A 1 21 ? -10.635 9.626   2.411   1.00 0.00 ? 30 PRO S HA   10 
ATOM 10263 H HB2  . PRO A 1 21 ? -10.799 6.922   2.166   1.00 0.00 ? 30 PRO S HB2  10 
ATOM 10264 H HB3  . PRO A 1 21 ? -11.310 8.043   0.897   1.00 0.00 ? 30 PRO S HB3  10 
ATOM 10265 H HG2  . PRO A 1 21 ? -8.710  6.581   1.187   1.00 0.00 ? 30 PRO S HG2  10 
ATOM 10266 H HG3  . PRO A 1 21 ? -9.747  6.735   -0.252  1.00 0.00 ? 30 PRO S HG3  10 
ATOM 10267 H HD2  . PRO A 1 21 ? -7.583  8.267   0.050   1.00 0.00 ? 30 PRO S HD2  10 
ATOM 10268 H HD3  . PRO A 1 21 ? -9.083  8.932   -0.634  1.00 0.00 ? 30 PRO S HD3  10 
ATOM 10269 N N    . GLU A 1 22 ? -10.274 7.653   4.337   1.00 0.00 ? 31 GLU S N    10 
ATOM 10270 C CA   . GLU A 1 22 ? -9.943  7.131   5.657   1.00 0.00 ? 31 GLU S CA   10 
ATOM 10271 C C    . GLU A 1 22 ? -9.479  5.688   5.569   1.00 0.00 ? 31 GLU S C    10 
ATOM 10272 O O    . GLU A 1 22 ? -8.529  5.301   6.250   1.00 0.00 ? 31 GLU S O    10 
ATOM 10273 C CB   . GLU A 1 22 ? -11.138 7.254   6.604   1.00 0.00 ? 31 GLU S CB   10 
ATOM 10274 C CG   . GLU A 1 22 ? -10.851 6.756   8.012   1.00 0.00 ? 31 GLU S CG   10 
ATOM 10275 C CD   . GLU A 1 22 ? -12.116 6.519   8.813   1.00 0.00 ? 31 GLU S CD   10 
ATOM 10276 O OE1  . GLU A 1 22 ? -12.698 5.419   8.695   1.00 0.00 ? 31 GLU S OE1  10 
ATOM 10277 O OE2  . GLU A 1 22 ? -12.526 7.434   9.559   1.00 0.00 ? 31 GLU S OE2  10 
ATOM 10278 H H    . GLU A 1 22 ? -11.152 7.459   3.951   1.00 0.00 ? 31 GLU S H    10 
ATOM 10279 H HA   . GLU A 1 22 ? -9.123  7.718   6.038   1.00 0.00 ? 31 GLU S HA   10 
ATOM 10280 H HB2  . GLU A 1 22 ? -11.429 8.292   6.666   1.00 0.00 ? 31 GLU S HB2  10 
ATOM 10281 H HB3  . GLU A 1 22 ? -11.961 6.680   6.203   1.00 0.00 ? 31 GLU S HB3  10 
ATOM 10282 H HG2  . GLU A 1 22 ? -10.306 5.827   7.946   1.00 0.00 ? 31 GLU S HG2  10 
ATOM 10283 H HG3  . GLU A 1 22 ? -10.249 7.491   8.524   1.00 0.00 ? 31 GLU S HG3  10 
ATOM 10284 N N    . GLY A 1 23 ? -10.118 4.897   4.707   1.00 0.00 ? 32 GLY S N    10 
ATOM 10285 C CA   . GLY A 1 23 ? -9.692  3.518   4.544   1.00 0.00 ? 32 GLY S CA   10 
ATOM 10286 C C    . GLY A 1 23 ? -8.192  3.458   4.336   1.00 0.00 ? 32 GLY S C    10 
ATOM 10287 O O    . GLY A 1 23 ? -7.533  2.479   4.687   1.00 0.00 ? 32 GLY S O    10 
ATOM 10288 H H    . GLY A 1 23 ? -10.851 5.256   4.163   1.00 0.00 ? 32 GLY S H    10 
ATOM 10289 H HA2  . GLY A 1 23 ? -9.954  2.956   5.431   1.00 0.00 ? 32 GLY S HA2  10 
ATOM 10290 H HA3  . GLY A 1 23 ? -10.187 3.086   3.687   1.00 0.00 ? 32 GLY S HA3  10 
ATOM 10291 N N    . VAL A 1 24 ? -7.659  4.551   3.791   1.00 0.00 ? 33 VAL S N    10 
ATOM 10292 C CA   . VAL A 1 24 ? -6.237  4.697   3.555   1.00 0.00 ? 33 VAL S CA   10 
ATOM 10293 C C    . VAL A 1 24 ? -5.540  5.067   4.863   1.00 0.00 ? 33 VAL S C    10 
ATOM 10294 O O    . VAL A 1 24 ? -5.716  6.172   5.378   1.00 0.00 ? 33 VAL S O    10 
ATOM 10295 C CB   . VAL A 1 24 ? -5.975  5.785   2.475   1.00 0.00 ? 33 VAL S CB   10 
ATOM 10296 C CG1  . VAL A 1 24 ? -4.952  6.820   2.923   1.00 0.00 ? 33 VAL S CG1  10 
ATOM 10297 C CG2  . VAL A 1 24 ? -5.539  5.150   1.169   1.00 0.00 ? 33 VAL S CG2  10 
ATOM 10298 H H    . VAL A 1 24 ? -8.247  5.299   3.561   1.00 0.00 ? 33 VAL S H    10 
ATOM 10299 H HA   . VAL A 1 24 ? -5.853  3.753   3.198   1.00 0.00 ? 33 VAL S HA   10 
ATOM 10300 H HB   . VAL A 1 24 ? -6.906  6.301   2.294   1.00 0.00 ? 33 VAL S HB   10 
ATOM 10301 H HG11 . VAL A 1 24 ? -5.392  7.458   3.673   1.00 0.00 ? 33 VAL S HG11 10 
ATOM 10302 H HG12 . VAL A 1 24 ? -4.653  7.415   2.076   1.00 0.00 ? 33 VAL S HG12 10 
ATOM 10303 H HG13 . VAL A 1 24 ? -4.088  6.320   3.336   1.00 0.00 ? 33 VAL S HG13 10 
ATOM 10304 H HG21 . VAL A 1 24 ? -5.774  4.098   1.182   1.00 0.00 ? 33 VAL S HG21 10 
ATOM 10305 H HG22 . VAL A 1 24 ? -4.473  5.282   1.044   1.00 0.00 ? 33 VAL S HG22 10 
ATOM 10306 H HG23 . VAL A 1 24 ? -6.061  5.627   0.351   1.00 0.00 ? 33 VAL S HG23 10 
ATOM 10307 N N    . ASP A 1 25 ? -4.760  4.146   5.404   1.00 0.00 ? 34 ASP S N    10 
ATOM 10308 C CA   . ASP A 1 25 ? -4.057  4.401   6.652   1.00 0.00 ? 34 ASP S CA   10 
ATOM 10309 C C    . ASP A 1 25 ? -2.640  4.899   6.363   1.00 0.00 ? 34 ASP S C    10 
ATOM 10310 O O    . ASP A 1 25 ? -1.949  4.348   5.509   1.00 0.00 ? 34 ASP S O    10 
ATOM 10311 C CB   . ASP A 1 25 ? -4.014  3.138   7.512   1.00 0.00 ? 34 ASP S CB   10 
ATOM 10312 C CG   . ASP A 1 25 ? -5.301  2.919   8.280   1.00 0.00 ? 34 ASP S CG   10 
ATOM 10313 O OD1  . ASP A 1 25 ? -6.059  3.896   8.459   1.00 0.00 ? 34 ASP S OD1  10 
ATOM 10314 O OD2  . ASP A 1 25 ? -5.551  1.772   8.705   1.00 0.00 ? 34 ASP S OD2  10 
ATOM 10315 H H    . ASP A 1 25 ? -4.657  3.277   4.962   1.00 0.00 ? 34 ASP S H    10 
ATOM 10316 H HA   . ASP A 1 25 ? -4.603  5.173   7.180   1.00 0.00 ? 34 ASP S HA   10 
ATOM 10317 H HB2  . ASP A 1 25 ? -3.846  2.281   6.874   1.00 0.00 ? 34 ASP S HB2  10 
ATOM 10318 H HB3  . ASP A 1 25 ? -3.200  3.222   8.220   1.00 0.00 ? 34 ASP S HB3  10 
ATOM 10319 N N    . PRO A 1 26 ? -2.195  5.962   7.057   1.00 0.00 ? 35 PRO S N    10 
ATOM 10320 C CA   . PRO A 1 26 ? -0.860  6.541   6.846   1.00 0.00 ? 35 PRO S CA   10 
ATOM 10321 C C    . PRO A 1 26 ? 0.280   5.622   7.282   1.00 0.00 ? 35 PRO S C    10 
ATOM 10322 O O    . PRO A 1 26 ? 1.304   5.531   6.604   1.00 0.00 ? 35 PRO S O    10 
ATOM 10323 C CB   . PRO A 1 26 ? -0.879  7.809   7.705   1.00 0.00 ? 35 PRO S CB   10 
ATOM 10324 C CG   . PRO A 1 26 ? -1.915  7.550   8.744   1.00 0.00 ? 35 PRO S CG   10 
ATOM 10325 C CD   . PRO A 1 26 ? -2.959  6.698   8.080   1.00 0.00 ? 35 PRO S CD   10 
ATOM 10326 H HA   . PRO A 1 26 ? -0.718  6.815   5.809   1.00 0.00 ? 35 PRO S HA   10 
ATOM 10327 H HB2  . PRO A 1 26 ? 0.096   7.961   8.148   1.00 0.00 ? 35 PRO S HB2  10 
ATOM 10328 H HB3  . PRO A 1 26 ? -1.141  8.660   7.092   1.00 0.00 ? 35 PRO S HB3  10 
ATOM 10329 H HG2  . PRO A 1 26 ? -1.475  7.024   9.578   1.00 0.00 ? 35 PRO S HG2  10 
ATOM 10330 H HG3  . PRO A 1 26 ? -2.347  8.484   9.074   1.00 0.00 ? 35 PRO S HG3  10 
ATOM 10331 H HD2  . PRO A 1 26 ? -3.401  6.017   8.796   1.00 0.00 ? 35 PRO S HD2  10 
ATOM 10332 H HD3  . PRO A 1 26 ? -3.719  7.317   7.626   1.00 0.00 ? 35 PRO S HD3  10 
ATOM 10333 N N    . LEU A 1 27 ? 0.109   4.951   8.417   1.00 0.00 ? 36 LEU S N    10 
ATOM 10334 C CA   . LEU A 1 27 ? 1.140   4.053   8.935   1.00 0.00 ? 36 LEU S CA   10 
ATOM 10335 C C    . LEU A 1 27 ? 1.263   2.785   8.089   1.00 0.00 ? 36 LEU S C    10 
ATOM 10336 O O    . LEU A 1 27 ? 2.192   1.999   8.267   1.00 0.00 ? 36 LEU S O    10 
ATOM 10337 C CB   . LEU A 1 27 ? 0.856   3.682   10.399  1.00 0.00 ? 36 LEU S CB   10 
ATOM 10338 C CG   . LEU A 1 27 ? -0.578  3.241   10.724  1.00 0.00 ? 36 LEU S CG   10 
ATOM 10339 C CD1  . LEU A 1 27 ? -1.432  4.434   11.128  1.00 0.00 ? 36 LEU S CD1  10 
ATOM 10340 C CD2  . LEU A 1 27 ? -1.207  2.505   9.548   1.00 0.00 ? 36 LEU S CD2  10 
ATOM 10341 H H    . LEU A 1 27 ? -0.722  5.066   8.918   1.00 0.00 ? 36 LEU S H    10 
ATOM 10342 H HA   . LEU A 1 27 ? 2.080   4.583   8.890   1.00 0.00 ? 36 LEU S HA   10 
ATOM 10343 H HB2  . LEU A 1 27 ? 1.524   2.879   10.676  1.00 0.00 ? 36 LEU S HB2  10 
ATOM 10344 H HB3  . LEU A 1 27 ? 1.088   4.544   11.011  1.00 0.00 ? 36 LEU S HB3  10 
ATOM 10345 H HG   . LEU A 1 27 ? -0.550  2.560   11.563  1.00 0.00 ? 36 LEU S HG   10 
ATOM 10346 H HD11 . LEU A 1 27 ? -2.017  4.180   11.999  1.00 0.00 ? 36 LEU S HD11 10 
ATOM 10347 H HD12 . LEU A 1 27 ? -2.091  4.698   10.314  1.00 0.00 ? 36 LEU S HD12 10 
ATOM 10348 H HD13 . LEU A 1 27 ? -0.791  5.274   11.358  1.00 0.00 ? 36 LEU S HD13 10 
ATOM 10349 H HD21 . LEU A 1 27 ? -1.312  3.184   8.715   1.00 0.00 ? 36 LEU S HD21 10 
ATOM 10350 H HD22 . LEU A 1 27 ? -2.177  2.129   9.832   1.00 0.00 ? 36 LEU S HD22 10 
ATOM 10351 H HD23 . LEU A 1 27 ? -0.569  1.680   9.258   1.00 0.00 ? 36 LEU S HD23 10 
ATOM 10352 N N    . LYS A 1 28 ? 0.322   2.592   7.165   1.00 0.00 ? 37 LYS S N    10 
ATOM 10353 C CA   . LYS A 1 28 ? 0.332   1.424   6.295   1.00 0.00 ? 37 LYS S CA   10 
ATOM 10354 C C    . LYS A 1 28 ? -0.198  1.787   4.914   1.00 0.00 ? 37 LYS S C    10 
ATOM 10355 O O    . LYS A 1 28 ? -1.395  1.676   4.649   1.00 0.00 ? 37 LYS S O    10 
ATOM 10356 C CB   . LYS A 1 28 ? -0.511  0.301   6.904   1.00 0.00 ? 37 LYS S CB   10 
ATOM 10357 C CG   . LYS A 1 28 ? -1.946  0.707   7.193   1.00 0.00 ? 37 LYS S CG   10 
ATOM 10358 C CD   . LYS A 1 28 ? -2.473  0.032   8.449   1.00 0.00 ? 37 LYS S CD   10 
ATOM 10359 C CE   . LYS A 1 28 ? -2.882  -1.407  8.179   1.00 0.00 ? 37 LYS S CE   10 
ATOM 10360 N NZ   . LYS A 1 28 ? -2.579  -2.298  9.333   1.00 0.00 ? 37 LYS S NZ   10 
ATOM 10361 H H    . LYS A 1 28 ? -0.394  3.252   7.063   1.00 0.00 ? 37 LYS S H    10 
ATOM 10362 H HA   . LYS A 1 28 ? 1.352   1.090   6.202   1.00 0.00 ? 37 LYS S HA   10 
ATOM 10363 H HB2  . LYS A 1 28 ? -0.529  -0.532  6.217   1.00 0.00 ? 37 LYS S HB2  10 
ATOM 10364 H HB3  . LYS A 1 28 ? -0.054  -0.014  7.831   1.00 0.00 ? 37 LYS S HB3  10 
ATOM 10365 H HG2  . LYS A 1 28 ? -1.985  1.776   7.327   1.00 0.00 ? 37 LYS S HG2  10 
ATOM 10366 H HG3  . LYS A 1 28 ? -2.566  0.423   6.355   1.00 0.00 ? 37 LYS S HG3  10 
ATOM 10367 H HD2  . LYS A 1 28 ? -1.700  0.040   9.202   1.00 0.00 ? 37 LYS S HD2  10 
ATOM 10368 H HD3  . LYS A 1 28 ? -3.332  0.580   8.806   1.00 0.00 ? 37 LYS S HD3  10 
ATOM 10369 H HE2  . LYS A 1 28 ? -3.943  -1.436  7.984   1.00 0.00 ? 37 LYS S HE2  10 
ATOM 10370 H HE3  . LYS A 1 28 ? -2.347  -1.764  7.310   1.00 0.00 ? 37 LYS S HE3  10 
ATOM 10371 H HZ1  . LYS A 1 28 ? -3.099  -1.980  10.176  1.00 0.00 ? 37 LYS S HZ1  10 
ATOM 10372 H HZ2  . LYS A 1 28 ? -1.559  -2.279  9.541   1.00 0.00 ? 37 LYS S HZ2  10 
ATOM 10373 H HZ3  . LYS A 1 28 ? -2.858  -3.276  9.115   1.00 0.00 ? 37 LYS S HZ3  10 
ATOM 10374 N N    . LEU A 1 29 ? 0.696   2.239   4.043   1.00 0.00 ? 38 LEU S N    10 
ATOM 10375 C CA   . LEU A 1 29 ? 0.313   2.637   2.697   1.00 0.00 ? 38 LEU S CA   10 
ATOM 10376 C C    . LEU A 1 29 ? 0.326   1.456   1.734   1.00 0.00 ? 38 LEU S C    10 
ATOM 10377 O O    . LEU A 1 29 ? -0.687  1.148   1.108   1.00 0.00 ? 38 LEU S O    10 
ATOM 10378 C CB   . LEU A 1 29 ? 1.234   3.751   2.187   1.00 0.00 ? 38 LEU S CB   10 
ATOM 10379 C CG   . LEU A 1 29 ? 1.271   5.032   3.039   1.00 0.00 ? 38 LEU S CG   10 
ATOM 10380 C CD1  . LEU A 1 29 ? 1.449   6.257   2.158   1.00 0.00 ? 38 LEU S CD1  10 
ATOM 10381 C CD2  . LEU A 1 29 ? 0.014   5.180   3.891   1.00 0.00 ? 38 LEU S CD2  10 
ATOM 10382 H H    . LEU A 1 29 ? 1.632   2.317   4.314   1.00 0.00 ? 38 LEU S H    10 
ATOM 10383 H HA   . LEU A 1 29 ? -0.691  3.015   2.752   1.00 0.00 ? 38 LEU S HA   10 
ATOM 10384 H HB2  . LEU A 1 29 ? 2.239   3.355   2.131   1.00 0.00 ? 38 LEU S HB2  10 
ATOM 10385 H HB3  . LEU A 1 29 ? 0.917   4.019   1.188   1.00 0.00 ? 38 LEU S HB3  10 
ATOM 10386 H HG   . LEU A 1 29 ? 2.119   4.981   3.705   1.00 0.00 ? 38 LEU S HG   10 
ATOM 10387 H HD11 . LEU A 1 29 ? 2.018   5.992   1.281   1.00 0.00 ? 38 LEU S HD11 10 
ATOM 10388 H HD12 . LEU A 1 29 ? 1.972   7.022   2.711   1.00 0.00 ? 38 LEU S HD12 10 
ATOM 10389 H HD13 . LEU A 1 29 ? 0.481   6.631   1.859   1.00 0.00 ? 38 LEU S HD13 10 
ATOM 10390 H HD21 . LEU A 1 29 ? -0.822  4.721   3.390   1.00 0.00 ? 38 LEU S HD21 10 
ATOM 10391 H HD22 . LEU A 1 29 ? -0.192  6.229   4.042   1.00 0.00 ? 38 LEU S HD22 10 
ATOM 10392 H HD23 . LEU A 1 29 ? 0.169   4.702   4.846   1.00 0.00 ? 38 LEU S HD23 10 
ATOM 10393 N N    . GLU A 1 30 ? 1.467   0.787   1.622   1.00 0.00 ? 39 GLU S N    10 
ATOM 10394 C CA   . GLU A 1 30 ? 1.587   -0.368  0.733   1.00 0.00 ? 39 GLU S CA   10 
ATOM 10395 C C    . GLU A 1 30 ? 0.449   -1.360  0.973   1.00 0.00 ? 39 GLU S C    10 
ATOM 10396 O O    . GLU A 1 30 ? 0.103   -2.159  0.101   1.00 0.00 ? 39 GLU S O    10 
ATOM 10397 C CB   . GLU A 1 30 ? 2.933   -1.063  0.945   1.00 0.00 ? 39 GLU S CB   10 
ATOM 10398 C CG   . GLU A 1 30 ? 3.045   -1.797  2.274   1.00 0.00 ? 39 GLU S CG   10 
ATOM 10399 C CD   . GLU A 1 30 ? 4.192   -2.788  2.302   1.00 0.00 ? 39 GLU S CD   10 
ATOM 10400 O OE1  . GLU A 1 30 ? 4.063   -3.864  1.682   1.00 0.00 ? 39 GLU S OE1  10 
ATOM 10401 O OE2  . GLU A 1 30 ? 5.220   -2.489  2.949   1.00 0.00 ? 39 GLU S OE2  10 
ATOM 10402 H H    . GLU A 1 30 ? 2.242   1.070   2.150   1.00 0.00 ? 39 GLU S H    10 
ATOM 10403 H HA   . GLU A 1 30 ? 1.532   -0.010  -0.282  1.00 0.00 ? 39 GLU S HA   10 
ATOM 10404 H HB2  . GLU A 1 30 ? 3.084   -1.779  0.150   1.00 0.00 ? 39 GLU S HB2  10 
ATOM 10405 H HB3  . GLU A 1 30 ? 3.717   -0.319  0.899   1.00 0.00 ? 39 GLU S HB3  10 
ATOM 10406 H HG2  . GLU A 1 30 ? 3.194   -1.072  3.060   1.00 0.00 ? 39 GLU S HG2  10 
ATOM 10407 H HG3  . GLU A 1 30 ? 2.124   -2.332  2.452   1.00 0.00 ? 39 GLU S HG3  10 
ATOM 10408 N N    . ILE A 1 31 ? -0.111  -1.304  2.171   1.00 0.00 ? 40 ILE S N    10 
ATOM 10409 C CA   . ILE A 1 31 ? -1.194  -2.185  2.570   1.00 0.00 ? 40 ILE S CA   10 
ATOM 10410 C C    . ILE A 1 31 ? -2.448  -1.994  1.707   1.00 0.00 ? 40 ILE S C    10 
ATOM 10411 O O    . ILE A 1 31 ? -3.137  -2.962  1.390   1.00 0.00 ? 40 ILE S O    10 
ATOM 10412 C CB   . ILE A 1 31 ? -1.539  -1.948  4.057   1.00 0.00 ? 40 ILE S CB   10 
ATOM 10413 C CG1  . ILE A 1 31 ? -0.534  -2.671  4.952   1.00 0.00 ? 40 ILE S CG1  10 
ATOM 10414 C CG2  . ILE A 1 31 ? -2.955  -2.394  4.375   1.00 0.00 ? 40 ILE S CG2  10 
ATOM 10415 C CD1  . ILE A 1 31 ? 0.840   -2.038  4.951   1.00 0.00 ? 40 ILE S CD1  10 
ATOM 10416 H H    . ILE A 1 31 ? 0.224   -0.654  2.819   1.00 0.00 ? 40 ILE S H    10 
ATOM 10417 H HA   . ILE A 1 31 ? -0.851  -3.202  2.464   1.00 0.00 ? 40 ILE S HA   10 
ATOM 10418 H HB   . ILE A 1 31 ? -1.475  -0.887  4.249   1.00 0.00 ? 40 ILE S HB   10 
ATOM 10419 H HG12 . ILE A 1 31 ? -0.900  -2.666  5.966   1.00 0.00 ? 40 ILE S HG12 10 
ATOM 10420 H HG13 . ILE A 1 31 ? -0.431  -3.693  4.615   1.00 0.00 ? 40 ILE S HG13 10 
ATOM 10421 H HG21 . ILE A 1 31 ? -3.642  -1.598  4.133   1.00 0.00 ? 40 ILE S HG21 10 
ATOM 10422 H HG22 . ILE A 1 31 ? -3.029  -2.627  5.426   1.00 0.00 ? 40 ILE S HG22 10 
ATOM 10423 H HG23 . ILE A 1 31 ? -3.194  -3.269  3.792   1.00 0.00 ? 40 ILE S HG23 10 
ATOM 10424 H HD11 . ILE A 1 31 ? 0.758   -1.000  4.658   1.00 0.00 ? 40 ILE S HD11 10 
ATOM 10425 H HD12 . ILE A 1 31 ? 1.476   -2.559  4.253   1.00 0.00 ? 40 ILE S HD12 10 
ATOM 10426 H HD13 . ILE A 1 31 ? 1.265   -2.100  5.942   1.00 0.00 ? 40 ILE S HD13 10 
ATOM 10427 N N    . TYR A 1 32 ? -2.760  -0.749  1.356   1.00 0.00 ? 41 TYR S N    10 
ATOM 10428 C CA   . TYR A 1 32 ? -3.956  -0.470  0.559   1.00 0.00 ? 41 TYR S CA   10 
ATOM 10429 C C    . TYR A 1 32 ? -3.675  -0.409  -0.936  1.00 0.00 ? 41 TYR S C    10 
ATOM 10430 O O    . TYR A 1 32 ? -4.376  0.293   -1.665  1.00 0.00 ? 41 TYR S O    10 
ATOM 10431 C CB   . TYR A 1 32 ? -4.622  0.834   1.010   1.00 0.00 ? 41 TYR S CB   10 
ATOM 10432 C CG   . TYR A 1 32 ? -3.691  2.022   1.103   1.00 0.00 ? 41 TYR S CG   10 
ATOM 10433 C CD1  . TYR A 1 32 ? -2.818  2.347   0.070   1.00 0.00 ? 41 TYR S CD1  10 
ATOM 10434 C CD2  . TYR A 1 32 ? -3.699  2.831   2.230   1.00 0.00 ? 41 TYR S CD2  10 
ATOM 10435 C CE1  . TYR A 1 32 ? -1.982  3.442   0.162   1.00 0.00 ? 41 TYR S CE1  10 
ATOM 10436 C CE2  . TYR A 1 32 ? -2.866  3.925   2.330   1.00 0.00 ? 41 TYR S CE2  10 
ATOM 10437 C CZ   . TYR A 1 32 ? -2.012  4.228   1.294   1.00 0.00 ? 41 TYR S CZ   10 
ATOM 10438 O OH   . TYR A 1 32 ? -1.184  5.324   1.393   1.00 0.00 ? 41 TYR S OH   10 
ATOM 10439 H H    . TYR A 1 32 ? -2.193  -0.007  1.652   1.00 0.00 ? 41 TYR S H    10 
ATOM 10440 H HA   . TYR A 1 32 ? -4.651  -1.277  0.730   1.00 0.00 ? 41 TYR S HA   10 
ATOM 10441 H HB2  . TYR A 1 32 ? -5.404  1.087   0.308   1.00 0.00 ? 41 TYR S HB2  10 
ATOM 10442 H HB3  . TYR A 1 32 ? -5.059  0.683   1.985   1.00 0.00 ? 41 TYR S HB3  10 
ATOM 10443 H HD1  . TYR A 1 32 ? -2.797  1.732   -0.816  1.00 0.00 ? 41 TYR S HD1  10 
ATOM 10444 H HD2  . TYR A 1 32 ? -4.367  2.590   3.043   1.00 0.00 ? 41 TYR S HD2  10 
ATOM 10445 H HE1  . TYR A 1 32 ? -1.305  3.675   -0.648  1.00 0.00 ? 41 TYR S HE1  10 
ATOM 10446 H HE2  . TYR A 1 32 ? -2.888  4.540   3.217   1.00 0.00 ? 41 TYR S HE2  10 
ATOM 10447 H HH   . TYR A 1 32 ? -0.433  5.217   0.805   1.00 0.00 ? 41 TYR S HH   10 
ATOM 10448 N N    . LEU A 1 33 ? -2.675  -1.147  -1.408  1.00 0.00 ? 42 LEU S N    10 
ATOM 10449 C CA   . LEU A 1 33 ? -2.374  -1.148  -2.834  1.00 0.00 ? 42 LEU S CA   10 
ATOM 10450 C C    . LEU A 1 33 ? -2.061  -2.545  -3.334  1.00 0.00 ? 42 LEU S C    10 
ATOM 10451 O O    . LEU A 1 33 ? -1.074  -3.149  -2.930  1.00 0.00 ? 42 LEU S O    10 
ATOM 10452 C CB   . LEU A 1 33 ? -1.211  -0.213  -3.164  1.00 0.00 ? 42 LEU S CB   10 
ATOM 10453 C CG   . LEU A 1 33 ? -0.119  -0.107  -2.099  1.00 0.00 ? 42 LEU S CG   10 
ATOM 10454 C CD1  . LEU A 1 33 ? 1.075   -0.978  -2.471  1.00 0.00 ? 42 LEU S CD1  10 
ATOM 10455 C CD2  . LEU A 1 33 ? 0.310   1.345   -1.924  1.00 0.00 ? 42 LEU S CD2  10 
ATOM 10456 H H    . LEU A 1 33 ? -2.142  -1.706  -0.796  1.00 0.00 ? 42 LEU S H    10 
ATOM 10457 H HA   . LEU A 1 33 ? -3.252  -0.795  -3.349  1.00 0.00 ? 42 LEU S HA   10 
