data_2K6T
# 
_entry.id   2K6T 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2K6T         
RCSB  RCSB100748   
WWPDB D_1000100748 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2h8b PDB 'independent structure assignment'                                         
unspecified 2K6U PDB 'cross-linked derivative determine under the same experimental conditions' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K6T 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-07-23 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bullesbach, E.E.' 1 
'Hass, M.A.S.'     2 
'Jensen, M.R.'     3 
'Hansen, D.F.'     4 
'Kristensen, S.M.' 5 
'Schwabe, C.'      6 
'Led, J.J.'        7 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of a conformationally restricted fully active derivative of the human relaxin-like factor' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            47 
_citation.page_first                13308 
_citation.page_last                 13317 
_citation.year                      2008 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19086273 
_citation.pdbx_database_id_DOI      10.1021/bi801412w 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bullesbach, E.E.' 1 
primary 'Hass, M.A.S.'     2 
primary 'Jensen, M.R.'     3 
primary 'Hansen, D.F.'     4 
primary 'Kristensen, S.M.' 5 
primary 'Schwabe, C.'      6 
primary 'Led, J.J.'        7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'Insulin-like 3 A chain' 2778.189 1 ? ? 'UNP residues 106-131' ? 
2 polymer syn 'Insulin-like 3 B chain' 3528.118 1 ? ? 'UNP residues 25-55'   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Leydig insulin-like peptide, Ley-I-L, Relaxin-like factor, RLF' 
2 'Leydig insulin-like peptide, Ley-I-L, Relaxin-like factor, RLF' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no AAATNPARYCCLSGCTQQDLLTLCPY      AAATNPARYCCLSGCTQQDLLTLCPY      A ? 
2 'polypeptide(L)' no no PTPEMREKLCGHHFVRALVRVCGGPRWSTEA PTPEMREKLCGHHFVRALVRVCGGPRWSTEA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  ALA n 
1 3  ALA n 
1 4  THR n 
1 5  ASN n 
1 6  PRO n 
1 7  ALA n 
1 8  ARG n 
1 9  TYR n 
1 10 CYS n 
1 11 CYS n 
1 12 LEU n 
1 13 SER n 
1 14 GLY n 
1 15 CYS n 
1 16 THR n 
1 17 GLN n 
1 18 GLN n 
1 19 ASP n 
1 20 LEU n 
1 21 LEU n 
1 22 THR n 
1 23 LEU n 
1 24 CYS n 
1 25 PRO n 
1 26 TYR n 
2 1  PRO n 
2 2  THR n 
2 3  PRO n 
2 4  GLU n 
2 5  MET n 
2 6  ARG n 
2 7  GLU n 
2 8  LYS n 
2 9  LEU n 
2 10 CYS n 
2 11 GLY n 
2 12 HIS n 
2 13 HIS n 
2 14 PHE n 
2 15 VAL n 
2 16 ARG n 
2 17 ALA n 
2 18 LEU n 
2 19 VAL n 
2 20 ARG n 
2 21 VAL n 
2 22 CYS n 
2 23 GLY n 
2 24 GLY n 
2 25 PRO n 
2 26 ARG n 
2 27 TRP n 
2 28 SER n 
2 29 THR n 
2 30 GLU n 
2 31 ALA n 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
1 1 sample ? ? ? ? ? 'This sequence occurs naturally in humans.' 
2 1 sample ? ? ? ? ? 'This sequence occurs naturally in humans.' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP INSL3_HUMAN P51460 1 AAATNPARYCCLSGCTQQDLLTLCPY      106 ? 
2 UNP INSL3_HUMAN P51460 2 PTPEMREKLCGHHFVRALVRVCGGPRWSTEA 25  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2K6T A 1 ? 26 ? P51460 106 ? 131 ? 106 131 
2 2 2K6T B 1 ? 31 ? P51460 25  ? 55  ? 25  55  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
8 1  2 '2D DQF-COSY'          
9 2  2 '2D DQF-COSY'          
6 3  1 '2D DQF-COSY'          
9 4  2 '2D 1H-1H TOCSY'       
6 5  1 '2D 1H-1H TOCSY'       
9 6  2 '2D 1H-13C HSQC'       
8 7  2 '2D 1H-1H NOESY'       
9 8  2 '2D 1H-1H NOESY'       
1 9  1 '2D 1H-1H NOESY'       
2 10 1 '2D 1H-1H NOESY'       
3 11 1 '2D 1H-1H NOESY'       
4 12 1 '2D 1H-1H NOESY'       
5 13 1 '2D 1H-1H NOESY'       
6 14 1 '2D 1H-1H NOESY'       
7 15 1 '2D 1H-1H NOESY'       
6 16 1 '2D 1H-15N HSQC'       
9 17 2 '2D 1H-13C HSQC'       
5 18 3 '2D 1H-15N HSQC'       
5 19 3 '2D 1H-15N HSQC-NOESY' 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 ? 5.0 ? ? 293 K 
2 ? 5.0 ? ? 296 K 
3 ? 5.0 ? ? 301 K 
4 ? 5.0 ? ? 303 K 
5 ? 5.0 ? ? 306 K 
6 ? 5.0 ? ? 308 K 
7 ? 5.0 ? ? 313 K 
8 ? ?   ? ? 288 K 
9 ? ?   ? ? 308 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.1 mM RLF; H2O sodium acetate, 0.2 mM RLF; H2O sodium acetate, 0.3 mM RLF; H2O sodium acetate, 0.6 mM RLF; H2O sodium acetate, 1.2 mM RLF; H2O sodium acetate, 92% H2O/8% D2O
;
1 '92% H2O/8% D2O' 
'1.2 mM RLF; D2O sodium acetate, 1.2 mM RLF; D2O, 100% D2O' 2 '100% D2O'       
;1.2 mM [U-15N] Gly(47), Gly(48), Ala(107), Ala(112), Gly(119) RLF; H2O sodium acetate, 0.6 mM [U-15N] Gly(47), Gly(48), Ala(107), Ala(112), Gly(119) RLF; H2O sodium acetate, 0.4 mM [U-15N] Gly(47), Gly(48), Ala(107), Ala(112), Gly(119) RLF; H2O sodium acetate, 0.2 mM [U-15N] Gly(47), Gly(48), Ala(107), Ala(112), Gly(119) RLF; H2O sodium acetate, 92% H2O/8% D2O
;
3 '92% H2O/8% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Varian INOVA 1 'Varian INOVA' 
500 Varian INOVA 2 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2K6T 
_pdbx_nmr_refine.method             'torsion angle dynamics, simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2K6T 
_pdbx_nmr_details.text       'structure was determined using homonuclear NOE' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K6T 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   6 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K6T 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS      1.1   1 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS      1.1   2 
;Linge, O'Donoghue and Nilges
;
refinement                  ARIA     2.1   3 
;Linge, O'Donoghue and Nilges
;
'noe assignment'            ARIA     2.1   4 
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA     2.1   5 
Goddard                                             'peak picking'              SPARKY   3.110 6 
Goddard                                             'chemical shift assignment' SPARKY   3.110 7 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe  ?     8 
Wishart                                             'bond angle prediction'     PREDITOR ?     9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K6T 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K6T 
_struct.title                     'Solution structure of the relaxin-like factor' 
_struct.pdbx_descriptor           'Insulin-like 3 A chain, Insulin-like 3 B chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K6T 
_struct_keywords.pdbx_keywords   HORMONE 
_struct_keywords.text            'protein, Cleavage on pair of basic residues, Disease mutation, Hormone, Polymorphism, Secreted' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 5  ? SER A 13 ? ASN A 110 SER A 118 1 ? 9  
HELX_P HELX_P2 2 THR A 16 ? CYS A 24 ? THR A 121 CYS A 129 1 ? 9  
HELX_P HELX_P3 3 GLY B 11 ? CYS B 22 ? GLY B 35  CYS B 46  1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 115 A CYS 120 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 B CYS 10 SG ? ? A CYS 116 B CYS 34  1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf3 disulf ? ? A CYS 24 SG ? ? ? 1_555 B CYS 22 SG ? ? A CYS 129 B CYS 46  1_555 ? ? ? ? ? ? ? 2.038 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_atom_sites.entry_id                    2K6T 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1  ? -2.619  -1.199  16.907  1.00 0.00 ? 106 ALA A N    1  
ATOM 2     C CA   . ALA A 1 1  ? -2.733  -0.228  15.788  1.00 0.00 ? 106 ALA A CA   1  
ATOM 3     C C    . ALA A 1 1  ? -2.477  -0.907  14.448  1.00 0.00 ? 106 ALA A C    1  
ATOM 4     O O    . ALA A 1 1  ? -2.993  -0.479  13.415  1.00 0.00 ? 106 ALA A O    1  
ATOM 5     C CB   . ALA A 1 1  ? -1.761  0.924   15.992  1.00 0.00 ? 106 ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1  ? -1.664  -1.608  16.929  1.00 0.00 ? 106 ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1  ? -3.310  -1.966  16.786  1.00 0.00 ? 106 ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1  ? -2.803  -0.723  17.814  1.00 0.00 ? 106 ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1  ? -3.735  0.175   15.789  1.00 0.00 ? 106 ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1  ? -1.932  1.373   16.960  1.00 0.00 ? 106 ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1  ? -1.913  1.663   15.220  1.00 0.00 ? 106 ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1  ? -0.748  0.554   15.941  1.00 0.00 ? 106 ALA A HB3  1  
ATOM 13    N N    . ALA A 1 2  ? -1.677  -1.969  14.472  1.00 0.00 ? 107 ALA A N    1  
ATOM 14    C CA   . ALA A 1 2  ? -1.351  -2.712  13.260  1.00 0.00 ? 107 ALA A CA   1  
ATOM 15    C C    . ALA A 1 2  ? -2.575  -3.448  12.726  1.00 0.00 ? 107 ALA A C    1  
ATOM 16    O O    . ALA A 1 2  ? -3.609  -3.521  13.390  1.00 0.00 ? 107 ALA A O    1  
ATOM 17    C CB   . ALA A 1 2  ? -0.220  -3.692  13.532  1.00 0.00 ? 107 ALA A CB   1  
ATOM 18    H H    . ALA A 1 2  ? -1.296  -2.260  15.327  1.00 0.00 ? 107 ALA A H    1  
ATOM 19    H HA   . ALA A 1 2  ? -1.015  -2.006  12.516  1.00 0.00 ? 107 ALA A HA   1  
ATOM 20    H HB1  . ALA A 1 2  ? 0.024   -4.221  12.623  1.00 0.00 ? 107 ALA A HB1  1  
ATOM 21    H HB2  . ALA A 1 2  ? -0.530  -4.399  14.287  1.00 0.00 ? 107 ALA A HB2  1  
ATOM 22    H HB3  . ALA A 1 2  ? 0.648   -3.152  13.879  1.00 0.00 ? 107 ALA A HB3  1  
ATOM 23    N N    . ALA A 1 3  ? -2.448  -3.994  11.519  1.00 0.00 ? 108 ALA A N    1  
ATOM 24    C CA   . ALA A 1 3  ? -3.541  -4.725  10.889  1.00 0.00 ? 108 ALA A CA   1  
ATOM 25    C C    . ALA A 1 3  ? -3.075  -6.085  10.392  1.00 0.00 ? 108 ALA A C    1  
ATOM 26    O O    . ALA A 1 3  ? -2.099  -6.645  10.891  1.00 0.00 ? 108 ALA A O    1  
ATOM 27    C CB   . ALA A 1 3  ? -4.106  -3.927  9.726   1.00 0.00 ? 108 ALA A CB   1  
ATOM 28    H H    . ALA A 1 3  ? -1.599  -3.901  11.040  1.00 0.00 ? 108 ALA A H    1  
ATOM 29    H HA   . ALA A 1 3  ? -4.324  -4.862  11.620  1.00 0.00 ? 108 ALA A HA   1  
ATOM 30    H HB1  . ALA A 1 3  ? -5.183  -3.890  9.802   1.00 0.00 ? 108 ALA A HB1  1  
ATOM 31    H HB2  . ALA A 1 3  ? -3.828  -4.410  8.795   1.00 0.00 ? 108 ALA A HB2  1  
ATOM 32    H HB3  . ALA A 1 3  ? -3.706  -2.924  9.746   1.00 0.00 ? 108 ALA A HB3  1  
ATOM 33    N N    . THR A 1 4  ? -3.785  -6.606  9.399   1.00 0.00 ? 109 THR A N    1  
ATOM 34    C CA   . THR A 1 4  ? -3.455  -7.888  8.804   1.00 0.00 ? 109 THR A CA   1  
ATOM 35    C C    . THR A 1 4  ? -2.231  -7.742  7.905   1.00 0.00 ? 109 THR A C    1  
ATOM 36    O O    . THR A 1 4  ? -1.438  -6.817  8.074   1.00 0.00 ? 109 THR A O    1  
ATOM 37    C CB   . THR A 1 4  ? -4.645  -8.419  7.977   1.00 0.00 ? 109 THR A CB   1  
ATOM 38    O OG1  . THR A 1 4  ? -4.417  -9.782  7.598   1.00 0.00 ? 109 THR A OG1  1  
ATOM 39    C CG2  . THR A 1 4  ? -4.864  -7.566  6.729   1.00 0.00 ? 109 THR A CG2  1  
ATOM 40    H H    . THR A 1 4  ? -4.561  -6.114  9.060   1.00 0.00 ? 109 THR A H    1  
ATOM 41    H HA   . THR A 1 4  ? -3.239  -8.590  9.597   1.00 0.00 ? 109 THR A HA   1  
ATOM 42    H HB   . THR A 1 4  ? -5.536  -8.369  8.586   1.00 0.00 ? 109 THR A HB   1  
ATOM 43    H HG1  . THR A 1 4  ? -3.573  -10.075 7.946   1.00 0.00 ? 109 THR A HG1  1  
ATOM 44    H HG21 . THR A 1 4  ? -4.788  -6.516  6.985   1.00 0.00 ? 109 THR A HG21 1  
ATOM 45    H HG22 . THR A 1 4  ? -5.844  -7.767  6.323   1.00 0.00 ? 109 THR A HG22 1  
ATOM 46    H HG23 . THR A 1 4  ? -4.113  -7.811  5.991   1.00 0.00 ? 109 THR A HG23 1  
ATOM 47    N N    . ASN A 1 5  ? -2.078  -8.654  6.955   1.00 0.00 ? 110 ASN A N    1  
ATOM 48    C CA   . ASN A 1 5  ? -0.965  -8.601  6.020   1.00 0.00 ? 110 ASN A CA   1  
ATOM 49    C C    . ASN A 1 5  ? -1.297  -7.602  4.917   1.00 0.00 ? 110 ASN A C    1  
ATOM 50    O O    . ASN A 1 5  ? -2.119  -7.889  4.055   1.00 0.00 ? 110 ASN A O    1  
ATOM 51    C CB   . ASN A 1 5  ? -0.706  -9.983  5.416   1.00 0.00 ? 110 ASN A CB   1  
ATOM 52    C CG   . ASN A 1 5  ? -0.062  -10.934 6.399   1.00 0.00 ? 110 ASN A CG   1  
ATOM 53    O OD1  . ASN A 1 5  ? -0.743  -11.569 7.205   1.00 0.00 ? 110 ASN A OD1  1  
ATOM 54    N ND2  . ASN A 1 5  ? 1.255   -11.046 6.329   1.00 0.00 ? 110 ASN A ND2  1  
ATOM 55    H H    . ASN A 1 5  ? -2.734  -9.371  6.873   1.00 0.00 ? 110 ASN A H    1  
ATOM 56    H HA   . ASN A 1 5  ? -0.088  -8.271  6.553   1.00 0.00 ? 110 ASN A HA   1  
ATOM 57    H HB2  . ASN A 1 5  ? -1.640  -10.412 5.097   1.00 0.00 ? 110 ASN A HB2  1  
ATOM 58    H HB3  . ASN A 1 5  ? -0.053  -9.880  4.562   1.00 0.00 ? 110 ASN A HB3  1  
ATOM 59    H HD21 . ASN A 1 5  ? 1.729   -10.514 5.656   1.00 0.00 ? 110 ASN A HD21 1  
ATOM 60    H HD22 . ASN A 1 5  ? 1.698   -11.656 6.949   1.00 0.00 ? 110 ASN A HD22 1  
ATOM 61    N N    . PRO A 1 6  ? -0.666  -6.414  4.927   1.00 0.00 ? 111 PRO A N    1  
ATOM 62    C CA   . PRO A 1 6  ? -0.942  -5.374  3.932   1.00 0.00 ? 111 PRO A CA   1  
ATOM 63    C C    . PRO A 1 6  ? -0.700  -5.839  2.500   1.00 0.00 ? 111 PRO A C    1  
ATOM 64    O O    . PRO A 1 6  ? -1.447  -5.481  1.596   1.00 0.00 ? 111 PRO A O    1  
ATOM 65    C CB   . PRO A 1 6  ? 0.012   -4.238  4.316   1.00 0.00 ? 111 PRO A CB   1  
ATOM 66    C CG   . PRO A 1 6  ? 1.067   -4.884  5.146   1.00 0.00 ? 111 PRO A CG   1  
ATOM 67    C CD   . PRO A 1 6  ? 0.376   -5.994  5.880   1.00 0.00 ? 111 PRO A CD   1  
ATOM 68    H HA   . PRO A 1 6  ? -1.959  -5.025  4.015   1.00 0.00 ? 111 PRO A HA   1  
ATOM 69    H HB2  . PRO A 1 6  ? 0.423   -3.795  3.424   1.00 0.00 ? 111 PRO A HB2  1  
ATOM 70    H HB3  . PRO A 1 6  ? -0.527  -3.490  4.879   1.00 0.00 ? 111 PRO A HB3  1  
ATOM 71    H HG2  . PRO A 1 6  ? 1.845   -5.280  4.511   1.00 0.00 ? 111 PRO A HG2  1  
ATOM 72    H HG3  . PRO A 1 6  ? 1.476   -4.169  5.844   1.00 0.00 ? 111 PRO A HG3  1  
ATOM 73    H HD2  . PRO A 1 6  ? 1.065   -6.801  6.084   1.00 0.00 ? 111 PRO A HD2  1  
ATOM 74    H HD3  . PRO A 1 6  ? -0.063  -5.627  6.796   1.00 0.00 ? 111 PRO A HD3  1  
ATOM 75    N N    . ALA A 1 7  ? 0.334   -6.641  2.292   1.00 0.00 ? 112 ALA A N    1  
ATOM 76    C CA   . ALA A 1 7  ? 0.645   -7.142  0.957   1.00 0.00 ? 112 ALA A CA   1  
ATOM 77    C C    . ALA A 1 7  ? -0.530  -7.913  0.377   1.00 0.00 ? 112 ALA A C    1  
ATOM 78    O O    . ALA A 1 7  ? -0.869  -7.769  -0.798  1.00 0.00 ? 112 ALA A O    1  
ATOM 79    C CB   . ALA A 1 7  ? 1.882   -8.013  1.005   1.00 0.00 ? 112 ALA A CB   1  
ATOM 80    H H    . ALA A 1 7  ? 0.900   -6.903  3.048   1.00 0.00 ? 112 ALA A H    1  
ATOM 81    H HA   . ALA A 1 7  ? 0.852   -6.295  0.323   1.00 0.00 ? 112 ALA A HA   1  
ATOM 82    H HB1  . ALA A 1 7  ? 1.604   -9.023  1.270   1.00 0.00 ? 112 ALA A HB1  1  
ATOM 83    H HB2  . ALA A 1 7  ? 2.557   -7.620  1.747   1.00 0.00 ? 112 ALA A HB2  1  
ATOM 84    H HB3  . ALA A 1 7  ? 2.365   -8.012  0.039   1.00 0.00 ? 112 ALA A HB3  1  
ATOM 85    N N    . ARG A 1 8  ? -1.142  -8.732  1.214   1.00 0.00 ? 113 ARG A N    1  
ATOM 86    C CA   . ARG A 1 8  ? -2.293  -9.536  0.810   1.00 0.00 ? 113 ARG A CA   1  
ATOM 87    C C    . ARG A 1 8  ? -3.561  -8.685  0.762   1.00 0.00 ? 113 ARG A C    1  
ATOM 88    O O    . ARG A 1 8  ? -4.314  -8.711  -0.210  1.00 0.00 ? 113 ARG A O    1  
ATOM 89    C CB   . ARG A 1 8  ? -2.495  -10.687 1.799   1.00 0.00 ? 113 ARG A CB   1  
ATOM 90    C CG   . ARG A 1 8  ? -3.247  -11.874 1.216   1.00 0.00 ? 113 ARG A CG   1  
ATOM 91    C CD   . ARG A 1 8  ? -2.458  -12.556 0.108   1.00 0.00 ? 113 ARG A CD   1  
ATOM 92    N NE   . ARG A 1 8  ? -3.205  -13.658 -0.493  1.00 0.00 ? 113 ARG A NE   1  
ATOM 93    C CZ   . ARG A 1 8  ? -2.694  -14.494 -1.392  1.00 0.00 ? 113 ARG A CZ   1  
ATOM 94    N NH1  . ARG A 1 8  ? -1.439  -14.353 -1.797  1.00 0.00 ? 113 ARG A NH1  1  
ATOM 95    N NH2  . ARG A 1 8  ? -3.439  -15.471 -1.888  1.00 0.00 ? 113 ARG A NH2  1  
ATOM 96    H H    . ARG A 1 8  ? -0.800  -8.807  2.132   1.00 0.00 ? 113 ARG A H    1  
ATOM 97    H HA   . ARG A 1 8  ? -2.097  -9.939  -0.172  1.00 0.00 ? 113 ARG A HA   1  
ATOM 98    H HB2  . ARG A 1 8  ? -1.530  -11.024 2.144   1.00 0.00 ? 113 ARG A HB2  1  
ATOM 99    H HB3  . ARG A 1 8  ? -3.055  -10.317 2.645   1.00 0.00 ? 113 ARG A HB3  1  
ATOM 100   H HG2  . ARG A 1 8  ? -3.431  -12.590 2.002   1.00 0.00 ? 113 ARG A HG2  1  
ATOM 101   H HG3  . ARG A 1 8  ? -4.188  -11.529 0.815   1.00 0.00 ? 113 ARG A HG3  1  
ATOM 102   H HD2  . ARG A 1 8  ? -2.230  -11.828 -0.657  1.00 0.00 ? 113 ARG A HD2  1  
ATOM 103   H HD3  . ARG A 1 8  ? -1.537  -12.941 0.523   1.00 0.00 ? 113 ARG A HD3  1  
ATOM 104   H HE   . ARG A 1 8  ? -4.136  -13.781 -0.211  1.00 0.00 ? 113 ARG A HE   1  
ATOM 105   H HH11 . ARG A 1 8  ? -0.873  -13.617 -1.425  1.00 0.00 ? 113 ARG A HH11 1  
ATOM 106   H HH12 . ARG A 1 8  ? -1.058  -14.984 -2.473  1.00 0.00 ? 113 ARG A HH12 1  
ATOM 107   H HH21 . ARG A 1 8  ? -4.387  -15.580 -1.586  1.00 0.00 ? 113 ARG A HH21 1  
ATOM 108   H HH22 . ARG A 1 8  ? -3.055  -16.100 -2.564  1.00 0.00 ? 113 ARG A HH22 1  
ATOM 109   N N    . TYR A 1 9  ? -3.774  -7.937  1.835   1.00 0.00 ? 114 TYR A N    1  
ATOM 110   C CA   . TYR A 1 9  ? -4.936  -7.066  1.981   1.00 0.00 ? 114 TYR A CA   1  
ATOM 111   C C    . TYR A 1 9  ? -5.085  -6.098  0.800   1.00 0.00 ? 114 TYR A C    1  
ATOM 112   O O    . TYR A 1 9  ? -6.183  -5.955  0.261   1.00 0.00 ? 114 TYR A O    1  
ATOM 113   C CB   . TYR A 1 9  ? -4.844  -6.360  3.350   1.00 0.00 ? 114 TYR A CB   1  
ATOM 114   C CG   . TYR A 1 9  ? -5.199  -4.888  3.394   1.00 0.00 ? 114 TYR A CG   1  
ATOM 115   C CD1  . TYR A 1 9  ? -6.325  -4.384  2.760   1.00 0.00 ? 114 TYR A CD1  1  
ATOM 116   C CD2  . TYR A 1 9  ? -4.397  -4.006  4.102   1.00 0.00 ? 114 TYR A CD2  1  
ATOM 117   C CE1  . TYR A 1 9  ? -6.637  -3.046  2.823   1.00 0.00 ? 114 TYR A CE1  1  
ATOM 118   C CE2  . TYR A 1 9  ? -4.698  -2.665  4.175   1.00 0.00 ? 114 TYR A CE2  1  
ATOM 119   C CZ   . TYR A 1 9  ? -5.823  -2.185  3.533   1.00 0.00 ? 114 TYR A CZ   1  
ATOM 120   O OH   . TYR A 1 9  ? -6.132  -0.846  3.600   1.00 0.00 ? 114 TYR A OH   1  
ATOM 121   H H    . TYR A 1 9  ? -3.124  -7.975  2.563   1.00 0.00 ? 114 TYR A H    1  
ATOM 122   H HA   . TYR A 1 9  ? -5.810  -7.695  1.993   1.00 0.00 ? 114 TYR A HA   1  
ATOM 123   H HB2  . TYR A 1 9  ? -5.505  -6.862  4.037   1.00 0.00 ? 114 TYR A HB2  1  
ATOM 124   H HB3  . TYR A 1 9  ? -3.831  -6.460  3.715   1.00 0.00 ? 114 TYR A HB3  1  
ATOM 125   H HD1  . TYR A 1 9  ? -6.960  -5.057  2.205   1.00 0.00 ? 114 TYR A HD1  1  
ATOM 126   H HD2  . TYR A 1 9  ? -3.521  -4.383  4.605   1.00 0.00 ? 114 TYR A HD2  1  
ATOM 127   H HE1  . TYR A 1 9  ? -7.514  -2.681  2.317   1.00 0.00 ? 114 TYR A HE1  1  
ATOM 128   H HE2  . TYR A 1 9  ? -4.051  -1.999  4.731   1.00 0.00 ? 114 TYR A HE2  1  
ATOM 129   H HH   . TYR A 1 9  ? -7.065  -0.743  3.799   1.00 0.00 ? 114 TYR A HH   1  
ATOM 130   N N    . CYS A 1 10 ? -4.004  -5.444  0.383   1.00 0.00 ? 115 CYS A N    1  
ATOM 131   C CA   . CYS A 1 10 ? -4.092  -4.513  -0.743  1.00 0.00 ? 115 CYS A CA   1  
ATOM 132   C C    . CYS A 1 10 ? -4.211  -5.270  -2.065  1.00 0.00 ? 115 CYS A C    1  
ATOM 133   O O    . CYS A 1 10 ? -4.727  -4.744  -3.048  1.00 0.00 ? 115 CYS A O    1  
ATOM 134   C CB   . CYS A 1 10 ? -2.886  -3.569  -0.803  1.00 0.00 ? 115 CYS A CB   1  
ATOM 135   S SG   . CYS A 1 10 ? -2.271  -2.986  0.812   1.00 0.00 ? 115 CYS A SG   1  
ATOM 136   H H    . CYS A 1 10 ? -3.146  -5.587  0.830   1.00 0.00 ? 115 CYS A H    1  
ATOM 137   H HA   . CYS A 1 10 ? -4.987  -3.924  -0.606  1.00 0.00 ? 115 CYS A HA   1  
ATOM 138   H HB2  . CYS A 1 10 ? -2.068  -4.069  -1.301  1.00 0.00 ? 115 CYS A HB2  1  
ATOM 139   H HB3  . CYS A 1 10 ? -3.165  -2.698  -1.380  1.00 0.00 ? 115 CYS A HB3  1  
ATOM 140   N N    . CYS A 1 11 ? -3.731  -6.506  -2.087  1.00 0.00 ? 116 CYS A N    1  
ATOM 141   C CA   . CYS A 1 11 ? -3.790  -7.322  -3.297  1.00 0.00 ? 116 CYS A CA   1  
ATOM 142   C C    . CYS A 1 11 ? -5.235  -7.591  -3.705  1.00 0.00 ? 116 CYS A C    1  
ATOM 143   O O    . CYS A 1 11 ? -5.572  -7.558  -4.888  1.00 0.00 ? 116 CYS A O    1  
ATOM 144   C CB   . CYS A 1 11 ? -3.057  -8.647  -3.078  1.00 0.00 ? 116 CYS A CB   1  
ATOM 145   S SG   . CYS A 1 11 ? -3.049  -9.745  -4.532  1.00 0.00 ? 116 CYS A SG   1  
ATOM 146   H H    . CYS A 1 11 ? -3.328  -6.880  -1.276  1.00 0.00 ? 116 CYS A H    1  
ATOM 147   H HA   . CYS A 1 11 ? -3.302  -6.776  -4.093  1.00 0.00 ? 116 CYS A HA   1  
ATOM 148   H HB2  . CYS A 1 11 ? -2.029  -8.441  -2.818  1.00 0.00 ? 116 CYS A HB2  1  
ATOM 149   H HB3  . CYS A 1 11 ? -3.526  -9.179  -2.266  1.00 0.00 ? 116 CYS A HB3  1  
ATOM 150   N N    . LEU A 1 12 ? -6.083  -7.856  -2.718  1.00 0.00 ? 117 LEU A N    1  
ATOM 151   C CA   . LEU A 1 12 ? -7.487  -8.135  -2.968  1.00 0.00 ? 117 LEU A CA   1  
ATOM 152   C C    . LEU A 1 12 ? -8.293  -6.854  -3.170  1.00 0.00 ? 117 LEU A C    1  
ATOM 153   O O    . LEU A 1 12 ? -9.107  -6.764  -4.089  1.00 0.00 ? 117 LEU A O    1  
ATOM 154   C CB   . LEU A 1 12 ? -8.068  -8.936  -1.807  1.00 0.00 ? 117 LEU A CB   1  
ATOM 155   C CG   . LEU A 1 12 ? -7.943  -10.457 -1.933  1.00 0.00 ? 117 LEU A CG   1  
ATOM 156   C CD1  . LEU A 1 12 ? -8.423  -11.139 -0.660  1.00 0.00 ? 117 LEU A CD1  1  
ATOM 157   C CD2  . LEU A 1 12 ? -8.729  -10.962 -3.135  1.00 0.00 ? 117 LEU A CD2  1  
ATOM 158   H H    . LEU A 1 12 ? -5.757  -7.867  -1.796  1.00 0.00 ? 117 LEU A H    1  
ATOM 159   H HA   . LEU A 1 12 ? -7.551  -8.729  -3.862  1.00 0.00 ? 117 LEU A HA   1  
ATOM 160   H HB2  . LEU A 1 12 ? -7.561  -8.629  -0.908  1.00 0.00 ? 117 LEU A HB2  1  
ATOM 161   H HB3  . LEU A 1 12 ? -9.110  -8.687  -1.714  1.00 0.00 ? 117 LEU A HB3  1  
ATOM 162   H HG   . LEU A 1 12 ? -6.905  -10.715 -2.078  1.00 0.00 ? 117 LEU A HG   1  
ATOM 163   H HD11 . LEU A 1 12 ? -7.807  -10.828 0.170   1.00 0.00 ? 117 LEU A HD11 1  
ATOM 164   H HD12 . LEU A 1 12 ? -8.354  -12.210 -0.779  1.00 0.00 ? 117 LEU A HD12 1  
ATOM 165   H HD13 . LEU A 1 12 ? -9.450  -10.862 -0.470  1.00 0.00 ? 117 LEU A HD13 1  
ATOM 166   H HD21 . LEU A 1 12 ? -8.641  -12.037 -3.196  1.00 0.00 ? 117 LEU A HD21 1  
ATOM 167   H HD22 . LEU A 1 12 ? -8.334  -10.517 -4.036  1.00 0.00 ? 117 LEU A HD22 1  
ATOM 168   H HD23 . LEU A 1 12 ? -9.769  -10.692 -3.024  1.00 0.00 ? 117 LEU A HD23 1  
ATOM 169   N N    . SER A 1 13 ? -8.064  -5.863  -2.311  1.00 0.00 ? 118 SER A N    1  
ATOM 170   C CA   . SER A 1 13 ? -8.793  -4.601  -2.397  1.00 0.00 ? 118 SER A CA   1  
ATOM 171   C C    . SER A 1 13 ? -7.910  -3.457  -2.898  1.00 0.00 ? 118 SER A C    1  
ATOM 172   O O    . SER A 1 13 ? -8.257  -2.777  -3.864  1.00 0.00 ? 118 SER A O    1  
ATOM 173   C CB   . SER A 1 13 ? -9.383  -4.239  -1.033  1.00 0.00 ? 118 SER A CB   1  
ATOM 174   O OG   . SER A 1 13 ? -10.175 -3.067  -1.116  1.00 0.00 ? 118 SER A OG   1  
ATOM 175   H H    . SER A 1 13 ? -7.393  -5.984  -1.607  1.00 0.00 ? 118 SER A H    1  
ATOM 176   H HA   . SER A 1 13 ? -9.603  -4.738  -3.096  1.00 0.00 ? 118 SER A HA   1  
ATOM 177   H HB2  . SER A 1 13 ? -10.002 -5.052  -0.683  1.00 0.00 ? 118 SER A HB2  1  
ATOM 178   H HB3  . SER A 1 13 ? -8.581  -4.069  -0.330  1.00 0.00 ? 118 SER A HB3  1  
ATOM 179   H HG   . SER A 1 13 ? -10.514 -2.972  -2.008  1.00 0.00 ? 118 SER A HG   1  
ATOM 180   N N    . GLY A 1 14 ? -6.774  -3.246  -2.237  1.00 0.00 ? 119 GLY A N    1  
ATOM 181   C CA   . GLY A 1 14 ? -5.879  -2.171  -2.623  1.00 0.00 ? 119 GLY A CA   1  
ATOM 182   C C    . GLY A 1 14 ? -5.560  -1.264  -1.454  1.00 0.00 ? 119 GLY A C    1  
ATOM 183   O O    . GLY A 1 14 ? -6.210  -1.352  -0.411  1.00 0.00 ? 119 GLY A O    1  
ATOM 184   H H    . GLY A 1 14 ? -6.534  -3.829  -1.486  1.00 0.00 ? 119 GLY A H    1  
ATOM 185   H HA2  . GLY A 1 14 ? -4.960  -2.602  -2.990  1.00 0.00 ? 119 GLY A HA2  1  
ATOM 186   H HA3  . GLY A 1 14 ? -6.339  -1.593  -3.413  1.00 0.00 ? 119 GLY A HA3  1  
ATOM 187   N N    . CYS A 1 15 ? -4.566  -0.393  -1.607  1.00 0.00 ? 120 CYS A N    1  
ATOM 188   C CA   . CYS A 1 15 ? -4.194  0.501   -0.517  1.00 0.00 ? 120 CYS A CA   1  
ATOM 189   C C    . CYS A 1 15 ? -3.845  1.898   -0.995  1.00 0.00 ? 120 CYS A C    1  
ATOM 190   O O    . CYS A 1 15 ? -3.187  2.079   -2.019  1.00 0.00 ? 120 CYS A O    1  
ATOM 191   C CB   . CYS A 1 15 ? -3.043  -0.083  0.301   1.00 0.00 ? 120 CYS A CB   1  
ATOM 192   S SG   . CYS A 1 15 ? -3.542  -1.498  1.332   1.00 0.00 ? 120 CYS A SG   1  
ATOM 193   H H    . CYS A 1 15 ? -4.087  -0.345  -2.462  1.00 0.00 ? 120 CYS A H    1  
ATOM 194   H HA   . CYS A 1 15 ? -5.045  0.578   0.121   1.00 0.00 ? 120 CYS A HA   1  
ATOM 195   H HB2  . CYS A 1 15 ? -2.263  -0.411  -0.359  1.00 0.00 ? 120 CYS A HB2  1  
ATOM 196   H HB3  . CYS A 1 15 ? -2.653  0.682   0.956   1.00 0.00 ? 120 CYS A HB3  1  
ATOM 197   N N    . THR A 1 16 ? -4.313  2.886   -0.236  1.00 0.00 ? 121 THR A N    1  
ATOM 198   C CA   . THR A 1 16 ? -4.052  4.281   -0.545  1.00 0.00 ? 121 THR A CA   1  
ATOM 199   C C    . THR A 1 16 ? -2.687  4.679   -0.056  1.00 0.00 ? 121 THR A C    1  
ATOM 200   O O    . THR A 1 16 ? -2.121  4.030   0.822   1.00 0.00 ? 121 THR A O    1  
ATOM 201   C CB   . THR A 1 16 ? -5.058  5.231   0.128   1.00 0.00 ? 121 THR A CB   1  
ATOM 202   O OG1  . THR A 1 16 ? -4.987  5.101   1.552   1.00 0.00 ? 121 THR A OG1  1  
ATOM 203   C CG2  . THR A 1 16 ? -6.453  4.944   -0.340  1.00 0.00 ? 121 THR A CG2  1  
ATOM 204   H H    . THR A 1 16 ? -4.848  2.666   0.555   1.00 0.00 ? 121 THR A H    1  
ATOM 205   H HA   . THR A 1 16 ? -4.108  4.416   -1.615  1.00 0.00 ? 121 THR A HA   1  
ATOM 206   H HB   . THR A 1 16 ? -4.808  6.241   -0.150  1.00 0.00 ? 121 THR A HB   1  
ATOM 207   H HG1  . THR A 1 16 ? -5.389  4.272   1.819   1.00 0.00 ? 121 THR A HG1  1  
ATOM 208   H HG21 . THR A 1 16 ? -6.389  4.347   -1.223  1.00 0.00 ? 121 THR A HG21 1  
ATOM 209   H HG22 . THR A 1 16 ? -6.962  5.871   -0.561  1.00 0.00 ? 121 THR A HG22 1  
ATOM 210   H HG23 . THR A 1 16 ? -6.991  4.405   0.425   1.00 0.00 ? 121 THR A HG23 1  
ATOM 211   N N    . GLN A 1 17 ? -2.169  5.757   -0.610  1.00 0.00 ? 122 GLN A N    1  
ATOM 212   C CA   . GLN A 1 17 ? -0.887  6.263   -0.189  1.00 0.00 ? 122 GLN A CA   1  
ATOM 213   C C    . GLN A 1 17 ? -0.921  6.474   1.310   1.00 0.00 ? 122 GLN A C    1  
ATOM 214   O O    . GLN A 1 17 ? 0.109   6.577   1.948   1.00 0.00 ? 122 GLN A O    1  
ATOM 215   C CB   . GLN A 1 17 ? -0.569  7.564   -0.919  1.00 0.00 ? 122 GLN A CB   1  
ATOM 216   C CG   . GLN A 1 17 ? -0.030  7.347   -2.323  1.00 0.00 ? 122 GLN A CG   1  
ATOM 217   C CD   . GLN A 1 17 ? -0.206  8.559   -3.217  1.00 0.00 ? 122 GLN A CD   1  
ATOM 218   O OE1  . GLN A 1 17 ? 0.589   8.795   -4.128  1.00 0.00 ? 122 GLN A OE1  1  
ATOM 219   N NE2  . GLN A 1 17 ? -1.252  9.338   -2.962  1.00 0.00 ? 122 GLN A NE2  1  
ATOM 220   H H    . GLN A 1 17 ? -2.668  6.227   -1.310  1.00 0.00 ? 122 GLN A H    1  
ATOM 221   H HA   . GLN A 1 17 ? -0.122  5.521   -0.413  1.00 0.00 ? 122 GLN A HA   1  
ATOM 222   H HB2  . GLN A 1 17 ? -1.471  8.153   -0.989  1.00 0.00 ? 122 GLN A HB2  1  
ATOM 223   H HB3  . GLN A 1 17 ? 0.162   8.109   -0.354  1.00 0.00 ? 122 GLN A HB3  1  
ATOM 224   H HG2  . GLN A 1 17 ? 1.023   7.120   -2.257  1.00 0.00 ? 122 GLN A HG2  1  
ATOM 225   H HG3  . GLN A 1 17 ? -0.545  6.509   -2.765  1.00 0.00 ? 122 GLN A HG3  1  
ATOM 226   H HE21 . GLN A 1 17 ? -1.842  9.089   -2.220  1.00 0.00 ? 122 GLN A HE21 1  
ATOM 227   H HE22 . GLN A 1 17 ? -1.390  10.128  -3.525  1.00 0.00 ? 122 GLN A HE22 1  
ATOM 228   N N    . GLN A 1 18 ? -2.120  6.528   1.879   1.00 0.00 ? 123 GLN A N    1  
ATOM 229   C CA   . GLN A 1 18 ? -2.241  6.675   3.307   1.00 0.00 ? 123 GLN A CA   1  
ATOM 230   C C    . GLN A 1 18 ? -1.816  5.376   3.957   1.00 0.00 ? 123 GLN A C    1  
ATOM 231   O O    . GLN A 1 18 ? -0.909  5.361   4.784   1.00 0.00 ? 123 GLN A O    1  
ATOM 232   C CB   . GLN A 1 18 ? -3.667  7.023   3.696   1.00 0.00 ? 123 GLN A CB   1  
ATOM 233   C CG   . GLN A 1 18 ? -4.191  8.288   3.040   1.00 0.00 ? 123 GLN A CG   1  
ATOM 234   C CD   . GLN A 1 18 ? -5.626  8.589   3.420   1.00 0.00 ? 123 GLN A CD   1  
ATOM 235   O OE1  . GLN A 1 18 ? -5.888  9.296   4.394   1.00 0.00 ? 123 GLN A OE1  1  
ATOM 236   N NE2  . GLN A 1 18 ? -6.566  8.047   2.654   1.00 0.00 ? 123 GLN A NE2  1  
ATOM 237   H H    . GLN A 1 18 ? -2.935  6.462   1.332   1.00 0.00 ? 123 GLN A H    1  
ATOM 238   H HA   . GLN A 1 18 ? -1.573  7.459   3.625   1.00 0.00 ? 123 GLN A HA   1  
ATOM 239   H HB2  . GLN A 1 18 ? -4.309  6.206   3.418   1.00 0.00 ? 123 GLN A HB2  1  
ATOM 240   H HB3  . GLN A 1 18 ? -3.704  7.152   4.759   1.00 0.00 ? 123 GLN A HB3  1  
ATOM 241   H HG2  . GLN A 1 18 ? -3.571  9.119   3.343   1.00 0.00 ? 123 GLN A HG2  1  
ATOM 242   H HG3  . GLN A 1 18 ? -4.134  8.172   1.967   1.00 0.00 ? 123 GLN A HG3  1  
ATOM 243   H HE21 . GLN A 1 18 ? -6.283  7.492   1.898   1.00 0.00 ? 123 GLN A HE21 1  
ATOM 244   H HE22 . GLN A 1 18 ? -7.504  8.226   2.876   1.00 0.00 ? 123 GLN A HE22 1  
ATOM 245   N N    . ASP A 1 19 ? -2.463  4.278   3.560   1.00 0.00 ? 124 ASP A N    1  
ATOM 246   C CA   . ASP A 1 19 ? -2.109  2.973   4.097   1.00 0.00 ? 124 ASP A CA   1  
ATOM 247   C C    . ASP A 1 19 ? -0.614  2.757   3.919   1.00 0.00 ? 124 ASP A C    1  
ATOM 248   O O    . ASP A 1 19 ? 0.123   2.538   4.882   1.00 0.00 ? 124 ASP A O    1  
ATOM 249   C CB   . ASP A 1 19 ? -2.887  1.856   3.389   1.00 0.00 ? 124 ASP A CB   1  
ATOM 250   C CG   . ASP A 1 19 ? -3.795  1.097   4.336   1.00 0.00 ? 124 ASP A CG   1  
ATOM 251   O OD1  . ASP A 1 19 ? -3.321  0.128   4.964   1.00 0.00 ? 124 ASP A OD1  1  
ATOM 252   O OD2  . ASP A 1 19 ? -4.980  1.475   4.453   1.00 0.00 ? 124 ASP A OD2  1  
ATOM 253   H H    . ASP A 1 19 ? -3.184  4.350   2.891   1.00 0.00 ? 124 ASP A H    1  
ATOM 254   H HA   . ASP A 1 19 ? -2.345  2.965   5.152   1.00 0.00 ? 124 ASP A HA   1  
ATOM 255   H HB2  . ASP A 1 19 ? -3.495  2.284   2.606   1.00 0.00 ? 124 ASP A HB2  1  
ATOM 256   H HB3  . ASP A 1 19 ? -2.189  1.156   2.948   1.00 0.00 ? 124 ASP A HB3  1  
ATOM 257   N N    . LEU A 1 20 ? -0.173  2.869   2.673   1.00 0.00 ? 125 LEU A N    1  
ATOM 258   C CA   . LEU A 1 20 ? 1.228   2.695   2.336   1.00 0.00 ? 125 LEU A CA   1  
ATOM 259   C C    . LEU A 1 20 ? 2.107   3.682   3.112   1.00 0.00 ? 125 LEU A C    1  
ATOM 260   O O    . LEU A 1 20 ? 3.246   3.358   3.469   1.00 0.00 ? 125 LEU A O    1  
ATOM 261   C CB   . LEU A 1 20 ? 1.411   2.830   0.818   1.00 0.00 ? 125 LEU A CB   1  
ATOM 262   C CG   . LEU A 1 20 ? 0.614   1.817   0.001   1.00 0.00 ? 125 LEU A CG   1  
ATOM 263   C CD1  . LEU A 1 20 ? -0.402  2.521   -0.875  1.00 0.00 ? 125 LEU A CD1  1  
ATOM 264   C CD2  . LEU A 1 20 ? 1.537   0.991   -0.855  1.00 0.00 ? 125 LEU A CD2  1  
ATOM 265   H H    . LEU A 1 20 ? -0.810  3.074   1.960   1.00 0.00 ? 125 LEU A H    1  
ATOM 266   H HA   . LEU A 1 20 ? 1.506   1.693   2.628   1.00 0.00 ? 125 LEU A HA   1  
ATOM 267   H HB2  . LEU A 1 20 ? 1.110   3.813   0.509   1.00 0.00 ? 125 LEU A HB2  1  
ATOM 268   H HB3  . LEU A 1 20 ? 2.449   2.712   0.582   1.00 0.00 ? 125 LEU A HB3  1  
ATOM 269   H HG   . LEU A 1 20 ? 0.085   1.153   0.668   1.00 0.00 ? 125 LEU A HG   1  
ATOM 270   H HD11 . LEU A 1 20 ? -1.381  2.104   -0.698  1.00 0.00 ? 125 LEU A HD11 1  
ATOM 271   H HD12 . LEU A 1 20 ? -0.132  2.379   -1.911  1.00 0.00 ? 125 LEU A HD12 1  
ATOM 272   H HD13 . LEU A 1 20 ? -0.409  3.576   -0.644  1.00 0.00 ? 125 LEU A HD13 1  
ATOM 273   H HD21 . LEU A 1 20 ? 2.365   0.641   -0.257  1.00 0.00 ? 125 LEU A HD21 1  
ATOM 274   H HD22 . LEU A 1 20 ? 1.906   1.610   -1.663  1.00 0.00 ? 125 LEU A HD22 1  
ATOM 275   H HD23 . LEU A 1 20 ? 1.000   0.149   -1.260  1.00 0.00 ? 125 LEU A HD23 1  
ATOM 276   N N    . LEU A 1 21 ? 1.574   4.875   3.397   1.00 0.00 ? 126 LEU A N    1  
ATOM 277   C CA   . LEU A 1 21 ? 2.321   5.875   4.154   1.00 0.00 ? 126 LEU A CA   1  
ATOM 278   C C    . LEU A 1 21 ? 2.601   5.369   5.561   1.00 0.00 ? 126 LEU A C    1  
ATOM 279   O O    . LEU A 1 21 ? 3.593   5.750   6.183   1.00 0.00 ? 126 LEU A O    1  
ATOM 280   C CB   . LEU A 1 21 ? 1.546   7.196   4.234   1.00 0.00 ? 126 LEU A CB   1  
ATOM 281   C CG   . LEU A 1 21 ? 1.967   8.267   3.225   1.00 0.00 ? 126 LEU A CG   1  
ATOM 282   C CD1  . LEU A 1 21 ? 1.137   9.528   3.412   1.00 0.00 ? 126 LEU A CD1  1  
ATOM 283   C CD2  . LEU A 1 21 ? 3.450   8.581   3.355   1.00 0.00 ? 126 LEU A CD2  1  
ATOM 284   H H    . LEU A 1 21 ? 0.665   5.088   3.090   1.00 0.00 ? 126 LEU A H    1  
ATOM 285   H HA   . LEU A 1 21 ? 3.260   6.044   3.649   1.00 0.00 ? 126 LEU A HA   1  
ATOM 286   H HB2  . LEU A 1 21 ? 0.500   6.979   4.076   1.00 0.00 ? 126 LEU A HB2  1  
ATOM 287   H HB3  . LEU A 1 21 ? 1.661   7.601   5.225   1.00 0.00 ? 126 LEU A HB3  1  
ATOM 288   H HG   . LEU A 1 21 ? 1.787   7.895   2.226   1.00 0.00 ? 126 LEU A HG   1  
ATOM 289   H HD11 . LEU A 1 21 ? 0.092   9.294   3.276   1.00 0.00 ? 126 LEU A HD11 1  
ATOM 290   H HD12 . LEU A 1 21 ? 1.437   10.267  2.683   1.00 0.00 ? 126 LEU A HD12 1  
ATOM 291   H HD13 . LEU A 1 21 ? 1.293   9.918   4.406   1.00 0.00 ? 126 LEU A HD13 1  
ATOM 292   H HD21 . LEU A 1 21 ? 3.661   8.920   4.358   1.00 0.00 ? 126 LEU A HD21 1  
ATOM 293   H HD22 . LEU A 1 21 ? 3.718   9.354   2.649   1.00 0.00 ? 126 LEU A HD22 1  
ATOM 294   H HD23 . LEU A 1 21 ? 4.026   7.691   3.148   1.00 0.00 ? 126 LEU A HD23 1  
ATOM 295   N N    . THR A 1 22 ? 1.719   4.506   6.056   1.00 0.00 ? 127 THR A N    1  
ATOM 296   C CA   . THR A 1 22 ? 1.869   3.955   7.393   1.00 0.00 ? 127 THR A CA   1  
ATOM 297   C C    . THR A 1 22 ? 2.420   2.532   7.359   1.00 0.00 ? 127 THR A C    1  
ATOM 298   O O    . THR A 1 22 ? 2.656   1.936   8.411   1.00 0.00 ? 127 THR A O    1  
ATOM 299   C CB   . THR A 1 22 ? 0.535   3.946   8.173   1.00 0.00 ? 127 THR A CB   1  
ATOM 300   O OG1  . THR A 1 22 ? -0.012  2.622   8.192   1.00 0.00 ? 127 THR A OG1  1  
ATOM 301   C CG2  . THR A 1 22 ? -0.481  4.898   7.559   1.00 0.00 ? 127 THR A CG2  1  
ATOM 302   H H    . THR A 1 22 ? 0.951   4.239   5.509   1.00 0.00 ? 127 THR A H    1  
ATOM 303   H HA   . THR A 1 22 ? 2.564   4.583   7.930   1.00 0.00 ? 127 THR A HA   1  
ATOM 304   H HB   . THR A 1 22 ? 0.728   4.260   9.187   1.00 0.00 ? 127 THR A HB   1  
ATOM 305   H HG1  . THR A 1 22 ? -0.911  2.652   8.529   1.00 0.00 ? 127 THR A HG1  1  
ATOM 306   H HG21 . THR A 1 22 ? 0.015   5.797   7.228   1.00 0.00 ? 127 THR A HG21 1  
ATOM 307   H HG22 . THR A 1 22 ? -1.227  5.153   8.298   1.00 0.00 ? 127 THR A HG22 1  
ATOM 308   H HG23 . THR A 1 22 ? -0.960  4.419   6.718   1.00 0.00 ? 127 THR A HG23 1  
ATOM 309   N N    . LEU A 1 23 ? 2.632   1.979   6.161   1.00 0.00 ? 128 LEU A N    1  
ATOM 310   C CA   . LEU A 1 23 ? 3.146   0.628   6.053   1.00 0.00 ? 128 LEU A CA   1  
ATOM 311   C C    . LEU A 1 23 ? 4.658   0.649   5.864   1.00 0.00 ? 128 LEU A C    1  
ATOM 312   O O    . LEU A 1 23 ? 5.331   -0.365  6.054   1.00 0.00 ? 128 LEU A O    1  
ATOM 313   C CB   . LEU A 1 23 ? 2.440   -0.110  4.918   1.00 0.00 ? 128 LEU A CB   1  
ATOM 314   C CG   . LEU A 1 23 ? 0.933   -0.276  5.120   1.00 0.00 ? 128 LEU A CG   1  
ATOM 315   C CD1  . LEU A 1 23 ? 0.256   -0.701  3.832   1.00 0.00 ? 128 LEU A CD1  1  
ATOM 316   C CD2  . LEU A 1 23 ? 0.668   -1.287  6.210   1.00 0.00 ? 128 LEU A CD2  1  
ATOM 317   H H    . LEU A 1 23 ? 2.463   2.490   5.336   1.00 0.00 ? 128 LEU A H    1  
ATOM 318   H HA   . LEU A 1 23 ? 2.924   0.121   6.982   1.00 0.00 ? 128 LEU A HA   1  
ATOM 319   H HB2  . LEU A 1 23 ? 2.603   0.425   4.004   1.00 0.00 ? 128 LEU A HB2  1  
ATOM 320   H HB3  . LEU A 1 23 ? 2.878   -1.088  4.827   1.00 0.00 ? 128 LEU A HB3  1  
ATOM 321   H HG   . LEU A 1 23 ? 0.509   0.664   5.428   1.00 0.00 ? 128 LEU A HG   1  
ATOM 322   H HD11 . LEU A 1 23 ? 0.522   -1.724  3.609   1.00 0.00 ? 128 LEU A HD11 1  
ATOM 323   H HD12 . LEU A 1 23 ? 0.580   -0.060  3.026   1.00 0.00 ? 128 LEU A HD12 1  
ATOM 324   H HD13 . LEU A 1 23 ? -0.815  -0.625  3.946   1.00 0.00 ? 128 LEU A HD13 1  
ATOM 325   H HD21 . LEU A 1 23 ? 0.892   -0.851  7.172   1.00 0.00 ? 128 LEU A HD21 1  
ATOM 326   H HD22 . LEU A 1 23 ? 1.299   -2.139  6.045   1.00 0.00 ? 128 LEU A HD22 1  
ATOM 327   H HD23 . LEU A 1 23 ? -0.369  -1.591  6.181   1.00 0.00 ? 128 LEU A HD23 1  
ATOM 328   N N    . CYS A 1 24 ? 5.190   1.814   5.487   1.00 0.00 ? 129 CYS A N    1  
ATOM 329   C CA   . CYS A 1 24 ? 6.632   1.971   5.306   1.00 0.00 ? 129 CYS A CA   1  
ATOM 330   C C    . CYS A 1 24 ? 7.344   1.956   6.661   1.00 0.00 ? 129 CYS A C    1  
ATOM 331   O O    . CYS A 1 24 ? 6.742   2.270   7.687   1.00 0.00 ? 129 CYS A O    1  
ATOM 332   C CB   . CYS A 1 24 ? 6.949   3.271   4.562   1.00 0.00 ? 129 CYS A CB   1  
ATOM 333   S SG   . CYS A 1 24 ? 6.458   4.790   5.447   1.00 0.00 ? 129 CYS A SG   1  
ATOM 334   H H    . CYS A 1 24 ? 4.595   2.578   5.308   1.00 0.00 ? 129 CYS A H    1  
ATOM 335   H HA   . CYS A 1 24 ? 6.982   1.134   4.719   1.00 0.00 ? 129 CYS A HA   1  
ATOM 336   H HB2  . CYS A 1 24 ? 8.014   3.325   4.391   1.00 0.00 ? 129 CYS A HB2  1  
ATOM 337   H HB3  . CYS A 1 24 ? 6.441   3.263   3.612   1.00 0.00 ? 129 CYS A HB3  1  
ATOM 338   N N    . PRO A 1 25 ? 8.641   1.587   6.684   1.00 0.00 ? 130 PRO A N    1  
ATOM 339   C CA   . PRO A 1 25 ? 9.434   1.521   7.910   1.00 0.00 ? 130 PRO A CA   1  
ATOM 340   C C    . PRO A 1 25 ? 10.010  2.875   8.313   1.00 0.00 ? 130 PRO A C    1  
ATOM 341   O O    . PRO A 1 25 ? 11.034  2.945   8.995   1.00 0.00 ? 130 PRO A O    1  
ATOM 342   C CB   . PRO A 1 25 ? 10.569  0.544   7.554   1.00 0.00 ? 130 PRO A CB   1  
ATOM 343   C CG   . PRO A 1 25 ? 10.375  0.178   6.112   1.00 0.00 ? 130 PRO A CG   1  
ATOM 344   C CD   . PRO A 1 25 ? 9.447   1.204   5.527   1.00 0.00 ? 130 PRO A CD   1  
ATOM 345   H HA   . PRO A 1 25 ? 8.857   1.119   8.731   1.00 0.00 ? 130 PRO A HA   1  
ATOM 346   H HB2  . PRO A 1 25 ? 11.520  1.031   7.708   1.00 0.00 ? 130 PRO A HB2  1  
ATOM 347   H HB3  . PRO A 1 25 ? 10.504  -0.326  8.190   1.00 0.00 ? 130 PRO A HB3  1  
ATOM 348   H HG2  . PRO A 1 25 ? 11.324  0.200   5.599   1.00 0.00 ? 130 PRO A HG2  1  
ATOM 349   H HG3  . PRO A 1 25 ? 9.936   -0.807  6.042   1.00 0.00 ? 130 PRO A HG3  1  
ATOM 350   H HD2  . PRO A 1 25 ? 10.005  2.045   5.145   1.00 0.00 ? 130 PRO A HD2  1  
ATOM 351   H HD3  . PRO A 1 25 ? 8.833   0.768   4.753   1.00 0.00 ? 130 PRO A HD3  1  
ATOM 352   N N    . TYR A 1 26 ? 9.351   3.948   7.888   1.00 0.00 ? 131 TYR A N    1  
ATOM 353   C CA   . TYR A 1 26 ? 9.797   5.299   8.209   1.00 0.00 ? 131 TYR A CA   1  
ATOM 354   C C    . TYR A 1 26 ? 8.611   6.206   8.516   1.00 0.00 ? 131 TYR A C    1  
ATOM 355   O O    . TYR A 1 26 ? 8.010   6.738   7.559   1.00 0.00 ? 131 TYR A O    1  
ATOM 356   C CB   . TYR A 1 26 ? 10.618  5.881   7.056   1.00 0.00 ? 131 TYR A CB   1  
ATOM 357   C CG   . TYR A 1 26 ? 12.024  5.331   6.972   1.00 0.00 ? 131 TYR A CG   1  
ATOM 358   C CD1  . TYR A 1 26 ? 13.068  5.942   7.655   1.00 0.00 ? 131 TYR A CD1  1  
ATOM 359   C CD2  . TYR A 1 26 ? 12.309  4.205   6.210   1.00 0.00 ? 131 TYR A CD2  1  
ATOM 360   C CE1  . TYR A 1 26 ? 14.356  5.446   7.581   1.00 0.00 ? 131 TYR A CE1  1  
ATOM 361   C CE2  . TYR A 1 26 ? 13.594  3.702   6.132   1.00 0.00 ? 131 TYR A CE2  1  
ATOM 362   C CZ   . TYR A 1 26 ? 14.613  4.327   6.820   1.00 0.00 ? 131 TYR A CZ   1  
ATOM 363   O OH   . TYR A 1 26 ? 15.895  3.830   6.745   1.00 0.00 ? 131 TYR A OH   1  
ATOM 364   O OXT  . TYR A 1 26 ? 8.291   6.377   9.711   1.00 0.00 ? 131 TYR A OXT  1  
ATOM 365   H H    . TYR A 1 26 ? 8.544   3.828   7.345   1.00 0.00 ? 131 TYR A H    1  
ATOM 366   H HA   . TYR A 1 26 ? 10.423  5.239   9.088   1.00 0.00 ? 131 TYR A HA   1  
ATOM 367   H HB2  . TYR A 1 26 ? 10.120  5.660   6.123   1.00 0.00 ? 131 TYR A HB2  1  
ATOM 368   H HB3  . TYR A 1 26 ? 10.686  6.952   7.176   1.00 0.00 ? 131 TYR A HB3  1  
ATOM 369   H HD1  . TYR A 1 26 ? 12.864  6.819   8.251   1.00 0.00 ? 131 TYR A HD1  1  
ATOM 370   H HD2  . TYR A 1 26 ? 11.508  3.718   5.673   1.00 0.00 ? 131 TYR A HD2  1  
ATOM 371   H HE1  . TYR A 1 26 ? 15.154  5.936   8.120   1.00 0.00 ? 131 TYR A HE1  1  
ATOM 372   H HE2  . TYR A 1 26 ? 13.795  2.825   5.536   1.00 0.00 ? 131 TYR A HE2  1  
ATOM 373   H HH   . TYR A 1 26 ? 16.114  3.647   5.828   1.00 0.00 ? 131 TYR A HH   1  
ATOM 374   N N    . PRO B 2 1  ? 0.455   12.863  -10.979 1.00 0.00 ? 25  PRO B N    1  
ATOM 375   C CA   . PRO B 2 1  ? 0.202   11.653  -11.799 1.00 0.00 ? 25  PRO B CA   1  
ATOM 376   C C    . PRO B 2 1  ? -0.371  10.525  -10.947 1.00 0.00 ? 25  PRO B C    1  
ATOM 377   O O    . PRO B 2 1  ? 0.341   9.930   -10.141 1.00 0.00 ? 25  PRO B O    1  
ATOM 378   C CB   . PRO B 2 1  ? 1.511   11.213  -12.439 1.00 0.00 ? 25  PRO B CB   1  
ATOM 379   C CG   . PRO B 2 1  ? 2.483   12.266  -12.027 1.00 0.00 ? 25  PRO B CG   1  
ATOM 380   C CD   . PRO B 2 1  ? 1.916   12.908  -10.781 1.00 0.00 ? 25  PRO B CD   1  
ATOM 381   H H2   . PRO B 2 1  ? -0.132  12.756  -10.137 1.00 0.00 ? 25  PRO B H2   1  
ATOM 382   H H3   . PRO B 2 1  ? -0.012  13.641  -11.503 1.00 0.00 ? 25  PRO B H3   1  
ATOM 383   H HA   . PRO B 2 1  ? -0.507  11.905  -12.573 1.00 0.00 ? 25  PRO B HA   1  
ATOM 384   H HB2  . PRO B 2 1  ? 1.792   10.239  -12.063 1.00 0.00 ? 25  PRO B HB2  1  
ATOM 385   H HB3  . PRO B 2 1  ? 1.398   11.177  -13.512 1.00 0.00 ? 25  PRO B HB3  1  
ATOM 386   H HG2  . PRO B 2 1  ? 3.441   11.815  -11.812 1.00 0.00 ? 25  PRO B HG2  1  
ATOM 387   H HG3  . PRO B 2 1  ? 2.584   13.000  -12.814 1.00 0.00 ? 25  PRO B HG3  1  
ATOM 388   H HD2  . PRO B 2 1  ? 2.200   12.344  -9.906  1.00 0.00 ? 25  PRO B HD2  1  
ATOM 389   H HD3  . PRO B 2 1  ? 2.258   13.929  -10.697 1.00 0.00 ? 25  PRO B HD3  1  
ATOM 390   N N    . THR B 2 2  ? -1.660  10.240  -11.145 1.00 0.00 ? 26  THR B N    1  
ATOM 391   C CA   . THR B 2 2  ? -2.362  9.189   -10.405 1.00 0.00 ? 26  THR B CA   1  
ATOM 392   C C    . THR B 2 2  ? -2.236  9.372   -8.888  1.00 0.00 ? 26  THR B C    1  
ATOM 393   O O    . THR B 2 2  ? -1.135  9.345   -8.340  1.00 0.00 ? 26  THR B O    1  
ATOM 394   C CB   . THR B 2 2  ? -1.861  7.780   -10.788 1.00 0.00 ? 26  THR B CB   1  
ATOM 395   O OG1  . THR B 2 2  ? -0.478  7.628   -10.451 1.00 0.00 ? 26  THR B OG1  1  
ATOM 396   C CG2  . THR B 2 2  ? -2.058  7.521   -12.274 1.00 0.00 ? 26  THR B CG2  1  
ATOM 397   H H    . THR B 2 2  ? -2.158  10.755  -11.814 1.00 0.00 ? 26  THR B H    1  
ATOM 398   H HA   . THR B 2 2  ? -3.406  9.251   -10.674 1.00 0.00 ? 26  THR B HA   1  
ATOM 399   H HB   . THR B 2 2  ? -2.437  7.050   -10.235 1.00 0.00 ? 26  THR B HB   1  
ATOM 400   H HG1  . THR B 2 2  ? 0.023   7.419   -11.243 1.00 0.00 ? 26  THR B HG1  1  
ATOM 401   H HG21 . THR B 2 2  ? -1.508  8.256   -12.843 1.00 0.00 ? 26  THR B HG21 1  
ATOM 402   H HG22 . THR B 2 2  ? -3.109  7.593   -12.516 1.00 0.00 ? 26  THR B HG22 1  
ATOM 403   H HG23 . THR B 2 2  ? -1.700  6.533   -12.519 1.00 0.00 ? 26  THR B HG23 1  
ATOM 404   N N    . PRO B 2 3  ? -3.371  9.547   -8.182  1.00 0.00 ? 27  PRO B N    1  
ATOM 405   C CA   . PRO B 2 3  ? -3.385  9.737   -6.742  1.00 0.00 ? 27  PRO B CA   1  
ATOM 406   C C    . PRO B 2 3  ? -3.587  8.425   -6.000  1.00 0.00 ? 27  PRO B C    1  
ATOM 407   O O    . PRO B 2 3  ? -3.307  7.352   -6.535  1.00 0.00 ? 27  PRO B O    1  
ATOM 408   C CB   . PRO B 2 3  ? -4.593  10.651  -6.554  1.00 0.00 ? 27  PRO B CB   1  
ATOM 409   C CG   . PRO B 2 3  ? -5.541  10.276  -7.652  1.00 0.00 ? 27  PRO B CG   1  
ATOM 410   C CD   . PRO B 2 3  ? -4.741  9.561   -8.720  1.00 0.00 ? 27  PRO B CD   1  
ATOM 411   H HA   . PRO B 2 3  ? -2.493  10.228  -6.385  1.00 0.00 ? 27  PRO B HA   1  
ATOM 412   H HB2  . PRO B 2 3  ? -5.029  10.478  -5.580  1.00 0.00 ? 27  PRO B HB2  1  
ATOM 413   H HB3  . PRO B 2 3  ? -4.284  11.682  -6.638  1.00 0.00 ? 27  PRO B HB3  1  
ATOM 414   H HG2  . PRO B 2 3  ? -6.306  9.620   -7.264  1.00 0.00 ? 27  PRO B HG2  1  
ATOM 415   H HG3  . PRO B 2 3  ? -5.991  11.168  -8.062  1.00 0.00 ? 27  PRO B HG3  1  
ATOM 416   H HD2  . PRO B 2 3  ? -5.110  8.551   -8.852  1.00 0.00 ? 27  PRO B HD2  1  
ATOM 417   H HD3  . PRO B 2 3  ? -4.783  10.104  -9.651  1.00 0.00 ? 27  PRO B HD3  1  
ATOM 418   N N    . GLU B 2 4  ? -4.072  8.513   -4.768  1.00 0.00 ? 28  GLU B N    1  
ATOM 419   C CA   . GLU B 2 4  ? -4.324  7.319   -3.975  1.00 0.00 ? 28  GLU B CA   1  
ATOM 420   C C    . GLU B 2 4  ? -5.650  6.706   -4.370  1.00 0.00 ? 28  GLU B C    1  
ATOM 421   O O    . GLU B 2 4  ? -6.659  6.844   -3.678  1.00 0.00 ? 28  GLU B O    1  
ATOM 422   C CB   . GLU B 2 4  ? -4.303  7.625   -2.485  1.00 0.00 ? 28  GLU B CB   1  
ATOM 423   C CG   . GLU B 2 4  ? -4.957  8.944   -2.108  1.00 0.00 ? 28  GLU B CG   1  
ATOM 424   C CD   . GLU B 2 4  ? -5.097  9.115   -0.608  1.00 0.00 ? 28  GLU B CD   1  
ATOM 425   O OE1  . GLU B 2 4  ? -4.160  9.654   0.018   1.00 0.00 ? 28  GLU B OE1  1  
ATOM 426   O OE2  . GLU B 2 4  ? -6.144  8.711   -0.060  1.00 0.00 ? 28  GLU B OE2  1  
ATOM 427   H H    . GLU B 2 4  ? -4.264  9.394   -4.391  1.00 0.00 ? 28  GLU B H    1  
ATOM 428   H HA   . GLU B 2 4  ? -3.540  6.611   -4.197  1.00 0.00 ? 28  GLU B HA   1  
ATOM 429   H HB2  . GLU B 2 4  ? -4.818  6.833   -1.963  1.00 0.00 ? 28  GLU B HB2  1  
ATOM 430   H HB3  . GLU B 2 4  ? -3.280  7.646   -2.166  1.00 0.00 ? 28  GLU B HB3  1  
ATOM 431   H HG2  . GLU B 2 4  ? -4.355  9.753   -2.489  1.00 0.00 ? 28  GLU B HG2  1  
ATOM 432   H HG3  . GLU B 2 4  ? -5.941  8.986   -2.554  1.00 0.00 ? 28  GLU B HG3  1  
ATOM 433   N N    . MET B 2 5  ? -5.623  6.027   -5.499  1.00 0.00 ? 29  MET B N    1  
ATOM 434   C CA   . MET B 2 5  ? -6.807  5.381   -6.041  1.00 0.00 ? 29  MET B CA   1  
ATOM 435   C C    . MET B 2 5  ? -7.035  4.030   -5.377  1.00 0.00 ? 29  MET B C    1  
ATOM 436   O O    . MET B 2 5  ? -7.818  3.208   -5.852  1.00 0.00 ? 29  MET B O    1  
ATOM 437   C CB   . MET B 2 5  ? -6.667  5.218   -7.555  1.00 0.00 ? 29  MET B CB   1  
ATOM 438   C CG   . MET B 2 5  ? -7.973  4.898   -8.266  1.00 0.00 ? 29  MET B CG   1  
ATOM 439   S SD   . MET B 2 5  ? -7.783  4.797   -10.056 1.00 0.00 ? 29  MET B SD   1  
ATOM 440   C CE   . MET B 2 5  ? -9.469  4.458   -10.557 1.00 0.00 ? 29  MET B CE   1  
ATOM 441   H H    . MET B 2 5  ? -4.771  5.951   -5.972  1.00 0.00 ? 29  MET B H    1  
ATOM 442   H HA   . MET B 2 5  ? -7.651  6.013   -5.830  1.00 0.00 ? 29  MET B HA   1  
ATOM 443   H HB2  . MET B 2 5  ? -6.270  6.136   -7.970  1.00 0.00 ? 29  MET B HB2  1  
ATOM 444   H HB3  . MET B 2 5  ? -5.969  4.416   -7.750  1.00 0.00 ? 29  MET B HB3  1  
ATOM 445   H HG2  . MET B 2 5  ? -8.341  3.950   -7.903  1.00 0.00 ? 29  MET B HG2  1  
ATOM 446   H HG3  . MET B 2 5  ? -8.691  5.672   -8.036  1.00 0.00 ? 29  MET B HG3  1  
ATOM 447   H HE1  . MET B 2 5  ? -9.792  3.521   -10.129 1.00 0.00 ? 29  MET B HE1  1  
ATOM 448   H HE2  . MET B 2 5  ? -9.519  4.398   -11.635 1.00 0.00 ? 29  MET B HE2  1  
ATOM 449   H HE3  . MET B 2 5  ? -10.113 5.253   -10.212 1.00 0.00 ? 29  MET B HE3  1  
ATOM 450   N N    . ARG B 2 6  ? -6.346  3.831   -4.259  1.00 0.00 ? 30  ARG B N    1  
ATOM 451   C CA   . ARG B 2 6  ? -6.439  2.604   -3.488  1.00 0.00 ? 30  ARG B CA   1  
ATOM 452   C C    . ARG B 2 6  ? -6.489  1.378   -4.384  1.00 0.00 ? 30  ARG B C    1  
ATOM 453   O O    . ARG B 2 6  ? -7.200  0.416   -4.092  1.00 0.00 ? 30  ARG B O    1  
ATOM 454   C CB   . ARG B 2 6  ? -7.678  2.644   -2.632  1.00 0.00 ? 30  ARG B CB   1  
ATOM 455   C CG   . ARG B 2 6  ? -7.463  2.053   -1.262  1.00 0.00 ? 30  ARG B CG   1  
ATOM 456   C CD   . ARG B 2 6  ? -8.382  0.891   -1.041  1.00 0.00 ? 30  ARG B CD   1  
ATOM 457   N NE   . ARG B 2 6  ? -8.404  0.477   0.356   1.00 0.00 ? 30  ARG B NE   1  
ATOM 458   C CZ   . ARG B 2 6  ? -9.357  -0.282  0.891   1.00 0.00 ? 30  ARG B CZ   1  
ATOM 459   N NH1  . ARG B 2 6  ? -10.368 -0.706  0.146   1.00 0.00 ? 30  ARG B NH1  1  
ATOM 460   N NH2  . ARG B 2 6  ? -9.300  -0.613  2.174   1.00 0.00 ? 30  ARG B NH2  1  
ATOM 461   H H    . ARG B 2 6  ? -5.776  4.543   -3.931  1.00 0.00 ? 30  ARG B H    1  
ATOM 462   H HA   . ARG B 2 6  ? -5.575  2.536   -2.845  1.00 0.00 ? 30  ARG B HA   1  
ATOM 463   H HB2  . ARG B 2 6  ? -7.998  3.667   -2.514  1.00 0.00 ? 30  ARG B HB2  1  
ATOM 464   H HB3  . ARG B 2 6  ? -8.450  2.082   -3.133  1.00 0.00 ? 30  ARG B HB3  1  
ATOM 465   H HG2  . ARG B 2 6  ? -6.440  1.721   -1.180  1.00 0.00 ? 30  ARG B HG2  1  
ATOM 466   H HG3  . ARG B 2 6  ? -7.663  2.807   -0.517  1.00 0.00 ? 30  ARG B HG3  1  
ATOM 467   H HD2  . ARG B 2 6  ? -9.370  1.193   -1.339  1.00 0.00 ? 30  ARG B HD2  1  
ATOM 468   H HD3  . ARG B 2 6  ? -8.049  0.070   -1.655  1.00 0.00 ? 30  ARG B HD3  1  
ATOM 469   H HE   . ARG B 2 6  ? -7.671  0.786   0.926   1.00 0.00 ? 30  ARG B HE   1  
ATOM 470   H HH11 . ARG B 2 6  ? -10.417 -0.457  -0.821  1.00 0.00 ? 30  ARG B HH11 1  
ATOM 471   H HH12 . ARG B 2 6  ? -11.082 -1.277  0.552   1.00 0.00 ? 30  ARG B HH12 1  
ATOM 472   H HH21 . ARG B 2 6  ? -8.540  -0.292  2.740   1.00 0.00 ? 30  ARG B HH21 1  
ATOM 473   H HH22 . ARG B 2 6  ? -10.017 -1.183  2.575   1.00 0.00 ? 30  ARG B HH22 1  
ATOM 474   N N    . GLU B 2 7  ? -5.734  1.410   -5.469  1.00 0.00 ? 31  GLU B N    1  
ATOM 475   C CA   . GLU B 2 7  ? -5.724  0.298   -6.398  1.00 0.00 ? 31  GLU B CA   1  
ATOM 476   C C    . GLU B 2 7  ? -5.131  -0.936  -5.757  1.00 0.00 ? 31  GLU B C    1  
ATOM 477   O O    . GLU B 2 7  ? -4.365  -0.857  -4.799  1.00 0.00 ? 31  GLU B O    1  
ATOM 478   C CB   . GLU B 2 7  ? -4.969  0.660   -7.674  1.00 0.00 ? 31  GLU B CB   1  
ATOM 479   C CG   . GLU B 2 7  ? -3.519  1.020   -7.426  1.00 0.00 ? 31  GLU B CG   1  
ATOM 480   C CD   . GLU B 2 7  ? -2.721  1.162   -8.708  1.00 0.00 ? 31  GLU B CD   1  
ATOM 481   O OE1  . GLU B 2 7  ? -2.683  2.281   -9.263  1.00 0.00 ? 31  GLU B OE1  1  
ATOM 482   O OE2  . GLU B 2 7  ? -2.135  0.155   -9.157  1.00 0.00 ? 31  GLU B OE2  1  
ATOM 483   H H    . GLU B 2 7  ? -5.167  2.189   -5.640  1.00 0.00 ? 31  GLU B H    1  
ATOM 484   H HA   . GLU B 2 7  ? -6.749  0.072   -6.644  1.00 0.00 ? 31  GLU B HA   1  
ATOM 485   H HB2  . GLU B 2 7  ? -4.999  -0.182  -8.350  1.00 0.00 ? 31  GLU B HB2  1  
ATOM 486   H HB3  . GLU B 2 7  ? -5.454  1.505   -8.141  1.00 0.00 ? 31  GLU B HB3  1  
ATOM 487   H HG2  . GLU B 2 7  ? -3.481  1.957   -6.889  1.00 0.00 ? 31  GLU B HG2  1  
ATOM 488   H HG3  . GLU B 2 7  ? -3.075  0.244   -6.824  1.00 0.00 ? 31  GLU B HG3  1  
ATOM 489   N N    . LYS B 2 8  ? -5.497  -2.072  -6.315  1.00 0.00 ? 32  LYS B N    1  
ATOM 490   C CA   . LYS B 2 8  ? -5.069  -3.355  -5.814  1.00 0.00 ? 32  LYS B CA   1  
ATOM 491   C C    . LYS B 2 8  ? -3.563  -3.539  -5.886  1.00 0.00 ? 32  LYS B C    1  
ATOM 492   O O    . LYS B 2 8  ? -2.984  -3.728  -6.956  1.00 0.00 ? 32  LYS B O    1  
ATOM 493   C CB   . LYS B 2 8  ? -5.793  -4.440  -6.583  1.00 0.00 ? 32  LYS B CB   1  
ATOM 494   C CG   . LYS B 2 8  ? -7.287  -4.203  -6.642  1.00 0.00 ? 32  LYS B CG   1  
ATOM 495   C CD   . LYS B 2 8  ? -8.025  -5.419  -7.179  1.00 0.00 ? 32  LYS B CD   1  
ATOM 496   C CE   . LYS B 2 8  ? -9.521  -5.186  -7.225  1.00 0.00 ? 32  LYS B CE   1  
ATOM 497   N NZ   . LYS B 2 8  ? -10.258 -6.390  -7.704  1.00 0.00 ? 32  LYS B NZ   1  
ATOM 498   H H    . LYS B 2 8  ? -6.078  -2.047  -7.100  1.00 0.00 ? 32  LYS B H    1  
ATOM 499   H HA   . LYS B 2 8  ? -5.370  -3.415  -4.781  1.00 0.00 ? 32  LYS B HA   1  
ATOM 500   H HB2  . LYS B 2 8  ? -5.408  -4.478  -7.590  1.00 0.00 ? 32  LYS B HB2  1  
ATOM 501   H HB3  . LYS B 2 8  ? -5.618  -5.380  -6.101  1.00 0.00 ? 32  LYS B HB3  1  
ATOM 502   H HG2  . LYS B 2 8  ? -7.639  -3.980  -5.648  1.00 0.00 ? 32  LYS B HG2  1  
ATOM 503   H HG3  . LYS B 2 8  ? -7.483  -3.360  -7.284  1.00 0.00 ? 32  LYS B HG3  1  
ATOM 504   H HD2  . LYS B 2 8  ? -7.678  -5.627  -8.176  1.00 0.00 ? 32  LYS B HD2  1  
ATOM 505   H HD3  . LYS B 2 8  ? -7.820  -6.266  -6.540  1.00 0.00 ? 32  LYS B HD3  1  
ATOM 506   H HE2  . LYS B 2 8  ? -9.856  -4.941  -6.234  1.00 0.00 ? 32  LYS B HE2  1  
ATOM 507   H HE3  . LYS B 2 8  ? -9.725  -4.360  -7.890  1.00 0.00 ? 32  LYS B HE3  1  
ATOM 508   H HZ1  . LYS B 2 8  ? -10.060 -7.200  -7.081  1.00 0.00 ? 32  LYS B HZ1  1  
ATOM 509   H HZ2  . LYS B 2 8  ? -9.959  -6.630  -8.671  1.00 0.00 ? 32  LYS B HZ2  1  
ATOM 510   H HZ3  . LYS B 2 8  ? -11.281 -6.206  -7.704  1.00 0.00 ? 32  LYS B HZ3  1  
ATOM 511   N N    . LEU B 2 9  ? -2.951  -3.481  -4.716  1.00 0.00 ? 33  LEU B N    1  
ATOM 512   C CA   . LEU B 2 9  ? -1.523  -3.649  -4.559  1.00 0.00 ? 33  LEU B CA   1  
ATOM 513   C C    . LEU B 2 9  ? -1.191  -5.078  -4.151  1.00 0.00 ? 33  LEU B C    1  
ATOM 514   O O    . LEU B 2 9  ? -1.238  -5.430  -2.972  1.00 0.00 ? 33  LEU B O    1  
ATOM 515   C CB   . LEU B 2 9  ? -1.023  -2.673  -3.527  1.00 0.00 ? 33  LEU B CB   1  
ATOM 516   C CG   . LEU B 2 9  ? -1.538  -1.248  -3.692  1.00 0.00 ? 33  LEU B CG   1  
ATOM 517   C CD1  . LEU B 2 9  ? -1.035  -0.360  -2.567  1.00 0.00 ? 33  LEU B CD1  1  
ATOM 518   C CD2  . LEU B 2 9  ? -1.122  -0.694  -5.050  1.00 0.00 ? 33  LEU B CD2  1  
ATOM 519   H H    . LEU B 2 9  ? -3.484  -3.292  -3.924  1.00 0.00 ? 33  LEU B H    1  
ATOM 520   H HA   . LEU B 2 9  ? -1.037  -3.426  -5.489  1.00 0.00 ? 33  LEU B HA   1  
ATOM 521   H HB2  . LEU B 2 9  ? -1.291  -3.030  -2.547  1.00 0.00 ? 33  LEU B HB2  1  
ATOM 522   H HB3  . LEU B 2 9  ? 0.036   -2.653  -3.609  1.00 0.00 ? 33  LEU B HB3  1  
ATOM 523   H HG   . LEU B 2 9  ? -2.611  -1.258  -3.645  1.00 0.00 ? 33  LEU B HG   1  
ATOM 524   H HD11 . LEU B 2 9  ? -1.835  0.282   -2.231  1.00 0.00 ? 33  LEU B HD11 1  
ATOM 525   H HD12 . LEU B 2 9  ? -0.216  0.247   -2.921  1.00 0.00 ? 33  LEU B HD12 1  
ATOM 526   H HD13 . LEU B 2 9  ? -0.700  -0.975  -1.745  1.00 0.00 ? 33  LEU B HD13 1  
ATOM 527   H HD21 . LEU B 2 9  ? -1.877  -0.010  -5.408  1.00 0.00 ? 33  LEU B HD21 1  
ATOM 528   H HD22 . LEU B 2 9  ? -1.007  -1.512  -5.757  1.00 0.00 ? 33  LEU B HD22 1  
ATOM 529   H HD23 . LEU B 2 9  ? -0.182  -0.171  -4.952  1.00 0.00 ? 33  LEU B HD23 1  
ATOM 530   N N    . CYS B 2 10 ? -0.859  -5.897  -5.142  1.00 0.00 ? 34  CYS B N    1  
ATOM 531   C CA   . CYS B 2 10 ? -0.530  -7.298  -4.913  1.00 0.00 ? 34  CYS B CA   1  
ATOM 532   C C    . CYS B 2 10 ? 0.965   -7.496  -4.712  1.00 0.00 ? 34  CYS B C    1  
ATOM 533   O O    . CYS B 2 10 ? 1.697   -7.806  -5.652  1.00 0.00 ? 34  CYS B O    1  
ATOM 534   C CB   . CYS B 2 10 ? -1.005  -8.130  -6.094  1.00 0.00 ? 34  CYS B CB   1  
ATOM 535   S SG   . CYS B 2 10 ? -2.794  -8.479  -6.098  1.00 0.00 ? 34  CYS B SG   1  
ATOM 536   H H    . CYS B 2 10 ? -0.842  -5.550  -6.058  1.00 0.00 ? 34  CYS B H    1  
ATOM 537   H HA   . CYS B 2 10 ? -1.048  -7.620  -4.025  1.00 0.00 ? 34  CYS B HA   1  
ATOM 538   H HB2  . CYS B 2 10 ? -0.776  -7.594  -6.995  1.00 0.00 ? 34  CYS B HB2  1  
ATOM 539   H HB3  . CYS B 2 10 ? -0.479  -9.072  -6.100  1.00 0.00 ? 34  CYS B HB3  1  
ATOM 540   N N    . GLY B 2 11 ? 1.397   -7.327  -3.472  1.00 0.00 ? 35  GLY B N    1  
ATOM 541   C CA   . GLY B 2 11 ? 2.801   -7.488  -3.128  1.00 0.00 ? 35  GLY B CA   1  
ATOM 542   C C    . GLY B 2 11 ? 3.700   -6.518  -3.865  1.00 0.00 ? 35  GLY B C    1  
ATOM 543   O O    . GLY B 2 11 ? 4.148   -5.533  -3.286  1.00 0.00 ? 35  GLY B O    1  
ATOM 544   H H    . GLY B 2 11 ? 0.751   -7.088  -2.781  1.00 0.00 ? 35  GLY B H    1  
ATOM 545   H HA2  . GLY B 2 11 ? 2.915   -7.326  -2.066  1.00 0.00 ? 35  GLY B HA2  1  
ATOM 546   H HA3  . GLY B 2 11 ? 3.106   -8.493  -3.356  1.00 0.00 ? 35  GLY B HA3  1  
ATOM 547   N N    . HIS B 2 12 ? 3.993   -6.806  -5.132  1.00 0.00 ? 36  HIS B N    1  
ATOM 548   C CA   . HIS B 2 12 ? 4.832   -5.934  -5.926  1.00 0.00 ? 36  HIS B CA   1  
ATOM 549   C C    . HIS B 2 12 ? 4.182   -4.570  -6.117  1.00 0.00 ? 36  HIS B C    1  
ATOM 550   O O    . HIS B 2 12 ? 4.808   -3.553  -5.849  1.00 0.00 ? 36  HIS B O    1  
ATOM 551   C CB   . HIS B 2 12 ? 5.154   -6.557  -7.273  1.00 0.00 ? 36  HIS B CB   1  
ATOM 552   C CG   . HIS B 2 12 ? 6.404   -5.997  -7.853  1.00 0.00 ? 36  HIS B CG   1  
ATOM 553   N ND1  . HIS B 2 12 ? 6.687   -5.977  -9.195  1.00 0.00 ? 36  HIS B ND1  1  
ATOM 554   C CD2  . HIS B 2 12 ? 7.459   -5.409  -7.230  1.00 0.00 ? 36  HIS B CD2  1  
ATOM 555   C CE1  . HIS B 2 12 ? 7.876   -5.389  -9.353  1.00 0.00 ? 36  HIS B CE1  1  
ATOM 556   N NE2  . HIS B 2 12 ? 8.391   -5.024  -8.190  1.00 0.00 ? 36  HIS B NE2  1  
ATOM 557   H H    . HIS B 2 12 ? 3.663   -7.630  -5.529  1.00 0.00 ? 36  HIS B H    1  
ATOM 558   H HA   . HIS B 2 12 ? 5.754   -5.795  -5.382  1.00 0.00 ? 36  HIS B HA   1  
ATOM 559   H HB2  . HIS B 2 12 ? 5.282   -7.623  -7.156  1.00 0.00 ? 36  HIS B HB2  1  
ATOM 560   H HB3  . HIS B 2 12 ? 4.347   -6.362  -7.962  1.00 0.00 ? 36  HIS B HB3  1  
ATOM 561   H HD1  . HIS B 2 12 ? 6.118   -6.330  -9.911  1.00 0.00 ? 36  HIS B HD1  1  
ATOM 562   H HD2  . HIS B 2 12 ? 7.558   -5.250  -6.155  1.00 0.00 ? 36  HIS B HD2  1  
ATOM 563   H HE1  . HIS B 2 12 ? 8.342   -5.219  -10.308 1.00 0.00 ? 36  HIS B HE1  1  
ATOM 564   N N    . HIS B 2 13 ? 2.948   -4.532  -6.618  1.00 0.00 ? 37  HIS B N    1  
ATOM 565   C CA   . HIS B 2 13 ? 2.259   -3.252  -6.757  1.00 0.00 ? 37  HIS B CA   1  
ATOM 566   C C    . HIS B 2 13 ? 2.322   -2.574  -5.423  1.00 0.00 ? 37  HIS B C    1  
ATOM 567   O O    . HIS B 2 13 ? 2.564   -1.377  -5.300  1.00 0.00 ? 37  HIS B O    1  
ATOM 568   C CB   . HIS B 2 13 ? 0.792   -3.431  -7.102  1.00 0.00 ? 37  HIS B CB   1  
ATOM 569   C CG   . HIS B 2 13 ? 0.542   -3.831  -8.503  1.00 0.00 ? 37  HIS B CG   1  
ATOM 570   N ND1  . HIS B 2 13 ? -0.365  -3.206  -9.316  1.00 0.00 ? 37  HIS B ND1  1  
ATOM 571   C CD2  . HIS B 2 13 ? 1.088   -4.828  -9.227  1.00 0.00 ? 37  HIS B CD2  1  
ATOM 572   C CE1  . HIS B 2 13 ? -0.350  -3.827  -10.493 1.00 0.00 ? 37  HIS B CE1  1  
ATOM 573   N NE2  . HIS B 2 13 ? 0.518   -4.825  -10.499 1.00 0.00 ? 37  HIS B NE2  1  
ATOM 574   H H    . HIS B 2 13 ? 2.502   -5.361  -6.892  1.00 0.00 ? 37  HIS B H    1  
ATOM 575   H HA   . HIS B 2 13 ? 2.755   -2.654  -7.506  1.00 0.00 ? 37  HIS B HA   1  
ATOM 576   H HB2  . HIS B 2 13 ? 0.374   -4.194  -6.464  1.00 0.00 ? 37  HIS B HB2  1  
ATOM 577   H HB3  . HIS B 2 13 ? 0.274   -2.497  -6.921  1.00 0.00 ? 37  HIS B HB3  1  
ATOM 578   H HD1  . HIS B 2 13 ? -0.924  -2.438  -9.076  1.00 0.00 ? 37  HIS B HD1  1  
ATOM 579   H HD2  . HIS B 2 13 ? 1.844   -5.518  -8.877  1.00 0.00 ? 37  HIS B HD2  1  
ATOM 580   H HE1  . HIS B 2 13 ? -0.972  -3.550  -11.322 1.00 0.00 ? 37  HIS B HE1  1  
ATOM 581   N N    . PHE B 2 14 ? 2.083   -3.397  -4.427  1.00 0.00 ? 38  PHE B N    1  
ATOM 582   C CA   . PHE B 2 14 ? 2.105   -2.981  -3.060  1.00 0.00 ? 38  PHE B CA   1  
ATOM 583   C C    . PHE B 2 14 ? 3.486   -2.508  -2.690  1.00 0.00 ? 38  PHE B C    1  
ATOM 584   O O    . PHE B 2 14 ? 3.647   -1.658  -1.825  1.00 0.00 ? 38  PHE B O    1  
ATOM 585   C CB   . PHE B 2 14 ? 1.649   -4.141  -2.188  1.00 0.00 ? 38  PHE B CB   1  
ATOM 586   C CG   . PHE B 2 14 ? 1.830   -3.866  -0.747  1.00 0.00 ? 38  PHE B CG   1  
ATOM 587   C CD1  . PHE B 2 14 ? 1.190   -2.787  -0.183  1.00 0.00 ? 38  PHE B CD1  1  
ATOM 588   C CD2  . PHE B 2 14 ? 2.650   -4.663  0.031   1.00 0.00 ? 38  PHE B CD2  1  
ATOM 589   C CE1  . PHE B 2 14 ? 1.360   -2.496  1.151   1.00 0.00 ? 38  PHE B CE1  1  
ATOM 590   C CE2  . PHE B 2 14 ? 2.830   -4.378  1.369   1.00 0.00 ? 38  PHE B CE2  1  
ATOM 591   C CZ   . PHE B 2 14 ? 2.185   -3.291  1.931   1.00 0.00 ? 38  PHE B CZ   1  
ATOM 592   H H    . PHE B 2 14 ? 1.879   -4.334  -4.630  1.00 0.00 ? 38  PHE B H    1  
ATOM 593   H HA   . PHE B 2 14 ? 1.418   -2.158  -2.946  1.00 0.00 ? 38  PHE B HA   1  
ATOM 594   H HB2  . PHE B 2 14 ? 0.598   -4.322  -2.363  1.00 0.00 ? 38  PHE B HB2  1  
ATOM 595   H HB3  . PHE B 2 14 ? 2.208   -5.022  -2.445  1.00 0.00 ? 38  PHE B HB3  1  
ATOM 596   H HD1  . PHE B 2 14 ? 0.540   -2.170  -0.807  1.00 0.00 ? 38  PHE B HD1  1  
ATOM 597   H HD2  . PHE B 2 14 ? 3.148   -5.516  -0.417  1.00 0.00 ? 38  PHE B HD2  1  
ATOM 598   H HE1  . PHE B 2 14 ? 0.855   -1.649  1.582   1.00 0.00 ? 38  PHE B HE1  1  
ATOM 599   H HE2  . PHE B 2 14 ? 3.468   -5.007  1.974   1.00 0.00 ? 38  PHE B HE2  1  
ATOM 600   H HZ   . PHE B 2 14 ? 2.322   -3.064  2.978   1.00 0.00 ? 38  PHE B HZ   1  
ATOM 601   N N    . VAL B 2 15 ? 4.475   -3.067  -3.359  1.00 0.00 ? 39  VAL B N    1  
ATOM 602   C CA   . VAL B 2 15 ? 5.847   -2.680  -3.145  1.00 0.00 ? 39  VAL B CA   1  
ATOM 603   C C    . VAL B 2 15 ? 6.063   -1.296  -3.736  1.00 0.00 ? 39  VAL B C    1  
ATOM 604   O O    . VAL B 2 15 ? 6.281   -0.341  -2.999  1.00 0.00 ? 39  VAL B O    1  
ATOM 605   C CB   . VAL B 2 15 ? 6.823   -3.717  -3.757  1.00 0.00 ? 39  VAL B CB   1  
ATOM 606   C CG1  . VAL B 2 15 ? 8.071   -3.061  -4.322  1.00 0.00 ? 39  VAL B CG1  1  
ATOM 607   C CG2  . VAL B 2 15 ? 7.201   -4.763  -2.722  1.00 0.00 ? 39  VAL B CG2  1  
ATOM 608   H H    . VAL B 2 15 ? 4.272   -3.762  -4.017  1.00 0.00 ? 39  VAL B H    1  
ATOM 609   H HA   . VAL B 2 15 ? 6.014   -2.629  -2.078  1.00 0.00 ? 39  VAL B HA   1  
ATOM 610   H HB   . VAL B 2 15 ? 6.316   -4.220  -4.565  1.00 0.00 ? 39  VAL B HB   1  
ATOM 611   H HG11 . VAL B 2 15 ? 8.025   -3.066  -5.401  1.00 0.00 ? 39  VAL B HG11 1  
ATOM 612   H HG12 . VAL B 2 15 ? 8.937   -3.608  -3.994  1.00 0.00 ? 39  VAL B HG12 1  
ATOM 613   H HG13 . VAL B 2 15 ? 8.140   -2.044  -3.970  1.00 0.00 ? 39  VAL B HG13 1  
ATOM 614   H HG21 . VAL B 2 15 ? 6.439   -4.804  -1.955  1.00 0.00 ? 39  VAL B HG21 1  
ATOM 615   H HG22 . VAL B 2 15 ? 8.149   -4.500  -2.277  1.00 0.00 ? 39  VAL B HG22 1  
ATOM 616   H HG23 . VAL B 2 15 ? 7.282   -5.728  -3.198  1.00 0.00 ? 39  VAL B HG23 1  
ATOM 617   N N    . ARG B 2 16 ? 5.978   -1.190  -5.066  1.00 0.00 ? 40  ARG B N    1  
ATOM 618   C CA   . ARG B 2 16 ? 6.142   0.086   -5.733  1.00 0.00 ? 40  ARG B CA   1  
ATOM 619   C C    . ARG B 2 16 ? 5.339   1.161   -5.033  1.00 0.00 ? 40  ARG B C    1  
ATOM 620   O O    . ARG B 2 16 ? 5.916   2.131   -4.565  1.00 0.00 ? 40  ARG B O    1  
ATOM 621   C CB   . ARG B 2 16 ? 5.723   -0.009  -7.195  1.00 0.00 ? 40  ARG B CB   1  
ATOM 622   C CG   . ARG B 2 16 ? 6.583   -0.957  -8.005  1.00 0.00 ? 40  ARG B CG   1  
ATOM 623   C CD   . ARG B 2 16 ? 5.849   -2.237  -8.329  1.00 0.00 ? 40  ARG B CD   1  
ATOM 624   N NE   . ARG B 2 16 ? 6.322   -2.838  -9.573  1.00 0.00 ? 40  ARG B NE   1  
ATOM 625   C CZ   . ARG B 2 16 ? 5.516   -3.276  -10.536 1.00 0.00 ? 40  ARG B CZ   1  
ATOM 626   N NH1  . ARG B 2 16 ? 4.200   -3.181  -10.398 1.00 0.00 ? 40  ARG B NH1  1  
ATOM 627   N NH2  . ARG B 2 16 ? 6.026   -3.810  -11.637 1.00 0.00 ? 40  ARG B NH2  1  
ATOM 628   H H    . ARG B 2 16 ? 5.817   -1.988  -5.608  1.00 0.00 ? 40  ARG B H    1  
ATOM 629   H HA   . ARG B 2 16 ? 7.189   0.358   -5.684  1.00 0.00 ? 40  ARG B HA   1  
ATOM 630   H HB2  . ARG B 2 16 ? 4.700   -0.353  -7.243  1.00 0.00 ? 40  ARG B HB2  1  
ATOM 631   H HB3  . ARG B 2 16 ? 5.785   0.972   -7.641  1.00 0.00 ? 40  ARG B HB3  1  
ATOM 632   H HG2  . ARG B 2 16 ? 6.861   -0.480  -8.920  1.00 0.00 ? 40  ARG B HG2  1  
ATOM 633   H HG3  . ARG B 2 16 ? 7.470   -1.197  -7.437  1.00 0.00 ? 40  ARG B HG3  1  
ATOM 634   H HD2  . ARG B 2 16 ? 6.009   -2.930  -7.522  1.00 0.00 ? 40  ARG B HD2  1  
ATOM 635   H HD3  . ARG B 2 16 ? 4.794   -2.023  -8.418  1.00 0.00 ? 40  ARG B HD3  1  
ATOM 636   H HE   . ARG B 2 16 ? 7.291   -2.918  -9.697  1.00 0.00 ? 40  ARG B HE   1  
ATOM 637   H HH11 . ARG B 2 16 ? 3.811   -2.780  -9.568  1.00 0.00 ? 40  ARG B HH11 1  
ATOM 638   H HH12 . ARG B 2 16 ? 3.596   -3.510  -11.123 1.00 0.00 ? 40  ARG B HH12 1  
ATOM 639   H HH21 . ARG B 2 16 ? 7.017   -3.882  -11.745 1.00 0.00 ? 40  ARG B HH21 1  
ATOM 640   H HH22 . ARG B 2 16 ? 5.417   -4.140  -12.359 1.00 0.00 ? 40  ARG B HH22 1  
ATOM 641   N N    . ALA B 2 17 ? 4.014   0.994   -4.930  1.00 0.00 ? 41  ALA B N    1  
ATOM 642   C CA   . ALA B 2 17 ? 3.215   2.000   -4.267  1.00 0.00 ? 41  ALA B CA   1  
ATOM 643   C C    . ALA B 2 17 ? 3.821   2.304   -2.903  1.00 0.00 ? 41  ALA B C    1  
ATOM 644   O O    . ALA B 2 17 ? 4.074   3.450   -2.598  1.00 0.00 ? 41  ALA B O    1  
ATOM 645   C CB   . ALA B 2 17 ? 1.754   1.559   -4.153  1.00 0.00 ? 41  ALA B CB   1  
ATOM 646   H H    . ALA B 2 17 ? 3.575   0.187   -5.284  1.00 0.00 ? 41  ALA B H    1  
ATOM 647   H HA   . ALA B 2 17 ? 3.255   2.910   -4.873  1.00 0.00 ? 41  ALA B HA   1  
ATOM 648   H HB1  . ALA B 2 17 ? 1.146   2.408   -3.873  1.00 0.00 ? 41  ALA B HB1  1  
ATOM 649   H HB2  . ALA B 2 17 ? 1.653   0.783   -3.400  1.00 0.00 ? 41  ALA B HB2  1  
ATOM 650   H HB3  . ALA B 2 17 ? 1.420   1.179   -5.106  1.00 0.00 ? 41  ALA B HB3  1  
ATOM 651   N N    . LEU B 2 18 ? 4.118   1.271   -2.111  1.00 0.00 ? 42  LEU B N    1  
ATOM 652   C CA   . LEU B 2 18 ? 4.703   1.481   -0.784  1.00 0.00 ? 42  LEU B CA   1  
ATOM 653   C C    . LEU B 2 18 ? 5.811   2.525   -0.861  1.00 0.00 ? 42  LEU B C    1  
ATOM 654   O O    . LEU B 2 18 ? 5.968   3.359   0.029   1.00 0.00 ? 42  LEU B O    1  
ATOM 655   C CB   . LEU B 2 18 ? 5.272   0.168   -0.240  1.00 0.00 ? 42  LEU B CB   1  
ATOM 656   C CG   . LEU B 2 18 ? 4.931   -0.146  1.215   1.00 0.00 ? 42  LEU B CG   1  
ATOM 657   C CD1  . LEU B 2 18 ? 5.538   -1.478  1.627   1.00 0.00 ? 42  LEU B CD1  1  
ATOM 658   C CD2  . LEU B 2 18 ? 5.423   0.967   2.116   1.00 0.00 ? 42  LEU B CD2  1  
ATOM 659   H H    . LEU B 2 18 ? 3.954   0.354   -2.422  1.00 0.00 ? 42  LEU B H    1  
ATOM 660   H HA   . LEU B 2 18 ? 3.921   1.839   -0.125  1.00 0.00 ? 42  LEU B HA   1  
ATOM 661   H HB2  . LEU B 2 18 ? 4.909   -0.636  -0.853  1.00 0.00 ? 42  LEU B HB2  1  
ATOM 662   H HB3  . LEU B 2 18 ? 6.345   0.206   -0.334  1.00 0.00 ? 42  LEU B HB3  1  
ATOM 663   H HG   . LEU B 2 18 ? 3.858   -0.219  1.322   1.00 0.00 ? 42  LEU B HG   1  
ATOM 664   H HD11 . LEU B 2 18 ? 4.957   -2.284  1.206   1.00 0.00 ? 42  LEU B HD11 1  
ATOM 665   H HD12 . LEU B 2 18 ? 5.537   -1.556  2.703   1.00 0.00 ? 42  LEU B HD12 1  
ATOM 666   H HD13 . LEU B 2 18 ? 6.553   -1.539  1.263   1.00 0.00 ? 42  LEU B HD13 1  
ATOM 667   H HD21 . LEU B 2 18 ? 4.583   1.559   2.451   1.00 0.00 ? 42  LEU B HD21 1  
ATOM 668   H HD22 . LEU B 2 18 ? 6.102   1.590   1.558   1.00 0.00 ? 42  LEU B HD22 1  
ATOM 669   H HD23 . LEU B 2 18 ? 5.933   0.545   2.969   1.00 0.00 ? 42  LEU B HD23 1  
ATOM 670   N N    . VAL B 2 19 ? 6.568   2.457   -1.947  1.00 0.00 ? 43  VAL B N    1  
ATOM 671   C CA   . VAL B 2 19 ? 7.667   3.383   -2.198  1.00 0.00 ? 43  VAL B CA   1  
ATOM 672   C C    . VAL B 2 19 ? 7.132   4.714   -2.698  1.00 0.00 ? 43  VAL B C    1  
ATOM 673   O O    . VAL B 2 19 ? 7.280   5.742   -2.036  1.00 0.00 ? 43  VAL B O    1  
ATOM 674   C CB   . VAL B 2 19 ? 8.658   2.808   -3.235  1.00 0.00 ? 43  VAL B CB   1  
ATOM 675   C CG1  . VAL B 2 19 ? 10.078  3.188   -2.891  1.00 0.00 ? 43  VAL B CG1  1  
ATOM 676   C CG2  . VAL B 2 19 ? 8.555   1.311   -3.282  1.00 0.00 ? 43  VAL B CG2  1  
ATOM 677   H H    . VAL B 2 19 ? 6.384   1.754   -2.596  1.00 0.00 ? 43  VAL B H    1  
ATOM 678   H HA   . VAL B 2 19 ? 8.185   3.541   -1.267  1.00 0.00 ? 43  VAL B HA   1  
ATOM 679   H HB   . VAL B 2 19 ? 8.412   3.192   -4.216  1.00 0.00 ? 43  VAL B HB   1  
ATOM 680   H HG11 . VAL B 2 19 ? 10.684  3.175   -3.785  1.00 0.00 ? 43  VAL B HG11 1  
ATOM 681   H HG12 . VAL B 2 19 ? 10.460  2.462   -2.183  1.00 0.00 ? 43  VAL B HG12 1  
ATOM 682   H HG13 . VAL B 2 19 ? 10.095  4.174   -2.451  1.00 0.00 ? 43  VAL B HG13 1  
ATOM 683   H HG21 . VAL B 2 19 ? 7.601   1.024   -3.691  1.00 0.00 ? 43  VAL B HG21 1  
ATOM 684   H HG22 . VAL B 2 19 ? 8.654   0.929   -2.276  1.00 0.00 ? 43  VAL B HG22 1  
ATOM 685   H HG23 . VAL B 2 19 ? 9.348   0.914   -3.900  1.00 0.00 ? 43  VAL B HG23 1  
ATOM 686   N N    . ARG B 2 20 ? 6.539   4.674   -3.886  1.00 0.00 ? 44  ARG B N    1  
ATOM 687   C CA   . ARG B 2 20 ? 5.913   5.839   -4.505  1.00 0.00 ? 44  ARG B CA   1  
ATOM 688   C C    . ARG B 2 20 ? 5.322   6.741   -3.433  1.00 0.00 ? 44  ARG B C    1  
ATOM 689   O O    . ARG B 2 20 ? 5.429   7.967   -3.468  1.00 0.00 ? 44  ARG B O    1  
ATOM 690   C CB   . ARG B 2 20 ? 4.784   5.348   -5.415  1.00 0.00 ? 44  ARG B CB   1  
ATOM 691   C CG   . ARG B 2 20 ? 5.203   4.253   -6.375  1.00 0.00 ? 44  ARG B CG   1  
ATOM 692   C CD   . ARG B 2 20 ? 4.636   4.485   -7.758  1.00 0.00 ? 44  ARG B CD   1  
ATOM 693   N NE   . ARG B 2 20 ? 4.571   3.250   -8.535  1.00 0.00 ? 44  ARG B NE   1  
ATOM 694   C CZ   . ARG B 2 20 ? 4.807   3.185   -9.842  1.00 0.00 ? 44  ARG B CZ   1  
ATOM 695   N NH1  . ARG B 2 20 ? 5.128   4.280   -10.518 1.00 0.00 ? 44  ARG B NH1  1  
ATOM 696   N NH2  . ARG B 2 20 ? 4.723   2.022   -10.473 1.00 0.00 ? 44  ARG B NH2  1  
ATOM 697   H H    . ARG B 2 20 ? 6.534   3.824   -4.375  1.00 0.00 ? 44  ARG B H    1  
ATOM 698   H HA   . ARG B 2 20 ? 6.646   6.376   -5.086  1.00 0.00 ? 44  ARG B HA   1  
ATOM 699   H HB2  . ARG B 2 20 ? 3.990   4.960   -4.795  1.00 0.00 ? 44  ARG B HB2  1  
ATOM 700   H HB3  . ARG B 2 20 ? 4.399   6.169   -5.986  1.00 0.00 ? 44  ARG B HB3  1  
ATOM 701   H HG2  . ARG B 2 20 ? 6.280   4.230   -6.435  1.00 0.00 ? 44  ARG B HG2  1  
ATOM 702   H HG3  . ARG B 2 20 ? 4.840   3.307   -6.002  1.00 0.00 ? 44  ARG B HG3  1  
ATOM 703   H HD2  . ARG B 2 20 ? 3.644   4.897   -7.661  1.00 0.00 ? 44  ARG B HD2  1  
ATOM 704   H HD3  . ARG B 2 20 ? 5.270   5.188   -8.268  1.00 0.00 ? 44  ARG B HD3  1  
ATOM 705   H HE   . ARG B 2 20 ? 4.336   2.427   -8.058  1.00 0.00 ? 44  ARG B HE   1  
ATOM 706   H HH11 . ARG B 2 20 ? 5.194   5.159   -10.046 1.00 0.00 ? 44  ARG B HH11 1  
ATOM 707   H HH12 . ARG B 2 20 ? 5.304   4.227   -11.501 1.00 0.00 ? 44  ARG B HH12 1  
ATOM 708   H HH21 . ARG B 2 20 ? 4.483   1.194   -9.967  1.00 0.00 ? 44  ARG B HH21 1  
ATOM 709   H HH22 . ARG B 2 20 ? 4.902   1.973   -11.456 1.00 0.00 ? 44  ARG B HH22 1  
ATOM 710   N N    . VAL B 2 21 ? 4.695   6.073   -2.485  1.00 0.00 ? 45  VAL B N    1  
ATOM 711   C CA   . VAL B 2 21 ? 4.029   6.680   -1.355  1.00 0.00 ? 45  VAL B CA   1  
ATOM 712   C C    . VAL B 2 21 ? 4.998   7.201   -0.298  1.00 0.00 ? 45  VAL B C    1  
ATOM 713   O O    . VAL B 2 21 ? 5.059   8.400   -0.024  1.00 0.00 ? 45  VAL B O    1  
ATOM 714   C CB   . VAL B 2 21 ? 3.135   5.631   -0.679  1.00 0.00 ? 45  VAL B CB   1  
ATOM 715   C CG1  . VAL B 2 21 ? 2.410   6.218   0.503   1.00 0.00 ? 45  VAL B CG1  1  
ATOM 716   C CG2  . VAL B 2 21 ? 2.162   5.019   -1.663  1.00 0.00 ? 45  VAL B CG2  1  
ATOM 717   H H    . VAL B 2 21 ? 4.686   5.102   -2.549  1.00 0.00 ? 45  VAL B H    1  
ATOM 718   H HA   . VAL B 2 21 ? 3.405   7.485   -1.707  1.00 0.00 ? 45  VAL B HA   1  
ATOM 719   H HB   . VAL B 2 21 ? 3.773   4.841   -0.311  1.00 0.00 ? 45  VAL B HB   1  
ATOM 720   H HG11 . VAL B 2 21 ? 2.206   7.263   0.322   1.00 0.00 ? 45  VAL B HG11 1  
ATOM 721   H HG12 . VAL B 2 21 ? 3.025   6.111   1.380   1.00 0.00 ? 45  VAL B HG12 1  
ATOM 722   H HG13 . VAL B 2 21 ? 1.482   5.689   0.650   1.00 0.00 ? 45  VAL B HG13 1  
ATOM 723   H HG21 . VAL B 2 21 ? 1.152   5.220   -1.349  1.00 0.00 ? 45  VAL B HG21 1  
ATOM 724   H HG22 . VAL B 2 21 ? 2.322   3.952   -1.694  1.00 0.00 ? 45  VAL B HG22 1  
ATOM 725   H HG23 . VAL B 2 21 ? 2.329   5.438   -2.645  1.00 0.00 ? 45  VAL B HG23 1  
ATOM 726   N N    . CYS B 2 22 ? 5.751   6.276   0.285   1.00 0.00 ? 46  CYS B N    1  
ATOM 727   C CA   . CYS B 2 22 ? 6.669   6.591   1.371   1.00 0.00 ? 46  CYS B CA   1  
ATOM 728   C C    . CYS B 2 22 ? 8.100   6.259   1.006   1.00 0.00 ? 46  CYS B C    1  
ATOM 729   O O    . CYS B 2 22 ? 8.995   7.104   1.070   1.00 0.00 ? 46  CYS B O    1  
ATOM 730   C CB   . CYS B 2 22 ? 6.268   5.753   2.583   1.00 0.00 ? 46  CYS B CB   1  
ATOM 731   S SG   . CYS B 2 22 ? 6.972   6.294   4.172   1.00 0.00 ? 46  CYS B SG   1  
ATOM 732   H H    . CYS B 2 22 ? 5.706   5.348   -0.041  1.00 0.00 ? 46  CYS B H    1  
ATOM 733   H HA   . CYS B 2 22 ? 6.583   7.638   1.612   1.00 0.00 ? 46  CYS B HA   1  
ATOM 734   H HB2  . CYS B 2 22 ? 5.198   5.766   2.674   1.00 0.00 ? 46  CYS B HB2  1  
ATOM 735   H HB3  . CYS B 2 22 ? 6.590   4.735   2.417   1.00 0.00 ? 46  CYS B HB3  1  
ATOM 736   N N    . GLY B 2 23 ? 8.294   5.013   0.626   1.00 0.00 ? 47  GLY B N    1  
ATOM 737   C CA   . GLY B 2 23 ? 9.616   4.531   0.277   1.00 0.00 ? 47  GLY B CA   1  
ATOM 738   C C    . GLY B 2 23 ? 9.794   3.081   0.664   1.00 0.00 ? 47  GLY B C    1  
ATOM 739   O O    . GLY B 2 23 ? 9.472   2.184   -0.111  1.00 0.00 ? 47  GLY B O    1  
ATOM 740   H H    . GLY B 2 23 ? 7.515   4.409   0.563   1.00 0.00 ? 47  GLY B H    1  
ATOM 741   H HA2  . GLY B 2 23 ? 9.758   4.633   -0.787  1.00 0.00 ? 47  GLY B HA2  1  
ATOM 742   H HA3  . GLY B 2 23 ? 10.360  5.122   0.790   1.00 0.00 ? 47  GLY B HA3  1  
ATOM 743   N N    . GLY B 2 24 ? 10.285  2.851   1.873   1.00 0.00 ? 48  GLY B N    1  
ATOM 744   C CA   . GLY B 2 24 ? 10.493  1.498   2.337   1.00 0.00 ? 48  GLY B CA   1  
ATOM 745   C C    . GLY B 2 24 ? 11.843  1.324   3.003   1.00 0.00 ? 48  GLY B C    1  
ATOM 746   O O    . GLY B 2 24 ? 12.275  2.190   3.763   1.00 0.00 ? 48  GLY B O    1  
ATOM 747   H H    . GLY B 2 24 ? 10.510  3.604   2.455   1.00 0.00 ? 48  GLY B H    1  
ATOM 748   H HA2  . GLY B 2 24 ? 9.717   1.244   3.041   1.00 0.00 ? 48  GLY B HA2  1  
ATOM 749   H HA3  . GLY B 2 24 ? 10.429  0.831   1.493   1.00 0.00 ? 48  GLY B HA3  1  
ATOM 750   N N    . PRO B 2 25 ? 12.537  0.206   2.736   1.00 0.00 ? 49  PRO B N    1  
ATOM 751   C CA   . PRO B 2 25 ? 13.847  -0.066  3.319   1.00 0.00 ? 49  PRO B CA   1  
ATOM 752   C C    . PRO B 2 25 ? 14.948  0.833   2.759   1.00 0.00 ? 49  PRO B C    1  
ATOM 753   O O    . PRO B 2 25 ? 15.484  1.680   3.473   1.00 0.00 ? 49  PRO B O    1  
ATOM 754   C CB   . PRO B 2 25 ? 14.093  -1.532  2.961   1.00 0.00 ? 49  PRO B CB   1  
ATOM 755   C CG   . PRO B 2 25 ? 13.294  -1.771  1.734   1.00 0.00 ? 49  PRO B CG   1  
ATOM 756   C CD   . PRO B 2 25 ? 12.090  -0.883  1.853   1.00 0.00 ? 49  PRO B CD   1  
ATOM 757   H HA   . PRO B 2 25 ? 13.825  0.039   4.386   1.00 0.00 ? 49  PRO B HA   1  
ATOM 758   H HB2  . PRO B 2 25 ? 15.146  -1.696  2.788   1.00 0.00 ? 49  PRO B HB2  1  
ATOM 759   H HB3  . PRO B 2 25 ? 13.751  -2.153  3.766   1.00 0.00 ? 49  PRO B HB3  1  
ATOM 760   H HG2  . PRO B 2 25 ? 13.870  -1.506  0.860   1.00 0.00 ? 49  PRO B HG2  1  
ATOM 761   H HG3  . PRO B 2 25 ? 12.992  -2.806  1.688   1.00 0.00 ? 49  PRO B HG3  1  
ATOM 762   H HD2  . PRO B 2 25 ? 11.827  -0.504  0.896   1.00 0.00 ? 49  PRO B HD2  1  
ATOM 763   H HD3  . PRO B 2 25 ? 11.256  -1.412  2.282   1.00 0.00 ? 49  PRO B HD3  1  
ATOM 764   N N    . ARG B 2 26 ? 15.265  0.658   1.481   1.00 0.00 ? 50  ARG B N    1  
ATOM 765   C CA   . ARG B 2 26 ? 16.317  1.437   0.833   1.00 0.00 ? 50  ARG B CA   1  
ATOM 766   C C    . ARG B 2 26 ? 16.134  1.473   -0.678  1.00 0.00 ? 50  ARG B C    1  
ATOM 767   O O    . ARG B 2 26 ? 16.279  2.520   -1.308  1.00 0.00 ? 50  ARG B O    1  
ATOM 768   C CB   . ARG B 2 26 ? 17.663  0.808   1.130   1.00 0.00 ? 50  ARG B CB   1  
ATOM 769   C CG   . ARG B 2 26 ? 18.152  1.003   2.557   1.00 0.00 ? 50  ARG B CG   1  
ATOM 770   C CD   . ARG B 2 26 ? 19.430  0.222   2.822   1.00 0.00 ? 50  ARG B CD   1  
ATOM 771   N NE   . ARG B 2 26 ? 19.225  -1.219  2.707   1.00 0.00 ? 50  ARG B NE   1  
ATOM 772   C CZ   . ARG B 2 26 ? 20.134  -2.125  3.056   1.00 0.00 ? 50  ARG B CZ   1  
ATOM 773   N NH1  . ARG B 2 26 ? 21.308  -1.740  3.541   1.00 0.00 ? 50  ARG B NH1  1  
ATOM 774   N NH2  . ARG B 2 26 ? 19.871  -3.417  2.923   1.00 0.00 ? 50  ARG B NH2  1  
ATOM 775   H H    . ARG B 2 26 ? 14.788  -0.016  0.965   1.00 0.00 ? 50  ARG B H    1  
ATOM 776   H HA   . ARG B 2 26 ? 16.295  2.441   1.224   1.00 0.00 ? 50  ARG B HA   1  
ATOM 777   H HB2  . ARG B 2 26 ? 17.573  -0.245  0.940   1.00 0.00 ? 50  ARG B HB2  1  
ATOM 778   H HB3  . ARG B 2 26 ? 18.392  1.224   0.457   1.00 0.00 ? 50  ARG B HB3  1  
ATOM 779   H HG2  . ARG B 2 26 ? 18.343  2.053   2.721   1.00 0.00 ? 50  ARG B HG2  1  
ATOM 780   H HG3  . ARG B 2 26 ? 17.386  0.663   3.238   1.00 0.00 ? 50  ARG B HG3  1  
ATOM 781   H HD2  . ARG B 2 26 ? 20.179  0.529   2.107   1.00 0.00 ? 50  ARG B HD2  1  
ATOM 782   H HD3  . ARG B 2 26 ? 19.773  0.449   3.821   1.00 0.00 ? 50  ARG B HD3  1  
ATOM 783   H HE   . ARG B 2 26 ? 18.366  -1.528  2.350   1.00 0.00 ? 50  ARG B HE   1  
ATOM 784   H HH11 . ARG B 2 26 ? 21.512  -0.767  3.645   1.00 0.00 ? 50  ARG B HH11 1  
ATOM 785   H HH12 . ARG B 2 26 ? 21.989  -2.424  3.804   1.00 0.00 ? 50  ARG B HH12 1  
ATOM 786   H HH21 . ARG B 2 26 ? 18.988  -3.713  2.557   1.00 0.00 ? 50  ARG B HH21 1  
ATOM 787   H HH22 . ARG B 2 26 ? 20.556  -4.098  3.185   1.00 0.00 ? 50  ARG B HH22 1  
ATOM 788   N N    . TRP B 2 27 ? 15.821  0.309   -1.249  1.00 0.00 ? 51  TRP B N    1  
ATOM 789   C CA   . TRP B 2 27 ? 15.610  0.172   -2.677  1.00 0.00 ? 51  TRP B CA   1  
ATOM 790   C C    . TRP B 2 27 ? 16.864  0.489   -3.486  1.00 0.00 ? 51  TRP B C    1  
ATOM 791   O O    . TRP B 2 27 ? 16.856  0.400   -4.715  1.00 0.00 ? 51  TRP B O    1  
ATOM 792   C CB   . TRP B 2 27 ? 14.467  1.063   -3.092  1.00 0.00 ? 51  TRP B CB   1  
ATOM 793   C CG   . TRP B 2 27 ? 13.313  0.933   -2.168  1.00 0.00 ? 51  TRP B CG   1  
ATOM 794   C CD1  . TRP B 2 27 ? 13.116  1.566   -0.981  1.00 0.00 ? 51  TRP B CD1  1  
ATOM 795   C CD2  . TRP B 2 27 ? 12.218  0.073   -2.352  1.00 0.00 ? 51  TRP B CD2  1  
ATOM 796   N NE1  . TRP B 2 27 ? 11.933  1.158   -0.429  1.00 0.00 ? 51  TRP B NE1  1  
ATOM 797   C CE2  . TRP B 2 27 ? 11.361  0.235   -1.260  1.00 0.00 ? 51  TRP B CE2  1  
ATOM 798   C CE3  . TRP B 2 27 ? 11.884  -0.811  -3.351  1.00 0.00 ? 51  TRP B CE3  1  
ATOM 799   C CZ2  . TRP B 2 27 ? 10.177  -0.473  -1.143  1.00 0.00 ? 51  TRP B CZ2  1  
ATOM 800   C CZ3  . TRP B 2 27 ? 10.710  -1.511  -3.241  1.00 0.00 ? 51  TRP B CZ3  1  
ATOM 801   C CH2  . TRP B 2 27 ? 9.865   -1.333  -2.133  1.00 0.00 ? 51  TRP B CH2  1  
ATOM 802   H H    . TRP B 2 27 ? 15.692  -0.472  -0.687  1.00 0.00 ? 51  TRP B H    1  
ATOM 803   H HA   . TRP B 2 27 ? 15.316  -0.852  -2.864  1.00 0.00 ? 51  TRP B HA   1  
ATOM 804   H HB2  . TRP B 2 27 ? 14.781  2.087   -3.109  1.00 0.00 ? 51  TRP B HB2  1  
ATOM 805   H HB3  . TRP B 2 27 ? 14.141  0.768   -4.067  1.00 0.00 ? 51  TRP B HB3  1  
ATOM 806   H HD1  . TRP B 2 27 ? 13.800  2.275   -0.554  1.00 0.00 ? 51  TRP B HD1  1  
ATOM 807   H HE1  . TRP B 2 27 ? 11.561  1.476   0.417   1.00 0.00 ? 51  TRP B HE1  1  
ATOM 808   H HE3  . TRP B 2 27 ? 12.533  -0.949  -4.201  1.00 0.00 ? 51  TRP B HE3  1  
ATOM 809   H HZ2  . TRP B 2 27 ? 9.514   -0.361  -0.310  1.00 0.00 ? 51  TRP B HZ2  1  
ATOM 810   H HZ3  . TRP B 2 27 ? 10.436  -2.209  -4.007  1.00 0.00 ? 51  TRP B HZ3  1  
ATOM 811   H HH2  . TRP B 2 27 ? 8.944   -1.875  -2.078  1.00 0.00 ? 51  TRP B HH2  1  
ATOM 812   N N    . SER B 2 28 ? 17.942  0.852   -2.797  1.00 0.00 ? 52  SER B N    1  
ATOM 813   C CA   . SER B 2 28 ? 19.199  1.175   -3.461  1.00 0.00 ? 52  SER B CA   1  
ATOM 814   C C    . SER B 2 28 ? 19.853  -0.084  -4.012  1.00 0.00 ? 52  SER B C    1  
ATOM 815   O O    . SER B 2 28 ? 19.829  -0.329  -5.215  1.00 0.00 ? 52  SER B O    1  
ATOM 816   C CB   . SER B 2 28 ? 20.149  1.879   -2.487  1.00 0.00 ? 52  SER B CB   1  
ATOM 817   O OG   . SER B 2 28 ? 19.620  3.127   -2.072  1.00 0.00 ? 52  SER B OG   1  
ATOM 818   H H    . SER B 2 28 ? 17.891  0.901   -1.821  1.00 0.00 ? 52  SER B H    1  
ATOM 819   H HA   . SER B 2 28 ? 18.983  1.835   -4.279  1.00 0.00 ? 52  SER B HA   1  
ATOM 820   H HB2  . SER B 2 28 ? 20.294  1.257   -1.617  1.00 0.00 ? 52  SER B HB2  1  
ATOM 821   H HB3  . SER B 2 28 ? 21.099  2.047   -2.973  1.00 0.00 ? 52  SER B HB3  1  
ATOM 822   H HG   . SER B 2 28 ? 20.175  3.837   -2.404  1.00 0.00 ? 52  SER B HG   1  
ATOM 823   N N    . THR B 2 29 ? 20.426  -0.867  -3.107  1.00 0.00 ? 53  THR B N    1  
ATOM 824   C CA   . THR B 2 29 ? 21.098  -2.121  -3.445  1.00 0.00 ? 53  THR B CA   1  
ATOM 825   C C    . THR B 2 29 ? 22.167  -1.932  -4.523  1.00 0.00 ? 53  THR B C    1  
ATOM 826   O O    . THR B 2 29 ? 23.361  -1.896  -4.221  1.00 0.00 ? 53  THR B O    1  
ATOM 827   C CB   . THR B 2 29 ? 20.096  -3.208  -3.893  1.00 0.00 ? 53  THR B CB   1  
ATOM 828   O OG1  . THR B 2 29 ? 19.387  -2.787  -5.064  1.00 0.00 ? 53  THR B OG1  1  
ATOM 829   C CG2  . THR B 2 29 ? 19.101  -3.511  -2.782  1.00 0.00 ? 53  THR B CG2  1  
ATOM 830   H H    . THR B 2 29 ? 20.395  -0.587  -2.175  1.00 0.00 ? 53  THR B H    1  
ATOM 831   H HA   . THR B 2 29 ? 21.585  -2.474  -2.547  1.00 0.00 ? 53  THR B HA   1  
ATOM 832   H HB   . THR B 2 29 ? 20.644  -4.111  -4.119  1.00 0.00 ? 53  THR B HB   1  
ATOM 833   H HG1  . THR B 2 29 ? 19.313  -3.525  -5.675  1.00 0.00 ? 53  THR B HG1  1  
ATOM 834   H HG21 . THR B 2 29 ? 18.516  -2.629  -2.572  1.00 0.00 ? 53  THR B HG21 1  
ATOM 835   H HG22 . THR B 2 29 ? 19.635  -3.811  -1.892  1.00 0.00 ? 53  THR B HG22 1  
ATOM 836   H HG23 . THR B 2 29 ? 18.446  -4.312  -3.095  1.00 0.00 ? 53  THR B HG23 1  
ATOM 837   N N    . GLU B 2 30 ? 21.739  -1.812  -5.774  1.00 0.00 ? 54  GLU B N    1  
ATOM 838   C CA   . GLU B 2 30 ? 22.659  -1.637  -6.887  1.00 0.00 ? 54  GLU B CA   1  
ATOM 839   C C    . GLU B 2 30 ? 23.092  -0.180  -7.013  1.00 0.00 ? 54  GLU B C    1  
ATOM 840   O O    . GLU B 2 30 ? 24.034  0.144   -7.738  1.00 0.00 ? 54  GLU B O    1  
ATOM 841   C CB   . GLU B 2 30 ? 21.994  -2.116  -8.180  1.00 0.00 ? 54  GLU B CB   1  
ATOM 842   C CG   . GLU B 2 30 ? 22.824  -1.869  -9.426  1.00 0.00 ? 54  GLU B CG   1  
ATOM 843   C CD   . GLU B 2 30 ? 22.157  -2.392  -10.684 1.00 0.00 ? 54  GLU B CD   1  
ATOM 844   O OE1  . GLU B 2 30 ? 22.334  -3.589  -10.995 1.00 0.00 ? 54  GLU B OE1  1  
ATOM 845   O OE2  . GLU B 2 30 ? 21.458  -1.606  -11.356 1.00 0.00 ? 54  GLU B OE2  1  
ATOM 846   H H    . GLU B 2 30 ? 20.779  -1.833  -5.954  1.00 0.00 ? 54  GLU B H    1  
ATOM 847   H HA   . GLU B 2 30 ? 23.528  -2.240  -6.694  1.00 0.00 ? 54  GLU B HA   1  
ATOM 848   H HB2  . GLU B 2 30 ? 21.809  -3.177  -8.104  1.00 0.00 ? 54  GLU B HB2  1  
ATOM 849   H HB3  . GLU B 2 30 ? 21.050  -1.604  -8.296  1.00 0.00 ? 54  GLU B HB3  1  
ATOM 850   H HG2  . GLU B 2 30 ? 22.973  -0.807  -9.530  1.00 0.00 ? 54  GLU B HG2  1  
ATOM 851   H HG3  . GLU B 2 30 ? 23.780  -2.358  -9.310  1.00 0.00 ? 54  GLU B HG3  1  
ATOM 852   N N    . ALA B 2 31 ? 22.406  0.693   -6.288  1.00 0.00 ? 55  ALA B N    1  
ATOM 853   C CA   . ALA B 2 31 ? 22.714  2.118   -6.314  1.00 0.00 ? 55  ALA B CA   1  
ATOM 854   C C    . ALA B 2 31 ? 23.955  2.424   -5.484  1.00 0.00 ? 55  ALA B C    1  
ATOM 855   O O    . ALA B 2 31 ? 25.059  2.468   -6.067  1.00 0.00 ? 55  ALA B O    1  
ATOM 856   C CB   . ALA B 2 31 ? 21.526  2.925   -5.814  1.00 0.00 ? 55  ALA B CB   1  
ATOM 857   O OXT  . ALA B 2 31 ? 23.815  2.617   -4.258  1.00 0.00 ? 55  ALA B OXT  1  
ATOM 858   H H    . ALA B 2 31 ? 21.680  0.369   -5.719  1.00 0.00 ? 55  ALA B H    1  
ATOM 859   H HA   . ALA B 2 31 ? 22.902  2.397   -7.340  1.00 0.00 ? 55  ALA B HA   1  
ATOM 860   H HB1  . ALA B 2 31 ? 21.758  3.978   -5.870  1.00 0.00 ? 55  ALA B HB1  1  
ATOM 861   H HB2  . ALA B 2 31 ? 21.313  2.657   -4.790  1.00 0.00 ? 55  ALA B HB2  1  
ATOM 862   H HB3  . ALA B 2 31 ? 20.663  2.714   -6.427  1.00 0.00 ? 55  ALA B HB3  1  
ATOM 863   N N    . ALA A 1 1  ? 2.697   -3.010  13.414  1.00 0.00 ? 106 ALA A N    2  
ATOM 864   C CA   . ALA A 1 1  ? 2.047   -4.345  13.374  1.00 0.00 ? 106 ALA A CA   2  
ATOM 865   C C    . ALA A 1 1  ? 0.789   -4.366  14.235  1.00 0.00 ? 106 ALA A C    2  
ATOM 866   O O    . ALA A 1 1  ? 0.865   -4.458  15.461  1.00 0.00 ? 106 ALA A O    2  
ATOM 867   C CB   . ALA A 1 1  ? 3.021   -5.418  13.838  1.00 0.00 ? 106 ALA A CB   2  
ATOM 868   H H1   . ALA A 1 1  ? 2.041   -2.281  13.066  1.00 0.00 ? 106 ALA A H1   2  
ATOM 869   H H2   . ALA A 1 1  ? 3.548   -3.009  12.815  1.00 0.00 ? 106 ALA A H2   2  
ATOM 870   H H3   . ALA A 1 1  ? 2.973   -2.776  14.390  1.00 0.00 ? 106 ALA A H3   2  
ATOM 871   H HA   . ALA A 1 1  ? 1.774   -4.559  12.351  1.00 0.00 ? 106 ALA A HA   2  
ATOM 872   H HB1  . ALA A 1 1  ? 2.548   -6.386  13.772  1.00 0.00 ? 106 ALA A HB1  2  
ATOM 873   H HB2  . ALA A 1 1  ? 3.306   -5.226  14.862  1.00 0.00 ? 106 ALA A HB2  2  
ATOM 874   H HB3  . ALA A 1 1  ? 3.899   -5.402  13.212  1.00 0.00 ? 106 ALA A HB3  2  
ATOM 875   N N    . ALA A 1 2  ? -0.370  -4.280  13.586  1.00 0.00 ? 107 ALA A N    2  
ATOM 876   C CA   . ALA A 1 2  ? -1.645  -4.289  14.294  1.00 0.00 ? 107 ALA A CA   2  
ATOM 877   C C    . ALA A 1 2  ? -2.772  -4.786  13.396  1.00 0.00 ? 107 ALA A C    2  
ATOM 878   O O    . ALA A 1 2  ? -3.828  -5.194  13.879  1.00 0.00 ? 107 ALA A O    2  
ATOM 879   C CB   . ALA A 1 2  ? -1.963  -2.899  14.825  1.00 0.00 ? 107 ALA A CB   2  
ATOM 880   H H    . ALA A 1 2  ? -0.366  -4.208  12.609  1.00 0.00 ? 107 ALA A H    2  
ATOM 881   H HA   . ALA A 1 2  ? -1.551  -4.957  15.137  1.00 0.00 ? 107 ALA A HA   2  
ATOM 882   H HB1  . ALA A 1 2  ? -2.868  -2.936  15.410  1.00 0.00 ? 107 ALA A HB1  2  
ATOM 883   H HB2  . ALA A 1 2  ? -2.097  -2.220  13.996  1.00 0.00 ? 107 ALA A HB2  2  
ATOM 884   H HB3  . ALA A 1 2  ? -1.148  -2.555  15.444  1.00 0.00 ? 107 ALA A HB3  2  
ATOM 885   N N    . ALA A 1 3  ? -2.540  -4.750  12.088  1.00 0.00 ? 108 ALA A N    2  
ATOM 886   C CA   . ALA A 1 3  ? -3.533  -5.198  11.122  1.00 0.00 ? 108 ALA A CA   2  
ATOM 887   C C    . ALA A 1 3  ? -3.138  -6.524  10.498  1.00 0.00 ? 108 ALA A C    2  
ATOM 888   O O    . ALA A 1 3  ? -2.248  -7.220  10.988  1.00 0.00 ? 108 ALA A O    2  
ATOM 889   C CB   . ALA A 1 3  ? -3.717  -4.162  10.026  1.00 0.00 ? 108 ALA A CB   2  
ATOM 890   H H    . ALA A 1 3  ? -1.679  -4.414  11.766  1.00 0.00 ? 108 ALA A H    2  
ATOM 891   H HA   . ALA A 1 3  ? -4.476  -5.316  11.637  1.00 0.00 ? 108 ALA A HA   2  
ATOM 892   H HB1  . ALA A 1 3  ? -4.750  -3.848  9.994   1.00 0.00 ? 108 ALA A HB1  2  
ATOM 893   H HB2  . ALA A 1 3  ? -3.444  -4.604  9.072   1.00 0.00 ? 108 ALA A HB2  2  
ATOM 894   H HB3  . ALA A 1 3  ? -3.084  -3.310  10.224  1.00 0.00 ? 108 ALA A HB3  2  
ATOM 895   N N    . THR A 1 4  ? -3.810  -6.863  9.407   1.00 0.00 ? 109 THR A N    2  
ATOM 896   C CA   . THR A 1 4  ? -3.532  -8.090  8.682   1.00 0.00 ? 109 THR A CA   2  
ATOM 897   C C    . THR A 1 4  ? -2.272  -7.918  7.838   1.00 0.00 ? 109 THR A C    2  
ATOM 898   O O    . THR A 1 4  ? -1.453  -7.040  8.107   1.00 0.00 ? 109 THR A O    2  
ATOM 899   C CB   . THR A 1 4  ? -4.721  -8.468  7.772   1.00 0.00 ? 109 THR A CB   2  
ATOM 900   O OG1  . THR A 1 4  ? -4.556  -9.800  7.270   1.00 0.00 ? 109 THR A OG1  2  
ATOM 901   C CG2  . THR A 1 4  ? -4.850  -7.493  6.605   1.00 0.00 ? 109 THR A CG2  2  
ATOM 902   H H    . THR A 1 4  ? -4.517  -6.268  9.080   1.00 0.00 ? 109 THR A H    2  
ATOM 903   H HA   . THR A 1 4  ? -3.378  -8.882  9.400   1.00 0.00 ? 109 THR A HA   2  
ATOM 904   H HB   . THR A 1 4  ? -5.629  -8.424  8.357   1.00 0.00 ? 109 THR A HB   2  
ATOM 905   H HG1  . THR A 1 4  ? -4.918  -9.855  6.382   1.00 0.00 ? 109 THR A HG1  2  
ATOM 906   H HG21 . THR A 1 4  ? -4.820  -6.477  6.976   1.00 0.00 ? 109 THR A HG21 2  
ATOM 907   H HG22 . THR A 1 4  ? -5.787  -7.663  6.097   1.00 0.00 ? 109 THR A HG22 2  
ATOM 908   H HG23 . THR A 1 4  ? -4.034  -7.648  5.916   1.00 0.00 ? 109 THR A HG23 2  
ATOM 909   N N    . ASN A 1 5  ? -2.118  -8.762  6.827   1.00 0.00 ? 110 ASN A N    2  
ATOM 910   C CA   . ASN A 1 5  ? -0.969  -8.686  5.935   1.00 0.00 ? 110 ASN A CA   2  
ATOM 911   C C    . ASN A 1 5  ? -1.222  -7.630  4.865   1.00 0.00 ? 110 ASN A C    2  
ATOM 912   O O    . ASN A 1 5  ? -1.996  -7.866  3.942   1.00 0.00 ? 110 ASN A O    2  
ATOM 913   C CB   . ASN A 1 5  ? -0.709  -10.043 5.275   1.00 0.00 ? 110 ASN A CB   2  
ATOM 914   C CG   . ASN A 1 5  ? -0.382  -11.128 6.283   1.00 0.00 ? 110 ASN A CG   2  
ATOM 915   O OD1  . ASN A 1 5  ? -0.861  -11.104 7.418   1.00 0.00 ? 110 ASN A OD1  2  
ATOM 916   N ND2  . ASN A 1 5  ? 0.440   -12.087 5.874   1.00 0.00 ? 110 ASN A ND2  2  
ATOM 917   H H    . ASN A 1 5  ? -2.798  -9.442  6.673   1.00 0.00 ? 110 ASN A H    2  
ATOM 918   H HA   . ASN A 1 5  ? -0.107  -8.402  6.520   1.00 0.00 ? 110 ASN A HA   2  
ATOM 919   H HB2  . ASN A 1 5  ? -1.589  -10.343 4.721   1.00 0.00 ? 110 ASN A HB2  2  
ATOM 920   H HB3  . ASN A 1 5  ? 0.125   -9.949  4.593   1.00 0.00 ? 110 ASN A HB3  2  
ATOM 921   H HD21 . ASN A 1 5  ? 0.785   -12.041 4.957   1.00 0.00 ? 110 ASN A HD21 2  
ATOM 922   H HD22 . ASN A 1 5  ? 0.670   -12.802 6.504   1.00 0.00 ? 110 ASN A HD22 2  
ATOM 923   N N    . PRO A 1 6  ? -0.577  -6.453  4.963   1.00 0.00 ? 111 PRO A N    2  
ATOM 924   C CA   . PRO A 1 6  ? -0.773  -5.365  3.997   1.00 0.00 ? 111 PRO A CA   2  
ATOM 925   C C    . PRO A 1 6  ? -0.412  -5.757  2.566   1.00 0.00 ? 111 PRO A C    2  
ATOM 926   O O    . PRO A 1 6  ? -0.593  -4.972  1.640   1.00 0.00 ? 111 PRO A O    2  
ATOM 927   C CB   . PRO A 1 6  ? 0.147   -4.254  4.510   1.00 0.00 ? 111 PRO A CB   2  
ATOM 928   C CG   . PRO A 1 6  ? 1.147   -4.955  5.361   1.00 0.00 ? 111 PRO A CG   2  
ATOM 929   C CD   . PRO A 1 6  ? 0.399   -6.083  6.003   1.00 0.00 ? 111 PRO A CD   2  
ATOM 930   H HA   . PRO A 1 6  ? -1.793  -5.016  4.013   1.00 0.00 ? 111 PRO A HA   2  
ATOM 931   H HB2  . PRO A 1 6  ? 0.609   -3.753  3.677   1.00 0.00 ? 111 PRO A HB2  2  
ATOM 932   H HB3  . PRO A 1 6  ? -0.430  -3.546  5.086   1.00 0.00 ? 111 PRO A HB3  2  
ATOM 933   H HG2  . PRO A 1 6  ? 1.951   -5.335  4.748   1.00 0.00 ? 111 PRO A HG2  2  
ATOM 934   H HG3  . PRO A 1 6  ? 1.530   -4.281  6.113   1.00 0.00 ? 111 PRO A HG3  2  
ATOM 935   H HD2  . PRO A 1 6  ? 1.064   -6.905  6.224   1.00 0.00 ? 111 PRO A HD2  2  
ATOM 936   H HD3  . PRO A 1 6  ? -0.102  -5.745  6.897   1.00 0.00 ? 111 PRO A HD3  2  
ATOM 937   N N    . ALA A 1 7  ? 0.103   -6.966  2.385   1.00 0.00 ? 112 ALA A N    2  
ATOM 938   C CA   . ALA A 1 7  ? 0.457   -7.446  1.053   1.00 0.00 ? 112 ALA A CA   2  
ATOM 939   C C    . ALA A 1 7  ? -0.757  -8.066  0.388   1.00 0.00 ? 112 ALA A C    2  
ATOM 940   O O    . ALA A 1 7  ? -1.140  -7.690  -0.720  1.00 0.00 ? 112 ALA A O    2  
ATOM 941   C CB   . ALA A 1 7  ? 1.591   -8.447  1.135   1.00 0.00 ? 112 ALA A CB   2  
ATOM 942   H H    . ALA A 1 7  ? 0.249   -7.548  3.160   1.00 0.00 ? 112 ALA A H    2  
ATOM 943   H HA   . ALA A 1 7  ? 0.787   -6.600  0.468   1.00 0.00 ? 112 ALA A HA   2  
ATOM 944   H HB1  . ALA A 1 7  ? 1.238   -9.356  1.601   1.00 0.00 ? 112 ALA A HB1  2  
ATOM 945   H HB2  . ALA A 1 7  ? 2.388   -8.028  1.724   1.00 0.00 ? 112 ALA A HB2  2  
ATOM 946   H HB3  . ALA A 1 7  ? 1.952   -8.667  0.141   1.00 0.00 ? 112 ALA A HB3  2  
ATOM 947   N N    . ARG A 1 8  ? -1.355  -9.023  1.082   1.00 0.00 ? 113 ARG A N    2  
ATOM 948   C CA   . ARG A 1 8  ? -2.555  -9.693  0.592   1.00 0.00 ? 113 ARG A CA   2  
ATOM 949   C C    . ARG A 1 8  ? -3.757  -8.769  0.757   1.00 0.00 ? 113 ARG A C    2  
ATOM 950   O O    . ARG A 1 8  ? -4.757  -8.880  0.047   1.00 0.00 ? 113 ARG A O    2  
ATOM 951   C CB   . ARG A 1 8  ? -2.782  -10.998 1.362   1.00 0.00 ? 113 ARG A CB   2  
ATOM 952   C CG   . ARG A 1 8  ? -2.391  -12.244 0.582   1.00 0.00 ? 113 ARG A CG   2  
ATOM 953   C CD   . ARG A 1 8  ? -0.891  -12.305 0.340   1.00 0.00 ? 113 ARG A CD   2  
ATOM 954   N NE   . ARG A 1 8  ? -0.517  -13.443 -0.493  1.00 0.00 ? 113 ARG A NE   2  
ATOM 955   C CZ   . ARG A 1 8  ? 0.741   -13.783 -0.757  1.00 0.00 ? 113 ARG A CZ   2  
ATOM 956   N NH1  . ARG A 1 8  ? 1.744   -13.080 -0.248  1.00 0.00 ? 113 ARG A NH1  2  
ATOM 957   N NH2  . ARG A 1 8  ? 0.997   -14.829 -1.531  1.00 0.00 ? 113 ARG A NH2  2  
ATOM 958   H H    . ARG A 1 8  ? -0.966  -9.292  1.941   1.00 0.00 ? 113 ARG A H    2  
ATOM 959   H HA   . ARG A 1 8  ? -2.417  -9.914  -0.456  1.00 0.00 ? 113 ARG A HA   2  
ATOM 960   H HB2  . ARG A 1 8  ? -2.194  -10.971 2.268   1.00 0.00 ? 113 ARG A HB2  2  
ATOM 961   H HB3  . ARG A 1 8  ? -3.825  -11.074 1.625   1.00 0.00 ? 113 ARG A HB3  2  
ATOM 962   H HG2  . ARG A 1 8  ? -2.689  -13.116 1.144   1.00 0.00 ? 113 ARG A HG2  2  
ATOM 963   H HG3  . ARG A 1 8  ? -2.901  -12.235 -0.370  1.00 0.00 ? 113 ARG A HG3  2  
ATOM 964   H HD2  . ARG A 1 8  ? -0.581  -11.394 -0.151  1.00 0.00 ? 113 ARG A HD2  2  
ATOM 965   H HD3  . ARG A 1 8  ? -0.389  -12.386 1.293   1.00 0.00 ? 113 ARG A HD3  2  
ATOM 966   H HE   . ARG A 1 8  ? -1.242  -13.979 -0.879  1.00 0.00 ? 113 ARG A HE   2  
ATOM 967   H HH11 . ARG A 1 8  ? 1.555   -12.291 0.337   1.00 0.00 ? 113 ARG A HH11 2  
ATOM 968   H HH12 . ARG A 1 8  ? 2.688   -13.338 -0.449  1.00 0.00 ? 113 ARG A HH12 2  
ATOM 969   H HH21 . ARG A 1 8  ? 0.243   -15.362 -1.915  1.00 0.00 ? 113 ARG A HH21 2  
ATOM 970   H HH22 . ARG A 1 8  ? 1.943   -15.085 -1.729  1.00 0.00 ? 113 ARG A HH22 2  
ATOM 971   N N    . TYR A 1 9  ? -3.624  -7.849  1.702   1.00 0.00 ? 114 TYR A N    2  
ATOM 972   C CA   . TYR A 1 9  ? -4.653  -6.862  2.002   1.00 0.00 ? 114 TYR A CA   2  
ATOM 973   C C    . TYR A 1 9  ? -4.886  -5.960  0.793   1.00 0.00 ? 114 TYR A C    2  
ATOM 974   O O    . TYR A 1 9  ? -6.003  -5.885  0.279   1.00 0.00 ? 114 TYR A O    2  
ATOM 975   C CB   . TYR A 1 9  ? -4.214  -6.085  3.257   1.00 0.00 ? 114 TYR A CB   2  
ATOM 976   C CG   . TYR A 1 9  ? -4.782  -4.690  3.451   1.00 0.00 ? 114 TYR A CG   2  
ATOM 977   C CD1  . TYR A 1 9  ? -5.963  -4.273  2.850   1.00 0.00 ? 114 TYR A CD1  2  
ATOM 978   C CD2  . TYR A 1 9  ? -4.106  -3.787  4.259   1.00 0.00 ? 114 TYR A CD2  2  
ATOM 979   C CE1  . TYR A 1 9  ? -6.448  -2.997  3.046   1.00 0.00 ? 114 TYR A CE1  2  
ATOM 980   C CE2  . TYR A 1 9  ? -4.583  -2.512  4.463   1.00 0.00 ? 114 TYR A CE2  2  
ATOM 981   C CZ   . TYR A 1 9  ? -5.756  -2.118  3.854   1.00 0.00 ? 114 TYR A CZ   2  
ATOM 982   O OH   . TYR A 1 9  ? -6.237  -0.843  4.052   1.00 0.00 ? 114 TYR A OH   2  
ATOM 983   H H    . TYR A 1 9  ? -2.795  -7.829  2.221   1.00 0.00 ? 114 TYR A H    2  
ATOM 984   H HA   . TYR A 1 9  ? -5.571  -7.385  2.220   1.00 0.00 ? 114 TYR A HA   2  
ATOM 985   H HB2  . TYR A 1 9  ? -4.492  -6.658  4.125   1.00 0.00 ? 114 TYR A HB2  2  
ATOM 986   H HB3  . TYR A 1 9  ? -3.138  -5.995  3.239   1.00 0.00 ? 114 TYR A HB3  2  
ATOM 987   H HD1  . TYR A 1 9  ? -6.505  -4.961  2.220   1.00 0.00 ? 114 TYR A HD1  2  
ATOM 988   H HD2  . TYR A 1 9  ? -3.189  -4.096  4.737   1.00 0.00 ? 114 TYR A HD2  2  
ATOM 989   H HE1  . TYR A 1 9  ? -7.364  -2.696  2.566   1.00 0.00 ? 114 TYR A HE1  2  
ATOM 990   H HE2  . TYR A 1 9  ? -4.033  -1.833  5.099   1.00 0.00 ? 114 TYR A HE2  2  
ATOM 991   H HH   . TYR A 1 9  ? -7.183  -0.879  4.215   1.00 0.00 ? 114 TYR A HH   2  
ATOM 992   N N    . CYS A 1 10 ? -3.841  -5.285  0.331   1.00 0.00 ? 115 CYS A N    2  
ATOM 993   C CA   . CYS A 1 10 ? -3.976  -4.408  -0.825  1.00 0.00 ? 115 CYS A CA   2  
ATOM 994   C C    . CYS A 1 10 ? -4.151  -5.229  -2.099  1.00 0.00 ? 115 CYS A C    2  
ATOM 995   O O    . CYS A 1 10 ? -4.792  -4.788  -3.050  1.00 0.00 ? 115 CYS A O    2  
ATOM 996   C CB   . CYS A 1 10 ? -2.763  -3.491  -0.971  1.00 0.00 ? 115 CYS A CB   2  
ATOM 997   S SG   . CYS A 1 10 ? -2.090  -2.860  0.603   1.00 0.00 ? 115 CYS A SG   2  
ATOM 998   H H    . CYS A 1 10 ? -2.969  -5.377  0.771   1.00 0.00 ? 115 CYS A H    2  
ATOM 999   H HA   . CYS A 1 10 ? -4.858  -3.804  -0.678  1.00 0.00 ? 115 CYS A HA   2  
ATOM 1000  H HB2  . CYS A 1 10 ? -1.972  -4.029  -1.470  1.00 0.00 ? 115 CYS A HB2  2  
ATOM 1001  H HB3  . CYS A 1 10 ? -3.046  -2.641  -1.574  1.00 0.00 ? 115 CYS A HB3  2  
ATOM 1002  N N    . CYS A 1 11 ? -3.579  -6.427  -2.116  1.00 0.00 ? 116 CYS A N    2  
ATOM 1003  C CA   . CYS A 1 11 ? -3.683  -7.295  -3.282  1.00 0.00 ? 116 CYS A CA   2  
ATOM 1004  C C    . CYS A 1 11 ? -5.145  -7.565  -3.617  1.00 0.00 ? 116 CYS A C    2  
ATOM 1005  O O    . CYS A 1 11 ? -5.516  -7.686  -4.784  1.00 0.00 ? 116 CYS A O    2  
ATOM 1006  C CB   . CYS A 1 11 ? -2.960  -8.623  -3.034  1.00 0.00 ? 116 CYS A CB   2  
ATOM 1007  S SG   . CYS A 1 11 ? -3.141  -9.839  -4.383  1.00 0.00 ? 116 CYS A SG   2  
ATOM 1008  H H    . CYS A 1 11 ? -3.078  -6.733  -1.331  1.00 0.00 ? 116 CYS A H    2  
ATOM 1009  H HA   . CYS A 1 11 ? -3.221  -6.785  -4.115  1.00 0.00 ? 116 CYS A HA   2  
ATOM 1010  H HB2  . CYS A 1 11 ? -1.908  -8.434  -2.899  1.00 0.00 ? 116 CYS A HB2  2  
ATOM 1011  H HB3  . CYS A 1 11 ? -3.351  -9.072  -2.135  1.00 0.00 ? 116 CYS A HB3  2  
ATOM 1012  N N    . LEU A 1 12 ? -5.968  -7.657  -2.578  1.00 0.00 ? 117 LEU A N    2  
ATOM 1013  C CA   . LEU A 1 12 ? -7.385  -7.915  -2.741  1.00 0.00 ? 117 LEU A CA   2  
ATOM 1014  C C    . LEU A 1 12 ? -8.152  -6.654  -3.129  1.00 0.00 ? 117 LEU A C    2  
ATOM 1015  O O    . LEU A 1 12 ? -8.788  -6.606  -4.182  1.00 0.00 ? 117 LEU A O    2  
ATOM 1016  C CB   . LEU A 1 12 ? -7.947  -8.489  -1.448  1.00 0.00 ? 117 LEU A CB   2  
ATOM 1017  C CG   . LEU A 1 12 ? -7.725  -9.990  -1.248  1.00 0.00 ? 117 LEU A CG   2  
ATOM 1018  C CD1  . LEU A 1 12 ? -8.139  -10.406 0.156   1.00 0.00 ? 117 LEU A CD1  2  
ATOM 1019  C CD2  . LEU A 1 12 ? -8.497  -10.788 -2.288  1.00 0.00 ? 117 LEU A CD2  2  
ATOM 1020  H H    . LEU A 1 12 ? -5.610  -7.557  -1.672  1.00 0.00 ? 117 LEU A H    2  
ATOM 1021  H HA   . LEU A 1 12 ? -7.501  -8.645  -3.522  1.00 0.00 ? 117 LEU A HA   2  
ATOM 1022  H HB2  . LEU A 1 12 ? -7.484  -7.968  -0.628  1.00 0.00 ? 117 LEU A HB2  2  
ATOM 1023  H HB3  . LEU A 1 12 ? -9.002  -8.296  -1.425  1.00 0.00 ? 117 LEU A HB3  2  
ATOM 1024  H HG   . LEU A 1 12 ? -6.674  -10.212 -1.365  1.00 0.00 ? 117 LEU A HG   2  
ATOM 1025  H HD11 . LEU A 1 12 ? -9.186  -10.184 0.301   1.00 0.00 ? 117 LEU A HD11 2  
ATOM 1026  H HD12 . LEU A 1 12 ? -7.552  -9.861  0.881   1.00 0.00 ? 117 LEU A HD12 2  
ATOM 1027  H HD13 . LEU A 1 12 ? -7.975  -11.466 0.281   1.00 0.00 ? 117 LEU A HD13 2  
ATOM 1028  H HD21 . LEU A 1 12 ? -9.552  -10.576 -2.194  1.00 0.00 ? 117 LEU A HD21 2  
ATOM 1029  H HD22 . LEU A 1 12 ? -8.327  -11.843 -2.132  1.00 0.00 ? 117 LEU A HD22 2  
ATOM 1030  H HD23 . LEU A 1 12 ? -8.161  -10.511 -3.276  1.00 0.00 ? 117 LEU A HD23 2  
ATOM 1031  N N    . SER A 1 13 ? -8.093  -5.634  -2.276  1.00 0.00 ? 118 SER A N    2  
ATOM 1032  C CA   . SER A 1 13 ? -8.807  -4.389  -2.528  1.00 0.00 ? 118 SER A CA   2  
ATOM 1033  C C    . SER A 1 13 ? -7.881  -3.258  -2.974  1.00 0.00 ? 118 SER A C    2  
ATOM 1034  O O    . SER A 1 13 ? -8.237  -2.472  -3.854  1.00 0.00 ? 118 SER A O    2  
ATOM 1035  C CB   . SER A 1 13 ? -9.567  -3.966  -1.273  1.00 0.00 ? 118 SER A CB   2  
ATOM 1036  O OG   . SER A 1 13 ? -10.692 -4.796  -1.051  1.00 0.00 ? 118 SER A OG   2  
ATOM 1037  H H    . SER A 1 13 ? -7.561  -5.720  -1.459  1.00 0.00 ? 118 SER A H    2  
ATOM 1038  H HA   . SER A 1 13 ? -9.522  -4.577  -3.315  1.00 0.00 ? 118 SER A HA   2  
ATOM 1039  H HB2  . SER A 1 13 ? -8.911  -4.034  -0.418  1.00 0.00 ? 118 SER A HB2  2  
ATOM 1040  H HB3  . SER A 1 13 ? -9.901  -2.948  -1.387  1.00 0.00 ? 118 SER A HB3  2  
ATOM 1041  H HG   . SER A 1 13 ? -10.645 -5.171  -0.169  1.00 0.00 ? 118 SER A HG   2  
ATOM 1042  N N    . GLY A 1 14 ? -6.697  -3.171  -2.373  1.00 0.00 ? 119 GLY A N    2  
ATOM 1043  C CA   . GLY A 1 14 ? -5.773  -2.110  -2.720  1.00 0.00 ? 119 GLY A CA   2  
ATOM 1044  C C    . GLY A 1 14 ? -5.580  -1.147  -1.569  1.00 0.00 ? 119 GLY A C    2  
ATOM 1045  O O    . GLY A 1 14 ? -6.436  -1.059  -0.687  1.00 0.00 ? 119 GLY A O    2  
ATOM 1046  H H    . GLY A 1 14 ? -6.440  -3.835  -1.698  1.00 0.00 ? 119 GLY A H    2  
ATOM 1047  H HA2  . GLY A 1 14 ? -4.820  -2.548  -2.975  1.00 0.00 ? 119 GLY A HA2  2  
ATOM 1048  H HA3  . GLY A 1 14 ? -6.157  -1.573  -3.576  1.00 0.00 ? 119 GLY A HA3  2  
ATOM 1049  N N    . CYS A 1 15 ? -4.466  -0.423  -1.562  1.00 0.00 ? 120 CYS A N    2  
ATOM 1050  C CA   . CYS A 1 15 ? -4.199  0.513   -0.477  1.00 0.00 ? 120 CYS A CA   2  
ATOM 1051  C C    . CYS A 1 15 ? -3.869  1.906   -0.982  1.00 0.00 ? 120 CYS A C    2  
ATOM 1052  O O    . CYS A 1 15 ? -3.290  2.076   -2.055  1.00 0.00 ? 120 CYS A O    2  
ATOM 1053  C CB   . CYS A 1 15 ? -3.082  -0.004  0.426   1.00 0.00 ? 120 CYS A CB   2  
ATOM 1054  S SG   . CYS A 1 15 ? -3.495  -1.563  1.270   1.00 0.00 ? 120 CYS A SG   2  
ATOM 1055  H H    . CYS A 1 15 ? -3.823  -0.514  -2.296  1.00 0.00 ? 120 CYS A H    2  
ATOM 1056  H HA   . CYS A 1 15 ? -5.094  0.580   0.103   1.00 0.00 ? 120 CYS A HA   2  
ATOM 1057  H HB2  . CYS A 1 15 ? -2.195  -0.168  -0.161  1.00 0.00 ? 120 CYS A HB2  2  
ATOM 1058  H HB3  . CYS A 1 15 ? -2.871  0.736   1.183   1.00 0.00 ? 120 CYS A HB3  2  
ATOM 1059  N N    . THR A 1 16 ? -4.252  2.900   -0.187  1.00 0.00 ? 121 THR A N    2  
ATOM 1060  C CA   . THR A 1 16 ? -4.009  4.292   -0.526  1.00 0.00 ? 121 THR A CA   2  
ATOM 1061  C C    . THR A 1 16 ? -2.632  4.726   -0.103  1.00 0.00 ? 121 THR A C    2  
ATOM 1062  O O    . THR A 1 16 ? -1.976  4.073   0.705   1.00 0.00 ? 121 THR A O    2  
ATOM 1063  C CB   . THR A 1 16 ? -4.997  5.241   0.166   1.00 0.00 ? 121 THR A CB   2  
ATOM 1064  O OG1  . THR A 1 16 ? -4.642  5.405   1.542   1.00 0.00 ? 121 THR A OG1  2  
ATOM 1065  C CG2  . THR A 1 16 ? -6.399  4.718   0.071   1.00 0.00 ? 121 THR A CG2  2  
ATOM 1066  H H    . THR A 1 16 ? -4.709  2.689   0.654   1.00 0.00 ? 121 THR A H    2  
ATOM 1067  H HA   . THR A 1 16 ? -4.112  4.408   -1.595  1.00 0.00 ? 121 THR A HA   2  
ATOM 1068  H HB   . THR A 1 16 ? -4.955  6.197   -0.333  1.00 0.00 ? 121 THR A HB   2  
ATOM 1069  H HG1  . THR A 1 16 ? -5.420  5.658   2.046   1.00 0.00 ? 121 THR A HG1  2  
ATOM 1070  H HG21 . THR A 1 16 ? -6.609  4.526   -0.957  1.00 0.00 ? 121 THR A HG21 2  
ATOM 1071  H HG22 . THR A 1 16 ? -7.090  5.454   0.454   1.00 0.00 ? 121 THR A HG22 2  
ATOM 1072  H HG23 . THR A 1 16 ? -6.488  3.803   0.638   1.00 0.00 ? 121 THR A HG23 2  
ATOM 1073  N N    . GLN A 1 17 ? -2.220  5.864   -0.625  1.00 0.00 ? 122 GLN A N    2  
ATOM 1074  C CA   . GLN A 1 17 ? -0.930  6.425   -0.286  1.00 0.00 ? 122 GLN A CA   2  
ATOM 1075  C C    . GLN A 1 17 ? -0.916  6.805   1.180   1.00 0.00 ? 122 GLN A C    2  
ATOM 1076  O O    . GLN A 1 17 ? 0.062   7.340   1.682   1.00 0.00 ? 122 GLN A O    2  
ATOM 1077  C CB   . GLN A 1 17 ? -0.625  7.632   -1.167  1.00 0.00 ? 122 GLN A CB   2  
ATOM 1078  C CG   . GLN A 1 17 ? 0.142   7.276   -2.427  1.00 0.00 ? 122 GLN A CG   2  
ATOM 1079  C CD   . GLN A 1 17 ? 0.181   8.410   -3.435  1.00 0.00 ? 122 GLN A CD   2  
ATOM 1080  O OE1  . GLN A 1 17 ? 0.237   8.179   -4.644  1.00 0.00 ? 122 GLN A OE1  2  
ATOM 1081  N NE2  . GLN A 1 17 ? 0.152   9.645   -2.944  1.00 0.00 ? 122 GLN A NE2  2  
ATOM 1082  H H    . GLN A 1 17 ? -2.811  6.344   -1.245  1.00 0.00 ? 122 GLN A H    2  
ATOM 1083  H HA   . GLN A 1 17 ? -0.168  5.658   -0.443  1.00 0.00 ? 122 GLN A HA   2  
ATOM 1084  H HB2  . GLN A 1 17 ? -1.557  8.097   -1.456  1.00 0.00 ? 122 GLN A HB2  2  
ATOM 1085  H HB3  . GLN A 1 17 ? -0.042  8.339   -0.601  1.00 0.00 ? 122 GLN A HB3  2  
ATOM 1086  H HG2  . GLN A 1 17 ? 1.156   7.024   -2.153  1.00 0.00 ? 122 GLN A HG2  2  
ATOM 1087  H HG3  . GLN A 1 17 ? -0.323  6.417   -2.883  1.00 0.00 ? 122 GLN A HG3  2  
ATOM 1088  H HE21 . GLN A 1 17 ? 0.110   9.757   -1.972  1.00 0.00 ? 122 GLN A HE21 2  
ATOM 1089  H HE22 . GLN A 1 17 ? 0.176   10.394  -3.576  1.00 0.00 ? 122 GLN A HE22 2  
ATOM 1090  N N    . GLN A 1 18 ? -2.030  6.567   1.859   1.00 0.00 ? 123 GLN A N    2  
ATOM 1091  C CA   . GLN A 1 18 ? -2.102  6.813   3.275   1.00 0.00 ? 123 GLN A CA   2  
ATOM 1092  C C    . GLN A 1 18 ? -1.730  5.528   3.983   1.00 0.00 ? 123 GLN A C    2  
ATOM 1093  O O    . GLN A 1 18 ? -0.819  5.505   4.805   1.00 0.00 ? 123 GLN A O    2  
ATOM 1094  C CB   . GLN A 1 18 ? -3.494  7.265   3.682   1.00 0.00 ? 123 GLN A CB   2  
ATOM 1095  C CG   . GLN A 1 18 ? -3.811  8.700   3.296   1.00 0.00 ? 123 GLN A CG   2  
ATOM 1096  C CD   . GLN A 1 18 ? -5.236  9.099   3.637   1.00 0.00 ? 123 GLN A CD   2  
ATOM 1097  O OE1  . GLN A 1 18 ? -5.512  10.262  3.930   1.00 0.00 ? 123 GLN A OE1  2  
ATOM 1098  N NE2  . GLN A 1 18 ? -6.149  8.136   3.597   1.00 0.00 ? 123 GLN A NE2  2  
ATOM 1099  H H    . GLN A 1 18 ? -2.826  6.231   1.394   1.00 0.00 ? 123 GLN A H    2  
ATOM 1100  H HA   . GLN A 1 18 ? -1.381  7.574   3.526   1.00 0.00 ? 123 GLN A HA   2  
ATOM 1101  H HB2  . GLN A 1 18 ? -4.216  6.622   3.212   1.00 0.00 ? 123 GLN A HB2  2  
ATOM 1102  H HB3  . GLN A 1 18 ? -3.582  7.170   4.746   1.00 0.00 ? 123 GLN A HB3  2  
ATOM 1103  H HG2  . GLN A 1 18 ? -3.135  9.357   3.822   1.00 0.00 ? 123 GLN A HG2  2  
ATOM 1104  H HG3  . GLN A 1 18 ? -3.665  8.814   2.232   1.00 0.00 ? 123 GLN A HG3  2  
ATOM 1105  H HE21 . GLN A 1 18 ? -5.860  7.232   3.352   1.00 0.00 ? 123 GLN A HE21 2  
ATOM 1106  H HE22 . GLN A 1 18 ? -7.076  8.369   3.813   1.00 0.00 ? 123 GLN A HE22 2  
ATOM 1107  N N    . ASP A 1 19 ? -2.421  4.444   3.623   1.00 0.00 ? 124 ASP A N    2  
ATOM 1108  C CA   . ASP A 1 19 ? -2.132  3.145   4.206   1.00 0.00 ? 124 ASP A CA   2  
ATOM 1109  C C    . ASP A 1 19 ? -0.662  2.832   3.986   1.00 0.00 ? 124 ASP A C    2  
ATOM 1110  O O    . ASP A 1 19 ? 0.088   2.565   4.928   1.00 0.00 ? 124 ASP A O    2  
ATOM 1111  C CB   . ASP A 1 19 ? -3.002  2.059   3.562   1.00 0.00 ? 124 ASP A CB   2  
ATOM 1112  C CG   . ASP A 1 19 ? -3.982  1.449   4.543   1.00 0.00 ? 124 ASP A CG   2  
ATOM 1113  O OD1  . ASP A 1 19 ? -3.608  0.475   5.230   1.00 0.00 ? 124 ASP A OD1  2  
ATOM 1114  O OD2  . ASP A 1 19 ? -5.124  1.946   4.627   1.00 0.00 ? 124 ASP A OD2  2  
ATOM 1115  H H    . ASP A 1 19 ? -3.130  4.523   2.941   1.00 0.00 ? 124 ASP A H    2  
ATOM 1116  H HA   . ASP A 1 19 ? -2.334  3.192   5.266   1.00 0.00 ? 124 ASP A HA   2  
ATOM 1117  H HB2  . ASP A 1 19 ? -3.561  2.491   2.746   1.00 0.00 ? 124 ASP A HB2  2  
ATOM 1118  H HB3  . ASP A 1 19 ? -2.365  1.273   3.177   1.00 0.00 ? 124 ASP A HB3  2  
ATOM 1119  N N    . LEU A 1 20 ? -0.255  2.901   2.726   1.00 0.00 ? 125 LEU A N    2  
ATOM 1120  C CA   . LEU A 1 20 ? 1.120   2.644   2.352   1.00 0.00 ? 125 LEU A CA   2  
ATOM 1121  C C    . LEU A 1 20 ? 2.065   3.589   3.101   1.00 0.00 ? 125 LEU A C    2  
ATOM 1122  O O    . LEU A 1 20 ? 3.187   3.207   3.450   1.00 0.00 ? 125 LEU A O    2  
ATOM 1123  C CB   . LEU A 1 20 ? 1.275   2.759   0.828   1.00 0.00 ? 125 LEU A CB   2  
ATOM 1124  C CG   . LEU A 1 20 ? 0.514   1.705   0.030   1.00 0.00 ? 125 LEU A CG   2  
ATOM 1125  C CD1  . LEU A 1 20 ? -0.475  2.358   -0.915  1.00 0.00 ? 125 LEU A CD1  2  
ATOM 1126  C CD2  . LEU A 1 20 ? 1.477   0.857   -0.757  1.00 0.00 ? 125 LEU A CD2  2  
ATOM 1127  H H    . LEU A 1 20 ? -0.903  3.132   2.030   1.00 0.00 ? 125 LEU A H    2  
ATOM 1128  H HA   . LEU A 1 20 ? 1.351   1.630   2.646   1.00 0.00 ? 125 LEU A HA   2  
ATOM 1129  H HB2  . LEU A 1 20 ? 0.929   3.721   0.509   1.00 0.00 ? 125 LEU A HB2  2  
ATOM 1130  H HB3  . LEU A 1 20 ? 2.312   2.684   0.581   1.00 0.00 ? 125 LEU A HB3  2  
ATOM 1131  H HG   . LEU A 1 20 ? -0.032  1.065   0.707   1.00 0.00 ? 125 LEU A HG   2  
ATOM 1132  H HD11 . LEU A 1 20 ? -1.470  2.284   -0.504  1.00 0.00 ? 125 LEU A HD11 2  
ATOM 1133  H HD12 . LEU A 1 20 ? -0.439  1.855   -1.869  1.00 0.00 ? 125 LEU A HD12 2  
ATOM 1134  H HD13 . LEU A 1 20 ? -0.215  3.398   -1.045  1.00 0.00 ? 125 LEU A HD13 2  
ATOM 1135  H HD21 . LEU A 1 20 ? 2.285   0.536   -0.116  1.00 0.00 ? 125 LEU A HD21 2  
ATOM 1136  H HD22 . LEU A 1 20 ? 1.872   1.450   -1.573  1.00 0.00 ? 125 LEU A HD22 2  
ATOM 1137  H HD23 . LEU A 1 20 ? 0.963   -0.006  -1.151  1.00 0.00 ? 125 LEU A HD23 2  
ATOM 1138  N N    . LEU A 1 21 ? 1.603   4.817   3.369   1.00 0.00 ? 126 LEU A N    2  
ATOM 1139  C CA   . LEU A 1 21 ? 2.407   5.783   4.106   1.00 0.00 ? 126 LEU A CA   2  
ATOM 1140  C C    . LEU A 1 21 ? 2.686   5.271   5.512   1.00 0.00 ? 126 LEU A C    2  
ATOM 1141  O O    . LEU A 1 21 ? 3.699   5.612   6.121   1.00 0.00 ? 126 LEU A O    2  
ATOM 1142  C CB   . LEU A 1 21 ? 1.690   7.133   4.189   1.00 0.00 ? 126 LEU A CB   2  
ATOM 1143  C CG   . LEU A 1 21 ? 2.205   8.204   3.229   1.00 0.00 ? 126 LEU A CG   2  
ATOM 1144  C CD1  . LEU A 1 21 ? 1.411   9.491   3.393   1.00 0.00 ? 126 LEU A CD1  2  
ATOM 1145  C CD2  . LEU A 1 21 ? 3.690   8.459   3.449   1.00 0.00 ? 126 LEU A CD2  2  
ATOM 1146  H H    . LEU A 1 21 ? 0.710   5.082   3.056   1.00 0.00 ? 126 LEU A H    2  
ATOM 1147  H HA   . LEU A 1 21 ? 3.344   5.908   3.585   1.00 0.00 ? 126 LEU A HA   2  
ATOM 1148  H HB2  . LEU A 1 21 ? 0.643   6.970   3.981   1.00 0.00 ? 126 LEU A HB2  2  
ATOM 1149  H HB3  . LEU A 1 21 ? 1.783   7.508   5.196   1.00 0.00 ? 126 LEU A HB3  2  
ATOM 1150  H HG   . LEU A 1 21 ? 2.068   7.853   2.215   1.00 0.00 ? 126 LEU A HG   2  
ATOM 1151  H HD11 . LEU A 1 21 ? 0.374   9.308   3.155   1.00 0.00 ? 126 LEU A HD11 2  
ATOM 1152  H HD12 . LEU A 1 21 ? 1.805   10.245  2.728   1.00 0.00 ? 126 LEU A HD12 2  
ATOM 1153  H HD13 . LEU A 1 21 ? 1.490   9.836   4.413   1.00 0.00 ? 126 LEU A HD13 2  
ATOM 1154  H HD21 . LEU A 1 21 ? 4.243   7.550   3.263   1.00 0.00 ? 126 LEU A HD21 2  
ATOM 1155  H HD22 . LEU A 1 21 ? 3.853   8.778   4.468   1.00 0.00 ? 126 LEU A HD22 2  
ATOM 1156  H HD23 . LEU A 1 21 ? 4.026   9.231   2.772   1.00 0.00 ? 126 LEU A HD23 2  
ATOM 1157  N N    . THR A 1 22 ? 1.771   4.453   6.025   1.00 0.00 ? 127 THR A N    2  
ATOM 1158  C CA   . THR A 1 22 ? 1.917   3.894   7.359   1.00 0.00 ? 127 THR A CA   2  
ATOM 1159  C C    . THR A 1 22 ? 2.486   2.478   7.310   1.00 0.00 ? 127 THR A C    2  
ATOM 1160  O O    . THR A 1 22 ? 2.749   1.880   8.354   1.00 0.00 ? 127 THR A O    2  
ATOM 1161  C CB   . THR A 1 22 ? 0.577   3.854   8.127   1.00 0.00 ? 127 THR A CB   2  
ATOM 1162  O OG1  . THR A 1 22 ? 0.034   2.529   8.094   1.00 0.00 ? 127 THR A OG1  2  
ATOM 1163  C CG2  . THR A 1 22 ? -0.437  4.823   7.539   1.00 0.00 ? 127 THR A CG2  2  
ATOM 1164  H H    . THR A 1 22 ? 0.980   4.226   5.493   1.00 0.00 ? 127 THR A H    2  
ATOM 1165  H HA   . THR A 1 22 ? 2.601   4.523   7.909   1.00 0.00 ? 127 THR A HA   2  
ATOM 1166  H HB   . THR A 1 22 ? 0.763   4.131   9.155   1.00 0.00 ? 127 THR A HB   2  
ATOM 1167  H HG1  . THR A 1 22 ? 0.432   2.002   8.791   1.00 0.00 ? 127 THR A HG1  2  
ATOM 1168  H HG21 . THR A 1 22 ? 0.047   5.756   7.295   1.00 0.00 ? 127 THR A HG21 2  
