data_2K6N
# 
_entry.id   2K6N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2K6N         
RCSB  RCSB100742   
WWPDB D_1000100742 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2K6M PDB 'Solution Structure of Human Supervillin Headpiece'                                                       
unspecified 1YU5 PDB 'Crystal Structure of the Headpiece Domain of Chicken Villin'                                             
unspecified 1QZP PDB 'NMR Structure of the Human Dematin Headpiece Domain'                                                     
unspecified 1ZV6 PDB 'NMR Structure of the human Dematin Headpiece S74E Mutant'                                                
unspecified 1QQV PDB 'Solution Structure of the Headpiece Domain of Chicken Villin'                                            
unspecified 1YU7 PDB 'Crystal Structure of the W64A Mutant of Villin Headpiece'                                                
unspecified 1UNC PDB 'Solution Structure of the Human Villin C-Terminal Headpiece Subdomain'                                   
unspecified 1UND PDB 'Solution Structure of the Human Advillin C-Terminal Subdomain'                                           
unspecified 1YU8 PDB 'Crystal Structure of the R37A Mutant of Villin Headpiece'                                                
unspecified 1VII PDB 'Thermostable Subdomain from Chicken Villin Headpiece, NMR, Minimized Average Structure'                  
unspecified 2PPZ PDB 'NMR Solution Structure of the Villin Headpiece Mutant G34L'                                              
unspecified 1UJS PDB 'Solution Structure of the Villin Headpiece Domain of Human Actin-Binding LIM protein homolog'            
unspecified 1YRF PDB 'Chicken Villin Subdomain HP-35, N68H, pH 6.7'                                                            
unspecified 1YRI PDB 'Chicken Villin Subdomain HP-35, N68H, pH 6.4'                                                            
unspecified 2JM0 PDB 'Solution Structure of Chicken Villin Headpiece Subdomain Containing a Fluorinated Sidechain in the Core' 
unspecified 1WY3 PDB 'Chicken Villin Subdomain HP-35, K65(NLE), N68H, pH 7.0'                                                  
unspecified 1WY4 PDB 'Chicken Villin Subdomain HP-35, K65(NLE), N68H, pH 5.1'                                                  
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K6N 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-11 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Brown, J.W.'  1 
'Didem, V.'    2 
'McKnight, C.' 3 
# 
_citation.id                        primary 
_citation.title                     'How to arm a supervillin: designing F-actin binding activity into supervillin headpiece.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            393 
_citation.page_first                608 
_citation.page_last                 618 
_citation.year                      2009 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19683541 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2009.08.018 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Brown, J.W.'    1 
primary 'Vardar-Ulu, D.' 2 
primary 'McKnight, C.J.' 3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           Supervillin 
_entity.formula_weight             7708.040 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 2149-2214, HP' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Archvillin, p205/p250' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 
_entity_poly.pdbx_seq_one_letter_code_can   MLAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LEU n 
1 3  ALA n 
1 4  LYS n 
1 5  LEU n 
1 6  CYS n 
1 7  LYS n 
1 8  THR n 
1 9  ILE n 
1 10 TYR n 
1 11 PRO n 
1 12 LEU n 
1 13 ALA n 
1 14 ASP n 
1 15 LEU n 
1 16 LEU n 
1 17 ALA n 
1 18 ARG n 
1 19 PRO n 
1 20 LEU n 
1 21 PRO n 
1 22 GLU n 
1 23 GLY n 
1 24 VAL n 
1 25 ASP n 
1 26 PRO n 
1 27 LEU n 
1 28 LYS n 
1 29 LEU n 
1 30 GLU n 
1 31 ILE n 
1 32 TYR n 
1 33 LEU n 
1 34 THR n 
1 35 ASP n 
1 36 GLU n 
1 37 ASP n 
1 38 PHE n 
1 39 GLU n 
1 40 PHE n 
1 41 ALA n 
1 42 LEU n 
1 43 ASP n 
1 44 MET n 
1 45 THR n 
1 46 ARG n 
1 47 ASP n 
1 48 GLU n 
1 49 TYR n 
1 50 ASN n 
1 51 ALA n 
1 52 LEU n 
1 53 PRO n 
1 54 ALA n 
1 55 TRP n 
1 56 LYS n 
1 57 GLN n 
1 58 VAL n 
1 59 ASN n 
1 60 LEU n 
1 61 LYS n 
1 62 LYS n 
1 63 ALA n 
1 64 LYS n 
1 65 GLY n 
1 66 LEU n 
1 67 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SVIL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'pSVHP(pET24A)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SVIL_HUMAN 
_struct_ref.pdbx_db_accession          O95425 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LAKLCKTIYPLADLLARPLPEGVDPLKLEIYLTDEDFEFALDMTRDEYNALPAWKQVNLKKAKGLF 
_struct_ref.pdbx_align_begin           2149 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2K6N 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 67 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O95425 
_struct_ref_seq.db_align_beg                  2149 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  2214 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       11 
_struct_ref_seq.pdbx_auth_seq_align_end       76 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2K6N 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   O95425 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION TAG' 
_struct_ref_seq_dif.pdbx_auth_seq_num            10 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-15N HSQC'  
1 2  4 '2D 1H-13C HSQC'  
1 3  5 '2D 1H-1H TOCSY'  
1 4  5 '2D 1H-1H COSY'   
1 5  1 '3D HNCO'         
1 6  1 '3D HNCA'         
1 7  1 '3D HN(CO)CA'     
1 8  1 '3D HN(CA)CO'     
1 9  4 '3D HCCH-TOCSY'   
1 10 4 '3D HCCH-COSY'    
1 11 2 '3D HNHA'         
1 12 2 '3D HNHB'         
1 13 5 '2D 1H-1H NOESY'  
1 14 2 '3D 1H-15N NOESY' 
1 15 4 '3D 1H-13C NOESY' 
1 16 3 '2D 1H-13C HSQC'  
1 17 2 '3D HMQC-J'       
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;1.3-2.5 mM [U-13C; U-15N] Supervillin Headpiece, 4 mM DTT, 500 uM TMSP, 100 mM sodium chloride, 20 mM sodium phosphate, 95% H2O/5% D2O
;
1 '95% H2O/5% D2O' 
'1.3-2.5 mM [U-15N] Supervillin Headpiece, 4 mM DTT, 500 uM TMSP, 100 mM sodium chloride, 20 mM sodium phosphate, 95% H2O/5% D2O' 
2 '95% H2O/5% D2O' 

'1.3-2.5 mM [U-10% 13C] Supervillin Headpiece, 4 mM DTT, 500 uM TMSP, 100 mM sodium chloride, 20 mM sodium phosphate, 95% H2O/5% D2O' 
3 '95% H2O/5% D2O' 
'1.3-2.5 mM [U-13C] Supervillin Headpiece, 4 mM DTT, 500 uM TMSP, 100 mM sodium chloride, 20 mM sodium phosphate, 95% H2O/5% D2O' 
4 '95% H2O/5% D2O' 
'1.3-2.5 mM Supervillin Headpiece, 4 mM DTT, 500 uM TMSP, 100 mM sodium chloride, 20 mM sodium phosphate, 95% H2O/5% D2O' 5 
'95% H2O/5% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    500 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_pdbx_nmr_refine.entry_id           2K6N 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2K6N 
_pdbx_nmr_details.text       
;DISTANCE RESTRAINTS WERE DETERMINED FROM 
A NOESY BUILDUP SERIES. MIXING TIMES OF 
50, 75, 100, 125, 150 - 13C AND 15N NOE 
ASSIGNMENTS WERE BINED AS WEAK
;
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K6N 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K6N 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
BRUNGER                                               refinement                 CNS      1.1    1 
'Brunger, Adams, Clore, Gros, Nilges and Read'        'geometry optimization'    CNS      1.1    2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'   processing                 NMRPipe  ?      3 
'Koradi, Billeter and Wuthrich'                       'structural alignment'     Molmol   2K.2   4 
'Koradi, Billeter and Wuthrich'                       'structural visualization' Molmol   2K.2   5 
'Bruker Biospin'                                      collection                 xwinnmr  3.1    6 
'Cornilescu, Delaglio and Bax'                        'data analysis'            TALOS    ?      7 
'(PREDITOR) M. V. Berjanskii, S. Neal, D. S. Wishart' 'data analysis'            PREDITOR ?      8 
'Johnson, One Moon Scientific'                        'peak picking'             NMRView  7.0.16 9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K6N 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K6N 
_struct.title                     'Solution Structure of Human Supervillin Headpiece, Minimized Average' 
_struct.pdbx_descriptor           Supervillin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K6N 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            
;Supervillin, SVHP, HP, Headpiece, Villin, Archvillin, Actin capping, Actin-binding, Alternative splicing, Calcium, Cytoplasm, Cytoskeleton, Membrane, Phosphoprotein, Polymorphism, STRUCTURAL PROTEIN
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 11 ? ALA A 17 ? PRO A 20 ALA A 26 1 ? 7  
HELX_P HELX_P2 2 THR A 34 ? LEU A 42 ? THR A 43 LEU A 51 1 ? 9  
HELX_P HELX_P3 3 THR A 45 ? ASN A 50 ? THR A 54 ASN A 59 1 ? 6  
HELX_P HELX_P4 4 PRO A 53 ? GLY A 65 ? PRO A 62 GLY A 74 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2K6N 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . MET A 1 1  ? 88.223  -9.818  3.631   1.00 0.00 ? 10 MET A N    1 
ATOM 2    C CA   . MET A 1 1  ? 89.257  -8.775  3.864   1.00 0.00 ? 10 MET A CA   1 
ATOM 3    C C    . MET A 1 1  ? 90.080  -9.083  5.110   1.00 0.00 ? 10 MET A C    1 
ATOM 4    O O    . MET A 1 1  ? 91.264  -8.754  5.182   1.00 0.00 ? 10 MET A O    1 
ATOM 5    C CB   . MET A 1 1  ? 88.559  -7.422  4.013   1.00 0.00 ? 10 MET A CB   1 
ATOM 6    C CG   . MET A 1 1  ? 89.460  -6.236  3.710   1.00 0.00 ? 10 MET A CG   1 
ATOM 7    S SD   . MET A 1 1  ? 88.669  -4.655  4.067   1.00 0.00 ? 10 MET A SD   1 
ATOM 8    C CE   . MET A 1 1  ? 87.064  -4.901  3.311   1.00 0.00 ? 10 MET A CE   1 
ATOM 9    H H1   . MET A 1 1  ? 87.440  -9.641  4.291   1.00 0.00 ? 10 MET A H1   1 
ATOM 10   H H2   . MET A 1 1  ? 88.663  -10.744 3.809   1.00 0.00 ? 10 MET A H2   1 
ATOM 11   H H3   . MET A 1 1  ? 87.906  -9.735  2.644   1.00 0.00 ? 10 MET A H3   1 
ATOM 12   H HA   . MET A 1 1  ? 89.913  -8.744  3.007   1.00 0.00 ? 10 MET A HA   1 
ATOM 13   H HB2  . MET A 1 1  ? 87.716  -7.388  3.337   1.00 0.00 ? 10 MET A HB2  1 
ATOM 14   H HB3  . MET A 1 1  ? 88.200  -7.325  5.027   1.00 0.00 ? 10 MET A HB3  1 
ATOM 15   H HG2  . MET A 1 1  ? 90.353  -6.318  4.311   1.00 0.00 ? 10 MET A HG2  1 
ATOM 16   H HG3  . MET A 1 1  ? 89.727  -6.261  2.664   1.00 0.00 ? 10 MET A HG3  1 
ATOM 17   H HE1  . MET A 1 1  ? 86.554  -3.952  3.231   1.00 0.00 ? 10 MET A HE1  1 
ATOM 18   H HE2  . MET A 1 1  ? 86.478  -5.574  3.921   1.00 0.00 ? 10 MET A HE2  1 
ATOM 19   H HE3  . MET A 1 1  ? 87.191  -5.326  2.326   1.00 0.00 ? 10 MET A HE3  1 
ATOM 20   N N    . LEU A 1 2  ? 89.444  -9.716  6.091   1.00 0.00 ? 11 LEU A N    1 
ATOM 21   C CA   . LEU A 1 2  ? 90.118  -10.069 7.335   1.00 0.00 ? 11 LEU A CA   1 
ATOM 22   C C    . LEU A 1 2  ? 90.934  -11.347 7.169   1.00 0.00 ? 11 LEU A C    1 
ATOM 23   O O    . LEU A 1 2  ? 92.087  -11.419 7.594   1.00 0.00 ? 11 LEU A O    1 
ATOM 24   C CB   . LEU A 1 2  ? 89.096  -10.246 8.460   1.00 0.00 ? 11 LEU A CB   1 
ATOM 25   C CG   . LEU A 1 2  ? 88.325  -8.981  8.839   1.00 0.00 ? 11 LEU A CG   1 
ATOM 26   C CD1  . LEU A 1 2  ? 87.390  -9.255  10.007  1.00 0.00 ? 11 LEU A CD1  1 
ATOM 27   C CD2  . LEU A 1 2  ? 89.287  -7.852  9.178   1.00 0.00 ? 11 LEU A CD2  1 
ATOM 28   H H    . LEU A 1 2  ? 88.500  -9.952  5.975   1.00 0.00 ? 11 LEU A H    1 
ATOM 29   H HA   . LEU A 1 2  ? 90.785  -9.261  7.591   1.00 0.00 ? 11 LEU A HA   1 
ATOM 30   H HB2  . LEU A 1 2  ? 88.384  -11.000 8.156   1.00 0.00 ? 11 LEU A HB2  1 
ATOM 31   H HB3  . LEU A 1 2  ? 89.616  -10.599 9.338   1.00 0.00 ? 11 LEU A HB3  1 
ATOM 32   H HG   . LEU A 1 2  ? 87.724  -8.668  7.998   1.00 0.00 ? 11 LEU A HG   1 
ATOM 33   H HD11 . LEU A 1 2  ? 86.474  -8.699  9.874   1.00 0.00 ? 11 LEU A HD11 1 
ATOM 34   H HD12 . LEU A 1 2  ? 87.865  -8.951  10.928  1.00 0.00 ? 11 LEU A HD12 1 
ATOM 35   H HD13 . LEU A 1 2  ? 87.167  -10.311 10.049  1.00 0.00 ? 11 LEU A HD13 1 
ATOM 36   H HD21 . LEU A 1 2  ? 88.782  -7.119  9.789   1.00 0.00 ? 11 LEU A HD21 1 
ATOM 37   H HD22 . LEU A 1 2  ? 89.631  -7.386  8.267   1.00 0.00 ? 11 LEU A HD22 1 
ATOM 38   H HD23 . LEU A 1 2  ? 90.132  -8.251  9.720   1.00 0.00 ? 11 LEU A HD23 1 
ATOM 39   N N    . ALA A 1 3  ? 90.328  -12.354 6.548   1.00 0.00 ? 12 ALA A N    1 
ATOM 40   C CA   . ALA A 1 3  ? 90.998  -13.629 6.326   1.00 0.00 ? 12 ALA A CA   1 
ATOM 41   C C    . ALA A 1 3  ? 92.178  -13.469 5.374   1.00 0.00 ? 12 ALA A C    1 
ATOM 42   O O    . ALA A 1 3  ? 93.229  -14.083 5.563   1.00 0.00 ? 12 ALA A O    1 
ATOM 43   C CB   . ALA A 1 3  ? 90.015  -14.655 5.784   1.00 0.00 ? 12 ALA A CB   1 
ATOM 44   H H    . ALA A 1 3  ? 89.407  -12.236 6.232   1.00 0.00 ? 12 ALA A H    1 
ATOM 45   H HA   . ALA A 1 3  ? 91.363  -13.984 7.279   1.00 0.00 ? 12 ALA A HA   1 
ATOM 46   H HB1  . ALA A 1 3  ? 89.633  -14.319 4.831   1.00 0.00 ? 12 ALA A HB1  1 
ATOM 47   H HB2  . ALA A 1 3  ? 89.197  -14.772 6.479   1.00 0.00 ? 12 ALA A HB2  1 
ATOM 48   H HB3  . ALA A 1 3  ? 90.517  -15.603 5.657   1.00 0.00 ? 12 ALA A HB3  1 
ATOM 49   N N    . LYS A 1 4  ? 91.998  -12.642 4.350   1.00 0.00 ? 13 LYS A N    1 
ATOM 50   C CA   . LYS A 1 4  ? 93.048  -12.401 3.368   1.00 0.00 ? 13 LYS A CA   1 