ATOM 10458 H HB2  . LEU A 1 33 ? -0.753  -0.561  -4.082  1.00 0.00 ? 42 LEU S HB2  10 
ATOM 10459 H HB3  . LEU A 1 33 ? -1.614  0.771   -3.338  1.00 0.00 ? 42 LEU S HB3  10 
ATOM 10460 H HG   . LEU A 1 33 ? -0.508  -0.457  -1.155  1.00 0.00 ? 42 LEU S HG   10 
ATOM 10461 H HD11 . LEU A 1 33 ? 0.967   -1.321  -3.489  1.00 0.00 ? 42 LEU S HD11 10 
ATOM 10462 H HD12 . LEU A 1 33 ? 1.120   -1.829  -1.809  1.00 0.00 ? 42 LEU S HD12 10 
ATOM 10463 H HD13 . LEU A 1 33 ? 1.985   -0.403  -2.379  1.00 0.00 ? 42 LEU S HD13 10 
ATOM 10464 H HD21 . LEU A 1 33 ? 1.369   1.384   -1.715  1.00 0.00 ? 42 LEU S HD21 10 
ATOM 10465 H HD22 . LEU A 1 33 ? -0.235  1.784   -1.102  1.00 0.00 ? 42 LEU S HD22 10 
ATOM 10466 H HD23 . LEU A 1 33 ? 0.101   1.894   -2.829  1.00 0.00 ? 42 LEU S HD23 10 
ATOM 10467 N N    . THR A 1 34 ? -2.900  -3.049  -4.231  1.00 0.00 ? 43 THR S N    10 
ATOM 10468 C CA   . THR A 1 34 ? -2.690  -4.369  -4.802  1.00 0.00 ? 43 THR S CA   10 
ATOM 10469 C C    . THR A 1 34 ? -1.345  -4.413  -5.523  1.00 0.00 ? 43 THR S C    10 
ATOM 10470 O O    . THR A 1 34 ? -0.527  -3.515  -5.365  1.00 0.00 ? 43 THR S O    10 
ATOM 10471 C CB   . THR A 1 34 ? -3.824  -4.719  -5.767  1.00 0.00 ? 43 THR S CB   10 
ATOM 10472 O OG1  . THR A 1 34 ? -3.646  -6.018  -6.303  1.00 0.00 ? 43 THR S OG1  10 
ATOM 10473 C CG2  . THR A 1 34 ? -3.940  -3.755  -6.929  1.00 0.00 ? 43 THR S CG2  10 
ATOM 10474 H H    . THR A 1 34 ? -3.670  -2.515  -4.525  1.00 0.00 ? 43 THR S H    10 
ATOM 10475 H HA   . THR A 1 34 ? -2.679  -5.084  -3.992  1.00 0.00 ? 43 THR S HA   10 
ATOM 10476 H HB   . THR A 1 34 ? -4.761  -4.699  -5.229  1.00 0.00 ? 43 THR S HB   10 
ATOM 10477 H HG1  . THR A 1 34 ? -4.363  -6.585  -6.009  1.00 0.00 ? 43 THR S HG1  10 
ATOM 10478 H HG21 . THR A 1 34 ? -3.530  -4.212  -7.817  1.00 0.00 ? 43 THR S HG21 10 
ATOM 10479 H HG22 . THR A 1 34 ? -3.393  -2.852  -6.702  1.00 0.00 ? 43 THR S HG22 10 
ATOM 10480 H HG23 . THR A 1 34 ? -4.980  -3.513  -7.093  1.00 0.00 ? 43 THR S HG23 10 
ATOM 10481 N N    . ASP A 1 35 ? -1.137  -5.457  -6.313  1.00 0.00 ? 44 ASP S N    10 
ATOM 10482 C CA   . ASP A 1 35 ? 0.094   -5.638  -7.071  1.00 0.00 ? 44 ASP S CA   10 
ATOM 10483 C C    . ASP A 1 35 ? 0.222   -4.575  -8.148  1.00 0.00 ? 44 ASP S C    10 
ATOM 10484 O O    . ASP A 1 35 ? 1.305   -4.054  -8.393  1.00 0.00 ? 44 ASP S O    10 
ATOM 10485 C CB   . ASP A 1 35 ? 0.127   -7.030  -7.705  1.00 0.00 ? 44 ASP S CB   10 
ATOM 10486 C CG   . ASP A 1 35 ? -1.105  -7.313  -8.541  1.00 0.00 ? 44 ASP S CG   10 
ATOM 10487 O OD1  . ASP A 1 35 ? -1.254  -6.685  -9.611  1.00 0.00 ? 44 ASP S OD1  10 
ATOM 10488 O OD2  . ASP A 1 35 ? -1.921  -8.163  -8.126  1.00 0.00 ? 44 ASP S OD2  10 
ATOM 10489 H H    . ASP A 1 35 ? -1.831  -6.115  -6.396  1.00 0.00 ? 44 ASP S H    10 
ATOM 10490 H HA   . ASP A 1 35 ? 0.923   -5.545  -6.386  1.00 0.00 ? 44 ASP S HA   10 
ATOM 10491 H HB2  . ASP A 1 35 ? 0.998   -7.107  -8.342  1.00 0.00 ? 44 ASP S HB2  10 
ATOM 10492 H HB3  . ASP A 1 35 ? 0.189   -7.773  -6.922  1.00 0.00 ? 44 ASP S HB3  10 
ATOM 10493 N N    . GLU A 1 36 ? -0.900  -4.246  -8.781  1.00 0.00 ? 45 GLU S N    10 
ATOM 10494 C CA   . GLU A 1 36 ? -0.905  -3.226  -9.817  1.00 0.00 ? 45 GLU S CA   10 
ATOM 10495 C C    . GLU A 1 36 ? -0.519  -1.890  -9.209  1.00 0.00 ? 45 GLU S C    10 
ATOM 10496 O O    . GLU A 1 36 ? 0.417   -1.232  -9.664  1.00 0.00 ? 45 GLU S O    10 
ATOM 10497 C CB   . GLU A 1 36 ? -2.280  -3.121  -10.462 1.00 0.00 ? 45 GLU S CB   10 
ATOM 10498 C CG   . GLU A 1 36 ? -2.723  -4.390  -11.170 1.00 0.00 ? 45 GLU S CG   10 
ATOM 10499 C CD   . GLU A 1 36 ? -1.792  -4.782  -12.300 1.00 0.00 ? 45 GLU S CD   10 
ATOM 10500 O OE1  . GLU A 1 36 ? -1.708  -4.026  -13.291 1.00 0.00 ? 45 GLU S OE1  10 
ATOM 10501 O OE2  . GLU A 1 36 ? -1.144  -5.845  -12.194 1.00 0.00 ? 45 GLU S OE2  10 
ATOM 10502 H H    . GLU A 1 36 ? -1.738  -4.688  -8.536  1.00 0.00 ? 45 GLU S H    10 
ATOM 10503 H HA   . GLU A 1 36 ? -0.177  -3.499  -10.566 1.00 0.00 ? 45 GLU S HA   10 
ATOM 10504 H HB2  . GLU A 1 36 ? -3.002  -2.891  -9.695  1.00 0.00 ? 45 GLU S HB2  10 
ATOM 10505 H HB3  . GLU A 1 36 ? -2.262  -2.318  -11.181 1.00 0.00 ? 45 GLU S HB3  10 
ATOM 10506 H HG2  . GLU A 1 36 ? -2.754  -5.197  -10.454 1.00 0.00 ? 45 GLU S HG2  10 
ATOM 10507 H HG3  . GLU A 1 36 ? -3.713  -4.234  -11.577 1.00 0.00 ? 45 GLU S HG3  10 
ATOM 10508 N N    . ASP A 1 37 ? -1.229  -1.511  -8.150  1.00 0.00 ? 46 ASP S N    10 
ATOM 10509 C CA   . ASP A 1 37 ? -0.942  -0.277  -7.453  1.00 0.00 ? 46 ASP S CA   10 
ATOM 10510 C C    . ASP A 1 37 ? 0.441   -0.381  -6.825  1.00 0.00 ? 46 ASP S C    10 
ATOM 10511 O O    . ASP A 1 37 ? 1.192   0.591   -6.770  1.00 0.00 ? 46 ASP S O    10 
ATOM 10512 C CB   . ASP A 1 37 ? -2.005  -0.017  -6.387  1.00 0.00 ? 46 ASP S CB   10 
ATOM 10513 C CG   . ASP A 1 37 ? -1.778  1.288   -5.656  1.00 0.00 ? 46 ASP S CG   10 
ATOM 10514 O OD1  . ASP A 1 37 ? -0.639  1.523   -5.199  1.00 0.00 ? 46 ASP S OD1  10 
ATOM 10515 O OD2  . ASP A 1 37 ? -2.740  2.077   -5.538  1.00 0.00 ? 46 ASP S OD2  10 
ATOM 10516 H H    . ASP A 1 37 ? -1.945  -2.088  -7.816  1.00 0.00 ? 46 ASP S H    10 
ATOM 10517 H HA   . ASP A 1 37 ? -0.947  0.530   -8.172  1.00 0.00 ? 46 ASP S HA   10 
ATOM 10518 H HB2  . ASP A 1 37 ? -2.976  0.022   -6.861  1.00 0.00 ? 46 ASP S HB2  10 
ATOM 10519 H HB3  . ASP A 1 37 ? -1.990  -0.828  -5.668  1.00 0.00 ? 46 ASP S HB3  10 
ATOM 10520 N N    . PHE A 1 38 ? 0.776   -1.595  -6.391  1.00 0.00 ? 47 PHE S N    10 
ATOM 10521 C CA   . PHE A 1 38 ? 2.078   -1.870  -5.805  1.00 0.00 ? 47 PHE S CA   10 
ATOM 10522 C C    . PHE A 1 38 ? 3.151   -1.642  -6.844  1.00 0.00 ? 47 PHE S C    10 
ATOM 10523 O O    . PHE A 1 38 ? 4.178   -1.028  -6.579  1.00 0.00 ? 47 PHE S O    10 
ATOM 10524 C CB   . PHE A 1 38 ? 2.163   -3.325  -5.340  1.00 0.00 ? 47 PHE S CB   10 
ATOM 10525 C CG   . PHE A 1 38 ? 2.299   -3.495  -3.860  1.00 0.00 ? 47 PHE S CG   10 
ATOM 10526 C CD1  . PHE A 1 38 ? 3.403   -2.999  -3.189  1.00 0.00 ? 47 PHE S CD1  10 
ATOM 10527 C CD2  . PHE A 1 38 ? 1.323   -4.158  -3.144  1.00 0.00 ? 47 PHE S CD2  10 
ATOM 10528 C CE1  . PHE A 1 38 ? 3.527   -3.162  -1.825  1.00 0.00 ? 47 PHE S CE1  10 
ATOM 10529 C CE2  . PHE A 1 38 ? 1.438   -4.323  -1.781  1.00 0.00 ? 47 PHE S CE2  10 
ATOM 10530 C CZ   . PHE A 1 38 ? 2.542   -3.824  -1.119  1.00 0.00 ? 47 PHE S CZ   10 
ATOM 10531 H H    . PHE A 1 38 ? 0.138   -2.330  -6.493  1.00 0.00 ? 47 PHE S H    10 
ATOM 10532 H HA   . PHE A 1 38 ? 2.234   -1.207  -4.968  1.00 0.00 ? 47 PHE S HA   10 
ATOM 10533 H HB2  . PHE A 1 38 ? 1.275   -3.845  -5.650  1.00 0.00 ? 47 PHE S HB2  10 
ATOM 10534 H HB3  . PHE A 1 38 ? 3.019   -3.788  -5.803  1.00 0.00 ? 47 PHE S HB3  10 
ATOM 10535 H HD1  . PHE A 1 38 ? 4.172   -2.481  -3.742  1.00 0.00 ? 47 PHE S HD1  10 
ATOM 10536 H HD2  . PHE A 1 38 ? 0.461   -4.550  -3.663  1.00 0.00 ? 47 PHE S HD2  10 
ATOM 10537 H HE1  . PHE A 1 38 ? 4.392   -2.775  -1.309  1.00 0.00 ? 47 PHE S HE1  10 
ATOM 10538 H HE2  . PHE A 1 38 ? 0.665   -4.845  -1.238  1.00 0.00 ? 47 PHE S HE2  10 
ATOM 10539 H HZ   . PHE A 1 38 ? 2.632   -3.947  -0.051  1.00 0.00 ? 47 PHE S HZ   10 
ATOM 10540 N N    . GLU A 1 39 ? 2.900   -2.170  -8.034  1.00 0.00 ? 48 GLU S N    10 
ATOM 10541 C CA   . GLU A 1 39 ? 3.855   -2.049  -9.129  1.00 0.00 ? 48 GLU S CA   10 
ATOM 10542 C C    . GLU A 1 39 ? 4.185   -0.588  -9.434  1.00 0.00 ? 48 GLU S C    10 
ATOM 10543 O O    . GLU A 1 39 ? 5.347   -0.235  -9.631  1.00 0.00 ? 48 GLU S O    10 
ATOM 10544 C CB   . GLU A 1 39 ? 3.310   -2.734  -10.384 1.00 0.00 ? 48 GLU S CB   10 
ATOM 10545 C CG   . GLU A 1 39 ? 3.562   -4.234  -10.416 1.00 0.00 ? 48 GLU S CG   10 
ATOM 10546 C CD   . GLU A 1 39 ? 3.826   -4.751  -11.816 1.00 0.00 ? 48 GLU S CD   10 
ATOM 10547 O OE1  . GLU A 1 39 ? 3.242   -4.197  -12.773 1.00 0.00 ? 48 GLU S OE1  10 
ATOM 10548 O OE2  . GLU A 1 39 ? 4.613   -5.709  -11.957 1.00 0.00 ? 48 GLU S OE2  10 
ATOM 10549 H H    . GLU A 1 39 ? 2.049   -2.671  -8.175  1.00 0.00 ? 48 GLU S H    10 
ATOM 10550 H HA   . GLU A 1 39 ? 4.762   -2.551  -8.825  1.00 0.00 ? 48 GLU S HA   10 
ATOM 10551 H HB2  . GLU A 1 39 ? 2.243   -2.569  -10.436 1.00 0.00 ? 48 GLU S HB2  10 
ATOM 10552 H HB3  . GLU A 1 39 ? 3.777   -2.295  -11.252 1.00 0.00 ? 48 GLU S HB3  10 
ATOM 10553 H HG2  . GLU A 1 39 ? 4.423   -4.454  -9.799  1.00 0.00 ? 48 GLU S HG2  10 
ATOM 10554 H HG3  . GLU A 1 39 ? 2.692   -4.741  -10.017 1.00 0.00 ? 48 GLU S HG3  10 
ATOM 10555 N N    . PHE A 1 40 ? 3.159   0.256   -9.486  1.00 0.00 ? 49 PHE S N    10 
ATOM 10556 C CA   . PHE A 1 40 ? 3.352   1.674   -9.786  1.00 0.00 ? 49 PHE S CA   10 
ATOM 10557 C C    . PHE A 1 40 ? 3.617   2.504   -8.528  1.00 0.00 ? 49 PHE S C    10 
ATOM 10558 O O    . PHE A 1 40 ? 4.039   3.656   -8.622  1.00 0.00 ? 49 PHE S O    10 
ATOM 10559 C CB   . PHE A 1 40 ? 2.129   2.223   -10.524 1.00 0.00 ? 49 PHE S CB   10 
ATOM 10560 C CG   . PHE A 1 40 ? 2.454   2.823   -11.861 1.00 0.00 ? 49 PHE S CG   10 
ATOM 10561 C CD1  . PHE A 1 40 ? 3.116   2.080   -12.825 1.00 0.00 ? 49 PHE S CD1  10 
ATOM 10562 C CD2  . PHE A 1 40 ? 2.096   4.129   -12.155 1.00 0.00 ? 49 PHE S CD2  10 
ATOM 10563 C CE1  . PHE A 1 40 ? 3.415   2.629   -14.059 1.00 0.00 ? 49 PHE S CE1  10 
ATOM 10564 C CE2  . PHE A 1 40 ? 2.393   4.683   -13.386 1.00 0.00 ? 49 PHE S CE2  10 
ATOM 10565 C CZ   . PHE A 1 40 ? 3.053   3.932   -14.339 1.00 0.00 ? 49 PHE S CZ   10 
ATOM 10566 H H    . PHE A 1 40 ? 2.252   -0.082  -9.330  1.00 0.00 ? 49 PHE S H    10 
ATOM 10567 H HA   . PHE A 1 40 ? 4.210   1.754   -10.436 1.00 0.00 ? 49 PHE S HA   10 
ATOM 10568 H HB2  . PHE A 1 40 ? 1.423   1.419   -10.683 1.00 0.00 ? 49 PHE S HB2  10 
ATOM 10569 H HB3  . PHE A 1 40 ? 1.665   2.991   -9.917  1.00 0.00 ? 49 PHE S HB3  10 
ATOM 10570 H HD1  . PHE A 1 40 ? 3.399   1.061   -12.608 1.00 0.00 ? 49 PHE S HD1  10 
ATOM 10571 H HD2  . PHE A 1 40 ? 1.581   4.717   -11.410 1.00 0.00 ? 49 PHE S HD2  10 
ATOM 10572 H HE1  . PHE A 1 40 ? 3.931   2.039   -14.802 1.00 0.00 ? 49 PHE S HE1  10 
ATOM 10573 H HE2  . PHE A 1 40 ? 2.109   5.702   -13.603 1.00 0.00 ? 49 PHE S HE2  10 
ATOM 10574 H HZ   . PHE A 1 40 ? 3.287   4.364   -15.301 1.00 0.00 ? 49 PHE S HZ   10 
ATOM 10575 N N    . ALA A 1 41 ? 3.363   1.929   -7.357  1.00 0.00 ? 50 ALA S N    10 
ATOM 10576 C CA   . ALA A 1 41 ? 3.575   2.646   -6.101  1.00 0.00 ? 50 ALA S CA   10 
ATOM 10577 C C    . ALA A 1 41 ? 4.891   2.251   -5.437  1.00 0.00 ? 50 ALA S C    10 
ATOM 10578 O O    . ALA A 1 41 ? 5.639   3.106   -4.963  1.00 0.00 ? 50 ALA S O    10 
ATOM 10579 C CB   . ALA A 1 41 ? 2.412   2.401   -5.153  1.00 0.00 ? 50 ALA S CB   10 
ATOM 10580 H H    . ALA A 1 41 ? 3.023   1.011   -7.333  1.00 0.00 ? 50 ALA S H    10 
ATOM 10581 H HA   . ALA A 1 41 ? 3.604   3.703   -6.327  1.00 0.00 ? 50 ALA S HA   10 
ATOM 10582 H HB1  . ALA A 1 41 ? 1.481   2.527   -5.686  1.00 0.00 ? 50 ALA S HB1  10 
ATOM 10583 H HB2  . ALA A 1 41 ? 2.458   3.106   -4.337  1.00 0.00 ? 50 ALA S HB2  10 
ATOM 10584 H HB3  . ALA A 1 41 ? 2.471   1.394   -4.763  1.00 0.00 ? 50 ALA S HB3  10 
ATOM 10585 N N    . LEU A 1 42 ? 5.161   0.954   -5.390  1.00 0.00 ? 51 LEU S N    10 
ATOM 10586 C CA   . LEU A 1 42 ? 6.380   0.447   -4.767  1.00 0.00 ? 51 LEU S CA   10 
ATOM 10587 C C    . LEU A 1 42 ? 7.158   -0.491  -5.689  1.00 0.00 ? 51 LEU S C    10 
ATOM 10588 O O    . LEU A 1 42 ? 8.222   -0.986  -5.316  1.00 0.00 ? 51 LEU S O    10 
ATOM 10589 C CB   . LEU A 1 42 ? 6.036   -0.284  -3.469  1.00 0.00 ? 51 LEU S CB   10 
ATOM 10590 C CG   . LEU A 1 42 ? 6.051   0.582   -2.210  1.00 0.00 ? 51 LEU S CG   10 
ATOM 10591 C CD1  . LEU A 1 42 ? 5.090   0.029   -1.167  1.00 0.00 ? 51 LEU S CD1  10 
ATOM 10592 C CD2  . LEU A 1 42 ? 7.467   0.659   -1.664  1.00 0.00 ? 51 LEU S CD2  10 
ATOM 10593 H H    . LEU A 1 42 ? 4.521   0.319   -5.772  1.00 0.00 ? 51 LEU S H    10 
ATOM 10594 H HA   . LEU A 1 42 ? 7.005   1.294   -4.530  1.00 0.00 ? 51 LEU S HA   10 
ATOM 10595 H HB2  . LEU A 1 42 ? 5.049   -0.711  -3.574  1.00 0.00 ? 51 LEU S HB2  10 
ATOM 10596 H HB3  . LEU A 1 42 ? 6.744   -1.087  -3.332  1.00 0.00 ? 51 LEU S HB3  10 
ATOM 10597 H HG   . LEU A 1 42 ? 5.732   1.585   -2.457  1.00 0.00 ? 51 LEU S HG   10 
ATOM 10598 H HD11 . LEU A 1 42 ? 4.357   0.782   -0.918  1.00 0.00 ? 51 LEU S HD11 10 
ATOM 10599 H HD12 . LEU A 1 42 ? 5.640   -0.241  -0.277  1.00 0.00 ? 51 LEU S HD12 10 
ATOM 10600 H HD13 . LEU A 1 42 ? 4.593   -0.843  -1.561  1.00 0.00 ? 51 LEU S HD13 10 
ATOM 10601 H HD21 . LEU A 1 42 ? 7.481   0.307   -0.648  1.00 0.00 ? 51 LEU S HD21 10 
ATOM 10602 H HD22 . LEU A 1 42 ? 7.814   1.678   -1.700  1.00 0.00 ? 51 LEU S HD22 10 
ATOM 10603 H HD23 . LEU A 1 42 ? 8.116   0.039   -2.264  1.00 0.00 ? 51 LEU S HD23 10 
ATOM 10604 N N    . ASP A 1 43 ? 6.631   -0.746  -6.881  1.00 0.00 ? 52 ASP S N    10 
ATOM 10605 C CA   . ASP A 1 43 ? 7.293   -1.637  -7.822  1.00 0.00 ? 52 ASP S CA   10 
ATOM 10606 C C    . ASP A 1 43 ? 7.450   -3.042  -7.237  1.00 0.00 ? 52 ASP S C    10 
ATOM 10607 O O    . ASP A 1 43 ? 8.197   -3.862  -7.770  1.00 0.00 ? 52 ASP S O    10 
ATOM 10608 C CB   . ASP A 1 43 ? 8.665   -1.080  -8.206  1.00 0.00 ? 52 ASP S CB   10 
ATOM 10609 C CG   . ASP A 1 43 ? 8.607   0.387   -8.586  1.00 0.00 ? 52 ASP S CG   10 
ATOM 10610 O OD1  . ASP A 1 43 ? 8.016   0.705   -9.640  1.00 0.00 ? 52 ASP S OD1  10 
ATOM 10611 O OD2  . ASP A 1 43 ? 9.152   1.217   -7.830  1.00 0.00 ? 52 ASP S OD2  10 
ATOM 10612 H H    . ASP A 1 43 ? 5.778   -0.334  -7.132  1.00 0.00 ? 52 ASP S H    10 
ATOM 10613 H HA   . ASP A 1 43 ? 6.680   -1.698  -8.708  1.00 0.00 ? 52 ASP S HA   10 
ATOM 10614 H HB2  . ASP A 1 43 ? 9.339   -1.188  -7.369  1.00 0.00 ? 52 ASP S HB2  10 
ATOM 10615 H HB3  . ASP A 1 43 ? 9.049   -1.636  -9.051  1.00 0.00 ? 52 ASP S HB3  10 
ATOM 10616 N N    . MET A 1 44 ? 6.738   -3.321  -6.142  1.00 0.00 ? 53 MET S N    10 
ATOM 10617 C CA   . MET A 1 44 ? 6.808   -4.638  -5.508  1.00 0.00 ? 53 MET S CA   10 
ATOM 10618 C C    . MET A 1 44 ? 5.439   -5.312  -5.515  1.00 0.00 ? 53 MET S C    10 
ATOM 10619 O O    . MET A 1 44 ? 4.563   -4.920  -6.282  1.00 0.00 ? 53 MET S O    10 
ATOM 10620 C CB   . MET A 1 44 ? 7.340   -4.520  -4.079  1.00 0.00 ? 53 MET S CB   10 
ATOM 10621 C CG   . MET A 1 44 ? 8.607   -5.326  -3.843  1.00 0.00 ? 53 MET S CG   10 
ATOM 10622 S SD   . MET A 1 44 ? 10.105  -4.345  -4.052  1.00 0.00 ? 53 MET S SD   10 
ATOM 10623 C CE   . MET A 1 44 ? 11.262  -5.604  -4.586  1.00 0.00 ? 53 MET S CE   10 
ATOM 10624 H H    . MET A 1 44 ? 6.150   -2.632  -5.757  1.00 0.00 ? 53 MET S H    10 
ATOM 10625 H HA   . MET A 1 44 ? 7.492   -5.243  -6.085  1.00 0.00 ? 53 MET S HA   10 
ATOM 10626 H HB2  . MET A 1 44 ? 7.556   -3.482  -3.874  1.00 0.00 ? 53 MET S HB2  10 
ATOM 10627 H HB3  . MET A 1 44 ? 6.582   -4.867  -3.390  1.00 0.00 ? 53 MET S HB3  10 
ATOM 10628 H HG2  . MET A 1 44 ? 8.587   -5.719  -2.838  1.00 0.00 ? 53 MET S HG2  10 
ATOM 10629 H HG3  . MET A 1 44 ? 8.629   -6.147  -4.545  1.00 0.00 ? 53 MET S HG3  10 
ATOM 10630 H HE1  . MET A 1 44 ? 11.386  -6.335  -3.802  1.00 0.00 ? 53 MET S HE1  10 
ATOM 10631 H HE2  . MET A 1 44 ? 12.215  -5.148  -4.808  1.00 0.00 ? 53 MET S HE2  10 
ATOM 10632 H HE3  . MET A 1 44 ? 10.881  -6.090  -5.473  1.00 0.00 ? 53 MET S HE3  10 
ATOM 10633 N N    . THR A 1 45 ? 5.251   -6.326  -4.671  1.00 0.00 ? 54 THR S N    10 
ATOM 10634 C CA   . THR A 1 45 ? 3.973   -7.021  -4.613  1.00 0.00 ? 54 THR S CA   10 
ATOM 10635 C C    . THR A 1 45 ? 3.526   -7.212  -3.174  1.00 0.00 ? 54 THR S C    10 
ATOM 10636 O O    . THR A 1 45 ? 4.351   -7.398  -2.280  1.00 0.00 ? 54 THR S O    10 
ATOM 10637 C CB   . THR A 1 45 ? 4.065   -8.370  -5.326  1.00 0.00 ? 54 THR S CB   10 
ATOM 10638 O OG1  . THR A 1 45 ? 5.387   -8.874  -5.278  1.00 0.00 ? 54 THR S OG1  10 
ATOM 10639 C CG2  . THR A 1 45 ? 3.657   -8.301  -6.781  1.00 0.00 ? 54 THR S CG2  10 
ATOM 10640 H H    . THR A 1 45 ? 5.976   -6.610  -4.069  1.00 0.00 ? 54 THR S H    10 
ATOM 10641 H HA   . THR A 1 45 ? 3.245   -6.407  -5.121  1.00 0.00 ? 54 THR S HA   10 
ATOM 10642 H HB   . THR A 1 45 ? 3.413   -9.075  -4.833  1.00 0.00 ? 54 THR S HB   10 
ATOM 10643 H HG1  . THR A 1 45 ? 5.379   -9.813  -5.479  1.00 0.00 ? 54 THR S HG1  10 
ATOM 10644 H HG21 . THR A 1 45 ? 4.079   -9.139  -7.315  1.00 0.00 ? 54 THR S HG21 10 
ATOM 10645 H HG22 . THR A 1 45 ? 4.020   -7.379  -7.213  1.00 0.00 ? 54 THR S HG22 10 
ATOM 10646 H HG23 . THR A 1 45 ? 2.580   -8.331  -6.855  1.00 0.00 ? 54 THR S HG23 10 
ATOM 10647 N N    . ARG A 1 46 ? 2.218   -7.185  -2.950  1.00 0.00 ? 55 ARG S N    10 
ATOM 10648 C CA   . ARG A 1 46 ? 1.680   -7.378  -1.611  1.00 0.00 ? 55 ARG S CA   10 
ATOM 10649 C C    . ARG A 1 46 ? 2.159   -8.709  -1.043  1.00 0.00 ? 55 ARG S C    10 
ATOM 10650 O O    . ARG A 1 46 ? 2.308   -8.862  0.165   1.00 0.00 ? 55 ARG S O    10 
ATOM 10651 C CB   . ARG A 1 46 ? 0.151   -7.338  -1.638  1.00 0.00 ? 55 ARG S CB   10 
ATOM 10652 C CG   . ARG A 1 46 ? -0.468  -6.852  -0.337  1.00 0.00 ? 55 ARG S CG   10 