ATOM 1169  H HG22 . THR A 1 22 ? -1.220  5.005   8.262   1.00 0.00 ? 127 THR A HG22 2  
ATOM 1170  H HG23 . THR A 1 22 ? -0.866  4.395   6.646   1.00 0.00 ? 127 THR A HG23 2  
ATOM 1171  N N    . LEU A 1 23 ? 2.677   1.936   6.105   1.00 0.00 ? 128 LEU A N    2  
ATOM 1172  C CA   . LEU A 1 23 ? 3.205   0.593   5.972   1.00 0.00 ? 128 LEU A CA   2  
ATOM 1173  C C    . LEU A 1 23 ? 4.720   0.626   5.799   1.00 0.00 ? 128 LEU A C    2  
ATOM 1174  O O    . LEU A 1 23 ? 5.398   -0.383  5.997   1.00 0.00 ? 128 LEU A O    2  
ATOM 1175  C CB   . LEU A 1 23 ? 2.521   -0.125  4.813   1.00 0.00 ? 128 LEU A CB   2  
ATOM 1176  C CG   . LEU A 1 23 ? 1.009   -0.277  4.971   1.00 0.00 ? 128 LEU A CG   2  
ATOM 1177  C CD1  . LEU A 1 23 ? 0.361   -0.680  3.658   1.00 0.00 ? 128 LEU A CD1  2  
ATOM 1178  C CD2  . LEU A 1 23 ? 0.708   -1.300  6.042   1.00 0.00 ? 128 LEU A CD2  2  
ATOM 1179  H H    . LEU A 1 23 ? 2.472   2.450   5.289   1.00 0.00 ? 128 LEU A H    2  
ATOM 1180  H HA   . LEU A 1 23 ? 2.979   0.064   6.887   1.00 0.00 ? 128 LEU A HA   2  
ATOM 1181  H HB2  . LEU A 1 23 ? 2.714   0.419   3.908   1.00 0.00 ? 128 LEU A HB2  2  
ATOM 1182  H HB3  . LEU A 1 23 ? 2.951   -1.106  4.721   1.00 0.00 ? 128 LEU A HB3  2  
ATOM 1183  H HG   . LEU A 1 23 ? 0.587   0.664   5.279   1.00 0.00 ? 128 LEU A HG   2  
ATOM 1184  H HD11 . LEU A 1 23 ? 0.540   -1.729  3.479   1.00 0.00 ? 128 LEU A HD11 2  
ATOM 1185  H HD12 . LEU A 1 23 ? 0.786   -0.099  2.854   1.00 0.00 ? 128 LEU A HD12 2  
ATOM 1186  H HD13 . LEU A 1 23 ? -0.703  -0.500  3.711   1.00 0.00 ? 128 LEU A HD13 2  
ATOM 1187  H HD21 . LEU A 1 23 ? 0.875   -0.864  7.016   1.00 0.00 ? 128 LEU A HD21 2  
ATOM 1188  H HD22 . LEU A 1 23 ? 1.363   -2.139  5.906   1.00 0.00 ? 128 LEU A HD22 2  
ATOM 1189  H HD23 . LEU A 1 23 ? -0.320  -1.621  5.959   1.00 0.00 ? 128 LEU A HD23 2  
ATOM 1190  N N    . CYS A 1 24 ? 5.246   1.792   5.425   1.00 0.00 ? 129 CYS A N    2  
ATOM 1191  C CA   . CYS A 1 24 ? 6.688   1.955   5.256   1.00 0.00 ? 129 CYS A CA   2  
ATOM 1192  C C    . CYS A 1 24 ? 7.394   1.895   6.612   1.00 0.00 ? 129 CYS A C    2  
ATOM 1193  O O    . CYS A 1 24 ? 6.789   2.186   7.645   1.00 0.00 ? 129 CYS A O    2  
ATOM 1194  C CB   . CYS A 1 24 ? 7.007   3.283   4.562   1.00 0.00 ? 129 CYS A CB   2  
ATOM 1195  S SG   . CYS A 1 24 ? 6.488   4.764   5.492   1.00 0.00 ? 129 CYS A SG   2  
ATOM 1196  H H    . CYS A 1 24 ? 4.650   2.553   5.242   1.00 0.00 ? 129 CYS A H    2  
ATOM 1197  H HA   . CYS A 1 24 ? 7.042   1.142   4.641   1.00 0.00 ? 129 CYS A HA   2  
ATOM 1198  H HB2  . CYS A 1 24 ? 8.073   3.351   4.410   1.00 0.00 ? 129 CYS A HB2  2  
ATOM 1199  H HB3  . CYS A 1 24 ? 6.513   3.305   3.603   1.00 0.00 ? 129 CYS A HB3  2  
ATOM 1200  N N    . PRO A 1 25 ? 8.687   1.514   6.628   1.00 0.00 ? 130 PRO A N    2  
ATOM 1201  C CA   . PRO A 1 25 ? 9.472   1.406   7.854   1.00 0.00 ? 130 PRO A CA   2  
ATOM 1202  C C    . PRO A 1 25 ? 10.090  2.737   8.271   1.00 0.00 ? 130 PRO A C    2  
ATOM 1203  O O    . PRO A 1 25 ? 10.768  2.823   9.295   1.00 0.00 ? 130 PRO A O    2  
ATOM 1204  C CB   . PRO A 1 25 ? 10.573  0.397   7.488   1.00 0.00 ? 130 PRO A CB   2  
ATOM 1205  C CG   . PRO A 1 25 ? 10.416  0.109   6.021   1.00 0.00 ? 130 PRO A CG   2  
ATOM 1206  C CD   . PRO A 1 25 ? 9.493   1.157   5.464   1.00 0.00 ? 130 PRO A CD   2  
ATOM 1207  H HA   . PRO A 1 25 ? 8.880   1.017   8.668   1.00 0.00 ? 130 PRO A HA   2  
ATOM 1208  H HB2  . PRO A 1 25 ? 11.540  0.832   7.697   1.00 0.00 ? 130 PRO A HB2  2  
ATOM 1209  H HB3  . PRO A 1 25 ? 10.447  -0.499  8.077   1.00 0.00 ? 130 PRO A HB3  2  
ATOM 1210  H HG2  . PRO A 1 25 ? 11.378  0.167   5.534   1.00 0.00 ? 130 PRO A HG2  2  
ATOM 1211  H HG3  . PRO A 1 25 ? 9.989   -0.874  5.888   1.00 0.00 ? 130 PRO A HG3  2  
ATOM 1212  H HD2  . PRO A 1 25 ? 10.055  2.006   5.104   1.00 0.00 ? 130 PRO A HD2  2  
ATOM 1213  H HD3  . PRO A 1 25 ? 8.876   0.746   4.677   1.00 0.00 ? 130 PRO A HD3  2  
ATOM 1214  N N    . TYR A 1 26 ? 9.854   3.769   7.470   1.00 0.00 ? 131 TYR A N    2  
ATOM 1215  C CA   . TYR A 1 26 ? 10.385  5.098   7.752   1.00 0.00 ? 131 TYR A CA   2  
ATOM 1216  C C    . TYR A 1 26 ? 9.291   6.156   7.650   1.00 0.00 ? 131 TYR A C    2  
ATOM 1217  O O    . TYR A 1 26 ? 8.671   6.466   8.689   1.00 0.00 ? 131 TYR A O    2  
ATOM 1218  C CB   . TYR A 1 26 ? 11.528  5.433   6.789   1.00 0.00 ? 131 TYR A CB   2  
ATOM 1219  C CG   . TYR A 1 26 ? 12.822  4.713   7.102   1.00 0.00 ? 131 TYR A CG   2  
ATOM 1220  C CD1  . TYR A 1 26 ? 13.010  3.387   6.732   1.00 0.00 ? 131 TYR A CD1  2  
ATOM 1221  C CD2  . TYR A 1 26 ? 13.856  5.361   7.766   1.00 0.00 ? 131 TYR A CD2  2  
ATOM 1222  C CE1  . TYR A 1 26 ? 14.190  2.727   7.016   1.00 0.00 ? 131 TYR A CE1  2  
ATOM 1223  C CE2  . TYR A 1 26 ? 15.040  4.709   8.053   1.00 0.00 ? 131 TYR A CE2  2  
ATOM 1224  C CZ   . TYR A 1 26 ? 15.202  3.392   7.674   1.00 0.00 ? 131 TYR A CZ   2  
ATOM 1225  O OH   . TYR A 1 26 ? 16.380  2.738   7.958   1.00 0.00 ? 131 TYR A OH   2  
ATOM 1226  O OXT  . TYR A 1 26 ? 9.061   6.664   6.532   1.00 0.00 ? 131 TYR A OXT  2  
ATOM 1227  H H    . TYR A 1 26 ? 9.305   3.635   6.669   1.00 0.00 ? 131 TYR A H    2  
ATOM 1228  H HA   . TYR A 1 26 ? 10.769  5.092   8.762   1.00 0.00 ? 131 TYR A HA   2  
ATOM 1229  H HB2  . TYR A 1 26 ? 11.234  5.163   5.786   1.00 0.00 ? 131 TYR A HB2  2  
ATOM 1230  H HB3  . TYR A 1 26 ? 11.722  6.495   6.828   1.00 0.00 ? 131 TYR A HB3  2  
ATOM 1231  H HD1  . TYR A 1 26 ? 12.216  2.869   6.214   1.00 0.00 ? 131 TYR A HD1  2  
ATOM 1232  H HD2  . TYR A 1 26 ? 13.725  6.392   8.060   1.00 0.00 ? 131 TYR A HD2  2  
ATOM 1233  H HE1  . TYR A 1 26 ? 14.317  1.697   6.719   1.00 0.00 ? 131 TYR A HE1  2  
ATOM 1234  H HE2  . TYR A 1 26 ? 15.833  5.229   8.569   1.00 0.00 ? 131 TYR A HE2  2  
ATOM 1235  H HH   . TYR A 1 26 ? 16.659  2.234   7.191   1.00 0.00 ? 131 TYR A HH   2  
ATOM 1236  N N    . PRO B 2 1  ? -0.590  15.395  -7.333  1.00 0.00 ? 25  PRO B N    2  
ATOM 1237  C CA   . PRO B 2 1  ? -1.580  15.543  -6.238  1.00 0.00 ? 25  PRO B CA   2  
ATOM 1238  C C    . PRO B 2 1  ? -2.694  14.505  -6.358  1.00 0.00 ? 25  PRO B C    2  
ATOM 1239  O O    . PRO B 2 1  ? -3.844  14.840  -6.643  1.00 0.00 ? 25  PRO B O    2  
ATOM 1240  C CB   . PRO B 2 1  ? -2.162  16.950  -6.291  1.00 0.00 ? 25  PRO B CB   2  
ATOM 1241  C CG   . PRO B 2 1  ? -1.545  17.547  -7.511  1.00 0.00 ? 25  PRO B CG   2  
ATOM 1242  C CD   . PRO B 2 1  ? -0.274  16.769  -7.769  1.00 0.00 ? 25  PRO B CD   2  
ATOM 1243  H H2   . PRO B 2 1  ? -1.033  14.770  -8.026  1.00 0.00 ? 25  PRO B H2   2  
ATOM 1244  H H3   . PRO B 2 1  ? 0.170   14.803  -6.925  1.00 0.00 ? 25  PRO B H3   2  
ATOM 1245  H HA   . PRO B 2 1  ? -1.072  15.404  -5.296  1.00 0.00 ? 25  PRO B HA   2  
ATOM 1246  H HB2  . PRO B 2 1  ? -3.239  16.899  -6.371  1.00 0.00 ? 25  PRO B HB2  2  
ATOM 1247  H HB3  . PRO B 2 1  ? -1.885  17.495  -5.402  1.00 0.00 ? 25  PRO B HB3  2  
ATOM 1248  H HG2  . PRO B 2 1  ? -2.220  17.447  -8.348  1.00 0.00 ? 25  PRO B HG2  2  
ATOM 1249  H HG3  . PRO B 2 1  ? -1.317  18.587  -7.334  1.00 0.00 ? 25  PRO B HG3  2  
ATOM 1250  H HD2  . PRO B 2 1  ? -0.030  16.789  -8.820  1.00 0.00 ? 25  PRO B HD2  2  
ATOM 1251  H HD3  . PRO B 2 1  ? 0.539   17.175  -7.186  1.00 0.00 ? 25  PRO B HD3  2  
ATOM 1252  N N    . THR B 2 2  ? -2.343  13.242  -6.143  1.00 0.00 ? 26  THR B N    2  
ATOM 1253  C CA   . THR B 2 2  ? -3.314  12.156  -6.225  1.00 0.00 ? 26  THR B CA   2  
ATOM 1254  C C    . THR B 2 2  ? -4.240  12.154  -5.008  1.00 0.00 ? 26  THR B C    2  
ATOM 1255  O O    . THR B 2 2  ? -3.798  12.400  -3.886  1.00 0.00 ? 26  THR B O    2  
ATOM 1256  C CB   . THR B 2 2  ? -2.622  10.785  -6.332  1.00 0.00 ? 26  THR B CB   2  
ATOM 1257  O OG1  . THR B 2 2  ? -1.655  10.640  -5.283  1.00 0.00 ? 26  THR B OG1  2  
ATOM 1258  C CG2  . THR B 2 2  ? -1.941  10.626  -7.683  1.00 0.00 ? 26  THR B CG2  2  
ATOM 1259  H H    . THR B 2 2  ? -1.411  13.033  -5.925  1.00 0.00 ? 26  THR B H    2  
ATOM 1260  H HA   . THR B 2 2  ? -3.903  12.308  -7.117  1.00 0.00 ? 26  THR B HA   2  
ATOM 1261  H HB   . THR B 2 2  ? -3.370  10.013  -6.230  1.00 0.00 ? 26  THR B HB   2  
ATOM 1262  H HG1  . THR B 2 2  ? -0.774  10.770  -5.640  1.00 0.00 ? 26  THR B HG1  2  
ATOM 1263  H HG21 . THR B 2 2  ? -2.686  10.643  -8.465  1.00 0.00 ? 26  THR B HG21 2  
ATOM 1264  H HG22 . THR B 2 2  ? -1.411  9.685   -7.712  1.00 0.00 ? 26  THR B HG22 2  
ATOM 1265  H HG23 . THR B 2 2  ? -1.244  11.437  -7.833  1.00 0.00 ? 26  THR B HG23 2  
ATOM 1266  N N    . PRO B 2 3  ? -5.542  11.876  -5.216  1.00 0.00 ? 27  PRO B N    2  
ATOM 1267  C CA   . PRO B 2 3  ? -6.527  11.842  -4.145  1.00 0.00 ? 27  PRO B CA   2  
ATOM 1268  C C    . PRO B 2 3  ? -6.723  10.435  -3.593  1.00 0.00 ? 27  PRO B C    2  
ATOM 1269  O O    . PRO B 2 3  ? -7.777  9.826   -3.787  1.00 0.00 ? 27  PRO B O    2  
ATOM 1270  C CB   . PRO B 2 3  ? -7.785  12.315  -4.864  1.00 0.00 ? 27  PRO B CB   2  
ATOM 1271  C CG   . PRO B 2 3  ? -7.648  11.782  -6.257  1.00 0.00 ? 27  PRO B CG   2  
ATOM 1272  C CD   . PRO B 2 3  ? -6.170  11.573  -6.514  1.00 0.00 ? 27  PRO B CD   2  
ATOM 1273  H HA   . PRO B 2 3  ? -6.281  12.523  -3.344  1.00 0.00 ? 27  PRO B HA   2  
ATOM 1274  H HB2  . PRO B 2 3  ? -8.658  11.914  -4.370  1.00 0.00 ? 27  PRO B HB2  2  
ATOM 1275  H HB3  . PRO B 2 3  ? -7.823  13.394  -4.858  1.00 0.00 ? 27  PRO B HB3  2  
ATOM 1276  H HG2  . PRO B 2 3  ? -8.175  10.843  -6.341  1.00 0.00 ? 27  PRO B HG2  2  
ATOM 1277  H HG3  . PRO B 2 3  ? -8.050  12.498  -6.960  1.00 0.00 ? 27  PRO B HG3  2  
ATOM 1278  H HD2  . PRO B 2 3  ? -5.978  10.550  -6.804  1.00 0.00 ? 27  PRO B HD2  2  
ATOM 1279  H HD3  . PRO B 2 3  ? -5.821  12.254  -7.278  1.00 0.00 ? 27  PRO B HD3  2  
ATOM 1280  N N    . GLU B 2 4  ? -5.701  9.934   -2.896  1.00 0.00 ? 28  GLU B N    2  
ATOM 1281  C CA   . GLU B 2 4  ? -5.717  8.601   -2.331  1.00 0.00 ? 28  GLU B CA   2  
ATOM 1282  C C    . GLU B 2 4  ? -6.441  7.627   -3.230  1.00 0.00 ? 28  GLU B C    2  
ATOM 1283  O O    . GLU B 2 4  ? -7.490  7.083   -2.885  1.00 0.00 ? 28  GLU B O    2  
ATOM 1284  C CB   . GLU B 2 4  ? -6.312  8.605   -0.945  1.00 0.00 ? 28  GLU B CB   2  
ATOM 1285  C CG   . GLU B 2 4  ? -7.642  9.332   -0.823  1.00 0.00 ? 28  GLU B CG   2  
ATOM 1286  C CD   . GLU B 2 4  ? -8.229  9.241   0.572   1.00 0.00 ? 28  GLU B CD   2  
ATOM 1287  O OE1  . GLU B 2 4  ? -8.918  8.241   0.862   1.00 0.00 ? 28  GLU B OE1  2  
ATOM 1288  O OE2  . GLU B 2 4  ? -7.998  10.170  1.373   1.00 0.00 ? 28  GLU B OE2  2  
ATOM 1289  H H    . GLU B 2 4  ? -4.924  10.490  -2.729  1.00 0.00 ? 28  GLU B H    2  
ATOM 1290  H HA   . GLU B 2 4  ? -4.688  8.280   -2.257  1.00 0.00 ? 28  GLU B HA   2  
ATOM 1291  H HB2  . GLU B 2 4  ? -6.451  7.593   -0.643  1.00 0.00 ? 28  GLU B HB2  2  
ATOM 1292  H HB3  . GLU B 2 4  ? -5.607  9.066   -0.290  1.00 0.00 ? 28  GLU B HB3  2  
ATOM 1293  H HG2  . GLU B 2 4  ? -7.492  10.373  -1.066  1.00 0.00 ? 28  GLU B HG2  2  
ATOM 1294  H HG3  . GLU B 2 4  ? -8.342  8.897   -1.523  1.00 0.00 ? 28  GLU B HG3  2  
ATOM 1295  N N    . MET B 2 5  ? -5.860  7.415   -4.387  1.00 0.00 ? 29  MET B N    2  
ATOM 1296  C CA   . MET B 2 5  ? -6.425  6.503   -5.367  1.00 0.00 ? 29  MET B CA   2  
ATOM 1297  C C    . MET B 2 5  ? -6.120  5.076   -4.965  1.00 0.00 ? 29  MET B C    2  
ATOM 1298  O O    . MET B 2 5  ? -4.970  4.635   -4.992  1.00 0.00 ? 29  MET B O    2  
ATOM 1299  C CB   . MET B 2 5  ? -5.876  6.781   -6.757  1.00 0.00 ? 29  MET B CB   2  
ATOM 1300  C CG   . MET B 2 5  ? -6.908  6.626   -7.864  1.00 0.00 ? 29  MET B CG   2  
ATOM 1301  S SD   . MET B 2 5  ? -6.305  7.201   -9.464  1.00 0.00 ? 29  MET B SD   2  
ATOM 1302  C CE   . MET B 2 5  ? -4.873  6.150   -9.690  1.00 0.00 ? 29  MET B CE   2  
ATOM 1303  H H    . MET B 2 5  ? -5.023  7.882   -4.579  1.00 0.00 ? 29  MET B H    2  
ATOM 1304  H HA   . MET B 2 5  ? -7.497  6.639   -5.372  1.00 0.00 ? 29  MET B HA   2  
ATOM 1305  H HB2  . MET B 2 5  ? -5.485  7.789   -6.790  1.00 0.00 ? 29  MET B HB2  2  
ATOM 1306  H HB3  . MET B 2 5  ? -5.080  6.082   -6.944  1.00 0.00 ? 29  MET B HB3  2  
ATOM 1307  H HG2  . MET B 2 5  ? -7.171  5.583   -7.949  1.00 0.00 ? 29  MET B HG2  2  
ATOM 1308  H HG3  . MET B 2 5  ? -7.786  7.197   -7.599  1.00 0.00 ? 29  MET B HG3  2  
ATOM 1309  H HE1  . MET B 2 5  ? -4.189  6.292   -8.866  1.00 0.00 ? 29  MET B HE1  2  
ATOM 1310  H HE2  . MET B 2 5  ? -4.379  6.409   -10.616 1.00 0.00 ? 29  MET B HE2  2  
ATOM 1311  H HE3  . MET B 2 5  ? -5.185  5.116   -9.725  1.00 0.00 ? 29  MET B HE3  2  
ATOM 1312  N N    . ARG B 2 6  ? -7.162  4.367   -4.594  1.00 0.00 ? 30  ARG B N    2  
ATOM 1313  C CA   . ARG B 2 6  ? -7.037  2.991   -4.152  1.00 0.00 ? 30  ARG B CA   2  
ATOM 1314  C C    . ARG B 2 6  ? -6.875  2.033   -5.323  1.00 0.00 ? 30  ARG B C    2  
ATOM 1315  O O    . ARG B 2 6  ? -7.708  1.993   -6.230  1.00 0.00 ? 30  ARG B O    2  
ATOM 1316  C CB   . ARG B 2 6  ? -8.249  2.595   -3.320  1.00 0.00 ? 30  ARG B CB   2  
ATOM 1317  C CG   . ARG B 2 6  ? -8.001  2.709   -1.833  1.00 0.00 ? 30  ARG B CG   2  
ATOM 1318  C CD   . ARG B 2 6  ? -8.539  1.510   -1.089  1.00 0.00 ? 30  ARG B CD   2  
ATOM 1319  N NE   . ARG B 2 6  ? -8.250  1.583   0.335   1.00 0.00 ? 30  ARG B NE   2  
ATOM 1320  C CZ   . ARG B 2 6  ? -8.427  0.571   1.181   1.00 0.00 ? 30  ARG B CZ   2  
ATOM 1321  N NH1  . ARG B 2 6  ? -8.887  -0.594  0.742   1.00 0.00 ? 30  ARG B NH1  2  
ATOM 1322  N NH2  . ARG B 2 6  ? -8.143  0.724   2.467   1.00 0.00 ? 30  ARG B NH2  2  
ATOM 1323  H H    . ARG B 2 6  ? -8.045  4.777   -4.639  1.00 0.00 ? 30  ARG B H    2  
ATOM 1324  H HA   . ARG B 2 6  ? -6.157  2.930   -3.522  1.00 0.00 ? 30  ARG B HA   2  
ATOM 1325  H HB2  . ARG B 2 6  ? -9.075  3.240   -3.574  1.00 0.00 ? 30  ARG B HB2  2  
ATOM 1326  H HB3  . ARG B 2 6  ? -8.512  1.576   -3.547  1.00 0.00 ? 30  ARG B HB3  2  
ATOM 1327  H HG2  . ARG B 2 6  ? -6.938  2.779   -1.660  1.00 0.00 ? 30  ARG B HG2  2  
ATOM 1328  H HG3  . ARG B 2 6  ? -8.487  3.599   -1.463  1.00 0.00 ? 30  ARG B HG3  2  
ATOM 1329  H HD2  . ARG B 2 6  ? -9.604  1.472   -1.227  1.00 0.00 ? 30  ARG B HD2  2  
ATOM 1330  H HD3  . ARG B 2 6  ? -8.086  0.621   -1.496  1.00 0.00 ? 30  ARG B HD3  2  
ATOM 1331  H HE   . ARG B 2 6  ? -7.905  2.430   0.678   1.00 0.00 ? 30  ARG B HE   2  
ATOM 1332  H HH11 . ARG B 2 6  ? -9.100  -0.714  -0.228  1.00 0.00 ? 30  ARG B HH11 2  
ATOM 1333  H HH12 . ARG B 2 6  ? -9.018  -1.353  1.380   1.00 0.00 ? 30  ARG B HH12 2  
ATOM 1334  H HH21 . ARG B 2 6  ? -7.795  1.599   2.802   1.00 0.00 ? 30  ARG B HH21 2  
ATOM 1335  H HH22 . ARG B 2 6  ? -8.278  -0.036  3.103   1.00 0.00 ? 30  ARG B HH22 2  
ATOM 1336  N N    . GLU B 2 7  ? -5.797  1.262   -5.294  1.00 0.00 ? 31  GLU B N    2  
ATOM 1337  C CA   . GLU B 2 7  ? -5.520  0.286   -6.336  1.00 0.00 ? 31  GLU B CA   2  
ATOM 1338  C C    . GLU B 2 7  ? -4.924  -0.969  -5.732  1.00 0.00 ? 31  GLU B C    2  
ATOM 1339  O O    . GLU B 2 7  ? -4.142  -0.910  -4.789  1.00 0.00 ? 31  GLU B O    2  
ATOM 1340  C CB   . GLU B 2 7  ? -4.598  0.876   -7.403  1.00 0.00 ? 31  GLU B CB   2  
ATOM 1341  C CG   . GLU B 2 7  ? -3.323  1.456   -6.836  1.00 0.00 ? 31  GLU B CG   2  
ATOM 1342  C CD   . GLU B 2 7  ? -2.367  1.937   -7.910  1.00 0.00 ? 31  GLU B CD   2  
ATOM 1343  O OE1  . GLU B 2 7  ? -1.585  1.110   -8.425  1.00 0.00 ? 31  GLU B OE1  2  
ATOM 1344  O OE2  . GLU B 2 7  ? -2.402  3.142   -8.238  1.00 0.00 ? 31  GLU B OE2  2  
ATOM 1345  H H    . GLU B 2 7  ? -5.167  1.354   -4.547  1.00 0.00 ? 31  GLU B H    2  
ATOM 1346  H HA   . GLU B 2 7  ? -6.454  0.014   -6.791  1.00 0.00 ? 31  GLU B HA   2  
ATOM 1347  H HB2  . GLU B 2 7  ? -4.336  0.099   -8.106  1.00 0.00 ? 31  GLU B HB2  2  
ATOM 1348  H HB3  . GLU B 2 7  ? -5.125  1.662   -7.925  1.00 0.00 ? 31  GLU B HB3  2  
ATOM 1349  H HG2  . GLU B 2 7  ? -3.572  2.287   -6.196  1.00 0.00 ? 31  GLU B HG2  2  
ATOM 1350  H HG3  . GLU B 2 7  ? -2.837  0.691   -6.257  1.00 0.00 ? 31  GLU B HG3  2  
ATOM 1351  N N    . LYS B 2 8  ? -5.322  -2.100  -6.286  1.00 0.00 ? 32  LYS B N    2  
ATOM 1352  C CA   . LYS B 2 8  ? -4.890  -3.398  -5.810  1.00 0.00 ? 32  LYS B CA   2  
ATOM 1353  C C    . LYS B 2 8  ? -3.379  -3.583  -5.877  1.00 0.00 ? 32  LYS B C    2  
ATOM 1354  O O    . LYS B 2 8  ? -2.788  -3.658  -6.954  1.00 0.00 ? 32  LYS B O    2  
ATOM 1355  C CB   . LYS B 2 8  ? -5.607  -4.470  -6.608  1.00 0.00 ? 32  LYS B CB   2  
ATOM 1356  C CG   . LYS B 2 8  ? -7.102  -4.229  -6.683  1.00 0.00 ? 32  LYS B CG   2  
ATOM 1357  C CD   . LYS B 2 8  ? -7.848  -5.474  -7.131  1.00 0.00 ? 32  LYS B CD   2  
ATOM 1358  C CE   . LYS B 2 8  ? -9.346  -5.259  -7.104  1.00 0.00 ? 32  LYS B CE   2  
ATOM 1359  N NZ   . LYS B 2 8  ? -10.095 -6.515  -7.378  1.00 0.00 ? 32  LYS B NZ   2  
ATOM 1360  H H    . LYS B 2 8  ? -5.930  -2.063  -7.050  1.00 0.00 ? 32  LYS B H    2  
ATOM 1361  H HA   . LYS B 2 8  ? -5.196  -3.482  -4.780  1.00 0.00 ? 32  LYS B HA   2  
ATOM 1362  H HB2  . LYS B 2 8  ? -5.212  -4.488  -7.612  1.00 0.00 ? 32  LYS B HB2  2  
ATOM 1363  H HB3  . LYS B 2 8  ? -5.440  -5.419  -6.143  1.00 0.00 ? 32  LYS B HB3  2  
ATOM 1364  H HG2  . LYS B 2 8  ? -7.456  -3.934  -5.706  1.00 0.00 ? 32  LYS B HG2  2  
ATOM 1365  H HG3  . LYS B 2 8  ? -7.293  -3.431  -7.383  1.00 0.00 ? 32  LYS B HG3  2  
ATOM 1366  H HD2  . LYS B 2 8  ? -7.551  -5.717  -8.136  1.00 0.00 ? 32  LYS B HD2  2  
ATOM 1367  H HD3  . LYS B 2 8  ? -7.597  -6.291  -6.470  1.00 0.00 ? 32  LYS B HD3  2  
ATOM 1368  H HE2  . LYS B 2 8  ? -9.618  -4.893  -6.130  1.00 0.00 ? 32  LYS B HE2  2  
ATOM 1369  H HE3  . LYS B 2 8  ? -9.606  -4.523  -7.851  1.00 0.00 ? 32  LYS B HE3  2  
ATOM 1370  H HZ1  . LYS B 2 8  ? -9.869  -7.232  -6.658  1.00 0.00 ? 32  LYS B HZ1  2  
ATOM 1371  H HZ2  . LYS B 2 8  ? -9.838  -6.888  -8.314  1.00 0.00 ? 32  LYS B HZ2  2  
ATOM 1372  H HZ3  . LYS B 2 8  ? -11.120 -6.332  -7.360  1.00 0.00 ? 32  LYS B HZ3  2  
ATOM 1373  N N    . LEU B 2 9  ? -2.774  -3.656  -4.698  1.00 0.00 ? 33  LEU B N    2  
ATOM 1374  C CA   . LEU B 2 9  ? -1.341  -3.839  -4.554  1.00 0.00 ? 33  LEU B CA   2  
ATOM 1375  C C    . LEU B 2 9  ? -1.002  -5.248  -4.103  1.00 0.00 ? 33  LEU B C    2  
ATOM 1376  O O    . LEU B 2 9  ? -1.089  -5.571  -2.918  1.00 0.00 ? 33  LEU B O    2  
ATOM 1377  C CB   . LEU B 2 9  ? -0.805  -2.840  -3.564  1.00 0.00 ? 33  LEU B CB   2  
ATOM 1378  C CG   . LEU B 2 9  ? -1.498  -1.496  -3.594  1.00 0.00 ? 33  LEU B CG   2  
ATOM 1379  C CD1  . LEU B 2 9  ? -1.028  -0.614  -2.451  1.00 0.00 ? 33  LEU B CD1  2  
ATOM 1380  C CD2  . LEU B 2 9  ? -1.242  -0.835  -4.935  1.00 0.00 ? 33  LEU B CD2  2  
ATOM 1381  H H    . LEU B 2 9  ? -3.312  -3.559  -3.890  1.00 0.00 ? 33  LEU B H    2  
ATOM 1382  H HA   . LEU B 2 9  ? -0.867  -3.654  -5.497  1.00 0.00 ? 33  LEU B HA   2  
ATOM 1383  H HB2  . LEU B 2 9  ? -0.871  -3.252  -2.572  1.00 0.00 ? 33  LEU B HB2  2  
ATOM 1384  H HB3  . LEU B 2 9  ? 0.217   -2.686  -3.808  1.00 0.00 ? 33  LEU B HB3  2  
ATOM 1385  H HG   . LEU B 2 9  ? -2.556  -1.651  -3.485  1.00 0.00 ? 33  LEU B HG   2  
ATOM 1386  H HD11 . LEU B 2 9  ? -1.851  -0.006  -2.106  1.00 0.00 ? 33  LEU B HD11 2  
ATOM 1387  H HD12 . LEU B 2 9  ? -0.228  0.027   -2.793  1.00 0.00 ? 33  LEU B HD12 2  
ATOM 1388  H HD13 . LEU B 2 9  ? -0.674  -1.233  -1.640  1.00 0.00 ? 33  LEU B HD13 2  
ATOM 1389  H HD21 . LEU B 2 9  ? -2.125  -0.303  -5.248  1.00 0.00 ? 33  LEU B HD21 2  
ATOM 1390  H HD22 . LEU B 2 9  ? -0.996  -1.599  -5.668  1.00 0.00 ? 33  LEU B HD22 2  
ATOM 1391  H HD23 . LEU B 2 9  ? -0.416  -0.143  -4.845  1.00 0.00 ? 33  LEU B HD23 2  
ATOM 1392  N N    . CYS B 2 10 ? -0.622  -6.083  -5.056  1.00 0.00 ? 34  CYS B N    2  
ATOM 1393  C CA   . CYS B 2 10 ? -0.264  -7.459  -4.754  1.00 0.00 ? 34  CYS B CA   2  
ATOM 1394  C C    . CYS B 2 10 ? 1.243   -7.632  -4.694  1.00 0.00 ? 34  CYS B C    2  
ATOM 1395  O O    . CYS B 2 10 ? 1.908   -7.812  -5.714  1.00 0.00 ? 34  CYS B O    2  
ATOM 1396  C CB   . CYS B 2 10 ? -0.866  -8.403  -5.782  1.00 0.00 ? 34  CYS B CB   2  
ATOM 1397  S SG   . CYS B 2 10 ? -1.259  -10.054 -5.124  1.00 0.00 ? 34  CYS B SG   2  
ATOM 1398  H H    . CYS B 2 10 ? -0.587  -5.767  -5.983  1.00 0.00 ? 34  CYS B H    2  
ATOM 1399  H HA   . CYS B 2 10 ? -0.673  -7.695  -3.786  1.00 0.00 ? 34  CYS B HA   2  
ATOM 1400  H HB2  . CYS B 2 10 ? -1.777  -7.971  -6.145  1.00 0.00 ? 34  CYS B HB2  2  
ATOM 1401  H HB3  . CYS B 2 10 ? -0.174  -8.526  -6.602  1.00 0.00 ? 34  CYS B HB3  2  
ATOM 1402  N N    . GLY B 2 11 ? 1.761   -7.581  -3.480  1.00 0.00 ? 35  GLY B N    2  
ATOM 1403  C CA   . GLY B 2 11 ? 3.189   -7.728  -3.256  1.00 0.00 ? 35  GLY B CA   2  
ATOM 1404  C C    . GLY B 2 11 ? 4.012   -6.674  -3.972  1.00 0.00 ? 35  GLY B C    2  
ATOM 1405  O O    . GLY B 2 11 ? 4.399   -5.679  -3.366  1.00 0.00 ? 35  GLY B O    2  
ATOM 1406  H H    . GLY B 2 11 ? 1.158   -7.445  -2.721  1.00 0.00 ? 35  GLY B H    2  
ATOM 1407  H HA2  . GLY B 2 11 ? 3.380   -7.652  -2.196  1.00 0.00 ? 35  GLY B HA2  2  
ATOM 1408  H HA3  . GLY B 2 11 ? 3.498   -8.701  -3.591  1.00 0.00 ? 35  GLY B HA3  2  
ATOM 1409  N N    . HIS B 2 12 ? 4.301   -6.893  -5.256  1.00 0.00 ? 36  HIS B N    2  
ATOM 1410  C CA   . HIS B 2 12 ? 5.079   -5.937  -6.022  1.00 0.00 ? 36  HIS B CA   2  
ATOM 1411  C C    . HIS B 2 12 ? 4.345   -4.610  -6.168  1.00 0.00 ? 36  HIS B C    2  
ATOM 1412  O O    . HIS B 2 12 ? 4.910   -3.570  -5.865  1.00 0.00 ? 36  HIS B O    2  
ATOM 1413  C CB   . HIS B 2 12 ? 5.458   -6.492  -7.387  1.00 0.00 ? 36  HIS B CB   2  
ATOM 1414  C CG   . HIS B 2 12 ? 6.721   -5.886  -7.898  1.00 0.00 ? 36  HIS B CG   2  
ATOM 1415  N ND1  . HIS B 2 12 ? 7.081   -5.858  -9.223  1.00 0.00 ? 36  HIS B ND1  2  
ATOM 1416  C CD2  . HIS B 2 12 ? 7.717   -5.259  -7.218  1.00 0.00 ? 36  HIS B CD2  2  
ATOM 1417  C CE1  . HIS B 2 12 ? 8.259   -5.228  -9.313  1.00 0.00 ? 36  HIS B CE1  2  
ATOM 1418  N NE2  . HIS B 2 12 ? 8.691   -4.845  -8.124  1.00 0.00 ? 36  HIS B NE2  2  
ATOM 1419  H H    . HIS B 2 12 ? 4.012   -7.718  -5.684  1.00 0.00 ? 36  HIS B H    2  
ATOM 1420  H HA   . HIS B 2 12 ? 5.986   -5.755  -5.465  1.00 0.00 ? 36  HIS B HA   2  
ATOM 1421  H HB2  . HIS B 2 12 ? 5.601   -7.561  -7.312  1.00 0.00 ? 36  HIS B HB2  2  
ATOM 1422  H HB3  . HIS B 2 12 ? 4.671   -6.280  -8.093  1.00 0.00 ? 36  HIS B HB3  2  
ATOM 1423  H HD1  . HIS B 2 12 ? 6.569   -6.233  -9.970  1.00 0.00 ? 36  HIS B HD1  2  
ATOM 1424  H HD2  . HIS B 2 12 ? 7.751   -5.098  -6.140  1.00 0.00 ? 36  HIS B HD2  2  
ATOM 1425  H HE1  . HIS B 2 12 ? 8.778   -5.046  -10.239 1.00 0.00 ? 36  HIS B HE1  2  
ATOM 1426  N N    . HIS B 2 13 ? 3.107   -4.623  -6.667  1.00 0.00 ? 37  HIS B N    2  
ATOM 1427  C CA   . HIS B 2 13 ? 2.353   -3.374  -6.762  1.00 0.00 ? 37  HIS B CA   2  
ATOM 1428  C C    . HIS B 2 13 ? 2.357   -2.748  -5.401  1.00 0.00 ? 37  HIS B C    2  
ATOM 1429  O O    . HIS B 2 13 ? 2.464   -1.534  -5.233  1.00 0.00 ? 37  HIS B O    2  
ATOM 1430  C CB   . HIS B 2 13 ? 0.905   -3.609  -7.163  1.00 0.00 ? 37  HIS B CB   2  
ATOM 1431  C CG   . HIS B 2 13 ? 0.696   -3.695  -8.624  1.00 0.00 ? 37  HIS B CG   2  
ATOM 1432  N ND1  . HIS B 2 13 ? -0.291  -3.021  -9.299  1.00 0.00 ? 37  HIS B ND1  2  
ATOM 1433  C CD2  . HIS B 2 13 ? 1.374   -4.403  -9.543  1.00 0.00 ? 37  HIS B CD2  2  
ATOM 1434  C CE1  . HIS B 2 13 ? -0.185  -3.335  -10.591 1.00 0.00 ? 37  HIS B CE1  2  
ATOM 1435  N NE2  . HIS B 2 13 ? 0.815   -4.176  -10.799 1.00 0.00 ? 37  HIS B NE2  2  
ATOM 1436  H H    . HIS B 2 13 ? 2.705   -5.465  -6.967  1.00 0.00 ? 37  HIS B H    2  
ATOM 1437  H HA   . HIS B 2 13 ? 2.838   -2.719  -7.472  1.00 0.00 ? 37  HIS B HA   2  
ATOM 1438  H HB2  . HIS B 2 13 ? 0.565   -4.534  -6.725  1.00 0.00 ? 37  HIS B HB2  2  
ATOM 1439  H HB3  . HIS B 2 13 ? 0.302   -2.792  -6.784  1.00 0.00 ? 37  HIS B HB3  2  
ATOM 1440  H HD1  . HIS B 2 13 ? -0.954  -2.419  -8.904  1.00 0.00 ? 37  HIS B HD1  2  
ATOM 1441  H HD2  . HIS B 2 13 ? 2.219   -5.042  -9.336  1.00 0.00 ? 37  HIS B HD2  2  
ATOM 1442  H HE1  . HIS B 2 13 ? -0.831  -2.949  -11.360 1.00 0.00 ? 37  HIS B HE1  2  
ATOM 1443  N N    . PHE B 2 14 ? 2.225   -3.628  -4.432  1.00 0.00 ? 38  PHE B N    2  
ATOM 1444  C CA   . PHE B 2 14 ? 2.221   -3.255  -3.051  1.00 0.00 ? 38  PHE B CA   2  
ATOM 1445  C C    . PHE B 2 14 ? 3.571   -2.702  -2.668  1.00 0.00 ? 38  PHE B C    2  
ATOM 1446  O O    . PHE B 2 14 ? 3.683   -1.882  -1.765  1.00 0.00 ? 38  PHE B O    2  
ATOM 1447  C CB   . PHE B 2 14 ? 1.823   -4.463  -2.216  1.00 0.00 ? 38  PHE B CB   2  
ATOM 1448  C CG   . PHE B 2 14 ? 1.990   -4.225  -0.767  1.00 0.00 ? 38  PHE B CG   2  
ATOM 1449  C CD1  . PHE B 2 14 ? 1.411   -3.111  -0.203  1.00 0.00 ? 38  PHE B CD1  2  
ATOM 1450  C CD2  . PHE B 2 14 ? 2.741   -5.081  0.018   1.00 0.00 ? 38  PHE B CD2  2  
ATOM 1451  C CE1  . PHE B 2 14 ? 1.574   -2.841  1.138   1.00 0.00 ? 38  PHE B CE1  2  
ATOM 1452  C CE2  . PHE B 2 14 ? 2.917   -4.820  1.362   1.00 0.00 ? 38  PHE B CE2  2  
ATOM 1453  C CZ   . PHE B 2 14 ? 2.334   -3.695  1.924   1.00 0.00 ? 38  PHE B CZ   2  
ATOM 1454  H H    . PHE B 2 14 ? 2.129   -4.575  -4.665  1.00 0.00 ? 38  PHE B H    2  
ATOM 1455  H HA   . PHE B 2 14 ? 1.490   -2.476  -2.916  1.00 0.00 ? 38  PHE B HA   2  
ATOM 1456  H HB2  . PHE B 2 14 ? 0.783   -4.689  -2.398  1.00 0.00 ? 38  PHE B HB2  2  
ATOM 1457  H HB3  . PHE B 2 14 ? 2.423   -5.308  -2.500  1.00 0.00 ? 38  PHE B HB3  2  
ATOM 1458  H HD1  . PHE B 2 14 ? 0.809   -2.453  -0.836  1.00 0.00 ? 38  PHE B HD1  2  
ATOM 1459  H HD2  . PHE B 2 14 ? 3.193   -5.962  -0.429  1.00 0.00 ? 38  PHE B HD2  2  
ATOM 1460  H HE1  . PHE B 2 14 ? 1.121   -1.963  1.569   1.00 0.00 ? 38  PHE B HE1  2  
ATOM 1461  H HE2  . PHE B 2 14 ? 3.501   -5.494  1.972   1.00 0.00 ? 38  PHE B HE2  2  
ATOM 1462  H HZ   . PHE B 2 14 ? 2.473   -3.485  2.973   1.00 0.00 ? 38  PHE B HZ   2  
ATOM 1463  N N    . VAL B 2 15 ? 4.588   -3.160  -3.368  1.00 0.00 ? 39  VAL B N    2  
ATOM 1464  C CA   . VAL B 2 15 ? 5.931   -2.680  -3.151  1.00 0.00 ? 39  VAL B CA   2  
ATOM 1465  C C    . VAL B 2 15 ? 6.055   -1.283  -3.741  1.00 0.00 ? 39  VAL B C    2  
ATOM 1466  O O    . VAL B 2 15 ? 6.187   -0.312  -3.001  1.00 0.00 ? 39  VAL B O    2  
ATOM 1467  C CB   . VAL B 2 15 ? 6.978   -3.644  -3.760  1.00 0.00 ? 39  VAL B CB   2  
ATOM 1468  C CG1  . VAL B 2 15 ? 8.188   -2.900  -4.299  1.00 0.00 ? 39  VAL B CG1  2  
ATOM 1469  C CG2  . VAL B 2 15 ? 7.411   -4.674  -2.731  1.00 0.00 ? 39  VAL B CG2  2  
ATOM 1470  H H    . VAL B 2 15 ? 4.430   -3.845  -4.048  1.00 0.00 ? 39  VAL B H    2  
ATOM 1471  H HA   . VAL B 2 15 ? 6.090   -2.616  -2.085  1.00 0.00 ? 39  VAL B HA   2  
ATOM 1472  H HB   . VAL B 2 15 ? 6.515   -4.168  -4.582  1.00 0.00 ? 39  VAL B HB   2  
ATOM 1473  H HG11 . VAL B 2 15 ? 8.136   -2.856  -5.377  1.00 0.00 ? 39  VAL B HG11 2  
ATOM 1474  H HG12 . VAL B 2 15 ? 9.084   -3.419  -4.002  1.00 0.00 ? 39  VAL B HG12 2  
ATOM 1475  H HG13 . VAL B 2 15 ? 8.208   -1.898  -3.899  1.00 0.00 ? 39  VAL B HG13 2  
ATOM 1476  H HG21 . VAL B 2 15 ? 6.637   -4.786  -1.984  1.00 0.00 ? 39  VAL B HG21 2  
ATOM 1477  H HG22 . VAL B 2 15 ? 8.325   -4.346  -2.260  1.00 0.00 ? 39  VAL B HG22 2  
ATOM 1478  H HG23 . VAL B 2 15 ? 7.578   -5.622  -3.220  1.00 0.00 ? 39  VAL B HG23 2  
ATOM 1479  N N    . ARG B 2 16 ? 5.989   -1.186  -5.074  1.00 0.00 ? 40  ARG B N    2  
ATOM 1480  C CA   . ARG B 2 16 ? 6.081   0.092   -5.752  1.00 0.00 ? 40  ARG B CA   2  
ATOM 1481  C C    . ARG B 2 16 ? 5.245   1.140   -5.053  1.00 0.00 ? 40  ARG B C    2  
ATOM 1482  O O    . ARG B 2 16 ? 5.781   2.152   -4.630  1.00 0.00 ? 40  ARG B O    2  
ATOM 1483  C CB   . ARG B 2 16 ? 5.644   -0.039  -7.206  1.00 0.00 ? 40  ARG B CB   2  
ATOM 1484  C CG   . ARG B 2 16 ? 6.548   -0.935  -8.027  1.00 0.00 ? 40  ARG B CG   2  
ATOM 1485  C CD   . ARG B 2 16 ? 5.882   -2.255  -8.347  1.00 0.00 ? 40  ARG B CD   2  
ATOM 1486  N NE   . ARG B 2 16 ? 6.352   -2.808  -9.614  1.00 0.00 ? 40  ARG B NE   2  
ATOM 1487  C CZ   . ARG B 2 16 ? 5.625   -3.613  -10.384 1.00 0.00 ? 40  ARG B CZ   2  
ATOM 1488  N NH1  . ARG B 2 16 ? 4.402   -3.966  -10.012 1.00 0.00 ? 40  ARG B NH1  2  
ATOM 1489  N NH2  . ARG B 2 16 ? 6.123   -4.067  -11.526 1.00 0.00 ? 40  ARG B NH2  2  
ATOM 1490  H H    . ARG B 2 16 ? 5.888   -1.998  -5.612  1.00 0.00 ? 40  ARG B H    2  
ATOM 1491  H HA   . ARG B 2 16 ? 7.116   0.408   -5.725  1.00 0.00 ? 40  ARG B HA   2  
ATOM 1492  H HB2  . ARG B 2 16 ? 4.644   -0.447  -7.235  1.00 0.00 ? 40  ARG B HB2  2  
ATOM 1493  H HB3  . ARG B 2 16 ? 5.638   0.942   -7.658  1.00 0.00 ? 40  ARG B HB3  2  
ATOM 1494  H HG2  . ARG B 2 16 ? 6.790   -0.441  -8.944  1.00 0.00 ? 40  ARG B HG2  2  
ATOM 1495  H HG3  . ARG B 2 16 ? 7.452   -1.127  -7.468  1.00 0.00 ? 40  ARG B HG3  2  
ATOM 1496  H HD2  . ARG B 2 16 ? 6.109   -2.947  -7.556  1.00 0.00 ? 40  ARG B HD2  2  
ATOM 1497  H HD3  . ARG B 2 16 ? 4.813   -2.104  -8.402  1.00 0.00 ? 40  ARG B HD3  2  
ATOM 1498  H HE   . ARG B 2 16 ? 7.255   -2.567  -9.907  1.00 0.00 ? 40  ARG B HE   2  
ATOM 1499  H HH11 . ARG B 2 16 ? 4.023   -3.628  -9.151  1.00 0.00 ? 40  ARG B HH11 2  
ATOM 1500  H HH12 . ARG B 2 16 ? 3.859   -4.571  -10.594 1.00 0.00 ? 40  ARG B HH12 2  
ATOM 1501  H HH21 . ARG B 2 16 ? 7.045   -3.804  -11.808 1.00 0.00 ? 40  ARG B HH21 2  
ATOM 1502  H HH22 . ARG B 2 16 ? 5.575   -4.671  -12.104 1.00 0.00 ? 40  ARG B HH22 2  
ATOM 1503  N N    . ALA B 2 17 ? 3.937   0.907   -4.903  1.00 0.00 ? 41  ALA B N    2  
ATOM 1504  C CA   . ALA B 2 17 ? 3.108   1.886   -4.240  1.00 0.00 ? 41  ALA B CA   2  
ATOM 1505  C C    . ALA B 2 17 ? 3.718   2.230   -2.891  1.00 0.00 ? 41  ALA B C    2  
ATOM 1506  O O    . ALA B 2 17 ? 3.965   3.385   -2.619  1.00 0.00 ? 41  ALA B O    2  
ATOM 1507  C CB   . ALA B 2 17 ? 1.668   1.392   -4.101  1.00 0.00 ? 41  ALA B CB   2  
ATOM 1508  H H    . ALA B 2 17 ? 3.535   0.068   -5.221  1.00 0.00 ? 41  ALA B H    2  
ATOM 1509  H HA   . ALA B 2 17 ? 3.105   2.789   -4.859  1.00 0.00 ? 41  ALA B HA   2  
ATOM 1510  H HB1  . ALA B 2 17 ? 1.030   2.220   -3.828  1.00 0.00 ? 41  ALA B HB1  2  
ATOM 1511  H HB2  . ALA B 2 17 ? 1.607   0.626   -3.336  1.00 0.00 ? 41  ALA B HB2  2  
ATOM 1512  H HB3  . ALA B 2 17 ? 1.337   0.983   -5.044  1.00 0.00 ? 41  ALA B HB3  2  
ATOM 1513  N N    . LEU B 2 18 ? 4.024   1.221   -2.073  1.00 0.00 ? 42  LEU B N    2  
ATOM 1514  C CA   . LEU B 2 18 ? 4.616   1.463   -0.752  1.00 0.00 ? 42  LEU B CA   2  
ATOM 1515  C C    . LEU B 2 18 ? 5.705   2.529   -0.842  1.00 0.00 ? 42  LEU B C    2  
ATOM 1516  O O    . LEU B 2 18 ? 5.840   3.381   0.037   1.00 0.00 ? 42  LEU B O    2  
ATOM 1517  C CB   . LEU B 2 18 ? 5.210   0.164   -0.203  1.00 0.00 ? 42  LEU B CB   2  
ATOM 1518  C CG   . LEU B 2 18 ? 4.936   -0.122  1.273   1.00 0.00 ? 42  LEU B CG   2  
ATOM 1519  C CD1  . LEU B 2 18 ? 5.628   -1.408  1.696   1.00 0.00 ? 42  LEU B CD1  2  
ATOM 1520  C CD2  . LEU B 2 18 ? 5.400   1.041   2.126   1.00 0.00 ? 42  LEU B CD2  2  
ATOM 1521  H H    . LEU B 2 18 ? 3.860   0.295   -2.361  1.00 0.00 ? 42  LEU B H    2  
ATOM 1522  H HA   . LEU B 2 18 ? 3.829   1.811   -0.090  1.00 0.00 ? 42  LEU B HA   2  
ATOM 1523  H HB2  . LEU B 2 18 ? 4.820   -0.655  -0.782  1.00 0.00 ? 42  LEU B HB2  2  
ATOM 1524  H HB3  . LEU B 2 18 ? 6.278   0.199   -0.345  1.00 0.00 ? 42  LEU B HB3  2  
ATOM 1525  H HG   . LEU B 2 18 ? 3.873   -0.248  1.419   1.00 0.00 ? 42  LEU B HG   2  
ATOM 1526  H HD11 . LEU B 2 18 ? 5.101   -2.255  1.282   1.00 0.00 ? 42  LEU B HD11 2  
ATOM 1527  H HD12 . LEU B 2 18 ? 5.634   -1.478  2.773   1.00 0.00 ? 42  LEU B HD12 2  
ATOM 1528  H HD13 . LEU B 2 18 ? 6.645   -1.406  1.332   1.00 0.00 ? 42  LEU B HD13 2  
ATOM 1529  H HD21 . LEU B 2 18 ? 4.571   1.709   2.307   1.00 0.00 ? 42  LEU B HD21 2  
ATOM 1530  H HD22 . LEU B 2 18 ? 6.177   1.570   1.600   1.00 0.00 ? 42  LEU B HD22 2  
ATOM 1531  H HD23 . LEU B 2 18 ? 5.782   0.672   3.066   1.00 0.00 ? 42  LEU B HD23 2  
ATOM 1532  N N    . VAL B 2 19 ? 6.476   2.457   -1.916  1.00 0.00 ? 43  VAL B N    2  
ATOM 1533  C CA   . VAL B 2 19 ? 7.560   3.404   -2.176  1.00 0.00 ? 43  VAL B CA   2  
ATOM 1534  C C    . VAL B 2 19 ? 6.991   4.727   -2.668  1.00 0.00 ? 43  VAL B C    2  
ATOM 1535  O O    . VAL B 2 19 ? 7.137   5.762   -2.019  1.00 0.00 ? 43  VAL B O    2  
ATOM 1536  C CB   . VAL B 2 19 ? 8.542   2.843   -3.228  1.00 0.00 ? 43  VAL B CB   2  
ATOM 1537  C CG1  . VAL B 2 19 ? 9.962   3.250   -2.915  1.00 0.00 ? 43  VAL B CG1  2  
ATOM 1538  C CG2  . VAL B 2 19 ? 8.461   1.345   -3.260  1.00 0.00 ? 43  VAL B CG2  2  
ATOM 1539  H H    . VAL B 2 19 ? 6.315   1.737   -2.553  1.00 0.00 ? 43  VAL B H    2  
ATOM 1540  H HA   . VAL B 2 19 ? 8.090   3.568   -1.249  1.00 0.00 ? 43  VAL B HA   2  
ATOM 1541  H HB   . VAL B 2 19 ? 8.269   3.217   -4.206  1.00 0.00 ? 43  VAL B HB   2  
ATOM 1542  H HG11 . VAL B 2 19 ? 10.570  3.154   -3.801  1.00 0.00 ? 43  VAL B HG11 2  
ATOM 1543  H HG12 . VAL B 2 19 ? 10.340  2.591   -2.142  1.00 0.00 ? 43  VAL B HG12 2  
ATOM 1544  H HG13 . VAL B 2 19 ? 9.981   4.273   -2.567  1.00 0.00 ? 43  VAL B HG13 2  
ATOM 1545  H HG21 . VAL B 2 19 ? 7.529   1.041   -3.709  1.00 0.00 ? 43  VAL B HG21 2  
ATOM 1546  H HG22 . VAL B 2 19 ? 8.519   0.978   -2.243  1.00 0.00 ? 43  VAL B HG22 2  
ATOM 1547  H HG23 . VAL B 2 19 ? 9.287   0.951   -3.836  1.00 0.00 ? 43  VAL B HG23 2  
ATOM 1548  N N    . ARG B 2 20 ? 6.366   4.670   -3.838  1.00 0.00 ? 44  ARG B N    2  
ATOM 1549  C CA   . ARG B 2 20 ? 5.703   5.819   -4.448  1.00 0.00 ? 44  ARG B CA   2  
ATOM 1550  C C    . ARG B 2 20 ? 5.091   6.701   -3.370  1.00 0.00 ? 44  ARG B C    2  
ATOM 1551  O O    . ARG B 2 20 ? 5.155   7.929   -3.405  1.00 0.00 ? 44  ARG B O    2  
ATOM 1552  C CB   . ARG B 2 20 ? 4.580   5.296   -5.341  1.00 0.00 ? 44  ARG B CB   2  
ATOM 1553  C CG   . ARG B 2 20 ? 5.055   4.327   -6.388  1.00 0.00 ? 44  ARG B CG   2  
ATOM 1554  C CD   . ARG B 2 20 ? 4.568   4.727   -7.755  1.00 0.00 ? 44  ARG B CD   2  
ATOM 1555  N NE   . ARG B 2 20 ? 3.360   4.003   -8.141  1.00 0.00 ? 44  ARG B NE   2  
ATOM 1556  C CZ   . ARG B 2 20 ? 2.622   4.309   -9.205  1.00 0.00 ? 44  ARG B CZ   2  
ATOM 1557  N NH1  . ARG B 2 20 ? 2.968   5.319   -9.992  1.00 0.00 ? 44  ARG B NH1  2  
ATOM 1558  N NH2  . ARG B 2 20 ? 1.533   3.602   -9.481  1.00 0.00 ? 44  ARG B NH2  2  
ATOM 1559  H H    . ARG B 2 20 ? 6.362   3.819   -4.322  1.00 0.00 ? 44  ARG B H    2  
ATOM 1560  H HA   . ARG B 2 20 ? 6.413   6.373   -5.042  1.00 0.00 ? 44  ARG B HA   2  
ATOM 1561  H HB2  . ARG B 2 20 ? 3.858   4.788   -4.728  1.00 0.00 ? 44  ARG B HB2  2  
ATOM 1562  H HB3  . ARG B 2 20 ? 4.098   6.117   -5.833  1.00 0.00 ? 44  ARG B HB3  2  
ATOM 1563  H HG2  . ARG B 2 20 ? 6.135   4.308   -6.388  1.00 0.00 ? 44  ARG B HG2  2  
ATOM 1564  H HG3  . ARG B 2 20 ? 4.673   3.345   -6.152  1.00 0.00 ? 44  ARG B HG3  2  
ATOM 1565  H HD2  . ARG B 2 20 ? 4.360   5.787   -7.756  1.00 0.00 ? 44  ARG B HD2  2  
ATOM 1566  H HD3  . ARG B 2 20 ? 5.347   4.514   -8.451  1.00 0.00 ? 44  ARG B HD3  2  
ATOM 1567  H HE   . ARG B 2 20 ? 3.081   3.251   -7.577  1.00 0.00 ? 44  ARG B HE   2  
ATOM 1568  H HH11 . ARG B 2 20 ? 3.788   5.854   -9.788  1.00 0.00 ? 44  ARG B HH11 2  
ATOM 1569  H HH12 . ARG B 2 20 ? 2.409   5.546   -10.790 1.00 0.00 ? 44  ARG B HH12 2  
ATOM 1570  H HH21 . ARG B 2 20 ? 1.267   2.841   -8.889  1.00 0.00 ? 44  ARG B HH21 2  
ATOM 1571  H HH22 . ARG B 2 20 ? 0.978   3.831   -10.280 1.00 0.00 ? 44  ARG B HH22 2  
ATOM 1572  N N    . VAL B 2 21 ? 4.501   6.008   -2.419  1.00 0.00 ? 45  VAL B N    2  
ATOM 1573  C CA   . VAL B 2 21 ? 3.816   6.581   -1.284  1.00 0.00 ? 45  VAL B CA   2  
ATOM 1574  C C    . VAL B 2 21 ? 4.760   7.164   -0.239  1.00 0.00 ? 45  VAL B C    2  
ATOM 1575  O O    . VAL B 2 21 ? 4.780   8.371   0.000   1.00 0.00 ? 45  VAL B O    2  
ATOM 1576  C CB   . VAL B 2 21 ? 2.986   5.484   -0.600  1.00 0.00 ? 45  VAL B CB   2  
ATOM 1577  C CG1  . VAL B 2 21 ? 2.260   6.031   0.601   1.00 0.00 ? 45  VAL B CG1  2  
ATOM 1578  C CG2  . VAL B 2 21 ? 2.024   4.834   -1.576  1.00 0.00 ? 45  VAL B CG2  2  
ATOM 1579  H H    . VAL B 2 21 ? 4.539   5.037   -2.481  1.00 0.00 ? 45  VAL B H    2  
ATOM 1580  H HA   . VAL B 2 21 ? 3.143   7.347   -1.634  1.00 0.00 ? 45  VAL B HA   2  
ATOM 1581  H HB   . VAL B 2 21 ? 3.667   4.722   -0.252  1.00 0.00 ? 45  VAL B HB   2  
ATOM 1582  H HG11 . VAL B 2 21 ? 1.906   7.028   0.386   1.00 0.00 ? 45  VAL B HG11 2  
ATOM 1583  H HG12 . VAL B 2 21 ? 2.937   6.060   1.436   1.00 0.00 ? 45  VAL B HG12 2  
ATOM 1584  H HG13 . VAL B 2 21 ? 1.420   5.395   0.837   1.00 0.00 ? 45  VAL B HG13 2  
ATOM 1585  H HG21 . VAL B 2 21 ? 1.009   5.038   -1.277  1.00 0.00 ? 45  VAL B HG21 2  
ATOM 1586  H HG22 . VAL B 2 21 ? 2.190   3.769   -1.577  1.00 0.00 ? 45  VAL B HG22 2  
ATOM 1587  H HG23 . VAL B 2 21 ? 2.195   5.226   -2.568  1.00 0.00 ? 45  VAL B HG23 2  
ATOM 1588  N N    . CYS B 2 22 ? 5.541   6.283   0.378   1.00 0.00 ? 46  CYS B N    2  
ATOM 1589  C CA   . CYS B 2 22 ? 6.442   6.669   1.454   1.00 0.00 ? 46  CYS B CA   2  
ATOM 1590  C C    . CYS B 2 22 ? 7.892   6.551   1.036   1.00 0.00 ? 46  CYS B C    2  
ATOM 1591  O O    . CYS B 2 22 ? 8.718   7.414   1.332   1.00 0.00 ? 46  CYS B O    2  
ATOM 1592  C CB   . CYS B 2 22 ? 6.193   5.741   2.641   1.00 0.00 ? 46  CYS B CB   2  
ATOM 1593  S SG   . CYS B 2 22 ? 6.888   6.307   4.225   1.00 0.00 ? 46  CYS B SG   2  
ATOM 1594  H H    . CYS B 2 22 ? 5.532   5.344   0.079   1.00 0.00 ? 46  CYS B H    2  
ATOM 1595  H HA   . CYS B 2 22 ? 6.227   7.685   1.742   1.00 0.00 ? 46  CYS B HA   2  
ATOM 1596  H HB2  . CYS B 2 22 ? 5.133   5.619   2.771   1.00 0.00 ? 46  CYS B HB2  2  
ATOM 1597  H HB3  . CYS B 2 22 ? 6.628   4.777   2.421   1.00 0.00 ? 46  CYS B HB3  2  
ATOM 1598  N N    . GLY B 2 23 ? 8.181   5.468   0.344   1.00 0.00 ? 47  GLY B N    2  
ATOM 1599  C CA   . GLY B 2 23 ? 9.537   5.204   -0.093  1.00 0.00 ? 47  GLY B CA   2  
ATOM 1600  C C    . GLY B 2 23 ? 10.143  4.067   0.689   1.00 0.00 ? 47  GLY B C    2  
ATOM 1601  O O    . GLY B 2 23 ? 11.346  3.832   0.613   1.00 0.00 ? 47  GLY B O    2  
ATOM 1602  H H    . GLY B 2 23 ? 7.455   4.840   0.118   1.00 0.00 ? 47  GLY B H    2  
ATOM 1603  H HA2  . GLY B 2 23 ? 9.525   4.949   -1.138  1.00 0.00 ? 47  GLY B HA2  2  
ATOM 1604  H HA3  . GLY B 2 23 ? 10.143  6.085   0.049   1.00 0.00 ? 47  GLY B HA3  2  
ATOM 1605  N N    . GLY B 2 24 ? 9.294   3.380   1.459   1.00 0.00 ? 48  GLY B N    2  
ATOM 1606  C CA   . GLY B 2 24 ? 9.723   2.253   2.266   1.00 0.00 ? 48  GLY B CA   2  
ATOM 1607  C C    . GLY B 2 24 ? 11.169  2.355   2.720   1.00 0.00 ? 48  GLY B C    2  
ATOM 1608  O O    . GLY B 2 24 ? 11.599  3.406   3.194   1.00 0.00 ? 48  GLY B O    2  
ATOM 1609  H H    . GLY B 2 24 ? 8.353   3.645   1.474   1.00 0.00 ? 48  GLY B H    2  
ATOM 1610  H HA2  . GLY B 2 24 ? 9.091   2.194   3.138   1.00 0.00 ? 48  GLY B HA2  2  
ATOM 1611  H HA3  . GLY B 2 24 ? 9.600   1.352   1.687   1.00 0.00 ? 48  GLY B HA3  2  
ATOM 1612  N N    . PRO B 2 25 ? 11.940  1.263   2.593   1.00 0.00 ? 49  PRO B N    2  
ATOM 1613  C CA   . PRO B 2 25 ? 13.352  1.242   2.980   1.00 0.00 ? 49  PRO B CA   2  
ATOM 1614  C C    . PRO B 2 25 ? 14.225  2.109   2.062   1.00 0.00 ? 49  PRO B C    2  
ATOM 1615  O O    . PRO B 2 25 ? 13.864  3.241   1.737   1.00 0.00 ? 49  PRO B O    2  
ATOM 1616  C CB   . PRO B 2 25 ? 13.714  -0.244  2.870   1.00 0.00 ? 49  PRO B CB   2  
ATOM 1617  C CG   . PRO B 2 25 ? 12.776  -0.784  1.858   1.00 0.00 ? 49  PRO B CG   2  
ATOM 1618  C CD   . PRO B 2 25 ? 11.493  -0.042  2.080   1.00 0.00 ? 49  PRO B CD   2  
ATOM 1619  H HA   . PRO B 2 25 ? 13.481  1.569   4.000   1.00 0.00 ? 49  PRO B HA   2  
ATOM 1620  H HB2  . PRO B 2 25 ? 14.741  -0.355  2.563   1.00 0.00 ? 49  PRO B HB2  2  
ATOM 1621  H HB3  . PRO B 2 25 ? 13.562  -0.717  3.823   1.00 0.00 ? 49  PRO B HB3  2  
ATOM 1622  H HG2  . PRO B 2 25 ? 13.156  -0.596  0.865   1.00 0.00 ? 49  PRO B HG2  2  
ATOM 1623  H HG3  . PRO B 2 25 ? 12.631  -1.842  2.016   1.00 0.00 ? 49  PRO B HG3  2  
ATOM 1624  H HD2  . PRO B 2 25 ? 10.971  0.073   1.160   1.00 0.00 ? 49  PRO B HD2  2  
ATOM 1625  H HD3  . PRO B 2 25 ? 10.871  -0.546  2.797   1.00 0.00 ? 49  PRO B HD3  2  
ATOM 1626  N N    . ARG B 2 26 ? 15.373  1.574   1.653   1.00 0.00 ? 50  ARG B N    2  
ATOM 1627  C CA   . ARG B 2 26 ? 16.318  2.299   0.802   1.00 0.00 ? 50  ARG B CA   2  
ATOM 1628  C C    . ARG B 2 26 ? 15.956  2.267   -0.681  1.00 0.00 ? 50  ARG B C    2  
ATOM 1629  O O    . ARG B 2 26 ? 15.834  3.314   -1.318  1.00 0.00 ? 50  ARG B O    2  
ATOM 1630  C CB   . ARG B 2 26 ? 17.696  1.693   0.958   1.00 0.00 ? 50  ARG B CB   2  
ATOM 1631  C CG   . ARG B 2 26 ? 18.224  1.708   2.383   1.00 0.00 ? 50  ARG B CG   2  
ATOM 1632  C CD   . ARG B 2 26 ? 19.608  1.085   2.465   1.00 0.00 ? 50  ARG B CD   2  
ATOM 1633  N NE   . ARG B 2 26 ? 20.219  1.274   3.777   1.00 0.00 ? 50  ARG B NE   2  
ATOM 1634  C CZ   . ARG B 2 26 ? 21.522  1.139   4.009   1.00 0.00 ? 50  ARG B CZ   2  
ATOM 1635  N NH1  . ARG B 2 26 ? 22.344  0.810   3.021   1.00 0.00 ? 50  ARG B NH1  2  
ATOM 1636  N NH2  . ARG B 2 26 ? 22.003  1.331   5.230   1.00 0.00 ? 50  ARG B NH2  2  
ATOM 1637  H H    . ARG B 2 26 ? 15.597  0.663   1.933   1.00 0.00 ? 50  ARG B H    2  
ATOM 1638  H HA   . ARG B 2 26 ? 16.349  3.322   1.132   1.00 0.00 ? 50  ARG B HA   2  
ATOM 1639  H HB2  . ARG B 2 26 ? 17.638  0.674   0.622   1.00 0.00 ? 50  ARG B HB2  2  
ATOM 1640  H HB3  . ARG B 2 26 ? 18.391  2.233   0.331   1.00 0.00 ? 50  ARG B HB3  2  
ATOM 1641  H HG2  . ARG B 2 26 ? 18.279  2.729   2.727   1.00 0.00 ? 50  ARG B HG2  2  
ATOM 1642  H HG3  . ARG B 2 26 ? 17.549  1.149   3.014   1.00 0.00 ? 50  ARG B HG3  2  
ATOM 1643  H HD2  . ARG B 2 26 ? 19.524  0.027   2.268   1.00 0.00 ? 50  ARG B HD2  2  
ATOM 1644  H HD3  . ARG B 2 26 ? 20.238  1.541   1.715   1.00 0.00 ? 50  ARG B HD3  2  
ATOM 1645  H HE   . ARG B 2 26 ? 19.630  1.515   4.522   1.00 0.00 ? 50  ARG B HE   2  
ATOM 1646  H HH11 . ARG B 2 26 ? 21.984  0.663   2.099   1.00 0.00 ? 50  ARG B HH11 2  
ATOM 1647  H HH12 . ARG B 2 26 ? 23.323  0.710   3.197   1.00 0.00 ? 50  ARG B HH12 2  
ATOM 1648  H HH21 . ARG B 2 26 ? 21.386  1.578   5.977   1.00 0.00 ? 50  ARG B HH21 2  
ATOM 1649  H HH22 . ARG B 2 26 ? 22.983  1.229   5.402   1.00 0.00 ? 50  ARG B HH22 2  
ATOM 1650  N N    . TRP B 2 27 ? 15.802  1.057   -1.224  1.00 0.00 ? 51  TRP B N    2  
ATOM 1651  C CA   . TRP B 2 27 ? 15.506  0.865   -2.630  1.00 0.00 ? 51  TRP B CA   2  
ATOM 1652  C C    . TRP B 2 27 ? 16.680  1.293   -3.504  1.00 0.00 ? 51  TRP B C    2  
ATOM 1653  O O    . TRP B 2 27 ? 16.554  1.387   -4.725  1.00 0.00 ? 51  TRP B O    2  
ATOM 1654  C CB   . TRP B 2 27 ? 14.274  1.638   -3.009  1.00 0.00 ? 51  TRP B CB   2  
ATOM 1655  C CG   . TRP B 2 27 ? 13.147  1.388   -2.086  1.00 0.00 ? 51  TRP B CG   2  
ATOM 1656  C CD1  . TRP B 2 27 ? 12.881  2.008   -0.910  1.00 0.00 ? 51  TRP B CD1  2  
ATOM 1657  C CD2  . TRP B 2 27 ? 12.145  0.422   -2.268  1.00 0.00 ? 51  TRP B CD2  2  
ATOM 1658  N NE1  . TRP B 2 27 ? 11.735  1.492   -0.362  1.00 0.00 ? 51  TRP B NE1  2  
ATOM 1659  C CE2  . TRP B 2 27 ? 11.265  0.508   -1.186  1.00 0.00 ? 51  TRP B CE2  2  
ATOM 1660  C CE3  . TRP B 2 27 ? 11.910  -0.501  -3.261  1.00 0.00 ? 51  TRP B CE3  2  
ATOM 1661  C CZ2  . TRP B 2 27 ? 10.154  -0.311  -1.075  1.00 0.00 ? 51  TRP B CZ2  2  
ATOM 1662  C CZ3  . TRP B 2 27 ? 10.809  -1.314  -3.154  1.00 0.00 ? 51  TRP B CZ3  2  
ATOM 1663  C CH2  . TRP B 2 27 ? 9.939   -1.207  -2.058  1.00 0.00 ? 51  TRP B CH2  2  
ATOM 1664  H H    . TRP B 2 27 ? 15.845  0.276   -0.657  1.00 0.00 ? 51  TRP B H    2  
ATOM 1665  H HA   . TRP B 2 27 ? 15.309  -0.186  -2.784  1.00 0.00 ? 51  TRP B HA   2  
ATOM 1666  H HB2  . TRP B 2 27 ? 14.486  2.687   -3.014  1.00 0.00 ? 51  TRP B HB2  2  
ATOM 1667  H HB3  . TRP B 2 27 ? 13.972  1.329   -3.985  1.00 0.00 ? 51  TRP B HB3  2  
ATOM 1668  H HD1  . TRP B 2 27 ? 13.487  2.788   -0.488  1.00 0.00 ? 51  TRP B HD1  2  
ATOM 1669  H HE1  . TRP B 2 27 ? 11.324  1.779   0.479   1.00 0.00 ? 51  TRP B HE1  2  
ATOM 1670  H HE3  . TRP B 2 27 ? 12.583  -0.583  -4.099  1.00 0.00 ? 51  TRP B HE3  2  
ATOM 1671  H HZ2  . TRP B 2 27 ? 9.473   -0.252  -0.251  1.00 0.00 ? 51  TRP B HZ2  2  
ATOM 1672  H HZ3  . TRP B 2 27 ? 10.612  -2.042  -3.917  1.00 0.00 ? 51  TRP B HZ3  2  
ATOM 1673  H HH2  . TRP B 2 27 ? 9.076   -1.837  -2.005  1.00 0.00 ? 51  TRP B HH2  2  
ATOM 1674  N N    . SER B 2 28 ? 17.821  1.549   -2.867  1.00 0.00 ? 52  SER B N    2  
ATOM 1675  C CA   . SER B 2 28 ? 19.023  1.975   -3.571  1.00 0.00 ? 52  SER B CA   2  
ATOM 1676  C C    . SER B 2 28 ? 18.786  3.289   -4.311  1.00 0.00 ? 52  SER B C    2  
ATOM 1677  O O    . SER B 2 28 ? 17.668  3.802   -4.339  1.00 0.00 ? 52  SER B O    2  
ATOM 1678  C CB   . SER B 2 28 ? 19.470  0.890   -4.547  1.00 0.00 ? 52  SER B CB   2  
ATOM 1679  O OG   . SER B 2 28 ? 19.864  -0.285  -3.859  1.00 0.00 ? 52  SER B OG   2  
ATOM 1680  H H    . SER B 2 28 ? 17.856  1.442   -1.898  1.00 0.00 ? 52  SER B H    2  
ATOM 1681  H HA   . SER B 2 28 ? 19.800  2.125   -2.836  1.00 0.00 ? 52  SER B HA   2  
ATOM 1682  H HB2  . SER B 2 28 ? 18.651  0.648   -5.204  1.00 0.00 ? 52  SER B HB2  2  
ATOM 1683  H HB3  . SER B 2 28 ? 20.304  1.252   -5.125  1.00 0.00 ? 52  SER B HB3  2  
ATOM 1684  H HG   . SER B 2 28 ? 20.415  -0.050  -3.111  1.00 0.00 ? 52  SER B HG   2  
ATOM 1685  N N    . THR B 2 29 ? 19.844  3.821   -4.918  1.00 0.00 ? 53  THR B N    2  
ATOM 1686  C CA   . THR B 2 29 ? 19.758  5.080   -5.655  1.00 0.00 ? 53  THR B CA   2  
ATOM 1687  C C    . THR B 2 29 ? 20.838  5.165   -6.728  1.00 0.00 ? 53  THR B C    2  
ATOM 1688  O O    . THR B 2 29 ? 20.560  5.512   -7.876  1.00 0.00 ? 53  THR B O    2  
ATOM 1689  C CB   . THR B 2 29 ? 19.908  6.298   -4.719  1.00 0.00 ? 53  THR B CB   2  
ATOM 1690  O OG1  . THR B 2 29 ? 21.060  6.134   -3.884  1.00 0.00 ? 53  THR B OG1  2  
ATOM 1691  C CG2  . THR B 2 29 ? 18.672  6.487   -3.853  1.00 0.00 ? 53  THR B CG2  2  
ATOM 1692  H H    . THR B 2 29 ? 20.705  3.356   -4.871  1.00 0.00 ? 53  THR B H    2  
ATOM 1693  H HA   . THR B 2 29 ? 18.787  5.130   -6.125  1.00 0.00 ? 53  THR B HA   2  
ATOM 1694  H HB   . THR B 2 29 ? 20.040  7.182   -5.327  1.00 0.00 ? 53  THR B HB   2  
ATOM 1695  H HG1  . THR B 2 29 ? 20.927  6.603   -3.058  1.00 0.00 ? 53  THR B HG1  2  
ATOM 1696  H HG21 . THR B 2 29 ? 18.495  5.590   -3.277  1.00 0.00 ? 53  THR B HG21 2  
ATOM 1697  H HG22 . THR B 2 29 ? 17.816  6.684   -4.484  1.00 0.00 ? 53  THR B HG22 2  
ATOM 1698  H HG23 . THR B 2 29 ? 18.824  7.320   -3.184  1.00 0.00 ? 53  THR B HG23 2  
ATOM 1699  N N    . GLU B 2 30 ? 22.070  4.847   -6.346  1.00 0.00 ? 54  GLU B N    2  
ATOM 1700  C CA   . GLU B 2 30 ? 23.192  4.889   -7.274  1.00 0.00 ? 54  GLU B CA   2  
ATOM 1701  C C    . GLU B 2 30 ? 24.325  3.983   -6.803  1.00 0.00 ? 54  GLU B C    2  
ATOM 1702  O O    . GLU B 2 30 ? 25.362  4.455   -6.336  1.00 0.00 ? 54  GLU B O    2  
ATOM 1703  C CB   . GLU B 2 30 ? 23.694  6.322   -7.434  1.00 0.00 ? 54  GLU B CB   2  
ATOM 1704  C CG   . GLU B 2 30 ? 23.735  7.088   -6.128  1.00 0.00 ? 54  GLU B CG   2  
ATOM 1705  C CD   . GLU B 2 30 ? 24.009  8.566   -6.325  1.00 0.00 ? 54  GLU B CD   2  
ATOM 1706  O OE1  . GLU B 2 30 ? 23.042  9.326   -6.544  1.00 0.00 ? 54  GLU B OE1  2  
ATOM 1707  O OE2  . GLU B 2 30 ? 25.192  8.964   -6.259  1.00 0.00 ? 54  GLU B OE2  2  
ATOM 1708  H H    . GLU B 2 30 ? 22.229  4.581   -5.417  1.00 0.00 ? 54  GLU B H    2  
ATOM 1709  H HA   . GLU B 2 30 ? 22.840  4.537   -8.227  1.00 0.00 ? 54  GLU B HA   2  
ATOM 1710  H HB2  . GLU B 2 30 ? 24.689  6.302   -7.849  1.00 0.00 ? 54  GLU B HB2  2  
ATOM 1711  H HB3  . GLU B 2 30 ? 23.038  6.845   -8.113  1.00 0.00 ? 54  GLU B HB3  2  
ATOM 1712  H HG2  . GLU B 2 30 ? 22.782  6.973   -5.639  1.00 0.00 ? 54  GLU B HG2  2  
ATOM 1713  H HG3  . GLU B 2 30 ? 24.512  6.670   -5.504  1.00 0.00 ? 54  GLU B HG3  2  
ATOM 1714  N N    . ALA B 2 31 ? 24.116  2.676   -6.928  1.00 0.00 ? 55  ALA B N    2  
ATOM 1715  C CA   . ALA B 2 31 ? 25.114  1.697   -6.516  1.00 0.00 ? 55  ALA B CA   2  
ATOM 1716  C C    . ALA B 2 31 ? 26.238  1.596   -7.541  1.00 0.00 ? 55  ALA B C    2  
ATOM 1717  O O    . ALA B 2 31 ? 26.104  0.795   -8.489  1.00 0.00 ? 55  ALA B O    2  
ATOM 1718  C CB   . ALA B 2 31 ? 24.462  0.337   -6.306  1.00 0.00 ? 55  ALA B CB   2  
ATOM 1719  O OXT  . ALA B 2 31 ? 27.244  2.321   -7.387  1.00 0.00 ? 55  ALA B OXT  2  
ATOM 1720  H H    . ALA B 2 31 ? 23.269  2.364   -7.309  1.00 0.00 ? 55  ALA B H    2  
ATOM 1721  H HA   . ALA B 2 31 ? 25.528  2.021   -5.573  1.00 0.00 ? 55  ALA B HA   2  
ATOM 1722  H HB1  . ALA B 2 31 ? 24.044  -0.009  -7.239  1.00 0.00 ? 55  ALA B HB1  2  
ATOM 1723  H HB2  . ALA B 2 31 ? 23.677  0.425   -5.570  1.00 0.00 ? 55  ALA B HB2  2  
ATOM 1724  H HB3  . ALA B 2 31 ? 25.203  -0.366  -5.959  1.00 0.00 ? 55  ALA B HB3  2  
ATOM 1725  N N    . ALA A 1 1  ? 0.325   -0.053  11.418  1.00 0.00 ? 106 ALA A N    3  
ATOM 1726  C CA   . ALA A 1 1  ? 1.236   -1.205  11.644  1.00 0.00 ? 106 ALA A CA   3  
ATOM 1727  C C    . ALA A 1 1  ? 0.675   -2.147  12.705  1.00 0.00 ? 106 ALA A C    3  
ATOM 1728  O O    . ALA A 1 1  ? 1.384   -2.553  13.629  1.00 0.00 ? 106 ALA A O    3  
ATOM 1729  C CB   . ALA A 1 1  ? 2.617   -0.711  12.049  1.00 0.00 ? 106 ALA A CB   3  
ATOM 1730  H H1   . ALA A 1 1  ? -0.616  -0.391  11.129  1.00 0.00 ? 106 ALA A H1   3  
ATOM 1731  H H2   . ALA A 1 1  ? 0.705   0.561   10.670  1.00 0.00 ? 106 ALA A H2   3  
ATOM 1732  H H3   . ALA A 1 1  ? 0.229   0.502   12.292  1.00 0.00 ? 106 ALA A H3   3  
ATOM 1733  H HA   . ALA A 1 1  ? 1.333   -1.748  10.715  1.00 0.00 ? 106 ALA A HA   3  
ATOM 1734  H HB1  . ALA A 1 1  ? 2.543   -0.162  12.977  1.00 0.00 ? 106 ALA A HB1  3  
ATOM 1735  H HB2  . ALA A 1 1  ? 3.009   -0.066  11.277  1.00 0.00 ? 106 ALA A HB2  3  
ATOM 1736  H HB3  . ALA A 1 1  ? 3.276   -1.555  12.181  1.00 0.00 ? 106 ALA A HB3  3  
ATOM 1737  N N    . ALA A 1 2  ? -0.601  -2.492  12.568  1.00 0.00 ? 107 ALA A N    3  
ATOM 1738  C CA   . ALA A 1 2  ? -1.257  -3.387  13.515  1.00 0.00 ? 107 ALA A CA   3  
ATOM 1739  C C    . ALA A 1 2  ? -2.445  -4.098  12.871  1.00 0.00 ? 107 ALA A C    3  
ATOM 1740  O O    . ALA A 1 2  ? -3.347  -4.571  13.563  1.00 0.00 ? 107 ALA A O    3  
ATOM 1741  C CB   . ALA A 1 2  ? -1.709  -2.614  14.745  1.00 0.00 ? 107 ALA A CB   3  
ATOM 1742  H H    . ALA A 1 2  ? -1.114  -2.138  11.811  1.00 0.00 ? 107 ALA A H    3  
ATOM 1743  H HA   . ALA A 1 2  ? -0.536  -4.127  13.829  1.00 0.00 ? 107 ALA A HA   3  
ATOM 1744  H HB1  . ALA A 1 2  ? -2.085  -3.304  15.486  1.00 0.00 ? 107 ALA A HB1  3  
ATOM 1745  H HB2  . ALA A 1 2  ? -2.489  -1.920  14.469  1.00 0.00 ? 107 ALA A HB2  3  
ATOM 1746  H HB3  . ALA A 1 2  ? -0.872  -2.068  15.155  1.00 0.00 ? 107 ALA A HB3  3  
ATOM 1747  N N    . ALA A 1 3  ? -2.435  -4.172  11.543  1.00 0.00 ? 108 ALA A N    3  
ATOM 1748  C CA   . ALA A 1 3  ? -3.508  -4.826  10.805  1.00 0.00 ? 108 ALA A CA   3  
ATOM 1749  C C    . ALA A 1 3  ? -3.063  -6.183  10.280  1.00 0.00 ? 108 ALA A C    3  
ATOM 1750  O O    . ALA A 1 3  ? -2.079  -6.753  10.751  1.00 0.00 ? 108 ALA A O    3  
ATOM 1751  C CB   . ALA A 1 3  ? -3.969  -3.949  9.649   1.00 0.00 ? 108 ALA A CB   3  
ATOM 1752  H H    . ALA A 1 3  ? -1.687  -3.775  11.049  1.00 0.00 ? 108 ALA A H    3  
ATOM 1753  H HA   . ALA A 1 3  ? -4.344  -4.965  11.478  1.00 0.00 ? 108 ALA A HA   3  
ATOM 1754  H HB1  . ALA A 1 3  ? -5.032  -3.770  9.734   1.00 0.00 ? 108 ALA A HB1  3  
ATOM 1755  H HB2  . ALA A 1 3  ? -3.762  -4.450  8.710   1.00 0.00 ? 108 ALA A HB2  3  
ATOM 1756  H HB3  . ALA A 1 3  ? -3.442  -3.006  9.680   1.00 0.00 ? 108 ALA A HB3  3  
ATOM 1757  N N    . THR A 1 4  ? -3.800  -6.695  9.301   1.00 0.00 ? 109 THR A N    3  
ATOM 1758  C CA   . THR A 1 4  ? -3.480  -7.977  8.693   1.00 0.00 ? 109 THR A CA   3  
ATOM 1759  C C    . THR A 1 4  ? -2.286  -7.824  7.753   1.00 0.00 ? 109 THR A C    3  
ATOM 1760  O O    . THR A 1 4  ? -1.418  -6.982  7.985   1.00 0.00 ? 109 THR A O    3  
ATOM 1761  C CB   . THR A 1 4  ? -4.697  -8.533  7.922   1.00 0.00 ? 109 THR A CB   3  
ATOM 1762  O OG1  . THR A 1 4  ? -4.455  -9.888  7.522   1.00 0.00 ? 109 THR A OG1  3  
ATOM 1763  C CG2  . THR A 1 4  ? -5.004  -7.682  6.693   1.00 0.00 ? 109 THR A CG2  3  
ATOM 1764  H H    . THR A 1 4  ? -4.580  -6.198  8.981   1.00 0.00 ? 109 THR A H    3  
ATOM 1765  H HA   . THR A 1 4  ? -3.224  -8.672  9.481   1.00 0.00 ? 109 THR A HA   3  
ATOM 1766  H HB   . THR A 1 4  ? -5.556  -8.511  8.576   1.00 0.00 ? 109 THR A HB   3  
ATOM 1767  H HG1  . THR A 1 4  ? -4.820  -10.487 8.176   1.00 0.00 ? 109 THR A HG1  3  
ATOM 1768  H HG21 . THR A 1 4  ? -4.930  -6.634  6.951   1.00 0.00 ? 109 THR A HG21 3  
ATOM 1769  H HG22 . THR A 1 4  ? -6.003  -7.899  6.345   1.00 0.00 ? 109 THR A HG22 3  
ATOM 1770  H HG23 . THR A 1 4  ? -4.294  -7.910  5.912   1.00 0.00 ? 109 THR A HG23 3  
ATOM 1771  N N    . ASN A 1 5  ? -2.235  -8.630  6.700   1.00 0.00 ? 110 ASN A N    3  
ATOM 1772  C CA   . ASN A 1 5  ? -1.150  -8.549  5.732   1.00 0.00 ? 110 ASN A CA   3  
ATOM 1773  C C    . ASN A 1 5  ? -1.417  -7.406  4.757   1.00 0.00 ? 110 ASN A C    3  
ATOM 1774  O O    . ASN A 1 5  ? -2.300  -7.508  3.905   1.00 0.00 ? 110 ASN A O    3  
ATOM 1775  C CB   . ASN A 1 5  ? -1.011  -9.869  4.971   1.00 0.00 ? 110 ASN A CB   3  
ATOM 1776  C CG   . ASN A 1 5  ? -0.646  -11.022 5.877   1.00 0.00 ? 110 ASN A CG   3  
ATOM 1777  O OD1  . ASN A 1 5  ? -1.516  -11.689 6.436   1.00 0.00 ? 110 ASN A OD1  3  
ATOM 1778  N ND2  . ASN A 1 5  ? 0.647   -11.268 6.025   1.00 0.00 ? 110 ASN A ND2  3  
ATOM 1779  H H    . ASN A 1 5  ? -2.945  -9.289  6.564   1.00 0.00 ? 110 ASN A H    3  
ATOM 1780  H HA   . ASN A 1 5  ? -0.235  -8.349  6.271   1.00 0.00 ? 110 ASN A HA   3  
ATOM 1781  H HB2  . ASN A 1 5  ? -1.944  -10.102 4.492   1.00 0.00 ? 110 ASN A HB2  3  
ATOM 1782  H HB3  . ASN A 1 5  ? -0.240  -9.766  4.222   1.00 0.00 ? 110 ASN A HB3  3  
ATOM 1783  H HD21 . ASN A 1 5  ? 1.285   -10.697 5.549   1.00 0.00 ? 110 ASN A HD21 3  
ATOM 1784  H HD22 . ASN A 1 5  ? 0.910   -12.011 6.601   1.00 0.00 ? 110 ASN A HD22 3  
ATOM 1785  N N    . PRO A 1 6  ? -0.661  -6.298  4.862   1.00 0.00 ? 111 PRO A N    3  
ATOM 1786  C CA   . PRO A 1 6  ? -0.849  -5.137  3.988   1.00 0.00 ? 111 PRO A CA   3  
ATOM 1787  C C    . PRO A 1 6  ? -0.507  -5.445  2.537   1.00 0.00 ? 111 PRO A C    3  
ATOM 1788  O O    . PRO A 1 6  ? -0.738  -4.629  1.646   1.00 0.00 ? 111 PRO A O    3  
ATOM 1789  C CB   . PRO A 1 6  ? 0.106   -4.097  4.568   1.00 0.00 ? 111 PRO A CB   3  
ATOM 1790  C CG   . PRO A 1 6  ? 1.160   -4.901  5.242   1.00 0.00 ? 111 PRO A CG   3  
ATOM 1791  C CD   . PRO A 1 6  ? 0.447   -6.088  5.815   1.00 0.00 ? 111 PRO A CD   3  
ATOM 1792  H HA   . PRO A 1 6  ? -1.854  -4.765  4.040   1.00 0.00 ? 111 PRO A HA   3  
ATOM 1793  H HB2  . PRO A 1 6  ? 0.505   -3.493  3.772   1.00 0.00 ? 111 PRO A HB2  3  
ATOM 1794  H HB3  . PRO A 1 6  ? -0.422  -3.472  5.271   1.00 0.00 ? 111 PRO A HB3  3  
ATOM 1795  H HG2  . PRO A 1 6  ? 1.900   -5.217  4.522   1.00 0.00 ? 111 PRO A HG2  3  
ATOM 1796  H HG3  . PRO A 1 6  ? 1.621   -4.323  6.029   1.00 0.00 ? 111 PRO A HG3  3  
ATOM 1797  H HD2  . PRO A 1 6  ? 1.103   -6.947  5.842   1.00 0.00 ? 111 PRO A HD2  3  
ATOM 1798  H HD3  . PRO A 1 6  ? 0.072   -5.865  6.802   1.00 0.00 ? 111 PRO A HD3  3  
ATOM 1799  N N    . ALA A 1 7  ? 0.035   -6.634  2.308   1.00 0.00 ? 112 ALA A N    3  
ATOM 1800  C CA   . ALA A 1 7  ? 0.407   -7.061  0.966   1.00 0.00 ? 112 ALA A CA   3  
ATOM 1801  C C    . ALA A 1 7  ? -0.721  -7.839  0.310   1.00 0.00 ? 112 ALA A C    3  
ATOM 1802  O O    . ALA A 1 7  ? -1.018  -7.654  -0.870  1.00 0.00 ? 112 ALA A O    3  
ATOM 1803  C CB   . ALA A 1 7  ? 1.666   -7.907  1.027   1.00 0.00 ? 112 ALA A CB   3  
ATOM 1804  H H    . ALA A 1 7  ? 0.190   -7.242  3.061   1.00 0.00 ? 112 ALA A H    3  
ATOM 1805  H HA   . ALA A 1 7  ? 0.618   -6.181  0.379   1.00 0.00 ? 112 ALA A HA   3  
ATOM 1806  H HB1  . ALA A 1 7  ? 1.398   -8.942  1.175   1.00 0.00 ? 112 ALA A HB1  3  
ATOM 1807  H HB2  . ALA A 1 7  ? 2.274   -7.573  1.854   1.00 0.00 ? 112 ALA A HB2  3  
ATOM 1808  H HB3  . ALA A 1 7  ? 2.217   -7.802  0.105   1.00 0.00 ? 112 ALA A HB3  3  
ATOM 1809  N N    . ARG A 1 8  ? -1.343  -8.712  1.089   1.00 0.00 ? 113 ARG A N    3  
ATOM 1810  C CA   . ARG A 1 8  ? -2.447  -9.528  0.597   1.00 0.00 ? 113 ARG A CA   3  
ATOM 1811  C C    . ARG A 1 8  ? -3.740  -8.722  0.528   1.00 0.00 ? 113 ARG A C    3  
ATOM 1812  O O    . ARG A 1 8  ? -4.415  -8.694  -0.505  1.00 0.00 ? 113 ARG A O    3  
ATOM 1813  C CB   . ARG A 1 8  ? -2.650  -10.743 1.500   1.00 0.00 ? 113 ARG A CB   3  
ATOM 1814  C CG   . ARG A 1 8  ? -3.267  -11.929 0.780   1.00 0.00 ? 113 ARG A CG   3  
ATOM 1815  C CD   . ARG A 1 8  ? -2.977  -13.231 1.502   1.00 0.00 ? 113 ARG A CD   3  
ATOM 1816  N NE   . ARG A 1 8  ? -3.459  -14.390 0.753   1.00 0.00 ? 113 ARG A NE   3  
ATOM 1817  C CZ   . ARG A 1 8  ? -3.668  -15.586 1.296   1.00 0.00 ? 113 ARG A CZ   3  
ATOM 1818  N NH1  . ARG A 1 8  ? -3.446  -15.782 2.589   1.00 0.00 ? 113 ARG A NH1  3  
ATOM 1819  N NH2  . ARG A 1 8  ? -4.102  -16.588 0.544   1.00 0.00 ? 113 ARG A NH2  3  
ATOM 1820  H H    . ARG A 1 8  ? -1.042  -8.816  2.017   1.00 0.00 ? 113 ARG A H    3  
ATOM 1821  H HA   . ARG A 1 8  ? -2.193  -9.872  -0.394  1.00 0.00 ? 113 ARG A HA   3  
ATOM 1822  H HB2  . ARG A 1 8  ? -1.696  -11.042 1.904   1.00 0.00 ? 113 ARG A HB2  3  
ATOM 1823  H HB3  . ARG A 1 8  ? -3.303  -10.465 2.314   1.00 0.00 ? 113 ARG A HB3  3  
ATOM 1824  H HG2  . ARG A 1 8  ? -4.337  -11.791 0.727   1.00 0.00 ? 113 ARG A HG2  3  
ATOM 1825  H HG3  . ARG A 1 8  ? -2.859  -11.983 -0.219  1.00 0.00 ? 113 ARG A HG3  3  
ATOM 1826  H HD2  . ARG A 1 8  ? -1.909  -13.319 1.635   1.00 0.00 ? 113 ARG A HD2  3  
ATOM 1827  H HD3  . ARG A 1 8  ? -3.461  -13.210 2.467   1.00 0.00 ? 113 ARG A HD3  3  
ATOM 1828  H HE   . ARG A 1 8  ? -3.634  -14.270 -0.203  1.00 0.00 ? 113 ARG A HE   3  
ATOM 1829  H HH11 . ARG A 1 8  ? -3.120  -15.028 3.160   1.00 0.00 ? 113 ARG A HH11 3  
ATOM 1830  H HH12 . ARG A 1 8  ? -3.606  -16.682 2.993   1.00 0.00 ? 113 ARG A HH12 3  
ATOM 1831  H HH21 . ARG A 1 8  ? -4.272  -16.445 -0.431  1.00 0.00 ? 113 ARG A HH21 3  
ATOM 1832  H HH22 . ARG A 1 8  ? -4.260  -17.488 0.952   1.00 0.00 ? 113 ARG A HH22 3  
ATOM 1833  N N    . TYR A 1 9  ? -4.078  -8.070  1.637   1.00 0.00 ? 114 TYR A N    3  
ATOM 1834  C CA   . TYR A 1 9  ? -5.297  -7.271  1.713   1.00 0.00 ? 114 TYR A CA   3  
ATOM 1835  C C    . TYR A 1 9  ? -5.379  -6.281  0.555   1.00 0.00 ? 114 TYR A C    3  
ATOM 1836  O O    . TYR A 1 9  ? -6.467  -6.022  0.035   1.00 0.00 ? 114 TYR A O    3  
ATOM 1837  C CB   . TYR A 1 9  ? -5.406  -6.565  3.090   1.00 0.00 ? 114 TYR A CB   3  
ATOM 1838  C CG   . TYR A 1 9  ? -5.267  -5.044  3.086   1.00 0.00 ? 114 TYR A CG   3  
ATOM 1839  C CD1  . TYR A 1 9  ? -6.160  -4.236  2.387   1.00 0.00 ? 114 TYR A CD1  3  
ATOM 1840  C CD2  . TYR A 1 9  ? -4.248  -4.420  3.799   1.00 0.00 ? 114 TYR A CD2  3  
ATOM 1841  C CE1  . TYR A 1 9  ? -6.038  -2.861  2.391   1.00 0.00 ? 114 TYR A CE1  3  
ATOM 1842  C CE2  . TYR A 1 9  ? -4.119  -3.041  3.811   1.00 0.00 ? 114 TYR A CE2  3  
ATOM 1843  C CZ   . TYR A 1 9  ? -5.016  -2.268  3.104   1.00 0.00 ? 114 TYR A CZ   3  
ATOM 1844  O OH   . TYR A 1 9  ? -4.892  -0.898  3.109   1.00 0.00 ? 114 TYR A OH   3  
ATOM 1845  H H    . TYR A 1 9  ? -3.496  -8.131  2.423   1.00 0.00 ? 114 TYR A H    3  
ATOM 1846  H HA   . TYR A 1 9  ? -6.127  -7.955  1.620   1.00 0.00 ? 114 TYR A HA   3  
ATOM 1847  H HB2  . TYR A 1 9  ? -6.368  -6.796  3.519   1.00 0.00 ? 114 TYR A HB2  3  
ATOM 1848  H HB3  . TYR A 1 9  ? -4.636  -6.961  3.738   1.00 0.00 ? 114 TYR A HB3  3  
ATOM 1849  H HD1  . TYR A 1 9  ? -6.959  -4.700  1.827   1.00 0.00 ? 114 TYR A HD1  3  
ATOM 1850  H HD2  . TYR A 1 9  ? -3.549  -5.027  4.356   1.00 0.00 ? 114 TYR A HD2  3  
ATOM 1851  H HE1  . TYR A 1 9  ? -6.743  -2.258  1.835   1.00 0.00 ? 114 TYR A HE1  3  
ATOM 1852  H HE2  . TYR A 1 9  ? -3.314  -2.576  4.371   1.00 0.00 ? 114 TYR A HE2  3  
ATOM 1853  H HH   . TYR A 1 9  ? -3.975  -0.659  2.950   1.00 0.00 ? 114 TYR A HH   3  
ATOM 1854  N N    . CYS A 1 10 ? -4.240  -5.733  0.139   1.00 0.00 ? 115 CYS A N    3  
ATOM 1855  C CA   . CYS A 1 10 ? -4.241  -4.766  -0.951  1.00 0.00 ? 115 CYS A CA   3  
ATOM 1856  C C    . CYS A 1 10 ? -4.347  -5.439  -2.311  1.00 0.00 ? 115 CYS A C    3  
ATOM 1857  O O    . CYS A 1 10 ? -4.905  -4.869  -3.247  1.00 0.00 ? 115 CYS A O    3  
ATOM 1858  C CB   . CYS A 1 10 ? -3.011  -3.859  -0.909  1.00 0.00 ? 115 CYS A CB   3  
ATOM 1859  S SG   . CYS A 1 10 ? -2.898  -2.860  0.600   1.00 0.00 ? 115 CYS A SG   3  
ATOM 1860  H H    . CYS A 1 10 ? -3.396  -5.981  0.568   1.00 0.00 ? 115 CYS A H    3  
ATOM 1861  H HA   . CYS A 1 10 ? -5.116  -4.150  -0.820  1.00 0.00 ? 115 CYS A HA   3  
ATOM 1862  H HB2  . CYS A 1 10 ? -2.101  -4.445  -0.990  1.00 0.00 ? 115 CYS A HB2  3  
ATOM 1863  H HB3  . CYS A 1 10 ? -3.061  -3.176  -1.743  1.00 0.00 ? 115 CYS A HB3  3  
ATOM 1864  N N    . CYS A 1 11 ? -3.816  -6.648  -2.427  1.00 0.00 ? 116 CYS A N    3  
ATOM 1865  C CA   . CYS A 1 11 ? -3.881  -7.366  -3.689  1.00 0.00 ? 116 CYS A CA   3  
ATOM 1866  C C    . CYS A 1 11 ? -5.329  -7.513  -4.130  1.00 0.00 ? 116 CYS A C    3  
ATOM 1867  O O    . CYS A 1 11 ? -5.664  -7.288  -5.293  1.00 0.00 ? 116 CYS A O    3  
ATOM 1868  C CB   . CYS A 1 11 ? -3.228  -8.746  -3.565  1.00 0.00 ? 116 CYS A CB   3  
ATOM 1869  S SG   . CYS A 1 11 ? -3.313  -9.752  -5.084  1.00 0.00 ? 116 CYS A SG   3  
ATOM 1870  H H    . CYS A 1 11 ? -3.377  -7.061  -1.654  1.00 0.00 ? 116 CYS A H    3  
ATOM 1871  H HA   . CYS A 1 11 ? -3.347  -6.779  -4.428  1.00 0.00 ? 116 CYS A HA   3  
ATOM 1872  H HB2  . CYS A 1 11 ? -2.189  -8.624  -3.309  1.00 0.00 ? 116 CYS A HB2  3  
ATOM 1873  H HB3  . CYS A 1 11 ? -3.718  -9.296  -2.779  1.00 0.00 ? 116 CYS A HB3  3  
ATOM 1874  N N    . LEU A 1 12 ? -6.185  -7.896  -3.187  1.00 0.00 ? 117 LEU A N    3  
ATOM 1875  C CA   . LEU A 1 12 ? -7.600  -8.065  -3.460  1.00 0.00 ? 117 LEU A CA   3  
ATOM 1876  C C    . LEU A 1 12 ? -8.334  -6.726  -3.435  1.00 0.00 ? 117 LEU A C    3  
ATOM 1877  O O    . LEU A 1 12 ? -9.228  -6.482  -4.246  1.00 0.00 ? 117 LEU A O    3  
ATOM 1878  C CB   . LEU A 1 12 ? -8.210  -9.017  -2.436  1.00 0.00 ? 117 LEU A CB   3  
ATOM 1879  C CG   . LEU A 1 12 ? -8.033  -10.507 -2.739  1.00 0.00 ? 117 LEU A CG   3  
ATOM 1880  C CD1  . LEU A 1 12 ? -8.581  -11.350 -1.598  1.00 0.00 ? 117 LEU A CD1  3  
ATOM 1881  C CD2  . LEU A 1 12 ? -8.717  -10.874 -4.048  1.00 0.00 ? 117 LEU A CD2  3  
ATOM 1882  H H    . LEU A 1 12 ? -5.855  -8.074  -2.280  1.00 0.00 ? 117 LEU A H    3  
ATOM 1883  H HA   . LEU A 1 12 ? -7.701  -8.499  -4.439  1.00 0.00 ? 117 LEU A HA   3  
ATOM 1884  H HB2  . LEU A 1 12 ? -7.755  -8.810  -1.484  1.00 0.00 ? 117 LEU A HB2  3  
ATOM 1885  H HB3  . LEU A 1 12 ? -9.260  -8.807  -2.365  1.00 0.00 ? 117 LEU A HB3  3  
ATOM 1886  H HG   . LEU A 1 12 ? -6.979  -10.725 -2.838  1.00 0.00 ? 117 LEU A HG   3  
ATOM 1887  H HD11 . LEU A 1 12 ? -9.640  -11.169 -1.493  1.00 0.00 ? 117 LEU A HD11 3  
ATOM 1888  H HD12 . LEU A 1 12 ? -8.077  -11.084 -0.680  1.00 0.00 ? 117 LEU A HD12 3  
ATOM 1889  H HD13 . LEU A 1 12 ? -8.413  -12.396 -1.810  1.00 0.00 ? 117 LEU A HD13 3  
ATOM 1890  H HD21 . LEU A 1 12 ? -8.638  -11.938 -4.210  1.00 0.00 ? 117 LEU A HD21 3  
ATOM 1891  H HD22 . LEU A 1 12 ? -8.241  -10.348 -4.863  1.00 0.00 ? 117 LEU A HD22 3  
ATOM 1892  H HD23 . LEU A 1 12 ? -9.760  -10.595 -3.999  1.00 0.00 ? 117 LEU A HD23 3  
ATOM 1893  N N    . SER A 1 13 ? -7.950  -5.862  -2.498  1.00 0.00 ? 118 SER A N    3  
ATOM 1894  C CA   . SER A 1 13 ? -8.575  -4.549  -2.363  1.00 0.00 ? 118 SER A CA   3  
ATOM 1895  C C    . SER A 1 13 ? -7.651  -3.440  -2.857  1.00 0.00 ? 118 SER A C    3  
ATOM 1896  O O    . SER A 1 13 ? -7.872  -2.853  -3.916  1.00 0.00 ? 118 SER A O    3  
ATOM 1897  C CB   . SER A 1 13 ? -8.952  -4.286  -0.903  1.00 0.00 ? 118 SER A CB   3  
ATOM 1898  O OG   . SER A 1 13 ? -9.784  -3.146  -0.790  1.00 0.00 ? 118 SER A OG   3  
ATOM 1899  H H    . SER A 1 13 ? -7.230  -6.113  -1.883  1.00 0.00 ? 118 SER A H    3  
ATOM 1900  H HA   . SER A 1 13 ? -9.474  -4.546  -2.963  1.00 0.00 ? 118 SER A HA   3  
ATOM 1901  H HB2  . SER A 1 13 ? -9.476  -5.140  -0.506  1.00 0.00 ? 118 SER A HB2  3  
ATOM 1902  H HB3  . SER A 1 13 ? -8.054  -4.120  -0.328  1.00 0.00 ? 118 SER A HB3  3  
ATOM 1903  H HG   . SER A 1 13 ? -10.447 -3.299  -0.114  1.00 0.00 ? 118 SER A HG   3  
ATOM 1904  N N    . GLY A 1 14 ? -6.613  -3.161  -2.074  1.00 0.00 ? 119 GLY A N    3  
ATOM 1905  C CA   . GLY A 1 14 ? -5.664  -2.119  -2.418  1.00 0.00 ? 119 GLY A CA   3  
ATOM 1906  C C    . GLY A 1 14 ? -5.445  -1.163  -1.258  1.00 0.00 ? 119 GLY A C    3  
ATOM 1907  O O    . GLY A 1 14 ? -6.297  -1.065  -0.375  1.00 0.00 ? 119 GLY A O    3  
ATOM 1908  H H    . GLY A 1 14 ? -6.488  -3.675  -1.249  1.00 0.00 ? 119 GLY A H    3  
ATOM 1909  H HA2  . GLY A 1 14 ? -4.722  -2.579  -2.673  1.00 0.00 ? 119 GLY A HA2  3  
ATOM 1910  H HA3  . GLY A 1 14 ? -6.036  -1.569  -3.276  1.00 0.00 ? 119 GLY A HA3  3  
ATOM 1911  N N    . CYS A 1 15 ? -4.306  -0.471  -1.233  1.00 0.00 ? 120 CYS A N    3  
ATOM 1912  C CA   . CYS A 1 15 ? -4.024  0.463   -0.141  1.00 0.00 ? 120 CYS A CA   3  
ATOM 1913  C C    . CYS A 1 15 ? -3.989  1.901   -0.612  1.00 0.00 ? 120 CYS A C    3  
ATOM 1914  O O    . CYS A 1 15 ? -3.812  2.190   -1.795  1.00 0.00 ? 120 CYS A O    3  
ATOM 1915  C CB   . CYS A 1 15 ? -2.694  0.163   0.564   1.00 0.00 ? 120 CYS A CB   3  
ATOM 1916  S SG   . CYS A 1 15 ? -1.797  -1.301  -0.018  1.00 0.00 ? 120 CYS A SG   3  
ATOM 1917  H H    . CYS A 1 15 ? -3.653  -0.583  -1.956  1.00 0.00 ? 120 CYS A H    3  
ATOM 1918  H HA   . CYS A 1 15 ? -4.818  0.372   0.575   1.00 0.00 ? 120 CYS A HA   3  
ATOM 1919  H HB2  . CYS A 1 15 ? -2.035  1.005   0.419   1.00 0.00 ? 120 CYS A HB2  3  
ATOM 1920  H HB3  . CYS A 1 15 ? -2.877  0.039   1.620   1.00 0.00 ? 120 CYS A HB3  3  
ATOM 1921  N N    . THR A 1 16 ? -4.162  2.798   0.348   1.00 0.00 ? 121 THR A N    3  
ATOM 1922  C CA   . THR A 1 16 ? -4.118  4.221   0.089   1.00 0.00 ? 121 THR A CA   3  
ATOM 1923  C C    . THR A 1 16 ? -2.737  4.738   0.387   1.00 0.00 ? 121 THR A C    3  
ATOM 1924  O O    . THR A 1 16 ? -2.013  4.156   1.192   1.00 0.00 ? 121 THR A O    3  
ATOM 1925  C CB   . THR A 1 16 ? -5.105  5.002   0.970   1.00 0.00 ? 121 THR A CB   3  
ATOM 1926  O OG1  . THR A 1 16 ? -4.733  4.893   2.349   1.00 0.00 ? 121 THR A OG1  3  
ATOM 1927  C CG2  . THR A 1 16 ? -6.504  4.484   0.780   1.00 0.00 ? 121 THR A CG2  3  
ATOM 1928  H H    . THR A 1 16 ? -4.324  2.488   1.263   1.00 0.00 ? 121 THR A H    3  
ATOM 1929  H HA   . THR A 1 16 ? -4.357  4.395   -0.949  1.00 0.00 ? 121 THR A HA   3  
ATOM 1930  H HB   . THR A 1 16 ? -5.080  6.040   0.674   1.00 0.00 ? 121 THR A HB   3  
ATOM 1931  H HG1  . THR A 1 16 ? -5.334  4.294   2.796   1.00 0.00 ? 121 THR A HG1  3  
ATOM 1932  H HG21 . THR A 1 16 ? -6.643  4.269   -0.260  1.00 0.00 ? 121 THR A HG21 3  
ATOM 1933  H HG22 . THR A 1 16 ? -7.216  5.233   1.097   1.00 0.00 ? 121 THR A HG22 3  
ATOM 1934  H HG23 . THR A 1 16 ? -6.641  3.583   1.358   1.00 0.00 ? 121 THR A HG23 3  
ATOM 1935  N N    . GLN A 1 17 ? -2.378  5.838   -0.242  1.00 0.00 ? 122 GLN A N    3  
ATOM 1936  C CA   . GLN A 1 17 ? -1.079  6.434   -0.002  1.00 0.00 ? 122 GLN A CA   3  
ATOM 1937  C C    . GLN A 1 17 ? -0.963  6.806   1.463   1.00 0.00 ? 122 GLN A C    3  
ATOM 1938  O O    . GLN A 1 17 ? 0.062   7.301   1.905   1.00 0.00 ? 122 GLN A O    3  
ATOM 1939  C CB   . GLN A 1 17 ? -0.871  7.651   -0.898  1.00 0.00 ? 122 GLN A CB   3  
ATOM 1940  C CG   . GLN A 1 17 ? -0.174  7.312   -2.203  1.00 0.00 ? 122 GLN A CG   3  
ATOM 1941  C CD   . GLN A 1 17 ? -0.226  8.446   -3.207  1.00 0.00 ? 122 GLN A CD   3  
ATOM 1942  O OE1  . GLN A 1 17 ? -1.153  8.536   -4.011  1.00 0.00 ? 122 GLN A OE1  3  
ATOM 1943  N NE2  . GLN A 1 17 ? 0.773   9.319   -3.166  1.00 0.00 ? 122 GLN A NE2  3  
ATOM 1944  H H    . GLN A 1 17 ? -3.002  6.262   -0.868  1.00 0.00 ? 122 GLN A H    3  
ATOM 1945  H HA   . GLN A 1 17 ? -0.312  5.687   -0.221  1.00 0.00 ? 122 GLN A HA   3  
ATOM 1946  H HB2  . GLN A 1 17 ? -1.834  8.084   -1.128  1.00 0.00 ? 122 GLN A HB2  3  
ATOM 1947  H HB3  . GLN A 1 17 ? -0.277  8.375   -0.370  1.00 0.00 ? 122 GLN A HB3  3  
ATOM 1948  H HG2  . GLN A 1 17 ? 0.860   7.082   -1.993  1.00 0.00 ? 122 GLN A HG2  3  
ATOM 1949  H HG3  . GLN A 1 17 ? -0.647  6.443   -2.631  1.00 0.00 ? 122 GLN A HG3  3  
ATOM 1950  H HE21 . GLN A 1 17 ? 1.478   9.184   -2.498  1.00 0.00 ? 122 GLN A HE21 3  
ATOM 1951  H HE22 . GLN A 1 17 ? 0.765   10.062  -3.803  1.00 0.00 ? 122 GLN A HE22 3  
ATOM 1952  N N    . GLN A 1 18 ? -2.041  6.596   2.211   1.00 0.00 ? 123 GLN A N    3  
ATOM 1953  C CA   . GLN A 1 18 ? -2.021  6.833   3.628   1.00 0.00 ? 123 GLN A CA   3  
ATOM 1954  C C    . GLN A 1 18 ? -1.544  5.563   4.299   1.00 0.00 ? 123 GLN A C    3  
ATOM 1955  O O    . GLN A 1 18 ? -0.550  5.570   5.019   1.00 0.00 ? 123 GLN A O    3  
ATOM 1956  C CB   . GLN A 1 18 ? -3.401  7.209   4.133   1.00 0.00 ? 123 GLN A CB   3  
ATOM 1957  C CG   . GLN A 1 18 ? -3.926  8.521   3.574   1.00 0.00 ? 123 GLN A CG   3  
ATOM 1958  C CD   . GLN A 1 18 ? -5.329  8.836   4.053   1.00 0.00 ? 123 GLN A CD   3  
ATOM 1959  O OE1  . GLN A 1 18 ? -5.517  9.510   5.066   1.00 0.00 ? 123 GLN A OE1  3  
ATOM 1960  N NE2  . GLN A 1 18 ? -6.326  8.340   3.327   1.00 0.00 ? 123 GLN A NE2  3  
ATOM 1961  H H    . GLN A 1 18 ? -2.873  6.289   1.795   1.00 0.00 ? 123 GLN A H    3  
ATOM 1962  H HA   . GLN A 1 18 ? -1.324  7.628   3.834   1.00 0.00 ? 123 GLN A HA   3  
ATOM 1963  H HB2  . GLN A 1 18 ? -4.090  6.429   3.864   1.00 0.00 ? 123 GLN A HB2  3  
ATOM 1964  H HB3  . GLN A 1 18 ? -3.360  7.285   5.201   1.00 0.00 ? 123 GLN A HB3  3  
ATOM 1965  H HG2  . GLN A 1 18 ? -3.269  9.320   3.886   1.00 0.00 ? 123 GLN A HG2  3  
ATOM 1966  H HG3  . GLN A 1 18 ? -3.933  8.463   2.496   1.00 0.00 ? 123 GLN A HG3  3  
ATOM 1967  H HE21 . GLN A 1 18 ? -6.100  7.804   2.536   1.00 0.00 ? 123 GLN A HE21 3  
ATOM 1968  H HE22 . GLN A 1 18 ? -7.245  8.529   3.611   1.00 0.00 ? 123 GLN A HE22 3  
ATOM 1969  N N    . ASP A 1 19 ? -2.250  4.460   4.029   1.00 0.00 ? 124 ASP A N    3  
ATOM 1970  C CA   . ASP A 1 19 ? -1.867  3.169   4.583   1.00 0.00 ? 124 ASP A CA   3  
ATOM 1971  C C    . ASP A 1 19 ? -0.408  2.913   4.248   1.00 0.00 ? 124 ASP A C    3  
ATOM 1972  O O    . ASP A 1 19 ? 0.418   2.673   5.131   1.00 0.00 ? 124 ASP A O    3  
ATOM 1973  C CB   . ASP A 1 19 ? -2.737  2.043   4.008   1.00 0.00 ? 124 ASP A CB   3  
ATOM 1974  C CG   . ASP A 1 19 ? -2.667  0.776   4.838   1.00 0.00 ? 124 ASP A CG   3  
ATOM 1975  O OD1  . ASP A 1 19 ? -3.124  0.803   5.999   1.00 0.00 ? 124 ASP A OD1  3  
ATOM 1976  O OD2  . ASP A 1 19 ? -2.157  -0.241  4.326   1.00 0.00 ? 124 ASP A OD2  3  
ATOM 1977  H H    . ASP A 1 19 ? -3.037  4.521   3.443   1.00 0.00 ? 124 ASP A H    3  
ATOM 1978  H HA   . ASP A 1 19 ? -1.988  3.210   5.657   1.00 0.00 ? 124 ASP A HA   3  
ATOM 1979  H HB2  . ASP A 1 19 ? -3.765  2.364   3.964   1.00 0.00 ? 124 ASP A HB2  3  
ATOM 1980  H HB3  . ASP A 1 19 ? -2.396  1.813   3.010   1.00 0.00 ? 124 ASP A HB3  3  
ATOM 1981  N N    . LEU A 1 20 ? -0.095  2.996   2.959   1.00 0.00 ? 125 LEU A N    3  
ATOM 1982  C CA   . LEU A 1 20 ? 1.261   2.788   2.483   1.00 0.00 ? 125 LEU A CA   3  
ATOM 1983  C C    . LEU A 1 20 ? 2.223   3.760   3.175   1.00 0.00 ? 125 LEU A C    3  
ATOM 1984  O O    . LEU A 1 20 ? 3.369   3.407   3.470   1.00 0.00 ? 125 LEU A O    3  
ATOM 1985  C CB   . LEU A 1 20 ? 1.315   2.913   0.950   1.00 0.00 ? 125 LEU A CB   3  
ATOM 1986  C CG   . LEU A 1 20 ? 0.482   1.887   0.194   1.00 0.00 ? 125 LEU A CG   3  
ATOM 1987  C CD1  . LEU A 1 20 ? -0.483  2.583   -0.743  1.00 0.00 ? 125 LEU A CD1  3  
ATOM 1988  C CD2  . LEU A 1 20 ? 1.381   0.980   -0.602  1.00 0.00 ? 125 LEU A CD2  3  
ATOM 1989  H H    . LEU A 1 20 ? -0.800  3.200   2.310   1.00 0.00 ? 125 LEU A H    3  
ATOM 1990  H HA   . LEU A 1 20 ? 1.545   1.783   2.757   1.00 0.00 ? 125 LEU A HA   3  
ATOM 1991  H HB2  . LEU A 1 20 ? 0.974   3.884   0.654   1.00 0.00 ? 125 LEU A HB2  3  
ATOM 1992  H HB3  . LEU A 1 20 ? 2.330   2.812   0.636   1.00 0.00 ? 125 LEU A HB3  3  
ATOM 1993  H HG   . LEU A 1 20 ? -0.083  1.287   0.891   1.00 0.00 ? 125 LEU A HG   3  
ATOM 1994  H HD11 . LEU A 1 20 ? -1.394  2.009   -0.818  1.00 0.00 ? 125 LEU A HD11 3  
ATOM 1995  H HD12 . LEU A 1 20 ? -0.026  2.660   -1.714  1.00 0.00 ? 125 LEU A HD12 3  
ATOM 1996  H HD13 . LEU A 1 20 ? -0.704  3.570   -0.369  1.00 0.00 ? 125 LEU A HD13 3  
ATOM 1997  H HD21 . LEU A 1 20 ? 2.269   0.755   -0.028  1.00 0.00 ? 125 LEU A HD21 3  
ATOM 1998  H HD22 . LEU A 1 20 ? 1.657   1.486   -1.521  1.00 0.00 ? 125 LEU A HD22 3  
ATOM 1999  H HD23 . LEU A 1 20 ? 0.859   0.066   -0.832  1.00 0.00 ? 125 LEU A HD23 3  
ATOM 2000  N N    . LEU A 1 21 ? 1.748   4.981   3.454   1.00 0.00 ? 126 LEU A N    3  
ATOM 2001  C CA   . LEU A 1 21 ? 2.566   5.972   4.146   1.00 0.00 ? 126 LEU A CA   3  
ATOM 2002  C C    . LEU A 1 21 ? 2.895   5.491   5.553   1.00 0.00 ? 126 LEU A C    3  
ATOM 2003  O O    . LEU A 1 21 ? 3.901   5.893   6.138   1.00 0.00 ? 126 LEU A O    3  
ATOM 2004  C CB   . LEU A 1 21 ? 1.836   7.317   4.223   1.00 0.00 ? 126 LEU A CB   3  
ATOM 2005  C CG   . LEU A 1 21 ? 2.285   8.364   3.202   1.00 0.00 ? 126 LEU A CG   3  
ATOM 2006  C CD1  . LEU A 1 21 ? 1.469   9.639   3.352   1.00 0.00 ? 126 LEU A CD1  3  
ATOM 2007  C CD2  . LEU A 1 21 ? 3.770   8.660   3.346   1.00 0.00 ? 126 LEU A CD2  3  
ATOM 2008  H H    . LEU A 1 21 ? 0.837   5.224   3.179   1.00 0.00 ? 126 LEU A H    3  
ATOM 2009  H HA   . LEU A 1 21 ? 3.484   6.096   3.591   1.00 0.00 ? 126 LEU A HA   3  
ATOM 2010  H HB2  . LEU A 1 21 ? 0.781   7.136   4.077   1.00 0.00 ? 126 LEU A HB2  3  
ATOM 2011  H HB3  . LEU A 1 21 ? 1.976   7.726   5.209   1.00 0.00 ? 126 LEU A HB3  3  
ATOM 2012  H HG   . LEU A 1 21 ? 2.111   7.972   2.209   1.00 0.00 ? 126 LEU A HG   3  
ATOM 2013  H HD11 . LEU A 1 21 ? 0.431   9.428   3.139   1.00 0.00 ? 126 LEU A HD11 3  
ATOM 2014  H HD12 . LEU A 1 21 ? 1.836   10.383  2.661   1.00 0.00 ? 126 LEU A HD12 3  
ATOM 2015  H HD13 . LEU A 1 21 ? 1.561   10.008  4.363   1.00 0.00 ? 126 LEU A HD13 3  
ATOM 2016  H HD21 . LEU A 1 21 ? 4.336   7.754   3.186   1.00 0.00 ? 126 LEU A HD21 3  
ATOM 2017  H HD22 . LEU A 1 21 ? 3.968   9.037   4.338   1.00 0.00 ? 126 LEU A HD22 3  
ATOM 2018  H HD23 . LEU A 1 21 ? 4.062   9.399   2.615   1.00 0.00 ? 126 LEU A HD23 3  
ATOM 2019  N N    . THR A 1 22 ? 2.036   4.630   6.090   1.00 0.00 ? 127 THR A N    3  
ATOM 2020  C CA   . THR A 1 22 ? 2.230   4.093   7.430   1.00 0.00 ? 127 THR A CA   3  
ATOM 2021  C C    . THR A 1 22 ? 2.896   2.719   7.391   1.00 0.00 ? 127 THR A C    3  
ATOM 2022  O O    . THR A 1 22 ? 3.250   2.171   8.434   1.00 0.00 ? 127 THR A O    3  
ATOM 2023  C CB   . THR A 1 22 ? 0.900   3.965   8.203   1.00 0.00 ? 127 THR A CB   3  
ATOM 2024  O OG1  . THR A 1 22 ? 0.322   2.674   7.966   1.00 0.00 ? 127 THR A OG1  3  
ATOM 2025  C CG2  . THR A 1 22 ? -0.095  5.040   7.794   1.00 0.00 ? 127 THR A CG2  3  
ATOM 2026  H H    . THR A 1 22 ? 1.251   4.354   5.575   1.00 0.00 ? 127 THR A H    3  
ATOM 2027  H HA   . THR A 1 22 ? 2.870   4.776   7.971   1.00 0.00 ? 127 THR A HA   3  
ATOM 2028  H HB   . THR A 1 22 ? 1.104   4.071   9.258   1.00 0.00 ? 127 THR A HB   3  
ATOM 2029  H HG1  . THR A 1 22 ? -0.438  2.554   8.541   1.00 0.00 ? 127 THR A HG1  3  
ATOM 2030  H HG21 . THR A 1 22 ? 0.428   5.962   7.594   1.00 0.00 ? 127 THR A HG21 3  
ATOM 2031  H HG22 . THR A 1 22 ? -0.803  5.196   8.594   1.00 0.00 ? 127 THR A HG22 3  
ATOM 2032  H HG23 . THR A 1 22 ? -0.621  4.723   6.907   1.00 0.00 ? 127 THR A HG23 3  
ATOM 2033  N N    . LEU A 1 23 ? 3.069   2.161   6.192   1.00 0.00 ? 128 LEU A N    3  
ATOM 2034  C CA   . LEU A 1 23 ? 3.683   0.852   6.058   1.00 0.00 ? 128 LEU A CA   3  
ATOM 2035  C C    . LEU A 1 23 ? 5.188   0.985   5.865   1.00 0.00 ? 128 LEU A C    3  
ATOM 2036  O O    . LEU A 1 23 ? 5.943   0.049   6.124   1.00 0.00 ? 128 LEU A O    3  
ATOM 2037  C CB   . LEU A 1 23 ? 3.039   0.096   4.903   1.00 0.00 ? 128 LEU A CB   3  
ATOM 2038  C CG   . LEU A 1 23 ? 1.532   -0.093  5.046   1.00 0.00 ? 128 LEU A CG   3  
ATOM 2039  C CD1  . LEU A 1 23 ? 0.909   -0.477  3.720   1.00 0.00 ? 128 LEU A CD1  3  
ATOM 2040  C CD2  . LEU A 1 23 ? 1.244   -1.146  6.090   1.00 0.00 ? 128 LEU A CD2  3  
ATOM 2041  H H    . LEU A 1 23 ? 2.791   2.638   5.379   1.00 0.00 ? 128 LEU A H    3  
ATOM 2042  H HA   . LEU A 1 23 ? 3.498   0.306   6.973   1.00 0.00 ? 128 LEU A HA   3  
ATOM 2043  H HB2  . LEU A 1 23 ? 3.230   0.628   3.991   1.00 0.00 ? 128 LEU A HB2  3  
ATOM 2044  H HB3  . LEU A 1 23 ? 3.495   -0.875  4.836   1.00 0.00 ? 128 LEU A HB3  3  
ATOM 2045  H HG   . LEU A 1 23 ? 1.087   0.830   5.371   1.00 0.00 ? 128 LEU A HG   3  
ATOM 2046  H HD11 . LEU A 1 23 ? 0.886   -1.553  3.632   1.00 0.00 ? 128 LEU A HD11 3  
ATOM 2047  H HD12 . LEU A 1 23 ? 1.498   -0.062  2.914   1.00 0.00 ? 128 LEU A HD12 3  
ATOM 2048  H HD13 . LEU A 1 23 ? -0.097  -0.090  3.667   1.00 0.00 ? 128 LEU A HD13 3  
ATOM 2049  H HD21 . LEU A 1 23 ? 1.387   -0.728  7.076   1.00 0.00 ? 128 LEU A HD21 3  
ATOM 2050  H HD22 . LEU A 1 23 ? 1.922   -1.966  5.946   1.00 0.00 ? 128 LEU A HD22 3  
ATOM 2051  H HD23 . LEU A 1 23 ? 0.227   -1.493  5.986   1.00 0.00 ? 128 LEU A HD23 3  
ATOM 2052  N N    . CYS A 1 24 ? 5.620   2.160   5.406   1.00 0.00 ? 129 CYS A N    3  
ATOM 2053  C CA   . CYS A 1 24 ? 7.043   2.417   5.206   1.00 0.00 ? 129 CYS A CA   3  
ATOM 2054  C C    . CYS A 1 24 ? 7.765   2.511   6.552   1.00 0.00 ? 129 CYS A C    3  
ATOM 2055  O O    . CYS A 1 24 ? 7.151   2.842   7.568   1.00 0.00 ? 129 CYS A O    3  
ATOM 2056  C CB   . CYS A 1 24 ? 7.258   3.710   4.414   1.00 0.00 ? 129 CYS A CB   3  
ATOM 2057  S SG   . CYS A 1 24 ? 6.681   5.218   5.261   1.00 0.00 ? 129 CYS A SG   3  
ATOM 2058  H H    . CYS A 1 24 ? 4.967   2.860   5.182   1.00 0.00 ? 129 CYS A H    3  
ATOM 2059  H HA   . CYS A 1 24 ? 7.453   1.588   4.649   1.00 0.00 ? 129 CYS A HA   3  
ATOM 2060  H HB2  . CYS A 1 24 ? 8.314   3.829   4.219   1.00 0.00 ? 129 CYS A HB2  3  
ATOM 2061  H HB3  . CYS A 1 24 ? 6.734   3.633   3.476   1.00 0.00 ? 129 CYS A HB3  3  
ATOM 2062  N N    . PRO A 1 25 ? 9.077   2.217   6.576   1.00 0.00 ? 130 PRO A N    3  
ATOM 2063  C CA   . PRO A 1 25 ? 9.884   2.260   7.793   1.00 0.00 ? 130 PRO A CA   3  
ATOM 2064  C C    . PRO A 1 25 ? 10.350  3.673   8.127   1.00 0.00 ? 130 PRO A C    3  
ATOM 2065  O O    . PRO A 1 25 ? 11.135  3.873   9.056   1.00 0.00 ? 130 PRO A O    3  
ATOM 2066  C CB   . PRO A 1 25 ? 11.089  1.361   7.463   1.00 0.00 ? 130 PRO A CB   3  
ATOM 2067  C CG   . PRO A 1 25 ? 10.881  0.881   6.056   1.00 0.00 ? 130 PRO A CG   3  
ATOM 2068  C CD   . PRO A 1 25 ? 9.889   1.817   5.428   1.00 0.00 ? 130 PRO A CD   3  
ATOM 2069  H HA   . PRO A 1 25 ? 9.347   1.850   8.636   1.00 0.00 ? 130 PRO A HA   3  
ATOM 2070  H HB2  . PRO A 1 25 ? 11.998  1.936   7.549   1.00 0.00 ? 130 PRO A HB2  3  
ATOM 2071  H HB3  . PRO A 1 25 ? 11.119  0.533   8.157   1.00 0.00 ? 130 PRO A HB3  3  
ATOM 2072  H HG2  . PRO A 1 25 ? 11.817  0.913   5.517   1.00 0.00 ? 130 PRO A HG2  3  
ATOM 2073  H HG3  . PRO A 1 25 ? 10.491  -0.126  6.067   1.00 0.00 ? 130 PRO A HG3  3  
ATOM 2074  H HD2  . PRO A 1 25 ? 10.392  2.667   4.992   1.00 0.00 ? 130 PRO A HD2  3  
ATOM 2075  H HD3  . PRO A 1 25 ? 9.289   1.305   4.689   1.00 0.00 ? 130 PRO A HD3  3  
ATOM 2076  N N    . TYR A 1 26 ? 9.865   4.649   7.364   1.00 0.00 ? 131 TYR A N    3  
ATOM 2077  C CA   . TYR A 1 26 ? 10.233  6.045   7.577   1.00 0.00 ? 131 TYR A CA   3  
ATOM 2078  C C    . TYR A 1 26 ? 9.006   6.948   7.506   1.00 0.00 ? 131 TYR A C    3  
ATOM 2079  O O    . TYR A 1 26 ? 8.390   7.194   8.564   1.00 0.00 ? 131 TYR A O    3  
ATOM 2080  C CB   . TYR A 1 26 ? 11.269  6.488   6.541   1.00 0.00 ? 131 TYR A CB   3  
ATOM 2081  C CG   . TYR A 1 26 ? 12.627  5.851   6.729   1.00 0.00 ? 131 TYR A CG   3  
ATOM 2082  C CD1  . TYR A 1 26 ? 13.546  6.386   7.623   1.00 0.00 ? 131 TYR A CD1  3  
ATOM 2083  C CD2  . TYR A 1 26 ? 12.990  4.716   6.014   1.00 0.00 ? 131 TYR A CD2  3  
ATOM 2084  C CE1  . TYR A 1 26 ? 14.789  5.808   7.799   1.00 0.00 ? 131 TYR A CE1  3  
ATOM 2085  C CE2  . TYR A 1 26 ? 14.232  4.132   6.185   1.00 0.00 ? 131 TYR A CE2  3  
ATOM 2086  C CZ   . TYR A 1 26 ? 15.126  4.682   7.079   1.00 0.00 ? 131 TYR A CZ   3  
ATOM 2087  O OH   . TYR A 1 26 ? 16.363  4.103   7.254   1.00 0.00 ? 131 TYR A OH   3  
ATOM 2088  O OXT  . TYR A 1 26 ? 8.671   7.403   6.391   1.00 0.00 ? 131 TYR A OXT  3  
ATOM 2089  H H    . TYR A 1 26 ? 9.244   4.423   6.641   1.00 0.00 ? 131 TYR A H    3  
ATOM 2090  H HA   . TYR A 1 26 ? 10.666  6.127   8.563   1.00 0.00 ? 131 TYR A HA   3  
ATOM 2091  H HB2  . TYR A 1 26 ? 10.915  6.228   5.554   1.00 0.00 ? 131 TYR A HB2  3  
ATOM 2092  H HB3  . TYR A 1 26 ? 11.392  7.560   6.604   1.00 0.00 ? 131 TYR A HB3  3  
ATOM 2093  H HD1  . TYR A 1 26 ? 13.280  7.268   8.185   1.00 0.00 ? 131 TYR A HD1  3  
ATOM 2094  H HD2  . TYR A 1 26 ? 12.287  4.289   5.314   1.00 0.00 ? 131 TYR A HD2  3  
ATOM 2095  H HE1  . TYR A 1 26 ? 15.490  6.240   8.499   1.00 0.00 ? 131 TYR A HE1  3  
ATOM 2096  H HE2  . TYR A 1 26 ? 14.496  3.251   5.620   1.00 0.00 ? 131 TYR A HE2  3  
ATOM 2097  H HH   . TYR A 1 26 ? 16.544  4.014   8.192   1.00 0.00 ? 131 TYR A HH   3  
ATOM 2098  N N    . PRO B 2 1  ? -5.587  18.210  -3.401  1.00 0.00 ? 25  PRO B N    3  
ATOM 2099  C CA   . PRO B 2 1  ? -5.771  17.711  -4.786  1.00 0.00 ? 25  PRO B CA   3  
ATOM 2100  C C    . PRO B 2 1  ? -5.945  16.196  -4.805  1.00 0.00 ? 25  PRO B C    3  
ATOM 2101  O O    . PRO B 2 1  ? -7.046  15.692  -5.027  1.00 0.00 ? 25  PRO B O    3  
ATOM 2102  C CB   . PRO B 2 1  ? -4.558  18.112  -5.616  1.00 0.00 ? 25  PRO B CB   3  
ATOM 2103  C CG   . PRO B 2 1  ? -3.737  18.930  -4.679  1.00 0.00 ? 25  PRO B CG   3  
ATOM 2104  C CD   . PRO B 2 1  ? -4.151  18.525  -3.281  1.00 0.00 ? 25  PRO B CD   3  
ATOM 2105  H H2   . PRO B 2 1  ? -5.960  17.468  -2.786  1.00 0.00 ? 25  PRO B H2   3  
ATOM 2106  H H3   . PRO B 2 1  ? -6.288  18.983  -3.301  1.00 0.00 ? 25  PRO B H3   3  
ATOM 2107  H HA   . PRO B 2 1  ? -6.654  18.174  -5.201  1.00 0.00 ? 25  PRO B HA   3  
ATOM 2108  H HB2  . PRO B 2 1  ? -4.031  17.226  -5.941  1.00 0.00 ? 25  PRO B HB2  3  
ATOM 2109  H HB3  . PRO B 2 1  ? -4.875  18.689  -6.471  1.00 0.00 ? 25  PRO B HB3  3  
ATOM 2110  H HG2  . PRO B 2 1  ? -2.689  18.720  -4.833  1.00 0.00 ? 25  PRO B HG2  3  
ATOM 2111  H HG3  . PRO B 2 1  ? -3.935  19.979  -4.838  1.00 0.00 ? 25  PRO B HG3  3  
ATOM 2112  H HD2  . PRO B 2 1  ? -3.595  17.654  -2.963  1.00 0.00 ? 25  PRO B HD2  3  
ATOM 2113  H HD3  . PRO B 2 1  ? -3.997  19.342  -2.592  1.00 0.00 ? 25  PRO B HD3  3  
ATOM 2114  N N    . THR B 2 2  ? -4.852  15.475  -4.572  1.00 0.00 ? 26  THR B N    3  
ATOM 2115  C CA   . THR B 2 2  ? -4.885  14.018  -4.563  1.00 0.00 ? 26  THR B CA   3  
ATOM 2116  C C    . THR B 2 2  ? -5.555  13.493  -3.292  1.00 0.00 ? 26  THR B C    3  
ATOM 2117  O O    . THR B 2 2  ? -5.171  13.869  -2.186  1.00 0.00 ? 26  THR B O    3  
ATOM 2118  C CB   . THR B 2 2  ? -3.469  13.421  -4.660  1.00 0.00 ? 26  THR B CB   3  
ATOM 2119  O OG1  . THR B 2 2  ? -2.656  13.909  -3.586  1.00 0.00 ? 26  THR B OG1  3  
ATOM 2120  C CG2  . THR B 2 2  ? -2.823  13.773  -5.992  1.00 0.00 ? 26  THR B CG2  3  
ATOM 2121  H H    . THR B 2 2  ? -4.002  15.934  -4.404  1.00 0.00 ? 26  THR B H    3  
ATOM 2122  H HA   . THR B 2 2  ? -5.450  13.694  -5.423  1.00 0.00 ? 26  THR B HA   3  
ATOM 2123  H HB   . THR B 2 2  ? -3.541  12.346  -4.585  1.00 0.00 ? 26  THR B HB   3  
ATOM 2124  H HG1  . THR B 2 2  ? -2.070  14.596  -3.914  1.00 0.00 ? 26  THR B HG1  3  
ATOM 2125  H HG21 . THR B 2 2  ? -1.831  13.344  -6.035  1.00 0.00 ? 26  THR B HG21 3  
ATOM 2126  H HG22 . THR B 2 2  ? -2.755  14.845  -6.087  1.00 0.00 ? 26  THR B HG22 3  
ATOM 2127  H HG23 . THR B 2 2  ? -3.421  13.375  -6.799  1.00 0.00 ? 26  THR B HG23 3  
ATOM 2128  N N    . PRO B 2 3  ? -6.569  12.615  -3.431  1.00 0.00 ? 27  PRO B N    3  
ATOM 2129  C CA   . PRO B 2 3  ? -7.284  12.042  -2.305  1.00 0.00 ? 27  PRO B CA   3  
ATOM 2130  C C    . PRO B 2 3  ? -6.761  10.658  -1.955  1.00 0.00 ? 27  PRO B C    3  
ATOM 2131  O O    . PRO B 2 3  ? -5.636  10.305  -2.309  1.00 0.00 ? 27  PRO B O    3  
ATOM 2132  C CB   . PRO B 2 3  ? -8.702  11.953  -2.858  1.00 0.00 ? 27  PRO B CB   3  
ATOM 2133  C CG   . PRO B 2 3  ? -8.529  11.689  -4.326  1.00 0.00 ? 27  PRO B CG   3  
ATOM 2134  C CD   . PRO B 2 3  ? -7.118  12.099  -4.695  1.00 0.00 ? 27  PRO B CD   3  
ATOM 2135  H HA   . PRO B 2 3  ? -7.261  12.682  -1.437  1.00 0.00 ? 27  PRO B HA   3  
ATOM 2136  H HB2  . PRO B 2 3  ? -9.231  11.148  -2.370  1.00 0.00 ? 27  PRO B HB2  3  
ATOM 2137  H HB3  . PRO B 2 3  ? -9.217  12.886  -2.685  1.00 0.00 ? 27  PRO B HB3  3  
ATOM 2138  H HG2  . PRO B 2 3  ? -8.673  10.637  -4.524  1.00 0.00 ? 27  PRO B HG2  3  
ATOM 2139  H HG3  . PRO B 2 3  ? -9.244  12.274  -4.886  1.00 0.00 ? 27  PRO B HG3  3  
ATOM 2140  H HD2  . PRO B 2 3  ? -6.553  11.240  -5.036  1.00 0.00 ? 27  PRO B HD2  3  
ATOM 2141  H HD3  . PRO B 2 3  ? -7.134  12.868  -5.451  1.00 0.00 ? 27  PRO B HD3  3  
ATOM 2142  N N    . GLU B 2 4  ? -7.576  9.878   -1.260  1.00 0.00 ? 28  GLU B N    3  
ATOM 2143  C CA   . GLU B 2 4  ? -7.186  8.528   -0.892  1.00 0.00 ? 28  GLU B CA   3  
ATOM 2144  C C    . GLU B 2 4  ? -7.457  7.580   -2.039  1.00 0.00 ? 28  GLU B C    3  
ATOM 2145  O O    . GLU B 2 4  ? -8.371  6.757   -1.998  1.00 0.00 ? 28  GLU B O    3  
ATOM 2146  C CB   . GLU B 2 4  ? -7.907  8.068   0.363   1.00 0.00 ? 28  GLU B CB   3  
ATOM 2147  C CG   . GLU B 2 4  ? -9.400  8.339   0.362   1.00 0.00 ? 28  GLU B CG   3  
ATOM 2148  C CD   . GLU B 2 4  ? -10.104 7.724   1.557   1.00 0.00 ? 28  GLU B CD   3  
ATOM 2149  O OE1  . GLU B 2 4  ? -9.996  8.289   2.665   1.00 0.00 ? 28  GLU B OE1  3  
ATOM 2150  O OE2  . GLU B 2 4  ? -10.761 6.676   1.383   1.00 0.00 ? 28  GLU B OE2  3  
ATOM 2151  H H    . GLU B 2 4  ? -8.454  10.215  -0.994  1.00 0.00 ? 28  GLU B H    3  
ATOM 2152  H HA   . GLU B 2 4  ? -6.122  8.538   -0.700  1.00 0.00 ? 28  GLU B HA   3  
ATOM 2153  H HB2  . GLU B 2 4  ? -7.756  7.007   0.479   1.00 0.00 ? 28  GLU B HB2  3  
ATOM 2154  H HB3  . GLU B 2 4  ? -7.466  8.575   1.197   1.00 0.00 ? 28  GLU B HB3  3  
ATOM 2155  H HG2  . GLU B 2 4  ? -9.559  9.405   0.384   1.00 0.00 ? 28  GLU B HG2  3  
ATOM 2156  H HG3  . GLU B 2 4  ? -9.828  7.929   -0.540  1.00 0.00 ? 28  GLU B HG3  3  
ATOM 2157  N N    . MET B 2 5  ? -6.638  7.714   -3.060  1.00 0.00 ? 29  MET B N    3  
ATOM 2158  C CA   . MET B 2 5  ? -6.758  6.894   -4.255  1.00 0.00 ? 29  MET B CA   3  
ATOM 2159  C C    . MET B 2 5  ? -6.151  5.524   -4.024  1.00 0.00 ? 29  MET B C    3  
ATOM 2160  O O    . MET B 2 5  ? -4.932  5.351   -3.998  1.00 0.00 ? 29  MET B O    3  
ATOM 2161  C CB   . MET B 2 5  ? -6.097  7.574   -5.447  1.00 0.00 ? 29  MET B CB   3  
ATOM 2162  C CG   . MET B 2 5  ? -7.035  7.795   -6.623  1.00 0.00 ? 29  MET B CG   3  
ATOM 2163  S SD   . MET B 2 5  ? -7.532  6.254   -7.416  1.00 0.00 ? 29  MET B SD   3  
ATOM 2164  C CE   . MET B 2 5  ? -5.952  5.656   -8.015  1.00 0.00 ? 29  MET B CE   3  
ATOM 2165  H H    . MET B 2 5  ? -5.926  8.381   -2.998  1.00 0.00 ? 29  MET B H    3  
ATOM 2166  H HA   . MET B 2 5  ? -7.810  6.761   -4.462  1.00 0.00 ? 29  MET B HA   3  
ATOM 2167  H HB2  . MET B 2 5  ? -5.711  8.537   -5.136  1.00 0.00 ? 29  MET B HB2  3  
ATOM 2168  H HB3  . MET B 2 5  ? -5.281  6.954   -5.780  1.00 0.00 ? 29  MET B HB3  3  
ATOM 2169  H HG2  . MET B 2 5  ? -7.921  8.301   -6.268  1.00 0.00 ? 29  MET B HG2  3  
ATOM 2170  H HG3  . MET B 2 5  ? -6.537  8.416   -7.352  1.00 0.00 ? 29  MET B HG3  3  
ATOM 2171  H HE1  . MET B 2 5  ? -5.497  6.409   -8.641  1.00 0.00 ? 29  MET B HE1  3  
ATOM 2172  H HE2  . MET B 2 5  ? -6.102  4.753   -8.587  1.00 0.00 ? 29  MET B HE2  3  
ATOM 2173  H HE3  . MET B 2 5  ? -5.305  5.448   -7.175  1.00 0.00 ? 29  MET B HE3  3  
ATOM 2174  N N    . ARG B 2 6  ? -7.035  4.565   -3.859  1.00 0.00 ? 30  ARG B N    3  
ATOM 2175  C CA   . ARG B 2 6  ? -6.662  3.187   -3.610  1.00 0.00 ? 30  ARG B CA   3  
ATOM 2176  C C    . ARG B 2 6  ? -6.258  2.470   -4.893  1.00 0.00 ? 30  ARG B C    3  
ATOM 2177  O O    . ARG B 2 6  ? -6.561  2.927   -5.995  1.00 0.00 ? 30  ARG B O    3  
ATOM 2178  C CB   . ARG B 2 6  ? -7.826  2.471   -2.953  1.00 0.00 ? 30  ARG B CB   3  
ATOM 2179  C CG   . ARG B 2 6  ? -7.726  2.453   -1.446  1.00 0.00 ? 30  ARG B CG   3  
ATOM 2180  C CD   . ARG B 2 6  ? -8.222  1.149   -0.882  1.00 0.00 ? 30  ARG B CD   3  
ATOM 2181  N NE   . ARG B 2 6  ? -8.077  1.096   0.565   1.00 0.00 ? 30  ARG B NE   3  
ATOM 2182  C CZ   . ARG B 2 6  ? -8.443  0.056   1.309   1.00 0.00 ? 30  ARG B CZ   3  
ATOM 2183  N NH1  . ARG B 2 6  ? -8.979  -1.014  0.740   1.00 0.00 ? 30  ARG B NH1  3  
ATOM 2184  N NH2  . ARG B 2 6  ? -8.275  0.088   2.623   1.00 0.00 ? 30  ARG B NH2  3  
ATOM 2185  H H    . ARG B 2 6  ? -7.982  4.793   -3.923  1.00 0.00 ? 30  ARG B H    3  
ATOM 2186  H HA   . ARG B 2 6  ? -5.828  3.181   -2.922  1.00 0.00 ? 30  ARG B HA   3  
ATOM 2187  H HB2  . ARG B 2 6  ? -8.744  2.970   -3.222  1.00 0.00 ? 30  ARG B HB2  3  
ATOM 2188  H HB3  . ARG B 2 6  ? -7.859  1.459   -3.307  1.00 0.00 ? 30  ARG B HB3  3  
ATOM 2189  H HG2  . ARG B 2 6  ? -6.693  2.586   -1.162  1.00 0.00 ? 30  ARG B HG2  3  
ATOM 2190  H HG3  . ARG B 2 6  ? -8.319  3.259   -1.043  1.00 0.00 ? 30  ARG B HG3  3  
ATOM 2191  H HD2  . ARG B 2 6  ? -9.261  1.037   -1.137  1.00 0.00 ? 30  ARG B HD2  3  
ATOM 2192  H HD3  . ARG B 2 6  ? -7.648  0.352   -1.327  1.00 0.00 ? 30  ARG B HD3  3  
ATOM 2193  H HE   . ARG B 2 6  ? -7.687  1.877   1.005   1.00 0.00 ? 30  ARG B HE   3  
ATOM 2194  H HH11 . ARG B 2 6  ? -9.109  -1.043  -0.252  1.00 0.00 ? 30  ARG B HH11 3  
ATOM 2195  H HH12 . ARG B 2 6  ? -9.253  -1.795  1.302   1.00 0.00 ? 30  ARG B HH12 3  
ATOM 2196  H HH21 . ARG B 2 6  ? -7.873  0.894   3.057   1.00 0.00 ? 30  ARG B HH21 3  
ATOM 2197  H HH22 . ARG B 2 6  ? -8.551  -0.694  3.181   1.00 0.00 ? 30  ARG B HH22 3  
ATOM 2198  N N    . GLU B 2 7  ? -5.574  1.341   -4.736  1.00 0.00 ? 31  GLU B N    3  
ATOM 2199  C CA   . GLU B 2 7  ? -5.132  0.546   -5.876  1.00 0.00 ? 31  GLU B CA   3  
ATOM 2200  C C    . GLU B 2 7  ? -4.672  -0.826  -5.426  1.00 0.00 ? 31  GLU B C    3  
ATOM 2201  O O    . GLU B 2 7  ? -3.967  -0.975  -4.430  1.00 0.00 ? 31  GLU B O    3  
ATOM 2202  C CB   . GLU B 2 7  ? -4.020  1.263   -6.642  1.00 0.00 ? 31  GLU B CB   3  
ATOM 2203  C CG   . GLU B 2 7  ? -2.746  1.424   -5.839  1.00 0.00 ? 31  GLU B CG   3  
ATOM 2204  C CD   . GLU B 2 7  ? -1.617  2.033   -6.646  1.00 0.00 ? 31  GLU B CD   3  
ATOM 2205  O OE1  . GLU B 2 7  ? -0.930  1.281   -7.369  1.00 0.00 ? 31  GLU B OE1  3  
ATOM 2206  O OE2  . GLU B 2 7  ? -1.418  3.262   -6.555  1.00 0.00 ? 31  GLU B OE2  3  
ATOM 2207  H H    . GLU B 2 7  ? -5.360  1.035   -3.830  1.00 0.00 ? 31  GLU B H    3  
ATOM 2208  H HA   . GLU B 2 7  ? -5.976  0.404   -6.527  1.00 0.00 ? 31  GLU B HA   3  
ATOM 2209  H HB2  . GLU B 2 7  ? -3.791  0.700   -7.534  1.00 0.00 ? 31  GLU B HB2  3  
ATOM 2210  H HB3  . GLU B 2 7  ? -4.369  2.245   -6.925  1.00 0.00 ? 31  GLU B HB3  3  
ATOM 2211  H HG2  . GLU B 2 7  ? -2.948  2.058   -4.991  1.00 0.00 ? 31  GLU B HG2  3  
ATOM 2212  H HG3  . GLU B 2 7  ? -2.441  0.450   -5.493  1.00 0.00 ? 31  GLU B HG3  3  
ATOM 2213  N N    . LYS B 2 8  ? -5.079  -1.819  -6.193  1.00 0.00 ? 32  LYS B N    3  
ATOM 2214  C CA   . LYS B 2 8  ? -4.775  -3.204  -5.906  1.00 0.00 ? 32  LYS B CA   3  
ATOM 2215  C C    . LYS B 2 8  ? -3.280  -3.484  -5.945  1.00 0.00 ? 32  LYS B C    3  
ATOM 2216  O O    . LYS B 2 8  ? -2.639  -3.431  -6.994  1.00 0.00 ? 32  LYS B O    3  
ATOM 2217  C CB   . LYS B 2 8  ? -5.533  -4.077  -6.884  1.00 0.00 ? 32  LYS B CB   3  
ATOM 2218  C CG   . LYS B 2 8  ? -6.997  -3.692  -6.973  1.00 0.00 ? 32  LYS B CG   3  
ATOM 2219  C CD   . LYS B 2 8  ? -7.794  -4.711  -7.770  1.00 0.00 ? 32  LYS B CD   3  
ATOM 2220  C CE   . LYS B 2 8  ? -9.273  -4.391  -7.756  1.00 0.00 ? 32  LYS B CE   3  
ATOM 2221  N NZ   . LYS B 2 8  ? -10.059 -5.347  -8.585  1.00 0.00 ? 32  LYS B NZ   3  
ATOM 2222  H H    . LYS B 2 8  ? -5.600  -1.613  -6.991  1.00 0.00 ? 32  LYS B H    3  
ATOM 2223  H HA   . LYS B 2 8  ? -5.135  -3.414  -4.909  1.00 0.00 ? 32  LYS B HA   3  
ATOM 2224  H HB2  . LYS B 2 8  ? -5.093  -3.980  -7.865  1.00 0.00 ? 32  LYS B HB2  3  
ATOM 2225  H HB3  . LYS B 2 8  ? -5.469  -5.098  -6.564  1.00 0.00 ? 32  LYS B HB3  3  
ATOM 2226  H HG2  . LYS B 2 8  ? -7.396  -3.622  -5.975  1.00 0.00 ? 32  LYS B HG2  3  
ATOM 2227  H HG3  . LYS B 2 8  ? -7.075  -2.730  -7.450  1.00 0.00 ? 32  LYS B HG3  3  
ATOM 2228  H HD2  . LYS B 2 8  ? -7.449  -4.704  -8.790  1.00 0.00 ? 32  LYS B HD2  3  
ATOM 2229  H HD3  . LYS B 2 8  ? -7.640  -5.691  -7.341  1.00 0.00 ? 32  LYS B HD3  3  
ATOM 2230  H HE2  . LYS B 2 8  ? -9.618  -4.442  -6.740  1.00 0.00 ? 32  LYS B HE2  3  
ATOM 2231  H HE3  . LYS B 2 8  ? -9.419  -3.392  -8.137  1.00 0.00 ? 32  LYS B HE3  3  
ATOM 2232  H HZ1  . LYS B 2 8  ? -9.702  -5.351  -9.563  1.00 0.00 ? 32  LYS B HZ1  3  
ATOM 2233  H HZ2  . LYS B 2 8  ? -11.061 -5.072  -8.596  1.00 0.00 ? 32  LYS B HZ2  3  
ATOM 2234  H HZ3  . LYS B 2 8  ? -9.979  -6.309  -8.194  1.00 0.00 ? 32  LYS B HZ3  3  
ATOM 2235  N N    . LEU B 2 9  ? -2.749  -3.784  -4.770  1.00 0.00 ? 33  LEU B N    3  
ATOM 2236  C CA   . LEU B 2 9  ? -1.341  -4.065  -4.583  1.00 0.00 ? 33  LEU B CA   3  
ATOM 2237  C C    . LEU B 2 9  ? -1.077  -5.516  -4.197  1.00 0.00 ? 33  LEU B C    3  
ATOM 2238  O O    . LEU B 2 9  ? -1.345  -5.922  -3.067  1.00 0.00 ? 33  LEU B O    3  
ATOM 2239  C CB   . LEU B 2 9  ? -0.826  -3.165  -3.509  1.00 0.00 ? 33  LEU B CB   3  
ATOM 2240  C CG   . LEU B 2 9  ? -0.996  -1.675  -3.783  1.00 0.00 ? 33  LEU B CG   3  
ATOM 2241  C CD1  . LEU B 2 9  ? -0.217  -0.868  -2.764  1.00 0.00 ? 33  LEU B CD1  3  
ATOM 2242  C CD2  . LEU B 2 9  ? -0.531  -1.333  -5.194  1.00 0.00 ? 33  LEU B CD2  3  
ATOM 2243  H H    . LEU B 2 9  ? -3.331  -3.797  -3.989  1.00 0.00 ? 33  LEU B H    3  
ATOM 2244  H HA   . LEU B 2 9  ? -0.805  -3.830  -5.482  1.00 0.00 ? 33  LEU B HA   3  
ATOM 2245  H HB2  . LEU B 2 9  ? -1.311  -3.413  -2.581  1.00 0.00 ? 33  LEU B HB2  3  
ATOM 2246  H HB3  . LEU B 2 9  ? 0.204   -3.371  -3.411  1.00 0.00 ? 33  LEU B HB3  3  
ATOM 2247  H HG   . LEU B 2 9  ? -2.041  -1.421  -3.696  1.00 0.00 ? 33  LEU B HG   3  
ATOM 2248  H HD11 . LEU B 2 9  ? -0.413  -1.251  -1.780  1.00 0.00 ? 33  LEU B HD11 3  
ATOM 2249  H HD12 . LEU B 2 9  ? -0.505  0.172   -2.810  1.00 0.00 ? 33  LEU B HD12 3  
ATOM 2250  H HD13 . LEU B 2 9  ? 0.837   -0.954  -2.975  1.00 0.00 ? 33  LEU B HD13 3  
ATOM 2251  H HD21 . LEU B 2 9  ? -0.917  -0.365  -5.475  1.00 0.00 ? 33  LEU B HD21 3  
ATOM 2252  H HD22 . LEU B 2 9  ? -0.892  -2.082  -5.885  1.00 0.00 ? 33  LEU B HD22 3  
ATOM 2253  H HD23 . LEU B 2 9  ? 0.548   -1.311  -5.220  1.00 0.00 ? 33  LEU B HD23 3  
ATOM 2254  N N    . CYS B 2 10 ? -0.537  -6.290  -5.131  1.00 0.00 ? 34  CYS B N    3  
ATOM 2255  C CA   . CYS B 2 10 ? -0.233  -7.690  -4.867  1.00 0.00 ? 34  CYS B CA   3  
ATOM 2256  C C    . CYS B 2 10 ? 1.250   -7.890  -4.602  1.00 0.00 ? 34  CYS B C    3  
ATOM 2257  O O    . CYS B 2 10 ? 2.012   -8.295  -5.480  1.00 0.00 ? 34  CYS B O    3  
ATOM 2258  C CB   . CYS B 2 10 ? -0.688  -8.561  -6.025  1.00 0.00 ? 34  CYS B CB   3  
ATOM 2259  S SG   . CYS B 2 10 ? -1.371  -10.170 -5.514  1.00 0.00 ? 34  CYS B SG   3  
ATOM 2260  H H    . CYS B 2 10 ? -0.343  -5.914  -6.015  1.00 0.00 ? 34  CYS B H    3  
ATOM 2261  H HA   . CYS B 2 10 ? -0.778  -7.979  -3.983  1.00 0.00 ? 34  CYS B HA   3  
ATOM 2262  H HB2  . CYS B 2 10 ? -1.452  -8.034  -6.559  1.00 0.00 ? 34  CYS B HB2  3  
ATOM 2263  H HB3  . CYS B 2 10 ? 0.148   -8.747  -6.682  1.00 0.00 ? 34  CYS B HB3  3  
ATOM 2264  N N    . GLY B 2 11 ? 1.636   -7.603  -3.372  1.00 0.00 ? 35  GLY B N    3  
ATOM 2265  C CA   . GLY B 2 11 ? 3.023   -7.742  -2.958  1.00 0.00 ? 35  GLY B CA   3  
ATOM 2266  C C    . GLY B 2 11 ? 3.953   -6.787  -3.679  1.00 0.00 ? 35  GLY B C    3  
ATOM 2267  O O    . GLY B 2 11 ? 4.312   -5.746  -3.133  1.00 0.00 ? 35  GLY B O    3  
ATOM 2268  H H    . GLY B 2 11 ? 0.963   -7.291  -2.736  1.00 0.00 ? 35  GLY B H    3  
ATOM 2269  H HA2  . GLY B 2 11 ? 3.085   -7.547  -1.896  1.00 0.00 ? 35  GLY B HA2  3  
ATOM 2270  H HA3  . GLY B 2 11 ? 3.345   -8.751  -3.141  1.00 0.00 ? 35  GLY B HA3  3  
ATOM 2271  N N    . HIS B 2 12 ? 4.371   -7.141  -4.896  1.00 0.00 ? 36  HIS B N    3  
ATOM 2272  C CA   . HIS B 2 12 ? 5.252   -6.286  -5.664  1.00 0.00 ? 36  HIS B CA   3  
ATOM 2273  C C    . HIS B 2 12 ? 4.627   -4.917  -5.878  1.00 0.00 ? 36  HIS B C    3  
ATOM 2274  O O    . HIS B 2 12 ? 5.242   -3.908  -5.553  1.00 0.00 ? 36  HIS B O    3  
ATOM 2275  C CB   . HIS B 2 12 ? 5.605   -6.914  -7.001  1.00 0.00 ? 36  HIS B CB   3  
ATOM 2276  C CG   . HIS B 2 12 ? 6.804   -6.280  -7.612  1.00 0.00 ? 36  HIS B CG   3  
ATOM 2277  N ND1  . HIS B 2 12 ? 7.094   -6.295  -8.955  1.00 0.00 ? 36  HIS B ND1  3  
ATOM 2278  C CD2  . HIS B 2 12 ? 7.802   -5.587  -7.014  1.00 0.00 ? 36  HIS B CD2  3  
ATOM 2279  C CE1  . HIS B 2 12 ? 8.237   -5.621  -9.131  1.00 0.00 ? 36  HIS B CE1  3  
ATOM 2280  N NE2  . HIS B 2 12 ? 8.709   -5.169  -7.983  1.00 0.00 ? 36  HIS B NE2  3  
ATOM 2281  H H    . HIS B 2 12 ? 4.103   -7.997  -5.269  1.00 0.00 ? 36  HIS B H    3  
ATOM 2282  H HA   . HIS B 2 12 ? 6.159   -6.161  -5.091  1.00 0.00 ? 36  HIS B HA   3  
ATOM 2283  H HB2  . HIS B 2 12 ? 5.812   -7.964  -6.859  1.00 0.00 ? 36  HIS B HB2  3  
ATOM 2284  H HB3  . HIS B 2 12 ? 4.777   -6.797  -7.682  1.00 0.00 ? 36  HIS B HB3  3  
ATOM 2285  H HD1  . HIS B 2 12 ? 6.560   -6.720  -9.657  1.00 0.00 ? 36  HIS B HD1  3  
ATOM 2286  H HD2  . HIS B 2 12 ? 7.874   -5.378  -5.949  1.00 0.00 ? 36  HIS B HD2  3  
ATOM 2287  H HE1  . HIS B 2 12 ? 8.705   -5.461  -10.090 1.00 0.00 ? 36  HIS B HE1  3  
ATOM 2288  N N    . HIS B 2 13 ? 3.424   -4.870  -6.457  1.00 0.00 ? 37  HIS B N    3  
ATOM 2289  C CA   . HIS B 2 13 ? 2.751   -3.589  -6.633  1.00 0.00 ? 37  HIS B CA   3  
ATOM 2290  C C    . HIS B 2 13 ? 2.724   -2.915  -5.299  1.00 0.00 ? 37  HIS B C    3  
ATOM 2291  O O    . HIS B 2 13 ? 3.030   -1.737  -5.156  1.00 0.00 ? 37  HIS B O    3  
ATOM 2292  C CB   . HIS B 2 13 ? 1.301   -3.749  -7.072  1.00 0.00 ? 37  HIS B CB   3  
ATOM 2293  C CG   . HIS B 2 13 ? 1.129   -4.148  -8.487  1.00 0.00 ? 37  HIS B CG   3  
ATOM 2294  N ND1  . HIS B 2 13 ? 0.359   -3.455  -9.387  1.00 0.00 ? 37  HIS B ND1  3  
ATOM 2295  C CD2  . HIS B 2 13 ? 1.629   -5.210  -9.151  1.00 0.00 ? 37  HIS B CD2  3  
ATOM 2296  C CE1  . HIS B 2 13 ? 0.408   -4.106  -10.550 1.00 0.00 ? 37  HIS B CE1  3  
ATOM 2297  N NE2  . HIS B 2 13 ? 1.169   -5.184  -10.465 1.00 0.00 ? 37  HIS B NE2  3  
ATOM 2298  H H    . HIS B 2 13 ? 2.995   -5.696  -6.763  1.00 0.00 ? 37  HIS B H    3  
ATOM 2299  H HA   . HIS B 2 13 ? 3.300   -2.989  -7.345  1.00 0.00 ? 37  HIS B HA   3  
ATOM 2300  H HB2  . HIS B 2 13 ? 0.833   -4.504  -6.459  1.00 0.00 ? 37  HIS B HB2  3  
ATOM 2301  H HB3  . HIS B 2 13 ? 0.788   -2.804  -6.922  1.00 0.00 ? 37  HIS B HB3  3  
ATOM 2302  H HD1  . HIS B 2 13 ? -0.139  -2.630  -9.207  1.00 0.00 ? 37  HIS B HD1  3  
ATOM 2303  H HD2  . HIS B 2 13 ? 2.277   -5.963  -8.728  1.00 0.00 ? 37  HIS B HD2  3  
ATOM 2304  H HE1  . HIS B 2 13 ? -0.115  -3.794  -11.436 1.00 0.00 ? 37  HIS B HE1  3  
ATOM 2305  N N    . PHE B 2 14 ? 2.341   -3.712  -4.323  1.00 0.00 ? 38  PHE B N    3  
ATOM 2306  C CA   . PHE B 2 14 ? 2.252   -3.262  -2.968  1.00 0.00 ? 38  PHE B CA   3  
ATOM 2307  C C    . PHE B 2 14 ? 3.559   -2.659  -2.536  1.00 0.00 ? 38  PHE B C    3  
ATOM 2308  O O    . PHE B 2 14 ? 3.590   -1.747  -1.716  1.00 0.00 ? 38  PHE B O    3  
ATOM 2309  C CB   . PHE B 2 14 ? 1.820   -4.415  -2.071  1.00 0.00 ? 38  PHE B CB   3  
ATOM 2310  C CG   . PHE B 2 14 ? 1.981   -4.105  -0.633  1.00 0.00 ? 38  PHE B CG   3  
ATOM 2311  C CD1  . PHE B 2 14 ? 1.316   -3.022  -0.103  1.00 0.00 ? 38  PHE B CD1  3  
ATOM 2312  C CD2  . PHE B 2 14 ? 2.803   -4.864  0.176   1.00 0.00 ? 38  PHE B CD2  3  
ATOM 2313  C CE1  . PHE B 2 14 ? 1.463   -2.691  1.224   1.00 0.00 ? 38  PHE B CE1  3  
ATOM 2314  C CE2  . PHE B 2 14 ? 2.962   -4.540  1.508   1.00 0.00 ? 38  PHE B CE2  3  
ATOM 2315  C CZ   . PHE B 2 14 ? 2.290   -3.449  2.035   1.00 0.00 ? 38  PHE B CZ   3  
ATOM 2316  H H    . PHE B 2 14 ? 2.110   -4.640  -4.531  1.00 0.00 ? 38  PHE B H    3  
ATOM 2317  H HA   . PHE B 2 14 ? 1.502   -2.493  -2.935  1.00 0.00 ? 38  PHE B HA   3  
ATOM 2318  H HB2  . PHE B 2 14 ? 0.775   -4.625  -2.248  1.00 0.00 ? 38  PHE B HB2  3  
ATOM 2319  H HB3  . PHE B 2 14 ? 2.393   -5.286  -2.306  1.00 0.00 ? 38  PHE B HB3  3  
ATOM 2320  H HD1  . PHE B 2 14 ? 0.662   -2.438  -0.750  1.00 0.00 ? 38  PHE B HD1  3  
ATOM 2321  H HD2  . PHE B 2 14 ? 3.324   -5.717  -0.247  1.00 0.00 ? 38  PHE B HD2  3  
ATOM 2322  H HE1  . PHE B 2 14 ? 0.939   -1.837  1.624   1.00 0.00 ? 38  PHE B HE1  3  
ATOM 2323  H HE2  . PHE B 2 14 ? 3.602   -5.143  2.138   1.00 0.00 ? 38  PHE B HE2  3  
ATOM 2324  H HZ   . PHE B 2 14 ? 2.412   -3.191  3.076   1.00 0.00 ? 38  PHE B HZ   3  
ATOM 2325  N N    . VAL B 2 15 ? 4.634   -3.170  -3.097  1.00 0.00 ? 39  VAL B N    3  
ATOM 2326  C CA   . VAL B 2 15 ? 5.940   -2.644  -2.812  1.00 0.00 ? 39  VAL B CA   3  
ATOM 2327  C C    . VAL B 2 15 ? 6.077   -1.297  -3.503  1.00 0.00 ? 39  VAL B C    3  
ATOM 2328  O O    . VAL B 2 15 ? 6.383   -0.300  -2.861  1.00 0.00 ? 39  VAL B O    3  
ATOM 2329  C CB   . VAL B 2 15 ? 7.054   -3.633  -3.253  1.00 0.00 ? 39  VAL B CB   3  
ATOM 2330  C CG1  . VAL B 2 15 ? 8.104   -2.965  -4.125  1.00 0.00 ? 39  VAL B CG1  3  
ATOM 2331  C CG2  . VAL B 2 15 ? 7.702   -4.268  -2.033  1.00 0.00 ? 39  VAL B CG2  3  
ATOM 2332  H H    . VAL B 2 15 ? 4.541   -3.918  -3.721  1.00 0.00 ? 39  VAL B H    3  
ATOM 2333  H HA   . VAL B 2 15 ? 6.009   -2.492  -1.744  1.00 0.00 ? 39  VAL B HA   3  
ATOM 2334  H HB   . VAL B 2 15 ? 6.593   -4.422  -3.837  1.00 0.00 ? 39  VAL B HB   3  
ATOM 2335  H HG11 . VAL B 2 15 ? 7.810   -3.039  -5.160  1.00 0.00 ? 39  VAL B HG11 3  
ATOM 2336  H HG12 . VAL B 2 15 ? 9.051   -3.456  -3.982  1.00 0.00 ? 39  VAL B HG12 3  
ATOM 2337  H HG13 . VAL B 2 15 ? 8.196   -1.925  -3.852  1.00 0.00 ? 39  VAL B HG13 3  
ATOM 2338  H HG21 . VAL B 2 15 ? 7.611   -3.603  -1.187  1.00 0.00 ? 39  VAL B HG21 3  
ATOM 2339  H HG22 . VAL B 2 15 ? 8.748   -4.449  -2.236  1.00 0.00 ? 39  VAL B HG22 3  
ATOM 2340  H HG23 . VAL B 2 15 ? 7.212   -5.204  -1.809  1.00 0.00 ? 39  VAL B HG23 3  
ATOM 2341  N N    . ARG B 2 16 ? 5.795   -1.278  -4.807  1.00 0.00 ? 40  ARG B N    3  
ATOM 2342  C CA   . ARG B 2 16 ? 5.866   -0.066  -5.608  1.00 0.00 ? 40  ARG B CA   3  
ATOM 2343  C C    . ARG B 2 16 ? 5.081   1.054   -4.963  1.00 0.00 ? 40  ARG B C    3  
ATOM 2344  O O    . ARG B 2 16 ? 5.666   2.048   -4.554  1.00 0.00 ? 40  ARG B O    3  
ATOM 2345  C CB   . ARG B 2 16 ? 5.322   -0.340  -7.004  1.00 0.00 ? 40  ARG B CB   3  
ATOM 2346  C CG   . ARG B 2 16 ? 6.357   -0.879  -7.976  1.00 0.00 ? 40  ARG B CG   3  
ATOM 2347  C CD   . ARG B 2 16 ? 7.162   -2.031  -7.397  1.00 0.00 ? 40  ARG B CD   3  
ATOM 2348  N NE   . ARG B 2 16 ? 8.403   -1.566  -6.782  1.00 0.00 ? 40  ARG B NE   3  
ATOM 2349  C CZ   . ARG B 2 16 ? 9.616   -1.879  -7.229  1.00 0.00 ? 40  ARG B CZ   3  
ATOM 2350  N NH1  . ARG B 2 16 ? 9.754   -2.657  -8.294  1.00 0.00 ? 40  ARG B NH1  3  
ATOM 2351  N NH2  . ARG B 2 16 ? 10.691  -1.411  -6.611  1.00 0.00 ? 40  ARG B NH2  3  
ATOM 2352  H H    . ARG B 2 16 ? 5.527   -2.108  -5.247  1.00 0.00 ? 40  ARG B H    3  
ATOM 2353  H HA   . ARG B 2 16 ? 6.903   0.240   -5.682  1.00 0.00 ? 40  ARG B HA   3  
ATOM 2354  H HB2  . ARG B 2 16 ? 4.523   -1.062  -6.931  1.00 0.00 ? 40  ARG B HB2  3  
ATOM 2355  H HB3  . ARG B 2 16 ? 4.928   0.580   -7.410  1.00 0.00 ? 40  ARG B HB3  3  
ATOM 2356  H HG2  . ARG B 2 16 ? 5.849   -1.226  -8.852  1.00 0.00 ? 40  ARG B HG2  3  
ATOM 2357  H HG3  . ARG B 2 16 ? 7.031   -0.082  -8.241  1.00 0.00 ? 40  ARG B HG3  3  
ATOM 2358  H HD2  . ARG B 2 16 ? 6.568   -2.532  -6.654  1.00 0.00 ? 40  ARG B HD2  3  
ATOM 2359  H HD3  . ARG B 2 16 ? 7.397   -2.724  -8.187  1.00 0.00 ? 40  ARG B HD3  3  
ATOM 2360  H HE   . ARG B 2 16 ? 8.327   -0.988  -5.995  1.00 0.00 ? 40  ARG B HE   3  
ATOM 2361  H HH11 . ARG B 2 16 ? 8.946   -3.009  -8.766  1.00 0.00 ? 40  ARG B HH11 3  
ATOM 2362  H HH12 . ARG B 2 16 ? 10.668  -2.891  -8.625  1.00 0.00 ? 40  ARG B HH12 3  
ATOM 2363  H HH21 . ARG B 2 16 ? 10.590  -0.824  -5.809  1.00 0.00 ? 40  ARG B HH21 3  
ATOM 2364  H HH22 . ARG B 2 16 ? 11.603  -1.648  -6.947  1.00 0.00 ? 40  ARG B HH22 3  
ATOM 2365  N N    . ALA B 2 17 ? 3.758   0.903   -4.862  1.00 0.00 ? 41  ALA B N    3  
ATOM 2366  C CA   . ALA B 2 17 ? 2.957   1.932   -4.251  1.00 0.00 ? 41  ALA B CA   3  
ATOM 2367  C C    . ALA B 2 17 ? 3.565   2.300   -2.916  1.00 0.00 ? 41  ALA B C    3  
ATOM 2368  O O    . ALA B 2 17 ? 3.762   3.461   -2.642  1.00 0.00 ? 41  ALA B O    3  
ATOM 2369  C CB   . ALA B 2 17 ? 1.508   1.484   -4.092  1.00 0.00 ? 41  ALA B CB   3  
ATOM 2370  H H    . ALA B 2 17 ? 3.322   0.084   -5.179  1.00 0.00 ? 41  ALA B H    3  
ATOM 2371  H HA   . ALA B 2 17 ? 2.982   2.810   -4.901  1.00 0.00 ? 41  ALA B HA   3  
ATOM 2372  H HB1  . ALA B 2 17 ? 0.900   2.332   -3.809  1.00 0.00 ? 41  ALA B HB1  3  
ATOM 2373  H HB2  . ALA B 2 17 ? 1.436   0.718   -3.324  1.00 0.00 ? 41  ALA B HB2  3  
ATOM 2374  H HB3  . ALA B 2 17 ? 1.150   1.085   -5.030  1.00 0.00 ? 41  ALA B HB3  3  
ATOM 2375  N N    . LEU B 2 18 ? 3.936   1.301   -2.115  1.00 0.00 ? 42  LEU B N    3  
ATOM 2376  C CA   . LEU B 2 18 ? 4.528   1.576   -0.812  1.00 0.00 ? 42  LEU B CA   3  
ATOM 2377  C C    . LEU B 2 18 ? 5.613   2.640   -0.951  1.00 0.00 ? 42  LEU B C    3  
ATOM 2378  O O    . LEU B 2 18 ? 5.738   3.537   -0.118  1.00 0.00 ? 42  LEU B O    3  
ATOM 2379  C CB   . LEU B 2 18 ? 5.119   0.295   -0.219  1.00 0.00 ? 42  LEU B CB   3  
ATOM 2380  C CG   . LEU B 2 18 ? 4.804   0.050   1.254   1.00 0.00 ? 42  LEU B CG   3  
ATOM 2381  C CD1  . LEU B 2 18 ? 5.317   -1.311  1.693   1.00 0.00 ? 42  LEU B CD1  3  
ATOM 2382  C CD2  . LEU B 2 18 ? 5.418   1.150   2.096   1.00 0.00 ? 42  LEU B CD2  3  
ATOM 2383  H H    . LEU B 2 18 ? 3.826   0.369   -2.408  1.00 0.00 ? 42  LEU B H    3  
ATOM 2384  H HA   . LEU B 2 18 ? 3.740   1.949   -0.165  1.00 0.00 ? 42  LEU B HA   3  
ATOM 2385  H HB2  . LEU B 2 18 ? 4.753   -0.541  -0.786  1.00 0.00 ? 42  LEU B HB2  3  
ATOM 2386  H HB3  . LEU B 2 18 ? 6.191   0.337   -0.330  1.00 0.00 ? 42  LEU B HB3  3  
ATOM 2387  H HG   . LEU B 2 18 ? 3.732   0.069   1.397   1.00 0.00 ? 42  LEU B HG   3  
ATOM 2388  H HD11 . LEU B 2 18 ? 4.481   -1.977  1.855   1.00 0.00 ? 42  LEU B HD11 3  
ATOM 2389  H HD12 . LEU B 2 18 ? 5.877   -1.207  2.610   1.00 0.00 ? 42  LEU B HD12 3  
ATOM 2390  H HD13 . LEU B 2 18 ? 5.957   -1.720  0.925   1.00 0.00 ? 42  LEU B HD13 3  
ATOM 2391  H HD21 . LEU B 2 18 ? 4.685   1.923   2.272   1.00 0.00 ? 42  LEU B HD21 3  
ATOM 2392  H HD22 . LEU B 2 18 ? 6.260   1.564   1.564   1.00 0.00 ? 42  LEU B HD22 3  
ATOM 2393  H HD23 . LEU B 2 18 ? 5.748   0.740   3.040   1.00 0.00 ? 42  LEU B HD23 3  
ATOM 2394  N N    . VAL B 2 19 ? 6.391   2.517   -2.021  1.00 0.00 ? 43  VAL B N    3  
ATOM 2395  C CA   . VAL B 2 19 ? 7.457   3.469   -2.328  1.00 0.00 ? 43  VAL B CA   3  
ATOM 2396  C C    . VAL B 2 19 ? 6.862   4.771   -2.831  1.00 0.00 ? 43  VAL B C    3  
ATOM 2397  O O    . VAL B 2 19 ? 7.004   5.820   -2.202  1.00 0.00 ? 43  VAL B O    3  
ATOM 2398  C CB   . VAL B 2 19 ? 8.426   2.920   -3.402  1.00 0.00 ? 43  VAL B CB   3  
ATOM 2399  C CG1  . VAL B 2 19 ? 9.831   3.426   -3.172  1.00 0.00 ? 43  VAL B CG1  3  
ATOM 2400  C CG2  . VAL B 2 19 ? 8.442   1.422   -3.386  1.00 0.00 ? 43  VAL B CG2  3  
ATOM 2401  H H    . VAL B 2 19 ? 6.253   1.755   -2.611  1.00 0.00 ? 43  VAL B H    3  
ATOM 2402  H HA   . VAL B 2 19 ? 8.004   3.660   -1.419  1.00 0.00 ? 43  VAL B HA   3  
ATOM 2403  H HB   . VAL B 2 19 ? 8.088   3.236   -4.380  1.00 0.00 ? 43  VAL B HB   3  
ATOM 2404  H HG11 . VAL B 2 19 ? 10.359  3.472   -4.113  1.00 0.00 ? 43  VAL B HG11 3  
ATOM 2405  H HG12 . VAL B 2 19 ? 10.336  2.734   -2.505  1.00 0.00 ? 43  VAL B HG12 3  
ATOM 2406  H HG13 . VAL B 2 19 ? 9.797   4.408   -2.723  1.00 0.00 ? 43  VAL B HG13 3  
ATOM 2407  H HG21 . VAL B 2 19 ? 7.498   1.047   -3.742  1.00 0.00 ? 43  VAL B HG21 3  
ATOM 2408  H HG22 . VAL B 2 19 ? 8.611   1.094   -2.373  1.00 0.00 ? 43  VAL B HG22 3  
ATOM 2409  H HG23 . VAL B 2 19 ? 9.238   1.062   -4.020  1.00 0.00 ? 43  VAL B HG23 3  
ATOM 2410  N N    . ARG B 2 20 ? 6.219   4.678   -3.990  1.00 0.00 ? 44  ARG B N    3  
ATOM 2411  C CA   . ARG B 2 20 ? 5.536   5.808   -4.617  1.00 0.00 ? 44  ARG B CA   3  
ATOM 2412  C C    . ARG B 2 20 ? 4.943   6.718   -3.550  1.00 0.00 ? 44  ARG B C    3  
ATOM 2413  O O    . ARG B 2 20 ? 4.994   7.946   -3.632  1.00 0.00 ? 44  ARG B O    3  
ATOM 2414  C CB   . ARG B 2 20 ? 4.404   5.265   -5.493  1.00 0.00 ? 44  ARG B CB   3  
ATOM 2415  C CG   . ARG B 2 20 ? 4.832   4.147   -6.425  1.00 0.00 ? 44  ARG B CG   3  
ATOM 2416  C CD   . ARG B 2 20 ? 4.273   4.344   -7.820  1.00 0.00 ? 44  ARG B CD   3  
ATOM 2417  N NE   . ARG B 2 20 ? 4.220   3.092   -8.573  1.00 0.00 ? 44  ARG B NE   3  
ATOM 2418  C CZ   . ARG B 2 20 ? 4.403   3.012   -9.888  1.00 0.00 ? 44  ARG B CZ   3  
ATOM 2419  N NH1  . ARG B 2 20 ? 4.667   4.104   -10.593 1.00 0.00 ? 44  ARG B NH1  3  