ATOM 51   C C    . LYS A 1 4  ? 93.662  -11.018 3.556   1.00 0.00 ? 13 LYS A C    1 
ATOM 52   O O    . LYS A 1 4  ? 92.973  -10.067 3.924   1.00 0.00 ? 13 LYS A O    1 
ATOM 53   C CB   . LYS A 1 4  ? 92.490  -12.536 1.950   1.00 0.00 ? 13 LYS A CB   1 
ATOM 54   C CG   . LYS A 1 4  ? 91.616  -13.764 1.756   1.00 0.00 ? 13 LYS A CG   1 
ATOM 55   C CD   . LYS A 1 4  ? 90.972  -13.778 0.378   1.00 0.00 ? 13 LYS A CD   1 
ATOM 56   C CE   . LYS A 1 4  ? 89.835  -14.784 0.304   1.00 0.00 ? 13 LYS A CE   1 
ATOM 57   N NZ   . LYS A 1 4  ? 89.845  -15.540 -0.980  1.00 0.00 ? 13 LYS A NZ   1 
ATOM 58   H H    . LYS A 1 4  ? 91.138  -12.182 4.253   1.00 0.00 ? 13 LYS A H    1 
ATOM 59   H HA   . LYS A 1 4  ? 93.817  -13.145 3.515   1.00 0.00 ? 13 LYS A HA   1 
ATOM 60   H HB2  . LYS A 1 4  ? 91.900  -11.661 1.723   1.00 0.00 ? 13 LYS A HB2  1 
ATOM 61   H HB3  . LYS A 1 4  ? 93.315  -12.594 1.255   1.00 0.00 ? 13 LYS A HB3  1 
ATOM 62   H HG2  . LYS A 1 4  ? 92.224  -14.649 1.866   1.00 0.00 ? 13 LYS A HG2  1 
ATOM 63   H HG3  . LYS A 1 4  ? 90.839  -13.763 2.506   1.00 0.00 ? 13 LYS A HG3  1 
ATOM 64   H HD2  . LYS A 1 4  ? 90.583  -12.794 0.163   1.00 0.00 ? 13 LYS A HD2  1 
ATOM 65   H HD3  . LYS A 1 4  ? 91.721  -14.039 -0.355  1.00 0.00 ? 13 LYS A HD3  1 
ATOM 66   H HE2  . LYS A 1 4  ? 89.934  -15.482 1.122   1.00 0.00 ? 13 LYS A HE2  1 
ATOM 67   H HE3  . LYS A 1 4  ? 88.898  -14.256 0.394   1.00 0.00 ? 13 LYS A HE3  1 
ATOM 68   H HZ1  . LYS A 1 4  ? 89.054  -16.214 -1.003  1.00 0.00 ? 13 LYS A HZ1  1 
ATOM 69   H HZ2  . LYS A 1 4  ? 90.737  -16.065 -1.079  1.00 0.00 ? 13 LYS A HZ2  1 
ATOM 70   H HZ3  . LYS A 1 4  ? 89.752  -14.884 -1.781  1.00 0.00 ? 13 LYS A HZ3  1 
ATOM 71   N N    . LEU A 1 5  ? 94.962  -10.913 3.300   1.00 0.00 ? 14 LEU A N    1 
ATOM 72   C CA   . LEU A 1 5  ? 95.669  -9.646  3.442   1.00 0.00 ? 14 LEU A CA   1 
ATOM 73   C C    . LEU A 1 5  ? 95.989  -9.045  2.077   1.00 0.00 ? 14 LEU A C    1 
ATOM 74   O O    . LEU A 1 5  ? 96.745  -9.622  1.295   1.00 0.00 ? 14 LEU A O    1 
ATOM 75   C CB   . LEU A 1 5  ? 96.959  -9.844  4.240   1.00 0.00 ? 14 LEU A CB   1 
ATOM 76   C CG   . LEU A 1 5  ? 96.760  -10.177 5.720   1.00 0.00 ? 14 LEU A CG   1 
ATOM 77   C CD1  . LEU A 1 5  ? 98.046  -10.722 6.322   1.00 0.00 ? 14 LEU A CD1  1 
ATOM 78   C CD2  . LEU A 1 5  ? 96.291  -8.947  6.483   1.00 0.00 ? 14 LEU A CD2  1 
ATOM 79   H H    . LEU A 1 5  ? 95.458  -11.707 3.010   1.00 0.00 ? 14 LEU A H    1 
ATOM 80   H HA   . LEU A 1 5  ? 95.025  -8.966  3.979   1.00 0.00 ? 14 LEU A HA   1 
ATOM 81   H HB2  . LEU A 1 5  ? 97.520  -10.647 3.784   1.00 0.00 ? 14 LEU A HB2  1 
ATOM 82   H HB3  . LEU A 1 5  ? 97.542  -8.938  4.173   1.00 0.00 ? 14 LEU A HB3  1 
ATOM 83   H HG   . LEU A 1 5  ? 96.000  -10.939 5.812   1.00 0.00 ? 14 LEU A HG   1 
ATOM 84   H HD11 . LEU A 1 5  ? 97.809  -11.498 7.034   1.00 0.00 ? 14 LEU A HD11 1 
ATOM 85   H HD12 . LEU A 1 5  ? 98.576  -9.925  6.821   1.00 0.00 ? 14 LEU A HD12 1 
ATOM 86   H HD13 . LEU A 1 5  ? 98.666  -11.130 5.538   1.00 0.00 ? 14 LEU A HD13 1 
ATOM 87   H HD21 . LEU A 1 5  ? 95.823  -9.254  7.407   1.00 0.00 ? 14 LEU A HD21 1 
ATOM 88   H HD22 . LEU A 1 5  ? 95.579  -8.401  5.883   1.00 0.00 ? 14 LEU A HD22 1 
ATOM 89   H HD23 . LEU A 1 5  ? 97.139  -8.314  6.702   1.00 0.00 ? 14 LEU A HD23 1 
ATOM 90   N N    . CYS A 1 6  ? 95.408  -7.883  1.797   1.00 0.00 ? 15 CYS A N    1 
ATOM 91   C CA   . CYS A 1 6  ? 95.630  -7.204  0.526   1.00 0.00 ? 15 CYS A CA   1 
ATOM 92   C C    . CYS A 1 6  ? 96.869  -6.316  0.595   1.00 0.00 ? 15 CYS A C    1 
ATOM 93   O O    . CYS A 1 6  ? 96.845  -5.247  1.205   1.00 0.00 ? 15 CYS A O    1 
ATOM 94   C CB   . CYS A 1 6  ? 94.407  -6.365  0.151   1.00 0.00 ? 15 CYS A CB   1 
ATOM 95   S SG   . CYS A 1 6  ? 94.047  -6.336  -1.621  1.00 0.00 ? 15 CYS A SG   1 
ATOM 96   H H    . CYS A 1 6  ? 94.815  -7.473  2.461   1.00 0.00 ? 15 CYS A H    1 
ATOM 97   H HA   . CYS A 1 6  ? 95.784  -7.958  -0.231  1.00 0.00 ? 15 CYS A HA   1 
ATOM 98   H HB2  . CYS A 1 6  ? 93.539  -6.763  0.655   1.00 0.00 ? 15 CYS A HB2  1 
ATOM 99   H HB3  . CYS A 1 6  ? 94.566  -5.346  0.472   1.00 0.00 ? 15 CYS A HB3  1 
ATOM 100  H HG   . CYS A 1 6  ? 94.077  -5.422  -1.914  1.00 0.00 ? 15 CYS A HG   1 
ATOM 101  N N    . LYS A 1 7  ? 97.949  -6.767  -0.034  1.00 0.00 ? 16 LYS A N    1 
ATOM 102  C CA   . LYS A 1 7  ? 99.198  -6.013  -0.043  1.00 0.00 ? 16 LYS A CA   1 
ATOM 103  C C    . LYS A 1 7  ? 99.210  -4.990  -1.173  1.00 0.00 ? 16 LYS A C    1 
ATOM 104  O O    . LYS A 1 7  ? 99.329  -5.345  -2.346  1.00 0.00 ? 16 LYS A O    1 
ATOM 105  C CB   . LYS A 1 7  ? 100.390 -6.961  -0.188  1.00 0.00 ? 16 LYS A CB   1 
ATOM 106  C CG   . LYS A 1 7  ? 100.506 -7.969  0.944   1.00 0.00 ? 16 LYS A CG   1 
ATOM 107  C CD   . LYS A 1 7  ? 101.958 -8.231  1.311   1.00 0.00 ? 16 LYS A CD   1 
ATOM 108  C CE   . LYS A 1 7  ? 102.144 -8.322  2.817   1.00 0.00 ? 16 LYS A CE   1 
ATOM 109  N NZ   . LYS A 1 7  ? 103.556 -8.621  3.185   1.00 0.00 ? 16 LYS A NZ   1 
ATOM 110  H H    . LYS A 1 7  ? 97.906  -7.626  -0.503  1.00 0.00 ? 16 LYS A H    1 
ATOM 111  H HA   . LYS A 1 7  ? 99.277  -5.492  0.899   1.00 0.00 ? 16 LYS A HA   1 
ATOM 112  H HB2  . LYS A 1 7  ? 100.293 -7.504  -1.116  1.00 0.00 ? 16 LYS A HB2  1 
ATOM 113  H HB3  . LYS A 1 7  ? 101.298 -6.377  -0.216  1.00 0.00 ? 16 LYS A HB3  1 
ATOM 114  H HG2  . LYS A 1 7  ? 99.990  -7.584  1.810   1.00 0.00 ? 16 LYS A HG2  1 
ATOM 115  H HG3  . LYS A 1 7  ? 100.049 -8.898  0.633   1.00 0.00 ? 16 LYS A HG3  1 
ATOM 116  H HD2  . LYS A 1 7  ? 102.270 -9.163  0.863   1.00 0.00 ? 16 LYS A HD2  1 
ATOM 117  H HD3  . LYS A 1 7  ? 102.567 -7.424  0.930   1.00 0.00 ? 16 LYS A HD3  1 
ATOM 118  H HE2  . LYS A 1 7  ? 101.859 -7.380  3.260   1.00 0.00 ? 16 LYS A HE2  1 
ATOM 119  H HE3  . LYS A 1 7  ? 101.507 -9.107  3.199   1.00 0.00 ? 16 LYS A HE3  1 
ATOM 120  H HZ1  . LYS A 1 7  ? 103.585 -9.211  4.042   1.00 0.00 ? 16 LYS A HZ1  1 
ATOM 121  H HZ2  . LYS A 1 7  ? 104.073 -7.738  3.368   1.00 0.00 ? 16 LYS A HZ2  1 
ATOM 122  H HZ3  . LYS A 1 7  ? 104.027 -9.131  2.410   1.00 0.00 ? 16 LYS A HZ3  1 
ATOM 123  N N    . THR A 1 8  ? 99.087  -3.717  -0.812  1.00 0.00 ? 17 THR A N    1 
ATOM 124  C CA   . THR A 1 8  ? 99.085  -2.640  -1.795  1.00 0.00 ? 17 THR A CA   1 
ATOM 125  C C    . THR A 1 8  ? 100.243 -1.679  -1.548  1.00 0.00 ? 17 THR A C    1 
ATOM 126  O O    . THR A 1 8  ? 100.405 -1.157  -0.444  1.00 0.00 ? 17 THR A O    1 
ATOM 127  C CB   . THR A 1 8  ? 97.758  -1.880  -1.748  1.00 0.00 ? 17 THR A CB   1 
ATOM 128  O OG1  . THR A 1 8  ? 97.715  -0.885  -2.755  1.00 0.00 ? 17 THR A OG1  1 
ATOM 129  C CG2  . THR A 1 8  ? 97.504  -1.201  -0.420  1.00 0.00 ? 17 THR A CG2  1 
ATOM 130  H H    . THR A 1 8  ? 98.996  -3.496  0.139   1.00 0.00 ? 17 THR A H    1 
ATOM 131  H HA   . THR A 1 8  ? 99.202  -3.082  -2.773  1.00 0.00 ? 17 THR A HA   1 
ATOM 132  H HB   . THR A 1 8  ? 96.950  -2.576  -1.924  1.00 0.00 ? 17 THR A HB   1 
ATOM 133  H HG1  . THR A 1 8  ? 96.818  -0.801  -3.085  1.00 0.00 ? 17 THR A HG1  1 
ATOM 134  H HG21 . THR A 1 8  ? 97.924  -1.798  0.376   1.00 0.00 ? 17 THR A HG21 1 
ATOM 135  H HG22 . THR A 1 8  ? 96.440  -1.094  -0.267  1.00 0.00 ? 17 THR A HG22 1 
ATOM 136  H HG23 . THR A 1 8  ? 97.967  -0.225  -0.420  1.00 0.00 ? 17 THR A HG23 1 
ATOM 137  N N    . ILE A 1 9  ? 101.049 -1.454  -2.580  1.00 0.00 ? 18 ILE A N    1 
ATOM 138  C CA   . ILE A 1 9  ? 102.194 -0.566  -2.478  1.00 0.00 ? 18 ILE A CA   1 
ATOM 139  C C    . ILE A 1 9  ? 101.805 0.871   -2.815  1.00 0.00 ? 18 ILE A C    1 
ATOM 140  O O    . ILE A 1 9  ? 100.980 1.113   -3.696  1.00 0.00 ? 18 ILE A O    1 
ATOM 141  C CB   . ILE A 1 9  ? 103.323 -1.035  -3.421  1.00 0.00 ? 18 ILE A CB   1 
ATOM 142  C CG1  . ILE A 1 9  ? 104.076 -2.226  -2.810  1.00 0.00 ? 18 ILE A CG1  1 
ATOM 143  C CG2  . ILE A 1 9  ? 104.285 0.105   -3.737  1.00 0.00 ? 18 ILE A CG2  1 
ATOM 144  C CD1  . ILE A 1 9  ? 103.206 -3.163  -1.995  1.00 0.00 ? 18 ILE A CD1  1 
ATOM 145  H H    . ILE A 1 9  ? 100.876 -1.905  -3.432  1.00 0.00 ? 18 ILE A H    1 
ATOM 146  H HA   . ILE A 1 9  ? 102.560 -0.603  -1.462  1.00 0.00 ? 18 ILE A HA   1 
ATOM 147  H HB   . ILE A 1 9  ? 102.870 -1.351  -4.349  1.00 0.00 ? 18 ILE A HB   1 
ATOM 148  H HG12 . ILE A 1 9  ? 104.516 -2.804  -3.604  1.00 0.00 ? 18 ILE A HG12 1 
ATOM 149  H HG13 . ILE A 1 9  ? 104.858 -1.855  -2.165  1.00 0.00 ? 18 ILE A HG13 1 
ATOM 150  H HG21 . ILE A 1 9  ? 105.162 -0.287  -4.228  1.00 0.00 ? 18 ILE A HG21 1 
ATOM 151  H HG22 . ILE A 1 9  ? 104.575 0.597   -2.822  1.00 0.00 ? 18 ILE A HG22 1 
ATOM 152  H HG23 . ILE A 1 9  ? 103.797 0.816   -4.388  1.00 0.00 ? 18 ILE A HG23 1 
ATOM 153  H HD11 . ILE A 1 9  ? 103.782 -4.031  -1.710  1.00 0.00 ? 18 ILE A HD11 1 
ATOM 154  H HD12 . ILE A 1 9  ? 102.358 -3.473  -2.587  1.00 0.00 ? 18 ILE A HD12 1 
ATOM 155  H HD13 . ILE A 1 9  ? 102.860 -2.654  -1.108  1.00 0.00 ? 18 ILE A HD13 1 
ATOM 156  N N    . TYR A 1 10 ? 102.412 1.820   -2.109  1.00 0.00 ? 19 TYR A N    1 
ATOM 157  C CA   . TYR A 1 10 ? 102.138 3.231   -2.334  1.00 0.00 ? 19 TYR A CA   1 
ATOM 158  C C    . TYR A 1 10 ? 103.093 3.764   -3.408  1.00 0.00 ? 19 TYR A C    1 
ATOM 159  O O    . TYR A 1 10 ? 104.253 3.356   -3.469  1.00 0.00 ? 19 TYR A O    1 
ATOM 160  C CB   . TYR A 1 10 ? 102.269 4.018   -1.012  1.00 0.00 ? 19 TYR A CB   1 
ATOM 161  C CG   . TYR A 1 10 ? 101.254 3.611   0.059   1.00 0.00 ? 19 TYR A CG   1 
ATOM 162  C CD1  . TYR A 1 10 ? 100.539 2.418   -0.049  1.00 0.00 ? 19 TYR A CD1  1 
ATOM 163  C CD2  . TYR A 1 10 ? 101.004 4.415   1.179   1.00 0.00 ? 19 TYR A CD2  1 
ATOM 164  C CE1  . TYR A 1 10 ? 99.618  2.042   0.908   1.00 0.00 ? 19 TYR A CE1  1 
ATOM 165  C CE2  . TYR A 1 10 ? 100.080 4.036   2.137   1.00 0.00 ? 19 TYR A CE2  1 
ATOM 166  C CZ   . TYR A 1 10 ? 99.392  2.851   1.995   1.00 0.00 ? 19 TYR A CZ   1 
ATOM 167  O OH   . TYR A 1 10 ? 98.469  2.475   2.944   1.00 0.00 ? 19 TYR A OH   1 
ATOM 168  H H    . TYR A 1 10 ? 103.063 1.563   -1.424  1.00 0.00 ? 19 TYR A H    1 
ATOM 169  H HA   . TYR A 1 10 ? 101.124 3.315   -2.698  1.00 0.00 ? 19 TYR A HA   1 
ATOM 170  H HB2  . TYR A 1 10 ? 103.258 3.860   -0.605  1.00 0.00 ? 19 TYR A HB2  1 
ATOM 171  H HB3  . TYR A 1 10 ? 102.130 5.072   -1.216  1.00 0.00 ? 19 TYR A HB3  1 
ATOM 172  H HD1  . TYR A 1 10 ? 100.711 1.778   -0.895  1.00 0.00 ? 19 TYR A HD1  1 
ATOM 173  H HD2  . TYR A 1 10 ? 101.539 5.348   1.301   1.00 0.00 ? 19 TYR A HD2  1 
ATOM 174  H HE1  . TYR A 1 10 ? 99.078  1.113   0.798   1.00 0.00 ? 19 TYR A HE1  1 
ATOM 175  H HE2  . TYR A 1 10 ? 99.902  4.668   2.994   1.00 0.00 ? 19 TYR A HE2  1 
ATOM 176  H HH   . TYR A 1 10 ? 97.583  2.625   2.607   1.00 0.00 ? 19 TYR A HH   1 
ATOM 177  N N    . PRO A 1 11 ? 102.614 4.660   -4.291  1.00 0.00 ? 20 PRO A N    1 
ATOM 178  C CA   . PRO A 1 11 ? 103.424 5.220   -5.385  1.00 0.00 ? 20 PRO A CA   1 
ATOM 179  C C    . PRO A 1 11 ? 104.740 5.820   -4.907  1.00 0.00 ? 20 PRO A C    1 
ATOM 180  O O    . PRO A 1 11 ? 104.758 6.847   -4.231  1.00 0.00 ? 20 PRO A O    1 
ATOM 181  C CB   . PRO A 1 11 ? 102.523 6.308   -5.988  1.00 0.00 ? 20 PRO A CB   1 
ATOM 182  C CG   . PRO A 1 11 ? 101.446 6.520   -4.981  1.00 0.00 ? 20 PRO A CG   1 
ATOM 183  C CD   . PRO A 1 11 ? 101.248 5.191   -4.315  1.00 0.00 ? 20 PRO A CD   1 
ATOM 184  H HA   . PRO A 1 11 ? 103.631 4.472   -6.137  1.00 0.00 ? 20 PRO A HA   1 
ATOM 185  H HB2  . PRO A 1 11 ? 103.099 7.211   -6.145  1.00 0.00 ? 20 PRO A HB2  1 
ATOM 186  H HB3  . PRO A 1 11 ? 102.118 5.963   -6.930  1.00 0.00 ? 20 PRO A HB3  1 
ATOM 187  H HG2  . PRO A 1 11 ? 101.767 7.254   -4.260  1.00 0.00 ? 20 PRO A HG2  1 
ATOM 188  H HG3  . PRO A 1 11 ? 100.537 6.838   -5.469  1.00 0.00 ? 20 PRO A HG3  1 
ATOM 189  H HD2  . PRO A 1 11 ? 100.860 5.319   -3.314  1.00 0.00 ? 20 PRO A HD2  1 
ATOM 190  H HD3  . PRO A 1 11 ? 100.597 4.560   -4.904  1.00 0.00 ? 20 PRO A HD3  1 
ATOM 191  N N    . LEU A 1 12 ? 105.841 5.163   -5.268  1.00 0.00 ? 21 LEU A N    1 
ATOM 192  C CA   . LEU A 1 12 ? 107.181 5.607   -4.884  1.00 0.00 ? 21 LEU A CA   1 
ATOM 193  C C    . LEU A 1 12 ? 107.340 7.125   -4.942  1.00 0.00 ? 21 LEU A C    1 
ATOM 194  O O    . LEU A 1 12 ? 107.890 7.724   -4.026  1.00 0.00 ? 21 LEU A O    1 
ATOM 195  C CB   . LEU A 1 12 ? 108.232 4.960   -5.785  1.00 0.00 ? 21 LEU A CB   1 
ATOM 196  C CG   . LEU A 1 12 ? 107.889 4.944   -7.276  1.00 0.00 ? 21 LEU A CG   1 
ATOM 197  C CD1  . LEU A 1 12 ? 108.553 6.113   -7.989  1.00 0.00 ? 21 LEU A CD1  1 
ATOM 198  C CD2  . LEU A 1 12 ? 108.310 3.625   -7.907  1.00 0.00 ? 21 LEU A CD2  1 
ATOM 199  H H    . LEU A 1 12 ? 105.751 4.348   -5.807  1.00 0.00 ? 21 LEU A H    1 
ATOM 200  H HA   . LEU A 1 12 ? 107.353 5.282   -3.869  1.00 0.00 ? 21 LEU A HA   1 
ATOM 201  H HB2  . LEU A 1 12 ? 109.160 5.503   -5.656  1.00 0.00 ? 21 LEU A HB2  1 
ATOM 202  H HB3  . LEU A 1 12 ? 108.379 3.941   -5.459  1.00 0.00 ? 21 LEU A HB3  1 
ATOM 203  H HG   . LEU A 1 12 ? 106.820 5.046   -7.394  1.00 0.00 ? 21 LEU A HG   1 
ATOM 204  H HD11 . LEU A 1 12 ? 109.410 6.441   -7.419  1.00 0.00 ? 21 LEU A HD11 1 
ATOM 205  H HD12 . LEU A 1 12 ? 107.849 6.926   -8.080  1.00 0.00 ? 21 LEU A HD12 1 
ATOM 206  H HD13 . LEU A 1 12 ? 108.872 5.801   -8.972  1.00 0.00 ? 21 LEU A HD13 1 
ATOM 207  H HD21 . LEU A 1 12 ? 109.339 3.416   -7.653  1.00 0.00 ? 21 LEU A HD21 1 