ATOM 10653 C CD   . ARG A 1 46 ? -1.350  -7.915  0.295   1.00 0.00 ? 55 ARG S CD   10 
ATOM 10654 N NE   . ARG A 1 46 ? -1.413  -7.780  1.750   1.00 0.00 ? 55 ARG S NE   10 
ATOM 10655 C CZ   . ARG A 1 46 ? -2.362  -8.329  2.506   1.00 0.00 ? 55 ARG S CZ   10 
ATOM 10656 N NH1  . ARG A 1 46 ? -3.330  -9.047  1.950   1.00 0.00 ? 55 ARG S NH1  10 
ATOM 10657 N NH2  . ARG A 1 46 ? -2.343  -8.158  3.820   1.00 0.00 ? 55 ARG S NH2  10 
ATOM 10658 H H    . ARG A 1 46 ? 1.603   -7.047  -3.701  1.00 0.00 ? 55 ARG S H    10 
ATOM 10659 H HA   . ARG A 1 46 ? 2.047   -6.578  -0.985  1.00 0.00 ? 55 ARG S HA   10 
ATOM 10660 H HB2  . ARG A 1 46 ? -0.166  -6.673  -2.432  1.00 0.00 ? 55 ARG S HB2  10 
ATOM 10661 H HB3  . ARG A 1 46 ? -0.220  -8.333  -1.841  1.00 0.00 ? 55 ARG S HB3  10 
ATOM 10662 H HG2  . ARG A 1 46 ? 0.323   -6.600  0.354   1.00 0.00 ? 55 ARG S HG2  10 
ATOM 10663 H HG3  . ARG A 1 46 ? -1.064  -5.975  -0.539  1.00 0.00 ? 55 ARG S HG3  10 
ATOM 10664 H HD2  . ARG A 1 46 ? -2.348  -7.823  -0.107  1.00 0.00 ? 55 ARG S HD2  10 
ATOM 10665 H HD3  . ARG A 1 46 ? -0.953  -8.889  0.050   1.00 0.00 ? 55 ARG S HD3  10 
ATOM 10666 H HE   . ARG A 1 46 ? -0.711  -7.253  2.185   1.00 0.00 ? 55 ARG S HE   10 
ATOM 10667 H HH11 . ARG A 1 46 ? -3.350  -9.180  0.960   1.00 0.00 ? 55 ARG S HH11 10 
ATOM 10668 H HH12 . ARG A 1 46 ? -4.040  -9.456  2.525   1.00 0.00 ? 55 ARG S HH12 10 
ATOM 10669 H HH21 . ARG A 1 46 ? -1.616  -7.615  4.244   1.00 0.00 ? 55 ARG S HH21 10 
ATOM 10670 H HH22 . ARG A 1 46 ? -3.055  -8.569  4.389   1.00 0.00 ? 55 ARG S HH22 10 
ATOM 10671 N N    . ASP A 1 47 ? 2.402   -9.666  -1.937  1.00 0.00 ? 56 ASP S N    10 
ATOM 10672 C CA   . ASP A 1 47 ? 2.867   -10.993 -1.552  1.00 0.00 ? 56 ASP S CA   10 
ATOM 10673 C C    . ASP A 1 47 ? 4.392   -11.049 -1.437  1.00 0.00 ? 56 ASP S C    10 
ATOM 10674 O O    . ASP A 1 47 ? 4.946   -12.037 -0.958  1.00 0.00 ? 56 ASP S O    10 
ATOM 10675 C CB   . ASP A 1 47 ? 2.388   -12.034 -2.566  1.00 0.00 ? 56 ASP S CB   10 
ATOM 10676 C CG   . ASP A 1 47 ? 1.055   -12.646 -2.180  1.00 0.00 ? 56 ASP S CG   10 
ATOM 10677 O OD1  . ASP A 1 47 ? 0.842   -12.897 -0.975  1.00 0.00 ? 56 ASP S OD1  10 
ATOM 10678 O OD2  . ASP A 1 47 ? 0.223   -12.873 -3.083  1.00 0.00 ? 56 ASP S OD2  10 
ATOM 10679 H H    . ASP A 1 47 ? 2.265   -9.471  -2.887  1.00 0.00 ? 56 ASP S H    10 
ATOM 10680 H HA   . ASP A 1 47 ? 2.440   -11.225 -0.588  1.00 0.00 ? 56 ASP S HA   10 
ATOM 10681 H HB2  . ASP A 1 47 ? 2.280   -11.563 -3.531  1.00 0.00 ? 56 ASP S HB2  10 
ATOM 10682 H HB3  . ASP A 1 47 ? 3.120   -12.825 -2.635  1.00 0.00 ? 56 ASP S HB3  10 
ATOM 10683 N N    . GLU A 1 48 ? 5.069   -9.985  -1.868  1.00 0.00 ? 57 GLU S N    10 
ATOM 10684 C CA   . GLU A 1 48 ? 6.523   -9.928  -1.796  1.00 0.00 ? 57 GLU S CA   10 
ATOM 10685 C C    . GLU A 1 48 ? 6.919   -9.232  -0.517  1.00 0.00 ? 57 GLU S C    10 
ATOM 10686 O O    . GLU A 1 48 ? 7.527   -9.823  0.375   1.00 0.00 ? 57 GLU S O    10 
ATOM 10687 C CB   . GLU A 1 48 ? 7.087   -9.175  -3.001  1.00 0.00 ? 57 GLU S CB   10 
ATOM 10688 C CG   . GLU A 1 48 ? 8.600   -9.025  -2.972  1.00 0.00 ? 57 GLU S CG   10 
ATOM 10689 C CD   . GLU A 1 48 ? 9.181   -8.716  -4.339  1.00 0.00 ? 57 GLU S CD   10 
ATOM 10690 O OE1  . GLU A 1 48 ? 8.475   -8.929  -5.347  1.00 0.00 ? 57 GLU S OE1  10 
ATOM 10691 O OE2  . GLU A 1 48 ? 10.342  -8.259  -4.401  1.00 0.00 ? 57 GLU S OE2  10 
ATOM 10692 H H    . GLU A 1 48 ? 4.582   -9.211  -2.223  1.00 0.00 ? 57 GLU S H    10 
ATOM 10693 H HA   . GLU A 1 48 ? 6.904   -10.939 -1.789  1.00 0.00 ? 57 GLU S HA   10 
ATOM 10694 H HB2  . GLU A 1 48 ? 6.816   -9.708  -3.900  1.00 0.00 ? 57 GLU S HB2  10 
ATOM 10695 H HB3  . GLU A 1 48 ? 6.648   -8.184  -3.028  1.00 0.00 ? 57 GLU S HB3  10 
ATOM 10696 H HG2  . GLU A 1 48 ? 8.857   -8.222  -2.299  1.00 0.00 ? 57 GLU S HG2  10 
ATOM 10697 H HG3  . GLU A 1 48 ? 9.033   -9.949  -2.615  1.00 0.00 ? 57 GLU S HG3  10 
ATOM 10698 N N    . TYR A 1 49 ? 6.522   -7.975  -0.427  1.00 0.00 ? 58 TYR S N    10 
ATOM 10699 C CA   . TYR A 1 49 ? 6.775   -7.176  0.752   1.00 0.00 ? 58 TYR S CA   10 
ATOM 10700 C C    . TYR A 1 49 ? 6.195   -7.885  1.966   1.00 0.00 ? 58 TYR S C    10 
ATOM 10701 O O    . TYR A 1 49 ? 6.711   -7.770  3.077   1.00 0.00 ? 58 TYR S O    10 
ATOM 10702 C CB   . TYR A 1 49 ? 6.117   -5.814  0.579   1.00 0.00 ? 58 TYR S CB   10 
ATOM 10703 C CG   . TYR A 1 49 ? 7.014   -4.757  -0.030  1.00 0.00 ? 58 TYR S CG   10 
ATOM 10704 C CD1  . TYR A 1 49 ? 8.296   -5.062  -0.489  1.00 0.00 ? 58 TYR S CD1  10 
ATOM 10705 C CD2  . TYR A 1 49 ? 6.578   -3.446  -0.141  1.00 0.00 ? 58 TYR S CD2  10 
ATOM 10706 C CE1  . TYR A 1 49 ? 9.106   -4.089  -1.039  1.00 0.00 ? 58 TYR S CE1  10 
ATOM 10707 C CE2  . TYR A 1 49 ? 7.383   -2.472  -0.691  1.00 0.00 ? 58 TYR S CE2  10 
ATOM 10708 C CZ   . TYR A 1 49 ? 8.646   -2.796  -1.138  1.00 0.00 ? 58 TYR S CZ   10 
ATOM 10709 O OH   . TYR A 1 49 ? 9.448   -1.823  -1.686  1.00 0.00 ? 58 TYR S OH   10 
ATOM 10710 H H    . TYR A 1 49 ? 6.012   -7.582  -1.166  1.00 0.00 ? 58 TYR S H    10 
ATOM 10711 H HA   . TYR A 1 49 ? 7.839   -7.059  0.876   1.00 0.00 ? 58 TYR S HA   10 
ATOM 10712 H HB2  . TYR A 1 49 ? 5.261   -5.926  -0.072  1.00 0.00 ? 58 TYR S HB2  10 
ATOM 10713 H HB3  . TYR A 1 49 ? 5.783   -5.465  1.537   1.00 0.00 ? 58 TYR S HB3  10 
ATOM 10714 H HD1  . TYR A 1 49 ? 8.655   -6.077  -0.414  1.00 0.00 ? 58 TYR S HD1  10 
ATOM 10715 H HD2  . TYR A 1 49 ? 5.589   -3.190  0.211   1.00 0.00 ? 58 TYR S HD2  10 
ATOM 10716 H HE1  . TYR A 1 49 ? 10.095  -4.345  -1.389  1.00 0.00 ? 58 TYR S HE1  10 
ATOM 10717 H HE2  . TYR A 1 49 ? 7.022   -1.465  -0.768  1.00 0.00 ? 58 TYR S HE2  10 
ATOM 10718 H HH   . TYR A 1 49 ? 9.156   -1.633  -2.581  1.00 0.00 ? 58 TYR S HH   10 
ATOM 10719 N N    . ASN A 1 50 ? 5.120   -8.630  1.733   1.00 0.00 ? 59 ASN S N    10 
ATOM 10720 C CA   . ASN A 1 50 ? 4.461   -9.378  2.807   1.00 0.00 ? 59 ASN S CA   10 
ATOM 10721 C C    . ASN A 1 50 ? 5.465   -10.218 3.601   1.00 0.00 ? 59 ASN S C    10 
ATOM 10722 O O    . ASN A 1 50 ? 5.219   -10.559 4.757   1.00 0.00 ? 59 ASN S O    10 
ATOM 10723 C CB   . ASN A 1 50 ? 3.375   -10.294 2.235   1.00 0.00 ? 59 ASN S CB   10 
ATOM 10724 C CG   . ASN A 1 50 ? 1.978   -9.864  2.646   1.00 0.00 ? 59 ASN S CG   10 
ATOM 10725 O OD1  . ASN A 1 50 ? 1.123   -10.698 2.944   1.00 0.00 ? 59 ASN S OD1  10 
ATOM 10726 N ND2  . ASN A 1 50 ? 1.740   -8.558  2.665   1.00 0.00 ? 59 ASN S ND2  10 
ATOM 10727 H H    . ASN A 1 50 ? 4.763   -8.677  0.810   1.00 0.00 ? 59 ASN S H    10 
ATOM 10728 H HA   . ASN A 1 50 ? 4.003   -8.663  3.472   1.00 0.00 ? 59 ASN S HA   10 
ATOM 10729 H HB2  . ASN A 1 50 ? 3.434   -10.285 1.159   1.00 0.00 ? 59 ASN S HB2  10 
ATOM 10730 H HB3  . ASN A 1 50 ? 3.538   -11.302 2.589   1.00 0.00 ? 59 ASN S HB3  10 
ATOM 10731 H HD21 . ASN A 1 50 ? 2.467   -7.951  2.415   1.00 0.00 ? 59 ASN S HD21 10 
ATOM 10732 H HD22 . ASN A 1 50 ? 0.847   -8.254  2.928   1.00 0.00 ? 59 ASN S HD22 10 
ATOM 10733 N N    . ALA A 1 51 ? 6.589   -10.556 2.972   1.00 0.00 ? 60 ALA S N    10 
ATOM 10734 C CA   . ALA A 1 51 ? 7.613   -11.365 3.627   1.00 0.00 ? 60 ALA S CA   10 
ATOM 10735 C C    . ALA A 1 51 ? 8.901   -10.576 3.835   1.00 0.00 ? 60 ALA S C    10 
ATOM 10736 O O    . ALA A 1 51 ? 9.610   -10.779 4.821   1.00 0.00 ? 60 ALA S O    10 
ATOM 10737 C CB   . ALA A 1 51 ? 7.889   -12.622 2.816   1.00 0.00 ? 60 ALA S CB   10 
ATOM 10738 H H    . ALA A 1 51 ? 6.730   -10.262 2.048   1.00 0.00 ? 60 ALA S H    10 
ATOM 10739 H HA   . ALA A 1 51 ? 7.230   -11.667 4.591   1.00 0.00 ? 60 ALA S HA   10 
ATOM 10740 H HB1  . ALA A 1 51 ? 8.659   -13.202 3.301   1.00 0.00 ? 60 ALA S HB1  10 
ATOM 10741 H HB2  . ALA A 1 51 ? 8.216   -12.346 1.824   1.00 0.00 ? 60 ALA S HB2  10 
ATOM 10742 H HB3  . ALA A 1 51 ? 6.986   -13.210 2.745   1.00 0.00 ? 60 ALA S HB3  10 
ATOM 10743 N N    . LEU A 1 52 ? 9.198   -9.677  2.905   1.00 0.00 ? 61 LEU S N    10 
ATOM 10744 C CA   . LEU A 1 52 ? 10.404  -8.860  2.994   1.00 0.00 ? 61 LEU S CA   10 
ATOM 10745 C C    . LEU A 1 52 ? 10.384  -8.008  4.261   1.00 0.00 ? 61 LEU S C    10 
ATOM 10746 O O    . LEU A 1 52 ? 9.325   -7.785  4.848   1.00 0.00 ? 61 LEU S O    10 
ATOM 10747 C CB   . LEU A 1 52 ? 10.525  -7.963  1.759   1.00 0.00 ? 61 LEU S CB   10 
ATOM 10748 C CG   . LEU A 1 52 ? 11.492  -8.469  0.684   1.00 0.00 ? 61 LEU S CG   10 
ATOM 10749 C CD1  . LEU A 1 52 ? 10.838  -8.427  -0.689  1.00 0.00 ? 61 LEU S CD1  10 
ATOM 10750 C CD2  . LEU A 1 52 ? 12.776  -7.651  0.689   1.00 0.00 ? 61 LEU S CD2  10 
ATOM 10751 H H    . LEU A 1 52 ? 8.595   -9.558  2.143   1.00 0.00 ? 61 LEU S H    10 
ATOM 10752 H HA   . LEU A 1 52 ? 11.254  -9.524  3.034   1.00 0.00 ? 61 LEU S HA   10 
ATOM 10753 H HB2  . LEU A 1 52 ? 9.544   -7.867  1.316   1.00 0.00 ? 61 LEU S HB2  10 
ATOM 10754 H HB3  . LEU A 1 52 ? 10.855  -6.984  2.081   1.00 0.00 ? 61 LEU S HB3  10 
ATOM 10755 H HG   . LEU A 1 52 ? 11.749  -9.497  0.898   1.00 0.00 ? 61 LEU S HG   10 
ATOM 10756 H HD11 . LEU A 1 52 ? 9.809   -8.745  -0.607  1.00 0.00 ? 61 LEU S HD11 10 
ATOM 10757 H HD12 . LEU A 1 52 ? 11.367  -9.087  -1.360  1.00 0.00 ? 61 LEU S HD12 10 
ATOM 10758 H HD13 . LEU A 1 52 ? 10.873  -7.418  -1.073  1.00 0.00 ? 61 LEU S HD13 10 
ATOM 10759 H HD21 . LEU A 1 52 ? 13.160  -7.580  -0.317  1.00 0.00 ? 61 LEU S HD21 10 
ATOM 10760 H HD22 . LEU A 1 52 ? 13.507  -8.132  1.321   1.00 0.00 ? 61 LEU S HD22 10 
ATOM 10761 H HD23 . LEU A 1 52 ? 12.568  -6.661  1.067   1.00 0.00 ? 61 LEU S HD23 10 
ATOM 10762 N N    . PRO A 1 53 ? 11.555  -7.515  4.700   1.00 0.00 ? 62 PRO S N    10 
ATOM 10763 C CA   . PRO A 1 53 ? 11.655  -6.684  5.902   1.00 0.00 ? 62 PRO S CA   10 
ATOM 10764 C C    . PRO A 1 53 ? 10.634  -5.552  5.898   1.00 0.00 ? 62 PRO S C    10 
ATOM 10765 O O    . PRO A 1 53 ? 10.114  -5.181  4.848   1.00 0.00 ? 62 PRO S O    10 
ATOM 10766 C CB   . PRO A 1 53 ? 13.074  -6.125  5.833   1.00 0.00 ? 62 PRO S CB   10 
ATOM 10767 C CG   . PRO A 1 53 ? 13.840  -7.130  5.045   1.00 0.00 ? 62 PRO S CG   10 
ATOM 10768 C CD   . PRO A 1 53 ? 12.868  -7.726  4.062   1.00 0.00 ? 62 PRO S CD   10 
ATOM 10769 H HA   . PRO A 1 53 ? 11.538  -7.272  6.801   1.00 0.00 ? 62 PRO S HA   10 
ATOM 10770 H HB2  . PRO A 1 53 ? 13.060  -5.163  5.341   1.00 0.00 ? 62 PRO S HB2  10 
ATOM 10771 H HB3  . PRO A 1 53 ? 13.472  -6.021  6.833   1.00 0.00 ? 62 PRO S HB3  10 
ATOM 10772 H HG2  . PRO A 1 53 ? 14.652  -6.645  4.521   1.00 0.00 ? 62 PRO S HG2  10 
ATOM 10773 H HG3  . PRO A 1 53 ? 14.225  -7.898  5.703   1.00 0.00 ? 62 PRO S HG3  10 
ATOM 10774 H HD2  . PRO A 1 53 ? 12.922  -7.204  3.115   1.00 0.00 ? 62 PRO S HD2  10 
ATOM 10775 H HD3  . PRO A 1 53 ? 13.066  -8.780  3.926   1.00 0.00 ? 62 PRO S HD3  10 
ATOM 10776 N N    . ALA A 1 54 ? 10.350  -5.014  7.078   1.00 0.00 ? 63 ALA S N    10 
ATOM 10777 C CA   . ALA A 1 54 ? 9.386   -3.930  7.210   1.00 0.00 ? 63 ALA S CA   10 
ATOM 10778 C C    . ALA A 1 54 ? 10.042  -2.564  7.023   1.00 0.00 ? 63 ALA S C    10 
ATOM 10779 O O    . ALA A 1 54 ? 9.364   -1.574  6.753   1.00 0.00 ? 63 ALA S O    10 
ATOM 10780 C CB   . ALA A 1 54 ? 8.698   -4.004  8.565   1.00 0.00 ? 63 ALA S CB   10 
ATOM 10781 H H    . ALA A 1 54 ? 10.796  -5.358  7.880   1.00 0.00 ? 63 ALA S H    10 
ATOM 10782 H HA   . ALA A 1 54 ? 8.635   -4.063  6.447   1.00 0.00 ? 63 ALA S HA   10 
ATOM 10783 H HB1  . ALA A 1 54 ? 8.867   -4.977  9.001   1.00 0.00 ? 63 ALA S HB1  10 
ATOM 10784 H HB2  . ALA A 1 54 ? 7.636   -3.847  8.438   1.00 0.00 ? 63 ALA S HB2  10 
ATOM 10785 H HB3  . ALA A 1 54 ? 9.100   -3.242  9.216   1.00 0.00 ? 63 ALA S HB3  10 
ATOM 10786 N N    . TRP A 1 55 ? 11.364  -2.513  7.153   1.00 0.00 ? 64 TRP S N    10 
ATOM 10787 C CA   . TRP A 1 55 ? 12.095  -1.282  6.990   1.00 0.00 ? 64 TRP S CA   10 
ATOM 10788 C C    . TRP A 1 55 ? 12.499  -1.130  5.537   1.00 0.00 ? 64 TRP S C    10 
ATOM 10789 O O    . TRP A 1 55 ? 12.382  -0.054  4.965   1.00 0.00 ? 64 TRP S O    10 
ATOM 10790 C CB   . TRP A 1 55 ? 13.330  -1.278  7.903   1.00 0.00 ? 64 TRP S CB   10 
ATOM 10791 C CG   . TRP A 1 55 ? 14.606  -1.455  7.146   1.00 0.00 ? 64 TRP S CG   10 
ATOM 10792 C CD1  . TRP A 1 55 ? 15.416  -2.549  7.135   1.00 0.00 ? 64 TRP S CD1  10 
ATOM 10793 C CD2  . TRP A 1 55 ? 15.183  -0.509  6.252   1.00 0.00 ? 64 TRP S CD2  10 
ATOM 10794 N NE1  . TRP A 1 55 ? 16.478  -2.334  6.285   1.00 0.00 ? 64 TRP S NE1  10 
ATOM 10795 C CE2  . TRP A 1 55 ? 16.352  -1.084  5.730   1.00 0.00 ? 64 TRP S CE2  10 
ATOM 10796 C CE3  . TRP A 1 55 ? 14.816  0.773   5.848   1.00 0.00 ? 64 TRP S CE3  10 
ATOM 10797 C CZ2  . TRP A 1 55 ? 17.158  -0.413  4.814   1.00 0.00 ? 64 TRP S CZ2  10 
ATOM 10798 C CZ3  . TRP A 1 55 ? 15.612  1.435   4.942   1.00 0.00 ? 64 TRP S CZ3  10 
ATOM 10799 C CH2  . TRP A 1 55 ? 16.768  0.844   4.433   1.00 0.00 ? 64 TRP S CH2  10 
ATOM 10800 H H    . TRP A 1 55 ? 11.860  -3.322  7.339   1.00 0.00 ? 64 TRP S H    10 
ATOM 10801 H HA   . TRP A 1 55 ? 11.444  -0.465  7.266   1.00 0.00 ? 64 TRP S HA   10 
ATOM 10802 H HB2  . TRP A 1 55 ? 13.382  -0.333  8.430   1.00 0.00 ? 64 TRP S HB2  10 
ATOM 10803 H HB3  . TRP A 1 55 ? 13.248  -2.087  8.617   1.00 0.00 ? 64 TRP S HB3  10 
ATOM 10804 H HD1  . TRP A 1 55 ? 15.236  -3.442  7.714   1.00 0.00 ? 64 TRP S HD1  10 
ATOM 10805 H HE1  . TRP A 1 55 ? 17.201  -2.970  6.105   1.00 0.00 ? 64 TRP S HE1  10 
ATOM 10806 H HE3  . TRP A 1 55 ? 13.924  1.247   6.232   1.00 0.00 ? 64 TRP S HE3  10 
ATOM 10807 H HZ2  . TRP A 1 55 ? 18.057  -0.855  4.409   1.00 0.00 ? 64 TRP S HZ2  10 
ATOM 10808 H HZ3  . TRP A 1 55 ? 15.342  2.426   4.613   1.00 0.00 ? 64 TRP S HZ3  10 
ATOM 10809 H HH2  . TRP A 1 55 ? 17.348  1.398   3.721   1.00 0.00 ? 64 TRP S HH2  10 
ATOM 10810 N N    . LYS A 1 56 ? 12.974  -2.225  4.943   1.00 0.00 ? 65 LYS S N    10 
ATOM 10811 C CA   . LYS A 1 56 ? 13.386  -2.211  3.549   1.00 0.00 ? 65 LYS S CA   10 
ATOM 10812 C C    . LYS A 1 56 ? 12.193  -1.865  2.682   1.00 0.00 ? 65 LYS S C    10 
ATOM 10813 O O    . LYS A 1 56 ? 12.289  -1.032  1.780   1.00 0.00 ? 65 LYS S O    10 
ATOM 10814 C CB   . LYS A 1 56 ? 13.981  -3.559  3.139   1.00 0.00 ? 65 LYS S CB   10 
ATOM 10815 C CG   . LYS A 1 56 ? 15.397  -3.448  2.596   1.00 0.00 ? 65 LYS S CG   10 
ATOM 10816 C CD   . LYS A 1 56 ? 16.367  -4.315  3.380   1.00 0.00 ? 65 LYS S CD   10 
ATOM 10817 C CE   . LYS A 1 56 ? 17.753  -3.692  3.440   1.00 0.00 ? 65 LYS S CE   10 
ATOM 10818 N NZ   . LYS A 1 56 ? 18.733  -4.436  2.602   1.00 0.00 ? 65 LYS S NZ   10 
ATOM 10819 H H    . LYS A 1 56 ? 13.037  -3.058  5.452   1.00 0.00 ? 65 LYS S H    10 
ATOM 10820 H HA   . LYS A 1 56 ? 14.136  -1.442  3.433   1.00 0.00 ? 65 LYS S HA   10 
ATOM 10821 H HB2  . LYS A 1 56 ? 13.998  -4.211  4.003   1.00 0.00 ? 65 LYS S HB2  10 
ATOM 10822 H HB3  . LYS A 1 56 ? 13.357  -4.001  2.372   1.00 0.00 ? 65 LYS S HB3  10 
ATOM 10823 H HG2  . LYS A 1 56 ? 15.402  -3.765  1.563   1.00 0.00 ? 65 LYS S HG2  10 
ATOM 10824 H HG3  . LYS A 1 56 ? 15.715  -2.415  2.662   1.00 0.00 ? 65 LYS S HG3  10 
ATOM 10825 H HD2  . LYS A 1 56 ? 15.996  -4.434  4.388   1.00 0.00 ? 65 LYS S HD2  10 
ATOM 10826 H HD3  . LYS A 1 56 ? 16.437  -5.282  2.905   1.00 0.00 ? 65 LYS S HD3  10 
ATOM 10827 H HE2  . LYS A 1 56 ? 17.692  -2.673  3.085   1.00 0.00 ? 65 LYS S HE2  10 
ATOM 10828 H HE3  . LYS A 1 56 ? 18.093  -3.695  4.465   1.00 0.00 ? 65 LYS S HE3  10 
ATOM 10829 H HZ1  . LYS A 1 56 ? 18.780  -4.020  1.650   1.00 0.00 ? 65 LYS S HZ1  10 
ATOM 10830 H HZ2  . LYS A 1 56 ? 18.447  -5.433  2.519   1.00 0.00 ? 65 LYS S HZ2  10 
ATOM 10831 H HZ3  . LYS A 1 56 ? 19.678  -4.395  3.033   1.00 0.00 ? 65 LYS S HZ3  10 
ATOM 10832 N N    . GLN A 1 57 ? 11.049  -2.475  2.987   1.00 0.00 ? 66 GLN S N    10 
ATOM 10833 C CA   . GLN A 1 57 ? 9.836   -2.177  2.251   1.00 0.00 ? 66 GLN S CA   10 
ATOM 10834 C C    . GLN A 1 57 ? 9.504   -0.709  2.468   1.00 0.00 ? 66 GLN S C    10 
ATOM 10835 O O    . GLN A 1 57 ? 9.095   -0.007  1.544   1.00 0.00 ? 66 GLN S O    10 
ATOM 10836 C CB   . GLN A 1 57 ? 8.681   -3.079  2.690   1.00 0.00 ? 66 GLN S CB   10 
ATOM 10837 C CG   . GLN A 1 57 ? 8.319   -2.954  4.159   1.00 0.00 ? 66 GLN S CG   10 
ATOM 10838 C CD   . GLN A 1 57 ? 7.126   -3.814  4.538   1.00 0.00 ? 66 GLN S CD   10 
ATOM 10839 O OE1  . GLN A 1 57 ? 6.253   -3.384  5.292   1.00 0.00 ? 66 GLN S OE1  10 
ATOM 10840 N NE2  . GLN A 1 57 ? 7.080   -5.039  4.017   1.00 0.00 ? 66 GLN S NE2  10 
ATOM 10841 H H    . GLN A 1 57 ? 11.019  -3.106  3.739   1.00 0.00 ? 66 GLN S H    10 
ATOM 10842 H HA   . GLN A 1 57 ? 10.040  -2.338  1.204   1.00 0.00 ? 66 GLN S HA   10 
ATOM 10843 H HB2  . GLN A 1 57 ? 7.807   -2.834  2.105   1.00 0.00 ? 66 GLN S HB2  10 
ATOM 10844 H HB3  . GLN A 1 57 ? 8.956   -4.104  2.496   1.00 0.00 ? 66 GLN S HB3  10 
ATOM 10845 H HG2  . GLN A 1 57 ? 9.167   -3.258  4.754   1.00 0.00 ? 66 GLN S HG2  10 
ATOM 10846 H HG3  . GLN A 1 57 ? 8.081   -1.922  4.372   1.00 0.00 ? 66 GLN S HG3  10 
ATOM 10847 H HE21 . GLN A 1 57 ? 7.806   -5.323  3.424   1.00 0.00 ? 66 GLN S HE21 10 