ATOM 2420  N NH2  . ARG B 2 20 ? 4.325   1.838   -10.500 1.00 0.00 ? 44  ARG B NH2  3  
ATOM 2421  H H    . ARG B 2 20 ? 6.212   3.811   -4.448  1.00 0.00 ? 44  ARG B H    3  
ATOM 2422  H HA   . ARG B 2 20 ? 6.239   6.355   -5.225  1.00 0.00 ? 44  ARG B HA   3  
ATOM 2423  H HB2  . ARG B 2 20 ? 3.627   4.881   -4.850  1.00 0.00 ? 44  ARG B HB2  3  
ATOM 2424  H HB3  . ARG B 2 20 ? 3.995   6.059   -6.086  1.00 0.00 ? 44  ARG B HB3  3  
ATOM 2425  H HG2  . ARG B 2 20 ? 5.909   4.125   -6.478  1.00 0.00 ? 44  ARG B HG2  3  
ATOM 2426  H HG3  . ARG B 2 20 ? 4.468   3.208   -6.032  1.00 0.00 ? 44  ARG B HG3  3  
ATOM 2427  H HD2  . ARG B 2 20 ? 3.276   4.750   -7.742  1.00 0.00 ? 44  ARG B HD2  3  
ATOM 2428  H HD3  . ARG B 2 20 ? 4.905   5.042   -8.345  1.00 0.00 ? 44  ARG B HD3  3  
ATOM 2429  H HE   . ARG B 2 20 ? 4.032   2.270   -8.072  1.00 0.00 ? 44  ARG B HE   3  
ATOM 2430  H HH11 . ARG B 2 20 ? 4.729   4.992   -10.137 1.00 0.00 ? 44  ARG B HH11 3  
ATOM 2431  H HH12 . ARG B 2 20 ? 4.804   4.040   -11.581 1.00 0.00 ? 44  ARG B HH12 3  
ATOM 2432  H HH21 . ARG B 2 20 ? 4.128   1.012   -9.973  1.00 0.00 ? 44  ARG B HH21 3  
ATOM 2433  H HH22 . ARG B 2 20 ? 4.462   1.779   -11.489 1.00 0.00 ? 44  ARG B HH22 3  
ATOM 2434  N N    . VAL B 2 21 ? 4.383   6.062   -2.555  1.00 0.00 ? 45  VAL B N    3  
ATOM 2435  C CA   . VAL B 2 21 ? 3.736   6.687   -1.421  1.00 0.00 ? 45  VAL B CA   3  
ATOM 2436  C C    . VAL B 2 21 ? 4.733   7.284   -0.440  1.00 0.00 ? 45  VAL B C    3  
ATOM 2437  O O    . VAL B 2 21 ? 4.735   8.488   -0.180  1.00 0.00 ? 45  VAL B O    3  
ATOM 2438  C CB   . VAL B 2 21 ? 2.920   5.633   -0.653  1.00 0.00 ? 45  VAL B CB   3  
ATOM 2439  C CG1  . VAL B 2 21 ? 2.244   6.237   0.550   1.00 0.00 ? 45  VAL B CG1  3  
ATOM 2440  C CG2  . VAL B 2 21 ? 1.914   4.946   -1.551  1.00 0.00 ? 45  VAL B CG2  3  
ATOM 2441  H H    . VAL B 2 21 ? 4.415   5.089   -2.580  1.00 0.00 ? 45  VAL B H    3  
ATOM 2442  H HA   . VAL B 2 21 ? 3.065   7.452   -1.775  1.00 0.00 ? 45  VAL B HA   3  
ATOM 2443  H HB   . VAL B 2 21 ? 3.609   4.881   -0.296  1.00 0.00 ? 45  VAL B HB   3  
ATOM 2444  H HG11 . VAL B 2 21 ? 1.999   7.269   0.348   1.00 0.00 ? 45  VAL B HG11 3  
ATOM 2445  H HG12 . VAL B 2 21 ? 2.911   6.180   1.394   1.00 0.00 ? 45  VAL B HG12 3  
ATOM 2446  H HG13 . VAL B 2 21 ? 1.340   5.689   0.769   1.00 0.00 ? 45  VAL B HG13 3  
ATOM 2447  H HG21 . VAL B 2 21 ? 0.916   5.138   -1.192  1.00 0.00 ? 45  VAL B HG21 3  
ATOM 2448  H HG22 . VAL B 2 21 ? 2.104   3.885   -1.535  1.00 0.00 ? 45  VAL B HG22 3  
ATOM 2449  H HG23 . VAL B 2 21 ? 2.016   5.317   -2.561  1.00 0.00 ? 45  VAL B HG23 3  
ATOM 2450  N N    . CYS B 2 22 ? 5.583   6.417   0.096   1.00 0.00 ? 46  CYS B N    3  
ATOM 2451  C CA   . CYS B 2 22 ? 6.549   6.804   1.110   1.00 0.00 ? 46  CYS B CA   3  
ATOM 2452  C C    . CYS B 2 22 ? 7.963   6.456   0.697   1.00 0.00 ? 46  CYS B C    3  
ATOM 2453  O O    . CYS B 2 22 ? 8.840   7.316   0.619   1.00 0.00 ? 46  CYS B O    3  
ATOM 2454  C CB   . CYS B 2 22 ? 6.216   6.047   2.390   1.00 0.00 ? 46  CYS B CB   3  
ATOM 2455  S SG   . CYS B 2 22 ? 6.995   6.698   3.901   1.00 0.00 ? 46  CYS B SG   3  
ATOM 2456  H H    . CYS B 2 22 ? 5.574   5.485   -0.217  1.00 0.00 ? 46  CYS B H    3  
ATOM 2457  H HA   . CYS B 2 22 ? 6.466   7.864   1.287   1.00 0.00 ? 46  CYS B HA   3  
ATOM 2458  H HB2  . CYS B 2 22 ? 5.151   6.061   2.534   1.00 0.00 ? 46  CYS B HB2  3  
ATOM 2459  H HB3  . CYS B 2 22 ? 6.538   5.023   2.275   1.00 0.00 ? 46  CYS B HB3  3  
ATOM 2460  N N    . GLY B 2 23 ? 8.163   5.179   0.434   1.00 0.00 ? 47  GLY B N    3  
ATOM 2461  C CA   . GLY B 2 23 ? 9.477   4.696   0.059   1.00 0.00 ? 47  GLY B CA   3  
ATOM 2462  C C    . GLY B 2 23 ? 9.694   3.258   0.482   1.00 0.00 ? 47  GLY B C    3  
ATOM 2463  O O    . GLY B 2 23 ? 9.291   2.332   -0.219  1.00 0.00 ? 47  GLY B O    3  
ATOM 2464  H H    . GLY B 2 23 ? 7.396   4.558   0.473   1.00 0.00 ? 47  GLY B H    3  
ATOM 2465  H HA2  . GLY B 2 23 ? 9.584   4.767   -1.012  1.00 0.00 ? 47  GLY B HA2  3  
ATOM 2466  H HA3  . GLY B 2 23 ? 10.227  5.315   0.529   1.00 0.00 ? 47  GLY B HA3  3  
ATOM 2467  N N    . GLY B 2 24 ? 10.322  3.072   1.636   1.00 0.00 ? 48  GLY B N    3  
ATOM 2468  C CA   . GLY B 2 24 ? 10.582  1.738   2.130   1.00 0.00 ? 48  GLY B CA   3  
ATOM 2469  C C    . GLY B 2 24 ? 11.954  1.621   2.768   1.00 0.00 ? 48  GLY B C    3  
ATOM 2470  O O    . GLY B 2 24 ? 12.357  2.496   3.536   1.00 0.00 ? 48  GLY B O    3  
ATOM 2471  H H    . GLY B 2 24 ? 10.613  3.847   2.157   1.00 0.00 ? 48  GLY B H    3  
ATOM 2472  H HA2  . GLY B 2 24 ? 9.832   1.480   2.860   1.00 0.00 ? 48  GLY B HA2  3  
ATOM 2473  H HA3  . GLY B 2 24 ? 10.518  1.045   1.305   1.00 0.00 ? 48  GLY B HA3  3  
ATOM 2474  N N    . PRO B 2 25 ? 12.698  0.545   2.469   1.00 0.00 ? 49  PRO B N    3  
ATOM 2475  C CA   . PRO B 2 25 ? 14.036  0.331   3.020   1.00 0.00 ? 49  PRO B CA   3  
ATOM 2476  C C    . PRO B 2 25 ? 15.059  1.308   2.453   1.00 0.00 ? 49  PRO B C    3  
ATOM 2477  O O    . PRO B 2 25 ? 15.560  2.179   3.165   1.00 0.00 ? 49  PRO B O    3  
ATOM 2478  C CB   . PRO B 2 25 ? 14.356  -1.108  2.606   1.00 0.00 ? 49  PRO B CB   3  
ATOM 2479  C CG   . PRO B 2 25 ? 13.550  -1.341  1.381   1.00 0.00 ? 49  PRO B CG   3  
ATOM 2480  C CD   . PRO B 2 25 ? 12.293  -0.546  1.569   1.00 0.00 ? 49  PRO B CD   3  
ATOM 2481  H HA   . PRO B 2 25 ? 14.036  0.404   4.091   1.00 0.00 ? 49  PRO B HA   3  
ATOM 2482  H HB2  . PRO B 2 25 ? 15.413  -1.209  2.413   1.00 0.00 ? 49  PRO B HB2  3  
ATOM 2483  H HB3  . PRO B 2 25 ? 14.059  -1.776  3.391   1.00 0.00 ? 49  PRO B HB3  3  
ATOM 2484  H HG2  . PRO B 2 25 ? 14.090  -0.994  0.514   1.00 0.00 ? 49  PRO B HG2  3  
ATOM 2485  H HG3  . PRO B 2 25 ? 13.320  -2.392  1.287   1.00 0.00 ? 49  PRO B HG3  3  
ATOM 2486  H HD2  . PRO B 2 25 ? 11.965  -0.157  0.636   1.00 0.00 ? 49  PRO B HD2  3  
ATOM 2487  H HD3  . PRO B 2 25 ? 11.516  -1.146  2.015   1.00 0.00 ? 49  PRO B HD3  3  
ATOM 2488  N N    . ARG B 2 26 ? 15.366  1.161   1.169   1.00 0.00 ? 50  ARG B N    3  
ATOM 2489  C CA   . ARG B 2 26 ? 16.323  2.027   0.504   1.00 0.00 ? 50  ARG B CA   3  
ATOM 2490  C C    . ARG B 2 26 ? 16.130  2.024   -1.008  1.00 0.00 ? 50  ARG B C    3  
ATOM 2491  O O    . ARG B 2 26 ? 16.194  3.070   -1.655  1.00 0.00 ? 50  ARG B O    3  
ATOM 2492  C CB   . ARG B 2 26 ? 17.737  1.578   0.801   1.00 0.00 ? 50  ARG B CB   3  
ATOM 2493  C CG   . ARG B 2 26 ? 17.834  0.208   1.454   1.00 0.00 ? 50  ARG B CG   3  
ATOM 2494  C CD   . ARG B 2 26 ? 19.281  -0.220  1.643   1.00 0.00 ? 50  ARG B CD   3  
ATOM 2495  N NE   . ARG B 2 26 ? 19.386  -1.506  2.329   1.00 0.00 ? 50  ARG B NE   3  
ATOM 2496  C CZ   . ARG B 2 26 ? 20.381  -2.367  2.140   1.00 0.00 ? 50  ARG B CZ   3  
ATOM 2497  N NH1  . ARG B 2 26 ? 21.353  -2.084  1.283   1.00 0.00 ? 50  ARG B NH1  3  
ATOM 2498  N NH2  . ARG B 2 26 ? 20.405  -3.513  2.806   1.00 0.00 ? 50  ARG B NH2  3  
ATOM 2499  H H    . ARG B 2 26 ? 14.958  0.439   0.668   1.00 0.00 ? 50  ARG B H    3  
ATOM 2500  H HA   . ARG B 2 26 ? 16.188  3.028   0.876   1.00 0.00 ? 50  ARG B HA   3  
ATOM 2501  H HB2  . ARG B 2 26 ? 18.261  1.542   -0.134  1.00 0.00 ? 50  ARG B HB2  3  
ATOM 2502  H HB3  . ARG B 2 26 ? 18.206  2.299   1.448   1.00 0.00 ? 50  ARG B HB3  3  
ATOM 2503  H HG2  . ARG B 2 26 ? 17.351  0.247   2.418   1.00 0.00 ? 50  ARG B HG2  3  
ATOM 2504  H HG3  . ARG B 2 26 ? 17.333  -0.516  0.827   1.00 0.00 ? 50  ARG B HG3  3  
ATOM 2505  H HD2  . ARG B 2 26 ? 19.749  -0.303  0.673   1.00 0.00 ? 50  ARG B HD2  3  
ATOM 2506  H HD3  . ARG B 2 26 ? 19.792  0.531   2.225   1.00 0.00 ? 50  ARG B HD3  3  
ATOM 2507  H HE   . ARG B 2 26 ? 18.676  -1.738  2.966   1.00 0.00 ? 50  ARG B HE   3  
ATOM 2508  H HH11 . ARG B 2 26 ? 21.340  -1.220  0.778   1.00 0.00 ? 50  ARG B HH11 3  
ATOM 2509  H HH12 . ARG B 2 26 ? 22.100  -2.735  1.141   1.00 0.00 ? 50  ARG B HH12 3  
ATOM 2510  H HH21 . ARG B 2 26 ? 19.674  -3.730  3.452   1.00 0.00 ? 50  ARG B HH21 3  
ATOM 2511  H HH22 . ARG B 2 26 ? 21.154  -4.159  2.664   1.00 0.00 ? 50  ARG B HH22 3  
ATOM 2512  N N    . TRP B 2 27 ? 15.900  0.833   -1.561  1.00 0.00 ? 51  TRP B N    3  
ATOM 2513  C CA   . TRP B 2 27 ? 15.694  0.662   -2.988  1.00 0.00 ? 51  TRP B CA   3  
ATOM 2514  C C    . TRP B 2 27 ? 16.933  1.035   -3.798  1.00 0.00 ? 51  TRP B C    3  
ATOM 2515  O O    . TRP B 2 27 ? 16.937  0.919   -5.025  1.00 0.00 ? 51  TRP B O    3  
ATOM 2516  C CB   . TRP B 2 27 ? 14.505  1.481   -3.430  1.00 0.00 ? 51  TRP B CB   3  
ATOM 2517  C CG   . TRP B 2 27 ? 13.365  1.345   -2.493  1.00 0.00 ? 51  TRP B CG   3  
ATOM 2518  C CD1  . TRP B 2 27 ? 13.140  2.041   -1.351  1.00 0.00 ? 51  TRP B CD1  3  
ATOM 2519  C CD2  . TRP B 2 27 ? 12.315  0.418   -2.613  1.00 0.00 ? 51  TRP B CD2  3  
ATOM 2520  N NE1  . TRP B 2 27 ? 11.986  1.604   -0.755  1.00 0.00 ? 51  TRP B NE1  3  
ATOM 2521  C CE2  . TRP B 2 27 ? 11.460  0.599   -1.520  1.00 0.00 ? 51  TRP B CE2  3  
ATOM 2522  C CE3  . TRP B 2 27 ? 12.022  -0.545  -3.553  1.00 0.00 ? 51  TRP B CE3  3  
ATOM 2523  C CZ2  . TRP B 2 27 ? 10.319  -0.165  -1.349  1.00 0.00 ? 51  TRP B CZ2  3  
ATOM 2524  C CZ3  . TRP B 2 27 ? 10.888  -1.301  -3.386  1.00 0.00 ? 51  TRP B CZ3  3  
ATOM 2525  C CH2  . TRP B 2 27 ? 10.047  -1.101  -2.280  1.00 0.00 ? 51  TRP B CH2  3  
ATOM 2526  H H    . TRP B 2 27 ? 15.840  0.050   -0.991  1.00 0.00 ? 51  TRP B H    3  
ATOM 2527  H HA   . TRP B 2 27 ? 15.460  -0.379  -3.156  1.00 0.00 ? 51  TRP B HA   3  
ATOM 2528  H HB2  . TRP B 2 27 ? 14.773  2.516   -3.498  1.00 0.00 ? 51  TRP B HB2  3  
ATOM 2529  H HB3  . TRP B 2 27 ? 14.187  1.128   -4.388  1.00 0.00 ? 51  TRP B HB3  3  
ATOM 2530  H HD1  . TRP B 2 27 ? 13.787  2.814   -0.983  1.00 0.00 ? 51  TRP B HD1  3  
ATOM 2531  H HE1  . TRP B 2 27 ? 11.604  1.952   0.076   1.00 0.00 ? 51  TRP B HE1  3  
ATOM 2532  H HE3  . TRP B 2 27 ? 12.670  -0.697  -4.404  1.00 0.00 ? 51  TRP B HE3  3  
ATOM 2533  H HZ2  . TRP B 2 27 ? 9.657   -0.040  -0.516  1.00 0.00 ? 51  TRP B HZ2  3  
ATOM 2534  H HZ3  . TRP B 2 27 ? 10.646  -2.059  -4.104  1.00 0.00 ? 51  TRP B HZ3  3  
ATOM 2535  H HH2  . TRP B 2 27 ? 9.159   -1.690  -2.181  1.00 0.00 ? 51  TRP B HH2  3  
ATOM 2536  N N    . SER B 2 28 ? 17.981  1.477   -3.112  1.00 0.00 ? 52  SER B N    3  
ATOM 2537  C CA   . SER B 2 28 ? 19.222  1.863   -3.775  1.00 0.00 ? 52  SER B CA   3  
ATOM 2538  C C    . SER B 2 28 ? 20.365  0.947   -3.358  1.00 0.00 ? 52  SER B C    3  
ATOM 2539  O O    . SER B 2 28 ? 20.800  0.968   -2.207  1.00 0.00 ? 52  SER B O    3  
ATOM 2540  C CB   . SER B 2 28 ? 19.579  3.310   -3.439  1.00 0.00 ? 52  SER B CB   3  
ATOM 2541  O OG   . SER B 2 28 ? 18.442  4.153   -3.523  1.00 0.00 ? 52  SER B OG   3  
ATOM 2542  H H    . SER B 2 28 ? 17.922  1.543   -2.136  1.00 0.00 ? 52  SER B H    3  
ATOM 2543  H HA   . SER B 2 28 ? 19.072  1.776   -4.840  1.00 0.00 ? 52  SER B HA   3  
ATOM 2544  H HB2  . SER B 2 28 ? 19.974  3.355   -2.436  1.00 0.00 ? 52  SER B HB2  3  
ATOM 2545  H HB3  . SER B 2 28 ? 20.327  3.665   -4.135  1.00 0.00 ? 52  SER B HB3  3  
ATOM 2546  H HG   . SER B 2 28 ? 18.685  4.978   -3.947  1.00 0.00 ? 52  SER B HG   3  
ATOM 2547  N N    . THR B 2 29 ? 20.853  0.158   -4.308  1.00 0.00 ? 53  THR B N    3  
ATOM 2548  C CA   . THR B 2 29 ? 21.944  -0.776  -4.050  1.00 0.00 ? 53  THR B CA   3  
ATOM 2549  C C    . THR B 2 29 ? 22.685  -1.120  -5.337  1.00 0.00 ? 53  THR B C    3  
ATOM 2550  O O    . THR B 2 29 ? 23.915  -1.115  -5.377  1.00 0.00 ? 53  THR B O    3  
ATOM 2551  C CB   . THR B 2 29 ? 21.435  -2.086  -3.416  1.00 0.00 ? 53  THR B CB   3  
ATOM 2552  O OG1  . THR B 2 29 ? 20.269  -2.546  -4.110  1.00 0.00 ? 53  THR B OG1  3  
ATOM 2553  C CG2  . THR B 2 29 ? 21.113  -1.900  -1.942  1.00 0.00 ? 53  THR B CG2  3  
ATOM 2554  H H    . THR B 2 29 ? 20.473  0.210   -5.209  1.00 0.00 ? 53  THR B H    3  
ATOM 2555  H HA   . THR B 2 29 ? 22.631  -0.307  -3.361  1.00 0.00 ? 53  THR B HA   3  
ATOM 2556  H HB   . THR B 2 29 ? 22.212  -2.834  -3.507  1.00 0.00 ? 53  THR B HB   3  
ATOM 2557  H HG1  . THR B 2 29 ? 20.513  -3.253  -4.713  1.00 0.00 ? 53  THR B HG1  3  
ATOM 2558  H HG21 . THR B 2 29 ? 20.292  -1.206  -1.837  1.00 0.00 ? 53  THR B HG21 3  
ATOM 2559  H HG22 . THR B 2 29 ? 21.982  -1.513  -1.429  1.00 0.00 ? 53  THR B HG22 3  
ATOM 2560  H HG23 . THR B 2 29 ? 20.836  -2.851  -1.510  1.00 0.00 ? 53  THR B HG23 3  
ATOM 2561  N N    . GLU B 2 30 ? 21.925  -1.411  -6.389  1.00 0.00 ? 54  GLU B N    3  
ATOM 2562  C CA   . GLU B 2 30 ? 22.487  -1.762  -7.676  1.00 0.00 ? 54  GLU B CA   3  
ATOM 2563  C C    . GLU B 2 30 ? 21.545  -1.352  -8.801  1.00 0.00 ? 54  GLU B C    3  
ATOM 2564  O O    . GLU B 2 30 ? 20.502  -0.743  -8.561  1.00 0.00 ? 54  GLU B O    3  
ATOM 2565  C CB   . GLU B 2 30 ? 22.729  -3.265  -7.730  1.00 0.00 ? 54  GLU B CB   3  
ATOM 2566  C CG   . GLU B 2 30 ? 23.921  -3.722  -6.907  1.00 0.00 ? 54  GLU B CG   3  
ATOM 2567  C CD   . GLU B 2 30 ? 24.239  -5.192  -7.104  1.00 0.00 ? 54  GLU B CD   3  
ATOM 2568  O OE1  . GLU B 2 30 ? 25.006  -5.515  -8.034  1.00 0.00 ? 54  GLU B OE1  3  
ATOM 2569  O OE2  . GLU B 2 30 ? 23.721  -6.020  -6.325  1.00 0.00 ? 54  GLU B OE2  3  
ATOM 2570  H H    . GLU B 2 30 ? 20.959  -1.414  -6.293  1.00 0.00 ? 54  GLU B H    3  
ATOM 2571  H HA   . GLU B 2 30 ? 23.428  -1.244  -7.789  1.00 0.00 ? 54  GLU B HA   3  
ATOM 2572  H HB2  . GLU B 2 30 ? 21.850  -3.771  -7.358  1.00 0.00 ? 54  GLU B HB2  3  
ATOM 2573  H HB3  . GLU B 2 30 ? 22.889  -3.550  -8.750  1.00 0.00 ? 54  GLU B HB3  3  
ATOM 2574  H HG2  . GLU B 2 30 ? 24.781  -3.139  -7.195  1.00 0.00 ? 54  GLU B HG2  3  
ATOM 2575  H HG3  . GLU B 2 30 ? 23.707  -3.551  -5.862  1.00 0.00 ? 54  GLU B HG3  3  
ATOM 2576  N N    . ALA B 2 31 ? 21.917  -1.690  -10.029 1.00 0.00 ? 55  ALA B N    3  
ATOM 2577  C CA   . ALA B 2 31 ? 21.106  -1.358  -11.194 1.00 0.00 ? 55  ALA B CA   3  
ATOM 2578  C C    . ALA B 2 31 ? 21.516  -2.191  -12.404 1.00 0.00 ? 55  ALA B C    3  
ATOM 2579  O O    . ALA B 2 31 ? 20.907  -3.262  -12.618 1.00 0.00 ? 55  ALA B O    3  
ATOM 2580  C CB   . ALA B 2 31 ? 21.219  0.127   -11.509 1.00 0.00 ? 55  ALA B CB   3  
ATOM 2581  O OXT  . ALA B 2 31 ? 22.440  -1.769  -13.128 1.00 0.00 ? 55  ALA B OXT  3  
ATOM 2582  H H    . ALA B 2 31 ? 22.757  -2.177  -10.155 1.00 0.00 ? 55  ALA B H    3  
ATOM 2583  H HA   . ALA B 2 31 ? 20.076  -1.573  -10.954 1.00 0.00 ? 55  ALA B HA   3  
ATOM 2584  H HB1  . ALA B 2 31 ? 22.242  0.365   -11.758 1.00 0.00 ? 55  ALA B HB1  3  
ATOM 2585  H HB2  . ALA B 2 31 ? 20.915  0.701   -10.647 1.00 0.00 ? 55  ALA B HB2  3  
ATOM 2586  H HB3  . ALA B 2 31 ? 20.579  0.368   -12.345 1.00 0.00 ? 55  ALA B HB3  3  
ATOM 2587  N N    . ALA A 1 1  ? -0.839  0.680   15.700  1.00 0.00 ? 106 ALA A N    4  
ATOM 2588  C CA   . ALA A 1 1  ? -1.616  -0.585  15.709  1.00 0.00 ? 106 ALA A CA   4  
ATOM 2589  C C    . ALA A 1 1  ? -1.239  -1.469  14.524  1.00 0.00 ? 106 ALA A C    4  
ATOM 2590  O O    . ALA A 1 1  ? -1.307  -1.041  13.372  1.00 0.00 ? 106 ALA A O    4  
ATOM 2591  C CB   . ALA A 1 1  ? -3.107  -0.288  15.689  1.00 0.00 ? 106 ALA A CB   4  
ATOM 2592  H H1   . ALA A 1 1  ? 0.181   0.474   15.742  1.00 0.00 ? 106 ALA A H1   4  
ATOM 2593  H H2   . ALA A 1 1  ? -1.096  1.264   16.521  1.00 0.00 ? 106 ALA A H2   4  
ATOM 2594  H H3   . ALA A 1 1  ? -1.037  1.216   14.831  1.00 0.00 ? 106 ALA A H3   4  
ATOM 2595  H HA   . ALA A 1 1  ? -1.393  -1.116  16.623  1.00 0.00 ? 106 ALA A HA   4  
ATOM 2596  H HB1  . ALA A 1 1  ? -3.661  -1.211  15.771  1.00 0.00 ? 106 ALA A HB1  4  
ATOM 2597  H HB2  . ALA A 1 1  ? -3.362  0.206   14.762  1.00 0.00 ? 106 ALA A HB2  4  
ATOM 2598  H HB3  . ALA A 1 1  ? -3.357  0.357   16.519  1.00 0.00 ? 106 ALA A HB3  4  
ATOM 2599  N N    . ALA A 1 2  ? -0.841  -2.704  14.818  1.00 0.00 ? 107 ALA A N    4  
ATOM 2600  C CA   . ALA A 1 2  ? -0.456  -3.651  13.777  1.00 0.00 ? 107 ALA A CA   4  
ATOM 2601  C C    . ALA A 1 2  ? -1.679  -4.345  13.192  1.00 0.00 ? 107 ALA A C    4  
ATOM 2602  O O    . ALA A 1 2  ? -2.540  -4.831  13.926  1.00 0.00 ? 107 ALA A O    4  
ATOM 2603  C CB   . ALA A 1 2  ? 0.522   -4.675  14.333  1.00 0.00 ? 107 ALA A CB   4  
ATOM 2604  H H    . ALA A 1 2  ? -0.807  -2.984  15.755  1.00 0.00 ? 107 ALA A H    4  
ATOM 2605  H HA   . ALA A 1 2  ? 0.042   -3.099  12.993  1.00 0.00 ? 107 ALA A HA   4  
ATOM 2606  H HB1  . ALA A 1 2  ? 1.370   -4.165  14.766  1.00 0.00 ? 107 ALA A HB1  4  
ATOM 2607  H HB2  . ALA A 1 2  ? 0.860   -5.318  13.535  1.00 0.00 ? 107 ALA A HB2  4  
ATOM 2608  H HB3  . ALA A 1 2  ? 0.031   -5.267  15.091  1.00 0.00 ? 107 ALA A HB3  4  
ATOM 2609  N N    . ALA A 1 3  ? -1.750  -4.389  11.867  1.00 0.00 ? 108 ALA A N    4  
ATOM 2610  C CA   . ALA A 1 3  ? -2.869  -5.020  11.178  1.00 0.00 ? 108 ALA A CA   4  
ATOM 2611  C C    . ALA A 1 3  ? -2.470  -6.363  10.585  1.00 0.00 ? 108 ALA A C    4  
ATOM 2612  O O    . ALA A 1 3  ? -1.488  -6.977  11.002  1.00 0.00 ? 108 ALA A O    4  
ATOM 2613  C CB   . ALA A 1 3  ? -3.391  -4.110  10.078  1.00 0.00 ? 108 ALA A CB   4  
ATOM 2614  H H    . ALA A 1 3  ? -1.030  -3.986  11.336  1.00 0.00 ? 108 ALA A H    4  
ATOM 2615  H HA   . ALA A 1 3  ? -3.663  -5.173  11.896  1.00 0.00 ? 108 ALA A HA   4  
ATOM 2616  H HB1  . ALA A 1 3  ? -4.445  -3.928  10.230  1.00 0.00 ? 108 ALA A HB1  4  
ATOM 2617  H HB2  . ALA A 1 3  ? -3.244  -4.593  9.117   1.00 0.00 ? 108 ALA A HB2  4  
ATOM 2618  H HB3  . ALA A 1 3  ? -2.855  -3.174  10.097  1.00 0.00 ? 108 ALA A HB3  4  
ATOM 2619  N N    . THR A 1 4  ? -3.247  -6.806  9.605   1.00 0.00 ? 109 THR A N    4  
ATOM 2620  C CA   . THR A 1 4  ? -2.988  -8.061  8.923   1.00 0.00 ? 109 THR A CA   4  
ATOM 2621  C C    . THR A 1 4  ? -1.813  -7.902  7.960   1.00 0.00 ? 109 THR A C    4  
ATOM 2622  O O    . THR A 1 4  ? -0.988  -7.005  8.126   1.00 0.00 ? 109 THR A O    4  
ATOM 2623  C CB   . THR A 1 4  ? -4.239  -8.523  8.146   1.00 0.00 ? 109 THR A CB   4  
ATOM 2624  O OG1  . THR A 1 4  ? -4.071  -9.870  7.690   1.00 0.00 ? 109 THR A OG1  4  
ATOM 2625  C CG2  . THR A 1 4  ? -4.512  -7.606  6.956   1.00 0.00 ? 109 THR A CG2  4  
ATOM 2626  H H    . THR A 1 4  ? -4.024  -6.274  9.335   1.00 0.00 ? 109 THR A H    4  
ATOM 2627  H HA   . THR A 1 4  ? -2.744  -8.808  9.665   1.00 0.00 ? 109 THR A HA   4  
ATOM 2628  H HB   . THR A 1 4  ? -5.090  -8.482  8.813   1.00 0.00 ? 109 THR A HB   4  
ATOM 2629  H HG1  . THR A 1 4  ? -4.170  -9.900  6.735   1.00 0.00 ? 109 THR A HG1  4  
ATOM 2630  H HG21 . THR A 1 4  ? -4.370  -6.574  7.249   1.00 0.00 ? 109 THR A HG21 4  
ATOM 2631  H HG22 . THR A 1 4  ? -5.529  -7.748  6.621   1.00 0.00 ? 109 THR A HG22 4  
ATOM 2632  H HG23 . THR A 1 4  ? -3.833  -7.849  6.153   1.00 0.00 ? 109 THR A HG23 4  
ATOM 2633  N N    . ASN A 1 5  ? -1.739  -8.773  6.962   1.00 0.00 ? 110 ASN A N    4  
ATOM 2634  C CA   . ASN A 1 5  ? -0.675  -8.711  5.967   1.00 0.00 ? 110 ASN A CA   4  
ATOM 2635  C C    . ASN A 1 5  ? -1.033  -7.680  4.900   1.00 0.00 ? 110 ASN A C    4  
ATOM 2636  O O    . ASN A 1 5  ? -1.881  -7.940  4.047   1.00 0.00 ? 110 ASN A O    4  
ATOM 2637  C CB   . ASN A 1 5  ? -0.464  -10.083 5.319   1.00 0.00 ? 110 ASN A CB   4  
ATOM 2638  C CG   . ASN A 1 5  ? 0.019   -11.124 6.311   1.00 0.00 ? 110 ASN A CG   4  
ATOM 2639  O OD1  . ASN A 1 5  ? -0.284  -11.052 7.502   1.00 0.00 ? 110 ASN A OD1  4  
ATOM 2640  N ND2  . ASN A 1 5  ? 0.776   -12.099 5.821   1.00 0.00 ? 110 ASN A ND2  4  
ATOM 2641  H H    . ASN A 1 5  ? -2.422  -9.467  6.889   1.00 0.00 ? 110 ASN A H    4  
ATOM 2642  H HA   . ASN A 1 5  ? 0.234   -8.408  6.462   1.00 0.00 ? 110 ASN A HA   4  
ATOM 2643  H HB2  . ASN A 1 5  ? -1.400  -10.422 4.896   1.00 0.00 ? 110 ASN A HB2  4  
ATOM 2644  H HB3  . ASN A 1 5  ? 0.269   -9.992  4.532   1.00 0.00 ? 110 ASN A HB3  4  
ATOM 2645  H HD21 . ASN A 1 5  ? 0.976   -12.092 4.861   1.00 0.00 ? 110 ASN A HD21 4  
ATOM 2646  H HD22 . ASN A 1 5  ? 1.103   -12.786 6.439   1.00 0.00 ? 110 ASN A HD22 4  
ATOM 2647  N N    . PRO A 1 6  ? -0.390  -6.498  4.925   1.00 0.00 ? 111 PRO A N    4  
ATOM 2648  C CA   . PRO A 1 6  ? -0.680  -5.426  3.966   1.00 0.00 ? 111 PRO A CA   4  
ATOM 2649  C C    . PRO A 1 6  ? -0.316  -5.786  2.529   1.00 0.00 ? 111 PRO A C    4  
ATOM 2650  O O    . PRO A 1 6  ? -0.464  -4.973  1.623   1.00 0.00 ? 111 PRO A O    4  
ATOM 2651  C CB   . PRO A 1 6  ? 0.168   -4.260  4.475   1.00 0.00 ? 111 PRO A CB   4  
ATOM 2652  C CG   . PRO A 1 6  ? 1.287   -4.912  5.206   1.00 0.00 ? 111 PRO A CG   4  
ATOM 2653  C CD   . PRO A 1 6  ? 0.675   -6.109  5.869   1.00 0.00 ? 111 PRO A CD   4  
ATOM 2654  H HA   . PRO A 1 6  ? -1.718  -5.151  3.999   1.00 0.00 ? 111 PRO A HA   4  
ATOM 2655  H HB2  . PRO A 1 6  ? 0.517   -3.673  3.643   1.00 0.00 ? 111 PRO A HB2  4  
ATOM 2656  H HB3  . PRO A 1 6  ? -0.424  -3.643  5.134   1.00 0.00 ? 111 PRO A HB3  4  
ATOM 2657  H HG2  . PRO A 1 6  ? 2.055   -5.219  4.510   1.00 0.00 ? 111 PRO A HG2  4  
ATOM 2658  H HG3  . PRO A 1 6  ? 1.692   -4.239  5.946   1.00 0.00 ? 111 PRO A HG3  4  
ATOM 2659  H HD2  . PRO A 1 6  ? 1.405   -6.899  5.977   1.00 0.00 ? 111 PRO A HD2  4  
ATOM 2660  H HD3  . PRO A 1 6  ? 0.261   -5.838  6.827   1.00 0.00 ? 111 PRO A HD3  4  
ATOM 2661  N N    . ALA A 1 7  ? 0.160   -7.006  2.323   1.00 0.00 ? 112 ALA A N    4  
ATOM 2662  C CA   . ALA A 1 7  ? 0.513   -7.467  0.987   1.00 0.00 ? 112 ALA A CA   4  
ATOM 2663  C C    . ALA A 1 7  ? -0.696  -8.110  0.331   1.00 0.00 ? 112 ALA A C    4  
ATOM 2664  O O    . ALA A 1 7  ? -1.079  -7.763  -0.785  1.00 0.00 ? 112 ALA A O    4  
ATOM 2665  C CB   . ALA A 1 7  ? 1.674   -8.436  1.052   1.00 0.00 ? 112 ALA A CB   4  
ATOM 2666  H H    . ALA A 1 7  ? 0.279   -7.611  3.085   1.00 0.00 ? 112 ALA A H    4  
ATOM 2667  H HA   . ALA A 1 7  ? 0.812   -6.609  0.403   1.00 0.00 ? 112 ALA A HA   4  
ATOM 2668  H HB1  . ALA A 1 7  ? 1.343   -9.370  1.479   1.00 0.00 ? 112 ALA A HB1  4  
ATOM 2669  H HB2  . ALA A 1 7  ? 2.446   -8.011  1.671   1.00 0.00 ? 112 ALA A HB2  4  
ATOM 2670  H HB3  . ALA A 1 7  ? 2.060   -8.609  0.057   1.00 0.00 ? 112 ALA A HB3  4  
ATOM 2671  N N    . ARG A 1 8  ? -1.287  -9.054  1.044   1.00 0.00 ? 113 ARG A N    4  
ATOM 2672  C CA   . ARG A 1 8  ? -2.485  -9.737  0.571   1.00 0.00 ? 113 ARG A CA   4  
ATOM 2673  C C    . ARG A 1 8  ? -3.694  -8.823  0.765   1.00 0.00 ? 113 ARG A C    4  
ATOM 2674  O O    . ARG A 1 8  ? -4.703  -8.931  0.067   1.00 0.00 ? 113 ARG A O    4  
ATOM 2675  C CB   . ARG A 1 8  ? -2.685  -11.048 1.331   1.00 0.00 ? 113 ARG A CB   4  
ATOM 2676  C CG   . ARG A 1 8  ? -2.632  -12.277 0.440   1.00 0.00 ? 113 ARG A CG   4  
ATOM 2677  C CD   . ARG A 1 8  ? -2.060  -13.468 1.185   1.00 0.00 ? 113 ARG A CD   4  
ATOM 2678  N NE   . ARG A 1 8  ? -1.884  -14.630 0.318   1.00 0.00 ? 113 ARG A NE   4  
ATOM 2679  C CZ   . ARG A 1 8  ? -1.650  -15.861 0.770   1.00 0.00 ? 113 ARG A CZ   4  
ATOM 2680  N NH1  . ARG A 1 8  ? -1.582  -16.091 2.074   1.00 0.00 ? 113 ARG A NH1  4  
ATOM 2681  N NH2  . ARG A 1 8  ? -1.487  -16.861 -0.084  1.00 0.00 ? 113 ARG A NH2  4  
ATOM 2682  H H    . ARG A 1 8  ? -0.896  -9.306  1.909   1.00 0.00 ? 113 ARG A H    4  
ATOM 2683  H HA   . ARG A 1 8  ? -2.361  -9.949  -0.480  1.00 0.00 ? 113 ARG A HA   4  
ATOM 2684  H HB2  . ARG A 1 8  ? -1.910  -11.137 2.079   1.00 0.00 ? 113 ARG A HB2  4  
ATOM 2685  H HB3  . ARG A 1 8  ? -3.647  -11.024 1.820   1.00 0.00 ? 113 ARG A HB3  4  
ATOM 2686  H HG2  . ARG A 1 8  ? -3.630  -12.517 0.109   1.00 0.00 ? 113 ARG A HG2  4  
ATOM 2687  H HG3  . ARG A 1 8  ? -2.006  -12.065 -0.416  1.00 0.00 ? 113 ARG A HG3  4  
ATOM 2688  H HD2  . ARG A 1 8  ? -1.101  -13.186 1.591   1.00 0.00 ? 113 ARG A HD2  4  
ATOM 2689  H HD3  . ARG A 1 8  ? -2.729  -13.728 1.992   1.00 0.00 ? 113 ARG A HD3  4  
ATOM 2690  H HE   . ARG A 1 8  ? -1.936  -14.486 -0.649  1.00 0.00 ? 113 ARG A HE   4  
ATOM 2691  H HH11 . ARG A 1 8  ? -1.707  -15.339 2.723   1.00 0.00 ? 113 ARG A HH11 4  
ATOM 2692  H HH12 . ARG A 1 8  ? -1.408  -17.016 2.411   1.00 0.00 ? 113 ARG A HH12 4  
ATOM 2693  H HH21 . ARG A 1 8  ? -1.541  -16.693 -1.069  1.00 0.00 ? 113 ARG A HH21 4  
ATOM 2694  H HH22 . ARG A 1 8  ? -1.313  -17.785 0.256   1.00 0.00 ? 113 ARG A HH22 4  
ATOM 2695  N N    . TYR A 1 9  ? -3.554  -7.915  1.725   1.00 0.00 ? 114 TYR A N    4  
ATOM 2696  C CA   . TYR A 1 9  ? -4.587  -6.941  2.058   1.00 0.00 ? 114 TYR A CA   4  
ATOM 2697  C C    . TYR A 1 9  ? -4.836  -6.002  0.879   1.00 0.00 ? 114 TYR A C    4  
ATOM 2698  O O    . TYR A 1 9  ? -5.972  -5.877  0.416   1.00 0.00 ? 114 TYR A O    4  
ATOM 2699  C CB   . TYR A 1 9  ? -4.152  -6.203  3.341   1.00 0.00 ? 114 TYR A CB   4  
ATOM 2700  C CG   . TYR A 1 9  ? -4.662  -4.788  3.545   1.00 0.00 ? 114 TYR A CG   4  
ATOM 2701  C CD1  . TYR A 1 9  ? -5.842  -4.330  2.978   1.00 0.00 ? 114 TYR A CD1  4  
ATOM 2702  C CD2  . TYR A 1 9  ? -3.932  -3.907  4.332   1.00 0.00 ? 114 TYR A CD2  4  
ATOM 2703  C CE1  . TYR A 1 9  ? -6.276  -3.038  3.183   1.00 0.00 ? 114 TYR A CE1  4  
ATOM 2704  C CE2  . TYR A 1 9  ? -4.355  -2.618  4.548   1.00 0.00 ? 114 TYR A CE2  4  
ATOM 2705  C CZ   . TYR A 1 9  ? -5.530  -2.182  3.969   1.00 0.00 ? 114 TYR A CZ   4  
ATOM 2706  O OH   . TYR A 1 9  ? -5.961  -0.892  4.177   1.00 0.00 ? 114 TYR A OH   4  
ATOM 2707  H H    . TYR A 1 9  ? -2.717  -7.899  2.233   1.00 0.00 ? 114 TYR A H    4  
ATOM 2708  H HA   . TYR A 1 9  ? -5.502  -7.474  2.262   1.00 0.00 ? 114 TYR A HA   4  
ATOM 2709  H HB2  . TYR A 1 9  ? -4.480  -6.779  4.190   1.00 0.00 ? 114 TYR A HB2  4  
ATOM 2710  H HB3  . TYR A 1 9  ? -3.072  -6.163  3.355   1.00 0.00 ? 114 TYR A HB3  4  
ATOM 2711  H HD1  . TYR A 1 9  ? -6.426  -4.999  2.365   1.00 0.00 ? 114 TYR A HD1  4  
ATOM 2712  H HD2  . TYR A 1 9  ? -3.016  -4.248  4.786   1.00 0.00 ? 114 TYR A HD2  4  
ATOM 2713  H HE1  . TYR A 1 9  ? -7.193  -2.705  2.727   1.00 0.00 ? 114 TYR A HE1  4  
ATOM 2714  H HE2  . TYR A 1 9  ? -3.760  -1.958  5.165   1.00 0.00 ? 114 TYR A HE2  4  
ATOM 2715  H HH   . TYR A 1 9  ? -6.905  -0.894  4.355   1.00 0.00 ? 114 TYR A HH   4  
ATOM 2716  N N    . CYS A 1 10 ? -3.792  -5.350  0.379   1.00 0.00 ? 115 CYS A N    4  
ATOM 2717  C CA   . CYS A 1 10 ? -3.955  -4.442  -0.750  1.00 0.00 ? 115 CYS A CA   4  
ATOM 2718  C C    . CYS A 1 10 ? -4.148  -5.226  -2.046  1.00 0.00 ? 115 CYS A C    4  
ATOM 2719  O O    . CYS A 1 10 ? -4.552  -4.670  -3.066  1.00 0.00 ? 115 CYS A O    4  
ATOM 2720  C CB   . CYS A 1 10 ? -2.763  -3.494  -0.882  1.00 0.00 ? 115 CYS A CB   4  
ATOM 2721  S SG   . CYS A 1 10 ? -2.101  -2.884  0.702   1.00 0.00 ? 115 CYS A SG   4  
ATOM 2722  H H    . CYS A 1 10 ? -2.904  -5.480  0.775   1.00 0.00 ? 115 CYS A H    4  
ATOM 2723  H HA   . CYS A 1 10 ? -4.845  -3.857  -0.570  1.00 0.00 ? 115 CYS A HA   4  
ATOM 2724  H HB2  . CYS A 1 10 ? -1.960  -4.000  -1.400  1.00 0.00 ? 115 CYS A HB2  4  
ATOM 2725  H HB3  . CYS A 1 10 ? -3.070  -2.637  -1.464  1.00 0.00 ? 115 CYS A HB3  4  
ATOM 2726  N N    . CYS A 1 11 ? -3.854  -6.519  -2.008  1.00 0.00 ? 116 CYS A N    4  
ATOM 2727  C CA   . CYS A 1 11 ? -4.013  -7.365  -3.186  1.00 0.00 ? 116 CYS A CA   4  
ATOM 2728  C C    . CYS A 1 11 ? -5.484  -7.699  -3.395  1.00 0.00 ? 116 CYS A C    4  
ATOM 2729  O O    . CYS A 1 11 ? -5.928  -7.934  -4.519  1.00 0.00 ? 116 CYS A O    4  
ATOM 2730  C CB   . CYS A 1 11 ? -3.200  -8.654  -3.035  1.00 0.00 ? 116 CYS A CB   4  
ATOM 2731  S SG   . CYS A 1 11 ? -3.353  -9.804  -4.443  1.00 0.00 ? 116 CYS A SG   4  
ATOM 2732  H H    . CYS A 1 11 ? -3.522  -6.913  -1.174  1.00 0.00 ? 116 CYS A H    4  
ATOM 2733  H HA   . CYS A 1 11 ? -3.656  -6.814  -4.043  1.00 0.00 ? 116 CYS A HA   4  
ATOM 2734  H HB2  . CYS A 1 11 ? -2.158  -8.404  -2.930  1.00 0.00 ? 116 CYS A HB2  4  
ATOM 2735  H HB3  . CYS A 1 11 ? -3.525  -9.174  -2.151  1.00 0.00 ? 116 CYS A HB3  4  
ATOM 2736  N N    . LEU A 1 12 ? -6.234  -7.719  -2.298  1.00 0.00 ? 117 LEU A N    4  
ATOM 2737  C CA   . LEU A 1 12 ? -7.655  -8.019  -2.345  1.00 0.00 ? 117 LEU A CA   4  
ATOM 2738  C C    . LEU A 1 12 ? -8.477  -6.797  -2.749  1.00 0.00 ? 117 LEU A C    4  
ATOM 2739  O O    . LEU A 1 12 ? -9.496  -6.929  -3.429  1.00 0.00 ? 117 LEU A O    4  
ATOM 2740  C CB   . LEU A 1 12 ? -8.119  -8.533  -0.986  1.00 0.00 ? 117 LEU A CB   4  
ATOM 2741  C CG   . LEU A 1 12 ? -8.073  -10.051 -0.813  1.00 0.00 ? 117 LEU A CG   4  
ATOM 2742  C CD1  . LEU A 1 12 ? -8.350  -10.433 0.632   1.00 0.00 ? 117 LEU A CD1  4  
ATOM 2743  C CD2  . LEU A 1 12 ? -9.073  -10.725 -1.741  1.00 0.00 ? 117 LEU A CD2  4  
ATOM 2744  H H    . LEU A 1 12 ? -5.819  -7.532  -1.430  1.00 0.00 ? 117 LEU A H    4  
ATOM 2745  H HA   . LEU A 1 12 ? -7.803  -8.796  -3.075  1.00 0.00 ? 117 LEU A HA   4  
ATOM 2746  H HB2  . LEU A 1 12 ? -7.490  -8.088  -0.231  1.00 0.00 ? 117 LEU A HB2  4  
ATOM 2747  H HB3  . LEU A 1 12 ? -9.131  -8.201  -0.826  1.00 0.00 ? 117 LEU A HB3  4  
ATOM 2748  H HG   . LEU A 1 12 ? -7.085  -10.408 -1.069  1.00 0.00 ? 117 LEU A HG   4  
ATOM 2749  H HD11 . LEU A 1 12 ? -7.600  -9.990  1.271   1.00 0.00 ? 117 LEU A HD11 4  
ATOM 2750  H HD12 . LEU A 1 12 ? -8.320  -11.508 0.733   1.00 0.00 ? 117 LEU A HD12 4  
ATOM 2751  H HD13 . LEU A 1 12 ? -9.326  -10.072 0.920   1.00 0.00 ? 117 LEU A HD13 4  
ATOM 2752  H HD21 . LEU A 1 12 ? -8.850  -10.459 -2.764  1.00 0.00 ? 117 LEU A HD21 4  
ATOM 2753  H HD22 . LEU A 1 12 ? -10.071 -10.396 -1.494  1.00 0.00 ? 117 LEU A HD22 4  
ATOM 2754  H HD23 . LEU A 1 12 ? -9.008  -11.796 -1.625  1.00 0.00 ? 117 LEU A HD23 4  
ATOM 2755  N N    . SER A 1 13 ? -8.038  -5.610  -2.331  1.00 0.00 ? 118 SER A N    4  
ATOM 2756  C CA   . SER A 1 13 ? -8.759  -4.386  -2.649  1.00 0.00 ? 118 SER A CA   4  
ATOM 2757  C C    . SER A 1 13 ? -7.824  -3.240  -3.039  1.00 0.00 ? 118 SER A C    4  
ATOM 2758  O O    . SER A 1 13 ? -8.157  -2.436  -3.909  1.00 0.00 ? 118 SER A O    4  
ATOM 2759  C CB   . SER A 1 13 ? -9.608  -3.969  -1.452  1.00 0.00 ? 118 SER A CB   4  
ATOM 2760  O OG   . SER A 1 13 ? -10.872 -4.609  -1.473  1.00 0.00 ? 118 SER A OG   4  
ATOM 2761  H H    . SER A 1 13 ? -7.225  -5.558  -1.792  1.00 0.00 ? 118 SER A H    4  
ATOM 2762  H HA   . SER A 1 13 ? -9.413  -4.596  -3.479  1.00 0.00 ? 118 SER A HA   4  
ATOM 2763  H HB2  . SER A 1 13 ? -9.097  -4.240  -0.540  1.00 0.00 ? 118 SER A HB2  4  
ATOM 2764  H HB3  . SER A 1 13 ? -9.753  -2.905  -1.477  1.00 0.00 ? 118 SER A HB3  4  
ATOM 2765  H HG   . SER A 1 13 ? -10.973 -5.094  -2.295  1.00 0.00 ? 118 SER A HG   4  
ATOM 2766  N N    . GLY A 1 14 ? -6.659  -3.163  -2.400  1.00 0.00 ? 119 GLY A N    4  
ATOM 2767  C CA   . GLY A 1 14 ? -5.725  -2.093  -2.698  1.00 0.00 ? 119 GLY A CA   4  
ATOM 2768  C C    . GLY A 1 14 ? -5.464  -1.223  -1.488  1.00 0.00 ? 119 GLY A C    4  
ATOM 2769  O O    . GLY A 1 14 ? -6.132  -1.370  -0.465  1.00 0.00 ? 119 GLY A O    4  
ATOM 2770  H H    . GLY A 1 14 ? -6.423  -3.839  -1.728  1.00 0.00 ? 119 GLY A H    4  
ATOM 2771  H HA2  . GLY A 1 14 ? -4.792  -2.525  -3.026  1.00 0.00 ? 119 GLY A HA2  4  
ATOM 2772  H HA3  . GLY A 1 14 ? -6.132  -1.485  -3.496  1.00 0.00 ? 119 GLY A HA3  4  
ATOM 2773  N N    . CYS A 1 15 ? -4.498  -0.313  -1.591  1.00 0.00 ? 120 CYS A N    4  
ATOM 2774  C CA   . CYS A 1 15 ? -4.177  0.554   -0.465  1.00 0.00 ? 120 CYS A CA   4  
ATOM 2775  C C    . CYS A 1 15 ? -3.871  1.976   -0.897  1.00 0.00 ? 120 CYS A C    4  
ATOM 2776  O O    . CYS A 1 15 ? -3.195  2.208   -1.898  1.00 0.00 ? 120 CYS A O    4  
ATOM 2777  C CB   . CYS A 1 15 ? -3.013  -0.013  0.346   1.00 0.00 ? 120 CYS A CB   4  
ATOM 2778  S SG   . CYS A 1 15 ? -3.447  -1.497  1.308   1.00 0.00 ? 120 CYS A SG   4  
ATOM 2779  H H    . CYS A 1 15 ? -4.003  -0.222  -2.433  1.00 0.00 ? 120 CYS A H    4  
ATOM 2780  H HA   . CYS A 1 15 ? -5.042  0.581   0.165   1.00 0.00 ? 120 CYS A HA   4  
ATOM 2781  H HB2  . CYS A 1 15 ? -2.210  -0.275  -0.319  1.00 0.00 ? 120 CYS A HB2  4  
ATOM 2782  H HB3  . CYS A 1 15 ? -2.667  0.740   1.037   1.00 0.00 ? 120 CYS A HB3  4  
ATOM 2783  N N    . THR A 1 16 ? -4.391  2.925   -0.124  1.00 0.00 ? 121 THR A N    4  
ATOM 2784  C CA   . THR A 1 16 ? -4.176  4.335   -0.391  1.00 0.00 ? 121 THR A CA   4  
ATOM 2785  C C    . THR A 1 16 ? -2.798  4.751   0.050   1.00 0.00 ? 121 THR A C    4  
ATOM 2786  O O    . THR A 1 16 ? -2.191  4.106   0.904   1.00 0.00 ? 121 THR A O    4  
ATOM 2787  C CB   . THR A 1 16 ? -5.180  5.226   0.360   1.00 0.00 ? 121 THR A CB   4  
ATOM 2788  O OG1  . THR A 1 16 ? -5.090  4.994   1.770   1.00 0.00 ? 121 THR A OG1  4  
ATOM 2789  C CG2  . THR A 1 16 ? -6.584  4.963   -0.113  1.00 0.00 ? 121 THR A CG2  4  
ATOM 2790  H H    . THR A 1 16 ? -4.936  2.664   0.647   1.00 0.00 ? 121 THR A H    4  
ATOM 2791  H HA   . THR A 1 16 ? -4.284  4.508   -1.451  1.00 0.00 ? 121 THR A HA   4  
ATOM 2792  H HB   . THR A 1 16 ? -4.940  6.257   0.156   1.00 0.00 ? 121 THR A HB   4  
ATOM 2793  H HG1  . THR A 1 16 ? -4.575  4.201   1.932   1.00 0.00 ? 121 THR A HG1  4  
ATOM 2794  H HG21 . THR A 1 16 ? -6.530  4.486   -1.069  1.00 0.00 ? 121 THR A HG21 4  
ATOM 2795  H HG22 . THR A 1 16 ? -7.119  5.898   -0.199  1.00 0.00 ? 121 THR A HG22 4  
ATOM 2796  H HG23 . THR A 1 16 ? -7.088  4.316   0.589   1.00 0.00 ? 121 THR A HG23 4  
ATOM 2797  N N    . GLN A 1 17 ? -2.309  5.837   -0.521  1.00 0.00 ? 122 GLN A N    4  
ATOM 2798  C CA   . GLN A 1 17 ? -1.014  6.359   -0.142  1.00 0.00 ? 122 GLN A CA   4  
ATOM 2799  C C    . GLN A 1 17 ? -0.991  6.553   1.362   1.00 0.00 ? 122 GLN A C    4  
ATOM 2800  O O    . GLN A 1 17 ? 0.066   6.612   1.972   1.00 0.00 ? 122 GLN A O    4  
ATOM 2801  C CB   . GLN A 1 17 ? -0.740  7.677   -0.860  1.00 0.00 ? 122 GLN A CB   4  
ATOM 2802  C CG   . GLN A 1 17 ? 0.125   7.523   -2.099  1.00 0.00 ? 122 GLN A CG   4  
ATOM 2803  C CD   . GLN A 1 17 ? 0.197   8.789   -2.927  1.00 0.00 ? 122 GLN A CD   4  
ATOM 2804  O OE1  . GLN A 1 17 ? 0.042   9.896   -2.409  1.00 0.00 ? 122 GLN A OE1  4  
ATOM 2805  N NE2  . GLN A 1 17 ? 0.444   8.632   -4.220  1.00 0.00 ? 122 GLN A NE2  4  
ATOM 2806  H H    . GLN A 1 17 ? -2.836  6.301   -1.205  1.00 0.00 ? 122 GLN A H    4  
ATOM 2807  H HA   . GLN A 1 17 ? -0.250  5.626   -0.407  1.00 0.00 ? 122 GLN A HA   4  
ATOM 2808  H HB2  . GLN A 1 17 ? -1.681  8.115   -1.156  1.00 0.00 ? 122 GLN A HB2  4  
ATOM 2809  H HB3  . GLN A 1 17 ? -0.242  8.347   -0.180  1.00 0.00 ? 122 GLN A HB3  4  
ATOM 2810  H HG2  . GLN A 1 17 ? 1.123   7.257   -1.790  1.00 0.00 ? 122 GLN A HG2  4  
ATOM 2811  H HG3  . GLN A 1 17 ? -0.282  6.729   -2.709  1.00 0.00 ? 122 GLN A HG3  4  
ATOM 2812  H HE21 . GLN A 1 17 ? 0.566   7.720   -4.558  1.00 0.00 ? 122 GLN A HE21 4  
ATOM 2813  H HE22 . GLN A 1 17 ? 0.498   9.432   -4.784  1.00 0.00 ? 122 GLN A HE22 4  
ATOM 2814  N N    . GLN A 1 18 ? -2.174  6.643   1.960   1.00 0.00 ? 123 GLN A N    4  
ATOM 2815  C CA   . GLN A 1 18 ? -2.268  6.785   3.392   1.00 0.00 ? 123 GLN A CA   4  
ATOM 2816  C C    . GLN A 1 18 ? -1.858  5.476   4.028   1.00 0.00 ? 123 GLN A C    4  
ATOM 2817  O O    . GLN A 1 18 ? -0.962  5.437   4.870   1.00 0.00 ? 123 GLN A O    4  
ATOM 2818  C CB   . GLN A 1 18 ? -3.686  7.149   3.801   1.00 0.00 ? 123 GLN A CB   4  
ATOM 2819  C CG   . GLN A 1 18 ? -4.102  8.551   3.390   1.00 0.00 ? 123 GLN A CG   4  
ATOM 2820  C CD   . GLN A 1 18 ? -5.579  8.812   3.619   1.00 0.00 ? 123 GLN A CD   4  
ATOM 2821  O OE1  . GLN A 1 18 ? -5.985  9.939   3.898   1.00 0.00 ? 123 GLN A OE1  4  
ATOM 2822  N NE2  . GLN A 1 18 ? -6.391  7.767   3.497   1.00 0.00 ? 123 GLN A NE2  4  
ATOM 2823  H H    . GLN A 1 18 ? -3.002  6.596   1.428   1.00 0.00 ? 123 GLN A H    4  
ATOM 2824  H HA   . GLN A 1 18 ? -1.589  7.560   3.705   1.00 0.00 ? 123 GLN A HA   4  
ATOM 2825  H HB2  . GLN A 1 18 ? -4.364  6.449   3.345   1.00 0.00 ? 123 GLN A HB2  4  
ATOM 2826  H HB3  . GLN A 1 18 ? -3.762  7.069   4.867   1.00 0.00 ? 123 GLN A HB3  4  
ATOM 2827  H HG2  . GLN A 1 18 ? -3.533  9.265   3.967   1.00 0.00 ? 123 GLN A HG2  4  
ATOM 2828  H HG3  . GLN A 1 18 ? -3.885  8.685   2.340   1.00 0.00 ? 123 GLN A HG3  4  
ATOM 2829  H HE21 . GLN A 1 18 ? -5.997  6.897   3.269   1.00 0.00 ? 123 GLN A HE21 4  
ATOM 2830  H HE22 . GLN A 1 18 ? -7.350  7.908   3.637   1.00 0.00 ? 123 GLN A HE22 4  
ATOM 2831  N N    . ASP A 1 19 ? -2.511  4.396   3.602   1.00 0.00 ? 124 ASP A N    4  
ATOM 2832  C CA   . ASP A 1 19 ? -2.185  3.074   4.107   1.00 0.00 ? 124 ASP A CA   4  
ATOM 2833  C C    . ASP A 1 19 ? -0.697  2.824   3.921   1.00 0.00 ? 124 ASP A C    4  
ATOM 2834  O O    . ASP A 1 19 ? 0.018   2.503   4.869   1.00 0.00 ? 124 ASP A O    4  
ATOM 2835  C CB   . ASP A 1 19 ? -2.999  2.005   3.368   1.00 0.00 ? 124 ASP A CB   4  
ATOM 2836  C CG   . ASP A 1 19 ? -4.042  1.358   4.254   1.00 0.00 ? 124 ASP A CG   4  
ATOM 2837  O OD1  . ASP A 1 19 ? -3.685  0.425   5.005   1.00 0.00 ? 124 ASP A OD1  4  
ATOM 2838  O OD2  . ASP A 1 19 ? -5.214  1.787   4.202   1.00 0.00 ? 124 ASP A OD2  4  
ATOM 2839  H H    . ASP A 1 19 ? -3.223  4.496   2.929   1.00 0.00 ? 124 ASP A H    4  
ATOM 2840  H HA   . ASP A 1 19 ? -2.424  3.044   5.159   1.00 0.00 ? 124 ASP A HA   4  
ATOM 2841  H HB2  . ASP A 1 19 ? -3.503  2.463   2.529   1.00 0.00 ? 124 ASP A HB2  4  
ATOM 2842  H HB3  . ASP A 1 19 ? -2.331  1.236   3.002   1.00 0.00 ? 124 ASP A HB3  4  
ATOM 2843  N N    . LEU A 1 20 ? -0.236  3.011   2.689   1.00 0.00 ? 125 LEU A N    4  
ATOM 2844  C CA   . LEU A 1 20 ? 1.164   2.819   2.356   1.00 0.00 ? 125 LEU A CA   4  
ATOM 2845  C C    . LEU A 1 20 ? 2.045   3.779   3.157   1.00 0.00 ? 125 LEU A C    4  
ATOM 2846  O O    . LEU A 1 20 ? 3.187   3.455   3.489   1.00 0.00 ? 125 LEU A O    4  
ATOM 2847  C CB   . LEU A 1 20 ? 1.365   2.984   0.844   1.00 0.00 ? 125 LEU A CB   4  
ATOM 2848  C CG   . LEU A 1 20 ? 0.551   2.009   -0.001  1.00 0.00 ? 125 LEU A CG   4  
ATOM 2849  C CD1  . LEU A 1 20 ? -0.372  2.755   -0.943  1.00 0.00 ? 125 LEU A CD1  4  
ATOM 2850  C CD2  . LEU A 1 20 ? 1.468   1.117   -0.790  1.00 0.00 ? 125 LEU A CD2  4  
ATOM 2851  H H    . LEU A 1 20 ? -0.858  3.286   1.986   1.00 0.00 ? 125 LEU A H    4  
ATOM 2852  H HA   . LEU A 1 20 ? 1.426   1.808   2.633   1.00 0.00 ? 125 LEU A HA   4  
ATOM 2853  H HB2  . LEU A 1 20 ? 1.098   3.981   0.554   1.00 0.00 ? 125 LEU A HB2  4  
ATOM 2854  H HB3  . LEU A 1 20 ? 2.402   2.842   0.614   1.00 0.00 ? 125 LEU A HB3  4  
ATOM 2855  H HG   . LEU A 1 20 ? -0.051  1.389   0.645   1.00 0.00 ? 125 LEU A HG   4  
ATOM 2856  H HD11 . LEU A 1 20 ? -1.389  2.680   -0.586  1.00 0.00 ? 125 LEU A HD11 4  
ATOM 2857  H HD12 . LEU A 1 20 ? -0.300  2.317   -1.928  1.00 0.00 ? 125 LEU A HD12 4  
ATOM 2858  H HD13 . LEU A 1 20 ? -0.081  3.794   -0.989  1.00 0.00 ? 125 LEU A HD13 4  
ATOM 2859  H HD21 . LEU A 1 20 ? 2.286   0.794   -0.163  1.00 0.00 ? 125 LEU A HD21 4  
ATOM 2860  H HD22 . LEU A 1 20 ? 1.853   1.677   -1.632  1.00 0.00 ? 125 LEU A HD22 4  
ATOM 2861  H HD23 . LEU A 1 20 ? 0.923   0.258   -1.145  1.00 0.00 ? 125 LEU A HD23 4  
ATOM 2862  N N    . LEU A 1 21 ? 1.505   4.958   3.480   1.00 0.00 ? 126 LEU A N    4  
ATOM 2863  C CA   . LEU A 1 21 ? 2.243   5.934   4.270   1.00 0.00 ? 126 LEU A CA   4  
ATOM 2864  C C    . LEU A 1 21 ? 2.526   5.363   5.651   1.00 0.00 ? 126 LEU A C    4  
ATOM 2865  O O    . LEU A 1 21 ? 3.502   5.735   6.305   1.00 0.00 ? 126 LEU A O    4  
ATOM 2866  C CB   . LEU A 1 21 ? 1.452   7.242   4.399   1.00 0.00 ? 126 LEU A CB   4  
ATOM 2867  C CG   . LEU A 1 21 ? 1.854   8.348   3.422   1.00 0.00 ? 126 LEU A CG   4  
ATOM 2868  C CD1  . LEU A 1 21 ? 0.966   9.570   3.604   1.00 0.00 ? 126 LEU A CD1  4  
ATOM 2869  C CD2  . LEU A 1 21 ? 3.318   8.723   3.600   1.00 0.00 ? 126 LEU A CD2  4  
ATOM 2870  H H    . LEU A 1 21 ? 0.596   5.172   3.179   1.00 0.00 ? 126 LEU A H    4  
ATOM 2871  H HA   . LEU A 1 21 ? 3.180   6.130   3.772   1.00 0.00 ? 126 LEU A HA   4  
ATOM 2872  H HB2  . LEU A 1 21 ? 0.407   7.019   4.244   1.00 0.00 ? 126 LEU A HB2  4  
ATOM 2873  H HB3  . LEU A 1 21 ? 1.573   7.618   5.401   1.00 0.00 ? 126 LEU A HB3  4  
ATOM 2874  H HG   . LEU A 1 21 ? 1.719   7.988   2.412   1.00 0.00 ? 126 LEU A HG   4  
ATOM 2875  H HD11 . LEU A 1 21 ? -0.063  9.302   3.412   1.00 0.00 ? 126 LEU A HD11 4  
ATOM 2876  H HD12 . LEU A 1 21 ? 1.270   10.344  2.913   1.00 0.00 ? 126 LEU A HD12 4  
ATOM 2877  H HD13 . LEU A 1 21 ? 1.060   9.935   4.617   1.00 0.00 ? 126 LEU A HD13 4  
ATOM 2878  H HD21 . LEU A 1 21 ? 3.488   9.034   4.620   1.00 0.00 ? 126 LEU A HD21 4  
ATOM 2879  H HD22 . LEU A 1 21 ? 3.567   9.532   2.932   1.00 0.00 ? 126 LEU A HD22 4  
ATOM 2880  H HD23 . LEU A 1 21 ? 3.938   7.867   3.377   1.00 0.00 ? 126 LEU A HD23 4  
ATOM 2881  N N    . THR A 1 22 ? 1.659   4.454   6.089   1.00 0.00 ? 127 THR A N    4  
ATOM 2882  C CA   . THR A 1 22 ? 1.808   3.820   7.389   1.00 0.00 ? 127 THR A CA   4  
ATOM 2883  C C    . THR A 1 22 ? 2.597   2.519   7.273   1.00 0.00 ? 127 THR A C    4  
ATOM 2884  O O    . THR A 1 22 ? 3.080   1.988   8.273   1.00 0.00 ? 127 THR A O    4  
ATOM 2885  C CB   . THR A 1 22 ? 0.445   3.510   8.048   1.00 0.00 ? 127 THR A CB   4  
ATOM 2886  O OG1  . THR A 1 22 ? 0.071   2.153   7.783   1.00 0.00 ? 127 THR A OG1  4  
ATOM 2887  C CG2  . THR A 1 22 ? -0.646  4.439   7.537   1.00 0.00 ? 127 THR A CG2  4  
ATOM 2888  H H    . THR A 1 22 ? 0.898   4.210   5.522   1.00 0.00 ? 127 THR A H    4  
ATOM 2889  H HA   . THR A 1 22 ? 2.349   4.499   8.032   1.00 0.00 ? 127 THR A HA   4  
ATOM 2890  H HB   . THR A 1 22 ? 0.540   3.647   9.115   1.00 0.00 ? 127 THR A HB   4  
ATOM 2891  H HG1  . THR A 1 22 ? 0.535   1.569   8.387   1.00 0.00 ? 127 THR A HG1  4  
ATOM 2892  H HG21 . THR A 1 22 ? -0.270  5.449   7.477   1.00 0.00 ? 127 THR A HG21 4  
ATOM 2893  H HG22 . THR A 1 22 ? -1.489  4.410   8.211   1.00 0.00 ? 127 THR A HG22 4  
ATOM 2894  H HG23 . THR A 1 22 ? -0.962  4.115   6.556   1.00 0.00 ? 127 THR A HG23 4  
ATOM 2895  N N    . LEU A 1 23 ? 2.729   2.002   6.048   1.00 0.00 ? 128 LEU A N    4  
ATOM 2896  C CA   . LEU A 1 23 ? 3.452   0.770   5.822   1.00 0.00 ? 128 LEU A CA   4  
ATOM 2897  C C    . LEU A 1 23 ? 4.879   1.095   5.398   1.00 0.00 ? 128 LEU A C    4  
ATOM 2898  O O    . LEU A 1 23 ? 5.702   0.208   5.173   1.00 0.00 ? 128 LEU A O    4  
ATOM 2899  C CB   . LEU A 1 23 ? 2.720   -0.053  4.766   1.00 0.00 ? 128 LEU A CB   4  
ATOM 2900  C CG   . LEU A 1 23 ? 1.223   -0.215  5.033   1.00 0.00 ? 128 LEU A CG   4  
ATOM 2901  C CD1  . LEU A 1 23 ? 0.491   -0.660  3.782   1.00 0.00 ? 128 LEU A CD1  4  
ATOM 2902  C CD2  . LEU A 1 23 ? 1.005   -1.205  6.153   1.00 0.00 ? 128 LEU A CD2  4  
ATOM 2903  H H    . LEU A 1 23 ? 2.354   2.472   5.271   1.00 0.00 ? 128 LEU A H    4  
ATOM 2904  H HA   . LEU A 1 23 ? 3.474   0.215   6.749   1.00 0.00 ? 128 LEU A HA   4  
ATOM 2905  H HB2  . LEU A 1 23 ? 2.848   0.417   3.811   1.00 0.00 ? 128 LEU A HB2  4  
ATOM 2906  H HB3  . LEU A 1 23 ? 3.164   -1.031  4.732   1.00 0.00 ? 128 LEU A HB3  4  
ATOM 2907  H HG   . LEU A 1 23 ? 0.815   0.733   5.342   1.00 0.00 ? 128 LEU A HG   4  
ATOM 2908  H HD11 . LEU A 1 23 ? 0.735   -1.689  3.571   1.00 0.00 ? 128 LEU A HD11 4  
ATOM 2909  H HD12 . LEU A 1 23 ? 0.790   -0.039  2.950   1.00 0.00 ? 128 LEU A HD12 4  
ATOM 2910  H HD13 . LEU A 1 23 ? -0.574  -0.566  3.936   1.00 0.00 ? 128 LEU A HD13 4  
ATOM 2911  H HD21 . LEU A 1 23 ? 1.193   -0.725  7.103   1.00 0.00 ? 128 LEU A HD21 4  
ATOM 2912  H HD22 . LEU A 1 23 ? 1.685   -2.023  6.024   1.00 0.00 ? 128 LEU A HD22 4  
ATOM 2913  H HD23 . LEU A 1 23 ? -0.011  -1.569  6.126   1.00 0.00 ? 128 LEU A HD23 4  
ATOM 2914  N N    . CYS A 1 24 ? 5.146   2.397   5.297   1.00 0.00 ? 129 CYS A N    4  
ATOM 2915  C CA   . CYS A 1 24 ? 6.461   2.909   4.923   1.00 0.00 ? 129 CYS A CA   4  
ATOM 2916  C C    . CYS A 1 24 ? 7.572   2.411   5.856   1.00 0.00 ? 129 CYS A C    4  
ATOM 2917  O O    . CYS A 1 24 ? 8.642   2.007   5.402   1.00 0.00 ? 129 CYS A O    4  
ATOM 2918  C CB   . CYS A 1 24 ? 6.434   4.444   4.890   1.00 0.00 ? 129 CYS A CB   4  
ATOM 2919  S SG   . CYS A 1 24 ? 8.049   5.234   4.594   1.00 0.00 ? 129 CYS A SG   4  
ATOM 2920  H H    . CYS A 1 24 ? 4.424   3.040   5.467   1.00 0.00 ? 129 CYS A H    4  
ATOM 2921  H HA   . CYS A 1 24 ? 6.663   2.553   3.957   1.00 0.00 ? 129 CYS A HA   4  
ATOM 2922  H HB2  . CYS A 1 24 ? 5.767   4.763   4.104   1.00 0.00 ? 129 CYS A HB2  4  
ATOM 2923  H HB3  . CYS A 1 24 ? 6.060   4.809   5.835   1.00 0.00 ? 129 CYS A HB3  4  
ATOM 2924  N N    . PRO A 1 25 ? 7.321   2.434   7.167   1.00 0.00 ? 130 PRO A N    4  
ATOM 2925  C CA   . PRO A 1 25 ? 8.272   2.000   8.179   1.00 0.00 ? 130 PRO A CA   4  
ATOM 2926  C C    . PRO A 1 25 ? 8.189   0.501   8.447   1.00 0.00 ? 130 PRO A C    4  
ATOM 2927  O O    . PRO A 1 25 ? 8.835   -0.015  9.359   1.00 0.00 ? 130 PRO A O    4  
ATOM 2928  C CB   . PRO A 1 25 ? 7.840   2.796   9.410   1.00 0.00 ? 130 PRO A CB   4  
ATOM 2929  C CG   . PRO A 1 25 ? 6.378   3.062   9.223   1.00 0.00 ? 130 PRO A CG   4  
ATOM 2930  C CD   . PRO A 1 25 ? 6.068   2.886   7.755   1.00 0.00 ? 130 PRO A CD   4  
ATOM 2931  H HA   . PRO A 1 25 ? 9.285   2.264   7.912   1.00 0.00 ? 130 PRO A HA   4  
ATOM 2932  H HB2  . PRO A 1 25 ? 8.024   2.210   10.299  1.00 0.00 ? 130 PRO A HB2  4  
ATOM 2933  H HB3  . PRO A 1 25 ? 8.403   3.716   9.459   1.00 0.00 ? 130 PRO A HB3  4  
ATOM 2934  H HG2  . PRO A 1 25 ? 5.803   2.357   9.809   1.00 0.00 ? 130 PRO A HG2  4  
ATOM 2935  H HG3  . PRO A 1 25 ? 6.151   4.072   9.532   1.00 0.00 ? 130 PRO A HG3  4  
ATOM 2936  H HD2  . PRO A 1 25 ? 5.306   2.142   7.604   1.00 0.00 ? 130 PRO A HD2  4  
ATOM 2937  H HD3  . PRO A 1 25 ? 5.767   3.817   7.302   1.00 0.00 ? 130 PRO A HD3  4  
ATOM 2938  N N    . TYR A 1 26 ? 7.387   -0.192  7.644   1.00 0.00 ? 131 TYR A N    4  
ATOM 2939  C CA   . TYR A 1 26 ? 7.216   -1.633  7.786   1.00 0.00 ? 131 TYR A CA   4  
ATOM 2940  C C    . TYR A 1 26 ? 7.597   -2.356  6.499   1.00 0.00 ? 131 TYR A C    4  
ATOM 2941  O O    . TYR A 1 26 ? 6.716   -2.518  5.629   1.00 0.00 ? 131 TYR A O    4  
ATOM 2942  C CB   . TYR A 1 26 ? 5.770   -1.966  8.163   1.00 0.00 ? 131 TYR A CB   4  
ATOM 2943  C CG   . TYR A 1 26 ? 5.372   -1.475  9.536   1.00 0.00 ? 131 TYR A CG   4  
ATOM 2944  C CD1  . TYR A 1 26 ? 4.829   -0.209  9.711   1.00 0.00 ? 131 TYR A CD1  4  
ATOM 2945  C CD2  . TYR A 1 26 ? 5.541   -2.277  10.657  1.00 0.00 ? 131 TYR A CD2  4  
ATOM 2946  C CE1  . TYR A 1 26 ? 4.465   0.244   10.965  1.00 0.00 ? 131 TYR A CE1  4  
ATOM 2947  C CE2  . TYR A 1 26 ? 5.180   -1.832  11.915  1.00 0.00 ? 131 TYR A CE2  4  
ATOM 2948  C CZ   . TYR A 1 26 ? 4.642   -0.571  12.063  1.00 0.00 ? 131 TYR A CZ   4  
ATOM 2949  O OH   . TYR A 1 26 ? 4.283   -0.122  13.313  1.00 0.00 ? 131 TYR A OH   4  
ATOM 2950  O OXT  . TYR A 1 26 ? 8.774   -2.752  6.369   1.00 0.00 ? 131 TYR A OXT  4  
ATOM 2951  H H    . TYR A 1 26 ? 6.897   0.279   6.938   1.00 0.00 ? 131 TYR A H    4  
ATOM 2952  H HA   . TYR A 1 26 ? 7.869   -1.967  8.579   1.00 0.00 ? 131 TYR A HA   4  
ATOM 2953  H HB2  . TYR A 1 26 ? 5.105   -1.511  7.444   1.00 0.00 ? 131 TYR A HB2  4  
ATOM 2954  H HB3  . TYR A 1 26 ? 5.637   -3.038  8.141   1.00 0.00 ? 131 TYR A HB3  4  
ATOM 2955  H HD1  . TYR A 1 26 ? 4.690   0.427   8.849   1.00 0.00 ? 131 TYR A HD1  4  
ATOM 2956  H HD2  . TYR A 1 26 ? 5.962   -3.265  10.538  1.00 0.00 ? 131 TYR A HD2  4  
ATOM 2957  H HE1  . TYR A 1 26 ? 4.044   1.232   11.080  1.00 0.00 ? 131 TYR A HE1  4  
ATOM 2958  H HE2  . TYR A 1 26 ? 5.319   -2.471  12.774  1.00 0.00 ? 131 TYR A HE2  4  
ATOM 2959  H HH   . TYR A 1 26 ? 4.998   -0.291  13.931  1.00 0.00 ? 131 TYR A HH   4  
ATOM 2960  N N    . PRO B 2 1  ? 1.097   12.590  -11.381 1.00 0.00 ? 25  PRO B N    4  
ATOM 2961  C CA   . PRO B 2 1  ? 0.082   13.191  -10.480 1.00 0.00 ? 25  PRO B CA   4  
ATOM 2962  C C    . PRO B 2 1  ? -0.835  12.122  -9.892  1.00 0.00 ? 25  PRO B C    4  
ATOM 2963  O O    . PRO B 2 1  ? -1.987  12.396  -9.554  1.00 0.00 ? 25  PRO B O    4  
ATOM 2964  C CB   . PRO B 2 1  ? -0.737  14.204  -11.266 1.00 0.00 ? 25  PRO B CB   4  
ATOM 2965  C CG   . PRO B 2 1  ? -0.273  14.020  -12.670 1.00 0.00 ? 25  PRO B CG   4  
ATOM 2966  C CD   . PRO B 2 1  ? 1.123   13.447  -12.583 1.00 0.00 ? 25  PRO B CD   4  
ATOM 2967  H H2   . PRO B 2 1  ? 0.807   11.607  -11.508 1.00 0.00 ? 25  PRO B H2   4  
ATOM 2968  H H3   . PRO B 2 1  ? 1.961   12.513  -10.793 1.00 0.00 ? 25  PRO B H3   4  
ATOM 2969  H HA   . PRO B 2 1  ? 0.594   13.696  -9.674  1.00 0.00 ? 25  PRO B HA   4  
ATOM 2970  H HB2  . PRO B 2 1  ? -1.789  13.987  -11.160 1.00 0.00 ? 25  PRO B HB2  4  
ATOM 2971  H HB3  . PRO B 2 1  ? -0.527  15.201  -10.908 1.00 0.00 ? 25  PRO B HB3  4  
ATOM 2972  H HG2  . PRO B 2 1  ? -0.928  13.334  -13.185 1.00 0.00 ? 25  PRO B HG2  4  
ATOM 2973  H HG3  . PRO B 2 1  ? -0.254  14.973  -13.178 1.00 0.00 ? 25  PRO B HG3  4  
ATOM 2974  H HD2  . PRO B 2 1  ? 1.341   12.860  -13.464 1.00 0.00 ? 25  PRO B HD2  4  
ATOM 2975  H HD3  . PRO B 2 1  ? 1.847   14.239  -12.470 1.00 0.00 ? 25  PRO B HD3  4  
ATOM 2976  N N    . THR B 2 2  ? -0.316  10.905  -9.772  1.00 0.00 ? 26  THR B N    4  
ATOM 2977  C CA   . THR B 2 2  ? -1.090  9.796   -9.226  1.00 0.00 ? 26  THR B CA   4  
ATOM 2978  C C    . THR B 2 2  ? -1.258  9.937   -7.712  1.00 0.00 ? 26  THR B C    4  
ATOM 2979  O O    . THR B 2 2  ? -0.271  9.972   -6.977  1.00 0.00 ? 26  THR B O    4  
ATOM 2980  C CB   . THR B 2 2  ? -0.425  8.441   -9.531  1.00 0.00 ? 26  THR B CB   4  
ATOM 2981  O OG1  . THR B 2 2  ? 0.894   8.404   -8.973  1.00 0.00 ? 26  THR B OG1  4  
ATOM 2982  C CG2  . THR B 2 2  ? -0.353  8.202   -11.031 1.00 0.00 ? 26  THR B CG2  4  
ATOM 2983  H H    . THR B 2 2  ? 0.608   10.748  -10.056 1.00 0.00 ? 26  THR B H    4  
ATOM 2984  H HA   . THR B 2 2  ? -2.063  9.808   -9.693  1.00 0.00 ? 26  THR B HA   4  
ATOM 2985  H HB   . THR B 2 2  ? -1.020  7.657   -9.083  1.00 0.00 ? 26  THR B HB   4  
ATOM 2986  H HG1  . THR B 2 2  ? 0.856   8.051   -8.081  1.00 0.00 ? 26  THR B HG1  4  
ATOM 2987  H HG21 . THR B 2 2  ? 0.123   7.251   -11.222 1.00 0.00 ? 26  THR B HG21 4  
ATOM 2988  H HG22 . THR B 2 2  ? 0.218   8.991   -11.495 1.00 0.00 ? 26  THR B HG22 4  
ATOM 2989  H HG23 . THR B 2 2  ? -1.353  8.191   -11.443 1.00 0.00 ? 26  THR B HG23 4  
ATOM 2990  N N    . PRO B 2 3  ? -2.512  10.020  -7.224  1.00 0.00 ? 27  PRO B N    4  
ATOM 2991  C CA   . PRO B 2 3  ? -2.805  10.158  -5.809  1.00 0.00 ? 27  PRO B CA   4  
ATOM 2992  C C    . PRO B 2 3  ? -3.126  8.817   -5.164  1.00 0.00 ? 27  PRO B C    4  
ATOM 2993  O O    . PRO B 2 3  ? -2.736  7.766   -5.672  1.00 0.00 ? 27  PRO B O    4  
ATOM 2994  C CB   . PRO B 2 3  ? -4.044  11.049  -5.834  1.00 0.00 ? 27  PRO B CB   4  
ATOM 2995  C CG   . PRO B 2 3  ? -4.760  10.682  -7.100  1.00 0.00 ? 27  PRO B CG   4  
ATOM 2996  C CD   . PRO B 2 3  ? -3.759  9.991   -8.004  1.00 0.00 ? 27  PRO B CD   4  
ATOM 2997  H HA   . PRO B 2 3  ? -2.009  10.646  -5.270  1.00 0.00 ? 27  PRO B HA   4  
ATOM 2998  H HB2  . PRO B 2 3  ? -4.652  10.851  -4.965  1.00 0.00 ? 27  PRO B HB2  4  
ATOM 2999  H HB3  . PRO B 2 3  ? -3.743  12.086  -5.841  1.00 0.00 ? 27  PRO B HB3  4  
ATOM 3000  H HG2  . PRO B 2 3  ? -5.576  10.013  -6.874  1.00 0.00 ? 27  PRO B HG2  4  
ATOM 3001  H HG3  . PRO B 2 3  ? -5.135  11.576  -7.577  1.00 0.00 ? 27  PRO B HG3  4  
ATOM 3002  H HD2  . PRO B 2 3  ? -4.067  8.972   -8.196  1.00 0.00 ? 27  PRO B HD2  4  
ATOM 3003  H HD3  . PRO B 2 3  ? -3.647  10.534  -8.930  1.00 0.00 ? 27  PRO B HD3  4  
ATOM 3004  N N    . GLU B 2 4  ? -3.838  8.857   -4.046  1.00 0.00 ? 28  GLU B N    4  
ATOM 3005  C CA   . GLU B 2 4  ? -4.220  7.637   -3.350  1.00 0.00 ? 28  GLU B CA   4  
ATOM 3006  C C    . GLU B 2 4  ? -5.437  7.022   -4.010  1.00 0.00 ? 28  GLU B C    4  
ATOM 3007  O O    . GLU B 2 4  ? -6.565  7.151   -3.533  1.00 0.00 ? 28  GLU B O    4  
ATOM 3008  C CB   . GLU B 2 4  ? -4.491  7.904   -1.876  1.00 0.00 ? 28  GLU B CB   4  
ATOM 3009  C CG   . GLU B 2 4  ? -5.242  9.197   -1.604  1.00 0.00 ? 28  GLU B CG   4  
ATOM 3010  C CD   . GLU B 2 4  ? -5.690  9.317   -0.162  1.00 0.00 ? 28  GLU B CD   4  
ATOM 3011  O OE1  . GLU B 2 4  ? -6.797  8.838   0.157   1.00 0.00 ? 28  GLU B OE1  4  
ATOM 3012  O OE2  . GLU B 2 4  ? -4.934  9.892   0.650   1.00 0.00 ? 28  GLU B OE2  4  
ATOM 3013  H H    . GLU B 2 4  ? -4.110  9.725   -3.684  1.00 0.00 ? 28  GLU B H    4  
ATOM 3014  H HA   . GLU B 2 4  ? -3.397  6.942   -3.434  1.00 0.00 ? 28  GLU B HA   4  
ATOM 3015  H HB2  . GLU B 2 4  ? -5.072  7.087   -1.478  1.00 0.00 ? 28  GLU B HB2  4  
ATOM 3016  H HB3  . GLU B 2 4  ? -3.548  7.943   -1.370  1.00 0.00 ? 28  GLU B HB3  4  
ATOM 3017  H HG2  . GLU B 2 4  ? -4.592  10.029  -1.830  1.00 0.00 ? 28  GLU B HG2  4  
ATOM 3018  H HG3  . GLU B 2 4  ? -6.113  9.237   -2.241  1.00 0.00 ? 28  GLU B HG3  4  
ATOM 3019  N N    . MET B 2 5  ? -5.181  6.352   -5.115  1.00 0.00 ? 29  MET B N    4  
ATOM 3020  C CA   . MET B 2 5  ? -6.233  5.713   -5.894  1.00 0.00 ? 29  MET B CA   4  
ATOM 3021  C C    . MET B 2 5  ? -6.581  4.342   -5.329  1.00 0.00 ? 29  MET B C    4  
ATOM 3022  O O    . MET B 2 5  ? -7.315  3.568   -5.942  1.00 0.00 ? 29  MET B O    4  
ATOM 3023  C CB   . MET B 2 5  ? -5.809  5.608   -7.362  1.00 0.00 ? 29  MET B CB   4  
ATOM 3024  C CG   . MET B 2 5  ? -6.941  5.232   -8.307  1.00 0.00 ? 29  MET B CG   4  
ATOM 3025  S SD   . MET B 2 5  ? -6.449  5.295   -10.041 1.00 0.00 ? 29  MET B SD   4  
ATOM 3026  C CE   . MET B 2 5  ? -6.101  7.042   -10.230 1.00 0.00 ? 29  MET B CE   4  
ATOM 3027  H H    . MET B 2 5  ? -4.251  6.278   -5.407  1.00 0.00 ? 29  MET B H    4  
ATOM 3028  H HA   . MET B 2 5  ? -7.105  6.335   -5.822  1.00 0.00 ? 29  MET B HA   4  
ATOM 3029  H HB2  . MET B 2 5  ? -5.409  6.562   -7.678  1.00 0.00 ? 29  MET B HB2  4  
ATOM 3030  H HB3  . MET B 2 5  ? -5.036  4.858   -7.446  1.00 0.00 ? 29  MET B HB3  4  
ATOM 3031  H HG2  . MET B 2 5  ? -7.266  4.229   -8.077  1.00 0.00 ? 29  MET B HG2  4  
ATOM 3032  H HG3  . MET B 2 5  ? -7.762  5.919   -8.155  1.00 0.00 ? 29  MET B HG3  4  
ATOM 3033  H HE1  . MET B 2 5  ? -5.315  7.330   -9.548  1.00 0.00 ? 29  MET B HE1  4  
ATOM 3034  H HE2  . MET B 2 5  ? -6.994  7.612   -10.016 1.00 0.00 ? 29  MET B HE2  4  
ATOM 3035  H HE3  . MET B 2 5  ? -5.785  7.239   -11.245 1.00 0.00 ? 29  MET B HE3  4  
ATOM 3036  N N    . ARG B 2 6  ? -6.057  4.074   -4.139  1.00 0.00 ? 30  ARG B N    4  
ATOM 3037  C CA   . ARG B 2 6  ? -6.288  2.818   -3.440  1.00 0.00 ? 30  ARG B CA   4  
ATOM 3038  C C    . ARG B 2 6  ? -6.325  1.627   -4.385  1.00 0.00 ? 30  ARG B C    4  
ATOM 3039  O O    . ARG B 2 6  ? -7.071  0.675   -4.161  1.00 0.00 ? 30  ARG B O    4  
ATOM 3040  C CB   . ARG B 2 6  ? -7.601  2.898   -2.696  1.00 0.00 ? 30  ARG B CB   4  
ATOM 3041  C CG   . ARG B 2 6  ? -7.573  2.190   -1.364  1.00 0.00 ? 30  ARG B CG   4  
ATOM 3042  C CD   . ARG B 2 6  ? -8.527  1.029   -1.365  1.00 0.00 ? 30  ARG B CD   4  
ATOM 3043  N NE   . ARG B 2 6  ? -8.802  0.543   -0.017  1.00 0.00 ? 30  ARG B NE   4  
ATOM 3044  C CZ   . ARG B 2 6  ? -9.740  -0.357  0.267   1.00 0.00 ? 30  ARG B CZ   4  
ATOM 3045  N NH1  . ARG B 2 6  ? -10.479 -0.875  -0.704  1.00 0.00 ? 30  ARG B NH1  4  
ATOM 3046  N NH2  . ARG B 2 6  ? -9.937  -0.738  1.521   1.00 0.00 ? 30  ARG B NH2  4  
ATOM 3047  H H    . ARG B 2 6  ? -5.517  4.757   -3.705  1.00 0.00 ? 30  ARG B H    4  
ATOM 3048  H HA   . ARG B 2 6  ? -5.493  2.676   -2.724  1.00 0.00 ? 30  ARG B HA   4  
ATOM 3049  H HB2  . ARG B 2 6  ? -7.850  3.934   -2.527  1.00 0.00 ? 30  ARG B HB2  4  
ATOM 3050  H HB3  . ARG B 2 6  ? -8.363  2.443   -3.311  1.00 0.00 ? 30  ARG B HB3  4  
ATOM 3051  H HG2  . ARG B 2 6  ? -6.572  1.832   -1.180  1.00 0.00 ? 30  ARG B HG2  4  
ATOM 3052  H HG3  . ARG B 2 6  ? -7.862  2.882   -0.588  1.00 0.00 ? 30  ARG B HG3  4  
ATOM 3053  H HD2  . ARG B 2 6  ? -9.445  1.358   -1.818  1.00 0.00 ? 30  ARG B HD2  4  
ATOM 3054  H HD3  . ARG B 2 6  ? -8.096  0.231   -1.950  1.00 0.00 ? 30  ARG B HD3  4  
ATOM 3055  H HE   . ARG B 2 6  ? -8.266  0.913   0.715   1.00 0.00 ? 30  ARG B HE   4  
ATOM 3056  H HH11 . ARG B 2 6  ? -10.336 -0.590  -1.652  1.00 0.00 ? 30  ARG B HH11 4  
ATOM 3057  H HH12 . ARG B 2 6  ? -11.184 -1.553  -0.488  1.00 0.00 ? 30  ARG B HH12 4  
ATOM 3058  H HH21 . ARG B 2 6  ? -9.382  -0.348  2.256   1.00 0.00 ? 30  ARG B HH21 4  
ATOM 3059  H HH22 . ARG B 2 6  ? -10.641 -1.416  1.731   1.00 0.00 ? 30  ARG B HH22 4  
ATOM 3060  N N    . GLU B 2 7  ? -5.518  1.670   -5.434  1.00 0.00 ? 31  GLU B N    4  
ATOM 3061  C CA   . GLU B 2 7  ? -5.498  0.586   -6.401  1.00 0.00 ? 31  GLU B CA   4  
ATOM 3062  C C    . GLU B 2 7  ? -4.971  -0.687  -5.773  1.00 0.00 ? 31  GLU B C    4  
ATOM 3063  O O    . GLU B 2 7  ? -4.235  -0.659  -4.790  1.00 0.00 ? 31  GLU B O    4  
ATOM 3064  C CB   . GLU B 2 7  ? -4.677  0.966   -7.632  1.00 0.00 ? 31  GLU B CB   4  
ATOM 3065  C CG   . GLU B 2 7  ? -3.199  1.117   -7.342  1.00 0.00 ? 31  GLU B CG   4  
ATOM 3066  C CD   . GLU B 2 7  ? -2.382  1.400   -8.588  1.00 0.00 ? 31  GLU B CD   4  
ATOM 3067  O OE1  . GLU B 2 7  ? -2.207  2.588   -8.927  1.00 0.00 ? 31  GLU B OE1  4  
ATOM 3068  O OE2  . GLU B 2 7  ? -1.915  0.430   -9.223  1.00 0.00 ? 31  GLU B OE2  4  
ATOM 3069  H H    . GLU B 2 7  ? -4.922  2.438   -5.555  1.00 0.00 ? 31  GLU B H    4  
ATOM 3070  H HA   . GLU B 2 7  ? -6.517  0.400   -6.699  1.00 0.00 ? 31  GLU B HA   4  
ATOM 3071  H HB2  . GLU B 2 7  ? -4.799  0.200   -8.384  1.00 0.00 ? 31  GLU B HB2  4  
ATOM 3072  H HB3  . GLU B 2 7  ? -5.044  1.904   -8.022  1.00 0.00 ? 31  GLU B HB3  4  
ATOM 3073  H HG2  . GLU B 2 7  ? -3.063  1.934   -6.648  1.00 0.00 ? 31  GLU B HG2  4  
ATOM 3074  H HG3  . GLU B 2 7  ? -2.846  0.202   -6.894  1.00 0.00 ? 31  GLU B HG3  4  
ATOM 3075  N N    . LYS B 2 8  ? -5.363  -1.800  -6.364  1.00 0.00 ? 32  LYS B N    4  
ATOM 3076  C CA   . LYS B 2 8  ? -4.995  -3.111  -5.881  1.00 0.00 ? 32  LYS B CA   4  
ATOM 3077  C C    . LYS B 2 8  ? -3.493  -3.354  -5.933  1.00 0.00 ? 32  LYS B C    4  
ATOM 3078  O O    . LYS B 2 8  ? -2.904  -3.526  -7.000  1.00 0.00 ? 32  LYS B O    4  
ATOM 3079  C CB   . LYS B 2 8  ? -5.749  -4.154  -6.681  1.00 0.00 ? 32  LYS B CB   4  
ATOM 3080  C CG   . LYS B 2 8  ? -7.232  -3.844  -6.778  1.00 0.00 ? 32  LYS B CG   4  
ATOM 3081  C CD   . LYS B 2 8  ? -8.025  -5.023  -7.312  1.00 0.00 ? 32  LYS B CD   4  
ATOM 3082  C CE   . LYS B 2 8  ? -8.175  -6.089  -6.255  1.00 0.00 ? 32  LYS B CE   4  
ATOM 3083  N NZ   . LYS B 2 8  ? -8.255  -7.456  -6.844  1.00 0.00 ? 32  LYS B NZ   4  
ATOM 3084  H H    . LYS B 2 8  ? -5.922  -1.738  -7.163  1.00 0.00 ? 32  LYS B H    4  
ATOM 3085  H HA   . LYS B 2 8  ? -5.312  -3.177  -4.854  1.00 0.00 ? 32  LYS B HA   4  
ATOM 3086  H HB2  . LYS B 2 8  ? -5.337  -4.201  -7.677  1.00 0.00 ? 32  LYS B HB2  4  
ATOM 3087  H HB3  . LYS B 2 8  ? -5.633  -5.105  -6.204  1.00 0.00 ? 32  LYS B HB3  4  
ATOM 3088  H HG2  . LYS B 2 8  ? -7.594  -3.589  -5.795  1.00 0.00 ? 32  LYS B HG2  4  
ATOM 3089  H HG3  . LYS B 2 8  ? -7.368  -3.007  -7.429  1.00 0.00 ? 32  LYS B HG3  4  
ATOM 3090  H HD2  . LYS B 2 8  ? -9.005  -4.681  -7.608  1.00 0.00 ? 32  LYS B HD2  4  
ATOM 3091  H HD3  . LYS B 2 8  ? -7.510  -5.439  -8.165  1.00 0.00 ? 32  LYS B HD3  4  
ATOM 3092  H HE2  . LYS B 2 8  ? -7.322  -6.031  -5.602  1.00 0.00 ? 32  LYS B HE2  4  
ATOM 3093  H HE3  . LYS B 2 8  ? -9.075  -5.894  -5.689  1.00 0.00 ? 32  LYS B HE3  4  
ATOM 3094  H HZ1  . LYS B 2 8  ? -7.374  -7.678  -7.349  1.00 0.00 ? 32  LYS B HZ1  4  
ATOM 3095  H HZ2  . LYS B 2 8  ? -9.049  -7.510  -7.513  1.00 0.00 ? 32  LYS B HZ2  4  
ATOM 3096  H HZ3  . LYS B 2 8  ? -8.401  -8.161  -6.092  1.00 0.00 ? 32  LYS B HZ3  4  
ATOM 3097  N N    . LEU B 2 9  ? -2.897  -3.367  -4.751  1.00 0.00 ? 33  LEU B N    4  
ATOM 3098  C CA   . LEU B 2 9  ? -1.473  -3.597  -4.584  1.00 0.00 ? 33  LEU B CA   4  
ATOM 3099  C C    . LEU B 2 9  ? -1.202  -5.022  -4.129  1.00 0.00 ? 33  LEU B C    4  
ATOM 3100  O O    . LEU B 2 9  ? -1.319  -5.340  -2.946  1.00 0.00 ? 33  LEU B O    4  
ATOM 3101  C CB   . LEU B 2 9  ? -0.924  -2.622  -3.579  1.00 0.00 ? 33  LEU B CB   4  
ATOM 3102  C CG   . LEU B 2 9  ? -1.499  -1.219  -3.663  1.00 0.00 ? 33  LEU B CG   4  
ATOM 3103  C CD1  . LEU B 2 9  ? -0.968  -0.347  -2.540  1.00 0.00 ? 33  LEU B CD1  4  
ATOM 3104  C CD2  . LEU B 2 9  ? -1.179  -0.618  -5.023  1.00 0.00 ? 33  LEU B CD2  4  
ATOM 3105  H H    . LEU B 2 9  ? -3.436  -3.198  -3.956  1.00 0.00 ? 33  LEU B H    4  
ATOM 3106  H HA   . LEU B 2 9  ? -0.975  -3.423  -5.516  1.00 0.00 ? 33  LEU B HA   4  
ATOM 3107  H HB2  . LEU B 2 9  ? -1.082  -3.008  -2.587  1.00 0.00 ? 33  LEU B HB2  4  
ATOM 3108  H HB3  . LEU B 2 9  ? 0.121   -2.558  -3.764  1.00 0.00 ? 33  LEU B HB3  4  
ATOM 3109  H HG   . LEU B 2 9  ? -2.566  -1.273  -3.558  1.00 0.00 ? 33  LEU B HG   4  
ATOM 3110  H HD11 . LEU B 2 9  ? -1.790  0.153   -2.053  1.00 0.00 ? 33  LEU B HD11 4  
ATOM 3111  H HD12 . LEU B 2 9  ? -0.289  0.389   -2.941  1.00 0.00 ? 33  LEU B HD12 4  
ATOM 3112  H HD13 . LEU B 2 9  ? -0.446  -0.964  -1.823  1.00 0.00 ? 33  LEU B HD13 4  
ATOM 3113  H HD21 . LEU B 2 9  ? -2.005  -0.003  -5.348  1.00 0.00 ? 33  LEU B HD21 4  
ATOM 3114  H HD22 . LEU B 2 9  ? -1.014  -1.416  -5.739  1.00 0.00 ? 33  LEU B HD22 4  
ATOM 3115  H HD23 . LEU B 2 9  ? -0.288  -0.012  -4.947  1.00 0.00 ? 33  LEU B HD23 4  
ATOM 3116  N N    . CYS B 2 10 ? -0.842  -5.878  -5.074  1.00 0.00 ? 34  CYS B N    4  
ATOM 3117  C CA   . CYS B 2 10 ? -0.561  -7.271  -4.762  1.00 0.00 ? 34  CYS B CA   4  
ATOM 3118  C C    . CYS B 2 10 ? 0.932   -7.526  -4.655  1.00 0.00 ? 34  CYS B C    4  
ATOM 3119  O O    . CYS B 2 10 ? 1.608   -7.790  -5.650  1.00 0.00 ? 34  CYS B O    4  
ATOM 3120  C CB   . CYS B 2 10 ? -1.182  -8.185  -5.807  1.00 0.00 ? 34  CYS B CB   4  
ATOM 3121  S SG   . CYS B 2 10 ? -1.477  -9.885  -5.225  1.00 0.00 ? 34  CYS B SG   4  
ATOM 3122  H H    . CYS B 2 10 ? -0.759  -5.565  -6.000  1.00 0.00 ? 34  CYS B H    4  
ATOM 3123  H HA   . CYS B 2 10 ? -1.013  -7.486  -3.805  1.00 0.00 ? 34  CYS B HA   4  
ATOM 3124  H HB2  . CYS B 2 10 ? -2.128  -7.772  -6.100  1.00 0.00 ? 34  CYS B HB2  4  
ATOM 3125  H HB3  . CYS B 2 10 ? -0.530  -8.236  -6.668  1.00 0.00 ? 34  CYS B HB3  4  
ATOM 3126  N N    . GLY B 2 11 ? 1.426   -7.449  -3.432  1.00 0.00 ? 35  GLY B N    4  
ATOM 3127  C CA   . GLY B 2 11 ? 2.839   -7.667  -3.169  1.00 0.00 ? 35  GLY B CA   4  
ATOM 3128  C C    . GLY B 2 11 ? 3.736   -6.686  -3.900  1.00 0.00 ? 35  GLY B C    4  
ATOM 3129  O O    . GLY B 2 11 ? 4.163   -5.687  -3.323  1.00 0.00 ? 35  GLY B O    4  
ATOM 3130  H H    . GLY B 2 11 ? 0.817   -7.248  -2.693  1.00 0.00 ? 35  GLY B H    4  
ATOM 3131  H HA2  . GLY B 2 11 ? 3.013   -7.567  -2.108  1.00 0.00 ? 35  GLY B HA2  4  
ATOM 3132  H HA3  . GLY B 2 11 ? 3.100   -8.667  -3.466  1.00 0.00 ? 35  GLY B HA3  4  
ATOM 3133  N N    . HIS B 2 12 ? 4.040   -6.974  -5.165  1.00 0.00 ? 36  HIS B N    4  
ATOM 3134  C CA   . HIS B 2 12 ? 4.891   -6.104  -5.961  1.00 0.00 ? 36  HIS B CA   4  
ATOM 3135  C C    . HIS B 2 12 ? 4.292   -4.711  -6.098  1.00 0.00 ? 36  HIS B C    4  
ATOM 3136  O O    . HIS B 2 12 ? 4.945   -3.730  -5.762  1.00 0.00 ? 36  HIS B O    4  
ATOM 3137  C CB   . HIS B 2 12 ? 5.142   -6.708  -7.334  1.00 0.00 ? 36  HIS B CB   4  
ATOM 3138  C CG   . HIS B 2 12 ? 6.497   -6.382  -7.863  1.00 0.00 ? 36  HIS B CG   4  
ATOM 3139  N ND1  . HIS B 2 12 ? 6.885   -6.599  -9.163  1.00 0.00 ? 36  HIS B ND1  4  
ATOM 3140  C CD2  . HIS B 2 12 ? 7.575   -5.844  -7.230  1.00 0.00 ? 36  HIS B CD2  4  
ATOM 3141  C CE1  . HIS B 2 12 ? 8.155   -6.199  -9.283  1.00 0.00 ? 36  HIS B CE1  4  
ATOM 3142  N NE2  . HIS B 2 12 ? 8.623   -5.733  -8.139  1.00 0.00 ? 36  HIS B NE2  4  
ATOM 3143  H H    . HIS B 2 12 ? 3.704   -7.795  -5.564  1.00 0.00 ? 36  HIS B H    4  
ATOM 3144  H HA   . HIS B 2 12 ? 5.834   -6.019  -5.443  1.00 0.00 ? 36  HIS B HA   4  
ATOM 3145  H HB2  . HIS B 2 12 ? 5.057   -7.783  -7.270  1.00 0.00 ? 36  HIS B HB2  4  
ATOM 3146  H HB3  . HIS B 2 12 ? 4.410   -6.330  -8.029  1.00 0.00 ? 36  HIS B HB3  4  
ATOM 3147  H HD1  . HIS B 2 12 ? 6.330   -6.982  -9.874  1.00 0.00 ? 36  HIS B HD1  4  
ATOM 3148  H HD2  . HIS B 2 12 ? 7.614   -5.539  -6.185  1.00 0.00 ? 36  HIS B HD2  4  
ATOM 3149  H HE1  . HIS B 2 12 ? 8.718   -6.241  -10.201 1.00 0.00 ? 36  HIS B HE1  4  
ATOM 3150  N N    . HIS B 2 13 ? 3.069   -4.609  -6.625  1.00 0.00 ? 37  HIS B N    4  
ATOM 3151  C CA   . HIS B 2 13 ? 2.425   -3.302  -6.729  1.00 0.00 ? 37  HIS B CA   4  
ATOM 3152  C C    . HIS B 2 13 ? 2.459   -2.674  -5.373  1.00 0.00 ? 37  HIS B C    4  
ATOM 3153  O O    . HIS B 2 13 ? 2.767   -1.498  -5.201  1.00 0.00 ? 37  HIS B O    4  
ATOM 3154  C CB   . HIS B 2 13 ? 0.964   -3.418  -7.144  1.00 0.00 ? 37  HIS B CB   4  
ATOM 3155  C CG   . HIS B 2 13 ? 0.766   -3.592  -8.598  1.00 0.00 ? 37  HIS B CG   4  
ATOM 3156  N ND1  . HIS B 2 13 ? -0.214  -2.959  -9.317  1.00 0.00 ? 37  HIS B ND1  4  
ATOM 3157  C CD2  . HIS B 2 13 ? 1.452   -4.353  -9.469  1.00 0.00 ? 37  HIS B CD2  4  
ATOM 3158  C CE1  . HIS B 2 13 ? -0.102  -3.348  -10.588 1.00 0.00 ? 37  HIS B CE1  4  
ATOM 3159  N NE2  . HIS B 2 13 ? 0.899   -4.199  -10.739 1.00 0.00 ? 37  HIS B NE2  4  
ATOM 3160  H H    . HIS B 2 13 ? 2.604   -5.412  -6.940  1.00 0.00 ? 37  HIS B H    4  
ATOM 3161  H HA   . HIS B 2 13 ? 2.974   -2.692  -7.434  1.00 0.00 ? 37  HIS B HA   4  
ATOM 3162  H HB2  . HIS B 2 13 ? 0.523   -4.270  -6.648  1.00 0.00 ? 37  HIS B HB2  4  
ATOM 3163  H HB3  . HIS B 2 13 ? 0.442   -2.521  -6.838  1.00 0.00 ? 37  HIS B HB3  4  
ATOM 3164  H HD1  . HIS B 2 13 ? -0.881  -2.335  -8.962  1.00 0.00 ? 37  HIS B HD1  4  
ATOM 3165  H HD2  . HIS B 2 13 ? 2.294   -4.979  -9.219  1.00 0.00 ? 37  HIS B HD2  4  
ATOM 3166  H HE1  . HIS B 2 13 ? -0.744  -3.008  -11.380 1.00 0.00 ? 37  HIS B HE1  4  
ATOM 3167  N N    . PHE B 2 14 ? 2.123   -3.506  -4.415  1.00 0.00 ? 38  PHE B N    4  
ATOM 3168  C CA   . PHE B 2 14 ? 2.106   -3.119  -3.039  1.00 0.00 ? 38  PHE B CA   4  
ATOM 3169  C C    . PHE B 2 14 ? 3.467   -2.620  -2.630  1.00 0.00 ? 38  PHE B C    4  
ATOM 3170  O O    . PHE B 2 14 ? 3.594   -1.781  -1.745  1.00 0.00 ? 38  PHE B O    4  
ATOM 3171  C CB   . PHE B 2 14 ? 1.647   -4.301  -2.199  1.00 0.00 ? 38  PHE B CB   4  
ATOM 3172  C CG   . PHE B 2 14 ? 1.833   -4.060  -0.755  1.00 0.00 ? 38  PHE B CG   4  
ATOM 3173  C CD1  . PHE B 2 14 ? 1.294   -2.925  -0.193  1.00 0.00 ? 38  PHE B CD1  4  
ATOM 3174  C CD2  . PHE B 2 14 ? 2.568   -4.932  0.026   1.00 0.00 ? 38  PHE B CD2  4  
ATOM 3175  C CE1  . PHE B 2 14 ? 1.480   -2.654  1.143   1.00 0.00 ? 38  PHE B CE1  4  
ATOM 3176  C CE2  . PHE B 2 14 ? 2.766   -4.670  1.363   1.00 0.00 ? 38  PHE B CE2  4  
ATOM 3177  C CZ   . PHE B 2 14 ? 2.223   -3.527  1.925   1.00 0.00 ? 38  PHE B CZ   4  
ATOM 3178  H H    . PHE B 2 14 ? 1.875   -4.425  -4.650  1.00 0.00 ? 38  PHE B H    4  
ATOM 3179  H HA   . PHE B 2 14 ? 1.406   -2.309  -2.926  1.00 0.00 ? 38  PHE B HA   4  
ATOM 3180  H HB2  . PHE B 2 14 ? 0.595   -4.472  -2.377  1.00 0.00 ? 38  PHE B HB2  4  
ATOM 3181  H HB3  . PHE B 2 14 ? 2.202   -5.176  -2.480  1.00 0.00 ? 38  PHE B HB3  4  
ATOM 3182  H HD1  . PHE B 2 14 ? 0.705   -2.252  -0.825  1.00 0.00 ? 38  PHE B HD1  4  
ATOM 3183  H HD2  . PHE B 2 14 ? 2.988   -5.827  -0.421  1.00 0.00 ? 38  PHE B HD2  4  
ATOM 3184  H HE1  . PHE B 2 14 ? 1.059   -1.761  1.573   1.00 0.00 ? 38  PHE B HE1  4  
ATOM 3185  H HE2  . PHE B 2 14 ? 3.336   -5.361  1.971   1.00 0.00 ? 38  PHE B HE2  4  
ATOM 3186  H HZ   . PHE B 2 14 ? 2.381   -3.314  2.972   1.00 0.00 ? 38  PHE B HZ   4  
ATOM 3187  N N    . VAL B 2 15 ? 4.481   -3.143  -3.287  1.00 0.00 ? 39  VAL B N    4  
ATOM 3188  C CA   . VAL B 2 15 ? 5.833   -2.721  -3.029  1.00 0.00 ? 39  VAL B CA   4  
ATOM 3189  C C    . VAL B 2 15 ? 6.050   -1.342  -3.636  1.00 0.00 ? 39  VAL B C    4  
ATOM 3190  O O    . VAL B 2 15 ? 6.340   -0.394  -2.913  1.00 0.00 ? 39  VAL B O    4  
ATOM 3191  C CB   . VAL B 2 15 ? 6.854   -3.761  -3.558  1.00 0.00 ? 39  VAL B CB   4  
ATOM 3192  C CG1  . VAL B 2 15 ? 7.968   -3.124  -4.373  1.00 0.00 ? 39  VAL B CG1  4  
ATOM 3193  C CG2  . VAL B 2 15 ? 7.431   -4.560  -2.400  1.00 0.00 ? 39  VAL B CG2  4  
ATOM 3194  H H    . VAL B 2 15 ? 4.314   -3.832  -3.960  1.00 0.00 ? 39  VAL B H    4  
ATOM 3195  H HA   . VAL B 2 15 ? 5.948   -2.636  -1.959  1.00 0.00 ? 39  VAL B HA   4  
ATOM 3196  H HB   . VAL B 2 15 ? 6.325   -4.450  -4.203  1.00 0.00 ? 39  VAL B HB   4  
ATOM 3197  H HG11 . VAL B 2 15 ? 7.726   -3.184  -5.424  1.00 0.00 ? 39  VAL B HG11 4  
ATOM 3198  H HG12 . VAL B 2 15 ? 8.887   -3.649  -4.183  1.00 0.00 ? 39  VAL B HG12 4  
ATOM 3199  H HG13 . VAL B 2 15 ? 8.084   -2.091  -4.087  1.00 0.00 ? 39  VAL B HG13 4  
ATOM 3200  H HG21 . VAL B 2 15 ? 7.308   -4.005  -1.483  1.00 0.00 ? 39  VAL B HG21 4  
ATOM 3201  H HG22 . VAL B 2 15 ? 8.482   -4.736  -2.574  1.00 0.00 ? 39  VAL B HG22 4  
ATOM 3202  H HG23 . VAL B 2 15 ? 6.915   -5.505  -2.321  1.00 0.00 ? 39  VAL B HG23 4  
ATOM 3203  N N    . ARG B 2 16 ? 5.884   -1.224  -4.957  1.00 0.00 ? 40  ARG B N    4  
ATOM 3204  C CA   . ARG B 2 16 ? 6.042   0.050   -5.631  1.00 0.00 ? 40  ARG B CA   4  
ATOM 3205  C C    . ARG B 2 16 ? 5.253   1.127   -4.925  1.00 0.00 ? 40  ARG B C    4  
ATOM 3206  O O    . ARG B 2 16 ? 5.844   2.052   -4.395  1.00 0.00 ? 40  ARG B O    4  
ATOM 3207  C CB   . ARG B 2 16 ? 5.583   -0.057  -7.079  1.00 0.00 ? 40  ARG B CB   4  
ATOM 3208  C CG   . ARG B 2 16 ? 6.556   -0.796  -7.973  1.00 0.00 ? 40  ARG B CG   4  
ATOM 3209  C CD   . ARG B 2 16 ? 6.325   -2.294  -7.980  1.00 0.00 ? 40  ARG B CD   4  
ATOM 3210  N NE   . ARG B 2 16 ? 7.187   -2.961  -8.955  1.00 0.00 ? 40  ARG B NE   4  
ATOM 3211  C CZ   . ARG B 2 16 ? 8.519   -2.912  -8.923  1.00 0.00 ? 40  ARG B CZ   4  
ATOM 3212  N NH1  . ARG B 2 16 ? 9.145   -2.291  -7.931  1.00 0.00 ? 40  ARG B NH1  4  
ATOM 3213  N NH2  . ARG B 2 16 ? 9.226   -3.496  -9.880  1.00 0.00 ? 40  ARG B NH2  4  
ATOM 3214  H H    . ARG B 2 16 ? 5.661   -2.012  -5.493  1.00 0.00 ? 40  ARG B H    4  
ATOM 3215  H HA   . ARG B 2 16 ? 7.092   0.328   -5.602  1.00 0.00 ? 40  ARG B HA   4  
ATOM 3216  H HB2  . ARG B 2 16 ? 4.638   -0.576  -7.107  1.00 0.00 ? 40  ARG B HB2  4  
ATOM 3217  H HB3  . ARG B 2 16 ? 5.448   0.939   -7.475  1.00 0.00 ? 40  ARG B HB3  4  
ATOM 3218  H HG2  . ARG B 2 16 ? 6.436   -0.439  -8.968  1.00 0.00 ? 40  ARG B HG2  4  
ATOM 3219  H HG3  . ARG B 2 16 ? 7.563   -0.598  -7.637  1.00 0.00 ? 40  ARG B HG3  4  
ATOM 3220  H HD2  . ARG B 2 16 ? 6.530   -2.681  -7.002  1.00 0.00 ? 40  ARG B HD2  4  
ATOM 3221  H HD3  . ARG B 2 16 ? 5.294   -2.486  -8.235  1.00 0.00 ? 40  ARG B HD3  4  
ATOM 3222  H HE   . ARG B 2 16 ? 6.752   -3.451  -9.683  1.00 0.00 ? 40  ARG B HE   4  
ATOM 3223  H HH11 . ARG B 2 16 ? 8.617   -1.857  -7.200  1.00 0.00 ? 40  ARG B HH11 4  
ATOM 3224  H HH12 . ARG B 2 16 ? 10.143  -2.258  -7.914  1.00 0.00 ? 40  ARG B HH12 4  
ATOM 3225  H HH21 . ARG B 2 16 ? 8.762   -3.973  -10.625 1.00 0.00 ? 40  ARG B HH21 4  
ATOM 3226  H HH22 . ARG B 2 16 ? 10.226  -3.459  -9.856  1.00 0.00 ? 40  ARG B HH22 4  
ATOM 3227  N N    . ALA B 2 17 ? 3.923   1.014   -4.898  1.00 0.00 ? 41  ALA B N    4  
ATOM 3228  C CA   . ALA B 2 17 ? 3.120   2.021   -4.241  1.00 0.00 ? 41  ALA B CA   4  
ATOM 3229  C C    . ALA B 2 17 ? 3.727   2.349   -2.883  1.00 0.00 ? 41  ALA B C    4  
ATOM 3230  O O    . ALA B 2 17 ? 3.961   3.502   -2.588  1.00 0.00 ? 41  ALA B O    4  
ATOM 3231  C CB   . ALA B 2 17 ? 1.665   1.573   -4.118  1.00 0.00 ? 41  ALA B CB   4  
ATOM 3232  H H    . ALA B 2 17 ? 3.481   0.240   -5.306  1.00 0.00 ? 41  ALA B H    4  
ATOM 3233  H HA   . ALA B 2 17 ? 3.152   2.922   -4.859  1.00 0.00 ? 41  ALA B HA   4  
ATOM 3234  H HB1  . ALA B 2 17 ? 1.044   2.431   -3.902  1.00 0.00 ? 41  ALA B HB1  4  
ATOM 3235  H HB2  . ALA B 2 17 ? 1.565   0.848   -3.319  1.00 0.00 ? 41  ALA B HB2  4  
ATOM 3236  H HB3  . ALA B 2 17 ? 1.348   1.128   -5.050  1.00 0.00 ? 41  ALA B HB3  4  
ATOM 3237  N N    . LEU B 2 18 ? 4.039   1.326   -2.086  1.00 0.00 ? 42  LEU B N    4  
ATOM 3238  C CA   . LEU B 2 18 ? 4.629   1.544   -0.764  1.00 0.00 ? 42  LEU B CA   4  
ATOM 3239  C C    . LEU B 2 18 ? 5.734   2.597   -0.840  1.00 0.00 ? 42  LEU B C    4  
ATOM 3240  O O    . LEU B 2 18 ? 5.859   3.457   0.031   1.00 0.00 ? 42  LEU B O    4  
ATOM 3241  C CB   . LEU B 2 18 ? 5.204   0.228   -0.238  1.00 0.00 ? 42  LEU B CB   4  
ATOM 3242  C CG   . LEU B 2 18 ? 4.867   -0.113  1.211   1.00 0.00 ? 42  LEU B CG   4  
ATOM 3243  C CD1  . LEU B 2 18 ? 5.426   -1.479  1.576   1.00 0.00 ? 42  LEU B CD1  4  
ATOM 3244  C CD2  . LEU B 2 18 ? 5.417   0.954   2.136   1.00 0.00 ? 42  LEU B CD2  4  
ATOM 3245  H H    . LEU B 2 18 ? 3.878   0.404   -2.391  1.00 0.00 ? 42  LEU B H    4  
ATOM 3246  H HA   . LEU B 2 18 ? 3.848   1.893   -0.098  1.00 0.00 ? 42  LEU B HA   4  
ATOM 3247  H HB2  . LEU B 2 18 ? 4.845   -0.570  -0.864  1.00 0.00 ? 42  LEU B HB2  4  
ATOM 3248  H HB3  . LEU B 2 18 ? 6.276   0.273   -0.330  1.00 0.00 ? 42  LEU B HB3  4  
ATOM 3249  H HG   . LEU B 2 18 ? 3.793   -0.143  1.332   1.00 0.00 ? 42  LEU B HG   4  
ATOM 3250  H HD11 . LEU B 2 18 ? 4.829   -2.248  1.110   1.00 0.00 ? 42  LEU B HD11 4  
ATOM 3251  H HD12 . LEU B 2 18 ? 5.402   -1.603  2.647   1.00 0.00 ? 42  LEU B HD12 4  
ATOM 3252  H HD13 . LEU B 2 18 ? 6.445   -1.554  1.228   1.00 0.00 ? 42  LEU B HD13 4  
ATOM 3253  H HD21 . LEU B 2 18 ? 4.607   1.556   2.518   1.00 0.00 ? 42  LEU B HD21 4  
ATOM 3254  H HD22 . LEU B 2 18 ? 6.096   1.577   1.579   1.00 0.00 ? 42  LEU B HD22 4  
ATOM 3255  H HD23 . LEU B 2 18 ? 5.942   0.488   2.956   1.00 0.00 ? 42  LEU B HD23 4  
ATOM 3256  N N    . VAL B 2 19 ? 6.523   2.506   -1.901  1.00 0.00 ? 43  VAL B N    4  
ATOM 3257  C CA   . VAL B 2 19 ? 7.628   3.431   -2.147  1.00 0.00 ? 43  VAL B CA   4  
ATOM 3258  C C    . VAL B 2 19 ? 7.111   4.732   -2.739  1.00 0.00 ? 43  VAL B C    4  
ATOM 3259  O O    . VAL B 2 19 ? 7.326   5.807   -2.179  1.00 0.00 ? 43  VAL B O    4  
ATOM 3260  C CB   . VAL B 2 19 ? 8.669   2.811   -3.112  1.00 0.00 ? 43  VAL B CB   4  
ATOM 3261  C CG1  . VAL B 2 19 ? 10.079  3.165   -2.697  1.00 0.00 ? 43  VAL B CG1  4  
ATOM 3262  C CG2  . VAL B 2 19 ? 8.536   1.314   -3.157  1.00 0.00 ? 43  VAL B CG2  4  
ATOM 3263  H H    . VAL B 2 19 ? 6.358   1.786   -2.539  1.00 0.00 ? 43  VAL B H    4  
ATOM 3264  H HA   . VAL B 2 19 ? 8.100   3.649   -1.201  1.00 0.00 ? 43  VAL B HA   4  
ATOM 3265  H HB   . VAL B 2 19 ? 8.487   3.184   -4.114  1.00 0.00 ? 43  VAL B HB   4  
ATOM 3266  H HG11 . VAL B 2 19 ? 10.653  3.454   -3.566  1.00 0.00 ? 43  VAL B HG11 4  
ATOM 3267  H HG12 . VAL B 2 19 ? 10.530  2.289   -2.239  1.00 0.00 ? 43  VAL B HG12 4  
ATOM 3268  H HG13 . VAL B 2 19 ? 10.057  3.977   -1.985  1.00 0.00 ? 43  VAL B HG13 4  
ATOM 3269  H HG21 . VAL B 2 19 ? 7.587   1.046   -3.587  1.00 0.00 ? 43  VAL B HG21 4  
ATOM 3270  H HG22 . VAL B 2 19 ? 8.607   0.926   -2.150  1.00 0.00 ? 43  VAL B HG22 4  
ATOM 3271  H HG23 . VAL B 2 19 ? 9.334   0.899   -3.757  1.00 0.00 ? 43  VAL B HG23 4  
ATOM 3272  N N    . ARG B 2 20 ? 6.465   4.617   -3.895  1.00 0.00 ? 44  ARG B N    4  
ATOM 3273  C CA   . ARG B 2 20 ? 5.853   5.755   -4.573  1.00 0.00 ? 44  ARG B CA   4  
ATOM 3274  C C    . ARG B 2 20 ? 5.275   6.706   -3.538  1.00 0.00 ? 44  ARG B C    4  
ATOM 3275  O O    . ARG B 2 20 ? 5.350   7.929   -3.659  1.00 0.00 ? 44  ARG B O    4  
ATOM 3276  C CB   . ARG B 2 20 ? 4.725   5.246   -5.473  1.00 0.00 ? 44  ARG B CB   4  
ATOM 3277  C CG   . ARG B 2 20 ? 5.131   4.091   -6.368  1.00 0.00 ? 44  ARG B CG   4  
ATOM 3278  C CD   . ARG B 2 20 ? 4.634   4.290   -7.785  1.00 0.00 ? 44  ARG B CD   4  
ATOM 3279  N NE   . ARG B 2 20 ? 4.580   3.032   -8.526  1.00 0.00 ? 44  ARG B NE   4  
ATOM 3280  C CZ   . ARG B 2 20 ? 4.812   2.935   -9.832  1.00 0.00 ? 44  ARG B CZ   4  
ATOM 3281  N NH1  . ARG B 2 20 ? 5.117   4.016   -10.538 1.00 0.00 ? 44  ARG B NH1  4  
ATOM 3282  N NH2  . ARG B 2 20 ? 4.743   1.754   -10.432 1.00 0.00 ? 44  ARG B NH2  4  
ATOM 3283  H H    . ARG B 2 20 ? 6.414   3.734   -4.314  1.00 0.00 ? 44  ARG B H    4  
ATOM 3284  H HA   . ARG B 2 20 ? 6.600   6.259   -5.167  1.00 0.00 ? 44  ARG B HA   4  
ATOM 3285  H HB2  . ARG B 2 20 ? 3.911   4.913   -4.847  1.00 0.00 ? 44  ARG B HB2  4  
ATOM 3286  H HB3  . ARG B 2 20 ? 4.374   6.048   -6.095  1.00 0.00 ? 44  ARG B HB3  4  
ATOM 3287  H HG2  . ARG B 2 20 ? 6.208   4.016   -6.380  1.00 0.00 ? 44  ARG B HG2  4  
ATOM 3288  H HG3  . ARG B 2 20 ? 4.709   3.180   -5.973  1.00 0.00 ? 44  ARG B HG3  4  
ATOM 3289  H HD2  . ARG B 2 20 ? 3.647   4.723   -7.748  1.00 0.00 ? 44  ARG B HD2  4  
ATOM 3290  H HD3  . ARG B 2 20 ? 5.305   4.966   -8.288  1.00 0.00 ? 44  ARG B HD3  4  
ATOM 3291  H HE   . ARG B 2 20 ? 4.354   2.220   -8.023  1.00 0.00 ? 44  ARG B HE   4  
ATOM 3292  H HH11 . ARG B 2 20 ? 5.169   4.907   -10.090 1.00 0.00 ? 44  ARG B HH11 4  
ATOM 3293  H HH12 . ARG B 2 20 ? 5.292   3.938   -11.520 1.00 0.00 ? 44  ARG B HH12 4  
ATOM 3294  H HH21 . ARG B 2 20 ? 4.515   0.936   -9.904  1.00 0.00 ? 44  ARG B HH21 4  
ATOM 3295  H HH22 . ARG B 2 20 ? 4.919   1.683   -11.414 1.00 0.00 ? 44  ARG B HH22 4  
ATOM 3296  N N    . VAL B 2 21 ? 4.696   6.091   -2.521  1.00 0.00 ? 45  VAL B N    4  
ATOM 3297  C CA   . VAL B 2 21 ? 4.076   6.779   -1.414  1.00 0.00 ? 45  VAL B CA   4  
ATOM 3298  C C    . VAL B 2 21 ? 5.114   7.334   -0.456  1.00 0.00 ? 45  VAL B C    4  
ATOM 3299  O O    . VAL B 2 21 ? 5.108   8.520   -0.121  1.00 0.00 ? 45  VAL B O    4  
ATOM 3300  C CB   . VAL B 2 21 ? 3.186   5.810   -0.617  1.00 0.00 ? 45  VAL B CB   4  
ATOM 3301  C CG1  . VAL B 2 21 ? 2.501   6.531   0.519   1.00 0.00 ? 45  VAL B CG1  4  
ATOM 3302  C CG2  . VAL B 2 21 ? 2.173   5.123   -1.512  1.00 0.00 ? 45  VAL B CG2  4  
ATOM 3303  H H    . VAL B 2 21 ? 4.705   5.115   -2.510  1.00 0.00 ? 45  VAL B H    4  
ATOM 3304  H HA   . VAL B 2 21 ? 3.464   7.581   -1.796  1.00 0.00 ? 45  VAL B HA   4  
ATOM 3305  H HB   . VAL B 2 21 ? 3.818   5.046   -0.186  1.00 0.00 ? 45  VAL B HB   4  
ATOM 3306  H HG11 . VAL B 2 21 ? 2.793   7.572   0.515   1.00 0.00 ? 45  VAL B HG11 4  
ATOM 3307  H HG12 . VAL B 2 21 ? 2.794   6.075   1.453   1.00 0.00 ? 45  VAL B HG12 4  
ATOM 3308  H HG13 . VAL B 2 21 ? 1.432   6.457   0.397   1.00 0.00 ? 45  VAL B HG13 4  
ATOM 3309  H HG21 . VAL B 2 21 ? 1.177   5.327   -1.156  1.00 0.00 ? 45  VAL B HG21 4  
ATOM 3310  H HG22 . VAL B 2 21 ? 2.350   4.060   -1.492  1.00 0.00 ? 45  VAL B HG22 4  
ATOM 3311  H HG23 . VAL B 2 21 ? 2.278   5.487   -2.525  1.00 0.00 ? 45  VAL B HG23 4  
ATOM 3312  N N    . CYS B 2 22 ? 6.003   6.452   -0.017  1.00 0.00 ? 46  CYS B N    4  
ATOM 3313  C CA   . CYS B 2 22 ? 7.019   6.813   0.953   1.00 0.00 ? 46  CYS B CA   4  
ATOM 3314  C C    . CYS B 2 22 ? 8.309   6.044   0.747   1.00 0.00 ? 46  CYS B C    4  
ATOM 3315  O O    . CYS B 2 22 ? 9.353   6.617   0.439   1.00 0.00 ? 46  CYS B O    4  
ATOM 3316  C CB   . CYS B 2 22 ? 6.483   6.484   2.336   1.00 0.00 ? 46  CYS B CB   4  
ATOM 3317  S SG   . CYS B 2 22 ? 7.559   6.998   3.711   1.00 0.00 ? 46  CYS B SG   4  
ATOM 3318  H H    . CYS B 2 22 ? 5.977   5.535   -0.362  1.00 0.00 ? 46  CYS B H    4  
ATOM 3319  H HA   . CYS B 2 22 ? 7.207   7.872   0.887   1.00 0.00 ? 46  CYS B HA   4  
ATOM 3320  H HB2  . CYS B 2 22 ? 5.528   6.951   2.455   1.00 0.00 ? 46  CYS B HB2  4  
ATOM 3321  H HB3  . CYS B 2 22 ? 6.354   5.414   2.410   1.00 0.00 ? 46  CYS B HB3  4  
ATOM 3322  N N    . GLY B 2 23 ? 8.215   4.735   0.922   1.00 0.00 ? 47  GLY B N    4  
ATOM 3323  C CA   . GLY B 2 23 ? 9.383   3.885   0.801   1.00 0.00 ? 47  GLY B CA   4  
ATOM 3324  C C    . GLY B 2 23 ? 9.361   2.742   1.792   1.00 0.00 ? 47  GLY B C    4  
ATOM 3325  O O    . GLY B 2 23 ? 9.236   2.956   2.997   1.00 0.00 ? 47  GLY B O    4  
ATOM 3326  H H    . GLY B 2 23 ? 7.329   4.340   1.109   1.00 0.00 ? 47  GLY B H    4  
ATOM 3327  H HA2  . GLY B 2 23 ? 9.421   3.480   -0.199  1.00 0.00 ? 47  GLY B HA2  4  
ATOM 3328  H HA3  . GLY B 2 23 ? 10.268  4.479   0.973   1.00 0.00 ? 47  GLY B HA3  4  
ATOM 3329  N N    . GLY B 2 24 ? 9.478   1.527   1.279   1.00 0.00 ? 48  GLY B N    4  
ATOM 3330  C CA   . GLY B 2 24 ? 9.466   0.349   2.124   1.00 0.00 ? 48  GLY B CA   4  
ATOM 3331  C C    . GLY B 2 24 ? 10.677  0.247   3.041   1.00 0.00 ? 48  GLY B C    4  
ATOM 3332  O O    . GLY B 2 24 ? 10.906  1.120   3.878   1.00 0.00 ? 48  GLY B O    4  
ATOM 3333  H H    . GLY B 2 24 ? 9.573   1.426   0.309   1.00 0.00 ? 48  GLY B H    4  
ATOM 3334  H HA2  . GLY B 2 24 ? 8.580   0.357   2.727   1.00 0.00 ? 48  GLY B HA2  4  
ATOM 3335  H HA3  . GLY B 2 24 ? 9.435   -0.521  1.491   1.00 0.00 ? 48  GLY B HA3  4  
ATOM 3336  N N    . PRO B 2 25 ? 11.467  -0.827  2.893   1.00 0.00 ? 49  PRO B N    4  
ATOM 3337  C CA   . PRO B 2 25 ? 12.657  -1.079  3.716   1.00 0.00 ? 49  PRO B CA   4  
ATOM 3338  C C    . PRO B 2 25 ? 13.827  -0.135  3.436   1.00 0.00 ? 49  PRO B C    4  
ATOM 3339  O O    . PRO B 2 25 ? 14.128  0.745   4.242   1.00 0.00 ? 49  PRO B O    4  
ATOM 3340  C CB   . PRO B 2 25 ? 13.021  -2.519  3.349   1.00 0.00 ? 49  PRO B CB   4  
ATOM 3341  C CG   . PRO B 2 25 ? 12.512  -2.696  1.967   1.00 0.00 ? 49  PRO B CG   4  
ATOM 3342  C CD   . PRO B 2 25 ? 11.251  -1.888  1.903   1.00 0.00 ? 49  PRO B CD   4  
ATOM 3343  H HA   . PRO B 2 25 ? 12.419  -1.033  4.764   1.00 0.00 ? 49  PRO B HA   4  
ATOM 3344  H HB2  . PRO B 2 25 ? 14.091  -2.654  3.402   1.00 0.00 ? 49  PRO B HB2  4  
ATOM 3345  H HB3  . PRO B 2 25 ? 12.530  -3.193  4.026   1.00 0.00 ? 49  PRO B HB3  4  
ATOM 3346  H HG2  . PRO B 2 25 ? 13.235  -2.323  1.256   1.00 0.00 ? 49  PRO B HG2  4  
ATOM 3347  H HG3  . PRO B 2 25 ? 12.301  -3.738  1.781   1.00 0.00 ? 49  PRO B HG3  4  
ATOM 3348  H HD2  . PRO B 2 25 ? 11.127  -1.469  0.934   1.00 0.00 ? 49  PRO B HD2  4  
ATOM 3349  H HD3  . PRO B 2 25 ? 10.390  -2.484  2.159   1.00 0.00 ? 49  PRO B HD3  4  
ATOM 3350  N N    . ARG B 2 26 ? 14.472  -0.314  2.288   1.00 0.00 ? 50  ARG B N    4  
ATOM 3351  C CA   . ARG B 2 26 ? 15.632  0.497   1.913   1.00 0.00 ? 50  ARG B CA   4  
ATOM 3352  C C    . ARG B 2 26 ? 15.777  0.608   0.400   1.00 0.00 ? 50  ARG B C    4  
ATOM 3353  O O    . ARG B 2 26 ? 16.146  1.664   -0.118  1.00 0.00 ? 50  ARG B O    4  
ATOM 3354  C CB   . ARG B 2 26 ? 16.895  -0.136  2.466   1.00 0.00 ? 50  ARG B CB   4  
ATOM 3355  C CG   . ARG B 2 26 ? 16.973  -0.174  3.985   1.00 0.00 ? 50  ARG B CG   4  
ATOM 3356  C CD   . ARG B 2 26 ? 17.132  1.219   4.573   1.00 0.00 ? 50  ARG B CD   4  
ATOM 3357  N NE   . ARG B 2 26 ? 17.228  1.187   6.029   1.00 0.00 ? 50  ARG B NE   4  
ATOM 3358  C CZ   . ARG B 2 26 ? 17.597  2.228   6.767   1.00 0.00 ? 50  ARG B CZ   4  
ATOM 3359  N NH1  . ARG B 2 26 ? 17.897  3.383   6.188   1.00 0.00 ? 50  ARG B NH1  4  
ATOM 3360  N NH2  . ARG B 2 26 ? 17.665  2.117   8.087   1.00 0.00 ? 50  ARG B NH2  4  
ATOM 3361  H H    . ARG B 2 26 ? 14.173  -1.016  1.686   1.00 0.00 ? 50  ARG B H    4  
ATOM 3362  H HA   . ARG B 2 26 ? 15.511  1.480   2.336   1.00 0.00 ? 50  ARG B HA   4  
ATOM 3363  H HB2  . ARG B 2 26 ? 16.940  -1.143  2.097   1.00 0.00 ? 50  ARG B HB2  4  
ATOM 3364  H HB3  . ARG B 2 26 ? 17.742  0.409   2.094   1.00 0.00 ? 50  ARG B HB3  4  
ATOM 3365  H HG2  . ARG B 2 26 ? 16.066  -0.614  4.370   1.00 0.00 ? 50  ARG B HG2  4  
ATOM 3366  H HG3  . ARG B 2 26 ? 17.820  -0.776  4.275   1.00 0.00 ? 50  ARG B HG3  4  
ATOM 3367  H HD2  . ARG B 2 26 ? 18.030  1.665   4.171   1.00 0.00 ? 50  ARG B HD2  4  
ATOM 3368  H HD3  . ARG B 2 26 ? 16.277  1.816   4.290   1.00 0.00 ? 50  ARG B HD3  4  
ATOM 3369  H HE   . ARG B 2 26 ? 17.008  0.345   6.480   1.00 0.00 ? 50  ARG B HE   4  
ATOM 3370  H HH11 . ARG B 2 26 ? 17.848  3.471   5.193   1.00 0.00 ? 50  ARG B HH11 4  
ATOM 3371  H HH12 . ARG B 2 26 ? 18.175  4.165   6.746   1.00 0.00 ? 50  ARG B HH12 4  
ATOM 3372  H HH21 . ARG B 2 26 ? 17.437  1.248   8.529   1.00 0.00 ? 50  ARG B HH21 4  
ATOM 3373  H HH22 . ARG B 2 26 ? 17.942  2.901   8.641   1.00 0.00 ? 50  ARG B HH22 4  
ATOM 3374  N N    . TRP B 2 27 ? 15.491  -0.490  -0.303  1.00 0.00 ? 51  TRP B N    4  
ATOM 3375  C CA   . TRP B 2 27 ? 15.560  -0.522  -1.751  1.00 0.00 ? 51  TRP B CA   4  
ATOM 3376  C C    . TRP B 2 27 ? 16.971  -0.254  -2.264  1.00 0.00 ? 51  TRP B C    4  
ATOM 3377  O O    . TRP B 2 27 ? 17.184  -0.082  -3.464  1.00 0.00 ? 51  TRP B O    4  
ATOM 3378  C CB   . TRP B 2 27 ? 14.581  0.486   -2.306  1.00 0.00 ? 51  TRP B CB   4  
ATOM 3379  C CG   . TRP B 2 27 ? 13.291  0.443   -1.572  1.00 0.00 ? 51  TRP B CG   4  
ATOM 3380  C CD1  . TRP B 2 27 ? 12.978  1.044   -0.395  1.00 0.00 ? 51  TRP B CD1  4  
ATOM 3381  C CD2  . TRP B 2 27 ? 12.157  -0.292  -1.958  1.00 0.00 ? 51  TRP B CD2  4  
ATOM 3382  N NE1  . TRP B 2 27 ? 11.698  0.734   -0.035  1.00 0.00 ? 51  TRP B NE1  4  
ATOM 3383  C CE2  . TRP B 2 27 ? 11.168  -0.087  -0.989  1.00 0.00 ? 51  TRP B CE2  4  
ATOM 3384  C CE3  . TRP B 2 27 ? 11.890  -1.095  -3.043  1.00 0.00 ? 51  TRP B CE3  4  
ATOM 3385  C CZ2  . TRP B 2 27 ? 9.920   -0.675  -1.082  1.00 0.00 ? 51  TRP B CZ2  4  
ATOM 3386  C CZ3  . TRP B 2 27 ? 10.650  -1.674  -3.137  1.00 0.00 ? 51  TRP B CZ3  4  
ATOM 3387  C CH2  . TRP B 2 27 ? 9.676   -1.457  -2.150  1.00 0.00 ? 51  TRP B CH2  4  
ATOM 3388  H H    . TRP B 2 27 ? 15.211  -1.292  0.162   1.00 0.00 ? 51  TRP B H    4  
ATOM 3389  H HA   . TRP B 2 27 ? 15.241  -1.505  -2.072  1.00 0.00 ? 51  TRP B HA   4  
ATOM 3390  H HB2  . TRP B 2 27 ? 14.987  1.475   -2.235  1.00 0.00 ? 51  TRP B HB2  4  
ATOM 3391  H HB3  . TRP B 2 27 ? 14.386  0.247   -3.331  1.00 0.00 ? 51  TRP B HB3  4  
ATOM 3392  H HD1  . TRP B 2 27 ? 13.657  1.660   0.163   1.00 0.00 ? 51  TRP B HD1  4  
ATOM 3393  H HE1  . TRP B 2 27 ? 11.238  1.052   0.768   1.00 0.00 ? 51  TRP B HE1  4  
ATOM 3394  H HE3  . TRP B 2 27 ? 12.640  -1.261  -3.802  1.00 0.00 ? 51  TRP B HE3  4  
ATOM 3395  H HZ2  . TRP B 2 27 ? 9.156   -0.532  -0.347  1.00 0.00 ? 51  TRP B HZ2  4  
ATOM 3396  H HZ3  . TRP B 2 27 ? 10.427  -2.309  -3.971  1.00 0.00 ? 51  TRP B HZ3  4  
ATOM 3397  H HH2  . TRP B 2 27 ? 8.706   -1.902  -2.252  1.00 0.00 ? 51  TRP B HH2  4  
ATOM 3398  N N    . SER B 2 28 ? 17.934  -0.226  -1.346  1.00 0.00 ? 52  SER B N    4  
ATOM 3399  C CA   . SER B 2 28 ? 19.328  0.017   -1.702  1.00 0.00 ? 52  SER B CA   4  
ATOM 3400  C C    . SER B 2 28 ? 20.255  -0.910  -0.921  1.00 0.00 ? 52  SER B C    4  
ATOM 3401  O O    . SER B 2 28 ? 20.027  -1.178  0.258   1.00 0.00 ? 52  SER B O    4  
ATOM 3402  C CB   . SER B 2 28 ? 19.699  1.476   -1.427  1.00 0.00 ? 52  SER B CB   4  
ATOM 3403  O OG   . SER B 2 28 ? 18.838  2.360   -2.122  1.00 0.00 ? 52  SER B OG   4  
ATOM 3404  H H    . SER B 2 28 ? 17.700  -0.373  -0.406  1.00 0.00 ? 52  SER B H    4  
ATOM 3405  H HA   . SER B 2 28 ? 19.441  -0.183  -2.757  1.00 0.00 ? 52  SER B HA   4  
ATOM 3406  H HB2  . SER B 2 28 ? 19.620  1.672   -0.369  1.00 0.00 ? 52  SER B HB2  4  
ATOM 3407  H HB3  . SER B 2 28 ? 20.715  1.652   -1.752  1.00 0.00 ? 52  SER B HB3  4  
ATOM 3408  H HG   . SER B 2 28 ? 18.326  1.869   -2.767  1.00 0.00 ? 52  SER B HG   4  
ATOM 3409  N N    . THR B 2 29 ? 21.307  -1.381  -1.586  1.00 0.00 ? 53  THR B N    4  
ATOM 3410  C CA   . THR B 2 29 ? 22.275  -2.279  -0.962  1.00 0.00 ? 53  THR B CA   4  
ATOM 3411  C C    . THR B 2 29 ? 23.633  -2.179  -1.650  1.00 0.00 ? 53  THR B C    4  
ATOM 3412  O O    . THR B 2 29 ? 24.635  -1.844  -1.019  1.00 0.00 ? 53  THR B O    4  
ATOM 3413  C CB   . THR B 2 29 ? 21.806  -3.749  -1.013  1.00 0.00 ? 53  THR B CB   4  
ATOM 3414  O OG1  . THR B 2 29 ? 21.403  -4.088  -2.346  1.00 0.00 ? 53  THR B OG1  4  
ATOM 3415  C CG2  . THR B 2 29 ? 20.654  -3.996  -0.052  1.00 0.00 ? 53  THR B CG2  4  
ATOM 3416  H H    . THR B 2 29 ? 21.438  -1.116  -2.520  1.00 0.00 ? 53  THR B H    4  
ATOM 3417  H HA   . THR B 2 29 ? 22.381  -1.992  0.073   1.00 0.00 ? 53  THR B HA   4  
ATOM 3418  H HB   . THR B 2 29 ? 22.635  -4.383  -0.728  1.00 0.00 ? 53  THR B HB   4  
ATOM 3419  H HG1  . THR B 2 29 ? 21.608  -5.009  -2.518  1.00 0.00 ? 53  THR B HG1  4  
ATOM 3420  H HG21 . THR B 2 29 ? 19.805  -3.397  -0.346  1.00 0.00 ? 53  THR B HG21 4  
ATOM 3421  H HG22 . THR B 2 29 ? 20.956  -3.725  0.949   1.00 0.00 ? 53  THR B HG22 4  
ATOM 3422  H HG23 . THR B 2 29 ? 20.382  -5.042  -0.076  1.00 0.00 ? 53  THR B HG23 4  
ATOM 3423  N N    . GLU B 2 30 ? 23.657  -2.473  -2.947  1.00 0.00 ? 54  GLU B N    4  
ATOM 3424  C CA   . GLU B 2 30 ? 24.891  -2.413  -3.721  1.00 0.00 ? 54  GLU B CA   4  
ATOM 3425  C C    . GLU B 2 30 ? 25.184  -0.985  -4.169  1.00 0.00 ? 54  GLU B C    4  
ATOM 3426  O O    . GLU B 2 30 ? 26.038  -0.754  -5.024  1.00 0.00 ? 54  GLU B O    4  
ATOM 3427  C CB   . GLU B 2 30 ? 24.794  -3.333  -4.939  1.00 0.00 ? 54  GLU B CB   4  
ATOM 3428  C CG   . GLU B 2 30 ? 24.646  -4.802  -4.579  1.00 0.00 ? 54  GLU B CG   4  
ATOM 3429  C CD   . GLU B 2 30 ? 24.472  -5.687  -5.797  1.00 0.00 ? 54  GLU B CD   4  
ATOM 3430  O OE1  . GLU B 2 30 ? 25.495  -6.078  -6.399  1.00 0.00 ? 54  GLU B OE1  4  
ATOM 3431  O OE2  . GLU B 2 30 ? 23.312  -5.988  -6.151  1.00 0.00 ? 54  GLU B OE2  4  
ATOM 3432  H H    . GLU B 2 30 ? 22.826  -2.737  -3.393  1.00 0.00 ? 54  GLU B H    4  
ATOM 3433  H HA   . GLU B 2 30 ? 25.696  -2.752  -3.089  1.00 0.00 ? 54  GLU B HA   4  
ATOM 3434  H HB2  . GLU B 2 30 ? 23.937  -3.041  -5.530  1.00 0.00 ? 54  GLU B HB2  4  
ATOM 3435  H HB3  . GLU B 2 30 ? 25.686  -3.219  -5.535  1.00 0.00 ? 54  GLU B HB3  4  
ATOM 3436  H HG2  . GLU B 2 30 ? 25.531  -5.119  -4.048  1.00 0.00 ? 54  GLU B HG2  4  
ATOM 3437  H HG3  . GLU B 2 30 ? 23.782  -4.918  -3.940  1.00 0.00 ? 54  GLU B HG3  4  
ATOM 3438  N N    . ALA B 2 31 ? 24.469  -0.028  -3.582  1.00 0.00 ? 55  ALA B N    4  
ATOM 3439  C CA   . ALA B 2 31 ? 24.651  1.379   -3.918  1.00 0.00 ? 55  ALA B CA   4  
ATOM 3440  C C    . ALA B 2 31 ? 25.920  1.936   -3.282  1.00 0.00 ? 55  ALA B C    4  
ATOM 3441  O O    . ALA B 2 31 ? 26.977  1.907   -3.945  1.00 0.00 ? 55  ALA B O    4  
ATOM 3442  C CB   . ALA B 2 31 ? 23.438  2.186   -3.481  1.00 0.00 ? 55  ALA B CB   4  
ATOM 3443  O OXT  . ALA B 2 31 ? 25.846  2.397   -2.122  1.00 0.00 ? 55  ALA B OXT  4  
ATOM 3444  H H    . ALA B 2 31 ? 23.802  -0.275  -2.907  1.00 0.00 ? 55  ALA B H    4  
ATOM 3445  H HA   . ALA B 2 31 ? 24.736  1.457   -4.993  1.00 0.00 ? 55  ALA B HA   4  
ATOM 3446  H HB1  . ALA B 2 31 ? 23.567  3.218   -3.775  1.00 0.00 ? 55  ALA B HB1  4  
ATOM 3447  H HB2  . ALA B 2 31 ? 23.337  2.129   -2.406  1.00 0.00 ? 55  ALA B HB2  4  
ATOM 3448  H HB3  . ALA B 2 31 ? 22.551  1.785   -3.948  1.00 0.00 ? 55  ALA B HB3  4  
ATOM 3449  N N    . ALA A 1 1  ? -2.325  -4.536  15.075  1.00 0.00 ? 106 ALA A N    5  
ATOM 3450  C CA   . ALA A 1 1  ? -2.897  -3.383  15.815  1.00 0.00 ? 106 ALA A CA   5  
ATOM 3451  C C    . ALA A 1 1  ? -3.674  -2.463  14.882  1.00 0.00 ? 106 ALA A C    5  
ATOM 3452  O O    . ALA A 1 1  ? -4.632  -1.808  15.295  1.00 0.00 ? 106 ALA A O    5  
ATOM 3453  C CB   . ALA A 1 1  ? -1.793  -2.608  16.519  1.00 0.00 ? 106 ALA A CB   5  
ATOM 3454  H H1   . ALA A 1 1  ? -1.792  -5.150  15.724  1.00 0.00 ? 106 ALA A H1   5  
ATOM 3455  H H2   . ALA A 1 1  ? -1.683  -4.200  14.328  1.00 0.00 ? 106 ALA A H2   5  
ATOM 3456  H H3   . ALA A 1 1  ? -3.087  -5.093  14.637  1.00 0.00 ? 106 ALA A H3   5  
ATOM 3457  H HA   . ALA A 1 1  ? -3.570  -3.763  16.569  1.00 0.00 ? 106 ALA A HA   5  
ATOM 3458  H HB1  . ALA A 1 1  ? -1.143  -2.158  15.782  1.00 0.00 ? 106 ALA A HB1  5  
ATOM 3459  H HB2  . ALA A 1 1  ? -1.220  -3.281  17.140  1.00 0.00 ? 106 ALA A HB2  5  
ATOM 3460  H HB3  . ALA A 1 1  ? -2.230  -1.835  17.133  1.00 0.00 ? 106 ALA A HB3  5  
ATOM 3461  N N    . ALA A 1 2  ? -3.254  -2.416  13.621  1.00 0.00 ? 107 ALA A N    5  
ATOM 3462  C CA   . ALA A 1 2  ? -3.911  -1.575  12.628  1.00 0.00 ? 107 ALA A CA   5  
ATOM 3463  C C    . ALA A 1 2  ? -4.910  -2.374  11.804  1.00 0.00 ? 107 ALA A C    5  
ATOM 3464  O O    . ALA A 1 2  ? -6.118  -2.298  12.024  1.00 0.00 ? 107 ALA A O    5  
ATOM 3465  C CB   . ALA A 1 2  ? -2.877  -0.921  11.722  1.00 0.00 ? 107 ALA A CB   5  
ATOM 3466  H H    . ALA A 1 2  ? -2.484  -2.959  13.353  1.00 0.00 ? 107 ALA A H    5  
ATOM 3467  H HA   . ALA A 1 2  ? -4.438  -0.797  13.148  1.00 0.00 ? 107 ALA A HA   5  
ATOM 3468  H HB1  . ALA A 1 2  ? -2.180  -0.355  12.322  1.00 0.00 ? 107 ALA A HB1  5  
ATOM 3469  H HB2  . ALA A 1 2  ? -3.375  -0.260  11.028  1.00 0.00 ? 107 ALA A HB2  5  
ATOM 3470  H HB3  . ALA A 1 2  ? -2.344  -1.683  11.174  1.00 0.00 ? 107 ALA A HB3  5  
ATOM 3471  N N    . ALA A 1 3  ? -4.391  -3.140  10.855  1.00 0.00 ? 108 ALA A N    5  
ATOM 3472  C CA   . ALA A 1 3  ? -5.228  -3.959  9.987   1.00 0.00 ? 108 ALA A CA   5  
ATOM 3473  C C    . ALA A 1 3  ? -4.704  -5.387  9.902   1.00 0.00 ? 108 ALA A C    5  
ATOM 3474  O O    . ALA A 1 3  ? -3.925  -5.828  10.748  1.00 0.00 ? 108 ALA A O    5  
ATOM 3475  C CB   . ALA A 1 3  ? -5.303  -3.349  8.596   1.00 0.00 ? 108 ALA A CB   5  
ATOM 3476  H H    . ALA A 1 3  ? -3.422  -3.152  10.738  1.00 0.00 ? 108 ALA A H    5  
ATOM 3477  H HA   . ALA A 1 3  ? -6.225  -3.976  10.401  1.00 0.00 ? 108 ALA A HA   5  
ATOM 3478  H HB1  . ALA A 1 3  ? -6.282  -3.525  8.177   1.00 0.00 ? 108 ALA A HB1  5  
ATOM 3479  H HB2  . ALA A 1 3  ? -4.554  -3.808  7.964   1.00 0.00 ? 108 ALA A HB2  5  
ATOM 3480  H HB3  . ALA A 1 3  ? -5.121  -2.286  8.658   1.00 0.00 ? 108 ALA A HB3  5  
ATOM 3481  N N    . THR A 1 4  ? -5.136  -6.104  8.870   1.00 0.00 ? 109 THR A N    5  
ATOM 3482  C CA   . THR A 1 4  ? -4.712  -7.481  8.658   1.00 0.00 ? 109 THR A CA   5  
ATOM 3483  C C    . THR A 1 4  ? -3.288  -7.521  8.096   1.00 0.00 ? 109 THR A C    5  
ATOM 3484  O O    . THR A 1 4  ? -2.421  -6.774  8.552   1.00 0.00 ? 109 THR A O    5  
ATOM 3485  C CB   . THR A 1 4  ? -5.689  -8.209  7.709   1.00 0.00 ? 109 THR A CB   5  
ATOM 3486  O OG1  . THR A 1 4  ? -5.318  -9.585  7.568   1.00 0.00 ? 109 THR A OG1  5  
ATOM 3487  C CG2  . THR A 1 4  ? -5.724  -7.537  6.341   1.00 0.00 ? 109 THR A CG2  5  
ATOM 3488  H H    . THR A 1 4  ? -5.758  -5.694  8.233   1.00 0.00 ? 109 THR A H    5  
ATOM 3489  H HA   . THR A 1 4  ? -4.726  -7.985  9.615   1.00 0.00 ? 109 THR A HA   5  
ATOM 3490  H HB   . THR A 1 4  ? -6.680  -8.157  8.138   1.00 0.00 ? 109 THR A HB   5  
ATOM 3491  H HG1  . THR A 1 4  ? -5.280  -9.813  6.638   1.00 0.00 ? 109 THR A HG1  5  
ATOM 3492  H HG21 . THR A 1 4  ? -5.030  -6.708  6.327   1.00 0.00 ? 109 THR A HG21 5  
ATOM 3493  H HG22 . THR A 1 4  ? -6.722  -7.176  6.143   1.00 0.00 ? 109 THR A HG22 5  
ATOM 3494  H HG23 . THR A 1 4  ? -5.443  -8.253  5.582   1.00 0.00 ? 109 THR A HG23 5  
ATOM 3495  N N    . ASN A 1 5  ? -3.041  -8.388  7.117   1.00 0.00 ? 110 ASN A N    5  
ATOM 3496  C CA   . ASN A 1 5  ? -1.722  -8.497  6.509   1.00 0.00 ? 110 ASN A CA   5  
ATOM 3497  C C    . ASN A 1 5  ? -1.527  -7.413  5.453   1.00 0.00 ? 110 ASN A C    5  
ATOM 3498  O O    . ASN A 1 5  ? -2.146  -7.460  4.390   1.00 0.00 ? 110 ASN A O    5  
ATOM 3499  C CB   . ASN A 1 5  ? -1.537  -9.875  5.869   1.00 0.00 ? 110 ASN A CB   5  
ATOM 3500  C CG   . ASN A 1 5  ? -1.007  -10.901 6.844   1.00 0.00 ? 110 ASN A CG   5  
ATOM 3501  O OD1  . ASN A 1 5  ? -1.768  -11.537 7.573   1.00 0.00 ? 110 ASN A OD1  5  
ATOM 3502  N ND2  . ASN A 1 5  ? 0.307   -11.073 6.856   1.00 0.00 ? 110 ASN A ND2  5  
ATOM 3503  H H    . ASN A 1 5  ? -3.761  -8.962  6.791   1.00 0.00 ? 110 ASN A H    5  
ATOM 3504  H HA   . ASN A 1 5  ? -0.983  -8.368  7.284   1.00 0.00 ? 110 ASN A HA   5  
ATOM 3505  H HB2  . ASN A 1 5  ? -2.483  -10.226 5.493   1.00 0.00 ? 110 ASN A HB2  5  
ATOM 3506  H HB3  . ASN A 1 5  ? -0.837  -9.794  5.049   1.00 0.00 ? 110 ASN A HB3  5  
ATOM 3507  H HD21 . ASN A 1 5  ? 0.851   -10.534 6.242   1.00 0.00 ? 110 ASN A HD21 5  
ATOM 3508  H HD22 . ASN A 1 5  ? 0.677   -11.733 7.472   1.00 0.00 ? 110 ASN A HD22 5  
ATOM 3509  N N    . PRO A 1 6  ? -0.666  -6.418  5.728   1.00 0.00 ? 111 PRO A N    5  
ATOM 3510  C CA   . PRO A 1 6  ? -0.404  -5.337  4.782   1.00 0.00 ? 111 PRO A CA   5  
ATOM 3511  C C    . PRO A 1 6  ? 0.402   -5.821  3.587   1.00 0.00 ? 111 PRO A C    5  
ATOM 3512  O O    . PRO A 1 6  ? 1.631   -5.782  3.601   1.00 0.00 ? 111 PRO A O    5  
ATOM 3513  C CB   . PRO A 1 6  ? 0.392   -4.331  5.604   1.00 0.00 ? 111 PRO A CB   5  
ATOM 3514  C CG   . PRO A 1 6  ? 1.079   -5.157  6.632   1.00 0.00 ? 111 PRO A CG   5  
ATOM 3515  C CD   . PRO A 1 6  ? 0.124   -6.268  6.967   1.00 0.00 ? 111 PRO A CD   5  
ATOM 3516  H HA   . PRO A 1 6  ? -1.316  -4.882  4.437   1.00 0.00 ? 111 PRO A HA   5  
ATOM 3517  H HB2  . PRO A 1 6  ? 1.089   -3.820  4.962   1.00 0.00 ? 111 PRO A HB2  5  
ATOM 3518  H HB3  . PRO A 1 6  ? -0.282  -3.618  6.054   1.00 0.00 ? 111 PRO A HB3  5  
ATOM 3519  H HG2  . PRO A 1 6  ? 1.996   -5.561  6.230   1.00 0.00 ? 111 PRO A HG2  5  
ATOM 3520  H HG3  . PRO A 1 6  ? 1.282   -4.563  7.510   1.00 0.00 ? 111 PRO A HG3  5  
ATOM 3521  H HD2  . PRO A 1 6  ? 0.666   -7.175  7.194   1.00 0.00 ? 111 PRO A HD2  5  
ATOM 3522  H HD3  . PRO A 1 6  ? -0.508  -5.986  7.796   1.00 0.00 ? 111 PRO A HD3  5  
ATOM 3523  N N    . ALA A 1 7  ? -0.321  -6.291  2.570   1.00 0.00 ? 112 ALA A N    5  
ATOM 3524  C CA   . ALA A 1 7  ? 0.264   -6.808  1.331   1.00 0.00 ? 112 ALA A CA   5  
ATOM 3525  C C    . ALA A 1 7  ? -0.789  -7.586  0.572   1.00 0.00 ? 112 ALA A C    5  
ATOM 3526  O O    . ALA A 1 7  ? -1.102  -7.294  -0.581  1.00 0.00 ? 112 ALA A O    5  
ATOM 3527  C CB   . ALA A 1 7  ? 1.453   -7.714  1.610   1.00 0.00 ? 112 ALA A CB   5  
ATOM 3528  H H    . ALA A 1 7  ? -1.296  -6.291  2.657   1.00 0.00 ? 112 ALA A H    5  
ATOM 3529  H HA   . ALA A 1 7  ? 0.594   -5.973  0.733   1.00 0.00 ? 112 ALA A HA   5  
ATOM 3530  H HB1  . ALA A 1 7  ? 1.128   -8.568  2.186   1.00 0.00 ? 112 ALA A HB1  5  
ATOM 3531  H HB2  . ALA A 1 7  ? 2.193   -7.170  2.165   1.00 0.00 ? 112 ALA A HB2  5  
ATOM 3532  H HB3  . ALA A 1 7  ? 1.876   -8.051  0.677   1.00 0.00 ? 112 ALA A HB3  5  
ATOM 3533  N N    . ARG A 1 8  ? -1.329  -8.586  1.251   1.00 0.00 ? 113 ARG A N    5  
ATOM 3534  C CA   . ARG A 1 8  ? -2.371  -9.429  0.686   1.00 0.00 ? 113 ARG A CA   5  
ATOM 3535  C C    . ARG A 1 8  ? -3.705  -8.694  0.687   1.00 0.00 ? 113 ARG A C    5  
ATOM 3536  O O    . ARG A 1 8  ? -4.521  -8.861  -0.222  1.00 0.00 ? 113 ARG A O    5  
ATOM 3537  C CB   . ARG A 1 8  ? -2.488  -10.729 1.486   1.00 0.00 ? 113 ARG A CB   5  
ATOM 3538  C CG   . ARG A 1 8  ? -2.098  -11.969 0.699   1.00 0.00 ? 113 ARG A CG   5  
ATOM 3539  C CD   . ARG A 1 8  ? -3.095  -12.268 -0.411  1.00 0.00 ? 113 ARG A CD   5  
ATOM 3540  N NE   . ARG A 1 8  ? -4.413  -12.617 0.115   1.00 0.00 ? 113 ARG A NE   5  
ATOM 3541  C CZ   . ARG A 1 8  ? -5.346  -13.249 -0.590  1.00 0.00 ? 113 ARG A CZ   5  
ATOM 3542  N NH1  . ARG A 1 8  ? -5.111  -13.600 -1.848  1.00 0.00 ? 113 ARG A NH1  5  
ATOM 3543  N NH2  . ARG A 1 8  ? -6.518  -13.533 -0.038  1.00 0.00 ? 113 ARG A NH2  5  
ATOM 3544  H H    . ARG A 1 8  ? -1.003  -8.767  2.159   1.00 0.00 ? 113 ARG A H    5  
ATOM 3545  H HA   . ARG A 1 8  ? -2.097  -9.662  -0.333  1.00 0.00 ? 113 ARG A HA   5  
ATOM 3546  H HB2  . ARG A 1 8  ? -1.847  -10.662 2.353   1.00 0.00 ? 113 ARG A HB2  5  
ATOM 3547  H HB3  . ARG A 1 8  ? -3.512  -10.844 1.817   1.00 0.00 ? 113 ARG A HB3  5  
ATOM 3548  H HG2  . ARG A 1 8  ? -1.124  -11.812 0.259   1.00 0.00 ? 113 ARG A HG2  5  
ATOM 3549  H HG3  . ARG A 1 8  ? -2.059  -12.813 1.371   1.00 0.00 ? 113 ARG A HG3  5  
ATOM 3550  H HD2  . ARG A 1 8  ? -3.189  -11.392 -1.038  1.00 0.00 ? 113 ARG A HD2  5  
ATOM 3551  H HD3  . ARG A 1 8  ? -2.722  -13.093 -1.000  1.00 0.00 ? 113 ARG A HD3  5  
ATOM 3552  H HE   . ARG A 1 8  ? -4.611  -12.367 1.042   1.00 0.00 ? 113 ARG A HE   5  
ATOM 3553  H HH11 . ARG A 1 8  ? -4.229  -13.389 -2.269  1.00 0.00 ? 113 ARG A HH11 5  
ATOM 3554  H HH12 . ARG A 1 8  ? -5.815  -14.076 -2.376  1.00 0.00 ? 113 ARG A HH12 5  
ATOM 3555  H HH21 . ARG A 1 8  ? -6.701  -13.270 0.910   1.00 0.00 ? 113 ARG A HH21 5  
ATOM 3556  H HH22 . ARG A 1 8  ? -7.219  -14.008 -0.567  1.00 0.00 ? 113 ARG A HH22 5  
ATOM 3557  N N    . TYR A 1 9  ? -3.918  -7.869  1.712   1.00 0.00 ? 114 TYR A N    5  
ATOM 3558  C CA   . TYR A 1 9  ? -5.156  -7.113  1.823   1.00 0.00 ? 114 TYR A CA   5  
ATOM 3559  C C    . TYR A 1 9  ? -5.304  -6.164  0.642   1.00 0.00 ? 114 TYR A C    5  
ATOM 3560  O O    . TYR A 1 9  ? -6.420  -5.846  0.232   1.00 0.00 ? 114 TYR A O    5  
ATOM 3561  C CB   . TYR A 1 9  ? -5.230  -6.367  3.173   1.00 0.00 ? 114 TYR A CB   5  
ATOM 3562  C CG   . TYR A 1 9  ? -4.823  -4.900  3.160   1.00 0.00 ? 114 TYR A CG   5  
ATOM 3563  C CD1  . TYR A 1 9  ? -5.591  -3.941  2.503   1.00 0.00 ? 114 TYR A CD1  5  
ATOM 3564  C CD2  . TYR A 1 9  ? -3.687  -4.469  3.837   1.00 0.00 ? 114 TYR A CD2  5  
ATOM 3565  C CE1  . TYR A 1 9  ? -5.236  -2.605  2.517   1.00 0.00 ? 114 TYR A CE1  5  
ATOM 3566  C CE2  . TYR A 1 9  ? -3.327  -3.136  3.854   1.00 0.00 ? 114 TYR A CE2  5  
ATOM 3567  C CZ   . TYR A 1 9  ? -4.105  -2.209  3.196   1.00 0.00 ? 114 TYR A CZ   5  
ATOM 3568  O OH   . TYR A 1 9  ? -3.751  -0.880  3.218   1.00 0.00 ? 114 TYR A OH   5  
ATOM 3569  H H    . TYR A 1 9  ? -3.230  -7.771  2.402   1.00 0.00 ? 114 TYR A H    5  
ATOM 3570  H HA   . TYR A 1 9  ? -5.967  -7.823  1.780   1.00 0.00 ? 114 TYR A HA   5  
ATOM 3571  H HB2  . TYR A 1 9  ? -6.245  -6.414  3.534   1.00 0.00 ? 114 TYR A HB2  5  
ATOM 3572  H HB3  . TYR A 1 9  ? -4.590  -6.877  3.879   1.00 0.00 ? 114 TYR A HB3  5  
ATOM 3573  H HD1  . TYR A 1 9  ? -6.477  -4.254  1.970   1.00 0.00 ? 114 TYR A HD1  5  
ATOM 3574  H HD2  . TYR A 1 9  ? -3.072  -5.194  4.353   1.00 0.00 ? 114 TYR A HD2  5  
ATOM 3575  H HE1  . TYR A 1 9  ? -5.842  -1.879  1.994   1.00 0.00 ? 114 TYR A HE1  5  
ATOM 3576  H HE2  . TYR A 1 9  ? -2.442  -2.826  4.386   1.00 0.00 ? 114 TYR A HE2  5  
ATOM 3577  H HH   . TYR A 1 9  ? -2.804  -0.798  3.083   1.00 0.00 ? 114 TYR A HH   5  
ATOM 3578  N N    . CYS A 1 10 ? -4.178  -5.712  0.092   1.00 0.00 ? 115 CYS A N    5  
ATOM 3579  C CA   . CYS A 1 10 ? -4.223  -4.808  -1.046  1.00 0.00 ? 115 CYS A CA   5  
ATOM 3580  C C    . CYS A 1 10 ? -4.373  -5.581  -2.343  1.00 0.00 ? 115 CYS A C    5  
ATOM 3581  O O    . CYS A 1 10 ? -5.015  -5.111  -3.285  1.00 0.00 ? 115 CYS A O    5  
ATOM 3582  C CB   . CYS A 1 10 ? -2.993  -3.904  -1.109  1.00 0.00 ? 115 CYS A CB   5  
ATOM 3583  S SG   . CYS A 1 10 ? -2.711  -2.942  0.395   1.00 0.00 ? 115 CYS A SG   5  
ATOM 3584  H H    . CYS A 1 10 ? -3.313  -5.990  0.457   1.00 0.00 ? 115 CYS A H    5  
ATOM 3585  H HA   . CYS A 1 10 ? -5.097  -4.188  -0.922  1.00 0.00 ? 115 CYS A HA   5  
ATOM 3586  H HB2  . CYS A 1 10 ? -2.101  -4.485  -1.302  1.00 0.00 ? 115 CYS A HB2  5  
ATOM 3587  H HB3  . CYS A 1 10 ? -3.128  -3.201  -1.918  1.00 0.00 ? 115 CYS A HB3  5  
ATOM 3588  N N    . CYS A 1 11 ? -3.776  -6.764  -2.396  1.00 0.00 ? 116 CYS A N    5  
ATOM 3589  C CA   . CYS A 1 11 ? -3.873  -7.600  -3.579  1.00 0.00 ? 116 CYS A CA   5  
ATOM 3590  C C    . CYS A 1 11 ? -5.339  -7.822  -3.917  1.00 0.00 ? 116 CYS A C    5  
ATOM 3591  O O    . CYS A 1 11 ? -5.721  -7.895  -5.085  1.00 0.00 ? 116 CYS A O    5  
ATOM 3592  C CB   . CYS A 1 11 ? -3.169  -8.939  -3.340  1.00 0.00 ? 116 CYS A CB   5  
ATOM 3593  S SG   . CYS A 1 11 ? -3.150  -10.052 -4.782  1.00 0.00 ? 116 CYS A SG   5  
ATOM 3594  H H    . CYS A 1 11 ? -3.264  -7.080  -1.622  1.00 0.00 ? 116 CYS A H    5  
ATOM 3595  H HA   . CYS A 1 11 ? -3.398  -7.079  -4.399  1.00 0.00 ? 116 CYS A HA   5  
ATOM 3596  H HB2  . CYS A 1 11 ? -2.144  -8.751  -3.061  1.00 0.00 ? 116 CYS A HB2  5  
ATOM 3597  H HB3  . CYS A 1 11 ? -3.662  -9.454  -2.534  1.00 0.00 ? 116 CYS A HB3  5  
ATOM 3598  N N    . LEU A 1 12 ? -6.155  -7.928  -2.873  1.00 0.00 ? 117 LEU A N    5  
ATOM 3599  C CA   . LEU A 1 12 ? -7.582  -8.118  -3.026  1.00 0.00 ? 117 LEU A CA   5  
ATOM 3600  C C    . LEU A 1 12 ? -8.291  -6.786  -3.275  1.00 0.00 ? 117 LEU A C    5  
ATOM 3601  O O    . LEU A 1 12 ? -9.031  -6.639  -4.249  1.00 0.00 ? 117 LEU A O    5  
ATOM 3602  C CB   . LEU A 1 12 ? -8.142  -8.785  -1.774  1.00 0.00 ? 117 LEU A CB   5  
ATOM 3603  C CG   . LEU A 1 12 ? -7.881  -10.289 -1.659  1.00 0.00 ? 117 LEU A CG   5  
ATOM 3604  C CD1  . LEU A 1 12 ? -8.326  -10.804 -0.300  1.00 0.00 ? 117 LEU A CD1  5  
ATOM 3605  C CD2  . LEU A 1 12 ? -8.594  -11.043 -2.774  1.00 0.00 ? 117 LEU A CD2  5  
ATOM 3606  H H    . LEU A 1 12 ? -5.782  -7.888  -1.967  1.00 0.00 ? 117 LEU A H    5  
ATOM 3607  H HA   . LEU A 1 12 ? -7.745  -8.766  -3.867  1.00 0.00 ? 117 LEU A HA   5  
ATOM 3608  H HB2  . LEU A 1 12 ? -7.702  -8.301  -0.920  1.00 0.00 ? 117 LEU A HB2  5  
ATOM 3609  H HB3  . LEU A 1 12 ? -9.201  -8.620  -1.751  1.00 0.00 ? 117 LEU A HB3  5  
ATOM 3610  H HG   . LEU A 1 12 ? -6.821  -10.473 -1.754  1.00 0.00 ? 117 LEU A HG   5  
ATOM 3611  H HD11 . LEU A 1 12 ? -9.375  -10.586 -0.157  1.00 0.00 ? 117 LEU A HD11 5  
ATOM 3612  H HD12 . LEU A 1 12 ? -7.749  -10.324 0.475   1.00 0.00 ? 117 LEU A HD12 5  
ATOM 3613  H HD13 . LEU A 1 12 ? -8.173  -11.873 -0.252  1.00 0.00 ? 117 LEU A HD13 5  
ATOM 3614  H HD21 . LEU A 1 12 ? -9.658  -10.877 -2.698  1.00 0.00 ? 117 LEU A HD21 5  
ATOM 3615  H HD22 . LEU A 1 12 ? -8.387  -12.098 -2.683  1.00 0.00 ? 117 LEU A HD22 5  
ATOM 3616  H HD23 . LEU A 1 12 ? -8.242  -10.688 -3.731  1.00 0.00 ? 117 LEU A HD23 5  
ATOM 3617  N N    . SER A 1 13 ? -8.062  -5.817  -2.386  1.00 0.00 ? 118 SER A N    5  
ATOM 3618  C CA   . SER A 1 13 ? -8.685  -4.502  -2.501  1.00 0.00 ? 118 SER A CA   5  
ATOM 3619  C C    . SER A 1 13 ? -7.687  -3.429  -2.945  1.00 0.00 ? 118 SER A C    5  
ATOM 3620  O O    . SER A 1 13 ? -7.888  -2.769  -3.964  1.00 0.00 ? 118 SER A O    5  
ATOM 3621  C CB   . SER A 1 13 ? -9.307  -4.108  -1.164  1.00 0.00 ? 118 SER A CB   5  
ATOM 3622  O OG   . SER A 1 13 ? -10.430 -4.916  -0.864  1.00 0.00 ? 118 SER A OG   5  
ATOM 3623  H H    . SER A 1 13 ? -7.465  -5.990  -1.632  1.00 0.00 ? 118 SER A H    5  
ATOM 3624  H HA   . SER A 1 13 ? -9.468  -4.572  -3.241  1.00 0.00 ? 118 SER A HA   5  
ATOM 3625  H HB2  . SER A 1 13 ? -8.573  -4.229  -0.380  1.00 0.00 ? 118 SER A HB2  5  
ATOM 3626  H HB3  . SER A 1 13 ? -9.617  -3.078  -1.207  1.00 0.00 ? 118 SER A HB3  5  
ATOM 3627  H HG   . SER A 1 13 ? -10.267 -5.815  -1.158  1.00 0.00 ? 118 SER A HG   5  
ATOM 3628  N N    . GLY A 1 14 ? -6.621  -3.249  -2.166  1.00 0.00 ? 119 GLY A N    5  
ATOM 3629  C CA   . GLY A 1 14 ? -5.613  -2.250  -2.495  1.00 0.00 ? 119 GLY A CA   5  
ATOM 3630  C C    . GLY A 1 14 ? -5.310  -1.326  -1.325  1.00 0.00 ? 119 GLY A C    5  
ATOM 3631  O O    . GLY A 1 14 ? -5.961  -1.415  -0.286  1.00 0.00 ? 119 GLY A O    5  
ATOM 3632  H H    . GLY A 1 14 ? -6.512  -3.803  -1.365  1.00 0.00 ? 119 GLY A H    5  
ATOM 3633  H HA2  . GLY A 1 14 ? -4.705  -2.756  -2.776  1.00 0.00 ? 119 GLY A HA2  5  
ATOM 3634  H HA3  . GLY A 1 14 ? -5.965  -1.661  -3.334  1.00 0.00 ? 119 GLY A HA3  5  
ATOM 3635  N N    . CYS A 1 15 ? -4.314  -0.446  -1.478  1.00 0.00 ? 120 CYS A N    5  
ATOM 3636  C CA   . CYS A 1 15 ? -3.960  0.486   -0.403  1.00 0.00 ? 120 CYS A CA   5  
ATOM 3637  C C    . CYS A 1 15 ? -3.793  1.903   -0.921  1.00 0.00 ? 120 CYS A C    5  
ATOM 3638  O O    . CYS A 1 15 ? -3.500  2.124   -2.097  1.00 0.00 ? 120 CYS A O    5  
ATOM 3639  C CB   . CYS A 1 15 ? -2.680  0.081   0.344   1.00 0.00 ? 120 CYS A CB   5  
ATOM 3640  S SG   . CYS A 1 15 ? -1.778  -1.332  -0.339  1.00 0.00 ? 120 CYS A SG   5  
ATOM 3641  H H    . CYS A 1 15 ? -3.824  -0.412  -2.329  1.00 0.00 ? 120 CYS A H    5  
ATOM 3642  H HA   . CYS A 1 15 ? -4.775  0.484   0.297   1.00 0.00 ? 120 CYS A HA   5  
ATOM 3643  H HB2  . CYS A 1 15 ? -1.994  0.915   0.327   1.00 0.00 ? 120 CYS A HB2  5  
ATOM 3644  H HB3  . CYS A 1 15 ? -2.928  -0.150  1.367   1.00 0.00 ? 120 CYS A HB3  5  
ATOM 3645  N N    . THR A 1 16 ? -3.985  2.858   -0.020  1.00 0.00 ? 121 THR A N    5  
ATOM 3646  C CA   . THR A 1 16 ? -3.845  4.265   -0.352  1.00 0.00 ? 121 THR A CA   5  
ATOM 3647  C C    . THR A 1 16 ? -2.486  4.769   0.050   1.00 0.00 ? 121 THR A C    5  
ATOM 3648  O O    . THR A 1 16 ? -1.828  4.187   0.910   1.00 0.00 ? 121 THR A O    5  
ATOM 3649  C CB   . THR A 1 16 ? -4.882  5.132   0.369   1.00 0.00 ? 121 THR A CB   5  
ATOM 3650  O OG1  . THR A 1 16 ? -4.693  5.061   1.787   1.00 0.00 ? 121 THR A OG1  5  
ATOM 3651  C CG2  . THR A 1 16 ? -6.271  4.683   0.019   1.00 0.00 ? 121 THR A CG2  5  
ATOM 3652  H H    . THR A 1 16 ? -4.227  2.608   0.896   1.00 0.00 ? 121 THR A H    5  
ATOM 3653  H HA   . THR A 1 16 ? -3.973  4.383   -1.417  1.00 0.00 ? 121 THR A HA   5  
ATOM 3654  H HB   . THR A 1 16 ? -4.761  6.151   0.044   1.00 0.00 ? 121 THR A HB   5  
ATOM 3655  H HG1  . THR A 1 16 ? -5.383  4.517   2.176   1.00 0.00 ? 121 THR A HG1  5  
ATOM 3656  H HG21 . THR A 1 16 ? -6.241  4.223   -0.950  1.00 0.00 ? 121 THR A HG21 5  
ATOM 3657  H HG22 . THR A 1 16 ? -6.935  5.536   -0.002  1.00 0.00 ? 121 THR A HG22 5  
ATOM 3658  H HG23 . THR A 1 16 ? -6.619  3.968   0.750   1.00 0.00 ? 121 THR A HG23 5  
ATOM 3659  N N    . GLN A 1 17 ? -2.081  5.875   -0.546  1.00 0.00 ? 122 GLN A N    5  
ATOM 3660  C CA   . GLN A 1 17 ? -0.804  6.476   -0.226  1.00 0.00 ? 122 GLN A CA   5  
ATOM 3661  C C    . GLN A 1 17 ? -0.788  6.890   1.234   1.00 0.00 ? 122 GLN A C    5  
ATOM 3662  O O    . GLN A 1 17 ? 0.164   7.499   1.704   1.00 0.00 ? 122 GLN A O    5  
ATOM 3663  C CB   . GLN A 1 17 ? -0.530  7.658   -1.149  1.00 0.00 ? 122 GLN A CB   5  
ATOM 3664  C CG   . GLN A 1 17 ? 0.084   7.246   -2.478  1.00 0.00 ? 122 GLN A CG   5  
ATOM 3665  C CD   . GLN A 1 17 ? -0.015  8.330   -3.534  1.00 0.00 ? 122 GLN A CD   5  
ATOM 3666  O OE1  . GLN A 1 17 ? -0.106  8.042   -4.728  1.00 0.00 ? 122 GLN A OE1  5  
ATOM 3667  N NE2  . GLN A 1 17 ? 0.003   9.587   -3.102  1.00 0.00 ? 122 GLN A NE2  5  
ATOM 3668  H H    . GLN A 1 17 ? -2.661  6.301   -1.211  1.00 0.00 ? 122 GLN A H    5  
ATOM 3669  H HA   . GLN A 1 17 ? -0.032  5.722   -0.370  1.00 0.00 ? 122 GLN A HA   5  
ATOM 3670  H HB2  . GLN A 1 17 ? -1.462  8.168   -1.347  1.00 0.00 ? 122 GLN A HB2  5  