ATOM 208  H HD22 . LEU A 1 12 ? 108.211 3.692   -8.981  1.00 0.00 ? 21 LEU A HD22 1 
ATOM 209  H HD23 . LEU A 1 12 ? 107.680 2.831   -7.537  1.00 0.00 ? 21 LEU A HD23 1 
ATOM 210  N N    . ALA A 1 13 ? 106.870 7.743   -6.019  1.00 0.00 ? 22 ALA A N    1 
ATOM 211  C CA   . ALA A 1 13 ? 106.990 9.193   -6.172  1.00 0.00 ? 22 ALA A CA   1 
ATOM 212  C C    . ALA A 1 13 ? 106.245 9.920   -5.063  1.00 0.00 ? 22 ALA A C    1 
ATOM 213  O O    . ALA A 1 13 ? 106.823 10.706  -4.312  1.00 0.00 ? 22 ALA A O    1 
ATOM 214  C CB   . ALA A 1 13 ? 106.468 9.626   -7.534  1.00 0.00 ? 22 ALA A CB   1 
ATOM 215  H H    . ALA A 1 13 ? 106.437 7.219   -6.724  1.00 0.00 ? 22 ALA A H    1 
ATOM 216  H HA   . ALA A 1 13 ? 108.039 9.448   -6.117  1.00 0.00 ? 22 ALA A HA   1 
ATOM 217  H HB1  . ALA A 1 13 ? 106.032 10.611  -7.455  1.00 0.00 ? 22 ALA A HB1  1 
ATOM 218  H HB2  . ALA A 1 13 ? 105.718 8.927   -7.871  1.00 0.00 ? 22 ALA A HB2  1 
ATOM 219  H HB3  . ALA A 1 13 ? 107.284 9.650   -8.241  1.00 0.00 ? 22 ALA A HB3  1 
ATOM 220  N N    . ASP A 1 14 ? 104.956 9.641   -4.976  1.00 0.00 ? 23 ASP A N    1 
ATOM 221  C CA   . ASP A 1 14 ? 104.083 10.238  -3.978  1.00 0.00 ? 23 ASP A CA   1 
ATOM 222  C C    . ASP A 1 14 ? 104.667 10.162  -2.567  1.00 0.00 ? 23 ASP A C    1 
ATOM 223  O O    . ASP A 1 14 ? 104.259 10.912  -1.686  1.00 0.00 ? 23 ASP A O    1 
ATOM 224  C CB   . ASP A 1 14 ? 102.749 9.507   -4.000  1.00 0.00 ? 23 ASP A CB   1 
ATOM 225  C CG   . ASP A 1 14 ? 101.606 10.380  -4.477  1.00 0.00 ? 23 ASP A CG   1 
ATOM 226  O OD1  . ASP A 1 14 ? 101.864 11.333  -5.242  1.00 0.00 ? 23 ASP A OD1  1 
ATOM 227  O OD2  . ASP A 1 14 ? 100.450 10.107  -4.089  1.00 0.00 ? 23 ASP A OD2  1 
ATOM 228  H H    . ASP A 1 14 ? 104.571 9.007   -5.613  1.00 0.00 ? 23 ASP A H    1 
ATOM 229  H HA   . ASP A 1 14 ? 103.922 11.270  -4.244  1.00 0.00 ? 23 ASP A HA   1 
ATOM 230  H HB2  . ASP A 1 14 ? 102.835 8.662   -4.667  1.00 0.00 ? 23 ASP A HB2  1 
ATOM 231  H HB3  . ASP A 1 14 ? 102.526 9.155   -3.002  1.00 0.00 ? 23 ASP A HB3  1 
ATOM 232  N N    . LEU A 1 15 ? 105.593 9.239   -2.345  1.00 0.00 ? 24 LEU A N    1 
ATOM 233  C CA   . LEU A 1 15 ? 106.189 9.070   -1.019  1.00 0.00 ? 24 LEU A CA   1 
ATOM 234  C C    . LEU A 1 15 ? 107.677 9.378   -1.019  1.00 0.00 ? 24 LEU A C    1 
ATOM 235  O O    . LEU A 1 15 ? 108.246 9.729   0.015   1.00 0.00 ? 24 LEU A O    1 
ATOM 236  C CB   . LEU A 1 15 ? 105.955 7.648   -0.510  1.00 0.00 ? 24 LEU A CB   1 
ATOM 237  C CG   . LEU A 1 15 ? 105.934 6.558   -1.587  1.00 0.00 ? 24 LEU A CG   1 
ATOM 238  C CD1  . LEU A 1 15 ? 107.027 5.537   -1.343  1.00 0.00 ? 24 LEU A CD1  1 
ATOM 239  C CD2  . LEU A 1 15 ? 104.573 5.887   -1.625  1.00 0.00 ? 24 LEU A CD2  1 
ATOM 240  H H    . LEU A 1 15 ? 105.871 8.652   -3.076  1.00 0.00 ? 24 LEU A H    1 
ATOM 241  H HA   . LEU A 1 15 ? 105.702 9.761   -0.352  1.00 0.00 ? 24 LEU A HA   1 
ATOM 242  H HB2  . LEU A 1 15 ? 106.736 7.412   0.199   1.00 0.00 ? 24 LEU A HB2  1 
ATOM 243  H HB3  . LEU A 1 15 ? 105.008 7.629   0.009   1.00 0.00 ? 24 LEU A HB3  1 
ATOM 244  H HG   . LEU A 1 15 ? 106.115 7.001   -2.549  1.00 0.00 ? 24 LEU A HG   1 
ATOM 245  H HD11 . LEU A 1 15 ? 107.863 5.741   -1.996  1.00 0.00 ? 24 LEU A HD11 1 
ATOM 246  H HD12 . LEU A 1 15 ? 106.647 4.546   -1.543  1.00 0.00 ? 24 LEU A HD12 1 
ATOM 247  H HD13 . LEU A 1 15 ? 107.349 5.599   -0.318  1.00 0.00 ? 24 LEU A HD13 1 
ATOM 248  H HD21 . LEU A 1 15 ? 104.690 4.853   -1.909  1.00 0.00 ? 24 LEU A HD21 1 
ATOM 249  H HD22 . LEU A 1 15 ? 103.943 6.391   -2.341  1.00 0.00 ? 24 LEU A HD22 1 
ATOM 250  H HD23 . LEU A 1 15 ? 104.120 5.943   -0.648  1.00 0.00 ? 24 LEU A HD23 1 
ATOM 251  N N    . LEU A 1 16 ? 108.305 9.242   -2.171  1.00 0.00 ? 25 LEU A N    1 
ATOM 252  C CA   . LEU A 1 16 ? 109.732 9.506   -2.284  1.00 0.00 ? 25 LEU A CA   1 
ATOM 253  C C    . LEU A 1 16 ? 110.046 10.980  -2.023  1.00 0.00 ? 25 LEU A C    1 
ATOM 254  O O    . LEU A 1 16 ? 111.208 11.353  -1.860  1.00 0.00 ? 25 LEU A O    1 
ATOM 255  C CB   . LEU A 1 16 ? 110.243 9.080   -3.661  1.00 0.00 ? 25 LEU A CB   1 
ATOM 256  C CG   . LEU A 1 16 ? 111.763 9.094   -3.815  1.00 0.00 ? 25 LEU A CG   1 
ATOM 257  C CD1  . LEU A 1 16 ? 112.403 8.243   -2.730  1.00 0.00 ? 25 LEU A CD1  1 
ATOM 258  C CD2  . LEU A 1 16 ? 112.165 8.599   -5.197  1.00 0.00 ? 25 LEU A CD2  1 
ATOM 259  H H    . LEU A 1 16 ? 107.800 8.955   -2.964  1.00 0.00 ? 25 LEU A H    1 
ATOM 260  H HA   . LEU A 1 16 ? 110.230 8.913   -1.531  1.00 0.00 ? 25 LEU A HA   1 
ATOM 261  H HB2  . LEU A 1 16 ? 109.897 8.072   -3.849  1.00 0.00 ? 25 LEU A HB2  1 
ATOM 262  H HB3  . LEU A 1 16 ? 109.818 9.737   -4.404  1.00 0.00 ? 25 LEU A HB3  1 
ATOM 263  H HG   . LEU A 1 16 ? 112.122 10.107  -3.701  1.00 0.00 ? 25 LEU A HG   1 
ATOM 264  H HD11 . LEU A 1 16 ? 112.961 8.877   -2.058  1.00 0.00 ? 25 LEU A HD11 1 
ATOM 265  H HD12 . LEU A 1 16 ? 113.068 7.522   -3.181  1.00 0.00 ? 25 LEU A HD12 1 
ATOM 266  H HD13 . LEU A 1 16 ? 111.630 7.726   -2.179  1.00 0.00 ? 25 LEU A HD13 1 
ATOM 267  H HD21 . LEU A 1 16 ? 113.241 8.623   -5.289  1.00 0.00 ? 25 LEU A HD21 1 
ATOM 268  H HD22 . LEU A 1 16 ? 111.725 9.236   -5.950  1.00 0.00 ? 25 LEU A HD22 1 
ATOM 269  H HD23 . LEU A 1 16 ? 111.815 7.586   -5.333  1.00 0.00 ? 25 LEU A HD23 1 
ATOM 270  N N    . ALA A 1 17 ? 109.003 11.812  -1.976  1.00 0.00 ? 26 ALA A N    1 
ATOM 271  C CA   . ALA A 1 17 ? 109.164 13.247  -1.724  1.00 0.00 ? 26 ALA A CA   1 
ATOM 272  C C    . ALA A 1 17 ? 107.870 14.002  -2.021  1.00 0.00 ? 26 ALA A C    1 
ATOM 273  O O    . ALA A 1 17 ? 107.884 15.055  -2.659  1.00 0.00 ? 26 ALA A O    1 
ATOM 274  C CB   . ALA A 1 17 ? 110.307 13.815  -2.557  1.00 0.00 ? 26 ALA A CB   1 
ATOM 275  H H    . ALA A 1 17 ? 108.101 11.452  -2.108  1.00 0.00 ? 26 ALA A H    1 
ATOM 276  H HA   . ALA A 1 17 ? 109.412 13.376  -0.680  1.00 0.00 ? 26 ALA A HA   1 
ATOM 277  H HB1  . ALA A 1 17 ? 110.139 14.868  -2.729  1.00 0.00 ? 26 ALA A HB1  1 
ATOM 278  H HB2  . ALA A 1 17 ? 110.353 13.298  -3.505  1.00 0.00 ? 26 ALA A HB2  1 
ATOM 279  H HB3  . ALA A 1 17 ? 111.239 13.681  -2.028  1.00 0.00 ? 26 ALA A HB3  1 
ATOM 280  N N    . ARG A 1 18 ? 106.751 13.445  -1.568  1.00 0.00 ? 27 ARG A N    1 
ATOM 281  C CA   . ARG A 1 18 ? 105.442 14.050  -1.796  1.00 0.00 ? 27 ARG A CA   1 
ATOM 282  C C    . ARG A 1 18 ? 104.475 13.690  -0.669  1.00 0.00 ? 27 ARG A C    1 
ATOM 283  O O    . ARG A 1 18 ? 104.535 12.584  -0.143  1.00 0.00 ? 27 ARG A O    1 
ATOM 284  C CB   . ARG A 1 18 ? 104.896 13.552  -3.141  1.00 0.00 ? 27 ARG A CB   1 
ATOM 285  C CG   . ARG A 1 18 ? 103.471 13.983  -3.454  1.00 0.00 ? 27 ARG A CG   1 
ATOM 286  C CD   . ARG A 1 18 ? 102.434 13.063  -2.827  1.00 0.00 ? 27 ARG A CD   1 
ATOM 287  N NE   . ARG A 1 18 ? 101.159 13.127  -3.541  1.00 0.00 ? 27 ARG A NE   1 
ATOM 288  C CZ   . ARG A 1 18 ? 100.025 12.592  -3.096  1.00 0.00 ? 27 ARG A CZ   1 
ATOM 289  N NH1  . ARG A 1 18 ? 99.996  11.946  -1.938  1.00 0.00 ? 27 ARG A NH1  1 
ATOM 290  N NH2  . ARG A 1 18 ? 98.915  12.702  -3.813  1.00 0.00 ? 27 ARG A NH2  1 
ATOM 291  H H    . ARG A 1 18 ? 106.805 12.599  -1.076  1.00 0.00 ? 27 ARG A H    1 
ATOM 292  H HA   . ARG A 1 18 ? 105.564 15.122  -1.834  1.00 0.00 ? 27 ARG A HA   1 
ATOM 293  H HB2  . ARG A 1 18 ? 105.535 13.922  -3.928  1.00 0.00 ? 27 ARG A HB2  1 
ATOM 294  H HB3  . ARG A 1 18 ? 104.931 12.476  -3.146  1.00 0.00 ? 27 ARG A HB3  1 
ATOM 295  H HG2  . ARG A 1 18 ? 103.316 14.978  -3.082  1.00 0.00 ? 27 ARG A HG2  1 
ATOM 296  H HG3  . ARG A 1 18 ? 103.338 13.971  -4.528  1.00 0.00 ? 27 ARG A HG3  1 
ATOM 297  H HD2  . ARG A 1 18 ? 102.803 12.048  -2.857  1.00 0.00 ? 27 ARG A HD2  1 
ATOM 298  H HD3  . ARG A 1 18 ? 102.277 13.363  -1.799  1.00 0.00 ? 27 ARG A HD3  1 
ATOM 299  H HE   . ARG A 1 18 ? 101.149 13.596  -4.402  1.00 0.00 ? 27 ARG A HE   1 
ATOM 300  H HH11 . ARG A 1 18 ? 100.829 11.857  -1.393  1.00 0.00 ? 27 ARG A HH11 1 
ATOM 301  H HH12 . ARG A 1 18 ? 99.139  11.547  -1.610  1.00 0.00 ? 27 ARG A HH12 1 
ATOM 302  H HH21 . ARG A 1 18 ? 98.930  13.186  -4.688  1.00 0.00 ? 27 ARG A HH21 1 
ATOM 303  H HH22 . ARG A 1 18 ? 98.062  12.300  -3.479  1.00 0.00 ? 27 ARG A HH22 1 
ATOM 304  N N    . PRO A 1 19 ? 103.565 14.614  -0.287  1.00 0.00 ? 28 PRO A N    1 
ATOM 305  C CA   . PRO A 1 19 ? 102.571 14.377  0.767   1.00 0.00 ? 28 PRO A CA   1 
ATOM 306  C C    . PRO A 1 19 ? 101.979 12.966  0.699   1.00 0.00 ? 28 PRO A C    1 
ATOM 307  O O    . PRO A 1 19 ? 100.837 12.767  0.288   1.00 0.00 ? 28 PRO A O    1 
ATOM 308  C CB   . PRO A 1 19 ? 101.487 15.437  0.490   1.00 0.00 ? 28 PRO A CB   1 
ATOM 309  C CG   . PRO A 1 19 ? 101.936 16.180  -0.733  1.00 0.00 ? 28 PRO A CG   1 
ATOM 310  C CD   . PRO A 1 19 ? 103.416 15.959  -0.843  1.00 0.00 ? 28 PRO A CD   1 
ATOM 311  H HA   . PRO A 1 19 ? 102.993 14.539  1.748   1.00 0.00 ? 28 PRO A HA   1 
ATOM 312  H HB2  . PRO A 1 19 ? 100.537 14.946  0.321   1.00 0.00 ? 28 PRO A HB2  1 
ATOM 313  H HB3  . PRO A 1 19 ? 101.409 16.100  1.344   1.00 0.00 ? 28 PRO A HB3  1 
ATOM 314  H HG2  . PRO A 1 19 ? 101.433 15.788  -1.604  1.00 0.00 ? 28 PRO A HG2  1 
ATOM 315  H HG3  . PRO A 1 19 ? 101.723 17.233  -0.620  1.00 0.00 ? 28 PRO A HG3  1 
ATOM 316  H HD2  . PRO A 1 19 ? 103.735 15.997  -1.873  1.00 0.00 ? 28 PRO A HD2  1 
ATOM 317  H HD3  . PRO A 1 19 ? 103.953 16.684  -0.249  1.00 0.00 ? 28 PRO A HD3  1 
ATOM 318  N N    . LEU A 1 20 ? 102.793 12.000  1.101   1.00 0.00 ? 29 LEU A N    1 
ATOM 319  C CA   . LEU A 1 20 ? 102.419 10.588  1.097   1.00 0.00 ? 29 LEU A CA   1 
ATOM 320  C C    . LEU A 1 20 ? 101.387 10.256  2.170   1.00 0.00 ? 29 LEU A C    1 
ATOM 321  O O    . LEU A 1 20 ? 101.216 10.992  3.142   1.00 0.00 ? 29 LEU A O    1 
ATOM 322  C CB   . LEU A 1 20 ? 103.660 9.724   1.313   1.00 0.00 ? 29 LEU A CB   1 
ATOM 323  C CG   . LEU A 1 20 ? 104.523 10.122  2.516   1.00 0.00 ? 29 LEU A CG   1 
ATOM 324  C CD1  . LEU A 1 20 ? 103.835 9.735   3.815   1.00 0.00 ? 29 LEU A CD1  1 
ATOM 325  C CD2  . LEU A 1 20 ? 105.900 9.480   2.425   1.00 0.00 ? 29 LEU A CD2  1 
ATOM 326  H H    . LEU A 1 20 ? 103.691 12.247  1.400   1.00 0.00 ? 29 LEU A H    1 
ATOM 327  H HA   . LEU A 1 20 ? 102.002 10.360  0.129   1.00 0.00 ? 29 LEU A HA   1 
ATOM 328  H HB2  . LEU A 1 20 ? 103.339 8.698   1.448   1.00 0.00 ? 29 LEU A HB2  1 
ATOM 329  H HB3  . LEU A 1 20 ? 104.269 9.783   0.425   1.00 0.00 ? 29 LEU A HB3  1 
ATOM 330  H HG   . LEU A 1 20 ? 104.654 11.193  2.518   1.00 0.00 ? 29 LEU A HG   1 
ATOM 331  H HD11 . LEU A 1 20 ? 104.578 9.446   4.544   1.00 0.00 ? 29 LEU A HD11 1 
ATOM 332  H HD12 . LEU A 1 20 ? 103.166 8.907   3.635   1.00 0.00 ? 29 LEU A HD12 1 
ATOM 333  H HD13 . LEU A 1 20 ? 103.272 10.577  4.190   1.00 0.00 ? 29 LEU A HD13 1 
ATOM 334  H HD21 . LEU A 1 20 ? 106.177 9.082   3.390   1.00 0.00 ? 29 LEU A HD21 1 
ATOM 335  H HD22 . LEU A 1 20 ? 106.623 10.223  2.121   1.00 0.00 ? 29 LEU A HD22 1 
ATOM 336  H HD23 . LEU A 1 20 ? 105.879 8.683   1.699   1.00 0.00 ? 29 LEU A HD23 1 
ATOM 337  N N    . PRO A 1 21 ? 100.679 9.123   1.987   1.00 0.00 ? 30 PRO A N    1 
ATOM 338  C CA   . PRO A 1 21 ? 99.650  8.661   2.913   1.00 0.00 ? 30 PRO A CA   1 
ATOM 339  C C    . PRO A 1 21 ? 100.194 8.357   4.295   1.00 0.00 ? 30 PRO A C    1 
ATOM 340  O O    . PRO A 1 21 ? 101.222 8.887   4.714   1.00 0.00 ? 30 PRO A O    1 
ATOM 341  C CB   . PRO A 1 21 ? 99.120  7.373   2.268   1.00 0.00 ? 30 PRO A CB   1 
ATOM 342  C CG   . PRO A 1 21 ? 99.542  7.443   0.849   1.00 0.00 ? 30 PRO A CG   1 
ATOM 343  C CD   . PRO A 1 21 ? 100.828 8.205   0.849   1.00 0.00 ? 30 PRO A CD   1 
ATOM 344  H HA   . PRO A 1 21 ? 98.851  9.369   2.998   1.00 0.00 ? 30 PRO A HA   1 
ATOM 345  H HB2  . PRO A 1 21 ? 99.554  6.517   2.765   1.00 0.00 ? 30 PRO A HB2  1 
ATOM 346  H HB3  . PRO A 1 21 ? 98.045  7.341   2.359   1.00 0.00 ? 30 PRO A HB3  1 
ATOM 347  H HG2  . PRO A 1 21 ? 99.695  6.444   0.460   1.00 0.00 ? 30 PRO A HG2  1 
ATOM 348  H HG3  . PRO A 1 21 ? 98.794  7.968   0.267   1.00 0.00 ? 30 PRO A HG3  1 
ATOM 349  H HD2  . PRO A 1 21 ? 101.667 7.538   0.995   1.00 0.00 ? 30 PRO A HD2  1 
ATOM 350  H HD3  . PRO A 1 21 ? 100.929 8.750   -0.063  1.00 0.00 ? 30 PRO A HD3  1 
ATOM 351  N N    . GLU A 1 22 ? 99.483  7.489   4.988   1.00 0.00 ? 31 GLU A N    1 
ATOM 352  C CA   . GLU A 1 22 ? 99.865  7.077   6.332   1.00 0.00 ? 31 GLU A CA   1 
ATOM 353  C C    . GLU A 1 22 ? 100.346 5.641   6.339   1.00 0.00 ? 31 GLU A C    1 
ATOM 354  O O    . GLU A 1 22 ? 101.349 5.328   6.981   1.00 0.00 ? 31 GLU A O    1 
ATOM 355  C CB   . GLU A 1 22 ? 98.704  7.259   7.312   1.00 0.00 ? 31 GLU A CB   1 
ATOM 356  C CG   . GLU A 1 22 ? 99.047  6.868   8.740   1.00 0.00 ? 31 GLU A CG   1 
ATOM 357  C CD   . GLU A 1 22 ? 99.959  7.873   9.417   1.00 0.00 ? 31 GLU A CD   1 
ATOM 358  O OE1  . GLU A 1 22 ? 101.127 7.995   8.992   1.00 0.00 ? 31 GLU A OE1  1 
ATOM 359  O OE2  . GLU A 1 22 ? 99.504  8.538   10.371  1.00 0.00 ? 31 GLU A OE2  1 
ATOM 360  H H    . GLU A 1 22 ? 98.682  7.112   4.573   1.00 0.00 ? 31 GLU A H    1 
ATOM 361  H HA   . GLU A 1 22 ? 100.691 7.701   6.635   1.00 0.00 ? 31 GLU A HA   1 
ATOM 362  H HB2  . GLU A 1 22 ? 98.403  8.297   7.308   1.00 0.00 ? 31 GLU A HB2  1 
ATOM 363  H HB3  . GLU A 1 22 ? 97.873  6.651   6.985   1.00 0.00 ? 31 GLU A HB3  1 
ATOM 364  H HG2  . GLU A 1 22 ? 98.133  6.794   9.310   1.00 0.00 ? 31 GLU A HG2  1 