ATOM 10848 H HE22 . GLN A 1 57 ? 6.320   -5.612  4.251   1.00 0.00 ? 66 GLN S HE22 10 
ATOM 10849 N N    . VAL A 1 58 ? 9.744   -0.239  3.694   1.00 0.00 ? 67 VAL S N    10 
ATOM 10850 C CA   . VAL A 1 58 ? 9.533   1.160   4.019   1.00 0.00 ? 67 VAL S CA   10 
ATOM 10851 C C    . VAL A 1 58 ? 10.551  1.991   3.250   1.00 0.00 ? 67 VAL S C    10 
ATOM 10852 O O    . VAL A 1 58 ? 10.226  3.050   2.713   1.00 0.00 ? 67 VAL S O    10 
ATOM 10853 C CB   . VAL A 1 58 ? 9.672   1.428   5.536   1.00 0.00 ? 67 VAL S CB   10 
ATOM 10854 C CG1  . VAL A 1 58 ? 9.850   2.917   5.817   1.00 0.00 ? 67 VAL S CG1  10 
ATOM 10855 C CG2  . VAL A 1 58 ? 8.464   0.889   6.285   1.00 0.00 ? 67 VAL S CG2  10 
ATOM 10856 H H    . VAL A 1 58 ? 10.109  -0.841  4.381   1.00 0.00 ? 67 VAL S H    10 
ATOM 10857 H HA   . VAL A 1 58 ? 8.538   1.438   3.706   1.00 0.00 ? 67 VAL S HA   10 
ATOM 10858 H HB   . VAL A 1 58 ? 10.552  0.912   5.894   1.00 0.00 ? 67 VAL S HB   10 
ATOM 10859 H HG11 . VAL A 1 58 ? 9.456   3.489   4.989   1.00 0.00 ? 67 VAL S HG11 10 
ATOM 10860 H HG12 . VAL A 1 58 ? 10.901  3.136   5.938   1.00 0.00 ? 67 VAL S HG12 10 
ATOM 10861 H HG13 . VAL A 1 58 ? 9.322   3.180   6.721   1.00 0.00 ? 67 VAL S HG13 10 
ATOM 10862 H HG21 . VAL A 1 58 ? 7.741   1.679   6.417   1.00 0.00 ? 67 VAL S HG21 10 
ATOM 10863 H HG22 . VAL A 1 58 ? 8.775   0.520   7.251   1.00 0.00 ? 67 VAL S HG22 10 
ATOM 10864 H HG23 . VAL A 1 58 ? 8.020   0.084   5.718   1.00 0.00 ? 67 VAL S HG23 10 
ATOM 10865 N N    . ASN A 1 59 ? 11.789  1.491   3.187   1.00 0.00 ? 68 ASN S N    10 
ATOM 10866 C CA   . ASN A 1 59 ? 12.855  2.181   2.465   1.00 0.00 ? 68 ASN S CA   10 
ATOM 10867 C C    . ASN A 1 59 ? 12.388  2.629   1.080   1.00 0.00 ? 68 ASN S C    10 
ATOM 10868 O O    . ASN A 1 59 ? 12.573  3.784   0.692   1.00 0.00 ? 68 ASN S O    10 
ATOM 10869 C CB   . ASN A 1 59 ? 14.068  1.263   2.312   1.00 0.00 ? 68 ASN S CB   10 
ATOM 10870 C CG   . ASN A 1 59 ? 15.351  2.036   2.073   1.00 0.00 ? 68 ASN S CG   10 
ATOM 10871 O OD1  . ASN A 1 59 ? 15.488  3.181   2.501   1.00 0.00 ? 68 ASN S OD1  10 
ATOM 10872 N ND2  . ASN A 1 59 ? 16.299  1.409   1.386   1.00 0.00 ? 68 ASN S ND2  10 
ATOM 10873 H H    . ASN A 1 59 ? 11.992  0.624   3.643   1.00 0.00 ? 68 ASN S H    10 
ATOM 10874 H HA   . ASN A 1 59 ? 13.141  3.049   3.039   1.00 0.00 ? 68 ASN S HA   10 
ATOM 10875 H HB2  . ASN A 1 59 ? 14.183  0.672   3.207   1.00 0.00 ? 68 ASN S HB2  10 
ATOM 10876 H HB3  . ASN A 1 59 ? 13.905  0.603   1.471   1.00 0.00 ? 68 ASN S HB3  10 
ATOM 10877 H HD21 . ASN A 1 59 ? 16.120  0.497   1.075   1.00 0.00 ? 68 ASN S HD21 10 
ATOM 10878 H HD22 . ASN A 1 59 ? 17.140  1.886   1.217   1.00 0.00 ? 68 ASN S HD22 10 
ATOM 10879 N N    . LEU A 1 60 ? 11.793  1.702   0.336   1.00 0.00 ? 69 LEU S N    10 
ATOM 10880 C CA   . LEU A 1 60 ? 11.313  1.990   -1.009  1.00 0.00 ? 69 LEU S CA   10 
ATOM 10881 C C    . LEU A 1 60 ? 10.087  2.898   -0.982  1.00 0.00 ? 69 LEU S C    10 
ATOM 10882 O O    . LEU A 1 60 ? 9.981   3.831   -1.779  1.00 0.00 ? 69 LEU S O    10 
ATOM 10883 C CB   . LEU A 1 60 ? 10.989  0.687   -1.744  1.00 0.00 ? 69 LEU S CB   10 
ATOM 10884 C CG   . LEU A 1 60 ? 11.427  0.643   -3.208  1.00 0.00 ? 69 LEU S CG   10 
ATOM 10885 C CD1  . LEU A 1 60 ? 12.907  0.974   -3.334  1.00 0.00 ? 69 LEU S CD1  10 
ATOM 10886 C CD2  . LEU A 1 60 ? 11.132  -0.722  -3.810  1.00 0.00 ? 69 LEU S CD2  10 
ATOM 10887 H H    . LEU A 1 60 ? 11.681  0.798   0.699   1.00 0.00 ? 69 LEU S H    10 
ATOM 10888 H HA   . LEU A 1 60 ? 12.107  2.498   -1.537  1.00 0.00 ? 69 LEU S HA   10 
ATOM 10889 H HB2  . LEU A 1 60 ? 11.474  -0.125  -1.219  1.00 0.00 ? 69 LEU S HB2  10 
ATOM 10890 H HB3  . LEU A 1 60 ? 9.920   0.533   -1.706  1.00 0.00 ? 69 LEU S HB3  10 
ATOM 10891 H HG   . LEU A 1 60 ? 10.872  1.383   -3.766  1.00 0.00 ? 69 LEU S HG   10 
ATOM 10892 H HD11 . LEU A 1 60 ? 13.336  0.400   -4.141  1.00 0.00 ? 69 LEU S HD11 10 
ATOM 10893 H HD12 . LEU A 1 60 ? 13.410  0.729   -2.410  1.00 0.00 ? 69 LEU S HD12 10 
ATOM 10894 H HD13 . LEU A 1 60 ? 13.024  2.028   -3.540  1.00 0.00 ? 69 LEU S HD13 10 
ATOM 10895 H HD21 . LEU A 1 60 ? 10.096  -0.767  -4.112  1.00 0.00 ? 69 LEU S HD21 10 
ATOM 10896 H HD22 . LEU A 1 60 ? 11.326  -1.489  -3.075  1.00 0.00 ? 69 LEU S HD22 10 
ATOM 10897 H HD23 . LEU A 1 60 ? 11.764  -0.881  -4.671  1.00 0.00 ? 69 LEU S HD23 10 
ATOM 10898 N N    . LYS A 1 61 ? 9.163   2.628   -0.064  1.00 0.00 ? 70 LYS S N    10 
ATOM 10899 C CA   . LYS A 1 61 ? 7.951   3.434   0.051   1.00 0.00 ? 70 LYS S CA   10 
ATOM 10900 C C    . LYS A 1 61 ? 8.296   4.914   0.155   1.00 0.00 ? 70 LYS S C    10 
ATOM 10901 O O    . LYS A 1 61 ? 7.688   5.752   -0.510  1.00 0.00 ? 70 LYS S O    10 
ATOM 10902 C CB   . LYS A 1 61 ? 7.124   2.998   1.262   1.00 0.00 ? 70 LYS S CB   10 
ATOM 10903 C CG   . LYS A 1 61 ? 6.174   1.853   0.956   1.00 0.00 ? 70 LYS S CG   10 
ATOM 10904 C CD   . LYS A 1 61 ? 5.136   1.674   2.052   1.00 0.00 ? 70 LYS S CD   10 
ATOM 10905 C CE   . LYS A 1 61 ? 5.304   0.341   2.770   1.00 0.00 ? 70 LYS S CE   10 
ATOM 10906 N NZ   . LYS A 1 61 ? 6.698   0.124   3.250   1.00 0.00 ? 70 LYS S NZ   10 
ATOM 10907 H H    . LYS A 1 61 ? 9.298   1.874   0.547   1.00 0.00 ? 70 LYS S H    10 
ATOM 10908 H HA   . LYS A 1 61 ? 7.367   3.280   -0.844  1.00 0.00 ? 70 LYS S HA   10 
ATOM 10909 H HB2  . LYS A 1 61 ? 7.793   2.686   2.052   1.00 0.00 ? 70 LYS S HB2  10 
ATOM 10910 H HB3  . LYS A 1 61 ? 6.539   3.838   1.600   1.00 0.00 ? 70 LYS S HB3  10 
ATOM 10911 H HG2  . LYS A 1 61 ? 5.669   2.058   0.028   1.00 0.00 ? 70 LYS S HG2  10 
ATOM 10912 H HG3  . LYS A 1 61 ? 6.745   0.943   0.867   1.00 0.00 ? 70 LYS S HG3  10 
ATOM 10913 H HD2  . LYS A 1 61 ? 5.237   2.473   2.764   1.00 0.00 ? 70 LYS S HD2  10 
ATOM 10914 H HD3  . LYS A 1 61 ? 4.152   1.710   1.607   1.00 0.00 ? 70 LYS S HD3  10 
ATOM 10915 H HE2  . LYS A 1 61 ? 4.634   0.316   3.616   1.00 0.00 ? 70 LYS S HE2  10 
ATOM 10916 H HE3  . LYS A 1 61 ? 5.046   -0.452  2.087   1.00 0.00 ? 70 LYS S HE3  10 
ATOM 10917 H HZ1  . LYS A 1 61 ? 7.374   0.574   2.602   1.00 0.00 ? 70 LYS S HZ1  10 
ATOM 10918 H HZ2  . LYS A 1 61 ? 6.902   -0.894  3.292   1.00 0.00 ? 70 LYS S HZ2  10 
ATOM 10919 H HZ3  . LYS A 1 61 ? 6.818   0.530   4.196   1.00 0.00 ? 70 LYS S HZ3  10 
ATOM 10920 N N    . LYS A 1 62 ? 9.288   5.227   0.978   1.00 0.00 ? 71 LYS S N    10 
ATOM 10921 C CA   . LYS A 1 62 ? 9.727   6.604   1.150   1.00 0.00 ? 71 LYS S CA   10 
ATOM 10922 C C    . LYS A 1 62 ? 10.325  7.129   -0.151  1.00 0.00 ? 71 LYS S C    10 
ATOM 10923 O O    . LYS A 1 62 ? 10.216  8.314   -0.465  1.00 0.00 ? 71 LYS S O    10 
ATOM 10924 C CB   . LYS A 1 62 ? 10.757  6.700   2.276   1.00 0.00 ? 71 LYS S CB   10 
ATOM 10925 C CG   . LYS A 1 62 ? 10.286  6.093   3.588   1.00 0.00 ? 71 LYS S CG   10 
ATOM 10926 C CD   . LYS A 1 62 ? 11.453  5.797   4.517   1.00 0.00 ? 71 LYS S CD   10 
ATOM 10927 C CE   . LYS A 1 62 ? 11.612  6.881   5.572   1.00 0.00 ? 71 LYS S CE   10 
ATOM 10928 N NZ   . LYS A 1 62 ? 12.932  6.797   6.257   1.00 0.00 ? 71 LYS S NZ   10 
ATOM 10929 H H    . LYS A 1 62 ? 9.744   4.513   1.472   1.00 0.00 ? 71 LYS S H    10 
ATOM 10930 H HA   . LYS A 1 62 ? 8.865   7.200   1.407   1.00 0.00 ? 71 LYS S HA   10 
ATOM 10931 H HB2  . LYS A 1 62 ? 11.657  6.186   1.970   1.00 0.00 ? 71 LYS S HB2  10 
ATOM 10932 H HB3  . LYS A 1 62 ? 10.989  7.741   2.449   1.00 0.00 ? 71 LYS S HB3  10 
ATOM 10933 H HG2  . LYS A 1 62 ? 9.618   6.787   4.075   1.00 0.00 ? 71 LYS S HG2  10 
ATOM 10934 H HG3  . LYS A 1 62 ? 9.761   5.172   3.377   1.00 0.00 ? 71 LYS S HG3  10 
ATOM 10935 H HD2  . LYS A 1 62 ? 11.277  4.853   5.009   1.00 0.00 ? 71 LYS S HD2  10 
ATOM 10936 H HD3  . LYS A 1 62 ? 12.360  5.740   3.933   1.00 0.00 ? 71 LYS S HD3  10 
ATOM 10937 H HE2  . LYS A 1 62 ? 11.525  7.847   5.095   1.00 0.00 ? 71 LYS S HE2  10 
ATOM 10938 H HE3  . LYS A 1 62 ? 10.827  6.768   6.306   1.00 0.00 ? 71 LYS S HE3  10 
ATOM 10939 H HZ1  . LYS A 1 62 ? 13.248  7.746   6.540   1.00 0.00 ? 71 LYS S HZ1  10 
ATOM 10940 H HZ2  . LYS A 1 62 ? 13.640  6.382   5.618   1.00 0.00 ? 71 LYS S HZ2  10 
ATOM 10941 H HZ3  . LYS A 1 62 ? 12.857  6.202   7.106   1.00 0.00 ? 71 LYS S HZ3  10 
ATOM 10942 N N    . ALA A 1 63 ? 10.953  6.230   -0.904  1.00 0.00 ? 72 ALA S N    10 
ATOM 10943 C CA   . ALA A 1 63 ? 11.567  6.590   -2.176  1.00 0.00 ? 72 ALA S CA   10 
ATOM 10944 C C    . ALA A 1 63 ? 10.521  7.064   -3.180  1.00 0.00 ? 72 ALA S C    10 
ATOM 10945 O O    . ALA A 1 63 ? 10.772  7.979   -3.965  1.00 0.00 ? 72 ALA S O    10 
ATOM 10946 C CB   . ALA A 1 63 ? 12.346  5.411   -2.738  1.00 0.00 ? 72 ALA S CB   10 
ATOM 10947 H H    . ALA A 1 63 ? 11.005  5.300   -0.596  1.00 0.00 ? 72 ALA S H    10 
ATOM 10948 H HA   . ALA A 1 63 ? 12.264  7.395   -1.991  1.00 0.00 ? 72 ALA S HA   10 
ATOM 10949 H HB1  . ALA A 1 63 ? 11.703  4.831   -3.384  1.00 0.00 ? 72 ALA S HB1  10 
ATOM 10950 H HB2  . ALA A 1 63 ? 12.695  4.790   -1.925  1.00 0.00 ? 72 ALA S HB2  10 
ATOM 10951 H HB3  . ALA A 1 63 ? 13.192  5.774   -3.302  1.00 0.00 ? 72 ALA S HB3  10 
ATOM 10952 N N    . LYS A 1 64 ? 9.346   6.440   -3.150  1.00 0.00 ? 73 LYS S N    10 
ATOM 10953 C CA   . LYS A 1 64 ? 8.267   6.810   -4.062  1.00 0.00 ? 73 LYS S CA   10 
ATOM 10954 C C    . LYS A 1 64 ? 7.388   7.898   -3.453  1.00 0.00 ? 73 LYS S C    10 
ATOM 10955 O O    . LYS A 1 64 ? 6.718   8.640   -4.170  1.00 0.00 ? 73 LYS S O    10 
ATOM 10956 C CB   . LYS A 1 64 ? 7.416   5.591   -4.422  1.00 0.00 ? 73 LYS S CB   10 
ATOM 10957 C CG   . LYS A 1 64 ? 6.684   5.742   -5.746  1.00 0.00 ? 73 LYS S CG   10 
ATOM 10958 C CD   . LYS A 1 64 ? 7.549   5.297   -6.914  1.00 0.00 ? 73 LYS S CD   10 
ATOM 10959 C CE   . LYS A 1 64 ? 8.317   6.464   -7.516  1.00 0.00 ? 73 LYS S CE   10 
ATOM 10960 N NZ   . LYS A 1 64 ? 8.652   6.231   -8.947  1.00 0.00 ? 73 LYS S NZ   10 
ATOM 10961 H H    . LYS A 1 64 ? 9.200   5.720   -2.503  1.00 0.00 ? 73 LYS S H    10 
ATOM 10962 H HA   . LYS A 1 64 ? 8.719   7.197   -4.963  1.00 0.00 ? 73 LYS S HA   10 
ATOM 10963 H HB2  . LYS A 1 64 ? 8.057   4.723   -4.484  1.00 0.00 ? 73 LYS S HB2  10 
ATOM 10964 H HB3  . LYS A 1 64 ? 6.682   5.436   -3.643  1.00 0.00 ? 73 LYS S HB3  10 
ATOM 10965 H HG2  . LYS A 1 64 ? 5.789   5.140   -5.724  1.00 0.00 ? 73 LYS S HG2  10 
ATOM 10966 H HG3  . LYS A 1 64 ? 6.419   6.781   -5.882  1.00 0.00 ? 73 LYS S HG3  10 
ATOM 10967 H HD2  . LYS A 1 64 ? 8.254   4.556   -6.566  1.00 0.00 ? 73 LYS S HD2  10 
ATOM 10968 H HD3  . LYS A 1 64 ? 6.914   4.864   -7.674  1.00 0.00 ? 73 LYS S HD3  10 
ATOM 10969 H HE2  . LYS A 1 64 ? 7.711   7.354   -7.438  1.00 0.00 ? 73 LYS S HE2  10 
ATOM 10970 H HE3  . LYS A 1 64 ? 9.231   6.601   -6.958  1.00 0.00 ? 73 LYS S HE3  10 
ATOM 10971 H HZ1  . LYS A 1 64 ? 8.559   7.117   -9.486  1.00 0.00 ? 73 LYS S HZ1  10 
ATOM 10972 H HZ2  . LYS A 1 64 ? 8.008   5.522   -9.355  1.00 0.00 ? 73 LYS S HZ2  10 
ATOM 10973 H HZ3  . LYS A 1 64 ? 9.629   5.886   -9.035  1.00 0.00 ? 73 LYS S HZ3  10 
ATOM 10974 N N    . GLY A 1 65 ? 7.410   8.003   -2.126  1.00 0.00 ? 74 GLY S N    10 
ATOM 10975 C CA   . GLY A 1 65 ? 6.626   9.020   -1.454  1.00 0.00 ? 74 GLY S CA   10 
ATOM 10976 C C    . GLY A 1 65 ? 5.473   8.473   -0.636  1.00 0.00 ? 74 GLY S C    10 
ATOM 10977 O O    . GLY A 1 65 ? 4.867   9.214   0.138   1.00 0.00 ? 74 GLY S O    10 
ATOM 10978 H H    . GLY A 1 65 ? 7.972   7.395   -1.603  1.00 0.00 ? 74 GLY S H    10 
ATOM 10979 H HA2  . GLY A 1 65 ? 7.279   9.567   -0.790  1.00 0.00 ? 74 GLY S HA2  10 
ATOM 10980 H HA3  . GLY A 1 65 ? 6.233   9.702   -2.197  1.00 0.00 ? 74 GLY S HA3  10 
ATOM 10981 N N    . LEU A 1 66 ? 5.164   7.185   -0.774  1.00 0.00 ? 75 LEU S N    10 
ATOM 10982 C CA   . LEU A 1 66 ? 4.074   6.604   0.004   1.00 0.00 ? 75 LEU S CA   10 
ATOM 10983 C C    . LEU A 1 66 ? 4.331   6.836   1.487   1.00 0.00 ? 75 LEU S C    10 
ATOM 10984 O O    . LEU A 1 66 ? 3.843   7.811   2.058   1.00 0.00 ? 75 LEU S O    10 
ATOM 10985 C CB   . LEU A 1 66 ? 3.903   5.108   -0.294  1.00 0.00 ? 75 LEU S CB   10 
ATOM 10986 C CG   . LEU A 1 66 ? 3.945   4.745   -1.782  1.00 0.00 ? 75 LEU S CG   10 
ATOM 10987 C CD1  . LEU A 1 66 ? 3.725   3.253   -1.973  1.00 0.00 ? 75 LEU S CD1  10 
ATOM 10988 C CD2  . LEU A 1 66 ? 2.902   5.544   -2.557  1.00 0.00 ? 75 LEU S CD2  10 
ATOM 10989 H H    . LEU A 1 66 ? 5.678   6.623   -1.390  1.00 0.00 ? 75 LEU S H    10 
ATOM 10990 H HA   . LEU A 1 66 ? 3.167   7.123   -0.269  1.00 0.00 ? 75 LEU S HA   10 
ATOM 10991 H HB2  . LEU A 1 66 ? 4.681   4.558   0.221   1.00 0.00 ? 75 LEU S HB2  10 
ATOM 10992 H HB3  . LEU A 1 66 ? 2.945   4.795   0.098   1.00 0.00 ? 75 LEU S HB3  10 
ATOM 10993 H HG   . LEU A 1 66 ? 4.918   4.992   -2.179  1.00 0.00 ? 75 LEU S HG   10 
ATOM 10994 H HD11 . LEU A 1 66 ? 4.404   2.705   -1.338  1.00 0.00 ? 75 LEU S HD11 10 
ATOM 10995 H HD12 . LEU A 1 66 ? 3.908   2.991   -3.005  1.00 0.00 ? 75 LEU S HD12 10 
ATOM 10996 H HD13 . LEU A 1 66 ? 2.708   3.002   -1.712  1.00 0.00 ? 75 LEU S HD13 10 
ATOM 10997 H HD21 . LEU A 1 66 ? 3.339   5.917   -3.472  1.00 0.00 ? 75 LEU S HD21 10 
ATOM 10998 H HD22 . LEU A 1 66 ? 2.562   6.376   -1.957  1.00 0.00 ? 75 LEU S HD22 10 
ATOM 10999 H HD23 . LEU A 1 66 ? 2.062   4.908   -2.793  1.00 0.00 ? 75 LEU S HD23 10 
ATOM 11000 N N    . PHE A 1 67 ? 5.121   5.967   2.107   1.00 0.00 ? 76 PHE S N    10 
ATOM 11001 C CA   . PHE A 1 67 ? 5.440   6.142   3.524   1.00 0.00 ? 76 PHE S CA   10 
ATOM 11002 C C    . PHE A 1 67 ? 6.253   7.417   3.732   1.00 0.00 ? 76 PHE S C    10 
ATOM 11003 O O    . PHE A 1 67 ? 5.864   8.230   4.597   1.00 0.00 ? 76 PHE S O    10 
ATOM 11004 C CB   . PHE A 1 67 ? 6.220   4.943   4.082   1.00 0.00 ? 76 PHE S CB   10 
ATOM 11005 C CG   . PHE A 1 67 ? 5.376   3.888   4.761   1.00 0.00 ? 76 PHE S CG   10 
ATOM 11006 C CD1  . PHE A 1 67 ? 4.054   4.125   5.125   1.00 0.00 ? 76 PHE S CD1  10 
ATOM 11007 C CD2  . PHE A 1 67 ? 5.922   2.645   5.034   1.00 0.00 ? 76 PHE S CD2  10 
ATOM 11008 C CE1  . PHE A 1 67 ? 3.305   3.144   5.741   1.00 0.00 ? 76 PHE S CE1  10 
ATOM 11009 C CE2  . PHE A 1 67 ? 5.175   1.663   5.649   1.00 0.00 ? 76 PHE S CE2  10 
ATOM 11010 C CZ   . PHE A 1 67 ? 3.865   1.910   6.003   1.00 0.00 ? 76 PHE S CZ   10 
ATOM 11011 O OXT  . PHE A 1 67 ? 7.269   7.592   3.028   1.00 0.00 ? 76 PHE S OXT  10 
ATOM 11012 H H    . PHE A 1 67 ? 5.506   5.212   1.602   1.00 0.00 ? 76 PHE S H    10 
ATOM 11013 H HA   . PHE A 1 67 ? 4.514   6.244   4.055   1.00 0.00 ? 76 PHE S HA   10 
ATOM 11014 H HB2  . PHE A 1 67 ? 6.750   4.466   3.277   1.00 0.00 ? 76 PHE S HB2  10 
ATOM 11015 H HB3  . PHE A 1 67 ? 6.937   5.303   4.806   1.00 0.00 ? 76 PHE S HB3  10 
ATOM 11016 H HD1  . PHE A 1 67 ? 3.610   5.085   4.927   1.00 0.00 ? 76 PHE S HD1  10 
ATOM 11017 H HD2  . PHE A 1 67 ? 6.947   2.446   4.757   1.00 0.00 ? 76 PHE S HD2  10 
ATOM 11018 H HE1  . PHE A 1 67 ? 2.277   3.341   6.012   1.00 0.00 ? 76 PHE S HE1  10 
ATOM 11019 H HE2  . PHE A 1 67 ? 5.615   0.699   5.850   1.00 0.00 ? 76 PHE S HE2  10 
ATOM 11020 H HZ   . PHE A 1 67 ? 3.281   1.141   6.485   1.00 0.00 ? 76 PHE S HZ   10 
ATOM 11021 N N    . MET A 1 1  ? -19.504 -16.647 1.438   1.00 0.00 ? 10 MET S N    11 
ATOM 11022 C CA   . MET A 1 1  ? -19.012 -15.389 0.820   1.00 0.00 ? 10 MET S CA   11 
ATOM 11023 C C    . MET A 1 1  ? -19.445 -14.171 1.630   1.00 0.00 ? 10 MET S C    11 
ATOM 11024 O O    . MET A 1 1  ? -18.744 -13.160 1.672   1.00 0.00 ? 10 MET S O    11 
ATOM 11025 C CB   . MET A 1 1  ? -19.563 -15.297 -0.604  1.00 0.00 ? 10 MET S CB   11 
ATOM 11026 C CG   . MET A 1 1  ? -18.908 -14.212 -1.443  1.00 0.00 ? 10 MET S CG   11 
ATOM 11027 S SD   . MET A 1 1  ? -20.070 -13.393 -2.549  1.00 0.00 ? 10 MET S SD   11 
ATOM 11028 C CE   . MET A 1 1  ? -20.284 -14.650 -3.808  1.00 0.00 ? 10 MET S CE   11 
ATOM 11029 H H1   . MET A 1 1  ? -18.951 -17.432 1.043   1.00 0.00 ? 10 MET S H1   11 
ATOM 11030 H H2   . MET A 1 1  ? -20.513 -16.742 1.203   1.00 0.00 ? 10 MET S H2   11 
ATOM 11031 H H3   . MET A 1 1  ? -19.364 -16.571 2.466   1.00 0.00 ? 10 MET S H3   11 
ATOM 11032 H HA   . MET A 1 1  ? -17.934 -15.422 0.782   1.00 0.00 ? 10 MET S HA   11 
ATOM 11033 H HB2  . MET A 1 1  ? -19.410 -16.245 -1.099  1.00 0.00 ? 10 MET S HB2  11 
ATOM 11034 H HB3  . MET A 1 1  ? -20.622 -15.094 -0.557  1.00 0.00 ? 10 MET S HB3  11 
ATOM 11035 H HG2  . MET A 1 1  ? -18.481 -13.473 -0.780  1.00 0.00 ? 10 MET S HG2  11 
ATOM 11036 H HG3  . MET A 1 1  ? -18.121 -14.658 -2.034  1.00 0.00 ? 10 MET S HG3  11 
ATOM 11037 H HE1  . MET A 1 1  ? -21.308 -14.993 -3.803  1.00 0.00 ? 10 MET S HE1  11 
ATOM 11038 H HE2  . MET A 1 1  ? -19.626 -15.481 -3.601  1.00 0.00 ? 10 MET S HE2  11 
ATOM 11039 H HE3  . MET A 1 1  ? -20.047 -14.235 -4.776  1.00 0.00 ? 10 MET S HE3  11 
ATOM 11040 N N    . LEU A 1 2  ? -20.604 -14.276 2.273   1.00 0.00 ? 11 LEU S N    11 
ATOM 11041 C CA   . LEU A 1 2  ? -21.130 -13.183 3.082   1.00 0.00 ? 11 LEU S CA   11 
ATOM 11042 C C    . LEU A 1 2  ? -20.269 -12.960 4.320   1.00 0.00 ? 11 LEU S C    11 
ATOM 11043 O O    . LEU A 1 2  ? -19.976 -11.821 4.688   1.00 0.00 ? 11 LEU S O    11 