ATOM 3671  H HB3  . GLN A 1 17 ? 0.143   8.334   -0.655  1.00 0.00 ? 122 GLN A HB3  5  
ATOM 3672  H HG2  . GLN A 1 17 ? 1.127   7.011   -2.320  1.00 0.00 ? 122 GLN A HG2  5  
ATOM 3673  H HG3  . GLN A 1 17 ? -0.424  6.362   -2.834  1.00 0.00 ? 122 GLN A HG3  5  
ATOM 3674  H HE21 . GLN A 1 17 ? 0.079   9.743   -2.138  1.00 0.00 ? 122 GLN A HE21 5  
ATOM 3675  H HE22 . GLN A 1 17 ? -0.061  10.305  -3.764  1.00 0.00 ? 122 GLN A HE22 5  
ATOM 3676  N N    . GLN A 1 18 ? -1.873  6.590   1.938   1.00 0.00 ? 123 GLN A N    5  
ATOM 3677  C CA   . GLN A 1 18 ? -1.949  6.849   3.353   1.00 0.00 ? 123 GLN A CA   5  
ATOM 3678  C C    . GLN A 1 18 ? -1.552  5.576   4.074   1.00 0.00 ? 123 GLN A C    5  
ATOM 3679  O O    . GLN A 1 18 ? -0.601  5.565   4.852   1.00 0.00 ? 123 GLN A O    5  
ATOM 3680  C CB   . GLN A 1 18 ? -3.353  7.270   3.757   1.00 0.00 ? 123 GLN A CB   5  
ATOM 3681  C CG   . GLN A 1 18 ? -3.634  8.749   3.557   1.00 0.00 ? 123 GLN A CG   5  
ATOM 3682  C CD   . GLN A 1 18 ? -5.079  9.114   3.844   1.00 0.00 ? 123 GLN A CD   5  
ATOM 3683  O OE1  . GLN A 1 18 ? -5.618  10.056  3.264   1.00 0.00 ? 123 GLN A OE1  5  
ATOM 3684  N NE2  . GLN A 1 18 ? -5.713  8.369   4.744   1.00 0.00 ? 123 GLN A NE2  5  
ATOM 3685  H H    . GLN A 1 18 ? -2.653  6.198   1.488   1.00 0.00 ? 123 GLN A H    5  
ATOM 3686  H HA   . GLN A 1 18 ? -1.245  7.628   3.597   1.00 0.00 ? 123 GLN A HA   5  
ATOM 3687  H HB2  . GLN A 1 18 ? -4.062  6.708   3.171   1.00 0.00 ? 123 GLN A HB2  5  
ATOM 3688  H HB3  . GLN A 1 18 ? -3.492  7.032   4.796   1.00 0.00 ? 123 GLN A HB3  5  
ATOM 3689  H HG2  . GLN A 1 18 ? -2.998  9.316   4.221   1.00 0.00 ? 123 GLN A HG2  5  
ATOM 3690  H HG3  . GLN A 1 18 ? -3.409  9.010   2.534   1.00 0.00 ? 123 GLN A HG3  5  
ATOM 3691  H HE21 . GLN A 1 18 ? -5.222  7.634   5.166   1.00 0.00 ? 123 GLN A HE21 5  
ATOM 3692  H HE22 . GLN A 1 18 ? -6.648  8.584   4.946   1.00 0.00 ? 123 GLN A HE22 5  
ATOM 3693  N N    . ASP A 1 19 ? -2.270  4.490   3.780   1.00 0.00 ? 124 ASP A N    5  
ATOM 3694  C CA   . ASP A 1 19 ? -1.961  3.200   4.377   1.00 0.00 ? 124 ASP A CA   5  
ATOM 3695  C C    . ASP A 1 19 ? -0.504  2.861   4.092   1.00 0.00 ? 124 ASP A C    5  
ATOM 3696  O O    . ASP A 1 19 ? 0.272   2.547   4.996   1.00 0.00 ? 124 ASP A O    5  
ATOM 3697  C CB   . ASP A 1 19 ? -2.883  2.108   3.813   1.00 0.00 ? 124 ASP A CB   5  
ATOM 3698  C CG   . ASP A 1 19 ? -4.224  2.064   4.519   1.00 0.00 ? 124 ASP A CG   5  
ATOM 3699  O OD1  . ASP A 1 19 ? -4.329  1.369   5.551   1.00 0.00 ? 124 ASP A OD1  5  
ATOM 3700  O OD2  . ASP A 1 19 ? -5.168  2.727   4.041   1.00 0.00 ? 124 ASP A OD2  5  
ATOM 3701  H H    . ASP A 1 19 ? -3.016  4.560   3.137   1.00 0.00 ? 124 ASP A H    5  
ATOM 3702  H HA   . ASP A 1 19 ? -2.106  3.277   5.445   1.00 0.00 ? 124 ASP A HA   5  
ATOM 3703  H HB2  . ASP A 1 19 ? -3.059  2.299   2.766   1.00 0.00 ? 124 ASP A HB2  5  
ATOM 3704  H HB3  . ASP A 1 19 ? -2.406  1.146   3.919   1.00 0.00 ? 124 ASP A HB3  5  
ATOM 3705  N N    . LEU A 1 20 ? -0.141  2.960   2.819   1.00 0.00 ? 125 LEU A N    5  
ATOM 3706  C CA   . LEU A 1 20 ? 1.218   2.691   2.391   1.00 0.00 ? 125 LEU A CA   5  
ATOM 3707  C C    . LEU A 1 20 ? 2.192   3.630   3.110   1.00 0.00 ? 125 LEU A C    5  
ATOM 3708  O O    . LEU A 1 20 ? 3.315   3.237   3.440   1.00 0.00 ? 125 LEU A O    5  
ATOM 3709  C CB   . LEU A 1 20 ? 1.323   2.822   0.861   1.00 0.00 ? 125 LEU A CB   5  
ATOM 3710  C CG   . LEU A 1 20 ? 0.554   1.773   0.063   1.00 0.00 ? 125 LEU A CG   5  
ATOM 3711  C CD1  . LEU A 1 20 ? -0.373  2.451   -0.921  1.00 0.00 ? 125 LEU A CD1  5  
ATOM 3712  C CD2  . LEU A 1 20 ? 1.505   0.884   -0.693  1.00 0.00 ? 125 LEU A CD2  5  
ATOM 3713  H H    . LEU A 1 20 ? -0.807  3.222   2.153   1.00 0.00 ? 125 LEU A H    5  
ATOM 3714  H HA   . LEU A 1 20 ? 1.452   1.674   2.670   1.00 0.00 ? 125 LEU A HA   5  
ATOM 3715  H HB2  . LEU A 1 20 ? 0.950   3.784   0.567   1.00 0.00 ? 125 LEU A HB2  5  
ATOM 3716  H HB3  . LEU A 1 20 ? 2.356   2.773   0.577   1.00 0.00 ? 125 LEU A HB3  5  
ATOM 3717  H HG   . LEU A 1 20 ? -0.034  1.162   0.733   1.00 0.00 ? 125 LEU A HG   5  
ATOM 3718  H HD11 . LEU A 1 20 ? -1.266  1.858   -1.048  1.00 0.00 ? 125 LEU A HD11 5  
ATOM 3719  H HD12 . LEU A 1 20 ? 0.135   2.545   -1.869  1.00 0.00 ? 125 LEU A HD12 5  
ATOM 3720  H HD13 . LEU A 1 20 ? -0.635  3.430   -0.557  1.00 0.00 ? 125 LEU A HD13 5  
ATOM 3721  H HD21 . LEU A 1 20 ? 2.329   0.604   -0.054  1.00 0.00 ? 125 LEU A HD21 5  
ATOM 3722  H HD22 . LEU A 1 20 ? 1.878   1.432   -1.552  1.00 0.00 ? 125 LEU A HD22 5  
ATOM 3723  H HD23 . LEU A 1 20 ? 0.985   -0.002  -1.027  1.00 0.00 ? 125 LEU A HD23 5  
ATOM 3724  N N    . LEU A 1 21 ? 1.756   4.870   3.369   1.00 0.00 ? 126 LEU A N    5  
ATOM 3725  C CA   . LEU A 1 21 ? 2.590   5.838   4.073   1.00 0.00 ? 126 LEU A CA   5  
ATOM 3726  C C    . LEU A 1 21 ? 2.893   5.363   5.487   1.00 0.00 ? 126 LEU A C    5  
ATOM 3727  O O    . LEU A 1 21 ? 3.944   5.678   6.045   1.00 0.00 ? 126 LEU A O    5  
ATOM 3728  C CB   . LEU A 1 21 ? 1.895   7.202   4.136   1.00 0.00 ? 126 LEU A CB   5  
ATOM 3729  C CG   . LEU A 1 21 ? 2.423   8.253   3.160   1.00 0.00 ? 126 LEU A CG   5  
ATOM 3730  C CD1  . LEU A 1 21 ? 1.712   9.581   3.373   1.00 0.00 ? 126 LEU A CD1  5  
ATOM 3731  C CD2  . LEU A 1 21 ? 3.929   8.428   3.302   1.00 0.00 ? 126 LEU A CD2  5  
ATOM 3732  H H    . LEU A 1 21 ? 0.862   5.146   3.067   1.00 0.00 ? 126 LEU A H    5  
ATOM 3733  H HA   . LEU A 1 21 ? 3.517   5.936   3.532   1.00 0.00 ? 126 LEU A HA   5  
ATOM 3734  H HB2  . LEU A 1 21 ? 0.845   7.053   3.933   1.00 0.00 ? 126 LEU A HB2  5  
ATOM 3735  H HB3  . LEU A 1 21 ? 1.995   7.591   5.138   1.00 0.00 ? 126 LEU A HB3  5  
ATOM 3736  H HG   . LEU A 1 21 ? 2.213   7.921   2.153   1.00 0.00 ? 126 LEU A HG   5  
ATOM 3737  H HD11 . LEU A 1 21 ? 0.650   9.448   3.231   1.00 0.00 ? 126 LEU A HD11 5  
ATOM 3738  H HD12 . LEU A 1 21 ? 2.082   10.306  2.663   1.00 0.00 ? 126 LEU A HD12 5  
ATOM 3739  H HD13 . LEU A 1 21 ? 1.900   9.932   4.377   1.00 0.00 ? 126 LEU A HD13 5  
ATOM 3740  H HD21 . LEU A 1 21 ? 4.265   9.210   2.640   1.00 0.00 ? 126 LEU A HD21 5  
ATOM 3741  H HD22 . LEU A 1 21 ? 4.423   7.502   3.045   1.00 0.00 ? 126 LEU A HD22 5  
ATOM 3742  H HD23 . LEU A 1 21 ? 4.166   8.691   4.322   1.00 0.00 ? 126 LEU A HD23 5  
ATOM 3743  N N    . THR A 1 22 ? 1.965   4.608   6.065   1.00 0.00 ? 127 THR A N    5  
ATOM 3744  C CA   . THR A 1 22 ? 2.141   4.103   7.418   1.00 0.00 ? 127 THR A CA   5  
ATOM 3745  C C    . THR A 1 22 ? 2.735   2.699   7.418   1.00 0.00 ? 127 THR A C    5  
ATOM 3746  O O    . THR A 1 22 ? 3.047   2.156   8.478   1.00 0.00 ? 127 THR A O    5  
ATOM 3747  C CB   . THR A 1 22 ? 0.810   4.070   8.205   1.00 0.00 ? 127 THR A CB   5  
ATOM 3748  O OG1  . THR A 1 22 ? 0.269   2.744   8.193   1.00 0.00 ? 127 THR A OG1  5  
ATOM 3749  C CG2  . THR A 1 22 ? -0.217  5.032   7.624   1.00 0.00 ? 127 THR A CG2  5  
ATOM 3750  H H    . THR A 1 22 ? 1.150   4.385   5.570   1.00 0.00 ? 127 THR A H    5  
ATOM 3751  H HA   . THR A 1 22 ? 2.819   4.768   7.933   1.00 0.00 ? 127 THR A HA   5  
ATOM 3752  H HB   . THR A 1 22 ? 1.009   4.359   9.227   1.00 0.00 ? 127 THR A HB   5  
ATOM 3753  H HG1  . THR A 1 22 ? -0.681  2.784   8.331   1.00 0.00 ? 127 THR A HG1  5  
ATOM 3754  H HG21 . THR A 1 22 ? 0.266   5.957   7.344   1.00 0.00 ? 127 THR A HG21 5  
ATOM 3755  H HG22 . THR A 1 22 ? -0.977  5.234   8.363   1.00 0.00 ? 127 THR A HG22 5  
ATOM 3756  H HG23 . THR A 1 22 ? -0.673  4.586   6.754   1.00 0.00 ? 127 THR A HG23 5  
ATOM 3757  N N    . LEU A 1 23 ? 2.897   2.104   6.234   1.00 0.00 ? 128 LEU A N    5  
ATOM 3758  C CA   . LEU A 1 23 ? 3.440   0.760   6.147   1.00 0.00 ? 128 LEU A CA   5  
ATOM 3759  C C    . LEU A 1 23 ? 4.941   0.772   5.881   1.00 0.00 ? 128 LEU A C    5  
ATOM 3760  O O    . LEU A 1 23 ? 5.628   -0.216  6.146   1.00 0.00 ? 128 LEU A O    5  
ATOM 3761  C CB   . LEU A 1 23 ? 2.700   -0.033  5.073   1.00 0.00 ? 128 LEU A CB   5  
ATOM 3762  C CG   . LEU A 1 23 ? 1.236   -0.328  5.398   1.00 0.00 ? 128 LEU A CG   5  
ATOM 3763  C CD1  . LEU A 1 23 ? 0.544   -1.007  4.229   1.00 0.00 ? 128 LEU A CD1  5  
ATOM 3764  C CD2  . LEU A 1 23 ? 1.156   -1.190  6.639   1.00 0.00 ? 128 LEU A CD2  5  
ATOM 3765  H H    . LEU A 1 23 ? 2.654   2.575   5.403   1.00 0.00 ? 128 LEU A H    5  
ATOM 3766  H HA   . LEU A 1 23 ? 3.271   0.284   7.100   1.00 0.00 ? 128 LEU A HA   5  
ATOM 3767  H HB2  . LEU A 1 23 ? 2.738   0.519   4.154   1.00 0.00 ? 128 LEU A HB2  5  
ATOM 3768  H HB3  . LEU A 1 23 ? 3.210   -0.969  4.931   1.00 0.00 ? 128 LEU A HB3  5  
ATOM 3769  H HG   . LEU A 1 23 ? 0.723   0.599   5.600   1.00 0.00 ? 128 LEU A HG   5  
ATOM 3770  H HD11 . LEU A 1 23 ? 0.915   -2.015  4.128   1.00 0.00 ? 128 LEU A HD11 5  
ATOM 3771  H HD12 . LEU A 1 23 ? 0.744   -0.458  3.321   1.00 0.00 ? 128 LEU A HD12 5  
ATOM 3772  H HD13 . LEU A 1 23 ? -0.521  -1.032  4.406   1.00 0.00 ? 128 LEU A HD13 5  
ATOM 3773  H HD21 . LEU A 1 23 ? 1.027   -0.562  7.509   1.00 0.00 ? 128 LEU A HD21 5  
ATOM 3774  H HD22 . LEU A 1 23 ? 2.074   -1.747  6.730   1.00 0.00 ? 128 LEU A HD22 5  
ATOM 3775  H HD23 . LEU A 1 23 ? 0.323   -1.872  6.556   1.00 0.00 ? 128 LEU A HD23 5  
ATOM 3776  N N    . CYS A 1 24 ? 5.457   1.884   5.359   1.00 0.00 ? 129 CYS A N    5  
ATOM 3777  C CA   . CYS A 1 24 ? 6.888   1.988   5.085   1.00 0.00 ? 129 CYS A CA   5  
ATOM 3778  C C    . CYS A 1 24 ? 7.699   1.772   6.362   1.00 0.00 ? 129 CYS A C    5  
ATOM 3779  O O    . CYS A 1 24 ? 7.248   2.110   7.457   1.00 0.00 ? 129 CYS A O    5  
ATOM 3780  C CB   . CYS A 1 24 ? 7.236   3.341   4.463   1.00 0.00 ? 129 CYS A CB   5  
ATOM 3781  S SG   . CYS A 1 24 ? 6.744   4.790   5.457   1.00 0.00 ? 129 CYS A SG   5  
ATOM 3782  H H    . CYS A 1 24 ? 4.864   2.637   5.141   1.00 0.00 ? 129 CYS A H    5  
ATOM 3783  H HA   . CYS A 1 24 ? 7.139   1.208   4.383   1.00 0.00 ? 129 CYS A HA   5  
ATOM 3784  H HB2  . CYS A 1 24 ? 8.304   3.396   4.319   1.00 0.00 ? 129 CYS A HB2  5  
ATOM 3785  H HB3  . CYS A 1 24 ? 6.749   3.416   3.505   1.00 0.00 ? 129 CYS A HB3  5  
ATOM 3786  N N    . PRO A 1 25 ? 8.912   1.202   6.236   1.00 0.00 ? 130 PRO A N    5  
ATOM 3787  C CA   . PRO A 1 25 ? 9.784   0.920   7.377   1.00 0.00 ? 130 PRO A CA   5  
ATOM 3788  C C    . PRO A 1 25 ? 10.474  2.170   7.908   1.00 0.00 ? 130 PRO A C    5  
ATOM 3789  O O    . PRO A 1 25 ? 11.140  2.129   8.942   1.00 0.00 ? 130 PRO A O    5  
ATOM 3790  C CB   . PRO A 1 25 ? 10.821  -0.066  6.812   1.00 0.00 ? 130 PRO A CB   5  
ATOM 3791  C CG   . PRO A 1 25 ? 10.375  -0.379  5.417   1.00 0.00 ? 130 PRO A CG   5  
ATOM 3792  C CD   . PRO A 1 25 ? 9.537   0.784   4.978   1.00 0.00 ? 130 PRO A CD   5  
ATOM 3793  H HA   . PRO A 1 25 ? 9.237   0.450   8.178   1.00 0.00 ? 130 PRO A HA   5  
ATOM 3794  H HB2  . PRO A 1 25 ? 11.797  0.396   6.816   1.00 0.00 ? 130 PRO A HB2  5  
ATOM 3795  H HB3  . PRO A 1 25 ? 10.841  -0.957  7.425   1.00 0.00 ? 130 PRO A HB3  5  
ATOM 3796  H HG2  . PRO A 1 25 ? 11.235  -0.484  4.771   1.00 0.00 ? 130 PRO A HG2  5  
ATOM 3797  H HG3  . PRO A 1 25 ? 9.789   -1.287  5.413   1.00 0.00 ? 130 PRO A HG3  5  
ATOM 3798  H HD2  . PRO A 1 25 ? 10.159  1.569   4.572   1.00 0.00 ? 130 PRO A HD2  5  
ATOM 3799  H HD3  . PRO A 1 25 ? 8.793   0.475   4.259   1.00 0.00 ? 130 PRO A HD3  5  
ATOM 3800  N N    . TYR A 1 26 ? 10.310  3.276   7.195   1.00 0.00 ? 131 TYR A N    5  
ATOM 3801  C CA   . TYR A 1 26 ? 10.916  4.542   7.593   1.00 0.00 ? 131 TYR A CA   5  
ATOM 3802  C C    . TYR A 1 26 ? 10.013  5.717   7.229   1.00 0.00 ? 131 TYR A C    5  
ATOM 3803  O O    . TYR A 1 26 ? 9.184   6.109   8.078   1.00 0.00 ? 131 TYR A O    5  
ATOM 3804  C CB   . TYR A 1 26 ? 12.287  4.711   6.932   1.00 0.00 ? 131 TYR A CB   5  
ATOM 3805  C CG   . TYR A 1 26 ? 13.334  3.749   7.445   1.00 0.00 ? 131 TYR A CG   5  
ATOM 3806  C CD1  . TYR A 1 26 ? 14.090  4.051   8.571   1.00 0.00 ? 131 TYR A CD1  5  
ATOM 3807  C CD2  . TYR A 1 26 ? 13.567  2.538   6.806   1.00 0.00 ? 131 TYR A CD2  5  
ATOM 3808  C CE1  . TYR A 1 26 ? 15.048  3.175   9.044   1.00 0.00 ? 131 TYR A CE1  5  
ATOM 3809  C CE2  . TYR A 1 26 ? 14.524  1.656   7.272   1.00 0.00 ? 131 TYR A CE2  5  
ATOM 3810  C CZ   . TYR A 1 26 ? 15.261  1.979   8.391   1.00 0.00 ? 131 TYR A CZ   5  
ATOM 3811  O OH   . TYR A 1 26 ? 16.215  1.104   8.859   1.00 0.00 ? 131 TYR A OH   5  
ATOM 3812  O OXT  . TYR A 1 26 ? 10.142  6.236   6.100   1.00 0.00 ? 131 TYR A OXT  5  
ATOM 3813  H H    . TYR A 1 26 ? 9.767   3.240   6.381   1.00 0.00 ? 131 TYR A H    5  
ATOM 3814  H HA   . TYR A 1 26 ? 11.044  4.523   8.665   1.00 0.00 ? 131 TYR A HA   5  
ATOM 3815  H HB2  . TYR A 1 26 ? 12.186  4.556   5.870   1.00 0.00 ? 131 TYR A HB2  5  
ATOM 3816  H HB3  . TYR A 1 26 ? 12.642  5.717   7.111   1.00 0.00 ? 131 TYR A HB3  5  
ATOM 3817  H HD1  . TYR A 1 26 ? 13.920  4.989   9.080   1.00 0.00 ? 131 TYR A HD1  5  
ATOM 3818  H HD2  . TYR A 1 26 ? 12.989  2.288   5.929   1.00 0.00 ? 131 TYR A HD2  5  
ATOM 3819  H HE1  . TYR A 1 26 ? 15.625  3.430   9.921   1.00 0.00 ? 131 TYR A HE1  5  
ATOM 3820  H HE2  . TYR A 1 26 ? 14.689  0.720   6.761   1.00 0.00 ? 131 TYR A HE2  5  
ATOM 3821  H HH   . TYR A 1 26 ? 16.152  1.040   9.815   1.00 0.00 ? 131 TYR A HH   5  
ATOM 3822  N N    . PRO B 2 1  ? 0.257   12.726  -11.274 1.00 0.00 ? 25  PRO B N    5  
ATOM 3823  C CA   . PRO B 2 1  ? 0.310   11.375  -11.884 1.00 0.00 ? 25  PRO B CA   5  
ATOM 3824  C C    . PRO B 2 1  ? -0.873  10.520  -11.437 1.00 0.00 ? 25  PRO B C    5  
ATOM 3825  O O    . PRO B 2 1  ? -1.678  10.080  -12.256 1.00 0.00 ? 25  PRO B O    5  
ATOM 3826  C CB   . PRO B 2 1  ? 1.619   10.707  -11.490 1.00 0.00 ? 25  PRO B CB   5  
ATOM 3827  C CG   . PRO B 2 1  ? 2.233   11.668  -10.530 1.00 0.00 ? 25  PRO B CG   5  
ATOM 3828  C CD   . PRO B 2 1  ? 1.636   13.022  -10.841 1.00 0.00 ? 25  PRO B CD   5  
ATOM 3829  H H2   . PRO B 2 1  ? -0.466  12.671  -10.537 1.00 0.00 ? 25  PRO B H2   5  
ATOM 3830  H H3   . PRO B 2 1  ? -0.188  13.331  -12.004 1.00 0.00 ? 25  PRO B H3   5  
ATOM 3831  H HA   . PRO B 2 1  ? 0.276   11.483  -12.958 1.00 0.00 ? 25  PRO B HA   5  
ATOM 3832  H HB2  . PRO B 2 1  ? 1.417   9.752   -11.026 1.00 0.00 ? 25  PRO B HB2  5  
ATOM 3833  H HB3  . PRO B 2 1  ? 2.238   10.571  -12.363 1.00 0.00 ? 25  PRO B HB3  5  
ATOM 3834  H HG2  . PRO B 2 1  ? 1.993   11.376  -9.517  1.00 0.00 ? 25  PRO B HG2  5  
ATOM 3835  H HG3  . PRO B 2 1  ? 3.304   11.690  -10.669 1.00 0.00 ? 25  PRO B HG3  5  
ATOM 3836  H HD2  . PRO B 2 1  ? 1.634   13.641  -9.957  1.00 0.00 ? 25  PRO B HD2  5  
ATOM 3837  H HD3  . PRO B 2 1  ? 2.190   13.501  -11.635 1.00 0.00 ? 25  PRO B HD3  5  
ATOM 3838  N N    . THR B 2 2  ? -0.972  10.292  -10.129 1.00 0.00 ? 26  THR B N    5  
ATOM 3839  C CA   . THR B 2 2  ? -2.056  9.492   -9.571  1.00 0.00 ? 26  THR B CA   5  
ATOM 3840  C C    . THR B 2 2  ? -2.141  9.665   -8.053  1.00 0.00 ? 26  THR B C    5  
ATOM 3841  O O    . THR B 2 2  ? -1.117  9.763   -7.377  1.00 0.00 ? 26  THR B O    5  
ATOM 3842  C CB   . THR B 2 2  ? -1.877  7.998   -9.899  1.00 0.00 ? 26  THR B CB   5  
ATOM 3843  O OG1  . THR B 2 2  ? -2.893  7.228   -9.245  1.00 0.00 ? 26  THR B OG1  5  
ATOM 3844  C CG2  . THR B 2 2  ? -0.504  7.506   -9.467  1.00 0.00 ? 26  THR B CG2  5  
ATOM 3845  H H    . THR B 2 2  ? -0.299  10.672  -9.526  1.00 0.00 ? 26  THR B H    5  
ATOM 3846  H HA   . THR B 2 2  ? -2.980  9.829   -10.016 1.00 0.00 ? 26  THR B HA   5  
ATOM 3847  H HB   . THR B 2 2  ? -1.970  7.868   -10.967 1.00 0.00 ? 26  THR B HB   5  
ATOM 3848  H HG1  . THR B 2 2  ? -3.328  6.663   -9.887  1.00 0.00 ? 26  THR B HG1  5  
ATOM 3849  H HG21 . THR B 2 2  ? 0.258   8.109   -9.940  1.00 0.00 ? 26  THR B HG21 5  
ATOM 3850  H HG22 . THR B 2 2  ? -0.381  6.475   -9.762  1.00 0.00 ? 26  THR B HG22 5  
ATOM 3851  H HG23 . THR B 2 2  ? -0.414  7.590   -8.394  1.00 0.00 ? 26  THR B HG23 5  
ATOM 3852  N N    . PRO B 2 3  ? -3.369  9.707   -7.497  1.00 0.00 ? 27  PRO B N    5  
ATOM 3853  C CA   . PRO B 2 3  ? -3.591  9.872   -6.072  1.00 0.00 ? 27  PRO B CA   5  
ATOM 3854  C C    . PRO B 2 3  ? -3.841  8.545   -5.369  1.00 0.00 ? 27  PRO B C    5  
ATOM 3855  O O    . PRO B 2 3  ? -3.469  7.484   -5.872  1.00 0.00 ? 27  PRO B O    5  
ATOM 3856  C CB   . PRO B 2 3  ? -4.852  10.732  -6.058  1.00 0.00 ? 27  PRO B CB   5  
ATOM 3857  C CG   . PRO B 2 3  ? -5.622  10.315  -7.279  1.00 0.00 ? 27  PRO B CG   5  
ATOM 3858  C CD   . PRO B 2 3  ? -4.654  9.605   -8.204  1.00 0.00 ? 27  PRO B CD   5  
ATOM 3859  H HA   . PRO B 2 3  ? -2.781  10.400  -5.592  1.00 0.00 ? 27  PRO B HA   5  
ATOM 3860  H HB2  . PRO B 2 3  ? -5.412  10.539  -5.154  1.00 0.00 ? 27  PRO B HB2  5  
ATOM 3861  H HB3  . PRO B 2 3  ? -4.579  11.775  -6.104  1.00 0.00 ? 27  PRO B HB3  5  
ATOM 3862  H HG2  . PRO B 2 3  ? -6.419  9.647   -6.996  1.00 0.00 ? 27  PRO B HG2  5  
ATOM 3863  H HG3  . PRO B 2 3  ? -6.027  11.191  -7.768  1.00 0.00 ? 27  PRO B HG3  5  
ATOM 3864  H HD2  . PRO B 2 3  ? -4.943  8.571   -8.328  1.00 0.00 ? 27  PRO B HD2  5  
ATOM 3865  H HD3  . PRO B 2 3  ? -4.608  10.102  -9.160  1.00 0.00 ? 27  PRO B HD3  5  
ATOM 3866  N N    . GLU B 2 4  ? -4.473  8.611   -4.204  1.00 0.00 ? 28  GLU B N    5  
ATOM 3867  C CA   . GLU B 2 4  ? -4.781  7.411   -3.434  1.00 0.00 ? 28  GLU B CA   5  
ATOM 3868  C C    . GLU B 2 4  ? -6.042  6.754   -3.958  1.00 0.00 ? 28  GLU B C    5  
ATOM 3869  O O    . GLU B 2 4  ? -7.123  6.876   -3.378  1.00 0.00 ? 28  GLU B O    5  
ATOM 3870  C CB   . GLU B 2 4  ? -4.925  7.736   -1.956  1.00 0.00 ? 28  GLU B CB   5  
ATOM 3871  C CG   . GLU B 2 4  ? -5.624  9.057   -1.671  1.00 0.00 ? 28  GLU B CG   5  
ATOM 3872  C CD   . GLU B 2 4  ? -5.967  9.232   -0.205  1.00 0.00 ? 28  GLU B CD   5  
ATOM 3873  O OE1  . GLU B 2 4  ? -5.095  9.698   0.556   1.00 0.00 ? 28  GLU B OE1  5  
ATOM 3874  O OE2  . GLU B 2 4  ? -7.107  8.899   0.181   1.00 0.00 ? 28  GLU B OE2  5  
ATOM 3875  H H    . GLU B 2 4  ? -4.742  9.485   -3.859  1.00 0.00 ? 28  GLU B H    5  
ATOM 3876  H HA   . GLU B 2 4  ? -3.957  6.722   -3.562  1.00 0.00 ? 28  GLU B HA   5  
ATOM 3877  H HB2  . GLU B 2 4  ? -5.488  6.947   -1.482  1.00 0.00 ? 28  GLU B HB2  5  
ATOM 3878  H HB3  . GLU B 2 4  ? -3.942  7.769   -1.527  1.00 0.00 ? 28  GLU B HB3  5  
ATOM 3879  H HG2  . GLU B 2 4  ? -4.974  9.864   -1.971  1.00 0.00 ? 28  GLU B HG2  5  
ATOM 3880  H HG3  . GLU B 2 4  ? -6.537  9.098   -2.248  1.00 0.00 ? 28  GLU B HG3  5  
ATOM 3881  N N    . MET B 2 5  ? -5.879  6.058   -5.064  1.00 0.00 ? 29  MET B N    5  
ATOM 3882  C CA   . MET B 2 5  ? -6.983  5.373   -5.725  1.00 0.00 ? 29  MET B CA   5  
ATOM 3883  C C    . MET B 2 5  ? -7.204  3.984   -5.159  1.00 0.00 ? 29  MET B C    5  
ATOM 3884  O O    . MET B 2 5  ? -7.836  3.136   -5.790  1.00 0.00 ? 29  MET B O    5  
ATOM 3885  C CB   . MET B 2 5  ? -6.721  5.297   -7.227  1.00 0.00 ? 29  MET B CB   5  
ATOM 3886  C CG   . MET B 2 5  ? -7.956  4.981   -8.057  1.00 0.00 ? 29  MET B CG   5  
ATOM 3887  S SD   . MET B 2 5  ? -7.587  4.822   -9.815  1.00 0.00 ? 29  MET B SD   5  
ATOM 3888  C CE   . MET B 2 5  ? -9.206  4.416   -10.465 1.00 0.00 ? 29  MET B CE   5  
ATOM 3889  H H    . MET B 2 5  ? -4.979  5.993   -5.440  1.00 0.00 ? 29  MET B H    5  
ATOM 3890  H HA   . MET B 2 5  ? -7.876  5.945   -5.549  1.00 0.00 ? 29  MET B HA   5  
ATOM 3891  H HB2  . MET B 2 5  ? -6.318  6.244   -7.561  1.00 0.00 ? 29  MET B HB2  5  
ATOM 3892  H HB3  . MET B 2 5  ? -5.988  4.523   -7.399  1.00 0.00 ? 29  MET B HB3  5  
ATOM 3893  H HG2  . MET B 2 5  ? -8.380  4.051   -7.708  1.00 0.00 ? 29  MET B HG2  5  
ATOM 3894  H HG3  . MET B 2 5  ? -8.674  5.775   -7.924  1.00 0.00 ? 29  MET B HG3  5  
ATOM 3895  H HE1  . MET B 2 5  ? -9.891  5.223   -10.256 1.00 0.00 ? 29  MET B HE1  5  
ATOM 3896  H HE2  . MET B 2 5  ? -9.564  3.509   -9.999  1.00 0.00 ? 29  MET B HE2  5  
ATOM 3897  H HE3  . MET B 2 5  ? -9.138  4.270   -11.532 1.00 0.00 ? 29  MET B HE3  5  
ATOM 3898  N N    . ARG B 2 6  ? -6.695  3.768   -3.958  1.00 0.00 ? 30  ARG B N    5  
ATOM 3899  C CA   . ARG B 2 6  ? -6.835  2.500   -3.283  1.00 0.00 ? 30  ARG B CA   5  
ATOM 3900  C C    . ARG B 2 6  ? -6.672  1.321   -4.238  1.00 0.00 ? 30  ARG B C    5  
ATOM 3901  O O    . ARG B 2 6  ? -7.324  0.290   -4.074  1.00 0.00 ? 30  ARG B O    5  
ATOM 3902  C CB   . ARG B 2 6  ? -8.214  2.456   -2.683  1.00 0.00 ? 30  ARG B CB   5  
ATOM 3903  C CG   . ARG B 2 6  ? -8.239  2.348   -1.184  1.00 0.00 ? 30  ARG B CG   5  
ATOM 3904  C CD   . ARG B 2 6  ? -7.374  1.226   -0.659  1.00 0.00 ? 30  ARG B CD   5  
ATOM 3905  N NE   . ARG B 2 6  ? -7.134  1.394   0.762   1.00 0.00 ? 30  ARG B NE   5  
ATOM 3906  C CZ   . ARG B 2 6  ? -7.374  0.460   1.677   1.00 0.00 ? 30  ARG B CZ   5  
ATOM 3907  N NH1  . ARG B 2 6  ? -7.875  -0.715  1.317   1.00 0.00 ? 30  ARG B NH1  5  
ATOM 3908  N NH2  . ARG B 2 6  ? -7.126  0.702   2.956   1.00 0.00 ? 30  ARG B NH2  5  
ATOM 3909  H H    . ARG B 2 6  ? -6.253  4.492   -3.499  1.00 0.00 ? 30  ARG B H    5  
ATOM 3910  H HA   . ARG B 2 6  ? -6.103  2.446   -2.491  1.00 0.00 ? 30  ARG B HA   5  
ATOM 3911  H HB2  . ARG B 2 6  ? -8.727  3.364   -2.948  1.00 0.00 ? 30  ARG B HB2  5  
ATOM 3912  H HB3  . ARG B 2 6  ? -8.733  1.626   -3.106  1.00 0.00 ? 30  ARG B HB3  5  
ATOM 3913  H HG2  . ARG B 2 6  ? -7.898  3.274   -0.764  1.00 0.00 ? 30  ARG B HG2  5  
ATOM 3914  H HG3  . ARG B 2 6  ? -9.242  2.177   -0.879  1.00 0.00 ? 30  ARG B HG3  5  
ATOM 3915  H HD2  . ARG B 2 6  ? -7.876  0.291   -0.827  1.00 0.00 ? 30  ARG B HD2  5  
ATOM 3916  H HD3  . ARG B 2 6  ? -6.431  1.233   -1.179  1.00 0.00 ? 30  ARG B HD3  5  
ATOM 3917  H HE   . ARG B 2 6  ? -6.784  2.260   1.050   1.00 0.00 ? 30  ARG B HE   5  
ATOM 3918  H HH11 . ARG B 2 6  ? -8.073  -0.901  0.354   1.00 0.00 ? 30  ARG B HH11 5  
ATOM 3919  H HH12 . ARG B 2 6  ? -8.054  -1.416  2.009   1.00 0.00 ? 30  ARG B HH12 5  
ATOM 3920  H HH21 . ARG B 2 6  ? -6.759  1.590   3.235   1.00 0.00 ? 30  ARG B HH21 5  
ATOM 3921  H HH22 . ARG B 2 6  ? -7.308  -0.001  3.643   1.00 0.00 ? 30  ARG B HH22 5  
ATOM 3922  N N    . GLU B 2 7  ? -5.798  1.465   -5.222  1.00 0.00 ? 31  GLU B N    5  
ATOM 3923  C CA   . GLU B 2 7  ? -5.604  0.419   -6.214  1.00 0.00 ? 31  GLU B CA   5  
ATOM 3924  C C    . GLU B 2 7  ? -5.034  -0.843  -5.600  1.00 0.00 ? 31  GLU B C    5  
ATOM 3925  O O    . GLU B 2 7  ? -4.325  -0.806  -4.598  1.00 0.00 ? 31  GLU B O    5  
ATOM 3926  C CB   . GLU B 2 7  ? -4.717  0.913   -7.355  1.00 0.00 ? 31  GLU B CB   5  
ATOM 3927  C CG   . GLU B 2 7  ? -3.304  1.234   -6.916  1.00 0.00 ? 31  GLU B CG   5  
ATOM 3928  C CD   . GLU B 2 7  ? -2.404  1.619   -8.073  1.00 0.00 ? 31  GLU B CD   5  
ATOM 3929  O OE1  . GLU B 2 7  ? -1.891  0.709   -8.756  1.00 0.00 ? 31  GLU B OE1  5  
ATOM 3930  O OE2  . GLU B 2 7  ? -2.213  2.833   -8.297  1.00 0.00 ? 31  GLU B OE2  5  
ATOM 3931  H H    . GLU B 2 7  ? -5.260  2.283   -5.270  1.00 0.00 ? 31  GLU B H    5  
ATOM 3932  H HA   . GLU B 2 7  ? -6.576  0.170   -6.609  1.00 0.00 ? 31  GLU B HA   5  
ATOM 3933  H HB2  . GLU B 2 7  ? -4.672  0.152   -8.118  1.00 0.00 ? 31  GLU B HB2  5  
ATOM 3934  H HB3  . GLU B 2 7  ? -5.154  1.808   -7.774  1.00 0.00 ? 31  GLU B HB3  5  
ATOM 3935  H HG2  . GLU B 2 7  ? -3.337  2.053   -6.214  1.00 0.00 ? 31  GLU B HG2  5  
ATOM 3936  H HG3  . GLU B 2 7  ? -2.897  0.362   -6.432  1.00 0.00 ? 31  GLU B HG3  5  
ATOM 3937  N N    . LYS B 2 8  ? -5.355  -1.953  -6.245  1.00 0.00 ? 32  LYS B N    5  
ATOM 3938  C CA   . LYS B 2 8  ? -4.950  -3.269  -5.799  1.00 0.00 ? 32  LYS B CA   5  
ATOM 3939  C C    . LYS B 2 8  ? -3.445  -3.474  -5.859  1.00 0.00 ? 32  LYS B C    5  
ATOM 3940  O O    . LYS B 2 8  ? -2.849  -3.577  -6.932  1.00 0.00 ? 32  LYS B O    5  
ATOM 3941  C CB   . LYS B 2 8  ? -5.674  -4.305  -6.635  1.00 0.00 ? 32  LYS B CB   5  
ATOM 3942  C CG   . LYS B 2 8  ? -7.163  -4.040  -6.711  1.00 0.00 ? 32  LYS B CG   5  
ATOM 3943  C CD   . LYS B 2 8  ? -7.907  -5.191  -7.368  1.00 0.00 ? 32  LYS B CD   5  
ATOM 3944  C CE   . LYS B 2 8  ? -9.406  -4.986  -7.311  1.00 0.00 ? 32  LYS B CE   5  
ATOM 3945  N NZ   . LYS B 2 8  ? -10.151 -6.113  -7.938  1.00 0.00 ? 32  LYS B NZ   5  
ATOM 3946  H H    . LYS B 2 8  ? -5.885  -1.884  -7.061  1.00 0.00 ? 32  LYS B H    5  
ATOM 3947  H HA   . LYS B 2 8  ? -5.266  -3.377  -4.774  1.00 0.00 ? 32  LYS B HA   5  
ATOM 3948  H HB2  . LYS B 2 8  ? -5.272  -4.298  -7.637  1.00 0.00 ? 32  LYS B HB2  5  
ATOM 3949  H HB3  . LYS B 2 8  ? -5.524  -5.272  -6.200  1.00 0.00 ? 32  LYS B HB3  5  
ATOM 3950  H HG2  . LYS B 2 8  ? -7.537  -3.899  -5.711  1.00 0.00 ? 32  LYS B HG2  5  
ATOM 3951  H HG3  . LYS B 2 8  ? -7.329  -3.140  -7.279  1.00 0.00 ? 32  LYS B HG3  5  
ATOM 3952  H HD2  . LYS B 2 8  ? -7.606  -5.257  -8.400  1.00 0.00 ? 32  LYS B HD2  5  
ATOM 3953  H HD3  . LYS B 2 8  ? -7.657  -6.109  -6.858  1.00 0.00 ? 32  LYS B HD3  5  
ATOM 3954  H HE2  . LYS B 2 8  ? -9.696  -4.902  -6.280  1.00 0.00 ? 32  LYS B HE2  5  
ATOM 3955  H HE3  . LYS B 2 8  ? -9.652  -4.070  -7.828  1.00 0.00 ? 32  LYS B HE3  5  
ATOM 3956  H HZ1  . LYS B 2 8  ? -11.175 -5.954  -7.856  1.00 0.00 ? 32  LYS B HZ1  5  
ATOM 3957  H HZ2  . LYS B 2 8  ? -9.911  -7.007  -7.462  1.00 0.00 ? 32  LYS B HZ2  5  
ATOM 3958  H HZ3  . LYS B 2 8  ? -9.900  -6.191  -8.943  1.00 0.00 ? 32  LYS B HZ3  5  
ATOM 3959  N N    . LEU B 2 9  ? -2.854  -3.534  -4.678  1.00 0.00 ? 33  LEU B N    5  
ATOM 3960  C CA   . LEU B 2 9  ? -1.431  -3.729  -4.511  1.00 0.00 ? 33  LEU B CA   5  
ATOM 3961  C C    . LEU B 2 9  ? -1.111  -5.145  -4.037  1.00 0.00 ? 33  LEU B C    5  
ATOM 3962  O O    . LEU B 2 9  ? -1.165  -5.449  -2.847  1.00 0.00 ? 33  LEU B O    5  
ATOM 3963  C CB   . LEU B 2 9  ? -0.925  -2.682  -3.545  1.00 0.00 ? 33  LEU B CB   5  
ATOM 3964  C CG   . LEU B 2 9  ? -1.320  -1.255  -3.947  1.00 0.00 ? 33  LEU B CG   5  
ATOM 3965  C CD1  . LEU B 2 9  ? -0.844  -0.193  -2.963  1.00 0.00 ? 33  LEU B CD1  5  
ATOM 3966  C CD2  . LEU B 2 9  ? -0.801  -0.955  -5.341  1.00 0.00 ? 33  LEU B CD2  5  
ATOM 3967  H H    . LEU B 2 9  ? -3.398  -3.411  -3.885  1.00 0.00 ? 33  LEU B H    5  
ATOM 3968  H HA   . LEU B 2 9  ? -0.947  -3.566  -5.453  1.00 0.00 ? 33  LEU B HA   5  
ATOM 3969  H HB2  . LEU B 2 9  ? -1.296  -2.897  -2.556  1.00 0.00 ? 33  LEU B HB2  5  
ATOM 3970  H HB3  . LEU B 2 9  ? 0.128   -2.753  -3.541  1.00 0.00 ? 33  LEU B HB3  5  
ATOM 3971  H HG   . LEU B 2 9  ? -2.389  -1.204  -3.977  1.00 0.00 ? 33  LEU B HG   5  
ATOM 3972  H HD11 . LEU B 2 9  ? -0.591  0.704   -3.506  1.00 0.00 ? 33  LEU B HD11 5  
ATOM 3973  H HD12 . LEU B 2 9  ? 0.022   -0.539  -2.421  1.00 0.00 ? 33  LEU B HD12 5  
ATOM 3974  H HD13 . LEU B 2 9  ? -1.638  0.029   -2.269  1.00 0.00 ? 33  LEU B HD13 5  
ATOM 3975  H HD21 . LEU B 2 9  ? -1.401  -0.181  -5.792  1.00 0.00 ? 33  LEU B HD21 5  
ATOM 3976  H HD22 . LEU B 2 9  ? -0.856  -1.855  -5.938  1.00 0.00 ? 33  LEU B HD22 5  
ATOM 3977  H HD23 . LEU B 2 9  ? 0.227   -0.626  -5.279  1.00 0.00 ? 33  LEU B HD23 5  
ATOM 3978  N N    . CYS B 2 10 ? -0.772  -6.009  -4.991  1.00 0.00 ? 34  CYS B N    5  
ATOM 3979  C CA   . CYS B 2 10 ? -0.458  -7.402  -4.693  1.00 0.00 ? 34  CYS B CA   5  
ATOM 3980  C C    . CYS B 2 10 ? 1.031   -7.596  -4.461  1.00 0.00 ? 34  CYS B C    5  
ATOM 3981  O O    . CYS B 2 10 ? 1.776   -7.973  -5.366  1.00 0.00 ? 34  CYS B O    5  
ATOM 3982  C CB   . CYS B 2 10 ? -0.931  -8.290  -5.833  1.00 0.00 ? 34  CYS B CB   5  
ATOM 3983  S SG   . CYS B 2 10 ? -1.207  -10.030 -5.370  1.00 0.00 ? 34  CYS B SG   5  
ATOM 3984  H H    . CYS B 2 10 ? -0.734  -5.702  -5.920  1.00 0.00 ? 34  CYS B H    5  
ATOM 3985  H HA   . CYS B 2 10 ? -0.990  -7.676  -3.794  1.00 0.00 ? 34  CYS B HA   5  
ATOM 3986  H HB2  . CYS B 2 10 ? -1.861  -7.900  -6.199  1.00 0.00 ? 34  CYS B HB2  5  
ATOM 3987  H HB3  . CYS B 2 10 ? -0.198  -8.269  -6.628  1.00 0.00 ? 34  CYS B HB3  5  
ATOM 3988  N N    . GLY B 2 11 ? 1.441   -7.340  -3.233  1.00 0.00 ? 35  GLY B N    5  
ATOM 3989  C CA   . GLY B 2 11 ? 2.836   -7.479  -2.852  1.00 0.00 ? 35  GLY B CA   5  
ATOM 3990  C C    . GLY B 2 11 ? 3.751   -6.530  -3.600  1.00 0.00 ? 35  GLY B C    5  
ATOM 3991  O O    . GLY B 2 11 ? 4.187   -5.528  -3.042  1.00 0.00 ? 35  GLY B O    5  
ATOM 3992  H H    . GLY B 2 11 ? 0.779   -7.054  -2.573  1.00 0.00 ? 35  GLY B H    5  
ATOM 3993  H HA2  . GLY B 2 11 ? 2.924   -7.277  -1.793  1.00 0.00 ? 35  GLY B HA2  5  
ATOM 3994  H HA3  . GLY B 2 11 ? 3.153   -8.488  -3.033  1.00 0.00 ? 35  GLY B HA3  5  
ATOM 3995  N N    . HIS B 2 12 ? 4.071   -6.850  -4.857  1.00 0.00 ? 36  HIS B N    5  
ATOM 3996  C CA   . HIS B 2 12 ? 4.931   -5.992  -5.648  1.00 0.00 ? 36  HIS B CA   5  
ATOM 3997  C C    . HIS B 2 12 ? 4.269   -4.649  -5.912  1.00 0.00 ? 36  HIS B C    5  
ATOM 3998  O O    . HIS B 2 12 ? 4.877   -3.612  -5.679  1.00 0.00 ? 36  HIS B O    5  
ATOM 3999  C CB   . HIS B 2 12 ? 5.332   -6.658  -6.957  1.00 0.00 ? 36  HIS B CB   5  
ATOM 4000  C CG   . HIS B 2 12 ? 6.658   -6.179  -7.442  1.00 0.00 ? 36  HIS B CG   5  
ATOM 4001  N ND1  . HIS B 2 12 ? 7.080   -6.260  -8.747  1.00 0.00 ? 36  HIS B ND1  5  
ATOM 4002  C CD2  . HIS B 2 12 ? 7.670   -5.587  -6.751  1.00 0.00 ? 36  HIS B CD2  5  
ATOM 4003  C CE1  . HIS B 2 12 ? 8.306   -5.727  -8.815  1.00 0.00 ? 36  HIS B CE1  5  
ATOM 4004  N NE2  . HIS B 2 12 ? 8.711   -5.304  -7.629  1.00 0.00 ? 36  HIS B NE2  5  
ATOM 4005  H H    . HIS B 2 12 ? 3.744   -7.681  -5.243  1.00 0.00 ? 36  HIS B H    5  
ATOM 4006  H HA   . HIS B 2 12 ? 5.824   -5.817  -5.066  1.00 0.00 ? 36  HIS B HA   5  
ATOM 4007  H HB2  . HIS B 2 12 ? 5.391   -7.728  -6.813  1.00 0.00 ? 36  HIS B HB2  5  
ATOM 4008  H HB3  . HIS B 2 12 ? 4.596   -6.435  -7.713  1.00 0.00 ? 36  HIS B HB3  5  
ATOM 4009  H HD1  . HIS B 2 12 ? 6.575   -6.640  -9.495  1.00 0.00 ? 36  HIS B HD1  5  
ATOM 4010  H HD2  . HIS B 2 12 ? 7.666   -5.361  -5.686  1.00 0.00 ? 36  HIS B HD2  5  
ATOM 4011  H HE1  . HIS B 2 12 ? 8.883   -5.645  -9.722  1.00 0.00 ? 36  HIS B HE1  5  
ATOM 4012  N N    . HIS B 2 13 ? 3.039   -4.647  -6.432  1.00 0.00 ? 37  HIS B N    5  
ATOM 4013  C CA   . HIS B 2 13 ? 2.343   -3.379  -6.638  1.00 0.00 ? 37  HIS B CA   5  
ATOM 4014  C C    . HIS B 2 13 ? 2.320   -2.670  -5.319  1.00 0.00 ? 37  HIS B C    5  
ATOM 4015  O O    . HIS B 2 13 ? 2.402   -1.448  -5.227  1.00 0.00 ? 37  HIS B O    5  
ATOM 4016  C CB   . HIS B 2 13 ? 0.901   -3.578  -7.077  1.00 0.00 ? 37  HIS B CB   5  
ATOM 4017  C CG   . HIS B 2 13 ? 0.761   -4.026  -8.482  1.00 0.00 ? 37  HIS B CG   5  
ATOM 4018  N ND1  . HIS B 2 13 ? -0.211  -3.571  -9.337  1.00 0.00 ? 37  HIS B ND1  5  
ATOM 4019  C CD2  . HIS B 2 13 ? 1.493   -4.918  -9.175  1.00 0.00 ? 37  HIS B CD2  5  
ATOM 4020  C CE1  . HIS B 2 13 ? -0.045  -4.191  -10.506 1.00 0.00 ? 37  HIS B CE1  5  
ATOM 4021  N NE2  . HIS B 2 13 ? 0.982   -5.023  -10.465 1.00 0.00 ? 37  HIS B NE2  5  
ATOM 4022  H H    . HIS B 2 13 ? 2.606   -5.493  -6.675  1.00 0.00 ? 37  HIS B H    5  
ATOM 4023  H HA   . HIS B 2 13 ? 2.881   -2.791  -7.366  1.00 0.00 ? 37  HIS B HA   5  
ATOM 4024  H HB2  . HIS B 2 13 ? 0.440   -4.322  -6.446  1.00 0.00 ? 37  HIS B HB2  5  
ATOM 4025  H HB3  . HIS B 2 13 ? 0.373   -2.640  -6.965  1.00 0.00 ? 37  HIS B HB3  5  
ATOM 4026  H HD1  . HIS B 2 13 ? -0.903  -2.910  -9.127  1.00 0.00 ? 37  HIS B HD1  5  
ATOM 4027  H HD2  . HIS B 2 13 ? 2.344   -5.461  -8.789  1.00 0.00 ? 37  HIS B HD2  5  
ATOM 4028  H HE1  . HIS B 2 13 ? -0.669  -4.029  -11.366 1.00 0.00 ? 37  HIS B HE1  5  
ATOM 4029  N N    . PHE B 2 14 ? 2.191   -3.489  -4.297  1.00 0.00 ? 38  PHE B N    5  
ATOM 4030  C CA   . PHE B 2 14 ? 2.158   -3.026  -2.947  1.00 0.00 ? 38  PHE B CA   5  
ATOM 4031  C C    . PHE B 2 14 ? 3.519   -2.511  -2.554  1.00 0.00 ? 38  PHE B C    5  
ATOM 4032  O O    . PHE B 2 14 ? 3.637   -1.664  -1.679  1.00 0.00 ? 38  PHE B O    5  
ATOM 4033  C CB   . PHE B 2 14 ? 1.666   -4.153  -2.049  1.00 0.00 ? 38  PHE B CB   5  
ATOM 4034  C CG   . PHE B 2 14 ? 1.778   -3.838  -0.608  1.00 0.00 ? 38  PHE B CG   5  
ATOM 4035  C CD1  . PHE B 2 14 ? 1.039   -2.800  -0.090  1.00 0.00 ? 38  PHE B CD1  5  
ATOM 4036  C CD2  . PHE B 2 14 ? 2.628   -4.550  0.218   1.00 0.00 ? 38  PHE B CD2  5  
ATOM 4037  C CE1  . PHE B 2 14 ? 1.136   -2.468  1.244   1.00 0.00 ? 38  PHE B CE1  5  
ATOM 4038  C CE2  . PHE B 2 14 ? 2.737   -4.223  1.553   1.00 0.00 ? 38  PHE B CE2  5  
ATOM 4039  C CZ   . PHE B 2 14 ? 1.988   -3.180  2.069   1.00 0.00 ? 38  PHE B CZ   5  
ATOM 4040  H H    . PHE B 2 14 ? 2.115   -4.451  -4.470  1.00 0.00 ? 38  PHE B H    5  
ATOM 4041  H HA   . PHE B 2 14 ? 1.460   -2.204  -2.898  1.00 0.00 ? 38  PHE B HA   5  
ATOM 4042  H HB2  . PHE B 2 14 ? 0.624   -4.338  -2.265  1.00 0.00 ? 38  PHE B HB2  5  
ATOM 4043  H HB3  . PHE B 2 14 ? 2.225   -5.041  -2.255  1.00 0.00 ? 38  PHE B HB3  5  
ATOM 4044  H HD1  . PHE B 2 14 ? 0.369   -2.248  -0.752  1.00 0.00 ? 38  PHE B HD1  5  
ATOM 4045  H HD2  . PHE B 2 14 ? 3.204   -5.376  -0.189  1.00 0.00 ? 38  PHE B HD2  5  
ATOM 4046  H HE1  . PHE B 2 14 ? 0.548   -1.654  1.642   1.00 0.00 ? 38  PHE B HE1  5  
ATOM 4047  H HE2  . PHE B 2 14 ? 3.401   -4.781  2.196   1.00 0.00 ? 38  PHE B HE2  5  
ATOM 4048  H HZ   . PHE B 2 14 ? 2.070   -2.921  3.115   1.00 0.00 ? 38  PHE B HZ   5  
ATOM 4049  N N    . VAL B 2 15 ? 4.541   -3.037  -3.208  1.00 0.00 ? 39  VAL B N    5  
ATOM 4050  C CA   . VAL B 2 15 ? 5.892   -2.580  -2.985  1.00 0.00 ? 39  VAL B CA   5  
ATOM 4051  C C    . VAL B 2 15 ? 6.042   -1.221  -3.640  1.00 0.00 ? 39  VAL B C    5  
ATOM 4052  O O    . VAL B 2 15 ? 6.164   -0.212  -2.953  1.00 0.00 ? 39  VAL B O    5  
ATOM 4053  C CB   . VAL B 2 15 ? 6.942   -3.565  -3.552  1.00 0.00 ? 39  VAL B CB   5  
ATOM 4054  C CG1  . VAL B 2 15 ? 8.212   -2.834  -3.957  1.00 0.00 ? 39  VAL B CG1  5  
ATOM 4055  C CG2  . VAL B 2 15 ? 7.261   -4.648  -2.536  1.00 0.00 ? 39  VAL B CG2  5  
ATOM 4056  H H    . VAL B 2 15 ? 4.378   -3.754  -3.853  1.00 0.00 ? 39  VAL B H    5  
ATOM 4057  H HA   . VAL B 2 15 ? 6.044   -2.477  -1.920  1.00 0.00 ? 39  VAL B HA   5  
ATOM 4058  H HB   . VAL B 2 15 ? 6.529   -4.037  -4.431  1.00 0.00 ? 39  VAL B HB   5  
ATOM 4059  H HG11 . VAL B 2 15 ? 8.139   -2.530  -4.991  1.00 0.00 ? 39  VAL B HG11 5  
ATOM 4060  H HG12 . VAL B 2 15 ? 9.057   -3.489  -3.831  1.00 0.00 ? 39  VAL B HG12 5  
ATOM 4061  H HG13 . VAL B 2 15 ? 8.340   -1.961  -3.334  1.00 0.00 ? 39  VAL B HG13 5  
ATOM 4062  H HG21 . VAL B 2 15 ? 6.358   -4.930  -2.014  1.00 0.00 ? 39  VAL B HG21 5  
ATOM 4063  H HG22 . VAL B 2 15 ? 7.986   -4.273  -1.832  1.00 0.00 ? 39  VAL B HG22 5  
ATOM 4064  H HG23 . VAL B 2 15 ? 7.667   -5.510  -3.046  1.00 0.00 ? 39  VAL B HG23 5  
ATOM 4065  N N    . ARG B 2 16 ? 6.001   -1.204  -4.978  1.00 0.00 ? 40  ARG B N    5  
ATOM 4066  C CA   . ARG B 2 16 ? 6.108   0.027   -5.735  1.00 0.00 ? 40  ARG B CA   5  
ATOM 4067  C C    . ARG B 2 16 ? 5.261   1.117   -5.117  1.00 0.00 ? 40  ARG B C    5  
ATOM 4068  O O    . ARG B 2 16 ? 5.784   2.171   -4.791  1.00 0.00 ? 40  ARG B O    5  
ATOM 4069  C CB   . ARG B 2 16 ? 5.699   -0.199  -7.184  1.00 0.00 ? 40  ARG B CB   5  
ATOM 4070  C CG   . ARG B 2 16 ? 6.644   -1.117  -7.931  1.00 0.00 ? 40  ARG B CG   5  
ATOM 4071  C CD   . ARG B 2 16 ? 5.994   -2.442  -8.261  1.00 0.00 ? 40  ARG B CD   5  
ATOM 4072  N NE   . ARG B 2 16 ? 6.708   -3.155  -9.315  1.00 0.00 ? 40  ARG B NE   5  
ATOM 4073  C CZ   . ARG B 2 16 ? 6.129   -3.618  -10.417 1.00 0.00 ? 40  ARG B CZ   5  
ATOM 4074  N NH1  . ARG B 2 16 ? 4.827   -3.450  -10.610 1.00 0.00 ? 40  ARG B NH1  5  
ATOM 4075  N NH2  . ARG B 2 16 ? 6.853   -4.252  -11.330 1.00 0.00 ? 40  ARG B NH2  5  
ATOM 4076  H H    . ARG B 2 16 ? 5.912   -2.047  -5.468  1.00 0.00 ? 40  ARG B H    5  
ATOM 4077  H HA   . ARG B 2 16 ? 7.143   0.344   -5.707  1.00 0.00 ? 40  ARG B HA   5  
ATOM 4078  H HB2  . ARG B 2 16 ? 4.711   -0.635  -7.206  1.00 0.00 ? 40  ARG B HB2  5  
ATOM 4079  H HB3  . ARG B 2 16 ? 5.676   0.753   -7.695  1.00 0.00 ? 40  ARG B HB3  5  
ATOM 4080  H HG2  . ARG B 2 16 ? 6.939   -0.646  -8.843  1.00 0.00 ? 40  ARG B HG2  5  
ATOM 4081  H HG3  . ARG B 2 16 ? 7.514   -1.298  -7.318  1.00 0.00 ? 40  ARG B HG3  5  
ATOM 4082  H HD2  . ARG B 2 16 ? 5.992   -3.044  -7.372  1.00 0.00 ? 40  ARG B HD2  5  
ATOM 4083  H HD3  . ARG B 2 16 ? 4.977   -2.265  -8.579  1.00 0.00 ? 40  ARG B HD3  5  
ATOM 4084  H HE   . ARG B 2 16 ? 7.671   -3.292  -9.195  1.00 0.00 ? 40  ARG B HE   5  
ATOM 4085  H HH11 . ARG B 2 16 ? 4.278   -2.971  -9.925  1.00 0.00 ? 40  ARG B HH11 5  
ATOM 4086  H HH12 . ARG B 2 16 ? 4.395   -3.801  -11.441 1.00 0.00 ? 40  ARG B HH12 5  
ATOM 4087  H HH21 . ARG B 2 16 ? 7.834   -4.382  -11.189 1.00 0.00 ? 40  ARG B HH21 5  
ATOM 4088  H HH22 . ARG B 2 16 ? 6.417   -4.600  -12.161 1.00 0.00 ? 40  ARG B HH22 5  
ATOM 4089  N N    . ALA B 2 17 ? 3.960   0.873   -4.924  1.00 0.00 ? 41  ALA B N    5  
ATOM 4090  C CA   . ALA B 2 17 ? 3.125   1.890   -4.330  1.00 0.00 ? 41  ALA B CA   5  
ATOM 4091  C C    . ALA B 2 17 ? 3.710   2.292   -2.993  1.00 0.00 ? 41  ALA B C    5  
ATOM 4092  O O    . ALA B 2 17 ? 3.927   3.461   -2.756  1.00 0.00 ? 41  ALA B O    5  
ATOM 4093  C CB   . ALA B 2 17 ? 1.683   1.410   -4.187  1.00 0.00 ? 41  ALA B CB   5  
ATOM 4094  H H    . ALA B 2 17 ? 3.570   -0.001  -5.153  1.00 0.00 ? 41  ALA B H    5  
ATOM 4095  H HA   . ALA B 2 17 ? 3.136   2.766   -4.989  1.00 0.00 ? 41  ALA B HA   5  
ATOM 4096  H HB1  . ALA B 2 17 ? 1.040   2.258   -4.001  1.00 0.00 ? 41  ALA B HB1  5  
ATOM 4097  H HB2  . ALA B 2 17 ? 1.599   0.709   -3.358  1.00 0.00 ? 41  ALA B HB2  5  
ATOM 4098  H HB3  . ALA B 2 17 ? 1.376   0.921   -5.100  1.00 0.00 ? 41  ALA B HB3  5  
ATOM 4099  N N    . LEU B 2 18 ? 4.034   1.313   -2.148  1.00 0.00 ? 42  LEU B N    5  
ATOM 4100  C CA   . LEU B 2 18 ? 4.604   1.602   -0.834  1.00 0.00 ? 42  LEU B CA   5  
ATOM 4101  C C    . LEU B 2 18 ? 5.699   2.655   -0.958  1.00 0.00 ? 42  LEU B C    5  
ATOM 4102  O O    . LEU B 2 18 ? 5.823   3.552   -0.128  1.00 0.00 ? 42  LEU B O    5  
ATOM 4103  C CB   . LEU B 2 18 ? 5.188   0.327   -0.227  1.00 0.00 ? 42  LEU B CB   5  
ATOM 4104  C CG   . LEU B 2 18 ? 4.834   0.065   1.234   1.00 0.00 ? 42  LEU B CG   5  
ATOM 4105  C CD1  . LEU B 2 18 ? 5.429   -1.258  1.692   1.00 0.00 ? 42  LEU B CD1  5  
ATOM 4106  C CD2  . LEU B 2 18 ? 5.334   1.203   2.099   1.00 0.00 ? 42  LEU B CD2  5  
ATOM 4107  H H    . LEU B 2 18 ? 3.900   0.378   -2.416  1.00 0.00 ? 42  LEU B H    5  
ATOM 4108  H HA   . LEU B 2 18 ? 3.810   1.979   -0.201  1.00 0.00 ? 42  LEU B HA   5  
ATOM 4109  H HB2  . LEU B 2 18 ? 4.853   -0.509  -0.811  1.00 0.00 ? 42  LEU B HB2  5  
ATOM 4110  H HB3  . LEU B 2 18 ? 6.263   0.383   -0.304  1.00 0.00 ? 42  LEU B HB3  5  
ATOM 4111  H HG   . LEU B 2 18 ? 3.758   0.004   1.335   1.00 0.00 ? 42  LEU B HG   5  
ATOM 4112  H HD11 . LEU B 2 18 ? 4.693   -2.041  1.583   1.00 0.00 ? 42  LEU B HD11 5  
ATOM 4113  H HD12 . LEU B 2 18 ? 5.724   -1.179  2.729   1.00 0.00 ? 42  LEU B HD12 5  
ATOM 4114  H HD13 . LEU B 2 18 ? 6.294   -1.489  1.090   1.00 0.00 ? 42  LEU B HD13 5  
ATOM 4115  H HD21 . LEU B 2 18 ? 4.543   1.924   2.238   1.00 0.00 ? 42  LEU B HD21 5  
ATOM 4116  H HD22 . LEU B 2 18 ? 6.167   1.675   1.603   1.00 0.00 ? 42  LEU B HD22 5  
ATOM 4117  H HD23 . LEU B 2 18 ? 5.651   0.818   3.056   1.00 0.00 ? 42  LEU B HD23 5  
ATOM 4118  N N    . VAL B 2 19 ? 6.492   2.507   -2.008  1.00 0.00 ? 43  VAL B N    5  
ATOM 4119  C CA   . VAL B 2 19 ? 7.584   3.429   -2.310  1.00 0.00 ? 43  VAL B CA   5  
ATOM 4120  C C    . VAL B 2 19 ? 7.021   4.761   -2.787  1.00 0.00 ? 43  VAL B C    5  
ATOM 4121  O O    . VAL B 2 19 ? 7.244   5.803   -2.173  1.00 0.00 ? 43  VAL B O    5  
ATOM 4122  C CB   . VAL B 2 19 ? 8.518   2.850   -3.397  1.00 0.00 ? 43  VAL B CB   5  
ATOM 4123  C CG1  . VAL B 2 19 ? 9.951   3.200   -3.102  1.00 0.00 ? 43  VAL B CG1  5  
ATOM 4124  C CG2  . VAL B 2 19 ? 8.392   1.352   -3.466  1.00 0.00 ? 43  VAL B CG2  5  
ATOM 4125  H H    . VAL B 2 19 ? 6.343   1.743   -2.592  1.00 0.00 ? 43  VAL B H    5  
ATOM 4126  H HA   . VAL B 2 19 ? 8.152   3.588   -1.404  1.00 0.00 ? 43  VAL B HA   5  
ATOM 4127  H HB   . VAL B 2 19 ? 8.241   3.257   -4.361  1.00 0.00 ? 43  VAL B HB   5  
ATOM 4128  H HG11 . VAL B 2 19 ? 10.522  3.199   -4.019  1.00 0.00 ? 43  VAL B HG11 5  
ATOM 4129  H HG12 . VAL B 2 19 ? 10.339  2.447   -2.430  1.00 0.00 ? 43  VAL B HG12 5  
ATOM 4130  H HG13 . VAL B 2 19 ? 10.002  4.171   -2.636  1.00 0.00 ? 43  VAL B HG13 5  
ATOM 4131  H HG21 . VAL B 2 19 ? 7.448   1.088   -3.914  1.00 0.00 ? 43  VAL B HG21 5  
ATOM 4132  H HG22 . VAL B 2 19 ? 8.444   0.957   -2.464  1.00 0.00 ? 43  VAL B HG22 5  
ATOM 4133  H HG23 . VAL B 2 19 ? 9.200   0.945   -4.057  1.00 0.00 ? 43  VAL B HG23 5  
ATOM 4134  N N    . ARG B 2 20 ? 6.307   4.705   -3.906  1.00 0.00 ? 44  ARG B N    5  
ATOM 4135  C CA   . ARG B 2 20 ? 5.644   5.870   -4.483  1.00 0.00 ? 44  ARG B CA   5  
ATOM 4136  C C    . ARG B 2 20 ? 5.062   6.734   -3.372  1.00 0.00 ? 44  ARG B C    5  
ATOM 4137  O O    . ARG B 2 20 ? 5.079   7.963   -3.417  1.00 0.00 ? 44  ARG B O    5  
ATOM 4138  C CB   . ARG B 2 20 ? 4.494   5.376   -5.370  1.00 0.00 ? 44  ARG B CB   5  
ATOM 4139  C CG   . ARG B 2 20 ? 4.901   4.323   -6.383  1.00 0.00 ? 44  ARG B CG   5  
ATOM 4140  C CD   . ARG B 2 20 ? 4.321   4.620   -7.751  1.00 0.00 ? 44  ARG B CD   5  
ATOM 4141  N NE   . ARG B 2 20 ? 4.019   3.399   -8.491  1.00 0.00 ? 44  ARG B NE   5  
ATOM 4142  C CZ   . ARG B 2 20 ? 3.578   3.387   -9.746  1.00 0.00 ? 44  ARG B CZ   5  
ATOM 4143  N NH1  . ARG B 2 20 ? 3.413   4.526   -10.406 1.00 0.00 ? 44  ARG B NH1  5  
ATOM 4144  N NH2  . ARG B 2 20 ? 3.308   2.236   -10.343 1.00 0.00 ? 44  ARG B NH2  5  
ATOM 4145  H H    . ARG B 2 20 ? 6.234   3.850   -4.371  1.00 0.00 ? 44  ARG B H    5  
ATOM 4146  H HA   . ARG B 2 20 ? 6.350   6.433   -5.069  1.00 0.00 ? 44  ARG B HA   5  
ATOM 4147  H HB2  . ARG B 2 20 ? 3.736   4.944   -4.735  1.00 0.00 ? 44  ARG B HB2  5  
ATOM 4148  H HB3  . ARG B 2 20 ? 4.066   6.202   -5.896  1.00 0.00 ? 44  ARG B HB3  5  
ATOM 4149  H HG2  . ARG B 2 20 ? 5.977   4.300   -6.455  1.00 0.00 ? 44  ARG B HG2  5  
ATOM 4150  H HG3  . ARG B 2 20 ? 4.538   3.363   -6.050  1.00 0.00 ? 44  ARG B HG3  5  
ATOM 4151  H HD2  . ARG B 2 20 ? 3.414   5.192   -7.630  1.00 0.00 ? 44  ARG B HD2  5  
ATOM 4152  H HD3  . ARG B 2 20 ? 5.040   5.198   -8.306  1.00 0.00 ? 44  ARG B HD3  5  
ATOM 4153  H HE   . ARG B 2 20 ? 4.140   2.545   -8.028  1.00 0.00 ? 44  ARG B HE   5  
ATOM 4154  H HH11 . ARG B 2 20 ? 3.618   5.398   -9.959  1.00 0.00 ? 44  ARG B HH11 5  
ATOM 4155  H HH12 . ARG B 2 20 ? 3.082   4.515   -11.350 1.00 0.00 ? 44  ARG B HH12 5  
ATOM 4156  H HH21 . ARG B 2 20 ? 3.434   1.374   -9.852  1.00 0.00 ? 44  ARG B HH21 5  
ATOM 4157  H HH22 . ARG B 2 20 ? 2.975   2.228   -11.288 1.00 0.00 ? 44  ARG B HH22 5  
ATOM 4158  N N    . VAL B 2 21 ? 4.549   6.029   -2.385  1.00 0.00 ? 45  VAL B N    5  
ATOM 4159  C CA   . VAL B 2 21 ? 3.900   6.593   -1.223  1.00 0.00 ? 45  VAL B CA   5  
ATOM 4160  C C    . VAL B 2 21 ? 4.864   7.180   -0.197  1.00 0.00 ? 45  VAL B C    5  
ATOM 4161  O O    . VAL B 2 21 ? 4.851   8.382   0.072   1.00 0.00 ? 45  VAL B O    5  
ATOM 4162  C CB   . VAL B 2 21 ? 3.089   5.489   -0.527  1.00 0.00 ? 45  VAL B CB   5  
ATOM 4163  C CG1  . VAL B 2 21 ? 2.386   6.031   0.686   1.00 0.00 ? 45  VAL B CG1  5  
ATOM 4164  C CG2  . VAL B 2 21 ? 2.110   4.849   -1.489  1.00 0.00 ? 45  VAL B CG2  5  
ATOM 4165  H H    . VAL B 2 21 ? 4.624   5.059   -2.436  1.00 0.00 ? 45  VAL B H    5  
ATOM 4166  H HA   . VAL B 2 21 ? 3.213   7.357   -1.550  1.00 0.00 ? 45  VAL B HA   5  
ATOM 4167  H HB   . VAL B 2 21 ? 3.780   4.727   -0.198  1.00 0.00 ? 45  VAL B HB   5  
ATOM 4168  H HG11 . VAL B 2 21 ? 1.974   7.004   0.461   1.00 0.00 ? 45  VAL B HG11 5  
ATOM 4169  H HG12 . VAL B 2 21 ? 3.096   6.117   1.489   1.00 0.00 ? 45  VAL B HG12 5  
ATOM 4170  H HG13 . VAL B 2 21 ? 1.592   5.362   0.975   1.00 0.00 ? 45  VAL B HG13 5  
ATOM 4171  H HG21 . VAL B 2 21 ? 2.033   3.796   -1.273  1.00 0.00 ? 45  VAL B HG21 5  
ATOM 4172  H HG22 . VAL B 2 21 ? 2.467   4.981   -2.495  1.00 0.00 ? 45  VAL B HG22 5  
ATOM 4173  H HG23 . VAL B 2 21 ? 1.143   5.308   -1.382  1.00 0.00 ? 45  VAL B HG23 5  
ATOM 4174  N N    . CYS B 2 22 ? 5.698   6.316   0.371   1.00 0.00 ? 46  CYS B N    5  
ATOM 4175  C CA   . CYS B 2 22 ? 6.618   6.710   1.430   1.00 0.00 ? 46  CYS B CA   5  
ATOM 4176  C C    . CYS B 2 22 ? 8.059   6.632   0.972   1.00 0.00 ? 46  CYS B C    5  
ATOM 4177  O O    . CYS B 2 22 ? 8.901   7.442   1.361   1.00 0.00 ? 46  CYS B O    5  
ATOM 4178  C CB   . CYS B 2 22 ? 6.418   5.764   2.611   1.00 0.00 ? 46  CYS B CB   5  
ATOM 4179  S SG   . CYS B 2 22 ? 7.060   6.365   4.206   1.00 0.00 ? 46  CYS B SG   5  
ATOM 4180  H H    . CYS B 2 22 ? 5.722   5.387   0.041   1.00 0.00 ? 46  CYS B H    5  
ATOM 4181  H HA   . CYS B 2 22 ? 6.387   7.717   1.734   1.00 0.00 ? 46  CYS B HA   5  
ATOM 4182  H HB2  . CYS B 2 22 ? 5.366   5.575   2.732   1.00 0.00 ? 46  CYS B HB2  5  
ATOM 4183  H HB3  . CYS B 2 22 ? 6.915   4.830   2.393   1.00 0.00 ? 46  CYS B HB3  5  
ATOM 4184  N N    . GLY B 2 23 ? 8.327   5.645   0.140   1.00 0.00 ? 47  GLY B N    5  
ATOM 4185  C CA   . GLY B 2 23 ? 9.674   5.438   -0.355  1.00 0.00 ? 47  GLY B CA   5  
ATOM 4186  C C    . GLY B 2 23 ? 10.341  4.255   0.312   1.00 0.00 ? 47  GLY B C    5  
ATOM 4187  O O    . GLY B 2 23 ? 11.564  4.136   0.294   1.00 0.00 ? 47  GLY B O    5  
ATOM 4188  H H    . GLY B 2 23 ? 7.591   5.056   -0.154  1.00 0.00 ? 47  GLY B H    5  
ATOM 4189  H HA2  . GLY B 2 23 ? 9.632   5.263   -1.419  1.00 0.00 ? 47  GLY B HA2  5  
ATOM 4190  H HA3  . GLY B 2 23 ? 10.265  6.321   -0.168  1.00 0.00 ? 47  GLY B HA3  5  
ATOM 4191  N N    . GLY B 2 24 ? 9.521   3.396   0.919   1.00 0.00 ? 48  GLY B N    5  
ATOM 4192  C CA   . GLY B 2 24 ? 10.017  2.203   1.589   1.00 0.00 ? 48  GLY B CA   5  
ATOM 4193  C C    . GLY B 2 24 ? 11.293  2.426   2.386   1.00 0.00 ? 48  GLY B C    5  
ATOM 4194  O O    . GLY B 2 24 ? 11.551  3.535   2.855   1.00 0.00 ? 48  GLY B O    5  
ATOM 4195  H H    . GLY B 2 24 ? 8.557   3.577   0.914   1.00 0.00 ? 48  GLY B H    5  
ATOM 4196  H HA2  . GLY B 2 24 ? 9.254   1.840   2.260   1.00 0.00 ? 48  GLY B HA2  5  
ATOM 4197  H HA3  . GLY B 2 24 ? 10.204  1.447   0.843   1.00 0.00 ? 48  GLY B HA3  5  
ATOM 4198  N N    . PRO B 2 25 ? 12.112  1.368   2.559   1.00 0.00 ? 49  PRO B N    5  
ATOM 4199  C CA   . PRO B 2 25 ? 13.367  1.444   3.306   1.00 0.00 ? 49  PRO B CA   5  
ATOM 4200  C C    . PRO B 2 25 ? 14.539  1.936   2.458   1.00 0.00 ? 49  PRO B C    5  
ATOM 4201  O O    . PRO B 2 25 ? 15.617  1.341   2.477   1.00 0.00 ? 49  PRO B O    5  
ATOM 4202  C CB   . PRO B 2 25 ? 13.575  -0.008  3.718   1.00 0.00 ? 49  PRO B CB   5  
ATOM 4203  C CG   . PRO B 2 25 ? 13.040  -0.790  2.576   1.00 0.00 ? 49  PRO B CG   5  
ATOM 4204  C CD   . PRO B 2 25 ? 11.872  0.001   2.051   1.00 0.00 ? 49  PRO B CD   5  
ATOM 4205  H HA   . PRO B 2 25 ? 13.272  2.061   4.186   1.00 0.00 ? 49  PRO B HA   5  
ATOM 4206  H HB2  . PRO B 2 25 ? 14.625  -0.201  3.881   1.00 0.00 ? 49  PRO B HB2  5  
ATOM 4207  H HB3  . PRO B 2 25 ? 13.018  -0.209  4.613   1.00 0.00 ? 49  PRO B HB3  5  
ATOM 4208  H HG2  . PRO B 2 25 ? 13.796  -0.892  1.812   1.00 0.00 ? 49  PRO B HG2  5  
ATOM 4209  H HG3  . PRO B 2 25 ? 12.713  -1.762  2.915   1.00 0.00 ? 49  PRO B HG3  5  
ATOM 4210  H HD2  . PRO B 2 25 ? 11.874  -0.010  0.983   1.00 0.00 ? 49  PRO B HD2  5  
ATOM 4211  H HD3  . PRO B 2 25 ? 10.942  -0.394  2.431   1.00 0.00 ? 49  PRO B HD3  5  
ATOM 4212  N N    . ARG B 2 26 ? 14.318  3.026   1.721   1.00 0.00 ? 50  ARG B N    5  
ATOM 4213  C CA   . ARG B 2 26 ? 15.336  3.620   0.870   1.00 0.00 ? 50  ARG B CA   5  
ATOM 4214  C C    . ARG B 2 26 ? 15.710  2.728   -0.314  1.00 0.00 ? 50  ARG B C    5  
ATOM 4215  O O    . ARG B 2 26 ? 16.200  3.221   -1.332  1.00 0.00 ? 50  ARG B O    5  
ATOM 4216  C CB   . ARG B 2 26 ? 16.558  3.923   1.693   1.00 0.00 ? 50  ARG B CB   5  
ATOM 4217  C CG   . ARG B 2 26 ? 16.268  4.728   2.949   1.00 0.00 ? 50  ARG B CG   5  
ATOM 4218  C CD   . ARG B 2 26 ? 17.506  4.872   3.819   1.00 0.00 ? 50  ARG B CD   5  
ATOM 4219  N NE   . ARG B 2 26 ? 18.542  5.673   3.172   1.00 0.00 ? 50  ARG B NE   5  
ATOM 4220  C CZ   . ARG B 2 26 ? 19.421  6.416   3.836   1.00 0.00 ? 50  ARG B CZ   5  
ATOM 4221  N NH1  . ARG B 2 26 ? 19.391  6.461   5.162   1.00 0.00 ? 50  ARG B NH1  5  
ATOM 4222  N NH2  . ARG B 2 26 ? 20.334  7.114   3.175   1.00 0.00 ? 50  ARG B NH2  5  
ATOM 4223  H H    . ARG B 2 26 ? 13.458  3.460   1.772   1.00 0.00 ? 50  ARG B H    5  
ATOM 4224  H HA   . ARG B 2 26 ? 14.940  4.549   0.489   1.00 0.00 ? 50  ARG B HA   5  
ATOM 4225  H HB2  . ARG B 2 26 ? 16.995  2.989   1.976   1.00 0.00 ? 50  ARG B HB2  5  
ATOM 4226  H HB3  . ARG B 2 26 ? 17.248  4.473   1.088   1.00 0.00 ? 50  ARG B HB3  5  
ATOM 4227  H HG2  . ARG B 2 26 ? 15.924  5.711   2.664   1.00 0.00 ? 50  ARG B HG2  5  
ATOM 4228  H HG3  . ARG B 2 26 ? 15.496  4.226   3.516   1.00 0.00 ? 50  ARG B HG3  5  
ATOM 4229  H HD2  . ARG B 2 26 ? 17.224  5.349   4.747   1.00 0.00 ? 50  ARG B HD2  5  
ATOM 4230  H HD3  . ARG B 2 26 ? 17.900  3.889   4.027   1.00 0.00 ? 50  ARG B HD3  5  
ATOM 4231  H HE   . ARG B 2 26 ? 18.584  5.655   2.193   1.00 0.00 ? 50  ARG B HE   5  
ATOM 4232  H HH11 . ARG B 2 26 ? 18.703  5.936   5.665   1.00 0.00 ? 50  ARG B HH11 5  
ATOM 4233  H HH12 . ARG B 2 26 ? 20.053  7.020   5.657   1.00 0.00 ? 50  ARG B HH12 5  
ATOM 4234  H HH21 . ARG B 2 26 ? 20.361  7.082   2.177   1.00 0.00 ? 50  ARG B HH21 5  
ATOM 4235  H HH22 . ARG B 2 26 ? 20.994  7.674   3.677   1.00 0.00 ? 50  ARG B HH22 5  
ATOM 4236  N N    . TRP B 2 27 ? 15.482  1.418   -0.181  1.00 0.00 ? 51  TRP B N    5  
ATOM 4237  C CA   . TRP B 2 27 ? 15.764  0.481   -1.249  1.00 0.00 ? 51  TRP B CA   5  
ATOM 4238  C C    . TRP B 2 27 ? 17.218  0.535   -1.702  1.00 0.00 ? 51  TRP B C    5  
ATOM 4239  O O    . TRP B 2 27 ? 17.567  0.021   -2.766  1.00 0.00 ? 51  TRP B O    5  
ATOM 4240  C CB   . TRP B 2 27 ? 14.832  0.797   -2.386  1.00 0.00 ? 51  TRP B CB   5  
ATOM 4241  C CG   . TRP B 2 27 ? 13.445  0.988   -1.891  1.00 0.00 ? 51  TRP B CG   5  
ATOM 4242  C CD1  . TRP B 2 27 ? 12.901  2.099   -1.318  1.00 0.00 ? 51  TRP B CD1  5  
ATOM 4243  C CD2  . TRP B 2 27 ? 12.446  -0.000  -1.875  1.00 0.00 ? 51  TRP B CD2  5  
ATOM 4244  N NE1  . TRP B 2 27 ? 11.602  1.847   -0.968  1.00 0.00 ? 51  TRP B NE1  5  
ATOM 4245  C CE2  . TRP B 2 27 ? 11.298  0.563   -1.310  1.00 0.00 ? 51  TRP B CE2  5  
ATOM 4246  C CE3  . TRP B 2 27 ? 12.419  -1.307  -2.304  1.00 0.00 ? 51  TRP B CE3  5  
ATOM 4247  C CZ2  . TRP B 2 27 ? 10.125  -0.154  -1.162  1.00 0.00 ? 51  TRP B CZ2  5  
ATOM 4248  C CZ3  . TRP B 2 27 ? 11.256  -2.021  -2.157  1.00 0.00 ? 51  TRP B CZ3  5  
ATOM 4249  C CH2  . TRP B 2 27 ? 10.118  -1.431  -1.586  1.00 0.00 ? 51  TRP B CH2  5  
ATOM 4250  H H    . TRP B 2 27 ? 15.084  1.080   0.636   1.00 0.00 ? 51  TRP B H    5  
ATOM 4251  H HA   . TRP B 2 27 ? 15.533  -0.515  -0.892  1.00 0.00 ? 51  TRP B HA   5  
ATOM 4252  H HB2  . TRP B 2 27 ? 15.151  1.692   -2.883  1.00 0.00 ? 51  TRP B HB2  5  
ATOM 4253  H HB3  . TRP B 2 27 ? 14.830  -0.022  -3.074  1.00 0.00 ? 51  TRP B HB3  5  
ATOM 4254  H HD1  . TRP B 2 27 ? 13.430  3.026   -1.160  1.00 0.00 ? 51  TRP B HD1  5  
ATOM 4255  H HE1  . TRP B 2 27 ? 10.991  2.485   -0.551  1.00 0.00 ? 51  TRP B HE1  5  
ATOM 4256  H HE3  . TRP B 2 27 ? 13.295  -1.758  -2.742  1.00 0.00 ? 51  TRP B HE3  5  
ATOM 4257  H HZ2  . TRP B 2 27 ? 9.237   0.268   -0.733  1.00 0.00 ? 51  TRP B HZ2  5  
ATOM 4258  H HZ3  . TRP B 2 27 ? 11.220  -3.042  -2.477  1.00 0.00 ? 51  TRP B HZ3  5  
ATOM 4259  H HH2  . TRP B 2 27 ? 9.221   -2.000  -1.488  1.00 0.00 ? 51  TRP B HH2  5  
ATOM 4260  N N    . SER B 2 28 ? 18.060  1.160   -0.886  1.00 0.00 ? 52  SER B N    5  
ATOM 4261  C CA   . SER B 2 28 ? 19.483  1.283   -1.188  1.00 0.00 ? 52  SER B CA   5  
ATOM 4262  C C    . SER B 2 28 ? 20.097  -0.079  -1.500  1.00 0.00 ? 52  SER B C    5  
ATOM 4263  O O    . SER B 2 28 ? 19.501  -1.119  -1.216  1.00 0.00 ? 52  SER B O    5  
ATOM 4264  C CB   . SER B 2 28 ? 20.218  1.925   -0.010  1.00 0.00 ? 52  SER B CB   5  
ATOM 4265  O OG   . SER B 2 28 ? 19.687  3.204   0.288   1.00 0.00 ? 52  SER B OG   5  
ATOM 4266  H H    . SER B 2 28 ? 17.711  1.558   -0.063  1.00 0.00 ? 52  SER B H    5  
ATOM 4267  H HA   . SER B 2 28 ? 19.585  1.918   -2.055  1.00 0.00 ? 52  SER B HA   5  
ATOM 4268  H HB2  . SER B 2 28 ? 20.116  1.296   0.862   1.00 0.00 ? 52  SER B HB2  5  
ATOM 4269  H HB3  . SER B 2 28 ? 21.265  2.031   -0.256  1.00 0.00 ? 52  SER B HB3  5  
ATOM 4270  H HG   . SER B 2 28 ? 19.597  3.299   1.239   1.00 0.00 ? 52  SER B HG   5  
ATOM 4271  N N    . THR B 2 29 ? 21.300  -0.064  -2.070  1.00 0.00 ? 53  THR B N    5  
ATOM 4272  C CA   . THR B 2 29 ? 22.000  -1.295  -2.431  1.00 0.00 ? 53  THR B CA   5  
ATOM 4273  C C    . THR B 2 29 ? 23.510  -1.080  -2.455  1.00 0.00 ? 53  THR B C    5  
ATOM 4274  O O    . THR B 2 29 ? 24.274  -1.928  -1.992  1.00 0.00 ? 53  THR B O    5  
ATOM 4275  C CB   . THR B 2 29 ? 21.560  -1.819  -3.813  1.00 0.00 ? 53  THR B CB   5  
ATOM 4276  O OG1  . THR B 2 29 ? 21.659  -0.775  -4.788  1.00 0.00 ? 53  THR B OG1  5  
ATOM 4277  C CG2  . THR B 2 29 ? 20.135  -2.350  -3.776  1.00 0.00 ? 53  THR B CG2  5  
ATOM 4278  H H    . THR B 2 29 ? 21.730  0.797   -2.251  1.00 0.00 ? 53  THR B H    5  
ATOM 4279  H HA   . THR B 2 29 ? 21.763  -2.045  -1.690  1.00 0.00 ? 53  THR B HA   5  
ATOM 4280  H HB   . THR B 2 29 ? 22.219  -2.628  -4.098  1.00 0.00 ? 53  THR B HB   5  
ATOM 4281  H HG1  . THR B 2 29 ? 20.851  -0.742  -5.306  1.00 0.00 ? 53  THR B HG1  5  
ATOM 4282  H HG21 . THR B 2 29 ? 19.460  -1.552  -3.504  1.00 0.00 ? 53  THR B HG21 5  
ATOM 4283  H HG22 . THR B 2 29 ? 20.066  -3.144  -3.048  1.00 0.00 ? 53  THR B HG22 5  
ATOM 4284  H HG23 . THR B 2 29 ? 19.867  -2.732  -4.751  1.00 0.00 ? 53  THR B HG23 5  
ATOM 4285  N N    . GLU B 2 30 ? 23.935  0.057   -2.999  1.00 0.00 ? 54  GLU B N    5  
ATOM 4286  C CA   . GLU B 2 30 ? 25.348  0.382   -3.081  1.00 0.00 ? 54  GLU B CA   5  
ATOM 4287  C C    . GLU B 2 30 ? 25.836  0.966   -1.760  1.00 0.00 ? 54  GLU B C    5  
ATOM 4288  O O    . GLU B 2 30 ? 25.139  0.901   -0.746  1.00 0.00 ? 54  GLU B O    5  
ATOM 4289  C CB   . GLU B 2 30 ? 25.591  1.372   -4.224  1.00 0.00 ? 54  GLU B CB   5  
ATOM 4290  C CG   . GLU B 2 30 ? 25.006  0.922   -5.552  1.00 0.00 ? 54  GLU B CG   5  
ATOM 4291  C CD   . GLU B 2 30 ? 25.291  1.899   -6.676  1.00 0.00 ? 54  GLU B CD   5  
ATOM 4292  O OE1  . GLU B 2 30 ? 24.484  2.834   -6.870  1.00 0.00 ? 54  GLU B OE1  5  
ATOM 4293  O OE2  . GLU B 2 30 ? 26.320  1.730   -7.363  1.00 0.00 ? 54  GLU B OE2  5  
ATOM 4294  H H    . GLU B 2 30 ? 23.284  0.693   -3.349  1.00 0.00 ? 54  GLU B H    5  
ATOM 4295  H HA   . GLU B 2 30 ? 25.889  -0.530  -3.282  1.00 0.00 ? 54  GLU B HA   5  
ATOM 4296  H HB2  . GLU B 2 30 ? 25.147  2.322   -3.964  1.00 0.00 ? 54  GLU B HB2  5  
ATOM 4297  H HB3  . GLU B 2 30 ? 26.653  1.505   -4.352  1.00 0.00 ? 54  GLU B HB3  5  
ATOM 4298  H HG2  . GLU B 2 30 ? 25.432  -0.035  -5.812  1.00 0.00 ? 54  GLU B HG2  5  
ATOM 4299  H HG3  . GLU B 2 30 ? 23.936  0.821   -5.445  1.00 0.00 ? 54  GLU B HG3  5  
ATOM 4300  N N    . ALA B 2 31 ? 27.032  1.534   -1.779  1.00 0.00 ? 55  ALA B N    5  
ATOM 4301  C CA   . ALA B 2 31 ? 27.618  2.129   -0.583  1.00 0.00 ? 55  ALA B CA   5  
ATOM 4302  C C    . ALA B 2 31 ? 28.784  3.044   -0.941  1.00 0.00 ? 55  ALA B C    5  
ATOM 4303  O O    . ALA B 2 31 ? 29.922  2.539   -1.052  1.00 0.00 ? 55  ALA B O    5  
ATOM 4304  C CB   . ALA B 2 31 ? 28.073  1.040   0.379   1.00 0.00 ? 55  ALA B CB   5  
ATOM 4305  O OXT  . ALA B 2 31 ? 28.550  4.260   -1.109  1.00 0.00 ? 55  ALA B OXT  5  
ATOM 4306  H H    . ALA B 2 31 ? 27.530  1.560   -2.620  1.00 0.00 ? 55  ALA B H    5  
ATOM 4307  H HA   . ALA B 2 31 ? 26.853  2.712   -0.094  1.00 0.00 ? 55  ALA B HA   5  
ATOM 4308  H HB1  . ALA B 2 31 ? 28.447  1.493   1.285   1.00 0.00 ? 55  ALA B HB1  5  
ATOM 4309  H HB2  . ALA B 2 31 ? 28.856  0.455   -0.080  1.00 0.00 ? 55  ALA B HB2  5  
ATOM 4310  H HB3  . ALA B 2 31 ? 27.238  0.397   0.618   1.00 0.00 ? 55  ALA B HB3  5  
ATOM 4311  N N    . ALA A 1 1  ? -0.484  -0.033  17.445  1.00 0.00 ? 106 ALA A N    6  
ATOM 4312  C CA   . ALA A 1 1  ? -1.452  -0.394  16.376  1.00 0.00 ? 106 ALA A CA   6  
ATOM 4313  C C    . ALA A 1 1  ? -0.812  -1.323  15.350  1.00 0.00 ? 106 ALA A C    6  
ATOM 4314  O O    . ALA A 1 1  ? 0.366   -1.188  15.025  1.00 0.00 ? 106 ALA A O    6  
ATOM 4315  C CB   . ALA A 1 1  ? -1.978  0.861   15.695  1.00 0.00 ? 106 ALA A CB   6  
ATOM 4316  H H1   . ALA A 1 1  ? -0.939  0.589   18.144  1.00 0.00 ? 106 ALA A H1   6  
ATOM 4317  H H2   . ALA A 1 1  ? 0.331   0.464   17.034  1.00 0.00 ? 106 ALA A H2   6  
ATOM 4318  H H3   . ALA A 1 1  ? -0.147  -0.892  17.926  1.00 0.00 ? 106 ALA A H3   6  
ATOM 4319  H HA   . ALA A 1 1  ? -2.288  -0.903  16.834  1.00 0.00 ? 106 ALA A HA   6  
ATOM 4320  H HB1  . ALA A 1 1  ? -1.177  1.343   15.156  1.00 0.00 ? 106 ALA A HB1  6  
ATOM 4321  H HB2  . ALA A 1 1  ? -2.368  1.539   16.441  1.00 0.00 ? 106 ALA A HB2  6  
ATOM 4322  H HB3  . ALA A 1 1  ? -2.767  0.593   15.007  1.00 0.00 ? 106 ALA A HB3  6  
ATOM 4323  N N    . ALA A 1 2  ? -1.600  -2.266  14.843  1.00 0.00 ? 107 ALA A N    6  
ATOM 4324  C CA   . ALA A 1 2  ? -1.116  -3.221  13.854  1.00 0.00 ? 107 ALA A CA   6  
ATOM 4325  C C    . ALA A 1 2  ? -2.275  -3.861  13.099  1.00 0.00 ? 107 ALA A C    6  
ATOM 4326  O O    . ALA A 1 2  ? -3.258  -4.290  13.703  1.00 0.00 ? 107 ALA A O    6  
ATOM 4327  C CB   . ALA A 1 2  ? -0.265  -4.290  14.524  1.00 0.00 ? 107 ALA A CB   6  
ATOM 4328  H H    . ALA A 1 2  ? -2.533  -2.321  15.143  1.00 0.00 ? 107 ALA A H    6  
ATOM 4329  H HA   . ALA A 1 2  ? -0.493  -2.686  13.150  1.00 0.00 ? 107 ALA A HA   6  
ATOM 4330  H HB1  . ALA A 1 2  ? -0.866  -4.834  15.236  1.00 0.00 ? 107 ALA A HB1  6  
ATOM 4331  H HB2  . ALA A 1 2  ? 0.563   -3.821  15.034  1.00 0.00 ? 107 ALA A HB2  6  
ATOM 4332  H HB3  . ALA A 1 2  ? 0.111   -4.971  13.775  1.00 0.00 ? 107 ALA A HB3  6  
ATOM 4333  N N    . ALA A 1 3  ? -2.152  -3.922  11.777  1.00 0.00 ? 108 ALA A N    6  
ATOM 4334  C CA   . ALA A 1 3  ? -3.192  -4.505  10.939  1.00 0.00 ? 108 ALA A CA   6  
ATOM 4335  C C    . ALA A 1 3  ? -2.789  -5.881  10.431  1.00 0.00 ? 108 ALA A C    6  
ATOM 4336  O O    . ALA A 1 3  ? -1.850  -6.497  10.935  1.00 0.00 ? 108 ALA A O    6  
ATOM 4337  C CB   . ALA A 1 3  ? -3.489  -3.599  9.758   1.00 0.00 ? 108 ALA A CB   6  
ATOM 4338  H H    . ALA A 1 3  ? -1.344  -3.566  11.353  1.00 0.00 ? 108 ALA A H    6  
ATOM 4339  H HA   . ALA A 1 3  ? -4.090  -4.594  11.531  1.00 0.00 ? 108 ALA A HA   6  
ATOM 4340  H HB1  . ALA A 1 3  ? -4.529  -3.307  9.778   1.00 0.00 ? 108 ALA A HB1  6  
ATOM 4341  H HB2  . ALA A 1 3  ? -3.281  -4.134  8.839   1.00 0.00 ? 108 ALA A HB2  6  
ATOM 4342  H HB3  . ALA A 1 3  ? -2.866  -2.718  9.812   1.00 0.00 ? 108 ALA A HB3  6  
ATOM 4343  N N    . THR A 1 4  ? -3.515  -6.351  9.425   1.00 0.00 ? 109 THR A N    6  
ATOM 4344  C CA   . THR A 1 4  ? -3.244  -7.643  8.819   1.00 0.00 ? 109 THR A CA   6  
ATOM 4345  C C    . THR A 1 4  ? -2.030  -7.545  7.899   1.00 0.00 ? 109 THR A C    6  
ATOM 4346  O O    . THR A 1 4  ? -1.188  -6.664  8.070   1.00 0.00 ? 109 THR A O    6  
ATOM 4347  C CB   . THR A 1 4  ? -4.470  -8.129  8.014   1.00 0.00 ? 109 THR A CB   6  
ATOM 4348  O OG1  . THR A 1 4  ? -4.297  -9.497  7.621   1.00 0.00 ? 109 THR A OG1  6  
ATOM 4349  C CG2  . THR A 1 4  ? -4.691  -7.263  6.778   1.00 0.00 ? 109 THR A CG2  6  
ATOM 4350  H H    . THR A 1 4  ? -4.257  -5.812  9.082   1.00 0.00 ? 109 THR A H    6  
ATOM 4351  H HA   . THR A 1 4  ? -3.042  -8.353  9.605   1.00 0.00 ? 109 THR A HA   6  
ATOM 4352  H HB   . THR A 1 4  ? -5.344  -8.054  8.645   1.00 0.00 ? 109 THR A HB   6  
ATOM 4353  H HG1  . THR A 1 4  ? -3.458  -9.821  7.953   1.00 0.00 ? 109 THR A HG1  6  
ATOM 4354  H HG21 . THR A 1 4  ? -4.642  -6.216  7.052   1.00 0.00 ? 109 THR A HG21 6  
ATOM 4355  H HG22 . THR A 1 4  ? -5.662  -7.478  6.357   1.00 0.00 ? 109 THR A HG22 6  
ATOM 4356  H HG23 . THR A 1 4  ? -3.928  -7.478  6.046   1.00 0.00 ? 109 THR A HG23 6  
ATOM 4357  N N    . ASN A 1 5  ? -1.936  -8.453  6.937   1.00 0.00 ? 110 ASN A N    6  
ATOM 4358  C CA   . ASN A 1 5  ? -0.835  -8.451  5.978   1.00 0.00 ? 110 ASN A CA   6  
ATOM 4359  C C    . ASN A 1 5  ? -1.144  -7.466  4.854   1.00 0.00 ? 110 ASN A C    6  
ATOM 4360  O O    . ASN A 1 5  ? -1.948  -7.766  3.975   1.00 0.00 ? 110 ASN A O    6  
ATOM 4361  C CB   . ASN A 1 5  ? -0.619  -9.851  5.398   1.00 0.00 ? 110 ASN A CB   6  
ATOM 4362  C CG   . ASN A 1 5  ? -0.244  -10.868 6.460   1.00 0.00 ? 110 ASN A CG   6  
ATOM 4363  O OD1  . ASN A 1 5  ? -0.645  -10.754 7.618   1.00 0.00 ? 110 ASN A OD1  6  
ATOM 4364  N ND2  . ASN A 1 5  ? 0.533   -11.871 6.066   1.00 0.00 ? 110 ASN A ND2  6  
ATOM 4365  H H    . ASN A 1 5  ? -2.627  -9.137  6.864   1.00 0.00 ? 110 ASN A H    6  
ATOM 4366  H HA   . ASN A 1 5  ? 0.060   -8.133  6.493   1.00 0.00 ? 110 ASN A HA   6  
ATOM 4367  H HB2  . ASN A 1 5  ? -1.530  -10.180 4.916   1.00 0.00 ? 110 ASN A HB2  6  
ATOM 4368  H HB3  . ASN A 1 5  ? 0.175   -9.811  4.668   1.00 0.00 ? 110 ASN A HB3  6  
ATOM 4369  H HD21 . ASN A 1 5  ? 0.814   -11.897 5.129   1.00 0.00 ? 110 ASN A HD21 6  
ATOM 4370  H HD22 . ASN A 1 5  ? 0.789   -12.544 6.731   1.00 0.00 ? 110 ASN A HD22 6  
ATOM 4371  N N    . PRO A 1 6  ? -0.508  -6.280  4.857   1.00 0.00 ? 111 PRO A N    6  
ATOM 4372  C CA   . PRO A 1 6  ? -0.757  -5.251  3.839   1.00 0.00 ? 111 PRO A CA   6  
ATOM 4373  C C    . PRO A 1 6  ? -0.376  -5.691  2.428   1.00 0.00 ? 111 PRO A C    6  
ATOM 4374  O O    . PRO A 1 6  ? -0.556  -4.943  1.471   1.00 0.00 ? 111 PRO A O    6  
ATOM 4375  C CB   . PRO A 1 6  ? 0.102   -4.076  4.302   1.00 0.00 ? 111 PRO A CB   6  
ATOM 4376  C CG   . PRO A 1 6  ? 1.173   -4.700  5.127   1.00 0.00 ? 111 PRO A CG   6  
ATOM 4377  C CD   . PRO A 1 6  ? 0.509   -5.844  5.831   1.00 0.00 ? 111 PRO A CD   6  
ATOM 4378  H HA   . PRO A 1 6  ? -1.793  -4.955  3.840   1.00 0.00 ? 111 PRO A HA   6  
ATOM 4379  H HB2  . PRO A 1 6  ? 0.505   -3.560  3.448   1.00 0.00 ? 111 PRO A HB2  6  
ATOM 4380  H HB3  . PRO A 1 6  ? -0.498  -3.397  4.888   1.00 0.00 ? 111 PRO A HB3  6  
ATOM 4381  H HG2  . PRO A 1 6  ? 1.968   -5.059  4.490   1.00 0.00 ? 111 PRO A HG2  6  
ATOM 4382  H HG3  . PRO A 1 6  ? 1.553   -3.987  5.843   1.00 0.00 ? 111 PRO A HG3  6  
ATOM 4383  H HD2  . PRO A 1 6  ? 1.219   -6.632  6.029   1.00 0.00 ? 111 PRO A HD2  6  
ATOM 4384  H HD3  . PRO A 1 6  ? 0.046   -5.506  6.745   1.00 0.00 ? 111 PRO A HD3  6  
ATOM 4385  N N    . ALA A 1 7  ? 0.151   -6.900  2.295   1.00 0.00 ? 112 ALA A N    6  
ATOM 4386  C CA   . ALA A 1 7  ? 0.519   -7.420  0.984   1.00 0.00 ? 112 ALA A CA   6  
ATOM 4387  C C    . ALA A 1 7  ? -0.690  -8.067  0.335   1.00 0.00 ? 112 ALA A C    6  
ATOM 4388  O O    . ALA A 1 7  ? -1.058  -7.749  -0.796  1.00 0.00 ? 112 ALA A O    6  
ATOM 4389  C CB   . ALA A 1 7  ? 1.656   -8.414  1.106   1.00 0.00 ? 112 ALA A CB   6  
ATOM 4390  H H    . ALA A 1 7  ? 0.297   -7.451  3.090   1.00 0.00 ? 112 ALA A H    6  
ATOM 4391  H HA   . ALA A 1 7  ? 0.848   -6.594  0.372   1.00 0.00 ? 112 ALA A HA   6  
ATOM 4392  H HB1  . ALA A 1 7  ? 1.294   -9.324  1.561   1.00 0.00 ? 112 ALA A HB1  6  
ATOM 4393  H HB2  . ALA A 1 7  ? 2.428   -7.987  1.724   1.00 0.00 ? 112 ALA A HB2  6  
ATOM 4394  H HB3  . ALA A 1 7  ? 2.055   -8.631  0.126   1.00 0.00 ? 112 ALA A HB3  6  
ATOM 4395  N N    . ARG A 1 8  ? -1.299  -8.978  1.074   1.00 0.00 ? 113 ARG A N    6  
ATOM 4396  C CA   . ARG A 1 8  ? -2.494  -9.673  0.618   1.00 0.00 ? 113 ARG A CA   6  
ATOM 4397  C C    . ARG A 1 8  ? -3.706  -8.755  0.769   1.00 0.00 ? 113 ARG A C    6  
ATOM 4398  O O    . ARG A 1 8  ? -4.702  -8.880  0.052   1.00 0.00 ? 113 ARG A O    6  
ATOM 4399  C CB   . ARG A 1 8  ? -2.687  -10.955 1.430   1.00 0.00 ? 113 ARG A CB   6  
ATOM 4400  C CG   . ARG A 1 8  ? -2.427  -12.226 0.637   1.00 0.00 ? 113 ARG A CG   6  
ATOM 4401  C CD   . ARG A 1 8  ? -3.640  -12.629 -0.185  1.00 0.00 ? 113 ARG A CD   6  
ATOM 4402  N NE   . ARG A 1 8  ? -4.779  -12.977 0.660   1.00 0.00 ? 113 ARG A NE   6  
ATOM 4403  C CZ   . ARG A 1 8  ? -5.853  -13.628 0.223   1.00 0.00 ? 113 ARG A CZ   6  
ATOM 4404  N NH1  . ARG A 1 8  ? -5.938  -13.992 -1.050  1.00 0.00 ? 113 ARG A NH1  6  
ATOM 4405  N NH2  . ARG A 1 8  ? -6.843  -13.915 1.056   1.00 0.00 ? 113 ARG A NH2  6  
ATOM 4406  H H    . ARG A 1 8  ? -0.921  -9.197  1.953   1.00 0.00 ? 113 ARG A H    6  
ATOM 4407  H HA   . ARG A 1 8  ? -2.365  -9.922  -0.424  1.00 0.00 ? 113 ARG A HA   6  
ATOM 4408  H HB2  . ARG A 1 8  ? -2.008  -10.937 2.270   1.00 0.00 ? 113 ARG A HB2  6  
ATOM 4409  H HB3  . ARG A 1 8  ? -3.700  -10.985 1.802   1.00 0.00 ? 113 ARG A HB3  6  
ATOM 4410  H HG2  . ARG A 1 8  ? -1.595  -12.059 -0.029  1.00 0.00 ? 113 ARG A HG2  6  
ATOM 4411  H HG3  . ARG A 1 8  ? -2.187  -13.024 1.325   1.00 0.00 ? 113 ARG A HG3  6  
ATOM 4412  H HD2  . ARG A 1 8  ? -3.917  -11.804 -0.825  1.00 0.00 ? 113 ARG A HD2  6  
ATOM 4413  H HD3  . ARG A 1 8  ? -3.380  -13.484 -0.792  1.00 0.00 ? 113 ARG A HD3  6  
ATOM 4414  H HE   . ARG A 1 8  ? -4.741  -12.713 1.604   1.00 0.00 ? 113 ARG A HE   6  
ATOM 4415  H HH11 . ARG A 1 8  ? -5.194  -13.777 -1.683  1.00 0.00 ? 113 ARG A HH11 6  
ATOM 4416  H HH12 . ARG A 1 8  ? -6.746  -14.482 -1.376  1.00 0.00 ? 113 ARG A HH12 6  
ATOM 4417  H HH21 . ARG A 1 8  ? -6.783  -13.640 2.016   1.00 0.00 ? 113 ARG A HH21 6  
ATOM 4418  H HH22 . ARG A 1 8  ? -7.648  -14.405 0.725   1.00 0.00 ? 113 ARG A HH22 6  
ATOM 4419  N N    . TYR A 1 9  ? -3.589  -7.825  1.711   1.00 0.00 ? 114 TYR A N    6  
ATOM 4420  C CA   . TYR A 1 9  ? -4.633  -6.850  1.998   1.00 0.00 ? 114 TYR A CA   6  
ATOM 4421  C C    . TYR A 1 9  ? -4.874  -5.949  0.787   1.00 0.00 ? 114 TYR A C    6  
ATOM 4422  O O    . TYR A 1 9  ? -5.997  -5.863  0.291   1.00 0.00 ? 114 TYR A O    6  
ATOM 4423  C CB   . TYR A 1 9  ? -4.228  -6.061  3.259   1.00 0.00 ? 114 TYR A CB   6  
ATOM 4424  C CG   . TYR A 1 9  ? -4.781  -4.654  3.405   1.00 0.00 ? 114 TYR A CG   6  
ATOM 4425  C CD1  . TYR A 1 9  ? -5.995  -4.271  2.851   1.00 0.00 ? 114 TYR A CD1  6  
ATOM 4426  C CD2  . TYR A 1 9  ? -4.062  -3.705  4.120   1.00 0.00 ? 114 TYR A CD2  6  
ATOM 4427  C CE1  . TYR A 1 9  ? -6.472  -2.985  3.000   1.00 0.00 ? 114 TYR A CE1  6  
ATOM 4428  C CE2  . TYR A 1 9  ? -4.528  -2.420  4.278   1.00 0.00 ? 114 TYR A CE2  6  
ATOM 4429  C CZ   . TYR A 1 9  ? -5.735  -2.061  3.716   1.00 0.00 ? 114 TYR A CZ   6  
ATOM 4430  O OH   . TYR A 1 9  ? -6.207  -0.778  3.868   1.00 0.00 ? 114 TYR A OH   6  
ATOM 4431  H H    . TYR A 1 9  ? -2.762  -7.792  2.234   1.00 0.00 ? 114 TYR A H    6  
ATOM 4432  H HA   . TYR A 1 9  ? -5.547  -7.387  2.207   1.00 0.00 ? 114 TYR A HA   6  
ATOM 4433  H HB2  . TYR A 1 9  ? -4.550  -6.616  4.126   1.00 0.00 ? 114 TYR A HB2  6  
ATOM 4434  H HB3  . TYR A 1 9  ? -3.151  -5.990  3.280   1.00 0.00 ? 114 TYR A HB3  6  
ATOM 4435  H HD1  . TYR A 1 9  ? -6.571  -4.993  2.292   1.00 0.00 ? 114 TYR A HD1  6  
ATOM 4436  H HD2  . TYR A 1 9  ? -3.119  -3.986  4.562   1.00 0.00 ? 114 TYR A HD2  6  
ATOM 4437  H HE1  . TYR A 1 9  ? -7.414  -2.709  2.557   1.00 0.00 ? 114 TYR A HE1  6  
ATOM 4438  H HE2  . TYR A 1 9  ? -3.944  -1.704  4.839   1.00 0.00 ? 114 TYR A HE2  6  
ATOM 4439  H HH   . TYR A 1 9  ? -7.144  -0.803  4.073   1.00 0.00 ? 114 TYR A HH   6  
ATOM 4440  N N    . CYS A 1 10 ? -3.828  -5.286  0.304   1.00 0.00 ? 115 CYS A N    6  
ATOM 4441  C CA   . CYS A 1 10 ? -3.975  -4.411  -0.852  1.00 0.00 ? 115 CYS A CA   6  
ATOM 4442  C C    . CYS A 1 10 ? -4.155  -5.227  -2.130  1.00 0.00 ? 115 CYS A C    6  
ATOM 4443  O O    . CYS A 1 10 ? -4.793  -4.778  -3.078  1.00 0.00 ? 115 CYS A O    6  
ATOM 4444  C CB   . CYS A 1 10 ? -2.773  -3.483  -1.007  1.00 0.00 ? 115 CYS A CB   6  
ATOM 4445  S SG   . CYS A 1 10 ? -2.089  -2.842  0.556   1.00 0.00 ? 115 CYS A SG   6  
ATOM 4446  H H    . CYS A 1 10 ? -2.950  -5.388  0.728   1.00 0.00 ? 115 CYS A H    6  
ATOM 4447  H HA   . CYS A 1 10 ? -4.861  -3.812  -0.699  1.00 0.00 ? 115 CYS A HA   6  
ATOM 4448  H HB2  . CYS A 1 10 ? -1.981  -4.013  -1.515  1.00 0.00 ? 115 CYS A HB2  6  
ATOM 4449  H HB3  . CYS A 1 10 ? -3.069  -2.635  -1.609  1.00 0.00 ? 115 CYS A HB3  6  
ATOM 4450  N N    . CYS A 1 11 ? -3.587  -6.426  -2.156  1.00 0.00 ? 116 CYS A N    6  
ATOM 4451  C CA   . CYS A 1 11 ? -3.696  -7.285  -3.329  1.00 0.00 ? 116 CYS A CA   6  
ATOM 4452  C C    . CYS A 1 11 ? -5.158  -7.551  -3.669  1.00 0.00 ? 116 CYS A C    6  
ATOM 4453  O O    . CYS A 1 11 ? -5.533  -7.614  -4.840  1.00 0.00 ? 116 CYS A O    6  
ATOM 4454  C CB   . CYS A 1 11 ? -2.974  -8.616  -3.095  1.00 0.00 ? 116 CYS A CB   6  
ATOM 4455  S SG   . CYS A 1 11 ? -3.150  -9.811  -4.465  1.00 0.00 ? 116 CYS A SG   6  
ATOM 4456  H H    . CYS A 1 11 ? -3.085  -6.741  -1.374  1.00 0.00 ? 116 CYS A H    6  
ATOM 4457  H HA   . CYS A 1 11 ? -3.234  -6.766  -4.157  1.00 0.00 ? 116 CYS A HA   6  
ATOM 4458  H HB2  . CYS A 1 11 ? -1.923  -8.429  -2.956  1.00 0.00 ? 116 CYS A HB2  6  
ATOM 4459  H HB3  . CYS A 1 11 ? -3.368  -9.078  -2.205  1.00 0.00 ? 116 CYS A HB3  6  
ATOM 4460  N N    . LEU A 1 12 ? -5.979  -7.707  -2.635  1.00 0.00 ? 117 LEU A N    6  
ATOM 4461  C CA   . LEU A 1 12 ? -7.395  -7.973  -2.818  1.00 0.00 ? 117 LEU A CA   6  
ATOM 4462  C C    . LEU A 1 12 ? -8.175  -6.700  -3.142  1.00 0.00 ? 117 LEU A C    6  
ATOM 4463  O O    . LEU A 1 12 ? -8.852  -6.626  -4.168  1.00 0.00 ? 117 LEU A O    6  
ATOM 4464  C CB   . LEU A 1 12 ? -7.960  -8.626  -1.561  1.00 0.00 ? 117 LEU A CB   6  
ATOM 4465  C CG   . LEU A 1 12 ? -7.841  -10.151 -1.510  1.00 0.00 ? 117 LEU A CG   6  
ATOM 4466  C CD1  . LEU A 1 12 ? -8.185  -10.666 -0.120  1.00 0.00 ? 117 LEU A CD1  6  
ATOM 4467  C CD2  . LEU A 1 12 ? -8.743  -10.794 -2.556  1.00 0.00 ? 117 LEU A CD2  6  
ATOM 4468  H H    . LEU A 1 12 ? -5.622  -7.650  -1.724  1.00 0.00 ? 117 LEU A H    6  
ATOM 4469  H HA   . LEU A 1 12 ? -7.497  -8.660  -3.638  1.00 0.00 ? 117 LEU A HA   6  
ATOM 4470  H HB2  . LEU A 1 12 ? -7.437  -8.220  -0.713  1.00 0.00 ? 117 LEU A HB2  6  
ATOM 4471  H HB3  . LEU A 1 12 ? -8.998  -8.365  -1.481  1.00 0.00 ? 117 LEU A HB3  6  
ATOM 4472  H HG   . LEU A 1 12 ? -6.821  -10.434 -1.727  1.00 0.00 ? 117 LEU A HG   6  
ATOM 4473  H HD11 . LEU A 1 12 ? -8.124  -11.744 -0.112  1.00 0.00 ? 117 LEU A HD11 6  
ATOM 4474  H HD12 . LEU A 1 12 ? -9.187  -10.360 0.139   1.00 0.00 ? 117 LEU A HD12 6  
ATOM 4475  H HD13 . LEU A 1 12 ? -7.486  -10.260 0.596   1.00 0.00 ? 117 LEU A HD13 6  
ATOM 4476  H HD21 . LEU A 1 12 ? -8.668  -11.869 -2.484  1.00 0.00 ? 117 LEU A HD21 6  
ATOM 4477  H HD22 . LEU A 1 12 ? -8.433  -10.477 -3.540  1.00 0.00 ? 117 LEU A HD22 6  
ATOM 4478  H HD23 . LEU A 1 12 ? -9.765  -10.492 -2.384  1.00 0.00 ? 117 LEU A HD23 6  
ATOM 4479  N N    . SER A 1 13 ? -8.078  -5.701  -2.269  1.00 0.00 ? 118 SER A N    6  
ATOM 4480  C CA   . SER A 1 13 ? -8.797  -4.449  -2.463  1.00 0.00 ? 118 SER A CA   6  
ATOM 4481  C C    . SER A 1 13 ? -7.884  -3.309  -2.917  1.00 0.00 ? 118 SER A C    6  
ATOM 4482  O O    . SER A 1 13 ? -8.243  -2.543  -3.812  1.00 0.00 ? 118 SER A O    6  
ATOM 4483  C CB   . SER A 1 13 ? -9.504  -4.055  -1.168  1.00 0.00 ? 118 SER A CB   6  
ATOM 4484  O OG   . SER A 1 13 ? -10.579 -4.935  -0.884  1.00 0.00 ? 118 SER A OG   6  
ATOM 4485  H H    . SER A 1 13 ? -7.518  -5.808  -1.474  1.00 0.00 ? 118 SER A H    6  
ATOM 4486  H HA   . SER A 1 13 ? -9.543  -4.614  -3.224  1.00 0.00 ? 118 SER A HA   6  
ATOM 4487  H HB2  . SER A 1 13 ? -8.800  -4.094  -0.350  1.00 0.00 ? 118 SER A HB2  6  
ATOM 4488  H HB3  . SER A 1 13 ? -9.888  -3.055  -1.262  1.00 0.00 ? 118 SER A HB3  6  
ATOM 4489  H HG   . SER A 1 13 ? -11.409 -4.456  -0.944  1.00 0.00 ? 118 SER A HG   6  
ATOM 4490  N N    . GLY A 1 14 ? -6.707  -3.196  -2.304  1.00 0.00 ? 119 GLY A N    6  
ATOM 4491  C CA   . GLY A 1 14 ? -5.794  -2.129  -2.655  1.00 0.00 ? 119 GLY A CA   6  
ATOM 4492  C C    . GLY A 1 14 ? -5.590  -1.175  -1.499  1.00 0.00 ? 119 GLY A C    6  
ATOM 4493  O O    . GLY A 1 14 ? -6.405  -1.140  -0.576  1.00 0.00 ? 119 GLY A O    6  
ATOM 4494  H H    . GLY A 1 14 ? -6.451  -3.848  -1.617  1.00 0.00 ? 119 GLY A H    6  
ATOM 4495  H HA2  . GLY A 1 14 ? -4.841  -2.558  -2.927  1.00 0.00 ? 119 GLY A HA2  6  
ATOM 4496  H HA3  . GLY A 1 14 ? -6.192  -1.586  -3.501  1.00 0.00 ? 119 GLY A HA3  6  
ATOM 4497  N N    . CYS A 1 15 ? -4.511  -0.400  -1.532  1.00 0.00 ? 120 CYS A N    6  
ATOM 4498  C CA   . CYS A 1 15 ? -4.238  0.533   -0.446  1.00 0.00 ? 120 CYS A CA   6  
ATOM 4499  C C    . CYS A 1 15 ? -3.912  1.928   -0.946  1.00 0.00 ? 120 CYS A C    6  
ATOM 4500  O O    . CYS A 1 15 ? -3.346  2.105   -2.026  1.00 0.00 ? 120 CYS A O    6  
ATOM 4501  C CB   . CYS A 1 15 ? -3.113  0.011   0.444   1.00 0.00 ? 120 CYS A CB   6  
ATOM 4502  S SG   . CYS A 1 15 ? -3.507  -1.575  1.249   1.00 0.00 ? 120 CYS A SG   6  
ATOM 4503  H H    . CYS A 1 15 ? -3.897  -0.452  -2.293  1.00 0.00 ? 120 CYS A H    6  
ATOM 4504  H HA   . CYS A 1 15 ? -5.128  0.594   0.143   1.00 0.00 ? 120 CYS A HA   6  
ATOM 4505  H HB2  . CYS A 1 15 ? -2.223  -0.127  -0.144  1.00 0.00 ? 120 CYS A HB2  6  
ATOM 4506  H HB3  . CYS A 1 15 ? -2.915  0.733   1.221   1.00 0.00 ? 120 CYS A HB3  6  
ATOM 4507  N N    . THR A 1 16 ? -4.290  2.918   -0.144  1.00 0.00 ? 121 THR A N    6  
ATOM 4508  C CA   . THR A 1 16 ? -4.048  4.310   -0.477  1.00 0.00 ? 121 THR A CA   6  
ATOM 4509  C C    . THR A 1 16 ? -2.674  4.738   -0.042  1.00 0.00 ? 121 THR A C    6  
ATOM 4510  O O    . THR A 1 16 ? -2.037  4.090   0.786   1.00 0.00 ? 121 THR A O    6  
ATOM 4511  C CB   . THR A 1 16 ? -5.039  5.256   0.213   1.00 0.00 ? 121 THR A CB   6  
ATOM 4512  O OG1  . THR A 1 16 ? -4.690  5.418   1.590   1.00 0.00 ? 121 THR A OG1  6  
ATOM 4513  C CG2  . THR A 1 16 ? -6.439  4.730   0.112   1.00 0.00 ? 121 THR A CG2  6  
ATOM 4514  H H    . THR A 1 16 ? -4.746  2.702   0.695   1.00 0.00 ? 121 THR A H    6  
ATOM 4515  H HA   . THR A 1 16 ? -4.143  4.431   -1.546  1.00 0.00 ? 121 THR A HA   6  
ATOM 4516  H HB   . THR A 1 16 ? -4.999  6.212   -0.285  1.00 0.00 ? 121 THR A HB   6  
ATOM 4517  H HG1  . THR A 1 16 ? -5.271  6.065   1.995   1.00 0.00 ? 121 THR A HG1  6  
ATOM 4518  H HG21 . THR A 1 16 ? -6.639  4.523   -0.915  1.00 0.00 ? 121 THR A HG21 6  
ATOM 4519  H HG22 . THR A 1 16 ? -7.135  5.470   0.480   1.00 0.00 ? 121 THR A HG22 6  
ATOM 4520  H HG23 . THR A 1 16 ? -6.531  3.821   0.691   1.00 0.00 ? 121 THR A HG23 6  
ATOM 4521  N N    . GLN A 1 17 ? -2.243  5.863   -0.573  1.00 0.00 ? 122 GLN A N    6  
ATOM 4522  C CA   . GLN A 1 17 ? -0.954  6.415   -0.222  1.00 0.00 ? 122 GLN A CA   6  
ATOM 4523  C C    . GLN A 1 17 ? -0.946  6.765   1.254   1.00 0.00 ? 122 GLN A C    6  
ATOM 4524  O O    . GLN A 1 17 ? 0.056   7.216   1.784   1.00 0.00 ? 122 GLN A O    6  
ATOM 4525  C CB   . GLN A 1 17 ? -0.648  7.637   -1.079  1.00 0.00 ? 122 GLN A CB   6  
ATOM 4526  C CG   . GLN A 1 17 ? 0.067   7.294   -2.374  1.00 0.00 ? 122 GLN A CG   6  
ATOM 4527  C CD   . GLN A 1 17 ? 0.040   8.431   -3.377  1.00 0.00 ? 122 GLN A CD   6  
ATOM 4528  O OE1  . GLN A 1 17 ? -0.904  9.219   -3.416  1.00 0.00 ? 122 GLN A OE1  6  
ATOM 4529  N NE2  . GLN A 1 17 ? 1.083   8.525   -4.195  1.00 0.00 ? 122 GLN A NE2  6  
ATOM 4530  H H    . GLN A 1 17 ? -2.820  6.339   -1.210  1.00 0.00 ? 122 GLN A H    6  
ATOM 4531  H HA   . GLN A 1 17 ? -0.192  5.651   -0.392  1.00 0.00 ? 122 GLN A HA   6  
ATOM 4532  H HB2  . GLN A 1 17 ? -1.575  8.133   -1.324  1.00 0.00 ? 122 GLN A HB2  6  
ATOM 4533  H HB3  . GLN A 1 17 ? -0.027  8.311   -0.516  1.00 0.00 ? 122 GLN A HB3  6  
ATOM 4534  H HG2  . GLN A 1 17 ? 1.095   7.053   -2.150  1.00 0.00 ? 122 GLN A HG2  6  
ATOM 4535  H HG3  . GLN A 1 17 ? -0.409  6.431   -2.813  1.00 0.00 ? 122 GLN A HG3  6  
ATOM 4536  H HE21 . GLN A 1 17 ? 1.802   7.863   -4.106  1.00 0.00 ? 122 GLN A HE21 6  
ATOM 4537  H HE22 . GLN A 1 17 ? 1.091   9.252   -4.853  1.00 0.00 ? 122 GLN A HE22 6  
ATOM 4538  N N    . GLN A 1 18 ? -2.086  6.587   1.909   1.00 0.00 ? 123 GLN A N    6  
ATOM 4539  C CA   . GLN A 1 18 ? -2.166  6.818   3.330   1.00 0.00 ? 123 GLN A CA   6  
ATOM 4540  C C    . GLN A 1 18 ? -1.785  5.530   4.028   1.00 0.00 ? 123 GLN A C    6  
ATOM 4541  O O    . GLN A 1 18 ? -0.869  5.510   4.847   1.00 0.00 ? 123 GLN A O    6  
ATOM 4542  C CB   . GLN A 1 18 ? -3.558  7.259   3.745   1.00 0.00 ? 123 GLN A CB   6  
ATOM 4543  C CG   . GLN A 1 18 ? -3.755  8.762   3.689   1.00 0.00 ? 123 GLN A CG   6  
ATOM 4544  C CD   . GLN A 1 18 ? -2.817  9.513   4.613   1.00 0.00 ? 123 GLN A CD   6  
ATOM 4545  O OE1  . GLN A 1 18 ? -3.125  9.732   5.785   1.00 0.00 ? 123 GLN A OE1  6  
ATOM 4546  N NE2  . GLN A 1 18 ? -1.667  9.917   4.088   1.00 0.00 ? 123 GLN A NE2  6  
ATOM 4547  H H    . GLN A 1 18 ? -2.891  6.302   1.424   1.00 0.00 ? 123 GLN A H    6  
ATOM 4548  H HA   . GLN A 1 18 ? -1.452  7.585   3.590   1.00 0.00 ? 123 GLN A HA   6  
ATOM 4549  H HB2  . GLN A 1 18 ? -4.278  6.799   3.092   1.00 0.00 ? 123 GLN A HB2  6  
ATOM 4550  H HB3  . GLN A 1 18 ? -3.733  6.928   4.755   1.00 0.00 ? 123 GLN A HB3  6  
ATOM 4551  H HG2  . GLN A 1 18 ? -3.584  9.099   2.677   1.00 0.00 ? 123 GLN A HG2  6  
ATOM 4552  H HG3  . GLN A 1 18 ? -4.768  8.985   3.972   1.00 0.00 ? 123 GLN A HG3  6  
ATOM 4553  H HE21 . GLN A 1 18 ? -1.489  9.709   3.147   1.00 0.00 ? 123 GLN A HE21 6  
ATOM 4554  H HE22 . GLN A 1 18 ? -1.042  10.407  4.663   1.00 0.00 ? 123 GLN A HE22 6  
ATOM 4555  N N    . ASP A 1 19 ? -2.472  4.443   3.671   1.00 0.00 ? 124 ASP A N    6  
ATOM 4556  C CA   . ASP A 1 19 ? -2.169  3.143   4.250   1.00 0.00 ? 124 ASP A CA   6  
ATOM 4557  C C    . ASP A 1 19 ? -0.697  2.843   4.020   1.00 0.00 ? 124 ASP A C    6  
ATOM 4558  O O    . ASP A 1 19 ? 0.056   2.579   4.957   1.00 0.00 ? 124 ASP A O    6  
ATOM 4559  C CB   . ASP A 1 19 ? -3.033  2.042   3.622   1.00 0.00 ? 124 ASP A CB   6  
ATOM 4560  C CG   . ASP A 1 19 ? -3.973  1.405   4.627   1.00 0.00 ? 124 ASP A CG   6  
ATOM 4561  O OD1  . ASP A 1 19 ? -3.534  0.487   5.351   1.00 0.00 ? 124 ASP A OD1  6  
ATOM 4562  O OD2  . ASP A 1 19 ? -5.147  1.826   4.690   1.00 0.00 ? 124 ASP A OD2  6  
ATOM 4563  H H    . ASP A 1 19 ? -3.190  4.519   2.999   1.00 0.00 ? 124 ASP A H    6  
ATOM 4564  H HA   . ASP A 1 19 ? -2.360  3.192   5.311   1.00 0.00 ? 124 ASP A HA   6  
ATOM 4565  H HB2  . ASP A 1 19 ? -3.623  2.461   2.822   1.00 0.00 ? 124 ASP A HB2  6  
ATOM 4566  H HB3  . ASP A 1 19 ? -2.389  1.270   3.219   1.00 0.00 ? 124 ASP A HB3  6  
ATOM 4567  N N    . LEU A 1 20 ? -0.294  2.921   2.758   1.00 0.00 ? 125 LEU A N    6  
ATOM 4568  C CA   . LEU A 1 20 ? 1.082   2.672   2.378   1.00 0.00 ? 125 LEU A CA   6  
ATOM 4569  C C    . LEU A 1 20 ? 2.026   3.616   3.129   1.00 0.00 ? 125 LEU A C    6  
ATOM 4570  O O    . LEU A 1 20 ? 3.153   3.239   3.463   1.00 0.00 ? 125 LEU A O    6  
ATOM 4571  C CB   . LEU A 1 20 ? 1.237   2.792   0.855   1.00 0.00 ? 125 LEU A CB   6  
ATOM 4572  C CG   . LEU A 1 20 ? 0.464   1.747   0.056   1.00 0.00 ? 125 LEU A CG   6  
ATOM 4573  C CD1  . LEU A 1 20 ? -0.523  2.409   -0.885  1.00 0.00 ? 125 LEU A CD1  6  
ATOM 4574  C CD2  . LEU A 1 20 ? 1.417   0.891   -0.735  1.00 0.00 ? 125 LEU A CD2  6  
ATOM 4575  H H    . LEU A 1 20 ? -0.946  3.154   2.063   1.00 0.00 ? 125 LEU A H    6  
ATOM 4576  H HA   . LEU A 1 20 ? 1.316   1.659   2.669   1.00 0.00 ? 125 LEU A HA   6  
ATOM 4577  H HB2  . LEU A 1 20 ? 0.904   3.761   0.538   1.00 0.00 ? 125 LEU A HB2  6  
ATOM 4578  H HB3  . LEU A 1 20 ? 2.274   2.703   0.607   1.00 0.00 ? 125 LEU A HB3  6  
ATOM 4579  H HG   . LEU A 1 20 ? -0.085  1.109   0.732   1.00 0.00 ? 125 LEU A HG   6  
ATOM 4580  H HD11 . LEU A 1 20 ? -1.511  2.376   -0.451  1.00 0.00 ? 125 LEU A HD11 6  
ATOM 4581  H HD12 . LEU A 1 20 ? -0.523  1.883   -1.827  1.00 0.00 ? 125 LEU A HD12 6  
ATOM 4582  H HD13 . LEU A 1 20 ? -0.234  3.438   -1.046  1.00 0.00 ? 125 LEU A HD13 6  
ATOM 4583  H HD21 . LEU A 1 20 ? 2.222   0.560   -0.096  1.00 0.00 ? 125 LEU A HD21 6  
ATOM 4584  H HD22 . LEU A 1 20 ? 1.818   1.484   -1.548  1.00 0.00 ? 125 LEU A HD22 6  
ATOM 4585  H HD23 . LEU A 1 20 ? 0.895   0.036   -1.132  1.00 0.00 ? 125 LEU A HD23 6  
ATOM 4586  N N    . LEU A 1 21 ? 1.560   4.838   3.414   1.00 0.00 ? 126 LEU A N    6  
ATOM 4587  C CA   . LEU A 1 21 ? 2.366   5.798   4.157   1.00 0.00 ? 126 LEU A CA   6  
ATOM 4588  C C    . LEU A 1 21 ? 2.629   5.282   5.565   1.00 0.00 ? 126 LEU A C    6  
ATOM 4589  O O    . LEU A 1 21 ? 3.642   5.617   6.182   1.00 0.00 ? 126 LEU A O    6  
ATOM 4590  C CB   . LEU A 1 21 ? 1.660   7.155   4.228   1.00 0.00 ? 126 LEU A CB   6  
ATOM 4591  C CG   . LEU A 1 21 ? 2.180   8.214   3.258   1.00 0.00 ? 126 LEU A CG   6  
ATOM 4592  C CD1  . LEU A 1 21 ? 1.401   9.509   3.413   1.00 0.00 ? 126 LEU A CD1  6  
ATOM 4593  C CD2  . LEU A 1 21 ? 3.669   8.457   3.464   1.00 0.00 ? 126 LEU A CD2  6  
ATOM 4594  H H    . LEU A 1 21 ? 0.664   5.104   3.109   1.00 0.00 ? 126 LEU A H    6  
ATOM 4595  H HA   . LEU A 1 21 ? 3.309   5.914   3.643   1.00 0.00 ? 126 LEU A HA   6  
ATOM 4596  H HB2  . LEU A 1 21 ? 0.611   6.997   4.022   1.00 0.00 ? 126 LEU A HB2  6  
ATOM 4597  H HB3  . LEU A 1 21 ? 1.754   7.539   5.231   1.00 0.00 ? 126 LEU A HB3  6  
ATOM 4598  H HG   . LEU A 1 21 ? 2.034   7.857   2.248   1.00 0.00 ? 126 LEU A HG   6  
ATOM 4599  H HD11 . LEU A 1 21 ? 1.803   10.255  2.743   1.00 0.00 ? 126 LEU A HD11 6  
ATOM 4600  H HD12 . LEU A 1 21 ? 1.482   9.858   4.431   1.00 0.00 ? 126 LEU A HD12 6  
ATOM 4601  H HD13 . LEU A 1 21 ? 0.362   9.334   3.176   1.00 0.00 ? 126 LEU A HD13 6  
ATOM 4602  H HD21 . LEU A 1 21 ? 4.007   9.224   2.782   1.00 0.00 ? 126 LEU A HD21 6  
ATOM 4603  H HD22 . LEU A 1 21 ? 4.214   7.543   3.277   1.00 0.00 ? 126 LEU A HD22 6  
ATOM 4604  H HD23 . LEU A 1 21 ? 3.844   8.778   4.481   1.00 0.00 ? 126 LEU A HD23 6  
ATOM 4605  N N    . THR A 1 22 ? 1.708   4.466   6.069   1.00 0.00 ? 127 THR A N    6  
ATOM 4606  C CA   . THR A 1 22 ? 1.841   3.902   7.403   1.00 0.00 ? 127 THR A CA   6  
ATOM 4607  C C    . THR A 1 22 ? 2.477   2.516   7.356   1.00 0.00 ? 127 THR A C    6  
ATOM 4608  O O    . THR A 1 22 ? 2.791   1.941   8.399   1.00 0.00 ? 127 THR A O    6  
ATOM 4609  C CB   . THR A 1 22 ? 0.484   3.791   8.132   1.00 0.00 ? 127 THR A CB   6  
ATOM 4610  O OG1  . THR A 1 22 ? -0.025  2.456   8.015   1.00 0.00 ? 127 THR A OG1  6  
ATOM 4611  C CG2  . THR A 1 22 ? -0.539  4.766   7.569   1.00 0.00 ? 127 THR A CG2  6  
ATOM 4612  H H    . THR A 1 22 ? 0.921   4.245   5.529   1.00 0.00 ? 127 THR A H    6  
ATOM 4613  H HA   . THR A 1 22 ? 2.479   4.557   7.978   1.00 0.00 ? 127 THR A HA   6  
ATOM 4614  H HB   . THR A 1 22 ? 0.636   4.018   9.177   1.00 0.00 ? 127 THR A HB   6  
ATOM 4615  H HG1  . THR A 1 22 ? -0.587  2.262   8.768   1.00 0.00 ? 127 THR A HG1  6  
ATOM 4616  H HG21 . THR A 1 22 ? -0.065  5.710   7.355   1.00 0.00 ? 127 THR A HG21 6  
ATOM 4617  H HG22 . THR A 1 22 ? -1.326  4.916   8.294   1.00 0.00 ? 127 THR A HG22 6  
ATOM 4618  H HG23 . THR A 1 22 ? -0.960  4.360   6.661   1.00 0.00 ? 127 THR A HG23 6  
ATOM 4619  N N    . LEU A 1 23 ? 2.669   1.973   6.152   1.00 0.00 ? 128 LEU A N    6  
ATOM 4620  C CA   . LEU A 1 23 ? 3.256   0.655   6.014   1.00 0.00 ? 128 LEU A CA   6  
ATOM 4621  C C    . LEU A 1 23 ? 4.765   0.759   5.829   1.00 0.00 ? 128 LEU A C    6  
ATOM 4622  O O    . LEU A 1 23 ? 5.491   -0.217  6.017   1.00 0.00 ? 128 LEU A O    6  
ATOM 4623  C CB   . LEU A 1 23 ? 2.598   -0.086  4.854   1.00 0.00 ? 128 LEU A CB   6  
ATOM 4624  C CG   . LEU A 1 23 ? 1.083   -0.229  4.978   1.00 0.00 ? 128 LEU A CG   6  
ATOM 4625  C CD1  . LEU A 1 23 ? 0.466   -0.652  3.657   1.00 0.00 ? 128 LEU A CD1  6  
ATOM 4626  C CD2  . LEU A 1 23 ? 0.750   -1.227  6.061   1.00 0.00 ? 128 LEU A CD2  6  
ATOM 4627  H H    . LEU A 1 23 ? 2.423   2.471   5.338   1.00 0.00 ? 128 LEU A H    6  
ATOM 4628  H HA   . LEU A 1 23 ? 3.057   0.112   6.927   1.00 0.00 ? 128 LEU A HA   6  
ATOM 4629  H HB2  . LEU A 1 23 ? 2.817   0.434   3.941   1.00 0.00 ? 128 LEU A HB2  6  
ATOM 4630  H HB3  . LEU A 1 23 ? 3.024   -1.071  4.797   1.00 0.00 ? 128 LEU A HB3  6  
ATOM 4631  H HG   . LEU A 1 23 ? 0.659   0.720   5.258   1.00 0.00 ? 128 LEU A HG   6  
ATOM 4632  H HD11 . LEU A 1 23 ? 0.697   -1.689  3.473   1.00 0.00 ? 128 LEU A HD11 6  
ATOM 4633  H HD12 . LEU A 1 23 ? 0.869   -0.044  2.860   1.00 0.00 ? 128 LEU A HD12 6  
ATOM 4634  H HD13 . LEU A 1 23 ? -0.605  -0.523  3.703   1.00 0.00 ? 128 LEU A HD13 6  
ATOM 4635  H HD21 . LEU A 1 23 ? 0.898   -0.775  7.030   1.00 0.00 ? 128 LEU A HD21 6  
ATOM 4636  H HD22 . LEU A 1 23 ? 1.402   -2.075  5.956   1.00 0.00 ? 128 LEU A HD22 6  
ATOM 4637  H HD23 . LEU A 1 23 ? -0.278  -1.544  5.961   1.00 0.00 ? 128 LEU A HD23 6  
ATOM 4638  N N    . CYS A 1 24 ? 5.231   1.950   5.456   1.00 0.00 ? 129 CYS A N    6  
ATOM 4639  C CA   . CYS A 1 24 ? 6.660   2.184   5.277   1.00 0.00 ? 129 CYS A CA   6  
ATOM 4640  C C    . CYS A 1 24 ? 7.361   2.258   6.632   1.00 0.00 ? 129 CYS A C    6  
ATOM 4641  O O    . CYS A 1 24 ? 6.714   2.469   7.658   1.00 0.00 ? 129 CYS A O    6  
ATOM 4642  C CB   . CYS A 1 24 ? 6.905   3.477   4.496   1.00 0.00 ? 129 CYS A CB   6  
ATOM 4643  S SG   . CYS A 1 24 ? 6.519   5.006   5.415   1.00 0.00 ? 129 CYS A SG   6  
ATOM 4644  H H    . CYS A 1 24 ? 4.597   2.681   5.282   1.00 0.00 ? 129 CYS A H    6  
ATOM 4645  H HA   . CYS A 1 24 ? 7.065   1.353   4.719   1.00 0.00 ? 129 CYS A HA   6  
ATOM 4646  H HB2  . CYS A 1 24 ? 7.946   3.524   4.213   1.00 0.00 ? 129 CYS A HB2  6  
ATOM 4647  H HB3  . CYS A 1 24 ? 6.300   3.466   3.603   1.00 0.00 ? 129 CYS A HB3  6  
ATOM 4648  N N    . PRO A 1 25 ? 8.697   2.088   6.655   1.00 0.00 ? 130 PRO A N    6  
ATOM 4649  C CA   . PRO A 1 25 ? 9.484   2.130   7.890   1.00 0.00 ? 130 PRO A CA   6  
ATOM 4650  C C    . PRO A 1 25 ? 9.683   3.552   8.407   1.00 0.00 ? 130 PRO A C    6  
ATOM 4651  O O    . PRO A 1 25 ? 10.574  3.807   9.218   1.00 0.00 ? 130 PRO A O    6  
ATOM 4652  C CB   . PRO A 1 25 ? 10.838  1.517   7.483   1.00 0.00 ? 130 PRO A CB   6  
ATOM 4653  C CG   . PRO A 1 25 ? 10.650  1.004   6.091   1.00 0.00 ? 130 PRO A CG   6  
ATOM 4654  C CD   . PRO A 1 25 ? 9.551   1.829   5.493   1.00 0.00 ? 130 PRO A CD   6  
ATOM 4655  H HA   . PRO A 1 25 ? 9.034   1.528   8.664   1.00 0.00 ? 130 PRO A HA   6  
ATOM 4656  H HB2  . PRO A 1 25 ? 11.602  2.279   7.521   1.00 0.00 ? 130 PRO A HB2  6  
ATOM 4657  H HB3  . PRO A 1 25 ? 11.089  0.720   8.164   1.00 0.00 ? 130 PRO A HB3  6  
ATOM 4658  H HG2  . PRO A 1 25 ? 11.562  1.128   5.526   1.00 0.00 ? 130 PRO A HG2  6  
ATOM 4659  H HG3  . PRO A 1 25 ? 10.364  -0.038  6.118   1.00 0.00 ? 130 PRO A HG3  6  
ATOM 4660  H HD2  . PRO A 1 25 ? 9.945   2.750   5.086   1.00 0.00 ? 130 PRO A HD2  6  
ATOM 4661  H HD3  . PRO A 1 25 ? 9.017   1.275   4.734   1.00 0.00 ? 130 PRO A HD3  6  
ATOM 4662  N N    . TYR A 1 26 ? 8.848   4.474   7.934   1.00 0.00 ? 131 TYR A N    6  
ATOM 4663  C CA   . TYR A 1 26 ? 8.931   5.869   8.351   1.00 0.00 ? 131 TYR A CA   6  
ATOM 4664  C C    . TYR A 1 26 ? 7.595   6.350   8.911   1.00 0.00 ? 131 TYR A C    6  
ATOM 4665  O O    . TYR A 1 26 ? 7.389   6.221   10.135  1.00 0.00 ? 131 TYR A O    6  
ATOM 4666  C CB   . TYR A 1 26 ? 9.350   6.752   7.171   1.00 0.00 ? 131 TYR A CB   6  
ATOM 4667  C CG   . TYR A 1 26 ? 10.758  6.489   6.686   1.00 0.00 ? 131 TYR A CG   6  
ATOM 4668  C CD1  . TYR A 1 26 ? 11.048  5.379   5.901   1.00 0.00 ? 131 TYR A CD1  6  
ATOM 4669  C CD2  . TYR A 1 26 ? 11.799  7.350   7.014   1.00 0.00 ? 131 TYR A CD2  6  
ATOM 4670  C CE1  . TYR A 1 26 ? 12.334  5.135   5.456   1.00 0.00 ? 131 TYR A CE1  6  
ATOM 4671  C CE2  . TYR A 1 26 ? 13.086  7.113   6.571   1.00 0.00 ? 131 TYR A CE2  6  
ATOM 4672  C CZ   . TYR A 1 26 ? 13.348  6.007   5.794   1.00 0.00 ? 131 TYR A CZ   6  
ATOM 4673  O OH   . TYR A 1 26 ? 14.629  5.766   5.353   1.00 0.00 ? 131 TYR A OH   6  
ATOM 4674  O OXT  . TYR A 1 26 ? 6.767   6.849   8.120   1.00 0.00 ? 131 TYR A OXT  6  
ATOM 4675  H H    . TYR A 1 26 ? 8.160   4.209   7.289   1.00 0.00 ? 131 TYR A H    6  
ATOM 4676  H HA   . TYR A 1 26 ? 9.678   5.941   9.125   1.00 0.00 ? 131 TYR A HA   6  
ATOM 4677  H HB2  . TYR A 1 26 ? 8.677   6.580   6.345   1.00 0.00 ? 131 TYR A HB2  6  
ATOM 4678  H HB3  . TYR A 1 26 ? 9.289   7.789   7.468   1.00 0.00 ? 131 TYR A HB3  6  
ATOM 4679  H HD1  . TYR A 1 26 ? 10.250  4.700   5.639   1.00 0.00 ? 131 TYR A HD1  6  
ATOM 4680  H HD2  . TYR A 1 26 ? 11.589  8.217   7.623   1.00 0.00 ? 131 TYR A HD2  6  
ATOM 4681  H HE1  . TYR A 1 26 ? 12.538  4.268   4.848   1.00 0.00 ? 131 TYR A HE1  6  
ATOM 4682  H HE2  . TYR A 1 26 ? 13.881  7.795   6.836   1.00 0.00 ? 131 TYR A HE2  6  
ATOM 4683  H HH   . TYR A 1 26 ? 15.246  5.889   6.078   1.00 0.00 ? 131 TYR A HH   6  
ATOM 4684  N N    . PRO B 2 1  ? -0.834  15.973  -7.300  1.00 0.00 ? 25  PRO B N    6  
ATOM 4685  C CA   . PRO B 2 1  ? 0.051   14.873  -6.842  1.00 0.00 ? 25  PRO B CA   6  
ATOM 4686  C C    . PRO B 2 1  ? -0.747  13.605  -6.554  1.00 0.00 ? 25  PRO B C    6  
ATOM 4687  O O    . PRO B 2 1  ? -0.370  12.812  -5.692  1.00 0.00 ? 25  PRO B O    6  
ATOM 4688  C CB   . PRO B 2 1  ? 0.788   15.327  -5.589  1.00 0.00 ? 25  PRO B CB   6  
ATOM 4689  C CG   . PRO B 2 1  ? 0.375   16.750  -5.431  1.00 0.00 ? 25  PRO B CG   6  
ATOM 4690  C CD   . PRO B 2 1  ? -0.944  16.894  -6.156  1.00 0.00 ? 25  PRO B CD   6  
ATOM 4691  H H2   . PRO B 2 1  ? -1.702  15.516  -7.624  1.00 0.00 ? 25  PRO B H2   6  
ATOM 4692  H H3   . PRO B 2 1  ? -0.395  16.314  -8.189  1.00 0.00 ? 25  PRO B H3   6  
ATOM 4693  H HA   . PRO B 2 1  ? 0.771   14.665  -7.621  1.00 0.00 ? 25  PRO B HA   6  
ATOM 4694  H HB2  . PRO B 2 1  ? 0.481   14.724  -4.746  1.00 0.00 ? 25  PRO B HB2  6  
ATOM 4695  H HB3  . PRO B 2 1  ? 1.853   15.239  -5.739  1.00 0.00 ? 25  PRO B HB3  6  
ATOM 4696  H HG2  . PRO B 2 1  ? 0.253   16.981  -4.382  1.00 0.00 ? 25  PRO B HG2  6  
ATOM 4697  H HG3  . PRO B 2 1  ? 1.117   17.398  -5.872  1.00 0.00 ? 25  PRO B HG3  6  
ATOM 4698  H HD2  . PRO B 2 1  ? -1.760  16.603  -5.510  1.00 0.00 ? 25  PRO B HD2  6  
ATOM 4699  H HD3  . PRO B 2 1  ? -1.076  17.910  -6.496  1.00 0.00 ? 25  PRO B HD3  6  
ATOM 4700  N N    . THR B 2 2  ? -1.850  13.431  -7.283  1.00 0.00 ? 26  THR B N    6  
ATOM 4701  C CA   . THR B 2 2  ? -2.725  12.267  -7.131  1.00 0.00 ? 26  THR B CA   6  
ATOM 4702  C C    . THR B 2 2  ? -3.347  12.210  -5.734  1.00 0.00 ? 26  THR B C    6  
ATOM 4703  O O    . THR B 2 2  ? -2.693  12.523  -4.739  1.00 0.00 ? 26  THR B O    6  
ATOM 4704  C CB   . THR B 2 2  ? -1.980  10.942  -7.407  1.00 0.00 ? 26  THR B CB   6  
ATOM 4705  O OG1  . THR B 2 2  ? -1.172  10.577  -6.282  1.00 0.00 ? 26  THR B OG1  6  
ATOM 4706  C CG2  . THR B 2 2  ? -1.105  11.060  -8.647  1.00 0.00 ? 26  THR B CG2  6  
ATOM 4707  H H    . THR B 2 2  ? -2.084  14.111  -7.949  1.00 0.00 ? 26  THR B H    6  
ATOM 4708  H HA   . THR B 2 2  ? -3.516  12.362  -7.858  1.00 0.00 ? 26  THR B HA   6  
ATOM 4709  H HB   . THR B 2 2  ? -2.713  10.167  -7.577  1.00 0.00 ? 26  THR B HB   6  
ATOM 4710  H HG1  . THR B 2 2  ? -0.405  10.088  -6.585  1.00 0.00 ? 26  THR B HG1  6  
ATOM 4711  H HG21 . THR B 2 2  ? -1.720  11.303  -9.501  1.00 0.00 ? 26  THR B HG21 6  
ATOM 4712  H HG22 . THR B 2 2  ? -0.602  10.119  -8.823  1.00 0.00 ? 26  THR B HG22 6  
ATOM 4713  H HG23 . THR B 2 2  ? -0.371  11.837  -8.497  1.00 0.00 ? 26  THR B HG23 6  
ATOM 4714  N N    . PRO B 2 3  ? -4.630  11.805  -5.641  1.00 0.00 ? 27  PRO B N    6  
ATOM 4715  C CA   . PRO B 2 3  ? -5.341  11.706  -4.376  1.00 0.00 ? 27  PRO B CA   6  
ATOM 4716  C C    . PRO B 2 3  ? -5.257  10.306  -3.788  1.00 0.00 ? 27  PRO B C    6  
ATOM 4717  O O    . PRO B 2 3  ? -4.347  9.544   -4.109  1.00 0.00 ? 27  PRO B O    6  
ATOM 4718  C CB   . PRO B 2 3  ? -6.772  12.029  -4.794  1.00 0.00 ? 27  PRO B CB   6  
ATOM 4719  C CG   . PRO B 2 3  ? -6.896  11.487  -6.184  1.00 0.00 ? 27  PRO B CG   6  
ATOM 4720  C CD   . PRO B 2 3  ? -5.499  11.403  -6.760  1.00 0.00 ? 27  PRO B CD   6  
ATOM 4721  H HA   . PRO B 2 3  ? -4.994  12.431  -3.656  1.00 0.00 ? 27  PRO B HA   6  
ATOM 4722  H HB2  . PRO B 2 3  ? -7.465  11.550  -4.118  1.00 0.00 ? 27  PRO B HB2  6  
ATOM 4723  H HB3  . PRO B 2 3  ? -6.924  13.097  -4.775  1.00 0.00 ? 27  PRO B HB3  6  
ATOM 4724  H HG2  . PRO B 2 3  ? -7.343  10.503  -6.151  1.00 0.00 ? 27  PRO B HG2  6  
ATOM 4725  H HG3  . PRO B 2 3  ? -7.505  12.151  -6.780  1.00 0.00 ? 27  PRO B HG3  6  
ATOM 4726  H HD2  . PRO B 2 3  ? -5.280  10.391  -7.071  1.00 0.00 ? 27  PRO B HD2  6  
ATOM 4727  H HD3  . PRO B 2 3  ? -5.395  12.084  -7.593  1.00 0.00 ? 27  PRO B HD3  6  
ATOM 4728  N N    . GLU B 2 4  ? -6.205  9.973   -2.919  1.00 0.00 ? 28  GLU B N    6  
ATOM 4729  C CA   . GLU B 2 4  ? -6.237  8.656   -2.302  1.00 0.00 ? 28  GLU B CA   6  
ATOM 4730  C C    . GLU B 2 4  ? -6.875  7.647   -3.232  1.00 0.00 ? 28  GLU B C    6  
ATOM 4731  O O    . GLU B 2 4  ? -7.933  7.083   -2.950  1.00 0.00 ? 28  GLU B O    6  
ATOM 4732  C CB   . GLU B 2 4  ? -6.981  8.687   -0.984  1.00 0.00 ? 28  GLU B CB   6  
ATOM 4733  C CG   . GLU B 2 4  ? -8.284  9.467   -1.030  1.00 0.00 ? 28  GLU B CG   6  
ATOM 4734  C CD   . GLU B 2 4  ? -8.234  10.740  -0.208  1.00 0.00 ? 28  GLU B CD   6  
ATOM 4735  O OE1  . GLU B 2 4  ? -8.532  10.677  1.003   1.00 0.00 ? 28  GLU B OE1  6  
ATOM 4736  O OE2  . GLU B 2 4  ? -7.899  11.800  -0.776  1.00 0.00 ? 28  GLU B OE2  6  
ATOM 4737  H H    . GLU B 2 4  ? -6.893  10.631  -2.688  1.00 0.00 ? 28  GLU B H    6  
ATOM 4738  H HA   . GLU B 2 4  ? -5.215  8.356   -2.120  1.00 0.00 ? 28  GLU B HA   6  
ATOM 4739  H HB2  . GLU B 2 4  ? -7.202  7.674   -0.686  1.00 0.00 ? 28  GLU B HB2  6  
ATOM 4740  H HB3  . GLU B 2 4  ? -6.337  9.132   -0.257  1.00 0.00 ? 28  GLU B HB3  6  
ATOM 4741  H HG2  . GLU B 2 4  ? -8.498  9.726   -2.056  1.00 0.00 ? 28  GLU B HG2  6  
ATOM 4742  H HG3  . GLU B 2 4  ? -9.073  8.838   -0.650  1.00 0.00 ? 28  GLU B HG3  6  
ATOM 4743  N N    . MET B 2 5  ? -6.208  7.438   -4.340  1.00 0.00 ? 29  MET B N    6  
ATOM 4744  C CA   . MET B 2 5  ? -6.664  6.498   -5.351  1.00 0.00 ? 29  MET B CA   6  
ATOM 4745  C C    . MET B 2 5  ? -6.315  5.081   -4.935  1.00 0.00 ? 29  MET B C    6  
ATOM 4746  O O    . MET B 2 5  ? -5.156  4.668   -4.985  1.00 0.00 ? 29  MET B O    6  
ATOM 4747  C CB   . MET B 2 5  ? -6.036  6.814   -6.702  1.00 0.00 ? 29  MET B CB   6  
ATOM 4748  C CG   . MET B 2 5  ? -7.048  7.181   -7.775  1.00 0.00 ? 29  MET B CG   6  
ATOM 4749  S SD   . MET B 2 5  ? -6.271  7.666   -9.329  1.00 0.00 ? 29  MET B SD   6  
ATOM 4750  C CE   . MET B 2 5  ? -5.315  6.200   -9.710  1.00 0.00 ? 29  MET B CE   6  
ATOM 4751  H H    . MET B 2 5  ? -5.378  7.928   -4.475  1.00 0.00 ? 29  MET B H    6  
ATOM 4752  H HA   . MET B 2 5  ? -7.738  6.581   -5.426  1.00 0.00 ? 29  MET B HA   6  
ATOM 4753  H HB2  . MET B 2 5  ? -5.349  7.641   -6.587  1.00 0.00 ? 29  MET B HB2  6  
ATOM 4754  H HB3  . MET B 2 5  ? -5.492  5.946   -7.033  1.00 0.00 ? 29  MET B HB3  6  
ATOM 4755  H HG2  . MET B 2 5  ? -7.682  6.325   -7.958  1.00 0.00 ? 29  MET B HG2  6  
ATOM 4756  H HG3  . MET B 2 5  ? -7.649  8.002   -7.418  1.00 0.00 ? 29  MET B HG3  6  
ATOM 4757  H HE1  . MET B 2 5  ? -4.799  6.341   -10.649 1.00 0.00 ? 29  MET B HE1  6  
ATOM 4758  H HE2  . MET B 2 5  ? -5.975  5.349   -9.787  1.00 0.00 ? 29  MET B HE2  6  
ATOM 4759  H HE3  . MET B 2 5  ? -4.593  6.027   -8.925  1.00 0.00 ? 29  MET B HE3  6  
ATOM 4760  N N    . ARG B 2 6  ? -7.332  4.350   -4.524  1.00 0.00 ? 30  ARG B N    6  
ATOM 4761  C CA   . ARG B 2 6  ? -7.161  2.981   -4.072  1.00 0.00 ? 30  ARG B CA   6  
ATOM 4762  C C    . ARG B 2 6  ? -7.008  2.015   -5.240  1.00 0.00 ? 30  ARG B C    6  
ATOM 4763  O O    . ARG B 2 6  ? -7.881  1.921   -6.103  1.00 0.00 ? 30  ARG B O    6  
ATOM 4764  C CB   . ARG B 2 6  ? -8.341  2.567   -3.207  1.00 0.00 ? 30  ARG B CB   6  
ATOM 4765  C CG   . ARG B 2 6  ? -8.060  2.716   -1.731  1.00 0.00 ? 30  ARG B CG   6  
ATOM 4766  C CD   . ARG B 2 6  ? -8.577  1.537   -0.945  1.00 0.00 ? 30  ARG B CD   6  
ATOM 4767  N NE   . ARG B 2 6  ? -8.266  1.653   0.472   1.00 0.00 ? 30  ARG B NE   6  
ATOM 4768  C CZ   . ARG B 2 6  ? -8.376  0.652   1.340   1.00 0.00 ? 30  ARG B CZ   6  
ATOM 4769  N NH1  . ARG B 2 6  ? -8.783  -0.544  0.932   1.00 0.00 ? 30  ARG B NH1  6  
ATOM 4770  N NH2  . ARG B 2 6  ? -8.076  0.844   2.617   1.00 0.00 ? 30  ARG B NH2  6  
ATOM 4771  H H    . ARG B 2 6  ? -8.226  4.740   -4.537  1.00 0.00 ? 30  ARG B H    6  
ATOM 4772  H HA   . ARG B 2 6  ? -6.265  2.946   -3.465  1.00 0.00 ? 30  ARG B HA   6  
ATOM 4773  H HB2  . ARG B 2 6  ? -9.192  3.184   -3.453  1.00 0.00 ? 30  ARG B HB2  6  
ATOM 4774  H HB3  . ARG B 2 6  ? -8.581  1.537   -3.409  1.00 0.00 ? 30  ARG B HB3  6  
ATOM 4775  H HG2  . ARG B 2 6  ? -6.993  2.788   -1.585  1.00 0.00 ? 30  ARG B HG2  6  
ATOM 4776  H HG3  . ARG B 2 6  ? -8.536  3.617   -1.371  1.00 0.00 ? 30  ARG B HG3  6  
ATOM 4777  H HD2  . ARG B 2 6  ? -9.644  1.486   -1.066  1.00 0.00 ? 30  ARG B HD2  6  
ATOM 4778  H HD3  . ARG B 2 6  ? -8.122  0.642   -1.333  1.00 0.00 ? 30  ARG B HD3  6  
ATOM 4779  H HE   . ARG B 2 6  ? -7.961  2.524   0.792   1.00 0.00 ? 30  ARG B HE   6  
ATOM 4780  H HH11 . ARG B 2 6  ? -9.008  -0.694  -0.029  1.00 0.00 ? 30  ARG B HH11 6  
ATOM 4781  H HH12 . ARG B 2 6  ? -8.862  -1.295  1.588   1.00 0.00 ? 30  ARG B HH12 6  
ATOM 4782  H HH21 . ARG B 2 6  ? -7.767  1.742   2.930   1.00 0.00 ? 30  ARG B HH21 6  
ATOM 4783  H HH22 . ARG B 2 6  ? -8.158  0.090   3.269   1.00 0.00 ? 30  ARG B HH22 6  
ATOM 4784  N N    . GLU B 2 7  ? -5.892  1.297   -5.258  1.00 0.00 ? 31  GLU B N    6  
ATOM 4785  C CA   . GLU B 2 7  ? -5.621  0.319   -6.302  1.00 0.00 ? 31  GLU B CA   6  
ATOM 4786  C C    . GLU B 2 7  ? -5.015  -0.934  -5.701  1.00 0.00 ? 31  GLU B C    6  
ATOM 4787  O O    . GLU B 2 7  ? -4.249  -0.874  -4.744  1.00 0.00 ? 31  GLU B O    6  
ATOM 4788  C CB   . GLU B 2 7  ? -4.708  0.912   -7.375  1.00 0.00 ? 31  GLU B CB   6  
ATOM 4789  C CG   . GLU B 2 7  ? -3.429  1.493   -6.815  1.00 0.00 ? 31  GLU B CG   6  
ATOM 4790  C CD   . GLU B 2 7  ? -2.472  1.957   -7.895  1.00 0.00 ? 31  GLU B CD   6  
ATOM 4791  O OE1  . GLU B 2 7  ? -1.719  1.112   -8.426  1.00 0.00 ? 31  GLU B OE1  6  
ATOM 4792  O OE2  . GLU B 2 7  ? -2.475  3.164   -8.211  1.00 0.00 ? 31  GLU B OE2  6  
ATOM 4793  H H    . GLU B 2 7  ? -5.230  1.430   -4.548  1.00 0.00 ? 31  GLU B H    6  
ATOM 4794  H HA   . GLU B 2 7  ? -6.558  0.044   -6.752  1.00 0.00 ? 31  GLU B HA   6  
ATOM 4795  H HB2  . GLU B 2 7  ? -4.450  0.135   -8.081  1.00 0.00 ? 31  GLU B HB2  6  
ATOM 4796  H HB3  . GLU B 2 7  ? -5.240  1.695   -7.893  1.00 0.00 ? 31  GLU B HB3  6  
ATOM 4797  H HG2  . GLU B 2 7  ? -3.675  2.335   -6.186  1.00 0.00 ? 31  GLU B HG2  6  
ATOM 4798  H HG3  . GLU B 2 7  ? -2.947  0.735   -6.226  1.00 0.00 ? 31  GLU B HG3  6  
ATOM 4799  N N    . LYS B 2 8  ? -5.374  -2.065  -6.282  1.00 0.00 ? 32  LYS B N    6  
ATOM 4800  C CA   . LYS B 2 8  ? -4.932  -3.360  -5.809  1.00 0.00 ? 32  LYS B CA   6  
ATOM 4801  C C    . LYS B 2 8  ? -3.422  -3.538  -5.892  1.00 0.00 ? 32  LYS B C    6  
ATOM 4802  O O    . LYS B 2 8  ? -2.839  -3.601  -6.974  1.00 0.00 ? 32  LYS B O    6  
ATOM 4803  C CB   . LYS B 2 8  ? -5.655  -4.436  -6.597  1.00 0.00 ? 32  LYS B CB   6  
ATOM 4804  C CG   . LYS B 2 8  ? -7.151  -4.193  -6.670  1.00 0.00 ? 32  LYS B CG   6  
ATOM 4805  C CD   . LYS B 2 8  ? -7.895  -5.422  -7.169  1.00 0.00 ? 32  LYS B CD   6  
ATOM 4806  C CE   . LYS B 2 8  ? -9.391  -5.196  -7.175  1.00 0.00 ? 32  LYS B CE   6  
ATOM 4807  N NZ   . LYS B 2 8  ? -10.137 -6.413  -7.598  1.00 0.00 ? 32  LYS B NZ   6  
ATOM 4808  H H    . LYS B 2 8  ? -5.959  -2.028  -7.065  1.00 0.00 ? 32  LYS B H    6  
ATOM 4809  H HA   . LYS B 2 8  ? -5.227  -3.442  -4.775  1.00 0.00 ? 32  LYS B HA   6  
ATOM 4810  H HB2  . LYS B 2 8  ? -5.263  -4.465  -7.601  1.00 0.00 ? 32  LYS B HB2  6  
ATOM 4811  H HB3  . LYS B 2 8  ? -5.489  -5.383  -6.125  1.00 0.00 ? 32  LYS B HB3  6  
ATOM 4812  H HG2  . LYS B 2 8  ? -7.509  -3.935  -5.686  1.00 0.00 ? 32  LYS B HG2  6  
ATOM 4813  H HG3  . LYS B 2 8  ? -7.338  -3.371  -7.342  1.00 0.00 ? 32  LYS B HG3  6  
ATOM 4814  H HD2  . LYS B 2 8  ? -7.572  -5.644  -8.170  1.00 0.00 ? 32  LYS B HD2  6  
ATOM 4815  H HD3  . LYS B 2 8  ? -7.668  -6.256  -6.521  1.00 0.00 ? 32  LYS B HD3  6  
ATOM 4816  H HE2  . LYS B 2 8  ? -9.698  -4.923  -6.183  1.00 0.00 ? 32  LYS B HE2  6  
ATOM 4817  H HE3  . LYS B 2 8  ? -9.617  -4.388  -7.856  1.00 0.00 ? 32  LYS B HE3  6  
ATOM 4818  H HZ1  . LYS B 2 8  ? -11.161 -6.220  -7.605  1.00 0.00 ? 32  LYS B HZ1  6  
ATOM 4819  H HZ2  . LYS B 2 8  ? -9.948  -7.195  -6.941  1.00 0.00 ? 32  LYS B HZ2  6  
ATOM 4820  H HZ3  . LYS B 2 8  ? -9.843  -6.698  -8.555  1.00 0.00 ? 32  LYS B HZ3  6  
ATOM 4821  N N    . LEU B 2 9  ? -2.806  -3.618  -4.717  1.00 0.00 ? 33  LEU B N    6  
ATOM 4822  C CA   . LEU B 2 9  ? -1.372  -3.798  -4.583  1.00 0.00 ? 33  LEU B CA   6  
ATOM 4823  C C    . LEU B 2 9  ? -1.030  -5.206  -4.138  1.00 0.00 ? 33  LEU B C    6  
ATOM 4824  O O    . LEU B 2 9  ? -1.122  -5.539  -2.956  1.00 0.00 ? 33  LEU B O    6  
ATOM 4825  C CB   . LEU B 2 9  ? -0.835  -2.800  -3.593  1.00 0.00 ? 33  LEU B CB   6  
ATOM 4826  C CG   . LEU B 2 9  ? -1.555  -1.469  -3.598  1.00 0.00 ? 33  LEU B CG   6  
ATOM 4827  C CD1  . LEU B 2 9  ? -1.095  -0.594  -2.444  1.00 0.00 ? 33  LEU B CD1  6  
ATOM 4828  C CD2  . LEU B 2 9  ? -1.319  -0.785  -4.932  1.00 0.00 ? 33  LEU B CD2  6  
ATOM 4829  H H    . LEU B 2 9  ? -3.339  -3.532  -3.905  1.00 0.00 ? 33  LEU B H    6  
ATOM 4830  H HA   . LEU B 2 9  ? -0.902  -3.608  -5.528  1.00 0.00 ? 33  LEU B HA   6  
ATOM 4831  H HB2  . LEU B 2 9  ? -0.875  -3.222  -2.605  1.00 0.00 ? 33  LEU B HB2  6  
ATOM 4832  H HB3  . LEU B 2 9  ? 0.181   -2.625  -3.855  1.00 0.00 ? 33  LEU B HB3  6  
ATOM 4833  H HG   . LEU B 2 9  ? -2.609  -1.645  -3.485  1.00 0.00 ? 33  LEU B HG   6  
ATOM 4834  H HD11 . LEU B 2 9  ? -1.921  0.011   -2.100  1.00 0.00 ? 33  LEU B HD11 6  
ATOM 4835  H HD12 . LEU B 2 9  ? -0.292  0.051   -2.774  1.00 0.00 ? 33  LEU B HD12 6  
ATOM 4836  H HD13 . LEU B 2 9  ? -0.746  -1.218  -1.634  1.00 0.00 ? 33  LEU B HD13 6  
ATOM 4837  H HD21 . LEU B 2 9  ? -2.215  -0.269  -5.233  1.00 0.00 ? 33  LEU B HD21 6  
ATOM 4838  H HD22 . LEU B 2 9  ? -1.062  -1.537  -5.674  1.00 0.00 ? 33  LEU B HD22 6  
ATOM 4839  H HD23 . LEU B 2 9  ? -0.507  -0.080  -4.838  1.00 0.00 ? 33  LEU B HD23 6  
ATOM 4840  N N    . CYS B 2 10 ? -0.643  -6.033  -5.096  1.00 0.00 ? 34  CYS B N    6  
ATOM 4841  C CA   . CYS B 2 10 ? -0.286  -7.412  -4.803  1.00 0.00 ? 34  CYS B CA   6  
ATOM 4842  C C    . CYS B 2 10 ? 1.219   -7.590  -4.727  1.00 0.00 ? 34  CYS B C    6  
ATOM 4843  O O    . CYS B 2 10 ? 1.897   -7.725  -5.747  1.00 0.00 ? 34  CYS B O    6  
ATOM 4844  C CB   . CYS B 2 10 ? -0.879  -8.347  -5.845  1.00 0.00 ? 34  CYS B CB   6  
ATOM 4845  S SG   . CYS B 2 10 ? -1.266  -10.008 -5.208  1.00 0.00 ? 34  CYS B SG   6  
ATOM 4846  H H    . CYS B 2 10 ? -0.599  -5.708  -6.018  1.00 0.00 ? 34  CYS B H    6  
ATOM 4847  H HA   . CYS B 2 10 ? -0.705  -7.656  -3.839  1.00 0.00 ? 34  CYS B HA   6  
ATOM 4848  H HB2  . CYS B 2 10 ? -1.792  -7.915  -6.208  1.00 0.00 ? 34  CYS B HB2  6  
ATOM 4849  H HB3  . CYS B 2 10 ? -0.181  -8.457  -6.662  1.00 0.00 ? 34  CYS B HB3  6  
ATOM 4850  N N    . GLY B 2 11 ? 1.720   -7.594  -3.504  1.00 0.00 ? 35  GLY B N    6  
ATOM 4851  C CA   . GLY B 2 11 ? 3.144   -7.753  -3.265  1.00 0.00 ? 35  GLY B CA   6  
ATOM 4852  C C    . GLY B 2 11 ? 3.986   -6.710  -3.976  1.00 0.00 ? 35  GLY B C    6  
ATOM 4853  O O    . GLY B 2 11 ? 4.373   -5.714  -3.369  1.00 0.00 ? 35  GLY B O    6  
ATOM 4854  H H    . GLY B 2 11 ? 1.107   -7.495  -2.749  1.00 0.00 ? 35  GLY B H    6  
ATOM 4855  H HA2  . GLY B 2 11 ? 3.325   -7.675  -2.203  1.00 0.00 ? 35  GLY B HA2  6  
ATOM 4856  H HA3  . GLY B 2 11 ? 3.448   -8.730  -3.594  1.00 0.00 ? 35  GLY B HA3  6  
ATOM 4857  N N    . HIS B 2 12 ? 4.289   -6.937  -5.254  1.00 0.00 ? 36  HIS B N    6  
ATOM 4858  C CA   . HIS B 2 12 ? 5.088   -5.996  -6.017  1.00 0.00 ? 36  HIS B CA   6  
ATOM 4859  C C    . HIS B 2 12 ? 4.383   -4.653  -6.158  1.00 0.00 ? 36  HIS B C    6  
ATOM 4860  O O    . HIS B 2 12 ? 4.963   -3.628  -5.834  1.00 0.00 ? 36  HIS B O    6  
ATOM 4861  C CB   . HIS B 2 12 ? 5.451   -6.550  -7.386  1.00 0.00 ? 36  HIS B CB   6  
ATOM 4862  C CG   . HIS B 2 12 ? 6.727   -5.969  -7.897  1.00 0.00 ? 36  HIS B CG   6  
ATOM 4863  N ND1  . HIS B 2 12 ? 7.080   -5.930  -9.224  1.00 0.00 ? 36  HIS B ND1  6  
ATOM 4864  C CD2  . HIS B 2 12 ? 7.747   -5.385  -7.213  1.00 0.00 ? 36  HIS B CD2  6  
ATOM 4865  C CE1  . HIS B 2 12 ? 8.276   -5.336  -9.310  1.00 0.00 ? 36  HIS B CE1  6  
ATOM 4866  N NE2  . HIS B 2 12 ? 8.726   -4.986  -8.118  1.00 0.00 ? 36  HIS B NE2  6  
ATOM 4867  H H    . HIS B 2 12 ? 3.994   -7.760  -5.682  1.00 0.00 ? 36  HIS B H    6  
ATOM 4868  H HA   . HIS B 2 12 ? 6.000   -5.836  -5.461  1.00 0.00 ? 36  HIS B HA   6  
ATOM 4869  H HB2  . HIS B 2 12 ? 5.567   -7.621  -7.322  1.00 0.00 ? 36  HIS B HB2  6  
ATOM 4870  H HB3  . HIS B 2 12 ? 4.668   -6.311  -8.089  1.00 0.00 ? 36  HIS B HB3  6  
ATOM 4871  H HD1  . HIS B 2 12 ? 6.551   -6.276  -9.973  1.00 0.00 ? 36  HIS B HD1  6  
ATOM 4872  H HD2  . HIS B 2 12 ? 7.789   -5.238  -6.134  1.00 0.00 ? 36  HIS B HD2  6  
ATOM 4873  H HE1  . HIS B 2 12 ? 8.799   -5.156  -10.238 1.00 0.00 ? 36  HIS B HE1  6  
ATOM 4874  N N    . HIS B 2 13 ? 3.152   -4.639  -6.676  1.00 0.00 ? 37  HIS B N    6  
ATOM 4875  C CA   . HIS B 2 13 ? 2.421   -3.376  -6.774  1.00 0.00 ? 37  HIS B CA   6  
ATOM 4876  C C    . HIS B 2 13 ? 2.426   -2.753  -5.412  1.00 0.00 ? 37  HIS B C    6  
ATOM 4877  O O    . HIS B 2 13 ? 2.623   -1.553  -5.237  1.00 0.00 ? 37  HIS B O    6  
ATOM 4878  C CB   . HIS B 2 13 ? 0.967   -3.586  -7.177  1.00 0.00 ? 37  HIS B CB   6  
ATOM 4879  C CG   . HIS B 2 13 ? 0.756   -3.639  -8.640  1.00 0.00 ? 37  HIS B CG   6  
ATOM 4880  N ND1  . HIS B 2 13 ? -0.218  -2.937  -9.303  1.00 0.00 ? 37  HIS B ND1  6  
ATOM 4881  C CD2  . HIS B 2 13 ? 1.422   -4.345  -9.570  1.00 0.00 ? 37  HIS B CD2  6  
ATOM 4882  C CE1  . HIS B 2 13 ? -0.118  -3.231  -10.600 1.00 0.00 ? 37  HIS B CE1  6  
ATOM 4883  N NE2  . HIS B 2 13 ? 0.867   -4.085  -10.822 1.00 0.00 ? 37  HIS B NE2  6  
ATOM 4884  H H    . HIS B 2 13 ? 2.741   -5.471  -6.991  1.00 0.00 ? 37  HIS B H    6  
ATOM 4885  H HA   . HIS B 2 13 ? 2.922   -2.730  -7.481  1.00 0.00 ? 37  HIS B HA   6  
ATOM 4886  H HB2  . HIS B 2 13 ? 0.616   -4.513  -6.757  1.00 0.00 ? 37  HIS B HB2  6  
ATOM 4887  H HB3  . HIS B 2 13 ? 0.376   -2.770  -6.781  1.00 0.00 ? 37  HIS B HB3  6  
ATOM 4888  H HD1  . HIS B 2 13 ? -0.869  -2.328  -8.897  1.00 0.00 ? 37  HIS B HD1  6  
ATOM 4889  H HD2  . HIS B 2 13 ? 2.254   -5.001  -9.374  1.00 0.00 ? 37  HIS B HD2  6  
ATOM 4890  H HE1  . HIS B 2 13 ? -0.759  -2.822  -11.363 1.00 0.00 ? 37  HIS B HE1  6  
ATOM 4891  N N    . PHE B 2 14 ? 2.192   -3.621  -4.452  1.00 0.00 ? 38  PHE B N    6  
ATOM 4892  C CA   . PHE B 2 14 ? 2.170   -3.248  -3.072  1.00 0.00 ? 38  PHE B CA   6  
ATOM 4893  C C    . PHE B 2 14 ? 3.505   -2.679  -2.671  1.00 0.00 ? 38  PHE B C    6  
ATOM 4894  O O    . PHE B 2 14 ? 3.588   -1.818  -1.802  1.00 0.00 ? 38  PHE B O    6  
ATOM 4895  C CB   . PHE B 2 14 ? 1.781   -4.460  -2.238  1.00 0.00 ? 38  PHE B CB   6  
ATOM 4896  C CG   . PHE B 2 14 ? 1.962   -4.218  -0.794  1.00 0.00 ? 38  PHE B CG   6  
ATOM 4897  C CD1  . PHE B 2 14 ? 1.377   -3.107  -0.228  1.00 0.00 ? 38  PHE B CD1  6  
ATOM 4898  C CD2  . PHE B 2 14 ? 2.735   -5.059  -0.016  1.00 0.00 ? 38  PHE B CD2  6  
ATOM 4899  C CE1  . PHE B 2 14 ? 1.553   -2.830  1.109   1.00 0.00 ? 38  PHE B CE1  6  
ATOM 4900  C CE2  . PHE B 2 14 ? 2.923   -4.791  1.323   1.00 0.00 ? 38  PHE B CE2  6  
ATOM 4901  C CZ   . PHE B 2 14 ? 2.333   -3.673  1.889   1.00 0.00 ? 38  PHE B CZ   6  
ATOM 4902  H H    . PHE B 2 14 ? 2.025   -4.557  -4.693  1.00 0.00 ? 38  PHE B H    6  
ATOM 4903  H HA   . PHE B 2 14 ? 1.429   -2.479  -2.943  1.00 0.00 ? 38  PHE B HA   6  
ATOM 4904  H HB2  . PHE B 2 14 ? 0.741   -4.687  -2.413  1.00 0.00 ? 38  PHE B HB2  6  
ATOM 4905  H HB3  . PHE B 2 14 ? 2.383   -5.301  -2.529  1.00 0.00 ? 38  PHE B HB3  6  
ATOM 4906  H HD1  . PHE B 2 14 ? 0.761   -2.457  -0.857  1.00 0.00 ? 38  PHE B HD1  6  
ATOM 4907  H HD2  . PHE B 2 14 ? 3.190   -5.937  -0.466  1.00 0.00 ? 38  PHE B HD2  6  
ATOM 4908  H HE1  . PHE B 2 14 ? 1.095   -1.956  1.541   1.00 0.00 ? 38  PHE B HE1  6  
ATOM 4909  H HE2  . PHE B 2 14 ? 3.523   -5.455  1.930   1.00 0.00 ? 38  PHE B HE2  6  
ATOM 4910  H HZ   . PHE B 2 14 ? 2.478   -3.457  2.936   1.00 0.00 ? 38  PHE B HZ   6  
ATOM 4911  N N    . VAL B 2 15 ? 4.546   -3.159  -3.317  1.00 0.00 ? 39  VAL B N    6  
ATOM 4912  C CA   . VAL B 2 15 ? 5.876   -2.662  -3.065  1.00 0.00 ? 39  VAL B CA   6  
ATOM 4913  C C    . VAL B 2 15 ? 5.994   -1.273  -3.671  1.00 0.00 ? 39  VAL B C    6  
ATOM 4914  O O    . VAL B 2 15 ? 6.141   -0.294  -2.947  1.00 0.00 ? 39  VAL B O    6  
ATOM 4915  C CB   . VAL B 2 15 ? 6.950   -3.614  -3.643  1.00 0.00 ? 39  VAL B CB   6  
ATOM 4916  C CG1  . VAL B 2 15 ? 8.137   -2.847  -4.200  1.00 0.00 ? 39  VAL B CG1  6  
ATOM 4917  C CG2  . VAL B 2 15 ? 7.407   -4.605  -2.585  1.00 0.00 ? 39  VAL B CG2  6  
ATOM 4918  H H    . VAL B 2 15 ? 4.415   -3.865  -3.980  1.00 0.00 ? 39  VAL B H    6  
ATOM 4919  H HA   . VAL B 2 15 ? 6.007   -2.586  -1.997  1.00 0.00 ? 39  VAL B HA   6  
ATOM 4920  H HB   . VAL B 2 15 ? 6.506   -4.174  -4.453  1.00 0.00 ? 39  VAL B HB   6  
ATOM 4921  H HG11 . VAL B 2 15 ? 7.984   -2.663  -5.251  1.00 0.00 ? 39  VAL B HG11 6  
ATOM 4922  H HG12 . VAL B 2 15 ? 9.033   -3.426  -4.061  1.00 0.00 ? 39  VAL B HG12 6  