ATOM 365  H HG3  . GLU A 1 22 ? 99.541  5.907   8.728   1.00 0.00 ? 31 GLU A HG3  1 
ATOM 366  N N    . GLY A 1 23 ? 99.664  4.769   5.595   1.00 0.00 ? 32 GLY A N    1 
ATOM 367  C CA   . GLY A 1 23 ? 100.106 3.388   5.521   1.00 0.00 ? 32 GLY A CA   1 
ATOM 368  C C    . GLY A 1 23 ? 101.591 3.343   5.235   1.00 0.00 ? 32 GLY A C    1 
ATOM 369  O O    . GLY A 1 23 ? 102.300 2.427   5.653   1.00 0.00 ? 32 GLY A O    1 
ATOM 370  H H    . GLY A 1 23 ? 98.889  5.070   5.076   1.00 0.00 ? 32 GLY A H    1 
ATOM 371  H HA2  . GLY A 1 23 ? 99.904  2.896   6.465   1.00 0.00 ? 32 GLY A HA2  1 
ATOM 372  H HA3  . GLY A 1 23 ? 99.576  2.882   4.728   1.00 0.00 ? 32 GLY A HA3  1 
ATOM 373  N N    . VAL A 1 24 ? 102.055 4.387   4.549   1.00 0.00 ? 33 VAL A N    1 
ATOM 374  C CA   . VAL A 1 24 ? 103.453 4.549   4.220   1.00 0.00 ? 33 VAL A CA   1 
ATOM 375  C C    . VAL A 1 24 ? 104.212 5.003   5.465   1.00 0.00 ? 33 VAL A C    1 
ATOM 376  O O    . VAL A 1 24 ? 104.056 6.138   5.917   1.00 0.00 ? 33 VAL A O    1 
ATOM 377  C CB   . VAL A 1 24 ? 103.618 5.589   3.078   1.00 0.00 ? 33 VAL A CB   1 
ATOM 378  C CG1  . VAL A 1 24 ? 104.669 6.645   3.394   1.00 0.00 ? 33 VAL A CG1  1 
ATOM 379  C CG2  . VAL A 1 24 ? 103.944 4.902   1.768   1.00 0.00 ? 33 VAL A CG2  1 
ATOM 380  H H    . VAL A 1 24 ? 101.429 5.090   4.278   1.00 0.00 ? 33 VAL A H    1 
ATOM 381  H HA   . VAL A 1 24 ? 103.839 3.598   3.888   1.00 0.00 ? 33 VAL A HA   1 
ATOM 382  H HB   . VAL A 1 24 ? 102.672 6.097   2.954   1.00 0.00 ? 33 VAL A HB   1 
ATOM 383  H HG11 . VAL A 1 24 ? 104.913 7.187   2.493   1.00 0.00 ? 33 VAL A HG11 1 
ATOM 384  H HG12 . VAL A 1 24 ? 105.558 6.168   3.779   1.00 0.00 ? 33 VAL A HG12 1 
ATOM 385  H HG13 . VAL A 1 24 ? 104.278 7.331   4.130   1.00 0.00 ? 33 VAL A HG13 1 
ATOM 386  H HG21 . VAL A 1 24 ? 104.998 5.016   1.556   1.00 0.00 ? 33 VAL A HG21 1 
ATOM 387  H HG22 . VAL A 1 24 ? 103.364 5.353   0.978   1.00 0.00 ? 33 VAL A HG22 1 
ATOM 388  H HG23 . VAL A 1 24 ? 103.701 3.853   1.841   1.00 0.00 ? 33 VAL A HG23 1 
ATOM 389  N N    . ASP A 1 25 ? 105.021 4.118   6.027   1.00 0.00 ? 34 ASP A N    1 
ATOM 390  C CA   . ASP A 1 25 ? 105.779 4.460   7.218   1.00 0.00 ? 34 ASP A CA   1 
ATOM 391  C C    . ASP A 1 25 ? 107.085 5.146   6.822   1.00 0.00 ? 34 ASP A C    1 
ATOM 392  O O    . ASP A 1 25 ? 107.793 4.675   5.932   1.00 0.00 ? 34 ASP A O    1 
ATOM 393  C CB   . ASP A 1 25 ? 106.066 3.212   8.059   1.00 0.00 ? 34 ASP A CB   1 
ATOM 394  C CG   . ASP A 1 25 ? 104.946 2.191   7.994   1.00 0.00 ? 34 ASP A CG   1 
ATOM 395  O OD1  . ASP A 1 25 ? 103.790 2.593   7.746   1.00 0.00 ? 34 ASP A OD1  1 
ATOM 396  O OD2  . ASP A 1 25 ? 105.225 0.989   8.191   1.00 0.00 ? 34 ASP A OD2  1 
ATOM 397  H H    . ASP A 1 25 ? 105.106 3.223   5.640   1.00 0.00 ? 34 ASP A H    1 
ATOM 398  H HA   . ASP A 1 25 ? 105.177 5.150   7.797   1.00 0.00 ? 34 ASP A HA   1 
ATOM 399  H HB2  . ASP A 1 25 ? 106.974 2.744   7.702   1.00 0.00 ? 34 ASP A HB2  1 
ATOM 400  H HB3  . ASP A 1 25 ? 106.198 3.507   9.092   1.00 0.00 ? 34 ASP A HB3  1 
ATOM 401  N N    . PRO A 1 26 ? 107.416 6.280   7.462   1.00 0.00 ? 35 PRO A N    1 
ATOM 402  C CA   . PRO A 1 26 ? 108.634 7.031   7.147   1.00 0.00 ? 35 PRO A CA   1 
ATOM 403  C C    . PRO A 1 26 ? 109.904 6.365   7.670   1.00 0.00 ? 35 PRO A C    1 
ATOM 404  O O    . PRO A 1 26 ? 110.945 6.401   7.015   1.00 0.00 ? 35 PRO A O    1 
ATOM 405  C CB   . PRO A 1 26 ? 108.407 8.371   7.846   1.00 0.00 ? 35 PRO A CB   1 
ATOM 406  C CG   . PRO A 1 26 ? 107.512 8.050   8.992   1.00 0.00 ? 35 PRO A CG   1 
ATOM 407  C CD   . PRO A 1 26 ? 106.624 6.929   8.525   1.00 0.00 ? 35 PRO A CD   1 
ATOM 408  H HA   . PRO A 1 26 ? 108.727 7.192   6.082   1.00 0.00 ? 35 PRO A HA   1 
ATOM 409  H HB2  . PRO A 1 26 ? 109.355 8.770   8.183   1.00 0.00 ? 35 PRO A HB2  1 
ATOM 410  H HB3  . PRO A 1 26 ? 107.938 9.064   7.162   1.00 0.00 ? 35 PRO A HB3  1 
ATOM 411  H HG2  . PRO A 1 26 ? 108.101 7.733   9.840   1.00 0.00 ? 35 PRO A HG2  1 
ATOM 412  H HG3  . PRO A 1 26 ? 106.919 8.915   9.249   1.00 0.00 ? 35 PRO A HG3  1 
ATOM 413  H HD2  . PRO A 1 26 ? 106.430 6.239   9.336   1.00 0.00 ? 35 PRO A HD2  1 
ATOM 414  H HD3  . PRO A 1 26 ? 105.697 7.321   8.130   1.00 0.00 ? 35 PRO A HD3  1 
ATOM 415  N N    . LEU A 1 27 ? 109.821 5.767   8.855   1.00 0.00 ? 36 LEU A N    1 
ATOM 416  C CA   . LEU A 1 27 ? 110.978 5.111   9.454   1.00 0.00 ? 36 LEU A CA   1 
ATOM 417  C C    . LEU A 1 27 ? 111.542 4.036   8.528   1.00 0.00 ? 36 LEU A C    1 
ATOM 418  O O    . LEU A 1 27 ? 112.727 3.711   8.595   1.00 0.00 ? 36 LEU A O    1 
ATOM 419  C CB   . LEU A 1 27 ? 110.639 4.530   10.840  1.00 0.00 ? 36 LEU A CB   1 
ATOM 420  C CG   . LEU A 1 27 ? 109.674 3.337   10.873  1.00 0.00 ? 36 LEU A CG   1 
ATOM 421  C CD1  . LEU A 1 27 ? 108.365 3.673   10.179  1.00 0.00 ? 36 LEU A CD1  1 
ATOM 422  C CD2  . LEU A 1 27 ? 110.310 2.107   10.249  1.00 0.00 ? 36 LEU A CD2  1 
ATOM 423  H H    . LEU A 1 27 ? 108.972 5.776   9.336   1.00 0.00 ? 36 LEU A H    1 
ATOM 424  H HA   . LEU A 1 27 ? 111.738 5.869   9.582   1.00 0.00 ? 36 LEU A HA   1 
ATOM 425  H HB2  . LEU A 1 27 ? 111.565 4.220   11.306  1.00 0.00 ? 36 LEU A HB2  1 
ATOM 426  H HB3  . LEU A 1 27 ? 110.207 5.325   11.436  1.00 0.00 ? 36 LEU A HB3  1 
ATOM 427  H HG   . LEU A 1 27 ? 109.446 3.105   11.903  1.00 0.00 ? 36 LEU A HG   1 
ATOM 428  H HD11 . LEU A 1 27 ? 107.665 2.863   10.320  1.00 0.00 ? 36 LEU A HD11 1 
ATOM 429  H HD12 . LEU A 1 27 ? 108.542 3.815   9.124   1.00 0.00 ? 36 LEU A HD12 1 
ATOM 430  H HD13 . LEU A 1 27 ? 107.956 4.580   10.600  1.00 0.00 ? 36 LEU A HD13 1 
ATOM 431  H HD21 . LEU A 1 27 ? 110.070 1.237   10.842  1.00 0.00 ? 36 LEU A HD21 1 
ATOM 432  H HD22 . LEU A 1 27 ? 111.384 2.233   10.213  1.00 0.00 ? 36 LEU A HD22 1 
ATOM 433  H HD23 . LEU A 1 27 ? 109.929 1.977   9.250   1.00 0.00 ? 36 LEU A HD23 1 
ATOM 434  N N    . LYS A 1 28 ? 110.698 3.502   7.648   1.00 0.00 ? 37 LYS A N    1 
ATOM 435  C CA   . LYS A 1 28 ? 111.141 2.486   6.701   1.00 0.00 ? 37 LYS A CA   1 
ATOM 436  C C    . LYS A 1 28 ? 110.208 2.410   5.494   1.00 0.00 ? 37 LYS A C    1 
ATOM 437  O O    . LYS A 1 28 ? 109.045 2.024   5.610   1.00 0.00 ? 37 LYS A O    1 
ATOM 438  C CB   . LYS A 1 28 ? 111.276 1.116   7.380   1.00 0.00 ? 37 LYS A CB   1 
ATOM 439  C CG   . LYS A 1 28 ? 109.968 0.351   7.514   1.00 0.00 ? 37 LYS A CG   1 
ATOM 440  C CD   . LYS A 1 28 ? 110.002 -0.602  8.698   1.00 0.00 ? 37 LYS A CD   1 
ATOM 441  C CE   . LYS A 1 28 ? 108.629 -0.753  9.335   1.00 0.00 ? 37 LYS A CE   1 
ATOM 442  N NZ   . LYS A 1 28 ? 108.323 -2.173  9.663   1.00 0.00 ? 37 LYS A NZ   1 
ATOM 443  H H    . LYS A 1 28 ? 109.768 3.808   7.624   1.00 0.00 ? 37 LYS A H    1 
ATOM 444  H HA   . LYS A 1 28 ? 112.111 2.794   6.353   1.00 0.00 ? 37 LYS A HA   1 
ATOM 445  H HB2  . LYS A 1 28 ? 111.960 0.510   6.801   1.00 0.00 ? 37 LYS A HB2  1 
ATOM 446  H HB3  . LYS A 1 28 ? 111.686 1.260   8.371   1.00 0.00 ? 37 LYS A HB3  1 
ATOM 447  H HG2  . LYS A 1 28 ? 109.162 1.056   7.654   1.00 0.00 ? 37 LYS A HG2  1 
ATOM 448  H HG3  . LYS A 1 28 ? 109.802 -0.216  6.611   1.00 0.00 ? 37 LYS A HG3  1 
ATOM 449  H HD2  . LYS A 1 28 ? 110.339 -1.570  8.359   1.00 0.00 ? 37 LYS A HD2  1 
ATOM 450  H HD3  . LYS A 1 28 ? 110.691 -0.218  9.436   1.00 0.00 ? 37 LYS A HD3  1 
ATOM 451  H HE2  . LYS A 1 28 ? 108.602 -0.170  10.243  1.00 0.00 ? 37 LYS A HE2  1 
ATOM 452  H HE3  . LYS A 1 28 ? 107.884 -0.383  8.647   1.00 0.00 ? 37 LYS A HE3  1 
ATOM 453  H HZ1  . LYS A 1 28 ? 108.890 -2.481  10.479  1.00 0.00 ? 37 LYS A HZ1  1 
ATOM 454  H HZ2  . LYS A 1 28 ? 108.545 -2.784  8.852   1.00 0.00 ? 37 LYS A HZ2  1 
ATOM 455  H HZ3  . LYS A 1 28 ? 107.315 -2.277  9.896   1.00 0.00 ? 37 LYS A HZ3  1 
ATOM 456  N N    . LEU A 1 29 ? 110.732 2.802   4.337   1.00 0.00 ? 38 LEU A N    1 
ATOM 457  C CA   . LEU A 1 29 ? 109.964 2.805   3.097   1.00 0.00 ? 38 LEU A CA   1 
ATOM 458  C C    . LEU A 1 29 ? 110.044 1.467   2.362   1.00 0.00 ? 38 LEU A C    1 
ATOM 459  O O    . LEU A 1 29 ? 109.161 1.132   1.572   1.00 0.00 ? 38 LEU A O    1 
ATOM 460  C CB   . LEU A 1 29 ? 110.470 3.924   2.183   1.00 0.00 ? 38 LEU A CB   1 
ATOM 461  C CG   . LEU A 1 29 ? 110.658 5.292   2.854   1.00 0.00 ? 38 LEU A CG   1 
ATOM 462  C CD1  . LEU A 1 29 ? 110.611 6.405   1.817   1.00 0.00 ? 38 LEU A CD1  1 
ATOM 463  C CD2  . LEU A 1 29 ? 109.607 5.524   3.936   1.00 0.00 ? 38 LEU A CD2  1 
ATOM 464  H H    . LEU A 1 29 ? 111.662 3.111   4.319   1.00 0.00 ? 38 LEU A H    1 
ATOM 465  H HA   . LEU A 1 29 ? 108.934 3.001   3.347   1.00 0.00 ? 38 LEU A HA   1 
ATOM 466  H HB2  . LEU A 1 29 ? 111.425 3.615   1.776   1.00 0.00 ? 38 LEU A HB2  1 
ATOM 467  H HB3  . LEU A 1 29 ? 109.771 4.038   1.368   1.00 0.00 ? 38 LEU A HB3  1 
ATOM 468  H HG   . LEU A 1 29 ? 111.631 5.321   3.324   1.00 0.00 ? 38 LEU A HG   1 
ATOM 469  H HD11 . LEU A 1 29 ? 111.424 7.093   1.989   1.00 0.00 ? 38 LEU A HD11 1 
ATOM 470  H HD12 . LEU A 1 29 ? 109.672 6.933   1.897   1.00 0.00 ? 38 LEU A HD12 1 
ATOM 471  H HD13 . LEU A 1 29 ? 110.702 5.981   0.828   1.00 0.00 ? 38 LEU A HD13 1 
ATOM 472  H HD21 . LEU A 1 29 ? 110.029 5.294   4.903   1.00 0.00 ? 38 LEU A HD21 1 
ATOM 473  H HD22 . LEU A 1 29 ? 108.755 4.886   3.755   1.00 0.00 ? 38 LEU A HD22 1 
ATOM 474  H HD23 . LEU A 1 29 ? 109.292 6.557   3.916   1.00 0.00 ? 38 LEU A HD23 1 
ATOM 475  N N    . GLU A 1 30 ? 111.114 0.720   2.605   1.00 0.00 ? 39 GLU A N    1 
ATOM 476  C CA   . GLU A 1 30 ? 111.321 -0.567  1.942   1.00 0.00 ? 39 GLU A CA   1 
ATOM 477  C C    . GLU A 1 30 ? 110.264 -1.612  2.317   1.00 0.00 ? 39 GLU A C    1 
ATOM 478  O O    . GLU A 1 30 ? 110.272 -2.718  1.776   1.00 0.00 ? 39 GLU A O    1 
ATOM 479  C CB   . GLU A 1 30 ? 112.716 -1.104  2.270   1.00 0.00 ? 39 GLU A CB   1 
ATOM 480  C CG   . GLU A 1 30 ? 112.888 -1.506  3.726   1.00 0.00 ? 39 GLU A CG   1 
ATOM 481  C CD   . GLU A 1 30 ? 113.558 -2.858  3.882   1.00 0.00 ? 39 GLU A CD   1 
ATOM 482  O OE1  . GLU A 1 30 ? 112.938 -3.874  3.504   1.00 0.00 ? 39 GLU A OE1  1 
ATOM 483  O OE2  . GLU A 1 30 ? 114.702 -2.900  4.382   1.00 0.00 ? 39 GLU A OE2  1 
ATOM 484  H H    . GLU A 1 30 ? 111.794 1.049   3.230   1.00 0.00 ? 39 GLU A H    1 
ATOM 485  H HA   . GLU A 1 30 ? 111.265 -0.395  0.878   1.00 0.00 ? 39 GLU A HA   1 
ATOM 486  H HB2  . GLU A 1 30 ? 112.908 -1.973  1.654   1.00 0.00 ? 39 GLU A HB2  1 
ATOM 487  H HB3  . GLU A 1 30 ? 113.445 -0.339  2.041   1.00 0.00 ? 39 GLU A HB3  1 
ATOM 488  H HG2  . GLU A 1 30 ? 113.494 -0.763  4.222   1.00 0.00 ? 39 GLU A HG2  1 
ATOM 489  H HG3  . GLU A 1 30 ? 111.915 -1.546  4.193   1.00 0.00 ? 39 GLU A HG3  1 
ATOM 490  N N    . ILE A 1 31 ? 109.366 -1.280  3.241   1.00 0.00 ? 40 ILE A N    1 
ATOM 491  C CA   . ILE A 1 31 ? 108.336 -2.228  3.660   1.00 0.00 ? 40 ILE A CA   1 
ATOM 492  C C    . ILE A 1 31 ? 106.986 -1.967  2.988   1.00 0.00 ? 40 ILE A C    1 
ATOM 493  O O    . ILE A 1 31 ? 106.009 -2.657  3.278   1.00 0.00 ? 40 ILE A O    1 
ATOM 494  C CB   . ILE A 1 31 ? 108.139 -2.212  5.189   1.00 0.00 ? 40 ILE A CB   1 
ATOM 495  C CG1  . ILE A 1 31 ? 107.619 -0.848  5.652   1.00 0.00 ? 40 ILE A CG1  1 
ATOM 496  C CG2  . ILE A 1 31 ? 109.442 -2.558  5.893   1.00 0.00 ? 40 ILE A CG2  1 
ATOM 497  C CD1  . ILE A 1 31 ? 106.117 -0.699  5.531   1.00 0.00 ? 40 ILE A CD1  1 
ATOM 498  H H    . ILE A 1 31 ? 109.401 -0.395  3.655   1.00 0.00 ? 40 ILE A H    1 
ATOM 499  H HA   . ILE A 1 31 ? 108.671 -3.216  3.381   1.00 0.00 ? 40 ILE A HA   1 
ATOM 500  H HB   . ILE A 1 31 ? 107.412 -2.969  5.441   1.00 0.00 ? 40 ILE A HB   1 
ATOM 501  H HG12 . ILE A 1 31 ? 107.882 -0.703  6.688   1.00 0.00 ? 40 ILE A HG12 1 
ATOM 502  H HG13 . ILE A 1 31 ? 108.078 -0.073  5.056   1.00 0.00 ? 40 ILE A HG13 1 
ATOM 503  H HG21 . ILE A 1 31 ? 109.301 -2.494  6.961   1.00 0.00 ? 40 ILE A HG21 1 
ATOM 504  H HG22 . ILE A 1 31 ? 110.211 -1.864  5.589   1.00 0.00 ? 40 ILE A HG22 1 
ATOM 505  H HG23 . ILE A 1 31 ? 109.738 -3.562  5.628   1.00 0.00 ? 40 ILE A HG23 1 
ATOM 506  H HD11 . ILE A 1 31 ? 105.682 -1.648  5.252   1.00 0.00 ? 40 ILE A HD11 1 
ATOM 507  H HD12 . ILE A 1 31 ? 105.888 0.038   4.776   1.00 0.00 ? 40 ILE A HD12 1 
ATOM 508  H HD13 . ILE A 1 31 ? 105.710 -0.382  6.480   1.00 0.00 ? 40 ILE A HD13 1 
ATOM 509  N N    . TYR A 1 32 ? 106.920 -0.977  2.100   1.00 0.00 ? 41 TYR A N    1 
ATOM 510  C CA   . TYR A 1 32 ? 105.662 -0.668  1.422   1.00 0.00 ? 41 TYR A CA   1 
ATOM 511  C C    . TYR A 1 32 ? 105.837 -0.511  -0.082  1.00 0.00 ? 41 TYR A C    1 
ATOM 512  O O    . TYR A 1 32 ? 104.996 0.096   -0.742  1.00 0.00 ? 41 TYR A O    1 
ATOM 513  C CB   . TYR A 1 32 ? 105.023 0.597   2.008   1.00 0.00 ? 41 TYR A CB   1 
ATOM 514  C CG   . TYR A 1 32 ? 105.868 1.859   1.924   1.00 0.00 ? 41 TYR A CG   1 
ATOM 515  C CD1  . TYR A 1 32 ? 106.561 2.209   0.766   1.00 0.00 ? 41 TYR A CD1  1 
ATOM 516  C CD2  . TYR A 1 32 ? 105.945 2.719   3.011   1.00 0.00 ? 41 TYR A CD2  1 
ATOM 517  C CE1  . TYR A 1 32 ? 107.305 3.372   0.704   1.00 0.00 ? 41 TYR A CE1  1 
ATOM 518  C CE2  . TYR A 1 32 ? 106.679 3.886   2.952   1.00 0.00 ? 41 TYR A CE2  1 
ATOM 519  C CZ   . TYR A 1 32 ? 107.358 4.208   1.799   1.00 0.00 ? 41 TYR A CZ   1 
ATOM 520  O OH   . TYR A 1 32 ? 108.083 5.377   1.739   1.00 0.00 ? 41 TYR A OH   1 
ATOM 521  H H    . TYR A 1 32 ? 107.720 -0.449  1.899   1.00 0.00 ? 41 TYR A H    1 
ATOM 522  H HA   . TYR A 1 32 ? 104.990 -1.495  1.595   1.00 0.00 ? 41 TYR A HA   1 