ATOM 11044 C CB   . LEU A 1 2  ? -22.574 -13.480 3.496   1.00 0.00 ? 11 LEU S CB   11 
ATOM 11045 C CG   . LEU A 1 2  ? -23.549 -13.693 2.338   1.00 0.00 ? 11 LEU S CG   11 
ATOM 11046 C CD1  . LEU A 1 2  ? -23.604 -15.163 1.952   1.00 0.00 ? 11 LEU S CD1  11 
ATOM 11047 C CD2  . LEU A 1 2  ? -24.934 -13.185 2.707   1.00 0.00 ? 11 LEU S CD2  11 
ATOM 11048 H H    . LEU A 1 2  ? -21.118 -15.108 2.199   1.00 0.00 ? 11 LEU S H    11 
ATOM 11049 H HA   . LEU A 1 2  ? -21.115 -12.288 2.480   1.00 0.00 ? 11 LEU S HA   11 
ATOM 11050 H HB2  . LEU A 1 2  ? -22.574 -14.368 4.110   1.00 0.00 ? 11 LEU S HB2  11 
ATOM 11051 H HB3  . LEU A 1 2  ? -22.932 -12.653 4.091   1.00 0.00 ? 11 LEU S HB3  11 
ATOM 11052 H HG   . LEU A 1 2  ? -23.205 -13.136 1.478   1.00 0.00 ? 11 LEU S HG   11 
ATOM 11053 H HD11 . LEU A 1 2  ? -23.354 -15.770 2.809   1.00 0.00 ? 11 LEU S HD11 11 
ATOM 11054 H HD12 . LEU A 1 2  ? -22.899 -15.353 1.157   1.00 0.00 ? 11 LEU S HD12 11 
ATOM 11055 H HD13 . LEU A 1 2  ? -24.601 -15.410 1.616   1.00 0.00 ? 11 LEU S HD13 11 
ATOM 11056 H HD21 . LEU A 1 2  ? -25.059 -13.225 3.779   1.00 0.00 ? 11 LEU S HD21 11 
ATOM 11057 H HD22 . LEU A 1 2  ? -25.683 -13.802 2.235   1.00 0.00 ? 11 LEU S HD22 11 
ATOM 11058 H HD23 . LEU A 1 2  ? -25.046 -12.164 2.370   1.00 0.00 ? 11 LEU S HD23 11 
ATOM 11059 N N    . ALA A 1 3  ? -19.864 -14.053 4.958   1.00 0.00 ? 12 ALA S N    11 
ATOM 11060 C CA   . ALA A 1 3  ? -19.035 -13.977 6.155   1.00 0.00 ? 12 ALA S CA   11 
ATOM 11061 C C    . ALA A 1 3  ? -17.647 -13.438 5.827   1.00 0.00 ? 12 ALA S C    11 
ATOM 11062 O O    . ALA A 1 3  ? -17.053 -12.703 6.615   1.00 0.00 ? 12 ALA S O    11 
ATOM 11063 C CB   . ALA A 1 3  ? -18.929 -15.346 6.811   1.00 0.00 ? 12 ALA S CB   11 
ATOM 11064 H H    . ALA A 1 3  ? -20.131 -14.932 4.616   1.00 0.00 ? 12 ALA S H    11 
ATOM 11065 H HA   . ALA A 1 3  ? -19.516 -13.306 6.852   1.00 0.00 ? 12 ALA S HA   11 
ATOM 11066 H HB1  . ALA A 1 3  ? -19.920 -15.747 6.967   1.00 0.00 ? 12 ALA S HB1  11 
ATOM 11067 H HB2  . ALA A 1 3  ? -18.425 -15.252 7.762   1.00 0.00 ? 12 ALA S HB2  11 
ATOM 11068 H HB3  . ALA A 1 3  ? -18.368 -16.010 6.171   1.00 0.00 ? 12 ALA S HB3  11 
ATOM 11069 N N    . LYS A 1 4  ? -17.136 -13.808 4.657   1.00 0.00 ? 13 LYS S N    11 
ATOM 11070 C CA   . LYS A 1 4  ? -15.816 -13.362 4.223   1.00 0.00 ? 13 LYS S CA   11 
ATOM 11071 C C    . LYS A 1 4  ? -15.865 -11.919 3.729   1.00 0.00 ? 13 LYS S C    11 
ATOM 11072 O O    . LYS A 1 4  ? -16.918 -11.426 3.327   1.00 0.00 ? 13 LYS S O    11 
ATOM 11073 C CB   . LYS A 1 4  ? -15.285 -14.275 3.117   1.00 0.00 ? 13 LYS S CB   11 
ATOM 11074 C CG   . LYS A 1 4  ? -14.734 -15.596 3.628   1.00 0.00 ? 13 LYS S CG   11 
ATOM 11075 C CD   . LYS A 1 4  ? -13.215 -15.581 3.693   1.00 0.00 ? 13 LYS S CD   11 
ATOM 11076 C CE   . LYS A 1 4  ? -12.622 -16.888 3.194   1.00 0.00 ? 13 LYS S CE   11 
ATOM 11077 N NZ   . LYS A 1 4  ? -13.266 -18.070 3.833   1.00 0.00 ? 13 LYS S NZ   11 
ATOM 11078 H H    . LYS A 1 4  ? -17.658 -14.396 4.071   1.00 0.00 ? 13 LYS S H    11 
ATOM 11079 H HA   . LYS A 1 4  ? -15.153 -13.417 5.072   1.00 0.00 ? 13 LYS S HA   11 
ATOM 11080 H HB2  . LYS A 1 4  ? -16.088 -14.488 2.425   1.00 0.00 ? 13 LYS S HB2  11 
ATOM 11081 H HB3  . LYS A 1 4  ? -14.495 -13.759 2.590   1.00 0.00 ? 13 LYS S HB3  11 
ATOM 11082 H HG2  . LYS A 1 4  ? -15.124 -15.778 4.618   1.00 0.00 ? 13 LYS S HG2  11 
ATOM 11083 H HG3  . LYS A 1 4  ? -15.049 -16.388 2.964   1.00 0.00 ? 13 LYS S HG3  11 
ATOM 11084 H HD2  . LYS A 1 4  ? -12.846 -14.772 3.079   1.00 0.00 ? 13 LYS S HD2  11 
ATOM 11085 H HD3  . LYS A 1 4  ? -12.910 -15.425 4.718   1.00 0.00 ? 13 LYS S HD3  11 
ATOM 11086 H HE2  . LYS A 1 4  ? -12.761 -16.947 2.124   1.00 0.00 ? 13 LYS S HE2  11 
ATOM 11087 H HE3  . LYS A 1 4  ? -11.566 -16.900 3.421   1.00 0.00 ? 13 LYS S HE3  11 
ATOM 11088 H HZ1  . LYS A 1 4  ? -12.765 -18.940 3.562   1.00 0.00 ? 13 LYS S HZ1  11 
ATOM 11089 H HZ2  . LYS A 1 4  ? -14.258 -18.145 3.527   1.00 0.00 ? 13 LYS S HZ2  11 
ATOM 11090 H HZ3  . LYS A 1 4  ? -13.240 -17.976 4.867   1.00 0.00 ? 13 LYS S HZ3  11 
ATOM 11091 N N    . LEU A 1 5  ? -14.718 -11.249 3.762   1.00 0.00 ? 14 LEU S N    11 
ATOM 11092 C CA   . LEU A 1 5  ? -14.628 -9.864  3.314   1.00 0.00 ? 14 LEU S CA   11 
ATOM 11093 C C    . LEU A 1 5  ? -13.576 -9.714  2.220   1.00 0.00 ? 14 LEU S C    11 
ATOM 11094 O O    . LEU A 1 5  ? -12.683 -10.550 2.086   1.00 0.00 ? 14 LEU S O    11 
ATOM 11095 C CB   . LEU A 1 5  ? -14.291 -8.947  4.493   1.00 0.00 ? 14 LEU S CB   11 
ATOM 11096 C CG   . LEU A 1 5  ? -15.102 -9.202  5.765   1.00 0.00 ? 14 LEU S CG   11 
ATOM 11097 C CD1  . LEU A 1 5  ? -14.350 -10.143 6.696   1.00 0.00 ? 14 LEU S CD1  11 
ATOM 11098 C CD2  . LEU A 1 5  ? -15.417 -7.892  6.470   1.00 0.00 ? 14 LEU S CD2  11 
ATOM 11099 H H    . LEU A 1 5  ? -13.912 -11.699 4.093   1.00 0.00 ? 14 LEU S H    11 
ATOM 11100 H HA   . LEU A 1 5  ? -15.590 -9.582  2.914   1.00 0.00 ? 14 LEU S HA   11 
ATOM 11101 H HB2  . LEU A 1 5  ? -13.243 -9.068  4.727   1.00 0.00 ? 14 LEU S HB2  11 
ATOM 11102 H HB3  . LEU A 1 5  ? -14.458 -7.925  4.186   1.00 0.00 ? 14 LEU S HB3  11 
ATOM 11103 H HG   . LEU A 1 5  ? -16.038 -9.674  5.499   1.00 0.00 ? 14 LEU S HG   11 
ATOM 11104 H HD11 . LEU A 1 5  ? -14.967 -10.366 7.554   1.00 0.00 ? 14 LEU S HD11 11 
ATOM 11105 H HD12 . LEU A 1 5  ? -13.437 -9.670  7.022   1.00 0.00 ? 14 LEU S HD12 11 
ATOM 11106 H HD13 . LEU A 1 5  ? -14.117 -11.057 6.172   1.00 0.00 ? 14 LEU S HD13 11 
ATOM 11107 H HD21 . LEU A 1 5  ? -16.019 -8.089  7.345   1.00 0.00 ? 14 LEU S HD21 11 
ATOM 11108 H HD22 . LEU A 1 5  ? -15.959 -7.243  5.799   1.00 0.00 ? 14 LEU S HD22 11 
ATOM 11109 H HD23 . LEU A 1 5  ? -14.495 -7.412  6.767   1.00 0.00 ? 14 LEU S HD23 11 
ATOM 11110 N N    . CYS A 1 6  ? -13.688 -8.645  1.440   1.00 0.00 ? 15 CYS S N    11 
ATOM 11111 C CA   . CYS A 1 6  ? -12.747 -8.387  0.356   1.00 0.00 ? 15 CYS S CA   11 
ATOM 11112 C C    . CYS A 1 6  ? -12.059 -7.038  0.539   1.00 0.00 ? 15 CYS S C    11 
ATOM 11113 O O    . CYS A 1 6  ? -12.716 -6.017  0.744   1.00 0.00 ? 15 CYS S O    11 
ATOM 11114 C CB   . CYS A 1 6  ? -13.468 -8.426  -0.993  1.00 0.00 ? 15 CYS S CB   11 
ATOM 11115 S SG   . CYS A 1 6  ? -12.361 -8.528  -2.418  1.00 0.00 ? 15 CYS S SG   11 
ATOM 11116 H H    . CYS A 1 6  ? -14.423 -8.014  1.596   1.00 0.00 ? 15 CYS S H    11 
ATOM 11117 H HA   . CYS A 1 6  ? -11.999 -9.165  0.376   1.00 0.00 ? 15 CYS S HA   11 
ATOM 11118 H HB2  . CYS A 1 6  ? -14.118 -9.288  -1.020  1.00 0.00 ? 15 CYS S HB2  11 
ATOM 11119 H HB3  . CYS A 1 6  ? -14.063 -7.530  -1.100  1.00 0.00 ? 15 CYS S HB3  11 
ATOM 11120 H HG   . CYS A 1 6  ? -12.656 -7.888  -3.068  1.00 0.00 ? 15 CYS S HG   11 
ATOM 11121 N N    . LYS A 1 7  ? -10.733 -7.042  0.461   1.00 0.00 ? 16 LYS S N    11 
ATOM 11122 C CA   . LYS A 1 7  ? -9.955  -5.817  0.614   1.00 0.00 ? 16 LYS S CA   11 
ATOM 11123 C C    . LYS A 1 7  ? -9.966  -5.003  -0.674  1.00 0.00 ? 16 LYS S C    11 
ATOM 11124 O O    . LYS A 1 7  ? -9.749  -5.538  -1.761  1.00 0.00 ? 16 LYS S O    11 
ATOM 11125 C CB   . LYS A 1 7  ? -8.514  -6.150  1.008   1.00 0.00 ? 16 LYS S CB   11 
ATOM 11126 C CG   . LYS A 1 7  ? -8.410  -7.073  2.212   1.00 0.00 ? 16 LYS S CG   11 
ATOM 11127 C CD   . LYS A 1 7  ? -7.964  -6.322  3.456   1.00 0.00 ? 16 LYS S CD   11 
ATOM 11128 C CE   . LYS A 1 7  ? -9.137  -5.651  4.152   1.00 0.00 ? 16 LYS S CE   11 
ATOM 11129 N NZ   . LYS A 1 7  ? -10.109 -6.645  4.685   1.00 0.00 ? 16 LYS S NZ   11 
ATOM 11130 H H    . LYS A 1 7  ? -10.265 -7.887  0.294   1.00 0.00 ? 16 LYS S H    11 
ATOM 11131 H HA   . LYS A 1 7  ? -10.407 -5.233  1.401   1.00 0.00 ? 16 LYS S HA   11 
ATOM 11132 H HB2  . LYS A 1 7  ? -8.026  -6.629  0.173   1.00 0.00 ? 16 LYS S HB2  11 
ATOM 11133 H HB3  . LYS A 1 7  ? -7.995  -5.232  1.239   1.00 0.00 ? 16 LYS S HB3  11 
ATOM 11134 H HG2  . LYS A 1 7  ? -9.377  -7.516  2.400   1.00 0.00 ? 16 LYS S HG2  11 
ATOM 11135 H HG3  . LYS A 1 7  ? -7.691  -7.851  1.996   1.00 0.00 ? 16 LYS S HG3  11 
ATOM 11136 H HD2  . LYS A 1 7  ? -7.504  -7.019  4.141   1.00 0.00 ? 16 LYS S HD2  11 
ATOM 11137 H HD3  . LYS A 1 7  ? -7.246  -5.567  3.172   1.00 0.00 ? 16 LYS S HD3  11 
ATOM 11138 H HE2  . LYS A 1 7  ? -8.761  -5.054  4.970   1.00 0.00 ? 16 LYS S HE2  11 
ATOM 11139 H HE3  . LYS A 1 7  ? -9.642  -5.011  3.443   1.00 0.00 ? 16 LYS S HE3  11 
ATOM 11140 H HZ1  . LYS A 1 7  ? -10.629 -6.240  5.490   1.00 0.00 ? 16 LYS S HZ1  11 
ATOM 11141 H HZ2  . LYS A 1 7  ? -9.608  -7.500  5.002   1.00 0.00 ? 16 LYS S HZ2  11 
ATOM 11142 H HZ3  . LYS A 1 7  ? -10.790 -6.911  3.946   1.00 0.00 ? 16 LYS S HZ3  11 
ATOM 11143 N N    . THR A 1 8  ? -10.221 -3.705  -0.546  1.00 0.00 ? 17 THR S N    11 
ATOM 11144 C CA   . THR A 1 8  ? -10.262 -2.817  -1.702  1.00 0.00 ? 17 THR S CA   11 
ATOM 11145 C C    . THR A 1 8  ? -9.039  -1.906  -1.735  1.00 0.00 ? 17 THR S C    11 
ATOM 11146 O O    . THR A 1 8  ? -8.595  -1.405  -0.703  1.00 0.00 ? 17 THR S O    11 
ATOM 11147 C CB   . THR A 1 8  ? -11.538 -1.973  -1.679  1.00 0.00 ? 17 THR S CB   11 
ATOM 11148 O OG1  . THR A 1 8  ? -12.665 -2.776  -1.372  1.00 0.00 ? 17 THR S OG1  11 
ATOM 11149 C CG2  . THR A 1 8  ? -11.817 -1.275  -2.992  1.00 0.00 ? 17 THR S CG2  11 
ATOM 11150 H H    . THR A 1 8  ? -10.388 -3.336  0.348   1.00 0.00 ? 17 THR S H    11 
ATOM 11151 H HA   . THR A 1 8  ? -10.263 -3.430  -2.589  1.00 0.00 ? 17 THR S HA   11 
ATOM 11152 H HB   . THR A 1 8  ? -11.443 -1.215  -0.914  1.00 0.00 ? 17 THR S HB   11 
ATOM 11153 H HG1  . THR A 1 8  ? -12.725 -2.891  -0.420  1.00 0.00 ? 17 THR S HG1  11 
ATOM 11154 H HG21 . THR A 1 8  ? -12.811 -0.853  -2.970  1.00 0.00 ? 17 THR S HG21 11 
ATOM 11155 H HG22 . THR A 1 8  ? -11.746 -1.988  -3.801  1.00 0.00 ? 17 THR S HG22 11 
ATOM 11156 H HG23 . THR A 1 8  ? -11.094 -0.488  -3.141  1.00 0.00 ? 17 THR S HG23 11 
ATOM 11157 N N    . ILE A 1 9  ? -8.494  -1.703  -2.930  1.00 0.00 ? 18 ILE S N    11 
ATOM 11158 C CA   . ILE A 1 9  ? -7.323  -0.862  -3.109  1.00 0.00 ? 18 ILE S CA   11 
ATOM 11159 C C    . ILE A 1 9  ? -7.717  0.590   -3.355  1.00 0.00 ? 18 ILE S C    11 
ATOM 11160 O O    . ILE A 1 9  ? -8.574  0.878   -4.191  1.00 0.00 ? 18 ILE S O    11 
ATOM 11161 C CB   . ILE A 1 9  ? -6.476  -1.351  -4.298  1.00 0.00 ? 18 ILE S CB   11 
ATOM 11162 C CG1  . ILE A 1 9  ? -6.031  -2.798  -4.076  1.00 0.00 ? 18 ILE S CG1  11 
ATOM 11163 C CG2  . ILE A 1 9  ? -5.272  -0.442  -4.508  1.00 0.00 ? 18 ILE S CG2  11 
ATOM 11164 C CD1  . ILE A 1 9  ? -7.151  -3.807  -4.207  1.00 0.00 ? 18 ILE S CD1  11 
ATOM 11165 H H    . ILE A 1 9  ? -8.886  -2.136  -3.715  1.00 0.00 ? 18 ILE S H    11 
ATOM 11166 H HA   . ILE A 1 9  ? -6.723  -0.923  -2.213  1.00 0.00 ? 18 ILE S HA   11 
ATOM 11167 H HB   . ILE A 1 9  ? -7.087  -1.304  -5.186  1.00 0.00 ? 18 ILE S HB   11 
ATOM 11168 H HG12 . ILE A 1 9  ? -5.282  -3.046  -4.805  1.00 0.00 ? 18 ILE S HG12 11 
ATOM 11169 H HG13 . ILE A 1 9  ? -5.610  -2.892  -3.086  1.00 0.00 ? 18 ILE S HG13 11 
ATOM 11170 H HG21 . ILE A 1 9  ? -4.468  -1.004  -4.958  1.00 0.00 ? 18 ILE S HG21 11 
ATOM 11171 H HG22 . ILE A 1 9  ? -4.947  -0.048  -3.556  1.00 0.00 ? 18 ILE S HG22 11 
ATOM 11172 H HG23 . ILE A 1 9  ? -5.548  0.375   -5.159  1.00 0.00 ? 18 ILE S HG23 11 
ATOM 11173 H HD11 . ILE A 1 9  ? -7.839  -3.482  -4.973  1.00 0.00 ? 18 ILE S HD11 11 
ATOM 11174 H HD12 . ILE A 1 9  ? -7.674  -3.889  -3.266  1.00 0.00 ? 18 ILE S HD12 11 
ATOM 11175 H HD13 . ILE A 1 9  ? -6.740  -4.769  -4.476  1.00 0.00 ? 18 ILE S HD13 11 
ATOM 11176 N N    . TYR A 1 10 ? -7.071  1.499   -2.635  1.00 0.00 ? 19 TYR S N    11 
ATOM 11177 C CA   . TYR A 1 10 ? -7.341  2.921   -2.789  1.00 0.00 ? 19 TYR S CA   11 
ATOM 11178 C C    . TYR A 1 10 ? -6.405  3.503   -3.851  1.00 0.00 ? 19 TYR S C    11 
ATOM 11179 O O    . TYR A 1 10 ? -5.231  3.137   -3.913  1.00 0.00 ? 19 TYR S O    11 
ATOM 11180 C CB   . TYR A 1 10 ? -7.182  3.647   -1.441  1.00 0.00 ? 19 TYR S CB   11 
ATOM 11181 C CG   . TYR A 1 10 ? -8.293  3.341   -0.444  1.00 0.00 ? 19 TYR S CG   11 
ATOM 11182 C CD1  . TYR A 1 10 ? -9.119  2.232   -0.613  1.00 0.00 ? 19 TYR S CD1  11 
ATOM 11183 C CD2  . TYR A 1 10 ? -8.522  4.160   0.665   1.00 0.00 ? 19 TYR S CD2  11 
ATOM 11184 C CE1  . TYR A 1 10 ? -10.133 1.949   0.283   1.00 0.00 ? 19 TYR S CE1  11 
ATOM 11185 C CE2  . TYR A 1 10 ? -9.536  3.877   1.562   1.00 0.00 ? 19 TYR S CE2  11 
ATOM 11186 C CZ   . TYR A 1 10 ? -10.337 2.773   1.366   1.00 0.00 ? 19 TYR S CZ   11 
ATOM 11187 O OH   . TYR A 1 10 ? -11.348 2.490   2.255   1.00 0.00 ? 19 TYR S OH   11 
ATOM 11188 H H    . TYR A 1 10 ? -6.390  1.207   -1.994  1.00 0.00 ? 19 TYR S H    11 
ATOM 11189 H HA   . TYR A 1 10 ? -8.361  3.028   -3.129  1.00 0.00 ? 19 TYR S HA   11 
ATOM 11190 H HB2  . TYR A 1 10 ? -6.244  3.354   -0.990  1.00 0.00 ? 19 TYR S HB2  11 
ATOM 11191 H HB3  . TYR A 1 10 ? -7.176  4.715   -1.614  1.00 0.00 ? 19 TYR S HB3  11 
ATOM 11192 H HD1  . TYR A 1 10 ? -8.961  1.585   -1.460  1.00 0.00 ? 19 TYR S HD1  11 
ATOM 11193 H HD2  . TYR A 1 10 ? -7.897  5.026   0.826   1.00 0.00 ? 19 TYR S HD2  11 
ATOM 11194 H HE1  . TYR A 1 10 ? -10.759 1.083   0.129   1.00 0.00 ? 19 TYR S HE1  11 
ATOM 11195 H HE2  . TYR A 1 10 ? -9.697  4.523   2.413   1.00 0.00 ? 19 TYR S HE2  11 
ATOM 11196 H HH   . TYR A 1 10 ? -11.295 1.570   2.520   1.00 0.00 ? 19 TYR S HH   11 
ATOM 11197 N N    . PRO A 1 11 ? -6.912  4.402   -4.715  1.00 0.00 ? 20 PRO S N    11 
ATOM 11198 C CA   . PRO A 1 11 ? -6.116  5.010   -5.788  1.00 0.00 ? 20 PRO S CA   11 
ATOM 11199 C C    . PRO A 1 11 ? -4.811  5.616   -5.284  1.00 0.00 ? 20 PRO S C    11 
ATOM 11200 O O    . PRO A 1 11 ? -4.805  6.693   -4.689  1.00 0.00 ? 20 PRO S O    11 
ATOM 11201 C CB   . PRO A 1 11 ? -7.036  6.103   -6.355  1.00 0.00 ? 20 PRO S CB   11 
ATOM 11202 C CG   . PRO A 1 11 ? -8.141  6.242   -5.363  1.00 0.00 ? 20 PRO S CG   11 
ATOM 11203 C CD   . PRO A 1 11 ? -8.293  4.890   -4.731  1.00 0.00 ? 20 PRO S CD   11 
ATOM 11204 H HA   . PRO A 1 11 ? -5.894  4.291   -6.564  1.00 0.00 ? 20 PRO S HA   11 
ATOM 11205 H HB2  . PRO A 1 11 ? -6.481  7.025   -6.459  1.00 0.00 ? 20 PRO S HB2  11 
ATOM 11206 H HB3  . PRO A 1 11 ? -7.411  5.793   -7.321  1.00 0.00 ? 20 PRO S HB3  11 
ATOM 11207 H HG2  . PRO A 1 11 ? -7.872  6.975   -4.620  1.00 0.00 ? 20 PRO S HG2  11 
ATOM 11208 H HG3  . PRO A 1 11 ? -9.054  6.528   -5.865  1.00 0.00 ? 20 PRO S HG3  11 
ATOM 11209 H HD2  . PRO A 1 11 ? -8.688  4.980   -3.728  1.00 0.00 ? 20 PRO S HD2  11 
ATOM 11210 H HD3  . PRO A 1 11 ? -8.923  4.254   -5.336  1.00 0.00 ? 20 PRO S HD3  11 
ATOM 11211 N N    . LEU A 1 12 ? -3.708  4.908   -5.527  1.00 0.00 ? 21 LEU S N    11 
ATOM 11212 C CA   . LEU A 1 12 ? -2.384  5.358   -5.101  1.00 0.00 ? 21 LEU S CA   11 
ATOM 11213 C C    . LEU A 1 12 ? -2.194  6.862   -5.297  1.00 0.00 ? 21 LEU S C    11 
ATOM 11214 O O    . LEU A 1 12 ? -1.580  7.526   -4.469  1.00 0.00 ? 21 LEU S O    11 
ATOM 11215 C CB   . LEU A 1 12 ? -1.295  4.602   -5.866  1.00 0.00 ? 21 LEU S CB   11 
ATOM 11216 C CG   . LEU A 1 12 ? -1.557  4.421   -7.363  1.00 0.00 ? 21 LEU S CG   11 
ATOM 11217 C CD1  . LEU A 1 12 ? -0.900  5.540   -8.157  1.00 0.00 ? 21 LEU S CD1  11 
ATOM 11218 C CD2  . LEU A 1 12 ? -1.052  3.065   -7.831  1.00 0.00 ? 21 LEU S CD2  11 
ATOM 11219 H H    . LEU A 1 12 ? -3.788  4.053   -6.004  1.00 0.00 ? 21 LEU S H    11 
ATOM 11220 H HA   . LEU A 1 12 ? -2.287  5.134   -4.051  1.00 0.00 ? 21 LEU S HA   11 
ATOM 11221 H HB2  . LEU A 1 12 ? -0.364  5.141   -5.747  1.00 0.00 ? 21 LEU S HB2  11 
ATOM 11222 H HB3  . LEU A 1 12 ? -1.186  3.624   -5.420  1.00 0.00 ? 21 LEU S HB3  11 
ATOM 11223 H HG   . LEU A 1 12 ? -2.621  4.464   -7.544  1.00 0.00 ? 21 LEU S HG   11 
ATOM 11224 H HD11 . LEU A 1 12 ? -1.533  5.809   -8.989  1.00 0.00 ? 21 LEU S HD11 11 
ATOM 11225 H HD12 . LEU A 1 12 ? 0.058   5.204   -8.527  1.00 0.00 ? 21 LEU S HD12 11 
ATOM 11226 H HD13 . LEU A 1 12 ? -0.758  6.399   -7.519  1.00 0.00 ? 21 LEU S HD13 11 
ATOM 11227 H HD21 . LEU A 1 12 ? -0.256  2.732   -7.181  1.00 0.00 ? 21 LEU S HD21 11 
ATOM 11228 H HD22 . LEU A 1 12 ? -0.680  3.147   -8.842  1.00 0.00 ? 21 LEU S HD22 11 
ATOM 11229 H HD23 . LEU A 1 12 ? -1.862  2.350   -7.803  1.00 0.00 ? 21 LEU S HD23 11 
ATOM 11230 N N    . ALA A 1 13 ? -2.719  7.390   -6.398  1.00 0.00 ? 22 ALA S N    11 
ATOM 11231 C CA   . ALA A 1 13 ? -2.588  8.814   -6.693  1.00 0.00 ? 22 ALA S CA   11 
ATOM 11232 C C    . ALA A 1 13 ? -3.365  9.664   -5.694  1.00 0.00 ? 22 ALA S C    11 
ATOM 11233 O O    . ALA A 1 13 ? -2.858  10.661  -5.179  1.00 0.00 ? 22 ALA S O    11 
ATOM 11234 C CB   . ALA A 1 13 ? -3.060  9.103   -8.109  1.00 0.00 ? 22 ALA S CB   11 
ATOM 11235 H H    . ALA A 1 13 ? -3.200  6.813   -7.026  1.00 0.00 ? 22 ALA S H    11 
ATOM 11236 H HA   . ALA A 1 13 ? -1.541  9.074   -6.630  1.00 0.00 ? 22 ALA S HA   11 
ATOM 11237 H HB1  . ALA A 1 13 ? -4.076  9.467   -8.084  1.00 0.00 ? 22 ALA S HB1  11 
ATOM 11238 H HB2  . ALA A 1 13 ? -3.019  8.196   -8.695  1.00 0.00 ? 22 ALA S HB2  11 