ATOM 4923  H HG13 . VAL B 2 15 ? 8.235   -1.907  -3.680  1.00 0.00 ? 39  VAL B HG13 6  
ATOM 4924  H HG21 . VAL B 2 15 ? 6.755   -4.542  -1.724  1.00 0.00 ? 39  VAL B HG21 6  
ATOM 4925  H HG22 . VAL B 2 15 ? 8.419   -4.372  -2.289  1.00 0.00 ? 39  VAL B HG22 6  
ATOM 4926  H HG23 . VAL B 2 15 ? 7.372   -5.606  -2.990  1.00 0.00 ? 39  VAL B HG23 6  
ATOM 4927  N N    . ARG B 2 16 ? 5.884   -1.200  -4.999  1.00 0.00 ? 40  ARG B N    6  
ATOM 4928  C CA   . ARG B 2 16 ? 5.955   0.055   -5.719  1.00 0.00 ? 40  ARG B CA   6  
ATOM 4929  C C    . ARG B 2 16 ? 5.167   1.123   -5.004  1.00 0.00 ? 40  ARG B C    6  
ATOM 4930  O O    . ARG B 2 16 ? 5.742   2.101   -4.557  1.00 0.00 ? 40  ARG B O    6  
ATOM 4931  C CB   . ARG B 2 16 ? 5.407   -0.122  -7.129  1.00 0.00 ? 40  ARG B CB   6  
ATOM 4932  C CG   . ARG B 2 16 ? 6.432   -0.594  -8.141  1.00 0.00 ? 40  ARG B CG   6  
ATOM 4933  C CD   . ARG B 2 16 ? 6.952   -1.988  -7.846  1.00 0.00 ? 40  ARG B CD   6  
ATOM 4934  N NE   . ARG B 2 16 ? 8.323   -1.960  -7.346  1.00 0.00 ? 40  ARG B NE   6  
ATOM 4935  C CZ   . ARG B 2 16 ? 9.392   -2.151  -8.113  1.00 0.00 ? 40  ARG B CZ   6  
ATOM 4936  N NH1  . ARG B 2 16 ? 9.252   -2.373  -9.413  1.00 0.00 ? 40  ARG B NH1  6  
ATOM 4937  N NH2  . ARG B 2 16 ? 10.605  -2.117  -7.579  1.00 0.00 ? 40  ARG B NH2  6  
ATOM 4938  H H    . ARG B 2 16 ? 5.744   -2.019  -5.509  1.00 0.00 ? 40  ARG B H    6  
ATOM 4939  H HA   . ARG B 2 16 ? 6.992   0.366   -5.772  1.00 0.00 ? 40  ARG B HA   6  
ATOM 4940  H HB2  . ARG B 2 16 ? 4.607   -0.847  -7.099  1.00 0.00 ? 40  ARG B HB2  6  
ATOM 4941  H HB3  . ARG B 2 16 ? 5.009   0.822   -7.467  1.00 0.00 ? 40  ARG B HB3  6  
ATOM 4942  H HG2  . ARG B 2 16 ? 5.965   -0.608  -9.101  1.00 0.00 ? 40  ARG B HG2  6  
ATOM 4943  H HG3  . ARG B 2 16 ? 7.261   0.098   -8.151  1.00 0.00 ? 40  ARG B HG3  6  
ATOM 4944  H HD2  . ARG B 2 16 ? 6.320   -2.449  -7.111  1.00 0.00 ? 40  ARG B HD2  6  
ATOM 4945  H HD3  . ARG B 2 16 ? 6.920   -2.568  -8.755  1.00 0.00 ? 40  ARG B HD3  6  
ATOM 4946  H HE   . ARG B 2 16 ? 8.455   -1.789  -6.391  1.00 0.00 ? 40  ARG B HE   6  
ATOM 4947  H HH11 . ARG B 2 16 ? 8.338   -2.395  -9.821  1.00 0.00 ? 40  ARG B HH11 6  
ATOM 4948  H HH12 . ARG B 2 16 ? 10.058  -2.515  -9.986  1.00 0.00 ? 40  ARG B HH12 6  
ATOM 4949  H HH21 . ARG B 2 16 ? 10.716  -1.948  -6.599  1.00 0.00 ? 40  ARG B HH21 6  
ATOM 4950  H HH22 . ARG B 2 16 ? 11.411  -2.263  -8.155  1.00 0.00 ? 40  ARG B HH22 6  
ATOM 4951  N N    . ALA B 2 17 ? 3.854   0.938   -4.872  1.00 0.00 ? 41  ALA B N    6  
ATOM 4952  C CA   . ALA B 2 17 ? 3.052   1.927   -4.197  1.00 0.00 ? 41  ALA B CA   6  
ATOM 4953  C C    . ALA B 2 17 ? 3.683   2.250   -2.850  1.00 0.00 ? 41  ALA B C    6  
ATOM 4954  O O    . ALA B 2 17 ? 3.974   3.394   -2.582  1.00 0.00 ? 41  ALA B O    6  
ATOM 4955  C CB   . ALA B 2 17 ? 1.605   1.462   -4.046  1.00 0.00 ? 41  ALA B CB   6  
ATOM 4956  H H    . ALA B 2 17 ? 3.427   0.124   -5.217  1.00 0.00 ? 41  ALA B H    6  
ATOM 4957  H HA   . ALA B 2 17 ? 3.063   2.832   -4.808  1.00 0.00 ? 41  ALA B HA   6  
ATOM 4958  H HB1  . ALA B 2 17 ? 0.994   2.294   -3.724  1.00 0.00 ? 41  ALA B HB1  6  
ATOM 4959  H HB2  . ALA B 2 17 ? 1.540   0.666   -3.313  1.00 0.00 ? 41  ALA B HB2  6  
ATOM 4960  H HB3  . ALA B 2 17 ? 1.243   1.101   -4.998  1.00 0.00 ? 41  ALA B HB3  6  
ATOM 4961  N N    . LEU B 2 18 ? 3.961   1.233   -2.032  1.00 0.00 ? 42  LEU B N    6  
ATOM 4962  C CA   . LEU B 2 18 ? 4.566   1.465   -0.719  1.00 0.00 ? 42  LEU B CA   6  
ATOM 4963  C C    . LEU B 2 18 ? 5.695   2.491   -0.825  1.00 0.00 ? 42  LEU B C    6  
ATOM 4964  O O    . LEU B 2 18 ? 5.868   3.336   0.051   1.00 0.00 ? 42  LEU B O    6  
ATOM 4965  C CB   . LEU B 2 18 ? 5.105   0.153   -0.145  1.00 0.00 ? 42  LEU B CB   6  
ATOM 4966  C CG   . LEU B 2 18 ? 4.812   -0.095  1.336   1.00 0.00 ? 42  LEU B CG   6  
ATOM 4967  C CD1  . LEU B 2 18 ? 5.415   -1.417  1.780   1.00 0.00 ? 42  LEU B CD1  6  
ATOM 4968  C CD2  . LEU B 2 18 ? 5.347   1.048   2.178   1.00 0.00 ? 42  LEU B CD2  6  
ATOM 4969  H H    . LEU B 2 18 ? 3.770   0.311   -2.317  1.00 0.00 ? 42  LEU B H    6  
ATOM 4970  H HA   . LEU B 2 18 ? 3.793   1.855   -0.062  1.00 0.00 ? 42  LEU B HA   6  
ATOM 4971  H HB2  . LEU B 2 18 ? 4.683   -0.659  -0.710  1.00 0.00 ? 42  LEU B HB2  6  
ATOM 4972  H HB3  . LEU B 2 18 ? 6.175   0.142   -0.282  1.00 0.00 ? 42  LEU B HB3  6  
ATOM 4973  H HG   . LEU B 2 18 ? 3.742   -0.148  1.481   1.00 0.00 ? 42  LEU B HG   6  
ATOM 4974  H HD11 . LEU B 2 18 ? 4.706   -2.212  1.605   1.00 0.00 ? 42  LEU B HD11 6  
ATOM 4975  H HD12 . LEU B 2 18 ? 5.654   -1.369  2.831   1.00 0.00 ? 42  LEU B HD12 6  
ATOM 4976  H HD13 . LEU B 2 18 ? 6.315   -1.609  1.215   1.00 0.00 ? 42  LEU B HD13 6  
ATOM 4977  H HD21 . LEU B 2 18 ? 4.535   1.702   2.457   1.00 0.00 ? 42  LEU B HD21 6  
ATOM 4978  H HD22 . LEU B 2 18 ? 6.069   1.599   1.599   1.00 0.00 ? 42  LEU B HD22 6  
ATOM 4979  H HD23 . LEU B 2 18 ? 5.819   0.654   3.066   1.00 0.00 ? 42  LEU B HD23 6  
ATOM 4980  N N    . VAL B 2 19 ? 6.453   2.396   -1.911  1.00 0.00 ? 43  VAL B N    6  
ATOM 4981  C CA   . VAL B 2 19 ? 7.561   3.315   -2.171  1.00 0.00 ? 43  VAL B CA   6  
ATOM 4982  C C    . VAL B 2 19 ? 7.026   4.650   -2.668  1.00 0.00 ? 43  VAL B C    6  
ATOM 4983  O O    . VAL B 2 19 ? 7.201   5.683   -2.023  1.00 0.00 ? 43  VAL B O    6  
ATOM 4984  C CB   . VAL B 2 19 ? 8.553   2.736   -3.213  1.00 0.00 ? 43  VAL B CB   6  
ATOM 4985  C CG1  . VAL B 2 19 ? 9.976   3.093   -2.852  1.00 0.00 ? 43  VAL B CG1  6  
ATOM 4986  C CG2  . VAL B 2 19 ? 8.439   1.240   -3.288  1.00 0.00 ? 43  VAL B CG2  6  
ATOM 4987  H H    . VAL B 2 19 ? 6.265   1.685   -2.551  1.00 0.00 ? 43  VAL B H    6  
ATOM 4988  H HA   . VAL B 2 19 ? 8.081   3.475   -1.241  1.00 0.00 ? 43  VAL B HA   6  
ATOM 4989  H HB   . VAL B 2 19 ? 8.317   3.137   -4.191  1.00 0.00 ? 43  VAL B HB   6  
ATOM 4990  H HG11 . VAL B 2 19 ? 10.580  3.128   -3.749  1.00 0.00 ? 43  VAL B HG11 6  
ATOM 4991  H HG12 . VAL B 2 19 ? 10.361  2.327   -2.185  1.00 0.00 ? 43  VAL B HG12 6  
ATOM 4992  H HG13 . VAL B 2 19 ? 9.999   4.053   -2.357  1.00 0.00 ? 43  VAL B HG13 6  
ATOM 4993  H HG21 . VAL B 2 19 ? 7.475   0.970   -3.685  1.00 0.00 ? 43  VAL B HG21 6  
ATOM 4994  H HG22 . VAL B 2 19 ? 8.552   0.840   -2.292  1.00 0.00 ? 43  VAL B HG22 6  
ATOM 4995  H HG23 . VAL B 2 19 ? 9.217   0.848   -3.925  1.00 0.00 ? 43  VAL B HG23 6  
ATOM 4996  N N    . ARG B 2 20 ? 6.401   4.601   -3.836  1.00 0.00 ? 44  ARG B N    6  
ATOM 4997  C CA   . ARG B 2 20 ? 5.763   5.760   -4.456  1.00 0.00 ? 44  ARG B CA   6  
ATOM 4998  C C    . ARG B 2 20 ? 5.182   6.673   -3.386  1.00 0.00 ? 44  ARG B C    6  
ATOM 4999  O O    . ARG B 2 20 ? 5.305   7.898   -3.424  1.00 0.00 ? 44  ARG B O    6  
ATOM 5000  C CB   . ARG B 2 20 ? 4.621   5.256   -5.336  1.00 0.00 ? 44  ARG B CB   6  
ATOM 5001  C CG   . ARG B 2 20 ? 5.065   4.269   -6.379  1.00 0.00 ? 44  ARG B CG   6  
ATOM 5002  C CD   . ARG B 2 20 ? 4.692   4.737   -7.758  1.00 0.00 ? 44  ARG B CD   6  
ATOM 5003  N NE   . ARG B 2 20 ? 3.358   4.293   -8.151  1.00 0.00 ? 44  ARG B NE   6  
ATOM 5004  C CZ   . ARG B 2 20 ? 2.939   4.230   -9.411  1.00 0.00 ? 44  ARG B CZ   6  
ATOM 5005  N NH1  . ARG B 2 20 ? 3.746   4.584   -10.402 1.00 0.00 ? 44  ARG B NH1  6  
ATOM 5006  N NH2  . ARG B 2 20 ? 1.709   3.812   -9.682  1.00 0.00 ? 44  ARG B NH2  6  
ATOM 5007  H H    . ARG B 2 20 ? 6.379   3.746   -4.312  1.00 0.00 ? 44  ARG B H    6  
ATOM 5008  H HA   . ARG B 2 20 ? 6.482   6.288   -5.063  1.00 0.00 ? 44  ARG B HA   6  
ATOM 5009  H HB2  . ARG B 2 20 ? 3.893   4.767   -4.715  1.00 0.00 ? 44  ARG B HB2  6  
ATOM 5010  H HB3  . ARG B 2 20 ? 4.152   6.085   -5.831  1.00 0.00 ? 44  ARG B HB3  6  
ATOM 5011  H HG2  . ARG B 2 20 ? 6.138   4.154   -6.322  1.00 0.00 ? 44  ARG B HG2  6  
ATOM 5012  H HG3  . ARG B 2 20 ? 4.587   3.320   -6.188  1.00 0.00 ? 44  ARG B HG3  6  
ATOM 5013  H HD2  . ARG B 2 20 ? 4.726   5.817   -7.782  1.00 0.00 ? 44  ARG B HD2  6  
ATOM 5014  H HD3  . ARG B 2 20 ? 5.411   4.344   -8.439  1.00 0.00 ? 44  ARG B HD3  6  
ATOM 5015  H HE   . ARG B 2 20 ? 2.742   4.027   -7.436  1.00 0.00 ? 44  ARG B HE   6  
ATOM 5016  H HH11 . ARG B 2 20 ? 4.674   4.899   -10.203 1.00 0.00 ? 44  ARG B HH11 6  
ATOM 5017  H HH12 . ARG B 2 20 ? 3.427   4.535   -11.348 1.00 0.00 ? 44  ARG B HH12 6  
ATOM 5018  H HH21 . ARG B 2 20 ? 1.097   3.544   -8.938  1.00 0.00 ? 44  ARG B HH21 6  
ATOM 5019  H HH22 . ARG B 2 20 ? 1.395   3.763   -10.629 1.00 0.00 ? 44  ARG B HH22 6  
ATOM 5020  N N    . VAL B 2 21 ? 4.550   6.012   -2.440  1.00 0.00 ? 45  VAL B N    6  
ATOM 5021  C CA   . VAL B 2 21 ? 3.888   6.622   -1.307  1.00 0.00 ? 45  VAL B CA   6  
ATOM 5022  C C    . VAL B 2 21 ? 4.868   7.175   -0.283  1.00 0.00 ? 45  VAL B C    6  
ATOM 5023  O O    . VAL B 2 21 ? 4.863   8.366   0.029   1.00 0.00 ? 45  VAL B O    6  
ATOM 5024  C CB   . VAL B 2 21 ? 3.036   5.558   -0.595  1.00 0.00 ? 45  VAL B CB   6  
ATOM 5025  C CG1  . VAL B 2 21 ? 2.312   6.143   0.589   1.00 0.00 ? 45  VAL B CG1  6  
ATOM 5026  C CG2  . VAL B 2 21 ? 2.069   4.892   -1.552  1.00 0.00 ? 45  VAL B CG2  6  
ATOM 5027  H H    . VAL B 2 21 ? 4.535   5.042   -2.501  1.00 0.00 ? 45  VAL B H    6  
ATOM 5028  H HA   . VAL B 2 21 ? 3.239   7.407   -1.659  1.00 0.00 ? 45  VAL B HA   6  
ATOM 5029  H HB   . VAL B 2 21 ? 3.706   4.796   -0.224  1.00 0.00 ? 45  VAL B HB   6  
ATOM 5030  H HG11 . VAL B 2 21 ? 2.106   7.187   0.408   1.00 0.00 ? 45  VAL B HG11 6  
ATOM 5031  H HG12 . VAL B 2 21 ? 2.931   6.042   1.465   1.00 0.00 ? 45  VAL B HG12 6  
ATOM 5032  H HG13 . VAL B 2 21 ? 1.384   5.613   0.742   1.00 0.00 ? 45  VAL B HG13 6  
ATOM 5033  H HG21 . VAL B 2 21 ? 1.056   5.094   -1.244  1.00 0.00 ? 45  VAL B HG21 6  
ATOM 5034  H HG22 . VAL B 2 21 ? 2.243   3.828   -1.537  1.00 0.00 ? 45  VAL B HG22 6  
ATOM 5035  H HG23 . VAL B 2 21 ? 2.227   5.271   -2.550  1.00 0.00 ? 45  VAL B HG23 6  
ATOM 5036  N N    . CYS B 2 22 ? 5.706   6.286   0.231   1.00 0.00 ? 46  CYS B N    6  
ATOM 5037  C CA   . CYS B 2 22 ? 6.650   6.632   1.280   1.00 0.00 ? 46  CYS B CA   6  
ATOM 5038  C C    . CYS B 2 22 ? 8.063   6.226   0.912   1.00 0.00 ? 46  CYS B C    6  
ATOM 5039  O O    . CYS B 2 22 ? 8.972   7.054   0.838   1.00 0.00 ? 46  CYS B O    6  
ATOM 5040  C CB   . CYS B 2 22 ? 6.234   5.881   2.540   1.00 0.00 ? 46  CYS B CB   6  
ATOM 5041  S SG   . CYS B 2 22 ? 6.964   6.490   4.092   1.00 0.00 ? 46  CYS B SG   6  
ATOM 5042  H H    . CYS B 2 22 ? 5.703   5.365   -0.120  1.00 0.00 ? 46  CYS B H    6  
ATOM 5043  H HA   . CYS B 2 22 ? 6.604   7.693   1.459   1.00 0.00 ? 46  CYS B HA   6  
ATOM 5044  H HB2  . CYS B 2 22 ? 5.166   5.931   2.634   1.00 0.00 ? 46  CYS B HB2  6  
ATOM 5045  H HB3  . CYS B 2 22 ? 6.523   4.846   2.431   1.00 0.00 ? 46  CYS B HB3  6  
ATOM 5046  N N    . GLY B 2 23 ? 8.224   4.936   0.686   1.00 0.00 ? 47  GLY B N    6  
ATOM 5047  C CA   . GLY B 2 23 ? 9.526   4.393   0.353   1.00 0.00 ? 47  GLY B CA   6  
ATOM 5048  C C    . GLY B 2 23 ? 9.633   2.930   0.724   1.00 0.00 ? 47  GLY B C    6  
ATOM 5049  O O    . GLY B 2 23 ? 9.040   2.074   0.071   1.00 0.00 ? 47  GLY B O    6  
ATOM 5050  H H    . GLY B 2 23 ? 7.433   4.346   0.724   1.00 0.00 ? 47  GLY B H    6  
ATOM 5051  H HA2  . GLY B 2 23 ? 9.689   4.499   -0.707  1.00 0.00 ? 47  GLY B HA2  6  
ATOM 5052  H HA3  . GLY B 2 23 ? 10.290  4.943   0.882   1.00 0.00 ? 47  GLY B HA3  6  
ATOM 5053  N N    . GLY B 2 24 ? 10.383  2.640   1.780   1.00 0.00 ? 48  GLY B N    6  
ATOM 5054  C CA   . GLY B 2 24 ? 10.549  1.266   2.207   1.00 0.00 ? 48  GLY B CA   6  
ATOM 5055  C C    . GLY B 2 24 ? 11.883  1.028   2.885   1.00 0.00 ? 48  GLY B C    6  
ATOM 5056  O O    . GLY B 2 24 ? 12.385  1.904   3.588   1.00 0.00 ? 48  GLY B O    6  
ATOM 5057  H H    . GLY B 2 24 ? 10.826  3.362   2.270   1.00 0.00 ? 48  GLY B H    6  
ATOM 5058  H HA2  . GLY B 2 24 ? 9.756   1.013   2.895   1.00 0.00 ? 48  GLY B HA2  6  
ATOM 5059  H HA3  . GLY B 2 24 ? 10.475  0.625   1.343   1.00 0.00 ? 48  GLY B HA3  6  
ATOM 5060  N N    . PRO B 2 25 ? 12.484  -0.156  2.686   1.00 0.00 ? 49  PRO B N    6  
ATOM 5061  C CA   . PRO B 2 25 ? 13.771  -0.497  3.283   1.00 0.00 ? 49  PRO B CA   6  
ATOM 5062  C C    . PRO B 2 25 ? 14.944  0.107   2.512   1.00 0.00 ? 49  PRO B C    6  
ATOM 5063  O O    . PRO B 2 25 ? 15.987  -0.529  2.356   1.00 0.00 ? 49  PRO B O    6  
ATOM 5064  C CB   . PRO B 2 25 ? 13.779  -2.020  3.190   1.00 0.00 ? 49  PRO B CB   6  
ATOM 5065  C CG   . PRO B 2 25 ? 13.023  -2.316  1.946   1.00 0.00 ? 49  PRO B CG   6  
ATOM 5066  C CD   . PRO B 2 25 ? 11.956  -1.258  1.860   1.00 0.00 ? 49  PRO B CD   6  
ATOM 5067  H HA   . PRO B 2 25 ? 13.824  -0.194  4.318   1.00 0.00 ? 49  PRO B HA   6  
ATOM 5068  H HB2  . PRO B 2 25 ? 14.795  -2.383  3.138   1.00 0.00 ? 49  PRO B HB2  6  
ATOM 5069  H HB3  . PRO B 2 25 ? 13.281  -2.432  4.047   1.00 0.00 ? 49  PRO B HB3  6  
ATOM 5070  H HG2  . PRO B 2 25 ? 13.682  -2.258  1.093   1.00 0.00 ? 49  PRO B HG2  6  
ATOM 5071  H HG3  . PRO B 2 25 ? 12.575  -3.295  2.012   1.00 0.00 ? 49  PRO B HG3  6  
ATOM 5072  H HD2  . PRO B 2 25 ? 11.836  -0.942  0.849   1.00 0.00 ? 49  PRO B HD2  6  
ATOM 5073  H HD3  . PRO B 2 25 ? 11.017  -1.621  2.251   1.00 0.00 ? 49  PRO B HD3  6  
ATOM 5074  N N    . ARG B 2 26 ? 14.750  1.338   2.029   1.00 0.00 ? 50  ARG B N    6  
ATOM 5075  C CA   . ARG B 2 26 ? 15.770  2.063   1.277   1.00 0.00 ? 50  ARG B CA   6  
ATOM 5076  C C    . ARG B 2 26 ? 15.964  1.487   -0.114  1.00 0.00 ? 50  ARG B C    6  
ATOM 5077  O O    . ARG B 2 26 ? 16.365  2.206   -1.031  1.00 0.00 ? 50  ARG B O    6  
ATOM 5078  C CB   . ARG B 2 26 ? 17.069  2.067   2.045   1.00 0.00 ? 50  ARG B CB   6  
ATOM 5079  C CG   . ARG B 2 26 ? 17.912  3.300   1.802   1.00 0.00 ? 50  ARG B CG   6  
ATOM 5080  C CD   . ARG B 2 26 ? 19.174  3.288   2.650   1.00 0.00 ? 50  ARG B CD   6  
ATOM 5081  N NE   . ARG B 2 26 ? 19.914  4.544   2.553   1.00 0.00 ? 50  ARG B NE   6  
ATOM 5082  C CZ   . ARG B 2 26 ? 21.054  4.780   3.195   1.00 0.00 ? 50  ARG B CZ   6  
ATOM 5083  N NH1  . ARG B 2 26 ? 21.587  3.846   3.972   1.00 0.00 ? 50  ARG B NH1  6  
ATOM 5084  N NH2  . ARG B 2 26 ? 21.662  5.950   3.061   1.00 0.00 ? 50  ARG B NH2  6  
ATOM 5085  H H    . ARG B 2 26 ? 13.902  1.781   2.197   1.00 0.00 ? 50  ARG B H    6  
ATOM 5086  H HA   . ARG B 2 26 ? 15.431  3.083   1.176   1.00 0.00 ? 50  ARG B HA   6  
ATOM 5087  H HB2  . ARG B 2 26 ? 16.823  2.020   3.085   1.00 0.00 ? 50  ARG B HB2  6  
ATOM 5088  H HB3  . ARG B 2 26 ? 17.640  1.195   1.774   1.00 0.00 ? 50  ARG B HB3  6  
ATOM 5089  H HG2  . ARG B 2 26 ? 18.187  3.336   0.761   1.00 0.00 ? 50  ARG B HG2  6  
ATOM 5090  H HG3  . ARG B 2 26 ? 17.326  4.172   2.054   1.00 0.00 ? 50  ARG B HG3  6  
ATOM 5091  H HD2  . ARG B 2 26 ? 18.898  3.124   3.680   1.00 0.00 ? 50  ARG B HD2  6  
ATOM 5092  H HD3  . ARG B 2 26 ? 19.808  2.482   2.314   1.00 0.00 ? 50  ARG B HD3  6  
ATOM 5093  H HE   . ARG B 2 26 ? 19.538  5.248   1.984   1.00 0.00 ? 50  ARG B HE   6  
ATOM 5094  H HH11 . ARG B 2 26 ? 21.133  2.961   4.075   1.00 0.00 ? 50  ARG B HH11 6  
ATOM 5095  H HH12 . ARG B 2 26 ? 22.446  4.025   4.453   1.00 0.00 ? 50  ARG B HH12 6  
ATOM 5096  H HH21 . ARG B 2 26 ? 21.264  6.656   2.477   1.00 0.00 ? 50  ARG B HH21 6  
ATOM 5097  H HH22 . ARG B 2 26 ? 22.520  6.126   3.544   1.00 0.00 ? 50  ARG B HH22 6  
ATOM 5098  N N    . TRP B 2 27 ? 15.677  0.195   -0.276  1.00 0.00 ? 51  TRP B N    6  
ATOM 5099  C CA   . TRP B 2 27 ? 15.767  -0.449  -1.556  1.00 0.00 ? 51  TRP B CA   6  
ATOM 5100  C C    . TRP B 2 27 ? 17.179  -0.447  -2.111  1.00 0.00 ? 51  TRP B C    6  
ATOM 5101  O O    . TRP B 2 27 ? 17.847  0.584   -2.188  1.00 0.00 ? 51  TRP B O    6  
ATOM 5102  C CB   . TRP B 2 27 ? 14.813  0.229   -2.497  1.00 0.00 ? 51  TRP B CB   6  
ATOM 5103  C CG   . TRP B 2 27 ? 13.494  0.472   -1.849  1.00 0.00 ? 51  TRP B CG   6  
ATOM 5104  C CD1  . TRP B 2 27 ? 13.128  1.487   -1.008  1.00 0.00 ? 51  TRP B CD1  6  
ATOM 5105  C CD2  . TRP B 2 27 ? 12.376  -0.372  -1.958  1.00 0.00 ? 51  TRP B CD2  6  
ATOM 5106  N NE1  . TRP B 2 27 ? 11.825  1.324   -0.620  1.00 0.00 ? 51  TRP B NE1  6  
ATOM 5107  C CE2  . TRP B 2 27 ? 11.341  0.183   -1.196  1.00 0.00 ? 51  TRP B CE2  6  
ATOM 5108  C CE3  . TRP B 2 27 ? 12.158  -1.544  -2.647  1.00 0.00 ? 51  TRP B CE3  6  
ATOM 5109  C CZ2  . TRP B 2 27 ? 10.098  -0.412  -1.110  1.00 0.00 ? 51  TRP B CZ2  6  
ATOM 5110  C CZ3  . TRP B 2 27 ? 10.924  -2.135  -2.560  1.00 0.00 ? 51  TRP B CZ3  6  
ATOM 5111  C CH2  . TRP B 2 27 ? 9.903   -1.558  -1.789  1.00 0.00 ? 51  TRP B CH2  6  
ATOM 5112  H H    . TRP B 2 27 ? 15.386  -0.333  0.478   1.00 0.00 ? 51  TRP B H    6  
ATOM 5113  H HA   . TRP B 2 27 ? 15.434  -1.472  -1.430  1.00 0.00 ? 51  TRP B HA   6  
ATOM 5114  H HB2  . TRP B 2 27 ? 15.227  1.154   -2.823  1.00 0.00 ? 51  TRP B HB2  6  
ATOM 5115  H HB3  . TRP B 2 27 ? 14.651  -0.411  -3.339  1.00 0.00 ? 51  TRP B HB3  6  
ATOM 5116  H HD1  . TRP B 2 27 ? 13.778  2.287   -0.696  1.00 0.00 ? 51  TRP B HD1  6  
ATOM 5117  H HE1  . TRP B 2 27 ? 11.325  1.923   -0.033  1.00 0.00 ? 51  TRP B HE1  6  
ATOM 5118  H HE3  . TRP B 2 27 ? 12.945  -1.987  -3.241  1.00 0.00 ? 51  TRP B HE3  6  
ATOM 5119  H HZ2  . TRP B 2 27 ? 9.296   0.003   -0.534  1.00 0.00 ? 51  TRP B HZ2  6  
ATOM 5120  H HZ3  . TRP B 2 27 ? 10.738  -3.053  -3.083  1.00 0.00 ? 51  TRP B HZ3  6  
ATOM 5121  H HH2  . TRP B 2 27 ? 8.942   -2.031  -1.745  1.00 0.00 ? 51  TRP B HH2  6  
ATOM 5122  N N    . SER B 2 28 ? 17.602  -1.630  -2.504  1.00 0.00 ? 52  SER B N    6  
ATOM 5123  C CA   . SER B 2 28 ? 18.929  -1.854  -3.069  1.00 0.00 ? 52  SER B CA   6  
ATOM 5124  C C    . SER B 2 28 ? 20.028  -1.512  -2.068  1.00 0.00 ? 52  SER B C    6  
ATOM 5125  O O    . SER B 2 28 ? 19.873  -0.623  -1.232  1.00 0.00 ? 52  SER B O    6  
ATOM 5126  C CB   . SER B 2 28 ? 19.107  -1.028  -4.336  1.00 0.00 ? 52  SER B CB   6  
ATOM 5127  O OG   . SER B 2 28 ? 18.188  -1.426  -5.340  1.00 0.00 ? 52  SER B OG   6  
ATOM 5128  H H    . SER B 2 28 ? 16.989  -2.375  -2.421  1.00 0.00 ? 52  SER B H    6  
ATOM 5129  H HA   . SER B 2 28 ? 19.005  -2.900  -3.321  1.00 0.00 ? 52  SER B HA   6  
ATOM 5130  H HB2  . SER B 2 28 ? 18.941  0.011   -4.105  1.00 0.00 ? 52  SER B HB2  6  
ATOM 5131  H HB3  . SER B 2 28 ? 20.110  -1.160  -4.710  1.00 0.00 ? 52  SER B HB3  6  
ATOM 5132  H HG   . SER B 2 28 ? 17.470  -0.791  -5.387  1.00 0.00 ? 52  SER B HG   6  
ATOM 5133  N N    . THR B 2 29 ? 21.148  -2.224  -2.168  1.00 0.00 ? 53  THR B N    6  
ATOM 5134  C CA   . THR B 2 29 ? 22.282  -2.002  -1.281  1.00 0.00 ? 53  THR B CA   6  
ATOM 5135  C C    . THR B 2 29 ? 23.571  -2.537  -1.894  1.00 0.00 ? 53  THR B C    6  
ATOM 5136  O O    . THR B 2 29 ? 24.539  -1.795  -2.063  1.00 0.00 ? 53  THR B O    6  
ATOM 5137  C CB   . THR B 2 29 ? 22.072  -2.672  0.092   1.00 0.00 ? 53  THR B CB   6  
ATOM 5138  O OG1  . THR B 2 29 ? 21.283  -3.857  -0.055  1.00 0.00 ? 53  THR B OG1  6  
ATOM 5139  C CG2  . THR B 2 29 ? 21.399  -1.722  1.071   1.00 0.00 ? 53  THR B CG2  6  
ATOM 5140  H H    . THR B 2 29 ? 21.212  -2.916  -2.860  1.00 0.00 ? 53  THR B H    6  
ATOM 5141  H HA   . THR B 2 29 ? 22.378  -0.936  -1.129  1.00 0.00 ? 53  THR B HA   6  
ATOM 5142  H HB   . THR B 2 29 ? 23.039  -2.945  0.489   1.00 0.00 ? 53  THR B HB   6  
ATOM 5143  H HG1  . THR B 2 29 ? 20.351  -3.622  -0.074  1.00 0.00 ? 53  THR B HG1  6  
ATOM 5144  H HG21 . THR B 2 29 ? 20.406  -1.484  0.719   1.00 0.00 ? 53  THR B HG21 6  
ATOM 5145  H HG22 . THR B 2 29 ? 21.981  -0.815  1.148   1.00 0.00 ? 53  THR B HG22 6  
ATOM 5146  H HG23 . THR B 2 29 ? 21.334  -2.191  2.041   1.00 0.00 ? 53  THR B HG23 6  
ATOM 5147  N N    . GLU B 2 30 ? 23.572  -3.825  -2.232  1.00 0.00 ? 54  GLU B N    6  
ATOM 5148  C CA   . GLU B 2 30 ? 24.732  -4.471  -2.822  1.00 0.00 ? 54  GLU B CA   6  
ATOM 5149  C C    . GLU B 2 30 ? 26.013  -4.092  -2.085  1.00 0.00 ? 54  GLU B C    6  
ATOM 5150  O O    . GLU B 2 30 ? 27.020  -3.744  -2.706  1.00 0.00 ? 54  GLU B O    6  
ATOM 5151  C CB   . GLU B 2 30 ? 24.842  -4.102  -4.298  1.00 0.00 ? 54  GLU B CB   6  
ATOM 5152  C CG   . GLU B 2 30 ? 23.500  -3.883  -4.978  1.00 0.00 ? 54  GLU B CG   6  
ATOM 5153  C CD   . GLU B 2 30 ? 23.642  -3.543  -6.449  1.00 0.00 ? 54  GLU B CD   6  
ATOM 5154  O OE1  . GLU B 2 30 ? 23.908  -2.364  -6.763  1.00 0.00 ? 54  GLU B OE1  6  
ATOM 5155  O OE2  . GLU B 2 30 ? 23.491  -4.458  -7.286  1.00 0.00 ? 54  GLU B OE2  6  
ATOM 5156  H H    . GLU B 2 30 ? 22.763  -4.354  -2.098  1.00 0.00 ? 54  GLU B H    6  
ATOM 5157  H HA   . GLU B 2 30 ? 24.591  -5.539  -2.741  1.00 0.00 ? 54  GLU B HA   6  
ATOM 5158  H HB2  . GLU B 2 30 ? 25.426  -3.199  -4.393  1.00 0.00 ? 54  GLU B HB2  6  
ATOM 5159  H HB3  . GLU B 2 30 ? 25.346  -4.901  -4.806  1.00 0.00 ? 54  GLU B HB3  6  
ATOM 5160  H HG2  . GLU B 2 30 ? 22.913  -4.784  -4.888  1.00 0.00 ? 54  GLU B HG2  6  
ATOM 5161  H HG3  . GLU B 2 30 ? 22.989  -3.070  -4.483  1.00 0.00 ? 54  GLU B HG3  6  
ATOM 5162  N N    . ALA B 2 31 ? 25.970  -4.157  -0.758  1.00 0.00 ? 55  ALA B N    6  
ATOM 5163  C CA   . ALA B 2 31 ? 27.125  -3.819  0.063   1.00 0.00 ? 55  ALA B CA   6  
ATOM 5164  C C    . ALA B 2 31 ? 26.965  -4.352  1.483   1.00 0.00 ? 55  ALA B C    6  
ATOM 5165  O O    . ALA B 2 31 ? 26.398  -3.627  2.327   1.00 0.00 ? 55  ALA B O    6  
ATOM 5166  C CB   . ALA B 2 31 ? 27.334  -2.312  0.082   1.00 0.00 ? 55  ALA B CB   6  
ATOM 5167  O OXT  . ALA B 2 31 ? 27.408  -5.491  1.740   1.00 0.00 ? 55  ALA B OXT  6  
ATOM 5168  H H    . ALA B 2 31 ? 25.139  -4.441  -0.321  1.00 0.00 ? 55  ALA B H    6  
ATOM 5169  H HA   . ALA B 2 31 ? 27.997  -4.273  -0.385  1.00 0.00 ? 55  ALA B HA   6  
ATOM 5170  H HB1  . ALA B 2 31 ? 28.210  -2.077  0.667   1.00 0.00 ? 55  ALA B HB1  6  
ATOM 5171  H HB2  . ALA B 2 31 ? 26.469  -1.833  0.519   1.00 0.00 ? 55  ALA B HB2  6  
ATOM 5172  H HB3  . ALA B 2 31 ? 27.470  -1.955  -0.928  1.00 0.00 ? 55  ALA B HB3  6  
ATOM 5173  N N    . ALA A 1 1  ? 1.903   -0.552  11.839  1.00 0.00 ? 106 ALA A N    7  
ATOM 5174  C CA   . ALA A 1 1  ? 1.970   -2.022  12.043  1.00 0.00 ? 106 ALA A CA   7  
ATOM 5175  C C    . ALA A 1 1  ? 1.007   -2.466  13.139  1.00 0.00 ? 106 ALA A C    7  
ATOM 5176  O O    . ALA A 1 1  ? 1.403   -2.654  14.289  1.00 0.00 ? 106 ALA A O    7  
ATOM 5177  C CB   . ALA A 1 1  ? 3.391   -2.443  12.386  1.00 0.00 ? 106 ALA A CB   7  
ATOM 5178  H H1   . ALA A 1 1  ? 0.941   -0.273  11.561  1.00 0.00 ? 106 ALA A H1   7  
ATOM 5179  H H2   . ALA A 1 1  ? 2.565   -0.265  11.089  1.00 0.00 ? 106 ALA A H2   7  
ATOM 5180  H H3   . ALA A 1 1  ? 2.158   -0.057  12.718  1.00 0.00 ? 106 ALA A H3   7  
ATOM 5181  H HA   . ALA A 1 1  ? 1.692   -2.506  11.117  1.00 0.00 ? 106 ALA A HA   7  
ATOM 5182  H HB1  . ALA A 1 1  ? 3.447   -3.521  12.430  1.00 0.00 ? 106 ALA A HB1  7  
ATOM 5183  H HB2  . ALA A 1 1  ? 3.668   -2.029  13.345  1.00 0.00 ? 106 ALA A HB2  7  
ATOM 5184  H HB3  . ALA A 1 1  ? 4.068   -2.078  11.627  1.00 0.00 ? 106 ALA A HB3  7  
ATOM 5185  N N    . ALA A 1 2  ? -0.260  -2.634  12.773  1.00 0.00 ? 107 ALA A N    7  
ATOM 5186  C CA   . ALA A 1 2  ? -1.280  -3.056  13.724  1.00 0.00 ? 107 ALA A CA   7  
ATOM 5187  C C    . ALA A 1 2  ? -2.499  -3.625  13.005  1.00 0.00 ? 107 ALA A C    7  
ATOM 5188  O O    . ALA A 1 2  ? -3.605  -3.631  13.547  1.00 0.00 ? 107 ALA A O    7  
ATOM 5189  C CB   . ALA A 1 2  ? -1.685  -1.890  14.614  1.00 0.00 ? 107 ALA A CB   7  
ATOM 5190  H H    . ALA A 1 2  ? -0.514  -2.470  11.841  1.00 0.00 ? 107 ALA A H    7  
ATOM 5191  H HA   . ALA A 1 2  ? -0.853  -3.826  14.351  1.00 0.00 ? 107 ALA A HA   7  
ATOM 5192  H HB1  . ALA A 1 2  ? -0.814  -1.509  15.126  1.00 0.00 ? 107 ALA A HB1  7  
ATOM 5193  H HB2  . ALA A 1 2  ? -2.410  -2.227  15.341  1.00 0.00 ? 107 ALA A HB2  7  
ATOM 5194  H HB3  . ALA A 1 2  ? -2.119  -1.109  14.008  1.00 0.00 ? 107 ALA A HB3  7  
ATOM 5195  N N    . ALA A 1 3  ? -2.289  -4.103  11.783  1.00 0.00 ? 108 ALA A N    7  
ATOM 5196  C CA   . ALA A 1 3  ? -3.368  -4.673  10.988  1.00 0.00 ? 108 ALA A CA   7  
ATOM 5197  C C    . ALA A 1 3  ? -2.993  -6.044  10.451  1.00 0.00 ? 108 ALA A C    7  
ATOM 5198  O O    . ALA A 1 3  ? -2.078  -6.697  10.954  1.00 0.00 ? 108 ALA A O    7  
ATOM 5199  C CB   . ALA A 1 3  ? -3.710  -3.757  9.826   1.00 0.00 ? 108 ALA A CB   7  
ATOM 5200  H H    . ALA A 1 3  ? -1.386  -4.069  11.403  1.00 0.00 ? 108 ALA A H    7  
ATOM 5201  H HA   . ALA A 1 3  ? -4.241  -4.764  11.617  1.00 0.00 ? 108 ALA A HA   7  
ATOM 5202  H HB1  . ALA A 1 3  ? -4.772  -3.564  9.818   1.00 0.00 ? 108 ALA A HB1  7  
ATOM 5203  H HB2  . ALA A 1 3  ? -3.423  -4.241  8.898   1.00 0.00 ? 108 ALA A HB2  7  
ATOM 5204  H HB3  . ALA A 1 3  ? -3.172  -2.825  9.929   1.00 0.00 ? 108 ALA A HB3  7  
ATOM 5205  N N    . THR A 1 4  ? -3.713  -6.469  9.423   1.00 0.00 ? 109 THR A N    7  
ATOM 5206  C CA   . THR A 1 4  ? -3.463  -7.747  8.783   1.00 0.00 ? 109 THR A CA   7  
ATOM 5207  C C    . THR A 1 4  ? -2.237  -7.644  7.880   1.00 0.00 ? 109 THR A C    7  
ATOM 5208  O O    . THR A 1 4  ? -1.412  -6.747  8.048   1.00 0.00 ? 109 THR A O    7  
ATOM 5209  C CB   . THR A 1 4  ? -4.686  -8.186  7.950   1.00 0.00 ? 109 THR A CB   7  
ATOM 5210  O OG1  . THR A 1 4  ? -4.534  -9.544  7.522   1.00 0.00 ? 109 THR A OG1  7  
ATOM 5211  C CG2  . THR A 1 4  ? -4.870  -7.281  6.735   1.00 0.00 ? 109 THR A CG2  7  
ATOM 5212  H H    . THR A 1 4  ? -4.437  -5.903  9.084   1.00 0.00 ? 109 THR A H    7  
ATOM 5213  H HA   . THR A 1 4  ? -3.282  -8.485  9.552   1.00 0.00 ? 109 THR A HA   7  
ATOM 5214  H HB   . THR A 1 4  ? -5.568  -8.110  8.570   1.00 0.00 ? 109 THR A HB   7  
ATOM 5215  H HG1  . THR A 1 4  ? -4.694  -10.133 8.262   1.00 0.00 ? 109 THR A HG1  7  
ATOM 5216  H HG21 . THR A 1 4  ? -4.841  -6.244  7.044   1.00 0.00 ? 109 THR A HG21 7  
ATOM 5217  H HG22 . THR A 1 4  ? -5.823  -7.492  6.272   1.00 0.00 ? 109 THR A HG22 7  
ATOM 5218  H HG23 . THR A 1 4  ? -4.078  -7.467  6.025   1.00 0.00 ? 109 THR A HG23 7  
ATOM 5219  N N    . ASN A 1 5  ? -2.119  -8.563  6.934   1.00 0.00 ? 110 ASN A N    7  
ATOM 5220  C CA   . ASN A 1 5  ? -1.005  -8.555  5.992   1.00 0.00 ? 110 ASN A CA   7  
ATOM 5221  C C    . ASN A 1 5  ? -1.312  -7.584  4.859   1.00 0.00 ? 110 ASN A C    7  
ATOM 5222  O O    . ASN A 1 5  ? -2.115  -7.894  3.984   1.00 0.00 ? 110 ASN A O    7  
ATOM 5223  C CB   . ASN A 1 5  ? -0.762  -9.955  5.423   1.00 0.00 ? 110 ASN A CB   7  
ATOM 5224  C CG   . ASN A 1 5  ? -0.330  -10.946 6.485   1.00 0.00 ? 110 ASN A CG   7  
ATOM 5225  O OD1  . ASN A 1 5  ? -0.758  -10.867 7.637   1.00 0.00 ? 110 ASN A OD1  7  
ATOM 5226  N ND2  . ASN A 1 5  ? 0.530   -11.881 6.101   1.00 0.00 ? 110 ASN A ND2  7  
ATOM 5227  H H    . ASN A 1 5  ? -2.800  -9.256  6.860   1.00 0.00 ? 110 ASN A H    7  
ATOM 5228  H HA   . ASN A 1 5  ? -0.122  -8.224  6.517   1.00 0.00 ? 110 ASN A HA   7  
ATOM 5229  H HB2  . ASN A 1 5  ? -1.674  -10.317 4.967   1.00 0.00 ? 110 ASN A HB2  7  
ATOM 5230  H HB3  . ASN A 1 5  ? 0.012   -9.900  4.672   1.00 0.00 ? 110 ASN A HB3  7  
ATOM 5231  H HD21 . ASN A 1 5  ? 0.832   -11.878 5.169   1.00 0.00 ? 110 ASN A HD21 7  
ATOM 5232  H HD22 . ASN A 1 5  ? 0.828   -12.537 6.766   1.00 0.00 ? 110 ASN A HD22 7  
ATOM 5233  N N    . PRO A 1 6  ? -0.677  -6.398  4.850   1.00 0.00 ? 111 PRO A N    7  
ATOM 5234  C CA   . PRO A 1 6  ? -0.928  -5.384  3.824   1.00 0.00 ? 111 PRO A CA   7  
ATOM 5235  C C    . PRO A 1 6  ? -0.626  -5.873  2.409   1.00 0.00 ? 111 PRO A C    7  
ATOM 5236  O O    . PRO A 1 6  ? -1.142  -5.329  1.439   1.00 0.00 ? 111 PRO A O    7  
ATOM 5237  C CB   . PRO A 1 6  ? -0.013  -4.225  4.227   1.00 0.00 ? 111 PRO A CB   7  
ATOM 5238  C CG   . PRO A 1 6  ? 1.040   -4.853  5.072   1.00 0.00 ? 111 PRO A CG   7  
ATOM 5239  C CD   . PRO A 1 6  ? 0.344   -5.952  5.815   1.00 0.00 ? 111 PRO A CD   7  
ATOM 5240  H HA   . PRO A 1 6  ? -1.953  -5.054  3.858   1.00 0.00 ? 111 PRO A HA   7  
ATOM 5241  H HB2  . PRO A 1 6  ? 0.401   -3.765  3.346   1.00 0.00 ? 111 PRO A HB2  7  
ATOM 5242  H HB3  . PRO A 1 6  ? -0.580  -3.495  4.786   1.00 0.00 ? 111 PRO A HB3  7  
ATOM 5243  H HG2  . PRO A 1 6  ? 1.823   -5.257  4.448   1.00 0.00 ? 111 PRO A HG2  7  
ATOM 5244  H HG3  . PRO A 1 6  ? 1.441   -4.127  5.764   1.00 0.00 ? 111 PRO A HG3  7  
ATOM 5245  H HD2  . PRO A 1 6  ? 1.034   -6.749  6.049   1.00 0.00 ? 111 PRO A HD2  7  
ATOM 5246  H HD3  . PRO A 1 6  ? -0.117  -5.569  6.713   1.00 0.00 ? 111 PRO A HD3  7  
ATOM 5247  N N    . ALA A 1 7  ? 0.195   -6.906  2.288   1.00 0.00 ? 112 ALA A N    7  
ATOM 5248  C CA   . ALA A 1 7  ? 0.526   -7.447  0.974   1.00 0.00 ? 112 ALA A CA   7  
ATOM 5249  C C    . ALA A 1 7  ? -0.697  -8.093  0.343   1.00 0.00 ? 112 ALA A C    7  
ATOM 5250  O O    . ALA A 1 7  ? -1.082  -7.769  -0.780  1.00 0.00 ? 112 ALA A O    7  
ATOM 5251  C CB   . ALA A 1 7  ? 1.658   -8.447  1.089   1.00 0.00 ? 112 ALA A CB   7  
ATOM 5252  H H    . ALA A 1 7  ? 0.586   -7.311  3.090   1.00 0.00 ? 112 ALA A H    7  
ATOM 5253  H HA   . ALA A 1 7  ? 0.854   -6.633  0.348   1.00 0.00 ? 112 ALA A HA   7  
ATOM 5254  H HB1  . ALA A 1 7  ? 1.298   -9.348  1.565   1.00 0.00 ? 112 ALA A HB1  7  
ATOM 5255  H HB2  . ALA A 1 7  ? 2.446   -8.017  1.683   1.00 0.00 ? 112 ALA A HB2  7  
ATOM 5256  H HB3  . ALA A 1 7  ? 2.034   -8.684  0.105   1.00 0.00 ? 112 ALA A HB3  7  
ATOM 5257  N N    . ARG A 1 8  ? -1.297  -9.011  1.083   1.00 0.00 ? 113 ARG A N    7  
ATOM 5258  C CA   . ARG A 1 8  ? -2.496  -9.709  0.630   1.00 0.00 ? 113 ARG A CA   7  
ATOM 5259  C C    . ARG A 1 8  ? -3.728  -8.815  0.782   1.00 0.00 ? 113 ARG A C    7  
ATOM 5260  O O    . ARG A 1 8  ? -4.748  -9.013  0.120   1.00 0.00 ? 113 ARG A O    7  
ATOM 5261  C CB   . ARG A 1 8  ? -2.678  -11.001 1.431   1.00 0.00 ? 113 ARG A CB   7  
ATOM 5262  C CG   . ARG A 1 8  ? -2.326  -12.258 0.653   1.00 0.00 ? 113 ARG A CG   7  
ATOM 5263  C CD   . ARG A 1 8  ? -3.401  -12.605 -0.364  1.00 0.00 ? 113 ARG A CD   7  
ATOM 5264  N NE   . ARG A 1 8  ? -4.682  -12.893 0.275   1.00 0.00 ? 113 ARG A NE   7  
ATOM 5265  C CZ   . ARG A 1 8  ? -5.528  -13.827 -0.153  1.00 0.00 ? 113 ARG A CZ   7  
ATOM 5266  N NH1  . ARG A 1 8  ? -5.229  -14.561 -1.217  1.00 0.00 ? 113 ARG A NH1  7  
ATOM 5267  N NH2  . ARG A 1 8  ? -6.673  -14.028 0.486   1.00 0.00 ? 113 ARG A NH2  7  
ATOM 5268  H H    . ARG A 1 8  ? -0.911  -9.234  1.958   1.00 0.00 ? 113 ARG A H    7  
ATOM 5269  H HA   . ARG A 1 8  ? -2.367  -9.954  -0.414  1.00 0.00 ? 113 ARG A HA   7  
ATOM 5270  H HB2  . ARG A 1 8  ? -2.046  -10.958 2.305   1.00 0.00 ? 113 ARG A HB2  7  
ATOM 5271  H HB3  . ARG A 1 8  ? -3.707  -11.074 1.747   1.00 0.00 ? 113 ARG A HB3  7  
ATOM 5272  H HG2  . ARG A 1 8  ? -1.393  -12.098 0.133   1.00 0.00 ? 113 ARG A HG2  7  
ATOM 5273  H HG3  . ARG A 1 8  ? -2.218  -13.080 1.345   1.00 0.00 ? 113 ARG A HG3  7  
ATOM 5274  H HD2  . ARG A 1 8  ? -3.525  -11.770 -1.037  1.00 0.00 ? 113 ARG A HD2  7  
ATOM 5275  H HD3  . ARG A 1 8  ? -3.084  -13.473 -0.923  1.00 0.00 ? 113 ARG A HD3  7  
ATOM 5276  H HE   . ARG A 1 8  ? -4.925  -12.364 1.064   1.00 0.00 ? 113 ARG A HE   7  
ATOM 5277  H HH11 . ARG A 1 8  ? -4.367  -14.414 -1.700  1.00 0.00 ? 113 ARG A HH11 7  
ATOM 5278  H HH12 . ARG A 1 8  ? -5.867  -15.263 -1.535  1.00 0.00 ? 113 ARG A HH12 7  
ATOM 5279  H HH21 . ARG A 1 8  ? -6.901  -13.477 1.289   1.00 0.00 ? 113 ARG A HH21 7  
ATOM 5280  H HH22 . ARG A 1 8  ? -7.309  -14.730 0.163   1.00 0.00 ? 113 ARG A HH22 7  
ATOM 5281  N N    . TYR A 1 9  ? -3.605  -7.821  1.655   1.00 0.00 ? 114 TYR A N    7  
ATOM 5282  C CA   . TYR A 1 9  ? -4.682  -6.872  1.929   1.00 0.00 ? 114 TYR A CA   7  
ATOM 5283  C C    . TYR A 1 9  ? -4.897  -5.930  0.743   1.00 0.00 ? 114 TYR A C    7  
ATOM 5284  O O    . TYR A 1 9  ? -6.023  -5.787  0.263   1.00 0.00 ? 114 TYR A O    7  
ATOM 5285  C CB   . TYR A 1 9  ? -4.354  -6.124  3.238   1.00 0.00 ? 114 TYR A CB   7  
ATOM 5286  C CG   . TYR A 1 9  ? -4.896  -4.714  3.380   1.00 0.00 ? 114 TYR A CG   7  
ATOM 5287  C CD1  . TYR A 1 9  ? -6.109  -4.331  2.825   1.00 0.00 ? 114 TYR A CD1  7  
ATOM 5288  C CD2  . TYR A 1 9  ? -4.174  -3.761  4.089   1.00 0.00 ? 114 TYR A CD2  7  
ATOM 5289  C CE1  . TYR A 1 9  ? -6.583  -3.046  2.966   1.00 0.00 ? 114 TYR A CE1  7  
ATOM 5290  C CE2  . TYR A 1 9  ? -4.638  -2.475  4.239   1.00 0.00 ? 114 TYR A CE2  7  
ATOM 5291  C CZ   . TYR A 1 9  ? -5.846  -2.117  3.674   1.00 0.00 ? 114 TYR A CZ   7  
ATOM 5292  O OH   . TYR A 1 9  ? -6.316  -0.832  3.818   1.00 0.00 ? 114 TYR A OH   7  
ATOM 5293  H H    . TYR A 1 9  ? -2.757  -7.716  2.132   1.00 0.00 ? 114 TYR A H    7  
ATOM 5294  H HA   . TYR A 1 9  ? -5.590  -7.435  2.077   1.00 0.00 ? 114 TYR A HA   7  
ATOM 5295  H HB2  . TYR A 1 9  ? -4.746  -6.696  4.064   1.00 0.00 ? 114 TYR A HB2  7  
ATOM 5296  H HB3  . TYR A 1 9  ? -3.281  -6.072  3.338   1.00 0.00 ? 114 TYR A HB3  7  
ATOM 5297  H HD1  . TYR A 1 9  ? -6.686  -5.057  2.271   1.00 0.00 ? 114 TYR A HD1  7  
ATOM 5298  H HD2  . TYR A 1 9  ? -3.233  -4.041  4.535   1.00 0.00 ? 114 TYR A HD2  7  
ATOM 5299  H HE1  . TYR A 1 9  ? -7.525  -2.773  2.522   1.00 0.00 ? 114 TYR A HE1  7  
ATOM 5300  H HE2  . TYR A 1 9  ? -4.052  -1.755  4.795   1.00 0.00 ? 114 TYR A HE2  7  
ATOM 5301  H HH   . TYR A 1 9  ? -7.244  -0.855  4.058   1.00 0.00 ? 114 TYR A HH   7  
ATOM 5302  N N    . CYS A 1 10 ? -3.832  -5.302  0.257   1.00 0.00 ? 115 CYS A N    7  
ATOM 5303  C CA   . CYS A 1 10 ? -3.960  -4.386  -0.872  1.00 0.00 ? 115 CYS A CA   7  
ATOM 5304  C C    . CYS A 1 10 ? -4.164  -5.149  -2.179  1.00 0.00 ? 115 CYS A C    7  
ATOM 5305  O O    . CYS A 1 10 ? -4.628  -4.589  -3.169  1.00 0.00 ? 115 CYS A O    7  
ATOM 5306  C CB   . CYS A 1 10 ? -2.734  -3.482  -1.000  1.00 0.00 ? 115 CYS A CB   7  
ATOM 5307  S SG   . CYS A 1 10 ? -2.026  -2.926  0.583   1.00 0.00 ? 115 CYS A SG   7  
ATOM 5308  H H    . CYS A 1 10 ? -2.953  -5.455  0.660   1.00 0.00 ? 115 CYS A H    7  
ATOM 5309  H HA   . CYS A 1 10 ? -4.829  -3.770  -0.696  1.00 0.00 ? 115 CYS A HA   7  
ATOM 5310  H HB2  . CYS A 1 10 ? -1.959  -4.009  -1.538  1.00 0.00 ? 115 CYS A HB2  7  
ATOM 5311  H HB3  . CYS A 1 10 ? -3.015  -2.604  -1.562  1.00 0.00 ? 115 CYS A HB3  7  
ATOM 5312  N N    . CYS A 1 11 ? -3.814  -6.427  -2.188  1.00 0.00 ? 116 CYS A N    7  
ATOM 5313  C CA   . CYS A 1 11 ? -3.964  -7.235  -3.391  1.00 0.00 ? 116 CYS A CA   7  
ATOM 5314  C C    . CYS A 1 11 ? -5.434  -7.519  -3.684  1.00 0.00 ? 116 CYS A C    7  
ATOM 5315  O O    . CYS A 1 11 ? -5.898  -7.340  -4.810  1.00 0.00 ? 116 CYS A O    7  
ATOM 5316  C CB   . CYS A 1 11 ? -3.197  -8.554  -3.250  1.00 0.00 ? 116 CYS A CB   7  
ATOM 5317  S SG   . CYS A 1 11 ? -3.359  -9.673  -4.682  1.00 0.00 ? 116 CYS A SG   7  
ATOM 5318  H H    . CYS A 1 11 ? -3.450  -6.834  -1.374  1.00 0.00 ? 116 CYS A H    7  
ATOM 5319  H HA   . CYS A 1 11 ? -3.549  -6.670  -4.216  1.00 0.00 ? 116 CYS A HA   7  
ATOM 5320  H HB2  . CYS A 1 11 ? -2.150  -8.342  -3.116  1.00 0.00 ? 116 CYS A HB2  7  
ATOM 5321  H HB3  . CYS A 1 11 ? -3.560  -9.079  -2.382  1.00 0.00 ? 116 CYS A HB3  7  
ATOM 5322  N N    . LEU A 1 12 ? -6.163  -7.960  -2.664  1.00 0.00 ? 117 LEU A N    7  
ATOM 5323  C CA   . LEU A 1 12 ? -7.575  -8.282  -2.812  1.00 0.00 ? 117 LEU A CA   7  
ATOM 5324  C C    . LEU A 1 12 ? -8.462  -7.041  -2.759  1.00 0.00 ? 117 LEU A C    7  
ATOM 5325  O O    . LEU A 1 12 ? -9.633  -7.097  -3.138  1.00 0.00 ? 117 LEU A O    7  
ATOM 5326  C CB   . LEU A 1 12 ? -7.993  -9.259  -1.720  1.00 0.00 ? 117 LEU A CB   7  
ATOM 5327  C CG   . LEU A 1 12 ? -7.864  -10.742 -2.079  1.00 0.00 ? 117 LEU A CG   7  
ATOM 5328  C CD1  . LEU A 1 12 ? -8.182  -11.610 -0.872  1.00 0.00 ? 117 LEU A CD1  7  
ATOM 5329  C CD2  . LEU A 1 12 ? -8.777  -11.094 -3.244  1.00 0.00 ? 117 LEU A CD2  7  
ATOM 5330  H H    . LEU A 1 12 ? -5.740  -8.076  -1.786  1.00 0.00 ? 117 LEU A H    7  
ATOM 5331  H HA   . LEU A 1 12 ? -7.705  -8.760  -3.768  1.00 0.00 ? 117 LEU A HA   7  
ATOM 5332  H HB2  . LEU A 1 12 ? -7.380  -9.066  -0.855  1.00 0.00 ? 117 LEU A HB2  7  
ATOM 5333  H HB3  . LEU A 1 12 ? -9.018  -9.059  -1.463  1.00 0.00 ? 117 LEU A HB3  7  
ATOM 5334  H HG   . LEU A 1 12 ? -6.845  -10.946 -2.377  1.00 0.00 ? 117 LEU A HG   7  
ATOM 5335  H HD11 . LEU A 1 12 ? -7.505  -11.370 -0.067  1.00 0.00 ? 117 LEU A HD11 7  
ATOM 5336  H HD12 . LEU A 1 12 ? -8.071  -12.651 -1.139  1.00 0.00 ? 117 LEU A HD12 7  
ATOM 5337  H HD13 . LEU A 1 12 ? -9.199  -11.426 -0.556  1.00 0.00 ? 117 LEU A HD13 7  
ATOM 5338  H HD21 . LEU A 1 12 ? -9.802  -10.878 -2.977  1.00 0.00 ? 117 LEU A HD21 7  
ATOM 5339  H HD22 . LEU A 1 12 ? -8.678  -12.144 -3.474  1.00 0.00 ? 117 LEU A HD22 7  
ATOM 5340  H HD23 . LEU A 1 12 ? -8.501  -10.508 -4.109  1.00 0.00 ? 117 LEU A HD23 7  
ATOM 5341  N N    . SER A 1 13 ? -7.914  -5.925  -2.291  1.00 0.00 ? 118 SER A N    7  
ATOM 5342  C CA   . SER A 1 13 ? -8.694  -4.693  -2.189  1.00 0.00 ? 118 SER A CA   7  
ATOM 5343  C C    . SER A 1 13 ? -7.934  -3.477  -2.719  1.00 0.00 ? 118 SER A C    7  
ATOM 5344  O O    . SER A 1 13 ? -8.443  -2.742  -3.565  1.00 0.00 ? 118 SER A O    7  
ATOM 5345  C CB   . SER A 1 13 ? -9.107  -4.449  -0.737  1.00 0.00 ? 118 SER A CB   7  
ATOM 5346  O OG   . SER A 1 13 ? -9.852  -3.250  -0.613  1.00 0.00 ? 118 SER A OG   7  
ATOM 5347  H H    . SER A 1 13 ? -6.977  -5.931  -2.004  1.00 0.00 ? 118 SER A H    7  
ATOM 5348  H HA   . SER A 1 13 ? -9.585  -4.823  -2.783  1.00 0.00 ? 118 SER A HA   7  
ATOM 5349  H HB2  . SER A 1 13 ? -9.715  -5.273  -0.395  1.00 0.00 ? 118 SER A HB2  7  
ATOM 5350  H HB3  . SER A 1 13 ? -8.223  -4.375  -0.122  1.00 0.00 ? 118 SER A HB3  7  
ATOM 5351  H HG   . SER A 1 13 ? -10.405 -3.134  -1.389  1.00 0.00 ? 118 SER A HG   7  
ATOM 5352  N N    . GLY A 1 14 ? -6.719  -3.268  -2.221  1.00 0.00 ? 119 GLY A N    7  
ATOM 5353  C CA   . GLY A 1 14 ? -5.933  -2.126  -2.644  1.00 0.00 ? 119 GLY A CA   7  
ATOM 5354  C C    . GLY A 1 14 ? -5.684  -1.171  -1.498  1.00 0.00 ? 119 GLY A C    7  
ATOM 5355  O O    . GLY A 1 14 ? -6.525  -1.043  -0.607  1.00 0.00 ? 119 GLY A O    7  
ATOM 5356  H H    . GLY A 1 14 ? -6.348  -3.895  -1.565  1.00 0.00 ? 119 GLY A H    7  
ATOM 5357  H HA2  . GLY A 1 14 ? -4.984  -2.476  -3.020  1.00 0.00 ? 119 GLY A HA2  7  
ATOM 5358  H HA3  . GLY A 1 14 ? -6.458  -1.607  -3.436  1.00 0.00 ? 119 GLY A HA3  7  
ATOM 5359  N N    . CYS A 1 15 ? -4.536  -0.497  -1.502  1.00 0.00 ? 120 CYS A N    7  
ATOM 5360  C CA   . CYS A 1 15 ? -4.218  0.421   -0.417  1.00 0.00 ? 120 CYS A CA   7  
ATOM 5361  C C    . CYS A 1 15 ? -3.947  1.834   -0.885  1.00 0.00 ? 120 CYS A C    7  
ATOM 5362  O O    . CYS A 1 15 ? -3.319  2.064   -1.919  1.00 0.00 ? 120 CYS A O    7  
ATOM 5363  C CB   . CYS A 1 15 ? -3.037  -0.088  0.402   1.00 0.00 ? 120 CYS A CB   7  
ATOM 5364  S SG   . CYS A 1 15 ? -3.388  -1.624  1.309   1.00 0.00 ? 120 CYS A SG   7  
ATOM 5365  H H    . CYS A 1 15 ? -3.903  -0.618  -2.240  1.00 0.00 ? 120 CYS A H    7  
ATOM 5366  H HA   . CYS A 1 15 ? -5.070  0.454   0.219   1.00 0.00 ? 120 CYS A HA   7  
ATOM 5367  H HB2  . CYS A 1 15 ? -2.203  -0.272  -0.251  1.00 0.00 ? 120 CYS A HB2  7  
ATOM 5368  H HB3  . CYS A 1 15 ? -2.758  0.665   1.124   1.00 0.00 ? 120 CYS A HB3  7  
ATOM 5369  N N    . THR A 1 16 ? -4.442  2.776   -0.094  1.00 0.00 ? 121 THR A N    7  
ATOM 5370  C CA   . THR A 1 16 ? -4.254  4.185   -0.363  1.00 0.00 ? 121 THR A CA   7  
ATOM 5371  C C    . THR A 1 16 ? -2.858  4.593   0.017   1.00 0.00 ? 121 THR A C    7  
ATOM 5372  O O    . THR A 1 16 ? -2.232  3.958   0.866   1.00 0.00 ? 121 THR A O    7  
ATOM 5373  C CB   . THR A 1 16 ? -5.224  5.058   0.451   1.00 0.00 ? 121 THR A CB   7  
ATOM 5374  O OG1  . THR A 1 16 ? -5.040  4.824   1.853   1.00 0.00 ? 121 THR A OG1  7  
ATOM 5375  C CG2  . THR A 1 16 ? -6.650  4.759   0.069   1.00 0.00 ? 121 THR A CG2  7  
ATOM 5376  H H    . THR A 1 16 ? -4.952  2.509   0.700   1.00 0.00 ? 121 THR A H    7  
ATOM 5377  H HA   . THR A 1 16 ? -4.415  4.366   -1.415  1.00 0.00 ? 121 THR A HA   7  
ATOM 5378  H HB   . THR A 1 16 ? -5.019  6.095   0.235   1.00 0.00 ? 121 THR A HB   7  
ATOM 5379  H HG1  . THR A 1 16 ? -4.248  5.277   2.151   1.00 0.00 ? 121 THR A HG1  7  
ATOM 5380  H HG21 . THR A 1 16 ? -6.661  4.396   -0.943  1.00 0.00 ? 121 THR A HG21 7  
ATOM 5381  H HG22 . THR A 1 16 ? -7.242  5.660   0.139   1.00 0.00 ? 121 THR A HG22 7  
ATOM 5382  H HG23 . THR A 1 16 ? -7.054  4.005   0.728   1.00 0.00 ? 121 THR A HG23 7  
ATOM 5383  N N    . GLN A 1 17 ? -2.372  5.651   -0.597  1.00 0.00 ? 122 GLN A N    7  
ATOM 5384  C CA   . GLN A 1 17 ? -1.057  6.145   -0.268  1.00 0.00 ? 122 GLN A CA   7  
ATOM 5385  C C    . GLN A 1 17 ? -1.004  6.404   1.222   1.00 0.00 ? 122 GLN A C    7  
ATOM 5386  O O    . GLN A 1 17 ? 0.064   6.447   1.811   1.00 0.00 ? 122 GLN A O    7  
ATOM 5387  C CB   . GLN A 1 17 ? -0.760  7.414   -1.061  1.00 0.00 ? 122 GLN A CB   7  
ATOM 5388  C CG   . GLN A 1 17 ? -0.255  7.136   -2.465  1.00 0.00 ? 122 GLN A CG   7  
ATOM 5389  C CD   . GLN A 1 17 ? -0.515  8.284   -3.421  1.00 0.00 ? 122 GLN A CD   7  
ATOM 5390  O OE1  . GLN A 1 17 ? -1.556  8.339   -4.076  1.00 0.00 ? 122 GLN A OE1  7  
ATOM 5391  N NE2  . GLN A 1 17 ? 0.433   9.210   -3.504  1.00 0.00 ? 122 GLN A NE2  7  
ATOM 5392  H H    . GLN A 1 17 ? -2.909  6.112   -1.272  1.00 0.00 ? 122 GLN A H    7  
ATOM 5393  H HA   . GLN A 1 17 ? -0.325  5.378   -0.513  1.00 0.00 ? 122 GLN A HA   7  
ATOM 5394  H HB2  . GLN A 1 17 ? -1.665  8.000   -1.134  1.00 0.00 ? 122 GLN A HB2  7  
ATOM 5395  H HB3  . GLN A 1 17 ? -0.015  7.983   -0.537  1.00 0.00 ? 122 GLN A HB3  7  
ATOM 5396  H HG2  . GLN A 1 17 ? 0.808   6.958   -2.424  1.00 0.00 ? 122 GLN A HG2  7  
ATOM 5397  H HG3  . GLN A 1 17 ? -0.746  6.252   -2.839  1.00 0.00 ? 122 GLN A HG3  7  
ATOM 5398  H HE21 . GLN A 1 17 ? 1.235   9.102   -2.952  1.00 0.00 ? 122 GLN A HE21 7  
ATOM 5399  H HE22 . GLN A 1 17 ? 0.291   9.963   -4.115  1.00 0.00 ? 122 GLN A HE22 7  
ATOM 5400  N N    . GLN A 1 18 ? -2.174  6.552   1.839   1.00 0.00 ? 123 GLN A N    7  
ATOM 5401  C CA   . GLN A 1 18 ? -2.232  6.759   3.269   1.00 0.00 ? 123 GLN A CA   7  
ATOM 5402  C C    . GLN A 1 18 ? -1.826  5.474   3.963   1.00 0.00 ? 123 GLN A C    7  
ATOM 5403  O O    . GLN A 1 18 ? -0.947  5.478   4.819   1.00 0.00 ? 123 GLN A O    7  
ATOM 5404  C CB   . GLN A 1 18 ? -3.625  7.186   3.708   1.00 0.00 ? 123 GLN A CB   7  
ATOM 5405  C CG   . GLN A 1 18 ? -3.809  8.694   3.756   1.00 0.00 ? 123 GLN A CG   7  
ATOM 5406  C CD   . GLN A 1 18 ? -3.530  9.361   2.423   1.00 0.00 ? 123 GLN A CD   7  
ATOM 5407  O OE1  . GLN A 1 18 ? -3.733  8.767   1.365   1.00 0.00 ? 123 GLN A OE1  7  
ATOM 5408  N NE2  . GLN A 1 18 ? -3.059  10.601  2.469   1.00 0.00 ? 123 GLN A NE2  7  
ATOM 5409  H H    . GLN A 1 18 ? -3.012  6.505   1.322   1.00 0.00 ? 123 GLN A H    7  
ATOM 5410  H HA   . GLN A 1 18 ? -1.524  7.533   3.522   1.00 0.00 ? 123 GLN A HA   7  
ATOM 5411  H HB2  . GLN A 1 18 ? -4.347  6.776   3.021   1.00 0.00 ? 123 GLN A HB2  7  
ATOM 5412  H HB3  . GLN A 1 18 ? -3.807  6.789   4.692   1.00 0.00 ? 123 GLN A HB3  7  
ATOM 5413  H HG2  . GLN A 1 18 ? -4.826  8.911   4.042   1.00 0.00 ? 123 GLN A HG2  7  
ATOM 5414  H HG3  . GLN A 1 18 ? -3.134  9.102   4.494   1.00 0.00 ? 123 GLN A HG3  7  
ATOM 5415  H HE21 . GLN A 1 18 ? -2.921  11.013  3.347   1.00 0.00 ? 123 GLN A HE21 7  
ATOM 5416  H HE22 . GLN A 1 18 ? -2.870  11.056  1.621   1.00 0.00 ? 123 GLN A HE22 7  
ATOM 5417  N N    . ASP A 1 19 ? -2.465  4.366   3.583   1.00 0.00 ? 124 ASP A N    7  
ATOM 5418  C CA   . ASP A 1 19 ? -2.116  3.076   4.160   1.00 0.00 ? 124 ASP A CA   7  
ATOM 5419  C C    . ASP A 1 19 ? -0.624  2.853   3.970   1.00 0.00 ? 124 ASP A C    7  
ATOM 5420  O O    . ASP A 1 19 ? 0.126   2.678   4.930   1.00 0.00 ? 124 ASP A O    7  
ATOM 5421  C CB   . ASP A 1 19 ? -2.901  1.937   3.497   1.00 0.00 ? 124 ASP A CB   7  
ATOM 5422  C CG   . ASP A 1 19 ? -3.749  1.168   4.491   1.00 0.00 ? 124 ASP A CG   7  
ATOM 5423  O OD1  . ASP A 1 19 ? -3.202  0.274   5.171   1.00 0.00 ? 124 ASP A OD1  7  
ATOM 5424  O OD2  . ASP A 1 19 ? -4.960  1.459   4.590   1.00 0.00 ? 124 ASP A OD2  7  
ATOM 5425  H H    . ASP A 1 19 ? -3.177  4.420   2.904   1.00 0.00 ? 124 ASP A H    7  
ATOM 5426  H HA   . ASP A 1 19 ? -2.339  3.105   5.217   1.00 0.00 ? 124 ASP A HA   7  
ATOM 5427  H HB2  . ASP A 1 19 ? -3.551  2.342   2.738   1.00 0.00 ? 124 ASP A HB2  7  
ATOM 5428  H HB3  . ASP A 1 19 ? -2.207  1.247   3.037   1.00 0.00 ? 124 ASP A HB3  7  
ATOM 5429  N N    . LEU A 1 20 ? -0.206  2.903   2.712   1.00 0.00 ? 125 LEU A N    7  
ATOM 5430  C CA   . LEU A 1 20 ? 1.189   2.722   2.356   1.00 0.00 ? 125 LEU A CA   7  
ATOM 5431  C C    . LEU A 1 20 ? 2.072   3.731   3.100   1.00 0.00 ? 125 LEU A C    7  
ATOM 5432  O O    . LEU A 1 20 ? 3.225   3.436   3.432   1.00 0.00 ? 125 LEU A O    7  
ATOM 5433  C CB   . LEU A 1 20 ? 1.349   2.837   0.833   1.00 0.00 ? 125 LEU A CB   7  
ATOM 5434  C CG   . LEU A 1 20 ? 0.558   1.804   0.036   1.00 0.00 ? 125 LEU A CG   7  
ATOM 5435  C CD1  . LEU A 1 20 ? -0.424  2.489   -0.894  1.00 0.00 ? 125 LEU A CD1  7  
ATOM 5436  C CD2  . LEU A 1 20 ? 1.489   0.930   -0.765  1.00 0.00 ? 125 LEU A CD2  7  
ATOM 5437  H H    . LEU A 1 20 ? -0.859  3.063   2.001   1.00 0.00 ? 125 LEU A H    7  
ATOM 5438  H HA   . LEU A 1 20 ? 1.477   1.727   2.661   1.00 0.00 ? 125 LEU A HA   7  
ATOM 5439  H HB2  . LEU A 1 20 ? 1.026   3.812   0.517   1.00 0.00 ? 125 LEU A HB2  7  
ATOM 5440  H HB3  . LEU A 1 20 ? 2.386   2.735   0.582   1.00 0.00 ? 125 LEU A HB3  7  
ATOM 5441  H HG   . LEU A 1 20 ? -0.000  1.176   0.714   1.00 0.00 ? 125 LEU A HG   7  
ATOM 5442  H HD11 . LEU A 1 20 ? -1.432  2.315   -0.548  1.00 0.00 ? 125 LEU A HD11 7  
ATOM 5443  H HD12 . LEU A 1 20 ? -0.308  2.084   -1.889  1.00 0.00 ? 125 LEU A HD12 7  
ATOM 5444  H HD13 . LEU A 1 20 ? -0.226  3.550   -0.910  1.00 0.00 ? 125 LEU A HD13 7  
ATOM 5445  H HD21 . LEU A 1 20 ? 2.297   0.591   -0.135  1.00 0.00 ? 125 LEU A HD21 7  
ATOM 5446  H HD22 . LEU A 1 20 ? 1.885   1.508   -1.589  1.00 0.00 ? 125 LEU A HD22 7  
ATOM 5447  H HD23 . LEU A 1 20 ? 0.946   0.079   -1.148  1.00 0.00 ? 125 LEU A HD23 7  
ATOM 5448  N N    . LEU A 1 21 ? 1.515   4.913   3.386   1.00 0.00 ? 126 LEU A N    7  
ATOM 5449  C CA   . LEU A 1 21 ? 2.249   5.945   4.115   1.00 0.00 ? 126 LEU A CA   7  
ATOM 5450  C C    . LEU A 1 21 ? 2.594   5.446   5.508   1.00 0.00 ? 126 LEU A C    7  
ATOM 5451  O O    . LEU A 1 21 ? 3.622   5.813   6.078   1.00 0.00 ? 126 LEU A O    7  
ATOM 5452  C CB   . LEU A 1 21 ? 1.422   7.234   4.230   1.00 0.00 ? 126 LEU A CB   7  
ATOM 5453  C CG   . LEU A 1 21 ? 1.710   8.312   3.181   1.00 0.00 ? 126 LEU A CG   7  
ATOM 5454  C CD1  . LEU A 1 21 ? 0.780   9.499   3.374   1.00 0.00 ? 126 LEU A CD1  7  
ATOM 5455  C CD2  . LEU A 1 21 ? 3.165   8.757   3.253   1.00 0.00 ? 126 LEU A CD2  7  
ATOM 5456  H H    . LEU A 1 21 ? 0.592   5.092   3.107   1.00 0.00 ? 126 LEU A H    7  
ATOM 5457  H HA   . LEU A 1 21 ? 3.162   6.153   3.576   1.00 0.00 ? 126 LEU A HA   7  
ATOM 5458  H HB2  . LEU A 1 21 ? 0.378   6.971   4.157   1.00 0.00 ? 126 LEU A HB2  7  
ATOM 5459  H HB3  . LEU A 1 21 ? 1.597   7.661   5.206   1.00 0.00 ? 126 LEU A HB3  7  
ATOM 5460  H HG   . LEU A 1 21 ? 1.529   7.905   2.195   1.00 0.00 ? 126 LEU A HG   7  
ATOM 5461  H HD11 . LEU A 1 21 ? 0.926   9.915   4.360   1.00 0.00 ? 126 LEU A HD11 7  
ATOM 5462  H HD12 . LEU A 1 21 ? -0.246  9.175   3.269   1.00 0.00 ? 126 LEU A HD12 7  
ATOM 5463  H HD13 . LEU A 1 21 ? 0.997   10.253  2.631   1.00 0.00 ? 126 LEU A HD13 7  
ATOM 5464  H HD21 . LEU A 1 21 ? 3.367   9.168   4.230   1.00 0.00 ? 126 LEU A HD21 7  
ATOM 5465  H HD22 . LEU A 1 21 ? 3.348   9.510   2.500   1.00 0.00 ? 126 LEU A HD22 7  
ATOM 5466  H HD23 . LEU A 1 21 ? 3.809   7.908   3.078   1.00 0.00 ? 126 LEU A HD23 7  
ATOM 5467  N N    . THR A 1 22 ? 1.720   4.603   6.050   1.00 0.00 ? 127 THR A N    7  
ATOM 5468  C CA   . THR A 1 22 ? 1.920   4.050   7.380   1.00 0.00 ? 127 THR A CA   7  
ATOM 5469  C C    . THR A 1 22 ? 2.471   2.627   7.323   1.00 0.00 ? 127 THR A C    7  
ATOM 5470  O O    . THR A 1 22 ? 2.726   2.021   8.364   1.00 0.00 ? 127 THR A O    7  
ATOM 5471  C CB   . THR A 1 22 ? 0.613   4.038   8.204   1.00 0.00 ? 127 THR A CB   7  
ATOM 5472  O OG1  . THR A 1 22 ? 0.105   2.702   8.301   1.00 0.00 ? 127 THR A OG1  7  
ATOM 5473  C CG2  . THR A 1 22 ? -0.447  4.934   7.582   1.00 0.00 ? 127 THR A CG2  7  
ATOM 5474  H H    . THR A 1 22 ? 0.922   4.350   5.541   1.00 0.00 ? 127 THR A H    7  
ATOM 5475  H HA   . THR A 1 22 ? 2.631   4.679   7.892   1.00 0.00 ? 127 THR A HA   7  
ATOM 5476  H HB   . THR A 1 22 ? 0.831   4.404   9.196   1.00 0.00 ? 127 THR A HB   7  
ATOM 5477  H HG1  . THR A 1 22 ? 0.074   2.438   9.223   1.00 0.00 ? 127 THR A HG1  7  
ATOM 5478  H HG21 . THR A 1 22 ? 0.014   5.834   7.205   1.00 0.00 ? 127 THR A HG21 7  
ATOM 5479  H HG22 . THR A 1 22 ? -1.183  5.192   8.329   1.00 0.00 ? 127 THR A HG22 7  
ATOM 5480  H HG23 . THR A 1 22 ? -0.929  4.409   6.770   1.00 0.00 ? 127 THR A HG23 7  
ATOM 5481  N N    . LEU A 1 23 ? 2.661   2.086   6.117   1.00 0.00 ? 128 LEU A N    7  
ATOM 5482  C CA   . LEU A 1 23 ? 3.176   0.737   5.983   1.00 0.00 ? 128 LEU A CA   7  
ATOM 5483  C C    . LEU A 1 23 ? 4.693   0.767   5.833   1.00 0.00 ? 128 LEU A C    7  
ATOM 5484  O O    . LEU A 1 23 ? 5.368   -0.239  6.056   1.00 0.00 ? 128 LEU A O    7  
ATOM 5485  C CB   . LEU A 1 23 ? 2.508   0.026   4.808   1.00 0.00 ? 128 LEU A CB   7  
ATOM 5486  C CG   . LEU A 1 23 ? 0.996   -0.157  4.950   1.00 0.00 ? 128 LEU A CG   7  
ATOM 5487  C CD1  . LEU A 1 23 ? 0.376   -0.601  3.639   1.00 0.00 ? 128 LEU A CD1  7  
ATOM 5488  C CD2  . LEU A 1 23 ? 0.703   -1.167  6.035   1.00 0.00 ? 128 LEU A CD2  7  
ATOM 5489  H H    . LEU A 1 23 ? 2.470   2.606   5.302   1.00 0.00 ? 128 LEU A H    7  
ATOM 5490  H HA   . LEU A 1 23 ? 2.933   0.204   6.892   1.00 0.00 ? 128 LEU A HA   7  
ATOM 5491  H HB2  . LEU A 1 23 ? 2.696   0.587   3.914   1.00 0.00 ? 128 LEU A HB2  7  
ATOM 5492  H HB3  . LEU A 1 23 ? 2.955   -0.945  4.702   1.00 0.00 ? 128 LEU A HB3  7  
ATOM 5493  H HG   . LEU A 1 23 ? 0.548   0.779   5.236   1.00 0.00 ? 128 LEU A HG   7  
ATOM 5494  H HD11 . LEU A 1 23 ? 0.535   -1.660  3.509   1.00 0.00 ? 128 LEU A HD11 7  
ATOM 5495  H HD12 . LEU A 1 23 ? 0.837   -0.064  2.823   1.00 0.00 ? 128 LEU A HD12 7  
ATOM 5496  H HD13 . LEU A 1 23 ? -0.684  -0.394  3.653   1.00 0.00 ? 128 LEU A HD13 7  
ATOM 5497  H HD21 . LEU A 1 23 ? 0.912   -0.733  7.002   1.00 0.00 ? 128 LEU A HD21 7  
ATOM 5498  H HD22 . LEU A 1 23 ? 1.333   -2.021  5.882   1.00 0.00 ? 128 LEU A HD22 7  
ATOM 5499  H HD23 . LEU A 1 23 ? -0.334  -1.464  5.985   1.00 0.00 ? 128 LEU A HD23 7  
ATOM 5500  N N    . CYS A 1 24 ? 5.225   1.930   5.452   1.00 0.00 ? 129 CYS A N    7  
ATOM 5501  C CA   . CYS A 1 24 ? 6.670   2.092   5.305   1.00 0.00 ? 129 CYS A CA   7  
ATOM 5502  C C    . CYS A 1 24 ? 7.339   2.147   6.679   1.00 0.00 ? 129 CYS A C    7  
ATOM 5503  O O    . CYS A 1 24 ? 6.675   2.388   7.687   1.00 0.00 ? 129 CYS A O    7  
ATOM 5504  C CB   . CYS A 1 24 ? 7.003   3.363   4.519   1.00 0.00 ? 129 CYS A CB   7  
ATOM 5505  S SG   . CYS A 1 24 ? 6.717   4.915   5.437   1.00 0.00 ? 129 CYS A SG   7  
ATOM 5506  H H    . CYS A 1 24 ? 4.630   2.686   5.245   1.00 0.00 ? 129 CYS A H    7  
ATOM 5507  H HA   . CYS A 1 24 ? 7.046   1.234   4.768   1.00 0.00 ? 129 CYS A HA   7  
ATOM 5508  H HB2  . CYS A 1 24 ? 8.045   3.338   4.239   1.00 0.00 ? 129 CYS A HB2  7  
ATOM 5509  H HB3  . CYS A 1 24 ? 6.401   3.389   3.627   1.00 0.00 ? 129 CYS A HB3  7  
ATOM 5510  N N    . PRO A 1 25 ? 8.665   1.928   6.740   1.00 0.00 ? 130 PRO A N    7  
ATOM 5511  C CA   . PRO A 1 25 ? 9.414   1.953   7.997   1.00 0.00 ? 130 PRO A CA   7  
ATOM 5512  C C    . PRO A 1 25 ? 9.617   3.367   8.517   1.00 0.00 ? 130 PRO A C    7  
ATOM 5513  O O    . PRO A 1 25 ? 8.991   3.783   9.494   1.00 0.00 ? 130 PRO A O    7  
ATOM 5514  C CB   . PRO A 1 25 ? 10.766  1.311   7.635   1.00 0.00 ? 130 PRO A CB   7  
ATOM 5515  C CG   . PRO A 1 25 ? 10.605  0.788   6.243   1.00 0.00 ? 130 PRO A CG   7  
ATOM 5516  C CD   . PRO A 1 25 ? 9.542   1.634   5.606   1.00 0.00 ? 130 PRO A CD   7  
ATOM 5517  H HA   . PRO A 1 25 ? 8.932   1.368   8.755   1.00 0.00 ? 130 PRO A HA   7  
ATOM 5518  H HB2  . PRO A 1 25 ? 11.544  2.058   7.685   1.00 0.00 ? 130 PRO A HB2  7  
ATOM 5519  H HB3  . PRO A 1 25 ? 10.984  0.515   8.330   1.00 0.00 ? 130 PRO A HB3  7  
ATOM 5520  H HG2  . PRO A 1 25 ? 11.536  0.884   5.704   1.00 0.00 ? 130 PRO A HG2  7  
ATOM 5521  H HG3  . PRO A 1 25 ? 10.293  -0.246  6.274   1.00 0.00 ? 130 PRO A HG3  7  
ATOM 5522  H HD2  . PRO A 1 25 ? 9.970   2.539   5.202   1.00 0.00 ? 130 PRO A HD2  7  
ATOM 5523  H HD3  . PRO A 1 25 ? 9.015   1.085   4.839   1.00 0.00 ? 130 PRO A HD3  7  
ATOM 5524  N N    . TYR A 1 26 ? 10.494  4.095   7.852   1.00 0.00 ? 131 TYR A N    7  
ATOM 5525  C CA   . TYR A 1 26 ? 10.799  5.471   8.228   1.00 0.00 ? 131 TYR A CA   7  
ATOM 5526  C C    . TYR A 1 26 ? 10.052  6.458   7.335   1.00 0.00 ? 131 TYR A C    7  
ATOM 5527  O O    . TYR A 1 26 ? 10.590  6.818   6.267   1.00 0.00 ? 131 TYR A O    7  
ATOM 5528  C CB   . TYR A 1 26 ? 12.306  5.722   8.138   1.00 0.00 ? 131 TYR A CB   7  
ATOM 5529  C CG   . TYR A 1 26 ? 13.123  4.842   9.057   1.00 0.00 ? 131 TYR A CG   7  
ATOM 5530  C CD1  . TYR A 1 26 ? 13.539  3.580   8.653   1.00 0.00 ? 131 TYR A CD1  7  
ATOM 5531  C CD2  . TYR A 1 26 ? 13.477  5.274   10.330  1.00 0.00 ? 131 TYR A CD2  7  
ATOM 5532  C CE1  . TYR A 1 26 ? 14.284  2.772   9.492   1.00 0.00 ? 131 TYR A CE1  7  
ATOM 5533  C CE2  . TYR A 1 26 ? 14.223  4.474   11.173  1.00 0.00 ? 131 TYR A CE2  7  
ATOM 5534  C CZ   . TYR A 1 26 ? 14.623  3.224   10.750  1.00 0.00 ? 131 TYR A CZ   7  
ATOM 5535  O OH   . TYR A 1 26 ? 15.365  2.423   11.587  1.00 0.00 ? 131 TYR A OH   7  
ATOM 5536  O OXT  . TYR A 1 26 ? 8.931   6.863   7.712   1.00 0.00 ? 131 TYR A OXT  7  
ATOM 5537  H H    . TYR A 1 26 ? 10.951  3.693   7.090   1.00 0.00 ? 131 TYR A H    7  
ATOM 5538  H HA   . TYR A 1 26 ? 10.481  5.615   9.249   1.00 0.00 ? 131 TYR A HA   7  
ATOM 5539  H HB2  . TYR A 1 26 ? 12.635  5.538   7.125   1.00 0.00 ? 131 TYR A HB2  7  
ATOM 5540  H HB3  . TYR A 1 26 ? 12.509  6.751   8.395   1.00 0.00 ? 131 TYR A HB3  7  
ATOM 5541  H HD1  . TYR A 1 26 ? 13.273  3.230   7.668   1.00 0.00 ? 131 TYR A HD1  7  
ATOM 5542  H HD2  . TYR A 1 26 ? 13.161  6.254   10.658  1.00 0.00 ? 131 TYR A HD2  7  
ATOM 5543  H HE1  . TYR A 1 26 ? 14.598  1.793   9.160   1.00 0.00 ? 131 TYR A HE1  7  
ATOM 5544  H HE2  . TYR A 1 26 ? 14.487  4.827   12.159  1.00 0.00 ? 131 TYR A HE2  7  
ATOM 5545  H HH   . TYR A 1 26 ? 14.980  2.435   12.467  1.00 0.00 ? 131 TYR A HH   7  
ATOM 5546  N N    . PRO B 2 1  ? 1.045   13.027  -9.769  1.00 0.00 ? 25  PRO B N    7  
ATOM 5547  C CA   . PRO B 2 1  ? -0.060  13.838  -9.202  1.00 0.00 ? 25  PRO B CA   7  
ATOM 5548  C C    . PRO B 2 1  ? -1.341  13.017  -9.084  1.00 0.00 ? 25  PRO B C    7  
ATOM 5549  O O    . PRO B 2 1  ? -2.122  12.933  -10.031 1.00 0.00 ? 25  PRO B O    7  
ATOM 5550  C CB   . PRO B 2 1  ? -0.294  15.047  -10.096 1.00 0.00 ? 25  PRO B CB   7  
ATOM 5551  C CG   . PRO B 2 1  ? 0.600   14.803  -11.263 1.00 0.00 ? 25  PRO B CG   7  
ATOM 5552  C CD   . PRO B 2 1  ? 1.700   13.890  -10.771 1.00 0.00 ? 25  PRO B CD   7  
ATOM 5553  H H2   . PRO B 2 1  ? 0.604   12.158  -10.112 1.00 0.00 ? 25  PRO B H2   7  
ATOM 5554  H H3   . PRO B 2 1  ? 1.594   12.708  -8.937  1.00 0.00 ? 25  PRO B H3   7  
ATOM 5555  H HA   . PRO B 2 1  ? 0.232   14.175  -8.218  1.00 0.00 ? 25  PRO B HA   7  
ATOM 5556  H HB2  . PRO B 2 1  ? -1.334  15.087  -10.391 1.00 0.00 ? 25  PRO B HB2  7  
ATOM 5557  H HB3  . PRO B 2 1  ? -0.023  15.949  -9.571  1.00 0.00 ? 25  PRO B HB3  7  
ATOM 5558  H HG2  . PRO B 2 1  ? 0.044   14.327  -12.056 1.00 0.00 ? 25  PRO B HG2  7  
ATOM 5559  H HG3  . PRO B 2 1  ? 1.016   15.739  -11.606 1.00 0.00 ? 25  PRO B HG3  7  
ATOM 5560  H HD2  . PRO B 2 1  ? 2.088   13.298  -11.588 1.00 0.00 ? 25  PRO B HD2  7  
ATOM 5561  H HD3  . PRO B 2 1  ? 2.492   14.467  -10.317 1.00 0.00 ? 25  PRO B HD3  7  
ATOM 5562  N N    . THR B 2 2  ? -1.553  12.434  -7.907  1.00 0.00 ? 26  THR B N    7  
ATOM 5563  C CA   . THR B 2 2  ? -2.732  11.610  -7.647  1.00 0.00 ? 26  THR B CA   7  
ATOM 5564  C C    . THR B 2 2  ? -2.969  11.464  -6.145  1.00 0.00 ? 26  THR B C    7  
ATOM 5565  O O    . THR B 2 2  ? -2.018  11.363  -5.370  1.00 0.00 ? 26  THR B O    7  
ATOM 5566  C CB   . THR B 2 2  ? -2.592  10.199  -8.256  1.00 0.00 ? 26  THR B CB   7  
ATOM 5567  O OG1  . THR B 2 2  ? -1.256  9.716   -8.068  1.00 0.00 ? 26  THR B OG1  7  
ATOM 5568  C CG2  . THR B 2 2  ? -2.935  10.194  -9.738  1.00 0.00 ? 26  THR B CG2  7  
ATOM 5569  H H    . THR B 2 2  ? -0.896  12.559  -7.190  1.00 0.00 ? 26  THR B H    7  
ATOM 5570  H HA   . THR B 2 2  ? -3.586  12.095  -8.098  1.00 0.00 ? 26  THR B HA   7  
ATOM 5571  H HB   . THR B 2 2  ? -3.277  9.538   -7.744  1.00 0.00 ? 26  THR B HB   7  
ATOM 5572  H HG1  . THR B 2 2  ? -0.692  10.438  -7.783  1.00 0.00 ? 26  THR B HG1  7  
ATOM 5573  H HG21 . THR B 2 2  ? -2.954  9.177   -10.100 1.00 0.00 ? 26  THR B HG21 7  
ATOM 5574  H HG22 . THR B 2 2  ? -2.190  10.755  -10.282 1.00 0.00 ? 26  THR B HG22 7  
ATOM 5575  H HG23 . THR B 2 2  ? -3.904  10.647  -9.884  1.00 0.00 ? 26  THR B HG23 7  
ATOM 5576  N N    . PRO B 2 3  ? -4.245  11.450  -5.712  1.00 0.00 ? 27  PRO B N    7  
ATOM 5577  C CA   . PRO B 2 3  ? -4.596  11.315  -4.304  1.00 0.00 ? 27  PRO B CA   7  
ATOM 5578  C C    . PRO B 2 3  ? -4.742  9.857   -3.893  1.00 0.00 ? 27  PRO B C    7  
ATOM 5579  O O    . PRO B 2 3  ? -4.212  8.962   -4.551  1.00 0.00 ? 27  PRO B O    7  
ATOM 5580  C CB   . PRO B 2 3  ? -5.939  12.032  -4.235  1.00 0.00 ? 27  PRO B CB   7  
ATOM 5581  C CG   . PRO B 2 3  ? -6.574  11.774  -5.562  1.00 0.00 ? 27  PRO B CG   7  
ATOM 5582  C CD   . PRO B 2 3  ? -5.452  11.558  -6.555  1.00 0.00 ? 27  PRO B CD   7  
ATOM 5583  H HA   . PRO B 2 3  ? -3.882  11.806  -3.661  1.00 0.00 ? 27  PRO B HA   7  
ATOM 5584  H HB2  . PRO B 2 3  ? -6.528  11.623  -3.427  1.00 0.00 ? 27  PRO B HB2  7  
ATOM 5585  H HB3  . PRO B 2 3  ? -5.779  13.088  -4.073  1.00 0.00 ? 27  PRO B HB3  7  
ATOM 5586  H HG2  . PRO B 2 3  ? -7.193  10.891  -5.504  1.00 0.00 ? 27  PRO B HG2  7  
ATOM 5587  H HG3  . PRO B 2 3  ? -7.168  12.628  -5.853  1.00 0.00 ? 27  PRO B HG3  7  
ATOM 5588  H HD2  . PRO B 2 3  ? -5.615  10.645  -7.111  1.00 0.00 ? 27  PRO B HD2  7  
ATOM 5589  H HD3  . PRO B 2 3  ? -5.377  12.401  -7.226  1.00 0.00 ? 27  PRO B HD3  7  
ATOM 5590  N N    . GLU B 2 4  ? -5.462  9.624   -2.804  1.00 0.00 ? 28  GLU B N    7  
ATOM 5591  C CA   . GLU B 2 4  ? -5.682  8.270   -2.317  1.00 0.00 ? 28  GLU B CA   7  
ATOM 5592  C C    . GLU B 2 4  ? -6.816  7.610   -3.070  1.00 0.00 ? 28  GLU B C    7  
ATOM 5593  O O    . GLU B 2 4  ? -7.863  7.281   -2.511  1.00 0.00 ? 28  GLU B O    7  
ATOM 5594  C CB   . GLU B 2 4  ? -5.963  8.274   -0.826  1.00 0.00 ? 28  GLU B CB   7  
ATOM 5595  C CG   . GLU B 2 4  ? -6.974  9.317   -0.381  1.00 0.00 ? 28  GLU B CG   7  
ATOM 5596  C CD   . GLU B 2 4  ? -7.357  9.172   1.078   1.00 0.00 ? 28  GLU B CD   7  
ATOM 5597  O OE1  . GLU B 2 4  ? -8.321  8.431   1.369   1.00 0.00 ? 28  GLU B OE1  7  
ATOM 5598  O OE2  . GLU B 2 4  ? -6.692  9.797   1.931   1.00 0.00 ? 28  GLU B OE2  7  
ATOM 5599  H H    . GLU B 2 4  ? -5.853  10.377  -2.320  1.00 0.00 ? 28  GLU B H    7  
ATOM 5600  H HA   . GLU B 2 4  ? -4.777  7.708   -2.498  1.00 0.00 ? 28  GLU B HA   7  
ATOM 5601  H HB2  . GLU B 2 4  ? -6.331  7.302   -0.539  1.00 0.00 ? 28  GLU B HB2  7  
ATOM 5602  H HB3  . GLU B 2 4  ? -5.038  8.460   -0.324  1.00 0.00 ? 28  GLU B HB3  7  
ATOM 5603  H HG2  . GLU B 2 4  ? -6.550  10.298  -0.526  1.00 0.00 ? 28  GLU B HG2  7  
ATOM 5604  H HG3  . GLU B 2 4  ? -7.866  9.219   -0.985  1.00 0.00 ? 28  GLU B HG3  7  
ATOM 5605  N N    . MET B 2 5  ? -6.582  7.427   -4.351  1.00 0.00 ? 29  MET B N    7  
ATOM 5606  C CA   . MET B 2 5  ? -7.559  6.812   -5.240  1.00 0.00 ? 29  MET B CA   7  
ATOM 5607  C C    . MET B 2 5  ? -7.475  5.298   -5.171  1.00 0.00 ? 29  MET B C    7  
ATOM 5608  O O    . MET B 2 5  ? -8.070  4.589   -5.983  1.00 0.00 ? 29  MET B O    7  
ATOM 5609  C CB   . MET B 2 5  ? -7.347  7.295   -6.677  1.00 0.00 ? 29  MET B CB   7  
ATOM 5610  C CG   . MET B 2 5  ? -8.527  7.025   -7.597  1.00 0.00 ? 29  MET B CG   7  
ATOM 5611  S SD   . MET B 2 5  ? -8.246  7.620   -9.276  1.00 0.00 ? 29  MET B SD   7  
ATOM 5612  C CE   . MET B 2 5  ? -9.792  7.168   -10.060 1.00 0.00 ? 29  MET B CE   7  
ATOM 5613  H H    . MET B 2 5  ? -5.715  7.708   -4.705  1.00 0.00 ? 29  MET B H    7  
ATOM 5614  H HA   . MET B 2 5  ? -8.534  7.106   -4.903  1.00 0.00 ? 29  MET B HA   7  
ATOM 5615  H HB2  . MET B 2 5  ? -7.162  8.361   -6.664  1.00 0.00 ? 29  MET B HB2  7  
ATOM 5616  H HB3  . MET B 2 5  ? -6.480  6.794   -7.082  1.00 0.00 ? 29  MET B HB3  7  
ATOM 5617  H HG2  . MET B 2 5  ? -8.701  5.960   -7.634  1.00 0.00 ? 29  MET B HG2  7  
ATOM 5618  H HG3  . MET B 2 5  ? -9.399  7.518   -7.196  1.00 0.00 ? 29  MET B HG3  7  
ATOM 5619  H HE1  . MET B 2 5  ? -10.610 7.656   -9.550  1.00 0.00 ? 29  MET B HE1  7  
ATOM 5620  H HE2  . MET B 2 5  ? -9.923  6.098   -10.007 1.00 0.00 ? 29  MET B HE2  7  
ATOM 5621  H HE3  . MET B 2 5  ? -9.776  7.479   -11.093 1.00 0.00 ? 29  MET B HE3  7  
ATOM 5622  N N    . ARG B 2 6  ? -6.751  4.821   -4.173  1.00 0.00 ? 30  ARG B N    7  
ATOM 5623  C CA   . ARG B 2 6  ? -6.568  3.405   -3.953  1.00 0.00 ? 30  ARG B CA   7  
ATOM 5624  C C    . ARG B 2 6  ? -6.101  2.670   -5.207  1.00 0.00 ? 30  ARG B C    7  
ATOM 5625  O O    . ARG B 2 6  ? -6.019  3.244   -6.293  1.00 0.00 ? 30  ARG B O    7  
ATOM 5626  C CB   . ARG B 2 6  ? -7.865  2.824   -3.444  1.00 0.00 ? 30  ARG B CB   7  
ATOM 5627  C CG   . ARG B 2 6  ? -7.877  2.644   -1.942  1.00 0.00 ? 30  ARG B CG   7  
ATOM 5628  C CD   . ARG B 2 6  ? -8.530  1.348   -1.551  1.00 0.00 ? 30  ARG B CD   7  
ATOM 5629  N NE   . ARG B 2 6  ? -9.020  1.366   -0.178  1.00 0.00 ? 30  ARG B NE   7  
ATOM 5630  C CZ   . ARG B 2 6  ? -8.235  1.429   0.894   1.00 0.00 ? 30  ARG B CZ   7  
ATOM 5631  N NH1  . ARG B 2 6  ? -6.918  1.491   0.757   1.00 0.00 ? 30  ARG B NH1  7  
ATOM 5632  N NH2  . ARG B 2 6  ? -8.770  1.434   2.107   1.00 0.00 ? 30  ARG B NH2  7  
ATOM 5633  H H    . ARG B 2 6  ? -6.356  5.440   -3.547  1.00 0.00 ? 30  ARG B H    7  
ATOM 5634  H HA   . ARG B 2 6  ? -5.821  3.282   -3.183  1.00 0.00 ? 30  ARG B HA   7  
ATOM 5635  H HB2  . ARG B 2 6  ? -8.677  3.482   -3.714  1.00 0.00 ? 30  ARG B HB2  7  
ATOM 5636  H HB3  . ARG B 2 6  ? -8.014  1.880   -3.906  1.00 0.00 ? 30  ARG B HB3  7  
ATOM 5637  H HG2  . ARG B 2 6  ? -6.860  2.640   -1.584  1.00 0.00 ? 30  ARG B HG2  7  
ATOM 5638  H HG3  . ARG B 2 6  ? -8.419  3.462   -1.493  1.00 0.00 ? 30  ARG B HG3  7  
ATOM 5639  H HD2  . ARG B 2 6  ? -9.355  1.180   -2.213  1.00 0.00 ? 30  ARG B HD2  7  
ATOM 5640  H HD3  . ARG B 2 6  ? -7.807  0.558   -1.660  1.00 0.00 ? 30  ARG B HD3  7  
ATOM 5641  H HE   . ARG B 2 6  ? -9.988  1.328   -0.048  1.00 0.00 ? 30  ARG B HE   7  
ATOM 5642  H HH11 . ARG B 2 6  ? -6.510  1.491   -0.156  1.00 0.00 ? 30  ARG B HH11 7  
ATOM 5643  H HH12 . ARG B 2 6  ? -6.333  1.538   1.566   1.00 0.00 ? 30  ARG B HH12 7  
ATOM 5644  H HH21 . ARG B 2 6  ? -9.762  1.390   2.216   1.00 0.00 ? 30  ARG B HH21 7  
ATOM 5645  H HH22 . ARG B 2 6  ? -8.180  1.481   2.914   1.00 0.00 ? 30  ARG B HH22 7  
ATOM 5646  N N    . GLU B 2 7  ? -5.787  1.390   -5.031  1.00 0.00 ? 31  GLU B N    7  
ATOM 5647  C CA   . GLU B 2 7  ? -5.314  0.537   -6.117  1.00 0.00 ? 31  GLU B CA   7  
ATOM 5648  C C    . GLU B 2 7  ? -4.902  -0.810  -5.573  1.00 0.00 ? 31  GLU B C    7  
ATOM 5649  O O    . GLU B 2 7  ? -4.282  -0.900  -4.520  1.00 0.00 ? 31  GLU B O    7  
ATOM 5650  C CB   . GLU B 2 7  ? -4.132  1.177   -6.843  1.00 0.00 ? 31  GLU B CB   7  
ATOM 5651  C CG   . GLU B 2 7  ? -3.491  0.264   -7.873  1.00 0.00 ? 31  GLU B CG   7  
ATOM 5652  C CD   . GLU B 2 7  ? -4.332  0.115   -9.126  1.00 0.00 ? 31  GLU B CD   7  
ATOM 5653  O OE1  . GLU B 2 7  ? -4.227  0.982   -10.019 1.00 0.00 ? 31  GLU B OE1  7  
ATOM 5654  O OE2  . GLU B 2 7  ? -5.096  -0.870  -9.215  1.00 0.00 ? 31  GLU B OE2  7  
ATOM 5655  H H    . GLU B 2 7  ? -5.876  1.004   -4.134  1.00 0.00 ? 31  GLU B H    7  
ATOM 5656  H HA   . GLU B 2 7  ? -6.124  0.383   -6.813  1.00 0.00 ? 31  GLU B HA   7  
ATOM 5657  H HB2  . GLU B 2 7  ? -4.472  2.069   -7.347  1.00 0.00 ? 31  GLU B HB2  7  
ATOM 5658  H HB3  . GLU B 2 7  ? -3.380  1.448   -6.117  1.00 0.00 ? 31  GLU B HB3  7  
ATOM 5659  H HG2  . GLU B 2 7  ? -2.534  0.670   -8.144  1.00 0.00 ? 31  GLU B HG2  7  
ATOM 5660  H HG3  . GLU B 2 7  ? -3.353  -0.712  -7.433  1.00 0.00 ? 31  GLU B HG3  7  
ATOM 5661  N N    . LYS B 2 8  ? -5.245  -1.848  -6.308  1.00 0.00 ? 32  LYS B N    7  
ATOM 5662  C CA   . LYS B 2 8  ? -4.933  -3.201  -5.910  1.00 0.00 ? 32  LYS B CA   7  
ATOM 5663  C C    . LYS B 2 8  ? -3.436  -3.464  -5.961  1.00 0.00 ? 32  LYS B C    7  
ATOM 5664  O O    . LYS B 2 8  ? -2.855  -3.676  -7.026  1.00 0.00 ? 32  LYS B O    7  
ATOM 5665  C CB   . LYS B 2 8  ? -5.692  -4.158  -6.804  1.00 0.00 ? 32  LYS B CB   7  
ATOM 5666  C CG   . LYS B 2 8  ? -7.151  -3.776  -6.944  1.00 0.00 ? 32  LYS B CG   7  
ATOM 5667  C CD   . LYS B 2 8  ? -7.966  -4.896  -7.570  1.00 0.00 ? 32  LYS B CD   7  
ATOM 5668  C CE   . LYS B 2 8  ? -9.445  -4.720  -7.306  1.00 0.00 ? 32  LYS B CE   7  
ATOM 5669  N NZ   . LYS B 2 8  ? -10.264 -5.749  -8.005  1.00 0.00 ? 32  LYS B NZ   7  
ATOM 5670  H H    . LYS B 2 8  ? -5.724  -1.702  -7.147  1.00 0.00 ? 32  LYS B H    7  
ATOM 5671  H HA   . LYS B 2 8  ? -5.271  -3.331  -4.895  1.00 0.00 ? 32  LYS B HA   7  
ATOM 5672  H HB2  . LYS B 2 8  ? -5.239  -4.163  -7.780  1.00 0.00 ? 32  LYS B HB2  7  
ATOM 5673  H HB3  . LYS B 2 8  ? -5.640  -5.141  -6.382  1.00 0.00 ? 32  LYS B HB3  7  
ATOM 5674  H HG2  . LYS B 2 8  ? -7.546  -3.547  -5.967  1.00 0.00 ? 32  LYS B HG2  7  
ATOM 5675  H HG3  . LYS B 2 8  ? -7.221  -2.898  -7.566  1.00 0.00 ? 32  LYS B HG3  7  
ATOM 5676  H HD2  . LYS B 2 8  ? -7.802  -4.895  -8.634  1.00 0.00 ? 32  LYS B HD2  7  
ATOM 5677  H HD3  . LYS B 2 8  ? -7.643  -5.839  -7.155  1.00 0.00 ? 32  LYS B HD3  7  
ATOM 5678  H HE2  . LYS B 2 8  ? -9.610  -4.802  -6.247  1.00 0.00 ? 32  LYS B HE2  7  
ATOM 5679  H HE3  . LYS B 2 8  ? -9.746  -3.739  -7.642  1.00 0.00 ? 32  LYS B HE3  7  
ATOM 5680  H HZ1  . LYS B 2 8  ? -10.012 -6.698  -7.664  1.00 0.00 ? 32  LYS B HZ1  7  
ATOM 5681  H HZ2  . LYS B 2 8  ? -10.094 -5.703  -9.030  1.00 0.00 ? 32  LYS B HZ2  7  
ATOM 5682  H HZ3  . LYS B 2 8  ? -11.275 -5.584  -7.824  1.00 0.00 ? 32  LYS B HZ3  7  
ATOM 5683  N N    . LEU B 2 9  ? -2.832  -3.442  -4.786  1.00 0.00 ? 33  LEU B N    7  
ATOM 5684  C CA   . LEU B 2 9  ? -1.405  -3.661  -4.628  1.00 0.00 ? 33  LEU B CA   7  
ATOM 5685  C C    . LEU B 2 9  ? -1.108  -5.082  -4.186  1.00 0.00 ? 33  LEU B C    7  
ATOM 5686  O O    . LEU B 2 9  ? -1.207  -5.418  -3.007  1.00 0.00 ? 33  LEU B O    7  
ATOM 5687  C CB   . LEU B 2 9  ? -0.864  -2.670  -3.631  1.00 0.00 ? 33  LEU B CB   7  
ATOM 5688  C CG   . LEU B 2 9  ? -1.541  -1.314  -3.672  1.00 0.00 ? 33  LEU B CG   7  
ATOM 5689  C CD1  . LEU B 2 9  ? -1.078  -0.433  -2.525  1.00 0.00 ? 33  LEU B CD1  7  
ATOM 5690  C CD2  . LEU B 2 9  ? -1.275  -0.653  -5.016  1.00 0.00 ? 33  LEU B CD2  7  
ATOM 5691  H H    . LEU B 2 9  ? -3.365  -3.254  -3.992  1.00 0.00 ? 33  LEU B H    7  
ATOM 5692  H HA   . LEU B 2 9  ? -0.919  -3.482  -5.565  1.00 0.00 ? 33  LEU B HA   7  
ATOM 5693  H HB2  . LEU B 2 9  ? -0.949  -3.081  -2.640  1.00 0.00 ? 33  LEU B HB2  7  
ATOM 5694  H HB3  . LEU B 2 9  ? 0.167   -2.531  -3.862  1.00 0.00 ? 33  LEU B HB3  7  
ATOM 5695  H HG   . LEU B 2 9  ? -2.598  -1.458  -3.571  1.00 0.00 ? 33  LEU B HG   7  
ATOM 5696  H HD11 . LEU B 2 9  ? -1.876  0.238   -2.245  1.00 0.00 ? 33  LEU B HD11 7  
ATOM 5697  H HD12 . LEU B 2 9  ? -0.220  0.143   -2.835  1.00 0.00 ? 33  LEU B HD12 7  
ATOM 5698  H HD13 . LEU B 2 9  ? -0.812  -1.050  -1.680  1.00 0.00 ? 33  LEU B HD13 7  
ATOM 5699  H HD21 . LEU B 2 9  ? -2.175  -0.171  -5.366  1.00 0.00 ? 33  LEU B HD21 7  
ATOM 5700  H HD22 . LEU B 2 9  ? -0.965  -1.411  -5.731  1.00 0.00 ? 33  LEU B HD22 7  
ATOM 5701  H HD23 . LEU B 2 9  ? -0.489  0.081   -4.907  1.00 0.00 ? 33  LEU B HD23 7  
ATOM 5702  N N    . CYS B 2 10 ? -0.751  -5.916  -5.152  1.00 0.00 ? 34  CYS B N    7  
ATOM 5703  C CA   . CYS B 2 10 ? -0.438  -7.309  -4.876  1.00 0.00 ? 34  CYS B CA   7  
ATOM 5704  C C    . CYS B 2 10 ? 1.061   -7.525  -4.779  1.00 0.00 ? 34  CYS B C    7  
ATOM 5705  O O    . CYS B 2 10 ? 1.742   -7.736  -5.783  1.00 0.00 ? 34  CYS B O    7  
ATOM 5706  C CB   . CYS B 2 10 ? -1.032  -8.204  -5.951  1.00 0.00 ? 34  CYS B CB   7  
ATOM 5707  S SG   . CYS B 2 10 ? -1.457  -9.877  -5.371  1.00 0.00 ? 34  CYS B SG   7  
ATOM 5708  H H    . CYS B 2 10 ? -0.697  -5.584  -6.071  1.00 0.00 ? 34  CYS B H    7  
ATOM 5709  H HA   . CYS B 2 10 ? -0.883  -7.562  -3.927  1.00 0.00 ? 34  CYS B HA   7  
ATOM 5710  H HB2  . CYS B 2 10 ? -1.932  -7.746  -6.312  1.00 0.00 ? 34  CYS B HB2  7  
ATOM 5711  H HB3  . CYS B 2 10 ? -0.326  -8.301  -6.763  1.00 0.00 ? 34  CYS B HB3  7  
ATOM 5712  N N    . GLY B 2 11 ? 1.554   -7.475  -3.556  1.00 0.00 ? 35  GLY B N    7  
ATOM 5713  C CA   . GLY B 2 11 ? 2.972   -7.660  -3.299  1.00 0.00 ? 35  GLY B CA   7  
ATOM 5714  C C    . GLY B 2 11 ? 3.837   -6.623  -3.989  1.00 0.00 ? 35  GLY B C    7  
ATOM 5715  O O    . GLY B 2 11 ? 4.275   -5.665  -3.357  1.00 0.00 ? 35  GLY B O    7  
ATOM 5716  H H    . GLY B 2 11 ? 0.938   -7.317  -2.812  1.00 0.00 ? 35  GLY B H    7  
ATOM 5717  H HA2  . GLY B 2 11 ? 3.140   -7.594  -2.234  1.00 0.00 ? 35  GLY B HA2  7  
ATOM 5718  H HA3  . GLY B 2 11 ? 3.264   -8.638  -3.632  1.00 0.00 ? 35  GLY B HA3  7  
ATOM 5719  N N    . HIS B 2 12 ? 4.106   -6.816  -5.281  1.00 0.00 ? 36  HIS B N    7  
ATOM 5720  C CA   . HIS B 2 12 ? 4.921   -5.876  -6.029  1.00 0.00 ? 36  HIS B CA   7  
ATOM 5721  C C    . HIS B 2 12 ? 4.232   -4.524  -6.164  1.00 0.00 ? 36  HIS B C    7  
ATOM 5722  O O    . HIS B 2 12 ? 4.818   -3.507  -5.822  1.00 0.00 ? 36  HIS B O    7  
ATOM 5723  C CB   . HIS B 2 12 ? 5.286   -6.424  -7.400  1.00 0.00 ? 36  HIS B CB   7  
ATOM 5724  C CG   . HIS B 2 12 ? 6.595   -5.895  -7.880  1.00 0.00 ? 36  HIS B CG   7  
ATOM 5725  N ND1  . HIS B 2 12 ? 6.980   -5.871  -9.198  1.00 0.00 ? 36  HIS B ND1  7  
ATOM 5726  C CD2  . HIS B 2 12 ? 7.620   -5.350  -7.173  1.00 0.00 ? 36  HIS B CD2  7  
ATOM 5727  C CE1  . HIS B 2 12 ? 8.201   -5.325  -9.258  1.00 0.00 ? 36  HIS B CE1  7  
ATOM 5728  N NE2  . HIS B 2 12 ? 8.636   -4.991  -8.055  1.00 0.00 ? 36  HIS B NE2  7  
ATOM 5729  H H    . HIS B 2 12 ? 3.771   -7.613  -5.730  1.00 0.00 ? 36  HIS B H    7  
ATOM 5730  H HA   . HIS B 2 12 ? 5.830   -5.732  -5.466  1.00 0.00 ? 36  HIS B HA   7  
ATOM 5731  H HB2  . HIS B 2 12 ? 5.353   -7.502  -7.349  1.00 0.00 ? 36  HIS B HB2  7  
ATOM 5732  H HB3  . HIS B 2 12 ? 4.526   -6.143  -8.113  1.00 0.00 ? 36  HIS B HB3  7  
ATOM 5733  H HD1  . HIS B 2 12 ? 6.455   -6.196  -9.960  1.00 0.00 ? 36  HIS B HD1  7  
ATOM 5734  H HD2  . HIS B 2 12 ? 7.646   -5.207  -6.092  1.00 0.00 ? 36  HIS B HD2  7  
ATOM 5735  H HE1  . HIS B 2 12 ? 8.749   -5.167  -10.172 1.00 0.00 ? 36  HIS B HE1  7  
ATOM 5736  N N    . HIS B 2 13 ? 3.009   -4.492  -6.693  1.00 0.00 ? 37  HIS B N    7  
ATOM 5737  C CA   . HIS B 2 13 ? 2.291   -3.222  -6.787  1.00 0.00 ? 37  HIS B CA   7  
ATOM 5738  C C    . HIS B 2 13 ? 2.285   -2.610  -5.418  1.00 0.00 ? 37  HIS B C    7  
ATOM 5739  O O    . HIS B 2 13 ? 2.382   -1.398  -5.237  1.00 0.00 ? 37  HIS B O    7  
ATOM 5740  C CB   . HIS B 2 13 ? 0.847   -3.417  -7.223  1.00 0.00 ? 37  HIS B CB   7  
ATOM 5741  C CG   . HIS B 2 13 ? 0.674   -3.463  -8.691  1.00 0.00 ? 37  HIS B CG   7  
ATOM 5742  N ND1  . HIS B 2 13 ? -0.275  -2.746  -9.374  1.00 0.00 ? 37  HIS B ND1  7  
ATOM 5743  C CD2  . HIS B 2 13 ? 1.361   -4.164  -9.610  1.00 0.00 ? 37  HIS B CD2  7  
ATOM 5744  C CE1  . HIS B 2 13 ? -0.142  -3.029  -10.671 1.00 0.00 ? 37  HIS B CE1  7  
ATOM 5745  N NE2  . HIS B 2 13 ? 0.842   -3.889  -10.874 1.00 0.00 ? 37  HIS B NE2  7  
ATOM 5746  H H    . HIS B 2 13 ? 2.592   -5.318  -7.018  1.00 0.00 ? 37  HIS B H    7  
ATOM 5747  H HA   . HIS B 2 13 ? 2.808   -2.574  -7.479  1.00 0.00 ? 37  HIS B HA   7  
ATOM 5748  H HB2  . HIS B 2 13 ? 0.478   -4.346  -6.817  1.00 0.00 ? 37  HIS B HB2  7  
ATOM 5749  H HB3  . HIS B 2 13 ? 0.253   -2.598  -6.839  1.00 0.00 ? 37  HIS B HB3  7  
ATOM 5750  H HD1  . HIS B 2 13 ? -0.934  -2.137  -8.980  1.00 0.00 ? 37  HIS B HD1  7  
ATOM 5751  H HD2  . HIS B 2 13 ? 2.185   -4.828  -9.399  1.00 0.00 ? 37  HIS B HD2  7  
ATOM 5752  H HE1  . HIS B 2 13 ? -0.755  -2.605  -11.447 1.00 0.00 ? 37  HIS B HE1  7  
ATOM 5753  N N    . PHE B 2 14 ? 2.157   -3.500  -4.458  1.00 0.00 ? 38  PHE B N    7  
ATOM 5754  C CA   . PHE B 2 14 ? 2.146   -3.142  -3.073  1.00 0.00 ? 38  PHE B CA   7  
ATOM 5755  C C    . PHE B 2 14 ? 3.507   -2.634  -2.665  1.00 0.00 ? 38  PHE B C    7  
ATOM 5756  O O    . PHE B 2 14 ? 3.632   -1.807  -1.766  1.00 0.00 ? 38  PHE B O    7  
ATOM 5757  C CB   . PHE B 2 14 ? 1.713   -4.349  -2.254  1.00 0.00 ? 38  PHE B CB   7  
ATOM 5758  C CG   . PHE B 2 14 ? 1.884   -4.123  -0.805  1.00 0.00 ? 38  PHE B CG   7  
ATOM 5759  C CD1  . PHE B 2 14 ? 1.318   -3.005  -0.237  1.00 0.00 ? 38  PHE B CD1  7  
ATOM 5760  C CD2  . PHE B 2 14 ? 2.629   -4.989  -0.026  1.00 0.00 ? 38  PHE B CD2  7  
ATOM 5761  C CE1  . PHE B 2 14 ? 1.488   -2.744  1.104   1.00 0.00 ? 38  PHE B CE1  7  
ATOM 5762  C CE2  . PHE B 2 14 ? 2.810   -4.735  1.317   1.00 0.00 ? 38  PHE B CE2  7  
ATOM 5763  C CZ   . PHE B 2 14 ? 2.240   -3.609  1.884   1.00 0.00 ? 38  PHE B CZ   7  
ATOM 5764  H H    . PHE B 2 14 ? 2.068   -4.445  -4.700  1.00 0.00 ? 38  PHE B H    7  
ATOM 5765  H HA   . PHE B 2 14 ? 1.434   -2.346  -2.937  1.00 0.00 ? 38  PHE B HA   7  
ATOM 5766  H HB2  . PHE B 2 14 ? 0.669   -4.546  -2.440  1.00 0.00 ? 38  PHE B HB2  7  
ATOM 5767  H HB3  . PHE B 2 14 ? 2.295   -5.205  -2.543  1.00 0.00 ? 38  PHE B HB3  7  
ATOM 5768  H HD1  . PHE B 2 14 ? 0.722   -2.337  -0.868  1.00 0.00 ? 38  PHE B HD1  7  
ATOM 5769  H HD2  . PHE B 2 14 ? 3.069   -5.874  -0.479  1.00 0.00 ? 38  PHE B HD2  7  
ATOM 5770  H HE1  . PHE B 2 14 ? 1.045   -1.863  1.540   1.00 0.00 ? 38  PHE B HE1  7  
ATOM 5771  H HE2  . PHE B 2 14 ? 3.389   -5.417  1.923   1.00 0.00 ? 38  PHE B HE2  7  
ATOM 5772  H HZ   . PHE B 2 14 ? 2.380   -3.405  2.935   1.00 0.00 ? 38  PHE B HZ   7  
ATOM 5773  N N    . VAL B 2 15 ? 4.518   -3.136  -3.340  1.00 0.00 ? 39  VAL B N    7  
ATOM 5774  C CA   . VAL B 2 15 ? 5.876   -2.718  -3.096  1.00 0.00 ? 39  VAL B CA   7  
ATOM 5775  C C    . VAL B 2 15 ? 6.082   -1.318  -3.656  1.00 0.00 ? 39  VAL B C    7  
ATOM 5776  O O    . VAL B 2 15 ? 6.299   -0.377  -2.897  1.00 0.00 ? 39  VAL B O    7  
ATOM 5777  C CB   . VAL B 2 15 ? 6.876   -3.729  -3.712  1.00 0.00 ? 39  VAL B CB   7  
ATOM 5778  C CG1  . VAL B 2 15 ? 8.120   -3.049  -4.256  1.00 0.00 ? 39  VAL B CG1  7  
ATOM 5779  C CG2  . VAL B 2 15 ? 7.257   -4.785  -2.686  1.00 0.00 ? 39  VAL B CG2  7  
ATOM 5780  H H    . VAL B 2 15 ? 4.342   -3.815  -4.022  1.00 0.00 ? 39  VAL B H    7  
ATOM 5781  H HA   . VAL B 2 15 ? 6.024   -2.684  -2.028  1.00 0.00 ? 39  VAL B HA   7  
ATOM 5782  H HB   . VAL B 2 15 ? 6.385   -4.228  -4.532  1.00 0.00 ? 39  VAL B HB   7  
ATOM 5783  H HG11 . VAL B 2 15 ? 8.087   -3.046  -5.336  1.00 0.00 ? 39  VAL B HG11 7  
ATOM 5784  H HG12 . VAL B 2 15 ? 8.992   -3.583  -3.922  1.00 0.00 ? 39  VAL B HG12 7  
ATOM 5785  H HG13 . VAL B 2 15 ? 8.167   -2.033  -3.896  1.00 0.00 ? 39  VAL B HG13 7  
ATOM 5786  H HG21 . VAL B 2 15 ? 6.474   -4.869  -1.947  1.00 0.00 ? 39  VAL B HG21 7  
ATOM 5787  H HG22 . VAL B 2 15 ? 8.180   -4.501  -2.206  1.00 0.00 ? 39  VAL B HG22 7  
ATOM 5788  H HG23 . VAL B 2 15 ? 7.387   -5.735  -3.181  1.00 0.00 ? 39  VAL B HG23 7  
ATOM 5789  N N    . ARG B 2 16 ? 5.998   -1.179  -4.980  1.00 0.00 ? 40  ARG B N    7  
ATOM 5790  C CA   . ARG B 2 16 ? 6.161   0.113   -5.618  1.00 0.00 ? 40  ARG B CA   7  
ATOM 5791  C C    . ARG B 2 16 ? 5.317   1.166   -4.931  1.00 0.00 ? 40  ARG B C    7  
ATOM 5792  O O    . ARG B 2 16 ? 5.863   2.139   -4.441  1.00 0.00 ? 40  ARG B O    7  
ATOM 5793  C CB   . ARG B 2 16 ? 5.794   0.037   -7.097  1.00 0.00 ? 40  ARG B CB   7  
ATOM 5794  C CG   . ARG B 2 16 ? 6.678   -0.907  -7.890  1.00 0.00 ? 40  ARG B CG   7  
ATOM 5795  C CD   . ARG B 2 16 ? 5.961   -2.199  -8.219  1.00 0.00 ? 40  ARG B CD   7  
ATOM 5796  N NE   . ARG B 2 16 ? 6.486   -2.823  -9.429  1.00 0.00 ? 40  ARG B NE   7  
ATOM 5797  C CZ   . ARG B 2 16 ? 5.721   -3.368  -10.371 1.00 0.00 ? 40  ARG B CZ   7  
ATOM 5798  N NH1  . ARG B 2 16 ? 4.401   -3.363  -10.243 1.00 0.00 ? 40  ARG B NH1  7  
ATOM 5799  N NH2  . ARG B 2 16 ? 6.276   -3.919  -11.442 1.00 0.00 ? 40  ARG B NH2  7  
ATOM 5800  H H    . ARG B 2 16 ? 5.838   -1.966  -5.541  1.00 0.00 ? 40  ARG B H    7  
ATOM 5801  H HA   . ARG B 2 16 ? 7.202   0.402   -5.526  1.00 0.00 ? 40  ARG B HA   7  
ATOM 5802  H HB2  . ARG B 2 16 ? 4.773   -0.300  -7.187  1.00 0.00 ? 40  ARG B HB2  7  
ATOM 5803  H HB3  . ARG B 2 16 ? 5.880   1.022   -7.528  1.00 0.00 ? 40  ARG B HB3  7  
ATOM 5804  H HG2  . ARG B 2 16 ? 6.962   -0.431  -8.804  1.00 0.00 ? 40  ARG B HG2  7  
ATOM 5805  H HG3  . ARG B 2 16 ? 7.559   -1.134  -7.310  1.00 0.00 ? 40  ARG B HG3  7  
ATOM 5806  H HD2  . ARG B 2 16 ? 6.091   -2.875  -7.392  1.00 0.00 ? 40  ARG B HD2  7  
ATOM 5807  H HD3  . ARG B 2 16 ? 4.911   -1.991  -8.354  1.00 0.00 ? 40  ARG B HD3  7  
ATOM 5808  H HE   . ARG B 2 16 ? 7.459   -2.837  -9.547  1.00 0.00 ? 40  ARG B HE   7  
ATOM 5809  H HH11 . ARG B 2 16 ? 3.978   -2.948  -9.438  1.00 0.00 ? 40  ARG B HH11 7  
ATOM 5810  H HH12 . ARG B 2 16 ? 3.828   -3.775  -10.953 1.00 0.00 ? 40  ARG B HH12 7  
ATOM 5811  H HH21 . ARG B 2 16 ? 7.272   -3.924  -11.543 1.00 0.00 ? 40  ARG B HH21 7  
ATOM 5812  H HH22 . ARG B 2 16 ? 5.701   -4.330  -12.148 1.00 0.00 ? 40  ARG B HH22 7  
ATOM 5813  N N    . ALA B 2 17 ? 3.994   0.978   -4.865  1.00 0.00 ? 41  ALA B N    7  
ATOM 5814  C CA   . ALA B 2 17 ? 3.158   1.971   -4.226  1.00 0.00 ? 41  ALA B CA   7  
ATOM 5815  C C    . ALA B 2 17 ? 3.724   2.305   -2.853  1.00 0.00 ? 41  ALA B C    7  
ATOM 5816  O O    . ALA B 2 17 ? 3.889   3.467   -2.528  1.00 0.00 ? 41  ALA B O    7  
ATOM 5817  C CB   . ALA B 2 17 ? 1.707   1.493   -4.133  1.00 0.00 ? 41  ALA B CB   7  
ATOM 5818  H H    . ALA B 2 17 ? 3.583   0.158   -5.222  1.00 0.00 ? 41  ALA B H    7  
ATOM 5819  H HA   . ALA B 2 17 ? 3.186   2.875   -4.841  1.00 0.00 ? 41  ALA B HA   7  
ATOM 5820  H HB1  . ALA B 2 17 ? 1.068   2.334   -3.903  1.00 0.00 ? 41  ALA B HB1  7  
ATOM 5821  H HB2  . ALA B 2 17 ? 1.608   0.745   -3.353  1.00 0.00 ? 41  ALA B HB2  7  
ATOM 5822  H HB3  . ALA B 2 17 ? 1.409   1.066   -5.078  1.00 0.00 ? 41  ALA B HB3  7  
ATOM 5823  N N    . LEU B 2 18 ? 4.072   1.280   -2.070  1.00 0.00 ? 42  LEU B N    7  
ATOM 5824  C CA   . LEU B 2 18 ? 4.634   1.500   -0.736  1.00 0.00 ? 42  LEU B CA   7  
ATOM 5825  C C    . LEU B 2 18 ? 5.732   2.555   -0.793  1.00 0.00 ? 42  LEU B C    7  
ATOM 5826  O O    . LEU B 2 18 ? 5.856   3.394   0.097   1.00 0.00 ? 42  LEU B O    7  
ATOM 5827  C CB   . LEU B 2 18 ? 5.203   0.192   -0.181  1.00 0.00 ? 42  LEU B CB   7  
ATOM 5828  C CG   . LEU B 2 18 ? 4.900   -0.090  1.290   1.00 0.00 ? 42  LEU B CG   7  
ATOM 5829  C CD1  . LEU B 2 18 ? 5.553   -1.394  1.721   1.00 0.00 ? 42  LEU B CD1  7  
ATOM 5830  C CD2  . LEU B 2 18 ? 5.377   1.058   2.157   1.00 0.00 ? 42  LEU B CD2  7  
ATOM 5831  H H    . LEU B 2 18 ? 3.949   0.358   -2.393  1.00 0.00 ? 42  LEU B H    7  
ATOM 5832  H HA   . LEU B 2 18 ? 3.838   1.851   -0.091  1.00 0.00 ? 42  LEU B HA   7  
ATOM 5833  H HB2  . LEU B 2 18 ? 4.812   -0.621  -0.767  1.00 0.00 ? 42  LEU B HB2  7  
ATOM 5834  H HB3  . LEU B 2 18 ? 6.275   0.214   -0.304  1.00 0.00 ? 42  LEU B HB3  7  
ATOM 5835  H HG   . LEU B 2 18 ? 3.832   -0.190  1.421   1.00 0.00 ? 42  LEU B HG   7  
ATOM 5836  H HD11 . LEU B 2 18 ? 4.980   -2.227  1.338   1.00 0.00 ? 42  LEU B HD11 7  
ATOM 5837  H HD12 . LEU B 2 18 ? 5.585   -1.443  2.798   1.00 0.00 ? 42  LEU B HD12 7  
ATOM 5838  H HD13 . LEU B 2 18 ? 6.558   -1.439  1.330   1.00 0.00 ? 42  LEU B HD13 7  
ATOM 5839  H HD21 . LEU B 2 18 ? 4.547   1.711   2.382   1.00 0.00 ? 42  LEU B HD21 7  
ATOM 5840  H HD22 . LEU B 2 18 ? 6.132   1.610   1.621   1.00 0.00 ? 42  LEU B HD22 7  
ATOM 5841  H HD23 . LEU B 2 18 ? 5.794   0.672   3.075   1.00 0.00 ? 42  LEU B HD23 7  
ATOM 5842  N N    . VAL B 2 19 ? 6.522   2.493   -1.857  1.00 0.00 ? 43  VAL B N    7  
ATOM 5843  C CA   . VAL B 2 19 ? 7.621   3.432   -2.073  1.00 0.00 ? 43  VAL B CA   7  
ATOM 5844  C C    . VAL B 2 19 ? 7.096   4.740   -2.626  1.00 0.00 ? 43  VAL B C    7  
ATOM 5845  O O    . VAL B 2 19 ? 7.262   5.793   -2.010  1.00 0.00 ? 43  VAL B O    7  
ATOM 5846  C CB   . VAL B 2 19 ? 8.674   2.857   -3.046  1.00 0.00 ? 43  VAL B CB   7  
ATOM 5847  C CG1  . VAL B 2 19 ? 10.070  3.269   -2.638  1.00 0.00 ? 43  VAL B CG1  7  
ATOM 5848  C CG2  . VAL B 2 19 ? 8.597   1.357   -3.086  1.00 0.00 ? 43  VAL B CG2  7  
ATOM 5849  H H    . VAL B 2 19 ? 6.361   1.791   -2.513  1.00 0.00 ? 43  VAL B H    7  
ATOM 5850  H HA   . VAL B 2 19 ? 8.082   3.625   -1.118  1.00 0.00 ? 43  VAL B HA   7  
ATOM 5851  H HB   . VAL B 2 19 ? 8.471   3.226   -4.043  1.00 0.00 ? 43  VAL B HB   7  
ATOM 5852  H HG11 . VAL B 2 19 ? 10.678  3.413   -3.519  1.00 0.00 ? 43  VAL B HG11 7  
ATOM 5853  H HG12 . VAL B 2 19 ? 10.495  2.477   -2.029  1.00 0.00 ? 43  VAL B HG12 7  
ATOM 5854  H HG13 . VAL B 2 19 ? 10.028  4.185   -2.067  1.00 0.00 ? 43  VAL B HG13 7  
ATOM 5855  H HG21 . VAL B 2 19 ? 7.633   1.052   -3.458  1.00 0.00 ? 43  VAL B HG21 7  
ATOM 5856  H HG22 . VAL B 2 19 ? 8.743   0.976   -2.083  1.00 0.00 ? 43  VAL B HG22 7  
ATOM 5857  H HG23 . VAL B 2 19 ? 9.372   0.975   -3.733  1.00 0.00 ? 43  VAL B HG23 7  
ATOM 5858  N N    . ARG B 2 20 ? 6.504   4.657   -3.813  1.00 0.00 ? 44  ARG B N    7  
ATOM 5859  C CA   . ARG B 2 20 ? 5.882   5.804   -4.465  1.00 0.00 ? 44  ARG B CA   7  
ATOM 5860  C C    . ARG B 2 20 ? 5.318   6.728   -3.400  1.00 0.00 ? 44  ARG B C    7  
ATOM 5861  O O    . ARG B 2 20 ? 5.410   7.954   -3.473  1.00 0.00 ? 44  ARG B O    7  
ATOM 5862  C CB   . ARG B 2 20 ? 4.736   5.307   -5.353  1.00 0.00 ? 44  ARG B CB   7  
ATOM 5863  C CG   . ARG B 2 20 ? 5.142   4.226   -6.331  1.00 0.00 ? 44  ARG B CG   7  
ATOM 5864  C CD   . ARG B 2 20 ? 4.625   4.524   -7.722  1.00 0.00 ? 44  ARG B CD   7  
ATOM 5865  N NE   . ARG B 2 20 ? 3.825   3.426   -8.262  1.00 0.00 ? 44  ARG B NE   7  
ATOM 5866  C CZ   . ARG B 2 20 ? 3.016   3.550   -9.311  1.00 0.00 ? 44  ARG B CZ   7  
ATOM 5867  N NH1  . ARG B 2 20 ? 2.896   4.717   -9.928  1.00 0.00 ? 44  ARG B NH1  7  
ATOM 5868  N NH2  . ARG B 2 20 ? 2.325   2.503   -9.742  1.00 0.00 ? 44  ARG B NH2  7  
ATOM 5869  H H    . ARG B 2 20 ? 6.506   3.793   -4.275  1.00 0.00 ? 44  ARG B H    7  
ATOM 5870  H HA   . ARG B 2 20 ? 6.617   6.323   -5.060  1.00 0.00 ? 44  ARG B HA   7  
ATOM 5871  H HB2  . ARG B 2 20 ? 3.962   4.903   -4.720  1.00 0.00 ? 44  ARG B HB2  7  
ATOM 5872  H HB3  . ARG B 2 20 ? 4.329   6.129   -5.907  1.00 0.00 ? 44  ARG B HB3  7  
ATOM 5873  H HG2  . ARG B 2 20 ? 6.220   4.166   -6.364  1.00 0.00 ? 44  ARG B HG2  7  
ATOM 5874  H HG3  . ARG B 2 20 ? 4.735   3.284   -6.000  1.00 0.00 ? 44  ARG B HG3  7  
ATOM 5875  H HD2  . ARG B 2 20 ? 4.018   5.415   -7.686  1.00 0.00 ? 44  ARG B HD2  7  
ATOM 5876  H HD3  . ARG B 2 20 ? 5.468   4.690   -8.364  1.00 0.00 ? 44  ARG B HD3  7  
ATOM 5877  H HE   . ARG B 2 20 ? 3.895   2.555   -7.821  1.00 0.00 ? 44  ARG B HE   7  
ATOM 5878  H HH11 . ARG B 2 20 ? 3.414   5.510   -9.605  1.00 0.00 ? 44  ARG B HH11 7  
ATOM 5879  H HH12 . ARG B 2 20 ? 2.287   4.807   -10.716 1.00 0.00 ? 44  ARG B HH12 7  
ATOM 5880  H HH21 . ARG B 2 20 ? 2.412   1.621   -9.280  1.00 0.00 ? 44  ARG B HH21 7  
ATOM 5881  H HH22 . ARG B 2 20 ? 1.716   2.597   -10.530 1.00 0.00 ? 44  ARG B HH22 7  
ATOM 5882  N N    . VAL B 2 21 ? 4.734   6.078   -2.412  1.00 0.00 ? 45  VAL B N    7  
ATOM 5883  C CA   . VAL B 2 21 ? 4.127   6.715   -1.267  1.00 0.00 ? 45  VAL B CA   7  
ATOM 5884  C C    . VAL B 2 21 ? 5.162   7.237   -0.284  1.00 0.00 ? 45  VAL B C    7  
ATOM 5885  O O    . VAL B 2 21 ? 5.310   8.442   -0.079  1.00 0.00 ? 45  VAL B O    7  
ATOM 5886  C CB   . VAL B 2 21 ? 3.271   5.689   -0.511  1.00 0.00 ? 45  VAL B CB   7  
ATOM 5887  C CG1  . VAL B 2 21 ? 2.704   6.278   0.757   1.00 0.00 ? 45  VAL B CG1  7  
ATOM 5888  C CG2  . VAL B 2 21 ? 2.172   5.143   -1.390  1.00 0.00 ? 45  VAL B CG2  7  
ATOM 5889  H H    . VAL B 2 21 ? 4.717   5.101   -2.454  1.00 0.00 ? 45  VAL B H    7  
ATOM 5890  H HA   . VAL B 2 21 ? 3.492   7.519   -1.602  1.00 0.00 ? 45  VAL B HA   7  
ATOM 5891  H HB   . VAL B 2 21 ? 3.908   4.861   -0.230  1.00 0.00 ? 45  VAL B HB   7  
ATOM 5892  H HG11 . VAL B 2 21 ? 3.341   7.078   1.105   1.00 0.00 ? 45  VAL B HG11 7  
ATOM 5893  H HG12 . VAL B 2 21 ? 2.656   5.507   1.508   1.00 0.00 ? 45  VAL B HG12 7  
ATOM 5894  H HG13 . VAL B 2 21 ? 1.714   6.662   0.565   1.00 0.00 ? 45  VAL B HG13 7  
ATOM 5895  H HG21 . VAL B 2 21 ? 1.218   5.486   -1.030  1.00 0.00 ? 45  VAL B HG21 7  
ATOM 5896  H HG22 . VAL B 2 21 ? 2.205   4.064   -1.358  1.00 0.00 ? 45  VAL B HG22 7  
ATOM 5897  H HG23 . VAL B 2 21 ? 2.321   5.478   -2.406  1.00 0.00 ? 45  VAL B HG23 7  
ATOM 5898  N N    . CYS B 2 22 ? 5.873   6.292   0.316   1.00 0.00 ? 46  CYS B N    7  
ATOM 5899  C CA   . CYS B 2 22 ? 6.847   6.585   1.350   1.00 0.00 ? 46  CYS B CA   7  
ATOM 5900  C C    . CYS B 2 22 ? 8.195   5.965   1.053   1.00 0.00 ? 46  CYS B C    7  
ATOM 5901  O O    . CYS B 2 22 ? 9.198   6.660   0.887   1.00 0.00 ? 46  CYS B O    7  
ATOM 5902  C CB   . CYS B 2 22 ? 6.316   5.999   2.650   1.00 0.00 ? 46  CYS B CB   7  
ATOM 5903  S SG   . CYS B 2 22 ? 7.296   6.370   4.136   1.00 0.00 ? 46  CYS B SG   7  
ATOM 5904  H H    . CYS B 2 22 ? 5.745   5.359   0.042   1.00 0.00 ? 46  CYS B H    7  
ATOM 5905  H HA   . CYS B 2 22 ? 6.945   7.654   1.450   1.00 0.00 ? 46  CYS B HA   7  
ATOM 5906  H HB2  . CYS B 2 22 ? 5.323   6.366   2.807   1.00 0.00 ? 46  CYS B HB2  7  
ATOM 5907  H HB3  . CYS B 2 22 ? 6.275   4.924   2.549   1.00 0.00 ? 46  CYS B HB3  7  
ATOM 5908  N N    . GLY B 2 23 ? 8.200   4.644   0.987   1.00 0.00 ? 47  GLY B N    7  
ATOM 5909  C CA   . GLY B 2 23 ? 9.435   3.923   0.745   1.00 0.00 ? 47  GLY B CA   7  
ATOM 5910  C C    . GLY B 2 23 ? 9.702   2.864   1.786   1.00 0.00 ? 47  GLY B C    7  
ATOM 5911  O O    . GLY B 2 23 ? 9.950   3.176   2.950   1.00 0.00 ? 47  GLY B O    7  
ATOM 5912  H H    . GLY B 2 23 ? 7.342   4.156   1.079   1.00 0.00 ? 47  GLY B H    7  
ATOM 5913  H HA2  . GLY B 2 23 ? 9.382   3.451   -0.222  1.00 0.00 ? 47  GLY B HA2  7  
ATOM 5914  H HA3  . GLY B 2 23 ? 10.256  4.625   0.743   1.00 0.00 ? 47  GLY B HA3  7  
ATOM 5915  N N    . GLY B 2 24 ? 9.636   1.606   1.366   1.00 0.00 ? 48  GLY B N    7  
ATOM 5916  C CA   . GLY B 2 24 ? 9.892   0.502   2.269   1.00 0.00 ? 48  GLY B CA   7  
ATOM 5917  C C    . GLY B 2 24 ? 11.307  0.529   2.812   1.00 0.00 ? 48  GLY B C    7  
ATOM 5918  O O    . GLY B 2 24 ? 11.696  1.475   3.498   1.00 0.00 ? 48  GLY B O    7  
ATOM 5919  H H    . GLY B 2 24 ? 9.409   1.426   0.431   1.00 0.00 ? 48  GLY B H    7  
ATOM 5920  H HA2  . GLY B 2 24 ? 9.201   0.538   3.086   1.00 0.00 ? 48  GLY B HA2  7  
ATOM 5921  H HA3  . GLY B 2 24 ? 9.740   -0.421  1.733   1.00 0.00 ? 48  GLY B HA3  7  
ATOM 5922  N N    . PRO B 2 25 ? 12.101  -0.501  2.515   1.00 0.00 ? 49  PRO B N    7  
ATOM 5923  C CA   . PRO B 2 25 ? 13.487  -0.585  2.964   1.00 0.00 ? 49  PRO B CA   7  
ATOM 5924  C C    . PRO B 2 25 ? 14.366  0.461   2.272   1.00 0.00 ? 49  PRO B C    7  
ATOM 5925  O O    . PRO B 2 25 ? 13.961  1.615   2.127   1.00 0.00 ? 49  PRO B O    7  
ATOM 5926  C CB   . PRO B 2 25 ? 13.887  -2.014  2.580   1.00 0.00 ? 49  PRO B CB   7  
ATOM 5927  C CG   . PRO B 2 25 ? 13.000  -2.370  1.447   1.00 0.00 ? 49  PRO B CG   7  
ATOM 5928  C CD   . PRO B 2 25 ? 11.706  -1.659  1.709   1.00 0.00 ? 49  PRO B CD   7  
ATOM 5929  H HA   . PRO B 2 25 ? 13.562  -0.461  4.035   1.00 0.00 ? 49  PRO B HA   7  
ATOM 5930  H HB2  . PRO B 2 25 ? 14.928  -2.044  2.297   1.00 0.00 ? 49  PRO B HB2  7  
ATOM 5931  H HB3  . PRO B 2 25 ? 13.716  -2.665  3.417   1.00 0.00 ? 49  PRO B HB3  7  
ATOM 5932  H HG2  . PRO B 2 25 ? 13.435  -2.031  0.517   1.00 0.00 ? 49  PRO B HG2  7  
ATOM 5933  H HG3  . PRO B 2 25 ? 12.844  -3.438  1.422   1.00 0.00 ? 49  PRO B HG3  7  
ATOM 5934  H HD2  . PRO B 2 25 ? 11.270  -1.339  0.799   1.00 0.00 ? 49  PRO B HD2  7  
ATOM 5935  H HD3  . PRO B 2 25 ? 11.013  -2.279  2.246   1.00 0.00 ? 49  PRO B HD3  7  
ATOM 5936  N N    . ARG B 2 26 ? 15.567  0.069   1.864   1.00 0.00 ? 50  ARG B N    7  
ATOM 5937  C CA   . ARG B 2 26 ? 16.487  0.991   1.198   1.00 0.00 ? 50  ARG B CA   7  
ATOM 5938  C C    . ARG B 2 26 ? 16.231  1.081   -0.304  1.00 0.00 ? 50  ARG B C    7  
ATOM 5939  O O    . ARG B 2 26 ? 16.304  2.164   -0.886  1.00 0.00 ? 50  ARG B O    7  
ATOM 5940  C CB   . ARG B 2 26 ? 17.916  0.542   1.412   1.00 0.00 ? 50  ARG B CB   7  
ATOM 5941  C CG   . ARG B 2 26 ? 18.204  0.034   2.817   1.00 0.00 ? 50  ARG B CG   7  
ATOM 5942  C CD   . ARG B 2 26 ? 17.958  1.109   3.865   1.00 0.00 ? 50  ARG B CD   7  
ATOM 5943  N NE   . ARG B 2 26 ? 18.812  2.277   3.664   1.00 0.00 ? 50  ARG B NE   7  
ATOM 5944  C CZ   . ARG B 2 26 ? 18.684  3.411   4.347   1.00 0.00 ? 50  ARG B CZ   7  
ATOM 5945  N NH1  . ARG B 2 26 ? 17.738  3.533   5.269   1.00 0.00 ? 50  ARG B NH1  7  
ATOM 5946  N NH2  . ARG B 2 26 ? 19.503  4.427   4.109   1.00 0.00 ? 50  ARG B NH2  7  
ATOM 5947  H H    . ARG B 2 26 ? 15.846  -0.858  2.014   1.00 0.00 ? 50  ARG B H    7  
ATOM 5948  H HA   . ARG B 2 26 ? 16.357  1.966   1.635   1.00 0.00 ? 50  ARG B HA   7  
ATOM 5949  H HB2  . ARG B 2 26 ? 18.112  -0.247  0.712   1.00 0.00 ? 50  ARG B HB2  7  
ATOM 5950  H HB3  . ARG B 2 26 ? 18.579  1.371   1.205   1.00 0.00 ? 50  ARG B HB3  7  
ATOM 5951  H HG2  . ARG B 2 26 ? 17.560  -0.807  3.023   1.00 0.00 ? 50  ARG B HG2  7  
ATOM 5952  H HG3  . ARG B 2 26 ? 19.236  -0.279  2.871   1.00 0.00 ? 50  ARG B HG3  7  
ATOM 5953  H HD2  . ARG B 2 26 ? 16.925  1.419   3.810   1.00 0.00 ? 50  ARG B HD2  7  
ATOM 5954  H HD3  . ARG B 2 26 ? 18.156  0.694   4.841   1.00 0.00 ? 50  ARG B HD3  7  
ATOM 5955  H HE   . ARG B 2 26 ? 19.518  2.212   2.988   1.00 0.00 ? 50  ARG B HE   7  
ATOM 5956  H HH11 . ARG B 2 26 ? 17.117  2.770   5.452   1.00 0.00 ? 50  ARG B HH11 7  
ATOM 5957  H HH12 . ARG B 2 26 ? 17.644  4.387   5.780   1.00 0.00 ? 50  ARG B HH12 7  
ATOM 5958  H HH21 . ARG B 2 26 ? 20.218  4.340   3.416   1.00 0.00 ? 50  ARG B HH21 7  
ATOM 5959  H HH22 . ARG B 2 26 ? 19.406  5.279   4.623   1.00 0.00 ? 50  ARG B HH22 7  
ATOM 5960  N N    . TRP B 2 27 ? 15.940  -0.069  -0.925  1.00 0.00 ? 51  TRP B N    7  
ATOM 5961  C CA   . TRP B 2 27 ? 15.687  -0.153  -2.350  1.00 0.00 ? 51  TRP B CA   7  
ATOM 5962  C C    . TRP B 2 27 ? 16.948  0.061   -3.185  1.00 0.00 ? 51  TRP B C    7  
ATOM 5963  O O    . TRP B 2 27 ? 17.010  -0.359  -4.340  1.00 0.00 ? 51  TRP B O    7  
ATOM 5964  C CB   . TRP B 2 27 ? 14.623  0.839   -2.738  1.00 0.00 ? 51  TRP B CB   7  
ATOM 5965  C CG   . TRP B 2 27 ? 13.431  0.746   -1.863  1.00 0.00 ? 51  TRP B CG   7  
ATOM 5966  C CD1  . TRP B 2 27 ? 13.224  1.348   -0.666  1.00 0.00 ? 51  TRP B CD1  7  
ATOM 5967  C CD2  . TRP B 2 27 ? 12.295  -0.035  -2.123  1.00 0.00 ? 51  TRP B CD2  7  
ATOM 5968  N NE1  . TRP B 2 27 ? 11.991  1.000   -0.175  1.00 0.00 ? 51  TRP B NE1  7  
ATOM 5969  C CE2  . TRP B 2 27 ? 11.400  0.144   -1.064  1.00 0.00 ? 51  TRP B CE2  7  
ATOM 5970  C CE3  . TRP B 2 27 ? 11.956  -0.862  -3.167  1.00 0.00 ? 51  TRP B CE3  7  
ATOM 5971  C CZ2  . TRP B 2 27 ? 10.168  -0.493  -1.029  1.00 0.00 ? 51  TRP B CZ2  7  
ATOM 5972  C CZ3  . TRP B 2 27 ? 10.737  -1.494  -3.138  1.00 0.00 ? 51  TRP B CZ3  7  
ATOM 5973  C CH2  . TRP B 2 27 ? 9.853   -1.300  -2.064  1.00 0.00 ? 51  TRP B CH2  7  
ATOM 5974  H H    . TRP B 2 27 ? 15.852  -0.876  -0.402  1.00 0.00 ? 51  TRP B H    7  
ATOM 5975  H HA   . TRP B 2 27 ? 15.304  -1.144  -2.550  1.00 0.00 ? 51  TRP B HA   7  
ATOM 5976  H HB2  . TRP B 2 27 ? 15.011  1.836   -2.687  1.00 0.00 ? 51  TRP B HB2  7  
ATOM 5977  H HB3  . TRP B 2 27 ? 14.313  0.626   -3.737  1.00 0.00 ? 51  TRP B HB3  7  
ATOM 5978  H HD1  . TRP B 2 27 ? 13.937  1.995   -0.188  1.00 0.00 ? 51  TRP B HD1  7  
ATOM 5979  H HE1  . TRP B 2 27 ? 11.600  1.314   0.668   1.00 0.00 ? 51  TRP B HE1  7  
ATOM 5980  H HE3  . TRP B 2 27 ? 12.642  -1.011  -3.988  1.00 0.00 ? 51  TRP B HE3  7  
ATOM 5981  H HZ2  . TRP B 2 27 ? 9.475   -0.367  -0.224  1.00 0.00 ? 51  TRP B HZ2  7  
ATOM 5982  H HZ3  . TRP B 2 27 ? 10.458  -2.147  -3.942  1.00 0.00 ? 51  TRP B HZ3  7  
ATOM 5983  H HH2  . TRP B 2 27 ? 8.899   -1.790  -2.071  1.00 0.00 ? 51  TRP B HH2  7  
ATOM 5984  N N    . SER B 2 28 ? 17.951  0.711   -2.602  1.00 0.00 ? 52  SER B N    7  
ATOM 5985  C CA   . SER B 2 28 ? 19.198  0.971   -3.310  1.00 0.00 ? 52  SER B CA   7  
ATOM 5986  C C    . SER B 2 28 ? 20.397  0.784   -2.389  1.00 0.00 ? 52  SER B C    7  
ATOM 5987  O O    . SER B 2 28 ? 20.536  1.481   -1.383  1.00 0.00 ? 52  SER B O    7  
ATOM 5988  C CB   . SER B 2 28 ? 19.204  2.388   -3.878  1.00 0.00 ? 52  SER B CB   7  
ATOM 5989  O OG   . SER B 2 28 ? 18.007  2.662   -4.584  1.00 0.00 ? 52  SER B OG   7  
ATOM 5990  H H    . SER B 2 28 ? 17.851  1.020   -1.679  1.00 0.00 ? 52  SER B H    7  
ATOM 5991  H HA   . SER B 2 28 ? 19.271  0.266   -4.124  1.00 0.00 ? 52  SER B HA   7  
ATOM 5992  H HB2  . SER B 2 28 ? 19.303  3.094   -3.069  1.00 0.00 ? 52  SER B HB2  7  
ATOM 5993  H HB3  . SER B 2 28 ? 20.040  2.497   -4.554  1.00 0.00 ? 52  SER B HB3  7  
ATOM 5994  H HG   . SER B 2 28 ? 17.509  3.340   -4.121  1.00 0.00 ? 52  SER B HG   7  
ATOM 5995  N N    . THR B 2 29 ? 21.258  -0.162  -2.742  1.00 0.00 ? 53  THR B N    7  
ATOM 5996  C CA   . THR B 2 29 ? 22.451  -0.443  -1.954  1.00 0.00 ? 53  THR B CA   7  
ATOM 5997  C C    . THR B 2 29 ? 23.495  -1.183  -2.784  1.00 0.00 ? 53  THR B C    7  
ATOM 5998  O O    . THR B 2 29 ? 24.535  -0.625  -3.133  1.00 0.00 ? 53  THR B O    7  
ATOM 5999  C CB   . THR B 2 29 ? 22.128  -1.266  -0.692  1.00 0.00 ? 53  THR B CB   7  
ATOM 6000  O OG1  . THR B 2 29 ? 23.202  -2.167  -0.396  1.00 0.00 ? 53  THR B OG1  7  
ATOM 6001  C CG2  . THR B 2 29 ? 20.839  -2.038  -0.878  1.00 0.00 ? 53  THR B CG2  7  
ATOM 6002  H H    . THR B 2 29 ? 21.088  -0.681  -3.553  1.00 0.00 ? 53  THR B H    7  
ATOM 6003  H HA   . THR B 2 29 ? 22.855  0.502   -1.639  1.00 0.00 ? 53  THR B HA   7  
ATOM 6004  H HB   . THR B 2 29 ? 22.003  -0.585  0.139   1.00 0.00 ? 53  THR B HB   7  
ATOM 6005  H HG1  . THR B 2 29 ? 23.965  -1.668  -0.096  1.00 0.00 ? 53  THR B HG1  7  
ATOM 6006  H HG21 . THR B 2 29 ? 20.095  -1.374  -1.288  1.00 0.00 ? 53  THR B HG21 7  
ATOM 6007  H HG22 . THR B 2 29 ? 20.502  -2.419  0.074   1.00 0.00 ? 53  THR B HG22 7  
ATOM 6008  H HG23 . THR B 2 29 ? 21.004  -2.860  -1.560  1.00 0.00 ? 53  THR B HG23 7  
ATOM 6009  N N    . GLU B 2 30 ? 23.208  -2.443  -3.097  1.00 0.00 ? 54  GLU B N    7  
ATOM 6010  C CA   . GLU B 2 30 ? 24.117  -3.264  -3.887  1.00 0.00 ? 54  GLU B CA   7  
ATOM 6011  C C    . GLU B 2 30 ? 23.927  -3.009  -5.380  1.00 0.00 ? 54  GLU B C    7  
ATOM 6012  O O    . GLU B 2 30 ? 24.531  -3.682  -6.215  1.00 0.00 ? 54  GLU B O    7  
ATOM 6013  C CB   . GLU B 2 30 ? 23.893  -4.746  -3.579  1.00 0.00 ? 54  GLU B CB   7  
ATOM 6014  C CG   . GLU B 2 30 ? 24.200  -5.121  -2.139  1.00 0.00 ? 54  GLU B CG   7  
ATOM 6015  C CD   . GLU B 2 30 ? 23.901  -6.577  -1.840  1.00 0.00 ? 54  GLU B CD   7  
ATOM 6016  O OE1  . GLU B 2 30 ? 24.753  -7.434  -2.154  1.00 0.00 ? 54  GLU B OE1  7  
ATOM 6017  O OE2  . GLU B 2 30 ? 22.816  -6.859  -1.290  1.00 0.00 ? 54  GLU B OE2  7  
ATOM 6018  H H    . GLU B 2 30 ? 22.363  -2.832  -2.788  1.00 0.00 ? 54  GLU B H    7  
ATOM 6019  H HA   . GLU B 2 30 ? 25.126  -2.997  -3.613  1.00 0.00 ? 54  GLU B HA   7  
ATOM 6020  H HB2  . GLU B 2 30 ? 22.861  -4.992  -3.781  1.00 0.00 ? 54  GLU B HB2  7  
ATOM 6021  H HB3  . GLU B 2 30 ? 24.527  -5.334  -4.224  1.00 0.00 ? 54  GLU B HB3  7  
ATOM 6022  H HG2  . GLU B 2 30 ? 25.246  -4.937  -1.948  1.00 0.00 ? 54  GLU B HG2  7  
ATOM 6023  H HG3  . GLU B 2 30 ? 23.601  -4.504  -1.485  1.00 0.00 ? 54  GLU B HG3  7  
ATOM 6024  N N    . ALA B 2 31 ? 23.086  -2.029  -5.705  1.00 0.00 ? 55  ALA B N    7  
ATOM 6025  C CA   . ALA B 2 31 ? 22.808  -1.680  -7.096  1.00 0.00 ? 55  ALA B CA   7  
ATOM 6026  C C    . ALA B 2 31 ? 22.323  -2.892  -7.885  1.00 0.00 ? 55  ALA B C    7  
ATOM 6027  O O    . ALA B 2 31 ? 21.104  -3.164  -7.860  1.00 0.00 ? 55  ALA B O    7  
ATOM 6028  C CB   . ALA B 2 31 ? 24.047  -1.081  -7.748  1.00 0.00 ? 55  ALA B CB   7  
ATOM 6029  O OXT  . ALA B 2 31 ? 23.165  -3.560  -8.523  1.00 0.00 ? 55  ALA B OXT  7  
ATOM 6030  H H    . ALA B 2 31 ? 22.638  -1.529  -4.991  1.00 0.00 ? 55  ALA B H    7  
ATOM 6031  H HA   . ALA B 2 31 ? 22.032  -0.928  -7.099  1.00 0.00 ? 55  ALA B HA   7  
ATOM 6032  H HB1  . ALA B 2 31 ? 23.807  -0.766  -8.753  1.00 0.00 ? 55  ALA B HB1  7  
ATOM 6033  H HB2  . ALA B 2 31 ? 24.831  -1.823  -7.781  1.00 0.00 ? 55  ALA B HB2  7  
ATOM 6034  H HB3  . ALA B 2 31 ? 24.381  -0.229  -7.173  1.00 0.00 ? 55  ALA B HB3  7  
ATOM 6035  N N    . ALA A 1 1  ? -5.018  1.117   14.334  1.00 0.00 ? 106 ALA A N    8  
ATOM 6036  C CA   . ALA A 1 1  ? -4.009  1.631   13.373  1.00 0.00 ? 106 ALA A CA   8  
ATOM 6037  C C    . ALA A 1 1  ? -3.460  0.506   12.502  1.00 0.00 ? 106 ALA A C    8  
ATOM 6038  O O    . ALA A 1 1  ? -3.483  0.591   11.274  1.00 0.00 ? 106 ALA A O    8  
ATOM 6039  C CB   . ALA A 1 1  ? -2.875  2.319   14.119  1.00 0.00 ? 106 ALA A CB   8  
ATOM 6040  H H1   . ALA A 1 1  ? -5.817  0.693   13.818  1.00 0.00 ? 106 ALA A H1   8  
ATOM 6041  H H2   . ALA A 1 1  ? -5.375  1.892   14.927  1.00 0.00 ? 106 ALA A H2   8  
ATOM 6042  H H3   . ALA A 1 1  ? -4.592  0.393   14.947  1.00 0.00 ? 106 ALA A H3   8  
ATOM 6043  H HA   . ALA A 1 1  ? -4.484  2.363   12.738  1.00 0.00 ? 106 ALA A HA   8  
ATOM 6044  H HB1  . ALA A 1 1  ? -2.412  1.618   14.799  1.00 0.00 ? 106 ALA A HB1  8  
ATOM 6045  H HB2  . ALA A 1 1  ? -3.267  3.156   14.678  1.00 0.00 ? 106 ALA A HB2  8  
ATOM 6046  H HB3  . ALA A 1 1  ? -2.139  2.671   13.411  1.00 0.00 ? 106 ALA A HB3  8  
ATOM 6047  N N    . ALA A 1 2  ? -2.967  -0.548  13.146  1.00 0.00 ? 107 ALA A N    8  
ATOM 6048  C CA   . ALA A 1 2  ? -2.412  -1.689  12.429  1.00 0.00 ? 107 ALA A CA   8  
ATOM 6049  C C    . ALA A 1 2  ? -3.515  -2.640  11.977  1.00 0.00 ? 107 ALA A C    8  
ATOM 6050  O O    . ALA A 1 2  ? -4.593  -2.684  12.571  1.00 0.00 ? 107 ALA A O    8  
ATOM 6051  C CB   . ALA A 1 2  ? -1.405  -2.423  13.303  1.00 0.00 ? 107 ALA A CB   8  
ATOM 6052  H H    . ALA A 1 2  ? -2.978  -0.557  14.126  1.00 0.00 ? 107 ALA A H    8  
ATOM 6053  H HA   . ALA A 1 2  ? -1.893  -1.317  11.558  1.00 0.00 ? 107 ALA A HA   8  
ATOM 6054  H HB1  . ALA A 1 2  ? -0.640  -1.733  13.627  1.00 0.00 ? 107 ALA A HB1  8  
ATOM 6055  H HB2  . ALA A 1 2  ? -0.952  -3.223  12.736  1.00 0.00 ? 107 ALA A HB2  8  
ATOM 6056  H HB3  . ALA A 1 2  ? -1.908  -2.833  14.167  1.00 0.00 ? 107 ALA A HB3  8  
ATOM 6057  N N    . ALA A 1 3  ? -3.239  -3.400  10.921  1.00 0.00 ? 108 ALA A N    8  
ATOM 6058  C CA   . ALA A 1 3  ? -4.210  -4.346  10.385  1.00 0.00 ? 108 ALA A CA   8  
ATOM 6059  C C    . ALA A 1 3  ? -3.557  -5.687  10.067  1.00 0.00 ? 108 ALA A C    8  
ATOM 6060  O O    . ALA A 1 3  ? -2.529  -6.044  10.643  1.00 0.00 ? 108 ALA A O    8  
ATOM 6061  C CB   . ALA A 1 3  ? -4.866  -3.775  9.137   1.00 0.00 ? 108 ALA A CB   8  
ATOM 6062  H H    . ALA A 1 3  ? -2.361  -3.321  10.492  1.00 0.00 ? 108 ALA A H    8  
ATOM 6063  H HA   . ALA A 1 3  ? -4.976  -4.497  11.131  1.00 0.00 ? 108 ALA A HA   8  
ATOM 6064  H HB1  . ALA A 1 3  ? -5.916  -4.025  9.137   1.00 0.00 ? 108 ALA A HB1  8  
ATOM 6065  H HB2  . ALA A 1 3  ? -4.396  -4.199  8.260   1.00 0.00 ? 108 ALA A HB2  8  
ATOM 6066  H HB3  . ALA A 1 3  ? -4.751  -2.701  9.127   1.00 0.00 ? 108 ALA A HB3  8  
ATOM 6067  N N    . THR A 1 4  ? -4.165  -6.421  9.143   1.00 0.00 ? 109 THR A N    8  
ATOM 6068  C CA   . THR A 1 4  ? -3.654  -7.720  8.731   1.00 0.00 ? 109 THR A CA   8  
ATOM 6069  C C    . THR A 1 4  ? -2.433  -7.546  7.823   1.00 0.00 ? 109 THR A C    8  
ATOM 6070  O O    . THR A 1 4  ? -1.629  -6.637  8.030   1.00 0.00 ? 109 THR A O    8  
ATOM 6071  C CB   . THR A 1 4  ? -4.755  -8.521  8.000   1.00 0.00 ? 109 THR A CB   8  
ATOM 6072  O OG1  . THR A 1 4  ? -4.309  -9.858  7.741   1.00 0.00 ? 109 THR A OG1  8  
ATOM 6073  C CG2  . THR A 1 4  ? -5.142  -7.844  6.689   1.00 0.00 ? 109 THR A CG2  8  
ATOM 6074  H H    . THR A 1 4  ? -4.985  -6.082  8.727   1.00 0.00 ? 109 THR A H    8  
ATOM 6075  H HA   . THR A 1 4  ? -3.363  -8.265  9.617   1.00 0.00 ? 109 THR A HA   8  
ATOM 6076  H HB   . THR A 1 4  ? -5.627  -8.562  8.634   1.00 0.00 ? 109 THR A HB   8  
ATOM 6077  H HG1  . THR A 1 4  ? -4.781  -10.470 8.310   1.00 0.00 ? 109 THR A HG1  8  
ATOM 6078  H HG21 . THR A 1 4  ? -5.027  -6.772  6.785   1.00 0.00 ? 109 THR A HG21 8  
ATOM 6079  H HG22 . THR A 1 4  ? -6.171  -8.077  6.456   1.00 0.00 ? 109 THR A HG22 8  
ATOM 6080  H HG23 . THR A 1 4  ? -4.504  -8.205  5.895   1.00 0.00 ? 109 THR A HG23 8  
ATOM 6081  N N    . ASN A 1 5  ? -2.295  -8.411  6.822   1.00 0.00 ? 110 ASN A N    8  
ATOM 6082  C CA   . ASN A 1 5  ? -1.178  -8.322  5.893   1.00 0.00 ? 110 ASN A CA   8  
ATOM 6083  C C    . ASN A 1 5  ? -1.448  -7.219  4.877   1.00 0.00 ? 110 ASN A C    8  
ATOM 6084  O O    . ASN A 1 5  ? -2.362  -7.330  4.060   1.00 0.00 ? 110 ASN A O    8  
ATOM 6085  C CB   . ASN A 1 5  ? -0.967  -9.660  5.181   1.00 0.00 ? 110 ASN A CB   8  
ATOM 6086  C CG   . ASN A 1 5  ? -0.599  -10.772 6.136   1.00 0.00 ? 110 ASN A CG   8  
ATOM 6087  O OD1  . ASN A 1 5  ? -1.468  -11.437 6.698   1.00 0.00 ? 110 ASN A OD1  8  
ATOM 6088  N ND2  . ASN A 1 5  ? 0.695   -10.987 6.319   1.00 0.00 ? 110 ASN A ND2  8  
ATOM 6089  H H    . ASN A 1 5  ? -2.958  -9.117  6.703   1.00 0.00 ? 110 ASN A H    8  
ATOM 6090  H HA   . ASN A 1 5  ? -0.291  -8.075  6.457   1.00 0.00 ? 110 ASN A HA   8  
ATOM 6091  H HB2  . ASN A 1 5  ? -1.876  -9.938  4.676   1.00 0.00 ? 110 ASN A HB2  8  
ATOM 6092  H HB3  . ASN A 1 5  ? -0.174  -9.554  4.456   1.00 0.00 ? 110 ASN A HB3  8  
ATOM 6093  H HD21 . ASN A 1 5  ? 1.332   -10.420 5.835   1.00 0.00 ? 110 ASN A HD21 8  
ATOM 6094  H HD22 . ASN A 1 5  ? 0.960   -11.702 6.927   1.00 0.00 ? 110 ASN A HD22 8  
ATOM 6095  N N    . PRO A 1 6  ? -0.657  -6.133  4.911   1.00 0.00 ? 111 PRO A N    8  
ATOM 6096  C CA   . PRO A 1 6  ? -0.844  -5.001  4.002   1.00 0.00 ? 111 PRO A CA   8  
ATOM 6097  C C    . PRO A 1 6  ? -0.501  -5.338  2.556   1.00 0.00 ? 111 PRO A C    8  
ATOM 6098  O O    . PRO A 1 6  ? -0.764  -4.551  1.650   1.00 0.00 ? 111 PRO A O    8  
ATOM 6099  C CB   . PRO A 1 6  ? 0.103   -3.946  4.559   1.00 0.00 ? 111 PRO A CB   8  
ATOM 6100  C CG   . PRO A 1 6  ? 1.176   -4.728  5.230   1.00 0.00 ? 111 PRO A CG   8  
ATOM 6101  C CD   . PRO A 1 6  ? 0.490   -5.926  5.817   1.00 0.00 ? 111 PRO A CD   8  
ATOM 6102  H HA   . PRO A 1 6  ? -1.850  -4.629  4.046   1.00 0.00 ? 111 PRO A HA   8  
ATOM 6103  H HB2  . PRO A 1 6  ? 0.483   -3.348  3.751   1.00 0.00 ? 111 PRO A HB2  8  
ATOM 6104  H HB3  . PRO A 1 6  ? -0.425  -3.319  5.260   1.00 0.00 ? 111 PRO A HB3  8  
ATOM 6105  H HG2  . PRO A 1 6  ? 1.917   -5.037  4.506   1.00 0.00 ? 111 PRO A HG2  8  
ATOM 6106  H HG3  . PRO A 1 6  ? 1.633   -4.137  6.009   1.00 0.00 ? 111 PRO A HG3  8  
ATOM 6107  H HD2  . PRO A 1 6  ? 1.149   -6.782  5.807   1.00 0.00 ? 111 PRO A HD2  8  
ATOM 6108  H HD3  . PRO A 1 6  ? 0.155   -5.715  6.822   1.00 0.00 ? 111 PRO A HD3  8  
ATOM 6109  N N    . ALA A 1 7  ? 0.076   -6.513  2.343   1.00 0.00 ? 112 ALA A N    8  
ATOM 6110  C CA   . ALA A 1 7  ? 0.449   -6.948  1.004   1.00 0.00 ? 112 ALA A CA   8  
ATOM 6111  C C    . ALA A 1 7  ? -0.649  -7.797  0.382   1.00 0.00 ? 112 ALA A C    8  
ATOM 6112  O O    . ALA A 1 7  ? -0.941  -7.692  -0.809  1.00 0.00 ? 112 ALA A O    8  
ATOM 6113  C CB   . ALA A 1 7  ? 1.748   -7.729  1.053   1.00 0.00 ? 112 ALA A CB   8  
ATOM 6114  H H    . ALA A 1 7  ? 0.254   -7.103  3.105   1.00 0.00 ? 112 ALA A H    8  
ATOM 6115  H HA   . ALA A 1 7  ? 0.602   -6.070  0.395   1.00 0.00 ? 112 ALA A HA   8  
ATOM 6116  H HB1  . ALA A 1 7  ? 1.534   -8.778  1.184   1.00 0.00 ? 112 ALA A HB1  8  
ATOM 6117  H HB2  . ALA A 1 7  ? 2.337   -7.378  1.884   1.00 0.00 ? 112 ALA A HB2  8  
ATOM 6118  H HB3  . ALA A 1 7  ? 2.294   -7.581  0.133   1.00 0.00 ? 112 ALA A HB3  8  
ATOM 6119  N N    . ARG A 1 8  ? -1.250  -8.638  1.209   1.00 0.00 ? 113 ARG A N    8  
ATOM 6120  C CA   . ARG A 1 8  ? -2.320  -9.524  0.765   1.00 0.00 ? 113 ARG A CA   8  
ATOM 6121  C C    . ARG A 1 8  ? -3.640  -8.772  0.622   1.00 0.00 ? 113 ARG A C    8  
ATOM 6122  O O    . ARG A 1 8  ? -4.295  -8.832  -0.423  1.00 0.00 ? 113 ARG A O    8  
ATOM 6123  C CB   . ARG A 1 8  ? -2.496  -10.669 1.762   1.00 0.00 ? 113 ARG A CB   8  
ATOM 6124  C CG   . ARG A 1 8  ? -3.085  -11.931 1.150   1.00 0.00 ? 113 ARG A CG   8  
ATOM 6125  C CD   . ARG A 1 8  ? -2.033  -12.726 0.393   1.00 0.00 ? 113 ARG A CD   8  
ATOM 6126  N NE   . ARG A 1 8  ? -0.923  -13.123 1.258   1.00 0.00 ? 113 ARG A NE   8  
ATOM 6127  C CZ   . ARG A 1 8  ? -0.134  -14.165 1.015   1.00 0.00 ? 113 ARG A CZ   8  
ATOM 6128  N NH1  . ARG A 1 8  ? -0.332  -14.916 -0.060  1.00 0.00 ? 113 ARG A NH1  8  
ATOM 6129  N NH2  . ARG A 1 8  ? 0.854   -14.457 1.850   1.00 0.00 ? 113 ARG A NH2  8  
ATOM 6130  H H    . ARG A 1 8  ? -0.955  -8.671  2.144   1.00 0.00 ? 113 ARG A H    8  
ATOM 6131  H HA   . ARG A 1 8  ? -2.041  -9.932  -0.194  1.00 0.00 ? 113 ARG A HA   8  
ATOM 6132  H HB2  . ARG A 1 8  ? -1.536  -10.912 2.186   1.00 0.00 ? 113 ARG A HB2  8  
ATOM 6133  H HB3  . ARG A 1 8  ? -3.154  -10.341 2.553   1.00 0.00 ? 113 ARG A HB3  8  
ATOM 6134  H HG2  . ARG A 1 8  ? -3.491  -12.546 1.938   1.00 0.00 ? 113 ARG A HG2  8  
ATOM 6135  H HG3  . ARG A 1 8  ? -3.873  -11.652 0.466   1.00 0.00 ? 113 ARG A HG3  8  
ATOM 6136  H HD2  . ARG A 1 8  ? -2.495  -13.614 -0.013  1.00 0.00 ? 113 ARG A HD2  8  
ATOM 6137  H HD3  . ARG A 1 8  ? -1.651  -12.119 -0.413  1.00 0.00 ? 113 ARG A HD3  8  
ATOM 6138  H HE   . ARG A 1 8  ? -0.758  -12.582 2.058   1.00 0.00 ? 113 ARG A HE   8  
ATOM 6139  H HH11 . ARG A 1 8  ? -1.077  -14.701 -0.691  1.00 0.00 ? 113 ARG A HH11 8  
ATOM 6140  H HH12 . ARG A 1 8  ? 0.264   -15.700 -0.239  1.00 0.00 ? 113 ARG A HH12 8  
ATOM 6141  H HH21 . ARG A 1 8  ? 1.007   -13.892 2.663   1.00 0.00 ? 113 ARG A HH21 8  
ATOM 6142  H HH22 . ARG A 1 8  ? 1.448   -15.240 1.668   1.00 0.00 ? 113 ARG A HH22 8  
ATOM 6143  N N    . TYR A 1 9  ? -4.025  -8.065  1.681   1.00 0.00 ? 114 TYR A N    8  
ATOM 6144  C CA   . TYR A 1 9  ? -5.280  -7.321  1.683   1.00 0.00 ? 114 TYR A CA   8  
ATOM 6145  C C    . TYR A 1 9  ? -5.368  -6.359  0.503   1.00 0.00 ? 114 TYR A C    8  
ATOM 6146  O O    . TYR A 1 9  ? -6.459  -6.112  -0.011  1.00 0.00 ? 114 TYR A O    8  
ATOM 6147  C CB   . TYR A 1 9  ? -5.481  -6.589  3.030   1.00 0.00 ? 114 TYR A CB   8  
ATOM 6148  C CG   . TYR A 1 9  ? -5.247  -5.083  3.024   1.00 0.00 ? 114 TYR A CG   8  
ATOM 6149  C CD1  . TYR A 1 9  ? -6.096  -4.216  2.338   1.00 0.00 ? 114 TYR A CD1  8  
ATOM 6150  C CD2  . TYR A 1 9  ? -4.188  -4.525  3.733   1.00 0.00 ? 114 TYR A CD2  8  
ATOM 6151  C CE1  . TYR A 1 9  ? -5.891  -2.850  2.355   1.00 0.00 ? 114 TYR A CE1  8  
ATOM 6152  C CE2  . TYR A 1 9  ? -3.976  -3.159  3.753   1.00 0.00 ? 114 TYR A CE2  8  
ATOM 6153  C CZ   . TYR A 1 9  ? -4.831  -2.327  3.064   1.00 0.00 ? 114 TYR A CZ   8  
ATOM 6154  O OH   . TYR A 1 9  ? -4.623  -0.967  3.084   1.00 0.00 ? 114 TYR A OH   8  
ATOM 6155  H H    . TYR A 1 9  ? -3.454  -8.048  2.477   1.00 0.00 ? 114 TYR A H    8  
ATOM 6156  H HA   . TYR A 1 9  ? -6.073  -8.045  1.576   1.00 0.00 ? 114 TYR A HA   8  
ATOM 6157  H HB2  . TYR A 1 9  ? -6.494  -6.751  3.362   1.00 0.00 ? 114 TYR A HB2  8  
ATOM 6158  H HB3  . TYR A 1 9  ? -4.807  -7.020  3.758   1.00 0.00 ? 114 TYR A HB3  8  
ATOM 6159  H HD1  . TYR A 1 9  ? -6.925  -4.628  1.781   1.00 0.00 ? 114 TYR A HD1  8  
ATOM 6160  H HD2  . TYR A 1 9  ? -3.515  -5.177  4.269   1.00 0.00 ? 114 TYR A HD2  8  
ATOM 6161  H HE1  . TYR A 1 9  ? -6.558  -2.198  1.810   1.00 0.00 ? 114 TYR A HE1  8  
ATOM 6162  H HE2  . TYR A 1 9  ? -3.144  -2.751  4.312   1.00 0.00 ? 114 TYR A HE2  8  
ATOM 6163  H HH   . TYR A 1 9  ? -3.686  -0.784  2.994   1.00 0.00 ? 114 TYR A HH   8  
ATOM 6164  N N    . CYS A 1 10 ? -4.233  -5.827  0.057   1.00 0.00 ? 115 CYS A N    8  
ATOM 6165  C CA   . CYS A 1 10 ? -4.252  -4.889  -1.058  1.00 0.00 ? 115 CYS A CA   8  
ATOM 6166  C C    . CYS A 1 10 ? -4.360  -5.600  -2.397  1.00 0.00 ? 115 CYS A C    8  
ATOM 6167  O O    . CYS A 1 10 ? -4.791  -5.008  -3.386  1.00 0.00 ? 115 CYS A O    8  
ATOM 6168  C CB   . CYS A 1 10 ? -3.047  -3.950  -1.027  1.00 0.00 ? 115 CYS A CB   8  
ATOM 6169  S SG   . CYS A 1 10 ? -2.944  -2.995  0.509   1.00 0.00 ? 115 CYS A SG   8  
ATOM 6170  H H    . CYS A 1 10 ? -3.383  -6.067  0.480   1.00 0.00 ? 115 CYS A H    8  
ATOM 6171  H HA   . CYS A 1 10 ? -5.141  -4.291  -0.935  1.00 0.00 ? 115 CYS A HA   8  
ATOM 6172  H HB2  . CYS A 1 10 ? -2.119  -4.501  -1.145  1.00 0.00 ? 115 CYS A HB2  8  
ATOM 6173  H HB3  . CYS A 1 10 ? -3.139  -3.245  -1.839  1.00 0.00 ? 115 CYS A HB3  8  