ATOM 523  H HB2  . TYR A 1 32 ? 104.098 0.793   1.483   1.00 0.00 ? 41 TYR A HB2  1 
ATOM 524  H HB3  . TYR A 1 32 ? 104.802 0.419   3.054   1.00 0.00 ? 41 TYR A HB3  1 
ATOM 525  H HD1  . TYR A 1 32 ? 106.519 1.561   -0.092  1.00 0.00 ? 41 TYR A HD1  1 
ATOM 526  H HD2  . TYR A 1 32 ? 105.418 2.464   3.916   1.00 0.00 ? 41 TYR A HD2  1 
ATOM 527  H HE1  . TYR A 1 32 ? 107.841 3.624   -0.202  1.00 0.00 ? 41 TYR A HE1  1 
ATOM 528  H HE2  . TYR A 1 32 ? 106.724 4.538   3.811   1.00 0.00 ? 41 TYR A HE2  1 
ATOM 529  H HH   . TYR A 1 32 ? 108.591 5.402   0.926   1.00 0.00 ? 41 TYR A HH   1 
ATOM 530  N N    . LEU A 1 33 ? 106.923 -1.048  -0.630  1.00 0.00 ? 42 LEU A N    1 
ATOM 531  C CA   . LEU A 1 33 ? 107.163 -0.935  -2.065  1.00 0.00 ? 42 LEU A CA   1 
ATOM 532  C C    . LEU A 1 33 ? 107.436 -2.295  -2.690  1.00 0.00 ? 42 LEU A C    1 
ATOM 533  O O    . LEU A 1 33 ? 108.245 -3.070  -2.187  1.00 0.00 ? 42 LEU A O    1 
ATOM 534  C CB   . LEU A 1 33 ? 108.327 0.019   -2.345  1.00 0.00 ? 42 LEU A CB   1 
ATOM 535  C CG   . LEU A 1 33 ? 109.427 0.066   -1.278  1.00 0.00 ? 42 LEU A CG   1 
ATOM 536  C CD1  . LEU A 1 33 ? 110.608 -0.796  -1.690  1.00 0.00 ? 42 LEU A CD1  1 
ATOM 537  C CD2  . LEU A 1 33 ? 109.873 1.502   -1.038  1.00 0.00 ? 42 LEU A CD2  1 
ATOM 538  H H    . LEU A 1 33 ? 107.573 -1.526  -0.065  1.00 0.00 ? 42 LEU A H    1 
ATOM 539  H HA   . LEU A 1 33 ? 106.270 -0.529  -2.512  1.00 0.00 ? 42 LEU A HA   1 
ATOM 540  H HB2  . LEU A 1 33 ? 108.782 -0.278  -3.282  1.00 0.00 ? 42 LEU A HB2  1 
ATOM 541  H HB3  . LEU A 1 33 ? 107.923 1.013   -2.462  1.00 0.00 ? 42 LEU A HB3  1 
ATOM 542  H HG   . LEU A 1 33 ? 109.041 -0.323  -0.349  1.00 0.00 ? 42 LEU A HG   1 
ATOM 543  H HD11 . LEU A 1 33 ? 110.757 -1.575  -0.958  1.00 0.00 ? 42 LEU A HD11 1 
ATOM 544  H HD12 . LEU A 1 33 ? 111.497 -0.187  -1.753  1.00 0.00 ? 42 LEU A HD12 1 
ATOM 545  H HD13 . LEU A 1 33 ? 110.407 -1.240  -2.652  1.00 0.00 ? 42 LEU A HD13 1 
ATOM 546  H HD21 . LEU A 1 33 ? 110.765 1.506   -0.430  1.00 0.00 ? 42 LEU A HD21 1 
ATOM 547  H HD22 . LEU A 1 33 ? 109.088 2.042   -0.528  1.00 0.00 ? 42 LEU A HD22 1 
ATOM 548  H HD23 . LEU A 1 33 ? 110.080 1.978   -1.985  1.00 0.00 ? 42 LEU A HD23 1 
ATOM 549  N N    . THR A 1 34 ? 106.749 -2.572  -3.796  1.00 0.00 ? 43 THR A N    1 
ATOM 550  C CA   . THR A 1 34 ? 106.912 -3.834  -4.506  1.00 0.00 ? 43 THR A CA   1 
ATOM 551  C C    . THR A 1 34 ? 108.123 -3.780  -5.430  1.00 0.00 ? 43 THR A C    1 
ATOM 552  O O    . THR A 1 34 ? 108.556 -2.711  -5.828  1.00 0.00 ? 43 THR A O    1 
ATOM 553  C CB   . THR A 1 34 ? 105.655 -4.162  -5.315  1.00 0.00 ? 43 THR A CB   1 
ATOM 554  O OG1  . THR A 1 34 ? 105.889 -5.258  -6.181  1.00 0.00 ? 43 THR A OG1  1 
ATOM 555  C CG2  . THR A 1 34 ? 105.167 -3.005  -6.161  1.00 0.00 ? 43 THR A CG2  1 
ATOM 556  H H    . THR A 1 34 ? 106.114 -1.908  -4.144  1.00 0.00 ? 43 THR A H    1 
ATOM 557  H HA   . THR A 1 34 ? 107.069 -4.609  -3.770  1.00 0.00 ? 43 THR A HA   1 
ATOM 558  H HB   . THR A 1 34 ? 104.861 -4.432  -4.634  1.00 0.00 ? 43 THR A HB   1 
ATOM 559  H HG1  . THR A 1 34 ? 106.493 -4.993  -6.878  1.00 0.00 ? 43 THR A HG1  1 
ATOM 560  H HG21 . THR A 1 34 ? 104.302 -2.559  -5.695  1.00 0.00 ? 43 THR A HG21 1 
ATOM 561  H HG22 . THR A 1 34 ? 104.902 -3.365  -7.144  1.00 0.00 ? 43 THR A HG22 1 
ATOM 562  H HG23 . THR A 1 34 ? 105.951 -2.267  -6.247  1.00 0.00 ? 43 THR A HG23 1 
ATOM 563  N N    . ASP A 1 35 ? 108.653 -4.953  -5.750  1.00 0.00 ? 44 ASP A N    1 
ATOM 564  C CA   . ASP A 1 35 ? 109.825 -5.112  -6.618  1.00 0.00 ? 44 ASP A CA   1 
ATOM 565  C C    . ASP A 1 35 ? 109.949 -3.990  -7.643  1.00 0.00 ? 44 ASP A C    1 
ATOM 566  O O    . ASP A 1 35 ? 111.044 -3.502  -7.899  1.00 0.00 ? 44 ASP A O    1 
ATOM 567  C CB   . ASP A 1 35 ? 109.767 -6.464  -7.331  1.00 0.00 ? 44 ASP A CB   1 
ATOM 568  C CG   . ASP A 1 35 ? 108.612 -6.555  -8.309  1.00 0.00 ? 44 ASP A CG   1 
ATOM 569  O OD1  . ASP A 1 35 ? 107.453 -6.643  -7.852  1.00 0.00 ? 44 ASP A OD1  1 
ATOM 570  O OD2  . ASP A 1 35 ? 108.866 -6.538  -9.532  1.00 0.00 ? 44 ASP A OD2  1 
ATOM 571  H H    . ASP A 1 35 ? 108.247 -5.742  -5.382  1.00 0.00 ? 44 ASP A H    1 
ATOM 572  H HA   . ASP A 1 35 ? 110.700 -5.095  -5.987  1.00 0.00 ? 44 ASP A HA   1 
ATOM 573  H HB2  . ASP A 1 35 ? 110.689 -6.616  -7.876  1.00 0.00 ? 44 ASP A HB2  1 
ATOM 574  H HB3  . ASP A 1 35 ? 109.654 -7.248  -6.594  1.00 0.00 ? 44 ASP A HB3  1 
ATOM 575  N N    . GLU A 1 36 ? 108.828 -3.573  -8.216  1.00 0.00 ? 45 GLU A N    1 
ATOM 576  C CA   . GLU A 1 36 ? 108.848 -2.489  -9.189  1.00 0.00 ? 45 GLU A CA   1 
ATOM 577  C C    . GLU A 1 36 ? 109.263 -1.202  -8.494  1.00 0.00 ? 45 GLU A C    1 
ATOM 578  O O    . GLU A 1 36 ? 110.212 -0.533  -8.902  1.00 0.00 ? 45 GLU A O    1 
ATOM 579  C CB   . GLU A 1 36 ? 107.475 -2.313  -9.822  1.00 0.00 ? 45 GLU A CB   1 
ATOM 580  C CG   . GLU A 1 36 ? 107.146 -3.360  -10.873 1.00 0.00 ? 45 GLU A CG   1 
ATOM 581  C CD   . GLU A 1 36 ? 105.922 -2.999  -11.692 1.00 0.00 ? 45 GLU A CD   1 
ATOM 582  O OE1  . GLU A 1 36 ? 105.121 -2.162  -11.226 1.00 0.00 ? 45 GLU A OE1  1 
ATOM 583  O OE2  . GLU A 1 36 ? 105.764 -3.554  -12.800 1.00 0.00 ? 45 GLU A OE2  1 
ATOM 584  H H    . GLU A 1 36 ? 107.975 -3.986  -7.970  1.00 0.00 ? 45 GLU A H    1 
ATOM 585  H HA   . GLU A 1 36 ? 109.570 -2.732  -9.954  1.00 0.00 ? 45 GLU A HA   1 
ATOM 586  H HB2  . GLU A 1 36 ? 106.729 -2.365  -9.044  1.00 0.00 ? 45 GLU A HB2  1 
ATOM 587  H HB3  . GLU A 1 36 ? 107.433 -1.340  -10.284 1.00 0.00 ? 45 GLU A HB3  1 
ATOM 588  H HG2  . GLU A 1 36 ? 107.989 -3.459  -11.541 1.00 0.00 ? 45 GLU A HG2  1 
ATOM 589  H HG3  . GLU A 1 36 ? 106.966 -4.304  -10.380 1.00 0.00 ? 45 GLU A HG3  1 
ATOM 590  N N    . ASP A 1 37 ? 108.557 -0.889  -7.414  1.00 0.00 ? 46 ASP A N    1 
ATOM 591  C CA   . ASP A 1 37 ? 108.846 0.281   -6.614  1.00 0.00 ? 46 ASP A CA   1 
ATOM 592  C C    . ASP A 1 37 ? 110.193 0.091   -5.930  1.00 0.00 ? 46 ASP A C    1 
ATOM 593  O O    . ASP A 1 37 ? 111.003 1.012   -5.837  1.00 0.00 ? 46 ASP A O    1 
ATOM 594  C CB   . ASP A 1 37 ? 107.740 0.457   -5.578  1.00 0.00 ? 46 ASP A CB   1 
ATOM 595  C CG   . ASP A 1 37 ? 107.938 1.688   -4.720  1.00 0.00 ? 46 ASP A CG   1 
ATOM 596  O OD1  . ASP A 1 37 ? 109.063 1.885   -4.214  1.00 0.00 ? 46 ASP A OD1  1 
ATOM 597  O OD2  . ASP A 1 37 ? 106.968 2.457   -4.553  1.00 0.00 ? 46 ASP A OD2  1 
ATOM 598  H H    . ASP A 1 37 ? 107.832 -1.484  -7.129  1.00 0.00 ? 46 ASP A H    1 
ATOM 599  H HA   . ASP A 1 37 ? 108.883 1.144   -7.261  1.00 0.00 ? 46 ASP A HA   1 
ATOM 600  H HB2  . ASP A 1 37 ? 106.791 0.549   -6.090  1.00 0.00 ? 46 ASP A HB2  1 
ATOM 601  H HB3  . ASP A 1 37 ? 107.718 -0.422  -4.936  1.00 0.00 ? 46 ASP A HB3  1 
ATOM 602  N N    . PHE A 1 38 ? 110.419 -1.138  -5.480  1.00 0.00 ? 47 PHE A N    1 
ATOM 603  C CA   . PHE A 1 38 ? 111.657 -1.522  -4.827  1.00 0.00 ? 47 PHE A CA   1 
ATOM 604  C C    . PHE A 1 38 ? 112.813 -1.358  -5.796  1.00 0.00 ? 47 PHE A C    1 
ATOM 605  O O    . PHE A 1 38 ? 113.896 -0.908  -5.425  1.00 0.00 ? 47 PHE A O    1 
ATOM 606  C CB   . PHE A 1 38 ? 111.567 -2.985  -4.378  1.00 0.00 ? 47 PHE A CB   1 
ATOM 607  C CG   . PHE A 1 38 ? 111.784 -3.192  -2.909  1.00 0.00 ? 47 PHE A CG   1 
ATOM 608  C CD1  . PHE A 1 38 ? 112.922 -2.713  -2.283  1.00 0.00 ? 47 PHE A CD1  1 
ATOM 609  C CD2  . PHE A 1 38 ? 110.837 -3.859  -2.152  1.00 0.00 ? 47 PHE A CD2  1 
ATOM 610  C CE1  . PHE A 1 38 ? 113.112 -2.899  -0.926  1.00 0.00 ? 47 PHE A CE1  1 
ATOM 611  C CE2  . PHE A 1 38 ? 111.018 -4.044  -0.797  1.00 0.00 ? 47 PHE A CE2  1 
ATOM 612  C CZ   . PHE A 1 38 ? 112.156 -3.565  -0.183  1.00 0.00 ? 47 PHE A CZ   1 
ATOM 613  H H    . PHE A 1 38 ? 109.730 -1.819  -5.612  1.00 0.00 ? 47 PHE A H    1 
ATOM 614  H HA   . PHE A 1 38 ? 111.809 -0.886  -3.969  1.00 0.00 ? 47 PHE A HA   1 
ATOM 615  H HB2  . PHE A 1 38 ? 110.583 -3.365  -4.619  1.00 0.00 ? 47 PHE A HB2  1 
ATOM 616  H HB3  . PHE A 1 38 ? 112.309 -3.563  -4.908  1.00 0.00 ? 47 PHE A HB3  1 
ATOM 617  H HD1  . PHE A 1 38 ? 113.669 -2.193  -2.864  1.00 0.00 ? 47 PHE A HD1  1 
ATOM 618  H HD2  . PHE A 1 38 ? 109.949 -4.239  -2.632  1.00 0.00 ? 47 PHE A HD2  1 
ATOM 619  H HE1  . PHE A 1 38 ? 114.006 -2.526  -0.449  1.00 0.00 ? 47 PHE A HE1  1 
ATOM 620  H HE2  . PHE A 1 38 ? 110.271 -4.566  -0.218  1.00 0.00 ? 47 PHE A HE2  1 
ATOM 621  H HZ   . PHE A 1 38 ? 112.295 -3.706  0.877   1.00 0.00 ? 47 PHE A HZ   1 
ATOM 622  N N    . GLU A 1 39 ? 112.568 -1.741  -7.045  1.00 0.00 ? 48 GLU A N    1 
ATOM 623  C CA   . GLU A 1 39 ? 113.591 -1.652  -8.083  1.00 0.00 ? 48 GLU A CA   1 
ATOM 624  C C    . GLU A 1 39 ? 113.948 -0.200  -8.398  1.00 0.00 ? 48 GLU A C    1 
ATOM 625  O O    . GLU A 1 39 ? 115.120 0.137   -8.559  1.00 0.00 ? 48 GLU A O    1 
ATOM 626  C CB   . GLU A 1 39 ? 113.121 -2.359  -9.356  1.00 0.00 ? 48 GLU A CB   1 
ATOM 627  C CG   . GLU A 1 39 ? 113.506 -3.829  -9.411  1.00 0.00 ? 48 GLU A CG   1 
ATOM 628  C CD   . GLU A 1 39 ? 113.969 -4.258  -10.789 1.00 0.00 ? 48 GLU A CD   1 
ATOM 629  O OE1  . GLU A 1 39 ? 114.762 -3.517  -11.407 1.00 0.00 ? 48 GLU A OE1  1 
ATOM 630  O OE2  . GLU A 1 39 ? 113.538 -5.335  -11.252 1.00 0.00 ? 48 GLU A OE2  1 
ATOM 631  H H    . GLU A 1 39 ? 111.671 -2.105  -7.272  1.00 0.00 ? 48 GLU A H    1 
ATOM 632  H HA   . GLU A 1 39 ? 114.474 -2.151  -7.715  1.00 0.00 ? 48 GLU A HA   1 
ATOM 633  H HB2  . GLU A 1 39 ? 112.046 -2.287  -9.420  1.00 0.00 ? 48 GLU A HB2  1 
ATOM 634  H HB3  . GLU A 1 39 ? 113.558 -1.864  -10.211 1.00 0.00 ? 48 GLU A HB3  1 
ATOM 635  H HG2  . GLU A 1 39 ? 114.312 -4.003  -8.708  1.00 0.00 ? 48 GLU A HG2  1 
ATOM 636  H HG3  . GLU A 1 39 ? 112.645 -4.426  -9.132  1.00 0.00 ? 48 GLU A HG3  1 
ATOM 637  N N    . PHE A 1 40 ? 112.936 0.653   -8.500  1.00 0.00 ? 49 PHE A N    1 
ATOM 638  C CA   . PHE A 1 40 ? 113.158 2.062   -8.813  1.00 0.00 ? 49 PHE A CA   1 
ATOM 639  C C    . PHE A 1 40 ? 113.454 2.886   -7.561  1.00 0.00 ? 49 PHE A C    1 
ATOM 640  O O    . PHE A 1 40 ? 113.929 4.018   -7.657  1.00 0.00 ? 49 PHE A O    1 
ATOM 641  C CB   . PHE A 1 40 ? 111.940 2.640   -9.534  1.00 0.00 ? 49 PHE A CB   1 
ATOM 642  C CG   . PHE A 1 40 ? 112.264 3.821   -10.403 1.00 0.00 ? 49 PHE A CG   1 
ATOM 643  C CD1  . PHE A 1 40 ? 112.661 3.641   -11.718 1.00 0.00 ? 49 PHE A CD1  1 
ATOM 644  C CD2  . PHE A 1 40 ? 112.173 5.111   -9.904  1.00 0.00 ? 49 PHE A CD2  1 
ATOM 645  C CE1  . PHE A 1 40 ? 112.961 4.726   -12.520 1.00 0.00 ? 49 PHE A CE1  1 
ATOM 646  C CE2  . PHE A 1 40 ? 112.472 6.199   -10.701 1.00 0.00 ? 49 PHE A CE2  1 
ATOM 647  C CZ   . PHE A 1 40 ? 112.866 6.007   -12.011 1.00 0.00 ? 49 PHE A CZ   1 
ATOM 648  H H    . PHE A 1 40 ? 112.020 0.328   -8.372  1.00 0.00 ? 49 PHE A H    1 
ATOM 649  H HA   . PHE A 1 40 ? 114.010 2.120   -9.473  1.00 0.00 ? 49 PHE A HA   1 
ATOM 650  H HB2  . PHE A 1 40 ? 111.505 1.875   -10.162 1.00 0.00 ? 49 PHE A HB2  1 
ATOM 651  H HB3  . PHE A 1 40 ? 111.212 2.956   -8.798  1.00 0.00 ? 49 PHE A HB3  1 
ATOM 652  H HD1  . PHE A 1 40 ? 112.735 2.640   -12.117 1.00 0.00 ? 49 PHE A HD1  1 
ATOM 653  H HD2  . PHE A 1 40 ? 111.865 5.262   -8.880  1.00 0.00 ? 49 PHE A HD2  1 
ATOM 654  H HE1  . PHE A 1 40 ? 113.269 4.572   -13.543 1.00 0.00 ? 49 PHE A HE1  1 
ATOM 655  H HE2  . PHE A 1 40 ? 112.396 7.199   -10.301 1.00 0.00 ? 49 PHE A HE2  1 
ATOM 656  H HZ   . PHE A 1 40 ? 113.100 6.856   -12.636 1.00 0.00 ? 49 PHE A HZ   1 
ATOM 657  N N    . ALA A 1 41 ? 113.164 2.328   -6.390  1.00 0.00 ? 50 ALA A N    1 
ATOM 658  C CA   . ALA A 1 41 ? 113.395 3.036   -5.136  1.00 0.00 ? 50 ALA A CA   1 
ATOM 659  C C    . ALA A 1 41 ? 114.681 2.582   -4.449  1.00 0.00 ? 50 ALA A C    1 
ATOM 660  O O    . ALA A 1 41 ? 115.450 3.404   -3.952  1.00 0.00 ? 50 ALA A O    1 
ATOM 661  C CB   . ALA A 1 41 ? 112.208 2.852   -4.203  1.00 0.00 ? 50 ALA A CB   1 
ATOM 662  H H    . ALA A 1 41 ? 112.778 1.428   -6.368  1.00 0.00 ? 50 ALA A H    1 
ATOM 663  H HA   . ALA A 1 41 ? 113.477 4.089   -5.363  1.00 0.00 ? 50 ALA A HA   1 
ATOM 664  H HB1  . ALA A 1 41 ? 111.291 2.962   -4.762  1.00 0.00 ? 50 ALA A HB1  1 
ATOM 665  H HB2  . ALA A 1 41 ? 112.245 3.596   -3.421  1.00 0.00 ? 50 ALA A HB2  1 
ATOM 666  H HB3  . ALA A 1 41 ? 112.245 1.866   -3.764  1.00 0.00 ? 50 ALA A HB3  1 
ATOM 667  N N    . LEU A 1 42 ? 114.900 1.273   -4.402  1.00 0.00 ? 51 LEU A N    1 
ATOM 668  C CA   . LEU A 1 42 ? 116.085 0.721   -3.750  1.00 0.00 ? 51 LEU A CA   1 
ATOM 669  C C    . LEU A 1 42 ? 116.909 -0.163  -4.682  1.00 0.00 ? 51 LEU A C    1 
ATOM 670  O O    . LEU A 1 42 ? 118.010 -0.585  -4.330  1.00 0.00 ? 51 LEU A O    1 
ATOM 671  C CB   . LEU A 1 42 ? 115.669 -0.091  -2.527  1.00 0.00 ? 51 LEU A CB   1 
ATOM 672  C CG   . LEU A 1 42 ? 115.617 0.689   -1.220  1.00 0.00 ? 51 LEU A CG   1 
ATOM 673  C CD1  . LEU A 1 42 ? 114.688 0.000   -0.234  1.00 0.00 ? 51 LEU A CD1  1 
ATOM 674  C CD2  . LEU A 1 42 ? 117.020 0.830   -0.649  1.00 0.00 ? 51 LEU A CD2  1 
ATOM 675  H H    . LEU A 1 42 ? 114.244 0.663   -4.800  1.00 0.00 ? 51 LEU A H    1 
ATOM 676  H HA   . LEU A 1 42 ? 116.698 1.547   -3.424  1.00 0.00 ? 51 LEU A HA   1 
ATOM 677  H HB2  . LEU A 1 42 ? 114.688 -0.504  -2.714  1.00 0.00 ? 51 LEU A HB2  1 
ATOM 678  H HB3  . LEU A 1 42 ? 116.366 -0.906  -2.405  1.00 0.00 ? 51 LEU A HB3  1 
ATOM 679  H HG   . LEU A 1 42 ? 115.230 1.679   -1.408  1.00 0.00 ? 51 LEU A HG   1 