ATOM 11239 H HB3  . ALA A 1 13 ? -2.420  9.849   -8.557  1.00 0.00 ? 22 ALA S HB3  11 
ATOM 11240 N N    . ASP A 1 14 ? -4.601  9.263   -5.432  1.00 0.00 ? 23 ASP S N    11 
ATOM 11241 C CA   . ASP A 1 14 ? -5.470  9.978   -4.505  1.00 0.00 ? 23 ASP S CA   11 
ATOM 11242 C C    . ASP A 1 14 ? -4.896  9.999   -3.090  1.00 0.00 ? 23 ASP S C    11 
ATOM 11243 O O    . ASP A 1 14 ? -5.319  10.791  -2.251  1.00 0.00 ? 23 ASP S O    11 
ATOM 11244 C CB   . ASP A 1 14 ? -6.840  9.313   -4.485  1.00 0.00 ? 23 ASP S CB   11 
ATOM 11245 C CG   . ASP A 1 14 ? -7.948  10.249  -4.926  1.00 0.00 ? 23 ASP S CG   11 
ATOM 11246 O OD1  . ASP A 1 14 ? -8.491  10.974  -4.067  1.00 0.00 ? 23 ASP S OD1  11 
ATOM 11247 O OD2  . ASP A 1 14 ? -8.273  10.256  -6.132  1.00 0.00 ? 23 ASP S OD2  11 
ATOM 11248 H H    . ASP A 1 14 ? -4.944  8.464   -5.881  1.00 0.00 ? 23 ASP S H    11 
ATOM 11249 H HA   . ASP A 1 14 ? -5.574  10.988  -4.858  1.00 0.00 ? 23 ASP S HA   11 
ATOM 11250 H HB2  . ASP A 1 14 ? -6.820  8.466   -5.153  1.00 0.00 ? 23 ASP S HB2  11 
ATOM 11251 H HB3  . ASP A 1 14 ? -7.056  8.971   -3.479  1.00 0.00 ? 23 ASP S HB3  11 
ATOM 11252 N N    . LEU A 1 15 ? -3.952  9.113   -2.828  1.00 0.00 ? 24 LEU S N    11 
ATOM 11253 C CA   . LEU A 1 15 ? -3.339  9.017   -1.508  1.00 0.00 ? 24 LEU S CA   11 
ATOM 11254 C C    . LEU A 1 15 ? -1.869  9.395   -1.545  1.00 0.00 ? 24 LEU S C    11 
ATOM 11255 O O    . LEU A 1 15 ? -1.269  9.696   -0.513  1.00 0.00 ? 24 LEU S O    11 
ATOM 11256 C CB   . LEU A 1 15 ? -3.488  7.596   -0.966  1.00 0.00 ? 24 LEU S CB   11 
ATOM 11257 C CG   . LEU A 1 15 ? -3.400  6.488   -2.021  1.00 0.00 ? 24 LEU S CG   11 
ATOM 11258 C CD1  . LEU A 1 15 ? -2.297  5.506   -1.681  1.00 0.00 ? 24 LEU S CD1  11 
ATOM 11259 C CD2  . LEU A 1 15 ? -4.734  5.775   -2.152  1.00 0.00 ? 24 LEU S CD2  11 
ATOM 11260 H H    . LEU A 1 15 ? -3.667  8.501   -3.534  1.00 0.00 ? 24 LEU S H    11 
ATOM 11261 H HA   . LEU A 1 15 ? -3.852  9.697   -0.851  1.00 0.00 ? 24 LEU S HA   11 
ATOM 11262 H HB2  . LEU A 1 15 ? -2.711  7.432   -0.233  1.00 0.00 ? 24 LEU S HB2  11 
ATOM 11263 H HB3  . LEU A 1 15 ? -4.444  7.521   -0.473  1.00 0.00 ? 24 LEU S HB3  11 
ATOM 11264 H HG   . LEU A 1 15 ? -3.161  6.923   -2.976  1.00 0.00 ? 24 LEU S HG   11 
ATOM 11265 H HD11 . LEU A 1 15 ? -2.014  5.630   -0.650  1.00 0.00 ? 24 LEU S HD11 11 
ATOM 11266 H HD12 . LEU A 1 15 ? -1.442  5.692   -2.314  1.00 0.00 ? 24 LEU S HD12 11 
ATOM 11267 H HD13 . LEU A 1 15 ? -2.650  4.497   -1.839  1.00 0.00 ? 24 LEU S HD13 11 
ATOM 11268 H HD21 . LEU A 1 15 ? -5.495  6.489   -2.433  1.00 0.00 ? 24 LEU S HD21 11 
ATOM 11269 H HD22 . LEU A 1 15 ? -4.995  5.324   -1.206  1.00 0.00 ? 24 LEU S HD22 11 
ATOM 11270 H HD23 . LEU A 1 15 ? -4.661  5.009   -2.907  1.00 0.00 ? 24 LEU S HD23 11 
ATOM 11271 N N    . LEU A 1 16 ? -1.286  9.363   -2.731  1.00 0.00 ? 25 LEU S N    11 
ATOM 11272 C CA   . LEU A 1 16 ? 0.119   9.687   -2.886  1.00 0.00 ? 25 LEU S CA   11 
ATOM 11273 C C    . LEU A 1 16 ? 0.383   11.184  -2.729  1.00 0.00 ? 25 LEU S C    11 
ATOM 11274 O O    . LEU A 1 16 ? 1.539   11.601  -2.640  1.00 0.00 ? 25 LEU S O    11 
ATOM 11275 C CB   . LEU A 1 16 ? 0.625   9.188   -4.238  1.00 0.00 ? 25 LEU S CB   11 
ATOM 11276 C CG   . LEU A 1 16 ? 2.125   9.355   -4.461  1.00 0.00 ? 25 LEU S CG   11 
ATOM 11277 C CD1  . LEU A 1 16 ? 2.891   8.676   -3.339  1.00 0.00 ? 25 LEU S CD1  11 
ATOM 11278 C CD2  . LEU A 1 16 ? 2.531   8.790   -5.814  1.00 0.00 ? 25 LEU S CD2  11 
ATOM 11279 H H    . LEU A 1 16 ? -1.808  9.102   -3.520  1.00 0.00 ? 25 LEU S H    11 
ATOM 11280 H HA   . LEU A 1 16 ? 0.655   9.166   -2.107  1.00 0.00 ? 25 LEU S HA   11 
ATOM 11281 H HB2  . LEU A 1 16 ? 0.390   8.134   -4.313  1.00 0.00 ? 25 LEU S HB2  11 
ATOM 11282 H HB3  . LEU A 1 16 ? 0.101   9.717   -5.018  1.00 0.00 ? 25 LEU S HB3  11 
ATOM 11283 H HG   . LEU A 1 16 ? 2.371   10.408  -4.446  1.00 0.00 ? 25 LEU S HG   11 
ATOM 11284 H HD11 . LEU A 1 16 ? 2.194   8.158   -2.695  1.00 0.00 ? 25 LEU S HD11 11 
ATOM 11285 H HD12 . LEU A 1 16 ? 3.426   9.420   -2.766  1.00 0.00 ? 25 LEU S HD12 11 
ATOM 11286 H HD13 . LEU A 1 16 ? 3.591   7.967   -3.756  1.00 0.00 ? 25 LEU S HD13 11 
ATOM 11287 H HD21 . LEU A 1 16 ? 1.804   8.056   -6.131  1.00 0.00 ? 25 LEU S HD21 11 
ATOM 11288 H HD22 . LEU A 1 16 ? 3.502   8.325   -5.733  1.00 0.00 ? 25 LEU S HD22 11 
ATOM 11289 H HD23 . LEU A 1 16 ? 2.574   9.589   -6.540  1.00 0.00 ? 25 LEU S HD23 11 
ATOM 11290 N N    . ALA A 1 17 ? -0.677  11.998  -2.680  1.00 0.00 ? 26 ALA S N    11 
ATOM 11291 C CA   . ALA A 1 17 ? -0.507  13.448  -2.517  1.00 0.00 ? 26 ALA S CA   11 
ATOM 11292 C C    . ALA A 1 17 ? -1.810  14.228  -2.717  1.00 0.00 ? 26 ALA S C    11 
ATOM 11293 O O    . ALA A 1 17 ? -1.796  15.333  -3.257  1.00 0.00 ? 26 ALA S O    11 
ATOM 11294 C CB   . ALA A 1 17 ? 0.552   13.969  -3.480  1.00 0.00 ? 26 ALA S CB   11 
ATOM 11295 H H    . ALA A 1 17 ? -1.580  11.619  -2.746  1.00 0.00 ? 26 ALA S H    11 
ATOM 11296 H HA   . ALA A 1 17 ? -0.154  13.624  -1.513  1.00 0.00 ? 26 ALA S HA   11 
ATOM 11297 H HB1  . ALA A 1 17 ? 1.533   13.816  -3.054  1.00 0.00 ? 26 ALA S HB1  11 
ATOM 11298 H HB2  . ALA A 1 17 ? 0.396   15.024  -3.651  1.00 0.00 ? 26 ALA S HB2  11 
ATOM 11299 H HB3  . ALA A 1 17 ? 0.480   13.438  -4.417  1.00 0.00 ? 26 ALA S HB3  11 
ATOM 11300 N N    . ARG A 1 18 ? -2.932  13.666  -2.275  1.00 0.00 ? 27 ARG S N    11 
ATOM 11301 C CA   . ARG A 1 18 ? -4.220  14.344  -2.414  1.00 0.00 ? 27 ARG S CA   11 
ATOM 11302 C C    . ARG A 1 18 ? -5.180  13.943  -1.295  1.00 0.00 ? 27 ARG S C    11 
ATOM 11303 O O    . ARG A 1 18 ? -5.061  12.856  -0.740  1.00 0.00 ? 27 ARG S O    11 
ATOM 11304 C CB   . ARG A 1 18 ? -4.838  14.047  -3.793  1.00 0.00 ? 27 ARG S CB   11 
ATOM 11305 C CG   . ARG A 1 18 ? -6.107  13.197  -3.760  1.00 0.00 ? 27 ARG S CG   11 
ATOM 11306 C CD   . ARG A 1 18 ? -7.361  14.054  -3.728  1.00 0.00 ? 27 ARG S CD   11 
ATOM 11307 N NE   . ARG A 1 18 ? -8.243  13.769  -4.860  1.00 0.00 ? 27 ARG S NE   11 
ATOM 11308 C CZ   . ARG A 1 18 ? -9.031  14.673  -5.439  1.00 0.00 ? 27 ARG S CZ   11 
ATOM 11309 N NH1  . ARG A 1 18 ? -9.060  15.926  -5.002  1.00 0.00 ? 27 ARG S NH1  11 
ATOM 11310 N NH2  . ARG A 1 18 ? -9.797  14.323  -6.463  1.00 0.00 ? 27 ARG S NH2  11 
ATOM 11311 H H    . ARG A 1 18 ? -2.894  12.788  -1.843  1.00 0.00 ? 27 ARG S H    11 
ATOM 11312 H HA   . ARG A 1 18 ? -4.037  15.406  -2.341  1.00 0.00 ? 27 ARG S HA   11 
ATOM 11313 H HB2  . ARG A 1 18 ? -5.076  14.985  -4.272  1.00 0.00 ? 27 ARG S HB2  11 
ATOM 11314 H HB3  . ARG A 1 18 ? -4.102  13.528  -4.393  1.00 0.00 ? 27 ARG S HB3  11 
ATOM 11315 H HG2  . ARG A 1 18 ? -6.135  12.582  -4.639  1.00 0.00 ? 27 ARG S HG2  11 
ATOM 11316 H HG3  . ARG A 1 18 ? -6.090  12.568  -2.885  1.00 0.00 ? 27 ARG S HG3  11 
ATOM 11317 H HD2  . ARG A 1 18 ? -7.895  13.855  -2.810  1.00 0.00 ? 27 ARG S HD2  11 
ATOM 11318 H HD3  . ARG A 1 18 ? -7.072  15.093  -3.759  1.00 0.00 ? 27 ARG S HD3  11 
ATOM 11319 H HE   . ARG A 1 18 ? -8.248  12.853  -5.207  1.00 0.00 ? 27 ARG S HE   11 
ATOM 11320 H HH11 . ARG A 1 18 ? -8.488  16.203  -4.232  1.00 0.00 ? 27 ARG S HH11 11 
ATOM 11321 H HH12 . ARG A 1 18 ? -9.655  16.596  -5.444  1.00 0.00 ? 27 ARG S HH12 11 
ATOM 11322 H HH21 . ARG A 1 18 ? -9.783  13.380  -6.799  1.00 0.00 ? 27 ARG S HH21 11 
ATOM 11323 H HH22 . ARG A 1 18 ? -10.390 14.999  -6.900  1.00 0.00 ? 27 ARG S HH22 11 
ATOM 11324 N N    . PRO A 1 19 ? -6.157  14.818  -0.969  1.00 0.00 ? 28 PRO S N    11 
ATOM 11325 C CA   . PRO A 1 19 ? -7.165  14.556  0.064   1.00 0.00 ? 28 PRO S CA   11 
ATOM 11326 C C    . PRO A 1 19 ? -7.727  13.133  -0.012  1.00 0.00 ? 28 PRO S C    11 
ATOM 11327 O O    . PRO A 1 19 ? -8.874  12.912  -0.403  1.00 0.00 ? 28 PRO S O    11 
ATOM 11328 C CB   . PRO A 1 19 ? -8.267  15.594  -0.221  1.00 0.00 ? 28 PRO S CB   11 
ATOM 11329 C CG   . PRO A 1 19 ? -7.861  16.288  -1.483  1.00 0.00 ? 28 PRO S CG   11 
ATOM 11330 C CD   . PRO A 1 19 ? -6.375  16.125  -1.594  1.00 0.00 ? 28 PRO S CD   11 
ATOM 11331 H HA   . PRO A 1 19 ? -6.762  14.724  1.053   1.00 0.00 ? 28 PRO S HA   11 
ATOM 11332 H HB2  . PRO A 1 19 ? -9.216  15.087  -0.341  1.00 0.00 ? 28 PRO S HB2  11 
ATOM 11333 H HB3  . PRO A 1 19 ? -8.327  16.288  0.606   1.00 0.00 ? 28 PRO S HB3  11 
ATOM 11334 H HG2  . PRO A 1 19 ? -8.353  15.829  -2.326  1.00 0.00 ? 28 PRO S HG2  11 
ATOM 11335 H HG3  . PRO A 1 19 ? -8.119  17.335  -1.424  1.00 0.00 ? 28 PRO S HG3  11 
ATOM 11336 H HD2  . PRO A 1 19 ? -6.064  16.120  -2.629  1.00 0.00 ? 28 PRO S HD2  11 
ATOM 11337 H HD3  . PRO A 1 19 ? -5.865  16.904  -1.045  1.00 0.00 ? 28 PRO S HD3  11 
ATOM 11338 N N    . LEU A 1 20 ? -6.888  12.183  0.375   1.00 0.00 ? 29 LEU S N    11 
ATOM 11339 C CA   . LEU A 1 20 ? -7.232  10.766  0.378   1.00 0.00 ? 29 LEU S CA   11 
ATOM 11340 C C    . LEU A 1 20 ? -8.258  10.429  1.459   1.00 0.00 ? 29 LEU S C    11 
ATOM 11341 O O    . LEU A 1 20 ? -8.427  11.165  2.430   1.00 0.00 ? 29 LEU S O    11 
ATOM 11342 C CB   . LEU A 1 20 ? -5.971  9.933   0.611   1.00 0.00 ? 29 LEU S CB   11 
ATOM 11343 C CG   . LEU A 1 20 ? -5.105  10.380  1.794   1.00 0.00 ? 29 LEU S CG   11 
ATOM 11344 C CD1  . LEU A 1 20 ? -5.749  9.969   3.107   1.00 0.00 ? 29 LEU S CD1  11 
ATOM 11345 C CD2  . LEU A 1 20 ? -3.702  9.802   1.681   1.00 0.00 ? 29 LEU S CD2  11 
ATOM 11346 H H    . LEU A 1 20 ? -5.993  12.449  0.660   1.00 0.00 ? 29 LEU S H    11 
ATOM 11347 H HA   . LEU A 1 20 ? -7.643  10.518  -0.587  1.00 0.00 ? 29 LEU S HA   11 
ATOM 11348 H HB2  . LEU A 1 20 ? -6.267  8.906   0.778   1.00 0.00 ? 29 LEU S HB2  11 
ATOM 11349 H HB3  . LEU A 1 20 ? -5.370  9.977   -0.282  1.00 0.00 ? 29 LEU S HB3  11 
ATOM 11350 H HG   . LEU A 1 20 ? -5.023  11.455  1.789   1.00 0.00 ? 29 LEU S HG   11 
ATOM 11351 H HD11 . LEU A 1 20 ? -4.980  9.721   3.824   1.00 0.00 ? 29 LEU S HD11 11 
ATOM 11352 H HD12 . LEU A 1 20 ? -6.378  9.108   2.943   1.00 0.00 ? 29 LEU S HD12 11 
ATOM 11353 H HD13 . LEU A 1 20 ? -6.346  10.783  3.487   1.00 0.00 ? 29 LEU S HD13 11 
ATOM 11354 H HD21 . LEU A 1 20 ? -3.727  8.917   1.062   1.00 0.00 ? 29 LEU S HD21 11 
ATOM 11355 H HD22 . LEU A 1 20 ? -3.339  9.541   2.664   1.00 0.00 ? 29 LEU S HD22 11 
ATOM 11356 H HD23 . LEU A 1 20 ? -3.045  10.533  1.236   1.00 0.00 ? 29 LEU S HD23 11 
ATOM 11357 N N    . PRO A 1 21 ? -8.960  9.294   1.281   1.00 0.00 ? 30 PRO S N    11 
ATOM 11358 C CA   . PRO A 1 21 ? -9.991  8.822   2.218   1.00 0.00 ? 30 PRO S CA   11 
ATOM 11359 C C    . PRO A 1 21 ? -9.430  8.437   3.580   1.00 0.00 ? 30 PRO S C    11 
ATOM 11360 O O    . PRO A 1 21 ? -8.307  8.795   3.927   1.00 0.00 ? 30 PRO S O    11 
ATOM 11361 C CB   . PRO A 1 21 ? -10.561 7.586   1.518   1.00 0.00 ? 30 PRO S CB   11 
ATOM 11362 C CG   . PRO A 1 21 ? -9.459  7.123   0.641   1.00 0.00 ? 30 PRO S CG   11 
ATOM 11363 C CD   . PRO A 1 21 ? -8.811  8.376   0.137   1.00 0.00 ? 30 PRO S CD   11 
ATOM 11364 H HA   . PRO A 1 21 ? -10.768 9.551   2.345   1.00 0.00 ? 30 PRO S HA   11 
ATOM 11365 H HB2  . PRO A 1 21 ? -10.824 6.837   2.252   1.00 0.00 ? 30 PRO S HB2  11 
ATOM 11366 H HB3  . PRO A 1 21 ? -11.428 7.863   0.945   1.00 0.00 ? 30 PRO S HB3  11 
ATOM 11367 H HG2  . PRO A 1 21 ? -8.753  6.543   1.216   1.00 0.00 ? 30 PRO S HG2  11 
ATOM 11368 H HG3  . PRO A 1 21 ? -9.854  6.543   -0.182  1.00 0.00 ? 30 PRO S HG3  11 
ATOM 11369 H HD2  . PRO A 1 21 ? -7.771  8.199   -0.091  1.00 0.00 ? 30 PRO S HD2  11 
ATOM 11370 H HD3  . PRO A 1 21 ? -9.336  8.750   -0.729  1.00 0.00 ? 30 PRO S HD3  11 
ATOM 11371 N N    . GLU A 1 22 ? -10.228 7.699   4.347   1.00 0.00 ? 31 GLU S N    11 
ATOM 11372 C CA   . GLU A 1 22 ? -9.811  7.260   5.672   1.00 0.00 ? 31 GLU S CA   11 
ATOM 11373 C C    . GLU A 1 22 ? -9.339  5.818   5.644   1.00 0.00 ? 31 GLU S C    11 
ATOM 11374 O O    . GLU A 1 22 ? -8.370  5.472   6.322   1.00 0.00 ? 31 GLU S O    11 
ATOM 11375 C CB   . GLU A 1 22 ? -10.945 7.432   6.686   1.00 0.00 ? 31 GLU S CB   11 
ATOM 11376 C CG   . GLU A 1 22 ? -10.522 7.166   8.121   1.00 0.00 ? 31 GLU S CG   11 
ATOM 11377 C CD   . GLU A 1 22 ? -9.592  8.234   8.662   1.00 0.00 ? 31 GLU S CD   11 
ATOM 11378 O OE1  . GLU A 1 22 ? -9.931  9.430   8.547   1.00 0.00 ? 31 GLU S OE1  11 
ATOM 11379 O OE2  . GLU A 1 22 ? -8.525  7.873   9.201   1.00 0.00 ? 31 GLU S OE2  11 
ATOM 11380 H H    . GLU A 1 22 ? -11.113 7.445   4.014   1.00 0.00 ? 31 GLU S H    11 
ATOM 11381 H HA   . GLU A 1 22 ? -8.975  7.873   5.963   1.00 0.00 ? 31 GLU S HA   11 
ATOM 11382 H HB2  . GLU A 1 22 ? -11.315 8.445   6.624   1.00 0.00 ? 31 GLU S HB2  11 
ATOM 11383 H HB3  . GLU A 1 22 ? -11.743 6.750   6.435   1.00 0.00 ? 31 GLU S HB3  11 
ATOM 11384 H HG2  . GLU A 1 22 ? -11.405 7.131   8.743   1.00 0.00 ? 31 GLU S HG2  11 
ATOM 11385 H HG3  . GLU A 1 22 ? -10.016 6.212   8.162   1.00 0.00 ? 31 GLU S HG3  11 
ATOM 11386 N N    . GLY A 1 23 ? -9.985  4.983   4.830   1.00 0.00 ? 32 GLY S N    11 
ATOM 11387 C CA   . GLY A 1 23 ? -9.545  3.602   4.721   1.00 0.00 ? 32 GLY S CA   11 
ATOM 11388 C C    . GLY A 1 23 ? -8.047  3.552   4.495   1.00 0.00 ? 32 GLY S C    11 
ATOM 11389 O O    . GLY A 1 23 ? -7.370  2.598   4.875   1.00 0.00 ? 32 GLY S O    11 
ATOM 11390 H H    . GLY A 1 23 ? -10.729 5.310   4.284   1.00 0.00 ? 32 GLY S H    11 
ATOM 11391 H HA2  . GLY A 1 23 ? -9.789  3.074   5.635   1.00 0.00 ? 32 GLY S HA2  11 
ATOM 11392 H HA3  . GLY A 1 23 ? -10.044 3.132   3.887   1.00 0.00 ? 32 GLY S HA3  11 
ATOM 11393 N N    . VAL A 1 24 ? -7.545  4.631   3.897   1.00 0.00 ? 33 VAL S N    11 
ATOM 11394 C CA   . VAL A 1 24 ? -6.132  4.798   3.626   1.00 0.00 ? 33 VAL S CA   11 
ATOM 11395 C C    . VAL A 1 24 ? -5.418  5.234   4.906   1.00 0.00 ? 33 VAL S C    11 
ATOM 11396 O O    . VAL A 1 24 ? -5.612  6.351   5.386   1.00 0.00 ? 33 VAL S O    11 
ATOM 11397 C CB   . VAL A 1 24 ? -5.936  5.849   2.500   1.00 0.00 ? 33 VAL S CB   11 
ATOM 11398 C CG1  . VAL A 1 24 ? -4.934  6.931   2.878   1.00 0.00 ? 33 VAL S CG1  11 
ATOM 11399 C CG2  . VAL A 1 24 ? -5.527  5.178   1.205   1.00 0.00 ? 33 VAL S CG2  11 
ATOM 11400 H H    . VAL A 1 24 ? -8.152  5.356   3.646   1.00 0.00 ? 33 VAL S H    11 
ATOM 11401 H HA   . VAL A 1 24 ? -5.733  3.852   3.294   1.00 0.00 ? 33 VAL S HA   11 
ATOM 11402 H HB   . VAL A 1 24 ? -6.887  6.331   2.332   1.00 0.00 ? 33 VAL S HB   11 
ATOM 11403 H HG11 . VAL A 1 24 ? -5.370  7.577   3.624   1.00 0.00 ? 33 VAL S HG11 11 
ATOM 11404 H HG12 . VAL A 1 24 ? -4.691  7.512   2.002   1.00 0.00 ? 33 VAL S HG12 11 
ATOM 11405 H HG13 . VAL A 1 24 ? -4.038  6.475   3.272   1.00 0.00 ? 33 VAL S HG13 11 
ATOM 11406 H HG21 . VAL A 1 24 ? -6.063  5.638   0.386   1.00 0.00 ? 33 VAL S HG21 11 
ATOM 11407 H HG22 . VAL A 1 24 ? -5.770  4.128   1.250   1.00 0.00 ? 33 VAL S HG22 11 
ATOM 11408 H HG23 . VAL A 1 24 ? -4.463  5.298   1.057   1.00 0.00 ? 33 VAL S HG23 11 
ATOM 11409 N N    . ASP A 1 25 ? -4.604  4.350   5.467   1.00 0.00 ? 34 ASP S N    11 
ATOM 11410 C CA   . ASP A 1 25 ? -3.886  4.665   6.694   1.00 0.00 ? 34 ASP S CA   11 
ATOM 11411 C C    . ASP A 1 25 ? -2.518  5.264   6.375   1.00 0.00 ? 34 ASP S C    11 
ATOM 11412 O O    . ASP A 1 25 ? -1.719  4.652   5.671   1.00 0.00 ? 34 ASP S O    11 
ATOM 11413 C CB   . ASP A 1 25 ? -3.725  3.411   7.554   1.00 0.00 ? 34 ASP S CB   11 
ATOM 11414 C CG   . ASP A 1 25 ? -5.040  2.944   8.145   1.00 0.00 ? 34 ASP S CG   11 
ATOM 11415 O OD1  . ASP A 1 25 ? -5.698  3.748   8.838   1.00 0.00 ? 34 ASP S OD1  11 
ATOM 11416 O OD2  . ASP A 1 25 ? -5.414  1.774   7.914   1.00 0.00 ? 34 ASP S OD2  11 
ATOM 11417 H H    . ASP A 1 25 ? -4.492  3.468   5.054   1.00 0.00 ? 34 ASP S H    11 
ATOM 11418 H HA   . ASP A 1 25 ? -4.475  5.393   7.239   1.00 0.00 ? 34 ASP S HA   11 
ATOM 11419 H HB2  . ASP A 1 25 ? -3.323  2.613   6.945   1.00 0.00 ? 34 ASP S HB2  11 
ATOM 11420 H HB3  . ASP A 1 25 ? -3.042  3.621   8.365   1.00 0.00 ? 34 ASP S HB3  11 
ATOM 11421 N N    . PRO A 1 26 ? -2.231  6.480   6.877   1.00 0.00 ? 35 PRO S N    11 
ATOM 11422 C CA   . PRO A 1 26 ? -0.953  7.166   6.623   1.00 0.00 ? 35 PRO S CA   11 
ATOM 11423 C C    . PRO A 1 26 ? 0.258   6.427   7.192   1.00 0.00 ? 35 PRO S C    11 
ATOM 11424 O O    . PRO A 1 26 ? 1.366   6.551   6.673   1.00 0.00 ? 35 PRO S O    11 
ATOM 11425 C CB   . PRO A 1 26 ? -1.123  8.521   7.320   1.00 0.00 ? 35 PRO S CB   11 
ATOM 11426 C CG   . PRO A 1 26 ? -2.201  8.306   8.325   1.00 0.00 ? 35 PRO S CG   11 
ATOM 11427 C CD   . PRO A 1 26 ? -3.128  7.291   7.720   1.00 0.00 ? 35 PRO S CD   11 
ATOM 11428 H HA   . PRO A 1 26 ? -0.802  7.327   5.566   1.00 0.00 ? 35 PRO S HA   11 
ATOM 11429 H HB2  . PRO A 1 26 ? -0.193  8.803   7.795   1.00 0.00 ? 35 PRO S HB2  11 
ATOM 11430 H HB3  . PRO A 1 26 ? -1.405  9.269   6.593   1.00 0.00 ? 35 PRO S HB3  11 
ATOM 11431 H HG2  . PRO A 1 26 ? -1.778  7.928   9.244   1.00 0.00 ? 35 PRO S HG2  11 
ATOM 11432 H HG3  . PRO A 1 26 ? -2.726  9.232   8.503   1.00 0.00 ? 35 PRO S HG3  11 
ATOM 11433 H HD2  . PRO A 1 26 ? -3.583  6.687   8.492   1.00 0.00 ? 35 PRO S HD2  11 
ATOM 11434 H HD3  . PRO A 1 26 ? -3.883  7.778   7.121   1.00 0.00 ? 35 PRO S HD3  11 