ATOM 6174  N N    . CYS A 1 11 ? -3.975  -6.865  -2.439  1.00 0.00 ? 116 CYS A N    8  
ATOM 6175  C CA   . CYS A 1 11 ? -4.083  -7.630  -3.669  1.00 0.00 ? 116 CYS A CA   8  
ATOM 6176  C C    . CYS A 1 11 ? -5.552  -7.899  -3.953  1.00 0.00 ? 116 CYS A C    8  
ATOM 6177  O O    . CYS A 1 11 ? -5.977  -7.952  -5.107  1.00 0.00 ? 116 CYS A O    8  
ATOM 6178  C CB   . CYS A 1 11 ? -3.305  -8.946  -3.564  1.00 0.00 ? 116 CYS A CB   8  
ATOM 6179  S SG   . CYS A 1 11 ? -3.332  -9.958  -5.081  1.00 0.00 ? 116 CYS A SG   8  
ATOM 6180  H H    . CYS A 1 11 ? -3.612  -7.289  -1.633  1.00 0.00 ? 116 CYS A H    8  
ATOM 6181  H HA   . CYS A 1 11 ? -3.678  -7.029  -4.474  1.00 0.00 ? 116 CYS A HA   8  
ATOM 6182  H HB2  . CYS A 1 11 ? -2.276  -8.730  -3.331  1.00 0.00 ? 116 CYS A HB2  8  
ATOM 6183  H HB3  . CYS A 1 11 ? -3.726  -9.538  -2.768  1.00 0.00 ? 116 CYS A HB3  8  
ATOM 6184  N N    . LEU A 1 12 ? -6.319  -8.076  -2.881  1.00 0.00 ? 117 LEU A N    8  
ATOM 6185  C CA   . LEU A 1 12 ? -7.747  -8.313  -2.991  1.00 0.00 ? 117 LEU A CA   8  
ATOM 6186  C C    . LEU A 1 12 ? -8.517  -6.997  -3.117  1.00 0.00 ? 117 LEU A C    8  
ATOM 6187  O O    . LEU A 1 12 ? -9.623  -6.968  -3.658  1.00 0.00 ? 117 LEU A O    8  
ATOM 6188  C CB   . LEU A 1 12 ? -8.243  -9.100  -1.781  1.00 0.00 ? 117 LEU A CB   8  
ATOM 6189  C CG   . LEU A 1 12 ? -8.253  -10.622 -1.946  1.00 0.00 ? 117 LEU A CG   8  
ATOM 6190  C CD1  . LEU A 1 12 ? -8.663  -11.298 -0.648  1.00 0.00 ? 117 LEU A CD1  8  
ATOM 6191  C CD2  . LEU A 1 12 ? -9.188  -11.031 -3.077  1.00 0.00 ? 117 LEU A CD2  8  
ATOM 6192  H H    . LEU A 1 12 ? -5.910  -8.052  -1.989  1.00 0.00 ? 117 LEU A H    8  
ATOM 6193  H HA   . LEU A 1 12 ? -7.915  -8.900  -3.879  1.00 0.00 ? 117 LEU A HA   8  
ATOM 6194  H HB2  . LEU A 1 12 ? -7.607  -8.857  -0.945  1.00 0.00 ? 117 LEU A HB2  8  
ATOM 6195  H HB3  . LEU A 1 12 ? -9.243  -8.776  -1.553  1.00 0.00 ? 117 LEU A HB3  8  
ATOM 6196  H HG   . LEU A 1 12 ? -7.258  -10.958 -2.198  1.00 0.00 ? 117 LEU A HG   8  
ATOM 6197  H HD11 . LEU A 1 12 ? -9.643  -10.953 -0.356  1.00 0.00 ? 117 LEU A HD11 8  
ATOM 6198  H HD12 . LEU A 1 12 ? -7.951  -11.053 0.126   1.00 0.00 ? 117 LEU A HD12 8  
ATOM 6199  H HD13 . LEU A 1 12 ? -8.686  -12.368 -0.791  1.00 0.00 ? 117 LEU A HD13 8  
ATOM 6200  H HD21 . LEU A 1 12 ? -8.860  -10.576 -3.999  1.00 0.00 ? 117 LEU A HD21 8  
ATOM 6201  H HD22 . LEU A 1 12 ? -10.191 -10.701 -2.851  1.00 0.00 ? 117 LEU A HD22 8  
ATOM 6202  H HD23 . LEU A 1 12 ? -9.178  -12.106 -3.181  1.00 0.00 ? 117 LEU A HD23 8  
ATOM 6203  N N    . SER A 1 13 ? -7.927  -5.911  -2.616  1.00 0.00 ? 118 SER A N    8  
ATOM 6204  C CA   . SER A 1 13 ? -8.569  -4.597  -2.671  1.00 0.00 ? 118 SER A CA   8  
ATOM 6205  C C    . SER A 1 13 ? -7.583  -3.501  -3.078  1.00 0.00 ? 118 SER A C    8  
ATOM 6206  O O    . SER A 1 13 ? -7.751  -2.863  -4.115  1.00 0.00 ? 118 SER A O    8  
ATOM 6207  C CB   . SER A 1 13 ? -9.198  -4.255  -1.317  1.00 0.00 ? 118 SER A CB   8  
ATOM 6208  O OG   . SER A 1 13 ? -8.227  -4.249  -0.287  1.00 0.00 ? 118 SER A OG   8  
ATOM 6209  H H    . SER A 1 13 ? -7.043  -5.994  -2.200  1.00 0.00 ? 118 SER A H    8  
ATOM 6210  H HA   . SER A 1 13 ? -9.352  -4.648  -3.413  1.00 0.00 ? 118 SER A HA   8  
ATOM 6211  H HB2  . SER A 1 13 ? -9.651  -3.277  -1.371  1.00 0.00 ? 118 SER A HB2  8  
ATOM 6212  H HB3  . SER A 1 13 ? -9.954  -4.988  -1.079  1.00 0.00 ? 118 SER A HB3  8  
ATOM 6213  H HG   . SER A 1 13 ? -8.466  -3.598  0.376   1.00 0.00 ? 118 SER A HG   8  
ATOM 6214  N N    . GLY A 1 14 ? -6.563  -3.280  -2.252  1.00 0.00 ? 119 GLY A N    8  
ATOM 6215  C CA   . GLY A 1 14 ? -5.567  -2.262  -2.552  1.00 0.00 ? 119 GLY A CA   8  
ATOM 6216  C C    . GLY A 1 14 ? -5.328  -1.312  -1.389  1.00 0.00 ? 119 GLY A C    8  
ATOM 6217  O O    . GLY A 1 14 ? -6.196  -1.158  -0.530  1.00 0.00 ? 119 GLY A O    8  
ATOM 6218  H H    . GLY A 1 14 ? -6.484  -3.812  -1.433  1.00 0.00 ? 119 GLY A H    8  
ATOM 6219  H HA2  . GLY A 1 14 ? -4.637  -2.752  -2.792  1.00 0.00 ? 119 GLY A HA2  8  
ATOM 6220  H HA3  . GLY A 1 14 ? -5.897  -1.694  -3.414  1.00 0.00 ? 119 GLY A HA3  8  
ATOM 6221  N N    . CYS A 1 15 ? -4.148  -0.677  -1.344  1.00 0.00 ? 120 CYS A N    8  
ATOM 6222  C CA   . CYS A 1 15 ? -3.846  0.257   -0.257  1.00 0.00 ? 120 CYS A CA   8  
ATOM 6223  C C    . CYS A 1 15 ? -3.850  1.696   -0.722  1.00 0.00 ? 120 CYS A C    8  
ATOM 6224  O O    . CYS A 1 15 ? -3.643  1.996   -1.899  1.00 0.00 ? 120 CYS A O    8  
ATOM 6225  C CB   . CYS A 1 15 ? -2.495  -0.004  0.431   1.00 0.00 ? 120 CYS A CB   8  
ATOM 6226  S SG   . CYS A 1 15 ? -1.651  -1.557  0.020   1.00 0.00 ? 120 CYS A SG   8  
ATOM 6227  H H    . CYS A 1 15 ? -3.488  -0.828  -2.054  1.00 0.00 ? 120 CYS A H    8  
ATOM 6228  H HA   . CYS A 1 15 ? -4.620  0.154   0.471   1.00 0.00 ? 120 CYS A HA   8  
ATOM 6229  H HB2  . CYS A 1 15 ? -1.821  0.793   0.168   1.00 0.00 ? 120 CYS A HB2  8  
ATOM 6230  H HB3  . CYS A 1 15 ? -2.645  0.011   1.501   1.00 0.00 ? 120 CYS A HB3  8  
ATOM 6231  N N    . THR A 1 16 ? -4.086  2.577   0.236   1.00 0.00 ? 121 THR A N    8  
ATOM 6232  C CA   . THR A 1 16 ? -4.093  4.003   -0.006  1.00 0.00 ? 121 THR A CA   8  
ATOM 6233  C C    . THR A 1 16 ? -2.733  4.574   0.316   1.00 0.00 ? 121 THR A C    8  
ATOM 6234  O O    . THR A 1 16 ? -2.026  4.044   1.174   1.00 0.00 ? 121 THR A O    8  
ATOM 6235  C CB   . THR A 1 16 ? -5.129  4.718   0.876   1.00 0.00 ? 121 THR A CB   8  
ATOM 6236  O OG1  . THR A 1 16 ? -4.949  4.350   2.248   1.00 0.00 ? 121 THR A OG1  8  
ATOM 6237  C CG2  . THR A 1 16 ? -6.532  4.380   0.437   1.00 0.00 ? 121 THR A CG2  8  
ATOM 6238  H H    . THR A 1 16 ? -4.261  2.252   1.144   1.00 0.00 ? 121 THR A H    8  
ATOM 6239  H HA   . THR A 1 16 ? -4.330  4.181   -1.045  1.00 0.00 ? 121 THR A HA   8  
ATOM 6240  H HB   . THR A 1 16 ? -4.988  5.778   0.775   1.00 0.00 ? 121 THR A HB   8  
ATOM 6241  H HG1  . THR A 1 16 ? -4.754  3.411   2.306   1.00 0.00 ? 121 THR A HG1  8  
ATOM 6242  H HG21 . THR A 1 16 ? -6.498  4.031   -0.580  1.00 0.00 ? 121 THR A HG21 8  
ATOM 6243  H HG22 . THR A 1 16 ? -7.154  5.260   0.499   1.00 0.00 ? 121 THR A HG22 8  
ATOM 6244  H HG23 . THR A 1 16 ? -6.935  3.605   1.072   1.00 0.00 ? 121 THR A HG23 8  
ATOM 6245  N N    . GLN A 1 17 ? -2.365  5.654   -0.354  1.00 0.00 ? 122 GLN A N    8  
ATOM 6246  C CA   . GLN A 1 17 ? -1.089  6.290   -0.088  1.00 0.00 ? 122 GLN A CA   8  
ATOM 6247  C C    . GLN A 1 17 ? -1.009  6.655   1.381   1.00 0.00 ? 122 GLN A C    8  
ATOM 6248  O O    . GLN A 1 17 ? 0.022   7.092   1.862   1.00 0.00 ? 122 GLN A O    8  
ATOM 6249  C CB   . GLN A 1 17 ? -0.910  7.521   -0.967  1.00 0.00 ? 122 GLN A CB   8  
ATOM 6250  C CG   . GLN A 1 17 ? -0.150  7.231   -2.249  1.00 0.00 ? 122 GLN A CG   8  
ATOM 6251  C CD   . GLN A 1 17 ? -0.187  8.385   -3.234  1.00 0.00 ? 122 GLN A CD   8  
ATOM 6252  O OE1  . GLN A 1 17 ? -0.156  8.179   -4.447  1.00 0.00 ? 122 GLN A OE1  8  
ATOM 6253  N NE2  . GLN A 1 17 ? -0.246  9.607   -2.717  1.00 0.00 ? 122 GLN A NE2  8  
ATOM 6254  H H    . GLN A 1 17 ? -2.962  6.031   -1.033  1.00 0.00 ? 122 GLN A H    8  
ATOM 6255  H HA   . GLN A 1 17 ? -0.294  5.573   -0.302  1.00 0.00 ? 122 GLN A HA   8  
ATOM 6256  H HB2  . GLN A 1 17 ? -1.884  7.909   -1.230  1.00 0.00 ? 122 GLN A HB2  8  
ATOM 6257  H HB3  . GLN A 1 17 ? -0.371  8.270   -0.414  1.00 0.00 ? 122 GLN A HB3  8  
ATOM 6258  H HG2  . GLN A 1 17 ? 0.880   7.024   -1.999  1.00 0.00 ? 122 GLN A HG2  8  
ATOM 6259  H HG3  . GLN A 1 17 ? -0.580  6.361   -2.714  1.00 0.00 ? 122 GLN A HG3  8  
ATOM 6260  H HE21 . GLN A 1 17 ? -0.263  9.696   -1.741  1.00 0.00 ? 122 GLN A HE21 8  
ATOM 6261  H HE22 . GLN A 1 17 ? -0.272  10.369  -3.331  1.00 0.00 ? 122 GLN A HE22 8  
ATOM 6262  N N    . GLN A 1 18 ? -2.119  6.499   2.090   1.00 0.00 ? 123 GLN A N    8  
ATOM 6263  C CA   . GLN A 1 18 ? -2.127  6.744   3.512   1.00 0.00 ? 123 GLN A CA   8  
ATOM 6264  C C    . GLN A 1 18 ? -1.626  5.493   4.204   1.00 0.00 ? 123 GLN A C    8  
ATOM 6265  O O    . GLN A 1 18 ? -0.659  5.541   4.960   1.00 0.00 ? 123 GLN A O    8  
ATOM 6266  C CB   . GLN A 1 18 ? -3.516  7.106   4.008   1.00 0.00 ? 123 GLN A CB   8  
ATOM 6267  C CG   . GLN A 1 18 ? -3.746  8.602   4.106   1.00 0.00 ? 123 GLN A CG   8  
ATOM 6268  C CD   . GLN A 1 18 ? -2.765  9.287   5.040   1.00 0.00 ? 123 GLN A CD   8  
ATOM 6269  O OE1  . GLN A 1 18 ? -2.427  10.456  4.854   1.00 0.00 ? 123 GLN A OE1  8  
ATOM 6270  N NE2  . GLN A 1 18 ? -2.301  8.561   6.051   1.00 0.00 ? 123 GLN A NE2  8  
ATOM 6271  H H    . GLN A 1 18 ? -2.948  6.219   1.645   1.00 0.00 ? 123 GLN A H    8  
ATOM 6272  H HA   . GLN A 1 18 ? -1.446  7.557   3.720   1.00 0.00 ? 123 GLN A HA   8  
ATOM 6273  H HB2  . GLN A 1 18 ? -4.248  6.692   3.331   1.00 0.00 ? 123 GLN A HB2  8  
ATOM 6274  H HB3  . GLN A 1 18 ? -3.655  6.674   4.985   1.00 0.00 ? 123 GLN A HB3  8  
ATOM 6275  H HG2  . GLN A 1 18 ? -3.643  9.036   3.122   1.00 0.00 ? 123 GLN A HG2  8  
ATOM 6276  H HG3  . GLN A 1 18 ? -4.744  8.773   4.470   1.00 0.00 ? 123 GLN A HG3  8  
ATOM 6277  H HE21 . GLN A 1 18 ? -2.612  7.636   6.138   1.00 0.00 ? 123 GLN A HE21 8  
ATOM 6278  H HE22 . GLN A 1 18 ? -1.666  8.980   6.669   1.00 0.00 ? 123 GLN A HE22 8  
ATOM 6279  N N    . ASP A 1 19 ? -2.274  4.363   3.914   1.00 0.00 ? 124 ASP A N    8  
ATOM 6280  C CA   . ASP A 1 19 ? -1.856  3.095   4.496   1.00 0.00 ? 124 ASP A CA   8  
ATOM 6281  C C    . ASP A 1 19 ? -0.380  2.888   4.196   1.00 0.00 ? 124 ASP A C    8  
ATOM 6282  O O    . ASP A 1 19 ? 0.438   2.702   5.099   1.00 0.00 ? 124 ASP A O    8  
ATOM 6283  C CB   . ASP A 1 19 ? -2.668  1.927   3.917   1.00 0.00 ? 124 ASP A CB   8  
ATOM 6284  C CG   . ASP A 1 19 ? -2.812  0.783   4.901   1.00 0.00 ? 124 ASP A CG   8  
ATOM 6285  O OD1  . ASP A 1 19 ? -3.596  0.921   5.863   1.00 0.00 ? 124 ASP A OD1  8  
ATOM 6286  O OD2  . ASP A 1 19 ? -2.146  -0.255  4.705   1.00 0.00 ? 124 ASP A OD2  8  
ATOM 6287  H H    . ASP A 1 19 ? -3.040  4.384   3.294   1.00 0.00 ? 124 ASP A H    8  
ATOM 6288  H HA   . ASP A 1 19 ? -2.003  3.144   5.564   1.00 0.00 ? 124 ASP A HA   8  
ATOM 6289  H HB2  . ASP A 1 19 ? -3.653  2.270   3.646   1.00 0.00 ? 124 ASP A HB2  8  
ATOM 6290  H HB3  . ASP A 1 19 ? -2.169  1.556   3.036   1.00 0.00 ? 124 ASP A HB3  8  
ATOM 6291  N N    . LEU A 1 20 ? -0.050  2.957   2.911   1.00 0.00 ? 125 LEU A N    8  
ATOM 6292  C CA   . LEU A 1 20 ? 1.319   2.795   2.459   1.00 0.00 ? 125 LEU A CA   8  
ATOM 6293  C C    . LEU A 1 20 ? 2.237   3.812   3.145   1.00 0.00 ? 125 LEU A C    8  
ATOM 6294  O O    . LEU A 1 20 ? 3.397   3.509   3.440   1.00 0.00 ? 125 LEU A O    8  
ATOM 6295  C CB   . LEU A 1 20 ? 1.386   2.910   0.926   1.00 0.00 ? 125 LEU A CB   8  
ATOM 6296  C CG   . LEU A 1 20 ? 0.552   1.887   0.166   1.00 0.00 ? 125 LEU A CG   8  
ATOM 6297  C CD1  . LEU A 1 20 ? -0.389  2.589   -0.790  1.00 0.00 ? 125 LEU A CD1  8  
ATOM 6298  C CD2  . LEU A 1 20 ? 1.453   0.958   -0.607  1.00 0.00 ? 125 LEU A CD2  8  
ATOM 6299  H H    . LEU A 1 20 ? -0.752  3.121   2.250   1.00 0.00 ? 125 LEU A H    8  
ATOM 6300  H HA   . LEU A 1 20 ? 1.637   1.803   2.745   1.00 0.00 ? 125 LEU A HA   8  
ATOM 6301  H HB2  . LEU A 1 20 ? 1.056   3.884   0.626   1.00 0.00 ? 125 LEU A HB2  8  
ATOM 6302  H HB3  . LEU A 1 20 ? 2.403   2.801   0.620   1.00 0.00 ? 125 LEU A HB3  8  
ATOM 6303  H HG   . LEU A 1 20 ? -0.032  1.301   0.861   1.00 0.00 ? 125 LEU A HG   8  
ATOM 6304  H HD11 . LEU A 1 20 ? -1.311  2.032   -0.870  1.00 0.00 ? 125 LEU A HD11 8  
ATOM 6305  H HD12 . LEU A 1 20 ? 0.079   2.645   -1.759  1.00 0.00 ? 125 LEU A HD12 8  
ATOM 6306  H HD13 . LEU A 1 20 ? -0.597  3.585   -0.430  1.00 0.00 ? 125 LEU A HD13 8  
ATOM 6307  H HD21 . LEU A 1 20 ? 2.300   0.684   0.004   1.00 0.00 ? 125 LEU A HD21 8  
ATOM 6308  H HD22 . LEU A 1 20 ? 1.798   1.472   -1.497  1.00 0.00 ? 125 LEU A HD22 8  
ATOM 6309  H HD23 . LEU A 1 20 ? 0.906   0.073   -0.887  1.00 0.00 ? 125 LEU A HD23 8  
ATOM 6310  N N    . LEU A 1 21 ? 1.711   5.014   3.417   1.00 0.00 ? 126 LEU A N    8  
ATOM 6311  C CA   . LEU A 1 21 ? 2.488   6.046   4.096   1.00 0.00 ? 126 LEU A CA   8  
ATOM 6312  C C    . LEU A 1 21 ? 2.875   5.590   5.496   1.00 0.00 ? 126 LEU A C    8  
ATOM 6313  O O    . LEU A 1 21 ? 3.906   5.995   6.030   1.00 0.00 ? 126 LEU A O    8  
ATOM 6314  C CB   . LEU A 1 21 ? 1.690   7.351   4.187   1.00 0.00 ? 126 LEU A CB   8  
ATOM 6315  C CG   . LEU A 1 21 ? 2.069   8.420   3.159   1.00 0.00 ? 126 LEU A CG   8  
ATOM 6316  C CD1  . LEU A 1 21 ? 1.174   9.642   3.305   1.00 0.00 ? 126 LEU A CD1  8  
ATOM 6317  C CD2  . LEU A 1 21 ? 3.533   8.810   3.299   1.00 0.00 ? 126 LEU A CD2  8  
ATOM 6318  H H    . LEU A 1 21 ? 0.788   5.213   3.148   1.00 0.00 ? 126 LEU A H    8  
ATOM 6319  H HA   . LEU A 1 21 ? 3.387   6.219   3.523   1.00 0.00 ? 126 LEU A HA   8  
ATOM 6320  H HB2  . LEU A 1 21 ? 0.645   7.115   4.057   1.00 0.00 ? 126 LEU A HB2  8  
ATOM 6321  H HB3  . LEU A 1 21 ? 1.825   7.767   5.172   1.00 0.00 ? 126 LEU A HB3  8  
ATOM 6322  H HG   . LEU A 1 21 ? 1.920   8.013   2.168   1.00 0.00 ? 126 LEU A HG   8  
ATOM 6323  H HD11 . LEU A 1 21 ? 1.291   10.058  4.295   1.00 0.00 ? 126 LEU A HD11 8  
ATOM 6324  H HD12 . LEU A 1 21 ? 0.144   9.354   3.154   1.00 0.00 ? 126 LEU A HD12 8  
ATOM 6325  H HD13 . LEU A 1 21 ? 1.452   10.381  2.568   1.00 0.00 ? 126 LEU A HD13 8  
ATOM 6326  H HD21 . LEU A 1 21 ? 3.754   9.625   2.626   1.00 0.00 ? 126 LEU A HD21 8  
ATOM 6327  H HD22 . LEU A 1 21 ? 4.156   7.962   3.054   1.00 0.00 ? 126 LEU A HD22 8  
ATOM 6328  H HD23 . LEU A 1 21 ? 3.727   9.118   4.315   1.00 0.00 ? 126 LEU A HD23 8  
ATOM 6329  N N    . THR A 1 22 ? 2.034   4.747   6.089   1.00 0.00 ? 127 THR A N    8  
ATOM 6330  C CA   . THR A 1 22 ? 2.287   4.241   7.431   1.00 0.00 ? 127 THR A CA   8  
ATOM 6331  C C    . THR A 1 22 ? 2.884   2.837   7.393   1.00 0.00 ? 127 THR A C    8  
ATOM 6332  O O    . THR A 1 22 ? 3.199   2.268   8.438   1.00 0.00 ? 127 THR A O    8  
ATOM 6333  C CB   . THR A 1 22 ? 1.005   4.207   8.293   1.00 0.00 ? 127 THR A CB   8  
ATOM 6334  O OG1  . THR A 1 22 ? 0.533   2.861   8.415   1.00 0.00 ? 127 THR A OG1  8  
ATOM 6335  C CG2  . THR A 1 22 ? -0.093  5.071   7.695   1.00 0.00 ? 127 THR A CG2  8  
ATOM 6336  H H    . THR A 1 22 ? 1.225   4.463   5.614   1.00 0.00 ? 127 THR A H    8  
ATOM 6337  H HA   . THR A 1 22 ? 2.991   4.906   7.905   1.00 0.00 ? 127 THR A HA   8  
ATOM 6338  H HB   . THR A 1 22 ? 1.243   4.586   9.275   1.00 0.00 ? 127 THR A HB   8  
ATOM 6339  H HG1  . THR A 1 22 ? 0.558   2.595   9.337   1.00 0.00 ? 127 THR A HG1  8  
ATOM 6340  H HG21 . THR A 1 22 ? 0.334   5.979   7.301   1.00 0.00 ? 127 THR A HG21 8  
ATOM 6341  H HG22 . THR A 1 22 ? -0.814  5.314   8.461   1.00 0.00 ? 127 THR A HG22 8  
ATOM 6342  H HG23 . THR A 1 22 ? -0.583  4.528   6.900   1.00 0.00 ? 127 THR A HG23 8  
ATOM 6343  N N    . LEU A 1 23 ? 3.043   2.275   6.193   1.00 0.00 ? 128 LEU A N    8  
ATOM 6344  C CA   . LEU A 1 23 ? 3.595   0.940   6.061   1.00 0.00 ? 128 LEU A CA   8  
ATOM 6345  C C    . LEU A 1 23 ? 5.102   0.999   5.855   1.00 0.00 ? 128 LEU A C    8  
ATOM 6346  O O    . LEU A 1 23 ? 5.814   0.036   6.140   1.00 0.00 ? 128 LEU A O    8  
ATOM 6347  C CB   . LEU A 1 23 ? 2.914   0.203   4.914   1.00 0.00 ? 128 LEU A CB   8  
ATOM 6348  C CG   . LEU A 1 23 ? 1.437   -0.103  5.148   1.00 0.00 ? 128 LEU A CG   8  
ATOM 6349  C CD1  . LEU A 1 23 ? 0.772   -0.517  3.852   1.00 0.00 ? 128 LEU A CD1  8  
ATOM 6350  C CD2  . LEU A 1 23 ? 1.298   -1.193  6.184   1.00 0.00 ? 128 LEU A CD2  8  
ATOM 6351  H H    . LEU A 1 23 ? 2.796   2.770   5.381   1.00 0.00 ? 128 LEU A H    8  
ATOM 6352  H HA   . LEU A 1 23 ? 3.393   0.406   6.978   1.00 0.00 ? 128 LEU A HA   8  
ATOM 6353  H HB2  . LEU A 1 23 ? 3.000   0.796   4.025   1.00 0.00 ? 128 LEU A HB2  8  
ATOM 6354  H HB3  . LEU A 1 23 ? 3.429   -0.727  4.757   1.00 0.00 ? 128 LEU A HB3  8  
ATOM 6355  H HG   . LEU A 1 23 ? 0.941   0.779   5.518   1.00 0.00 ? 128 LEU A HG   8  
ATOM 6356  H HD11 . LEU A 1 23 ? 1.408   -1.218  3.340   1.00 0.00 ? 128 LEU A HD11 8  
ATOM 6357  H HD12 . LEU A 1 23 ? 0.615   0.354   3.232   1.00 0.00 ? 128 LEU A HD12 8  
ATOM 6358  H HD13 . LEU A 1 23 ? -0.179  -0.983  4.068   1.00 0.00 ? 128 LEU A HD13 8  
ATOM 6359  H HD21 . LEU A 1 23 ? 1.487   -0.786  7.167   1.00 0.00 ? 128 LEU A HD21 8  
ATOM 6360  H HD22 . LEU A 1 23 ? 2.017   -1.963  5.968   1.00 0.00 ? 128 LEU A HD22 8  
ATOM 6361  H HD23 . LEU A 1 23 ? 0.301   -1.606  6.146   1.00 0.00 ? 128 LEU A HD23 8  
ATOM 6362  N N    . CYS A 1 24 ? 5.588   2.137   5.357   1.00 0.00 ? 129 CYS A N    8  
ATOM 6363  C CA   . CYS A 1 24 ? 7.019   2.311   5.140   1.00 0.00 ? 129 CYS A CA   8  
ATOM 6364  C C    . CYS A 1 24 ? 7.773   2.232   6.467   1.00 0.00 ? 129 CYS A C    8  
ATOM 6365  O O    . CYS A 1 24 ? 7.261   2.653   7.505   1.00 0.00 ? 129 CYS A O    8  
ATOM 6366  C CB   . CYS A 1 24 ? 7.316   3.645   4.452   1.00 0.00 ? 129 CYS A CB   8  
ATOM 6367  S SG   . CYS A 1 24 ? 6.704   5.114   5.347   1.00 0.00 ? 129 CYS A SG   8  
ATOM 6368  H H    . CYS A 1 24 ? 4.969   2.862   5.117   1.00 0.00 ? 129 CYS A H    8  
ATOM 6369  H HA   . CYS A 1 24 ? 7.353   1.506   4.502   1.00 0.00 ? 129 CYS A HA   8  
ATOM 6370  H HB2  . CYS A 1 24 ? 8.385   3.753   4.348   1.00 0.00 ? 129 CYS A HB2  8  
ATOM 6371  H HB3  . CYS A 1 24 ? 6.865   3.640   3.473   1.00 0.00 ? 129 CYS A HB3  8  
ATOM 6372  N N    . PRO A 1 25 ? 9.002   1.687   6.449   1.00 0.00 ? 130 PRO A N    8  
ATOM 6373  C CA   . PRO A 1 25 ? 9.832   1.538   7.637   1.00 0.00 ? 130 PRO A CA   8  
ATOM 6374  C C    . PRO A 1 25 ? 10.627  2.795   7.954   1.00 0.00 ? 130 PRO A C    8  
ATOM 6375  O O    . PRO A 1 25 ? 10.291  3.549   8.867   1.00 0.00 ? 130 PRO A O    8  
ATOM 6376  C CB   . PRO A 1 25 ? 10.779  0.379   7.271   1.00 0.00 ? 130 PRO A CB   8  
ATOM 6377  C CG   . PRO A 1 25 ? 10.475  0.023   5.843   1.00 0.00 ? 130 PRO A CG   8  
ATOM 6378  C CD   . PRO A 1 25 ? 9.691   1.169   5.271   1.00 0.00 ? 130 PRO A CD   8  
ATOM 6379  H HA   . PRO A 1 25 ? 9.250   1.266   8.494   1.00 0.00 ? 130 PRO A HA   8  
ATOM 6380  H HB2  . PRO A 1 25 ? 11.803  0.705   7.384   1.00 0.00 ? 130 PRO A HB2  8  
ATOM 6381  H HB3  . PRO A 1 25 ? 10.592  -0.456  7.930   1.00 0.00 ? 130 PRO A HB3  8  
ATOM 6382  H HG2  . PRO A 1 25 ? 11.397  -0.107  5.296   1.00 0.00 ? 130 PRO A HG2  8  
ATOM 6383  H HG3  . PRO A 1 25 ? 9.890   -0.885  5.810   1.00 0.00 ? 130 PRO A HG3  8  
ATOM 6384  H HD2  . PRO A 1 25 ? 10.353  1.911   4.850   1.00 0.00 ? 130 PRO A HD2  8  
ATOM 6385  H HD3  . PRO A 1 25 ? 8.985   0.822   4.529   1.00 0.00 ? 130 PRO A HD3  8  
ATOM 6386  N N    . TYR A 1 26 ? 11.685  3.007   7.189   1.00 0.00 ? 131 TYR A N    8  
ATOM 6387  C CA   . TYR A 1 26 ? 12.547  4.169   7.367   1.00 0.00 ? 131 TYR A CA   8  
ATOM 6388  C C    . TYR A 1 26 ? 12.177  5.277   6.386   1.00 0.00 ? 131 TYR A C    8  
ATOM 6389  O O    . TYR A 1 26 ? 12.715  5.275   5.259   1.00 0.00 ? 131 TYR A O    8  
ATOM 6390  C CB   . TYR A 1 26 ? 14.013  3.775   7.180   1.00 0.00 ? 131 TYR A CB   8  
ATOM 6391  C CG   . TYR A 1 26 ? 14.475  2.687   8.124   1.00 0.00 ? 131 TYR A CG   8  
ATOM 6392  C CD1  . TYR A 1 26 ? 14.970  2.997   9.384   1.00 0.00 ? 131 TYR A CD1  8  
ATOM 6393  C CD2  . TYR A 1 26 ? 14.416  1.349   7.753   1.00 0.00 ? 131 TYR A CD2  8  
ATOM 6394  C CE1  . TYR A 1 26 ? 15.395  2.006   10.248  1.00 0.00 ? 131 TYR A CE1  8  
ATOM 6395  C CE2  . TYR A 1 26 ? 14.837  0.351   8.612   1.00 0.00 ? 131 TYR A CE2  8  
ATOM 6396  C CZ   . TYR A 1 26 ? 15.325  0.685   9.858   1.00 0.00 ? 131 TYR A CZ   8  
ATOM 6397  O OH   . TYR A 1 26 ? 15.744  -0.305  10.716  1.00 0.00 ? 131 TYR A OH   8  
ATOM 6398  O OXT  . TYR A 1 26 ? 11.349  6.139   6.751   1.00 0.00 ? 131 TYR A OXT  8  
ATOM 6399  H H    . TYR A 1 26 ? 11.890  2.360   6.488   1.00 0.00 ? 131 TYR A H    8  
ATOM 6400  H HA   . TYR A 1 26 ? 12.407  4.536   8.373   1.00 0.00 ? 131 TYR A HA   8  
ATOM 6401  H HB2  . TYR A 1 26 ? 14.158  3.420   6.171   1.00 0.00 ? 131 TYR A HB2  8  
ATOM 6402  H HB3  . TYR A 1 26 ? 14.636  4.643   7.343   1.00 0.00 ? 131 TYR A HB3  8  
ATOM 6403  H HD1  . TYR A 1 26 ? 15.023  4.032   9.688   1.00 0.00 ? 131 TYR A HD1  8  
ATOM 6404  H HD2  . TYR A 1 26 ? 14.035  1.092   6.776   1.00 0.00 ? 131 TYR A HD2  8  
ATOM 6405  H HE1  . TYR A 1 26 ? 15.776  2.266   11.224  1.00 0.00 ? 131 TYR A HE1  8  
ATOM 6406  H HE2  . TYR A 1 26 ? 14.784  -0.683  8.306   1.00 0.00 ? 131 TYR A HE2  8  
ATOM 6407  H HH   . TYR A 1 26 ? 15.407  -0.129  11.597  1.00 0.00 ? 131 TYR A HH   8  
ATOM 6408  N N    . PRO B 2 1  ? -0.223  15.171  -8.130  1.00 0.00 ? 25  PRO B N    8  
ATOM 6409  C CA   . PRO B 2 1  ? -0.185  14.199  -9.250  1.00 0.00 ? 25  PRO B CA   8  
ATOM 6410  C C    . PRO B 2 1  ? -1.218  13.095  -9.056  1.00 0.00 ? 25  PRO B C    8  
ATOM 6411  O O    . PRO B 2 1  ? -1.999  12.800  -9.961  1.00 0.00 ? 25  PRO B O    8  
ATOM 6412  C CB   . PRO B 2 1  ? 1.212   13.601  -9.333  1.00 0.00 ? 25  PRO B CB   8  
ATOM 6413  C CG   . PRO B 2 1  ? 1.918   14.173  -8.152  1.00 0.00 ? 25  PRO B CG   8  
ATOM 6414  C CD   . PRO B 2 1  ? 1.187   15.448  -7.794  1.00 0.00 ? 25  PRO B CD   8  
ATOM 6415  H H2   . PRO B 2 1  ? -0.803  14.729  -7.399  1.00 0.00 ? 25  PRO B H2   8  
ATOM 6416  H H3   . PRO B 2 1  ? -0.826  15.954  -8.478  1.00 0.00 ? 25  PRO B H3   8  
ATOM 6417  H HA   . PRO B 2 1  ? -0.401  14.726  -10.167 1.00 0.00 ? 25  PRO B HA   8  
ATOM 6418  H HB2  . PRO B 2 1  ? 1.152   12.524  -9.280  1.00 0.00 ? 25  PRO B HB2  8  
ATOM 6419  H HB3  . PRO B 2 1  ? 1.682   13.899  -10.259 1.00 0.00 ? 25  PRO B HB3  8  
ATOM 6420  H HG2  . PRO B 2 1  ? 1.876   13.476  -7.329  1.00 0.00 ? 25  PRO B HG2  8  
ATOM 6421  H HG3  . PRO B 2 1  ? 2.944   14.391  -8.408  1.00 0.00 ? 25  PRO B HG3  8  
ATOM 6422  H HD2  . PRO B 2 1  ? 1.294   15.659  -6.741  1.00 0.00 ? 25  PRO B HD2  8  
ATOM 6423  H HD3  . PRO B 2 1  ? 1.563   16.274  -8.383  1.00 0.00 ? 25  PRO B HD3  8  
ATOM 6424  N N    . THR B 2 2  ? -1.224  12.502  -7.865  1.00 0.00 ? 26  THR B N    8  
ATOM 6425  C CA   . THR B 2 2  ? -2.155  11.425  -7.540  1.00 0.00 ? 26  THR B CA   8  
ATOM 6426  C C    . THR B 2 2  ? -2.264  11.236  -6.028  1.00 0.00 ? 26  THR B C    8  
ATOM 6427  O O    . THR B 2 2  ? -1.252  11.199  -5.330  1.00 0.00 ? 26  THR B O    8  
ATOM 6428  C CB   . THR B 2 2  ? -1.717  10.087  -8.171  1.00 0.00 ? 26  THR B CB   8  
ATOM 6429  O OG1  . THR B 2 2  ? -0.287  10.003  -8.201  1.00 0.00 ? 26  THR B OG1  8  
ATOM 6430  C CG2  . THR B 2 2  ? -2.273  9.930   -9.578  1.00 0.00 ? 26  THR B CG2  8  
ATOM 6431  H H    . THR B 2 2  ? -0.585  12.798  -7.184  1.00 0.00 ? 26  THR B H    8  
ATOM 6432  H HA   . THR B 2 2  ? -3.123  11.690  -7.939  1.00 0.00 ? 26  THR B HA   8  
ATOM 6433  H HB   . THR B 2 2  ? -2.099  9.282   -7.559  1.00 0.00 ? 26  THR B HB   8  
ATOM 6434  H HG1  . THR B 2 2  ? 0.066   10.743  -8.701  1.00 0.00 ? 26  THR B HG1  8  
ATOM 6435  H HG21 . THR B 2 2  ? -1.807  10.653  -10.231 1.00 0.00 ? 26  THR B HG21 8  
ATOM 6436  H HG22 . THR B 2 2  ? -3.340  10.095  -9.562  1.00 0.00 ? 26  THR B HG22 8  
ATOM 6437  H HG23 . THR B 2 2  ? -2.067  8.932   -9.937  1.00 0.00 ? 26  THR B HG23 8  
ATOM 6438  N N    . PRO B 2 3  ? -3.497  11.116  -5.499  1.00 0.00 ? 27  PRO B N    8  
ATOM 6439  C CA   . PRO B 2 3  ? -3.740  10.932  -4.078  1.00 0.00 ? 27  PRO B CA   8  
ATOM 6440  C C    . PRO B 2 3  ? -3.929  9.466   -3.715  1.00 0.00 ? 27  PRO B C    8  
ATOM 6441  O O    . PRO B 2 3  ? -3.461  8.575   -4.423  1.00 0.00 ? 27  PRO B O    8  
ATOM 6442  C CB   . PRO B 2 3  ? -5.041  11.703  -3.882  1.00 0.00 ? 27  PRO B CB   8  
ATOM 6443  C CG   . PRO B 2 3  ? -5.776  11.576  -5.184  1.00 0.00 ? 27  PRO B CG   8  
ATOM 6444  C CD   . PRO B 2 3  ? -4.771  11.153  -6.234  1.00 0.00 ? 27  PRO B CD   8  
ATOM 6445  H HA   . PRO B 2 3  ? -2.960  11.364  -3.471  1.00 0.00 ? 27  PRO B HA   8  
ATOM 6446  H HB2  . PRO B 2 3  ? -5.601  11.267  -3.069  1.00 0.00 ? 27  PRO B HB2  8  
ATOM 6447  H HB3  . PRO B 2 3  ? -4.818  12.737  -3.658  1.00 0.00 ? 27  PRO B HB3  8  
ATOM 6448  H HG2  . PRO B 2 3  ? -6.549  10.828  -5.091  1.00 0.00 ? 27  PRO B HG2  8  
ATOM 6449  H HG3  . PRO B 2 3  ? -6.211  12.528  -5.450  1.00 0.00 ? 27  PRO B HG3  8  
ATOM 6450  H HD2  . PRO B 2 3  ? -5.021  10.174  -6.622  1.00 0.00 ? 27  PRO B HD2  8  
ATOM 6451  H HD3  . PRO B 2 3  ? -4.734  11.878  -7.035  1.00 0.00 ? 27  PRO B HD3  8  
ATOM 6452  N N    . GLU B 2 4  ? -4.619  9.222   -2.608  1.00 0.00 ? 28  GLU B N    8  
ATOM 6453  C CA   . GLU B 2 4  ? -4.881  7.860   -2.164  1.00 0.00 ? 28  GLU B CA   8  
ATOM 6454  C C    . GLU B 2 4  ? -6.040  7.270   -2.939  1.00 0.00 ? 28  GLU B C    8  
ATOM 6455  O O    . GLU B 2 4  ? -7.173  7.203   -2.456  1.00 0.00 ? 28  GLU B O    8  
ATOM 6456  C CB   . GLU B 2 4  ? -5.174  7.814   -0.672  1.00 0.00 ? 28  GLU B CB   8  
ATOM 6457  C CG   . GLU B 2 4  ? -6.011  8.976   -0.164  1.00 0.00 ? 28  GLU B CG   8  
ATOM 6458  C CD   . GLU B 2 4  ? -6.481  8.777   1.263   1.00 0.00 ? 28  GLU B CD   8  
ATOM 6459  O OE1  . GLU B 2 4  ? -7.399  7.959   1.477   1.00 0.00 ? 28  GLU B OE1  8  
ATOM 6460  O OE2  . GLU B 2 4  ? -5.932  9.443   2.166   1.00 0.00 ? 28  GLU B OE2  8  
ATOM 6461  H H    . GLU B 2 4  ? -4.956  9.975   -2.081  1.00 0.00 ? 28  GLU B H    8  
ATOM 6462  H HA   . GLU B 2 4  ? -3.998  7.273   -2.367  1.00 0.00 ? 28  GLU B HA   8  
ATOM 6463  H HB2  . GLU B 2 4  ? -5.702  6.899   -0.454  1.00 0.00 ? 28  GLU B HB2  8  
ATOM 6464  H HB3  . GLU B 2 4  ? -4.237  7.811   -0.151  1.00 0.00 ? 28  GLU B HB3  8  
ATOM 6465  H HG2  . GLU B 2 4  ? -5.416  9.874   -0.205  1.00 0.00 ? 28  GLU B HG2  8  
ATOM 6466  H HG3  . GLU B 2 4  ? -6.876  9.088   -0.801  1.00 0.00 ? 28  GLU B HG3  8  
ATOM 6467  N N    . MET B 2 5  ? -5.735  6.848   -4.147  1.00 0.00 ? 29  MET B N    8  
ATOM 6468  C CA   . MET B 2 5  ? -6.731  6.272   -5.039  1.00 0.00 ? 29  MET B CA   8  
ATOM 6469  C C    . MET B 2 5  ? -6.922  4.789   -4.776  1.00 0.00 ? 29  MET B C    8  
ATOM 6470  O O    . MET B 2 5  ? -7.600  4.096   -5.533  1.00 0.00 ? 29  MET B O    8  
ATOM 6471  C CB   . MET B 2 5  ? -6.333  6.517   -6.493  1.00 0.00 ? 29  MET B CB   8  
ATOM 6472  C CG   . MET B 2 5  ? -7.452  6.253   -7.483  1.00 0.00 ? 29  MET B CG   8  
ATOM 6473  S SD   . MET B 2 5  ? -8.435  7.722   -7.832  1.00 0.00 ? 29  MET B SD   8  
ATOM 6474  C CE   . MET B 2 5  ? -9.588  7.077   -9.040  1.00 0.00 ? 29  MET B CE   8  
ATOM 6475  H H    . MET B 2 5  ? -4.804  6.916   -4.442  1.00 0.00 ? 29  MET B H    8  
ATOM 6476  H HA   . MET B 2 5  ? -7.662  6.764   -4.837  1.00 0.00 ? 29  MET B HA   8  
ATOM 6477  H HB2  . MET B 2 5  ? -6.021  7.548   -6.602  1.00 0.00 ? 29  MET B HB2  8  
ATOM 6478  H HB3  . MET B 2 5  ? -5.504  5.872   -6.740  1.00 0.00 ? 29  MET B HB3  8  
ATOM 6479  H HG2  . MET B 2 5  ? -7.016  5.898   -8.402  1.00 0.00 ? 29  MET B HG2  8  
ATOM 6480  H HG3  . MET B 2 5  ? -8.101  5.491   -7.077  1.00 0.00 ? 29  MET B HG3  8  
ATOM 6481  H HE1  . MET B 2 5  ? -9.044  6.731   -9.907  1.00 0.00 ? 29  MET B HE1  8  
ATOM 6482  H HE2  . MET B 2 5  ? -10.274 7.857   -9.335  1.00 0.00 ? 29  MET B HE2  8  
ATOM 6483  H HE3  . MET B 2 5  ? -10.139 6.256   -8.609  1.00 0.00 ? 29  MET B HE3  8  
ATOM 6484  N N    . ARG B 2 6  ? -6.337  4.327   -3.689  1.00 0.00 ? 30  ARG B N    8  
ATOM 6485  C CA   . ARG B 2 6  ? -6.438  2.936   -3.278  1.00 0.00 ? 30  ARG B CA   8  
ATOM 6486  C C    . ARG B 2 6  ? -6.413  1.981   -4.465  1.00 0.00 ? 30  ARG B C    8  
ATOM 6487  O O    . ARG B 2 6  ? -7.460  1.653   -5.031  1.00 0.00 ? 30  ARG B O    8  
ATOM 6488  C CB   . ARG B 2 6  ? -7.724  2.745   -2.516  1.00 0.00 ? 30  ARG B CB   8  
ATOM 6489  C CG   . ARG B 2 6  ? -7.569  1.870   -1.297  1.00 0.00 ? 30  ARG B CG   8  
ATOM 6490  C CD   . ARG B 2 6  ? -8.503  0.698   -1.367  1.00 0.00 ? 30  ARG B CD   8  
ATOM 6491  N NE   . ARG B 2 6  ? -8.600  -0.001  -0.092  1.00 0.00 ? 30  ARG B NE   8  
ATOM 6492  C CZ   . ARG B 2 6  ? -9.537  -0.903  0.189   1.00 0.00 ? 30  ARG B CZ   8  
ATOM 6493  N NH1  . ARG B 2 6  ? -10.457 -1.212  -0.716  1.00 0.00 ? 30  ARG B NH1  8  
ATOM 6494  N NH2  . ARG B 2 6  ? -9.557  -1.492  1.376   1.00 0.00 ? 30  ARG B NH2  8  
ATOM 6495  H H    . ARG B 2 6  ? -5.838  4.946   -3.135  1.00 0.00 ? 30  ARG B H    8  
ATOM 6496  H HA   . ARG B 2 6  ? -5.614  2.707   -2.625  1.00 0.00 ? 30  ARG B HA   8  
ATOM 6497  H HB2  . ARG B 2 6  ? -8.096  3.707   -2.198  1.00 0.00 ? 30  ARG B HB2  8  
ATOM 6498  H HB3  . ARG B 2 6  ? -8.439  2.288   -3.180  1.00 0.00 ? 30  ARG B HB3  8  
ATOM 6499  H HG2  . ARG B 2 6  ? -6.551  1.513   -1.249  1.00 0.00 ? 30  ARG B HG2  8  
ATOM 6500  H HG3  . ARG B 2 6  ? -7.795  2.448   -0.414  1.00 0.00 ? 30  ARG B HG3  8  
ATOM 6501  H HD2  . ARG B 2 6  ? -9.474  1.068   -1.644  1.00 0.00 ? 30  ARG B HD2  8  
ATOM 6502  H HD3  . ARG B 2 6  ? -8.137  0.021   -2.123  1.00 0.00 ? 30  ARG B HD3  8  
ATOM 6503  H HE   . ARG B 2 6  ? -7.934  0.215   0.592   1.00 0.00 ? 30  ARG B HE   8  
ATOM 6504  H HH11 . ARG B 2 6  ? -10.447 -0.769  -1.612  1.00 0.00 ? 30  ARG B HH11 8  
ATOM 6505  H HH12 . ARG B 2 6  ? -11.160 -1.891  -0.502  1.00 0.00 ? 30  ARG B HH12 8  
ATOM 6506  H HH21 . ARG B 2 6  ? -8.867  -1.260  2.062   1.00 0.00 ? 30  ARG B HH21 8  
ATOM 6507  H HH22 . ARG B 2 6  ? -10.263 -2.169  1.587   1.00 0.00 ? 30  ARG B HH22 8  
ATOM 6508  N N    . GLU B 2 7  ? -5.228  1.523   -4.828  1.00 0.00 ? 31  GLU B N    8  
ATOM 6509  C CA   . GLU B 2 7  ? -5.089  0.608   -5.948  1.00 0.00 ? 31  GLU B CA   8  
ATOM 6510  C C    . GLU B 2 7  ? -4.704  -0.777  -5.480  1.00 0.00 ? 31  GLU B C    8  
ATOM 6511  O O    . GLU B 2 7  ? -4.036  -0.942  -4.468  1.00 0.00 ? 31  GLU B O    8  
ATOM 6512  C CB   . GLU B 2 7  ? -4.061  1.141   -6.944  1.00 0.00 ? 31  GLU B CB   8  
ATOM 6513  C CG   . GLU B 2 7  ? -3.675  0.144   -8.023  1.00 0.00 ? 31  GLU B CG   8  
ATOM 6514  C CD   . GLU B 2 7  ? -4.760  -0.044  -9.066  1.00 0.00 ? 31  GLU B CD   8  
ATOM 6515  O OE1  . GLU B 2 7  ? -5.838  -0.569  -8.718  1.00 0.00 ? 31  GLU B OE1  8  
ATOM 6516  O OE2  . GLU B 2 7  ? -4.531  0.337   -10.233 1.00 0.00 ? 31  GLU B OE2  8  
ATOM 6517  H H    . GLU B 2 7  ? -4.430  1.806   -4.335  1.00 0.00 ? 31  GLU B H    8  
ATOM 6518  H HA   . GLU B 2 7  ? -6.050  0.532   -6.432  1.00 0.00 ? 31  GLU B HA   8  
ATOM 6519  H HB2  . GLU B 2 7  ? -4.465  2.020   -7.424  1.00 0.00 ? 31  GLU B HB2  8  
ATOM 6520  H HB3  . GLU B 2 7  ? -3.166  1.418   -6.405  1.00 0.00 ? 31  GLU B HB3  8  
ATOM 6521  H HG2  . GLU B 2 7  ? -2.787  0.497   -8.511  1.00 0.00 ? 31  GLU B HG2  8  
ATOM 6522  H HG3  . GLU B 2 7  ? -3.471  -0.811  -7.558  1.00 0.00 ? 31  GLU B HG3  8  
ATOM 6523  N N    . LYS B 2 8  ? -5.134  -1.762  -6.249  1.00 0.00 ? 32  LYS B N    8  
ATOM 6524  C CA   . LYS B 2 8  ? -4.883  -3.152  -5.951  1.00 0.00 ? 32  LYS B CA   8  
ATOM 6525  C C    . LYS B 2 8  ? -3.399  -3.470  -5.975  1.00 0.00 ? 32  LYS B C    8  
ATOM 6526  O O    . LYS B 2 8  ? -2.796  -3.659  -7.032  1.00 0.00 ? 32  LYS B O    8  
ATOM 6527  C CB   . LYS B 2 8  ? -5.637  -4.010  -6.942  1.00 0.00 ? 32  LYS B CB   8  
ATOM 6528  C CG   . LYS B 2 8  ? -7.083  -3.583  -7.083  1.00 0.00 ? 32  LYS B CG   8  
ATOM 6529  C CD   . LYS B 2 8  ? -7.893  -4.579  -7.894  1.00 0.00 ? 32  LYS B CD   8  
ATOM 6530  C CE   . LYS B 2 8  ? -8.699  -5.497  -6.994  1.00 0.00 ? 32  LYS B CE   8  
ATOM 6531  N NZ   . LYS B 2 8  ? -7.825  -6.288  -6.084  1.00 0.00 ? 32  LYS B NZ   8  
ATOM 6532  H H    . LYS B 2 8  ? -5.636  -1.542  -7.056  1.00 0.00 ? 32  LYS B H    8  
ATOM 6533  H HA   . LYS B 2 8  ? -5.261  -3.351  -4.961  1.00 0.00 ? 32  LYS B HA   8  
ATOM 6534  H HB2  . LYS B 2 8  ? -5.157  -3.940  -7.906  1.00 0.00 ? 32  LYS B HB2  8  
ATOM 6535  H HB3  . LYS B 2 8  ? -5.616  -5.028  -6.608  1.00 0.00 ? 32  LYS B HB3  8  
ATOM 6536  H HG2  . LYS B 2 8  ? -7.506  -3.499  -6.096  1.00 0.00 ? 32  LYS B HG2  8  
ATOM 6537  H HG3  . LYS B 2 8  ? -7.122  -2.622  -7.565  1.00 0.00 ? 32  LYS B HG3  8  
ATOM 6538  H HD2  . LYS B 2 8  ? -8.568  -4.039  -8.540  1.00 0.00 ? 32  LYS B HD2  8  
ATOM 6539  H HD3  . LYS B 2 8  ? -7.218  -5.175  -8.492  1.00 0.00 ? 32  LYS B HD3  8  
ATOM 6540  H HE2  . LYS B 2 8  ? -9.368  -4.894  -6.400  1.00 0.00 ? 32  LYS B HE2  8  
ATOM 6541  H HE3  . LYS B 2 8  ? -9.272  -6.174  -7.610  1.00 0.00 ? 32  LYS B HE3  8  
ATOM 6542  H HZ1  . LYS B 2 8  ? -7.293  -5.654  -5.456  1.00 0.00 ? 32  LYS B HZ1  8  
ATOM 6543  H HZ2  . LYS B 2 8  ? -7.151  -6.854  -6.638  1.00 0.00 ? 32  LYS B HZ2  8  
ATOM 6544  H HZ3  . LYS B 2 8  ? -8.402  -6.930  -5.504  1.00 0.00 ? 32  LYS B HZ3  8  
ATOM 6545  N N    . LEU B 2 9  ? -2.838  -3.522  -4.785  1.00 0.00 ? 33  LEU B N    8  
ATOM 6546  C CA   . LEU B 2 9  ? -1.434  -3.804  -4.589  1.00 0.00 ? 33  LEU B CA   8  
ATOM 6547  C C    . LEU B 2 9  ? -1.198  -5.256  -4.189  1.00 0.00 ? 33  LEU B C    8  
ATOM 6548  O O    . LEU B 2 9  ? -1.408  -5.637  -3.037  1.00 0.00 ? 33  LEU B O    8  
ATOM 6549  C CB   . LEU B 2 9  ? -0.909  -2.881  -3.528  1.00 0.00 ? 33  LEU B CB   8  
ATOM 6550  C CG   . LEU B 2 9  ? -1.167  -1.398  -3.796  1.00 0.00 ? 33  LEU B CG   8  
ATOM 6551  C CD1  . LEU B 2 9  ? -0.609  -0.540  -2.680  1.00 0.00 ? 33  LEU B CD1  8  
ATOM 6552  C CD2  . LEU B 2 9  ? -0.584  -0.990  -5.140  1.00 0.00 ? 33  LEU B CD2  8  
ATOM 6553  H H    . LEU B 2 9  ? -3.388  -3.341  -4.006  1.00 0.00 ? 33  LEU B H    8  
ATOM 6554  H HA   . LEU B 2 9  ? -0.900  -3.594  -5.495  1.00 0.00 ? 33  LEU B HA   8  
ATOM 6555  H HB2  . LEU B 2 9  ? -1.340  -3.152  -2.580  1.00 0.00 ? 33  LEU B HB2  8  
ATOM 6556  H HB3  . LEU B 2 9  ? 0.135   -3.036  -3.480  1.00 0.00 ? 33  LEU B HB3  8  
ATOM 6557  H HG   . LEU B 2 9  ? -2.227  -1.234  -3.833  1.00 0.00 ? 33  LEU B HG   8  
ATOM 6558  H HD11 . LEU B 2 9  ? -1.381  -0.358  -1.953  1.00 0.00 ? 33  LEU B HD11 8  
ATOM 6559  H HD12 . LEU B 2 9  ? -0.266  0.401   -3.075  1.00 0.00 ? 33  LEU B HD12 8  
ATOM 6560  H HD13 . LEU B 2 9  ? 0.215   -1.054  -2.209  1.00 0.00 ? 33  LEU B HD13 8  
ATOM 6561  H HD21 . LEU B 2 9  ? -0.983  -0.030  -5.432  1.00 0.00 ? 33  LEU B HD21 8  
ATOM 6562  H HD22 . LEU B 2 9  ? -0.846  -1.733  -5.885  1.00 0.00 ? 33  LEU B HD22 8  
ATOM 6563  H HD23 . LEU B 2 9  ? 0.490   -0.925  -5.061  1.00 0.00 ? 33  LEU B HD23 8  
ATOM 6564  N N    . CYS B 2 10 ? -0.760  -6.063  -5.151  1.00 0.00 ? 34  CYS B N    8  
ATOM 6565  C CA   . CYS B 2 10 ? -0.497  -7.476  -4.901  1.00 0.00 ? 34  CYS B CA   8  
ATOM 6566  C C    . CYS B 2 10 ? 0.982   -7.725  -4.653  1.00 0.00 ? 34  CYS B C    8  
ATOM 6567  O O    . CYS B 2 10 ? 1.704   -8.216  -5.522  1.00 0.00 ? 34  CYS B O    8  
ATOM 6568  C CB   . CYS B 2 10 ? -0.988  -8.310  -6.072  1.00 0.00 ? 34  CYS B CB   8  
ATOM 6569  S SG   . CYS B 2 10 ? -1.381  -10.038 -5.645  1.00 0.00 ? 34  CYS B SG   8  
ATOM 6570  H H    . CYS B 2 10 ? -0.610  -5.700  -6.049  1.00 0.00 ? 34  CYS B H    8  
ATOM 6571  H HA   . CYS B 2 10 ? -1.047  -7.759  -4.017  1.00 0.00 ? 34  CYS B HA   8  
ATOM 6572  H HB2  . CYS B 2 10 ? -1.881  -7.858  -6.456  1.00 0.00 ? 34  CYS B HB2  8  
ATOM 6573  H HB3  . CYS B 2 10 ? -0.232  -8.323  -6.843  1.00 0.00 ? 34  CYS B HB3  8  
ATOM 6574  N N    . GLY B 2 11 ? 1.410   -7.379  -3.454  1.00 0.00 ? 35  GLY B N    8  
ATOM 6575  C CA   . GLY B 2 11 ? 2.799   -7.557  -3.058  1.00 0.00 ? 35  GLY B CA   8  
ATOM 6576  C C    . GLY B 2 11 ? 3.742   -6.605  -3.771  1.00 0.00 ? 35  GLY B C    8  
ATOM 6577  O O    . GLY B 2 11 ? 4.221   -5.649  -3.167  1.00 0.00 ? 35  GLY B O    8  
ATOM 6578  H H    . GLY B 2 11 ? 0.767   -6.998  -2.826  1.00 0.00 ? 35  GLY B H    8  
ATOM 6579  H HA2  . GLY B 2 11 ? 2.877   -7.386  -1.996  1.00 0.00 ? 35  GLY B HA2  8  
ATOM 6580  H HA3  . GLY B 2 11 ? 3.098   -8.567  -3.266  1.00 0.00 ? 35  GLY B HA3  8  
ATOM 6581  N N    . HIS B 2 12 ? 4.038   -6.870  -5.045  1.00 0.00 ? 36  HIS B N    8  
ATOM 6582  C CA   . HIS B 2 12 ? 4.923   -6.003  -5.799  1.00 0.00 ? 36  HIS B CA   8  
ATOM 6583  C C    . HIS B 2 12 ? 4.289   -4.638  -6.014  1.00 0.00 ? 36  HIS B C    8  
ATOM 6584  O O    . HIS B 2 12 ? 4.914   -3.623  -5.728  1.00 0.00 ? 36  HIS B O    8  
ATOM 6585  C CB   . HIS B 2 12 ? 5.319   -6.624  -7.130  1.00 0.00 ? 36  HIS B CB   8  
ATOM 6586  C CG   . HIS B 2 12 ? 6.631   -6.102  -7.610  1.00 0.00 ? 36  HIS B CG   8  
ATOM 6587  N ND1  . HIS B 2 12 ? 7.041   -6.125  -8.920  1.00 0.00 ? 36  HIS B ND1  8  
ATOM 6588  C CD2  . HIS B 2 12 ? 7.633   -5.513  -6.906  1.00 0.00 ? 36  HIS B CD2  8  
ATOM 6589  C CE1  . HIS B 2 12 ? 8.255   -5.566  -8.979  1.00 0.00 ? 36  HIS B CE1  8  
ATOM 6590  N NE2  . HIS B 2 12 ? 8.661   -5.176  -7.783  1.00 0.00 ? 36  HIS B NE2  8  
ATOM 6591  H H    . HIS B 2 12 ? 3.679   -7.666  -5.470  1.00 0.00 ? 36  HIS B H    8  
ATOM 6592  H HA   . HIS B 2 12 ? 5.814   -5.869  -5.204  1.00 0.00 ? 36  HIS B HA   8  
ATOM 6593  H HB2  . HIS B 2 12 ? 5.400   -7.695  -7.019  1.00 0.00 ? 36  HIS B HB2  8  
ATOM 6594  H HB3  . HIS B 2 12 ? 4.570   -6.390  -7.873  1.00 0.00 ? 36  HIS B HB3  8  
ATOM 6595  H HD1  . HIS B 2 12 ? 6.536   -6.491  -9.677  1.00 0.00 ? 36  HIS B HD1  8  
ATOM 6596  H HD2  . HIS B 2 12 ? 7.633   -5.327  -5.833  1.00 0.00 ? 36  HIS B HD2  8  
ATOM 6597  H HE1  . HIS B 2 12 ? 8.820   -5.436  -9.887  1.00 0.00 ? 36  HIS B HE1  8  
ATOM 6598  N N    . HIS B 2 13 ? 3.069   -4.593  -6.552  1.00 0.00 ? 37  HIS B N    8  
ATOM 6599  C CA   . HIS B 2 13 ? 2.397   -3.307  -6.710  1.00 0.00 ? 37  HIS B CA   8  
ATOM 6600  C C    . HIS B 2 13 ? 2.401   -2.649  -5.366  1.00 0.00 ? 37  HIS B C    8  
ATOM 6601  O O    . HIS B 2 13 ? 2.572   -1.441  -5.227  1.00 0.00 ? 37  HIS B O    8  
ATOM 6602  C CB   . HIS B 2 13 ? 0.948   -3.465  -7.144  1.00 0.00 ? 37  HIS B CB   8  
ATOM 6603  C CG   . HIS B 2 13 ? 0.790   -3.801  -8.576  1.00 0.00 ? 37  HIS B CG   8  
ATOM 6604  N ND1  . HIS B 2 13 ? -0.137  -3.218  -9.402  1.00 0.00 ? 37  HIS B ND1  8  
ATOM 6605  C CD2  . HIS B 2 13 ? 1.466   -4.691  -9.325  1.00 0.00 ? 37  HIS B CD2  8  
ATOM 6606  C CE1  . HIS B 2 13 ? -0.001  -3.762  -10.612 1.00 0.00 ? 37  HIS B CE1  8  
ATOM 6607  N NE2  . HIS B 2 13 ? 0.963   -4.668  -10.624 1.00 0.00 ? 37  HIS B NE2  8  
ATOM 6608  H H    . HIS B 2 13 ? 2.626   -5.419  -6.840  1.00 0.00 ? 37  HIS B H    8  
ATOM 6609  H HA   . HIS B 2 13 ? 2.941   -2.704  -7.421  1.00 0.00 ? 37  HIS B HA   8  
ATOM 6610  H HB2  . HIS B 2 13 ? 0.489   -4.253  -6.567  1.00 0.00 ? 37  HIS B HB2  8  
ATOM 6611  H HB3  . HIS B 2 13 ? 0.425   -2.535  -6.955  1.00 0.00 ? 37  HIS B HB3  8  
ATOM 6612  H HD1  . HIS B 2 13 ? -0.783  -2.526  -9.148  1.00 0.00 ? 37  HIS B HD1  8  
ATOM 6613  H HD2  . HIS B 2 13 ? 2.270   -5.321  -8.972  1.00 0.00 ? 37  HIS B HD2  8  
ATOM 6614  H HE1  . HIS B 2 13 ? -0.602  -3.496  -11.463 1.00 0.00 ? 37  HIS B HE1  8  
ATOM 6615  N N    . PHE B 2 14 ? 2.205   -3.496  -4.377  1.00 0.00 ? 38  PHE B N    8  
ATOM 6616  C CA   . PHE B 2 14 ? 2.189   -3.080  -3.010  1.00 0.00 ? 38  PHE B CA   8  
ATOM 6617  C C    . PHE B 2 14 ? 3.548   -2.564  -2.617  1.00 0.00 ? 38  PHE B C    8  
ATOM 6618  O O    . PHE B 2 14 ? 3.667   -1.690  -1.769  1.00 0.00 ? 38  PHE B O    8  
ATOM 6619  C CB   . PHE B 2 14 ? 1.741   -4.242  -2.132  1.00 0.00 ? 38  PHE B CB   8  
ATOM 6620  C CG   . PHE B 2 14 ? 1.918   -3.958  -0.692  1.00 0.00 ? 38  PHE B CG   8  
ATOM 6621  C CD1  . PHE B 2 14 ? 1.224   -2.914  -0.136  1.00 0.00 ? 38  PHE B CD1  8  
ATOM 6622  C CD2  . PHE B 2 14 ? 2.787   -4.697  0.088   1.00 0.00 ? 38  PHE B CD2  8  
ATOM 6623  C CE1  . PHE B 2 14 ? 1.383   -2.595  1.192   1.00 0.00 ? 38  PHE B CE1  8  
ATOM 6624  C CE2  . PHE B 2 14 ? 2.961   -4.384  1.422   1.00 0.00 ? 38  PHE B CE2  8  
ATOM 6625  C CZ   . PHE B 2 14 ? 2.256   -3.329  1.978   1.00 0.00 ? 38  PHE B CZ   8  
ATOM 6626  H H    . PHE B 2 14 ? 2.066   -4.443  -4.585  1.00 0.00 ? 38  PHE B H    8  
ATOM 6627  H HA   . PHE B 2 14 ? 1.476   -2.272  -2.919  1.00 0.00 ? 38  PHE B HA   8  
ATOM 6628  H HB2  . PHE B 2 14 ? 0.693   -4.433  -2.307  1.00 0.00 ? 38  PHE B HB2  8  
ATOM 6629  H HB3  . PHE B 2 14 ? 2.303   -5.119  -2.385  1.00 0.00 ? 38  PHE B HB3  8  
ATOM 6630  H HD1  . PHE B 2 14 ? 0.534   -2.348  -0.761  1.00 0.00 ? 38  PHE B HD1  8  
ATOM 6631  H HD2  . PHE B 2 14 ? 3.329   -5.526  -0.356  1.00 0.00 ? 38  PHE B HD2  8  
ATOM 6632  H HE1  . PHE B 2 14 ? 0.829   -1.771  1.615   1.00 0.00 ? 38  PHE B HE1  8  
ATOM 6633  H HE2  . PHE B 2 14 ? 3.639   -4.966  2.030   1.00 0.00 ? 38  PHE B HE2  8  
ATOM 6634  H HZ   . PHE B 2 14 ? 2.388   -3.077  3.020   1.00 0.00 ? 38  PHE B HZ   8  
ATOM 6635  N N    . VAL B 2 15 ? 4.569   -3.113  -3.248  1.00 0.00 ? 39  VAL B N    8  
ATOM 6636  C CA   . VAL B 2 15 ? 5.923   -2.681  -3.007  1.00 0.00 ? 39  VAL B CA   8  
ATOM 6637  C C    . VAL B 2 15 ? 6.108   -1.299  -3.610  1.00 0.00 ? 39  VAL B C    8  
ATOM 6638  O O    . VAL B 2 15 ? 6.290   -0.330  -2.882  1.00 0.00 ? 39  VAL B O    8  
ATOM 6639  C CB   . VAL B 2 15 ? 6.948   -3.686  -3.589  1.00 0.00 ? 39  VAL B CB   8  
ATOM 6640  C CG1  . VAL B 2 15 ? 8.186   -2.984  -4.124  1.00 0.00 ? 39  VAL B CG1  8  
ATOM 6641  C CG2  . VAL B 2 15 ? 7.340   -4.709  -2.538  1.00 0.00 ? 39  VAL B CG2  8  
ATOM 6642  H H    . VAL B 2 15 ? 4.403   -3.831  -3.892  1.00 0.00 ? 39  VAL B H    8  
ATOM 6643  H HA   . VAL B 2 15 ? 6.065   -2.613  -1.938  1.00 0.00 ? 39  VAL B HA   8  
ATOM 6644  H HB   . VAL B 2 15 ? 6.481   -4.211  -4.407  1.00 0.00 ? 39  VAL B HB   8  
ATOM 6645  H HG11 . VAL B 2 15 ? 8.120   -2.907  -5.200  1.00 0.00 ? 39  VAL B HG11 8  
ATOM 6646  H HG12 . VAL B 2 15 ? 9.060   -3.550  -3.855  1.00 0.00 ? 39  VAL B HG12 8  
ATOM 6647  H HG13 . VAL B 2 15 ? 8.255   -1.995  -3.698  1.00 0.00 ? 39  VAL B HG13 8  
ATOM 6648  H HG21 . VAL B 2 15 ? 6.519   -4.856  -1.852  1.00 0.00 ? 39  VAL B HG21 8  
ATOM 6649  H HG22 . VAL B 2 15 ? 8.206   -4.355  -1.999  1.00 0.00 ? 39  VAL B HG22 8  
ATOM 6650  H HG23 . VAL B 2 15 ? 7.578   -5.647  -3.021  1.00 0.00 ? 39  VAL B HG23 8  
ATOM 6651  N N    . ARG B 2 16 ? 6.038   -1.212  -4.943  1.00 0.00 ? 40  ARG B N    8  
ATOM 6652  C CA   . ARG B 2 16 ? 6.172   0.061   -5.624  1.00 0.00 ? 40  ARG B CA   8  
ATOM 6653  C C    . ARG B 2 16 ? 5.323   1.114   -4.946  1.00 0.00 ? 40  ARG B C    8  
ATOM 6654  O O    . ARG B 2 16 ? 5.863   2.088   -4.446  1.00 0.00 ? 40  ARG B O    8  
ATOM 6655  C CB   . ARG B 2 16 ? 5.774   -0.073  -7.088  1.00 0.00 ? 40  ARG B CB   8  
ATOM 6656  C CG   . ARG B 2 16 ? 6.693   -0.985  -7.876  1.00 0.00 ? 40  ARG B CG   8  
ATOM 6657  C CD   . ARG B 2 16 ? 6.034   -2.308  -8.197  1.00 0.00 ? 40  ARG B CD   8  
ATOM 6658  N NE   . ARG B 2 16 ? 6.636   -2.947  -9.363  1.00 0.00 ? 40  ARG B NE   8  
ATOM 6659  C CZ   . ARG B 2 16 ? 5.942   -3.607  -10.286 1.00 0.00 ? 40  ARG B CZ   8  
ATOM 6660  N NH1  . ARG B 2 16 ? 4.625   -3.722  -10.178 1.00 0.00 ? 40  ARG B NH1  8  
ATOM 6661  N NH2  . ARG B 2 16 ? 6.566   -4.156  -11.319 1.00 0.00 ? 40  ARG B NH2  8  
ATOM 6662  H H    . ARG B 2 16 ? 5.911   -2.023  -5.477  1.00 0.00 ? 40  ARG B H    8  
ATOM 6663  H HA   . ARG B 2 16 ? 7.211   0.369   -5.564  1.00 0.00 ? 40  ARG B HA   8  
ATOM 6664  H HB2  . ARG B 2 16 ? 4.772   -0.473  -7.143  1.00 0.00 ? 40  ARG B HB2  8  
ATOM 6665  H HB3  . ARG B 2 16 ? 5.790   0.904   -7.547  1.00 0.00 ? 40  ARG B HB3  8  
ATOM 6666  H HG2  . ARG B 2 16 ? 6.958   -0.503  -8.793  1.00 0.00 ? 40  ARG B HG2  8  
ATOM 6667  H HG3  . ARG B 2 16 ? 7.585   -1.169  -7.295  1.00 0.00 ? 40  ARG B HG3  8  
ATOM 6668  H HD2  . ARG B 2 16 ? 6.147   -2.955  -7.346  1.00 0.00 ? 40  ARG B HD2  8  
ATOM 6669  H HD3  . ARG B 2 16 ? 4.984   -2.139  -8.388  1.00 0.00 ? 40  ARG B HD3  8  
ATOM 6670  H HE   . ARG B 2 16 ? 7.608   -2.881  -9.466  1.00 0.00 ? 40  ARG B HE   8  
ATOM 6671  H HH11 . ARG B 2 16 ? 4.149   -3.309  -9.401  1.00 0.00 ? 40  ARG B HH11 8  
ATOM 6672  H HH12 . ARG B 2 16 ? 4.107   -4.218  -10.874 1.00 0.00 ? 40  ARG B HH12 8  
ATOM 6673  H HH21 . ARG B 2 16 ? 7.558   -4.073  -11.405 1.00 0.00 ? 40  ARG B HH21 8  
ATOM 6674  H HH22 . ARG B 2 16 ? 6.045   -4.653  -12.013 1.00 0.00 ? 40  ARG B HH22 8  
ATOM 6675  N N    . ALA B 2 17 ? 4.000   0.922   -4.902  1.00 0.00 ? 41  ALA B N    8  
ATOM 6676  C CA   . ALA B 2 17 ? 3.147   1.898   -4.261  1.00 0.00 ? 41  ALA B CA   8  
ATOM 6677  C C    . ALA B 2 17 ? 3.716   2.252   -2.899  1.00 0.00 ? 41  ALA B C    8  
ATOM 6678  O O    . ALA B 2 17 ? 3.922   3.414   -2.616  1.00 0.00 ? 41  ALA B O    8  
ATOM 6679  C CB   . ALA B 2 17 ? 1.710   1.388   -4.147  1.00 0.00 ? 41  ALA B CB   8  
ATOM 6680  H H    . ALA B 2 17 ? 3.599   0.115   -5.290  1.00 0.00 ? 41  ALA B H    8  
ATOM 6681  H HA   . ALA B 2 17 ? 3.147   2.799   -4.881  1.00 0.00 ? 41  ALA B HA   8  
ATOM 6682  H HB1  . ALA B 2 17 ? 1.043   2.227   -4.028  1.00 0.00 ? 41  ALA B HB1  8  
ATOM 6683  H HB2  . ALA B 2 17 ? 1.609   0.724   -3.290  1.00 0.00 ? 41  ALA B HB2  8  
ATOM 6684  H HB3  . ALA B 2 17 ? 1.450   0.851   -5.048  1.00 0.00 ? 41  ALA B HB3  8  
ATOM 6685  N N    . LEU B 2 18 ? 4.039   1.247   -2.084  1.00 0.00 ? 42  LEU B N    8  
ATOM 6686  C CA   . LEU B 2 18 ? 4.589   1.506   -0.754  1.00 0.00 ? 42  LEU B CA   8  
ATOM 6687  C C    . LEU B 2 18 ? 5.667   2.581   -0.834  1.00 0.00 ? 42  LEU B C    8  
ATOM 6688  O O    . LEU B 2 18 ? 5.748   3.470   0.014   1.00 0.00 ? 42  LEU B O    8  
ATOM 6689  C CB   . LEU B 2 18 ? 5.182   0.225   -0.165  1.00 0.00 ? 42  LEU B CB   8  
ATOM 6690  C CG   . LEU B 2 18 ? 4.887   -0.020  1.312   1.00 0.00 ? 42  LEU B CG   8  
ATOM 6691  C CD1  . LEU B 2 18 ? 5.508   -1.331  1.765   1.00 0.00 ? 42  LEU B CD1  8  
ATOM 6692  C CD2  . LEU B 2 18 ? 5.412   1.134   2.143   1.00 0.00 ? 42  LEU B CD2  8  
ATOM 6693  H H    . LEU B 2 18 ? 3.922   0.317   -2.384  1.00 0.00 ? 42  LEU B H    8  
ATOM 6694  H HA   . LEU B 2 18 ? 3.779   1.857   -0.124  1.00 0.00 ? 42  LEU B HA   8  
ATOM 6695  H HB2  . LEU B 2 18 ? 4.808   -0.610  -0.726  1.00 0.00 ? 42  LEU B HB2  8  
ATOM 6696  H HB3  . LEU B 2 18 ? 6.254   0.264   -0.290  1.00 0.00 ? 42  LEU B HB3  8  
ATOM 6697  H HG   . LEU B 2 18 ? 3.817   -0.086  1.456   1.00 0.00 ? 42  LEU B HG   8  
ATOM 6698  H HD11 . LEU B 2 18 ? 4.782   -2.127  1.668   1.00 0.00 ? 42  LEU B HD11 8  
ATOM 6699  H HD12 . LEU B 2 18 ? 5.816   -1.247  2.797   1.00 0.00 ? 42  LEU B HD12 8  
ATOM 6700  H HD13 . LEU B 2 18 ? 6.368   -1.555  1.151   1.00 0.00 ? 42  LEU B HD13 8  
ATOM 6701  H HD21 . LEU B 2 18 ? 4.662   1.909   2.199   1.00 0.00 ? 42  LEU B HD21 8  
ATOM 6702  H HD22 . LEU B 2 18 ? 6.299   1.526   1.670   1.00 0.00 ? 42  LEU B HD22 8  
ATOM 6703  H HD23 . LEU B 2 18 ? 5.652   0.786   3.137   1.00 0.00 ? 42  LEU B HD23 8  
ATOM 6704  N N    . VAL B 2 19 ? 6.488   2.477   -1.869  1.00 0.00 ? 43  VAL B N    8  
ATOM 6705  C CA   . VAL B 2 19 ? 7.567   3.428   -2.114  1.00 0.00 ? 43  VAL B CA   8  
ATOM 6706  C C    . VAL B 2 19 ? 7.004   4.733   -2.650  1.00 0.00 ? 43  VAL B C    8  
ATOM 6707  O O    . VAL B 2 19 ? 7.129   5.782   -2.017  1.00 0.00 ? 43  VAL B O    8  
ATOM 6708  C CB   . VAL B 2 19 ? 8.594   2.867   -3.129  1.00 0.00 ? 43  VAL B CB   8  
ATOM 6709  C CG1  . VAL B 2 19 ? 9.998   3.289   -2.766  1.00 0.00 ? 43  VAL B CG1  8  
ATOM 6710  C CG2  . VAL B 2 19 ? 8.533   1.363   -3.179  1.00 0.00 ? 43  VAL B CG2  8  
ATOM 6711  H H    . VAL B 2 19 ? 6.367   1.728   -2.480  1.00 0.00 ? 43  VAL B H    8  
ATOM 6712  H HA   . VAL B 2 19 ? 8.061   3.620   -1.174  1.00 0.00 ? 43  VAL B HA   8  
ATOM 6713  H HB   . VAL B 2 19 ? 8.356   3.242   -4.114  1.00 0.00 ? 43  VAL B HB   8  
ATOM 6714  H HG11 . VAL B 2 19 ? 10.591  3.387   -3.665  1.00 0.00 ? 43  VAL B HG11 8  
ATOM 6715  H HG12 . VAL B 2 19 ? 10.431  2.525   -2.130  1.00 0.00 ? 43  VAL B HG12 8  
ATOM 6716  H HG13 . VAL B 2 19 ? 9.973   4.232   -2.239  1.00 0.00 ? 43  VAL B HG13 8  
ATOM 6717  H HG21 . VAL B 2 19 ? 7.588   1.052   -3.593  1.00 0.00 ? 43  VAL B HG21 8  
ATOM 6718  H HG22 . VAL B 2 19 ? 8.639   0.978   -2.176  1.00 0.00 ? 43  VAL B HG22 8  
ATOM 6719  H HG23 . VAL B 2 19 ? 9.338   0.990   -3.796  1.00 0.00 ? 43  VAL B HG23 8  
ATOM 6720  N N    . ARG B 2 20 ? 6.416   4.651   -3.841  1.00 0.00 ? 44  ARG B N    8  
ATOM 6721  C CA   . ARG B 2 20 ? 5.767   5.787   -4.492  1.00 0.00 ? 44  ARG B CA   8  
ATOM 6722  C C    . ARG B 2 20 ? 5.143   6.697   -3.443  1.00 0.00 ? 44  ARG B C    8  
ATOM 6723  O O    . ARG B 2 20 ? 5.212   7.923   -3.512  1.00 0.00 ? 44  ARG B O    8  
ATOM 6724  C CB   . ARG B 2 20 ? 4.664   5.256   -5.413  1.00 0.00 ? 44  ARG B CB   8  
ATOM 6725  C CG   . ARG B 2 20 ? 5.118   4.141   -6.335  1.00 0.00 ? 44  ARG B CG   8  
ATOM 6726  C CD   . ARG B 2 20 ? 4.563   4.316   -7.733  1.00 0.00 ? 44  ARG B CD   8  
ATOM 6727  N NE   . ARG B 2 20 ? 4.434   3.040   -8.434  1.00 0.00 ? 44  ARG B NE   8  
ATOM 6728  C CZ   . ARG B 2 20 ? 4.595   2.896   -9.746  1.00 0.00 ? 44  ARG B CZ   8  
ATOM 6729  N NH1  . ARG B 2 20 ? 4.908   3.943   -10.499 1.00 0.00 ? 44  ARG B NH1  8  
ATOM 6730  N NH2  . ARG B 2 20 ? 4.446   1.704   -10.306 1.00 0.00 ? 44  ARG B NH2  8  
ATOM 6731  H H    . ARG B 2 20 ? 6.429   3.789   -4.306  1.00 0.00 ? 44  ARG B H    8  
ATOM 6732  H HA   . ARG B 2 20 ? 6.499   6.331   -5.070  1.00 0.00 ? 44  ARG B HA   8  
ATOM 6733  H HB2  . ARG B 2 20 ? 3.863   4.872   -4.799  1.00 0.00 ? 44  ARG B HB2  8  
ATOM 6734  H HB3  . ARG B 2 20 ? 4.281   6.055   -6.015  1.00 0.00 ? 44  ARG B HB3  8  
ATOM 6735  H HG2  . ARG B 2 20 ? 6.196   4.141   -6.384  1.00 0.00 ? 44  ARG B HG2  8  
ATOM 6736  H HG3  . ARG B 2 20 ? 4.773   3.199   -5.936  1.00 0.00 ? 44  ARG B HG3  8  
ATOM 6737  H HD2  . ARG B 2 20 ? 3.591   4.782   -7.667  1.00 0.00 ? 44  ARG B HD2  8  
ATOM 6738  H HD3  . ARG B 2 20 ? 5.231   4.953   -8.286  1.00 0.00 ? 44  ARG B HD3  8  
ATOM 6739  H HE   . ARG B 2 20 ? 4.213   2.250   -7.897  1.00 0.00 ? 44  ARG B HE   8  
ATOM 6740  H HH11 . ARG B 2 20 ? 5.025   4.844   -10.081 1.00 0.00 ? 44  ARG B HH11 8  
ATOM 6741  H HH12 . ARG B 2 20 ? 5.027   3.830   -11.486 1.00 0.00 ? 44  ARG B HH12 8  
ATOM 6742  H HH21 . ARG B 2 20 ? 4.214   0.912   -9.740  1.00 0.00 ? 44  ARG B HH21 8  
ATOM 6743  H HH22 . ARG B 2 20 ? 4.564   1.596   -11.293 1.00 0.00 ? 44  ARG B HH22 8  
ATOM 6744  N N    . VAL B 2 21 ? 4.537   6.038   -2.476  1.00 0.00 ? 45  VAL B N    8  
ATOM 6745  C CA   . VAL B 2 21 ? 3.860   6.665   -1.363  1.00 0.00 ? 45  VAL B CA   8  
ATOM 6746  C C    . VAL B 2 21 ? 4.828   7.249   -0.345  1.00 0.00 ? 45  VAL B C    8  
ATOM 6747  O O    . VAL B 2 21 ? 4.809   8.446   -0.056  1.00 0.00 ? 45  VAL B O    8  
ATOM 6748  C CB   . VAL B 2 21 ? 3.006   5.619   -0.629  1.00 0.00 ? 45  VAL B CB   8  
ATOM 6749  C CG1  . VAL B 2 21 ? 2.277   6.237   0.536   1.00 0.00 ? 45  VAL B CG1  8  
ATOM 6750  C CG2  . VAL B 2 21 ? 2.040   4.932   -1.570  1.00 0.00 ? 45  VAL B CG2  8  
ATOM 6751  H H    . VAL B 2 21 ? 4.556   5.063   -2.510  1.00 0.00 ? 45  VAL B H    8  
ATOM 6752  H HA   . VAL B 2 21 ? 3.210   7.439   -1.739  1.00 0.00 ? 45  VAL B HA   8  
ATOM 6753  H HB   . VAL B 2 21 ? 3.673   4.867   -0.235  1.00 0.00 ? 45  VAL B HB   8  
ATOM 6754  H HG11 . VAL B 2 21 ? 2.103   7.286   0.341   1.00 0.00 ? 45  VAL B HG11 8  
ATOM 6755  H HG12 . VAL B 2 21 ? 2.875   6.126   1.424   1.00 0.00 ? 45  VAL B HG12 8  
ATOM 6756  H HG13 . VAL B 2 21 ? 1.332   5.735   0.675   1.00 0.00 ? 45  VAL B HG13 8  
ATOM 6757  H HG21 . VAL B 2 21 ? 1.028   5.096   -1.238  1.00 0.00 ? 45  VAL B HG21 8  
ATOM 6758  H HG22 . VAL B 2 21 ? 2.252   3.873   -1.569  1.00 0.00 ? 45  VAL B HG22 8  
ATOM 6759  H HG23 . VAL B 2 21 ? 2.164   5.323   -2.568  1.00 0.00 ? 45  VAL B HG23 8  
ATOM 6760  N N    . CYS B 2 22 ? 5.678   6.379   0.191   1.00 0.00 ? 46  CYS B N    8  
ATOM 6761  C CA   . CYS B 2 22 ? 6.612   6.759   1.239   1.00 0.00 ? 46  CYS B CA   8  
ATOM 6762  C C    . CYS B 2 22 ? 8.030   6.324   0.930   1.00 0.00 ? 46  CYS B C    8  
ATOM 6763  O O    . CYS B 2 22 ? 8.946   7.141   0.828   1.00 0.00 ? 46  CYS B O    8  
ATOM 6764  C CB   . CYS B 2 22 ? 6.169   6.073   2.525   1.00 0.00 ? 46  CYS B CB   8  
ATOM 6765  S SG   . CYS B 2 22 ? 7.000   6.648   4.040   1.00 0.00 ? 46  CYS B SG   8  
ATOM 6766  H H    . CYS B 2 22 ? 5.686   5.454   -0.139  1.00 0.00 ? 46  CYS B H    8  
ATOM 6767  H HA   . CYS B 2 22 ? 6.576   7.827   1.373   1.00 0.00 ? 46  CYS B HA   8  
ATOM 6768  H HB2  . CYS B 2 22 ? 5.114   6.219   2.648   1.00 0.00 ? 46  CYS B HB2  8  
ATOM 6769  H HB3  . CYS B 2 22 ? 6.362   5.014   2.433   1.00 0.00 ? 46  CYS B HB3  8  
ATOM 6770  N N    . GLY B 2 23 ? 8.189   5.021   0.786   1.00 0.00 ? 47  GLY B N    8  
ATOM 6771  C CA   . GLY B 2 23 ? 9.501   4.452   0.534   1.00 0.00 ? 47  GLY B CA   8  
ATOM 6772  C C    . GLY B 2 23 ? 9.833   3.366   1.531   1.00 0.00 ? 47  GLY B C    8  
ATOM 6773  O O    . GLY B 2 23 ? 9.938   3.625   2.729   1.00 0.00 ? 47  GLY B O    8  
ATOM 6774  H H    . GLY B 2 23 ? 7.393   4.436   0.829   1.00 0.00 ? 47  GLY B H    8  
ATOM 6775  H HA2  . GLY B 2 23 ? 9.517   4.033   -0.459  1.00 0.00 ? 47  GLY B HA2  8  
ATOM 6776  H HA3  . GLY B 2 23 ? 10.248  5.229   0.599   1.00 0.00 ? 47  GLY B HA3  8  
ATOM 6777  N N    . GLY B 2 24 ? 9.987   2.148   1.036   1.00 0.00 ? 48  GLY B N    8  
ATOM 6778  C CA   . GLY B 2 24 ? 10.295  1.019   1.892   1.00 0.00 ? 48  GLY B CA   8  
ATOM 6779  C C    . GLY B 2 24 ? 11.620  1.151   2.626   1.00 0.00 ? 48  GLY B C    8  
ATOM 6780  O O    . GLY B 2 24 ? 11.861  2.140   3.318   1.00 0.00 ? 48  GLY B O    8  
ATOM 6781  H H    . GLY B 2 24 ? 9.889   2.010   0.071   1.00 0.00 ? 48  GLY B H    8  
ATOM 6782  H HA2  . GLY B 2 24 ? 9.511   0.909   2.618   1.00 0.00 ? 48  GLY B HA2  8  
ATOM 6783  H HA3  . GLY B 2 24 ? 10.322  0.130   1.284   1.00 0.00 ? 48  GLY B HA3  8  
ATOM 6784  N N    . PRO B 2 25 ? 12.507  0.157   2.481   1.00 0.00 ? 49  PRO B N    8  
ATOM 6785  C CA   . PRO B 2 25 ? 13.811  0.143   3.151   1.00 0.00 ? 49  PRO B CA   8  
ATOM 6786  C C    . PRO B 2 25 ? 14.770  1.197   2.610   1.00 0.00 ? 49  PRO B C    8  
ATOM 6787  O O    . PRO B 2 25 ? 15.097  2.165   3.297   1.00 0.00 ? 49  PRO B O    8  
ATOM 6788  C CB   . PRO B 2 25 ? 14.324  -1.271  2.864   1.00 0.00 ? 49  PRO B CB   8  
ATOM 6789  C CG   . PRO B 2 25 ? 13.670  -1.663  1.591   1.00 0.00 ? 49  PRO B CG   8  
ATOM 6790  C CD   . PRO B 2 25 ? 12.314  -1.023  1.624   1.00 0.00 ? 49  PRO B CD   8  
ATOM 6791  H HA   . PRO B 2 25 ? 13.705  0.275   4.214   1.00 0.00 ? 49  PRO B HA   8  
ATOM 6792  H HB2  . PRO B 2 25 ? 15.400  -1.261  2.773   1.00 0.00 ? 49  PRO B HB2  8  
ATOM 6793  H HB3  . PRO B 2 25 ? 14.029  -1.925  3.662   1.00 0.00 ? 49  PRO B HB3  8  
ATOM 6794  H HG2  . PRO B 2 25 ? 14.241  -1.295  0.752   1.00 0.00 ? 49  PRO B HG2  8  
ATOM 6795  H HG3  . PRO B 2 25 ? 13.576  -2.739  1.540   1.00 0.00 ? 49  PRO B HG3  8  
ATOM 6796  H HD2  . PRO B 2 25 ? 12.022  -0.725  0.644   1.00 0.00 ? 49  PRO B HD2  8  
ATOM 6797  H HD3  . PRO B 2 25 ? 11.576  -1.689  2.043   1.00 0.00 ? 49  PRO B HD3  8  
ATOM 6798  N N    . ARG B 2 26 ? 15.220  0.999   1.379   1.00 0.00 ? 50  ARG B N    8  
ATOM 6799  C CA   . ARG B 2 26 ? 16.142  1.921   0.735   1.00 0.00 ? 50  ARG B CA   8  
ATOM 6800  C C    . ARG B 2 26 ? 16.053  1.809   -0.782  1.00 0.00 ? 50  ARG B C    8  
ATOM 6801  O O    . ARG B 2 26 ? 16.099  2.816   -1.487  1.00 0.00 ? 50  ARG B O    8  
ATOM 6802  C CB   . ARG B 2 26 ? 17.564  1.636   1.164   1.00 0.00 ? 50  ARG B CB   8  
ATOM 6803  C CG   . ARG B 2 26 ? 17.760  0.265   1.792   1.00 0.00 ? 50  ARG B CG   8  
ATOM 6804  C CD   . ARG B 2 26 ? 19.146  0.121   2.401   1.00 0.00 ? 50  ARG B CD   8  
ATOM 6805  N NE   . ARG B 2 26 ? 19.347  1.026   3.530   1.00 0.00 ? 50  ARG B NE   8  
ATOM 6806  C CZ   . ARG B 2 26 ? 20.350  0.917   4.395   1.00 0.00 ? 50  ARG B CZ   8  
ATOM 6807  N NH1  . ARG B 2 26 ? 21.237  -0.060  4.266   1.00 0.00 ? 50  ARG B NH1  8  
ATOM 6808  N NH2  . ARG B 2 26 ? 20.465  1.784   5.391   1.00 0.00 ? 50  ARG B NH2  8  
ATOM 6809  H H    . ARG B 2 26 ? 14.943  0.204   0.900   1.00 0.00 ? 50  ARG B H    8  
ATOM 6810  H HA   . ARG B 2 26 ? 15.875  2.921   1.031   1.00 0.00 ? 50  ARG B HA   8  
ATOM 6811  H HB2  . ARG B 2 26 ? 18.179  1.692   0.288   1.00 0.00 ? 50  ARG B HB2  8  
ATOM 6812  H HB3  . ARG B 2 26 ? 17.876  2.386   1.870   1.00 0.00 ? 50  ARG B HB3  8  
ATOM 6813  H HG2  . ARG B 2 26 ? 17.022  0.127   2.566   1.00 0.00 ? 50  ARG B HG2  8  
ATOM 6814  H HG3  . ARG B 2 26 ? 17.631  -0.491  1.030   1.00 0.00 ? 50  ARG B HG3  8  
ATOM 6815  H HD2  . ARG B 2 26 ? 19.270  -0.896  2.743   1.00 0.00 ? 50  ARG B HD2  8  
ATOM 6816  H HD3  . ARG B 2 26 ? 19.883  0.338   1.642   1.00 0.00 ? 50  ARG B HD3  8  
ATOM 6817  H HE   . ARG B 2 26 ? 18.701  1.754   3.649   1.00 0.00 ? 50  ARG B HE   8  
ATOM 6818  H HH11 . ARG B 2 26 ? 21.153  -0.718  3.518   1.00 0.00 ? 50  ARG B HH11 8  
ATOM 6819  H HH12 . ARG B 2 26 ? 21.991  -0.139  4.918   1.00 0.00 ? 50  ARG B HH12 8  
ATOM 6820  H HH21 . ARG B 2 26 ? 19.797  2.521   5.491   1.00 0.00 ? 50  ARG B HH21 8  
ATOM 6821  H HH22 . ARG B 2 26 ? 21.220  1.702   6.041   1.00 0.00 ? 50  ARG B HH22 8  
ATOM 6822  N N    . TRP B 2 27 ? 15.921  0.572   -1.268  1.00 0.00 ? 51  TRP B N    8  
ATOM 6823  C CA   . TRP B 2 27 ? 15.798  0.286   -2.682  1.00 0.00 ? 51  TRP B CA   8  
ATOM 6824  C C    . TRP B 2 27 ? 17.094  0.551   -3.438  1.00 0.00 ? 51  TRP B C    8  
ATOM 6825  O O    . TRP B 2 27 ? 17.735  -0.376  -3.933  1.00 0.00 ? 51  TRP B O    8  
ATOM 6826  C CB   . TRP B 2 27 ? 14.648  1.080   -3.266  1.00 0.00 ? 51  TRP B CB   8  
ATOM 6827  C CG   . TRP B 2 27 ? 13.456  1.059   -2.377  1.00 0.00 ? 51  TRP B CG   8  
ATOM 6828  C CD1  . TRP B 2 27 ? 13.173  1.894   -1.343  1.00 0.00 ? 51  TRP B CD1  8  
ATOM 6829  C CD2  . TRP B 2 27 ? 12.403  0.126   -2.437  1.00 0.00 ? 51  TRP B CD2  8  
ATOM 6830  N NE1  . TRP B 2 27 ? 11.991  1.531   -0.755  1.00 0.00 ? 51  TRP B NE1  8  
ATOM 6831  C CE2  . TRP B 2 27 ? 11.495  0.445   -1.419  1.00 0.00 ? 51  TRP B CE2  8  
ATOM 6832  C CE3  . TRP B 2 27 ? 12.144  -0.946  -3.265  1.00 0.00 ? 51  TRP B CE3  8  
ATOM 6833  C CZ2  . TRP B 2 27 ? 10.340  -0.290  -1.211  1.00 0.00 ? 51  TRP B CZ2  8  
ATOM 6834  C CZ3  . TRP B 2 27 ? 10.996  -1.670  -3.060  1.00 0.00 ? 51  TRP B CZ3  8  
ATOM 6835  C CH2  . TRP B 2 27 ? 10.104  -1.330  -2.032  1.00 0.00 ? 51  TRP B CH2  8  
ATOM 6836  H H    . TRP B 2 27 ? 15.901  -0.173  -0.656  1.00 0.00 ? 51  TRP B H    8  
ATOM 6837  H HA   . TRP B 2 27 ? 15.551  -0.757  -2.772  1.00 0.00 ? 51  TRP B HA   8  
ATOM 6838  H HB2  . TRP B 2 27 ? 14.943  2.096   -3.423  1.00 0.00 ? 51  TRP B HB2  8  
ATOM 6839  H HB3  . TRP B 2 27 ? 14.370  0.639   -4.198  1.00 0.00 ? 51  TRP B HB3  8  
ATOM 6840  H HD1  . TRP B 2 27 ? 13.805  2.706   -1.038  1.00 0.00 ? 51  TRP B HD1  8  
ATOM 6841  H HE1  . TRP B 2 27 ? 11.572  1.978   0.007   1.00 0.00 ? 51  TRP B HE1  8  
ATOM 6842  H HE3  . TRP B 2 27 ? 12.830  -1.205  -4.058  1.00 0.00 ? 51  TRP B HE3  8  
ATOM 6843  H HZ2  . TRP B 2 27 ? 9.637   -0.056  -0.436  1.00 0.00 ? 51  TRP B HZ2  8  
ATOM 6844  H HZ3  . TRP B 2 27 ? 10.778  -2.510  -3.692  1.00 0.00 ? 51  TRP B HZ3  8  
ATOM 6845  H HH2  . TRP B 2 27 ? 9.206   -1.900  -1.900  1.00 0.00 ? 51  TRP B HH2  8  
ATOM 6846  N N    . SER B 2 28 ? 17.472  1.818   -3.517  1.00 0.00 ? 52  SER B N    8  
ATOM 6847  C CA   . SER B 2 28 ? 18.694  2.213   -4.208  1.00 0.00 ? 52  SER B CA   8  
ATOM 6848  C C    . SER B 2 28 ? 19.174  3.579   -3.728  1.00 0.00 ? 52  SER B C    8  
ATOM 6849  O O    . SER B 2 28 ? 20.295  3.993   -4.025  1.00 0.00 ? 52  SER B O    8  
ATOM 6850  C CB   . SER B 2 28 ? 18.461  2.246   -5.721  1.00 0.00 ? 52  SER B CB   8  
ATOM 6851  O OG   . SER B 2 28 ? 18.098  0.967   -6.209  1.00 0.00 ? 52  SER B OG   8  
ATOM 6852  H H    . SER B 2 28 ? 16.917  2.503   -3.097  1.00 0.00 ? 52  SER B H    8  
ATOM 6853  H HA   . SER B 2 28 ? 19.454  1.479   -3.986  1.00 0.00 ? 52  SER B HA   8  
ATOM 6854  H HB2  . SER B 2 28 ? 17.668  2.941   -5.946  1.00 0.00 ? 52  SER B HB2  8  
ATOM 6855  H HB3  . SER B 2 28 ? 19.368  2.563   -6.216  1.00 0.00 ? 52  SER B HB3  8  
ATOM 6856  H HG   . SER B 2 28 ? 17.517  1.066   -6.968  1.00 0.00 ? 52  SER B HG   8  
ATOM 6857  N N    . THR B 2 29 ? 18.318  4.273   -2.984  1.00 0.00 ? 53  THR B N    8  
ATOM 6858  C CA   . THR B 2 29 ? 18.651  5.594   -2.464  1.00 0.00 ? 53  THR B CA   8  
ATOM 6859  C C    . THR B 2 29 ? 19.518  5.494   -1.213  1.00 0.00 ? 53  THR B C    8  
ATOM 6860  O O    . THR B 2 29 ? 20.537  6.174   -1.101  1.00 0.00 ? 53  THR B O    8  
ATOM 6861  C CB   . THR B 2 29 ? 17.384  6.402   -2.128  1.00 0.00 ? 53  THR B CB   8  
ATOM 6862  O OG1  . THR B 2 29 ? 16.661  5.760   -1.069  1.00 0.00 ? 53  THR B OG1  8  
ATOM 6863  C CG2  . THR B 2 29 ? 16.487  6.536   -3.348  1.00 0.00 ? 53  THR B CG2  8  
ATOM 6864  H H    . THR B 2 29 ? 17.441  3.887   -2.780  1.00 0.00 ? 53  THR B H    8  
ATOM 6865  H HA   . THR B 2 29 ? 19.199  6.126   -3.229  1.00 0.00 ? 53  THR B HA   8  
ATOM 6866  H HB   . THR B 2 29 ? 17.678  7.389   -1.806  1.00 0.00 ? 53  THR B HB   8  
ATOM 6867  H HG1  . THR B 2 29 ? 15.718  5.867   -1.215  1.00 0.00 ? 53  THR B HG1  8  
ATOM 6868  H HG21 . THR B 2 29 ? 16.180  5.555   -3.680  1.00 0.00 ? 53  THR B HG21 8  
ATOM 6869  H HG22 . THR B 2 29 ? 17.029  7.030   -4.141  1.00 0.00 ? 53  THR B HG22 8  
ATOM 6870  H HG23 . THR B 2 29 ? 15.614  7.118   -3.091  1.00 0.00 ? 53  THR B HG23 8  
ATOM 6871  N N    . GLU B 2 30 ? 19.106  4.633   -0.284  1.00 0.00 ? 54  GLU B N    8  
ATOM 6872  C CA   . GLU B 2 30 ? 19.828  4.437   0.962   1.00 0.00 ? 54  GLU B CA   8  
ATOM 6873  C C    . GLU B 2 30 ? 20.204  5.771   1.599   1.00 0.00 ? 54  GLU B C    8  
ATOM 6874  O O    . GLU B 2 30 ? 21.377  6.142   1.649   1.00 0.00 ? 54  GLU B O    8  
ATOM 6875  C CB   . GLU B 2 30 ? 21.077  3.599   0.716   1.00 0.00 ? 54  GLU B CB   8  
ATOM 6876  C CG   . GLU B 2 30 ? 20.941  2.618   -0.439  1.00 0.00 ? 54  GLU B CG   8  
ATOM 6877  C CD   . GLU B 2 30 ? 22.204  1.816   -0.674  1.00 0.00 ? 54  GLU B CD   8  
ATOM 6878  O OE1  . GLU B 2 30 ? 22.384  0.781   0.002   1.00 0.00 ? 54  GLU B OE1  8  
ATOM 6879  O OE2  . GLU B 2 30 ? 23.015  2.222   -1.533  1.00 0.00 ? 54  GLU B OE2  8  
ATOM 6880  H H    . GLU B 2 30 ? 18.307  4.102   -0.447  1.00 0.00 ? 54  GLU B H    8  
ATOM 6881  H HA   . GLU B 2 30 ? 19.177  3.902   1.638   1.00 0.00 ? 54  GLU B HA   8  
ATOM 6882  H HB2  . GLU B 2 30 ? 21.903  4.260   0.509   1.00 0.00 ? 54  GLU B HB2  8  
ATOM 6883  H HB3  . GLU B 2 30 ? 21.287  3.040   1.606   1.00 0.00 ? 54  GLU B HB3  8  
ATOM 6884  H HG2  . GLU B 2 30 ? 20.134  1.935   -0.220  1.00 0.00 ? 54  GLU B HG2  8  
ATOM 6885  H HG3  . GLU B 2 30 ? 20.709  3.170   -1.339  1.00 0.00 ? 54  GLU B HG3  8  
ATOM 6886  N N    . ALA B 2 31 ? 19.197  6.486   2.084   1.00 0.00 ? 55  ALA B N    8  
ATOM 6887  C CA   . ALA B 2 31 ? 19.411  7.782   2.719   1.00 0.00 ? 55  ALA B CA   8  
ATOM 6888  C C    . ALA B 2 31 ? 18.200  8.192   3.551   1.00 0.00 ? 55  ALA B C    8  
ATOM 6889  O O    . ALA B 2 31 ? 17.278  8.815   2.986   1.00 0.00 ? 55  ALA B O    8  
ATOM 6890  C CB   . ALA B 2 31 ? 19.714  8.841   1.670   1.00 0.00 ? 55  ALA B CB   8  
ATOM 6891  O OXT  . ALA B 2 31 ? 18.184  7.884   4.762   1.00 0.00 ? 55  ALA B OXT  8  
ATOM 6892  H H    . ALA B 2 31 ? 18.287  6.135   2.012   1.00 0.00 ? 55  ALA B H    8  
ATOM 6893  H HA   . ALA B 2 31 ? 20.269  7.697   3.369   1.00 0.00 ? 55  ALA B HA   8  
ATOM 6894  H HB1  . ALA B 2 31 ? 19.966  9.770   2.160   1.00 0.00 ? 55  ALA B HB1  8  
ATOM 6895  H HB2  . ALA B 2 31 ? 18.846  8.987   1.044   1.00 0.00 ? 55  ALA B HB2  8  
ATOM 6896  H HB3  . ALA B 2 31 ? 20.547  8.519   1.062   1.00 0.00 ? 55  ALA B HB3  8  
ATOM 6897  N N    . ALA A 1 1  ? -7.944  -2.630  14.754  1.00 0.00 ? 106 ALA A N    9  
ATOM 6898  C CA   . ALA A 1 1  ? -8.327  -1.258  14.332  1.00 0.00 ? 106 ALA A CA   9  
ATOM 6899  C C    . ALA A 1 1  ? -8.499  -1.181  12.821  1.00 0.00 ? 106 ALA A C    9  
ATOM 6900  O O    . ALA A 1 1  ? -9.580  -0.861  12.323  1.00 0.00 ? 106 ALA A O    9  
ATOM 6901  C CB   . ALA A 1 1  ? -7.282  -0.254  14.794  1.00 0.00 ? 106 ALA A CB   9  
ATOM 6902  H H1   . ALA A 1 1  ? -8.679  -3.309  14.471  1.00 0.00 ? 106 ALA A H1   9  
ATOM 6903  H H2   . ALA A 1 1  ? -7.832  -2.670  15.787  1.00 0.00 ? 106 ALA A H2   9  
ATOM 6904  H H3   . ALA A 1 1  ? -7.045  -2.903  14.309  1.00 0.00 ? 106 ALA A H3   9  
ATOM 6905  H HA   . ALA A 1 1  ? -9.265  -1.006  14.804  1.00 0.00 ? 106 ALA A HA   9  
ATOM 6906  H HB1  . ALA A 1 1  ? -7.566  0.737   14.474  1.00 0.00 ? 106 ALA A HB1  9  
ATOM 6907  H HB2  . ALA A 1 1  ? -6.322  -0.510  14.366  1.00 0.00 ? 106 ALA A HB2  9  
ATOM 6908  H HB3  . ALA A 1 1  ? -7.211  -0.278  15.873  1.00 0.00 ? 106 ALA A HB3  9  
ATOM 6909  N N    . ALA A 1 2  ? -7.427  -1.477  12.095  1.00 0.00 ? 107 ALA A N    9  
ATOM 6910  C CA   . ALA A 1 2  ? -7.454  -1.443  10.638  1.00 0.00 ? 107 ALA A CA   9  
ATOM 6911  C C    . ALA A 1 2  ? -6.490  -2.468  10.051  1.00 0.00 ? 107 ALA A C    9  
ATOM 6912  O O    . ALA A 1 2  ? -5.843  -3.215  10.784  1.00 0.00 ? 107 ALA A O    9  
ATOM 6913  C CB   . ALA A 1 2  ? -7.117  -0.048  10.136  1.00 0.00 ? 107 ALA A CB   9  
ATOM 6914  H H    . ALA A 1 2  ? -6.594  -1.725  12.550  1.00 0.00 ? 107 ALA A H    9  
ATOM 6915  H HA   . ALA A 1 2  ? -8.458  -1.683  10.317  1.00 0.00 ? 107 ALA A HA   9  
ATOM 6916  H HB1  . ALA A 1 2  ? -7.795  0.668   10.578  1.00 0.00 ? 107 ALA A HB1  9  
ATOM 6917  H HB2  . ALA A 1 2  ? -7.213  -0.020  9.061   1.00 0.00 ? 107 ALA A HB2  9  
ATOM 6918  H HB3  . ALA A 1 2  ? -6.103  0.199   10.413  1.00 0.00 ? 107 ALA A HB3  9  
ATOM 6919  N N    . ALA A 1 3  ? -6.406  -2.497  8.724   1.00 0.00 ? 108 ALA A N    9  
ATOM 6920  C CA   . ALA A 1 3  ? -5.521  -3.427  8.028   1.00 0.00 ? 108 ALA A CA   9  
ATOM 6921  C C    . ALA A 1 3  ? -5.862  -4.877  8.358   1.00 0.00 ? 108 ALA A C    9  
ATOM 6922  O O    . ALA A 1 3  ? -6.833  -5.159  9.062   1.00 0.00 ? 108 ALA A O    9  
ATOM 6923  C CB   . ALA A 1 3  ? -4.068  -3.137  8.372   1.00 0.00 ? 108 ALA A CB   9  
ATOM 6924  H H    . ALA A 1 3  ? -6.950  -1.876  8.199   1.00 0.00 ? 108 ALA A H    9  
ATOM 6925  H HA   . ALA A 1 3  ? -5.651  -3.274  6.968   1.00 0.00 ? 108 ALA A HA   9  
ATOM 6926  H HB1  . ALA A 1 3  ? -3.950  -3.108  9.445   1.00 0.00 ? 108 ALA A HB1  9  
ATOM 6927  H HB2  . ALA A 1 3  ? -3.781  -2.187  7.951   1.00 0.00 ? 108 ALA A HB2  9  
ATOM 6928  H HB3  . ALA A 1 3  ? -3.441  -3.916  7.962   1.00 0.00 ? 108 ALA A HB3  9  
ATOM 6929  N N    . THR A 1 4  ? -5.051  -5.789  7.837   1.00 0.00 ? 109 THR A N    9  
ATOM 6930  C CA   . THR A 1 4  ? -5.245  -7.217  8.054   1.00 0.00 ? 109 THR A CA   9  
ATOM 6931  C C    . THR A 1 4  ? -3.975  -7.980  7.705   1.00 0.00 ? 109 THR A C    9  
ATOM 6932  O O    . THR A 1 4  ? -3.453  -8.758  8.502   1.00 0.00 ? 109 THR A O    9  
ATOM 6933  C CB   . THR A 1 4  ? -6.418  -7.749  7.209   1.00 0.00 ? 109 THR A CB   9  
ATOM 6934  O OG1  . THR A 1 4  ? -6.371  -9.180  7.148   1.00 0.00 ? 109 THR A OG1  9  
ATOM 6935  C CG2  . THR A 1 4  ? -6.378  -7.171  5.799   1.00 0.00 ? 109 THR A CG2  9  
ATOM 6936  H H    . THR A 1 4  ? -4.296  -5.493  7.288   1.00 0.00 ? 109 THR A H    9  
ATOM 6937  H HA   . THR A 1 4  ? -5.471  -7.371  9.091   1.00 0.00 ? 109 THR A HA   9  
ATOM 6938  H HB   . THR A 1 4  ? -7.343  -7.448  7.677   1.00 0.00 ? 109 THR A HB   9  
ATOM 6939  H HG1  . THR A 1 4  ? -5.950  -9.521  7.940   1.00 0.00 ? 109 THR A HG1  9  
ATOM 6940  H HG21 . THR A 1 4  ? -6.111  -6.120  5.845   1.00 0.00 ? 109 THR A HG21 9  
ATOM 6941  H HG22 . THR A 1 4  ? -7.349  -7.276  5.340   1.00 0.00 ? 109 THR A HG22 9  
ATOM 6942  H HG23 . THR A 1 4  ? -5.642  -7.704  5.214   1.00 0.00 ? 109 THR A HG23 9  
ATOM 6943  N N    . ASN A 1 5  ? -3.496  -7.737  6.500   1.00 0.00 ? 110 ASN A N    9  
ATOM 6944  C CA   . ASN A 1 5  ? -2.277  -8.351  5.994   1.00 0.00 ? 110 ASN A CA   9  
ATOM 6945  C C    . ASN A 1 5  ? -1.721  -7.501  4.867   1.00 0.00 ? 110 ASN A C    9  
ATOM 6946  O O    . ASN A 1 5  ? -1.945  -7.797  3.698   1.00 0.00 ? 110 ASN A O    9  
ATOM 6947  C CB   . ASN A 1 5  ? -2.539  -9.774  5.497   1.00 0.00 ? 110 ASN A CB   9  
ATOM 6948  C CG   . ASN A 1 5  ? -2.135  -10.823 6.505   1.00 0.00 ? 110 ASN A CG   9  
ATOM 6949  O OD1  . ASN A 1 5  ? -2.930  -11.225 7.355   1.00 0.00 ? 110 ASN A OD1  9  
ATOM 6950  N ND2  . ASN A 1 5  ? -0.893  -11.273 6.415   1.00 0.00 ? 110 ASN A ND2  9  
ATOM 6951  H H    . ASN A 1 5  ? -3.985  -7.119  5.922   1.00 0.00 ? 110 ASN A H    9  
ATOM 6952  H HA   . ASN A 1 5  ? -1.557  -8.377  6.800   1.00 0.00 ? 110 ASN A HA   9  
ATOM 6953  H HB2  . ASN A 1 5  ? -3.588  -9.893  5.285   1.00 0.00 ? 110 ASN A HB2  9  
ATOM 6954  H HB3  . ASN A 1 5  ? -1.973  -9.939  4.591   1.00 0.00 ? 110 ASN A HB3  9  
ATOM 6955  H HD21 . ASN A 1 5  ? -0.315  -10.903 5.711   1.00 0.00 ? 110 ASN A HD21 9  
ATOM 6956  H HD22 . ASN A 1 5  ? -0.604  -11.953 7.050   1.00 0.00 ? 110 ASN A HD22 9  
ATOM 6957  N N    . PRO A 1 6  ? -0.973  -6.439  5.207   1.00 0.00 ? 111 PRO A N    9  
ATOM 6958  C CA   . PRO A 1 6  ? -0.411  -5.528  4.212   1.00 0.00 ? 111 PRO A CA   9  
ATOM 6959  C C    . PRO A 1 6  ? 0.396   -6.273  3.156   1.00 0.00 ? 111 PRO A C    9  
ATOM 6960  O O    . PRO A 1 6  ? 1.596   -6.498  3.310   1.00 0.00 ? 111 PRO A O    9  
ATOM 6961  C CB   . PRO A 1 6  ? 0.462   -4.582  5.040   1.00 0.00 ? 111 PRO A CB   9  
ATOM 6962  C CG   . PRO A 1 6  ? 0.688   -5.291  6.330   1.00 0.00 ? 111 PRO A CG   9  
ATOM 6963  C CD   . PRO A 1 6  ? -0.571  -6.068  6.573   1.00 0.00 ? 111 PRO A CD   9  
ATOM 6964  H HA   . PRO A 1 6  ? -1.190  -4.962  3.722   1.00 0.00 ? 111 PRO A HA   9  
ATOM 6965  H HB2  . PRO A 1 6  ? 1.383   -4.388  4.522   1.00 0.00 ? 111 PRO A HB2  9  
ATOM 6966  H HB3  . PRO A 1 6  ? -0.071  -3.659  5.196   1.00 0.00 ? 111 PRO A HB3  9  
ATOM 6967  H HG2  . PRO A 1 6  ? 1.534   -5.959  6.242   1.00 0.00 ? 111 PRO A HG2  9  
ATOM 6968  H HG3  . PRO A 1 6  ? 0.850   -4.578  7.124   1.00 0.00 ? 111 PRO A HG3  9  
ATOM 6969  H HD2  . PRO A 1 6  ? -0.369  -6.944  7.172   1.00 0.00 ? 111 PRO A HD2  9  
ATOM 6970  H HD3  . PRO A 1 6  ? -1.319  -5.447  7.042   1.00 0.00 ? 111 PRO A HD3  9  
ATOM 6971  N N    . ALA A 1 7  ? -0.316  -6.645  2.092   1.00 0.00 ? 112 ALA A N    9  
ATOM 6972  C CA   . ALA A 1 7  ? 0.211   -7.391  0.948   1.00 0.00 ? 112 ALA A CA   9  
ATOM 6973  C C    . ALA A 1 7  ? -0.958  -8.098  0.289   1.00 0.00 ? 112 ALA A C    9  
ATOM 6974  O O    . ALA A 1 7  ? -1.293  -7.852  -0.869  1.00 0.00 ? 112 ALA A O    9  
ATOM 6975  C CB   . ALA A 1 7  ? 1.263   -8.405  1.368   1.00 0.00 ? 112 ALA A CB   9  
ATOM 6976  H H    . ALA A 1 7  ? -1.266  -6.401  2.074   1.00 0.00 ? 112 ALA A H    9  
ATOM 6977  H HA   . ALA A 1 7  ? 0.650   -6.691  0.250   1.00 0.00 ? 112 ALA A HA   9  
ATOM 6978  H HB1  . ALA A 1 7  ? 0.838   -9.093  2.084   1.00 0.00 ? 112 ALA A HB1  9  
ATOM 6979  H HB2  . ALA A 1 7  ? 2.094   -7.887  1.818   1.00 0.00 ? 112 ALA A HB2  9  
ATOM 6980  H HB3  . ALA A 1 7  ? 1.605   -8.952  0.502   1.00 0.00 ? 112 ALA A HB3  9  
ATOM 6981  N N    . ARG A 1 8  ? -1.570  -8.982  1.063   1.00 0.00 ? 113 ARG A N    9  
ATOM 6982  C CA   . ARG A 1 8  ? -2.755  -9.709  0.635   1.00 0.00 ? 113 ARG A CA   9  
ATOM 6983  C C    . ARG A 1 8  ? -3.952  -8.780  0.777   1.00 0.00 ? 113 ARG A C    9  
ATOM 6984  O O    . ARG A 1 8  ? -5.012  -8.982  0.183   1.00 0.00 ? 113 ARG A O    9  
ATOM 6985  C CB   . ARG A 1 8  ? -2.951  -10.942 1.517   1.00 0.00 ? 113 ARG A CB   9  
ATOM 6986  C CG   . ARG A 1 8  ? -2.295  -12.201 0.973   1.00 0.00 ? 113 ARG A CG   9  
ATOM 6987  C CD   . ARG A 1 8  ? -0.779  -12.096 0.986   1.00 0.00 ? 113 ARG A CD   9  
ATOM 6988  N NE   . ARG A 1 8  ? -0.144  -13.305 0.470   1.00 0.00 ? 113 ARG A NE   9  
ATOM 6989  C CZ   . ARG A 1 8  ? 1.126   -13.630 0.699   1.00 0.00 ? 113 ARG A CZ   9  
ATOM 6990  N NH1  . ARG A 1 8  ? 1.897   -12.835 1.432   1.00 0.00 ? 113 ARG A NH1  9  
ATOM 6991  N NH2  . ARG A 1 8  ? 1.626   -14.750 0.193   1.00 0.00 ? 113 ARG A NH2  9  
ATOM 6992  H H    . ARG A 1 8  ? -1.203  -9.158  1.955   1.00 0.00 ? 113 ARG A H    9  
ATOM 6993  H HA   . ARG A 1 8  ? -2.635  -10.005 -0.394  1.00 0.00 ? 113 ARG A HA   9  
ATOM 6994  H HB2  . ARG A 1 8  ? -2.533  -10.733 2.492   1.00 0.00 ? 113 ARG A HB2  9  
ATOM 6995  H HB3  . ARG A 1 8  ? -4.008  -11.127 1.627   1.00 0.00 ? 113 ARG A HB3  9  
ATOM 6996  H HG2  . ARG A 1 8  ? -2.593  -13.042 1.584   1.00 0.00 ? 113 ARG A HG2  9  
ATOM 6997  H HG3  . ARG A 1 8  ? -2.627  -12.356 -0.043  1.00 0.00 ? 113 ARG A HG3  9  
ATOM 6998  H HD2  . ARG A 1 8  ? -0.484  -11.256 0.374   1.00 0.00 ? 113 ARG A HD2  9  
ATOM 6999  H HD3  . ARG A 1 8  ? -0.451  -11.932 2.002   1.00 0.00 ? 113 ARG A HD3  9  
ATOM 7000  H HE   . ARG A 1 8  ? -0.693  -13.908 -0.074  1.00 0.00 ? 113 ARG A HE   9  
ATOM 7001  H HH11 . ARG A 1 8  ? 1.524   -11.991 1.815   1.00 0.00 ? 113 ARG A HH11 9  
ATOM 7002  H HH12 . ARG A 1 8  ? 2.850   -13.083 1.601   1.00 0.00 ? 113 ARG A HH12 9  
ATOM 7003  H HH21 . ARG A 1 8  ? 1.048   -15.349 -0.360  1.00 0.00 ? 113 ARG A HH21 9  
ATOM 7004  H HH22 . ARG A 1 8  ? 2.580   -14.993 0.367   1.00 0.00 ? 113 ARG A HH22 9  
ATOM 7005  N N    . TYR A 1 9  ? -3.730  -7.753  1.583   1.00 0.00 ? 114 TYR A N    9  
ATOM 7006  C CA   . TYR A 1 9  ? -4.716  -6.733  1.888   1.00 0.00 ? 114 TYR A CA   9  
ATOM 7007  C C    . TYR A 1 9  ? -4.933  -5.812  0.691   1.00 0.00 ? 114 TYR A C    9  
ATOM 7008  O O    . TYR A 1 9  ? -6.059  -5.665  0.214   1.00 0.00 ? 114 TYR A O    9  
ATOM 7009  C CB   . TYR A 1 9  ? -4.222  -5.976  3.131   1.00 0.00 ? 114 TYR A CB   9  
ATOM 7010  C CG   . TYR A 1 9  ? -4.734  -4.566  3.335   1.00 0.00 ? 114 TYR A CG   9  
ATOM 7011  C CD1  . TYR A 1 9  ? -5.962  -4.141  2.842   1.00 0.00 ? 114 TYR A CD1  9  
ATOM 7012  C CD2  . TYR A 1 9  ? -3.965  -3.657  4.050   1.00 0.00 ? 114 TYR A CD2  9  
ATOM 7013  C CE1  . TYR A 1 9  ? -6.407  -2.852  3.054   1.00 0.00 ? 114 TYR A CE1  9  
ATOM 7014  C CE2  . TYR A 1 9  ? -4.401  -2.369  4.268   1.00 0.00 ? 114 TYR A CE2  9  
ATOM 7015  C CZ   . TYR A 1 9  ? -5.624  -1.969  3.769   1.00 0.00 ? 114 TYR A CZ   9  
ATOM 7016  O OH   . TYR A 1 9  ? -6.061  -0.683  3.982   1.00 0.00 ? 114 TYR A OH   9  
ATOM 7017  H H    . TYR A 1 9  ? -2.847  -7.675  1.997   1.00 0.00 ? 114 TYR A H    9  
ATOM 7018  H HA   . TYR A 1 9  ? -5.650  -7.220  2.125   1.00 0.00 ? 114 TYR A HA   9  
ATOM 7019  H HB2  . TYR A 1 9  ? -4.500  -6.540  4.006   1.00 0.00 ? 114 TYR A HB2  9  
ATOM 7020  H HB3  . TYR A 1 9  ? -3.142  -5.924  3.088   1.00 0.00 ? 114 TYR A HB3  9  
ATOM 7021  H HD1  . TYR A 1 9  ? -6.575  -4.835  2.286   1.00 0.00 ? 114 TYR A HD1  9  
ATOM 7022  H HD2  . TYR A 1 9  ? -3.001  -3.972  4.438   1.00 0.00 ? 114 TYR A HD2  9  
ATOM 7023  H HE1  . TYR A 1 9  ? -7.360  -2.540  2.657   1.00 0.00 ? 114 TYR A HE1  9  
ATOM 7024  H HE2  . TYR A 1 9  ? -3.788  -1.685  4.829   1.00 0.00 ? 114 TYR A HE2  9  
ATOM 7025  H HH   . TYR A 1 9  ? -6.974  -0.700  4.281   1.00 0.00 ? 114 TYR A HH   9  
ATOM 7026  N N    . CYS A 1 10 ? -3.864  -5.198  0.199   1.00 0.00 ? 115 CYS A N    9  
ATOM 7027  C CA   . CYS A 1 10 ? -3.978  -4.302  -0.942  1.00 0.00 ? 115 CYS A CA   9  
ATOM 7028  C C    . CYS A 1 10 ? -4.184  -5.087  -2.232  1.00 0.00 ? 115 CYS A C    9  
ATOM 7029  O O    . CYS A 1 10 ? -4.687  -4.558  -3.218  1.00 0.00 ? 115 CYS A O    9  
ATOM 7030  C CB   . CYS A 1 10 ? -2.739  -3.417  -1.070  1.00 0.00 ? 115 CYS A CB   9  
ATOM 7031  S SG   . CYS A 1 10 ? -2.059  -2.832  0.515   1.00 0.00 ? 115 CYS A SG   9  
ATOM 7032  H H    . CYS A 1 10 ? -2.988  -5.351  0.610   1.00 0.00 ? 115 CYS A H    9  
ATOM 7033  H HA   . CYS A 1 10 ? -4.841  -3.673  -0.779  1.00 0.00 ? 115 CYS A HA   9  
ATOM 7034  H HB2  . CYS A 1 10 ? -1.960  -3.967  -1.579  1.00 0.00 ? 115 CYS A HB2  9  
ATOM 7035  H HB3  . CYS A 1 10 ? -2.998  -2.548  -1.659  1.00 0.00 ? 115 CYS A HB3  9  
ATOM 7036  N N    . CYS A 1 11 ? -3.795  -6.352  -2.225  1.00 0.00 ? 116 CYS A N    9  
ATOM 7037  C CA   . CYS A 1 11 ? -3.942  -7.186  -3.409  1.00 0.00 ? 116 CYS A CA   9  
ATOM 7038  C C    . CYS A 1 11 ? -5.414  -7.474  -3.693  1.00 0.00 ? 116 CYS A C    9  
ATOM 7039  O O    . CYS A 1 11 ? -5.879  -7.334  -4.825  1.00 0.00 ? 116 CYS A O    9  
ATOM 7040  C CB   . CYS A 1 11 ? -3.185  -8.505  -3.232  1.00 0.00 ? 116 CYS A CB   9  
ATOM 7041  S SG   . CYS A 1 11 ? -3.348  -9.660  -4.635  1.00 0.00 ? 116 CYS A SG   9  
ATOM 7042  H H    . CYS A 1 11 ? -3.403  -6.733  -1.413  1.00 0.00 ? 116 CYS A H    9  
ATOM 7043  H HA   . CYS A 1 11 ? -3.523  -6.643  -4.246  1.00 0.00 ? 116 CYS A HA   9  
ATOM 7044  H HB2  . CYS A 1 11 ? -2.137  -8.296  -3.100  1.00 0.00 ? 116 CYS A HB2  9  
ATOM 7045  H HB3  . CYS A 1 11 ? -3.553  -9.007  -2.352  1.00 0.00 ? 116 CYS A HB3  9  
ATOM 7046  N N    . LEU A 1 12 ? -6.139  -7.876  -2.653  1.00 0.00 ? 117 LEU A N    9  
ATOM 7047  C CA   . LEU A 1 12 ? -7.552  -8.203  -2.775  1.00 0.00 ? 117 LEU A CA   9  
ATOM 7048  C C    . LEU A 1 12 ? -8.439  -6.961  -2.738  1.00 0.00 ? 117 LEU A C    9  
ATOM 7049  O O    . LEU A 1 12 ? -9.600  -7.012  -3.143  1.00 0.00 ? 117 LEU A O    9  
ATOM 7050  C CB   . LEU A 1 12 ? -7.947  -9.152  -1.652  1.00 0.00 ? 117 LEU A CB   9  
ATOM 7051  C CG   . LEU A 1 12 ? -7.730  -10.637 -1.945  1.00 0.00 ? 117 LEU A CG   9  
ATOM 7052  C CD1  . LEU A 1 12 ? -7.780  -11.445 -0.658  1.00 0.00 ? 117 LEU A CD1  9  
ATOM 7053  C CD2  . LEU A 1 12 ? -8.771  -11.142 -2.930  1.00 0.00 ? 117 LEU A CD2  9  
ATOM 7054  H H    . LEU A 1 12 ? -5.713  -7.958  -1.776  1.00 0.00 ? 117 LEU A H    9  
ATOM 7055  H HA   . LEU A 1 12 ? -7.695  -8.703  -3.716  1.00 0.00 ? 117 LEU A HA   9  
ATOM 7056  H HB2  . LEU A 1 12 ? -7.370  -8.892  -0.780  1.00 0.00 ? 117 LEU A HB2  9  
ATOM 7057  H HB3  . LEU A 1 12 ? -8.987  -8.997  -1.431  1.00 0.00 ? 117 LEU A HB3  9  
ATOM 7058  H HG   . LEU A 1 12 ? -6.754  -10.772 -2.387  1.00 0.00 ? 117 LEU A HG   9  
ATOM 7059  H HD11 . LEU A 1 12 ? -7.666  -12.494 -0.887  1.00 0.00 ? 117 LEU A HD11 9  
ATOM 7060  H HD12 . LEU A 1 12 ? -8.729  -11.285 -0.169  1.00 0.00 ? 117 LEU A HD12 9  
ATOM 7061  H HD13 . LEU A 1 12 ? -6.981  -11.130 -0.003  1.00 0.00 ? 117 LEU A HD13 9  
ATOM 7062  H HD21 . LEU A 1 12 ? -9.755  -11.044 -2.497  1.00 0.00 ? 117 LEU A HD21 9  
ATOM 7063  H HD22 . LEU A 1 12 ? -8.579  -12.181 -3.156  1.00 0.00 ? 117 LEU A HD22 9  
ATOM 7064  H HD23 . LEU A 1 12 ? -8.719  -10.560 -3.839  1.00 0.00 ? 117 LEU A HD23 9  
ATOM 7065  N N    . SER A 1 13 ? -7.896  -5.847  -2.255  1.00 0.00 ? 118 SER A N    9  
ATOM 7066  C CA   . SER A 1 13 ? -8.671  -4.612  -2.162  1.00 0.00 ? 118 SER A CA   9  
ATOM 7067  C C    . SER A 1 13 ? -7.910  -3.414  -2.724  1.00 0.00 ? 118 SER A C    9  
ATOM 7068  O O    . SER A 1 13 ? -8.408  -2.713  -3.604  1.00 0.00 ? 118 SER A O    9  
ATOM 7069  C CB   . SER A 1 13 ? -9.054  -4.340  -0.707  1.00 0.00 ? 118 SER A CB   9  
ATOM 7070  O OG   . SER A 1 13 ? -9.859  -3.178  -0.600  1.00 0.00 ? 118 SER A OG   9  
ATOM 7071  H H    . SER A 1 13 ? -6.964  -5.855  -1.956  1.00 0.00 ? 118 SER A H    9  
ATOM 7072  H HA   . SER A 1 13 ? -9.575  -4.748  -2.737  1.00 0.00 ? 118 SER A HA   9  
ATOM 7073  H HB2  . SER A 1 13 ? -9.606  -5.181  -0.316  1.00 0.00 ? 118 SER A HB2  9  
ATOM 7074  H HB3  . SER A 1 13 ? -8.157  -4.195  -0.123  1.00 0.00 ? 118 SER A HB3  9  
ATOM 7075  H HG   . SER A 1 13 ? -10.090 -2.866  -1.478  1.00 0.00 ? 118 SER A HG   9  
ATOM 7076  N N    . GLY A 1 14 ? -6.706  -3.186  -2.213  1.00 0.00 ? 119 GLY A N    9  
ATOM 7077  C CA   . GLY A 1 14 ? -5.914  -2.059  -2.663  1.00 0.00 ? 119 GLY A CA   9  
ATOM 7078  C C    . GLY A 1 14 ? -5.659  -1.076  -1.540  1.00 0.00 ? 119 GLY A C    9  
ATOM 7079  O O    . GLY A 1 14 ? -6.483  -0.946  -0.635  1.00 0.00 ? 119 GLY A O    9  
ATOM 7080  H H    . GLY A 1 14 ? -6.347  -3.788  -1.529  1.00 0.00 ? 119 GLY A H    9  
ATOM 7081  H HA2  . GLY A 1 14 ? -4.967  -2.425  -3.030  1.00 0.00 ? 119 GLY A HA2  9  
ATOM 7082  H HA3  . GLY A 1 14 ? -6.437  -1.557  -3.468  1.00 0.00 ? 119 GLY A HA3  9  
ATOM 7083  N N    . CYS A 1 15 ? -4.519  -0.387  -1.577  1.00 0.00 ? 120 CYS A N    9  
ATOM 7084  C CA   . CYS A 1 15 ? -4.191  0.567   -0.524  1.00 0.00 ? 120 CYS A CA   9  
ATOM 7085  C C    . CYS A 1 15 ? -3.837  1.942   -1.071  1.00 0.00 ? 120 CYS A C    9  
ATOM 7086  O O    . CYS A 1 15 ? -3.261  2.071   -2.151  1.00 0.00 ? 120 CYS A O    9  
ATOM 7087  C CB   . CYS A 1 15 ? -3.055  0.037   0.353   1.00 0.00 ? 120 CYS A CB   9  
ATOM 7088  S SG   . CYS A 1 15 ? -3.453  -1.527  1.198   1.00 0.00 ? 120 CYS A SG   9  
ATOM 7089  H H    . CYS A 1 15 ? -3.895  -0.523  -2.321  1.00 0.00 ? 120 CYS A H    9  
ATOM 7090  H HA   . CYS A 1 15 ? -5.061  0.667   0.086   1.00 0.00 ? 120 CYS A HA   9  
ATOM 7091  H HB2  . CYS A 1 15 ? -2.181  -0.125  -0.254  1.00 0.00 ? 120 CYS A HB2  9  
ATOM 7092  H HB3  . CYS A 1 15 ? -2.827  0.771   1.111   1.00 0.00 ? 120 CYS A HB3  9  
ATOM 7093  N N    . THR A 1 16 ? -4.201  2.969   -0.304  1.00 0.00 ? 121 THR A N    9  
ATOM 7094  C CA   . THR A 1 16 ? -3.926  4.352   -0.675  1.00 0.00 ? 121 THR A CA   9  
ATOM 7095  C C    . THR A 1 16 ? -2.558  4.775   -0.195  1.00 0.00 ? 121 THR A C    9  
ATOM 7096  O O    . THR A 1 16 ? -1.965  4.127   0.666   1.00 0.00 ? 121 THR A O    9  
ATOM 7097  C CB   . THR A 1 16 ? -4.936  5.330   -0.048  1.00 0.00 ? 121 THR A CB   9  
ATOM 7098  O OG1  . THR A 1 16 ? -4.932  5.193   1.379   1.00 0.00 ? 121 THR A OG1  9  
ATOM 7099  C CG2  . THR A 1 16 ? -6.323  5.085   -0.577  1.00 0.00 ? 121 THR A CG2  9  
ATOM 7100  H H    . THR A 1 16 ? -4.669  2.789   0.537   1.00 0.00 ? 121 THR A H    9  
ATOM 7101  H HA   . THR A 1 16 ? -3.977  4.441   -1.749  1.00 0.00 ? 121 THR A HA   9  
ATOM 7102  H HB   . THR A 1 16 ? -4.645  6.334   -0.307  1.00 0.00 ? 121 THR A HB   9  
ATOM 7103  H HG1  . THR A 1 16 ? -5.486  5.873   1.768   1.00 0.00 ? 121 THR A HG1  9  
ATOM 7104  H HG21 . THR A 1 16 ? -6.246  4.519   -1.482  1.00 0.00 ? 121 THR A HG21 9  
ATOM 7105  H HG22 . THR A 1 16 ? -6.806  6.029   -0.778  1.00 0.00 ? 121 THR A HG22 9  
ATOM 7106  H HG23 . THR A 1 16 ? -6.897  4.531   0.151   1.00 0.00 ? 121 THR A HG23 9  
ATOM 7107  N N    . GLN A 1 17 ? -2.076  5.886   -0.728  1.00 0.00 ? 122 GLN A N    9  
ATOM 7108  C CA   . GLN A 1 17 ? -0.796  6.421   -0.319  1.00 0.00 ? 122 GLN A CA   9  
ATOM 7109  C C    . GLN A 1 17 ? -0.847  6.769   1.156   1.00 0.00 ? 122 GLN A C    9  
ATOM 7110  O O    . GLN A 1 17 ? 0.117   7.265   1.716   1.00 0.00 ? 122 GLN A O    9  
ATOM 7111  C CB   . GLN A 1 17 ? -0.441  7.647   -1.154  1.00 0.00 ? 122 GLN A CB   9  
ATOM 7112  C CG   . GLN A 1 17 ? 0.300   7.314   -2.437  1.00 0.00 ? 122 GLN A CG   9  
ATOM 7113  C CD   . GLN A 1 17 ? 0.357   8.480   -3.404  1.00 0.00 ? 122 GLN A CD   9  
ATOM 7114  O OE1  . GLN A 1 17 ? 0.384   8.295   -4.620  1.00 0.00 ? 122 GLN A OE1  9  
ATOM 7115  N NE2  . GLN A 1 17 ? 0.379   9.696   -2.867  1.00 0.00 ? 122 GLN A NE2  9  
ATOM 7116  H H    . GLN A 1 17 ? -2.597  6.358   -1.410  1.00 0.00 ? 122 GLN A H    9  
ATOM 7117  H HA   . GLN A 1 17 ? -0.037  5.651   -0.461  1.00 0.00 ? 122 GLN A HA   9  
ATOM 7118  H HB2  . GLN A 1 17 ? -1.352  8.167   -1.414  1.00 0.00 ? 122 GLN A HB2  9  
ATOM 7119  H HB3  . GLN A 1 17 ? 0.176   8.300   -0.564  1.00 0.00 ? 122 GLN A HB3  9  
ATOM 7120  H HG2  . GLN A 1 17 ? 1.310   7.025   -2.187  1.00 0.00 ? 122 GLN A HG2  9  
ATOM 7121  H HG3  . GLN A 1 17 ? -0.196  6.485   -2.920  1.00 0.00 ? 122 GLN A HG3  9  
ATOM 7122  H HE21 . GLN A 1 17 ? 0.359   9.771   -1.890  1.00 0.00 ? 122 GLN A HE21 9  
ATOM 7123  H HE22 . GLN A 1 17 ? 0.414   10.469  -3.468  1.00 0.00 ? 122 GLN A HE22 9  
ATOM 7124  N N    . GLN A 1 18 ? -1.999  6.545   1.774   1.00 0.00 ? 123 GLN A N    9  
ATOM 7125  C CA   . GLN A 1 18 ? -2.138  6.767   3.189   1.00 0.00 ? 123 GLN A CA   9  
ATOM 7126  C C    . GLN A 1 18 ? -1.780  5.481   3.905   1.00 0.00 ? 123 GLN A C    9  
ATOM 7127  O O    . GLN A 1 18 ? -0.895  5.467   4.756   1.00 0.00 ? 123 GLN A O    9  
ATOM 7128  C CB   . GLN A 1 18 ? -3.552  7.194   3.543   1.00 0.00 ? 123 GLN A CB   9  
ATOM 7129  C CG   . GLN A 1 18 ? -3.839  8.663   3.272   1.00 0.00 ? 123 GLN A CG   9  
ATOM 7130  C CD   . GLN A 1 18 ? -5.241  9.067   3.685   1.00 0.00 ? 123 GLN A CD   9  
ATOM 7131  O OE1  . GLN A 1 18 ? -6.171  8.264   3.640   1.00 0.00 ? 123 GLN A OE1  9  
ATOM 7132  N NE2  . GLN A 1 18 ? -5.397  10.323  4.094   1.00 0.00 ? 123 GLN A NE2  9  
ATOM 7133  H H    . GLN A 1 18 ? -2.778  6.237   1.264   1.00 0.00 ? 123 GLN A H    9  
ATOM 7134  H HA   . GLN A 1 18 ? -1.440  7.535   3.481   1.00 0.00 ? 123 GLN A HA   9  
ATOM 7135  H HB2  . GLN A 1 18 ? -4.244  6.603   2.965   1.00 0.00 ? 123 GLN A HB2  9  
ATOM 7136  H HB3  . GLN A 1 18 ? -3.712  7.001   4.586   1.00 0.00 ? 123 GLN A HB3  9  
ATOM 7137  H HG2  . GLN A 1 18 ? -3.131  9.261   3.825   1.00 0.00 ? 123 GLN A HG2  9  
ATOM 7138  H HG3  . GLN A 1 18 ? -3.722  8.851   2.215   1.00 0.00 ? 123 GLN A HG3  9  
ATOM 7139  H HE21 . GLN A 1 18 ? -4.611  10.906  4.105   1.00 0.00 ? 123 GLN A HE21 9  
ATOM 7140  H HE22 . GLN A 1 18 ? -6.292  10.611  4.369   1.00 0.00 ? 123 GLN A HE22 9  
ATOM 7141  N N    . ASP A 1 19 ? -2.445  4.387   3.524   1.00 0.00 ? 124 ASP A N    9  
ATOM 7142  C CA   . ASP A 1 19 ? -2.157  3.096   4.137   1.00 0.00 ? 124 ASP A CA   9  
ATOM 7143  C C    . ASP A 1 19 ? -0.686  2.771   3.932   1.00 0.00 ? 124 ASP A C    9  
ATOM 7144  O O    . ASP A 1 19 ? 0.040   2.447   4.876   1.00 0.00 ? 124 ASP A O    9  
ATOM 7145  C CB   . ASP A 1 19 ? -3.028  1.992   3.530   1.00 0.00 ? 124 ASP A CB   9  
ATOM 7146  C CG   . ASP A 1 19 ? -3.920  1.338   4.568   1.00 0.00 ? 124 ASP A CG   9  
ATOM 7147  O OD1  . ASP A 1 19 ? -3.449  0.406   5.252   1.00 0.00 ? 124 ASP A OD1  9  
ATOM 7148  O OD2  . ASP A 1 19 ? -5.087  1.762   4.702   1.00 0.00 ? 124 ASP A OD2  9  
ATOM 7149  H H    . ASP A 1 19 ? -3.124  4.447   2.806   1.00 0.00 ? 124 ASP A H    9  
ATOM 7150  H HA   . ASP A 1 19 ? -2.358  3.175   5.194   1.00 0.00 ? 124 ASP A HA   9  
ATOM 7151  H HB2  . ASP A 1 19 ? -3.651  2.409   2.754   1.00 0.00 ? 124 ASP A HB2  9  
ATOM 7152  H HB3  . ASP A 1 19 ? -2.389  1.232   3.100   1.00 0.00 ? 124 ASP A HB3  9  
ATOM 7153  N N    . LEU A 1 20 ? -0.249  2.892   2.687   1.00 0.00 ? 125 LEU A N    9  
ATOM 7154  C CA   . LEU A 1 20 ? 1.131   2.627   2.337   1.00 0.00 ? 125 LEU A CA   9  
ATOM 7155  C C    . LEU A 1 20 ? 2.062   3.572   3.101   1.00 0.00 ? 125 LEU A C    9  
ATOM 7156  O O    . LEU A 1 20 ? 3.189   3.200   3.447   1.00 0.00 ? 125 LEU A O    9  
ATOM 7157  C CB   . LEU A 1 20 ? 1.313   2.725   0.818   1.00 0.00 ? 125 LEU A CB   9  
ATOM 7158  C CG   . LEU A 1 20 ? 0.564   1.656   0.028   1.00 0.00 ? 125 LEU A CG   9  
ATOM 7159  C CD1  . LEU A 1 20 ? -0.488  2.291   -0.860  1.00 0.00 ? 125 LEU A CD1  9  
ATOM 7160  C CD2  . LEU A 1 20 ? 1.523   0.851   -0.814  1.00 0.00 ? 125 LEU A CD2  9  
ATOM 7161  H H    . LEU A 1 20 ? -0.874  3.168   1.986   1.00 0.00 ? 125 LEU A H    9  
ATOM 7162  H HA   . LEU A 1 20 ? 1.352   1.615   2.647   1.00 0.00 ? 125 LEU A HA   9  
ATOM 7163  H HB2  . LEU A 1 20 ? 0.968   3.683   0.480   1.00 0.00 ? 125 LEU A HB2  9  
ATOM 7164  H HB3  . LEU A 1 20 ? 2.356   2.650   0.585   1.00 0.00 ? 125 LEU A HB3  9  
ATOM 7165  H HG   . LEU A 1 20 ? 0.068   0.984   0.717   1.00 0.00 ? 125 LEU A HG   9  
ATOM 7166  H HD11 . LEU A 1 20 ? -1.472  2.054   -0.480  1.00 0.00 ? 125 LEU A HD11 9  
ATOM 7167  H HD12 . LEU A 1 20 ? -0.386  1.909   -1.864  1.00 0.00 ? 125 LEU A HD12 9  
ATOM 7168  H HD13 . LEU A 1 20 ? -0.354  3.363   -0.867  1.00 0.00 ? 125 LEU A HD13 9  
ATOM 7169  H HD21 . LEU A 1 20 ? 2.351   0.523   -0.205  1.00 0.00 ? 125 LEU A HD21 9  
ATOM 7170  H HD22 . LEU A 1 20 ? 1.888   1.477   -1.619  1.00 0.00 ? 125 LEU A HD22 9  
ATOM 7171  H HD23 . LEU A 1 20 ? 1.014   -0.008  -1.225  1.00 0.00 ? 125 LEU A HD23 9  
ATOM 7172  N N    . LEU A 1 21 ? 1.585   4.793   3.383   1.00 0.00 ? 126 LEU A N    9  
ATOM 7173  C CA   . LEU A 1 21 ? 2.372   5.753   4.145   1.00 0.00 ? 126 LEU A CA   9  
ATOM 7174  C C    . LEU A 1 21 ? 2.600   5.235   5.557   1.00 0.00 ? 126 LEU A C    9  
ATOM 7175  O O    . LEU A 1 21 ? 3.600   5.560   6.197   1.00 0.00 ? 126 LEU A O    9  
ATOM 7176  C CB   . LEU A 1 21 ? 1.659   7.107   4.207   1.00 0.00 ? 126 LEU A CB   9  
ATOM 7177  C CG   . LEU A 1 21 ? 2.221   8.183   3.282   1.00 0.00 ? 126 LEU A CG   9  
ATOM 7178  C CD1  . LEU A 1 21 ? 1.423   9.471   3.414   1.00 0.00 ? 126 LEU A CD1  9  
ATOM 7179  C CD2  . LEU A 1 21 ? 3.694   8.437   3.574   1.00 0.00 ? 126 LEU A CD2  9  
ATOM 7180  H H    . LEU A 1 21 ? 0.696   5.058   3.060   1.00 0.00 ? 126 LEU A H    9  
ATOM 7181  H HA   . LEU A 1 21 ? 3.326   5.874   3.654   1.00 0.00 ? 126 LEU A HA   9  
ATOM 7182  H HB2  . LEU A 1 21 ? 0.620   6.952   3.950   1.00 0.00 ? 126 LEU A HB2  9  
ATOM 7183  H HB3  . LEU A 1 21 ? 1.706   7.474   5.220   1.00 0.00 ? 126 LEU A HB3  9  
ATOM 7184  H HG   . LEU A 1 21 ? 2.132   7.838   2.262   1.00 0.00 ? 126 LEU A HG   9  
ATOM 7185  H HD11 . LEU A 1 21 ? 1.478   9.825   4.433   1.00 0.00 ? 126 LEU A HD11 9  
ATOM 7186  H HD12 . LEU A 1 21 ? 0.392   9.283   3.154   1.00 0.00 ? 126 LEU A HD12 9  
ATOM 7187  H HD13 . LEU A 1 21 ? 1.831   10.218  2.750   1.00 0.00 ? 126 LEU A HD13 9  
ATOM 7188  H HD21 . LEU A 1 21 ? 4.068   9.201   2.907   1.00 0.00 ? 126 LEU A HD21 9  
ATOM 7189  H HD22 . LEU A 1 21 ? 4.254   7.525   3.424   1.00 0.00 ? 126 LEU A HD22 9  
ATOM 7190  H HD23 . LEU A 1 21 ? 3.808   8.764   4.596   1.00 0.00 ? 126 LEU A HD23 9  
ATOM 7191  N N    . THR A 1 22 ? 1.660   4.425   6.037   1.00 0.00 ? 127 THR A N    9  
ATOM 7192  C CA   . THR A 1 22 ? 1.756   3.865   7.375   1.00 0.00 ? 127 THR A CA   9  
ATOM 7193  C C    . THR A 1 22 ? 2.370   2.469   7.354   1.00 0.00 ? 127 THR A C    9  
ATOM 7194  O O    . THR A 1 22 ? 2.620   1.889   8.411   1.00 0.00 ? 127 THR A O    9  
ATOM 7195  C CB   . THR A 1 22 ? 0.378   3.782   8.072   1.00 0.00 ? 127 THR A CB   9  
ATOM 7196  O OG1  . THR A 1 22 ? -0.161  2.462   7.933   1.00 0.00 ? 127 THR A OG1  9  
ATOM 7197  C CG2  . THR A 1 22 ? -0.608  4.788   7.497   1.00 0.00 ? 127 THR A CG2  9  
ATOM 7198  H H    . THR A 1 22 ? 0.888   4.202   5.477   1.00 0.00 ? 127 THR A H    9  
ATOM 7199  H HA   . THR A 1 22 ? 2.390   4.515   7.960   1.00 0.00 ? 127 THR A HA   9  
ATOM 7200  H HB   . THR A 1 22 ? 0.513   3.998   9.122   1.00 0.00 ? 127 THR A HB   9  
ATOM 7201  H HG1  . THR A 1 22 ? -1.016  2.417   8.366   1.00 0.00 ? 127 THR A HG1  9  
ATOM 7202  H HG21 . THR A 1 22 ? -0.089  5.694   7.230   1.00 0.00 ? 127 THR A HG21 9  
ATOM 7203  H HG22 . THR A 1 22 ? -1.363  5.013   8.236   1.00 0.00 ? 127 THR A HG22 9  
ATOM 7204  H HG23 . THR A 1 22 ? -1.079  4.369   6.621   1.00 0.00 ? 127 THR A HG23 9  
ATOM 7205  N N    . LEU A 1 23 ? 2.618   1.919   6.161   1.00 0.00 ? 128 LEU A N    9  
ATOM 7206  C CA   . LEU A 1 23 ? 3.186   0.589   6.064   1.00 0.00 ? 128 LEU A CA   9  
ATOM 7207  C C    . LEU A 1 23 ? 4.698   0.648   5.883   1.00 0.00 ? 128 LEU A C    9  
ATOM 7208  O O    . LEU A 1 23 ? 5.395   -0.340  6.120   1.00 0.00 ? 128 LEU A O    9  
ATOM 7209  C CB   . LEU A 1 23 ? 2.519   -0.175  4.929   1.00 0.00 ? 128 LEU A CB   9  
ATOM 7210  C CG   . LEU A 1 23 ? 1.017   -0.382  5.111   1.00 0.00 ? 128 LEU A CG   9  
ATOM 7211  C CD1  . LEU A 1 23 ? 0.367   -0.794  3.806   1.00 0.00 ? 128 LEU A CD1  9  
ATOM 7212  C CD2  . LEU A 1 23 ? 0.772   -1.423  6.179   1.00 0.00 ? 128 LEU A CD2  9  
ATOM 7213  H H    . LEU A 1 23 ? 2.428   2.417   5.331   1.00 0.00 ? 128 LEU A H    9  
ATOM 7214  H HA   . LEU A 1 23 ? 2.974   0.077   6.991   1.00 0.00 ? 128 LEU A HA   9  
ATOM 7215  H HB2  . LEU A 1 23 ? 2.680   0.358   4.012   1.00 0.00 ? 128 LEU A HB2  9  
ATOM 7216  H HB3  . LEU A 1 23 ? 2.985   -1.140  4.850   1.00 0.00 ? 128 LEU A HB3  9  
ATOM 7217  H HG   . LEU A 1 23 ? 0.567   0.542   5.436   1.00 0.00 ? 128 LEU A HG   9  
ATOM 7218  H HD11 . LEU A 1 23 ? -0.136  -1.740  3.938   1.00 0.00 ? 128 LEU A HD11 9  
ATOM 7219  H HD12 . LEU A 1 23 ? 1.126   -0.892  3.047   1.00 0.00 ? 128 LEU A HD12 9  
ATOM 7220  H HD13 . LEU A 1 23 ? -0.347  -0.043  3.506   1.00 0.00 ? 128 LEU A HD13 9  
ATOM 7221  H HD21 . LEU A 1 23 ? 0.894   -0.977  7.156   1.00 0.00 ? 128 LEU A HD21 9  
ATOM 7222  H HD22 . LEU A 1 23 ? 1.486   -2.217  6.055   1.00 0.00 ? 128 LEU A HD22 9  
ATOM 7223  H HD23 . LEU A 1 23 ? -0.230  -1.815  6.082   1.00 0.00 ? 128 LEU A HD23 9  
ATOM 7224  N N    . CYS A 1 24 ? 5.206   1.805   5.464   1.00 0.00 ? 129 CYS A N    9  
ATOM 7225  C CA   . CYS A 1 24 ? 6.646   1.971   5.281   1.00 0.00 ? 129 CYS A CA   9  
ATOM 7226  C C    . CYS A 1 24 ? 7.365   1.929   6.627   1.00 0.00 ? 129 CYS A C    9  
ATOM 7227  O O    . CYS A 1 24 ? 6.798   2.303   7.654   1.00 0.00 ? 129 CYS A O    9  
ATOM 7228  C CB   . CYS A 1 24 ? 6.965   3.283   4.563   1.00 0.00 ? 129 CYS A CB   9  
ATOM 7229  S SG   . CYS A 1 24 ? 6.511   4.788   5.489   1.00 0.00 ? 129 CYS A SG   9  
ATOM 7230  H H    . CYS A 1 24 ? 4.602   2.553   5.259   1.00 0.00 ? 129 CYS A H    9  
ATOM 7231  H HA   . CYS A 1 24 ? 6.993   1.146   4.675   1.00 0.00 ? 129 CYS A HA   9  
ATOM 7232  H HB2  . CYS A 1 24 ? 8.027   3.326   4.373   1.00 0.00 ? 129 CYS A HB2  9  
ATOM 7233  H HB3  . CYS A 1 24 ? 6.440   3.300   3.621   1.00 0.00 ? 129 CYS A HB3  9  
ATOM 7234  N N    . PRO A 1 25 ? 8.629   1.469   6.638   1.00 0.00 ? 130 PRO A N    9  
ATOM 7235  C CA   . PRO A 1 25 ? 9.432   1.364   7.851   1.00 0.00 ? 130 PRO A CA   9  
ATOM 7236  C C    . PRO A 1 25 ? 10.147  2.666   8.187   1.00 0.00 ? 130 PRO A C    9  
ATOM 7237  O O    . PRO A 1 25 ? 10.758  2.797   9.248   1.00 0.00 ? 130 PRO A O    9  
ATOM 7238  C CB   . PRO A 1 25 ? 10.452  0.264   7.508   1.00 0.00 ? 130 PRO A CB   9  
ATOM 7239  C CG   . PRO A 1 25 ? 10.217  -0.097  6.068   1.00 0.00 ? 130 PRO A CG   9  
ATOM 7240  C CD   . PRO A 1 25 ? 9.386   1.006   5.478   1.00 0.00 ? 130 PRO A CD   9  
ATOM 7241  H HA   . PRO A 1 25 ? 8.835   1.057   8.693   1.00 0.00 ? 130 PRO A HA   9  
ATOM 7242  H HB2  . PRO A 1 25 ? 11.452  0.643   7.657   1.00 0.00 ? 130 PRO A HB2  9  
ATOM 7243  H HB3  . PRO A 1 25 ? 10.291  -0.587  8.154   1.00 0.00 ? 130 PRO A HB3  9  
ATOM 7244  H HG2  . PRO A 1 25 ? 11.162  -0.169  5.550   1.00 0.00 ? 130 PRO A HG2  9  
ATOM 7245  H HG3  . PRO A 1 25 ? 9.687   -1.037  6.009   1.00 0.00 ? 130 PRO A HG3  9  
ATOM 7246  H HD2  . PRO A 1 25 ? 10.018  1.791   5.087   1.00 0.00 ? 130 PRO A HD2  9  
ATOM 7247  H HD3  . PRO A 1 25 ? 8.726   0.627   4.709   1.00 0.00 ? 130 PRO A HD3  9  
ATOM 7248  N N    . TYR A 1 26 ? 10.066  3.625   7.273   1.00 0.00 ? 131 TYR A N    9  
ATOM 7249  C CA   . TYR A 1 26 ? 10.704  4.924   7.460   1.00 0.00 ? 131 TYR A CA   9  
ATOM 7250  C C    . TYR A 1 26 ? 9.892   6.030   6.793   1.00 0.00 ? 131 TYR A C    9  
ATOM 7251  O O    . TYR A 1 26 ? 9.029   6.623   7.475   1.00 0.00 ? 131 TYR A O    9  
ATOM 7252  C CB   . TYR A 1 26 ? 12.128  4.908   6.895   1.00 0.00 ? 131 TYR A CB   9  
ATOM 7253  C CG   . TYR A 1 26 ? 13.079  4.021   7.668   1.00 0.00 ? 131 TYR A CG   9  
ATOM 7254  C CD1  . TYR A 1 26 ? 13.694  4.473   8.828   1.00 0.00 ? 131 TYR A CD1  9  
ATOM 7255  C CD2  . TYR A 1 26 ? 13.361  2.730   7.237   1.00 0.00 ? 131 TYR A CD2  9  
ATOM 7256  C CE1  . TYR A 1 26 ? 14.563  3.665   9.538   1.00 0.00 ? 131 TYR A CE1  9  
ATOM 7257  C CE2  . TYR A 1 26 ? 14.228  1.916   7.942   1.00 0.00 ? 131 TYR A CE2  9  
ATOM 7258  C CZ   . TYR A 1 26 ? 14.826  2.387   9.091   1.00 0.00 ? 131 TYR A CZ   9  
ATOM 7259  O OH   . TYR A 1 26 ? 15.688  1.579   9.796   1.00 0.00 ? 131 TYR A OH   9  
ATOM 7260  O OXT  . TYR A 1 26 ? 10.123  6.293   5.593   1.00 0.00 ? 131 TYR A OXT  9  
ATOM 7261  H H    . TYR A 1 26 ? 9.559   3.455   6.454   1.00 0.00 ? 131 TYR A H    9  
ATOM 7262  H HA   . TYR A 1 26 ? 10.751  5.120   8.521   1.00 0.00 ? 131 TYR A HA   9  
ATOM 7263  H HB2  . TYR A 1 26 ? 12.098  4.552   5.876   1.00 0.00 ? 131 TYR A HB2  9  
ATOM 7264  H HB3  . TYR A 1 26 ? 12.525  5.912   6.907   1.00 0.00 ? 131 TYR A HB3  9  
ATOM 7265  H HD1  . TYR A 1 26 ? 13.486  5.475   9.177   1.00 0.00 ? 131 TYR A HD1  9  
ATOM 7266  H HD2  . TYR A 1 26 ? 12.891  2.363   6.338   1.00 0.00 ? 131 TYR A HD2  9  
ATOM 7267  H HE1  . TYR A 1 26 ? 15.032  4.035   10.439  1.00 0.00 ? 131 TYR A HE1  9  
ATOM 7268  H HE2  . TYR A 1 26 ? 14.433  0.915   7.591   1.00 0.00 ? 131 TYR A HE2  9  
ATOM 7269  H HH   . TYR A 1 26 ? 16.283  1.135   9.185   1.00 0.00 ? 131 TYR A HH   9  
ATOM 7270  N N    . PRO B 2 1  ? -12.372 15.808  -9.527  1.00 0.00 ? 25  PRO B N    9  
ATOM 7271  C CA   . PRO B 2 1  ? -13.542 15.109  -8.940  1.00 0.00 ? 25  PRO B CA   9  
ATOM 7272  C C    . PRO B 2 1  ? -13.250 13.624  -8.739  1.00 0.00 ? 25  PRO B C    9  
ATOM 7273  O O    . PRO B 2 1  ? -13.972 12.764  -9.244  1.00 0.00 ? 25  PRO B O    9  
ATOM 7274  C CB   . PRO B 2 1  ? -14.739 15.295  -9.866  1.00 0.00 ? 25  PRO B CB   9  
ATOM 7275  C CG   . PRO B 2 1  ? -14.177 16.031  -11.035 1.00 0.00 ? 25  PRO B CG   9  
ATOM 7276  C CD   . PRO B 2 1  ? -12.925 16.723  -10.544 1.00 0.00 ? 25  PRO B CD   9  
ATOM 7277  H H2   . PRO B 2 1  ? -11.741 15.061  -9.859  1.00 0.00 ? 25  PRO B H2   9  
ATOM 7278  H H3   . PRO B 2 1  ? -11.862 16.209  -8.706  1.00 0.00 ? 25  PRO B H3   9  
ATOM 7279  H HA   . PRO B 2 1  ? -13.762 15.557  -7.983  1.00 0.00 ? 25  PRO B HA   9  
ATOM 7280  H HB2  . PRO B 2 1  ? -15.132 14.330  -10.154 1.00 0.00 ? 25  PRO B HB2  9  
ATOM 7281  H HB3  . PRO B 2 1  ? -15.503 15.870  -9.366  1.00 0.00 ? 25  PRO B HB3  9  
ATOM 7282  H HG2  . PRO B 2 1  ? -13.936 15.336  -11.824 1.00 0.00 ? 25  PRO B HG2  9  
ATOM 7283  H HG3  . PRO B 2 1  ? -14.893 16.761  -11.385 1.00 0.00 ? 25  PRO B HG3  9  
ATOM 7284  H HD2  . PRO B 2 1  ? -12.227 16.853  -11.359 1.00 0.00 ? 25  PRO B HD2  9  
ATOM 7285  H HD3  . PRO B 2 1  ? -13.171 17.676  -10.104 1.00 0.00 ? 25  PRO B HD3  9  
ATOM 7286  N N    . THR B 2 2  ? -12.187 13.332  -7.993  1.00 0.00 ? 26  THR B N    9  
ATOM 7287  C CA   . THR B 2 2  ? -11.799 11.951  -7.726  1.00 0.00 ? 26  THR B CA   9  
ATOM 7288  C C    . THR B 2 2  ? -10.771 11.869  -6.597  1.00 0.00 ? 26  THR B C    9  
ATOM 7289  O O    . THR B 2 2  ? -9.911  12.742  -6.468  1.00 0.00 ? 26  THR B O    9  
ATOM 7290  C CB   . THR B 2 2  ? -11.215 11.282  -8.985  1.00 0.00 ? 26  THR B CB   9  
ATOM 7291  O OG1  . THR B 2 2  ? -10.676 9.997   -8.654  1.00 0.00 ? 26  THR B OG1  9  
ATOM 7292  C CG2  . THR B 2 2  ? -10.129 12.149  -9.606  1.00 0.00 ? 26  THR B CG2  9  
ATOM 7293  H H    . THR B 2 2  ? -11.651 14.061  -7.619  1.00 0.00 ? 26  THR B H    9  
ATOM 7294  H HA   . THR B 2 2  ? -12.686 11.409  -7.435  1.00 0.00 ? 26  THR B HA   9  
ATOM 7295  H HB   . THR B 2 2  ? -12.010 11.155  -9.705  1.00 0.00 ? 26  THR B HB   9  
ATOM 7296  H HG1  . THR B 2 2  ? -11.358 9.329   -8.751  1.00 0.00 ? 26  THR B HG1  9  
ATOM 7297  H HG21 . THR B 2 2  ? -9.323  12.276  -8.899  1.00 0.00 ? 26  THR B HG21 9  
ATOM 7298  H HG22 . THR B 2 2  ? -10.541 13.115  -9.859  1.00 0.00 ? 26  THR B HG22 9  
ATOM 7299  H HG23 . THR B 2 2  ? -9.755  11.671  -10.498 1.00 0.00 ? 26  THR B HG23 9  
ATOM 7300  N N    . PRO B 2 3  ? -10.850 10.815  -5.763  1.00 0.00 ? 27  PRO B N    9  
ATOM 7301  C CA   . PRO B 2 3  ? -9.935  10.609  -4.650  1.00 0.00 ? 27  PRO B CA   9  
ATOM 7302  C C    . PRO B 2 3  ? -8.750  9.733   -5.038  1.00 0.00 ? 27  PRO B C    9  
ATOM 7303  O O    . PRO B 2 3  ? -8.398  9.642   -6.213  1.00 0.00 ? 27  PRO B O    9  
ATOM 7304  C CB   . PRO B 2 3  ? -10.823 9.896   -3.635  1.00 0.00 ? 27  PRO B CB   9  
ATOM 7305  C CG   . PRO B 2 3  ? -11.783 9.094   -4.458  1.00 0.00 ? 27  PRO B CG   9  
ATOM 7306  C CD   . PRO B 2 3  ? -11.842 9.729   -5.832  1.00 0.00 ? 27  PRO B CD   9  
ATOM 7307  H HA   . PRO B 2 3  ? -9.580  11.539  -4.237  1.00 0.00 ? 27  PRO B HA   9  
ATOM 7308  H HB2  . PRO B 2 3  ? -10.216 9.263   -3.004  1.00 0.00 ? 27  PRO B HB2  9  
ATOM 7309  H HB3  . PRO B 2 3  ? -11.339 10.627  -3.031  1.00 0.00 ? 27  PRO B HB3  9  
ATOM 7310  H HG2  . PRO B 2 3  ? -11.432 8.075   -4.537  1.00 0.00 ? 27  PRO B HG2  9  
ATOM 7311  H HG3  . PRO B 2 3  ? -12.761 9.114   -3.999  1.00 0.00 ? 27  PRO B HG3  9  
ATOM 7312  H HD2  . PRO B 2 3  ? -11.569 9.009   -6.589  1.00 0.00 ? 27  PRO B HD2  9  
ATOM 7313  H HD3  . PRO B 2 3  ? -12.830 10.122  -6.024  1.00 0.00 ? 27  PRO B HD3  9  
ATOM 7314  N N    . GLU B 2 4  ? -8.143  9.088   -4.050  1.00 0.00 ? 28  GLU B N    9  
ATOM 7315  C CA   . GLU B 2 4  ? -7.015  8.219   -4.299  1.00 0.00 ? 28  GLU B CA   9  
ATOM 7316  C C    . GLU B 2 4  ? -7.490  6.884   -4.837  1.00 0.00 ? 28  GLU B C    9  
ATOM 7317  O O    . GLU B 2 4  ? -6.723  6.098   -5.393  1.00 0.00 ? 28  GLU B O    9  
ATOM 7318  C CB   . GLU B 2 4  ? -6.222  8.029   -3.011  1.00 0.00 ? 28  GLU B CB   9  
ATOM 7319  C CG   . GLU B 2 4  ? -5.838  9.332   -2.328  1.00 0.00 ? 28  GLU B CG   9  
ATOM 7320  C CD   . GLU B 2 4  ? -5.022  10.244  -3.223  1.00 0.00 ? 28  GLU B CD   9  
ATOM 7321  O OE1  . GLU B 2 4  ? -3.791  10.046  -3.306  1.00 0.00 ? 28  GLU B OE1  9  
ATOM 7322  O OE2  . GLU B 2 4  ? -5.613  11.156  -3.839  1.00 0.00 ? 28  GLU B OE2  9  
ATOM 7323  H H    . GLU B 2 4  ? -8.449  9.210   -3.132  1.00 0.00 ? 28  GLU B H    9  
ATOM 7324  H HA   . GLU B 2 4  ? -6.403  8.685   -5.034  1.00 0.00 ? 28  GLU B HA   9  
ATOM 7325  H HB2  . GLU B 2 4  ? -6.815  7.447   -2.321  1.00 0.00 ? 28  GLU B HB2  9  
ATOM 7326  H HB3  . GLU B 2 4  ? -5.329  7.492   -3.239  1.00 0.00 ? 28  GLU B HB3  9  
ATOM 7327  H HG2  . GLU B 2 4  ? -6.740  9.851   -2.039  1.00 0.00 ? 28  GLU B HG2  9  
ATOM 7328  H HG3  . GLU B 2 4  ? -5.258  9.103   -1.446  1.00 0.00 ? 28  GLU B HG3  9  
ATOM 7329  N N    . MET B 2 5  ? -8.782  6.683   -4.680  1.00 0.00 ? 29  MET B N    9  
ATOM 7330  C CA   . MET B 2 5  ? -9.483  5.482   -5.120  1.00 0.00 ? 29  MET B CA   9  
ATOM 7331  C C    . MET B 2 5  ? -8.652  4.217   -4.937  1.00 0.00 ? 29  MET B C    9  
ATOM 7332  O O    . MET B 2 5  ? -8.852  3.219   -5.631  1.00 0.00 ? 29  MET B O    9  
ATOM 7333  C CB   . MET B 2 5  ? -9.879  5.659   -6.575  1.00 0.00 ? 29  MET B CB   9  
ATOM 7334  C CG   . MET B 2 5  ? -10.789 4.570   -7.118  1.00 0.00 ? 29  MET B CG   9  
ATOM 7335  S SD   . MET B 2 5  ? -11.423 4.946   -8.763  1.00 0.00 ? 29  MET B SD   9  
ATOM 7336  C CE   . MET B 2 5  ? -12.493 6.336   -8.404  1.00 0.00 ? 29  MET B CE   9  
ATOM 7337  H H    . MET B 2 5  ? -9.297  7.402   -4.287  1.00 0.00 ? 29  MET B H    9  
ATOM 7338  H HA   . MET B 2 5  ? -10.373 5.386   -4.522  1.00 0.00 ? 29  MET B HA   9  
ATOM 7339  H HB2  . MET B 2 5  ? -10.383 6.608   -6.683  1.00 0.00 ? 29  MET B HB2  9  
ATOM 7340  H HB3  . MET B 2 5  ? -8.975  5.675   -7.153  1.00 0.00 ? 29  MET B HB3  9  
ATOM 7341  H HG2  . MET B 2 5  ? -10.231 3.649   -7.167  1.00 0.00 ? 29  MET B HG2  9  
ATOM 7342  H HG3  . MET B 2 5  ? -11.625 4.448   -6.445  1.00 0.00 ? 29  MET B HG3  9  
ATOM 7343  H HE1  . MET B 2 5  ? -12.987 6.655   -9.309  1.00 0.00 ? 29  MET B HE1  9  
ATOM 7344  H HE2  . MET B 2 5  ? -11.904 7.152   -8.009  1.00 0.00 ? 29  MET B HE2  9  
ATOM 7345  H HE3  . MET B 2 5  ? -13.233 6.042   -7.674  1.00 0.00 ? 29  MET B HE3  9  
ATOM 7346  N N    . ARG B 2 6  ? -7.738  4.261   -3.989  1.00 0.00 ? 30  ARG B N    9  
ATOM 7347  C CA   . ARG B 2 6  ? -6.884  3.136   -3.698  1.00 0.00 ? 30  ARG B CA   9  
ATOM 7348  C C    . ARG B 2 6  ? -6.301  2.524   -4.970  1.00 0.00 ? 30  ARG B C    9  
ATOM 7349  O O    . ARG B 2 6  ? -6.226  3.179   -6.011  1.00 0.00 ? 30  ARG B O    9  
ATOM 7350  C CB   . ARG B 2 6  ? -7.683  2.104   -2.936  1.00 0.00 ? 30  ARG B CB   9  
ATOM 7351  C CG   . ARG B 2 6  ? -8.204  2.608   -1.612  1.00 0.00 ? 30  ARG B CG   9  
ATOM 7352  C CD   . ARG B 2 6  ? -7.485  1.960   -0.443  1.00 0.00 ? 30  ARG B CD   9  
ATOM 7353  N NE   . ARG B 2 6  ? -8.061  2.357   0.831   1.00 0.00 ? 30  ARG B NE   9  
ATOM 7354  C CZ   . ARG B 2 6  ? -7.377  2.401   1.970   1.00 0.00 ? 30  ARG B CZ   9  
ATOM 7355  N NH1  . ARG B 2 6  ? -6.088  2.094   1.985   1.00 0.00 ? 30  ARG B NH1  9  
ATOM 7356  N NH2  . ARG B 2 6  ? -7.981  2.762   3.094   1.00 0.00 ? 30  ARG B NH2  9  
ATOM 7357  H H    . ARG B 2 6  ? -7.641  5.067   -3.469  1.00 0.00 ? 30  ARG B H    9  
ATOM 7358  H HA   . ARG B 2 6  ? -6.088  3.482   -3.065  1.00 0.00 ? 30  ARG B HA   9  
ATOM 7359  H HB2  . ARG B 2 6  ? -8.521  1.800   -3.533  1.00 0.00 ? 30  ARG B HB2  9  
ATOM 7360  H HB3  . ARG B 2 6  ? -7.056  1.265   -2.752  1.00 0.00 ? 30  ARG B HB3  9  
ATOM 7361  H HG2  . ARG B 2 6  ? -8.063  3.676   -1.564  1.00 0.00 ? 30  ARG B HG2  9  
ATOM 7362  H HG3  . ARG B 2 6  ? -9.247  2.385   -1.550  1.00 0.00 ? 30  ARG B HG3  9  
ATOM 7363  H HD2  . ARG B 2 6  ? -7.556  0.889   -0.541  1.00 0.00 ? 30  ARG B HD2  9  
ATOM 7364  H HD3  . ARG B 2 6  ? -6.452  2.258   -0.463  1.00 0.00 ? 30  ARG B HD3  9  
ATOM 7365  H HE   . ARG B 2 6  ? -9.004  2.599   0.838   1.00 0.00 ? 30  ARG B HE   9  
ATOM 7366  H HH11 . ARG B 2 6  ? -5.627  1.827   1.139   1.00 0.00 ? 30  ARG B HH11 9  
ATOM 7367  H HH12 . ARG B 2 6  ? -5.575  2.130   2.843   1.00 0.00 ? 30  ARG B HH12 9  
ATOM 7368  H HH21 . ARG B 2 6  ? -8.953  3.000   3.086   1.00 0.00 ? 30  ARG B HH21 9  
ATOM 7369  H HH22 . ARG B 2 6  ? -7.465  2.795   3.950   1.00 0.00 ? 30  ARG B HH22 9  
ATOM 7370  N N    . GLU B 2 7  ? -5.893  1.262   -4.870  1.00 0.00 ? 31  GLU B N    9  
ATOM 7371  C CA   . GLU B 2 7  ? -5.317  0.527   -5.993  1.00 0.00 ? 31  GLU B CA   9  
ATOM 7372  C C    . GLU B 2 7  ? -4.865  -0.837  -5.530  1.00 0.00 ? 31  GLU B C    9  
ATOM 7373  O O    . GLU B 2 7  ? -4.198  -0.962  -4.515  1.00 0.00 ? 31  GLU B O    9  
ATOM 7374  C CB   . GLU B 2 7  ? -4.138  1.284   -6.603  1.00 0.00 ? 31  GLU B CB   9  
ATOM 7375  C CG   . GLU B 2 7  ? -3.428  0.512   -7.703  1.00 0.00 ? 31  GLU B CG   9  
ATOM 7376  C CD   . GLU B 2 7  ? -4.279  0.352   -8.947  1.00 0.00 ? 31  GLU B CD   9  
ATOM 7377  O OE1  . GLU B 2 7  ? -4.289  1.281   -9.782  1.00 0.00 ? 31  GLU B OE1  9  
ATOM 7378  O OE2  . GLU B 2 7  ? -4.934  -0.701  -9.087  1.00 0.00 ? 31  GLU B OE2  9  
ATOM 7379  H H    . GLU B 2 7  ? -5.984  0.807   -4.007  1.00 0.00 ? 31  GLU B H    9  
ATOM 7380  H HA   . GLU B 2 7  ? -6.085  0.387   -6.742  1.00 0.00 ? 31  GLU B HA   9  
ATOM 7381  H HB2  . GLU B 2 7  ? -4.497  2.213   -7.021  1.00 0.00 ? 31  GLU B HB2  9  
ATOM 7382  H HB3  . GLU B 2 7  ? -3.421  1.501   -5.825  1.00 0.00 ? 31  GLU B HB3  9  
ATOM 7383  H HG2  . GLU B 2 7  ? -2.527  1.038   -7.965  1.00 0.00 ? 31  GLU B HG2  9  
ATOM 7384  H HG3  . GLU B 2 7  ? -3.175  -0.469  -7.330  1.00 0.00 ? 31  GLU B HG3  9  
ATOM 7385  N N    . LYS B 2 8  ? -5.227  -1.850  -6.292  1.00 0.00 ? 32  LYS B N    9  
ATOM 7386  C CA   . LYS B 2 8  ? -4.892  -3.216  -5.960  1.00 0.00 ? 32  LYS B CA   9  
ATOM 7387  C C    . LYS B 2 8  ? -3.392  -3.469  -6.018  1.00 0.00 ? 32  LYS B C    9  
ATOM 7388  O O    . LYS B 2 8  ? -2.805  -3.623  -7.090  1.00 0.00 ? 32  LYS B O    9  
ATOM 7389  C CB   . LYS B 2 8  ? -5.642  -4.141  -6.894  1.00 0.00 ? 32  LYS B CB   9  
ATOM 7390  C CG   . LYS B 2 8  ? -7.109  -3.771  -7.018  1.00 0.00 ? 32  LYS B CG   9  
ATOM 7391  C CD   . LYS B 2 8  ? -7.909  -4.887  -7.669  1.00 0.00 ? 32  LYS B CD   9  
ATOM 7392  C CE   . LYS B 2 8  ? -9.389  -4.755  -7.377  1.00 0.00 ? 32  LYS B CE   9  
ATOM 7393  N NZ   . LYS B 2 8  ? -10.180 -5.844  -8.014  1.00 0.00 ? 32  LYS B NZ   9  
ATOM 7394  H H    . LYS B 2 8  ? -5.735  -1.675  -7.109  1.00 0.00 ? 32  LYS B H    9  
ATOM 7395  H HA   . LYS B 2 8  ? -5.232  -3.397  -4.952  1.00 0.00 ? 32  LYS B HA   9  
ATOM 7396  H HB2  . LYS B 2 8  ? -5.191  -4.096  -7.871  1.00 0.00 ? 32  LYS B HB2  9  
ATOM 7397  H HB3  . LYS B 2 8  ? -5.577  -5.142  -6.517  1.00 0.00 ? 32  LYS B HB3  9  
ATOM 7398  H HG2  . LYS B 2 8  ? -7.502  -3.573  -6.032  1.00 0.00 ? 32  LYS B HG2  9  
ATOM 7399  H HG3  . LYS B 2 8  ? -7.193  -2.880  -7.615  1.00 0.00 ? 32  LYS B HG3  9  
ATOM 7400  H HD2  . LYS B 2 8  ? -7.763  -4.847  -8.734  1.00 0.00 ? 32  LYS B HD2  9  
ATOM 7401  H HD3  . LYS B 2 8  ? -7.560  -5.838  -7.290  1.00 0.00 ? 32  LYS B HD3  9  
ATOM 7402  H HE2  . LYS B 2 8  ? -9.530  -4.797  -6.312  1.00 0.00 ? 32  LYS B HE2  9  
ATOM 7403  H HE3  . LYS B 2 8  ? -9.734  -3.803  -7.750  1.00 0.00 ? 32  LYS B HE3  9  
ATOM 7404  H HZ1  . LYS B 2 8  ? -10.030 -5.841  -9.043  1.00 0.00 ? 32  LYS B HZ1  9  
ATOM 7405  H HZ2  . LYS B 2 8  ? -11.194 -5.708  -7.825  1.00 0.00 ? 32  LYS B HZ2  9  
ATOM 7406  H HZ3  . LYS B 2 8  ? -9.889  -6.767  -7.635  1.00 0.00 ? 32  LYS B HZ3  9  
ATOM 7407  N N    . LEU B 2 9  ? -2.793  -3.509  -4.838  1.00 0.00 ? 33  LEU B N    9  
ATOM 7408  C CA   . LEU B 2 9  ? -1.366  -3.736  -4.679  1.00 0.00 ? 33  LEU B CA   9  
ATOM 7409  C C    . LEU B 2 9  ? -1.074  -5.152  -4.213  1.00 0.00 ? 33  LEU B C    9  
ATOM 7410  O O    . LEU B 2 9  ? -1.204  -5.472  -3.032  1.00 0.00 ? 33  LEU B O    9  
ATOM 7411  C CB   . LEU B 2 9  ? -0.819  -2.739  -3.695  1.00 0.00 ? 33  LEU B CB   9  
ATOM 7412  C CG   . LEU B 2 9  ? -1.494  -1.385  -3.743  1.00 0.00 ? 33  LEU B CG   9  
ATOM 7413  C CD1  . LEU B 2 9  ? -1.045  -0.505  -2.589  1.00 0.00 ? 33  LEU B CD1  9  
ATOM 7414  C CD2  . LEU B 2 9  ? -1.207  -0.726  -5.083  1.00 0.00 ? 33  LEU B CD2  9  
ATOM 7415  H H    . LEU B 2 9  ? -3.330  -3.358  -4.041  1.00 0.00 ? 33  LEU B H    9  
ATOM 7416  H HA   . LEU B 2 9  ? -0.878  -3.572  -5.619  1.00 0.00 ? 33  LEU B HA   9  
ATOM 7417  H HB2  . LEU B 2 9  ? -0.899  -3.140  -2.700  1.00 0.00 ? 33  LEU B HB2  9  
ATOM 7418  H HB3  . LEU B 2 9  ? 0.209   -2.600  -3.934  1.00 0.00 ? 33  LEU B HB3  9  
ATOM 7419  H HG   . LEU B 2 9  ? -2.556  -1.532  -3.660  1.00 0.00 ? 33  LEU B HG   9  
ATOM 7420  H HD11 . LEU B 2 9  ? -1.867  0.120   -2.273  1.00 0.00 ? 33  LEU B HD11 9  
ATOM 7421  H HD12 . LEU B 2 9  ? -0.223  0.119   -2.906  1.00 0.00 ? 33  LEU B HD12 9  
ATOM 7422  H HD13 . LEU B 2 9  ? -0.729  -1.126  -1.764  1.00 0.00 ? 33  LEU B HD13 9  
ATOM 7423  H HD21 . LEU B 2 9  ? -2.085  -0.193  -5.420  1.00 0.00 ? 33  LEU B HD21 9  
ATOM 7424  H HD22 . LEU B 2 9  ? -0.945  -1.495  -5.805  1.00 0.00 ? 33  LEU B HD22 9  