ATOM 680  H HD11 . LEU A 1 42 ? 114.489 0.658   0.598   1.00 0.00 ? 51 LEU A HD11 1 
ATOM 681  H HD12 . LEU A 1 42 ? 115.153 -0.904  0.126   1.00 0.00 ? 51 LEU A HD12 1 
ATOM 682  H HD13 . LEU A 1 42 ? 113.760 -0.246  -0.728  1.00 0.00 ? 51 LEU A HD13 1 
ATOM 683  H HD21 . LEU A 1 42 ? 117.401 1.815   -0.871  1.00 0.00 ? 51 LEU A HD21 1 
ATOM 684  H HD22 . LEU A 1 42 ? 117.664 0.087   -1.093  1.00 0.00 ? 51 LEU A HD22 1 
ATOM 685  H HD23 . LEU A 1 42 ? 116.991 0.687   0.418   1.00 0.00 ? 51 LEU A HD23 1 
ATOM 686  N N    . ASP A 1 43 ? 116.372 -0.457  -5.857  1.00 0.00 ? 52 ASP A N    1 
ATOM 687  C CA   . ASP A 1 43 ? 117.062 -1.308  -6.816  1.00 0.00 ? 52 ASP A CA   1 
ATOM 688  C C    . ASP A 1 43 ? 117.144 -2.749  -6.312  1.00 0.00 ? 52 ASP A C    1 
ATOM 689  O O    . ASP A 1 43 ? 117.855 -3.571  -6.889  1.00 0.00 ? 52 ASP A O    1 
ATOM 690  C CB   . ASP A 1 43 ? 118.470 -0.772  -7.095  1.00 0.00 ? 52 ASP A CB   1 
ATOM 691  C CG   . ASP A 1 43 ? 118.480 0.722   -7.351  1.00 0.00 ? 52 ASP A CG   1 
ATOM 692  O OD1  . ASP A 1 43 ? 118.576 1.492   -6.371  1.00 0.00 ? 52 ASP A OD1  1 
ATOM 693  O OD2  . ASP A 1 43 ? 118.391 1.123   -8.530  1.00 0.00 ? 52 ASP A OD2  1 
ATOM 694  H H    . ASP A 1 43 ? 115.486 -0.106  -6.083  1.00 0.00 ? 52 ASP A H    1 
ATOM 695  H HA   . ASP A 1 43 ? 116.497 -1.297  -7.734  1.00 0.00 ? 52 ASP A HA   1 
ATOM 696  H HB2  . ASP A 1 43 ? 119.102 -0.976  -6.241  1.00 0.00 ? 52 ASP A HB2  1 
ATOM 697  H HB3  . ASP A 1 43 ? 118.872 -1.272  -7.967  1.00 0.00 ? 52 ASP A HB3  1 
ATOM 698  N N    . MET A 1 44 ? 116.398 -3.063  -5.249  1.00 0.00 ? 53 MET A N    1 
ATOM 699  C CA   . MET A 1 44 ? 116.390 -4.422  -4.710  1.00 0.00 ? 53 MET A CA   1 
ATOM 700  C C    . MET A 1 44 ? 114.960 -4.951  -4.629  1.00 0.00 ? 53 MET A C    1 
ATOM 701  O O    . MET A 1 44 ? 114.080 -4.448  -5.323  1.00 0.00 ? 53 MET A O    1 
ATOM 702  C CB   . MET A 1 44 ? 117.077 -4.479  -3.346  1.00 0.00 ? 53 MET A CB   1 
ATOM 703  C CG   . MET A 1 44 ? 118.218 -5.485  -3.305  1.00 0.00 ? 53 MET A CG   1 
ATOM 704  S SD   . MET A 1 44 ? 119.766 -4.803  -3.929  1.00 0.00 ? 53 MET A SD   1 
ATOM 705  C CE   . MET A 1 44 ? 120.824 -6.246  -3.860  1.00 0.00 ? 53 MET A CE   1 
ATOM 706  H H    . MET A 1 44 ? 115.834 -2.371  -4.826  1.00 0.00 ? 53 MET A H    1 
ATOM 707  H HA   . MET A 1 44 ? 116.940 -5.045  -5.401  1.00 0.00 ? 53 MET A HA   1 
ATOM 708  H HB2  . MET A 1 44 ? 117.476 -3.500  -3.113  1.00 0.00 ? 53 MET A HB2  1 
ATOM 709  H HB3  . MET A 1 44 ? 116.350 -4.756  -2.594  1.00 0.00 ? 53 MET A HB3  1 
ATOM 710  H HG2  . MET A 1 44 ? 118.367 -5.806  -2.287  1.00 0.00 ? 53 MET A HG2  1 
ATOM 711  H HG3  . MET A 1 44 ? 117.947 -6.336  -3.911  1.00 0.00 ? 53 MET A HG3  1 
ATOM 712  H HE1  . MET A 1 44 ? 120.778 -6.772  -4.802  1.00 0.00 ? 53 MET A HE1  1 
ATOM 713  H HE2  . MET A 1 44 ? 120.491 -6.898  -3.066  1.00 0.00 ? 53 MET A HE2  1 
ATOM 714  H HE3  . MET A 1 44 ? 121.841 -5.937  -3.669  1.00 0.00 ? 53 MET A HE3  1 
ATOM 715  N N    . THR A 1 45 ? 114.719 -5.970  -3.800  1.00 0.00 ? 54 THR A N    1 
ATOM 716  C CA   . THR A 1 45 ? 113.379 -6.529  -3.681  1.00 0.00 ? 54 THR A CA   1 
ATOM 717  C C    . THR A 1 45 ? 113.004 -6.743  -2.223  1.00 0.00 ? 54 THR A C    1 
ATOM 718  O O    . THR A 1 45 ? 113.873 -6.878  -1.362  1.00 0.00 ? 54 THR A O    1 
ATOM 719  C CB   . THR A 1 45 ? 113.278 -7.851  -4.447  1.00 0.00 ? 54 THR A CB   1 
ATOM 720  O OG1  . THR A 1 45 ? 113.768 -8.925  -3.666  1.00 0.00 ? 54 THR A OG1  1 
ATOM 721  C CG2  . THR A 1 45 ? 114.043 -7.848  -5.755  1.00 0.00 ? 54 THR A CG2  1 
ATOM 722  H H    . THR A 1 45 ? 115.448 -6.352  -3.259  1.00 0.00 ? 54 THR A H    1 
ATOM 723  H HA   . THR A 1 45 ? 112.688 -5.821  -4.115  1.00 0.00 ? 54 THR A HA   1 
ATOM 724  H HB   . THR A 1 45 ? 112.239 -8.043  -4.674  1.00 0.00 ? 54 THR A HB   1 
ATOM 725  H HG1  . THR A 1 45 ? 113.252 -9.715  -3.848  1.00 0.00 ? 54 THR A HG1  1 
ATOM 726  H HG21 . THR A 1 45 ? 115.037 -7.461  -5.590  1.00 0.00 ? 54 THR A HG21 1 
ATOM 727  H HG22 . THR A 1 45 ? 113.528 -7.225  -6.471  1.00 0.00 ? 54 THR A HG22 1 
ATOM 728  H HG23 . THR A 1 45 ? 114.108 -8.857  -6.136  1.00 0.00 ? 54 THR A HG23 1 
ATOM 729  N N    . ARG A 1 46 ? 111.707 -6.798  -1.953  1.00 0.00 ? 55 ARG A N    1 
ATOM 730  C CA   . ARG A 1 46 ? 111.229 -7.027  -0.598  1.00 0.00 ? 55 ARG A CA   1 
ATOM 731  C C    . ARG A 1 46 ? 111.710 -8.386  -0.105  1.00 0.00 ? 55 ARG A C    1 
ATOM 732  O O    . ARG A 1 46 ? 111.902 -8.592  1.090   1.00 0.00 ? 55 ARG A O    1 
ATOM 733  C CB   . ARG A 1 46 ? 109.702 -6.959  -0.549  1.00 0.00 ? 55 ARG A CB   1 
ATOM 734  C CG   . ARG A 1 46 ? 109.147 -6.757  0.851   1.00 0.00 ? 55 ARG A CG   1 
ATOM 735  C CD   . ARG A 1 46 ? 107.639 -6.567  0.830   1.00 0.00 ? 55 ARG A CD   1 
ATOM 736  N NE   . ARG A 1 46 ? 107.153 -5.905  2.039   1.00 0.00 ? 55 ARG A NE   1 
ATOM 737  C CZ   . ARG A 1 46 ? 105.870 -5.847  2.387   1.00 0.00 ? 55 ARG A CZ   1 
ATOM 738  N NH1  . ARG A 1 46 ? 104.941 -6.411  1.624   1.00 0.00 ? 55 ARG A NH1  1 
ATOM 739  N NH2  . ARG A 1 46 ? 105.513 -5.224  3.502   1.00 0.00 ? 55 ARG A NH2  1 
ATOM 740  H H    . ARG A 1 46 ? 111.058 -6.703  -2.683  1.00 0.00 ? 55 ARG A H    1 
ATOM 741  H HA   . ARG A 1 46 ? 111.641 -6.258  0.038   1.00 0.00 ? 55 ARG A HA   1 
ATOM 742  H HB2  . ARG A 1 46 ? 109.369 -6.136  -1.167  1.00 0.00 ? 55 ARG A HB2  1 
ATOM 743  H HB3  . ARG A 1 46 ? 109.299 -7.883  -0.943  1.00 0.00 ? 55 ARG A HB3  1 
ATOM 744  H HG2  . ARG A 1 46 ? 109.382 -7.624  1.451   1.00 0.00 ? 55 ARG A HG2  1 
ATOM 745  H HG3  . ARG A 1 46 ? 109.605 -5.880  1.287   1.00 0.00 ? 55 ARG A HG3  1 
ATOM 746  H HD2  . ARG A 1 46 ? 107.377 -5.965  -0.027  1.00 0.00 ? 55 ARG A HD2  1 
ATOM 747  H HD3  . ARG A 1 46 ? 107.168 -7.535  0.747   1.00 0.00 ? 55 ARG A HD3  1 
ATOM 748  H HE   . ARG A 1 46 ? 107.817 -5.482  2.621   1.00 0.00 ? 55 ARG A HE   1 
ATOM 749  H HH11 . ARG A 1 46 ? 105.204 -6.883  0.782   1.00 0.00 ? 55 ARG A HH11 1 
ATOM 750  H HH12 . ARG A 1 46 ? 103.979 -6.364  1.891   1.00 0.00 ? 55 ARG A HH12 1 
ATOM 751  H HH21 . ARG A 1 46 ? 106.209 -4.799  4.081   1.00 0.00 ? 55 ARG A HH21 1 
ATOM 752  H HH22 . ARG A 1 46 ? 104.549 -5.180  3.764   1.00 0.00 ? 55 ARG A HH22 1 
ATOM 753  N N    . ASP A 1 47 ? 111.908 -9.305  -1.047  1.00 0.00 ? 56 ASP A N    1 
ATOM 754  C CA   . ASP A 1 47 ? 112.372 -10.652 -0.737  1.00 0.00 ? 56 ASP A CA   1 
ATOM 755  C C    . ASP A 1 47 ? 113.899 -10.740 -0.767  1.00 0.00 ? 56 ASP A C    1 
ATOM 756  O O    . ASP A 1 47 ? 114.473 -11.757 -0.380  1.00 0.00 ? 56 ASP A O    1 
ATOM 757  C CB   . ASP A 1 47 ? 111.773 -11.658 -1.722  1.00 0.00 ? 56 ASP A CB   1 
ATOM 758  C CG   . ASP A 1 47 ? 110.257 -11.634 -1.722  1.00 0.00 ? 56 ASP A CG   1 
ATOM 759  O OD1  . ASP A 1 47 ? 109.679 -10.623 -1.272  1.00 0.00 ? 56 ASP A OD1  1 
ATOM 760  O OD2  . ASP A 1 47 ? 109.648 -12.627 -2.172  1.00 0.00 ? 56 ASP A OD2  1 
ATOM 761  H H    . ASP A 1 47 ? 111.739 -9.068  -1.983  1.00 0.00 ? 56 ASP A H    1 
ATOM 762  H HA   . ASP A 1 47 ? 112.032 -10.895 0.258   1.00 0.00 ? 56 ASP A HA   1 
ATOM 763  H HB2  . ASP A 1 47 ? 112.119 -11.427 -2.718  1.00 0.00 ? 56 ASP A HB2  1 
ATOM 764  H HB3  . ASP A 1 47 ? 112.100 -12.652 -1.453  1.00 0.00 ? 56 ASP A HB3  1 
ATOM 765  N N    . GLU A 1 48 ? 114.555 -9.669  -1.213  1.00 0.00 ? 57 GLU A N    1 
ATOM 766  C CA   . GLU A 1 48 ? 116.010 -9.638  -1.271  1.00 0.00 ? 57 GLU A CA   1 
ATOM 767  C C    . GLU A 1 48 ? 116.526 -8.978  -0.014  1.00 0.00 ? 57 GLU A C    1 
ATOM 768  O O    . GLU A 1 48 ? 117.286 -9.563  0.758   1.00 0.00 ? 57 GLU A O    1 
ATOM 769  C CB   . GLU A 1 48 ? 116.482 -8.860  -2.499  1.00 0.00 ? 57 GLU A CB   1 
ATOM 770  C CG   . GLU A 1 48 ? 117.968 -9.011  -2.781  1.00 0.00 ? 57 GLU A CG   1 
ATOM 771  C CD   . GLU A 1 48 ? 118.247 -9.907  -3.971  1.00 0.00 ? 57 GLU A CD   1 
ATOM 772  O OE1  . GLU A 1 48 ? 117.814 -9.559  -5.090  1.00 0.00 ? 57 GLU A OE1  1 
ATOM 773  O OE2  . GLU A 1 48 ? 118.898 -10.956 -3.785  1.00 0.00 ? 57 GLU A OE2  1 
ATOM 774  H H    . GLU A 1 48 ? 114.053 -8.871  -1.487  1.00 0.00 ? 57 GLU A H    1 
ATOM 775  H HA   . GLU A 1 48 ? 116.374 -10.653 -1.320  1.00 0.00 ? 57 GLU A HA   1 
ATOM 776  H HB2  . GLU A 1 48 ? 115.935 -9.210  -3.363  1.00 0.00 ? 57 GLU A HB2  1 
ATOM 777  H HB3  . GLU A 1 48 ? 116.270 -7.809  -2.345  1.00 0.00 ? 57 GLU A HB3  1 
ATOM 778  H HG2  . GLU A 1 48 ? 118.384 -8.035  -2.979  1.00 0.00 ? 57 GLU A HG2  1 
ATOM 779  H HG3  . GLU A 1 48 ? 118.445 -9.435  -1.910  1.00 0.00 ? 57 GLU A HG3  1 
ATOM 780  N N    . TYR A 1 49 ? 116.058 -7.761  0.195   1.00 0.00 ? 58 TYR A N    1 
ATOM 781  C CA   . TYR A 1 49 ? 116.405 -6.996  1.371   1.00 0.00 ? 58 TYR A CA   1 
ATOM 782  C C    . TYR A 1 49 ? 115.928 -7.740  2.605   1.00 0.00 ? 58 TYR A C    1 
ATOM 783  O O    . TYR A 1 49 ? 116.544 -7.674  3.669   1.00 0.00 ? 58 TYR A O    1 
ATOM 784  C CB   . TYR A 1 49 ? 115.735 -5.631  1.291   1.00 0.00 ? 58 TYR A CB   1 
ATOM 785  C CG   . TYR A 1 49 ? 116.611 -4.564  0.677   1.00 0.00 ? 58 TYR A CG   1 
ATOM 786  C CD1  . TYR A 1 49 ? 117.657 -4.903  -0.171  1.00 0.00 ? 58 TYR A CD1  1 
ATOM 787  C CD2  . TYR A 1 49 ? 116.396 -3.222  0.949   1.00 0.00 ? 58 TYR A CD2  1 
ATOM 788  C CE1  . TYR A 1 49 ? 118.463 -3.934  -0.730  1.00 0.00 ? 58 TYR A CE1  1 
ATOM 789  C CE2  . TYR A 1 49 ? 117.199 -2.248  0.392   1.00 0.00 ? 58 TYR A CE2  1 
ATOM 790  C CZ   . TYR A 1 49 ? 118.231 -2.610  -0.446  1.00 0.00 ? 58 TYR A CZ   1 
ATOM 791  O OH   . TYR A 1 49 ? 119.031 -1.645  -1.006  1.00 0.00 ? 58 TYR A OH   1 
ATOM 792  H H    . TYR A 1 49 ? 115.430 -7.376  -0.452  1.00 0.00 ? 58 TYR A H    1 
ATOM 793  H HA   . TYR A 1 49 ? 117.477 -6.877  1.406   1.00 0.00 ? 58 TYR A HA   1 
ATOM 794  H HB2  . TYR A 1 49 ? 114.846 -5.715  0.680   1.00 0.00 ? 58 TYR A HB2  1 
ATOM 795  H HB3  . TYR A 1 49 ? 115.456 -5.318  2.278   1.00 3.38 ? 58 TYR A HB3  1 
ATOM 796  H HD1  . TYR A 1 49 ? 117.836 -5.945  -0.392  1.00 0.00 ? 58 TYR A HD1  1 
ATOM 797  H HD2  . TYR A 1 49 ? 115.587 -2.941  1.607   1.00 0.00 ? 58 TYR A HD2  1 
ATOM 798  H HE1  . TYR A 1 49 ? 119.272 -4.219  -1.387  1.00 0.00 ? 58 TYR A HE1  1 
ATOM 799  H HE2  . TYR A 1 49 ? 117.019 -1.211  0.618   1.00 0.00 ? 58 TYR A HE2  1 
ATOM 800  H HH   . TYR A 1 49 ? 118.791 -1.523  -1.927  1.00 0.00 ? 58 TYR A HH   1 
ATOM 801  N N    . ASN A 1 50 ? 114.821 -8.455  2.446   1.00 0.00 ? 59 ASN A N    1 
ATOM 802  C CA   . ASN A 1 50 ? 114.245 -9.228  3.547   1.00 0.00 ? 59 ASN A CA   1 
ATOM 803  C C    . ASN A 1 50 ? 115.297 -10.110 4.221   1.00 0.00 ? 59 ASN A C    1 
ATOM 804  O O    . ASN A 1 50 ? 115.202 -10.401 5.413   1.00 0.00 ? 59 ASN A O    1 
ATOM 805  C CB   . ASN A 1 50 ? 113.092 -10.102 3.047   1.00 0.00 ? 59 ASN A CB   1 
ATOM 806  C CG   . ASN A 1 50 ? 111.745 -9.637  3.570   1.00 0.00 ? 59 ASN A CG   1 
ATOM 807  O OD1  . ASN A 1 50 ? 110.886 -10.449 3.913   1.00 0.00 ? 59 ASN A OD1  1 
ATOM 808  N ND2  . ASN A 1 50 ? 111.553 -8.324  3.632   1.00 0.00 ? 59 ASN A ND2  1 
ATOM 809  H H    . ASN A 1 50 ? 114.379 -8.459  1.560   1.00 0.00 ? 59 ASN A H    1 
ATOM 810  H HA   . ASN A 1 50 ? 113.863 -8.529  4.276   1.00 0.00 ? 59 ASN A HA   1 
ATOM 811  H HB2  . ASN A 1 50 ? 113.070 -10.078 1.970   1.00 0.00 ? 59 ASN A HB2  1 
ATOM 812  H HB3  . ASN A 1 50 ? 113.250 -11.119 3.375   1.00 0.00 ? 59 ASN A HB3  1 
ATOM 813  H HD21 . ASN A 1 50 ? 112.281 -7.735  3.342   1.00 0.00 ? 59 ASN A HD21 1 
ATOM 814  H HD22 . ASN A 1 50 ? 110.692 -7.997  3.967   1.00 0.00 ? 59 ASN A HD22 1 
ATOM 815  N N    . ALA A 1 51 ? 116.291 -10.544 3.450   1.00 0.00 ? 60 ALA A N    1 
ATOM 816  C CA   . ALA A 1 51 ? 117.345 -11.405 3.980   1.00 0.00 ? 60 ALA A CA   1 
ATOM 817  C C    . ALA A 1 51 ? 118.670 -10.660 4.120   1.00 0.00 ? 60 ALA A C    1 
ATOM 818  O O    . ALA A 1 51 ? 119.465 -10.957 5.012   1.00 0.00 ? 60 ALA A O    1 
ATOM 819  C CB   . ALA A 1 51 ? 117.520 -12.627 3.091   1.00 0.00 ? 60 ALA A CB   1 
ATOM 820  H H    . ALA A 1 51 ? 116.311 -10.288 2.504   1.00 0.00 ? 60 ALA A H    1 
ATOM 821  H HA   . ALA A 1 51 ? 117.034 -11.745 4.956   1.00 0.00 ? 60 ALA A HA   1 
ATOM 822  H HB1  . ALA A 1 51 ? 118.025 -12.341 2.180   1.00 0.00 ? 60 ALA A HB1  1 
ATOM 823  H HB2  . ALA A 1 51 ? 116.550 -13.039 2.850   1.00 0.00 ? 60 ALA A HB2  1 
ATOM 824  H HB3  . ALA A 1 51 ? 118.107 -13.370 3.611   1.00 0.00 ? 60 ALA A HB3  1 
ATOM 825  N N    . LEU A 1 52 ? 118.907 -9.698  3.236   1.00 0.00 ? 61 LEU A N    1 
ATOM 826  C CA   . LEU A 1 52 ? 120.142 -8.921  3.267   1.00 0.00 ? 61 LEU A CA   1 
ATOM 827  C C    . LEU A 1 52 ? 120.280 -8.173  4.591   1.00 0.00 ? 61 LEU A C    1 
ATOM 828  O O    . LEU A 1 52 ? 119.325 -8.082  5.363   1.00 0.00 ? 61 LEU A O    1 
ATOM 829  C CB   . LEU A 1 52 ? 120.171 -7.934  2.100   1.00 0.00 ? 61 LEU A CB   1 
ATOM 830  C CG   . LEU A 1 52 ? 120.896 -8.433  0.848   1.00 0.00 ? 61 LEU A CG   1 
ATOM 831  C CD1  . LEU A 1 52 ? 120.215 -7.910  -0.407  1.00 0.00 ? 61 LEU A CD1  1 
ATOM 832  C CD2  . LEU A 1 52 ? 122.359 -8.016  0.874   1.00 0.00 ? 61 LEU A CD2  1 
ATOM 833  H H    . LEU A 1 52 ? 118.238 -9.507  2.545   1.00 0.00 ? 61 LEU A H    1 
ATOM 834  H HA   . LEU A 1 52 ? 120.968 -9.609  3.168   1.00 0.00 ? 61 LEU A HA   1 
ATOM 835  H HB2  . LEU A 1 52 ? 119.150 -7.702  1.830   1.00 0.00 ? 61 LEU A HB2  1 
ATOM 836  H HB3  . LEU A 1 52 ? 120.656 -7.025  2.434   1.00 0.00 ? 61 LEU A HB3  1 