ATOM 11435 N N    . LEU A 1 27 ? 0.048   5.670   8.263   1.00 0.00 ? 36 LEU S N    11 
ATOM 11436 C CA   . LEU A 1 27 ? 1.140   4.931   8.896   1.00 0.00 ? 36 LEU S CA   11 
ATOM 11437 C C    . LEU A 1 27 ? 1.376   3.570   8.227   1.00 0.00 ? 36 LEU S C    11 
ATOM 11438 O O    . LEU A 1 27 ? 2.190   2.775   8.694   1.00 0.00 ? 36 LEU S O    11 
ATOM 11439 C CB   . LEU A 1 27 ? 0.860   4.739   10.392  1.00 0.00 ? 36 LEU S CB   11 
ATOM 11440 C CG   . LEU A 1 27 ? -0.515  4.158   10.746  1.00 0.00 ? 36 LEU S CG   11 
ATOM 11441 C CD1  . LEU A 1 27 ? -1.535  5.270   10.945  1.00 0.00 ? 36 LEU S CD1  11 
ATOM 11442 C CD2  . LEU A 1 27 ? -0.984  3.182   9.675   1.00 0.00 ? 36 LEU S CD2  11 
ATOM 11443 H H    . LEU A 1 27 ? -0.853  5.614   8.642   1.00 0.00 ? 36 LEU S H    11 
ATOM 11444 H HA   . LEU A 1 27 ? 2.033   5.525   8.787   1.00 0.00 ? 36 LEU S HA   11 
ATOM 11445 H HB2  . LEU A 1 27 ? 1.617   4.079   10.793  1.00 0.00 ? 36 LEU S HB2  11 
ATOM 11446 H HB3  . LEU A 1 27 ? 0.951   5.701   10.877  1.00 0.00 ? 36 LEU S HB3  11 
ATOM 11447 H HG   . LEU A 1 27 ? -0.435  3.615   11.677  1.00 0.00 ? 36 LEU S HG   11 
ATOM 11448 H HD11 . LEU A 1 27 ? -2.462  5.001   10.458  1.00 0.00 ? 36 LEU S HD11 11 
ATOM 11449 H HD12 . LEU A 1 27 ? -1.156  6.186   10.517  1.00 0.00 ? 36 LEU S HD12 11 
ATOM 11450 H HD13 . LEU A 1 27 ? -1.711  5.412   12.002  1.00 0.00 ? 36 LEU S HD13 11 
ATOM 11451 H HD21 . LEU A 1 27 ? -1.015  3.685   8.718   1.00 0.00 ? 36 LEU S HD21 11 
ATOM 11452 H HD22 . LEU A 1 27 ? -1.968  2.818   9.924   1.00 0.00 ? 36 LEU S HD22 11 
ATOM 11453 H HD23 . LEU A 1 27 ? -0.293  2.353   9.619   1.00 0.00 ? 36 LEU S HD23 11 
ATOM 11454 N N    . LYS A 1 28 ? 0.658   3.306   7.138   1.00 0.00 ? 37 LYS S N    11 
ATOM 11455 C CA   . LYS A 1 28 ? 0.791   2.043   6.414   1.00 0.00 ? 37 LYS S CA   11 
ATOM 11456 C C    . LYS A 1 28 ? 0.097   2.138   5.058   1.00 0.00 ? 37 LYS S C    11 
ATOM 11457 O O    . LYS A 1 28 ? -1.099  1.873   4.941   1.00 0.00 ? 37 LYS S O    11 
ATOM 11458 C CB   . LYS A 1 28 ? 0.198   0.894   7.234   1.00 0.00 ? 37 LYS S CB   11 
ATOM 11459 C CG   . LYS A 1 28 ? -1.286  1.054   7.523   1.00 0.00 ? 37 LYS S CG   11 
ATOM 11460 C CD   . LYS A 1 28 ? -1.676  0.381   8.829   1.00 0.00 ? 37 LYS S CD   11 
ATOM 11461 C CE   . LYS A 1 28 ? -2.294  -0.988  8.589   1.00 0.00 ? 37 LYS S CE   11 
ATOM 11462 N NZ   . LYS A 1 28 ? -1.257  -2.045  8.428   1.00 0.00 ? 37 LYS S NZ   11 
ATOM 11463 H H    . LYS A 1 28 ? 0.022   3.975   6.811   1.00 0.00 ? 37 LYS S H    11 
ATOM 11464 H HA   . LYS A 1 28 ? 1.845   1.861   6.256   1.00 0.00 ? 37 LYS S HA   11 
ATOM 11465 H HB2  . LYS A 1 28 ? 0.342   -0.029  6.693   1.00 0.00 ? 37 LYS S HB2  11 
ATOM 11466 H HB3  . LYS A 1 28 ? 0.722   0.836   8.178   1.00 0.00 ? 37 LYS S HB3  11 
ATOM 11467 H HG2  . LYS A 1 28 ? -1.520  2.104   7.587   1.00 0.00 ? 37 LYS S HG2  11 
ATOM 11468 H HG3  . LYS A 1 28 ? -1.852  0.609   6.719   1.00 0.00 ? 37 LYS S HG3  11 
ATOM 11469 H HD2  . LYS A 1 28 ? -0.794  0.265   9.441   1.00 0.00 ? 37 LYS S HD2  11 
ATOM 11470 H HD3  . LYS A 1 28 ? -2.393  1.003   9.344   1.00 0.00 ? 37 LYS S HD3  11 
ATOM 11471 H HE2  . LYS A 1 28 ? -2.922  -1.238  9.431   1.00 0.00 ? 37 LYS S HE2  11 
ATOM 11472 H HE3  . LYS A 1 28 ? -2.895  -0.944  7.693   1.00 0.00 ? 37 LYS S HE3  11 
ATOM 11473 H HZ1  . LYS A 1 28 ? -0.355  -1.619  8.136   1.00 0.00 ? 37 LYS S HZ1  11 
ATOM 11474 H HZ2  . LYS A 1 28 ? -1.556  -2.731  7.705   1.00 0.00 ? 37 LYS S HZ2  11 
ATOM 11475 H HZ3  . LYS A 1 28 ? -1.116  -2.547  9.328   1.00 0.00 ? 37 LYS S HZ3  11 
ATOM 11476 N N    . LEU A 1 29 ? 0.848   2.549   4.041   1.00 0.00 ? 38 LEU S N    11 
ATOM 11477 C CA   . LEU A 1 29 ? 0.294   2.715   2.704   1.00 0.00 ? 38 LEU S CA   11 
ATOM 11478 C C    . LEU A 1 29 ? 0.340   1.428   1.875   1.00 0.00 ? 38 LEU S C    11 
ATOM 11479 O O    . LEU A 1 29 ? -0.697  0.946   1.420   1.00 0.00 ? 38 LEU S O    11 
ATOM 11480 C CB   . LEU A 1 29 ? 1.019   3.853   1.977   1.00 0.00 ? 38 LEU S CB   11 
ATOM 11481 C CG   . LEU A 1 29 ? 1.141   5.164   2.772   1.00 0.00 ? 38 LEU S CG   11 
ATOM 11482 C CD1  . LEU A 1 29 ? 1.107   6.371   1.846   1.00 0.00 ? 38 LEU S CD1  11 
ATOM 11483 C CD2  . LEU A 1 29 ? 0.039   5.279   3.815   1.00 0.00 ? 38 LEU S CD2  11 
ATOM 11484 H H    . LEU A 1 29 ? 1.790   2.769   4.199   1.00 0.00 ? 38 LEU S H    11 
ATOM 11485 H HA   . LEU A 1 29 ? -0.737  2.992   2.825   1.00 0.00 ? 38 LEU S HA   11 
ATOM 11486 H HB2  . LEU A 1 29 ? 2.017   3.513   1.729   1.00 0.00 ? 38 LEU S HB2  11 
ATOM 11487 H HB3  . LEU A 1 29 ? 0.489   4.060   1.060   1.00 0.00 ? 38 LEU S HB3  11 
ATOM 11488 H HG   . LEU A 1 29 ? 2.091   5.172   3.289   1.00 0.00 ? 38 LEU S HG   11 
ATOM 11489 H HD11 . LEU A 1 29 ? 1.328   6.061   0.837   1.00 0.00 ? 38 LEU S HD11 11 
ATOM 11490 H HD12 . LEU A 1 29 ? 1.839   7.093   2.172   1.00 0.00 ? 38 LEU S HD12 11 
ATOM 11491 H HD13 . LEU A 1 29 ? 0.126   6.821   1.878   1.00 0.00 ? 38 LEU S HD13 11 
ATOM 11492 H HD21 . LEU A 1 29 ? 0.347   4.778   4.722   1.00 0.00 ? 38 LEU S HD21 11 
ATOM 11493 H HD22 . LEU A 1 29 ? -0.864  4.820   3.440   1.00 0.00 ? 38 LEU S HD22 11 
ATOM 11494 H HD23 . LEU A 1 29 ? -0.148  6.320   4.025   1.00 0.00 ? 38 LEU S HD23 11 
ATOM 11495 N N    . GLU A 1 30 ? 1.539   0.887   1.660   1.00 0.00 ? 39 GLU S N    11 
ATOM 11496 C CA   . GLU A 1 30 ? 1.704   -0.332  0.860   1.00 0.00 ? 39 GLU S CA   11 
ATOM 11497 C C    . GLU A 1 30 ? 0.624   -1.378  1.145   1.00 0.00 ? 39 GLU S C    11 
ATOM 11498 O O    . GLU A 1 30 ? 0.313   -2.206  0.288   1.00 0.00 ? 39 GLU S O    11 
ATOM 11499 C CB   . GLU A 1 30 ? 3.078   -0.948  1.112   1.00 0.00 ? 39 GLU S CB   11 
ATOM 11500 C CG   . GLU A 1 30 ? 3.264   -1.459  2.533   1.00 0.00 ? 39 GLU S CG   11 
ATOM 11501 C CD   . GLU A 1 30 ? 3.822   -2.868  2.579   1.00 0.00 ? 39 GLU S CD   11 
ATOM 11502 O OE1  . GLU A 1 30 ? 3.022   -3.825  2.531   1.00 0.00 ? 39 GLU S OE1  11 
ATOM 11503 O OE2  . GLU A 1 30 ? 5.059   -3.014  2.663   1.00 0.00 ? 39 GLU S OE2  11 
ATOM 11504 H H    . GLU A 1 30 ? 2.337   1.325   2.032   1.00 0.00 ? 39 GLU S H    11 
ATOM 11505 H HA   . GLU A 1 30 ? 1.642   -0.047  -0.177  1.00 0.00 ? 39 GLU S HA   11 
ATOM 11506 H HB2  . GLU A 1 30 ? 3.216   -1.779  0.433   1.00 0.00 ? 39 GLU S HB2  11 
ATOM 11507 H HB3  . GLU A 1 30 ? 3.834   -0.202  0.915   1.00 0.00 ? 39 GLU S HB3  11 
ATOM 11508 H HG2  . GLU A 1 30 ? 3.944   -0.803  3.054   1.00 0.00 ? 39 GLU S HG2  11 
ATOM 11509 H HG3  . GLU A 1 30 ? 2.306   -1.451  3.032   1.00 0.00 ? 39 GLU S HG3  11 
ATOM 11510 N N    . ILE A 1 31 ? 0.072   -1.355  2.351   1.00 0.00 ? 40 ILE S N    11 
ATOM 11511 C CA   . ILE A 1 31 ? -0.948  -2.322  2.741   1.00 0.00 ? 40 ILE S CA   11 
ATOM 11512 C C    . ILE A 1 31 ? -2.255  -2.144  1.966   1.00 0.00 ? 40 ILE S C    11 
ATOM 11513 O O    . ILE A 1 31 ? -2.961  -3.120  1.712   1.00 0.00 ? 40 ILE S O    11 
ATOM 11514 C CB   . ILE A 1 31 ? -1.256  -2.228  4.245   1.00 0.00 ? 40 ILE S CB   11 
ATOM 11515 C CG1  . ILE A 1 31 ? -1.650  -0.797  4.615   1.00 0.00 ? 40 ILE S CG1  11 
ATOM 11516 C CG2  . ILE A 1 31 ? -0.056  -2.686  5.061   1.00 0.00 ? 40 ILE S CG2  11 
ATOM 11517 C CD1  . ILE A 1 31 ? -3.107  -0.652  4.995   1.00 0.00 ? 40 ILE S CD1  11 
ATOM 11518 H H    . ILE A 1 31 ? 0.371   -0.688  3.002   1.00 0.00 ? 40 ILE S H    11 
ATOM 11519 H HA   . ILE A 1 31 ? -0.561  -3.309  2.542   1.00 0.00 ? 40 ILE S HA   11 
ATOM 11520 H HB   . ILE A 1 31 ? -2.082  -2.889  4.463   1.00 0.00 ? 40 ILE S HB   11 
ATOM 11521 H HG12 . ILE A 1 31 ? -1.054  -0.474  5.453   1.00 0.00 ? 40 ILE S HG12 11 
ATOM 11522 H HG13 . ILE A 1 31 ? -1.459  -0.148  3.773   1.00 0.00 ? 40 ILE S HG13 11 
ATOM 11523 H HG21 . ILE A 1 31 ? -0.033  -3.766  5.093   1.00 0.00 ? 40 ILE S HG21 11 
ATOM 11524 H HG22 . ILE A 1 31 ? -0.134  -2.298  6.066   1.00 0.00 ? 40 ILE S HG22 11 
ATOM 11525 H HG23 . ILE A 1 31 ? 0.852   -2.322  4.603   1.00 0.00 ? 40 ILE S HG23 11 
ATOM 11526 H HD11 . ILE A 1 31 ? -3.289  0.354   5.343   1.00 0.00 ? 40 ILE S HD11 11 
ATOM 11527 H HD12 . ILE A 1 31 ? -3.344  -1.354  5.781   1.00 0.00 ? 40 ILE S HD12 11 
ATOM 11528 H HD13 . ILE A 1 31 ? -3.725  -0.852  4.133   1.00 0.00 ? 40 ILE S HD13 11 
ATOM 11529 N N    . TYR A 1 32 ? -2.595  -0.907  1.609   1.00 0.00 ? 41 TYR S N    11 
ATOM 11530 C CA   . TYR A 1 32 ? -3.841  -0.655  0.889   1.00 0.00 ? 41 TYR S CA   11 
ATOM 11531 C C    . TYR A 1 32 ? -3.644  -0.572  -0.620  1.00 0.00 ? 41 TYR S C    11 
ATOM 11532 O O    . TYR A 1 32 ? -4.402  0.112   -1.309  1.00 0.00 ? 41 TYR S O    11 
ATOM 11533 C CB   . TYR A 1 32 ? -4.525  0.619   1.400   1.00 0.00 ? 41 TYR S CB   11 
ATOM 11534 C CG   . TYR A 1 32 ? -3.666  1.872   1.385   1.00 0.00 ? 41 TYR S CG   11 
ATOM 11535 C CD1  . TYR A 1 32 ? -2.850  2.192   0.302   1.00 0.00 ? 41 TYR S CD1  11 
ATOM 11536 C CD2  . TYR A 1 32 ? -3.696  2.752   2.460   1.00 0.00 ? 41 TYR S CD2  11 
ATOM 11537 C CE1  . TYR A 1 32 ? -2.089  3.347   0.300   1.00 0.00 ? 41 TYR S CE1  11 
ATOM 11538 C CE2  . TYR A 1 32 ? -2.944  3.907   2.462   1.00 0.00 ? 41 TYR S CE2  11 
ATOM 11539 C CZ   . TYR A 1 32 ? -2.142  4.202   1.381   1.00 0.00 ? 41 TYR S CZ   11 
ATOM 11540 O OH   . TYR A 1 32 ? -1.394  5.357   1.386   1.00 0.00 ? 41 TYR S OH   11 
ATOM 11541 H H    . TYR A 1 32 ? -2.012  -0.156  1.847   1.00 0.00 ? 41 TYR S H    11 
ATOM 11542 H HA   . TYR A 1 32 ? -4.497  -1.489  1.091   1.00 0.00 ? 41 TYR S HA   11 
ATOM 11543 H HB2  . TYR A 1 32 ? -5.393  0.817   0.788   1.00 0.00 ? 41 TYR S HB2  11 
ATOM 11544 H HB3  . TYR A 1 32 ? -4.847  0.454   2.420   1.00 0.00 ? 41 TYR S HB3  11 
ATOM 11545 H HD1  . TYR A 1 32 ? -2.811  1.527   -0.544  1.00 0.00 ? 41 TYR S HD1  11 
ATOM 11546 H HD2  . TYR A 1 32 ? -4.320  2.518   3.309   1.00 0.00 ? 41 TYR S HD2  11 
ATOM 11547 H HE1  . TYR A 1 32 ? -1.457  3.581   -0.549  1.00 0.00 ? 41 TYR S HE1  11 
ATOM 11548 H HE2  . TYR A 1 32 ? -2.983  4.576   3.309   1.00 0.00 ? 41 TYR S HE2  11 
ATOM 11549 H HH   . TYR A 1 32 ? -0.768  5.341   0.658   1.00 0.00 ? 41 TYR S HH   11 
ATOM 11550 N N    . LEU A 1 33 ? -2.640  -1.271  -1.143  1.00 0.00 ? 42 LEU S N    11 
ATOM 11551 C CA   . LEU A 1 33 ? -2.395  -1.255  -2.582  1.00 0.00 ? 42 LEU S CA   11 
ATOM 11552 C C    . LEU A 1 33 ? -2.056  -2.639  -3.104  1.00 0.00 ? 42 LEU S C    11 
ATOM 11553 O O    . LEU A 1 33 ? -1.088  -3.256  -2.667  1.00 0.00 ? 42 LEU S O    11 
ATOM 11554 C CB   . LEU A 1 33 ? -1.269  -0.285  -2.942  1.00 0.00 ? 42 LEU S CB   11 
ATOM 11555 C CG   . LEU A 1 33 ? -0.144  -0.162  -1.909  1.00 0.00 ? 42 LEU S CG   11 
ATOM 11556 C CD1  . LEU A 1 33 ? 1.079   -0.956  -2.355  1.00 0.00 ? 42 LEU S CD1  11 
ATOM 11557 C CD2  . LEU A 1 33 ? 0.216   1.301   -1.687  1.00 0.00 ? 42 LEU S CD2  11 
ATOM 11558 H H    . LEU A 1 33 ? -2.063  -1.810  -0.558  1.00 0.00 ? 42 LEU S H    11 
ATOM 11559 H HA   . LEU A 1 33 ? -3.302  -0.922  -3.061  1.00 0.00 ? 42 LEU S HA   11 
ATOM 11560 H HB2  . LEU A 1 33 ? -0.833  -0.612  -3.876  1.00 0.00 ? 42 LEU S HB2  11 
ATOM 11561 H HB3  . LEU A 1 33 ? -1.702  0.692   -3.091  1.00 0.00 ? 42 LEU S HB3  11 
ATOM 11562 H HG   . LEU A 1 33 ? -0.482  -0.571  -0.968  1.00 0.00 ? 42 LEU S HG   11 
ATOM 11563 H HD11 . LEU A 1 33 ? 1.955   -0.328  -2.302  1.00 0.00 ? 42 LEU S HD11 11 
ATOM 11564 H HD12 . LEU A 1 33 ? 0.939   -1.295  -3.371  1.00 0.00 ? 42 LEU S HD12 11 
ATOM 11565 H HD13 . LEU A 1 33 ? 1.208   -1.809  -1.706  1.00 0.00 ? 42 LEU S HD13 11 
ATOM 11566 H HD21 . LEU A 1 33 ? -0.313  1.674   -0.822  1.00 0.00 ? 42 LEU S HD21 11 
ATOM 11567 H HD22 . LEU A 1 33 ? -0.063  1.876   -2.557  1.00 0.00 ? 42 LEU S HD22 11 
ATOM 11568 H HD23 . LEU A 1 33 ? 1.280   1.387   -1.523  1.00 0.00 ? 42 LEU S HD23 11 
ATOM 11569 N N    . THR A 1 34 ? -2.848  -3.115  -4.057  1.00 0.00 ? 43 THR S N    11 
ATOM 11570 C CA   . THR A 1 34 ? -2.609  -4.420  -4.652  1.00 0.00 ? 43 THR S CA   11 
ATOM 11571 C C    . THR A 1 34 ? -1.267  -4.424  -5.379  1.00 0.00 ? 43 THR S C    11 
ATOM 11572 O O    . THR A 1 34 ? -0.472  -3.501  -5.224  1.00 0.00 ? 43 THR S O    11 
ATOM 11573 C CB   . THR A 1 34 ? -3.736  -4.784  -5.622  1.00 0.00 ? 43 THR S CB   11 
ATOM 11574 O OG1  . THR A 1 34 ? -3.499  -6.044  -6.225  1.00 0.00 ? 43 THR S OG1  11 
ATOM 11575 C CG2  . THR A 1 34 ? -3.923  -3.772  -6.732  1.00 0.00 ? 43 THR S CG2  11 
ATOM 11576 H H    . THR A 1 34 ? -3.602  -2.571  -4.372  1.00 0.00 ? 43 THR S H    11 
ATOM 11577 H HA   . THR A 1 34 ? -2.578  -5.149  -3.856  1.00 0.00 ? 43 THR S HA   11 
ATOM 11578 H HB   . THR A 1 34 ? -4.664  -4.844  -5.072  1.00 0.00 ? 43 THR S HB   11 
ATOM 11579 H HG1  . THR A 1 34 ? -3.595  -6.737  -5.567  1.00 0.00 ? 43 THR S HG1  11 
ATOM 11580 H HG21 . THR A 1 34 ? -3.057  -3.781  -7.377  1.00 0.00 ? 43 THR S HG21 11 
ATOM 11581 H HG22 . THR A 1 34 ? -4.043  -2.787  -6.306  1.00 0.00 ? 43 THR S HG22 11 
ATOM 11582 H HG23 . THR A 1 34 ? -4.801  -4.025  -7.307  1.00 0.00 ? 43 THR S HG23 11 
ATOM 11583 N N    . ASP A 1 35 ? -1.033  -5.460  -6.172  1.00 0.00 ? 44 ASP S N    11 
ATOM 11584 C CA   . ASP A 1 35 ? 0.198   -5.608  -6.938  1.00 0.00 ? 44 ASP S CA   11 
ATOM 11585 C C    . ASP A 1 35 ? 0.287   -4.535  -8.006  1.00 0.00 ? 44 ASP S C    11 
ATOM 11586 O O    . ASP A 1 35 ? 1.359   -3.996  -8.267  1.00 0.00 ? 44 ASP S O    11 
ATOM 11587 C CB   . ASP A 1 35 ? 0.259   -6.993  -7.583  1.00 0.00 ? 44 ASP S CB   11 
ATOM 11588 C CG   . ASP A 1 35 ? -0.966  -7.293  -8.426  1.00 0.00 ? 44 ASP S CG   11 
ATOM 11589 O OD1  . ASP A 1 35 ? -2.084  -7.286  -7.870  1.00 0.00 ? 44 ASP S OD1  11 
ATOM 11590 O OD2  . ASP A 1 35 ? -0.806  -7.533  -9.641  1.00 0.00 ? 44 ASP S OD2  11 
ATOM 11591 H H    . ASP A 1 35 ? -1.709  -6.138  -6.252  1.00 0.00 ? 44 ASP S H    11 
ATOM 11592 H HA   . ASP A 1 35 ? 1.029   -5.499  -6.259  1.00 0.00 ? 44 ASP S HA   11 
ATOM 11593 H HB2  . ASP A 1 35 ? 1.132   -7.049  -8.218  1.00 0.00 ? 44 ASP S HB2  11 
ATOM 11594 H HB3  . ASP A 1 35 ? 0.333   -7.743  -6.807  1.00 0.00 ? 44 ASP S HB3  11 
ATOM 11595 N N    . GLU A 1 36 ? -0.850  -4.217  -8.615  1.00 0.00 ? 45 GLU S N    11 
ATOM 11596 C CA   . GLU A 1 36 ? -0.893  -3.189  -9.641  1.00 0.00 ? 45 GLU S CA   11 
ATOM 11597 C C    . GLU A 1 36 ? -0.537  -1.848  -9.021  1.00 0.00 ? 45 GLU S C    11 
ATOM 11598 O O    . GLU A 1 36 ? 0.369   -1.155  -9.488  1.00 0.00 ? 45 GLU S O    11 
ATOM 11599 C CB   . GLU A 1 36 ? -2.277  -3.115  -10.272 1.00 0.00 ? 45 GLU S CB   11 
ATOM 11600 C CG   . GLU A 1 36 ? -2.718  -4.413  -10.930 1.00 0.00 ? 45 GLU S CG   11 
ATOM 11601 C CD   . GLU A 1 36 ? -4.216  -4.471  -11.160 1.00 0.00 ? 45 GLU S CD   11 
ATOM 11602 O OE1  . GLU A 1 36 ? -4.962  -3.856  -10.369 1.00 0.00 ? 45 GLU S OE1  11 
ATOM 11603 O OE2  . GLU A 1 36 ? -4.644  -5.130  -12.130 1.00 0.00 ? 45 GLU S OE2  11 
ATOM 11604 H H    . GLU A 1 36 ? -1.675  -4.677  -8.358  1.00 0.00 ? 45 GLU S H    11 
ATOM 11605 H HA   . GLU A 1 36 ? -0.164  -3.435  -10.399 1.00 0.00 ? 45 GLU S HA   11 
ATOM 11606 H HB2  . GLU A 1 36 ? -2.992  -2.865  -9.504  1.00 0.00 ? 45 GLU S HB2  11 
ATOM 11607 H HB3  . GLU A 1 36 ? -2.274  -2.339  -11.020 1.00 0.00 ? 45 GLU S HB3  11 
ATOM 11608 H HG2  . GLU A 1 36 ? -2.220  -4.506  -11.884 1.00 0.00 ? 45 GLU S HG2  11 
ATOM 11609 H HG3  . GLU A 1 36 ? -2.435  -5.240  -10.295 1.00 0.00 ? 45 GLU S HG3  11 
ATOM 11610 N N    . ASP A 1 37 ? -1.236  -1.504  -7.944  1.00 0.00 ? 46 ASP S N    11 
ATOM 11611 C CA   . ASP A 1 37 ? -0.973  -0.268  -7.235  1.00 0.00 ? 46 ASP S CA   11 
ATOM 11612 C C    . ASP A 1 37 ? 0.420   -0.342  -6.623  1.00 0.00 ? 46 ASP S C    11 
ATOM 11613 O O    . ASP A 1 37 ? 1.135   0.656   -6.543  1.00 0.00 ? 46 ASP S O    11 
ATOM 11614 C CB   . ASP A 1 37 ? -2.031  -0.048  -6.157  1.00 0.00 ? 46 ASP S CB   11 
ATOM 11615 C CG   . ASP A 1 37 ? -1.834  1.258   -5.414  1.00 0.00 ? 46 ASP S CG   11 
ATOM 11616 O OD1  . ASP A 1 37 ? -0.707  1.503   -4.936  1.00 0.00 ? 46 ASP S OD1  11 
ATOM 11617 O OD2  . ASP A 1 37 ? -2.805  2.035   -5.311  1.00 0.00 ? 46 ASP S OD2  11 
ATOM 11618 H H    . ASP A 1 37 ? -1.927  -2.109  -7.602  1.00 0.00 ? 46 ASP S H    11 
ATOM 11619 H HA   . ASP A 1 37 ? -1.006  0.544   -7.946  1.00 0.00 ? 46 ASP S HA   11 
ATOM 11620 H HB2  . ASP A 1 37 ? -3.008  -0.030  -6.622  1.00 0.00 ? 46 ASP S HB2  11 
ATOM 11621 H HB3  . ASP A 1 37 ? -1.989  -0.864  -5.446  1.00 0.00 ? 46 ASP S HB3  11 
ATOM 11622 N N    . PHE A 1 38 ? 0.806   -1.555  -6.229  1.00 0.00 ? 47 PHE S N    11 
ATOM 11623 C CA   . PHE A 1 38 ? 2.124   -1.799  -5.667  1.00 0.00 ? 47 PHE S CA   11 
ATOM 11624 C C    . PHE A 1 38 ? 3.168   -1.550  -6.735  1.00 0.00 ? 47 PHE S C    11 
ATOM 11625 O O    . PHE A 1 38 ? 4.189   -0.909  -6.495  1.00 0.00 ? 47 PHE S O    11 
ATOM 11626 C CB   . PHE A 1 38 ? 2.249   -3.252  -5.202  1.00 0.00 ? 47 PHE S CB   11 
ATOM 11627 C CG   . PHE A 1 38 ? 2.385   -3.428  -3.720  1.00 0.00 ? 47 PHE S CG   11 
ATOM 11628 C CD1  . PHE A 1 38 ? 3.493   -2.943  -3.047  1.00 0.00 ? 47 PHE S CD1  11 
ATOM 11629 C CD2  . PHE A 1 38 ? 1.409   -4.093  -3.006  1.00 0.00 ? 47 PHE S CD2  11 