ATOM 7425  H HD23 . LEU B 2 9  ? -0.384  -0.036  -4.975  1.00 0.00 ? 33  LEU B HD23 9  
ATOM 7426  N N    . CYS B 2 10 ? -0.685  -5.995  -5.157  1.00 0.00 ? 34  CYS B N    9  
ATOM 7427  C CA   . CYS B 2 10 ? -0.371  -7.383  -4.851  1.00 0.00 ? 34  CYS B CA   9  
ATOM 7428  C C    . CYS B 2 10 ? 1.128   -7.593  -4.737  1.00 0.00 ? 34  CYS B C    9  
ATOM 7429  O O    . CYS B 2 10 ? 1.814   -7.862  -5.722  1.00 0.00 ? 34  CYS B O    9  
ATOM 7430  C CB   . CYS B 2 10 ? -0.957  -8.303  -5.907  1.00 0.00 ? 34  CYS B CB   9  
ATOM 7431  S SG   . CYS B 2 10 ? -1.439  -9.941  -5.276  1.00 0.00 ? 34  CYS B SG   9  
ATOM 7432  H H    . CYS B 2 10 ? -0.611  -5.677  -6.080  1.00 0.00 ? 34  CYS B H    9  
ATOM 7433  H HA   . CYS B 2 10 ? -0.820  -7.614  -3.899  1.00 0.00 ? 34  CYS B HA   9  
ATOM 7434  H HB2  . CYS B 2 10 ? -1.833  -7.837  -6.312  1.00 0.00 ? 34  CYS B HB2  9  
ATOM 7435  H HB3  . CYS B 2 10 ? -0.231  -8.448  -6.695  1.00 0.00 ? 34  CYS B HB3  9  
ATOM 7436  N N    . GLY B 2 11 ? 1.614   -7.470  -3.514  1.00 0.00 ? 35  GLY B N    9  
ATOM 7437  C CA   . GLY B 2 11 ? 3.030   -7.641  -3.236  1.00 0.00 ? 35  GLY B CA   9  
ATOM 7438  C C    . GLY B 2 11 ? 3.899   -6.627  -3.955  1.00 0.00 ? 35  GLY B C    9  
ATOM 7439  O O    . GLY B 2 11 ? 4.334   -5.650  -3.349  1.00 0.00 ? 35  GLY B O    9  
ATOM 7440  H H    . GLY B 2 11 ? 0.995   -7.262  -2.787  1.00 0.00 ? 35  GLY B H    9  
ATOM 7441  H HA2  . GLY B 2 11 ? 3.186   -7.534  -2.173  1.00 0.00 ? 35  GLY B HA2  9  
ATOM 7442  H HA3  . GLY B 2 11 ? 3.329   -8.629  -3.530  1.00 0.00 ? 35  GLY B HA3  9  
ATOM 7443  N N    . HIS B 2 12 ? 4.178   -6.860  -5.240  1.00 0.00 ? 36  HIS B N    9  
ATOM 7444  C CA   . HIS B 2 12 ? 4.996   -5.937  -6.007  1.00 0.00 ? 36  HIS B CA   9  
ATOM 7445  C C    . HIS B 2 12 ? 4.305   -4.591  -6.165  1.00 0.00 ? 36  HIS B C    9  
ATOM 7446  O O    . HIS B 2 12 ? 4.886   -3.568  -5.834  1.00 0.00 ? 36  HIS B O    9  
ATOM 7447  C CB   . HIS B 2 12 ? 5.360   -6.512  -7.368  1.00 0.00 ? 36  HIS B CB   9  
ATOM 7448  C CG   . HIS B 2 12 ? 6.657   -5.972  -7.871  1.00 0.00 ? 36  HIS B CG   9  
ATOM 7449  N ND1  . HIS B 2 12 ? 7.035   -5.975  -9.192  1.00 0.00 ? 36  HIS B ND1  9  
ATOM 7450  C CD2  . HIS B 2 12 ? 7.675   -5.390  -7.184  1.00 0.00 ? 36  HIS B CD2  9  
ATOM 7451  C CE1  . HIS B 2 12 ? 8.245   -5.409  -9.273  1.00 0.00 ? 36  HIS B CE1  9  
ATOM 7452  N NE2  . HIS B 2 12 ? 8.680   -5.035  -8.082  1.00 0.00 ? 36  HIS B NE2  9  
ATOM 7453  H H    . HIS B 2 12 ? 3.849   -7.669  -5.668  1.00 0.00 ? 36  HIS B H    9  
ATOM 7454  H HA   . HIS B 2 12 ? 5.905   -5.783  -5.445  1.00 0.00 ? 36  HIS B HA   9  
ATOM 7455  H HB2  . HIS B 2 12 ? 5.447   -7.587  -7.293  1.00 0.00 ? 36  HIS B HB2  9  
ATOM 7456  H HB3  . HIS B 2 12 ? 4.591   -6.262  -8.082  1.00 0.00 ? 36  HIS B HB3  9  
ATOM 7457  H HD1  . HIS B 2 12 ? 6.512   -6.331  -9.941  1.00 0.00 ? 36  HIS B HD1  9  
ATOM 7458  H HD2  . HIS B 2 12 ? 7.705   -5.221  -6.110  1.00 0.00 ? 36  HIS B HD2  9  
ATOM 7459  H HE1  . HIS B 2 12 ? 8.788   -5.267  -10.192 1.00 0.00 ? 36  HIS B HE1  9  
ATOM 7460  N N    . HIS B 2 13 ? 3.084   -4.572  -6.701  1.00 0.00 ? 37  HIS B N    9  
ATOM 7461  C CA   . HIS B 2 13 ? 2.360   -3.308  -6.814  1.00 0.00 ? 37  HIS B CA   9  
ATOM 7462  C C    . HIS B 2 13 ? 2.345   -2.673  -5.454  1.00 0.00 ? 37  HIS B C    9  
ATOM 7463  O O    . HIS B 2 13 ? 2.451   -1.458  -5.293  1.00 0.00 ? 37  HIS B O    9  
ATOM 7464  C CB   . HIS B 2 13 ? 0.918   -3.518  -7.249  1.00 0.00 ? 37  HIS B CB   9  
ATOM 7465  C CG   . HIS B 2 13 ? 0.741   -3.613  -8.716  1.00 0.00 ? 37  HIS B CG   9  
ATOM 7466  N ND1  . HIS B 2 13 ? -0.212  -2.920  -9.418  1.00 0.00 ? 37  HIS B ND1  9  
ATOM 7467  C CD2  . HIS B 2 13 ? 1.420   -4.350  -9.615  1.00 0.00 ? 37  HIS B CD2  9  
ATOM 7468  C CE1  . HIS B 2 13 ? -0.090  -3.248  -10.705 1.00 0.00 ? 37  HIS B CE1  9  
ATOM 7469  N NE2  . HIS B 2 13 ? 0.891   -4.118  -10.884 1.00 0.00 ? 37  HIS B NE2  9  
ATOM 7470  H H    . HIS B 2 13 ? 2.674   -5.403  -7.018  1.00 0.00 ? 37  HIS B H    9  
ATOM 7471  H HA   . HIS B 2 13 ? 2.873   -2.666  -7.516  1.00 0.00 ? 37  HIS B HA   9  
ATOM 7472  H HB2  . HIS B 2 13 ? 0.550   -4.432  -6.812  1.00 0.00 ? 37  HIS B HB2  9  
ATOM 7473  H HB3  . HIS B 2 13 ? 0.322   -2.688  -6.891  1.00 0.00 ? 37  HIS B HB3  9  
ATOM 7474  H HD1  . HIS B 2 13 ? -0.865  -2.293  -9.041  1.00 0.00 ? 37  HIS B HD1  9  
ATOM 7475  H HD2  . HIS B 2 13 ? 2.242   -5.009  -9.389  1.00 0.00 ? 37  HIS B HD2  9  
ATOM 7476  H HE1  . HIS B 2 13 ? -0.708  -2.853  -11.491 1.00 0.00 ? 37  HIS B HE1  9  
ATOM 7477  N N    . PHE B 2 14 ? 2.204   -3.548  -4.478  1.00 0.00 ? 38  PHE B N    9  
ATOM 7478  C CA   . PHE B 2 14 ? 2.178   -3.166  -3.097  1.00 0.00 ? 38  PHE B CA   9  
ATOM 7479  C C    . PHE B 2 14 ? 3.531   -2.641  -2.687  1.00 0.00 ? 38  PHE B C    9  
ATOM 7480  O O    . PHE B 2 14 ? 3.643   -1.818  -1.785  1.00 0.00 ? 38  PHE B O    9  
ATOM 7481  C CB   . PHE B 2 14 ? 1.740   -4.366  -2.267  1.00 0.00 ? 38  PHE B CB   9  
ATOM 7482  C CG   . PHE B 2 14 ? 1.823   -4.113  -0.809  1.00 0.00 ? 38  PHE B CG   9  
ATOM 7483  C CD1  . PHE B 2 14 ? 1.208   -2.999  -0.286  1.00 0.00 ? 38  PHE B CD1  9  
ATOM 7484  C CD2  . PHE B 2 14 ? 2.528   -4.960  0.029   1.00 0.00 ? 38  PHE B CD2  9  
ATOM 7485  C CE1  . PHE B 2 14 ? 1.285   -2.722  1.058   1.00 0.00 ? 38  PHE B CE1  9  
ATOM 7486  C CE2  . PHE B 2 14 ? 2.616   -4.687  1.378   1.00 0.00 ? 38  PHE B CE2  9  
ATOM 7487  C CZ   . PHE B 2 14 ? 1.993   -3.564  1.895   1.00 0.00 ? 38  PHE B CZ   9  
ATOM 7488  H H    . PHE B 2 14 ? 2.113   -4.496  -4.707  1.00 0.00 ? 38  PHE B H    9  
ATOM 7489  H HA   . PHE B 2 14 ? 1.459   -2.372  -2.981  1.00 0.00 ? 38  PHE B HA   9  
ATOM 7490  H HB2  . PHE B 2 14 ? 0.712   -4.597  -2.503  1.00 0.00 ? 38  PHE B HB2  9  
ATOM 7491  H HB3  . PHE B 2 14 ? 2.356   -5.210  -2.509  1.00 0.00 ? 38  PHE B HB3  9  
ATOM 7492  H HD1  . PHE B 2 14 ? 0.651   -2.344  -0.952  1.00 0.00 ? 38  PHE B HD1  9  
ATOM 7493  H HD2  . PHE B 2 14 ? 3.007   -5.846  -0.382  1.00 0.00 ? 38  PHE B HD2  9  
ATOM 7494  H HE1  . PHE B 2 14 ? 0.796   -1.847  1.453   1.00 0.00 ? 38  PHE B HE1  9  
ATOM 7495  H HE2  . PHE B 2 14 ? 3.164   -5.353  2.029   1.00 0.00 ? 38  PHE B HE2  9  
ATOM 7496  H HZ   . PHE B 2 14 ? 2.062   -3.343  2.949   1.00 0.00 ? 38  PHE B HZ   9  
ATOM 7497  N N    . VAL B 2 15 ? 4.551   -3.128  -3.364  1.00 0.00 ? 39  VAL B N    9  
ATOM 7498  C CA   . VAL B 2 15 ? 5.903   -2.684  -3.125  1.00 0.00 ? 39  VAL B CA   9  
ATOM 7499  C C    . VAL B 2 15 ? 6.088   -1.293  -3.723  1.00 0.00 ? 39  VAL B C    9  
ATOM 7500  O O    . VAL B 2 15 ? 6.281   -0.330  -2.987  1.00 0.00 ? 39  VAL B O    9  
ATOM 7501  C CB   . VAL B 2 15 ? 6.926   -3.695  -3.706  1.00 0.00 ? 39  VAL B CB   9  
ATOM 7502  C CG1  . VAL B 2 15 ? 8.124   -3.004  -4.333  1.00 0.00 ? 39  VAL B CG1  9  
ATOM 7503  C CG2  . VAL B 2 15 ? 7.384   -4.663  -2.629  1.00 0.00 ? 39  VAL B CG2  9  
ATOM 7504  H H    . VAL B 2 15 ? 4.388   -3.812  -4.043  1.00 0.00 ? 39  VAL B H    9  
ATOM 7505  H HA   . VAL B 2 15 ? 6.046   -2.620  -2.057  1.00 0.00 ? 39  VAL B HA   9  
ATOM 7506  H HB   . VAL B 2 15 ? 6.432   -4.268  -4.476  1.00 0.00 ? 39  VAL B HB   9  
ATOM 7507  H HG11 . VAL B 2 15 ? 8.045   -3.050  -5.409  1.00 0.00 ? 39  VAL B HG11 9  
ATOM 7508  H HG12 . VAL B 2 15 ? 9.025   -3.502  -4.015  1.00 0.00 ? 39  VAL B HG12 9  
ATOM 7509  H HG13 . VAL B 2 15 ? 8.157   -1.974  -4.018  1.00 0.00 ? 39  VAL B HG13 9  
ATOM 7510  H HG21 . VAL B 2 15 ? 6.673   -4.661  -1.816  1.00 0.00 ? 39  VAL B HG21 9  
ATOM 7511  H HG22 . VAL B 2 15 ? 8.353   -4.356  -2.265  1.00 0.00 ? 39  VAL B HG22 9  
ATOM 7512  H HG23 . VAL B 2 15 ? 7.454   -5.658  -3.043  1.00 0.00 ? 39  VAL B HG23 9  
ATOM 7513  N N    . ARG B 2 16 ? 6.009   -1.193  -5.055  1.00 0.00 ? 40  ARG B N    9  
ATOM 7514  C CA   . ARG B 2 16 ? 6.149   0.083   -5.734  1.00 0.00 ? 40  ARG B CA   9  
ATOM 7515  C C    . ARG B 2 16 ? 5.324   1.150   -5.050  1.00 0.00 ? 40  ARG B C    9  
ATOM 7516  O O    . ARG B 2 16 ? 5.879   2.151   -4.613  1.00 0.00 ? 40  ARG B O    9  
ATOM 7517  C CB   . ARG B 2 16 ? 5.735   -0.040  -7.198  1.00 0.00 ? 40  ARG B CB   9  
ATOM 7518  C CG   . ARG B 2 16 ? 6.620   -0.976  -7.999  1.00 0.00 ? 40  ARG B CG   9  
ATOM 7519  C CD   . ARG B 2 16 ? 5.927   -2.288  -8.293  1.00 0.00 ? 40  ARG B CD   9  
ATOM 7520  N NE   . ARG B 2 16 ? 6.465   -2.934  -9.488  1.00 0.00 ? 40  ARG B NE   9  
ATOM 7521  C CZ   . ARG B 2 16 ? 5.711   -3.513  -10.417 1.00 0.00 ? 40  ARG B CZ   9  
ATOM 7522  N NH1  . ARG B 2 16 ? 4.390   -3.525  -10.293 1.00 0.00 ? 40  ARG B NH1  9  
ATOM 7523  N NH2  . ARG B 2 16 ? 6.277   -4.079  -11.474 1.00 0.00 ? 40  ARG B NH2  9  
ATOM 7524  H H    . ARG B 2 16 ? 5.869   -1.998  -5.592  1.00 0.00 ? 40  ARG B H    9  
ATOM 7525  H HA   . ARG B 2 16 ? 7.191   0.377   -5.685  1.00 0.00 ? 40  ARG B HA   9  
ATOM 7526  H HB2  . ARG B 2 16 ? 4.722   -0.409  -7.243  1.00 0.00 ? 40  ARG B HB2  9  
ATOM 7527  H HB3  . ARG B 2 16 ? 5.775   0.938   -7.655  1.00 0.00 ? 40  ARG B HB3  9  
ATOM 7528  H HG2  . ARG B 2 16 ? 6.873   -0.508  -8.925  1.00 0.00 ? 40  ARG B HG2  9  
ATOM 7529  H HG3  . ARG B 2 16 ? 7.521   -1.174  -7.436  1.00 0.00 ? 40  ARG B HG3  9  
ATOM 7530  H HD2  . ARG B 2 16 ? 6.068   -2.939  -7.450  1.00 0.00 ? 40  ARG B HD2  9  
ATOM 7531  H HD3  . ARG B 2 16 ? 4.874   -2.103  -8.436  1.00 0.00 ? 40  ARG B HD3  9  
ATOM 7532  H HE   . ARG B 2 16 ? 7.438   -2.938  -9.601  1.00 0.00 ? 40  ARG B HE   9  
ATOM 7533  H HH11 . ARG B 2 16 ? 3.959   -3.098  -9.499  1.00 0.00 ? 40  ARG B HH11 9  
ATOM 7534  H HH12 . ARG B 2 16 ? 3.827   -3.961  -10.995 1.00 0.00 ? 40  ARG B HH12 9  
ATOM 7535  H HH21 . ARG B 2 16 ? 7.273   -4.071  -11.572 1.00 0.00 ? 40  ARG B HH21 9  
ATOM 7536  H HH22 . ARG B 2 16 ? 5.710   -4.513  -12.172 1.00 0.00 ? 40  ARG B HH22 9  
ATOM 7537  N N    . ALA B 2 17 ? 4.007   0.950   -4.929  1.00 0.00 ? 41  ALA B N    9  
ATOM 7538  C CA   . ALA B 2 17 ? 3.189   1.945   -4.275  1.00 0.00 ? 41  ALA B CA   9  
ATOM 7539  C C    . ALA B 2 17 ? 3.796   2.271   -2.920  1.00 0.00 ? 41  ALA B C    9  
ATOM 7540  O O    . ALA B 2 17 ? 4.069   3.419   -2.645  1.00 0.00 ? 41  ALA B O    9  
ATOM 7541  C CB   . ALA B 2 17 ? 1.739   1.478   -4.151  1.00 0.00 ? 41  ALA B CB   9  
ATOM 7542  H H    . ALA B 2 17 ? 3.590   0.123   -5.262  1.00 0.00 ? 41  ALA B H    9  
ATOM 7543  H HA   . ALA B 2 17 ? 3.209   2.852   -4.890  1.00 0.00 ? 41  ALA B HA   9  
ATOM 7544  H HB1  . ALA B 2 17 ? 1.124   2.306   -3.830  1.00 0.00 ? 41  ALA B HB1  9  
ATOM 7545  H HB2  . ALA B 2 17 ? 1.665   0.676   -3.424  1.00 0.00 ? 41  ALA B HB2  9  
ATOM 7546  H HB3  . ALA B 2 17 ? 1.392   1.124   -5.109  1.00 0.00 ? 41  ALA B HB3  9  
ATOM 7547  N N    . LEU B 2 18 ? 4.074   1.249   -2.106  1.00 0.00 ? 42  LEU B N    9  
ATOM 7548  C CA   . LEU B 2 18 ? 4.660   1.471   -0.781  1.00 0.00 ? 42  LEU B CA   9  
ATOM 7549  C C    . LEU B 2 18 ? 5.757   2.530   -0.853  1.00 0.00 ? 42  LEU B C    9  
ATOM 7550  O O    . LEU B 2 18 ? 5.908   3.356   0.047   1.00 0.00 ? 42  LEU B O    9  
ATOM 7551  C CB   . LEU B 2 18 ? 5.242   0.163   -0.241  1.00 0.00 ? 42  LEU B CB   9  
ATOM 7552  C CG   . LEU B 2 18 ? 4.944   -0.139  1.227   1.00 0.00 ? 42  LEU B CG   9  
ATOM 7553  C CD1  . LEU B 2 18 ? 5.635   -1.424  1.654   1.00 0.00 ? 42  LEU B CD1  9  
ATOM 7554  C CD2  . LEU B 2 18 ? 5.383   1.020   2.096   1.00 0.00 ? 42  LEU B CD2  9  
ATOM 7555  H H    . LEU B 2 18 ? 3.894   0.329   -2.400  1.00 0.00 ? 42  LEU B H    9  
ATOM 7556  H HA   . LEU B 2 18 ? 3.874   1.816   -0.119  1.00 0.00 ? 42  LEU B HA   9  
ATOM 7557  H HB2  . LEU B 2 18 ? 4.860   -0.647  -0.836  1.00 0.00 ? 42  LEU B HB2  9  
ATOM 7558  H HB3  . LEU B 2 18 ? 6.313   0.197   -0.366  1.00 0.00 ? 42  LEU B HB3  9  
ATOM 7559  H HG   . LEU B 2 18 ? 3.880   -0.273  1.352   1.00 0.00 ? 42  LEU B HG   9  
ATOM 7560  H HD11 . LEU B 2 18 ? 5.031   -2.271  1.368   1.00 0.00 ? 42  LEU B HD11 9  
ATOM 7561  H HD12 . LEU B 2 18 ? 5.770   -1.421  2.725   1.00 0.00 ? 42  LEU B HD12 9  
ATOM 7562  H HD13 . LEU B 2 18 ? 6.600   -1.491  1.173   1.00 0.00 ? 42  LEU B HD13 9  
ATOM 7563  H HD21 . LEU B 2 18 ? 4.533   1.651   2.314   1.00 0.00 ? 42  LEU B HD21 9  
ATOM 7564  H HD22 . LEU B 2 18 ? 6.126   1.590   1.565   1.00 0.00 ? 42  LEU B HD22 9  
ATOM 7565  H HD23 . LEU B 2 18 ? 5.802   0.646   3.019   1.00 0.00 ? 42  LEU B HD23 9  
ATOM 7566  N N    . VAL B 2 19 ? 6.512   2.484   -1.941  1.00 0.00 ? 43  VAL B N    9  
ATOM 7567  C CA   . VAL B 2 19 ? 7.596   3.432   -2.187  1.00 0.00 ? 43  VAL B CA   9  
ATOM 7568  C C    . VAL B 2 19 ? 7.031   4.760   -2.656  1.00 0.00 ? 43  VAL B C    9  
ATOM 7569  O O    . VAL B 2 19 ? 7.180   5.785   -1.989  1.00 0.00 ? 43  VAL B O    9  
ATOM 7570  C CB   . VAL B 2 19 ? 8.575   2.900   -3.255  1.00 0.00 ? 43  VAL B CB   9  
ATOM 7571  C CG1  . VAL B 2 19 ? 9.991   3.330   -2.949  1.00 0.00 ? 43  VAL B CG1  9  
ATOM 7572  C CG2  . VAL B 2 19 ? 8.522   1.401   -3.312  1.00 0.00 ? 43  VAL B CG2  9  
ATOM 7573  H H    . VAL B 2 19 ? 6.339   1.782   -2.595  1.00 0.00 ? 43  VAL B H    9  
ATOM 7574  H HA   . VAL B 2 19 ? 8.127   3.581   -1.261  1.00 0.00 ? 43  VAL B HA   9  
ATOM 7575  H HB   . VAL B 2 19 ? 8.289   3.281   -4.225  1.00 0.00 ? 43  VAL B HB   9  
ATOM 7576  H HG11 . VAL B 2 19 ? 10.565  3.363   -3.863  1.00 0.00 ? 43  VAL B HG11 9  
ATOM 7577  H HG12 . VAL B 2 19 ? 10.430  2.606   -2.272  1.00 0.00 ? 43  VAL B HG12 9  
ATOM 7578  H HG13 . VAL B 2 19 ? 9.984   4.306   -2.486  1.00 0.00 ? 43  VAL B HG13 9  
ATOM 7579  H HG21 . VAL B 2 19 ? 7.563   1.085   -3.688  1.00 0.00 ? 43  VAL B HG21 9  
ATOM 7580  H HG22 . VAL B 2 19 ? 8.671   1.014   -2.314  1.00 0.00 ? 43  VAL B HG22 9  
ATOM 7581  H HG23 . VAL B 2 19 ? 9.303   1.035   -3.961  1.00 0.00 ? 43  VAL B HG23 9  
ATOM 7582  N N    . ARG B 2 20 ? 6.408   4.720   -3.831  1.00 0.00 ? 44  ARG B N    9  
ATOM 7583  C CA   . ARG B 2 20 ? 5.751   5.882   -4.424  1.00 0.00 ? 44  ARG B CA   9  
ATOM 7584  C C    . ARG B 2 20 ? 5.148   6.748   -3.327  1.00 0.00 ? 44  ARG B C    9  
ATOM 7585  O O    . ARG B 2 20 ? 5.204   7.978   -3.350  1.00 0.00 ? 44  ARG B O    9  
ATOM 7586  C CB   . ARG B 2 20 ? 4.625   5.385   -5.336  1.00 0.00 ? 44  ARG B CB   9  
ATOM 7587  C CG   . ARG B 2 20 ? 5.057   4.310   -6.314  1.00 0.00 ? 44  ARG B CG   9  
ATOM 7588  C CD   . ARG B 2 20 ? 4.513   4.578   -7.701  1.00 0.00 ? 44  ARG B CD   9  
ATOM 7589  N NE   . ARG B 2 20 ? 4.474   3.369   -8.519  1.00 0.00 ? 44  ARG B NE   9  
ATOM 7590  C CZ   . ARG B 2 20 ? 4.686   3.359   -9.831  1.00 0.00 ? 44  ARG B CZ   9  
ATOM 7591  N NH1  . ARG B 2 20 ? 4.962   4.489   -10.468 1.00 0.00 ? 44  ARG B NH1  9  
ATOM 7592  N NH2  . ARG B 2 20 ? 4.623   2.219   -10.508 1.00 0.00 ? 44  ARG B NH2  9  
ATOM 7593  H H    . ARG B 2 20 ? 6.401   3.874   -4.324  1.00 0.00 ? 44  ARG B H    9  
ATOM 7594  H HA   . ARG B 2 20 ? 6.468   6.448   -4.998  1.00 0.00 ? 44  ARG B HA   9  
ATOM 7595  H HB2  . ARG B 2 20 ? 3.842   4.972   -4.717  1.00 0.00 ? 44  ARG B HB2  9  
ATOM 7596  H HB3  . ARG B 2 20 ? 4.223   6.205   -5.894  1.00 0.00 ? 44  ARG B HB3  9  
ATOM 7597  H HG2  . ARG B 2 20 ? 6.135   4.287   -6.358  1.00 0.00 ? 44  ARG B HG2  9  
ATOM 7598  H HG3  . ARG B 2 20 ? 4.686   3.358   -5.970  1.00 0.00 ? 44  ARG B HG3  9  
ATOM 7599  H HD2  . ARG B 2 20 ? 3.515   4.976   -7.610  1.00 0.00 ? 44  ARG B HD2  9  
ATOM 7600  H HD3  . ARG B 2 20 ? 5.147   5.304   -8.180  1.00 0.00 ? 44  ARG B HD3  9  
ATOM 7601  H HE   . ARG B 2 20 ? 4.274   2.521   -8.067  1.00 0.00 ? 44  ARG B HE   9  
ATOM 7602  H HH11 . ARG B 2 20 ? 5.010   5.350   -9.963  1.00 0.00 ? 44  ARG B HH11 9  
ATOM 7603  H HH12 . ARG B 2 20 ? 5.121   4.480   -11.455 1.00 0.00 ? 44  ARG B HH12 9  
ATOM 7604  H HH21 . ARG B 2 20 ? 4.417   1.365   -10.030 1.00 0.00 ? 44  ARG B HH21 9  
ATOM 7605  H HH22 . ARG B 2 20 ? 4.783   2.216   -11.495 1.00 0.00 ? 44  ARG B HH22 9  
ATOM 7606  N N    . VAL B 2 21 ? 4.577   6.043   -2.376  1.00 0.00 ? 45  VAL B N    9  
ATOM 7607  C CA   . VAL B 2 21 ? 3.913   6.599   -1.220  1.00 0.00 ? 45  VAL B CA   9  
ATOM 7608  C C    . VAL B 2 21 ? 4.888   7.147   -0.187  1.00 0.00 ? 45  VAL B C    9  
ATOM 7609  O O    . VAL B 2 21 ? 4.905   8.341   0.111   1.00 0.00 ? 45  VAL B O    9  
ATOM 7610  C CB   . VAL B 2 21 ? 3.099   5.490   -0.537  1.00 0.00 ? 45  VAL B CB   9  
ATOM 7611  C CG1  . VAL B 2 21 ? 2.358   6.021   0.663   1.00 0.00 ? 45  VAL B CG1  9  
ATOM 7612  C CG2  . VAL B 2 21 ? 2.155   4.820   -1.514  1.00 0.00 ? 45  VAL B CG2  9  
ATOM 7613  H H    . VAL B 2 21 ? 4.613   5.073   -2.451  1.00 0.00 ? 45  VAL B H    9  
ATOM 7614  H HA   . VAL B 2 21 ? 3.238   7.376   -1.540  1.00 0.00 ? 45  VAL B HA   9  
ATOM 7615  H HB   . VAL B 2 21 ? 3.794   4.742   -0.186  1.00 0.00 ? 45  VAL B HB   9  
ATOM 7616  H HG11 . VAL B 2 21 ? 2.084   7.051   0.494   1.00 0.00 ? 45  VAL B HG11 9  
ATOM 7617  H HG12 . VAL B 2 21 ? 2.998   5.954   1.527   1.00 0.00 ? 45  VAL B HG12 9  
ATOM 7618  H HG13 . VAL B 2 21 ? 1.470   5.431   0.827   1.00 0.00 ? 45  VAL B HG13 9  
ATOM 7619  H HG21 . VAL B 2 21 ? 1.137   5.000   -1.218  1.00 0.00 ? 45  VAL B HG21 9  
ATOM 7620  H HG22 . VAL B 2 21 ? 2.348   3.759   -1.514  1.00 0.00 ? 45  VAL B HG22 9  
ATOM 7621  H HG23 . VAL B 2 21 ? 2.321   5.216   -2.506  1.00 0.00 ? 45  VAL B HG23 9  
ATOM 7622  N N    . CYS B 2 22 ? 5.697   6.243   0.352   1.00 0.00 ? 46  CYS B N    9  
ATOM 7623  C CA   . CYS B 2 22 ? 6.638   6.573   1.412   1.00 0.00 ? 46  CYS B CA   9  
ATOM 7624  C C    . CYS B 2 22 ? 8.065   6.254   1.009   1.00 0.00 ? 46  CYS B C    9  
ATOM 7625  O O    . CYS B 2 22 ? 8.934   7.125   0.981   1.00 0.00 ? 46  CYS B O    9  
ATOM 7626  C CB   . CYS B 2 22 ? 6.270   5.738   2.634   1.00 0.00 ? 46  CYS B CB   9  
ATOM 7627  S SG   . CYS B 2 22 ? 6.981   6.302   4.211   1.00 0.00 ? 46  CYS B SG   9  
ATOM 7628  H H    . CYS B 2 22 ? 5.673   5.322   0.014   1.00 0.00 ? 46  CYS B H    9  
ATOM 7629  H HA   . CYS B 2 22 ? 6.549   7.621   1.649   1.00 0.00 ? 46  CYS B HA   9  
ATOM 7630  H HB2  . CYS B 2 22 ? 5.201   5.732   2.739   1.00 0.00 ? 46  CYS B HB2  9  
ATOM 7631  H HB3  . CYS B 2 22 ? 6.609   4.725   2.471   1.00 0.00 ? 46  CYS B HB3  9  
ATOM 7632  N N    . GLY B 2 23 ? 8.284   4.989   0.698   1.00 0.00 ? 47  GLY B N    9  
ATOM 7633  C CA   . GLY B 2 23 ? 9.611   4.533   0.323   1.00 0.00 ? 47  GLY B CA   9  
ATOM 7634  C C    . GLY B 2 23 ? 9.847   3.092   0.719   1.00 0.00 ? 47  GLY B C    9  
ATOM 7635  O O    . GLY B 2 23 ? 9.377   2.173   0.049   1.00 0.00 ? 47  GLY B O    9  
ATOM 7636  H H    . GLY B 2 23 ? 7.525   4.357   0.706   1.00 0.00 ? 47  GLY B H    9  
ATOM 7637  H HA2  . GLY B 2 23 ? 9.723   4.627   -0.746  1.00 0.00 ? 47  GLY B HA2  9  
ATOM 7638  H HA3  . GLY B 2 23 ? 10.350  5.154   0.809   1.00 0.00 ? 47  GLY B HA3  9  
ATOM 7639  N N    . GLY B 2 24 ? 10.572  2.892   1.817   1.00 0.00 ? 48  GLY B N    9  
ATOM 7640  C CA   . GLY B 2 24 ? 10.855  1.552   2.281   1.00 0.00 ? 48  GLY B CA   9  
ATOM 7641  C C    . GLY B 2 24 ? 12.283  1.398   2.775   1.00 0.00 ? 48  GLY B C    9  
ATOM 7642  O O    . GLY B 2 24 ? 12.775  2.244   3.522   1.00 0.00 ? 48  GLY B O    9  
ATOM 7643  H H    . GLY B 2 24 ? 10.917  3.661   2.310   1.00 0.00 ? 48  GLY B H    9  
ATOM 7644  H HA2  . GLY B 2 24 ? 10.179  1.308   3.083   1.00 0.00 ? 48  GLY B HA2  9  
ATOM 7645  H HA3  . GLY B 2 24 ? 10.690  0.863   1.467   1.00 0.00 ? 48  GLY B HA3  9  
ATOM 7646  N N    . PRO B 2 25 ? 12.976  0.322   2.368   1.00 0.00 ? 49  PRO B N    9  
ATOM 7647  C CA   . PRO B 2 25 ? 14.356  0.064   2.777   1.00 0.00 ? 49  PRO B CA   9  
ATOM 7648  C C    . PRO B 2 25 ? 15.355  1.045   2.170   1.00 0.00 ? 49  PRO B C    9  
ATOM 7649  O O    . PRO B 2 25 ? 15.915  1.883   2.876   1.00 0.00 ? 49  PRO B O    9  
ATOM 7650  C CB   . PRO B 2 25 ? 14.608  -1.361  2.274   1.00 0.00 ? 49  PRO B CB   9  
ATOM 7651  C CG   . PRO B 2 25 ? 13.682  -1.527  1.128   1.00 0.00 ? 49  PRO B CG   9  
ATOM 7652  C CD   . PRO B 2 25 ? 12.461  -0.733  1.480   1.00 0.00 ? 49  PRO B CD   9  
ATOM 7653  H HA   . PRO B 2 25 ? 14.456  0.084   3.845   1.00 0.00 ? 49  PRO B HA   9  
ATOM 7654  H HB2  . PRO B 2 25 ? 15.639  -1.468  1.975   1.00 0.00 ? 49  PRO B HB2  9  
ATOM 7655  H HB3  . PRO B 2 25 ? 14.377  -2.059  3.056   1.00 0.00 ? 49  PRO B HB3  9  
ATOM 7656  H HG2  . PRO B 2 25 ? 14.138  -1.141  0.228   1.00 0.00 ? 49  PRO B HG2  9  
ATOM 7657  H HG3  . PRO B 2 25 ? 13.430  -2.570  1.006   1.00 0.00 ? 49  PRO B HG3  9  
ATOM 7658  H HD2  . PRO B 2 25 ? 12.041  -0.306  0.605   1.00 0.00 ? 49  PRO B HD2  9  
ATOM 7659  H HD3  . PRO B 2 25 ? 11.729  -1.341  1.982   1.00 0.00 ? 49  PRO B HD3  9  
ATOM 7660  N N    . ARG B 2 26 ? 15.563  0.946   0.862   1.00 0.00 ? 50  ARG B N    9  
ATOM 7661  C CA   . ARG B 2 26 ? 16.508  1.809   0.159   1.00 0.00 ? 50  ARG B CA   9  
ATOM 7662  C C    . ARG B 2 26 ? 16.158  1.924   -1.317  1.00 0.00 ? 50  ARG B C    9  
ATOM 7663  O O    . ARG B 2 26 ? 16.162  3.015   -1.888  1.00 0.00 ? 50  ARG B O    9  
ATOM 7664  C CB   . ARG B 2 26 ? 17.901  1.227   0.258   1.00 0.00 ? 50  ARG B CB   9  
ATOM 7665  C CG   . ARG B 2 26 ? 18.514  1.288   1.646   1.00 0.00 ? 50  ARG B CG   9  
ATOM 7666  C CD   . ARG B 2 26 ? 18.445  -0.061  2.345   1.00 0.00 ? 50  ARG B CD   9  
ATOM 7667  N NE   . ARG B 2 26 ? 19.132  -1.104  1.590   1.00 0.00 ? 50  ARG B NE   9  
ATOM 7668  C CZ   . ARG B 2 26 ? 19.111  -2.391  1.923   1.00 0.00 ? 50  ARG B CZ   9  
ATOM 7669  N NH1  . ARG B 2 26 ? 18.437  -2.793  2.992   1.00 0.00 ? 50  ARG B NH1  9  
ATOM 7670  N NH2  . ARG B 2 26 ? 19.762  -3.279  1.185   1.00 0.00 ? 50  ARG B NH2  9  
ATOM 7671  H H    . ARG B 2 26 ? 15.080  0.268   0.357   1.00 0.00 ? 50  ARG B H    9  
ATOM 7672  H HA   . ARG B 2 26 ? 16.495  2.784   0.615   1.00 0.00 ? 50  ARG B HA   9  
ATOM 7673  H HB2  . ARG B 2 26 ? 17.841  0.199   -0.044  1.00 0.00 ? 50  ARG B HB2  9  
ATOM 7674  H HB3  . ARG B 2 26 ? 18.544  1.755   -0.424  1.00 0.00 ? 50  ARG B HB3  9  
ATOM 7675  H HG2  . ARG B 2 26 ? 19.547  1.584   1.557   1.00 0.00 ? 50  ARG B HG2  9  
ATOM 7676  H HG3  . ARG B 2 26 ? 17.979  2.017   2.234   1.00 0.00 ? 50  ARG B HG3  9  
ATOM 7677  H HD2  . ARG B 2 26 ? 18.905  0.028   3.318   1.00 0.00 ? 50  ARG B HD2  9  
ATOM 7678  H HD3  . ARG B 2 26 ? 17.408  -0.338  2.462   1.00 0.00 ? 50  ARG B HD3  9  
ATOM 7679  H HE   . ARG B 2 26 ? 19.636  -0.832  0.794   1.00 0.00 ? 50  ARG B HE   9  
ATOM 7680  H HH11 . ARG B 2 26 ? 17.942  -2.127  3.550   1.00 0.00 ? 50  ARG B HH11 9  
ATOM 7681  H HH12 . ARG B 2 26 ? 18.424  -3.762  3.239   1.00 0.00 ? 50  ARG B HH12 9  
ATOM 7682  H HH21 . ARG B 2 26 ? 20.272  -2.981  0.377   1.00 0.00 ? 50  ARG B HH21 9  
ATOM 7683  H HH22 . ARG B 2 26 ? 19.746  -4.246  1.436   1.00 0.00 ? 50  ARG B HH22 9  
ATOM 7684  N N    . TRP B 2 27 ? 15.863  0.775   -1.925  1.00 0.00 ? 51  TRP B N    9  
ATOM 7685  C CA   . TRP B 2 27 ? 15.508  0.700   -3.329  1.00 0.00 ? 51  TRP B CA   9  
ATOM 7686  C C    . TRP B 2 27 ? 16.646  1.143   -4.246  1.00 0.00 ? 51  TRP B C    9  
ATOM 7687  O O    . TRP B 2 27 ? 16.516  1.100   -5.470  1.00 0.00 ? 51  TRP B O    9  
ATOM 7688  C CB   . TRP B 2 27 ? 14.277  1.535   -3.575  1.00 0.00 ? 51  TRP B CB   9  
ATOM 7689  C CG   . TRP B 2 27 ? 13.239  1.302   -2.543  1.00 0.00 ? 51  TRP B CG   9  
ATOM 7690  C CD1  . TRP B 2 27 ? 13.134  1.880   -1.321  1.00 0.00 ? 51  TRP B CD1  9  
ATOM 7691  C CD2  . TRP B 2 27 ? 12.179  0.384   -2.647  1.00 0.00 ? 51  TRP B CD2  9  
ATOM 7692  N NE1  . TRP B 2 27 ? 12.037  1.390   -0.664  1.00 0.00 ? 51  TRP B NE1  9  
ATOM 7693  C CE2  . TRP B 2 27 ? 11.433  0.461   -1.468  1.00 0.00 ? 51  TRP B CE2  9  
ATOM 7694  C CE3  . TRP B 2 27 ? 11.792  -0.485  -3.640  1.00 0.00 ? 51  TRP B CE3  9  
ATOM 7695  C CZ2  . TRP B 2 27 ? 10.306  -0.320  -1.258  1.00 0.00 ? 51  TRP B CZ2  9  
ATOM 7696  C CZ3  . TRP B 2 27 ? 10.676  -1.256  -3.438  1.00 0.00 ? 51  TRP B CZ3  9  
ATOM 7697  C CH2  . TRP B 2 27 ? 9.942   -1.164  -2.245  1.00 0.00 ? 51  TRP B CH2  9  
ATOM 7698  H H    . TRP B 2 27 ? 15.849  -0.044  -1.402  1.00 0.00 ? 51  TRP B H    9  
ATOM 7699  H HA   . TRP B 2 27 ? 15.258  -0.330  -3.547  1.00 0.00 ? 51  TRP B HA   9  
ATOM 7700  H HB2  . TRP B 2 27 ? 14.531  2.576   -3.578  1.00 0.00 ? 51  TRP B HB2  9  
ATOM 7701  H HB3  . TRP B 2 27 ? 13.865  1.262   -4.524  1.00 0.00 ? 51  TRP B HB3  9  
ATOM 7702  H HD1  . TRP B 2 27 ? 13.823  2.613   -0.940  1.00 0.00 ? 51  TRP B HD1  9  
ATOM 7703  H HE1  . TRP B 2 27 ? 11.740  1.658   0.227   1.00 0.00 ? 51  TRP B HE1  9  
ATOM 7704  H HE3  . TRP B 2 27 ? 12.354  -0.556  -4.557  1.00 0.00 ? 51  TRP B HE3  9  
ATOM 7705  H HZ2  . TRP B 2 27 ? 9.727   -0.274  -0.357  1.00 0.00 ? 51  TRP B HZ2  9  
ATOM 7706  H HZ3  . TRP B 2 27 ? 10.367  -1.943  -4.200  1.00 0.00 ? 51  TRP B HZ3  9  
ATOM 7707  H HH2  . TRP B 2 27 ? 9.061   -1.762  -2.120  1.00 0.00 ? 51  TRP B HH2  9  
ATOM 7708  N N    . SER B 2 28 ? 17.762  1.561   -3.649  1.00 0.00 ? 52  SER B N    9  
ATOM 7709  C CA   . SER B 2 28 ? 18.923  2.019   -4.407  1.00 0.00 ? 52  SER B CA   9  
ATOM 7710  C C    . SER B 2 28 ? 18.567  3.191   -5.318  1.00 0.00 ? 52  SER B C    9  
ATOM 7711  O O    . SER B 2 28 ? 17.396  3.540   -5.471  1.00 0.00 ? 52  SER B O    9  
ATOM 7712  C CB   . SER B 2 28 ? 19.496  0.869   -5.231  1.00 0.00 ? 52  SER B CB   9  
ATOM 7713  O OG   . SER B 2 28 ? 20.025  -0.145  -4.394  1.00 0.00 ? 52  SER B OG   9  
ATOM 7714  H H    . SER B 2 28 ? 17.812  1.551   -2.674  1.00 0.00 ? 52  SER B H    9  
ATOM 7715  H HA   . SER B 2 28 ? 19.669  2.346   -3.699  1.00 0.00 ? 52  SER B HA   9  
ATOM 7716  H HB2  . SER B 2 28 ? 18.713  0.445   -5.839  1.00 0.00 ? 52  SER B HB2  9  
ATOM 7717  H HB3  . SER B 2 28 ? 20.284  1.243   -5.866  1.00 0.00 ? 52  SER B HB3  9  
ATOM 7718  H HG   . SER B 2 28 ? 20.349  0.247   -3.579  1.00 0.00 ? 52  SER B HG   9  
ATOM 7719  N N    . THR B 2 29 ? 19.588  3.790   -5.927  1.00 0.00 ? 53  THR B N    9  
ATOM 7720  C CA   . THR B 2 29 ? 19.395  4.928   -6.824  1.00 0.00 ? 53  THR B CA   9  
ATOM 7721  C C    . THR B 2 29 ? 20.548  5.041   -7.817  1.00 0.00 ? 53  THR B C    9  
ATOM 7722  O O    . THR B 2 29 ? 20.333  5.223   -9.015  1.00 0.00 ? 53  THR B O    9  
ATOM 7723  C CB   . THR B 2 29 ? 19.288  6.258   -6.048  1.00 0.00 ? 53  THR B CB   9  
ATOM 7724  O OG1  . THR B 2 29 ? 20.358  6.361   -5.101  1.00 0.00 ? 53  THR B OG1  9  
ATOM 7725  C CG2  . THR B 2 29 ? 17.953  6.374   -5.326  1.00 0.00 ? 53  THR B CG2  9  
ATOM 7726  H H    . THR B 2 29 ? 20.496  3.456   -5.771  1.00 0.00 ? 53  THR B H    9  
ATOM 7727  H HA   . THR B 2 29 ? 18.475  4.774   -7.368  1.00 0.00 ? 53  THR B HA   9  
ATOM 7728  H HB   . THR B 2 29 ? 19.367  7.071   -6.754  1.00 0.00 ? 53  THR B HB   9  
ATOM 7729  H HG1  . THR B 2 29 ? 21.198  6.270   -5.556  1.00 0.00 ? 53  THR B HG1  9  
ATOM 7730  H HG21 . THR B 2 29 ? 17.840  5.546   -4.642  1.00 0.00 ? 53  THR B HG21 9  
ATOM 7731  H HG22 . THR B 2 29 ? 17.150  6.357   -6.050  1.00 0.00 ? 53  THR B HG22 9  
ATOM 7732  H HG23 . THR B 2 29 ? 17.922  7.303   -4.777  1.00 0.00 ? 53  THR B HG23 9  
ATOM 7733  N N    . GLU B 2 30 ? 21.772  4.935   -7.309  1.00 0.00 ? 54  GLU B N    9  
ATOM 7734  C CA   . GLU B 2 30 ? 22.962  5.027   -8.146  1.00 0.00 ? 54  GLU B CA   9  
ATOM 7735  C C    . GLU B 2 30 ? 23.270  3.688   -8.813  1.00 0.00 ? 54  GLU B C    9  
ATOM 7736  O O    . GLU B 2 30 ? 24.419  3.404   -9.153  1.00 0.00 ? 54  GLU B O    9  
ATOM 7737  C CB   . GLU B 2 30 ? 24.161  5.484   -7.315  1.00 0.00 ? 54  GLU B CB   9  
ATOM 7738  C CG   . GLU B 2 30 ? 23.971  6.850   -6.674  1.00 0.00 ? 54  GLU B CG   9  
ATOM 7739  C CD   . GLU B 2 30 ? 25.180  7.287   -5.869  1.00 0.00 ? 54  GLU B CD   9  
ATOM 7740  O OE1  . GLU B 2 30 ? 25.266  6.918   -4.681  1.00 0.00 ? 54  GLU B OE1  9  
ATOM 7741  O OE2  . GLU B 2 30 ? 26.041  7.999   -6.429  1.00 0.00 ? 54  GLU B OE2  9  
ATOM 7742  H H    . GLU B 2 30 ? 21.879  4.794   -6.344  1.00 0.00 ? 54  GLU B H    9  
ATOM 7743  H HA   . GLU B 2 30 ? 22.770  5.760   -8.915  1.00 0.00 ? 54  GLU B HA   9  
ATOM 7744  H HB2  . GLU B 2 30 ? 24.334  4.763   -6.530  1.00 0.00 ? 54  GLU B HB2  9  
ATOM 7745  H HB3  . GLU B 2 30 ? 25.031  5.527   -7.951  1.00 0.00 ? 54  GLU B HB3  9  
ATOM 7746  H HG2  . GLU B 2 30 ? 23.792  7.577   -7.452  1.00 0.00 ? 54  GLU B HG2  9  
ATOM 7747  H HG3  . GLU B 2 30 ? 23.116  6.809   -6.017  1.00 0.00 ? 54  GLU B HG3  9  
ATOM 7748  N N    . ALA B 2 31 ? 22.241  2.868   -8.999  1.00 0.00 ? 55  ALA B N    9  
ATOM 7749  C CA   . ALA B 2 31 ? 22.407  1.562   -9.623  1.00 0.00 ? 55  ALA B CA   9  
ATOM 7750  C C    . ALA B 2 31 ? 22.570  1.693   -11.134 1.00 0.00 ? 55  ALA B C    9  
ATOM 7751  O O    . ALA B 2 31 ? 21.540  1.705   -11.841 1.00 0.00 ? 55  ALA B O    9  
ATOM 7752  C CB   . ALA B 2 31 ? 21.224  0.663   -9.291  1.00 0.00 ? 55  ALA B CB   9  
ATOM 7753  O OXT  . ALA B 2 31 ? 23.726  1.784   -11.597 1.00 0.00 ? 55  ALA B OXT  9  
ATOM 7754  H H    . ALA B 2 31 ? 21.347  3.150   -8.709  1.00 0.00 ? 55  ALA B H    9  
ATOM 7755  H HA   . ALA B 2 31 ? 23.298  1.109   -9.213  1.00 0.00 ? 55  ALA B HA   9  
ATOM 7756  H HB1  . ALA B 2 31 ? 21.418  -0.335  -9.656  1.00 0.00 ? 55  ALA B HB1  9  
ATOM 7757  H HB2  . ALA B 2 31 ? 20.334  1.052   -9.761  1.00 0.00 ? 55  ALA B HB2  9  
ATOM 7758  H HB3  . ALA B 2 31 ? 21.084  0.635   -8.220  1.00 0.00 ? 55  ALA B HB3  9  
ATOM 7759  N N    . ALA A 1 1  ? -0.648  -1.114  16.346  1.00 0.00 ? 106 ALA A N    10 
ATOM 7760  C CA   . ALA A 1 1  ? -0.824  -0.669  14.939  1.00 0.00 ? 106 ALA A CA   10 
ATOM 7761  C C    . ALA A 1 1  ? -0.595  -1.822  13.968  1.00 0.00 ? 106 ALA A C    10 
ATOM 7762  O O    . ALA A 1 1  ? -0.616  -1.635  12.751  1.00 0.00 ? 106 ALA A O    10 
ATOM 7763  C CB   . ALA A 1 1  ? 0.126   0.478   14.626  1.00 0.00 ? 106 ALA A CB   10 
ATOM 7764  H H1   . ALA A 1 1  ? -0.802  -0.315  16.994  1.00 0.00 ? 106 ALA A H1   10 
ATOM 7765  H H2   . ALA A 1 1  ? 0.314   -1.481  16.486  1.00 0.00 ? 106 ALA A H2   10 
ATOM 7766  H H3   . ALA A 1 1  ? -1.330  -1.866  16.571  1.00 0.00 ? 106 ALA A H3   10 
ATOM 7767  H HA   . ALA A 1 1  ? -1.835  -0.309  14.820  1.00 0.00 ? 106 ALA A HA   10 
ATOM 7768  H HB1  . ALA A 1 1  ? -0.047  1.288   15.320  1.00 0.00 ? 106 ALA A HB1  10 
ATOM 7769  H HB2  . ALA A 1 1  ? -0.049  0.824   13.618  1.00 0.00 ? 106 ALA A HB2  10 
ATOM 7770  H HB3  . ALA A 1 1  ? 1.145   0.135   14.717  1.00 0.00 ? 106 ALA A HB3  10 
ATOM 7771  N N    . ALA A 1 2  ? -0.377  -3.013  14.514  1.00 0.00 ? 107 ALA A N    10 
ATOM 7772  C CA   . ALA A 1 2  ? -0.139  -4.197  13.697  1.00 0.00 ? 107 ALA A CA   10 
ATOM 7773  C C    . ALA A 1 2  ? -1.438  -4.732  13.105  1.00 0.00 ? 107 ALA A C    10 
ATOM 7774  O O    . ALA A 1 2  ? -2.320  -5.192  13.831  1.00 0.00 ? 107 ALA A O    10 
ATOM 7775  C CB   . ALA A 1 2  ? 0.549   -5.274  14.521  1.00 0.00 ? 107 ALA A CB   10 
ATOM 7776  H H    . ALA A 1 2  ? -0.375  -3.098  15.491  1.00 0.00 ? 107 ALA A H    10 
ATOM 7777  H HA   . ALA A 1 2  ? 0.524   -3.916  12.891  1.00 0.00 ? 107 ALA A HA   10 
ATOM 7778  H HB1  . ALA A 1 2  ? 1.466   -4.880  14.933  1.00 0.00 ? 107 ALA A HB1  10 
ATOM 7779  H HB2  . ALA A 1 2  ? 0.771   -6.122  13.891  1.00 0.00 ? 107 ALA A HB2  10 
ATOM 7780  H HB3  . ALA A 1 2  ? -0.103  -5.583  15.325  1.00 0.00 ? 107 ALA A HB3  10 
ATOM 7781  N N    . ALA A 1 3  ? -1.548  -4.667  11.781  1.00 0.00 ? 108 ALA A N    10 
ATOM 7782  C CA   . ALA A 1 3  ? -2.735  -5.148  11.084  1.00 0.00 ? 108 ALA A CA   10 
ATOM 7783  C C    . ALA A 1 3  ? -2.470  -6.501  10.441  1.00 0.00 ? 108 ALA A C    10 
ATOM 7784  O O    . ALA A 1 3  ? -1.542  -7.213  10.827  1.00 0.00 ? 108 ALA A O    10 
ATOM 7785  C CB   . ALA A 1 3  ? -3.166  -4.150  10.018  1.00 0.00 ? 108 ALA A CB   10 
ATOM 7786  H H    . ALA A 1 3  ? -0.813  -4.283  11.259  1.00 0.00 ? 108 ALA A H    10 
ATOM 7787  H HA   . ALA A 1 3  ? -3.536  -5.246  11.802  1.00 0.00 ? 108 ALA A HA   10 
ATOM 7788  H HB1  . ALA A 1 3  ? -4.186  -3.846  10.200  1.00 0.00 ? 108 ALA A HB1  10 
ATOM 7789  H HB2  . ALA A 1 3  ? -3.097  -4.616  9.038   1.00 0.00 ? 108 ALA A HB2  10 
ATOM 7790  H HB3  . ALA A 1 3  ? -2.519  -3.286  10.051  1.00 0.00 ? 108 ALA A HB3  10 
ATOM 7791  N N    . THR A 1 4  ? -3.290  -6.846  9.458   1.00 0.00 ? 109 THR A N    10 
ATOM 7792  C CA   . THR A 1 4  ? -3.133  -8.100  8.742   1.00 0.00 ? 109 THR A CA   10 
ATOM 7793  C C    . THR A 1 4  ? -1.946  -7.989  7.787   1.00 0.00 ? 109 THR A C    10 
ATOM 7794  O O    . THR A 1 4  ? -1.041  -7.192  8.020   1.00 0.00 ? 109 THR A O    10 
ATOM 7795  C CB   . THR A 1 4  ? -4.416  -8.446  7.955   1.00 0.00 ? 109 THR A CB   10 
ATOM 7796  O OG1  . THR A 1 4  ? -4.331  -9.774  7.424   1.00 0.00 ? 109 THR A OG1  10 
ATOM 7797  C CG2  . THR A 1 4  ? -4.648  -7.453  6.823   1.00 0.00 ? 109 THR A CG2  10 
ATOM 7798  H H    . THR A 1 4  ? -4.021  -6.244  9.209   1.00 0.00 ? 109 THR A H    10 
ATOM 7799  H HA   . THR A 1 4  ? -2.942  -8.883  9.462   1.00 0.00 ? 109 THR A HA   10 
ATOM 7800  H HB   . THR A 1 4  ? -5.257  -8.393  8.633   1.00 0.00 ? 109 THR A HB   10 
ATOM 7801  H HG1  . THR A 1 4  ? -4.204  -9.731  6.474   1.00 0.00 ? 109 THR A HG1  10 
ATOM 7802  H HG21 . THR A 1 4  ? -4.609  -6.444  7.211   1.00 0.00 ? 109 THR A HG21 10 
ATOM 7803  H HG22 . THR A 1 4  ? -5.616  -7.631  6.380   1.00 0.00 ? 109 THR A HG22 10 
ATOM 7804  H HG23 . THR A 1 4  ? -3.880  -7.579  6.073   1.00 0.00 ? 109 THR A HG23 10 
ATOM 7805  N N    . ASN A 1 5  ? -1.940  -8.793  6.734   1.00 0.00 ? 110 ASN A N    10 
ATOM 7806  C CA   . ASN A 1 5  ? -0.866  -8.748  5.748   1.00 0.00 ? 110 ASN A CA   10 
ATOM 7807  C C    . ASN A 1 5  ? -1.155  -7.662  4.718   1.00 0.00 ? 110 ASN A C    10 
ATOM 7808  O O    . ASN A 1 5  ? -1.957  -7.875  3.815   1.00 0.00 ? 110 ASN A O    10 
ATOM 7809  C CB   . ASN A 1 5  ? -0.717  -10.102 5.047   1.00 0.00 ? 110 ASN A CB   10 
ATOM 7810  C CG   . ASN A 1 5  ? -0.329  -11.210 6.007   1.00 0.00 ? 110 ASN A CG   10 
ATOM 7811  O OD1  . ASN A 1 5  ? -0.704  -11.193 7.180   1.00 0.00 ? 110 ASN A OD1  10 
ATOM 7812  N ND2  . ASN A 1 5  ? 0.431   -12.180 5.511   1.00 0.00 ? 110 ASN A ND2  10 
ATOM 7813  H H    . ASN A 1 5  ? -2.675  -9.422  6.611   1.00 0.00 ? 110 ASN A H    10 
ATOM 7814  H HA   . ASN A 1 5  ? 0.054   -8.511  6.263   1.00 0.00 ? 110 ASN A HA   10 
ATOM 7815  H HB2  . ASN A 1 5  ? -1.657  -10.366 4.579   1.00 0.00 ? 110 ASN A HB2  10 
ATOM 7816  H HB3  . ASN A 1 5  ? 0.048   -10.024 4.290   1.00 0.00 ? 110 ASN A HB3  10 
ATOM 7817  H HD21 . ASN A 1 5  ? 0.693   -12.125 4.569   1.00 0.00 ? 110 ASN A HD21 10 
ATOM 7818  H HD22 . ASN A 1 5  ? 0.698   -12.909 6.109   1.00 0.00 ? 110 ASN A HD22 10 
ATOM 7819  N N    . PRO A 1 6  ? -0.507  -6.486  4.824   1.00 0.00 ? 111 PRO A N    10 
ATOM 7820  C CA   . PRO A 1 6  ? -0.739  -5.374  3.894   1.00 0.00 ? 111 PRO A CA   10 
ATOM 7821  C C    . PRO A 1 6  ? -0.359  -5.711  2.456   1.00 0.00 ? 111 PRO A C    10 
ATOM 7822  O O    . PRO A 1 6  ? -0.478  -4.875  1.565   1.00 0.00 ? 111 PRO A O    10 
ATOM 7823  C CB   . PRO A 1 6  ? 0.140   -4.253  4.450   1.00 0.00 ? 111 PRO A CB   10 
ATOM 7824  C CG   . PRO A 1 6  ? 1.196   -4.958  5.224   1.00 0.00 ? 111 PRO A CG   10 
ATOM 7825  C CD   . PRO A 1 6  ? 0.508   -6.141  5.836   1.00 0.00 ? 111 PRO A CD   10 
ATOM 7826  H HA   . PRO A 1 6  ? -1.770  -5.063  3.916   1.00 0.00 ? 111 PRO A HA   10 
ATOM 7827  H HB2  . PRO A 1 6  ? 0.553   -3.678  3.637   1.00 0.00 ? 111 PRO A HB2  10 
ATOM 7828  H HB3  . PRO A 1 6  ? -0.450  -3.611  5.086   1.00 0.00 ? 111 PRO A HB3  10 
ATOM 7829  H HG2  . PRO A 1 6  ? 1.985   -5.285  4.562   1.00 0.00 ? 111 PRO A HG2  10 
ATOM 7830  H HG3  . PRO A 1 6  ? 1.589   -4.310  5.992   1.00 0.00 ? 111 PRO A HG3  10 
ATOM 7831  H HD2  . PRO A 1 6  ? 1.204   -6.952  5.985   1.00 0.00 ? 111 PRO A HD2  10 
ATOM 7832  H HD3  . PRO A 1 6  ? 0.041   -5.861  6.769   1.00 0.00 ? 111 PRO A HD3  10 
ATOM 7833  N N    . ALA A 1 7  ? 0.101   -6.930  2.231   1.00 0.00 ? 112 ALA A N    10 
ATOM 7834  C CA   . ALA A 1 7  ? 0.464   -7.369  0.890   1.00 0.00 ? 112 ALA A CA   10 
ATOM 7835  C C    . ALA A 1 7  ? -0.724  -8.057  0.242   1.00 0.00 ? 112 ALA A C    10 
ATOM 7836  O O    . ALA A 1 7  ? -1.104  -7.753  -0.889  1.00 0.00 ? 112 ALA A O    10 
ATOM 7837  C CB   . ALA A 1 7  ? 1.661   -8.297  0.948   1.00 0.00 ? 112 ALA A CB   10 
ATOM 7838  H H    . ALA A 1 7  ? 0.202   -7.553  2.982   1.00 0.00 ? 112 ALA A H    10 
ATOM 7839  H HA   . ALA A 1 7  ? 0.730   -6.497  0.310   1.00 0.00 ? 112 ALA A HA   10 
ATOM 7840  H HB1  . ALA A 1 7  ? 1.350   -9.270  1.301   1.00 0.00 ? 112 ALA A HB1  10 
ATOM 7841  H HB2  . ALA A 1 7  ? 2.391   -7.886  1.626   1.00 0.00 ? 112 ALA A HB2  10 
ATOM 7842  H HB3  . ALA A 1 7  ? 2.095   -8.390  -0.038  1.00 0.00 ? 112 ALA A HB3  10 
ATOM 7843  N N    . ARG A 1 8  ? -1.303  -8.989  0.984   1.00 0.00 ? 113 ARG A N    10 
ATOM 7844  C CA   . ARG A 1 8  ? -2.474  -9.725  0.536   1.00 0.00 ? 113 ARG A CA   10 
ATOM 7845  C C    . ARG A 1 8  ? -3.727  -8.864  0.706   1.00 0.00 ? 113 ARG A C    10 
ATOM 7846  O O    . ARG A 1 8  ? -4.737  -9.053  0.022   1.00 0.00 ? 113 ARG A O    10 
ATOM 7847  C CB   . ARG A 1 8  ? -2.600  -11.009 1.353   1.00 0.00 ? 113 ARG A CB   10 
ATOM 7848  C CG   . ARG A 1 8  ? -1.745  -12.156 0.836   1.00 0.00 ? 113 ARG A CG   10 
ATOM 7849  C CD   . ARG A 1 8  ? -2.277  -12.702 -0.479  1.00 0.00 ? 113 ARG A CD   10 
ATOM 7850  N NE   . ARG A 1 8  ? -3.610  -13.279 -0.330  1.00 0.00 ? 113 ARG A NE   10 
ATOM 7851  C CZ   . ARG A 1 8  ? -4.240  -13.943 -1.295  1.00 0.00 ? 113 ARG A CZ   10 
ATOM 7852  N NH1  . ARG A 1 8  ? -3.663  -14.111 -2.476  1.00 0.00 ? 113 ARG A NH1  10 
ATOM 7853  N NH2  . ARG A 1 8  ? -5.449  -14.440 -1.076  1.00 0.00 ? 113 ARG A NH2  10 
ATOM 7854  H H    . ARG A 1 8  ? -0.918  -9.198  1.860   1.00 0.00 ? 113 ARG A H    10 
ATOM 7855  H HA   . ARG A 1 8  ? -2.347  -9.974  -0.504  1.00 0.00 ? 113 ARG A HA   10 
ATOM 7856  H HB2  . ARG A 1 8  ? -2.300  -10.800 2.368   1.00 0.00 ? 113 ARG A HB2  10 
ATOM 7857  H HB3  . ARG A 1 8  ? -3.628  -11.323 1.355   1.00 0.00 ? 113 ARG A HB3  10 
ATOM 7858  H HG2  . ARG A 1 8  ? -0.737  -11.798 0.683   1.00 0.00 ? 113 ARG A HG2  10 
ATOM 7859  H HG3  . ARG A 1 8  ? -1.739  -12.948 1.570   1.00 0.00 ? 113 ARG A HG3  10 
ATOM 7860  H HD2  . ARG A 1 8  ? -2.321  -11.897 -1.198  1.00 0.00 ? 113 ARG A HD2  10 
ATOM 7861  H HD3  . ARG A 1 8  ? -1.601  -13.466 -0.837  1.00 0.00 ? 113 ARG A HD3  10 
ATOM 7862  H HE   . ARG A 1 8  ? -4.058  -13.166 0.534   1.00 0.00 ? 113 ARG A HE   10 
ATOM 7863  H HH11 . ARG A 1 8  ? -2.750  -13.739 -2.646  1.00 0.00 ? 113 ARG A HH11 10 
ATOM 7864  H HH12 . ARG A 1 8  ? -4.140  -14.612 -3.199  1.00 0.00 ? 113 ARG A HH12 10 
ATOM 7865  H HH21 . ARG A 1 8  ? -5.888  -14.314 -0.187  1.00 0.00 ? 113 ARG A HH21 10 
ATOM 7866  H HH22 . ARG A 1 8  ? -5.923  -14.938 -1.801  1.00 0.00 ? 113 ARG A HH22 10 
ATOM 7867  N N    . TYR A 1 9  ? -3.629  -7.909  1.623   1.00 0.00 ? 114 TYR A N    10 
ATOM 7868  C CA   . TYR A 1 9  ? -4.712  -6.982  1.935   1.00 0.00 ? 114 TYR A CA   10 
ATOM 7869  C C    . TYR A 1 9  ? -4.937  -6.003  0.782   1.00 0.00 ? 114 TYR A C    10 
ATOM 7870  O O    . TYR A 1 9  ? -6.064  -5.849  0.310   1.00 0.00 ? 114 TYR A O    10 
ATOM 7871  C CB   . TYR A 1 9  ? -4.380  -6.283  3.272   1.00 0.00 ? 114 TYR A CB   10 
ATOM 7872  C CG   . TYR A 1 9  ? -4.873  -4.860  3.453   1.00 0.00 ? 114 TYR A CG   10 
ATOM 7873  C CD1  . TYR A 1 9  ? -6.065  -4.415  2.902   1.00 0.00 ? 114 TYR A CD1  10 
ATOM 7874  C CD2  . TYR A 1 9  ? -4.121  -3.958  4.199   1.00 0.00 ? 114 TYR A CD2  10 
ATOM 7875  C CE1  . TYR A 1 9  ? -6.492  -3.119  3.078   1.00 0.00 ? 114 TYR A CE1  10 
ATOM 7876  C CE2  . TYR A 1 9  ? -4.538  -2.659  4.386   1.00 0.00 ? 114 TYR A CE2  10 
ATOM 7877  C CZ   . TYR A 1 9  ? -5.726  -2.240  3.820   1.00 0.00 ? 114 TYR A CZ   10 
ATOM 7878  O OH   . TYR A 1 9  ? -6.152  -0.944  3.999   1.00 0.00 ? 114 TYR A OH   10 
ATOM 7879  H H    . TYR A 1 9  ? -2.786  -7.819  2.112   1.00 0.00 ? 114 TYR A H    10 
ATOM 7880  H HA   . TYR A 1 9  ? -5.616  -7.555  2.066   1.00 0.00 ? 114 TYR A HA   10 
ATOM 7881  H HB2  . TYR A 1 9  ? -4.801  -6.864  4.075   1.00 0.00 ? 114 TYR A HB2  10 
ATOM 7882  H HB3  . TYR A 1 9  ? -3.306  -6.268  3.387   1.00 0.00 ? 114 TYR A HB3  10 
ATOM 7883  H HD1  . TYR A 1 9  ? -6.662  -5.102  2.319   1.00 0.00 ? 114 TYR A HD1  10 
ATOM 7884  H HD2  . TYR A 1 9  ? -3.197  -4.290  4.646   1.00 0.00 ? 114 TYR A HD2  10 
ATOM 7885  H HE1  . TYR A 1 9  ? -7.419  -2.800  2.635   1.00 0.00 ? 114 TYR A HE1  10 
ATOM 7886  H HE2  . TYR A 1 9  ? -3.929  -1.978  4.967   1.00 0.00 ? 114 TYR A HE2  10 
ATOM 7887  H HH   . TYR A 1 9  ? -7.085  -0.940  4.224   1.00 0.00 ? 114 TYR A HH   10 
ATOM 7888  N N    . CYS A 1 10 ? -3.876  -5.353  0.316   1.00 0.00 ? 115 CYS A N    10 
ATOM 7889  C CA   . CYS A 1 10 ? -4.008  -4.406  -0.785  1.00 0.00 ? 115 CYS A CA   10 
ATOM 7890  C C    . CYS A 1 10 ? -4.181  -5.135  -2.114  1.00 0.00 ? 115 CYS A C    10 
ATOM 7891  O O    . CYS A 1 10 ? -4.599  -4.545  -3.105  1.00 0.00 ? 115 CYS A O    10 
ATOM 7892  C CB   . CYS A 1 10 ? -2.795  -3.479  -0.866  1.00 0.00 ? 115 CYS A CB   10 
ATOM 7893  S SG   . CYS A 1 10 ? -2.186  -2.888  0.746   1.00 0.00 ? 115 CYS A SG   10 
ATOM 7894  H H    . CYS A 1 10 ? -2.996  -5.512  0.717   1.00 0.00 ? 115 CYS A H    10 
ATOM 7895  H HA   . CYS A 1 10 ? -4.891  -3.810  -0.600  1.00 0.00 ? 115 CYS A HA   10 
ATOM 7896  H HB2  . CYS A 1 10 ? -1.982  -3.997  -1.355  1.00 0.00 ? 115 CYS A HB2  10 
ATOM 7897  H HB3  . CYS A 1 10 ? -3.064  -2.612  -1.454  1.00 0.00 ? 115 CYS A HB3  10 
ATOM 7898  N N    . CYS A 1 11 ? -3.863  -6.422  -2.133  1.00 0.00 ? 116 CYS A N    10 
ATOM 7899  C CA   . CYS A 1 11 ? -3.985  -7.204  -3.357  1.00 0.00 ? 116 CYS A CA   10 
ATOM 7900  C C    . CYS A 1 11 ? -5.448  -7.455  -3.710  1.00 0.00 ? 116 CYS A C    10 
ATOM 7901  O O    . CYS A 1 11 ? -5.886  -7.171  -4.824  1.00 0.00 ? 116 CYS A O    10 
ATOM 7902  C CB   . CYS A 1 11 ? -3.258  -8.544  -3.212  1.00 0.00 ? 116 CYS A CB   10 
ATOM 7903  S SG   . CYS A 1 11 ? -3.447  -9.656  -4.648  1.00 0.00 ? 116 CYS A SG   10 
ATOM 7904  H H    . CYS A 1 11 ? -3.543  -6.853  -1.315  1.00 0.00 ? 116 CYS A H    10 
ATOM 7905  H HA   . CYS A 1 11 ? -3.527  -6.635  -4.155  1.00 0.00 ? 116 CYS A HA   10 
ATOM 7906  H HB2  . CYS A 1 11 ? -2.207  -8.364  -3.072  1.00 0.00 ? 116 CYS A HB2  10 
ATOM 7907  H HB3  . CYS A 1 11 ? -3.643  -9.059  -2.347  1.00 0.00 ? 116 CYS A HB3  10 
ATOM 7908  N N    . LEU A 1 12 ? -6.196  -7.988  -2.749  1.00 0.00 ? 117 LEU A N    10 
ATOM 7909  C CA   . LEU A 1 12 ? -7.603  -8.298  -2.960  1.00 0.00 ? 117 LEU A CA   10 
ATOM 7910  C C    . LEU A 1 12 ? -8.493  -7.064  -2.841  1.00 0.00 ? 117 LEU A C    10 
ATOM 7911  O O    . LEU A 1 12 ? -9.657  -7.096  -3.237  1.00 0.00 ? 117 LEU A O    10 
ATOM 7912  C CB   . LEU A 1 12 ? -8.045  -9.349  -1.952  1.00 0.00 ? 117 LEU A CB   10 
ATOM 7913  C CG   . LEU A 1 12 ? -7.874  -10.800 -2.403  1.00 0.00 ? 117 LEU A CG   10 
ATOM 7914  C CD1  . LEU A 1 12 ? -8.182  -11.753 -1.260  1.00 0.00 ? 117 LEU A CD1  10 
ATOM 7915  C CD2  . LEU A 1 12 ? -8.769  -11.097 -3.600  1.00 0.00 ? 117 LEU A CD2  10 
ATOM 7916  H H    . LEU A 1 12 ? -5.794  -8.181  -1.877  1.00 0.00 ? 117 LEU A H    10 
ATOM 7917  H HA   . LEU A 1 12 ? -7.705  -8.706  -3.950  1.00 0.00 ? 117 LEU A HA   10 
ATOM 7918  H HB2  . LEU A 1 12 ? -7.471  -9.204  -1.052  1.00 0.00 ? 117 LEU A HB2  10 
ATOM 7919  H HB3  . LEU A 1 12 ? -9.083  -9.182  -1.725  1.00 0.00 ? 117 LEU A HB3  10 
ATOM 7920  H HG   . LEU A 1 12 ? -6.848  -10.960 -2.704  1.00 0.00 ? 117 LEU A HG   10 
ATOM 7921  H HD11 . LEU A 1 12 ? -7.530  -11.537 -0.426  1.00 0.00 ? 117 LEU A HD11 10 
ATOM 7922  H HD12 . LEU A 1 12 ? -8.023  -12.770 -1.586  1.00 0.00 ? 117 LEU A HD12 10 
ATOM 7923  H HD13 . LEU A 1 12 ? -9.210  -11.630 -0.954  1.00 0.00 ? 117 LEU A HD13 10 
ATOM 7924  H HD21 . LEU A 1 12 ? -8.514  -10.434 -4.414  1.00 0.00 ? 117 LEU A HD21 10 
ATOM 7925  H HD22 . LEU A 1 12 ? -9.802  -10.945 -3.323  1.00 0.00 ? 117 LEU A HD22 10 
ATOM 7926  H HD23 . LEU A 1 12 ? -8.626  -12.121 -3.912  1.00 0.00 ? 117 LEU A HD23 10 
ATOM 7927  N N    . SER A 1 13 ? -7.949  -5.981  -2.298  1.00 0.00 ? 118 SER A N    10 
ATOM 7928  C CA   . SER A 1 13 ? -8.727  -4.755  -2.128  1.00 0.00 ? 118 SER A CA   10 
ATOM 7929  C C    . SER A 1 13 ? -8.008  -3.529  -2.687  1.00 0.00 ? 118 SER A C    10 
ATOM 7930  O O    . SER A 1 13 ? -8.553  -2.814  -3.528  1.00 0.00 ? 118 SER A O    10 
ATOM 7931  C CB   . SER A 1 13 ? -9.046  -4.537  -0.649  1.00 0.00 ? 118 SER A CB   10 
ATOM 7932  O OG   . SER A 1 13 ? -9.830  -3.372  -0.464  1.00 0.00 ? 118 SER A OG   10 
ATOM 7933  H H    . SER A 1 13 ? -7.019  -6.010  -1.997  1.00 0.00 ? 118 SER A H    10 
ATOM 7934  H HA   . SER A 1 13 ? -9.655  -4.882  -2.664  1.00 0.00 ? 118 SER A HA   10 
ATOM 7935  H HB2  . SER A 1 13 ? -9.593  -5.388  -0.272  1.00 0.00 ? 118 SER A HB2  10 
ATOM 7936  H HB3  . SER A 1 13 ? -8.125  -4.428  -0.096  1.00 0.00 ? 118 SER A HB3  10 
ATOM 7937  H HG   . SER A 1 13 ? -10.742 -3.621  -0.304  1.00 0.00 ? 118 SER A HG   10 
ATOM 7938  N N    . GLY A 1 14 ? -6.787  -3.286  -2.221  1.00 0.00 ? 119 GLY A N    10 
ATOM 7939  C CA   . GLY A 1 14 ? -6.036  -2.128  -2.672  1.00 0.00 ? 119 GLY A CA   10 
ATOM 7940  C C    . GLY A 1 14 ? -5.812  -1.146  -1.543  1.00 0.00 ? 119 GLY A C    10 
ATOM 7941  O O    . GLY A 1 14 ? -6.682  -0.980  -0.688  1.00 0.00 ? 119 GLY A O    10 
ATOM 7942  H H    . GLY A 1 14 ? -6.385  -3.899  -1.569  1.00 0.00 ? 119 GLY A H    10 
ATOM 7943  H HA2  . GLY A 1 14 ? -5.078  -2.457  -3.045  1.00 0.00 ? 119 GLY A HA2  10 
ATOM 7944  H HA3  . GLY A 1 14 ? -6.578  -1.639  -3.471  1.00 0.00 ? 119 GLY A HA3  10 
ATOM 7945  N N    . CYS A 1 15 ? -4.652  -0.492  -1.522  1.00 0.00 ? 120 CYS A N    10 
ATOM 7946  C CA   . CYS A 1 15 ? -4.356  0.445   -0.446  1.00 0.00 ? 120 CYS A CA   10 
ATOM 7947  C C    . CYS A 1 15 ? -4.058  1.848   -0.925  1.00 0.00 ? 120 CYS A C    10 
ATOM 7948  O O    . CYS A 1 15 ? -3.426  2.061   -1.960  1.00 0.00 ? 120 CYS A O    10 
ATOM 7949  C CB   . CYS A 1 15 ? -3.199  -0.057  0.411   1.00 0.00 ? 120 CYS A CB   10 
ATOM 7950  S SG   . CYS A 1 15 ? -3.589  -1.565  1.353   1.00 0.00 ? 120 CYS A SG   10 
ATOM 7951  H H    . CYS A 1 15 ? -3.996  -0.641  -2.235  1.00 0.00 ? 120 CYS A H    10 
ATOM 7952  H HA   . CYS A 1 15 ? -5.223  0.498   0.168   1.00 0.00 ? 120 CYS A HA   10 
ATOM 7953  H HB2  . CYS A 1 15 ? -2.357  -0.271  -0.220  1.00 0.00 ? 120 CYS A HB2  10 
ATOM 7954  H HB3  . CYS A 1 15 ? -2.924  0.711   1.115   1.00 0.00 ? 120 CYS A HB3  10 
ATOM 7955  N N    . THR A 1 16 ? -4.536  2.801   -0.136  1.00 0.00 ? 121 THR A N    10 
ATOM 7956  C CA   . THR A 1 16 ? -4.323  4.205   -0.408  1.00 0.00 ? 121 THR A CA   10 
ATOM 7957  C C    . THR A 1 16 ? -2.913  4.581   -0.049  1.00 0.00 ? 121 THR A C    10 
ATOM 7958  O O    . THR A 1 16 ? -2.276  3.922   0.774   1.00 0.00 ? 121 THR A O    10 
ATOM 7959  C CB   . THR A 1 16 ? -5.255  5.100   0.423   1.00 0.00 ? 121 THR A CB   10 
ATOM 7960  O OG1  . THR A 1 16 ? -4.973  4.945   1.819   1.00 0.00 ? 121 THR A OG1  10 
ATOM 7961  C CG2  . THR A 1 16 ? -6.695  4.755   0.157   1.00 0.00 ? 121 THR A CG2  10 
ATOM 7962  H H    . THR A 1 16 ? -5.049  2.545   0.658   1.00 0.00 ? 121 THR A H    10 
ATOM 7963  H HA   . THR A 1 16 ? -4.497  4.391   -1.457  1.00 0.00 ? 121 THR A HA   10 
ATOM 7964  H HB   . THR A 1 16 ? -5.089  6.128   0.139   1.00 0.00 ? 121 THR A HB   10 
ATOM 7965  H HG1  . THR A 1 16 ? -5.022  4.016   2.055   1.00 0.00 ? 121 THR A HG1  10 
ATOM 7966  H HG21 . THR A 1 16 ? -6.786  4.482   -0.875  1.00 0.00 ? 121 THR A HG21 10 
ATOM 7967  H HG22 . THR A 1 16 ? -7.320  5.610   0.365   1.00 0.00 ? 121 THR A HG22 10 
ATOM 7968  H HG23 . THR A 1 16 ? -6.992  3.925   0.779   1.00 0.00 ? 121 THR A HG23 10 
ATOM 7969  N N    . GLN A 1 17 ? -2.432  5.645   -0.649  1.00 0.00 ? 122 GLN A N    10 
ATOM 7970  C CA   . GLN A 1 17 ? -1.106  6.118   -0.352  1.00 0.00 ? 122 GLN A CA   10 
ATOM 7971  C C    . GLN A 1 17 ? -1.020  6.433   1.131   1.00 0.00 ? 122 GLN A C    10 
ATOM 7972  O O    . GLN A 1 17 ? 0.063   6.596   1.681   1.00 0.00 ? 122 GLN A O    10 
ATOM 7973  C CB   . GLN A 1 17 ? -0.792  7.340   -1.202  1.00 0.00 ? 122 GLN A CB   10 
ATOM 7974  C CG   . GLN A 1 17 ? -0.498  6.998   -2.654  1.00 0.00 ? 122 GLN A CG   10 
ATOM 7975  C CD   . GLN A 1 17 ? -0.880  8.119   -3.600  1.00 0.00 ? 122 GLN A CD   10 
ATOM 7976  O OE1  . GLN A 1 17 ? -1.979  8.129   -4.158  1.00 0.00 ? 122 GLN A OE1  10 
ATOM 7977  N NE2  . GLN A 1 17 ? 0.019   9.081   -3.774  1.00 0.00 ? 122 GLN A NE2  10 
ATOM 7978  H H    . GLN A 1 17 ? -2.986  6.128   -1.297  1.00 0.00 ? 122 GLN A H    10 
ATOM 7979  H HA   . GLN A 1 17 ? -0.398  5.323   -0.579  1.00 0.00 ? 122 GLN A HA   10 
ATOM 7980  H HB2  . GLN A 1 17 ? -1.638  8.013   -1.175  1.00 0.00 ? 122 GLN A HB2  10 
ATOM 7981  H HB3  . GLN A 1 17 ? 0.065   7.839   -0.791  1.00 0.00 ? 122 GLN A HB3  10 
ATOM 7982  H HG2  . GLN A 1 17 ? 0.559   6.801   -2.759  1.00 0.00 ? 122 GLN A HG2  10 
ATOM 7983  H HG3  . GLN A 1 17 ? -1.053  6.109   -2.921  1.00 0.00 ? 122 GLN A HG3  10 
ATOM 7984  H HE21 . GLN A 1 17 ? 0.867   9.013   -3.288  1.00 0.00 ? 122 GLN A HE21 10 
ATOM 7985  H HE22 . GLN A 1 17 ? -0.201  9.817   -4.382  1.00 0.00 ? 122 GLN A HE22 10 
ATOM 7986  N N    . GLN A 1 18 ? -2.184  6.513   1.776   1.00 0.00 ? 123 GLN A N    10 
ATOM 7987  C CA   . GLN A 1 18 ? -2.238  6.750   3.197   1.00 0.00 ? 123 GLN A CA   10 
ATOM 7988  C C    . GLN A 1 18 ? -1.834  5.474   3.912   1.00 0.00 ? 123 GLN A C    10 
ATOM 7989  O O    . GLN A 1 18 ? -0.948  5.486   4.762   1.00 0.00 ? 123 GLN A O    10 
ATOM 7990  C CB   . GLN A 1 18 ? -3.634  7.173   3.621   1.00 0.00 ? 123 GLN A CB   10 
ATOM 7991  C CG   . GLN A 1 18 ? -3.968  8.617   3.283   1.00 0.00 ? 123 GLN A CG   10 
ATOM 7992  C CD   . GLN A 1 18 ? -5.388  8.993   3.660   1.00 0.00 ? 123 GLN A CD   10 
ATOM 7993  O OE1  . GLN A 1 18 ? -6.006  9.845   3.023   1.00 0.00 ? 123 GLN A OE1  10 
ATOM 7994  N NE2  . GLN A 1 18 ? -5.917  8.355   4.701   1.00 0.00 ? 123 GLN A NE2  10 
ATOM 7995  H H    . GLN A 1 18 ? -3.024  6.405   1.281   1.00 0.00 ? 123 GLN A H    10 
ATOM 7996  H HA   . GLN A 1 18 ? -1.535  7.530   3.440   1.00 0.00 ? 123 GLN A HA   10 
ATOM 7997  H HB2  . GLN A 1 18 ? -4.349  6.537   3.131   1.00 0.00 ? 123 GLN A HB2  10 
ATOM 7998  H HB3  . GLN A 1 18 ? -3.720  7.045   4.685   1.00 0.00 ? 123 GLN A HB3  10 
ATOM 7999  H HG2  . GLN A 1 18 ? -3.287  9.265   3.815   1.00 0.00 ? 123 GLN A HG2  10 
ATOM 8000  H HG3  . GLN A 1 18 ? -3.842  8.762   2.220   1.00 0.00 ? 123 GLN A HG3  10 
ATOM 8001  H HE21 . GLN A 1 18 ? -5.369  7.686   5.161   1.00 0.00 ? 123 GLN A HE21 10 
ATOM 8002  H HE22 . GLN A 1 18 ? -6.833  8.580   4.965   1.00 0.00 ? 123 GLN A HE22 10 
ATOM 8003  N N    . ASP A 1 19 ? -2.486  4.364   3.549   1.00 0.00 ? 124 ASP A N    10 
ATOM 8004  C CA   . ASP A 1 19 ? -2.147  3.077   4.140   1.00 0.00 ? 124 ASP A CA   10 
ATOM 8005  C C    . ASP A 1 19 ? -0.653  2.863   3.988   1.00 0.00 ? 124 ASP A C    10 
ATOM 8006  O O    . ASP A 1 19 ? 0.075   2.695   4.965   1.00 0.00 ? 124 ASP A O    10 
ATOM 8007  C CB   . ASP A 1 19 ? -2.894  1.928   3.450   1.00 0.00 ? 124 ASP A CB   10 
ATOM 8008  C CG   . ASP A 1 19 ? -3.416  0.906   4.440   1.00 0.00 ? 124 ASP A CG   10 
ATOM 8009  O OD1  . ASP A 1 19 ? -4.547  1.086   4.938   1.00 0.00 ? 124 ASP A OD1  10 
ATOM 8010  O OD2  . ASP A 1 19 ? -2.694  -0.075  4.715   1.00 0.00 ? 124 ASP A OD2  10 
ATOM 8011  H H    . ASP A 1 19 ? -3.201  4.417   2.874   1.00 0.00 ? 124 ASP A H    10 
ATOM 8012  H HA   . ASP A 1 19 ? -2.404  3.102   5.190   1.00 0.00 ? 124 ASP A HA   10 
ATOM 8013  H HB2  . ASP A 1 19 ? -3.726  2.318   2.886   1.00 0.00 ? 124 ASP A HB2  10 
ATOM 8014  H HB3  . ASP A 1 19 ? -2.215  1.428   2.773   1.00 0.00 ? 124 ASP A HB3  10 
ATOM 8015  N N    . LEU A 1 20 ? -0.211  2.907   2.736   1.00 0.00 ? 125 LEU A N    10 
ATOM 8016  C CA   . LEU A 1 20 ? 1.188   2.735   2.398   1.00 0.00 ? 125 LEU A CA   10 
ATOM 8017  C C    . LEU A 1 20 ? 2.055   3.726   3.182   1.00 0.00 ? 125 LEU A C    10 
ATOM 8018  O O    . LEU A 1 20 ? 3.180   3.403   3.580   1.00 0.00 ? 125 LEU A O    10 
ATOM 8019  C CB   . LEU A 1 20 ? 1.360   2.885   0.880   1.00 0.00 ? 125 LEU A CB   10 
ATOM 8020  C CG   . LEU A 1 20 ? 0.564   1.872   0.057   1.00 0.00 ? 125 LEU A CG   10 
ATOM 8021  C CD1  . LEU A 1 20 ? -0.354  2.577   -0.919  1.00 0.00 ? 125 LEU A CD1  10 
ATOM 8022  C CD2  . LEU A 1 20 ? 1.490   0.959   -0.704  1.00 0.00 ? 125 LEU A CD2  10 
ATOM 8023  H H    . LEU A 1 20 ? -0.856  3.061   2.014   1.00 0.00 ? 125 LEU A H    10 
ATOM 8024  H HA   . LEU A 1 20 ? 1.472   1.732   2.684   1.00 0.00 ? 125 LEU A HA   10 
ATOM 8025  H HB2  . LEU A 1 20 ? 1.050   3.870   0.584   1.00 0.00 ? 125 LEU A HB2  10 
ATOM 8026  H HB3  . LEU A 1 20 ? 2.396   2.778   0.635   1.00 0.00 ? 125 LEU A HB3  10 
ATOM 8027  H HG   . LEU A 1 20 ? -0.042  1.267   0.717   1.00 0.00 ? 125 LEU A HG   10 
ATOM 8028  H HD11 . LEU A 1 20 ? -1.382  2.388   -0.649  1.00 0.00 ? 125 LEU A HD11 10 
ATOM 8029  H HD12 . LEU A 1 20 ? -0.163  2.200   -1.911  1.00 0.00 ? 125 LEU A HD12 10 
ATOM 8030  H HD13 . LEU A 1 20 ? -0.162  3.639   -0.892  1.00 0.00 ? 125 LEU A HD13 10 
ATOM 8031  H HD21 . LEU A 1 20 ? 2.323   0.681   -0.074  1.00 0.00 ? 125 LEU A HD21 10 
ATOM 8032  H HD22 . LEU A 1 20 ? 1.851   1.486   -1.578  1.00 0.00 ? 125 LEU A HD22 10 
ATOM 8033  H HD23 . LEU A 1 20 ? 0.954   0.073   -1.012  1.00 0.00 ? 125 LEU A HD23 10 
ATOM 8034  N N    . LEU A 1 21 ? 1.521   4.927   3.423   1.00 0.00 ? 126 LEU A N    10 
ATOM 8035  C CA   . LEU A 1 21 ? 2.237   5.941   4.191   1.00 0.00 ? 126 LEU A CA   10 
ATOM 8036  C C    . LEU A 1 21 ? 2.521   5.427   5.593   1.00 0.00 ? 126 LEU A C    10 
ATOM 8037  O O    . LEU A 1 21 ? 3.539   5.760   6.200   1.00 0.00 ? 126 LEU A O    10 
ATOM 8038  C CB   . LEU A 1 21 ? 1.417   7.234   4.280   1.00 0.00 ? 126 LEU A CB   10 
ATOM 8039  C CG   . LEU A 1 21 ? 1.823   8.341   3.310   1.00 0.00 ? 126 LEU A CG   10 
ATOM 8040  C CD1  . LEU A 1 21 ? 0.898   9.539   3.456   1.00 0.00 ? 126 LEU A CD1  10 
ATOM 8041  C CD2  . LEU A 1 21 ? 3.270   8.752   3.536   1.00 0.00 ? 126 LEU A CD2  10 
ATOM 8042  H H    . LEU A 1 21 ? 0.628   5.138   3.074   1.00 0.00 ? 126 LEU A H    10 
ATOM 8043  H HA   . LEU A 1 21 ? 3.173   6.144   3.692   1.00 0.00 ? 126 LEU A HA   10 
ATOM 8044  H HB2  . LEU A 1 21 ? 0.382   6.988   4.094   1.00 0.00 ? 126 LEU A HB2  10 
ATOM 8045  H HB3  . LEU A 1 21 ? 1.500   7.620   5.284   1.00 0.00 ? 126 LEU A HB3  10 
ATOM 8046  H HG   . LEU A 1 21 ? 1.730   7.972   2.300   1.00 0.00 ? 126 LEU A HG   10 
ATOM 8047  H HD11 . LEU A 1 21 ? 0.934   9.900   4.474   1.00 0.00 ? 126 LEU A HD11 10 
ATOM 8048  H HD12 . LEU A 1 21 ? -0.113  9.246   3.215   1.00 0.00 ? 126 LEU A HD12 10 
ATOM 8049  H HD13 . LEU A 1 21 ? 1.215   10.324  2.784   1.00 0.00 ? 126 LEU A HD13 10 
ATOM 8050  H HD21 . LEU A 1 21 ? 3.916   7.903   3.375   1.00 0.00 ? 126 LEU A HD21 10 
ATOM 8051  H HD22 . LEU A 1 21 ? 3.390   9.108   4.549   1.00 0.00 ? 126 LEU A HD22 10 
ATOM 8052  H HD23 . LEU A 1 21 ? 3.533   9.540   2.845   1.00 0.00 ? 126 LEU A HD23 10 
ATOM 8053  N N    . THR A 1 22 ? 1.603   4.610   6.103   1.00 0.00 ? 127 THR A N    10 
ATOM 8054  C CA   . THR A 1 22 ? 1.734   4.047   7.437   1.00 0.00 ? 127 THR A CA   10 
ATOM 8055  C C    . THR A 1 22 ? 2.458   2.702   7.412   1.00 0.00 ? 127 THR A C    10 
ATOM 8056  O O    . THR A 1 22 ? 2.813   2.169   8.463   1.00 0.00 ? 127 THR A O    10 
ATOM 8057  C CB   . THR A 1 22 ? 0.360   3.849   8.115   1.00 0.00 ? 127 THR A CB   10 
ATOM 8058  O OG1  . THR A 1 22 ? -0.117  2.521   7.875   1.00 0.00 ? 127 THR A OG1  10 
ATOM 8059  C CG2  . THR A 1 22 ? -0.664  4.851   7.602   1.00 0.00 ? 127 THR A CG2  10 
ATOM 8060  H H    . THR A 1 22 ? 0.816   4.384   5.565   1.00 0.00 ? 127 THR A H    10 
ATOM 8061  H HA   . THR A 1 22 ? 2.308   4.740   8.034   1.00 0.00 ? 127 THR A HA   10 
ATOM 8062  H HB   . THR A 1 22 ? 0.479   3.994   9.179   1.00 0.00 ? 127 THR A HB   10 
ATOM 8063  H HG1  . THR A 1 22 ? -0.647  2.231   8.621   1.00 0.00 ? 127 THR A HG1  10 
ATOM 8064  H HG21 . THR A 1 22 ? -0.198  5.815   7.470   1.00 0.00 ? 127 THR A HG21 10 
ATOM 8065  H HG22 . THR A 1 22 ? -1.470  4.938   8.316   1.00 0.00 ? 127 THR A HG22 10 
ATOM 8066  H HG23 . THR A 1 22 ? -1.058  4.508   6.658   1.00 0.00 ? 127 THR A HG23 10 
ATOM 8067  N N    . LEU A 1 23 ? 2.684   2.150   6.217   1.00 0.00 ? 128 LEU A N    10 
ATOM 8068  C CA   . LEU A 1 23 ? 3.359   0.872   6.102   1.00 0.00 ? 128 LEU A CA   10 
ATOM 8069  C C    . LEU A 1 23 ? 4.861   1.086   5.938   1.00 0.00 ? 128 LEU A C    10 
ATOM 8070  O O    . LEU A 1 23 ? 5.652   0.152   6.070   1.00 0.00 ? 128 LEU A O    10 
ATOM 8071  C CB   . LEU A 1 23 ? 2.765   0.078   4.942   1.00 0.00 ? 128 LEU A CB   10 
ATOM 8072  C CG   . LEU A 1 23 ? 1.243   -0.063  4.998   1.00 0.00 ? 128 LEU A CG   10 
ATOM 8073  C CD1  . LEU A 1 23 ? 0.699   -0.600  3.691   1.00 0.00 ? 128 LEU A CD1  10 
ATOM 8074  C CD2  . LEU A 1 23 ? 0.847   -0.970  6.140   1.00 0.00 ? 128 LEU A CD2  10 
ATOM 8075  H H    . LEU A 1 23 ? 2.403   2.614   5.396   1.00 0.00 ? 128 LEU A H    10 
ATOM 8076  H HA   . LEU A 1 23 ? 3.185   0.324   7.015   1.00 0.00 ? 128 LEU A HA   10 
ATOM 8077  H HB2  . LEU A 1 23 ? 3.029   0.557   4.022   1.00 0.00 ? 128 LEU A HB2  10 
ATOM 8078  H HB3  . LEU A 1 23 ? 3.194   -0.907  4.954   1.00 0.00 ? 128 LEU A HB3  10 
ATOM 8079  H HG   . LEU A 1 23 ? 0.804   0.904   5.172   1.00 0.00 ? 128 LEU A HG   10 
ATOM 8080  H HD11 . LEU A 1 23 ? 0.950   -1.645  3.605   1.00 0.00 ? 128 LEU A HD11 10 
ATOM 8081  H HD12 . LEU A 1 23 ? 1.136   -0.053  2.869   1.00 0.00 ? 128 LEU A HD12 10 
ATOM 8082  H HD13 . LEU A 1 23 ? -0.375  -0.482  3.673   1.00 0.00 ? 128 LEU A HD13 10 
ATOM 8083  H HD21 . LEU A 1 23 ? 0.994   -0.457  7.079   1.00 0.00 ? 128 LEU A HD21 10 
ATOM 8084  H HD22 . LEU A 1 23 ? 1.467   -1.846  6.107   1.00 0.00 ? 128 LEU A HD22 10 
ATOM 8085  H HD23 . LEU A 1 23 ? -0.189  -1.254  6.037   1.00 0.00 ? 128 LEU A HD23 10 
ATOM 8086  N N    . CYS A 1 24 ? 5.245   2.333   5.651   1.00 0.00 ? 129 CYS A N    10 
ATOM 8087  C CA   . CYS A 1 24 ? 6.656   2.689   5.502   1.00 0.00 ? 129 CYS A CA   10 
ATOM 8088  C C    . CYS A 1 24 ? 7.279   2.966   6.877   1.00 0.00 ? 129 CYS A C    10 
ATOM 8089  O O    . CYS A 1 24 ? 6.577   2.942   7.888   1.00 0.00 ? 129 CYS A O    10 
ATOM 8090  C CB   . CYS A 1 24 ? 6.806   3.912   4.589   1.00 0.00 ? 129 CYS A CB   10 
ATOM 8091  S SG   . CYS A 1 24 ? 6.663   5.519   5.442   1.00 0.00 ? 129 CYS A SG   10 
ATOM 8092  H H    . CYS A 1 24 ? 4.559   3.025   5.513   1.00 0.00 ? 129 CYS A H    10 
ATOM 8093  H HA   . CYS A 1 24 ? 7.164   1.850   5.056   1.00 0.00 ? 129 CYS A HA   10 
ATOM 8094  H HB2  . CYS A 1 24 ? 7.776   3.880   4.118   1.00 0.00 ? 129 CYS A HB2  10 
ATOM 8095  H HB3  . CYS A 1 24 ? 6.046   3.873   3.829   1.00 0.00 ? 129 CYS A HB3  10 
ATOM 8096  N N    . PRO A 1 25 ? 8.604   3.231   6.945   1.00 0.00 ? 130 PRO A N    10 
ATOM 8097  C CA   . PRO A 1 25 ? 9.288   3.499   8.216   1.00 0.00 ? 130 PRO A CA   10 
ATOM 8098  C C    . PRO A 1 25 ? 8.857   4.823   8.840   1.00 0.00 ? 130 PRO A C    10 
ATOM 8099  O O    . PRO A 1 25 ? 7.793   5.354   8.516   1.00 0.00 ? 130 PRO A O    10 
ATOM 8100  C CB   . PRO A 1 25 ? 10.776  3.543   7.834   1.00 0.00 ? 130 PRO A CB   10 
ATOM 8101  C CG   . PRO A 1 25 ? 10.851  2.971   6.457   1.00 0.00 ? 130 PRO A CG   10 
ATOM 8102  C CD   . PRO A 1 25 ? 9.538   3.293   5.813   1.00 0.00 ? 130 PRO A CD   10 
ATOM 8103  H HA   . PRO A 1 25 ? 9.122   2.701   8.927   1.00 0.00 ? 130 PRO A HA   10 
ATOM 8104  H HB2  . PRO A 1 25 ? 11.124  4.564   7.853   1.00 0.00 ? 130 PRO A HB2  10 
ATOM 8105  H HB3  . PRO A 1 25 ? 11.347  2.953   8.536   1.00 0.00 ? 130 PRO A HB3  10 
ATOM 8106  H HG2  . PRO A 1 25 ? 11.662  3.430   5.910   1.00 0.00 ? 130 PRO A HG2  10 
ATOM 8107  H HG3  . PRO A 1 25 ? 10.991  1.902   6.510   1.00 0.00 ? 130 PRO A HG3  10 
ATOM 8108  H HD2  . PRO A 1 25 ? 9.560   4.286   5.385   1.00 0.00 ? 130 PRO A HD2  10 
ATOM 8109  H HD3  . PRO A 1 25 ? 9.282   2.561   5.061   1.00 0.00 ? 130 PRO A HD3  10 
ATOM 8110  N N    . TYR A 1 26 ? 9.689   5.349   9.737   1.00 0.00 ? 131 TYR A N    10 
ATOM 8111  C CA   . TYR A 1 26 ? 9.402   6.608   10.410  1.00 0.00 ? 131 TYR A CA   10 
ATOM 8112  C C    . TYR A 1 26 ? 8.063   6.548   11.142  1.00 0.00 ? 131 TYR A C    10 
ATOM 8113  O O    . TYR A 1 26 ? 7.045   6.967   10.552  1.00 0.00 ? 131 TYR A O    10 
ATOM 8114  C CB   . TYR A 1 26 ? 9.401   7.759   9.403   1.00 0.00 ? 131 TYR A CB   10 
ATOM 8115  C CG   . TYR A 1 26 ? 10.707  7.917   8.661   1.00 0.00 ? 131 TYR A CG   10 
ATOM 8116  C CD1  . TYR A 1 26 ? 10.965  7.187   7.505   1.00 0.00 ? 131 TYR A CD1  10 
ATOM 8117  C CD2  . TYR A 1 26 ? 11.683  8.797   9.111   1.00 0.00 ? 131 TYR A CD2  10 
ATOM 8118  C CE1  . TYR A 1 26 ? 12.158  7.328   6.824   1.00 0.00 ? 131 TYR A CE1  10 
ATOM 8119  C CE2  . TYR A 1 26 ? 12.879  8.944   8.434   1.00 0.00 ? 131 TYR A CE2  10 
ATOM 8120  C CZ   . TYR A 1 26 ? 13.111  8.208   7.292   1.00 0.00 ? 131 TYR A CZ   10 
ATOM 8121  O OH   . TYR A 1 26 ? 14.300  8.351   6.615   1.00 0.00 ? 131 TYR A OH   10 
ATOM 8122  O OXT  . TYR A 1 26 ? 8.045   6.081   12.300  1.00 0.00 ? 131 TYR A OXT  10 
ATOM 8123  H H    . TYR A 1 26 ? 10.520  4.879   9.947   1.00 0.00 ? 131 TYR A H    10 
ATOM 8124  H HA   . TYR A 1 26 ? 10.185  6.780   11.134  1.00 0.00 ? 131 TYR A HA   10 
ATOM 8125  H HB2  . TYR A 1 26 ? 8.622   7.590   8.675   1.00 0.00 ? 131 TYR A HB2  10 
ATOM 8126  H HB3  . TYR A 1 26 ? 9.203   8.679   9.927   1.00 0.00 ? 131 TYR A HB3  10 
ATOM 8127  H HD1  . TYR A 1 26 ? 10.214  6.500   7.142   1.00 0.00 ? 131 TYR A HD1  10 
ATOM 8128  H HD2  . TYR A 1 26 ? 11.498  9.370   10.007  1.00 0.00 ? 131 TYR A HD2  10 
ATOM 8129  H HE1  . TYR A 1 26 ? 12.340  6.752   5.929   1.00 0.00 ? 131 TYR A HE1  10 
ATOM 8130  H HE2  . TYR A 1 26 ? 13.626  9.633   8.801   1.00 0.00 ? 131 TYR A HE2  10 
ATOM 8131  H HH   . TYR A 1 26 ? 14.132  8.363   5.670   1.00 0.00 ? 131 TYR A HH   10 
ATOM 8132  N N    . PRO B 2 1  ? -3.293  18.338  -6.622  1.00 0.00 ? 25  PRO B N    10 
ATOM 8133  C CA   . PRO B 2 1  ? -2.738  17.503  -5.527  1.00 0.00 ? 25  PRO B CA   10 
ATOM 8134  C C    . PRO B 2 1  ? -3.374  16.117  -5.522  1.00 0.00 ? 25  PRO B C    10 
ATOM 8135  O O    . PRO B 2 1  ? -4.599  15.985  -5.509  1.00 0.00 ? 25  PRO B O    10 
ATOM 8136  C CB   . PRO B 2 1  ? -2.992  18.200  -4.199  1.00 0.00 ? 25  PRO B CB   10 
ATOM 8137  C CG   . PRO B 2 1  ? -3.900  19.323  -4.558  1.00 0.00 ? 25  PRO B CG   10 
ATOM 8138  C CD   . PRO B 2 1  ? -3.627  19.641  -6.011  1.00 0.00 ? 25  PRO B CD   10 
ATOM 8139  H H2   . PRO B 2 1  ? -4.073  17.790  -7.021  1.00 0.00 ? 25  PRO B H2   10 
ATOM 8140  H H3   . PRO B 2 1  ? -2.566  18.304  -7.375  1.00 0.00 ? 25  PRO B H3   10 
ATOM 8141  H HA   . PRO B 2 1  ? -1.674  17.401  -5.678  1.00 0.00 ? 25  PRO B HA   10 
ATOM 8142  H HB2  . PRO B 2 1  ? -3.460  17.511  -3.509  1.00 0.00 ? 25  PRO B HB2  10 
ATOM 8143  H HB3  . PRO B 2 1  ? -2.060  18.558  -3.788  1.00 0.00 ? 25  PRO B HB3  10 
ATOM 8144  H HG2  . PRO B 2 1  ? -4.927  19.020  -4.427  1.00 0.00 ? 25  PRO B HG2  10 
ATOM 8145  H HG3  . PRO B 2 1  ? -3.681  20.182  -3.941  1.00 0.00 ? 25  PRO B HG3  10 
ATOM 8146  H HD2  . PRO B 2 1  ? -4.509  20.061  -6.473  1.00 0.00 ? 25  PRO B HD2  10 
ATOM 8147  H HD3  . PRO B 2 1  ? -2.796  20.324  -6.095  1.00 0.00 ? 25  PRO B HD3  10 
ATOM 8148  N N    . THR B 2 2  ? -2.536  15.085  -5.530  1.00 0.00 ? 26  THR B N    10 
ATOM 8149  C CA   . THR B 2 2  ? -3.017  13.709  -5.528  1.00 0.00 ? 26  THR B CA   10 
ATOM 8150  C C    . THR B 2 2  ? -3.590  13.331  -4.162  1.00 0.00 ? 26  THR B C    10 
ATOM 8151  O O    . THR B 2 2  ? -2.979  13.611  -3.131  1.00 0.00 ? 26  THR B O    10 
ATOM 8152  C CB   . THR B 2 2  ? -1.896  12.718  -5.893  1.00 0.00 ? 26  THR B CB   10 
ATOM 8153  O OG1  . THR B 2 2  ? -0.793  12.872  -4.990  1.00 0.00 ? 26  THR B OG1  10 
ATOM 8154  C CG2  . THR B 2 2  ? -1.422  12.936  -7.321  1.00 0.00 ? 26  THR B CG2  10 
ATOM 8155  H H    . THR B 2 2  ? -1.569  15.253  -5.538  1.00 0.00 ? 26  THR B H    10 
ATOM 8156  H HA   . THR B 2 2  ? -3.795  13.630  -6.273  1.00 0.00 ? 26  THR B HA   10 
ATOM 8157  H HB   . THR B 2 2  ? -2.283  11.713  -5.807  1.00 0.00 ? 26  THR B HB   10 
ATOM 8158  H HG1  . THR B 2 2  ? -0.603  12.030  -4.572  1.00 0.00 ? 26  THR B HG1  10 
ATOM 8159  H HG21 . THR B 2 2  ? -2.254  12.809  -8.000  1.00 0.00 ? 26  THR B HG21 10 
ATOM 8160  H HG22 . THR B 2 2  ? -0.652  12.217  -7.560  1.00 0.00 ? 26  THR B HG22 10 
ATOM 8161  H HG23 . THR B 2 2  ? -1.026  13.935  -7.422  1.00 0.00 ? 26  THR B HG23 10 
ATOM 8162  N N    . PRO B 2 3  ? -4.777  12.690  -4.135  1.00 0.00 ? 27  PRO B N    10 
ATOM 8163  C CA   . PRO B 2 3  ? -5.431  12.278  -2.910  1.00 0.00 ? 27  PRO B CA   10 
ATOM 8164  C C    . PRO B 2 3  ? -5.165  10.815  -2.591  1.00 0.00 ? 27  PRO B C    10 
ATOM 8165  O O    . PRO B 2 3  ? -4.176  10.242  -3.051  1.00 0.00 ? 27  PRO B O    10 
ATOM 8166  C CB   . PRO B 2 3  ? -6.903  12.493  -3.256  1.00 0.00 ? 27  PRO B CB   10 
ATOM 8167  C CG   . PRO B 2 3  ? -6.998  12.280  -4.740  1.00 0.00 ? 27  PRO B CG   10 
ATOM 8168  C CD   . PRO B 2 3  ? -5.591  12.308  -5.296  1.00 0.00 ? 27  PRO B CD   10 
ATOM 8169  H HA   . PRO B 2 3  ? -5.156  12.896  -2.070  1.00 0.00 ? 27  PRO B HA   10 
ATOM 8170  H HB2  . PRO B 2 3  ? -7.509  11.781  -2.715  1.00 0.00 ? 27  PRO B HB2  10 
ATOM 8171  H HB3  . PRO B 2 3  ? -7.194  13.496  -2.985  1.00 0.00 ? 27  PRO B HB3  10 
ATOM 8172  H HG2  . PRO B 2 3  ? -7.455  11.323  -4.941  1.00 0.00 ? 27  PRO B HG2  10 
ATOM 8173  H HG3  . PRO B 2 3  ? -7.588  13.070  -5.182  1.00 0.00 ? 27  PRO B HG3  10 
ATOM 8174  H HD2  . PRO B 2 3  ? -5.310  11.329  -5.658  1.00 0.00 ? 27  PRO B HD2  10 
ATOM 8175  H HD3  . PRO B 2 3  ? -5.511  13.042  -6.083  1.00 0.00 ? 27  PRO B HD3  10 
ATOM 8176  N N    . GLU B 2 4  ? -6.045  10.215  -1.803  1.00 0.00 ? 28  GLU B N    10 
ATOM 8177  C CA   . GLU B 2 4  ? -5.898  8.812   -1.449  1.00 0.00 ? 28  GLU B CA   10 
ATOM 8178  C C    . GLU B 2 4  ? -6.442  7.930   -2.550  1.00 0.00 ? 28  GLU B C    10 
ATOM 8179  O O    . GLU B 2 4  ? -7.522  7.349   -2.438  1.00 0.00 ? 28  GLU B O    10 
ATOM 8180  C CB   . GLU B 2 4  ? -6.592  8.493   -0.134  1.00 0.00 ? 28  GLU B CB   10 
ATOM 8181  C CG   . GLU B 2 4  ? -7.926  9.196   0.053   1.00 0.00 ? 28  GLU B CG   10 
ATOM 8182  C CD   . GLU B 2 4  ? -8.688  8.683   1.259   1.00 0.00 ? 28  GLU B CD   10 
ATOM 8183  O OE1  . GLU B 2 4  ? -9.338  7.622   1.143   1.00 0.00 ? 28  GLU B OE1  10 
ATOM 8184  O OE2  . GLU B 2 4  ? -8.638  9.342   2.318   1.00 0.00 ? 28  GLU B OE2  10 
ATOM 8185  H H    . GLU B 2 4  ? -6.803  10.725  -1.453  1.00 0.00 ? 28  GLU B H    10 
ATOM 8186  H HA   . GLU B 2 4  ? -4.843  8.613   -1.341  1.00 0.00 ? 28  GLU B HA   10 
ATOM 8187  H HB2  . GLU B 2 4  ? -6.762  7.428   -0.081  1.00 0.00 ? 28  GLU B HB2  10 
ATOM 8188  H HB3  . GLU B 2 4  ? -5.936  8.781   0.662   1.00 0.00 ? 28  GLU B HB3  10 
ATOM 8189  H HG2  . GLU B 2 4  ? -7.745  10.250  0.186   1.00 0.00 ? 28  GLU B HG2  10 
ATOM 8190  H HG3  . GLU B 2 4  ? -8.528  9.043   -0.829  1.00 0.00 ? 28  GLU B HG3  10 
ATOM 8191  N N    . MET B 2 5  ? -5.674  7.841   -3.615  1.00 0.00 ? 29  MET B N    10 
ATOM 8192  C CA   . MET B 2 5  ? -6.050  7.031   -4.764  1.00 0.00 ? 29  MET B CA   10 
ATOM 8193  C C    . MET B 2 5  ? -5.733  5.575   -4.492  1.00 0.00 ? 29  MET B C    10 
ATOM 8194  O O    . MET B 2 5  ? -4.573  5.187   -4.348  1.00 0.00 ? 29  MET B O    10 
ATOM 8195  C CB   . MET B 2 5  ? -5.327  7.493   -6.020  1.00 0.00 ? 29  MET B CB   10 
ATOM 8196  C CG   . MET B 2 5  ? -6.168  7.385   -7.282  1.00 0.00 ? 29  MET B CG   10 
ATOM 8197  S SD   . MET B 2 5  ? -5.225  7.735   -8.780  1.00 0.00 ? 29  MET B SD   10 
ATOM 8198  C CE   . MET B 2 5  ? -4.682  9.411   -8.458  1.00 0.00 ? 29  MET B CE   10 
ATOM 8199  H H    . MET B 2 5  ? -4.823  8.324   -3.618  1.00 0.00 ? 29  MET B H    10 
ATOM 8200  H HA   . MET B 2 5  ? -7.115  7.129   -4.907  1.00 0.00 ? 29  MET B HA   10 
ATOM 8201  H HB2  . MET B 2 5  ? -5.025  8.526   -5.897  1.00 0.00 ? 29  MET B HB2  10 
ATOM 8202  H HB3  . MET B 2 5  ? -4.452  6.879   -6.147  1.00 0.00 ? 29  MET B HB3  10 
ATOM 8203  H HG2  . MET B 2 5  ? -6.563  6.382   -7.350  1.00 0.00 ? 29  MET B HG2  10 
ATOM 8204  H HG3  . MET B 2 5  ? -6.986  8.087   -7.215  1.00 0.00 ? 29  MET B HG3  10 
ATOM 8205  H HE1  . MET B 2 5  ? -4.043  9.421   -7.587  1.00 0.00 ? 29  MET B HE1  10 
ATOM 8206  H HE2  . MET B 2 5  ? -5.542  10.039  -8.281  1.00 0.00 ? 29  MET B HE2  10 
ATOM 8207  H HE3  . MET B 2 5  ? -4.134  9.780   -9.311  1.00 0.00 ? 29  MET B HE3  10 
ATOM 8208  N N    . ARG B 2 6  ? -6.778  4.780   -4.427  1.00 0.00 ? 30  ARG B N    10 
ATOM 8209  C CA   . ARG B 2 6  ? -6.648  3.361   -4.149  1.00 0.00 ? 30  ARG B CA   10 
ATOM 8210  C C    . ARG B 2 6  ? -6.236  2.573   -5.384  1.00 0.00 ? 30  ARG B C    10 
ATOM 8211  O O    . ARG B 2 6  ? -6.349  3.048   -6.513  1.00 0.00 ? 30  ARG B O    10 
ATOM 8212  C CB   . ARG B 2 6  ? -7.948  2.814   -3.577  1.00 0.00 ? 30  ARG B CB   10 
ATOM 8213  C CG   . ARG B 2 6  ? -7.925  2.742   -2.066  1.00 0.00 ? 30  ARG B CG   10 
ATOM 8214  C CD   . ARG B 2 6  ? -8.561  1.474   -1.557  1.00 0.00 ? 30  ARG B CD   10 
ATOM 8215  N NE   . ARG B 2 6  ? -8.542  1.411   -0.101  1.00 0.00 ? 30  ARG B NE   10 
ATOM 8216  C CZ   . ARG B 2 6  ? -8.975  0.371   0.604   1.00 0.00 ? 30  ARG B CZ   10 
ATOM 8217  N NH1  . ARG B 2 6  ? -9.463  -0.697  -0.014  1.00 0.00 ? 30  ARG B NH1  10 
ATOM 8218  N NH2  . ARG B 2 6  ? -8.922  0.397   1.929   1.00 0.00 ? 30  ARG B NH2  10 
ATOM 8219  H H    . ARG B 2 6  ? -7.663  5.156   -4.588  1.00 0.00 ? 30  ARG B H    10 
ATOM 8220  H HA   . ARG B 2 6  ? -5.879  3.246   -3.400  1.00 0.00 ? 30  ARG B HA   10 
ATOM 8221  H HB2  . ARG B 2 6  ? -8.762  3.457   -3.875  1.00 0.00 ? 30  ARG B HB2  10 
ATOM 8222  H HB3  . ARG B 2 6  ? -8.114  1.825   -3.966  1.00 0.00 ? 30  ARG B HB3  10 
ATOM 8223  H HG2  . ARG B 2 6  ? -6.899  2.775   -1.731  1.00 0.00 ? 30  ARG B HG2  10 
ATOM 8224  H HG3  . ARG B 2 6  ? -8.461  3.590   -1.666  1.00 0.00 ? 30  ARG B HG3  10 
ATOM 8225  H HD2  . ARG B 2 6  ? -9.582  1.440   -1.896  1.00 0.00 ? 30  ARG B HD2  10 
ATOM 8226  H HD3  . ARG B 2 6  ? -8.015  0.635   -1.954  1.00 0.00 ? 30  ARG B HD3  10 
ATOM 8227  H HE   . ARG B 2 6  ? -8.185  2.187   0.376   1.00 0.00 ? 30  ARG B HE   10 
ATOM 8228  H HH11 . ARG B 2 6  ? -9.504  -0.721  -1.012  1.00 0.00 ? 30  ARG B HH11 10 
ATOM 8229  H HH12 . ARG B 2 6  ? -9.787  -1.477  0.519   1.00 0.00 ? 30  ARG B HH12 10 
ATOM 8230  H HH21 . ARG B 2 6  ? -8.554  1.200   2.399   1.00 0.00 ? 30  ARG B HH21 10 
ATOM 8231  H HH22 . ARG B 2 6  ? -9.249  -0.385  2.460   1.00 0.00 ? 30  ARG B HH22 10 
ATOM 8232  N N    . GLU B 2 7  ? -5.762  1.358   -5.142  1.00 0.00 ? 31  GLU B N    10 
ATOM 8233  C CA   . GLU B 2 7  ? -5.312  0.467   -6.202  1.00 0.00 ? 31  GLU B CA   10 
ATOM 8234  C C    . GLU B 2 7  ? -4.906  -0.866  -5.617  1.00 0.00 ? 31  GLU B C    10 
ATOM 8235  O O    . GLU B 2 7  ? -4.289  -0.928  -4.560  1.00 0.00 ? 31  GLU B O    10 
ATOM 8236  C CB   . GLU B 2 7  ? -4.136  1.081   -6.955  1.00 0.00 ? 31  GLU B CB   10 
ATOM 8237  C CG   . GLU B 2 7  ? -3.509  0.137   -7.966  1.00 0.00 ? 31  GLU B CG   10 
ATOM 8238  C CD   . GLU B 2 7  ? -4.293  0.062   -9.262  1.00 0.00 ? 31  GLU B CD   10 
ATOM 8239  O OE1  . GLU B 2 7  ? -4.021  0.878   -10.168 1.00 0.00 ? 31  GLU B OE1  10 
ATOM 8240  O OE2  . GLU B 2 7  ? -5.178  -0.811  -9.370  1.00 0.00 ? 31  GLU B OE2  10 
ATOM 8241  H H    . GLU B 2 7  ? -5.712  1.047   -4.213  1.00 0.00 ? 31  GLU B H    10 
ATOM 8242  H HA   . GLU B 2 7  ? -6.130  0.300   -6.884  1.00 0.00 ? 31  GLU B HA   10 
ATOM 8243  H HB2  . GLU B 2 7  ? -4.477  1.961   -7.480  1.00 0.00 ? 31  GLU B HB2  10 
ATOM 8244  H HB3  . GLU B 2 7  ? -3.377  1.368   -6.244  1.00 0.00 ? 31  GLU B HB3  10 
ATOM 8245  H HG2  . GLU B 2 7  ? -2.513  0.480   -8.182  1.00 0.00 ? 31  GLU B HG2  10 
ATOM 8246  H HG3  . GLU B 2 7  ? -3.461  -0.852  -7.535  1.00 0.00 ? 31  GLU B HG3  10 
ATOM 8247  N N    . LYS B 2 8  ? -5.258  -1.925  -6.319  1.00 0.00 ? 32  LYS B N    10 
ATOM 8248  C CA   . LYS B 2 8  ? -4.949  -3.264  -5.880  1.00 0.00 ? 32  LYS B CA   10 
ATOM 8249  C C    . LYS B 2 8  ? -3.452  -3.527  -5.914  1.00 0.00 ? 32  LYS B C    10 
ATOM 8250  O O    . LYS B 2 8  ? -2.865  -3.772  -6.968  1.00 0.00 ? 32  LYS B O    10 
ATOM 8251  C CB   . LYS B 2 8  ? -5.702  -4.249  -6.750  1.00 0.00 ? 32  LYS B CB   10 
ATOM 8252  C CG   . LYS B 2 8  ? -7.161  -3.874  -6.907  1.00 0.00 ? 32  LYS B CG   10 
ATOM 8253  C CD   . LYS B 2 8  ? -7.981  -5.032  -7.453  1.00 0.00 ? 32  LYS B CD   10 
ATOM 8254  C CE   . LYS B 2 8  ? -9.465  -4.805  -7.252  1.00 0.00 ? 32  LYS B CE   10 
ATOM 8255  N NZ   . LYS B 2 8  ? -10.274 -5.968  -7.712  1.00 0.00 ? 32  LYS B NZ   10 
ATOM 8256  H H    . LYS B 2 8  ? -5.742  -1.804  -7.160  1.00 0.00 ? 32  LYS B H    10 
ATOM 8257  H HA   . LYS B 2 8  ? -5.295  -3.364  -4.863  1.00 0.00 ? 32  LYS B HA   10 
ATOM 8258  H HB2  . LYS B 2 8  ? -5.245  -4.278  -7.725  1.00 0.00 ? 32  LYS B HB2  10 
ATOM 8259  H HB3  . LYS B 2 8  ? -5.648  -5.218  -6.301  1.00 0.00 ? 32  LYS B HB3  10 
ATOM 8260  H HG2  . LYS B 2 8  ? -7.550  -3.583  -5.943  1.00 0.00 ? 32  LYS B HG2  10 
ATOM 8261  H HG3  . LYS B 2 8  ? -7.234  -3.038  -7.583  1.00 0.00 ? 32  LYS B HG3  10 
ATOM 8262  H HD2  . LYS B 2 8  ? -7.786  -5.131  -8.506  1.00 0.00 ? 32  LYS B HD2  10 
ATOM 8263  H HD3  . LYS B 2 8  ? -7.690  -5.937  -6.942  1.00 0.00 ? 32  LYS B HD3  10 
ATOM 8264  H HE2  . LYS B 2 8  ? -9.644  -4.644  -6.205  1.00 0.00 ? 32  LYS B HE2  10 
ATOM 8265  H HE3  . LYS B 2 8  ? -9.761  -3.927  -7.807  1.00 0.00 ? 32  LYS B HE3  10 
ATOM 8266  H HZ1  . LYS B 2 8  ? -9.971  -6.831  -7.218  1.00 0.00 ? 32  LYS B HZ1  10 
ATOM 8267  H HZ2  . LYS B 2 8  ? -10.151 -6.108  -8.735  1.00 0.00 ? 32  LYS B HZ2  10 
ATOM 8268  H HZ3  . LYS B 2 8  ? -11.281 -5.803  -7.514  1.00 0.00 ? 32  LYS B HZ3  10 
ATOM 8269  N N    . LEU B 2 9  ? -2.854  -3.467  -4.736  1.00 0.00 ? 33  LEU B N    10 
ATOM 8270  C CA   . LEU B 2 9  ? -1.431  -3.684  -4.565  1.00 0.00 ? 33  LEU B CA   10 
ATOM 8271  C C    . LEU B 2 9  ? -1.138  -5.109  -4.137  1.00 0.00 ? 33  LEU B C    10 
ATOM 8272  O O    . LEU B 2 9  ? -1.216  -5.448  -2.957  1.00 0.00 ? 33  LEU B O    10 
ATOM 8273  C CB   . LEU B 2 9  ? -0.902  -2.708  -3.547  1.00 0.00 ? 33  LEU B CB   10 
ATOM 8274  C CG   . LEU B 2 9  ? -1.545  -1.336  -3.607  1.00 0.00 ? 33  LEU B CG   10 
ATOM 8275  C CD1  . LEU B 2 9  ? -1.082  -0.465  -2.453  1.00 0.00 ? 33  LEU B CD1  10 
ATOM 8276  C CD2  . LEU B 2 9  ? -1.239  -0.681  -4.948  1.00 0.00 ? 33  LEU B CD2  10 
ATOM 8277  H H    . LEU B 2 9  ? -3.393  -3.255  -3.952  1.00 0.00 ? 33  LEU B H    10 
ATOM 8278  H HA   . LEU B 2 9  ? -0.936  -3.487  -5.493  1.00 0.00 ? 33  LEU B HA   10 
ATOM 8279  H HB2  . LEU B 2 9  ? -1.039  -3.118  -2.560  1.00 0.00 ? 33  LEU B HB2  10 
ATOM 8280  H HB3  . LEU B 2 9  ? 0.137   -2.593  -3.734  1.00 0.00 ? 33  LEU B HB3  10 
ATOM 8281  H HG   . LEU B 2 9  ? -2.610  -1.454  -3.526  1.00 0.00 ? 33  LEU B HG   10 
ATOM 8282  H HD11 . LEU B 2 9  ? -1.910  0.130   -2.096  1.00 0.00 ? 33  LEU B HD11 10 
ATOM 8283  H HD12 . LEU B 2 9  ? -0.292  0.187   -2.786  1.00 0.00 ? 33  LEU B HD12 10 
ATOM 8284  H HD13 . LEU B 2 9  ? -0.719  -1.091  -1.651  1.00 0.00 ? 33  LEU B HD13 10 
ATOM 8285  H HD21 . LEU B 2 9  ? -2.112  -0.152  -5.299  1.00 0.00 ? 33  LEU B HD21 10 
ATOM 8286  H HD22 . LEU B 2 9  ? -0.963  -1.446  -5.669  1.00 0.00 ? 33  LEU B HD22 10 
ATOM 8287  H HD23 . LEU B 2 9  ? -0.420  0.012   -4.831  1.00 0.00 ? 33  LEU B HD23 10 
ATOM 8288  N N    . CYS B 2 10 ? -0.804  -5.942  -5.112  1.00 0.00 ? 34  CYS B N    10 
ATOM 8289  C CA   . CYS B 2 10 ? -0.505  -7.339  -4.848  1.00 0.00 ? 34  CYS B CA   10 
ATOM 8290  C C    . CYS B 2 10 ? 0.990   -7.566  -4.747  1.00 0.00 ? 34  CYS B C    10 
ATOM 8291  O O    . CYS B 2 10 ? 1.660   -7.878  -5.731  1.00 0.00 ? 34  CYS B O    10 
ATOM 8292  C CB   . CYS B 2 10 ? -1.102  -8.221  -5.928  1.00 0.00 ? 34  CYS B CB   10 
ATOM 8293  S SG   . CYS B 2 10 ? -1.555  -9.890  -5.355  1.00 0.00 ? 34  CYS B SG   10 
ATOM 8294  H H    . CYS B 2 10 ? -0.755  -5.605  -6.033  1.00 0.00 ? 34  CYS B H    10 
ATOM 8295  H HA   . CYS B 2 10 ? -0.952  -7.594  -3.901  1.00 0.00 ? 34  CYS B HA   10 
ATOM 8296  H HB2  . CYS B 2 10 ? -1.992  -7.747  -6.294  1.00 0.00 ? 34  CYS B HB2  10 
ATOM 8297  H HB3  . CYS B 2 10 ? -0.393  -8.325  -6.737  1.00 0.00 ? 34  CYS B HB3  10 
ATOM 8298  N N    . GLY B 2 11 ? 1.492   -7.410  -3.538  1.00 0.00 ? 35  GLY B N    10 
ATOM 8299  C CA   . GLY B 2 11 ? 2.908   -7.585  -3.277  1.00 0.00 ? 35  GLY B CA   10 
ATOM 8300  C C    . GLY B 2 11 ? 3.765   -6.563  -3.998  1.00 0.00 ? 35  GLY B C    10 
ATOM 8301  O O    . GLY B 2 11 ? 4.228   -5.609  -3.384  1.00 0.00 ? 35  GLY B O    10 
ATOM 8302  H H    . GLY B 2 11 ? 0.885   -7.177  -2.808  1.00 0.00 ? 35  GLY B H    10 
ATOM 8303  H HA2  . GLY B 2 11 ? 3.078   -7.489  -2.215  1.00 0.00 ? 35  GLY B HA2  10 
ATOM 8304  H HA3  . GLY B 2 11 ? 3.203   -8.571  -3.584  1.00 0.00 ? 35  GLY B HA3  10 
ATOM 8305  N N    . HIS B 2 12 ? 3.993   -6.762  -5.298  1.00 0.00 ? 36  HIS B N    10 
ATOM 8306  C CA   . HIS B 2 12 ? 4.799   -5.838  -6.071  1.00 0.00 ? 36  HIS B CA   10 
ATOM 8307  C C    . HIS B 2 12 ? 4.127   -4.477  -6.199  1.00 0.00 ? 36  HIS B C    10 
ATOM 8308  O O    . HIS B 2 12 ? 4.741   -3.464  -5.898  1.00 0.00 ? 36  HIS B O    10 
ATOM 8309  C CB   . HIS B 2 12 ? 5.125   -6.402  -7.445  1.00 0.00 ? 36  HIS B CB   10 
ATOM 8310  C CG   . HIS B 2 12 ? 6.415   -5.872  -7.966  1.00 0.00 ? 36  HIS B CG   10 
ATOM 8311  N ND1  . HIS B 2 12 ? 6.870   -6.062  -9.247  1.00 0.00 ? 36  HIS B ND1  10 
ATOM 8312  C CD2  . HIS B 2 12 ? 7.358   -5.129  -7.332  1.00 0.00 ? 36  HIS B CD2  10 
ATOM 8313  C CE1  . HIS B 2 12 ? 8.052   -5.443  -9.357  1.00 0.00 ? 36  HIS B CE1  10 
ATOM 8314  N NE2  . HIS B 2 12 ? 8.397   -4.862  -8.221  1.00 0.00 ? 36  HIS B NE2  10 
ATOM 8315  H H    . HIS B 2 12 ? 3.636   -7.552  -5.735  1.00 0.00 ? 36  HIS B H    10 
ATOM 8316  H HA   . HIS B 2 12 ? 5.724   -5.703  -5.531  1.00 0.00 ? 36  HIS B HA   10 
ATOM 8317  H HB2  . HIS B 2 12 ? 5.199   -7.478  -7.385  1.00 0.00 ? 36  HIS B HB2  10 
ATOM 8318  H HB3  . HIS B 2 12 ? 4.343   -6.131  -8.141  1.00 0.00 ? 36  HIS B HB3  10 
ATOM 8319  H HD1  . HIS B 2 12 ? 6.411   -6.560  -9.955  1.00 0.00 ? 36  HIS B HD1  10 
ATOM 8320  H HD2  . HIS B 2 12 ? 7.307   -4.784  -6.300  1.00 0.00 ? 36  HIS B HD2  10 
ATOM 8321  H HE1  . HIS B 2 12 ? 8.634   -5.408  -10.261 1.00 0.00 ? 36  HIS B HE1  10 
ATOM 8322  N N    . HIS B 2 13 ? 2.887   -4.432  -6.682  1.00 0.00 ? 37  HIS B N    10 
ATOM 8323  C CA   . HIS B 2 13 ? 2.186   -3.153  -6.763  1.00 0.00 ? 37  HIS B CA   10 
ATOM 8324  C C    . HIS B 2 13 ? 2.211   -2.542  -5.394  1.00 0.00 ? 37  HIS B C    10 
ATOM 8325  O O    . HIS B 2 13 ? 2.279   -1.329  -5.218  1.00 0.00 ? 37  HIS B O    10 
ATOM 8326  C CB   . HIS B 2 13 ? 0.737   -3.328  -7.184  1.00 0.00 ? 37  HIS B CB   10 
ATOM 8327  C CG   . HIS B 2 13 ? 0.555   -3.432  -8.648  1.00 0.00 ? 37  HIS B CG   10 
ATOM 8328  N ND1  . HIS B 2 13 ? -0.414  -2.759  -9.347  1.00 0.00 ? 37  HIS B ND1  10 
ATOM 8329  C CD2  . HIS B 2 13 ? 1.250   -4.153  -9.548  1.00 0.00 ? 37  HIS B CD2  10 
ATOM 8330  C CE1  . HIS B 2 13 ? -0.285  -3.085  -10.634 1.00 0.00 ? 37  HIS B CE1  10 
ATOM 8331  N NE2  . HIS B 2 13 ? 0.714   -3.932  -10.816 1.00 0.00 ? 37  HIS B NE2  10 
ATOM 8332  H H    . HIS B 2 13 ? 2.446   -5.254  -6.983  1.00 0.00 ? 37  HIS B H    10 
ATOM 8333  H HA   . HIS B 2 13 ? 2.706   -2.510  -7.461  1.00 0.00 ? 37  HIS B HA   10 
ATOM 8334  H HB2  . HIS B 2 13 ? 0.344   -4.227  -6.735  1.00 0.00 ? 37  HIS B HB2  10 
ATOM 8335  H HB3  . HIS B 2 13 ? 0.168   -2.475  -6.834  1.00 0.00 ? 37  HIS B HB3  10 
ATOM 8336  H HD1  . HIS B 2 13 ? -1.081  -2.151  -8.969  1.00 0.00 ? 37  HIS B HD1  10 
ATOM 8337  H HD2  . HIS B 2 13 ? 2.089   -4.794  -9.322  1.00 0.00 ? 37  HIS B HD2  10 
ATOM 8338  H HE1  . HIS B 2 13 ? -0.915  -2.701  -11.415 1.00 0.00 ? 37  HIS B HE1  10 
ATOM 8339  N N    . PHE B 2 14 ? 2.141   -3.433  -4.428  1.00 0.00 ? 38  PHE B N    10 
ATOM 8340  C CA   . PHE B 2 14 ? 2.168   -3.071  -3.043  1.00 0.00 ? 38  PHE B CA   10 
ATOM 8341  C C    . PHE B 2 14 ? 3.557   -2.616  -2.664  1.00 0.00 ? 38  PHE B C    10 
ATOM 8342  O O    . PHE B 2 14 ? 3.741   -1.821  -1.748  1.00 0.00 ? 38  PHE B O    10 
ATOM 8343  C CB   . PHE B 2 14 ? 1.718   -4.267  -2.215  1.00 0.00 ? 38  PHE B CB   10 
ATOM 8344  C CG   . PHE B 2 14 ? 1.899   -4.041  -0.768  1.00 0.00 ? 38  PHE B CG   10 
ATOM 8345  C CD1  . PHE B 2 14 ? 1.323   -2.935  -0.188  1.00 0.00 ? 38  PHE B CD1  10 
ATOM 8346  C CD2  . PHE B 2 14 ? 2.668   -4.898  0.001   1.00 0.00 ? 38  PHE B CD2  10 
ATOM 8347  C CE1  . PHE B 2 14 ? 1.505   -2.677  1.152   1.00 0.00 ? 38  PHE B CE1  10 
ATOM 8348  C CE2  . PHE B 2 14 ? 2.862   -4.647  1.343   1.00 0.00 ? 38  PHE B CE2  10 
ATOM 8349  C CZ   . PHE B 2 14 ? 2.280   -3.530  1.922   1.00 0.00 ? 38  PHE B CZ   10 
ATOM 8350  H H    . PHE B 2 14 ? 2.067   -4.380  -4.667  1.00 0.00 ? 38  PHE B H    10 
ATOM 8351  H HA   . PHE B 2 14 ? 1.482   -2.252  -2.893  1.00 0.00 ? 38  PHE B HA   10 
ATOM 8352  H HB2  . PHE B 2 14 ? 0.670   -4.450  -2.395  1.00 0.00 ? 38  PHE B HB2  10 
ATOM 8353  H HB3  . PHE B 2 14 ? 2.285   -5.136  -2.502  1.00 0.00 ? 38  PHE B HB3  10 
ATOM 8354  H HD1  . PHE B 2 14 ? 0.709   -2.276  -0.804  1.00 0.00 ? 38  PHE B HD1  10 
ATOM 8355  H HD2  . PHE B 2 14 ? 3.118   -5.770  -0.463  1.00 0.00 ? 38  PHE B HD2  10 
ATOM 8356  H HE1  . PHE B 2 14 ? 1.052   -1.807  1.595   1.00 0.00 ? 38  PHE B HE1  10 
ATOM 8357  H HE2  . PHE B 2 14 ? 3.458   -5.324  1.939   1.00 0.00 ? 38  PHE B HE2  10 
ATOM 8358  H HZ   . PHE B 2 14 ? 2.433   -3.323  2.974   1.00 0.00 ? 38  PHE B HZ   10 
ATOM 8359  N N    . VAL B 2 15 ? 4.526   -3.131  -3.392  1.00 0.00 ? 39  VAL B N    10 
ATOM 8360  C CA   . VAL B 2 15 ? 5.913   -2.786  -3.189  1.00 0.00 ? 39  VAL B CA   10 
ATOM 8361  C C    . VAL B 2 15 ? 6.173   -1.378  -3.716  1.00 0.00 ? 39  VAL B C    10 
ATOM 8362  O O    . VAL B 2 15 ? 6.509   -0.485  -2.944  1.00 0.00 ? 39  VAL B O    10 
ATOM 8363  C CB   . VAL B 2 15 ? 6.828   -3.848  -3.863  1.00 0.00 ? 39  VAL B CB   10 
ATOM 8364  C CG1  . VAL B 2 15 ? 8.163   -3.281  -4.305  1.00 0.00 ? 39  VAL B CG1  10 
ATOM 8365  C CG2  . VAL B 2 15 ? 7.051   -5.022  -2.926  1.00 0.00 ? 39  VAL B CG2  10 
ATOM 8366  H H    . VAL B 2 15 ? 4.297   -3.774  -4.092  1.00 0.00 ? 39  VAL B H    10 
ATOM 8367  H HA   . VAL B 2 15 ? 6.096   -2.787  -2.127  1.00 0.00 ? 39  VAL B HA   10 
ATOM 8368  H HB   . VAL B 2 15 ? 6.321   -4.220  -4.739  1.00 0.00 ? 39  VAL B HB   10 
ATOM 8369  H HG11 . VAL B 2 15 ? 8.837   -3.257  -3.467  1.00 0.00 ? 39  VAL B HG11 10 
ATOM 8370  H HG12 . VAL B 2 15 ? 8.025   -2.290  -4.684  1.00 0.00 ? 39  VAL B HG12 10 
ATOM 8371  H HG13 . VAL B 2 15 ? 8.580   -3.907  -5.081  1.00 0.00 ? 39  VAL B HG13 10 
ATOM 8372  H HG21 . VAL B 2 15 ? 6.205   -5.118  -2.261  1.00 0.00 ? 39  VAL B HG21 10 
ATOM 8373  H HG22 . VAL B 2 15 ? 7.948   -4.856  -2.351  1.00 0.00 ? 39  VAL B HG22 10 
ATOM 8374  H HG23 . VAL B 2 15 ? 7.157   -5.927  -3.504  1.00 0.00 ? 39  VAL B HG23 10 
ATOM 8375  N N    . ARG B 2 16 ? 5.989   -1.173  -5.021  1.00 0.00 ? 40  ARG B N    10 
ATOM 8376  C CA   . ARG B 2 16 ? 6.195   0.138   -5.620  1.00 0.00 ? 40  ARG B CA   10 
ATOM 8377  C C    . ARG B 2 16 ? 5.270   1.186   -5.028  1.00 0.00 ? 40  ARG B C    10 
ATOM 8378  O O    . ARG B 2 16 ? 5.712   2.290   -4.789  1.00 0.00 ? 40  ARG B O    10 
ATOM 8379  C CB   . ARG B 2 16 ? 5.981   0.086   -7.129  1.00 0.00 ? 40  ARG B CB   10 
ATOM 8380  C CG   . ARG B 2 16 ? 6.854   -0.922  -7.838  1.00 0.00 ? 40  ARG B CG   10 
ATOM 8381  C CD   . ARG B 2 16 ? 6.065   -2.158  -8.195  1.00 0.00 ? 40  ARG B CD   10 
ATOM 8382  N NE   . ARG B 2 16 ? 6.533   -2.774  -9.432  1.00 0.00 ? 40  ARG B NE   10 
ATOM 8383  C CZ   . ARG B 2 16 ? 5.735   -3.398  -10.295 1.00 0.00 ? 40  ARG B CZ   10 
ATOM 8384  N NH1  . ARG B 2 16 ? 4.437   -3.504  -10.043 1.00 0.00 ? 40  ARG B NH1  10 
ATOM 8385  N NH2  . ARG B 2 16 ? 6.235   -3.920  -11.405 1.00 0.00 ? 40  ARG B NH2  10 
ATOM 8386  H H    . ARG B 2 16 ? 5.728   -1.920  -5.597  1.00 0.00 ? 40  ARG B H    10 
ATOM 8387  H HA   . ARG B 2 16 ? 7.221   0.443   -5.416  1.00 0.00 ? 40  ARG B HA   10 
ATOM 8388  H HB2  . ARG B 2 16 ? 4.949   -0.172  -7.323  1.00 0.00 ? 40  ARG B HB2  10 
ATOM 8389  H HB3  . ARG B 2 16 ? 6.182   1.063   -7.545  1.00 0.00 ? 40  ARG B HB3  10 
ATOM 8390  H HG2  . ARG B 2 16 ? 7.236   -0.484  -8.738  1.00 0.00 ? 40  ARG B HG2  10 
ATOM 8391  H HG3  . ARG B 2 16 ? 7.670   -1.201  -7.190  1.00 0.00 ? 40  ARG B HG3  10 
ATOM 8392  H HD2  . ARG B 2 16 ? 6.167   -2.861  -7.389  1.00 0.00 ? 40  ARG B HD2  10 
ATOM 8393  H HD3  . ARG B 2 16 ? 5.026   -1.887  -8.307  1.00 0.00 ? 40  ARG B HD3  10 
ATOM 8394  H HE   . ARG B 2 16 ? 7.490   -2.715  -9.635  1.00 0.00 ? 40  ARG B HE   10 
ATOM 8395  H HH11 . ARG B 2 16 ? 4.055   -3.113  -9.206  1.00 0.00 ? 40  ARG B HH11 10 
ATOM 8396  H HH12 . ARG B 2 16 ? 3.838   -3.973  -10.692 1.00 0.00 ? 40  ARG B HH12 10 
ATOM 8397  H HH21 . ARG B 2 16 ? 7.212   -3.843  -11.598 1.00 0.00 ? 40  ARG B HH21 10 
ATOM 8398  H HH22 . ARG B 2 16 ? 5.633   -4.389  -12.052 1.00 0.00 ? 40  ARG B HH22 10 
ATOM 8399  N N    . ALA B 2 17 ? 3.986   0.879   -4.803  1.00 0.00 ? 41  ALA B N    10 
ATOM 8400  C CA   . ALA B 2 17 ? 3.109   1.882   -4.233  1.00 0.00 ? 41  ALA B CA   10 
ATOM 8401  C C    . ALA B 2 17 ? 3.632   2.284   -2.862  1.00 0.00 ? 41  ALA B C    10 
ATOM 8402  O O    . ALA B 2 17 ? 3.653   3.457   -2.525  1.00 0.00 ? 41  ALA B O    10 
ATOM 8403  C CB   . ALA B 2 17 ? 1.665   1.389   -4.158  1.00 0.00 ? 41  ALA B CB   10 
ATOM 8404  H H    . ALA B 2 17 ? 3.633   -0.017  -5.003  1.00 0.00 ? 41  ALA B H    10 
ATOM 8405  H HA   . ALA B 2 17 ? 3.139   2.756   -4.884  1.00 0.00 ? 41  ALA B HA   10 
ATOM 8406  H HB1  . ALA B 2 17 ? 1.000   2.239   -4.119  1.00 0.00 ? 41  ALA B HB1  10 
ATOM 8407  H HB2  . ALA B 2 17 ? 1.522   0.783   -3.273  1.00 0.00 ? 41  ALA B HB2  10 
ATOM 8408  H HB3  . ALA B 2 17 ? 1.441   0.802   -5.037  1.00 0.00 ? 41  ALA B HB3  10 
ATOM 8409  N N    . LEU B 2 18 ? 4.093   1.299   -2.091  1.00 0.00 ? 42  LEU B N    10 
ATOM 8410  C CA   . LEU B 2 18 ? 4.626   1.556   -0.753  1.00 0.00 ? 42  LEU B CA   10 
ATOM 8411  C C    . LEU B 2 18 ? 5.703   2.637   -0.784  1.00 0.00 ? 42  LEU B C    10 
ATOM 8412  O O    . LEU B 2 18 ? 5.699   3.561   0.026   1.00 0.00 ? 42  LEU B O    10 
ATOM 8413  C CB   . LEU B 2 18 ? 5.221   0.266   -0.187  1.00 0.00 ? 42  LEU B CB   10 
ATOM 8414  C CG   . LEU B 2 18 ? 4.822   -0.076  1.246   1.00 0.00 ? 42  LEU B CG   10 
ATOM 8415  C CD1  . LEU B 2 18 ? 5.483   -1.375  1.679   1.00 0.00 ? 42  LEU B CD1  10 
ATOM 8416  C CD2  . LEU B 2 18 ? 5.207   1.056   2.177   1.00 0.00 ? 42  LEU B CD2  10 
ATOM 8417  H H    . LEU B 2 18 ? 4.075   0.371   -2.426  1.00 0.00 ? 42  LEU B H    10 
ATOM 8418  H HA   . LEU B 2 18 ? 3.809   1.882   -0.123  1.00 0.00 ? 42  LEU B HA   10 
ATOM 8419  H HB2  . LEU B 2 18 ? 4.925   -0.548  -0.823  1.00 0.00 ? 42  LEU B HB2  10 
ATOM 8420  H HB3  . LEU B 2 18 ? 6.297   0.351   -0.222  1.00 0.00 ? 42  LEU B HB3  10 
ATOM 8421  H HG   . LEU B 2 18 ? 3.750   -0.207  1.297   1.00 0.00 ? 42  LEU B HG   10 
ATOM 8422  H HD11 . LEU B 2 18 ? 5.066   -2.196  1.114   1.00 0.00 ? 42  LEU B HD11 10 
ATOM 8423  H HD12 . LEU B 2 18 ? 5.308   -1.534  2.730   1.00 0.00 ? 42  LEU B HD12 10 
ATOM 8424  H HD13 . LEU B 2 18 ? 6.545   -1.315  1.496   1.00 0.00 ? 42  LEU B HD13 10 
ATOM 8425  H HD21 . LEU B 2 18 ? 4.382   1.749   2.267   1.00 0.00 ? 42  LEU B HD21 10 
ATOM 8426  H HD22 . LEU B 2 18 ? 6.063   1.566   1.768   1.00 0.00 ? 42  LEU B HD22 10 
ATOM 8427  H HD23 . LEU B 2 18 ? 5.454   0.657   3.151   1.00 0.00 ? 42  LEU B HD23 10 
ATOM 8428  N N    . VAL B 2 19 ? 6.619   2.496   -1.728  1.00 0.00 ? 43  VAL B N    10 
ATOM 8429  C CA   . VAL B 2 19 ? 7.737   3.430   -1.900  1.00 0.00 ? 43  VAL B CA   10 
ATOM 8430  C C    . VAL B 2 19 ? 7.279   4.717   -2.554  1.00 0.00 ? 43  VAL B C    10 
ATOM 8431  O O    . VAL B 2 19 ? 7.588   5.815   -2.090  1.00 0.00 ? 43  VAL B O    10 
ATOM 8432  C CB   . VAL B 2 19 ? 8.852   2.799   -2.765  1.00 0.00 ? 43  VAL B CB   10 
ATOM 8433  C CG1  . VAL B 2 19 ? 10.219  3.099   -2.192  1.00 0.00 ? 43  VAL B CG1  10 
ATOM 8434  C CG2  . VAL B 2 19 ? 8.681   1.312   -2.850  1.00 0.00 ? 43  VAL B CG2  10 
ATOM 8435  H H    . VAL B 2 19 ? 6.541   1.735   -2.332  1.00 0.00 ? 43  VAL B H    10 
ATOM 8436  H HA   . VAL B 2 19 ? 8.131   3.665   -0.925  1.00 0.00 ? 43  VAL B HA   10 
ATOM 8437  H HB   . VAL B 2 19 ? 8.786   3.192   -3.773  1.00 0.00 ? 43  VAL B HB   10 
ATOM 8438  H HG11 . VAL B 2 19 ? 10.942  3.162   -2.992  1.00 0.00 ? 43  VAL B HG11 10 
ATOM 8439  H HG12 . VAL B 2 19 ? 10.490  2.290   -1.519  1.00 0.00 ? 43  VAL B HG12 10 
ATOM 8440  H HG13 . VAL B 2 19 ? 10.190  4.031   -1.648  1.00 0.00 ? 43  VAL B HG13 10 
ATOM 8441  H HG21 . VAL B 2 19 ? 7.772   1.081   -3.382  1.00 0.00 ? 43  VAL B HG21 10 
ATOM 8442  H HG22 . VAL B 2 19 ? 8.636   0.903   -1.845  1.00 0.00 ? 43  VAL B HG22 10 
ATOM 8443  H HG23 . VAL B 2 19 ? 9.523   0.883   -3.374  1.00 0.00 ? 43  VAL B HG23 10 
ATOM 8444  N N    . ARG B 2 20 ? 6.554   4.553   -3.639  1.00 0.00 ? 44  ARG B N    10 
ATOM 8445  C CA   . ARG B 2 20 ? 5.984   5.638   -4.385  1.00 0.00 ? 44  ARG B CA   10 
ATOM 8446  C C    . ARG B 2 20 ? 5.394   6.604   -3.407  1.00 0.00 ? 44  ARG B C    10 
ATOM 8447  O O    . ARG B 2 20 ? 5.487   7.825   -3.535  1.00 0.00 ? 44  ARG B O    10 
ATOM 8448  C CB   . ARG B 2 20 ? 4.927   5.008   -5.267  1.00 0.00 ? 44  ARG B CB   10 
ATOM 8449  C CG   . ARG B 2 20 ? 3.841   5.910   -5.771  1.00 0.00 ? 44  ARG B CG   10 
ATOM 8450  C CD   . ARG B 2 20 ? 2.777   6.097   -4.718  1.00 0.00 ? 44  ARG B CD   10 
ATOM 8451  N NE   . ARG B 2 20 ? 1.530   6.609   -5.278  1.00 0.00 ? 44  ARG B NE   10 
ATOM 8452  C CZ   . ARG B 2 20 ? 1.417   7.789   -5.885  1.00 0.00 ? 44  ARG B CZ   10 
ATOM 8453  N NH1  . ARG B 2 20 ? 2.466   8.597   -5.983  1.00 0.00 ? 44  ARG B NH1  10 
ATOM 8454  N NH2  . ARG B 2 20 ? 0.250   8.166   -6.389  1.00 0.00 ? 44  ARG B NH2  10 
ATOM 8455  H H    . ARG B 2 20 ? 6.362   3.654   -3.938  1.00 0.00 ? 44  ARG B H    10 
ATOM 8456  H HA   . ARG B 2 20 ? 6.732   6.106   -4.983  1.00 0.00 ? 44  ARG B HA   10 
ATOM 8457  H HB2  . ARG B 2 20 ? 5.411   4.586   -6.104  1.00 0.00 ? 44  ARG B HB2  10 
ATOM 8458  H HB3  . ARG B 2 20 ? 4.464   4.214   -4.709  1.00 0.00 ? 44  ARG B HB3  10 
ATOM 8459  H HG2  . ARG B 2 20 ? 4.261   6.867   -6.039  1.00 0.00 ? 44  ARG B HG2  10 
ATOM 8460  H HG3  . ARG B 2 20 ? 3.401   5.439   -6.630  1.00 0.00 ? 44  ARG B HG3  10 
ATOM 8461  H HD2  . ARG B 2 20 ? 2.592   5.141   -4.257  1.00 0.00 ? 44  ARG B HD2  10 
ATOM 8462  H HD3  . ARG B 2 20 ? 3.149   6.781   -3.976  1.00 0.00 ? 44  ARG B HD3  10 
ATOM 8463  H HE   . ARG B 2 20 ? 0.737   6.039   -5.206  1.00 0.00 ? 44  ARG B HE   10 
ATOM 8464  H HH11 . ARG B 2 20 ? 3.347   8.320   -5.600  1.00 0.00 ? 44  ARG B HH11 10 
ATOM 8465  H HH12 . ARG B 2 20 ? 2.374   9.480   -6.441  1.00 0.00 ? 44  ARG B HH12 10 
ATOM 8466  H HH21 . ARG B 2 20 ? -0.546  7.563   -6.315  1.00 0.00 ? 44  ARG B HH21 10 
ATOM 8467  H HH22 . ARG B 2 20 ? 0.165   9.052   -6.843  1.00 0.00 ? 44  ARG B HH22 10 
ATOM 8468  N N    . VAL B 2 21 ? 4.780   5.996   -2.424  1.00 0.00 ? 45  VAL B N    10 
ATOM 8469  C CA   . VAL B 2 21 ? 4.151   6.697   -1.345  1.00 0.00 ? 45  VAL B CA   10 
ATOM 8470  C C    . VAL B 2 21 ? 5.182   7.267   -0.385  1.00 0.00 ? 45  VAL B C    10 
ATOM 8471  O O    . VAL B 2 21 ? 5.297   8.477   -0.197  1.00 0.00 ? 45  VAL B O    10 
ATOM 8472  C CB   . VAL B 2 21 ? 3.255   5.747   -0.533  1.00 0.00 ? 45  VAL B CB   10 
ATOM 8473  C CG1  . VAL B 2 21 ? 2.783   6.396   0.754   1.00 0.00 ? 45  VAL B CG1  10 
ATOM 8474  C CG2  . VAL B 2 21 ? 2.078   5.279   -1.351  1.00 0.00 ? 45  VAL B CG2  10 
ATOM 8475  H H    . VAL B 2 21 ? 4.745   5.017   -2.435  1.00 0.00 ? 45  VAL B H    10 
ATOM 8476  H HA   . VAL B 2 21 ? 3.549   7.479   -1.767  1.00 0.00 ? 45  VAL B HA   10 
ATOM 8477  H HB   . VAL B 2 21 ? 3.840   4.877   -0.267  1.00 0.00 ? 45  VAL B HB   10 
ATOM 8478  H HG11 . VAL B 2 21 ? 3.588   6.969   1.190   1.00 0.00 ? 45  VAL B HG11 10 
ATOM 8479  H HG12 . VAL B 2 21 ? 2.477   5.627   1.448   1.00 0.00 ? 45  VAL B HG12 10 
ATOM 8480  H HG13 . VAL B 2 21 ? 1.947   7.047   0.545   1.00 0.00 ? 45  VAL B HG13 10 
ATOM 8481  H HG21 . VAL B 2 21 ? 1.181   5.739   -0.983  1.00 0.00 ? 45  VAL B HG21 10 
ATOM 8482  H HG22 . VAL B 2 21 ? 2.000   4.206   -1.266  1.00 0.00 ? 45  VAL B HG22 10 
ATOM 8483  H HG23 . VAL B 2 21 ? 2.228   5.548   -2.385  1.00 0.00 ? 45  VAL B HG23 10 
ATOM 8484  N N    . CYS B 2 22 ? 5.926   6.345   0.216   1.00 0.00 ? 46  CYS B N    10 
ATOM 8485  C CA   . CYS B 2 22 ? 6.910   6.670   1.231   1.00 0.00 ? 46  CYS B CA   10 
ATOM 8486  C C    . CYS B 2 22 ? 8.162   5.820   1.100   1.00 0.00 ? 46  CYS B C    10 
ATOM 8487  O O    . CYS B 2 22 ? 9.263   6.332   0.894   1.00 0.00 ? 46  CYS B O    10 
ATOM 8488  C CB   . CYS B 2 22 ? 6.266   6.385   2.577   1.00 0.00 ? 46  CYS B CB   10 
ATOM 8489  S SG   . CYS B 2 22 ? 7.241   6.873   4.034   1.00 0.00 ? 46  CYS B SG   10 
ATOM 8490  H H    . CYS B 2 22 ? 5.808   5.409   -0.039  1.00 0.00 ? 46  CYS B H    10 
ATOM 8491  H HA   . CYS B 2 22 ? 7.159   7.715   1.163   1.00 0.00 ? 46  CYS B HA   10 
ATOM 8492  H HB2  . CYS B 2 22 ? 5.327   6.894   2.617   1.00 0.00 ? 46  CYS B HB2  10 
ATOM 8493  H HB3  . CYS B 2 22 ? 6.085   5.323   2.649   1.00 0.00 ? 46  CYS B HB3  10 
ATOM 8494  N N    . GLY B 2 23 ? 7.974   4.514   1.225   1.00 0.00 ? 47  GLY B N    10 
ATOM 8495  C CA   . GLY B 2 23 ? 9.091   3.592   1.159   1.00 0.00 ? 47  GLY B CA   10 
ATOM 8496  C C    . GLY B 2 23 ? 8.700   2.183   1.541   1.00 0.00 ? 47  GLY B C    10 
ATOM 8497  O O    . GLY B 2 23 ? 8.285   1.394   0.692   1.00 0.00 ? 47  GLY B O    10 
ATOM 8498  H H    . GLY B 2 23 ? 7.055   4.168   1.333   1.00 0.00 ? 47  GLY B H    10 
ATOM 8499  H HA2  . GLY B 2 23 ? 9.483   3.587   0.155   1.00 0.00 ? 47  GLY B HA2  10 
ATOM 8500  H HA3  . GLY B 2 23 ? 9.866   3.932   1.833   1.00 0.00 ? 47  GLY B HA3  10 
ATOM 8501  N N    . GLY B 2 24 ? 8.821   1.871   2.824   1.00 0.00 ? 48  GLY B N    10 
ATOM 8502  C CA   . GLY B 2 24 ? 8.487   0.550   3.305   1.00 0.00 ? 48  GLY B CA   10 
ATOM 8503  C C    . GLY B 2 24 ? 9.659   -0.094  4.015   1.00 0.00 ? 48  GLY B C    10 
ATOM 8504  O O    . GLY B 2 24 ? 10.196  0.469   4.966   1.00 0.00 ? 48  GLY B O    10 
ATOM 8505  H H    . GLY B 2 24 ? 9.151   2.543   3.450   1.00 0.00 ? 48  GLY B H    10 
ATOM 8506  H HA2  . GLY B 2 24 ? 7.654   0.614   3.983   1.00 0.00 ? 48  GLY B HA2  10 
ATOM 8507  H HA3  . GLY B 2 24 ? 8.204   -0.062  2.464   1.00 0.00 ? 48  GLY B HA3  10 
ATOM 8508  N N    . PRO B 2 25 ? 10.072  -1.286  3.578   1.00 0.00 ? 49  PRO B N    10 
ATOM 8509  C CA   . PRO B 2 25 ? 11.207  -1.997  4.165   1.00 0.00 ? 49  PRO B CA   10 
ATOM 8510  C C    . PRO B 2 25 ? 12.528  -1.249  3.949   1.00 0.00 ? 49  PRO B C    10 
ATOM 8511  O O    . PRO B 2 25 ? 12.580  -0.023  4.044   1.00 0.00 ? 49  PRO B O    10 
ATOM 8512  C CB   . PRO B 2 25 ? 11.189  -3.346  3.433   1.00 0.00 ? 49  PRO B CB   10 
ATOM 8513  C CG   . PRO B 2 25 ? 10.475  -3.084  2.160   1.00 0.00 ? 49  PRO B CG   10 
ATOM 8514  C CD   . PRO B 2 25 ? 9.450   -2.043  2.488   1.00 0.00 ? 49  PRO B CD   10 
ATOM 8515  H HA   . PRO B 2 25 ? 11.060  -2.158  5.223   1.00 0.00 ? 49  PRO B HA   10 
ATOM 8516  H HB2  . PRO B 2 25 ? 12.198  -3.687  3.261   1.00 0.00 ? 49  PRO B HB2  10 
ATOM 8517  H HB3  . PRO B 2 25 ? 10.655  -4.063  4.029   1.00 0.00 ? 49  PRO B HB3  10 
ATOM 8518  H HG2  . PRO B 2 25 ? 11.167  -2.713  1.418   1.00 0.00 ? 49  PRO B HG2  10 
ATOM 8519  H HG3  . PRO B 2 25 ? 9.996   -3.987  1.814   1.00 0.00 ? 49  PRO B HG3  10 
ATOM 8520  H HD2  . PRO B 2 25 ? 9.281   -1.413  1.648   1.00 0.00 ? 49  PRO B HD2  10 
ATOM 8521  H HD3  . PRO B 2 25 ? 8.525   -2.485  2.807   1.00 0.00 ? 49  PRO B HD3  10 
ATOM 8522  N N    . ARG B 2 26 ? 13.591  -1.992  3.662   1.00 0.00 ? 50  ARG B N    10 
ATOM 8523  C CA   . ARG B 2 26 ? 14.918  -1.407  3.461   1.00 0.00 ? 50  ARG B CA   10 
ATOM 8524  C C    . ARG B 2 26 ? 15.111  -0.826  2.063   1.00 0.00 ? 50  ARG B C    10 
ATOM 8525  O O    . ARG B 2 26 ? 15.417  0.357   1.908   1.00 0.00 ? 50  ARG B O    10 
ATOM 8526  C CB   . ARG B 2 26 ? 15.972  -2.471  3.670   1.00 0.00 ? 50  ARG B CB   10 
ATOM 8527  C CG   . ARG B 2 26 ? 15.741  -3.340  4.897   1.00 0.00 ? 50  ARG B CG   10 
ATOM 8528  C CD   . ARG B 2 26 ? 16.820  -4.402  5.034   1.00 0.00 ? 50  ARG B CD   10 
ATOM 8529  N NE   . ARG B 2 26 ? 16.628  -5.231  6.221   1.00 0.00 ? 50  ARG B NE   10 
ATOM 8530  C CZ   . ARG B 2 26 ? 17.539  -6.083  6.679   1.00 0.00 ? 50  ARG B CZ   10 
ATOM 8531  N NH1  . ARG B 2 26 ? 18.702  -6.217  6.056   1.00 0.00 ? 50  ARG B NH1  10 
ATOM 8532  N NH2  . ARG B 2 26 ? 17.287  -6.805  7.763   1.00 0.00 ? 50  ARG B NH2  10 
ATOM 8533  H H    . ARG B 2 26 ? 13.488  -2.962  3.584   1.00 0.00 ? 50  ARG B H    10 
ATOM 8534  H HA   . ARG B 2 26 ? 15.059  -0.628  4.190   1.00 0.00 ? 50  ARG B HA   10 
ATOM 8535  H HB2  . ARG B 2 26 ? 15.970  -3.100  2.797   1.00 0.00 ? 50  ARG B HB2  10 
ATOM 8536  H HB3  . ARG B 2 26 ? 16.939  -1.998  3.763   1.00 0.00 ? 50  ARG B HB3  10 
ATOM 8537  H HG2  . ARG B 2 26 ? 15.749  -2.715  5.777   1.00 0.00 ? 50  ARG B HG2  10 
ATOM 8538  H HG3  . ARG B 2 26 ? 14.780  -3.825  4.805   1.00 0.00 ? 50  ARG B HG3  10 
ATOM 8539  H HD2  . ARG B 2 26 ? 16.798  -5.035  4.160   1.00 0.00 ? 50  ARG B HD2  10 
ATOM 8540  H HD3  . ARG B 2 26 ? 17.781  -3.913  5.100   1.00 0.00 ? 50  ARG B HD3  10 
ATOM 8541  H HE   . ARG B 2 26 ? 15.776  -5.147  6.700   1.00 0.00 ? 50  ARG B HE   10 
ATOM 8542  H HH11 . ARG B 2 26 ? 18.896  -5.675  5.239   1.00 0.00 ? 50  ARG B HH11 10 
ATOM 8543  H HH12 . ARG B 2 26 ? 19.385  -6.860  6.403   1.00 0.00 ? 50  ARG B HH12 10 
ATOM 8544  H HH21 . ARG B 2 26 ? 16.413  -6.707  8.237   1.00 0.00 ? 50  ARG B HH21 10 
ATOM 8545  H HH22 . ARG B 2 26 ? 17.973  -7.447  8.107   1.00 0.00 ? 50  ARG B HH22 10 
ATOM 8546  N N    . TRP B 2 27 ? 14.944  -1.683  1.052   1.00 0.00 ? 51  TRP B N    10 
ATOM 8547  C CA   . TRP B 2 27 ? 15.124  -1.315  -0.340  1.00 0.00 ? 51  TRP B CA   10 
ATOM 8548  C C    . TRP B 2 27 ? 16.596  -1.101  -0.686  1.00 0.00 ? 51  TRP B C    10 
ATOM 8549  O O    . TRP B 2 27 ? 16.953  -0.990  -1.860  1.00 0.00 ? 51  TRP B O    10 
ATOM 8550  C CB   . TRP B 2 27 ? 14.328  -0.082  -0.673  1.00 0.00 ? 51  TRP B CB   10 
ATOM 8551  C CG   . TRP B 2 27 ? 12.922  -0.170  -0.216  1.00 0.00 ? 51  TRP B CG   10 
ATOM 8552  C CD1  . TRP B 2 27 ? 12.421  0.168   0.994   1.00 0.00 ? 51  TRP B CD1  10 
ATOM 8553  C CD2  . TRP B 2 27 ? 11.848  -0.657  -0.976  1.00 0.00 ? 51  TRP B CD2  10 
ATOM 8554  N NE1  . TRP B 2 27 ? 11.071  -0.055  1.022   1.00 0.00 ? 51  TRP B NE1  10 
ATOM 8555  C CE2  . TRP B 2 27 ? 10.696  -0.568  -0.186  1.00 0.00 ? 51  TRP B CE2  10 
ATOM 8556  C CE3  . TRP B 2 27 ? 11.756  -1.150  -2.258  1.00 0.00 ? 51  TRP B CE3  10 
ATOM 8557  C CZ2  . TRP B 2 27 ? 9.457   -0.961  -0.651  1.00 0.00 ? 51  TRP B CZ2  10 
ATOM 8558  C CZ3  . TRP B 2 27 ? 10.524  -1.541  -2.721  1.00 0.00 ? 51  TRP B CZ3  10 
ATOM 8559  C CH2  . TRP B 2 27 ? 9.387   -1.441  -1.908  1.00 0.00 ? 51  TRP B CH2  10 
ATOM 8560  H H    . TRP B 2 27 ? 14.650  -2.583  1.246   1.00 0.00 ? 51  TRP B H    10 
ATOM 8561  H HA   . TRP B 2 27 ? 14.740  -2.130  -0.937  1.00 0.00 ? 51  TRP B HA   10 
ATOM 8562  H HB2  . TRP B 2 27 ? 14.778  0.779   -0.225  1.00 0.00 ? 51  TRP B HB2  10 
ATOM 8563  H HB3  . TRP B 2 27 ? 14.318  0.032   -1.734  1.00 0.00 ? 51  TRP B HB3  10 
ATOM 8564  H HD1  . TRP B 2 27 ? 13.010  0.552   1.794   1.00 0.00 ? 51  TRP B HD1  10 
ATOM 8565  H HE1  . TRP B 2 27 ? 10.477  0.121   1.780   1.00 0.00 ? 51  TRP B HE1  10 
ATOM 8566  H HE3  . TRP B 2 27 ? 12.636  -1.227  -2.876  1.00 0.00 ? 51  TRP B HE3  10 
ATOM 8567  H HZ2  . TRP B 2 27 ? 8.567   -0.896  -0.054  1.00 0.00 ? 51  TRP B HZ2  10 
ATOM 8568  H HZ3  . TRP B 2 27 ? 10.431  -1.932  -3.718  1.00 0.00 ? 51  TRP B HZ3  10 
ATOM 8569  H HH2  . TRP B 2 27 ? 8.433   -1.730  -2.298  1.00 0.00 ? 51  TRP B HH2  10 
ATOM 8570  N N    . SER B 2 28 ? 17.443  -1.055  0.343   1.00 0.00 ? 52  SER B N    10 
ATOM 8571  C CA   . SER B 2 28 ? 18.878  -0.850  0.169   1.00 0.00 ? 52  SER B CA   10 
ATOM 8572  C C    . SER B 2 28 ? 19.175  0.505   -0.464  1.00 0.00 ? 52  SER B C    10 
ATOM 8573  O O    . SER B 2 28 ? 18.448  0.964   -1.344  1.00 0.00 ? 52  SER B O    10 
ATOM 8574  C CB   . SER B 2 28 ? 19.465  -1.959  -0.693  1.00 0.00 ? 52  SER B CB   10 
ATOM 8575  O OG   . SER B 2 28 ? 19.276  -3.228  -0.095  1.00 0.00 ? 52  SER B OG   10 
ATOM 8576  H H    . SER B 2 28 ? 17.098  -1.177  1.243   1.00 0.00 ? 52  SER B H    10 
ATOM 8577  H HA   . SER B 2 28 ? 19.338  -0.885  1.145   1.00 0.00 ? 52  SER B HA   10 
ATOM 8578  H HB2  . SER B 2 28 ? 18.975  -1.949  -1.651  1.00 0.00 ? 52  SER B HB2  10 
ATOM 8579  H HB3  . SER B 2 28 ? 20.523  -1.787  -0.825  1.00 0.00 ? 52  SER B HB3  10 
ATOM 8580  H HG   . SER B 2 28 ? 18.677  -3.145  0.652   1.00 0.00 ? 52  SER B HG   10 
ATOM 8581  N N    . THR B 2 29 ? 20.261  1.134   -0.022  1.00 0.00 ? 53  THR B N    10 
ATOM 8582  C CA   . THR B 2 29 ? 20.659  2.437   -0.544  1.00 0.00 ? 53  THR B CA   10 
ATOM 8583  C C    . THR B 2 29 ? 22.159  2.660   -0.375  1.00 0.00 ? 53  THR B C    10 
ATOM 8584  O O    . THR B 2 29 ? 22.825  3.172   -1.274  1.00 0.00 ? 53  THR B O    10 
ATOM 8585  C CB   . THR B 2 29 ? 19.915  3.592   0.159   1.00 0.00 ? 53  THR B CB   10 
ATOM 8586  O OG1  . THR B 2 29 ? 20.127  3.519   1.574   1.00 0.00 ? 53  THR B OG1  10 
ATOM 8587  C CG2  . THR B 2 29 ? 18.422  3.551   -0.134  1.00 0.00 ? 53  THR B CG2  10 
ATOM 8588  H H    . THR B 2 29 ? 20.806  0.711   0.675   1.00 0.00 ? 53  THR B H    10 
ATOM 8589  H HA   . THR B 2 29 ? 20.416  2.463   -1.596  1.00 0.00 ? 53  THR B HA   10 
ATOM 8590  H HB   . THR B 2 29 ? 20.312  4.528   -0.205  1.00 0.00 ? 53  THR B HB   10 
ATOM 8591  H HG1  . THR B 2 29 ? 20.253  4.403   1.925   1.00 0.00 ? 53  THR B HG1  10 
ATOM 8592  H HG21 . THR B 2 29 ? 18.268  3.311   -1.177  1.00 0.00 ? 53  THR B HG21 10 
ATOM 8593  H HG22 . THR B 2 29 ? 17.987  4.515   0.082   1.00 0.00 ? 53  THR B HG22 10 
ATOM 8594  H HG23 . THR B 2 29 ? 17.954  2.798   0.481   1.00 0.00 ? 53  THR B HG23 10 
ATOM 8595  N N    . GLU B 2 30 ? 22.683  2.272   0.785   1.00 0.00 ? 54  GLU B N    10 
ATOM 8596  C CA   . GLU B 2 30 ? 24.103  2.431   1.077   1.00 0.00 ? 54  GLU B CA   10 
ATOM 8597  C C    . GLU B 2 30 ? 24.920  1.286   0.486   1.00 0.00 ? 54  GLU B C    10 
ATOM 8598  O O    . GLU B 2 30 ? 26.012  0.979   0.965   1.00 0.00 ? 54  GLU B O    10 
ATOM 8599  C CB   . GLU B 2 30 ? 24.323  2.504   2.589   1.00 0.00 ? 54  GLU B CB   10 
ATOM 8600  C CG   . GLU B 2 30 ? 23.530  3.610   3.265   1.00 0.00 ? 54  GLU B CG   10 
ATOM 8601  C CD   . GLU B 2 30 ? 23.908  4.991   2.762   1.00 0.00 ? 54  GLU B CD   10 
ATOM 8602  O OE1  . GLU B 2 30 ? 23.327  5.433   1.748   1.00 0.00 ? 54  GLU B OE1  10 
ATOM 8603  O OE2  . GLU B 2 30 ? 24.786  5.628   3.382   1.00 0.00 ? 54  GLU B OE2  10 
ATOM 8604  H H    . GLU B 2 30 ? 22.101  1.870   1.462   1.00 0.00 ? 54  GLU B H    10 
ATOM 8605  H HA   . GLU B 2 30 ? 24.431  3.359   0.631   1.00 0.00 ? 54  GLU B HA   10 
ATOM 8606  H HB2  . GLU B 2 30 ? 24.032  1.561   3.028   1.00 0.00 ? 54  GLU B HB2  10 
ATOM 8607  H HB3  . GLU B 2 30 ? 25.371  2.672   2.780   1.00 0.00 ? 54  GLU B HB3  10 
ATOM 8608  H HG2  . GLU B 2 30 ? 22.479  3.451   3.075   1.00 0.00 ? 54  GLU B HG2  10 
ATOM 8609  H HG3  . GLU B 2 30 ? 23.713  3.568   4.330   1.00 0.00 ? 54  GLU B HG3  10 
ATOM 8610  N N    . ALA B 2 31 ? 24.386  0.659   -0.558  1.00 0.00 ? 55  ALA B N    10 
ATOM 8611  C CA   . ALA B 2 31 ? 25.065  -0.451  -1.213  1.00 0.00 ? 55  ALA B CA   10 
ATOM 8612  C C    . ALA B 2 31 ? 26.203  0.049   -2.098  1.00 0.00 ? 55  ALA B C    10 
ATOM 8613  O O    . ALA B 2 31 ? 27.348  0.118   -1.603  1.00 0.00 ? 55  ALA B O    10 
ATOM 8614  C CB   . ALA B 2 31 ? 24.073  -1.261  -2.032  1.00 0.00 ? 55  ALA B CB   10 
ATOM 8615  O OXT  . ALA B 2 31 ? 25.941  0.368   -3.277  1.00 0.00 ? 55  ALA B OXT  10 
ATOM 8616  H H    . ALA B 2 31 ? 23.512  0.948   -0.893  1.00 0.00 ? 55  ALA B H    10 
ATOM 8617  H HA   . ALA B 2 31 ? 25.472  -1.092  -0.446  1.00 0.00 ? 55  ALA B HA   10 
ATOM 8618  H HB1  . ALA B 2 31 ? 23.285  -1.622  -1.389  1.00 0.00 ? 55  ALA B HB1  10 
ATOM 8619  H HB2  . ALA B 2 31 ? 24.580  -2.099  -2.486  1.00 0.00 ? 55  ALA B HB2  10 
ATOM 8620  H HB3  . ALA B 2 31 ? 23.649  -0.637  -2.805  1.00 0.00 ? 55  ALA B HB3  10 
ATOM 8621  N N    . ALA A 1 1  ? -4.610  -3.949  18.010  1.00 0.00 ? 106 ALA A N    11 
ATOM 8622  C CA   . ALA A 1 1  ? -3.306  -3.426  17.531  1.00 0.00 ? 106 ALA A CA   11 
ATOM 8623  C C    . ALA A 1 1  ? -2.793  -4.237  16.345  1.00 0.00 ? 106 ALA A C    11 
ATOM 8624  O O    . ALA A 1 1  ? -3.027  -5.443  16.261  1.00 0.00 ? 106 ALA A O    11 
ATOM 8625  C CB   . ALA A 1 1  ? -2.284  -3.441  18.659  1.00 0.00 ? 106 ALA A CB   11 
ATOM 8626  H H1   . ALA A 1 1  ? -4.942  -3.391  18.822  1.00 0.00 ? 106 ALA A H1   11 
ATOM 8627  H H2   . ALA A 1 1  ? -4.511  -4.942  18.304  1.00 0.00 ? 106 ALA A H2   11 
ATOM 8628  H H3   . ALA A 1 1  ? -5.318  -3.894  17.250  1.00 0.00 ? 106 ALA A H3   11 
ATOM 8629  H HA   . ALA A 1 1  ? -3.445  -2.401  17.218  1.00 0.00 ? 106 ALA A HA   11 
ATOM 8630  H HB1  . ALA A 1 1  ? -2.658  -2.859  19.489  1.00 0.00 ? 106 ALA A HB1  11 
ATOM 8631  H HB2  . ALA A 1 1  ? -1.356  -3.014  18.308  1.00 0.00 ? 106 ALA A HB2  11 
ATOM 8632  H HB3  . ALA A 1 1  ? -2.116  -4.458  18.979  1.00 0.00 ? 106 ALA A HB3  11 
ATOM 8633  N N    . ALA A 1 2  ? -2.097  -3.562  15.431  1.00 0.00 ? 107 ALA A N    11 
ATOM 8634  C CA   . ALA A 1 2  ? -1.547  -4.207  14.240  1.00 0.00 ? 107 ALA A CA   11 
ATOM 8635  C C    . ALA A 1 2  ? -2.655  -4.746  13.340  1.00 0.00 ? 107 ALA A C    11 
ATOM 8636  O O    . ALA A 1 2  ? -3.754  -5.052  13.802  1.00 0.00 ? 107 ALA A O    11 
ATOM 8637  C CB   . ALA A 1 2  ? -0.592  -5.324  14.633  1.00 0.00 ? 107 ALA A CB   11 
ATOM 8638  H H    . ALA A 1 2  ? -1.949  -2.602  15.561  1.00 0.00 ? 107 ALA A H    11 
ATOM 8639  H HA   . ALA A 1 2  ? -0.985  -3.464  13.693  1.00 0.00 ? 107 ALA A HA   11 
ATOM 8640  H HB1  . ALA A 1 2  ? -1.140  -6.105  15.141  1.00 0.00 ? 107 ALA A HB1  11 
ATOM 8641  H HB2  . ALA A 1 2  ? 0.170   -4.934  15.291  1.00 0.00 ? 107 ALA A HB2  11 
ATOM 8642  H HB3  . ALA A 1 2  ? -0.128  -5.730  13.746  1.00 0.00 ? 107 ALA A HB3  11 
ATOM 8643  N N    . ALA A 1 3  ? -2.359  -4.855  12.048  1.00 0.00 ? 108 ALA A N    11 
ATOM 8644  C CA   . ALA A 1 3  ? -3.326  -5.358  11.083  1.00 0.00 ? 108 ALA A CA   11 
ATOM 8645  C C    . ALA A 1 3  ? -2.850  -6.648  10.442  1.00 0.00 ? 108 ALA A C    11 
ATOM 8646  O O    . ALA A 1 3  ? -1.893  -7.274  10.900  1.00 0.00 ? 108 ALA A O    11 
ATOM 8647  C CB   . ALA A 1 3  ? -3.578  -4.329  9.997   1.00 0.00 ? 108 ALA A CB   11 
ATOM 8648  H H    . ALA A 1 3  ? -1.469  -4.589  11.735  1.00 0.00 ? 108 ALA A H    11 
ATOM 8649  H HA   . ALA A 1 3  ? -4.257  -5.539  11.600  1.00 0.00 ? 108 ALA A HA   11 
ATOM 8650  H HB1  . ALA A 1 3  ? -4.633  -4.097  9.955   1.00 0.00 ? 108 ALA A HB1  11 
ATOM 8651  H HB2  . ALA A 1 3  ? -3.260  -4.738  9.044   1.00 0.00 ? 108 ALA A HB2  11 
ATOM 8652  H HB3  . ALA A 1 3  ? -3.016  -3.432  10.210  1.00 0.00 ? 108 ALA A HB3  11 
ATOM 8653  N N    . THR A 1 4  ? -3.530  -7.032  9.374   1.00 0.00 ? 109 THR A N    11 
ATOM 8654  C CA   . THR A 1 4  ? -3.187  -8.230  8.632   1.00 0.00 ? 109 THR A CA   11 
ATOM 8655  C C    . THR A 1 4  ? -1.982  -7.964  7.734   1.00 0.00 ? 109 THR A C    11 
ATOM 8656  O O    . THR A 1 4  ? -1.240  -7.005  7.947   1.00 0.00 ? 109 THR A O    11 
ATOM 8657  C CB   . THR A 1 4  ? -4.380  -8.693  7.768   1.00 0.00 ? 109 THR A CB   11 
ATOM 8658  O OG1  . THR A 1 4  ? -4.134  -10.004 7.246   1.00 0.00 ? 109 THR A OG1  11 
ATOM 8659  C CG2  . THR A 1 4  ? -4.629  -7.720  6.619   1.00 0.00 ? 109 THR A CG2  11 
ATOM 8660  H H    . THR A 1 4  ? -4.289  -6.491  9.073   1.00 0.00 ? 109 THR A H    11 
ATOM 8661  H HA   . THR A 1 4  ? -2.945  -9.012  9.336   1.00 0.00 ? 109 THR A HA   11 
ATOM 8662  H HB   . THR A 1 4  ? -5.263  -8.723  8.390   1.00 0.00 ? 109 THR A HB   11 
ATOM 8663  H HG1  . THR A 1 4  ? -4.915  -10.318 6.785   1.00 0.00 ? 109 THR A HG1  11 
ATOM 8664  H HG21 . THR A 1 4  ? -4.588  -6.702  6.985   1.00 0.00 ? 109 THR A HG21 11 
ATOM 8665  H HG22 . THR A 1 4  ? -5.604  -7.910  6.193   1.00 0.00 ? 109 THR A HG22 11 
ATOM 8666  H HG23 . THR A 1 4  ? -3.874  -7.860  5.860   1.00 0.00 ? 109 THR A HG23 11 
ATOM 8667  N N    . ASN A 1 5  ? -1.792  -8.819  6.740   1.00 0.00 ? 110 ASN A N    11 
ATOM 8668  C CA   . ASN A 1 5  ? -0.697  -8.666  5.793   1.00 0.00 ? 110 ASN A CA   11 
ATOM 8669  C C    . ASN A 1 5  ? -1.100  -7.671  4.711   1.00 0.00 ? 110 ASN A C    11 
ATOM 8670  O O    . ASN A 1 5  ? -1.907  -7.997  3.844   1.00 0.00 ? 110 ASN A O    11 
ATOM 8671  C CB   . ASN A 1 5  ? -0.339  -10.012 5.159   1.00 0.00 ? 110 ASN A CB   11 
ATOM 8672  C CG   . ASN A 1 5  ? 0.208   -11.001 6.169   1.00 0.00 ? 110 ASN A CG   11 
ATOM 8673  O OD1  . ASN A 1 5  ? -0.158  -10.975 7.344   1.00 0.00 ? 110 ASN A OD1  11 
ATOM 8674  N ND2  . ASN A 1 5  ? 1.095   -11.879 5.714   1.00 0.00 ? 110 ASN A ND2  11 
ATOM 8675  H H    . ASN A 1 5  ? -2.411  -9.564  6.636   1.00 0.00 ? 110 ASN A H    11 