ATOM 837  H HG   . LEU A 1 52 ? 120.856 -9.512  0.823   1.00 0.00 ? 61 LEU A HG   1 
ATOM 838  H HD11 . LEU A 1 52 ? 120.551 -8.477  -1.262  1.00 0.00 ? 61 LEU A HD11 1 
ATOM 839  H HD12 . LEU A 1 52 ? 120.465 -6.868  -0.545  1.00 0.00 ? 61 LEU A HD12 1 
ATOM 840  H HD13 . LEU A 1 52 ? 119.145 -8.012  -0.305  1.00 0.00 ? 61 LEU A HD13 1 
ATOM 841  H HD21 . LEU A 1 52 ? 122.803 -8.200  -0.093  1.00 0.00 ? 61 LEU A HD21 1 
ATOM 842  H HD22 . LEU A 1 52 ? 122.883 -8.589  1.625   1.00 0.00 ? 61 LEU A HD22 1 
ATOM 843  H HD23 . LEU A 1 52 ? 122.430 -6.964  1.108   1.00 0.00 ? 61 LEU A HD23 1 
ATOM 844  N N    . PRO A 1 53 ? 121.474 -7.621  4.874   1.00 0.00 ? 62 PRO A N    1 
ATOM 845  C CA   . PRO A 1 53 ? 121.721 -6.879  6.113   1.00 0.00 ? 62 PRO A CA   1 
ATOM 846  C C    . PRO A 1 53 ? 120.690 -5.782  6.334   1.00 0.00 ? 62 PRO A C    1 
ATOM 847  O O    . PRO A 1 53 ? 119.993 -5.380  5.403   1.00 0.00 ? 62 PRO A O    1 
ATOM 848  C CB   . PRO A 1 53 ? 123.105 -6.266  5.901   1.00 0.00 ? 62 PRO A CB   1 
ATOM 849  C CG   . PRO A 1 53 ? 123.766 -7.139  4.894   1.00 0.00 ? 62 PRO A CG   1 
ATOM 850  C CD   . PRO A 1 53 ? 122.669 -7.674  4.012   1.00 0.00 ? 62 PRO A CD   1 
ATOM 851  H HA   . PRO A 1 53 ? 121.739 -7.534  6.971   1.00 0.00 ? 62 PRO A HA   1 
ATOM 852  H HB2  . PRO A 1 53 ? 122.999 -5.253  5.537   1.00 0.00 ? 62 PRO A HB2  1 
ATOM 853  H HB3  . PRO A 1 53 ? 123.648 -6.264  6.837   1.00 0.00 ? 62 PRO A HB3  1 
ATOM 854  H HG2  . PRO A 1 53 ? 124.464 -6.556  4.310   1.00 0.00 ? 62 PRO A HG2  1 
ATOM 855  H HG3  . PRO A 1 53 ? 124.278 -7.952  5.391   1.00 0.00 ? 62 PRO A HG3  1 
ATOM 856  H HD2  . PRO A 1 53 ? 122.544 -7.043  3.144   1.00 0.00 ? 62 PRO A HD2  1 
ATOM 857  H HD3  . PRO A 1 53 ? 122.885 -8.691  3.716   1.00 0.00 ? 62 PRO A HD3  1 
ATOM 858  N N    . ALA A 1 54 ? 120.598 -5.301  7.568   1.00 0.00 ? 63 ALA A N    1 
ATOM 859  C CA   . ALA A 1 54 ? 119.651 -4.248  7.908   1.00 0.00 ? 63 ALA A CA   1 
ATOM 860  C C    . ALA A 1 54 ? 120.262 -2.864  7.701   1.00 0.00 ? 63 ALA A C    1 
ATOM 861  O O    . ALA A 1 54 ? 119.548 -1.887  7.474   1.00 0.00 ? 63 ALA A O    1 
ATOM 862  C CB   . ALA A 1 54 ? 119.183 -4.407  9.347   1.00 0.00 ? 63 ALA A CB   1 
ATOM 863  H H    . ALA A 1 54 ? 121.182 -5.663  8.266   1.00 0.00 ? 63 ALA A H    1 
ATOM 864  H HA   . ALA A 1 54 ? 118.792 -4.351  7.263   1.00 0.00 ? 63 ALA A HA   1 
ATOM 865  H HB1  . ALA A 1 54 ? 118.283 -5.004  9.369   1.00 0.00 ? 63 ALA A HB1  1 
ATOM 866  H HB2  . ALA A 1 54 ? 118.980 -3.434  9.769   1.00 0.00 ? 63 ALA A HB2  1 
ATOM 867  H HB3  . ALA A 1 54 ? 119.954 -4.896  9.924   1.00 0.00 ? 63 ALA A HB3  1 
ATOM 868  N N    . TRP A 1 55 ? 121.586 -2.787  7.759   1.00 0.00 ? 64 TRP A N    1 
ATOM 869  C CA   . TRP A 1 55 ? 122.284 -1.543  7.569   1.00 0.00 ? 64 TRP A CA   1 
ATOM 870  C C    . TRP A 1 55 ? 122.623 -1.389  6.099   1.00 0.00 ? 64 TRP A C    1 
ATOM 871  O O    . TRP A 1 55 ? 122.432 -0.331  5.523   1.00 0.00 ? 64 TRP A O    1 
ATOM 872  C CB   . TRP A 1 55 ? 123.560 -1.515  8.424   1.00 0.00 ? 64 TRP A CB   1 
ATOM 873  C CG   . TRP A 1 55 ? 124.791 -1.675  7.599   1.00 0.00 ? 64 TRP A CG   1 
ATOM 874  C CD1  . TRP A 1 55 ? 125.613 -2.757  7.538   1.00 0.00 ? 64 TRP A CD1  1 
ATOM 875  C CD2  . TRP A 1 55 ? 125.295 -0.726  6.668   1.00 0.00 ? 64 TRP A CD2  1 
ATOM 876  N NE1  . TRP A 1 55 ? 126.615 -2.531  6.621   1.00 0.00 ? 64 TRP A NE1  1 
ATOM 877  C CE2  . TRP A 1 55 ? 126.436 -1.284  6.072   1.00 0.00 ? 64 TRP A CE2  1 
ATOM 878  C CE3  . TRP A 1 55 ? 124.881 0.550   6.286   1.00 0.00 ? 64 TRP A CE3  1 
ATOM 879  C CZ2  . TRP A 1 55 ? 127.168 -0.603  5.103   1.00 0.00 ? 64 TRP A CZ2  1 
ATOM 880  C CZ3  . TRP A 1 55 ? 125.602 1.221   5.329   1.00 0.00 ? 64 TRP A CZ3  1 
ATOM 881  C CH2  . TRP A 1 55 ? 126.730 0.647   4.745   1.00 0.00 ? 64 TRP A CH2  1 
ATOM 882  H H    . TRP A 1 55 ? 122.109 -3.587  7.905   1.00 0.00 ? 64 TRP A H    1 
ATOM 883  H HA   . TRP A 1 55 ? 121.630 -0.738  7.871   1.00 0.00 ? 64 TRP A HA   1 
ATOM 884  H HB2  . TRP A 1 55 ? 123.622 -0.565  8.943   1.00 0.00 ? 64 TRP A HB2  1 
ATOM 885  H HB3  . TRP A 1 55 ? 123.527 -2.323  9.144   1.00 0.00 ? 64 TRP A HB3  1 
ATOM 886  H HD1  . TRP A 1 55 ? 125.482 -3.651  8.130   1.00 0.00 ? 64 TRP A HD1  1 
ATOM 887  H HE1  . TRP A 1 55 ? 127.335 -3.157  6.396   1.00 0.00 ? 64 TRP A HE1  1 
ATOM 888  H HE3  . TRP A 1 55 ? 124.009 1.009   6.727   1.00 0.00 ? 64 TRP A HE3  1 
ATOM 889  H HZ2  . TRP A 1 55 ? 128.045 -1.032  4.640   1.00 0.00 ? 64 TRP A HZ2  1 
ATOM 890  H HZ3  . TRP A 1 55 ? 125.293 2.206   5.016   1.00 0.00 ? 64 TRP A HZ3  1 
ATOM 891  H HH2  . TRP A 1 55 ? 127.248 1.208   3.993   1.00 0.00 ? 64 TRP A HH2  1 
ATOM 892  N N    . LYS A 1 56 ? 123.134 -2.468  5.502   1.00 0.00 ? 65 LYS A N    1 
ATOM 893  C CA   . LYS A 1 56 ? 123.499 -2.455  4.096   1.00 0.00 ? 65 LYS A CA   1 
ATOM 894  C C    . LYS A 1 56 ? 122.260 -2.193  3.266   1.00 0.00 ? 65 LYS A C    1 
ATOM 895  O O    . LYS A 1 56 ? 122.278 -1.382  2.339   1.00 0.00 ? 65 LYS A O    1 
ATOM 896  C CB   . LYS A 1 56 ? 124.153 -3.775  3.687   1.00 0.00 ? 65 LYS A CB   1 
ATOM 897  C CG   . LYS A 1 56 ? 125.409 -3.588  2.852   1.00 0.00 ? 65 LYS A CG   1 
ATOM 898  C CD   . LYS A 1 56 ? 126.497 -4.572  3.251   1.00 0.00 ? 65 LYS A CD   1 
ATOM 899  C CE   . LYS A 1 56 ? 127.882 -4.008  2.983   1.00 0.00 ? 65 LYS A CE   1 
ATOM 900  N NZ   . LYS A 1 56 ? 128.901 -5.083  2.828   1.00 0.00 ? 65 LYS A NZ   1 
ATOM 901  H H    . LYS A 1 56 ? 123.262 -3.288  6.021   1.00 0.00 ? 65 LYS A H    1 
ATOM 902  H HA   . LYS A 1 56 ? 124.199 -1.647  3.942   1.00 0.00 ? 65 LYS A HA   1 
ATOM 903  H HB2  . LYS A 1 56 ? 124.420 -4.325  4.582   1.00 0.00 ? 65 LYS A HB2  1 
ATOM 904  H HB3  . LYS A 1 56 ? 123.443 -4.355  3.108   1.00 0.00 ? 65 LYS A HB3  1 
ATOM 905  H HG2  . LYS A 1 56 ? 125.163 -3.741  1.810   1.00 0.00 ? 65 LYS A HG2  1 
ATOM 906  H HG3  . LYS A 1 56 ? 125.777 -2.579  2.996   1.00 0.00 ? 65 LYS A HG3  1 
ATOM 907  H HD2  . LYS A 1 56 ? 126.404 -4.788  4.304   1.00 0.00 ? 65 LYS A HD2  1 
ATOM 908  H HD3  . LYS A 1 56 ? 126.372 -5.482  2.682   1.00 0.00 ? 65 LYS A HD3  1 
ATOM 909  H HE2  . LYS A 1 56 ? 127.850 -3.422  2.076   1.00 0.00 ? 65 LYS A HE2  1 
ATOM 910  H HE3  . LYS A 1 56 ? 128.164 -3.373  3.811   1.00 0.00 ? 65 LYS A HE3  1 
ATOM 911  H HZ1  . LYS A 1 56 ? 129.317 -5.317  3.753   1.00 0.00 ? 65 LYS A HZ1  1 
ATOM 912  H HZ2  . LYS A 1 56 ? 129.659 -4.768  2.190   1.00 0.00 ? 65 LYS A HZ2  1 
ATOM 913  H HZ3  . LYS A 1 56 ? 128.461 -5.938  2.431   1.00 0.00 ? 65 LYS A HZ3  1 
ATOM 914  N N    . GLN A 1 57 ? 121.165 -2.853  3.633   1.00 0.00 ? 66 GLN A N    1 
ATOM 915  C CA   . GLN A 1 57 ? 119.910 -2.643  2.941   1.00 0.00 ? 66 GLN A CA   1 
ATOM 916  C C    . GLN A 1 57 ? 119.526 -1.182  3.102   1.00 0.00 ? 66 GLN A C    1 
ATOM 917  O O    . GLN A 1 57 ? 119.128 -0.520  2.143   1.00 0.80 ? 66 GLN A O    1 
ATOM 918  C CB   . GLN A 1 57 ? 118.815 -3.567  3.484   1.00 0.00 ? 66 GLN A CB   1 
ATOM 919  C CG   . GLN A 1 57 ? 118.372 -3.243  4.902   1.00 0.00 ? 66 GLN A CG   1 
ATOM 920  C CD   . GLN A 1 57 ? 117.194 -4.088  5.362   1.00 0.00 ? 66 GLN A CD   1 
ATOM 921  O OE1  . GLN A 1 57 ? 116.354 -3.628  6.135   1.00 0.00 ? 66 GLN A OE1  1 
ATOM 922  N NE2  . GLN A 1 57 ? 117.124 -5.332  4.891   1.00 0.00 ? 66 GLN A NE2  1 
ATOM 923  H H    . GLN A 1 57 ? 121.200 -3.462  4.400   1.00 0.00 ? 66 GLN A H    1 
ATOM 924  H HA   . GLN A 1 57 ? 120.071 -2.852  1.895   1.00 0.00 ? 66 GLN A HA   1 
ATOM 925  H HB2  . GLN A 1 57 ? 117.953 -3.499  2.839   1.00 0.00 ? 66 GLN A HB2  1 
ATOM 926  H HB3  . GLN A 1 57 ? 119.183 -4.582  3.469   1.00 0.00 ? 66 GLN A HB3  1 
ATOM 927  H HG2  . GLN A 1 57 ? 119.200 -3.415  5.572   1.00 0.00 ? 66 GLN A HG2  1 
ATOM 928  H HG3  . GLN A 1 57 ? 118.085 -2.202  4.946   1.00 0.00 ? 66 GLN A HG3  1 
ATOM 929  H HE21 . GLN A 1 57 ? 117.824 -5.638  4.280   1.00 0.00 ? 66 GLN A HE21 1 
ATOM 930  H HE22 . GLN A 1 57 ? 116.373 -5.891  5.175   1.00 0.00 ? 66 GLN A HE22 1 
ATOM 931  N N    . VAL A 1 58 ? 119.705 -0.670  4.321   1.00 0.00 ? 67 VAL A N    1 
ATOM 932  C CA   . VAL A 1 58 ? 119.429 0.727   4.596   1.00 0.00 ? 67 VAL A CA   1 
ATOM 933  C C    . VAL A 1 58 ? 120.409 1.595   3.811   1.00 0.00 ? 67 VAL A C    1 
ATOM 934  O O    . VAL A 1 58 ? 120.021 2.612   3.236   1.00 0.00 ? 67 VAL A O    1 
ATOM 935  C CB   . VAL A 1 58 ? 119.532 1.048   6.105   1.00 0.00 ? 67 VAL A CB   1 
ATOM 936  C CG1  . VAL A 1 58 ? 119.593 2.551   6.345   1.00 0.00 ? 67 VAL A CG1  1 
ATOM 937  C CG2  . VAL A 1 58 ? 118.360 0.435   6.856   1.00 0.00 ? 67 VAL A CG2  1 
ATOM 938  H H    . VAL A 1 58 ? 120.061 -1.241  5.039   1.00 0.00 ? 67 VAL A H    1 
ATOM 939  H HA   . VAL A 1 58 ? 118.423 0.943   4.265   1.00 0.00 ? 67 VAL A HA   1 
ATOM 940  H HB   . VAL A 1 58 ? 120.443 0.608   6.485   1.00 0.00 ? 67 VAL A HB   1 
ATOM 941  H HG11 . VAL A 1 58 ? 119.078 3.064   5.546   1.00 0.00 ? 67 VAL A HG11 1 
ATOM 942  H HG12 . VAL A 1 58 ? 120.624 2.870   6.372   1.00 0.00 ? 67 VAL A HG12 1 
ATOM 943  H HG13 . VAL A 1 58 ? 119.119 2.785   7.287   1.00 0.00 ? 67 VAL A HG13 1 
ATOM 944  H HG21 . VAL A 1 58 ? 117.519 1.111   6.824   1.00 0.00 ? 67 VAL A HG21 1 
ATOM 945  H HG22 . VAL A 1 58 ? 118.643 0.261   7.884   1.00 0.00 ? 67 VAL A HG22 1 
ATOM 946  H HG23 . VAL A 1 58 ? 118.087 -0.502  6.395   1.00 0.00 ? 67 VAL A HG23 1 
ATOM 947  N N    . ASN A 1 59 ? 121.684 1.178   3.781   1.00 0.00 ? 68 ASN A N    1 
ATOM 948  C CA   . ASN A 1 59 ? 122.715 1.917   3.048   1.00 0.00 ? 68 ASN A CA   1 
ATOM 949  C C    . ASN A 1 59 ? 122.186 2.430   1.709   1.00 0.00 ? 68 ASN A C    1 
ATOM 950  O O    . ASN A 1 59 ? 122.468 3.559   1.307   1.00 0.00 ? 68 ASN A O    1 
ATOM 951  C CB   . ASN A 1 59 ? 123.925 1.018   2.795   1.00 0.00 ? 68 ASN A CB   1 
ATOM 952  C CG   . ASN A 1 59 ? 125.175 1.811   2.465   1.00 0.00 ? 68 ASN A CG   1 
ATOM 953  O OD1  . ASN A 1 59 ? 125.332 2.952   2.899   1.00 0.00 ? 68 ASN A OD1  1 
ATOM 954  N ND2  . ASN A 1 59 ? 126.073 1.209   1.693   1.00 0.00 ? 68 ASN A ND2  1 
ATOM 955  H H    . ASN A 1 59 ? 121.944 0.342   4.268   1.00 0.00 ? 68 ASN A H    1 
ATOM 956  H HA   . ASN A 1 59 ? 123.019 2.757   3.653   1.00 0.00 ? 68 ASN A HA   1 
ATOM 957  H HB2  . ASN A 1 59 ? 124.115 0.423   3.674   1.00 0.00 ? 68 ASN A HB2  1 
ATOM 958  H HB3  . ASN A 1 59 ? 123.708 0.362   1.964   1.00 0.00 ? 68 ASN A HB3  1 
ATOM 959  H HD21 . ASN A 1 59 ? 125.881 0.299   1.383   1.00 0.00 ? 68 ASN A HD21 1 
ATOM 960  H HD22 . ASN A 1 59 ? 126.890 1.699   1.464   1.00 0.00 ? 68 ASN A HD22 1 
ATOM 961  N N    . LEU A 1 60 ? 121.426 1.584   1.022   1.00 0.00 ? 69 LEU A N    1 
ATOM 962  C CA   . LEU A 1 60 ? 120.865 1.939   -0.275  1.00 0.00 ? 69 LEU A CA   1 
ATOM 963  C C    . LEU A 1 60 ? 119.712 2.927   -0.134  1.00 0.00 ? 69 LEU A C    1 
ATOM 964  O O    . LEU A 1 60 ? 119.644 3.915   -0.866  1.00 0.00 ? 69 LEU A O    1 
ATOM 965  C CB   . LEU A 1 60 ? 120.393 0.682   -1.004  1.00 0.00 ? 69 LEU A CB   1 
ATOM 966  C CG   . LEU A 1 60 ? 121.318 0.192   -2.119  1.00 0.00 ? 69 LEU A CG   1 
ATOM 967  C CD1  . LEU A 1 60 ? 121.618 1.316   -3.099  1.00 0.00 ? 69 LEU A CD1  1 
ATOM 968  C CD2  . LEU A 1 60 ? 122.607 -0.366  -1.534  1.00 0.00 ? 69 LEU A CD2  1 
ATOM 969  H H    . LEU A 1 60 ? 121.243 0.695   1.394   1.00 0.00 ? 69 LEU A H    1 
ATOM 970  H HA   . LEU A 1 60 ? 121.648 2.404   -0.855  1.00 0.00 ? 69 LEU A HA   1 
ATOM 971  H HB2  . LEU A 1 60 ? 120.295 -0.110  -0.274  1.00 0.00 ? 69 LEU A HB2  1 
ATOM 972  H HB3  . LEU A 1 60 ? 119.421 0.881   -1.435  1.00 0.00 ? 69 LEU A HB3  1 
ATOM 973  H HG   . LEU A 1 60 ? 120.826 -0.601  -2.663  1.00 0.00 ? 69 LEU A HG   1 
ATOM 974  H HD11 . LEU A 1 60 ? 121.833 0.899   -4.071  1.00 0.00 ? 69 LEU A HD11 1 
ATOM 975  H HD12 . LEU A 1 60 ? 122.472 1.879   -2.751  1.00 0.00 ? 69 LEU A HD12 1 
ATOM 976  H HD13 . LEU A 1 60 ? 120.761 1.970   -3.170  1.00 0.00 ? 69 LEU A HD13 1 
ATOM 977  H HD21 . LEU A 1 60 ? 123.321 0.433   -1.407  1.00 0.00 ? 69 LEU A HD21 1 
ATOM 978  H HD22 . LEU A 1 60 ? 123.014 -1.110  -2.203  1.00 0.00 ? 69 LEU A HD22 1 
ATOM 979  H HD23 . LEU A 1 60 ? 122.400 -0.820  -0.576  1.00 0.00 ? 69 LEU A HD23 1 
ATOM 980  N N    . LYS A 1 61 ? 118.804 2.663   0.807   1.00 0.00 ? 70 LYS A N    1 
ATOM 981  C CA   . LYS A 1 61 ? 117.659 3.546   1.025   1.00 0.00 ? 70 LYS A CA   1 
ATOM 982  C C    . LYS A 1 61 ? 118.107 5.004   1.070   1.00 0.00 ? 70 LYS A C    1 
ATOM 983  O O    . LYS A 1 61 ? 117.542 5.860   0.390   1.00 0.00 ? 70 LYS A O    1 
ATOM 984  C CB   . LYS A 1 61 ? 116.930 3.190   2.323   1.00 0.00 ? 70 LYS A CB   1 
ATOM 985  C CG   . LYS A 1 61 ? 115.711 2.305   2.120   1.00 0.00 ? 70 LYS A CG   1 
ATOM 986  C CD   . LYS A 1 61 ? 115.622 1.219   3.182   1.00 0.00 ? 70 LYS A CD   1 
ATOM 987  C CE   . LYS A 1 61 ? 116.150 -0.114  2.685   1.00 0.00 ? 70 LYS A CE   1 
ATOM 988  N NZ   . LYS A 1 61 ? 116.409 -1.056  3.807   1.00 0.00 ? 70 LYS A NZ   1 
ATOM 989  H H    . LYS A 1 61 ? 118.906 1.860   1.362   1.00 0.00 ? 70 LYS A H    1 
ATOM 990  H HA   . LYS A 1 61 ? 116.980 3.418   0.195   1.00 0.00 ? 70 LYS A HA   1 
ATOM 991  H HB2  . LYS A 1 61 ? 117.615 2.678   2.987   1.00 0.00 ? 70 LYS A HB2  1 
ATOM 992  H HB3  . LYS A 1 61 ? 116.603 4.107   2.791   1.00 0.00 ? 70 LYS A HB3  1 
ATOM 993  H HG2  . LYS A 1 61 ? 114.824 2.918   2.174   1.00 0.00 ? 70 LYS A HG2  1 