ATOM 11630 C CE1  . PHE A 1 38 ? 3.621   -3.120  -1.683  1.00 0.00 ? 47 PHE S CE1  11 
ATOM 11631 C CE2  . PHE A 1 38 ? 1.528   -4.273  -1.647  1.00 0.00 ? 47 PHE S CE2  11 
ATOM 11632 C CZ   . PHE A 1 38 ? 2.635   -3.785  -0.980  1.00 0.00 ? 47 PHE S CZ   11 
ATOM 11633 H H    . PHE A 1 38 ? 0.194   -2.311  -6.350  1.00 0.00 ? 47 PHE S H    11 
ATOM 11634 H HA   . PHE A 1 38 ? 2.281   -1.130  -4.835  1.00 0.00 ? 47 PHE S HA   11 
ATOM 11635 H HB2  . PHE A 1 38 ? 1.378   -3.798  -5.519  1.00 0.00 ? 47 PHE S HB2  11 
ATOM 11636 H HB3  . PHE A 1 38 ? 3.120   -3.688  -5.664  1.00 0.00 ? 47 PHE S HB3  11 
ATOM 11637 H HD1  . PHE A 1 38 ? 4.261   -2.423  -3.597  1.00 0.00 ? 47 PHE S HD1  11 
ATOM 11638 H HD2  . PHE A 1 38 ? 0.542   -4.476  -3.524  1.00 0.00 ? 47 PHE S HD2  11 
ATOM 11639 H HE1  . PHE A 1 38 ? 4.490   -2.740  -1.168  1.00 0.00 ? 47 PHE S HE1  11 
ATOM 11640 H HE2  . PHE A 1 38 ? 0.755   -4.794  -1.105  1.00 0.00 ? 47 PHE S HE2  11 
ATOM 11641 H HZ   . PHE A 1 38 ? 2.731   -3.923  0.086   1.00 0.00 ? 47 PHE S HZ   11 
ATOM 11642 N N    . GLU A 1 39 ? 2.901   -2.083  -7.921  1.00 0.00 ? 48 GLU S N    11 
ATOM 11643 C CA   . GLU A 1 39 ? 3.820   -1.940  -9.044  1.00 0.00 ? 48 GLU S CA   11 
ATOM 11644 C C    . GLU A 1 39 ? 4.146   -0.472  -9.311  1.00 0.00 ? 48 GLU S C    11 
ATOM 11645 O O    . GLU A 1 39 ? 5.311   -0.101  -9.454  1.00 0.00 ? 48 GLU S O    11 
ATOM 11646 C CB   . GLU A 1 39 ? 3.227   -2.578  -10.301 1.00 0.00 ? 48 GLU S CB   11 
ATOM 11647 C CG   . GLU A 1 39 ? 3.475   -4.075  -10.396 1.00 0.00 ? 48 GLU S CG   11 
ATOM 11648 C CD   . GLU A 1 39 ? 3.764   -4.527  -11.814 1.00 0.00 ? 48 GLU S CD   11 
ATOM 11649 O OE1  . GLU A 1 39 ? 4.771   -4.066  -12.391 1.00 0.00 ? 48 GLU S OE1  11 
ATOM 11650 O OE2  . GLU A 1 39 ? 2.983   -5.343  -12.348 1.00 0.00 ? 48 GLU S OE2  11 
ATOM 11651 H H    . GLU A 1 39 ? 2.057   -2.599  -8.040  1.00 0.00 ? 48 GLU S H    11 
ATOM 11652 H HA   . GLU A 1 39 ? 4.733   -2.455  -8.787  1.00 0.00 ? 48 GLU S HA   11 
ATOM 11653 H HB2  . GLU A 1 39 ? 2.160   -2.410  -10.307 1.00 0.00 ? 48 GLU S HB2  11 
ATOM 11654 H HB3  . GLU A 1 39 ? 3.660   -2.107  -11.170 1.00 0.00 ? 48 GLU S HB3  11 
ATOM 11655 H HG2  . GLU A 1 39 ? 4.325   -4.327  -9.775  1.00 0.00 ? 48 GLU S HG2  11 
ATOM 11656 H HG3  . GLU A 1 39 ? 2.596   -4.596  -10.039 1.00 0.00 ? 48 GLU S HG3  11 
ATOM 11657 N N    . PHE A 1 40 ? 3.113   0.360   -9.382  1.00 0.00 ? 49 PHE S N    11 
ATOM 11658 C CA   . PHE A 1 40 ? 3.294   1.785   -9.637  1.00 0.00 ? 49 PHE S CA   11 
ATOM 11659 C C    . PHE A 1 40 ? 3.662   2.546   -8.363  1.00 0.00 ? 49 PHE S C    11 
ATOM 11660 O O    . PHE A 1 40 ? 4.044   3.715   -8.421  1.00 0.00 ? 49 PHE S O    11 
ATOM 11661 C CB   . PHE A 1 40 ? 2.023   2.379   -10.246 1.00 0.00 ? 49 PHE S CB   11 
ATOM 11662 C CG   . PHE A 1 40 ? 2.263   3.638   -11.029 1.00 0.00 ? 49 PHE S CG   11 
ATOM 11663 C CD1  . PHE A 1 40 ? 2.407   4.855   -10.383 1.00 0.00 ? 49 PHE S CD1  11 
ATOM 11664 C CD2  . PHE A 1 40 ? 2.344   3.603   -12.412 1.00 0.00 ? 49 PHE S CD2  11 
ATOM 11665 C CE1  . PHE A 1 40 ? 2.629   6.015   -11.102 1.00 0.00 ? 49 PHE S CE1  11 
ATOM 11666 C CE2  . PHE A 1 40 ? 2.565   4.760   -13.136 1.00 0.00 ? 49 PHE S CE2  11 
ATOM 11667 C CZ   . PHE A 1 40 ? 2.707   5.967   -12.481 1.00 0.00 ? 49 PHE S CZ   11 
ATOM 11668 H H    . PHE A 1 40 ? 2.206   0.008   -9.263  1.00 0.00 ? 49 PHE S H    11 
ATOM 11669 H HA   . PHE A 1 40 ? 4.101   1.891   -10.348 1.00 0.00 ? 49 PHE S HA   11 
ATOM 11670 H HB2  . PHE A 1 40 ? 1.578   1.653   -10.912 1.00 0.00 ? 49 PHE S HB2  11 
ATOM 11671 H HB3  . PHE A 1 40 ? 1.326   2.608   -9.451  1.00 0.00 ? 49 PHE S HB3  11 
ATOM 11672 H HD1  . PHE A 1 40 ? 2.346   4.894   -9.306  1.00 0.00 ? 49 PHE S HD1  11 
ATOM 11673 H HD2  . PHE A 1 40 ? 2.233   2.659   -12.926 1.00 0.00 ? 49 PHE S HD2  11 
ATOM 11674 H HE1  . PHE A 1 40 ? 2.739   6.958   -10.588 1.00 0.00 ? 49 PHE S HE1  11 
ATOM 11675 H HE2  . PHE A 1 40 ? 2.627   4.719   -14.214 1.00 0.00 ? 49 PHE S HE2  11 
ATOM 11676 H HZ   . PHE A 1 40 ? 2.880   6.872   -13.044 1.00 0.00 ? 49 PHE S HZ   11 
ATOM 11677 N N    . ALA A 1 41 ? 3.540   1.887   -7.214  1.00 0.00 ? 50 ALA S N    11 
ATOM 11678 C CA   . ALA A 1 41 ? 3.855   2.521   -5.938  1.00 0.00 ? 50 ALA S CA   11 
ATOM 11679 C C    . ALA A 1 41 ? 5.238   2.119   -5.434  1.00 0.00 ? 50 ALA S C    11 
ATOM 11680 O O    . ALA A 1 41 ? 6.113   2.965   -5.254  1.00 0.00 ? 50 ALA S O    11 
ATOM 11681 C CB   . ALA A 1 41 ? 2.796   2.175   -4.903  1.00 0.00 ? 50 ALA S CB   11 
ATOM 11682 H H    . ALA A 1 41 ? 3.225   0.960   -7.221  1.00 0.00 ? 50 ALA S H    11 
ATOM 11683 H HA   . ALA A 1 41 ? 3.837   3.591   -6.088  1.00 0.00 ? 50 ALA S HA   11 
ATOM 11684 H HB1  . ALA A 1 41 ? 1.876   2.688   -5.144  1.00 0.00 ? 50 ALA S HB1  11 
ATOM 11685 H HB2  . ALA A 1 41 ? 3.133   2.480   -3.925  1.00 0.00 ? 50 ALA S HB2  11 
ATOM 11686 H HB3  . ALA A 1 41 ? 2.624   1.108   -4.908  1.00 0.00 ? 50 ALA S HB3  11 
ATOM 11687 N N    . LEU A 1 42 ? 5.428   0.826   -5.196  1.00 0.00 ? 51 LEU S N    11 
ATOM 11688 C CA   . LEU A 1 42 ? 6.702   0.317   -4.699  1.00 0.00 ? 51 LEU S CA   11 
ATOM 11689 C C    . LEU A 1 42 ? 7.360   -0.641  -5.691  1.00 0.00 ? 51 LEU S C    11 
ATOM 11690 O O    . LEU A 1 42 ? 8.423   -1.195  -5.411  1.00 0.00 ? 51 LEU S O    11 
ATOM 11691 C CB   . LEU A 1 42 ? 6.491   -0.395  -3.365  1.00 0.00 ? 51 LEU S CB   11 
ATOM 11692 C CG   . LEU A 1 42 ? 6.227   0.530   -2.177  1.00 0.00 ? 51 LEU S CG   11 
ATOM 11693 C CD1  . LEU A 1 42 ? 5.138   -0.036  -1.280  1.00 0.00 ? 51 LEU S CD1  11 
ATOM 11694 C CD2  . LEU A 1 42 ? 7.506   0.749   -1.389  1.00 0.00 ? 51 LEU S CD2  11 
ATOM 11695 H H    . LEU A 1 42 ? 4.691   0.199   -5.351  1.00 0.00 ? 51 LEU S H    11 
ATOM 11696 H HA   . LEU A 1 42 ? 7.357   1.161   -4.544  1.00 0.00 ? 51 LEU S HA   11 
ATOM 11697 H HB2  . LEU A 1 42 ? 5.650   -1.065  -3.470  1.00 0.00 ? 51 LEU S HB2  11 
ATOM 11698 H HB3  . LEU A 1 42 ? 7.373   -0.981  -3.150  1.00 0.00 ? 51 LEU S HB3  11 
ATOM 11699 H HG   . LEU A 1 42 ? 5.893   1.488   -2.543  1.00 0.00 ? 51 LEU S HG   11 
ATOM 11700 H HD11 . LEU A 1 42 ? 4.415   0.735   -1.064  1.00 0.00 ? 51 LEU S HD11 11 
ATOM 11701 H HD12 . LEU A 1 42 ? 5.579   -0.383  -0.358  1.00 0.00 ? 51 LEU S HD12 11 
ATOM 11702 H HD13 . LEU A 1 42 ? 4.650   -0.860  -1.779  1.00 0.00 ? 51 LEU S HD13 11 
ATOM 11703 H HD21 . LEU A 1 42 ? 7.272   0.830   -0.338  1.00 0.00 ? 51 LEU S HD21 11 
ATOM 11704 H HD22 . LEU A 1 42 ? 7.981   1.655   -1.726  1.00 0.00 ? 51 LEU S HD22 11 
ATOM 11705 H HD23 . LEU A 1 42 ? 8.170   -0.087  -1.546  1.00 0.00 ? 51 LEU S HD23 11 
ATOM 11706 N N    . ASP A 1 43 ? 6.728   -0.839  -6.844  1.00 0.00 ? 52 ASP S N    11 
ATOM 11707 C CA   . ASP A 1 43 ? 7.263   -1.738  -7.861  1.00 0.00 ? 52 ASP S CA   11 
ATOM 11708 C C    . ASP A 1 43 ? 7.348   -3.175  -7.348  1.00 0.00 ? 52 ASP S C    11 
ATOM 11709 O O    . ASP A 1 43 ? 7.999   -4.020  -7.963  1.00 0.00 ? 52 ASP S O    11 
ATOM 11710 C CB   . ASP A 1 43 ? 8.645   -1.264  -8.315  1.00 0.00 ? 52 ASP S CB   11 
ATOM 11711 C CG   . ASP A 1 43 ? 8.572   -0.052  -9.221  1.00 0.00 ? 52 ASP S CG   11 
ATOM 11712 O OD1  . ASP A 1 43 ? 8.013   0.978   -8.791  1.00 0.00 ? 52 ASP S OD1  11 
ATOM 11713 O OD2  . ASP A 1 43 ? 9.072   -0.132  -10.363 1.00 0.00 ? 52 ASP S OD2  11 
ATOM 11714 H H    . ASP A 1 43 ? 5.883   -0.376  -7.016  1.00 0.00 ? 52 ASP S H    11 
ATOM 11715 H HA   . ASP A 1 43 ? 6.593   -1.714  -8.706  1.00 0.00 ? 52 ASP S HA   11 
ATOM 11716 H HB2  . ASP A 1 43 ? 9.236   -1.006  -7.446  1.00 0.00 ? 52 ASP S HB2  11 
ATOM 11717 H HB3  . ASP A 1 43 ? 9.134   -2.065  -8.854  1.00 0.00 ? 52 ASP S HB3  11 
ATOM 11718 N N    . MET A 1 44 ? 6.685   -3.456  -6.225  1.00 0.00 ? 53 MET S N    11 
ATOM 11719 C CA   . MET A 1 44 ? 6.695   -4.803  -5.658  1.00 0.00 ? 53 MET S CA   11 
ATOM 11720 C C    . MET A 1 44 ? 5.284   -5.384  -5.624  1.00 0.00 ? 53 MET S C    11 
ATOM 11721 O O    . MET A 1 44 ? 4.406   -4.917  -6.345  1.00 0.00 ? 53 MET S O    11 
ATOM 11722 C CB   . MET A 1 44 ? 7.309   -4.791  -4.256  1.00 0.00 ? 53 MET S CB   11 
ATOM 11723 C CG   . MET A 1 44 ? 8.493   -5.737  -4.113  1.00 0.00 ? 53 MET S CG   11 
ATOM 11724 S SD   . MET A 1 44 ? 10.048  -4.982  -4.621  1.00 0.00 ? 53 MET S SD   11 
ATOM 11725 C CE   . MET A 1 44 ? 10.776  -6.312  -5.575  1.00 0.00 ? 53 MET S CE   11 
ATOM 11726 H H    . MET A 1 44 ? 6.172   -2.747  -5.775  1.00 0.00 ? 53 MET S H    11 
ATOM 11727 H HA   . MET A 1 44 ? 7.305   -5.424  -6.299  1.00 0.00 ? 53 MET S HA   11 
ATOM 11728 H HB2  . MET A 1 44 ? 7.645   -3.790  -4.031  1.00 0.00 ? 53 MET S HB2  11 
ATOM 11729 H HB3  . MET A 1 44 ? 6.553   -5.082  -3.538  1.00 0.00 ? 53 MET S HB3  11 
ATOM 11730 H HG2  . MET A 1 44 ? 8.575   -6.038  -3.081  1.00 0.00 ? 53 MET S HG2  11 
ATOM 11731 H HG3  . MET A 1 44 ? 8.314   -6.609  -4.727  1.00 0.00 ? 53 MET S HG3  11 
ATOM 11732 H HE1  . MET A 1 44 ? 11.338  -5.898  -6.399  1.00 0.00 ? 53 MET S HE1  11 
ATOM 11733 H HE2  . MET A 1 44 ? 9.993   -6.951  -5.957  1.00 0.00 ? 53 MET S HE2  11 
ATOM 11734 H HE3  . MET A 1 44 ? 11.436  -6.889  -4.944  1.00 0.00 ? 53 MET S HE3  11 
ATOM 11735 N N    . THR A 1 45 ? 5.062   -6.405  -4.796  1.00 0.00 ? 54 THR S N    11 
ATOM 11736 C CA   . THR A 1 45 ? 3.745   -7.018  -4.698  1.00 0.00 ? 54 THR S CA   11 
ATOM 11737 C C    . THR A 1 45 ? 3.351   -7.216  -3.241  1.00 0.00 ? 54 THR S C    11 
ATOM 11738 O O    . THR A 1 45 ? 4.213   -7.363  -2.372  1.00 0.00 ? 54 THR S O    11 
ATOM 11739 C CB   . THR A 1 45 ? 3.720   -8.355  -5.438  1.00 0.00 ? 54 THR S CB   11 
ATOM 11740 O OG1  . THR A 1 45 ? 4.986   -8.984  -5.385  1.00 0.00 ? 54 THR S OG1  11 
ATOM 11741 C CG2  . THR A 1 45 ? 3.338   -8.220  -6.896  1.00 0.00 ? 54 THR S CG2  11 
ATOM 11742 H H    . THR A 1 45 ? 5.792   -6.750  -4.234  1.00 0.00 ? 54 THR S H    11 
ATOM 11743 H HA   . THR A 1 45 ? 3.035   -6.349  -5.159  1.00 0.00 ? 54 THR S HA   11 
ATOM 11744 H HB   . THR A 1 45 ? 2.996   -9.005  -4.966  1.00 0.00 ? 54 THR S HB   11 
ATOM 11745 H HG1  . THR A 1 45 ? 4.894   -9.912  -5.611  1.00 0.00 ? 54 THR S HG1  11 
ATOM 11746 H HG21 . THR A 1 45 ? 4.046   -8.760  -7.505  1.00 0.00 ? 54 THR S HG21 11 
ATOM 11747 H HG22 . THR A 1 45 ? 3.348   -7.176  -7.175  1.00 0.00 ? 54 THR S HG22 11 
ATOM 11748 H HG23 . THR A 1 45 ? 2.348   -8.624  -7.048  1.00 0.00 ? 54 THR S HG23 11 
ATOM 11749 N N    . ARG A 1 46 ? 2.052   -7.243  -2.976  1.00 0.00 ? 55 ARG S N    11 
ATOM 11750 C CA   . ARG A 1 46 ? 1.567   -7.452  -1.619  1.00 0.00 ? 55 ARG S CA   11 
ATOM 11751 C C    . ARG A 1 46 ? 2.090   -8.778  -1.077  1.00 0.00 ? 55 ARG S C    11 
ATOM 11752 O O    . ARG A 1 46 ? 2.265   -8.946  0.127   1.00 0.00 ? 55 ARG S O    11 
ATOM 11753 C CB   . ARG A 1 46 ? 0.037   -7.438  -1.586  1.00 0.00 ? 55 ARG S CB   11 
ATOM 11754 C CG   . ARG A 1 46 ? -0.539  -6.766  -0.350  1.00 0.00 ? 55 ARG S CG   11 
ATOM 11755 C CD   . ARG A 1 46 ? -0.992  -7.783  0.683   1.00 0.00 ? 55 ARG S CD   11 
ATOM 11756 N NE   . ARG A 1 46 ? -1.234  -7.163  1.983   1.00 0.00 ? 55 ARG S NE   11 
ATOM 11757 C CZ   . ARG A 1 46 ? -2.393  -6.612  2.342   1.00 0.00 ? 55 ARG S CZ   11 
ATOM 11758 N NH1  . ARG A 1 46 ? -3.417  -6.588  1.499   1.00 0.00 ? 55 ARG S NH1  11 
ATOM 11759 N NH2  . ARG A 1 46 ? -2.525  -6.078  3.548   1.00 0.00 ? 55 ARG S NH2  11 
ATOM 11760 H H    . ARG A 1 46 ? 1.408   -7.139  -3.707  1.00 0.00 ? 55 ARG S H    11 
ATOM 11761 H HA   . ARG A 1 46 ? 1.943   -6.649  -1.002  1.00 0.00 ? 55 ARG S HA   11 
ATOM 11762 H HB2  . ARG A 1 46 ? -0.325  -6.911  -2.459  1.00 0.00 ? 55 ARG S HB2  11 
ATOM 11763 H HB3  . ARG A 1 46 ? -0.321  -8.460  -1.616  1.00 0.00 ? 55 ARG S HB3  11 
ATOM 11764 H HG2  . ARG A 1 46 ? 0.219   -6.138  0.091   1.00 0.00 ? 55 ARG S HG2  11 
ATOM 11765 H HG3  . ARG A 1 46 ? -1.385  -6.161  -0.643  1.00 0.00 ? 55 ARG S HG3  11 
ATOM 11766 H HD2  . ARG A 1 46 ? -1.904  -8.248  0.339   1.00 0.00 ? 55 ARG S HD2  11 
ATOM 11767 H HD3  . ARG A 1 46 ? -0.224  -8.534  0.790   1.00 0.00 ? 55 ARG S HD3  11 
ATOM 11768 H HE   . ARG A 1 46 ? -0.494  -7.155  2.624   1.00 0.00 ? 55 ARG S HE   11 
ATOM 11769 H HH11 . ARG A 1 46 ? -3.324  -6.984  0.585   1.00 0.00 ? 55 ARG S HH11 11 
ATOM 11770 H HH12 . ARG A 1 46 ? -4.283  -6.174  1.776   1.00 0.00 ? 55 ARG S HH12 11 
ATOM 11771 H HH21 . ARG A 1 46 ? -1.757  -6.089  4.187   1.00 0.00 ? 55 ARG S HH21 11 
ATOM 11772 H HH22 . ARG A 1 46 ? -3.395  -5.664  3.818   1.00 0.00 ? 55 ARG S HH22 11 
ATOM 11773 N N    . ASP A 1 47 ? 2.337   -9.716  -1.990  1.00 0.00 ? 56 ASP S N    11 
ATOM 11774 C CA   . ASP A 1 47 ? 2.842   -11.039 -1.636  1.00 0.00 ? 56 ASP S CA   11 
ATOM 11775 C C    . ASP A 1 47 ? 4.370   -11.065 -1.577  1.00 0.00 ? 56 ASP S C    11 
ATOM 11776 O O    . ASP A 1 47 ? 4.960   -12.047 -1.125  1.00 0.00 ? 56 ASP S O    11 
ATOM 11777 C CB   . ASP A 1 47 ? 2.343   -12.079 -2.640  1.00 0.00 ? 56 ASP S CB   11 
ATOM 11778 C CG   . ASP A 1 47 ? 0.985   -12.639 -2.267  1.00 0.00 ? 56 ASP S CG   11 
ATOM 11779 O OD1  . ASP A 1 47 ? 0.847   -13.164 -1.142  1.00 0.00 ? 56 ASP S OD1  11 
ATOM 11780 O OD2  . ASP A 1 47 ? 0.058   -12.555 -3.102  1.00 0.00 ? 56 ASP S OD2  11 
ATOM 11781 H H    . ASP A 1 47 ? 2.176   -9.512  -2.935  1.00 0.00 ? 56 ASP S H    11 
ATOM 11782 H HA   . ASP A 1 47 ? 2.454   -11.285 -0.659  1.00 0.00 ? 56 ASP S HA   11 
ATOM 11783 H HB2  . ASP A 1 47 ? 2.268   -11.621 -3.615  1.00 0.00 ? 56 ASP S HB2  11 
ATOM 11784 H HB3  . ASP A 1 47 ? 3.050   -12.895 -2.683  1.00 0.00 ? 56 ASP S HB3  11 
ATOM 11785 N N    . GLU A 1 48 ? 5.012   -9.984  -2.024  1.00 0.00 ? 57 GLU S N    11 
ATOM 11786 C CA   . GLU A 1 48 ? 6.466   -9.903  -2.001  1.00 0.00 ? 57 GLU S CA   11 
ATOM 11787 C C    . GLU A 1 48 ? 6.892   -9.201  -0.734  1.00 0.00 ? 57 GLU S C    11 
ATOM 11788 O O    . GLU A 1 48 ? 7.585   -9.767  0.112   1.00 0.00 ? 57 GLU S O    11 
ATOM 11789 C CB   . GLU A 1 48 ? 6.981   -9.139  -3.220  1.00 0.00 ? 57 GLU S CB   11 
ATOM 11790 C CG   . GLU A 1 48 ? 8.497   -9.085  -3.310  1.00 0.00 ? 57 GLU S CG   11 
ATOM 11791 C CD   . GLU A 1 48 ? 9.005   -9.301  -4.721  1.00 0.00 ? 57 GLU S CD   11 
ATOM 11792 O OE1  . GLU A 1 48 ? 8.481   -8.647  -5.647  1.00 0.00 ? 57 GLU S OE1  11 
ATOM 11793 O OE2  . GLU A 1 48 ? 9.928   -10.124 -4.901  1.00 0.00 ? 57 GLU S OE2  11 
ATOM 11794 H H    . GLU A 1 48 ? 4.498   -9.218  -2.354  1.00 0.00 ? 57 GLU S H    11 
ATOM 11795 H HA   . GLU A 1 48 ? 6.865   -10.907 -2.008  1.00 0.00 ? 57 GLU S HA   11 
ATOM 11796 H HB2  . GLU A 1 48 ? 6.606   -9.617  -4.114  1.00 0.00 ? 57 GLU S HB2  11 
ATOM 11797 H HB3  . GLU A 1 48 ? 6.606   -8.123  -3.175  1.00 0.00 ? 57 GLU S HB3  11 
ATOM 11798 H HG2  . GLU A 1 48 ? 8.831   -8.117  -2.967  1.00 0.00 ? 57 GLU S HG2  11 
ATOM 11799 H HG3  . GLU A 1 48 ? 8.909   -9.853  -2.672  1.00 0.00 ? 57 GLU S HG3  11 
ATOM 11800 N N    . TYR A 1 49 ? 6.426   -7.973  -0.598  1.00 0.00 ? 58 TYR S N    11 
ATOM 11801 C CA   . TYR A 1 49 ? 6.700   -7.178  0.580   1.00 0.00 ? 58 TYR S CA   11 
ATOM 11802 C C    . TYR A 1 49 ? 6.173   -7.913  1.803   1.00 0.00 ? 58 TYR S C    11 
ATOM 11803 O O    . TYR A 1 49 ? 6.711   -7.784  2.903   1.00 0.00 ? 58 TYR S O    11 
ATOM 11804 C CB   . TYR A 1 49 ? 6.016   -5.823  0.440   1.00 0.00 ? 58 TYR S CB   11 
ATOM 11805 C CG   . TYR A 1 49 ? 6.900   -4.762  -0.181  1.00 0.00 ? 58 TYR S CG   11 
ATOM 11806 C CD1  . TYR A 1 49 ? 8.032   -5.111  -0.909  1.00 0.00 ? 58 TYR S CD1  11 
ATOM 11807 C CD2  . TYR A 1 49 ? 6.609   -3.412  -0.030  1.00 0.00 ? 58 TYR S CD2  11 
ATOM 11808 C CE1  . TYR A 1 49 ? 8.848   -4.149  -1.469  1.00 0.00 ? 58 TYR S CE1  11 
ATOM 11809 C CE2  . TYR A 1 49 ? 7.423   -2.444  -0.587  1.00 0.00 ? 58 TYR S CE2  11 
ATOM 11810 C CZ   . TYR A 1 49 ? 8.539   -2.817  -1.306  1.00 0.00 ? 58 TYR S CZ   11 
ATOM 11811 O OH   . TYR A 1 49 ? 9.351   -1.856  -1.862  1.00 0.00 ? 58 TYR S OH   11 
ATOM 11812 H H    . TYR A 1 49 ? 5.852   -7.600  -1.300  1.00 0.00 ? 58 TYR S H    11 
ATOM 11813 H HA   . TYR A 1 49 ? 7.766   -7.043  0.667   1.00 0.00 ? 58 TYR S HA   11 
ATOM 11814 H HB2  . TYR A 1 49 ? 5.146   -5.935  -0.191  1.00 0.00 ? 58 TYR S HB2  11 
ATOM 11815 H HB3  . TYR A 1 49 ? 5.708   -5.484  1.410   1.00 0.00 ? 58 TYR S HB3  11 
ATOM 11816 H HD1  . TYR A 1 49 ? 8.272   -6.157  -1.036  1.00 0.00 ? 58 TYR S HD1  11 
ATOM 11817 H HD2  . TYR A 1 49 ? 5.733   -3.119  0.532   1.00 0.00 ? 58 TYR S HD2  11 
ATOM 11818 H HE1  . TYR A 1 49 ? 9.722   -4.442  -2.030  1.00 0.00 ? 58 TYR S HE1  11 
ATOM 11819 H HE2  . TYR A 1 49 ? 7.181   -1.403  -0.457  1.00 0.00 ? 58 TYR S HE2  11 
ATOM 11820 H HH   . TYR A 1 49 ? 10.014  -1.587  -1.222  1.00 0.00 ? 58 TYR S HH   11 
ATOM 11821 N N    . ASN A 1 50 ? 5.118   -8.693  1.594   1.00 0.00 ? 59 ASN S N    11 
ATOM 11822 C CA   . ASN A 1 50 ? 4.509   -9.468  2.675   1.00 0.00 ? 59 ASN S CA   11 
ATOM 11823 C C    . ASN A 1 50 ? 5.556   -10.275 3.447   1.00 0.00 ? 59 ASN S C    11 
ATOM 11824 O O    . ASN A 1 50 ? 5.387   -10.544 4.635   1.00 0.00 ? 59 ASN S O    11 
ATOM 11825 C CB   . ASN A 1 50 ? 3.44