ATOM 994  H HG3  . LYS A 1 61 ? 115.770 1.847   1.149   1.00 0.00 ? 70 LYS A HG3  1 
ATOM 995  H HD2  . LYS A 1 61 ? 116.202 1.522   4.040   1.00 0.00 ? 70 LYS A HD2  1 
ATOM 996  H HD3  . LYS A 1 61 ? 114.587 1.099   3.470   1.00 0.00 ? 70 LYS A HD3  1 
ATOM 997  H HE2  . LYS A 1 61 ? 115.422 -0.552  2.022   1.00 0.00 ? 70 LYS A HE2  1 
ATOM 998  H HE3  . LYS A 1 61 ? 117.070 0.055   2.150   1.00 0.00 ? 70 LYS A HE3  1 
ATOM 999  H HZ1  . LYS A 1 61 ? 116.818 -1.941  3.445   1.00 0.00 ? 70 LYS A HZ1  1 
ATOM 1000 H HZ2  . LYS A 1 61 ? 115.521 -1.275  4.302   1.00 0.00 ? 70 LYS A HZ2  1 
ATOM 1001 H HZ3  . LYS A 1 61 ? 117.074 -0.629  4.484   1.00 0.00 ? 70 LYS A HZ3  1 
ATOM 1002 N N    . LYS A 1 62 ? 119.136 5.273   1.867   1.00 0.00 ? 71 LYS A N    1 
ATOM 1003 C CA   . LYS A 1 62 ? 119.670 6.622   1.990   1.00 0.00 ? 71 LYS A CA   1 
ATOM 1004 C C    . LYS A 1 62 ? 120.238 7.087   0.655   1.00 0.00 ? 71 LYS A C    1 
ATOM 1005 O O    . LYS A 1 62 ? 120.119 8.256   0.289   1.00 0.00 ? 71 LYS A O    1 
ATOM 1006 C CB   . LYS A 1 62 ? 120.753 6.672   3.069   1.00 0.00 ? 71 LYS A CB   1 
ATOM 1007 C CG   . LYS A 1 62 ? 120.310 6.089   4.401   1.00 0.00 ? 71 LYS A CG   1 
ATOM 1008 C CD   . LYS A 1 62 ? 121.448 6.076   5.408   1.00 0.00 ? 71 LYS A CD   1 
ATOM 1009 C CE   . LYS A 1 62 ? 120.930 6.058   6.836   1.00 0.00 ? 71 LYS A CE   1 
ATOM 1010 N NZ   . LYS A 1 62 ? 122.038 5.985   7.828   1.00 0.00 ? 71 LYS A NZ   1 
ATOM 1011 H H    . LYS A 1 62 ? 119.550 4.546   2.377   1.00 0.00 ? 71 LYS A H    1 
ATOM 1012 H HA   . LYS A 1 62 ? 118.859 7.278   2.272   1.00 0.00 ? 71 LYS A HA   1 
ATOM 1013 H HB2  . LYS A 1 62 ? 121.613 6.116   2.725   1.00 0.00 ? 71 LYS A HB2  1 
ATOM 1014 H HB3  . LYS A 1 62 ? 121.040 7.700   3.228   1.00 0.00 ? 71 LYS A HB3  1 
ATOM 1015 H HG2  . LYS A 1 62 ? 119.501 6.687   4.794   1.00 0.00 ? 71 LYS A HG2  1 
ATOM 1016 H HG3  . LYS A 1 62 ? 119.968 5.076   4.244   1.00 0.00 ? 71 LYS A HG3  1 
ATOM 1017 H HD2  . LYS A 1 62 ? 122.052 5.196   5.243   1.00 0.00 ? 71 LYS A HD2  1 
ATOM 1018 H HD3  . LYS A 1 62 ? 122.052 6.961   5.265   1.00 0.00 ? 71 LYS A HD3  1 
ATOM 1019 H HE2  . LYS A 1 62 ? 120.362 6.961   7.012   1.00 0.00 ? 71 LYS A HE2  1 
ATOM 1020 H HE3  . LYS A 1 62 ? 120.287 5.196   6.962   1.00 0.00 ? 71 LYS A HE3  1 
ATOM 1021 H HZ1  . LYS A 1 62 ? 122.776 5.334   7.491   1.00 0.00 ? 71 LYS A HZ1  1 
ATOM 1022 H HZ2  . LYS A 1 62 ? 121.679 5.642   8.741   1.00 0.00 ? 71 LYS A HZ2  1 
ATOM 1023 H HZ3  . LYS A 1 62 ? 122.457 6.927   7.965   1.00 0.00 ? 71 LYS A HZ3  1 
ATOM 1024 N N    . ALA A 1 63 ? 120.850 6.157   -0.074  1.00 0.00 ? 72 ALA A N    1 
ATOM 1025 C CA   . ALA A 1 63 ? 121.429 6.466   -1.375  1.00 0.00 ? 72 ALA A CA   1 
ATOM 1026 C C    . ALA A 1 63 ? 120.365 7.004   -2.326  1.00 0.00 ? 72 ALA A C    1 
ATOM 1027 O O    . ALA A 1 63 ? 120.618 7.930   -3.097  1.00 0.00 ? 72 ALA A O    1 
ATOM 1028 C CB   . ALA A 1 63 ? 122.092 5.230   -1.966  1.00 0.00 ? 72 ALA A CB   1 
ATOM 1029 H H    . ALA A 1 63 ? 120.907 5.240   0.269   1.00 0.00 ? 72 ALA A H    1 
ATOM 1030 H HA   . ALA A 1 63 ? 122.188 7.221   -1.233  1.00 0.00 ? 72 ALA A HA   1 
ATOM 1031 H HB1  . ALA A 1 63 ? 122.991 5.519   -2.489  1.00 0.00 ? 72 ALA A HB1  1 
ATOM 1032 H HB2  . ALA A 1 63 ? 121.412 4.752   -2.655  1.00 0.00 ? 72 ALA A HB2  1 
ATOM 1033 H HB3  . ALA A 1 63 ? 122.343 4.542   -1.172  1.00 0.00 ? 72 ALA A HB3  1 
ATOM 1034 N N    . LYS A 1 64 ? 119.170 6.423   -2.258  1.00 0.00 ? 73 LYS A N    1 
ATOM 1035 C CA   . LYS A 1 64 ? 118.064 6.850   -3.107  1.00 0.00 ? 73 LYS A CA   1 
ATOM 1036 C C    . LYS A 1 64 ? 117.255 7.948   -2.423  1.00 0.00 ? 73 LYS A C    1 
ATOM 1037 O O    . LYS A 1 64 ? 116.620 8.769   -3.084  1.00 0.00 ? 73 LYS A O    1 
ATOM 1038 C CB   . LYS A 1 64 ? 117.158 5.663   -3.442  1.00 0.00 ? 73 LYS A CB   1 
ATOM 1039 C CG   . LYS A 1 64 ? 116.656 5.670   -4.877  1.00 0.00 ? 73 LYS A CG   1 
ATOM 1040 C CD   . LYS A 1 64 ? 117.293 4.560   -5.699  1.00 0.00 ? 73 LYS A CD   1 
ATOM 1041 C CE   . LYS A 1 64 ? 118.628 4.993   -6.281  1.00 0.00 ? 73 LYS A CE   1 
ATOM 1042 N NZ   . LYS A 1 64 ? 118.930 4.294   -7.561  1.00 0.00 ? 73 LYS A NZ   1 
ATOM 1043 H H    . LYS A 1 64 ? 119.028 5.694   -1.618  1.00 0.00 ? 73 LYS A H    1 
ATOM 1044 H HA   . LYS A 1 64 ? 118.481 7.244   -4.022  1.00 0.00 ? 73 LYS A HA   1 
ATOM 1045 H HB2  . LYS A 1 64 ? 117.711 4.746   -3.279  1.00 0.00 ? 73 LYS A HB2  1 
ATOM 1046 H HB3  . LYS A 1 64 ? 116.300 5.681   -2.782  1.00 0.00 ? 73 LYS A HB3  1 
ATOM 1047 H HG2  . LYS A 1 64 ? 115.586 5.532   -4.875  1.00 0.00 ? 73 LYS A HG2  1 
ATOM 1048 H HG3  . LYS A 1 64 ? 116.898 6.622   -5.327  1.00 0.00 ? 73 LYS A HG3  1 
ATOM 1049 H HD2  . LYS A 1 64 ? 117.451 3.701   -5.064  1.00 0.00 ? 73 LYS A HD2  1 
ATOM 1050 H HD3  . LYS A 1 64 ? 116.626 4.295   -6.506  1.00 0.00 ? 73 LYS A HD3  1 
ATOM 1051 H HE2  . LYS A 1 64 ? 118.599 6.057   -6.462  1.00 0.00 ? 73 LYS A HE2  1 
ATOM 1052 H HE3  . LYS A 1 64 ? 119.407 4.771   -5.567  1.00 0.00 ? 73 LYS A HE3  1 
ATOM 1053 H HZ1  . LYS A 1 64 ? 119.951 4.114   -7.637  1.00 0.00 ? 73 LYS A HZ1  1 
ATOM 1054 H HZ2  . LYS A 1 64 ? 118.631 4.878   -8.367  1.00 0.00 ? 73 LYS A HZ2  1 
ATOM 1055 H HZ3  . LYS A 1 64 ? 118.424 3.386   -7.600  1.00 0.00 ? 73 LYS A HZ3  1 
ATOM 1056 N N    . GLY A 1 65 ? 117.297 7.965   -1.093  1.00 0.00 ? 74 GLY A N    1 
ATOM 1057 C CA   . GLY A 1 65 ? 116.578 8.976   -0.342  1.00 0.00 ? 74 GLY A CA   1 
ATOM 1058 C C    . GLY A 1 65 ? 115.263 8.480   0.229   1.00 0.00 ? 74 GLY A C    1 
ATOM 1059 O O    . GLY A 1 65 ? 114.380 9.281   0.537   1.00 0.00 ? 74 GLY A O    1 
ATOM 1060 H H    . GLY A 1 65 ? 117.828 7.293   -0.619  1.00 0.00 ? 74 GLY A H    1 
ATOM 1061 H HA2  . GLY A 1 65 ? 117.204 9.307   0.476   1.00 0.00 ? 74 GLY A HA2  1 
ATOM 1062 H HA3  . GLY A 1 65 ? 116.379 9.817   -0.994  1.00 0.00 ? 74 GLY A HA3  1 
ATOM 1063 N N    . LEU A 1 66 ? 115.124 7.166   0.382   1.00 0.00 ? 75 LEU A N    1 
ATOM 1064 C CA   . LEU A 1 66 ? 113.895 6.605   0.933   1.00 0.00 ? 75 LEU A CA   1 
ATOM 1065 C C    . LEU A 1 66 ? 113.868 6.762   2.448   1.00 0.00 ? 75 LEU A C    1 
ATOM 1066 O O    . LEU A 1 66 ? 113.249 7.692   2.966   1.00 0.00 ? 75 LEU A O    1 
ATOM 1067 C CB   . LEU A 1 66 ? 113.736 5.131   0.551   1.00 0.00 ? 75 LEU A CB   1 
ATOM 1068 C CG   . LEU A 1 66 ? 113.382 4.880   -0.917  1.00 0.00 ? 75 LEU A CG   1 
ATOM 1069 C CD1  . LEU A 1 66 ? 113.429 3.392   -1.230  1.00 0.00 ? 75 LEU A CD1  1 
ATOM 1070 C CD2  . LEU A 1 66 ? 112.006 5.452   -1.243  1.00 0.00 ? 75 LEU A CD2  1 
ATOM 1071 H H    . LEU A 1 66 ? 115.858 6.568   0.128   1.00 0.00 ? 75 LEU A H    1 
ATOM 1072 H HA   . LEU A 1 66 ? 113.070 7.164   0.519   1.00 0.00 ? 75 LEU A HA   1 
ATOM 1073 H HB2  . LEU A 1 66 ? 114.662 4.615   0.777   1.00 0.00 ? 75 LEU A HB2  1 
ATOM 1074 H HB3  . LEU A 1 66 ? 112.950 4.709   1.163   1.00 0.00 ? 75 LEU A HB3  1 
ATOM 1075 H HG   . LEU A 1 66 ? 114.108 5.376   -1.545  1.00 0.00 ? 75 LEU A HG   1 
ATOM 1076 H HD11 . LEU A 1 66 ? 113.934 3.239   -2.172  1.00 0.00 ? 75 LEU A HD11 1 
ATOM 1077 H HD12 . LEU A 1 66 ? 112.423 3.004   -1.293  1.00 0.00 ? 75 LEU A HD12 1 
ATOM 1078 H HD13 . LEU A 1 66 ? 113.965 2.876   -0.447  1.00 0.00 ? 75 LEU A HD13 1 
ATOM 1079 H HD21 . LEU A 1 66 ? 111.874 6.395   -0.733  1.00 0.00 ? 75 LEU A HD21 1 
ATOM 1080 H HD22 . LEU A 1 66 ? 111.242 4.761   -0.921  1.00 0.00 ? 75 LEU A HD22 1 
ATOM 1081 H HD23 . LEU A 1 66 ? 111.923 5.607   -2.309  1.00 0.00 ? 75 LEU A HD23 1 
ATOM 1082 N N    . PHE A 1 67 ? 114.536 5.851   3.160   1.00 0.00 ? 76 PHE A N    1 
ATOM 1083 C CA   . PHE A 1 67 ? 114.570 5.909   4.630   1.00 0.00 ? 76 PHE A CA   1 
ATOM 1084 C C    . PHE A 1 67 ? 114.671 7.348   5.134   1.00 0.00 ? 76 PHE A C    1 
ATOM 1085 O O    . PHE A 1 67 ? 113.796 7.759   5.926   1.00 0.00 ? 76 PHE A O    1 
ATOM 1086 C CB   . PHE A 1 67 ? 115.733 5.092   5.198   1.00 0.00 ? 76 PHE A CB   1 
ATOM 1087 C CG   . PHE A 1 67 ? 115.284 3.834   5.880   1.00 0.00 ? 76 PHE A CG   1 
ATOM 1088 C CD1  . PHE A 1 67 ? 114.534 2.901   5.192   1.00 0.00 ? 76 PHE A CD1  1 
ATOM 1089 C CD2  . PHE A 1 67 ? 115.602 3.589   7.206   1.00 0.00 ? 76 PHE A CD2  1 
ATOM 1090 C CE1  . PHE A 1 67 ? 114.110 1.742   5.806   1.00 0.00 ? 76 PHE A CE1  1 
ATOM 1091 C CE2  . PHE A 1 67 ? 115.178 2.430   7.830   1.00 0.00 ? 76 PHE A CE2  1 
ATOM 1092 C CZ   . PHE A 1 67 ? 114.431 1.504   7.128   1.00 0.00 ? 76 PHE A CZ   1 
ATOM 1093 O OXT  . PHE A 1 67 ? 115.623 8.049   4.734   1.00 0.00 ? 76 PHE A OXT  1 
ATOM 1094 H H    . PHE A 1 67 ? 115.008 5.122   2.687   1.00 0.00 ? 76 PHE A H    1 
ATOM 1095 H HA   . PHE A 1 67 ? 113.647 5.483   4.988   1.00 0.00 ? 76 PHE A HA   1 
ATOM 1096 H HB2  . PHE A 1 67 ? 116.403 4.822   4.402   1.00 0.00 ? 76 PHE A HB2  1 
ATOM 1097 H HB3  . PHE A 1 67 ? 116.266 5.690   5.923   1.00 0.00 ? 76 PHE A HB3  1 
ATOM 1098 H HD1  . PHE A 1 67 ? 114.281 3.085   4.158   1.00 0.00 ? 76 PHE A HD1  1 
ATOM 1099 H HD2  . PHE A 1 67 ? 116.189 4.312   7.754   1.00 0.00 ? 76 PHE A HD2  1 
ATOM 1100 H HE1  . PHE A 1 67 ? 113.526 1.022   5.251   1.00 0.00 ? 76 PHE A HE1  1 
ATOM 1101 H HE2  . PHE A 1 67 ? 115.429 2.248   8.864   1.00 0.00 ? 76 PHE A HE2  1 
ATOM 1102 H HZ   . PHE A 1 67 ? 114.098 0.598   7.611   1.00 0.00 ? 76 PHE A HZ   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  10 10 MET MET A . n 
A 1 2  LEU 2  11 11 LEU LEU A . n 
A 1 3  ALA 3  12 12 ALA ALA A . n 
A 1 4  LYS 4  13 13 LYS LYS A . n 
A 1 5  LEU 5  14 14 LEU LEU A . n 
A 1 6  CYS 6  15 15 CYS CYS A . n 
A 1 7  LYS 7  16 16 LYS LYS A . n 
A 1 8  THR 8  17 17 THR THR A . n 
A 1 9  ILE 9  18 18 ILE ILE A . n 
A 1 10 TYR 10 19 19 TYR TYR A . n 
A 1 11 PRO 11 20 20 PRO PRO A . n 
A 1 12 LEU 12 21 21 LEU LEU A . n 
A 1 13 ALA 13 22 22 ALA ALA A . n 
A 1 14 ASP 14 23 23 ASP ASP A . n 
A 1 15 LEU 15 24 24 LEU LEU A . n 
A 1 16 LEU 16 25 25 LEU LEU A . n 
A 1 17 ALA 17 26 26 ALA ALA A . n 
A 1 18 ARG 18 27 27 ARG ARG A . n 
A 1 19 PRO 19 28 28 PRO PRO A . n 
A 1 20 LEU 20 29 29 LEU LEU A . n 
A 1 21 PRO 21 30 30 PRO PRO A . n 
A 1 22 GLU 22 31 31 GLU GLU A . n 
A 1 23 GLY 23 32 32 GLY GLY A . n 
A 1 24 VAL 24 33 33 VAL VAL A . n 
A 1 25 ASP 25 34 34 ASP ASP A . n 
A 1 26 PRO 26 35 35 PRO PRO A . n 
A 1 27 LEU 27 36 36 LEU LEU A . n 
A 1 28 LYS 28 37 37 LYS LYS A . n 
A 1 29 LEU 29 38 38 LEU LEU A . n 
A 1 30 GLU 30 39 39 GLU GLU A . n 
A 1 31 ILE 31 40 40 ILE ILE A . n 
A 1 32 TYR 32 41 41 TYR TYR A . n 
A 1 33 LEU 33 42 42 LEU LEU A . n 
A 1 34 THR 34 43 43 THR THR A . n 
A 1 35 ASP 35 44 44 ASP ASP A . n 
A 1 36 GLU 36 45 45 GLU GLU A . n 
A 1 37 ASP 37 46 46 ASP ASP A . n 
A 1 38 PHE 38 47 47 PHE PHE A . n 
A 1 39 GLU 39 48 48 GLU GLU A . n 
A 1 40 PHE 40 49 49 PHE PHE A . n 
A 1 41 ALA 41 50 50 ALA ALA A . n 
A 1 42 LEU 42 51 51 LEU LEU A . n 
A 1 43 ASP 43 52 52 ASP ASP A . n 
A 1 44 MET 44 53 53 MET MET A . n 
A 1 45 THR 45 54 54 THR THR A . n 
A 1 46 ARG 46 55 55 ARG ARG A . n 
A 1 47 ASP 47 56 56 ASP ASP A . n 
A 1 48 GLU 48 57 57 GLU GLU A . n 
A 1 49 TYR 49 58 58 TYR TYR A . n 
A 1 50 ASN 50 59 59 ASN ASN A . n 
A 1 51 ALA 51 60 60 ALA ALA A . n 
A 1 52 LEU 52 61 61 LEU LEU A . n 
A 1 53 PRO 53 62 62 PRO PRO A . n 
A 1 54 ALA 54 63 63 ALA ALA A . n 
A 1 55 TRP 55 64 64 TRP TRP A . n 
A 1 56 LYS 56 65 65 LYS LYS A . n 
A 1 57 GLN 57 66 66 GLN GLN A . n 
A 1 58 VAL 58 67 67 VAL VAL A . n 
A 1 59 ASN 59 68 68 ASN ASN A . n 
A 1 60 LEU 60 69 69 LEU LEU A . n 
A 1 61 LYS 61 70 70 LYS LYS A . n 
A 1 62 LYS 62 71 71 LYS LYS A . n 
A 1 63 ALA 63 72 72 ALA ALA A . n 
A 1 64 LYS 64 73 73 LYS LYS A . n 
A 1 65 GLY 65 74 74 GLY GLY A . n 
A 1 66 LEU 66 75 75 LEU LEU A . n 
A 1 67 PHE 67 76 76 PHE PHE A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-07-14 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
'Supervillin Headpiece' 1.3 mM '[U-13C; U-15N]' 1 
DTT                     4   mM ?                1 
TMSP                    500 uM ?                1 
'sodium chloride'       100 mM ?                1 
'sodium phosphate'      20  mM ?                1 
'Supervillin Headpiece' 1.3 mM '[U-15N]'        2 
DTT                     4   mM ?                2 
TMSP                    500 uM ?                2 
'sodium chloride'       100 mM ?                2 
'sodium phosphate'      20  mM ?                2 
'Supervillin Headpiece' 1.3 mM '[U-10% 13C]'    3 
DTT                     4   mM ?                3 
TMSP                    500 uM ?                3 
'sodium chloride'       100 mM ?                3 
'sodium phosphate'      20  mM ?                3 
'Supervillin Headpiece' 1.3 mM '[U-13C]'        4 
DTT                     4   mM ?                4 
TMSP                    500 uM ?                4 
'sodium chloride'       100 mM ?                4 
'sodium phosphate'      20  mM ?                4 
'Supervillin Headpiece' 1.3 mM ?                5 
DTT                     4   mM ?                5 
TMSP                    500 uM ?                5 
'sodium chloride'       100 mM ?                5 
'sodium phosphate'      20  mM ?                5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A THR 43 ? ? H A PHE 47 ? ? 1.49 
2 1 O A TRP 64 ? ? H A ASN 68 ? ? 1.51 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 26 ? ? 167.69  44.21   
2 1 PRO A 28 ? ? -40.39  73.42   
3 1 PRO A 30 ? ? -62.31  -155.14 
4 1 ASP A 44 ? ? -29.13  -40.39  
5 1 MET A 53 ? ? -125.60 -159.53 
6 1 LEU A 75 ? ? -78.17  -82.02  
#