ATOM 8676  H HA   . ASN A 1 5  ? 0.161   -8.284  6.326   1.00 0.00 ? 110 ASN A HA   11 
ATOM 8677  H HB2  . ASN A 1 5  ? -1.224  -10.437 4.711   1.00 0.00 ? 110 ASN A HB2  11 
ATOM 8678  H HB3  . ASN A 1 5  ? 0.408   -9.855  4.395   1.00 0.00 ? 110 ASN A HB3  11 
ATOM 8679  H HD21 . ASN A 1 5  ? 1.341   -11.840 4.766   1.00 0.00 ? 110 ASN A HD21 11 
ATOM 8680  H HD22 . ASN A 1 5  ? 1.466   -12.532 6.345   1.00 0.00 ? 110 ASN A HD22 11 
ATOM 8681  N N    . PRO A 1 6  ? -0.551  -6.444  4.741   1.00 0.00 ? 111 PRO A N    11 
ATOM 8682  C CA   . PRO A 1 6  ? -0.896  -5.411  3.761   1.00 0.00 ? 111 PRO A CA   11 
ATOM 8683  C C    . PRO A 1 6  ? -0.575  -5.824  2.329   1.00 0.00 ? 111 PRO A C    11 
ATOM 8684  O O    . PRO A 1 6  ? -1.046  -5.210  1.377   1.00 0.00 ? 111 PRO A O    11 
ATOM 8685  C CB   . PRO A 1 6  ? -0.058  -4.203  4.194   1.00 0.00 ? 111 PRO A CB   11 
ATOM 8686  C CG   . PRO A 1 6  ? 1.050   -4.781  5.006   1.00 0.00 ? 111 PRO A CG   11 
ATOM 8687  C CD   . PRO A 1 6  ? 0.458   -5.967  5.704   1.00 0.00 ? 111 PRO A CD   11 
ATOM 8688  H HA   . PRO A 1 6  ? -1.942  -5.157  3.820   1.00 0.00 ? 111 PRO A HA   11 
ATOM 8689  H HB2  . PRO A 1 6  ? 0.313   -3.687  3.323   1.00 0.00 ? 111 PRO A HB2  11 
ATOM 8690  H HB3  . PRO A 1 6  ? -0.667  -3.533  4.781   1.00 0.00 ? 111 PRO A HB3  11 
ATOM 8691  H HG2  . PRO A 1 6  ? 1.859   -5.089  4.360   1.00 0.00 ? 111 PRO A HG2  11 
ATOM 8692  H HG3  . PRO A 1 6  ? 1.396   -4.054  5.726   1.00 0.00 ? 111 PRO A HG3  11 
ATOM 8693  H HD2  . PRO A 1 6  ? 1.213   -6.720  5.880   1.00 0.00 ? 111 PRO A HD2  11 
ATOM 8694  H HD3  . PRO A 1 6  ? -0.007  -5.669  6.633   1.00 0.00 ? 111 PRO A HD3  11 
ATOM 8695  N N    . ALA A 1 7  ? 0.224   -6.872  2.174   1.00 0.00 ? 112 ALA A N    11 
ATOM 8696  C CA   . ALA A 1 7  ? 0.577   -7.359  0.846   1.00 0.00 ? 112 ALA A CA   11 
ATOM 8697  C C    . ALA A 1 7  ? -0.618  -8.048  0.207   1.00 0.00 ? 112 ALA A C    11 
ATOM 8698  O O    . ALA A 1 7  ? -0.975  -7.775  -0.938  1.00 0.00 ? 112 ALA A O    11 
ATOM 8699  C CB   . ALA A 1 7  ? 1.760   -8.304  0.931   1.00 0.00 ? 112 ALA A CB   11 
ATOM 8700  H H    . ALA A 1 7  ? 0.582   -7.327  2.965   1.00 0.00 ? 112 ALA A H    11 
ATOM 8701  H HA   . ALA A 1 7  ? 0.859   -6.512  0.242   1.00 0.00 ? 112 ALA A HA   11 
ATOM 8702  H HB1  . ALA A 1 7  ? 1.425   -9.275  1.266   1.00 0.00 ? 112 ALA A HB1  11 
ATOM 8703  H HB2  . ALA A 1 7  ? 2.475   -7.909  1.635   1.00 0.00 ? 112 ALA A HB2  11 
ATOM 8704  H HB3  . ALA A 1 7  ? 2.222   -8.396  -0.040  1.00 0.00 ? 112 ALA A HB3  11 
ATOM 8705  N N    . ARG A 1 8  ? -1.224  -8.943  0.969   1.00 0.00 ? 113 ARG A N    11 
ATOM 8706  C CA   . ARG A 1 8  ? -2.401  -9.678  0.518   1.00 0.00 ? 113 ARG A CA   11 
ATOM 8707  C C    . ARG A 1 8  ? -3.639  -8.792  0.626   1.00 0.00 ? 113 ARG A C    11 
ATOM 8708  O O    . ARG A 1 8  ? -4.553  -8.862  -0.198  1.00 0.00 ? 113 ARG A O    11 
ATOM 8709  C CB   . ARG A 1 8  ? -2.585  -10.932 1.373   1.00 0.00 ? 113 ARG A CB   11 
ATOM 8710  C CG   . ARG A 1 8  ? -3.051  -12.148 0.589   1.00 0.00 ? 113 ARG A CG   11 
ATOM 8711  C CD   . ARG A 1 8  ? -4.517  -12.034 0.202   1.00 0.00 ? 113 ARG A CD   11 
ATOM 8712  N NE   . ARG A 1 8  ? -5.377  -11.880 1.373   1.00 0.00 ? 113 ARG A NE   11 
ATOM 8713  C CZ   . ARG A 1 8  ? -6.300  -12.767 1.737   1.00 0.00 ? 113 ARG A CZ   11 
ATOM 8714  N NH1  . ARG A 1 8  ? -6.480  -13.872 1.028   1.00 0.00 ? 113 ARG A NH1  11 
ATOM 8715  N NH2  . ARG A 1 8  ? -7.041  -12.549 2.815   1.00 0.00 ? 113 ARG A NH2  11 
ATOM 8716  H H    . ARG A 1 8  ? -0.860  -9.124  1.863   1.00 0.00 ? 113 ARG A H    11 
ATOM 8717  H HA   . ARG A 1 8  ? -2.251  -9.962  -0.513  1.00 0.00 ? 113 ARG A HA   11 
ATOM 8718  H HB2  . ARG A 1 8  ? -1.644  -11.171 1.847   1.00 0.00 ? 113 ARG A HB2  11 
ATOM 8719  H HB3  . ARG A 1 8  ? -3.317  -10.724 2.139   1.00 0.00 ? 113 ARG A HB3  11 
ATOM 8720  H HG2  . ARG A 1 8  ? -2.457  -12.233 -0.310  1.00 0.00 ? 113 ARG A HG2  11 
ATOM 8721  H HG3  . ARG A 1 8  ? -2.915  -13.031 1.196   1.00 0.00 ? 113 ARG A HG3  11 
ATOM 8722  H HD2  . ARG A 1 8  ? -4.641  -11.176 -0.439  1.00 0.00 ? 113 ARG A HD2  11 
ATOM 8723  H HD3  . ARG A 1 8  ? -4.805  -12.928 -0.330  1.00 0.00 ? 113 ARG A HD3  11 
ATOM 8724  H HE   . ARG A 1 8  ? -5.262  -11.072 1.916   1.00 0.00 ? 113 ARG A HE   11 
ATOM 8725  H HH11 . ARG A 1 8  ? -5.922  -14.043 0.216   1.00 0.00 ? 113 ARG A HH11 11 
ATOM 8726  H HH12 . ARG A 1 8  ? -7.176  -14.535 1.305   1.00 0.00 ? 113 ARG A HH12 11 
ATOM 8727  H HH21 . ARG A 1 8  ? -6.907  -11.717 3.355   1.00 0.00 ? 113 ARG A HH21 11 
ATOM 8728  H HH22 . ARG A 1 8  ? -7.734  -13.216 3.088   1.00 0.00 ? 113 ARG A HH22 11 
ATOM 8729  N N    . TYR A 1 9  ? -3.645  -7.961  1.658   1.00 0.00 ? 114 TYR A N    11 
ATOM 8730  C CA   . TYR A 1 9  ? -4.737  -7.033  1.930   1.00 0.00 ? 114 TYR A CA   11 
ATOM 8731  C C    . TYR A 1 9  ? -4.937  -6.061  0.767   1.00 0.00 ? 114 TYR A C    11 
ATOM 8732  O O    . TYR A 1 9  ? -6.033  -5.985  0.207   1.00 0.00 ? 114 TYR A O    11 
ATOM 8733  C CB   . TYR A 1 9  ? -4.448  -6.326  3.272   1.00 0.00 ? 114 TYR A CB   11 
ATOM 8734  C CG   . TYR A 1 9  ? -4.915  -4.888  3.418   1.00 0.00 ? 114 TYR A CG   11 
ATOM 8735  C CD1  . TYR A 1 9  ? -6.061  -4.409  2.795   1.00 0.00 ? 114 TYR A CD1  11 
ATOM 8736  C CD2  . TYR A 1 9  ? -4.189  -4.010  4.210   1.00 0.00 ? 114 TYR A CD2  11 
ATOM 8737  C CE1  . TYR A 1 9  ? -6.462  -3.101  2.953   1.00 0.00 ? 114 TYR A CE1  11 
ATOM 8738  C CE2  . TYR A 1 9  ? -4.581  -2.701  4.377   1.00 0.00 ? 114 TYR A CE2  11 
ATOM 8739  C CZ   . TYR A 1 9  ? -5.721  -2.247  3.745   1.00 0.00 ? 114 TYR A CZ   11 
ATOM 8740  O OH   . TYR A 1 9  ? -6.119  -0.939  3.904   1.00 0.00 ? 114 TYR A OH   11 
ATOM 8741  H H    . TYR A 1 9  ? -2.878  -7.971  2.266   1.00 0.00 ? 114 TYR A H    11 
ATOM 8742  H HA   . TYR A 1 9  ? -5.642  -7.610  2.039   1.00 0.00 ? 114 TYR A HA   11 
ATOM 8743  H HB2  . TYR A 1 9  ? -4.917  -6.890  4.061   1.00 0.00 ? 114 TYR A HB2  11 
ATOM 8744  H HB3  . TYR A 1 9  ? -3.380  -6.337  3.435   1.00 0.00 ? 114 TYR A HB3  11 
ATOM 8745  H HD1  . TYR A 1 9  ? -6.640  -5.077  2.176   1.00 0.00 ? 114 TYR A HD1  11 
ATOM 8746  H HD2  . TYR A 1 9  ? -3.300  -4.366  4.707   1.00 0.00 ? 114 TYR A HD2  11 
ATOM 8747  H HE1  . TYR A 1 9  ? -7.350  -2.753  2.453   1.00 0.00 ? 114 TYR A HE1  11 
ATOM 8748  H HE2  . TYR A 1 9  ? -3.994  -2.041  4.999   1.00 0.00 ? 114 TYR A HE2  11 
ATOM 8749  H HH   . TYR A 1 9  ? -5.359  -0.360  3.819   1.00 0.00 ? 114 TYR A HH   11 
ATOM 8750  N N    . CYS A 1 10 ? -3.897  -5.327  0.394   1.00 0.00 ? 115 CYS A N    11 
ATOM 8751  C CA   . CYS A 1 10 ? -4.017  -4.369  -0.703  1.00 0.00 ? 115 CYS A CA   11 
ATOM 8752  C C    . CYS A 1 10 ? -4.186  -5.080  -2.044  1.00 0.00 ? 115 CYS A C    11 
ATOM 8753  O O    . CYS A 1 10 ? -4.599  -4.472  -3.027  1.00 0.00 ? 115 CYS A O    11 
ATOM 8754  C CB   . CYS A 1 10 ? -2.797  -3.450  -0.770  1.00 0.00 ? 115 CYS A CB   11 
ATOM 8755  S SG   . CYS A 1 10 ? -2.243  -2.791  0.838   1.00 0.00 ? 115 CYS A SG   11 
ATOM 8756  H H    . CYS A 1 10 ? -3.041  -5.427  0.859   1.00 0.00 ? 115 CYS A H    11 
ATOM 8757  H HA   . CYS A 1 10 ? -4.894  -3.769  -0.518  1.00 0.00 ? 115 CYS A HA   11 
ATOM 8758  H HB2  . CYS A 1 10 ? -1.969  -3.993  -1.203  1.00 0.00 ? 115 CYS A HB2  11 
ATOM 8759  H HB3  . CYS A 1 10 ? -3.038  -2.611  -1.405  1.00 0.00 ? 115 CYS A HB3  11 
ATOM 8760  N N    . CYS A 1 11 ? -3.871  -6.365  -2.088  1.00 0.00 ? 116 CYS A N    11 
ATOM 8761  C CA   . CYS A 1 11 ? -3.982  -7.124  -3.331  1.00 0.00 ? 116 CYS A CA   11 
ATOM 8762  C C    . CYS A 1 11 ? -5.440  -7.365  -3.714  1.00 0.00 ? 116 CYS A C    11 
ATOM 8763  O O    . CYS A 1 11 ? -5.828  -7.167  -4.865  1.00 0.00 ? 116 CYS A O    11 
ATOM 8764  C CB   . CYS A 1 11 ? -3.252  -8.464  -3.206  1.00 0.00 ? 116 CYS A CB   11 
ATOM 8765  S SG   . CYS A 1 11 ? -3.440  -9.551  -4.660  1.00 0.00 ? 116 CYS A SG   11 
ATOM 8766  H H    . CYS A 1 11 ? -3.561  -6.815  -1.275  1.00 0.00 ? 116 CYS A H    11 
ATOM 8767  H HA   . CYS A 1 11 ? -3.514  -6.538  -4.109  1.00 0.00 ? 116 CYS A HA   11 
ATOM 8768  H HB2  . CYS A 1 11 ? -2.202  -8.282  -3.066  1.00 0.00 ? 116 CYS A HB2  11 
ATOM 8769  H HB3  . CYS A 1 11 ? -3.633  -8.994  -2.349  1.00 0.00 ? 116 CYS A HB3  11 
ATOM 8770  N N    . LEU A 1 12 ? -6.243  -7.793  -2.745  1.00 0.00 ? 117 LEU A N    11 
ATOM 8771  C CA   . LEU A 1 12 ? -7.651  -8.082  -2.986  1.00 0.00 ? 117 LEU A CA   11 
ATOM 8772  C C    . LEU A 1 12 ? -8.513  -6.822  -2.991  1.00 0.00 ? 117 LEU A C    11 
ATOM 8773  O O    . LEU A 1 12 ? -9.647  -6.849  -3.471  1.00 0.00 ? 117 LEU A O    11 
ATOM 8774  C CB   . LEU A 1 12 ? -8.164  -9.052  -1.930  1.00 0.00 ? 117 LEU A CB   11 
ATOM 8775  C CG   . LEU A 1 12 ? -8.130  -10.528 -2.329  1.00 0.00 ? 117 LEU A CG   11 
ATOM 8776  C CD1  . LEU A 1 12 ? -8.476  -11.410 -1.139  1.00 0.00 ? 117 LEU A CD1  11 
ATOM 8777  C CD2  . LEU A 1 12 ? -9.086  -10.792 -3.484  1.00 0.00 ? 117 LEU A CD2  11 
ATOM 8778  H H    . LEU A 1 12 ? -5.880  -7.922  -1.844  1.00 0.00 ? 117 LEU A H    11 
ATOM 8779  H HA   . LEU A 1 12 ? -7.727  -8.554  -3.951  1.00 0.00 ? 117 LEU A HA   11 
ATOM 8780  H HB2  . LEU A 1 12 ? -7.562  -8.925  -1.045  1.00 0.00 ? 117 LEU A HB2  11 
ATOM 8781  H HB3  . LEU A 1 12 ? -9.180  -8.788  -1.691  1.00 0.00 ? 117 LEU A HB3  11 
ATOM 8782  H HG   . LEU A 1 12 ? -7.132  -10.784 -2.653  1.00 0.00 ? 117 LEU A HG   11 
ATOM 8783  H HD11 . LEU A 1 12 ? -8.474  -12.445 -1.445  1.00 0.00 ? 117 LEU A HD11 11 
ATOM 8784  H HD12 . LEU A 1 12 ? -9.457  -11.147 -0.770  1.00 0.00 ? 117 LEU A HD12 11 
ATOM 8785  H HD13 . LEU A 1 12 ? -7.746  -11.264 -0.357  1.00 0.00 ? 117 LEU A HD13 11 
ATOM 8786  H HD21 . LEU A 1 12 ? -9.048  -11.838 -3.752  1.00 0.00 ? 117 LEU A HD21 11 
ATOM 8787  H HD22 . LEU A 1 12 ? -8.796  -10.191 -4.334  1.00 0.00 ? 117 LEU A HD22 11 
ATOM 8788  H HD23 . LEU A 1 12 ? -10.091 -10.533 -3.186  1.00 0.00 ? 117 LEU A HD23 11 
ATOM 8789  N N    . SER A 1 13 ? -7.987  -5.724  -2.460  1.00 0.00 ? 118 SER A N    11 
ATOM 8790  C CA   . SER A 1 13 ? -8.751  -4.479  -2.409  1.00 0.00 ? 118 SER A CA   11 
ATOM 8791  C C    . SER A 1 13 ? -7.931  -3.275  -2.870  1.00 0.00 ? 118 SER A C    11 
ATOM 8792  O O    . SER A 1 13 ? -8.370  -2.513  -3.729  1.00 0.00 ? 118 SER A O    11 
ATOM 8793  C CB   . SER A 1 13 ? -9.276  -4.238  -0.993  1.00 0.00 ? 118 SER A CB   11 
ATOM 8794  O OG   . SER A 1 13 ? -8.211  -4.139  -0.064  1.00 0.00 ? 118 SER A OG   11 
ATOM 8795  H H    . SER A 1 13 ? -7.079  -5.752  -2.093  1.00 0.00 ? 118 SER A H    11 
ATOM 8796  H HA   . SER A 1 13 ? -9.595  -4.590  -3.074  1.00 0.00 ? 118 SER A HA   11 
ATOM 8797  H HB2  . SER A 1 13 ? -9.841  -3.318  -0.973  1.00 0.00 ? 118 SER A HB2  11 
ATOM 8798  H HB3  . SER A 1 13 ? -9.915  -5.060  -0.704  1.00 0.00 ? 118 SER A HB3  11 
ATOM 8799  H HG   . SER A 1 13 ? -8.408  -3.452  0.578   1.00 0.00 ? 118 SER A HG   11 
ATOM 8800  N N    . GLY A 1 14 ? -6.743  -3.107  -2.296  1.00 0.00 ? 119 GLY A N    11 
ATOM 8801  C CA   . GLY A 1 14 ? -5.903  -1.982  -2.656  1.00 0.00 ? 119 GLY A CA   11 
ATOM 8802  C C    . GLY A 1 14 ? -5.651  -1.075  -1.470  1.00 0.00 ? 119 GLY A C    11 
ATOM 8803  O O    . GLY A 1 14 ? -6.388  -1.126  -0.485  1.00 0.00 ? 119 GLY A O    11 
ATOM 8804  H H    . GLY A 1 14 ? -6.429  -3.753  -1.629  1.00 0.00 ? 119 GLY A H    11 
ATOM 8805  H HA2  . GLY A 1 14 ? -4.958  -2.356  -3.015  1.00 0.00 ? 119 GLY A HA2  11 
ATOM 8806  H HA3  . GLY A 1 14 ? -6.384  -1.418  -3.445  1.00 0.00 ? 119 GLY A HA3  11 
ATOM 8807  N N    . CYS A 1 15 ? -4.611  -0.248  -1.545  1.00 0.00 ? 120 CYS A N    11 
ATOM 8808  C CA   . CYS A 1 15 ? -4.295  0.644   -0.437  1.00 0.00 ? 120 CYS A CA   11 
ATOM 8809  C C    . CYS A 1 15 ? -3.934  2.046   -0.894  1.00 0.00 ? 120 CYS A C    11 
ATOM 8810  O O    . CYS A 1 15 ? -3.296  2.240   -1.929  1.00 0.00 ? 120 CYS A O    11 
ATOM 8811  C CB   . CYS A 1 15 ? -3.169  0.065   0.414   1.00 0.00 ? 120 CYS A CB   11 
ATOM 8812  S SG   . CYS A 1 15 ? -3.653  -1.429  1.334   1.00 0.00 ? 120 CYS A SG   11 
ATOM 8813  H H    . CYS A 1 15 ? -4.056  -0.236  -2.352  1.00 0.00 ? 120 CYS A H    11 
ATOM 8814  H HA   . CYS A 1 15 ? -5.173  0.711   0.171   1.00 0.00 ? 120 CYS A HA   11 
ATOM 8815  H HB2  . CYS A 1 15 ? -2.337  -0.192  -0.219  1.00 0.00 ? 120 CYS A HB2  11 
ATOM 8816  H HB3  . CYS A 1 15 ? -2.852  0.806   1.132   1.00 0.00 ? 120 CYS A HB3  11 
ATOM 8817  N N    . THR A 1 16 ? -4.361  3.022   -0.097  1.00 0.00 ? 121 THR A N    11 
ATOM 8818  C CA   . THR A 1 16 ? -4.090  4.422   -0.375  1.00 0.00 ? 121 THR A CA   11 
ATOM 8819  C C    . THR A 1 16 ? -2.700  4.790   0.071   1.00 0.00 ? 121 THR A C    11 
ATOM 8820  O O    . THR A 1 16 ? -2.099  4.101   0.893   1.00 0.00 ? 121 THR A O    11 
ATOM 8821  C CB   . THR A 1 16 ? -5.061  5.353   0.372   1.00 0.00 ? 121 THR A CB   11 
ATOM 8822  O OG1  . THR A 1 16 ? -4.934  5.167   1.785   1.00 0.00 ? 121 THR A OG1  11 
ATOM 8823  C CG2  . THR A 1 16 ? -6.478  5.088   -0.049  1.00 0.00 ? 121 THR A CG2  11 
ATOM 8824  H H    . THR A 1 16 ? -4.877  2.788   0.702   1.00 0.00 ? 121 THR A H    11 
ATOM 8825  H HA   . THR A 1 16 ? -4.190  4.593   -1.436  1.00 0.00 ? 121 THR A HA   11 
ATOM 8826  H HB   . THR A 1 16 ? -4.815  6.375   0.125   1.00 0.00 ? 121 THR A HB   11 
ATOM 8827  H HG1  . THR A 1 16 ? -5.699  5.541   2.228   1.00 0.00 ? 121 THR A HG1  11 
ATOM 8828  H HG21 . THR A 1 16 ? -6.465  4.691   -1.046  1.00 0.00 ? 121 THR A HG21 11 
ATOM 8829  H HG22 . THR A 1 16 ? -7.044  6.008   -0.029  1.00 0.00 ? 121 THR A HG22 11 
ATOM 8830  H HG23 . THR A 1 16 ? -6.929  4.369   0.619   1.00 0.00 ? 121 THR A HG23 11 
ATOM 8831  N N    . GLN A 1 17 ? -2.199  5.891   -0.457  1.00 0.00 ? 122 GLN A N    11 
ATOM 8832  C CA   . GLN A 1 17 ? -0.896  6.372   -0.071  1.00 0.00 ? 122 GLN A CA   11 
ATOM 8833  C C    . GLN A 1 17 ? -0.894  6.609   1.424   1.00 0.00 ? 122 GLN A C    11 
ATOM 8834  O O    . GLN A 1 17 ? 0.151   6.746   2.031   1.00 0.00 ? 122 GLN A O    11 
ATOM 8835  C CB   . GLN A 1 17 ? -0.558  7.646   -0.836  1.00 0.00 ? 122 GLN A CB   11 
ATOM 8836  C CG   . GLN A 1 17 ? -0.005  7.377   -2.225  1.00 0.00 ? 122 GLN A CG   11 
ATOM 8837  C CD   . GLN A 1 17 ? -0.123  8.573   -3.148  1.00 0.00 ? 122 GLN A CD   11 
ATOM 8838  O OE1  . GLN A 1 17 ? -1.129  8.738   -3.842  1.00 0.00 ? 122 GLN A OE1  11 
ATOM 8839  N NE2  . GLN A 1 17 ? 0.904   9.413   -3.164  1.00 0.00 ? 122 GLN A NE2  11 
ATOM 8840  H H    . GLN A 1 17 ? -2.721  6.393   -1.117  1.00 0.00 ? 122 GLN A H    11 
ATOM 8841  H HA   . GLN A 1 17 ? -0.156  5.604   -0.294  1.00 0.00 ? 122 GLN A HA   11 
ATOM 8842  H HB2  . GLN A 1 17 ? -1.452  8.242   -0.936  1.00 0.00 ? 122 GLN A HB2  11 
ATOM 8843  H HB3  . GLN A 1 17 ? 0.175   8.202   -0.280  1.00 0.00 ? 122 GLN A HB3  11 
ATOM 8844  H HG2  . GLN A 1 17 ? 1.039   7.114   -2.135  1.00 0.00 ? 122 GLN A HG2  11 
ATOM 8845  H HG3  . GLN A 1 17 ? -0.541  6.545   -2.655  1.00 0.00 ? 122 GLN A HG3  11 
ATOM 8846  H HE21 . GLN A 1 17 ? 1.671   9.217   -2.587  1.00 0.00 ? 122 GLN A HE21 11 
ATOM 8847  H HE22 . GLN A 1 17 ? 0.854   10.195  -3.753  1.00 0.00 ? 122 GLN A HE22 11 
ATOM 8848  N N    . GLN A 1 18 ? -2.078  6.652   2.024   1.00 0.00 ? 123 GLN A N    11 
ATOM 8849  C CA   . GLN A 1 18 ? -2.164  6.813   3.452   1.00 0.00 ? 123 GLN A CA   11 
ATOM 8850  C C    . GLN A 1 18 ? -1.762  5.507   4.096   1.00 0.00 ? 123 GLN A C    11 
ATOM 8851  O O    . GLN A 1 18 ? -0.848  5.467   4.914   1.00 0.00 ? 123 GLN A O    11 
ATOM 8852  C CB   . GLN A 1 18 ? -3.572  7.188   3.879   1.00 0.00 ? 123 GLN A CB   11 
ATOM 8853  C CG   . GLN A 1 18 ? -3.951  8.626   3.579   1.00 0.00 ? 123 GLN A CG   11 
ATOM 8854  C CD   . GLN A 1 18 ? -5.361  8.960   4.030   1.00 0.00 ? 123 GLN A CD   11 
ATOM 8855  O OE1  . GLN A 1 18 ? -5.655  10.097  4.394   1.00 0.00 ? 123 GLN A OE1  11 
ATOM 8856  N NE2  . GLN A 1 18 ? -6.241  7.963   4.008   1.00 0.00 ? 123 GLN A NE2  11 
ATOM 8857  H H    . GLN A 1 18 ? -2.903  6.565   1.498   1.00 0.00 ? 123 GLN A H    11 
ATOM 8858  H HA   . GLN A 1 18 ? -1.471  7.582   3.752   1.00 0.00 ? 123 GLN A HA   11 
ATOM 8859  H HB2  . GLN A 1 18 ? -4.267  6.544   3.371   1.00 0.00 ? 123 GLN A HB2  11 
ATOM 8860  H HB3  . GLN A 1 18 ? -3.658  7.028   4.936   1.00 0.00 ? 123 GLN A HB3  11 
ATOM 8861  H HG2  . GLN A 1 18 ? -3.261  9.281   4.089   1.00 0.00 ? 123 GLN A HG2  11 
ATOM 8862  H HG3  . GLN A 1 18 ? -3.882  8.788   2.515   1.00 0.00 ? 123 GLN A HG3  11 
ATOM 8863  H HE21 . GLN A 1 18 ? -5.936  7.081   3.706   1.00 0.00 ? 123 GLN A HE21 11 
ATOM 8864  H HE22 . GLN A 1 18 ? -7.159  8.151   4.294   1.00 0.00 ? 123 GLN A HE22 11 
ATOM 8865  N N    . ASP A 1 19 ? -2.436  4.428   3.694   1.00 0.00 ? 124 ASP A N    11 
ATOM 8866  C CA   . ASP A 1 19 ? -2.120  3.115   4.225   1.00 0.00 ? 124 ASP A CA   11 
ATOM 8867  C C    . ASP A 1 19 ? -0.639  2.847   4.017   1.00 0.00 ? 124 ASP A C    11 
ATOM 8868  O O    . ASP A 1 19 ? 0.103   2.588   4.965   1.00 0.00 ? 124 ASP A O    11 
ATOM 8869  C CB   . ASP A 1 19 ? -2.956  2.033   3.530   1.00 0.00 ? 124 ASP A CB   11 
ATOM 8870  C CG   . ASP A 1 19 ? -3.885  1.317   4.492   1.00 0.00 ? 124 ASP A CG   11 
ATOM 8871  O OD1  . ASP A 1 19 ? -5.014  1.807   4.701   1.00 0.00 ? 124 ASP A OD1  11 
ATOM 8872  O OD2  . ASP A 1 19 ? -3.482  0.266   5.036   1.00 0.00 ? 124 ASP A OD2  11 
ATOM 8873  H H    . ASP A 1 19 ? -3.147  4.521   3.015   1.00 0.00 ? 124 ASP A H    11 
ATOM 8874  H HA   . ASP A 1 19 ? -2.336  3.115   5.283   1.00 0.00 ? 124 ASP A HA   11 
ATOM 8875  H HB2  . ASP A 1 19 ? -3.554  2.487   2.756   1.00 0.00 ? 124 ASP A HB2  11 
ATOM 8876  H HB3  . ASP A 1 19 ? -2.295  1.302   3.085   1.00 0.00 ? 124 ASP A HB3  11 
ATOM 8877  N N    . LEU A 1 20 ? -0.213  2.955   2.767   1.00 0.00 ? 125 LEU A N    11 
ATOM 8878  C CA   . LEU A 1 20 ? 1.174   2.736   2.411   1.00 0.00 ? 125 LEU A CA   11 
ATOM 8879  C C    . LEU A 1 20 ? 2.093   3.700   3.168   1.00 0.00 ? 125 LEU A C    11 
ATOM 8880  O O    . LEU A 1 20 ? 3.234   3.353   3.489   1.00 0.00 ? 125 LEU A O    11 
ATOM 8881  C CB   . LEU A 1 20 ? 1.349   2.848   0.888   1.00 0.00 ? 125 LEU A CB   11 
ATOM 8882  C CG   . LEU A 1 20 ? 0.572   1.809   0.090   1.00 0.00 ? 125 LEU A CG   11 
ATOM 8883  C CD1  . LEU A 1 20 ? -0.443  2.474   -0.818  1.00 0.00 ? 125 LEU A CD1  11 
ATOM 8884  C CD2  . LEU A 1 20 ? 1.516   0.979   -0.735  1.00 0.00 ? 125 LEU A CD2  11 
ATOM 8885  H H    . LEU A 1 20 ? -0.854  3.188   2.063   1.00 0.00 ? 125 LEU A H    11 
ATOM 8886  H HA   . LEU A 1 20 ? 1.424   1.729   2.709   1.00 0.00 ? 125 LEU A HA   11 
ATOM 8887  H HB2  . LEU A 1 20 ? 1.033   3.818   0.561   1.00 0.00 ? 125 LEU A HB2  11 
ATOM 8888  H HB3  . LEU A 1 20 ? 2.389   2.742   0.654   1.00 0.00 ? 125 LEU A HB3  11 
ATOM 8889  H HG   . LEU A 1 20 ? 0.043   1.154   0.769   1.00 0.00 ? 125 LEU A HG   11 
ATOM 8890  H HD11 . LEU A 1 20 ? -1.439  2.295   -0.439  1.00 0.00 ? 125 LEU A HD11 11 
ATOM 8891  H HD12 . LEU A 1 20 ? -0.352  2.059   -1.812  1.00 0.00 ? 125 LEU A HD12 11 
ATOM 8892  H HD13 . LEU A 1 20 ? -0.254  3.537   -0.852  1.00 0.00 ? 125 LEU A HD13 11 
ATOM 8893  H HD21 . LEU A 1 20 ? 2.406   0.767   -0.163  1.00 0.00 ? 125 LEU A HD21 11 
ATOM 8894  H HD22 . LEU A 1 20 ? 1.777   1.539   -1.626  1.00 0.00 ? 125 LEU A HD22 11 
ATOM 8895  H HD23 . LEU A 1 20 ? 1.037   0.055   -1.014  1.00 0.00 ? 125 LEU A HD23 11 
ATOM 8896  N N    . LEU A 1 21 ? 1.593   4.904   3.474   1.00 0.00 ? 126 LEU A N    11 
ATOM 8897  C CA   . LEU A 1 21 ? 2.381   5.879   4.225   1.00 0.00 ? 126 LEU A CA   11 
ATOM 8898  C C    . LEU A 1 21 ? 2.660   5.359   5.628   1.00 0.00 ? 126 LEU A C    11 
ATOM 8899  O O    . LEU A 1 21 ? 3.661   5.721   6.249   1.00 0.00 ? 126 LEU A O    11 
ATOM 8900  C CB   . LEU A 1 21 ? 1.652   7.224   4.313   1.00 0.00 ? 126 LEU A CB   11 
ATOM 8901  C CG   . LEU A 1 21 ? 2.110   8.281   3.307   1.00 0.00 ? 126 LEU A CG   11 
ATOM 8902  C CD1  . LEU A 1 21 ? 1.302   9.558   3.469   1.00 0.00 ? 126 LEU A CD1  11 
ATOM 8903  C CD2  . LEU A 1 21 ? 3.597   8.566   3.463   1.00 0.00 ? 126 LEU A CD2  11 
ATOM 8904  H H    . LEU A 1 21 ? 0.685   5.145   3.185   1.00 0.00 ? 126 LEU A H    11 
ATOM 8905  H HA   . LEU A 1 21 ? 3.319   6.016   3.710   1.00 0.00 ? 126 LEU A HA   11 
ATOM 8906  H HB2  . LEU A 1 21 ? 0.597   7.046   4.158   1.00 0.00 ? 126 LEU A HB2  11 
ATOM 8907  H HB3  . LEU A 1 21 ? 1.784   7.622   5.306   1.00 0.00 ? 126 LEU A HB3  11 
ATOM 8908  H HG   . LEU A 1 21 ? 1.942   7.905   2.307   1.00 0.00 ? 126 LEU A HG   11 
ATOM 8909  H HD11 . LEU A 1 21 ? 0.261   9.355   3.269   1.00 0.00 ? 126 LEU A HD11 11 
ATOM 8910  H HD12 . LEU A 1 21 ? 1.663   10.304  2.775   1.00 0.00 ? 126 LEU A HD12 11 
ATOM 8911  H HD13 . LEU A 1 21 ? 1.409   9.927   4.479   1.00 0.00 ? 126 LEU A HD13 11 
ATOM 8912  H HD21 . LEU A 1 21 ? 3.888   9.348   2.776   1.00 0.00 ? 126 LEU A HD21 11 
ATOM 8913  H HD22 . LEU A 1 21 ? 4.161   7.671   3.248   1.00 0.00 ? 126 LEU A HD22 11 
ATOM 8914  H HD23 . LEU A 1 21 ? 3.798   8.885   4.476   1.00 0.00 ? 126 LEU A HD23 11 
ATOM 8915  N N    . THR A 1 22 ? 1.763   4.512   6.124   1.00 0.00 ? 127 THR A N    11 
ATOM 8916  C CA   . THR A 1 22 ? 1.914   3.940   7.453   1.00 0.00 ? 127 THR A CA   11 
ATOM 8917  C C    . THR A 1 22 ? 2.522   2.542   7.388   1.00 0.00 ? 127 THR A C    11 
ATOM 8918  O O    . THR A 1 22 ? 2.834   1.952   8.422   1.00 0.00 ? 127 THR A O    11 
ATOM 8919  C CB   . THR A 1 22 ? 0.568   3.852   8.207   1.00 0.00 ? 127 THR A CB   11 
ATOM 8920  O OG1  . THR A 1 22 ? 0.024   2.533   8.082   1.00 0.00 ? 127 THR A OG1  11 
ATOM 8921  C CG2  . THR A 1 22 ? -0.440  4.860   7.679   1.00 0.00 ? 127 THR A CG2  11 
ATOM 8922  H H    . THR A 1 22 ? 0.983   4.271   5.584   1.00 0.00 ? 127 THR A H    11 
ATOM 8923  H HA   . THR A 1 22 ? 2.576   4.582   8.018   1.00 0.00 ? 127 THR A HA   11 
ATOM 8924  H HB   . THR A 1 22 ? 0.745   4.061   9.252   1.00 0.00 ? 127 THR A HB   11 
ATOM 8925  H HG1  . THR A 1 22 ? -0.077  2.315   7.152   1.00 0.00 ? 127 THR A HG1  11 
ATOM 8926  H HG21 . THR A 1 22 ? 0.058   5.788   7.449   1.00 0.00 ? 127 THR A HG21 11 
ATOM 8927  H HG22 . THR A 1 22 ? -1.198  5.036   8.428   1.00 0.00 ? 127 THR A HG22 11 
ATOM 8928  H HG23 . THR A 1 22 ? -0.903  4.469   6.786   1.00 0.00 ? 127 THR A HG23 11 
ATOM 8929  N N    . LEU A 1 23 ? 2.693   2.007   6.175   1.00 0.00 ? 128 LEU A N    11 
ATOM 8930  C CA   . LEU A 1 23 ? 3.251   0.676   6.017   1.00 0.00 ? 128 LEU A CA   11 
ATOM 8931  C C    . LEU A 1 23 ? 4.757   0.747   5.780   1.00 0.00 ? 128 LEU A C    11 
ATOM 8932  O O    . LEU A 1 23 ? 5.463   -0.252  5.915   1.00 0.00 ? 128 LEU A O    11 
ATOM 8933  C CB   . LEU A 1 23 ? 2.541   -0.053  4.880   1.00 0.00 ? 128 LEU A CB   11 
ATOM 8934  C CG   . LEU A 1 23 ? 1.034   -0.216  5.074   1.00 0.00 ? 128 LEU A CG   11 
ATOM 8935  C CD1  . LEU A 1 23 ? 0.357   -0.612  3.774   1.00 0.00 ? 128 LEU A CD1  11 
ATOM 8936  C CD2  . LEU A 1 23 ? 0.762   -1.248  6.143   1.00 0.00 ? 128 LEU A CD2  11 
ATOM 8937  H H    . LEU A 1 23 ? 2.451   2.518   5.369   1.00 0.00 ? 128 LEU A H    11 
ATOM 8938  H HA   . LEU A 1 23 ? 3.073   0.136   6.937   1.00 0.00 ? 128 LEU A HA   11 
ATOM 8939  H HB2  . LEU A 1 23 ? 2.709   0.485   3.967   1.00 0.00 ? 128 LEU A HB2  11 
ATOM 8940  H HB3  . LEU A 1 23 ? 2.975   -1.031  4.785   1.00 0.00 ? 128 LEU A HB3  11 
ATOM 8941  H HG   . LEU A 1 23 ? 0.614   0.721   5.400   1.00 0.00 ? 128 LEU A HG   11 
ATOM 8942  H HD11 . LEU A 1 23 ? 0.597   -1.640  3.546   1.00 0.00 ? 128 LEU A HD11 11 
ATOM 8943  H HD12 . LEU A 1 23 ? 0.707   0.026   2.976   1.00 0.00 ? 128 LEU A HD12 11 
ATOM 8944  H HD13 . LEU A 1 23 ? -0.714  -0.506  3.879   1.00 0.00 ? 128 LEU A HD13 11 
ATOM 8945  H HD21 . LEU A 1 23 ? 0.951   -0.820  7.116   1.00 0.00 ? 128 LEU A HD21 11 
ATOM 8946  H HD22 . LEU A 1 23 ? 1.416   -2.084  5.985   1.00 0.00 ? 128 LEU A HD22 11 
ATOM 8947  H HD23 . LEU A 1 23 ? -0.266  -1.574  6.082   1.00 0.00 ? 128 LEU A HD23 11 
ATOM 8948  N N    . CYS A 1 24 ? 5.247   1.937   5.425   1.00 0.00 ? 129 CYS A N    11 
ATOM 8949  C CA   . CYS A 1 24 ? 6.676   2.133   5.192   1.00 0.00 ? 129 CYS A CA   11 
ATOM 8950  C C    . CYS A 1 24 ? 7.444   2.148   6.514   1.00 0.00 ? 129 CYS A C    11 
ATOM 8951  O O    . CYS A 1 24 ? 6.884   2.470   7.561   1.00 0.00 ? 129 CYS A O    11 
ATOM 8952  C CB   . CYS A 1 24 ? 6.933   3.436   4.430   1.00 0.00 ? 129 CYS A CB   11 
ATOM 8953  S SG   . CYS A 1 24 ? 6.500   4.952   5.349   1.00 0.00 ? 129 CYS A SG   11 
ATOM 8954  H H    . CYS A 1 24 ? 4.631   2.693   5.303   1.00 0.00 ? 129 CYS A H    11 
ATOM 8955  H HA   . CYS A 1 24 ? 7.027   1.303   4.597   1.00 0.00 ? 129 CYS A HA   11 
ATOM 8956  H HB2  . CYS A 1 24 ? 7.982   3.494   4.182   1.00 0.00 ? 129 CYS A HB2  11 
ATOM 8957  H HB3  . CYS A 1 24 ? 6.357   3.423   3.518   1.00 0.00 ? 129 CYS A HB3  11 
ATOM 8958  N N    . PRO A 1 25 ? 8.745   1.798   6.478   1.00 0.00 ? 130 PRO A N    11 
ATOM 8959  C CA   . PRO A 1 25 ? 9.599   1.761   7.667   1.00 0.00 ? 130 PRO A CA   11 
ATOM 8960  C C    . PRO A 1 25 ? 10.130  3.139   8.046   1.00 0.00 ? 130 PRO A C    11 
ATOM 8961  O O    . PRO A 1 25 ? 11.096  3.254   8.802   1.00 0.00 ? 130 PRO A O    11 
ATOM 8962  C CB   . PRO A 1 25 ? 10.759  0.835   7.251   1.00 0.00 ? 130 PRO A CB   11 
ATOM 8963  C CG   . PRO A 1 25 ? 10.458  0.394   5.849   1.00 0.00 ? 130 PRO A CG   11 
ATOM 8964  C CD   . PRO A 1 25 ? 9.496   1.400   5.288   1.00 0.00 ? 130 PRO A CD   11 
ATOM 8965  H HA   . PRO A 1 25 ? 9.080   1.332   8.511   1.00 0.00 ? 130 PRO A HA   11 
ATOM 8966  H HB2  . PRO A 1 25 ? 11.688  1.384   7.297   1.00 0.00 ? 130 PRO A HB2  11 
ATOM 8967  H HB3  . PRO A 1 25 ? 10.804  -0.007  7.925   1.00 0.00 ? 130 PRO A HB3  11 
ATOM 8968  H HG2  . PRO A 1 25 ? 11.367  0.381   5.265   1.00 0.00 ? 130 PRO A HG2  11 
ATOM 8969  H HG3  . PRO A 1 25 ? 10.007  -0.588  5.863   1.00 0.00 ? 130 PRO A HG3  11 
ATOM 8970  H HD2  . PRO A 1 25 ? 10.028  2.239   4.864   1.00 0.00 ? 130 PRO A HD2  11 
ATOM 8971  H HD3  . PRO A 1 25 ? 8.847   0.946   4.552   1.00 0.00 ? 130 PRO A HD3  11 
ATOM 8972  N N    . TYR A 1 26 ? 9.498   4.182   7.517   1.00 0.00 ? 131 TYR A N    11 
ATOM 8973  C CA   . TYR A 1 26 ? 9.908   5.553   7.803   1.00 0.00 ? 131 TYR A CA   11 
ATOM 8974  C C    . TYR A 1 26 ? 8.718   6.398   8.248   1.00 0.00 ? 131 TYR A C    11 
ATOM 8975  O O    . TYR A 1 26 ? 8.486   6.493   9.472   1.00 0.00 ? 131 TYR A O    11 
ATOM 8976  C CB   . TYR A 1 26 ? 10.564  6.182   6.572   1.00 0.00 ? 131 TYR A CB   11 
ATOM 8977  C CG   . TYR A 1 26 ? 12.005  5.769   6.372   1.00 0.00 ? 131 TYR A CG   11 
ATOM 8978  C CD1  . TYR A 1 26 ? 12.326  4.594   5.703   1.00 0.00 ? 131 TYR A CD1  11 
ATOM 8979  C CD2  . TYR A 1 26 ? 13.045  6.556   6.851   1.00 0.00 ? 131 TYR A CD2  11 
ATOM 8980  C CE1  . TYR A 1 26 ? 13.643  4.215   5.519   1.00 0.00 ? 131 TYR A CE1  11 
ATOM 8981  C CE2  . TYR A 1 26 ? 14.364  6.186   6.669   1.00 0.00 ? 131 TYR A CE2  11 
ATOM 8982  C CZ   . TYR A 1 26 ? 14.658  5.015   6.003   1.00 0.00 ? 131 TYR A CZ   11 
ATOM 8983  O OH   . TYR A 1 26 ? 15.969  4.642   5.819   1.00 0.00 ? 131 TYR A OH   11 
ATOM 8984  O OXT  . TYR A 1 26 ? 8.029   6.960   7.369   1.00 0.00 ? 131 TYR A OXT  11 
ATOM 8985  H H    . TYR A 1 26 ? 8.737   4.026   6.920   1.00 0.00 ? 131 TYR A H    11 
ATOM 8986  H HA   . TYR A 1 26 ? 10.629  5.521   8.606   1.00 0.00 ? 131 TYR A HA   11 
ATOM 8987  H HB2  . TYR A 1 26 ? 10.011  5.892   5.691   1.00 0.00 ? 131 TYR A HB2  11 
ATOM 8988  H HB3  . TYR A 1 26 ? 10.537  7.258   6.669   1.00 0.00 ? 131 TYR A HB3  11 
ATOM 8989  H HD1  . TYR A 1 26 ? 11.530  3.970   5.325   1.00 0.00 ? 131 TYR A HD1  11 
ATOM 8990  H HD2  . TYR A 1 26 ? 12.811  7.473   7.372   1.00 0.00 ? 131 TYR A HD2  11 
ATOM 8991  H HE1  . TYR A 1 26 ? 13.873  3.298   4.998   1.00 0.00 ? 131 TYR A HE1  11 
ATOM 8992  H HE2  . TYR A 1 26 ? 15.157  6.811   7.049   1.00 0.00 ? 131 TYR A HE2  11 
ATOM 8993  H HH   . TYR A 1 26 ? 16.109  4.403   4.901   1.00 0.00 ? 131 TYR A HH   11 
ATOM 8994  N N    . PRO B 2 1  ? -2.245  13.667  -11.160 1.00 0.00 ? 25  PRO B N    11 
ATOM 8995  C CA   . PRO B 2 1  ? -2.921  14.112  -9.916  1.00 0.00 ? 25  PRO B CA   11 
ATOM 8996  C C    . PRO B 2 1  ? -4.069  13.177  -9.550  1.00 0.00 ? 25  PRO B C    11 
ATOM 8997  O O    . PRO B 2 1  ? -4.862  12.787  -10.406 1.00 0.00 ? 25  PRO B O    11 
ATOM 8998  C CB   . PRO B 2 1  ? -3.443  15.526  -10.116 1.00 0.00 ? 25  PRO B CB   11 
ATOM 8999  C CG   . PRO B 2 1  ? -2.875  15.928  -11.433 1.00 0.00 ? 25  PRO B CG   11 
ATOM 9000  C CD   . PRO B 2 1  ? -2.627  14.646  -12.197 1.00 0.00 ? 25  PRO B CD   11 
ATOM 9001  H H2   . PRO B 2 1  ? -2.545  12.689  -11.305 1.00 0.00 ? 25  PRO B H2   11 
ATOM 9002  H H3   . PRO B 2 1  ? -1.236  13.573  -10.895 1.00 0.00 ? 25  PRO B H3   11 
ATOM 9003  H HA   . PRO B 2 1  ? -2.198  14.109  -9.114  1.00 0.00 ? 25  PRO B HA   11 
ATOM 9004  H HB2  . PRO B 2 1  ? -4.523  15.518  -10.132 1.00 0.00 ? 25  PRO B HB2  11 
ATOM 9005  H HB3  . PRO B 2 1  ? -3.089  16.164  -9.321  1.00 0.00 ? 25  PRO B HB3  11 
ATOM 9006  H HG2  . PRO B 2 1  ? -3.582  16.548  -11.964 1.00 0.00 ? 25  PRO B HG2  11 
ATOM 9007  H HG3  . PRO B 2 1  ? -1.947  16.461  -11.284 1.00 0.00 ? 25  PRO B HG3  11 
ATOM 9008  H HD2  . PRO B 2 1  ? -3.526  14.332  -12.705 1.00 0.00 ? 25  PRO B HD2  11 
ATOM 9009  H HD3  . PRO B 2 1  ? -1.823  14.783  -12.905 1.00 0.00 ? 25  PRO B HD3  11 
ATOM 9010  N N    . THR B 2 2  ? -4.151  12.824  -8.270  1.00 0.00 ? 26  THR B N    11 
ATOM 9011  C CA   . THR B 2 2  ? -5.203  11.937  -7.789  1.00 0.00 ? 26  THR B CA   11 
ATOM 9012  C C    . THR B 2 2  ? -5.298  11.972  -6.265  1.00 0.00 ? 26  THR B C    11 
ATOM 9013  O O    . THR B 2 2  ? -4.281  12.074  -5.577  1.00 0.00 ? 26  THR B O    11 
ATOM 9014  C CB   . THR B 2 2  ? -4.967  10.483  -8.243  1.00 0.00 ? 26  THR B CB   11 
ATOM 9015  O OG1  . THR B 2 2  ? -5.941  9.617   -7.646  1.00 0.00 ? 26  THR B OG1  11 
ATOM 9016  C CG2  . THR B 2 2  ? -3.568  10.017  -7.867  1.00 0.00 ? 26  THR B CG2  11 
ATOM 9017  H H    . THR B 2 2  ? -3.490  13.170  -7.635  1.00 0.00 ? 26  THR B H    11 
ATOM 9018  H HA   . THR B 2 2  ? -6.139  12.275  -8.208  1.00 0.00 ? 26  THR B HA   11 
ATOM 9019  H HB   . THR B 2 2  ? -5.069  10.438  -9.317  1.00 0.00 ? 26  THR B HB   11 
ATOM 9020  H HG1  . THR B 2 2  ? -5.902  8.754   -8.067  1.00 0.00 ? 26  THR B HG1  11 
ATOM 9021  H HG21 . THR B 2 2  ? -3.432  8.993   -8.187  1.00 0.00 ? 26  THR B HG21 11 
ATOM 9022  H HG22 . THR B 2 2  ? -3.443  10.078  -6.796  1.00 0.00 ? 26  THR B HG22 11 
ATOM 9023  H HG23 . THR B 2 2  ? -2.836  10.646  -8.351  1.00 0.00 ? 26  THR B HG23 11 
ATOM 9024  N N    . PRO B 2 3  ? -6.524  11.892  -5.715  1.00 0.00 ? 27  PRO B N    11 
ATOM 9025  C CA   . PRO B 2 3  ? -6.754  11.915  -4.280  1.00 0.00 ? 27  PRO B CA   11 
ATOM 9026  C C    . PRO B 2 3  ? -6.835  10.513  -3.688  1.00 0.00 ? 27  PRO B C    11 
ATOM 9027  O O    . PRO B 2 3  ? -7.906  10.067  -3.274  1.00 0.00 ? 27  PRO B O    11 
ATOM 9028  C CB   . PRO B 2 3  ? -8.104  12.622  -4.187  1.00 0.00 ? 27  PRO B CB   11 
ATOM 9029  C CG   . PRO B 2 3  ? -8.827  12.257  -5.449  1.00 0.00 ? 27  PRO B CG   11 
ATOM 9030  C CD   . PRO B 2 3  ? -7.794  11.773  -6.445  1.00 0.00 ? 27  PRO B CD   11 
ATOM 9031  H HA   . PRO B 2 3  ? -6.002  12.490  -3.761  1.00 0.00 ? 27  PRO B HA   11 
ATOM 9032  H HB2  . PRO B 2 3  ? -8.633  12.273  -3.312  1.00 0.00 ? 27  PRO B HB2  11 
ATOM 9033  H HB3  . PRO B 2 3  ? -7.948  13.688  -4.118  1.00 0.00 ? 27  PRO B HB3  11 
ATOM 9034  H HG2  . PRO B 2 3  ? -9.539  11.471  -5.244  1.00 0.00 ? 27  PRO B HG2  11 
ATOM 9035  H HG3  . PRO B 2 3  ? -9.339  13.127  -5.837  1.00 0.00 ? 27  PRO B HG3  11 
ATOM 9036  H HD2  . PRO B 2 3  ? -7.986  10.745  -6.716  1.00 0.00 ? 27  PRO B HD2  11 
ATOM 9037  H HD3  . PRO B 2 3  ? -7.794  12.401  -7.324  1.00 0.00 ? 27  PRO B HD3  11 
ATOM 9038  N N    . GLU B 2 4  ? -5.689  9.832   -3.641  1.00 0.00 ? 28  GLU B N    11 
ATOM 9039  C CA   . GLU B 2 4  ? -5.604  8.485   -3.125  1.00 0.00 ? 28  GLU B CA   11 
ATOM 9040  C C    . GLU B 2 4  ? -6.813  7.655   -3.529  1.00 0.00 ? 28  GLU B C    11 
ATOM 9041  O O    . GLU B 2 4  ? -7.649  7.293   -2.700  1.00 0.00 ? 28  GLU B O    11 
ATOM 9042  C CB   . GLU B 2 4  ? -5.445  8.531   -1.622  1.00 0.00 ? 28  GLU B CB   11 
ATOM 9043  C CG   . GLU B 2 4  ? -4.908  9.856   -1.106  1.00 0.00 ? 28  GLU B CG   11 
ATOM 9044  C CD   . GLU B 2 4  ? -4.675  9.857   0.390   1.00 0.00 ? 28  GLU B CD   11 
ATOM 9045  O OE1  . GLU B 2 4  ? -5.661  9.735   1.147   1.00 0.00 ? 28  GLU B OE1  11 
ATOM 9046  O OE2  . GLU B 2 4  ? -3.504  9.982   0.805   1.00 0.00 ? 28  GLU B OE2  11 
ATOM 9047  H H    . GLU B 2 4  ? -4.869  10.265  -3.919  1.00 0.00 ? 28  GLU B H    11 
ATOM 9048  H HA   . GLU B 2 4  ? -4.719  8.031   -3.549  1.00 0.00 ? 28  GLU B HA   11 
ATOM 9049  H HB2  . GLU B 2 4  ? -6.398  8.345   -1.162  1.00 0.00 ? 28  GLU B HB2  11 
ATOM 9050  H HB3  . GLU B 2 4  ? -4.757  7.764   -1.347  1.00 0.00 ? 28  GLU B HB3  11 
ATOM 9051  H HG2  . GLU B 2 4  ? -3.972  10.062  -1.598  1.00 0.00 ? 28  GLU B HG2  11 
ATOM 9052  H HG3  . GLU B 2 4  ? -5.618  10.635  -1.346  1.00 0.00 ? 28  GLU B HG3  11 
ATOM 9053  N N    . MET B 2 5  ? -6.887  7.359   -4.816  1.00 0.00 ? 29  MET B N    11 
ATOM 9054  C CA   . MET B 2 5  ? -7.987  6.581   -5.372  1.00 0.00 ? 29  MET B CA   11 
ATOM 9055  C C    . MET B 2 5  ? -7.751  5.092   -5.185  1.00 0.00 ? 29  MET B C    11 
ATOM 9056  O O    . MET B 2 5  ? -8.398  4.258   -5.819  1.00 0.00 ? 29  MET B O    11 
ATOM 9057  C CB   . MET B 2 5  ? -8.155  6.909   -6.852  1.00 0.00 ? 29  MET B CB   11 
ATOM 9058  C CG   . MET B 2 5  ? -9.458  6.407   -7.457  1.00 0.00 ? 29  MET B CG   11 
ATOM 9059  S SD   . MET B 2 5  ? -9.690  6.955   -9.159  1.00 0.00 ? 29  MET B SD   11 
ATOM 9060  C CE   . MET B 2 5  ? -8.231  6.272   -9.942  1.00 0.00 ? 29  MET B CE   11 
ATOM 9061  H H    . MET B 2 5  ? -6.173  7.666   -5.410  1.00 0.00 ? 29  MET B H    11 
ATOM 9062  H HA   . MET B 2 5  ? -8.883  6.851   -4.844  1.00 0.00 ? 29  MET B HA   11 
ATOM 9063  H HB2  . MET B 2 5  ? -8.112  7.982   -6.980  1.00 0.00 ? 29  MET B HB2  11 
ATOM 9064  H HB3  . MET B 2 5  ? -7.336  6.458   -7.391  1.00 0.00 ? 29  MET B HB3  11 
ATOM 9065  H HG2  . MET B 2 5  ? -9.454  5.328   -7.440  1.00 0.00 ? 29  MET B HG2  11 
ATOM 9066  H HG3  . MET B 2 5  ? -10.279 6.774   -6.860  1.00 0.00 ? 29  MET B HG3  11 
ATOM 9067  H HE1  . MET B 2 5  ? -7.347  6.697   -9.488  1.00 0.00 ? 29  MET B HE1  11 
ATOM 9068  H HE2  . MET B 2 5  ? -8.243  6.512   -10.995 1.00 0.00 ? 29  MET B HE2  11 
ATOM 9069  H HE3  . MET B 2 5  ? -8.222  5.200   -9.815  1.00 0.00 ? 29  MET B HE3  11 
ATOM 9070  N N    . ARG B 2 6  ? -6.827  4.773   -4.296  1.00 0.00 ? 30  ARG B N    11 
ATOM 9071  C CA   . ARG B 2 6  ? -6.490  3.403   -3.996  1.00 0.00 ? 30  ARG B CA   11 
ATOM 9072  C C    . ARG B 2 6  ? -6.082  2.623   -5.245  1.00 0.00 ? 30  ARG B C    11 
ATOM 9073  O O    . ARG B 2 6  ? -6.155  3.127   -6.364  1.00 0.00 ? 30  ARG B O    11 
ATOM 9074  C CB   . ARG B 2 6  ? -7.673  2.752   -3.325  1.00 0.00 ? 30  ARG B CB   11 
ATOM 9075  C CG   . ARG B 2 6  ? -7.533  2.685   -1.823  1.00 0.00 ? 30  ARG B CG   11 
ATOM 9076  C CD   . ARG B 2 6  ? -8.075  1.393   -1.280  1.00 0.00 ? 30  ARG B CD   11 
ATOM 9077  N NE   . ARG B 2 6  ? -7.985  1.334   0.172   1.00 0.00 ? 30  ARG B NE   11 
ATOM 9078  C CZ   . ARG B 2 6  ? -8.506  0.355   0.908   1.00 0.00 ? 30  ARG B CZ   11 
ATOM 9079  N NH1  . ARG B 2 6  ? -9.151  -0.645  0.324   1.00 0.00 ? 30  ARG B NH1  11 
ATOM 9080  N NH2  . ARG B 2 6  ? -8.384  0.378   2.228   1.00 0.00 ? 30  ARG B NH2  11 
ATOM 9081  H H    . ARG B 2 6  ? -6.382  5.476   -3.813  1.00 0.00 ? 30  ARG B H    11 
ATOM 9082  H HA   . ARG B 2 6  ? -5.665  3.403   -3.300  1.00 0.00 ? 30  ARG B HA   11 
ATOM 9083  H HB2  . ARG B 2 6  ? -8.563  3.315   -3.556  1.00 0.00 ? 30  ARG B HB2  11 
ATOM 9084  H HB3  . ARG B 2 6  ? -7.775  1.767   -3.705  1.00 0.00 ? 30  ARG B HB3  11 
ATOM 9085  H HG2  . ARG B 2 6  ? -6.489  2.765   -1.562  1.00 0.00 ? 30  ARG B HG2  11 
ATOM 9086  H HG3  . ARG B 2 6  ? -8.079  3.509   -1.384  1.00 0.00 ? 30  ARG B HG3  11 
ATOM 9087  H HD2  . ARG B 2 6  ? -9.105  1.310   -1.573  1.00 0.00 ? 30  ARG B HD2  11 
ATOM 9088  H HD3  . ARG B 2 6  ? -7.503  0.584   -1.707  1.00 0.00 ? 30  ARG B HD3  11 
ATOM 9089  H HE   . ARG B 2 6  ? -7.516  2.066   0.624   1.00 0.00 ? 30  ARG B HE   11 
ATOM 9090  H HH11 . ARG B 2 6  ? -9.248  -0.667  -0.671  1.00 0.00 ? 30  ARG B HH11 11 
ATOM 9091  H HH12 . ARG B 2 6  ? -9.542  -1.381  0.879   1.00 0.00 ? 30  ARG B HH12 11 
ATOM 9092  H HH21 . ARG B 2 6  ? -7.900  1.132   2.671   1.00 0.00 ? 30  ARG B HH21 11 
ATOM 9093  H HH22 . ARG B 2 6  ? -8.775  -0.358  2.779   1.00 0.00 ? 30  ARG B HH22 11 
ATOM 9094  N N    . GLU B 2 7  ? -5.643  1.384   -5.030  1.00 0.00 ? 31  GLU B N    11 
ATOM 9095  C CA   . GLU B 2 7  ? -5.209  0.513   -6.117  1.00 0.00 ? 31  GLU B CA   11 
ATOM 9096  C C    . GLU B 2 7  ? -4.797  -0.839  -5.577  1.00 0.00 ? 31  GLU B C    11 
ATOM 9097  O O    . GLU B 2 7  ? -4.099  -0.932  -4.573  1.00 0.00 ? 31  GLU B O    11 
ATOM 9098  C CB   . GLU B 2 7  ? -4.044  1.141   -6.882  1.00 0.00 ? 31  GLU B CB   11 
ATOM 9099  C CG   . GLU B 2 7  ? -3.460  0.234   -7.951  1.00 0.00 ? 31  GLU B CG   11 
ATOM 9100  C CD   . GLU B 2 7  ? -4.401  0.027   -9.122  1.00 0.00 ? 31  GLU B CD   11 
ATOM 9101  O OE1  . GLU B 2 7  ? -5.262  -0.873  -9.039  1.00 0.00 ? 31  GLU B OE1  11 
ATOM 9102  O OE2  . GLU B 2 7  ? -4.273  0.764   -10.122 1.00 0.00 ? 31  GLU B OE2  11 
ATOM 9103  H H    . GLU B 2 7  ? -5.611  1.047   -4.111  1.00 0.00 ? 31  GLU B H    11 
ATOM 9104  H HA   . GLU B 2 7  ? -6.041  0.363   -6.790  1.00 0.00 ? 31  GLU B HA   11 
ATOM 9105  H HB2  . GLU B 2 7  ? -4.388  2.048   -7.358  1.00 0.00 ? 31  GLU B HB2  11 
ATOM 9106  H HB3  . GLU B 2 7  ? -3.261  1.388   -6.181  1.00 0.00 ? 31  GLU B HB3  11 
ATOM 9107  H HG2  . GLU B 2 7  ? -2.548  0.674   -8.313  1.00 0.00 ? 31  GLU B HG2  11 
ATOM 9108  H HG3  . GLU B 2 7  ? -3.242  -0.727  -7.508  1.00 0.00 ? 31  GLU B HG3  11 
ATOM 9109  N N    . LYS B 2 8  ? -5.230  -1.881  -6.265  1.00 0.00 ? 32  LYS B N    11 
ATOM 9110  C CA   . LYS B 2 8  ? -4.941  -3.238  -5.867  1.00 0.00 ? 32  LYS B CA   11 
ATOM 9111  C C    . LYS B 2 8  ? -3.453  -3.542  -5.937  1.00 0.00 ? 32  LYS B C    11 
ATOM 9112  O O    . LYS B 2 8  ? -2.888  -3.768  -7.008  1.00 0.00 ? 32  LYS B O    11 
ATOM 9113  C CB   . LYS B 2 8  ? -5.739  -4.185  -6.739  1.00 0.00 ? 32  LYS B CB   11 
ATOM 9114  C CG   . LYS B 2 8  ? -7.192  -3.775  -6.852  1.00 0.00 ? 32  LYS B CG   11 
ATOM 9115  C CD   . LYS B 2 8  ? -8.047  -4.901  -7.413  1.00 0.00 ? 32  LYS B CD   11 
ATOM 9116  C CE   . LYS B 2 8  ? -9.523  -4.621  -7.226  1.00 0.00 ? 32  LYS B CE   11 
ATOM 9117  N NZ   . LYS B 2 8  ? -10.369 -5.735  -7.739  1.00 0.00 ? 32  LYS B NZ   11 
ATOM 9118  H H    . LYS B 2 8  ? -5.764  -1.730  -7.070  1.00 0.00 ? 32  LYS B H    11 
ATOM 9119  H HA   . LYS B 2 8  ? -5.268  -3.355  -4.845  1.00 0.00 ? 32  LYS B HA   11 
ATOM 9120  H HB2  . LYS B 2 8  ? -5.308  -4.202  -7.726  1.00 0.00 ? 32  LYS B HB2  11 
ATOM 9121  H HB3  . LYS B 2 8  ? -5.696  -5.167  -6.315  1.00 0.00 ? 32  LYS B HB3  11 
ATOM 9122  H HG2  . LYS B 2 8  ? -7.554  -3.505  -5.871  1.00 0.00 ? 32  LYS B HG2  11 
ATOM 9123  H HG3  . LYS B 2 8  ? -7.265  -2.919  -7.501  1.00 0.00 ? 32  LYS B HG3  11 
ATOM 9124  H HD2  . LYS B 2 8  ? -7.844  -5.002  -8.464  1.00 0.00 ? 32  LYS B HD2  11 
ATOM 9125  H HD3  . LYS B 2 8  ? -7.795  -5.821  -6.905  1.00 0.00 ? 32  LYS B HD3  11 
ATOM 9126  H HE2  . LYS B 2 8  ? -9.712  -4.492  -6.176  1.00 0.00 ? 32  LYS B HE2  11 
ATOM 9127  H HE3  . LYS B 2 8  ? -9.776  -3.715  -7.754  1.00 0.00 ? 32  LYS B HE3  11 
ATOM 9128  H HZ1  . LYS B 2 8  ? -10.151 -6.615  -7.229  1.00 0.00 ? 32  LYS B HZ1  11 
ATOM 9129  H HZ2  . LYS B 2 8  ? -10.192 -5.882  -8.752  1.00 0.00 ? 32  LYS B HZ2  11 
ATOM 9130  H HZ3  . LYS B 2 8  ? -11.376 -5.511  -7.604  1.00 0.00 ? 32  LYS B HZ3  11 
ATOM 9131  N N    . LEU B 2 9  ? -2.839  -3.542  -4.767  1.00 0.00 ? 33  LEU B N    11 
ATOM 9132  C CA   . LEU B 2 9  ? -1.422  -3.801  -4.610  1.00 0.00 ? 33  LEU B CA   11 
ATOM 9133  C C    . LEU B 2 9  ? -1.145  -5.235  -4.177  1.00 0.00 ? 33  LEU B C    11 
ATOM 9134  O O    . LEU B 2 9  ? -1.351  -5.591  -3.016  1.00 0.00 ? 33  LEU B O    11 
ATOM 9135  C CB   . LEU B 2 9  ? -0.871  -2.863  -3.577  1.00 0.00 ? 33  LEU B CB   11 
ATOM 9136  C CG   . LEU B 2 9  ? -1.251  -1.404  -3.761  1.00 0.00 ? 33  LEU B CG   11 
ATOM 9137  C CD1  . LEU B 2 9  ? -0.673  -0.566  -2.635  1.00 0.00 ? 33  LEU B CD1  11 
ATOM 9138  C CD2  . LEU B 2 9  ? -0.782  -0.901  -5.119  1.00 0.00 ? 33  LEU B CD2  11 
ATOM 9139  H H    . LEU B 2 9  ? -3.362  -3.334  -3.972  1.00 0.00 ? 33  LEU B H    11 
ATOM 9140  H HA   . LEU B 2 9  ? -0.915  -3.601  -5.533  1.00 0.00 ? 33  LEU B HA   11 
ATOM 9141  H HB2  . LEU B 2 9  ? -1.192  -3.187  -2.603  1.00 0.00 ? 33  LEU B HB2  11 
ATOM 9142  H HB3  . LEU B 2 9  ? 0.184   -2.939  -3.635  1.00 0.00 ? 33  LEU B HB3  11 
ATOM 9143  H HG   . LEU B 2 9  ? -2.321  -1.321  -3.718  1.00 0.00 ? 33  LEU B HG   11 
ATOM 9144  H HD11 . LEU B 2 9  ? -1.367  -0.545  -1.808  1.00 0.00 ? 33  LEU B HD11 11 
ATOM 9145  H HD12 . LEU B 2 9  ? -0.493  0.442   -2.981  1.00 0.00 ? 33  LEU B HD12 11 
ATOM 9146  H HD13 . LEU B 2 9  ? 0.260   -1.002  -2.308  1.00 0.00 ? 33  LEU B HD13 11 
ATOM 9147  H HD21 . LEU B 2 9  ? -1.376  -0.048  -5.412  1.00 0.00 ? 33  LEU B HD21 11 
ATOM 9148  H HD22 . LEU B 2 9  ? -0.891  -1.691  -5.854  1.00 0.00 ? 33  LEU B HD22 11 
ATOM 9149  H HD23 . LEU B 2 9  ? 0.257   -0.612  -5.056  1.00 0.00 ? 33  LEU B HD23 11 
ATOM 9150  N N    . CYS B 2 10 ? -0.674  -6.055  -5.110  1.00 0.00 ? 34  CYS B N    11 
ATOM 9151  C CA   . CYS B 2 10 ? -0.362  -7.445  -4.804  1.00 0.00 ? 34  CYS B CA   11 
ATOM 9152  C C    . CYS B 2 10 ? 1.137   -7.652  -4.665  1.00 0.00 ? 34  CYS B C    11 
ATOM 9153  O O    . CYS B 2 10 ? 1.850   -7.860  -5.646  1.00 0.00 ? 34  CYS B O    11 
ATOM 9154  C CB   . CYS B 2 10 ? -0.928  -8.366  -5.872  1.00 0.00 ? 34  CYS B CB   11 
ATOM 9155  S SG   . CYS B 2 10 ? -1.533  -9.959  -5.229  1.00 0.00 ? 34  CYS B SG   11 
ATOM 9156  H H    . CYS B 2 10 ? -0.537  -5.721  -6.021  1.00 0.00 ? 34  CYS B H    11 
ATOM 9157  H HA   . CYS B 2 10 ? -0.829  -7.682  -3.861  1.00 0.00 ? 34  CYS B HA   11 
ATOM 9158  H HB2  . CYS B 2 10 ? -1.752  -7.871  -6.345  1.00 0.00 ? 34  CYS B HB2  11 
ATOM 9159  H HB3  . CYS B 2 10 ? -0.164  -8.573  -6.607  1.00 0.00 ? 34  CYS B HB3  11 
ATOM 9160  N N    . GLY B 2 11 ? 1.592   -7.595  -3.426  1.00 0.00 ? 35  GLY B N    11 
ATOM 9161  C CA   . GLY B 2 11 ? 3.004   -7.774  -3.123  1.00 0.00 ? 35  GLY B CA   11 
ATOM 9162  C C    . GLY B 2 11 ? 3.897   -6.761  -3.817  1.00 0.00 ? 35  GLY B C    11 
ATOM 9163  O O    . GLY B 2 11 ? 4.218   -5.726  -3.241  1.00 0.00 ? 35  GLY B O    11 
ATOM 9164  H H    . GLY B 2 11 ? 0.953   -7.436  -2.704  1.00 0.00 ? 35  GLY B H    11 
ATOM 9165  H HA2  . GLY B 2 11 ? 3.139   -7.675  -2.057  1.00 0.00 ? 35  GLY B HA2  11 
ATOM 9166  H HA3  . GLY B 2 11 ? 3.302   -8.762  -3.415  1.00 0.00 ? 35  GLY B HA3  11 
ATOM 9167  N N    . HIS B 2 12 ? 4.324   -7.064  -5.046  1.00 0.00 ? 36  HIS B N    11 
ATOM 9168  C CA   . HIS B 2 12 ? 5.177   -6.163  -5.790  1.00 0.00 ? 36  HIS B CA   11 
ATOM 9169  C C    . HIS B 2 12 ? 4.518   -4.810  -5.994  1.00 0.00 ? 36  HIS B C    11 
ATOM 9170  O O    . HIS B 2 12 ? 5.108   -3.805  -5.644  1.00 0.00 ? 36  HIS B O    11 
ATOM 9171  C CB   . HIS B 2 12 ? 5.579   -6.757  -7.125  1.00 0.00 ? 36  HIS B CB   11 
ATOM 9172  C CG   . HIS B 2 12 ? 6.665   -5.979  -7.777  1.00 0.00 ? 36  HIS B CG   11 
ATOM 9173  N ND1  . HIS B 2 12 ? 6.941   -5.998  -9.123  1.00 0.00 ? 36  HIS B ND1  11 
ATOM 9174  C CD2  . HIS B 2 12 ? 7.555   -5.127  -7.219  1.00 0.00 ? 36  HIS B CD2  11 
ATOM 9175  C CE1  . HIS B 2 12 ? 7.972   -5.171  -9.339  1.00 0.00 ? 36  HIS B CE1  11 
ATOM 9176  N NE2  . HIS B 2 12 ? 8.385   -4.616  -8.213  1.00 0.00 ? 36  HIS B NE2  11 
ATOM 9177  H H    . HIS B 2 12 ? 4.086   -7.913  -5.445  1.00 0.00 ? 36  HIS B H    11 
ATOM 9178  H HA   . HIS B 2 12 ? 6.072   -6.014  -5.201  1.00 0.00 ? 36  HIS B HA   11 
ATOM 9179  H HB2  . HIS B 2 12 ? 5.933   -7.763  -6.969  1.00 0.00 ? 36  HIS B HB2  11 
ATOM 9180  H HB3  . HIS B 2 12 ? 4.726   -6.768  -7.783  1.00 0.00 ? 36  HIS B HB3  11 
ATOM 9181  H HD1  . HIS B 2 12 ? 6.469   -6.523  -9.803  1.00 0.00 ? 36  HIS B HD1  11 
ATOM 9182  H HD2  . HIS B 2 12 ? 7.605   -4.873  -6.159  1.00 0.00 ? 36  HIS B HD2  11 
ATOM 9183  H HE1  . HIS B 2 12 ? 8.404   -4.977  -10.309 1.00 0.00 ? 36  HIS B HE1  11 
ATOM 9184  N N    . HIS B 2 13 ? 3.325   -4.764  -6.596  1.00 0.00 ? 37  HIS B N    11 
ATOM 9185  C CA   . HIS B 2 13 ? 2.638   -3.480  -6.755  1.00 0.00 ? 37  HIS B CA   11 
ATOM 9186  C C    . HIS B 2 13 ? 2.662   -2.796  -5.423  1.00 0.00 ? 37  HIS B C    11 
ATOM 9187  O O    . HIS B 2 13 ? 3.008   -1.632  -5.292  1.00 0.00 ? 37  HIS B O    11 
ATOM 9188  C CB   . HIS B 2 13 ? 1.169   -3.653  -7.128  1.00 0.00 ? 37  HIS B CB   11 
ATOM 9189  C CG   . HIS B 2 13 ? 0.929   -3.976  -8.552  1.00 0.00 ? 37  HIS B CG   11 
ATOM 9190  N ND1  . HIS B 2 13 ? 0.134   -3.227  -9.381  1.00 0.00 ? 37  HIS B ND1  11 
ATOM 9191  C CD2  . HIS B 2 13 ? 1.375   -5.013  -9.286  1.00 0.00 ? 37  HIS B CD2  11 
ATOM 9192  C CE1  . HIS B 2 13 ? 0.117   -3.819  -10.575 1.00 0.00 ? 37  HIS B CE1  11 
ATOM 9193  N NE2  . HIS B 2 13 ? 0.859   -4.914  -10.576 1.00 0.00 ? 37  HIS B NE2  11 
ATOM 9194  H H    . HIS B 2 13 ? 2.910   -5.588  -6.932  1.00 0.00 ? 37  HIS B H    11 
ATOM 9195  H HA   . HIS B 2 13 ? 3.155   -2.880  -7.497  1.00 0.00 ? 37  HIS B HA   11 
ATOM 9196  H HB2  . HIS B 2 13 ? 0.749   -4.449  -6.534  1.00 0.00 ? 37  HIS B HB2  11 
ATOM 9197  H HB3  . HIS B 2 13 ? 0.645   -2.730  -6.901  1.00 0.00 ? 37  HIS B HB3  11 
ATOM 9198  H HD1  . HIS B 2 13 ? -0.340  -2.404  -9.138  1.00 0.00 ? 37  HIS B HD1  11 
ATOM 9199  H HD2  . HIS B 2 13 ? 2.025   -5.796  -8.928  1.00 0.00 ? 37  HIS B HD2  11 
ATOM 9200  H HE1  . HIS B 2 13 ? -0.437  -3.454  -11.421 1.00 0.00 ? 37  HIS B HE1  11 
ATOM 9201  N N    . PHE B 2 14 ? 2.275   -3.577  -4.437  1.00 0.00 ? 38  PHE B N    11 
ATOM 9202  C CA   . PHE B 2 14 ? 2.229   -3.142  -3.072  1.00 0.00 ? 38  PHE B CA   11 
ATOM 9203  C C    . PHE B 2 14 ? 3.577   -2.625  -2.639  1.00 0.00 ? 38  PHE B C    11 
ATOM 9204  O O    . PHE B 2 14 ? 3.672   -1.727  -1.808  1.00 0.00 ? 38  PHE B O    11 
ATOM 9205  C CB   . PHE B 2 14 ? 1.757   -4.308  -2.213  1.00 0.00 ? 38  PHE B CB   11 
ATOM 9206  C CG   . PHE B 2 14 ? 1.938   -4.067  -0.766  1.00 0.00 ? 38  PHE B CG   11 
ATOM 9207  C CD1  . PHE B 2 14 ? 1.344   -2.970  -0.187  1.00 0.00 ? 38  PHE B CD1  11 
ATOM 9208  C CD2  . PHE B 2 14 ? 2.711   -4.916  0.005   1.00 0.00 ? 38  PHE B CD2  11 
ATOM 9209  C CE1  . PHE B 2 14 ? 1.514   -2.711  1.157   1.00 0.00 ? 38  PHE B CE1  11 
ATOM 9210  C CE2  . PHE B 2 14 ? 2.892   -4.668  1.348   1.00 0.00 ? 38  PHE B CE2  11 
ATOM 9211  C CZ   . PHE B 2 14 ? 2.294   -3.561  1.928   1.00 0.00 ? 38  PHE B CZ   11 
ATOM 9212  H H    . PHE B 2 14 ? 2.008   -4.498  -4.645  1.00 0.00 ? 38  PHE B H    11 
ATOM 9213  H HA   . PHE B 2 14 ? 1.516   -2.336  -3.001  1.00 0.00 ? 38  PHE B HA   11 
ATOM 9214  H HB2  . PHE B 2 14 ? 0.705   -4.474  -2.391  1.00 0.00 ? 38  PHE B HB2  11 
ATOM 9215  H HB3  . PHE B 2 14 ? 2.303   -5.194  -2.485  1.00 0.00 ? 38  PHE B HB3  11 
ATOM 9216  H HD1  . PHE B 2 14 ? 0.729   -2.314  -0.806  1.00 0.00 ? 38  PHE B HD1  11 
ATOM 9217  H HD2  . PHE B 2 14 ? 3.175   -5.783  -0.458  1.00 0.00 ? 38  PHE B HD2  11 
ATOM 9218  H HE1  . PHE B 2 14 ? 1.049   -1.848  1.602   1.00 0.00 ? 38  PHE B HE1  11 
ATOM 9219  H HE2  . PHE B 2 14 ? 3.492   -5.338  1.946   1.00 0.00 ? 38  PHE B HE2  11 
ATOM 9220  H HZ   . PHE B 2 14 ? 2.432   -3.361  2.980   1.00 0.00 ? 38  PHE B HZ   11 
ATOM 9221  N N    . VAL B 2 15 ? 4.611   -3.197  -3.214  1.00 0.00 ? 39  VAL B N    11 
ATOM 9222  C CA   . VAL B 2 15 ? 5.957   -2.777  -2.925  1.00 0.00 ? 39  VAL B CA   11 
ATOM 9223  C C    . VAL B 2 15 ? 6.201   -1.425  -3.583  1.00 0.00 ? 39  VAL B C    11 
ATOM 9224  O O    . VAL B 2 15 ? 6.706   -0.509  -2.949  1.00 0.00 ? 39  VAL B O    11 
ATOM 9225  C CB   . VAL B 2 15 ? 6.983   -3.846  -3.399  1.00 0.00 ? 39  VAL B CB   11 
ATOM 9226  C CG1  . VAL B 2 15 ? 7.877   -3.329  -4.516  1.00 0.00 ? 39  VAL B CG1  11 
ATOM 9227  C CG2  . VAL B 2 15 ? 7.823   -4.331  -2.230  1.00 0.00 ? 39  VAL B CG2  11 
ATOM 9228  H H    . VAL B 2 15 ? 4.462   -3.923  -3.852  1.00 0.00 ? 39  VAL B H    11 
ATOM 9229  H HA   . VAL B 2 15 ? 6.041   -2.656  -1.856  1.00 0.00 ? 39  VAL B HA   11 
ATOM 9230  H HB   . VAL B 2 15 ? 6.431   -4.698  -3.792  1.00 0.00 ? 39  VAL B HB   11 
ATOM 9231  H HG11 . VAL B 2 15 ? 8.459   -4.146  -4.914  1.00 0.00 ? 39  VAL B HG11 11 
ATOM 9232  H HG12 . VAL B 2 15 ? 8.535   -2.581  -4.135  1.00 0.00 ? 39  VAL B HG12 11 
ATOM 9233  H HG13 . VAL B 2 15 ? 7.268   -2.909  -5.301  1.00 0.00 ? 39  VAL B HG13 11 
ATOM 9234  H HG21 . VAL B 2 15 ? 7.535   -3.802  -1.334  1.00 0.00 ? 39  VAL B HG21 11 
ATOM 9235  H HG22 . VAL B 2 15 ? 8.866   -4.146  -2.438  1.00 0.00 ? 39  VAL B HG22 11 
ATOM 9236  H HG23 . VAL B 2 15 ? 7.667   -5.391  -2.089  1.00 0.00 ? 39  VAL B HG23 11 
ATOM 9237  N N    . ARG B 2 16 ? 5.774   -1.310  -4.841  1.00 0.00 ? 40  ARG B N    11 
ATOM 9238  C CA   . ARG B 2 16 ? 5.914   -0.089  -5.628  1.00 0.00 ? 40  ARG B CA   11 
ATOM 9239  C C    . ARG B 2 16 ? 5.171   1.057   -4.981  1.00 0.00 ? 40  ARG B C    11 
ATOM 9240  O O    . ARG B 2 16 ? 5.780   2.057   -4.623  1.00 0.00 ? 40  ARG B O    11 
ATOM 9241  C CB   . ARG B 2 16 ? 5.373   -0.323  -7.028  1.00 0.00 ? 40  ARG B CB   11 
ATOM 9242  C CG   . ARG B 2 16 ? 5.754   -1.673  -7.600  1.00 0.00 ? 40  ARG B CG   11 
ATOM 9243  C CD   . ARG B 2 16 ? 5.650   -1.654  -9.100  1.00 0.00 ? 40  ARG B CD   11 
ATOM 9244  N NE   . ARG B 2 16 ? 4.762   -2.693  -9.613  1.00 0.00 ? 40  ARG B NE   11 
ATOM 9245  C CZ   . ARG B 2 16 ? 4.621   -2.968  -10.908 1.00 0.00 ? 40  ARG B CZ   11 
ATOM 9246  N NH1  . ARG B 2 16 ? 5.299   -2.272  -11.813 1.00 0.00 ? 40  ARG B NH1  11 
ATOM 9247  N NH2  . ARG B 2 16 ? 3.804   -3.936  -11.300 1.00 0.00 ? 40  ARG B NH2  11 
ATOM 9248  H H    . ARG B 2 16 ? 5.339   -2.079  -5.254  1.00 0.00 ? 40  ARG B H    11 
ATOM 9249  H HA   . ARG B 2 16 ? 6.962   0.171   -5.698  1.00 0.00 ? 40  ARG B HA   11 
ATOM 9250  H HB2  . ARG B 2 16 ? 4.296   -0.256  -7.003  1.00 0.00 ? 40  ARG B HB2  11 
ATOM 9251  H HB3  . ARG B 2 16 ? 5.759   0.444   -7.684  1.00 0.00 ? 40  ARG B HB3  11 
ATOM 9252  H HG2  . ARG B 2 16 ? 6.770   -1.905  -7.318  1.00 0.00 ? 40  ARG B HG2  11 
ATOM 9253  H HG3  . ARG B 2 16 ? 5.085   -2.424  -7.209  1.00 0.00 ? 40  ARG B HG3  11 
ATOM 9254  H HD2  . ARG B 2 16 ? 5.271   -0.690  -9.383  1.00 0.00 ? 40  ARG B HD2  11 
ATOM 9255  H HD3  . ARG B 2 16 ? 6.634   -1.793  -9.517  1.00 0.00 ? 40  ARG B HD3  11 
ATOM 9256  H HE   . ARG B 2 16 ? 4.248   -3.216  -8.962  1.00 0.00 ? 40  ARG B HE   11 
ATOM 9257  H HH11 . ARG B 2 16 ? 5.917   -1.543  -11.521 1.00 0.00 ? 40  ARG B HH11 11 
ATOM 9258  H HH12 . ARG B 2 16 ? 5.193   -2.478  -12.785 1.00 0.00 ? 40  ARG B HH12 11 
ATOM 9259  H HH21 . ARG B 2 16 ? 3.292   -4.462  -10.621 1.00 0.00 ? 40  ARG B HH21 11 
ATOM 9260  H HH22 . ARG B 2 16 ? 3.700   -4.139  -12.273 1.00 0.00 ? 40  ARG B HH22 11 
ATOM 9261  N N    . ALA B 2 17 ? 3.854   0.923   -4.832  1.00 0.00 ? 41  ALA B N    11 
ATOM 9262  C CA   . ALA B 2 17 ? 3.084   1.967   -4.213  1.00 0.00 ? 41  ALA B CA   11 
ATOM 9263  C C    . ALA B 2 17 ? 3.714   2.308   -2.873  1.00 0.00 ? 41  ALA B C    11 
ATOM 9264  O O    . ALA B 2 17 ? 3.926   3.462   -2.585  1.00 0.00 ? 41  ALA B O    11 
ATOM 9265  C CB   . ALA B 2 17 ? 1.619   1.557   -4.065  1.00 0.00 ? 41  ALA B CB   11 
ATOM 9266  H H    . ALA B 2 17 ? 3.401   0.111   -5.135  1.00 0.00 ? 41  ALA B H    11 
ATOM 9267  H HA   . ALA B 2 17 ? 3.135   2.847   -4.857  1.00 0.00 ? 41  ALA B HA   11 
ATOM 9268  H HB1  . ALA B 2 17 ? 1.046   2.400   -3.711  1.00 0.00 ? 41  ALA B HB1  11 
ATOM 9269  H HB2  . ALA B 2 17 ? 1.529   0.738   -3.357  1.00 0.00 ? 41  ALA B HB2  11 
ATOM 9270  H HB3  . ALA B 2 17 ? 1.237   1.243   -5.026  1.00 0.00 ? 41  ALA B HB3  11 
ATOM 9271  N N    . LEU B 2 18 ? 4.072   1.296   -2.077  1.00 0.00 ? 42  LEU B N    11 
ATOM 9272  C CA   . LEU B 2 18 ? 4.695   1.552   -0.779  1.00 0.00 ? 42  LEU B CA   11 
ATOM 9273  C C    . LEU B 2 18 ? 5.788   2.610   -0.931  1.00 0.00 ? 42  LEU B C    11 
ATOM 9274  O O    . LEU B 2 18 ? 5.967   3.473   -0.073  1.00 0.00 ? 42  LEU B O    11 
ATOM 9275  C CB   . LEU B 2 18 ? 5.293   0.258   -0.216  1.00 0.00 ? 42  LEU B CB   11 
ATOM 9276  C CG   . LEU B 2 18 ? 4.994   -0.020  1.258   1.00 0.00 ? 42  LEU B CG   11 
ATOM 9277  C CD1  . LEU B 2 18 ? 5.686   -1.297  1.709   1.00 0.00 ? 42  LEU B CD1  11 
ATOM 9278  C CD2  . LEU B 2 18 ? 5.427   1.155   2.114   1.00 0.00 ? 42  LEU B CD2  11 
ATOM 9279  H H    . LEU B 2 18 ? 3.925   0.366   -2.366  1.00 0.00 ? 42  LEU B H    11 
ATOM 9280  H HA   . LEU B 2 18 ? 3.929   1.924   -0.105  1.00 0.00 ? 42  LEU B HA   11 
ATOM 9281  H HB2  . LEU B 2 18 ? 4.919   -0.567  -0.798  1.00 0.00 ? 42  LEU B HB2  11 
ATOM 9282  H HB3  . LEU B 2 18 ? 6.362   0.304   -0.339  1.00 0.00 ? 42  LEU B HB3  11 
ATOM 9283  H HG   . LEU B 2 18 ? 3.928   -0.154  1.384   1.00 0.00 ? 42  LEU B HG   11 
ATOM 9284  H HD11 . LEU B 2 18 ? 5.168   -2.151  1.301   1.00 0.00 ? 42  LEU B HD11 11 
ATOM 9285  H HD12 . LEU B 2 18 ? 5.678   -1.350  2.787   1.00 0.00 ? 42  LEU B HD12 11 
ATOM 9286  H HD13 . LEU B 2 18 ? 6.708   -1.294  1.357   1.00 0.00 ? 42  LEU B HD13 11 
ATOM 9287  H HD21 . LEU B 2 18 ? 4.557   1.645   2.524   1.00 0.00 ? 42  LEU B HD21 11 
ATOM 9288  H HD22 . LEU B 2 18 ? 5.974   1.851   1.500   1.00 0.00 ? 42  LEU B HD22 11 
ATOM 9289  H HD23 . LEU B 2 18 ? 6.059   0.805   2.917   1.00 0.00 ? 42  LEU B HD23 11 
ATOM 9290  N N    . VAL B 2 19 ? 6.509   2.516   -2.042  1.00 0.00 ? 43  VAL B N    11 
ATOM 9291  C CA   . VAL B 2 19 ? 7.581   3.456   -2.371  1.00 0.00 ? 43  VAL B CA   11 
ATOM 9292  C C    . VAL B 2 19 ? 6.999   4.770   -2.873  1.00 0.00 ? 43  VAL B C    11 
ATOM 9293  O O    . VAL B 2 19 ? 7.189   5.823   -2.268  1.00 0.00 ? 43  VAL B O    11 
ATOM 9294  C CB   . VAL B 2 19 ? 8.518   2.877   -3.454  1.00 0.00 ? 43  VAL B CB   11 
ATOM 9295  C CG1  . VAL B 2 19 ? 9.940   3.322   -3.225  1.00 0.00 ? 43  VAL B CG1  11 
ATOM 9296  C CG2  . VAL B 2 19 ? 8.470   1.384   -3.427  1.00 0.00 ? 43  VAL B CG2  11 
ATOM 9297  H H    . VAL B 2 19 ? 6.323   1.778   -2.654  1.00 0.00 ? 43  VAL B H    11 
ATOM 9298  H HA   . VAL B 2 19 ? 8.154   3.640   -1.473  1.00 0.00 ? 43  VAL B HA   11 
ATOM 9299  H HB   . VAL B 2 19 ? 8.185   3.203   -4.431  1.00 0.00 ? 43  VAL B HB   11 
ATOM 9300  H HG11 . VAL B 2 19 ? 10.514  3.179   -4.129  1.00 0.00 ? 43  VAL B HG11 11 
ATOM 9301  H HG12 . VAL B 2 19 ? 10.357  2.715   -2.431  1.00 0.00 ? 43  VAL B HG12 11 
ATOM 9302  H HG13 . VAL B 2 19 ? 9.956   4.362   -2.940  1.00 0.00 ? 43  VAL B HG13 11 
ATOM 9303  H HG21 . VAL B 2 19 ? 7.549   1.045   -3.872  1.00 0.00 ? 43  VAL B HG21 11 
ATOM 9304  H HG22 . VAL B 2 19 ? 8.522   1.058   -2.396  1.00 0.00 ? 43  VAL B HG22 11 
ATOM 9305  H HG23 . VAL B 2 19 ? 9.310   0.985   -3.977  1.00 0.00 ? 43  VAL B HG23 11 
ATOM 9306  N N    . ARG B 2 20 ? 6.308   4.681   -4.002  1.00 0.00 ? 44  ARG B N    11 
ATOM 9307  C CA   . ARG B 2 20 ? 5.637   5.823   -4.614  1.00 0.00 ? 44  ARG B CA   11 
ATOM 9308  C C    . ARG B 2 20 ? 5.058   6.732   -3.537  1.00 0.00 ? 44  ARG B C    11 
ATOM 9309  O O    . ARG B 2 20 ? 5.112   7.960   -3.610  1.00 0.00 ? 44  ARG B O    11 
ATOM 9310  C CB   . ARG B 2 20 ? 4.496   5.295   -5.482  1.00 0.00 ? 44  ARG B CB   11 
ATOM 9311  C CG   . ARG B 2 20 ? 4.945   4.288   -6.509  1.00 0.00 ? 44  ARG B CG   11 
ATOM 9312  C CD   . ARG B 2 20 ? 4.554   4.721   -7.897  1.00 0.00 ? 44  ARG B CD   11 
ATOM 9313  N NE   . ARG B 2 20 ? 3.280   4.146   -8.320  1.00 0.00 ? 44  ARG B NE   11 
ATOM 9314  C CZ   . ARG B 2 20 ? 2.546   4.630   -9.316  1.00 0.00 ? 44  ARG B CZ   11 
ATOM 9315  N NH1  . ARG B 2 20 ? 2.954   5.699   -9.989  1.00 0.00 ? 44  ARG B NH1  11 
ATOM 9316  N NH2  . ARG B 2 20 ? 1.399   4.047   -9.642  1.00 0.00 ? 44  ARG B NH2  11 
ATOM 9317  H H    . ARG B 2 20 ? 6.253   3.811   -4.446  1.00 0.00 ? 44  ARG B H    11 
ATOM 9318  H HA   . ARG B 2 20 ? 6.340   6.363   -5.229  1.00 0.00 ? 44  ARG B HA   11 
ATOM 9319  H HB2  . ARG B 2 20 ? 3.770   4.816   -4.850  1.00 0.00 ? 44  ARG B HB2  11 
ATOM 9320  H HB3  . ARG B 2 20 ? 4.024   6.112   -5.992  1.00 0.00 ? 44  ARG B HB3  11 
ATOM 9321  H HG2  . ARG B 2 20 ? 6.020   4.188   -6.458  1.00 0.00 ? 44  ARG B HG2  11 
ATOM 9322  H HG3  . ARG B 2 20 ? 4.480   3.336   -6.293  1.00 0.00 ? 44  ARG B HG3  11 
ATOM 9323  H HD2  . ARG B 2 20 ? 4.479   5.798   -7.918  1.00 0.00 ? 44  ARG B HD2  11 
ATOM 9324  H HD3  . ARG B 2 20 ? 5.324   4.404   -8.566  1.00 0.00 ? 44  ARG B HD3  11 
ATOM 9325  H HE   . ARG B 2 20 ? 2.956   3.358   -7.836  1.00 0.00 ? 44  ARG B HE   11 
ATOM 9326  H HH11 . ARG B 2 20 ? 3.817   6.143   -9.746  1.00 0.00 ? 44  ARG B HH11 11 
ATOM 9327  H HH12 . ARG B 2 20 ? 2.398   6.061   -10.737 1.00 0.00 ? 44  ARG B HH12 11 
ATOM 9328  H HH21 . ARG B 2 20 ? 1.088   3.241   -9.138  1.00 0.00 ? 44  ARG B HH21 11 
ATOM 9329  H HH22 . ARG B 2 20 ? 0.848   4.412   -10.392 1.00 0.00 ? 44  ARG B HH22 11 
ATOM 9330  N N    . VAL B 2 21 ? 4.510   6.066   -2.544  1.00 0.00 ? 45  VAL B N    11 
ATOM 9331  C CA   . VAL B 2 21 ? 3.864   6.673   -1.399  1.00 0.00 ? 45  VAL B CA   11 
ATOM 9332  C C    . VAL B 2 21 ? 4.846   7.264   -0.392  1.00 0.00 ? 45  VAL B C    11 
ATOM 9333  O O    . VAL B 2 21 ? 4.894   8.478   -0.183  1.00 0.00 ? 45  VAL B O    11 
ATOM 9334  C CB   . VAL B 2 21 ? 3.038   5.604   -0.668  1.00 0.00 ? 45  VAL B CB   11 
ATOM 9335  C CG1  . VAL B 2 21 ? 2.374   6.180   0.554   1.00 0.00 ? 45  VAL B CG1  11 
ATOM 9336  C CG2  . VAL B 2 21 ? 2.020   4.963   -1.591  1.00 0.00 ? 45  VAL B CG2  11 
ATOM 9337  H H    . VAL B 2 21 ? 4.548   5.094   -2.578  1.00 0.00 ? 45  VAL B H    11 
ATOM 9338  H HA   . VAL B 2 21 ? 3.193   7.442   -1.746  1.00 0.00 ? 45  VAL B HA   11 
ATOM 9339  H HB   . VAL B 2 21 ? 3.717   4.831   -0.337  1.00 0.00 ? 45  VAL B HB   11 
ATOM 9340  H HG11 . VAL B 2 21 ? 2.072   7.198   0.358   1.00 0.00 ? 45  VAL B HG11 11 
ATOM 9341  H HG12 . VAL B 2 21 ? 3.069   6.159   1.375   1.00 0.00 ? 45  VAL B HG12 11 
ATOM 9342  H HG13 . VAL B 2 21 ? 1.507   5.589   0.805   1.00 0.00 ? 45  VAL B HG13 11 
ATOM 9343  H HG21 . VAL B 2 21 ? 1.026   5.174   -1.239  1.00 0.00 ? 45  VAL B HG21 11 
ATOM 9344  H HG22 . VAL B 2 21 ? 2.177   3.896   -1.600  1.00 0.00 ? 45  VAL B HG22 11 
ATOM 9345  H HG23 . VAL B 2 21 ? 2.142   5.353   -2.591  1.00 0.00 ? 45  VAL B HG23 11 
ATOM 9346  N N    . CYS B 2 22 ? 5.628   6.385   0.225   1.00 0.00 ? 46  CYS B N    11 
ATOM 9347  C CA   . CYS B 2 22 ? 6.561   6.773   1.275   1.00 0.00 ? 46  CYS B CA   11 
ATOM 9348  C C    . CYS B 2 22 ? 8.001   6.670   0.809   1.00 0.00 ? 46  CYS B C    11 
ATOM 9349  O O    . CYS B 2 22 ? 8.844   7.502   1.144   1.00 0.00 ? 46  CYS B O    11 
ATOM 9350  C CB   . CYS B 2 22 ? 6.351   5.840   2.466   1.00 0.00 ? 46  CYS B CB   11 
ATOM 9351  S SG   . CYS B 2 22 ? 6.979   6.455   4.060   1.00 0.00 ? 46  CYS B SG   11 
ATOM 9352  H H    . CYS B 2 22 ? 5.596   5.440   -0.054  1.00 0.00 ? 46  CYS B H    11 
ATOM 9353  H HA   . CYS B 2 22 ? 6.348   7.787   1.573   1.00 0.00 ? 46  CYS B HA   11 
ATOM 9354  H HB2  . CYS B 2 22 ? 5.297   5.655   2.580   1.00 0.00 ? 46  CYS B HB2  11 
ATOM 9355  H HB3  . CYS B 2 22 ? 6.848   4.903   2.260   1.00 0.00 ? 46  CYS B HB3  11 
ATOM 9356  N N    . GLY B 2 23 ? 8.263   5.638   0.031   1.00 0.00 ? 47  GLY B N    11 
ATOM 9357  C CA   . GLY B 2 23 ? 9.606   5.396   -0.465  1.00 0.00 ? 47  GLY B CA   11 
ATOM 9358  C C    . GLY B 2 23 ? 10.299  4.319   0.327   1.00 0.00 ? 47  GLY B C    11 
ATOM 9359  O O    . GLY B 2 23 ? 11.493  4.093   0.154   1.00 0.00 ? 47  GLY B O    11 
ATOM 9360  H H    . GLY B 2 23 ? 7.525   5.030   -0.217  1.00 0.00 ? 47  GLY B H    11 
ATOM 9361  H HA2  . GLY B 2 23 ? 9.547   5.092   -1.496  1.00 0.00 ? 47  GLY B HA2  11 
ATOM 9362  H HA3  . GLY B 2 23 ? 10.188  6.301   -0.400  1.00 0.00 ? 47  GLY B HA3  11 
ATOM 9363  N N    . GLY B 2 24 ? 9.537   3.677   1.216   1.00 0.00 ? 48  GLY B N    11 
ATOM 9364  C CA   . GLY B 2 24 ? 10.056  2.605   2.046   1.00 0.00 ? 48  GLY B CA   11 
ATOM 9365  C C    . GLY B 2 24 ? 11.539  2.733   2.343   1.00 0.00 ? 48  GLY B C    11 
ATOM 9366  O O    . GLY B 2 24 ? 12.011  3.811   2.709   1.00 0.00 ? 48  GLY B O    11 
ATOM 9367  H H    . GLY B 2 24 ? 8.597   3.938   1.306   1.00 0.00 ? 48  GLY B H    11 
ATOM 9368  H HA2  . GLY B 2 24 ? 9.518   2.598   2.980   1.00 0.00 ? 48  GLY B HA2  11 
ATOM 9369  H HA3  . GLY B 2 24 ? 9.880   1.668   1.542   1.00 0.00 ? 48  GLY B HA3  11 
ATOM 9370  N N    . PRO B 2 25 ? 12.302  1.637   2.196   1.00 0.00 ? 49  PRO B N    11 
ATOM 9371  C CA   . PRO B 2 25 ? 13.746  1.634   2.439   1.00 0.00 ? 49  PRO B CA   11 
ATOM 9372  C C    . PRO B 2 25 ? 14.518  2.432   1.380   1.00 0.00 ? 49  PRO B C    11 
ATOM 9373  O O    . PRO B 2 25 ? 14.109  3.527   0.996   1.00 0.00 ? 49  PRO B O    11 
ATOM 9374  C CB   . PRO B 2 25 ? 14.097  0.144   2.391   1.00 0.00 ? 49  PRO B CB   11 
ATOM 9375  C CG   . PRO B 2 25 ? 13.068  -0.457  1.510   1.00 0.00 ? 49  PRO B CG   11 
ATOM 9376  C CD   . PRO B 2 25 ? 11.812  0.307   1.794   1.00 0.00 ? 49  PRO B CD   11 
ATOM 9377  H HA   . PRO B 2 25 ? 13.977  2.029   3.418   1.00 0.00 ? 49  PRO B HA   11 
ATOM 9378  H HB2  . PRO B 2 25 ? 15.090  0.008   1.997   1.00 0.00 ? 49  PRO B HB2  11 
ATOM 9379  H HB3  . PRO B 2 25 ? 14.035  -0.267  3.382   1.00 0.00 ? 49  PRO B HB3  11 
ATOM 9380  H HG2  . PRO B 2 25 ? 13.355  -0.340  0.475   1.00 0.00 ? 49  PRO B HG2  11 
ATOM 9381  H HG3  . PRO B 2 25 ? 12.936  -1.501  1.751   1.00 0.00 ? 49  PRO B HG3  11 
ATOM 9382  H HD2  . PRO B 2 25 ? 11.218  0.379   0.915   1.00 0.00 ? 49  PRO B HD2  11 
ATOM 9383  H HD3  . PRO B 2 25 ? 11.246  -0.152  2.583   1.00 0.00 ? 49  PRO B HD3  11 
ATOM 9384  N N    . ARG B 2 26 ? 15.639  1.878   0.921   1.00 0.00 ? 50  ARG B N    11 
ATOM 9385  C CA   . ARG B 2 26 ? 16.491  2.539   -0.069  1.00 0.00 ? 50  ARG B CA   11 
ATOM 9386  C C    . ARG B 2 26 ? 16.000  2.363   -1.504  1.00 0.00 ? 50  ARG B C    11 
ATOM 9387  O O    . ARG B 2 26 ? 15.822  3.341   -2.230  1.00 0.00 ? 50  ARG B O    11 
ATOM 9388  C CB   . ARG B 2 26 ? 17.892  1.970   0.019   1.00 0.00 ? 50  ARG B CB   11 
ATOM 9389  C CG   . ARG B 2 26 ? 18.372  1.742   1.444   1.00 0.00 ? 50  ARG B CG   11 
ATOM 9390  C CD   . ARG B 2 26 ? 19.768  1.143   1.475   1.00 0.00 ? 50  ARG B CD   11 
ATOM 9391  N NE   . ARG B 2 26 ? 20.174  0.774   2.830   1.00 0.00 ? 50  ARG B NE   11 
ATOM 9392  C CZ   . ARG B 2 26 ? 21.413  0.909   3.295   1.00 0.00 ? 50  ARG B CZ   11 
ATOM 9393  N NH1  . ARG B 2 26 ? 22.366  1.405   2.518   1.00 0.00 ? 50  ARG B NH1  11 
ATOM 9394  N NH2  . ARG B 2 26 ? 21.698  0.548   4.539   1.00 0.00 ? 50  ARG B NH2  11 
ATOM 9395  H H    . ARG B 2 26 ? 15.908  1.000   1.259   1.00 0.00 ? 50  ARG B H    11 
ATOM 9396  H HA   . ARG B 2 26 ? 16.525  3.588   0.163   1.00 0.00 ? 50  ARG B HA   11 
ATOM 9397  H HB2  . ARG B 2 26 ? 17.890  1.029   -0.500  1.00 0.00 ? 50  ARG B HB2  11 
ATOM 9398  H HB3  . ARG B 2 26 ? 18.578  2.647   -0.470  1.00 0.00 ? 50  ARG B HB3  11 
ATOM 9399  H HG2  . ARG B 2 26 ? 18.385  2.687   1.965   1.00 0.00 ? 50  ARG B HG2  11 
ATOM 9400  H HG3  . ARG B 2 26 ? 17.689  1.067   1.939   1.00 0.00 ? 50  ARG B HG3  11 
ATOM 9401  H HD2  . ARG B 2 26 ? 19.782  0.260   0.854   1.00 0.00 ? 50  ARG B HD2  11 
ATOM 9402  H HD3  . ARG B 2 26 ? 20.468  1.869   1.087   1.00 0.00 ? 50  ARG B HD3  11 
ATOM 9403  H HE   . ARG B 2 26 ? 19.486  0.405   3.423   1.00 0.00 ? 50  ARG B HE   11 
ATOM 9404  H HH11 . ARG B 2 26 ? 22.156  1.679   1.579   1.00 0.00 ? 50  ARG B HH11 11 
ATOM 9405  H HH12 . ARG B 2 26 ? 23.297  1.507   2.871   1.00 0.00 ? 50  ARG B HH12 11 
ATOM 9406  H HH21 . ARG B 2 26 ? 20.982  0.174   5.128   1.00 0.00 ? 50  ARG B HH21 11 
ATOM 9407  H HH22 . ARG B 2 26 ? 22.630  0.650   4.886   1.00 0.00 ? 50  ARG B HH22 11 
ATOM 9408  N N    . TRP B 2 27 ? 15.797  1.102   -1.904  1.00 0.00 ? 51  TRP B N    11 
ATOM 9409  C CA   . TRP B 2 27 ? 15.361  0.762   -3.243  1.00 0.00 ? 51  TRP B CA   11 
ATOM 9410  C C    . TRP B 2 27 ? 16.458  0.989   -4.281  1.00 0.00 ? 51  TRP B C    11 
ATOM 9411  O O    . TRP B 2 27 ? 16.244  0.774   -5.473  1.00 0.00 ? 51  TRP B O    11 
ATOM 9412  C CB   . TRP B 2 27 ? 14.129  1.546   -3.605  1.00 0.00 ? 51  TRP B CB   11 
ATOM 9413  C CG   . TRP B 2 27 ? 13.073  1.429   -2.575  1.00 0.00 ? 51  TRP B CG   11 
ATOM 9414  C CD1  . TRP B 2 27 ? 12.910  2.180   -1.459  1.00 0.00 ? 51  TRP B CD1  11 
ATOM 9415  C CD2  . TRP B 2 27 ? 12.044  0.470   -2.571  1.00 0.00 ? 51  TRP B CD2  11 
ATOM 9416  N NE1  . TRP B 2 27 ? 11.806  1.750   -0.767  1.00 0.00 ? 51  TRP B NE1  11 
ATOM 9417  C CE2  . TRP B 2 27 ? 11.257  0.694   -1.440  1.00 0.00 ? 51  TRP B CE2  11 
ATOM 9418  C CE3  . TRP B 2 27 ? 11.717  -0.550  -3.435  1.00 0.00 ? 51  TRP B CE3  11 
ATOM 9419  C CZ2  . TRP B 2 27 ? 10.147  -0.081  -1.149  1.00 0.00 ? 51  TRP B CZ2  11 
ATOM 9420  C CZ3  . TRP B 2 27 ? 10.612  -1.323  -3.154  1.00 0.00 ? 51  TRP B CZ3  11 
ATOM 9421  C CH2  . TRP B 2 27 ? 9.837   -1.078  -2.011  1.00 0.00 ? 51  TRP B CH2  11 
ATOM 9422  H H    . TRP B 2 27 ? 15.901  0.385   -1.268  1.00 0.00 ? 51  TRP B H    11 
ATOM 9423  H HA   . TRP B 2 27 ? 15.099  -0.287  -3.240  1.00 0.00 ? 51  TRP B HA   11 
ATOM 9424  H HB2  . TRP B 2 27 ? 14.374  2.580   -3.729  1.00 0.00 ? 51  TRP B HB2  11 
ATOM 9425  H HB3  . TRP B 2 27 ? 13.740  1.157   -4.518  1.00 0.00 ? 51  TRP B HB3  11 
ATOM 9426  H HD1  . TRP B 2 27 ? 13.559  2.992   -1.173  1.00 0.00 ? 51  TRP B HD1  11 
ATOM 9427  H HE1  . TRP B 2 27 ? 11.468  2.134   0.068   1.00 0.00 ? 51  TRP B HE1  11 
ATOM 9428  H HE3  . TRP B 2 27 ? 12.322  -0.737  -4.309  1.00 0.00 ? 51  TRP B HE3  11 
ATOM 9429  H HZ2  . TRP B 2 27 ? 9.535   0.089   -0.282  1.00 0.00 ? 51  TRP B HZ2  11 
ATOM 9430  H HZ3  . TRP B 2 27 ? 10.341  -2.126  -3.813  1.00 0.00 ? 51  TRP B HZ3  11 
ATOM 9431  H HH2  . TRP B 2 27 ? 8.973   -1.677  -1.825  1.00 0.00 ? 51  TRP B HH2  11 
ATOM 9432  N N    . SER B 2 28 ? 17.629  1.423   -3.825  1.00 0.00 ? 52  SER B N    11 
ATOM 9433  C CA   . SER B 2 28 ? 18.746  1.674   -4.729  1.00 0.00 ? 52  SER B CA   11 
ATOM 9434  C C    . SER B 2 28 ? 20.076  1.377   -4.052  1.00 0.00 ? 52  SER B C    11 
ATOM 9435  O O    . SER B 2 28 ? 20.543  2.146   -3.211  1.00 0.00 ? 52  SER B O    11 
ATOM 9436  C CB   . SER B 2 28 ? 18.734  3.122   -5.209  1.00 0.00 ? 52  SER B CB   11 
ATOM 9437  O OG   . SER B 2 28 ? 17.418  3.550   -5.513  1.00 0.00 ? 52  SER B OG   11 
ATOM 9438  H H    . SER B 2 28 ? 17.743  1.579   -2.865  1.00 0.00 ? 52  SER B H    11 
ATOM 9439  H HA   . SER B 2 28 ? 18.639  1.019   -5.581  1.00 0.00 ? 52  SER B HA   11 
ATOM 9440  H HB2  . SER B 2 28 ? 19.141  3.753   -4.438  1.00 0.00 ? 52  SER B HB2  11 
ATOM 9441  H HB3  . SER B 2 28 ? 19.341  3.207   -6.099  1.00 0.00 ? 52  SER B HB3  11 
ATOM 9442  H HG   . SER B 2 28 ? 16.874  2.789   -5.725  1.00 0.00 ? 52  SER B HG   11 
ATOM 9443  N N    . THR B 2 29 ? 20.682  0.264   -4.441  1.00 0.00 ? 53  THR B N    11 
ATOM 9444  C CA   . THR B 2 29 ? 21.968  -0.150  -3.892  1.00 0.00 ? 53  THR B CA   11 
ATOM 9445  C C    . THR B 2 29 ? 22.691  -1.082  -4.852  1.00 0.00 ? 53  THR B C    11 
ATOM 9446  O O    . THR B 2 29 ? 22.639  -2.305  -4.714  1.00 0.00 ? 53  THR B O    11 
ATOM 9447  C CB   . THR B 2 29 ? 21.832  -0.867  -2.544  1.00 0.00 ? 53  THR B CB   11 
ATOM 9448  O OG1  . THR B 2 29 ? 20.786  -1.845  -2.607  1.00 0.00 ? 53  THR B OG1  11 
ATOM 9449  C CG2  . THR B 2 29 ? 21.557  0.114   -1.416  1.00 0.00 ? 53  THR B CG2  11 
ATOM 9450  H H    . THR B 2 29 ? 20.254  -0.293  -5.120  1.00 0.00 ? 53  THR B H    11 
ATOM 9451  H HA   . THR B 2 29 ? 22.567  0.737   -3.748  1.00 0.00 ? 53  THR B HA   11 
ATOM 9452  H HB   . THR B 2 29 ? 22.767  -1.366  -2.345  1.00 0.00 ? 53  THR B HB   11 
ATOM 9453  H HG1  . THR B 2 29 ? 19.989  -1.488  -2.207  1.00 0.00 ? 53  THR B HG1  11 
ATOM 9454  H HG21 . THR B 2 29 ? 20.608  0.602   -1.586  1.00 0.00 ? 53  THR B HG21 11 
ATOM 9455  H HG22 . THR B 2 29 ? 22.342  0.857   -1.386  1.00 0.00 ? 53  THR B HG22 11 
ATOM 9456  H HG23 . THR B 2 29 ? 21.527  -0.416  -0.476  1.00 0.00 ? 53  THR B HG23 11 
ATOM 9457  N N    . GLU B 2 30 ? 23.364  -0.489  -5.819  1.00 0.00 ? 54  GLU B N    11 
ATOM 9458  C CA   . GLU B 2 30 ? 24.108  -1.249  -6.816  1.00 0.00 ? 54  GLU B CA   11 
ATOM 9459  C C    . GLU B 2 30 ? 25.500  -1.599  -6.305  1.00 0.00 ? 54  GLU B C    11 
ATOM 9460  O O    . GLU B 2 30 ? 26.226  -2.371  -6.931  1.00 0.00 ? 54  GLU B O    11 
ATOM 9461  C CB   . GLU B 2 30 ? 24.208  -0.465  -8.125  1.00 0.00 ? 54  GLU B CB   11 
ATOM 9462  C CG   . GLU B 2 30 ? 25.034  0.797   -8.001  1.00 0.00 ? 54  GLU B CG   11 
ATOM 9463  C CD   . GLU B 2 30 ? 24.261  1.946   -7.384  1.00 0.00 ? 54  GLU B CD   11 
ATOM 9464  O OE1  . GLU B 2 30 ? 23.447  2.566   -8.102  1.00 0.00 ? 54  GLU B OE1  11 
ATOM 9465  O OE2  . GLU B 2 30 ? 24.467  2.223   -6.184  1.00 0.00 ? 54  GLU B OE2  11 
ATOM 9466  H H    . GLU B 2 30 ? 23.365  0.486   -5.856  1.00 0.00 ? 54  GLU B H    11 
ATOM 9467  H HA   . GLU B 2 30 ? 23.576  -2.158  -6.998  1.00 0.00 ? 54  GLU B HA   11 
ATOM 9468  H HB2  . GLU B 2 30 ? 24.658  -1.096  -8.876  1.00 0.00 ? 54  GLU B HB2  11 
ATOM 9469  H HB3  . GLU B 2 30 ? 23.214  -0.191  -8.443  1.00 0.00 ? 54  GLU B HB3  11 
ATOM 9470  H HG2  . GLU B 2 30 ? 25.882  0.578   -7.375  1.00 0.00 ? 54  GLU B HG2  11 
ATOM 9471  H HG3  . GLU B 2 30 ? 25.374  1.090   -8.983  1.00 0.00 ? 54  GLU B HG3  11 
ATOM 9472  N N    . ALA B 2 31 ? 25.857  -1.030  -5.157  1.00 0.00 ? 55  ALA B N    11 
ATOM 9473  C CA   . ALA B 2 31 ? 27.161  -1.270  -4.545  1.00 0.00 ? 55  ALA B CA   11 
ATOM 9474  C C    . ALA B 2 31 ? 28.292  -1.088  -5.553  1.00 0.00 ? 55  ALA B C    11 
ATOM 9475  O O    . ALA B 2 31 ? 28.721  0.068   -5.759  1.00 0.00 ? 55  ALA B O    11 
ATOM 9476  C CB   . ALA B 2 31 ? 27.209  -2.664  -3.938  1.00 0.00 ? 55  ALA B CB   11 
ATOM 9477  O OXT  . ALA B 2 31 ? 28.744  -2.103  -6.126  1.00 0.00 ? 55  ALA B OXT  11 
ATOM 9478  H H    . ALA B 2 31 ? 25.222  -0.434  -4.708  1.00 0.00 ? 55  ALA B H    11 
ATOM 9479  H HA   . ALA B 2 31 ? 27.290  -0.553  -3.746  1.00 0.00 ? 55  ALA B HA   11 
ATOM 9480  H HB1  . ALA B 2 31 ? 27.102  -3.401  -4.719  1.00 0.00 ? 55  ALA B HB1  11 
ATOM 9481  H HB2  . ALA B 2 31 ? 26.406  -2.774  -3.224  1.00 0.00 ? 55  ALA B HB2  11 
ATOM 9482  H HB3  . ALA B 2 31 ? 28.157  -2.806  -3.437  1.00 0.00 ? 55  ALA B HB3  11 
ATOM 9483  N N    . ALA A 1 1  ? -2.389  1.451   14.576  1.00 0.00 ? 106 ALA A N    12 
ATOM 9484  C CA   . ALA A 1 1  ? -3.393  0.404   14.248  1.00 0.00 ? 106 ALA A CA   12 
ATOM 9485  C C    . ALA A 1 1  ? -2.913  -0.473  13.098  1.00 0.00 ? 106 ALA A C    12 
ATOM 9486  O O    . ALA A 1 1  ? -2.335  0.019   12.129  1.00 0.00 ? 106 ALA A O    12 
ATOM 9487  C CB   . ALA A 1 1  ? -4.730  1.043   13.903  1.00 0.00 ? 106 ALA A CB   12 
ATOM 9488  H H1   . ALA A 1 1  ? -2.233  2.066   13.752  1.00 0.00 ? 106 ALA A H1   12 
ATOM 9489  H H2   . ALA A 1 1  ? -1.487  1.009   14.841  1.00 0.00 ? 106 ALA A H2   12 
ATOM 9490  H H3   . ALA A 1 1  ? -2.726  2.033   15.370  1.00 0.00 ? 106 ALA A H3   12 
ATOM 9491  H HA   . ALA A 1 1  ? -3.535  -0.215  15.123  1.00 0.00 ? 106 ALA A HA   12 
ATOM 9492  H HB1  . ALA A 1 1  ? -5.062  1.654   14.730  1.00 0.00 ? 106 ALA A HB1  12 
ATOM 9493  H HB2  . ALA A 1 1  ? -5.459  0.270   13.710  1.00 0.00 ? 106 ALA A HB2  12 
ATOM 9494  H HB3  . ALA A 1 1  ? -4.616  1.658   13.024  1.00 0.00 ? 106 ALA A HB3  12 
ATOM 9495  N N    . ALA A 1 2  ? -3.158  -1.775  13.212  1.00 0.00 ? 107 ALA A N    12 
ATOM 9496  C CA   . ALA A 1 2  ? -2.752  -2.723  12.182  1.00 0.00 ? 107 ALA A CA   12 
ATOM 9497  C C    . ALA A 1 2  ? -3.890  -3.672  11.827  1.00 0.00 ? 107 ALA A C    12 
ATOM 9498  O O    . ALA A 1 2  ? -4.884  -3.764  12.547  1.00 0.00 ? 107 ALA A O    12 
ATOM 9499  C CB   . ALA A 1 2  ? -1.534  -3.510  12.644  1.00 0.00 ? 107 ALA A CB   12 
ATOM 9500  H H    . ALA A 1 2  ? -3.625  -2.105  14.008  1.00 0.00 ? 107 ALA A H    12 
ATOM 9501  H HA   . ALA A 1 2  ? -2.476  -2.164  11.301  1.00 0.00 ? 107 ALA A HA   12 
ATOM 9502  H HB1  . ALA A 1 2  ? -0.734  -2.827  12.884  1.00 0.00 ? 107 ALA A HB1  12 
ATOM 9503  H HB2  . ALA A 1 2  ? -1.214  -4.175  11.855  1.00 0.00 ? 107 ALA A HB2  12 
ATOM 9504  H HB3  . ALA A 1 2  ? -1.789  -4.088  13.520  1.00 0.00 ? 107 ALA A HB3  12 
ATOM 9505  N N    . ALA A 1 3  ? -3.735  -4.374  10.710  1.00 0.00 ? 108 ALA A N    12 
ATOM 9506  C CA   . ALA A 1 3  ? -4.747  -5.316  10.247  1.00 0.00 ? 108 ALA A CA   12 
ATOM 9507  C C    . ALA A 1 3  ? -4.110  -6.642  9.838   1.00 0.00 ? 108 ALA A C    12 
ATOM 9508  O O    . ALA A 1 3  ? -3.135  -7.087  10.442  1.00 0.00 ? 108 ALA A O    12 
ATOM 9509  C CB   . ALA A 1 3  ? -5.521  -4.720  9.082   1.00 0.00 ? 108 ALA A CB   12 
ATOM 9510  H H    . ALA A 1 3  ? -2.918  -4.256  10.182  1.00 0.00 ? 108 ALA A H    12 
ATOM 9511  H HA   . ALA A 1 3  ? -5.438  -5.493  11.058  1.00 0.00 ? 108 ALA A HA   12 
ATOM 9512  H HB1  . ALA A 1 3  ? -6.528  -5.109  9.082   1.00 0.00 ? 108 ALA A HB1  12 
ATOM 9513  H HB2  . ALA A 1 3  ? -5.033  -4.988  8.154   1.00 0.00 ? 108 ALA A HB2  12 
ATOM 9514  H HB3  . ALA A 1 3  ? -5.547  -3.645  9.178   1.00 0.00 ? 108 ALA A HB3  12 
ATOM 9515  N N    . THR A 1 4  ? -4.671  -7.268  8.808   1.00 0.00 ? 109 THR A N    12 
ATOM 9516  C CA   . THR A 1 4  ? -4.159  -8.535  8.309   1.00 0.00 ? 109 THR A CA   12 
ATOM 9517  C C    . THR A 1 4  ? -2.865  -8.312  7.520   1.00 0.00 ? 109 THR A C    12 
ATOM 9518  O O    . THR A 1 4  ? -2.032  -7.495  7.915   1.00 0.00 ? 109 THR A O    12 
ATOM 9519  C CB   . THR A 1 4  ? -5.216  -9.232  7.423   1.00 0.00 ? 109 THR A CB   12 
ATOM 9520  O OG1  . THR A 1 4  ? -4.749  -10.519 7.003   1.00 0.00 ? 109 THR A OG1  12 
ATOM 9521  C CG2  . THR A 1 4  ? -5.557  -8.380  6.207   1.00 0.00 ? 109 THR A CG2  12 
ATOM 9522  H H    . THR A 1 4  ? -5.452  -6.867  8.373   1.00 0.00 ? 109 THR A H    12 
ATOM 9523  H HA   . THR A 1 4  ? -3.950  -9.171  9.158   1.00 0.00 ? 109 THR A HA   12 
ATOM 9524  H HB   . THR A 1 4  ? -6.114  -9.363  8.007   1.00 0.00 ? 109 THR A HB   12 
ATOM 9525  H HG1  . THR A 1 4  ? -4.702  -11.107 7.760   1.00 0.00 ? 109 THR A HG1  12 
ATOM 9526  H HG21 . THR A 1 4  ? -4.777  -7.648  6.049   1.00 0.00 ? 109 THR A HG21 12 
ATOM 9527  H HG22 . THR A 1 4  ? -6.496  -7.874  6.375   1.00 0.00 ? 109 THR A HG22 12 
ATOM 9528  H HG23 . THR A 1 4  ? -5.639  -9.013  5.336   1.00 0.00 ? 109 THR A HG23 12 
ATOM 9529  N N    . ASN A 1 5  ? -2.691  -9.031  6.417   1.00 0.00 ? 110 ASN A N    12 
ATOM 9530  C CA   . ASN A 1 5  ? -1.499  -8.881  5.595   1.00 0.00 ? 110 ASN A CA   12 
ATOM 9531  C C    . ASN A 1 5  ? -1.630  -7.648  4.708   1.00 0.00 ? 110 ASN A C    12 
ATOM 9532  O O    . ASN A 1 5  ? -2.465  -7.616  3.807   1.00 0.00 ? 110 ASN A O    12 
ATOM 9533  C CB   . ASN A 1 5  ? -1.278  -10.124 4.730   1.00 0.00 ? 110 ASN A CB   12 
ATOM 9534  C CG   . ASN A 1 5  ? -0.953  -11.354 5.555   1.00 0.00 ? 110 ASN A CG   12 
ATOM 9535  O OD1  . ASN A 1 5  ? -1.442  -11.516 6.674   1.00 0.00 ? 110 ASN A OD1  12 
ATOM 9536  N ND2  . ASN A 1 5  ? -0.118  -12.228 5.005   1.00 0.00 ? 110 ASN A ND2  12 
ATOM 9537  H H    . ASN A 1 5  ? -3.380  -9.667  6.143   1.00 0.00 ? 110 ASN A H    12 
ATOM 9538  H HA   . ASN A 1 5  ? -0.653  -8.754  6.255   1.00 0.00 ? 110 ASN A HA   12 
ATOM 9539  H HB2  . ASN A 1 5  ? -2.176  -10.322 4.162   1.00 0.00 ? 110 ASN A HB2  12 
ATOM 9540  H HB3  . ASN A 1 5  ? -0.459  -9.941  4.052   1.00 0.00 ? 110 ASN A HB3  12 
ATOM 9541  H HD21 . ASN A 1 5  ? 0.236   -12.031 4.112   1.00 0.00 ? 110 ASN A HD21 12 
ATOM 9542  H HD22 . ASN A 1 5  ? 0.110   -13.034 5.514   1.00 0.00 ? 110 ASN A HD22 12 
ATOM 9543  N N    . PRO A 1 6  ? -0.809  -6.611  4.947   1.00 0.00 ? 111 PRO A N    12 
ATOM 9544  C CA   . PRO A 1 6  ? -0.863  -5.374  4.165   1.00 0.00 ? 111 PRO A CA   12 
ATOM 9545  C C    . PRO A 1 6  ? -0.491  -5.583  2.702   1.00 0.00 ? 111 PRO A C    12 
ATOM 9546  O O    . PRO A 1 6  ? -0.693  -4.698  1.871   1.00 0.00 ? 111 PRO A O    12 
ATOM 9547  C CB   . PRO A 1 6  ? 0.147   -4.469  4.859   1.00 0.00 ? 111 PRO A CB   12 
ATOM 9548  C CG   . PRO A 1 6  ? 1.085   -5.401  5.544   1.00 0.00 ? 111 PRO A CG   12 
ATOM 9549  C CD   . PRO A 1 6  ? 0.239   -6.560  5.983   1.00 0.00 ? 111 PRO A CD   12 
ATOM 9550  H HA   . PRO A 1 6  ? -1.834  -4.920  4.218   1.00 0.00 ? 111 PRO A HA   12 
ATOM 9551  H HB2  . PRO A 1 6  ? 0.646   -3.867  4.122   1.00 0.00 ? 111 PRO A HB2  12 
ATOM 9552  H HB3  . PRO A 1 6  ? -0.364  -3.834  5.566   1.00 0.00 ? 111 PRO A HB3  12 
ATOM 9553  H HG2  . PRO A 1 6  ? 1.847   -5.731  4.855   1.00 0.00 ? 111 PRO A HG2  12 
ATOM 9554  H HG3  . PRO A 1 6  ? 1.529   -4.916  6.400   1.00 0.00 ? 111 PRO A HG3  12 
ATOM 9555  H HD2  . PRO A 1 6  ? 0.820   -7.470  5.993   1.00 0.00 ? 111 PRO A HD2  12 
ATOM 9556  H HD3  . PRO A 1 6  ? -0.189  -6.371  6.956   1.00 0.00 ? 111 PRO A HD3  12 
ATOM 9557  N N    . ALA A 1 7  ? 0.037   -6.760  2.390   1.00 0.00 ? 112 ALA A N    12 
ATOM 9558  C CA   . ALA A 1 7  ? 0.441   -7.077  1.026   1.00 0.00 ? 112 ALA A CA   12 
ATOM 9559  C C    . ALA A 1 7  ? -0.631  -7.867  0.291   1.00 0.00 ? 112 ALA A C    12 
ATOM 9560  O O    . ALA A 1 7  ? -0.970  -7.562  -0.853  1.00 0.00 ? 112 ALA A O    12 
ATOM 9561  C CB   . ALA A 1 7  ? 1.745   -7.854  1.039   1.00 0.00 ? 112 ALA A CB   12 
ATOM 9562  H H    . ALA A 1 7  ? 0.159   -7.432  3.094   1.00 0.00 ? 112 ALA A H    12 
ATOM 9563  H HA   . ALA A 1 7  ? 0.609   -6.147  0.504   1.00 0.00 ? 112 ALA A HA   12 
ATOM 9564  H HB1  . ALA A 1 7  ? 1.535   -8.910  1.130   1.00 0.00 ? 112 ALA A HB1  12 
ATOM 9565  H HB2  . ALA A 1 7  ? 2.338   -7.533  1.881   1.00 0.00 ? 112 ALA A HB2  12 
ATOM 9566  H HB3  . ALA A 1 7  ? 2.286   -7.670  0.123   1.00 0.00 ? 112 ALA A HB3  12 
ATOM 9567  N N    . ARG A 1 8  ? -1.162  -8.879  0.957   1.00 0.00 ? 113 ARG A N    12 
ATOM 9568  C CA   . ARG A 1 8  ? -2.193  -9.726  0.367   1.00 0.00 ? 113 ARG A CA   12 
ATOM 9569  C C    . ARG A 1 8  ? -3.556  -9.038  0.368   1.00 0.00 ? 113 ARG A C    12 
ATOM 9570  O O    . ARG A 1 8  ? -4.308  -9.134  -0.609  1.00 0.00 ? 113 ARG A O    12 
ATOM 9571  C CB   . ARG A 1 8  ? -2.284  -11.057 1.118   1.00 0.00 ? 113 ARG A CB   12 
ATOM 9572  C CG   . ARG A 1 8  ? -1.826  -12.256 0.301   1.00 0.00 ? 113 ARG A CG   12 
ATOM 9573  C CD   . ARG A 1 8  ? -2.694  -12.458 -0.932  1.00 0.00 ? 113 ARG A CD   12 
ATOM 9574  N NE   . ARG A 1 8  ? -2.303  -13.644 -1.690  1.00 0.00 ? 113 ARG A NE   12 
ATOM 9575  C CZ   . ARG A 1 8  ? -1.972  -13.623 -2.979  1.00 0.00 ? 113 ARG A CZ   12 
ATOM 9576  N NH1  . ARG A 1 8  ? -1.968  -12.477 -3.647  1.00 0.00 ? 113 ARG A NH1  12 
ATOM 9577  N NH2  . ARG A 1 8  ? -1.639  -14.747 -3.599  1.00 0.00 ? 113 ARG A NH2  12 
ATOM 9578  H H    . ARG A 1 8  ? -0.844  -9.069  1.866   1.00 0.00 ? 113 ARG A H    12 
ATOM 9579  H HA   . ARG A 1 8  ? -1.908  -9.925  -0.656  1.00 0.00 ? 113 ARG A HA   12 
ATOM 9580  H HB2  . ARG A 1 8  ? -1.670  -10.998 2.005   1.00 0.00 ? 113 ARG A HB2  12 
ATOM 9581  H HB3  . ARG A 1 8  ? -3.311  -11.221 1.412   1.00 0.00 ? 113 ARG A HB3  12 
ATOM 9582  H HG2  . ARG A 1 8  ? -0.805  -12.096 -0.013  1.00 0.00 ? 113 ARG A HG2  12 
ATOM 9583  H HG3  . ARG A 1 8  ? -1.882  -13.140 0.917   1.00 0.00 ? 113 ARG A HG3  12 
ATOM 9584  H HD2  . ARG A 1 8  ? -3.721  -12.565 -0.620  1.00 0.00 ? 113 ARG A HD2  12 
ATOM 9585  H HD3  . ARG A 1 8  ? -2.600  -11.589 -1.568  1.00 0.00 ? 113 ARG A HD3  12 
ATOM 9586  H HE   . ARG A 1 8  ? -2.293  -14.502 -1.216  1.00 0.00 ? 113 ARG A HE   12 
ATOM 9587  H HH11 . ARG A 1 8  ? -2.218  -11.626 -3.185  1.00 0.00 ? 113 ARG A HH11 12 
ATOM 9588  H HH12 . ARG A 1 8  ? -1.717  -12.464 -4.616  1.00 0.00 ? 113 ARG A HH12 12 
ATOM 9589  H HH21 . ARG A 1 8  ? -1.638  -15.612 -3.097  1.00 0.00 ? 113 ARG A HH21 12 
ATOM 9590  H HH22 . ARG A 1 8  ? -1.391  -14.730 -4.567  1.00 0.00 ? 113 ARG A HH22 12 
ATOM 9591  N N    . TYR A 1 9  ? -3.877  -8.342  1.455   1.00 0.00 ? 114 TYR A N    12 
ATOM 9592  C CA   . TYR A 1 9  ? -5.162  -7.661  1.555   1.00 0.00 ? 114 TYR A CA   12 
ATOM 9593  C C    . TYR A 1 9  ? -5.319  -6.635  0.440   1.00 0.00 ? 114 TYR A C    12 
ATOM 9594  O O    . TYR A 1 9  ? -6.424  -6.430  -0.063  1.00 0.00 ? 114 TYR A O    12 
ATOM 9595  C CB   . TYR A 1 9  ? -5.350  -7.028  2.951   1.00 0.00 ? 114 TYR A CB   12 
ATOM 9596  C CG   . TYR A 1 9  ? -5.213  -5.514  3.022   1.00 0.00 ? 114 TYR A CG   12 
ATOM 9597  C CD1  . TYR A 1 9  ? -6.134  -4.675  2.401   1.00 0.00 ? 114 TYR A CD1  12 
ATOM 9598  C CD2  . TYR A 1 9  ? -4.168  -4.927  3.725   1.00 0.00 ? 114 TYR A CD2  12 
ATOM 9599  C CE1  . TYR A 1 9  ? -6.016  -3.301  2.478   1.00 0.00 ? 114 TYR A CE1  12 
ATOM 9600  C CE2  . TYR A 1 9  ? -4.042  -3.555  3.808   1.00 0.00 ? 114 TYR A CE2  12 
ATOM 9601  C CZ   . TYR A 1 9  ? -4.968  -2.745  3.184   1.00 0.00 ? 114 TYR A CZ   12 
ATOM 9602  O OH   . TYR A 1 9  ? -4.846  -1.376  3.264   1.00 0.00 ? 114 TYR A OH   12 
ATOM 9603  H H    . TYR A 1 9  ? -3.240  -8.282  2.196   1.00 0.00 ? 114 TYR A H    12 
ATOM 9604  H HA   . TYR A 1 9  ? -5.926  -8.412  1.421   1.00 0.00 ? 114 TYR A HA   12 
ATOM 9605  H HB2  . TYR A 1 9  ? -6.336  -7.275  3.311   1.00 0.00 ? 114 TYR A HB2  12 
ATOM 9606  H HB3  . TYR A 1 9  ? -4.620  -7.453  3.623   1.00 0.00 ? 114 TYR A HB3  12 
ATOM 9607  H HD1  . TYR A 1 9  ? -6.953  -5.112  1.850   1.00 0.00 ? 114 TYR A HD1  12 
ATOM 9608  H HD2  . TYR A 1 9  ? -3.441  -5.562  4.213   1.00 0.00 ? 114 TYR A HD2  12 
ATOM 9609  H HE1  . TYR A 1 9  ? -6.741  -2.672  1.983   1.00 0.00 ? 114 TYR A HE1  12 
ATOM 9610  H HE2  . TYR A 1 9  ? -3.218  -3.124  4.363   1.00 0.00 ? 114 TYR A HE2  12 
ATOM 9611  H HH   . TYR A 1 9  ? -5.697  -0.991  3.483   1.00 0.00 ? 114 TYR A HH   12 
ATOM 9612  N N    . CYS A 1 10 ? -4.222  -5.988  0.045   1.00 0.00 ? 115 CYS A N    12 
ATOM 9613  C CA   . CYS A 1 10 ? -4.301  -4.995  -1.015  1.00 0.00 ? 115 CYS A CA   12 
ATOM 9614  C C    . CYS A 1 10 ? -4.390  -5.658  -2.379  1.00 0.00 ? 115 CYS A C    12 
ATOM 9615  O O    . CYS A 1 10 ? -4.844  -5.046  -3.346  1.00 0.00 ? 115 CYS A O    12 
ATOM 9616  C CB   . CYS A 1 10 ? -3.138  -4.001  -0.967  1.00 0.00 ? 115 CYS A CB   12 
ATOM 9617  S SG   . CYS A 1 10 ? -3.113  -3.007  0.549   1.00 0.00 ? 115 CYS A SG   12 
ATOM 9618  H H    . CYS A 1 10 ? -3.362  -6.181  0.471   1.00 0.00 ? 115 CYS A H    12 
ATOM 9619  H HA   . CYS A 1 10 ? -5.216  -4.448  -0.856  1.00 0.00 ? 115 CYS A HA   12 
ATOM 9620  H HB2  . CYS A 1 10 ? -2.183  -4.515  -1.050  1.00 0.00 ? 115 CYS A HB2  12 
ATOM 9621  H HB3  . CYS A 1 10 ? -3.238  -3.319  -1.797  1.00 0.00 ? 115 CYS A HB3  12 
ATOM 9622  N N    . CYS A 1 11 ? -3.961  -6.908  -2.459  1.00 0.00 ? 116 CYS A N    12 
ATOM 9623  C CA   . CYS A 1 11 ? -4.036  -7.644  -3.710  1.00 0.00 ? 116 CYS A CA   12 
ATOM 9624  C C    . CYS A 1 11 ? -5.500  -7.845  -4.074  1.00 0.00 ? 116 CYS A C    12 
ATOM 9625  O O    . CYS A 1 11 ? -5.898  -7.683  -5.228  1.00 0.00 ? 116 CYS A O    12 
ATOM 9626  C CB   . CYS A 1 11 ? -3.326  -8.995  -3.582  1.00 0.00 ? 116 CYS A CB   12 
ATOM 9627  S SG   . CYS A 1 11 ? -3.334  -9.995  -5.105  1.00 0.00 ? 116 CYS A SG   12 
ATOM 9628  H H    . CYS A 1 11 ? -3.586  -7.343  -1.665  1.00 0.00 ? 116 CYS A H    12 
ATOM 9629  H HA   . CYS A 1 11 ? -3.561  -7.052  -4.479  1.00 0.00 ? 116 CYS A HA   12 
ATOM 9630  H HB2  . CYS A 1 11 ? -2.296  -8.824  -3.309  1.00 0.00 ? 116 CYS A HB2  12 
ATOM 9631  H HB3  . CYS A 1 11 ? -3.801  -9.569  -2.807  1.00 0.00 ? 116 CYS A HB3  12 
ATOM 9632  N N    . LEU A 1 12 ? -6.294  -8.204  -3.069  1.00 0.00 ? 117 LEU A N    12 
ATOM 9633  C CA   . LEU A 1 12 ? -7.719  -8.414  -3.245  1.00 0.00 ? 117 LEU A CA   12 
ATOM 9634  C C    . LEU A 1 12 ? -8.489  -7.095  -3.150  1.00 0.00 ? 117 LEU A C    12 
ATOM 9635  O O    . LEU A 1 12 ? -9.617  -6.992  -3.633  1.00 0.00 ? 117 LEU A O    12 
ATOM 9636  C CB   . LEU A 1 12 ? -8.223  -9.392  -2.192  1.00 0.00 ? 117 LEU A CB   12 
ATOM 9637  C CG   . LEU A 1 12 ? -8.022  -10.872 -2.524  1.00 0.00 ? 117 LEU A CG   12 
ATOM 9638  C CD1  . LEU A 1 12 ? -8.387  -11.740 -1.330  1.00 0.00 ? 117 LEU A CD1  12 
ATOM 9639  C CD2  . LEU A 1 12 ? -8.846  -11.266 -3.741  1.00 0.00 ? 117 LEU A CD2  12 
ATOM 9640  H H    . LEU A 1 12 ? -5.906  -8.340  -2.178  1.00 0.00 ? 117 LEU A H    12 
ATOM 9641  H HA   . LEU A 1 12 ? -7.874  -8.841  -4.220  1.00 0.00 ? 117 LEU A HA   12 
ATOM 9642  H HB2  . LEU A 1 12 ? -7.708  -9.180  -1.272  1.00 0.00 ? 117 LEU A HB2  12 
ATOM 9643  H HB3  . LEU A 1 12 ? -9.271  -9.216  -2.044  1.00 0.00 ? 117 LEU A HB3  12 
ATOM 9644  H HG   . LEU A 1 12 ? -6.980  -11.043 -2.754  1.00 0.00 ? 117 LEU A HG   12 
ATOM 9645  H HD11 . LEU A 1 12 ? -9.414  -11.555 -1.050  1.00 0.00 ? 117 LEU A HD11 12 
ATOM 9646  H HD12 . LEU A 1 12 ? -7.740  -11.501 -0.499  1.00 0.00 ? 117 LEU A HD12 12 
ATOM 9647  H HD13 . LEU A 1 12 ? -8.267  -12.781 -1.592  1.00 0.00 ? 117 LEU A HD13 12 
ATOM 9648  H HD21 . LEU A 1 12 ? -8.525  -10.688 -4.595  1.00 0.00 ? 117 LEU A HD21 12 
ATOM 9649  H HD22 . LEU A 1 12 ? -9.891  -11.071 -3.546  1.00 0.00 ? 117 LEU A HD22 12 
ATOM 9650  H HD23 . LEU A 1 12 ? -8.708  -12.317 -3.945  1.00 0.00 ? 117 LEU A HD23 12 
ATOM 9651  N N    . SER A 1 13 ? -7.873  -6.092  -2.525  1.00 0.00 ? 118 SER A N    12 
ATOM 9652  C CA   . SER A 1 13 ? -8.510  -4.784  -2.360  1.00 0.00 ? 118 SER A CA   12 
ATOM 9653  C C    . SER A 1 13 ? -7.607  -3.658  -2.861  1.00 0.00 ? 118 SER A C    12 
ATOM 9654  O O    . SER A 1 13 ? -7.837  -3.092  -3.927  1.00 0.00 ? 118 SER A O    12 
ATOM 9655  C CB   . SER A 1 13 ? -8.857  -4.545  -0.889  1.00 0.00 ? 118 SER A CB   12 
ATOM 9656  O OG   . SER A 1 13 ? -9.495  -3.294  -0.712  1.00 0.00 ? 118 SER A OG   12 
ATOM 9657  H H    . SER A 1 13 ? -6.973  -6.234  -2.167  1.00 0.00 ? 118 SER A H    12 
ATOM 9658  H HA   . SER A 1 13 ? -9.420  -4.783  -2.939  1.00 0.00 ? 118 SER A HA   12 
ATOM 9659  H HB2  . SER A 1 13 ? -9.519  -5.324  -0.544  1.00 0.00 ? 118 SER A HB2  12 
ATOM 9660  H HB3  . SER A 1 13 ? -7.951  -4.558  -0.301  1.00 0.00 ? 118 SER A HB3  12 
ATOM 9661  H HG   . SER A 1 13 ? -8.835  -2.596  -0.703  1.00 0.00 ? 118 SER A HG   12 
ATOM 9662  N N    . GLY A 1 14 ? -6.592  -3.330  -2.070  1.00 0.00 ? 119 GLY A N    12 
ATOM 9663  C CA   . GLY A 1 14 ? -5.661  -2.276  -2.439  1.00 0.00 ? 119 GLY A CA   12 
ATOM 9664  C C    . GLY A 1 14 ? -5.408  -1.309  -1.294  1.00 0.00 ? 119 GLY A C    12 
ATOM 9665  O O    . GLY A 1 14 ? -6.246  -1.175  -0.403  1.00 0.00 ? 119 GLY A O    12 
ATOM 9666  H H    . GLY A 1 14 ? -6.476  -3.804  -1.221  1.00 0.00 ? 119 GLY A H    12 
ATOM 9667  H HA2  . GLY A 1 14 ? -4.725  -2.729  -2.722  1.00 0.00 ? 119 GLY A HA2  12 
ATOM 9668  H HA3  . GLY A 1 14 ? -6.062  -1.733  -3.288  1.00 0.00 ? 119 GLY A HA3  12 
ATOM 9669  N N    . CYS A 1 15 ? -4.250  -0.636  -1.299  1.00 0.00 ? 120 CYS A N    12 
ATOM 9670  C CA   . CYS A 1 15 ? -3.936  0.314   -0.227  1.00 0.00 ? 120 CYS A CA   12 
ATOM 9671  C C    . CYS A 1 15 ? -3.851  1.739   -0.730  1.00 0.00 ? 120 CYS A C    12 
ATOM 9672  O O    . CYS A 1 15 ? -3.489  1.996   -1.878  1.00 0.00 ? 120 CYS A O    12 
ATOM 9673  C CB   . CYS A 1 15 ? -2.623  -0.004  0.509   1.00 0.00 ? 120 CYS A CB   12 
ATOM 9674  S SG   . CYS A 1 15 ? -1.801  -1.569  0.086   1.00 0.00 ? 120 CYS A SG   12 
ATOM 9675  H H    . CYS A 1 15 ? -3.616  -0.767  -2.036  1.00 0.00 ? 120 CYS A H    12 
ATOM 9676  H HA   . CYS A 1 15 ? -4.738  0.270   0.480   1.00 0.00 ? 120 CYS A HA   12 
ATOM 9677  H HB2  . CYS A 1 15 ? -1.916  0.783   0.294   1.00 0.00 ? 120 CYS A HB2  12 
ATOM 9678  H HB3  . CYS A 1 15 ? -2.815  -0.014  1.572   1.00 0.00 ? 120 CYS A HB3  12 
ATOM 9679  N N    . THR A 1 16 ? -4.196  2.662   0.159   1.00 0.00 ? 121 THR A N    12 
ATOM 9680  C CA   . THR A 1 16 ? -4.128  4.076   -0.138  1.00 0.00 ? 121 THR A CA   12 
ATOM 9681  C C    . THR A 1 16 ? -2.750  4.582   0.194   1.00 0.00 ? 121 THR A C    12 
ATOM 9682  O O    . THR A 1 16 ? -2.096  4.050   1.090   1.00 0.00 ? 121 THR A O    12 
ATOM 9683  C CB   . THR A 1 16 ? -5.132  4.894   0.689   1.00 0.00 ? 121 THR A CB   12 
ATOM 9684  O OG1  . THR A 1 16 ? -4.974  4.613   2.084   1.00 0.00 ? 121 THR A OG1  12 
ATOM 9685  C CG2  . THR A 1 16 ? -6.541  4.590   0.263   1.00 0.00 ? 121 THR A CG2  12 
ATOM 9686  H H    . THR A 1 16 ? -4.504  2.376   1.044   1.00 0.00 ? 121 THR A H    12 
ATOM 9687  H HA   . THR A 1 16 ? -4.329  4.224   -1.188  1.00 0.00 ? 121 THR A HA   12 
ATOM 9688  H HB   . THR A 1 16 ? -4.944  5.941   0.517   1.00 0.00 ? 121 THR A HB   12 
ATOM 9689  H HG1  . THR A 1 16 ? -5.813  4.327   2.451   1.00 0.00 ? 121 THR A HG1  12 
ATOM 9690  H HG21 . THR A 1 16 ? -6.509  4.146   -0.715  1.00 0.00 ? 121 THR A HG21 12 
ATOM 9691  H HG22 . THR A 1 16 ? -7.118  5.502   0.231   1.00 0.00 ? 121 THR A HG22 12 
ATOM 9692  H HG23 . THR A 1 16 ? -6.990  3.898   0.961   1.00 0.00 ? 121 THR A HG23 12 
ATOM 9693  N N    . GLN A 1 17 ? -2.305  5.605   -0.508  1.00 0.00 ? 122 GLN A N    12 
ATOM 9694  C CA   . GLN A 1 17 ? -1.004  6.171   -0.233  1.00 0.00 ? 122 GLN A CA   12 
ATOM 9695  C C    . GLN A 1 17 ? -0.919  6.508   1.243   1.00 0.00 ? 122 GLN A C    12 
ATOM 9696  O O    . GLN A 1 17 ? 0.165   6.651   1.792   1.00 0.00 ? 122 GLN A O    12 
ATOM 9697  C CB   . GLN A 1 17 ? -0.768  7.404   -1.100  1.00 0.00 ? 122 GLN A CB   12 
ATOM 9698  C CG   . GLN A 1 17 ? -0.216  7.075   -2.477  1.00 0.00 ? 122 GLN A CG   12 
ATOM 9699  C CD   . GLN A 1 17 ? -0.419  8.196   -3.476  1.00 0.00 ? 122 GLN A CD   12 
ATOM 9700  O OE1  . GLN A 1 17 ? -1.426  8.239   -4.179  1.00 0.00 ? 122 GLN A OE1  12 
ATOM 9701  N NE2  . GLN A 1 17 ? 0.540   9.112   -3.542  1.00 0.00 ? 122 GLN A NE2  12 
ATOM 9702  H H    . GLN A 1 17 ? -2.862  5.991   -1.215  1.00 0.00 ? 122 GLN A H    12 
ATOM 9703  H HA   . GLN A 1 17 ? -0.249  5.417   -0.455  1.00 0.00 ? 122 GLN A HA   12 
ATOM 9704  H HB2  . GLN A 1 17 ? -1.704  7.926   -1.225  1.00 0.00 ? 122 GLN A HB2  12 
ATOM 9705  H HB3  . GLN A 1 17 ? -0.072  8.050   -0.599  1.00 0.00 ? 122 GLN A HB3  12 
ATOM 9706  H HG2  . GLN A 1 17 ? 0.841   6.885   -2.391  1.00 0.00 ? 122 GLN A HG2  12 
ATOM 9707  H HG3  . GLN A 1 17 ? -0.704  6.188   -2.842  1.00 0.00 ? 122 GLN A HG3  12 
ATOM 9708  H HE21 . GLN A 1 17 ? 1.316   9.013   -2.950  1.00 0.00 ? 122 GLN A HE21 12 
ATOM 9709  H HE22 . GLN A 1 17 ? 0.434   9.847   -4.179  1.00 0.00 ? 122 GLN A HE22 12 
ATOM 9710  N N    . GLN A 1 18 ? -2.078  6.617   1.889   1.00 0.00 ? 123 GLN A N    12 
ATOM 9711  C CA   . GLN A 1 18 ? -2.113  6.892   3.315   1.00 0.00 ? 123 GLN A CA   12 
ATOM 9712  C C    . GLN A 1 18 ? -1.676  5.647   4.060   1.00 0.00 ? 123 GLN A C    12 
ATOM 9713  O O    . GLN A 1 18 ? -0.763  5.692   4.877   1.00 0.00 ? 123 GLN A O    12 
ATOM 9714  C CB   . GLN A 1 18 ? -3.507  7.304   3.771   1.00 0.00 ? 123 GLN A CB   12 
ATOM 9715  C CG   . GLN A 1 18 ? -3.537  8.637   4.498   1.00 0.00 ? 123 GLN A CG   12 
ATOM 9716  C CD   . GLN A 1 18 ? -3.422  8.484   6.003   1.00 0.00 ? 123 GLN A CD   12 
ATOM 9717  O OE1  . GLN A 1 18 ? -3.879  9.340   6.761   1.00 0.00 ? 123 GLN A OE1  12 
ATOM 9718  N NE2  . GLN A 1 18 ? -2.826  7.381   6.448   1.00 0.00 ? 123 GLN A NE2  12 
ATOM 9719  H H    . GLN A 1 18 ? -2.924  6.497   1.397   1.00 0.00 ? 123 GLN A H    12 
ATOM 9720  H HA   . GLN A 1 18 ? -1.416  7.688   3.524   1.00 0.00 ? 123 GLN A HA   12 
ATOM 9721  H HB2  . GLN A 1 18 ? -4.159  7.363   2.913   1.00 0.00 ? 123 GLN A HB2  12 
ATOM 9722  H HB3  . GLN A 1 18 ? -3.872  6.547   4.448   1.00 0.00 ? 123 GLN A HB3  12 
ATOM 9723  H HG2  . GLN A 1 18 ? -2.711  9.241   4.150   1.00 0.00 ? 123 GLN A HG2  12 
ATOM 9724  H HG3  . GLN A 1 18 ? -4.467  9.136   4.270   1.00 0.00 ? 123 GLN A HG3  12 
ATOM 9725  H HE21 . GLN A 1 18 ? -2.499  6.731   5.790   1.00 0.00 ? 123 GLN A HE21 12 
ATOM 9726  H HE22 . GLN A 1 18 ? -2.740  7.261   7.418   1.00 0.00 ? 123 GLN A HE22 12 
ATOM 9727  N N    . ASP A 1 19 ? -2.335  4.528   3.765   1.00 0.00 ? 124 ASP A N    12 
ATOM 9728  C CA   . ASP A 1 19 ? -1.987  3.264   4.394   1.00 0.00 ? 124 ASP A CA   12 
ATOM 9729  C C    . ASP A 1 19 ? -0.509  2.992   4.164   1.00 0.00 ? 124 ASP A C    12 
ATOM 9730  O O    . ASP A 1 19 ? 0.251   2.742   5.103   1.00 0.00 ? 124 ASP A O    12 
ATOM 9731  C CB   . ASP A 1 19 ? -2.824  2.126   3.808   1.00 0.00 ? 124 ASP A CB   12 
ATOM 9732  C CG   . ASP A 1 19 ? -2.907  0.929   4.734   1.00 0.00 ? 124 ASP A CG   12 
ATOM 9733  O OD1  . ASP A 1 19 ? -3.646  1.006   5.738   1.00 0.00 ? 124 ASP A OD1  12 
ATOM 9734  O OD2  . ASP A 1 19 ? -2.233  -0.085  4.456   1.00 0.00 ? 124 ASP A OD2  12 
ATOM 9735  H H    . ASP A 1 19 ? -3.070  4.557   3.111   1.00 0.00 ? 124 ASP A H    12 
ATOM 9736  H HA   . ASP A 1 19 ? -2.176  3.345   5.455   1.00 0.00 ? 124 ASP A HA   12 
ATOM 9737  H HB2  . ASP A 1 19 ? -3.824  2.483   3.619   1.00 0.00 ? 124 ASP A HB2  12 
ATOM 9738  H HB3  . ASP A 1 19 ? -2.382  1.806   2.877   1.00 0.00 ? 124 ASP A HB3  12 
ATOM 9739  N N    . LEU A 1 20 ? -0.109  3.064   2.901   1.00 0.00 ? 125 LEU A N    12 
ATOM 9740  C CA   . LEU A 1 20 ? 1.276   2.851   2.524   1.00 0.00 ? 125 LEU A CA   12 
ATOM 9741  C C    . LEU A 1 20 ? 2.171   3.865   3.239   1.00 0.00 ? 125 LEU A C    12 
ATOM 9742  O O    . LEU A 1 20 ? 3.319   3.564   3.585   1.00 0.00 ? 125 LEU A O    12 
ATOM 9743  C CB   . LEU A 1 20 ? 1.416   2.917   0.994   1.00 0.00 ? 125 LEU A CB   12 
ATOM 9744  C CG   . LEU A 1 20 ? 0.593   1.876   0.239   1.00 0.00 ? 125 LEU A CG   12 
ATOM 9745  C CD1  . LEU A 1 20 ? -0.358  2.556   -0.726  1.00 0.00 ? 125 LEU A CD1  12 
ATOM 9746  C CD2  . LEU A 1 20 ? 1.496   0.939   -0.526  1.00 0.00 ? 125 LEU A CD2  12 
ATOM 9747  H H    . LEU A 1 20 ? -0.765  3.265   2.205   1.00 0.00 ? 125 LEU A H    12 
ATOM 9748  H HA   . LEU A 1 20 ? 1.554   1.861   2.856   1.00 0.00 ? 125 LEU A HA   12 
ATOM 9749  H HB2  . LEU A 1 20 ? 1.108   3.888   0.651   1.00 0.00 ? 125 LEU A HB2  12 
ATOM 9750  H HB3  . LEU A 1 20 ? 2.446   2.785   0.733   1.00 0.00 ? 125 LEU A HB3  12 
ATOM 9751  H HG   . LEU A 1 20 ? 0.012   1.296   0.939   1.00 0.00 ? 125 LEU A HG   12 
ATOM 9752  H HD11 . LEU A 1 20 ? -1.287  2.009   -0.766  1.00 0.00 ? 125 LEU A HD11 12 
ATOM 9753  H HD12 . LEU A 1 20 ? 0.092   2.574   -1.703  1.00 0.00 ? 125 LEU A HD12 12 
ATOM 9754  H HD13 . LEU A 1 20 ? -0.545  3.568   -0.396  1.00 0.00 ? 125 LEU A HD13 12 
ATOM 9755  H HD21 . LEU A 1 20 ? 2.366   0.708   0.074   1.00 0.00 ? 125 LEU A HD21 12 
ATOM 9756  H HD22 . LEU A 1 20 ? 1.804   1.422   -1.445  1.00 0.00 ? 125 LEU A HD22 12 
ATOM 9757  H HD23 . LEU A 1 20 ? 0.963   0.028   -0.754  1.00 0.00 ? 125 LEU A HD23 12 
ATOM 9758  N N    . LEU A 1 21 ? 1.628   5.063   3.484   1.00 0.00 ? 126 LEU A N    12 
ATOM 9759  C CA   . LEU A 1 21 ? 2.363   6.104   4.197   1.00 0.00 ? 126 LEU A CA   12 
ATOM 9760  C C    . LEU A 1 21 ? 2.664   5.634   5.614   1.00 0.00 ? 126 LEU A C    12 
ATOM 9761  O O    . LEU A 1 21 ? 3.657   6.036   6.220   1.00 0.00 ? 126 LEU A O    12 
ATOM 9762  C CB   . LEU A 1 21 ? 1.558   7.412   4.250   1.00 0.00 ? 126 LEU A CB   12 
ATOM 9763  C CG   . LEU A 1 21 ? 1.903   8.454   3.182   1.00 0.00 ? 126 LEU A CG   12 
ATOM 9764  C CD1  . LEU A 1 21 ? 1.026   9.686   3.339   1.00 0.00 ? 126 LEU A CD1  12 
ATOM 9765  C CD2  . LEU A 1 21 ? 3.374   8.836   3.257   1.00 0.00 ? 126 LEU A CD2  12 
ATOM 9766  H H    . LEU A 1 21 ? 0.717   5.253   3.173   1.00 0.00 ? 126 LEU A H    12 
ATOM 9767  H HA   . LEU A 1 21 ? 3.295   6.275   3.678   1.00 0.00 ? 126 LEU A HA   12 
ATOM 9768  H HB2  . LEU A 1 21 ? 0.513   7.166   4.149   1.00 0.00 ? 126 LEU A HB2  12 
ATOM 9769  H HB3  . LEU A 1 21 ? 1.709   7.862   5.219   1.00 0.00 ? 126 LEU A HB3  12 
ATOM 9770  H HG   . LEU A 1 21 ? 1.712   8.033   2.203   1.00 0.00 ? 126 LEU A HG   12 
ATOM 9771  H HD11 . LEU A 1 21 ? 1.198   10.130  4.308   1.00 0.00 ? 126 LEU A HD11 12 
ATOM 9772  H HD12 . LEU A 1 21 ? -0.013  9.401   3.252   1.00 0.00 ? 126 LEU A HD12 12 
ATOM 9773  H HD13 . LEU A 1 21 ? 1.269   10.401  2.567   1.00 0.00 ? 126 LEU A HD13 12 
ATOM 9774  H HD21 . LEU A 1 21 ? 3.588   9.596   2.519   1.00 0.00 ? 126 LEU A HD21 12 
ATOM 9775  H HD22 . LEU A 1 21 ? 3.982   7.965   3.065   1.00 0.00 ? 126 LEU A HD22 12 
ATOM 9776  H HD23 . LEU A 1 21 ? 3.596   9.220   4.242   1.00 0.00 ? 126 LEU A HD23 12 
ATOM 9777  N N    . THR A 1 22 ? 1.789   4.775   6.137   1.00 0.00 ? 127 THR A N    12 
ATOM 9778  C CA   . THR A 1 22 ? 1.951   4.243   7.482   1.00 0.00 ? 127 THR A CA   12 
ATOM 9779  C C    . THR A 1 22 ? 2.592   2.859   7.459   1.00 0.00 ? 127 THR A C    12 
ATOM 9780  O O    . THR A 1 22 ? 2.874   2.288   8.513   1.00 0.00 ? 127 THR A O    12 
ATOM 9781  C CB   . THR A 1 22 ? 0.610   4.150   8.245   1.00 0.00 ? 127 THR A CB   12 
ATOM 9782  O OG1  . THR A 1 22 ? 0.217   2.779   8.380   1.00 0.00 ? 127 THR A OG1  12 
ATOM 9783  C CG2  . THR A 1 22 ? -0.492  4.919   7.536   1.00 0.00 ? 127 THR A CG2  12 
ATOM 9784  H H    . THR A 1 22 ? 1.018   4.496   5.601   1.00 0.00 ? 127 THR A H    12 
ATOM 9785  H HA   . THR A 1 22 ? 2.595   4.919   8.023   1.00 0.00 ? 127 THR A HA   12 
ATOM 9786  H HB   . THR A 1 22 ? 0.745   4.575   9.228   1.00 0.00 ? 127 THR A HB   12 
ATOM 9787  H HG1  . THR A 1 22 ? -0.628  2.645   7.945   1.00 0.00 ? 127 THR A HG1  12 
ATOM 9788  H HG21 . THR A 1 22 ? -0.094  5.843   7.144   1.00 0.00 ? 127 THR A HG21 12 
ATOM 9789  H HG22 . THR A 1 22 ? -1.285  5.137   8.235   1.00 0.00 ? 127 THR A HG22 12 
ATOM 9790  H HG23 . THR A 1 22 ? -0.881  4.323   6.724   1.00 0.00 ? 127 THR A HG23 12 
ATOM 9791  N N    . LEU A 1 23 ? 2.829   2.315   6.263   1.00 0.00 ? 128 LEU A N    12 
ATOM 9792  C CA   . LEU A 1 23 ? 3.428   0.998   6.147   1.00 0.00 ? 128 LEU A CA   12 
ATOM 9793  C C    . LEU A 1 23 ? 4.945   1.109   6.062   1.00 0.00 ? 128 LEU A C    12 
ATOM 9794  O O    . LEU A 1 23 ? 5.663   0.152   6.349   1.00 0.00 ? 128 LEU A O    12 
ATOM 9795  C CB   . LEU A 1 23 ? 2.847   0.272   4.941   1.00 0.00 ? 128 LEU A CB   12 
ATOM 9796  C CG   . LEU A 1 23 ? 1.358   -0.046  5.068   1.00 0.00 ? 128 LEU A CG   12 
ATOM 9797  C CD1  . LEU A 1 23 ? 0.745   -0.299  3.707   1.00 0.00 ? 128 LEU A CD1  12 
ATOM 9798  C CD2  . LEU A 1 23 ? 1.158   -1.239  5.974   1.00 0.00 ? 128 LEU A CD2  12 
ATOM 9799  H H    . LEU A 1 23 ? 2.609   2.811   5.441   1.00 0.00 ? 128 LEU A H    12 
ATOM 9800  H HA   . LEU A 1 23 ? 3.172   0.441   7.037   1.00 0.00 ? 128 LEU A HA   12 
ATOM 9801  H HB2  . LEU A 1 23 ? 2.994   0.878   4.067   1.00 0.00 ? 128 LEU A HB2  12 
ATOM 9802  H HB3  . LEU A 1 23 ? 3.380   -0.654  4.814   1.00 0.00 ? 128 LEU A HB3  12 
ATOM 9803  H HG   . LEU A 1 23 ? 0.852   0.798   5.512   1.00 0.00 ? 128 LEU A HG   12 
ATOM 9804  H HD11 . LEU A 1 23 ? 0.068   -1.139  3.769   1.00 0.00 ? 128 LEU A HD11 12 
ATOM 9805  H HD12 . LEU A 1 23 ? 1.527   -0.514  2.998   1.00 0.00 ? 128 LEU A HD12 12 
ATOM 9806  H HD13 . LEU A 1 23 ? 0.200   0.577   3.390   1.00 0.00 ? 128 LEU A HD13 12 
ATOM 9807  H HD21 . LEU A 1 23 ? 1.187   -0.920  7.004   1.00 0.00 ? 128 LEU A HD21 12 
ATOM 9808  H HD22 . LEU A 1 23 ? 1.949   -1.943  5.794   1.00 0.00 ? 128 LEU A HD22 12 
ATOM 9809  H HD23 . LEU A 1 23 ? 0.205   -1.701  5.762   1.00 0.00 ? 128 LEU A HD23 12 
ATOM 9810  N N    . CYS A 1 24 ? 5.428   2.288   5.667   1.00 0.00 ? 129 CYS A N    12 
ATOM 9811  C CA   . CYS A 1 24 ? 6.866   2.529   5.584   1.00 0.00 ? 129 CYS A CA   12 
ATOM 9812  C C    . CYS A 1 24 ? 7.433   2.812   6.974   1.00 0.00 ? 129 CYS A C    12 
ATOM 9813  O O    . CYS A 1 24 ? 6.680   3.066   7.915   1.00 0.00 ? 129 CYS A O    12 
ATOM 9814  C CB   . CYS A 1 24 ? 7.172   3.706   4.656   1.00 0.00 ? 129 CYS A CB   12 
ATOM 9815  S SG   . CYS A 1 24 ? 7.035   5.344   5.451   1.00 0.00 ? 129 CYS A SG   12 
ATOM 9816  H H    . CYS A 1 24 ? 4.803   3.003   5.408   1.00 0.00 ? 129 CYS A H    12 
ATOM 9817  H HA   . CYS A 1 24 ? 7.332   1.636   5.190   1.00 0.00 ? 129 CYS A HA   12 
ATOM 9818  H HB2  . CYS A 1 24 ? 8.182   3.609   4.286   1.00 0.00 ? 129 CYS A HB2  12 
ATOM 9819  H HB3  . CYS A 1 24 ? 6.490   3.681   3.825   1.00 0.00 ? 129 CYS A HB3  12 
ATOM 9820  N N    . PRO A 1 25 ? 8.769   2.774   7.127   1.00 0.00 ? 130 PRO A N    12 
ATOM 9821  C CA   . PRO A 1 25 ? 9.431   3.028   8.405   1.00 0.00 ? 130 PRO A CA   12 
ATOM 9822  C C    . PRO A 1 25 ? 9.573   4.520   8.687   1.00 0.00 ? 130 PRO A C    12 
ATOM 9823  O O    . PRO A 1 25 ? 8.988   5.350   7.991   1.00 0.00 ? 130 PRO A O    12 
ATOM 9824  C CB   . PRO A 1 25 ? 10.816  2.377   8.233   1.00 0.00 ? 130 PRO A CB   12 
ATOM 9825  C CG   . PRO A 1 25 ? 10.818  1.764   6.865   1.00 0.00 ? 130 PRO A CG   12 
ATOM 9826  C CD   . PRO A 1 25 ? 9.749   2.472   6.086   1.00 0.00 ? 130 PRO A CD   12 
ATOM 9827  H HA   . PRO A 1 25 ? 8.906   2.556   9.224   1.00 0.00 ? 130 PRO A HA   12 
ATOM 9828  H HB2  . PRO A 1 25 ? 11.581  3.133   8.323   1.00 0.00 ? 130 PRO A HB2  12 
ATOM 9829  H HB3  . PRO A 1 25 ? 10.957  1.629   8.999   1.00 0.00 ? 130 PRO A HB3  12 
ATOM 9830  H HG2  . PRO A 1 25 ? 11.779  1.910   6.398   1.00 0.00 ? 130 PRO A HG2  12 
ATOM 9831  H HG3  . PRO A 1 25 ? 10.591  0.710   6.935   1.00 0.00 ? 130 PRO A HG3  12 
ATOM 9832  H HD2  . PRO A 1 25 ? 10.138  3.379   5.644   1.00 0.00 ? 130 PRO A HD2  12 
ATOM 9833  H HD3  . PRO A 1 25 ? 9.325   1.829   5.329   1.00 0.00 ? 130 PRO A HD3  12 
ATOM 9834  N N    . TYR A 1 26 ? 10.358  4.853   9.710   1.00 0.00 ? 131 TYR A N    12 
ATOM 9835  C CA   . TYR A 1 26 ? 10.582  6.244   10.090  1.00 0.00 ? 131 TYR A CA   12 
ATOM 9836  C C    . TYR A 1 26 ? 9.261   6.975   10.316  1.00 0.00 ? 131 TYR A C    12 
ATOM 9837  O O    . TYR A 1 26 ? 8.757   7.599   9.357   1.00 0.00 ? 131 TYR A O    12 
ATOM 9838  C CB   . TYR A 1 26 ? 11.402  6.959   9.016   1.00 0.00 ? 131 TYR A CB   12 
ATOM 9839  C CG   . TYR A 1 26 ? 12.758  6.334   8.771   1.00 0.00 ? 131 TYR A CG   12 
ATOM 9840  C CD1  . TYR A 1 26 ? 13.867  6.728   9.509   1.00 0.00 ? 131 TYR A CD1  12 
ATOM 9841  C CD2  . TYR A 1 26 ? 12.925  5.351   7.806   1.00 0.00 ? 131 TYR A CD2  12 
ATOM 9842  C CE1  . TYR A 1 26 ? 15.107  6.158   9.290   1.00 0.00 ? 131 TYR A CE1  12 
ATOM 9843  C CE2  . TYR A 1 26 ? 14.164  4.776   7.582   1.00 0.00 ? 131 TYR A CE2  12 
ATOM 9844  C CZ   . TYR A 1 26 ? 15.251  5.183   8.326   1.00 0.00 ? 131 TYR A CZ   12 
ATOM 9845  O OH   . TYR A 1 26 ? 16.483  4.613   8.106   1.00 0.00 ? 131 TYR A OH   12 
ATOM 9846  O OXT  . TYR A 1 26 ? 8.741   6.918   11.450  1.00 0.00 ? 131 TYR A OXT  12 
ATOM 9847  H H    . TYR A 1 26 ? 10.801  4.147   10.220  1.00 0.00 ? 131 TYR A H    12 
ATOM 9848  H HA   . TYR A 1 26 ? 11.141  6.246   11.013  1.00 0.00 ? 131 TYR A HA   12 
ATOM 9849  H HB2  . TYR A 1 26 ? 10.857  6.944   8.083   1.00 0.00 ? 131 TYR A HB2  12 
ATOM 9850  H HB3  . TYR A 1 26 ? 11.558  7.981   9.319   1.00 0.00 ? 131 TYR A HB3  12 
ATOM 9851  H HD1  . TYR A 1 26 ? 13.752  7.492   10.264  1.00 0.00 ? 131 TYR A HD1  12 
ATOM 9852  H HD2  . TYR A 1 26 ? 12.074  5.035   7.224   1.00 0.00 ? 131 TYR A HD2  12 
ATOM 9853  H HE1  . TYR A 1 26 ? 15.958  6.478   9.873   1.00 0.00 ? 131 TYR A HE1  12 
ATOM 9854  H HE2  . TYR A 1 26 ? 14.274  4.012   6.827   1.00 0.00 ? 131 TYR A HE2  12 
ATOM 9855  H HH   . TYR A 1 26 ? 16.876  4.368   8.947   1.00 0.00 ? 131 TYR A HH   12 
ATOM 9856  N N    . PRO B 2 1  ? -0.045  13.311  -10.717 1.00 0.00 ? 25  PRO B N    12 
ATOM 9857  C CA   . PRO B 2 1  ? -0.989  14.049  -9.839  1.00 0.00 ? 25  PRO B CA   12 
ATOM 9858  C C    . PRO B 2 1  ? -2.050  13.118  -9.257  1.00 0.00 ? 25  PRO B C    12 
ATOM 9859  O O    . PRO B 2 1  ? -3.061  13.574  -8.722  1.00 0.00 ? 25  PRO B O    12 
ATOM 9860  C CB   . PRO B 2 1  ? -1.651  15.153  -10.650 1.00 0.00 ? 25  PRO B CB   12 
ATOM 9861  C CG   . PRO B 2 1  ? -0.965  15.085  -11.973 1.00 0.00 ? 25  PRO B CG   12 
ATOM 9862  C CD   . PRO B 2 1  ? -0.413  13.682  -12.095 1.00 0.00 ? 25  PRO B CD   12 
ATOM 9863  H H2   . PRO B 2 1  ? -0.137  12.317  -10.455 1.00 0.00 ? 25  PRO B H2   12 
ATOM 9864  H H3   . PRO B 2 1  ? 0.905   13.568  -10.358 1.00 0.00 ? 25  PRO B H3   12 
ATOM 9865  H HA   . PRO B 2 1  ? -0.429  14.491  -9.029  1.00 0.00 ? 25  PRO B HA   12 
ATOM 9866  H HB2  . PRO B 2 1  ? -2.709  14.956  -10.739 1.00 0.00 ? 25  PRO B HB2  12 
ATOM 9867  H HB3  . PRO B 2 1  ? -1.492  16.106  -10.170 1.00 0.00 ? 25  PRO B HB3  12 
ATOM 9868  H HG2  . PRO B 2 1  ? -1.675  15.279  -12.763 1.00 0.00 ? 25  PRO B HG2  12 
ATOM 9869  H HG3  . PRO B 2 1  ? -0.162  15.807  -12.004 1.00 0.00 ? 25  PRO B HG3  12 
ATOM 9870  H HD2  . PRO B 2 1  ? -1.170  13.015  -12.480 1.00 0.00 ? 25  PRO B HD2  12 
ATOM 9871  H HD3  . PRO B 2 1  ? 0.455   13.676  -12.737 1.00 0.00 ? 25  PRO B HD3  12 
ATOM 9872  N N    . THR B 2 2  ? -1.816  11.813  -9.365  1.00 0.00 ? 26  THR B N    12 
ATOM 9873  C CA   . THR B 2 2  ? -2.754  10.824  -8.848  1.00 0.00 ? 26  THR B CA   12 
ATOM 9874  C C    . THR B 2 2  ? -2.697  10.764  -7.321  1.00 0.00 ? 26  THR B C    12 
ATOM 9875  O O    . THR B 2 2  ? -1.614  10.764  -6.737  1.00 0.00 ? 26  THR B O    12 
ATOM 9876  C CB   . THR B 2 2  ? -2.462  9.422   -9.415  1.00 0.00 ? 26  THR B CB   12 
ATOM 9877  O OG1  . THR B 2 2  ? -1.133  9.016   -9.063  1.00 0.00 ? 26  THR B OG1  12 
ATOM 9878  C CG2  . THR B 2 2  ? -2.616  9.408   -10.927 1.00 0.00 ? 26  THR B CG2  12 
ATOM 9879  H H    . THR B 2 2  ? -0.994  11.508  -9.801  1.00 0.00 ? 26  THR B H    12 
ATOM 9880  H HA   . THR B 2 2  ? -3.746  11.115  -9.155  1.00 0.00 ? 26  THR B HA   12 
ATOM 9881  H HB   . THR B 2 2  ? -3.167  8.722   -8.988  1.00 0.00 ? 26  THR B HB   12 
ATOM 9882  H HG1  . THR B 2 2  ? -0.838  8.330   -9.664  1.00 0.00 ? 26  THR B HG1  12 
ATOM 9883  H HG21 . THR B 2 2  ? -1.927  10.112  -11.368 1.00 0.00 ? 26  THR B HG21 12 
ATOM 9884  H HG22 . THR B 2 2  ? -3.628  9.682   -11.188 1.00 0.00 ? 26  THR B HG22 12 
ATOM 9885  H HG23 . THR B 2 2  ? -2.405  8.416   -11.302 1.00 0.00 ? 26  THR B HG23 12 
ATOM 9886  N N    . PRO B 2 3  ? -3.865  10.712  -6.648  1.00 0.00 ? 27  PRO B N    12 
ATOM 9887  C CA   . PRO B 2 3  ? -3.942  10.653  -5.200  1.00 0.00 ? 27  PRO B CA   12 
ATOM 9888  C C    . PRO B 2 3  ? -4.088  9.223   -4.703  1.00 0.00 ? 27  PRO B C    12 
ATOM 9889  O O    . PRO B 2 3  ? -3.764  8.274   -5.418  1.00 0.00 ? 27  PRO B O    12 
ATOM 9890  C CB   . PRO B 2 3  ? -5.212  11.452  -4.923  1.00 0.00 ? 27  PRO B CB   12 
ATOM 9891  C CG   . PRO B 2 3  ? -6.098  11.187  -6.103  1.00 0.00 ? 27  PRO B CG   12 
ATOM 9892  C CD   . PRO B 2 3  ? -5.215  10.704  -7.235  1.00 0.00 ? 27  PRO B CD   12 
ATOM 9893  H HA   . PRO B 2 3  ? -3.096  11.124  -4.725  1.00 0.00 ? 27  PRO B HA   12 
ATOM 9894  H HB2  . PRO B 2 3  ? -5.663  11.108  -4.003  1.00 0.00 ? 27  PRO B HB2  12 
ATOM 9895  H HB3  . PRO B 2 3  ? -4.969  12.500  -4.842  1.00 0.00 ? 27  PRO B HB3  12 
ATOM 9896  H HG2  . PRO B 2 3  ? -6.823  10.428  -5.850  1.00 0.00 ? 27  PRO B HG2  12 
ATOM 9897  H HG3  . PRO B 2 3  ? -6.603  12.099  -6.388  1.00 0.00 ? 27  PRO B HG3  12 
ATOM 9898  H HD2  . PRO B 2 3  ? -5.499  9.703   -7.532  1.00 0.00 ? 27  PRO B HD2  12 
ATOM 9899  H HD3  . PRO B 2 3  ? -5.275  11.379  -8.074  1.00 0.00 ? 27  PRO B HD3  12 
ATOM 9900  N N    . GLU B 2 4  ? -4.583  9.069   -3.483  1.00 0.00 ? 28  GLU B N    12 
ATOM 9901  C CA   . GLU B 2 4  ? -4.777  7.744   -2.915  1.00 0.00 ? 28  GLU B CA   12 
ATOM 9902  C C    . GLU B 2 4  ? -6.065  7.136   -3.427  1.00 0.00 ? 28  GLU B C    12 
ATOM 9903  O O    . GLU B 2 4  ? -7.086  7.107   -2.739  1.00 0.00 ? 28  GLU B O    12 
ATOM 9904  C CB   . GLU B 2 4  ? -4.780  7.788   -1.396  1.00 0.00 ? 28  GLU B CB   12 
ATOM 9905  C CG   . GLU B 2 4  ? -5.547  8.961   -0.806  1.00 0.00 ? 28  GLU B CG   12 
ATOM 9906  C CD   . GLU B 2 4  ? -5.708  8.853   0.697   1.00 0.00 ? 28  GLU B CD   12 
ATOM 9907  O OE1  . GLU B 2 4  ? -6.664  8.184   1.145   1.00 0.00 ? 28  GLU B OE1  12 
ATOM 9908  O OE2  . GLU B 2 4  ? -4.879  9.437   1.426   1.00 0.00 ? 28  GLU B OE2  12 
ATOM 9909  H H    . GLU B 2 4  ? -4.825  9.860   -2.962  1.00 0.00 ? 28  GLU B H    12 
ATOM 9910  H HA   . GLU B 2 4  ? -3.954  7.127   -3.243  1.00 0.00 ? 28  GLU B HA   12 
ATOM 9911  H HB2  . GLU B 2 4  ? -5.220  6.877   -1.025  1.00 0.00 ? 28  GLU B HB2  12 
ATOM 9912  H HB3  . GLU B 2 4  ? -3.761  7.843   -1.065  1.00 0.00 ? 28  GLU B HB3  12 
ATOM 9913  H HG2  . GLU B 2 4  ? -5.012  9.871   -1.028  1.00 0.00 ? 28  GLU B HG2  12 
ATOM 9914  H HG3  . GLU B 2 4  ? -6.526  9.000   -1.258  1.00 0.00 ? 28  GLU B HG3  12 
ATOM 9915  N N    . MET B 2 5  ? -5.991  6.652   -4.648  1.00 0.00 ? 29  MET B N    12 
ATOM 9916  C CA   . MET B 2 5  ? -7.133  6.041   -5.312  1.00 0.00 ? 29  MET B CA   12 
ATOM 9917  C C    . MET B 2 5  ? -7.281  4.586   -4.904  1.00 0.00 ? 29  MET B C    12 
ATOM 9918  O O    . MET B 2 5  ? -8.007  3.822   -5.541  1.00 0.00 ? 29  MET B O    12 
ATOM 9919  C CB   . MET B 2 5  ? -6.982  6.163   -6.828  1.00 0.00 ? 29  MET B CB   12 
ATOM 9920  C CG   . MET B 2 5  ? -8.275  5.931   -7.595  1.00 0.00 ? 29  MET B CG   12 
ATOM 9921  S SD   . MET B 2 5  ? -8.069  6.112   -9.378  1.00 0.00 ? 29  MET B SD   12 
ATOM 9922  C CE   . MET B 2 5  ? -6.921  4.781   -9.725  1.00 0.00 ? 29  MET B CE   12 
ATOM 9923  H H    . MET B 2 5  ? -5.132  6.701   -5.113  1.00 0.00 ? 29  MET B H    12 
ATOM 9924  H HA   . MET B 2 5  ? -8.014  6.570   -4.997  1.00 0.00 ? 29  MET B HA   12 
ATOM 9925  H HB2  . MET B 2 5  ? -6.619  7.155   -7.065  1.00 0.00 ? 29  MET B HB2  12 
ATOM 9926  H HB3  . MET B 2 5  ? -6.255  5.435   -7.158  1.00 0.00 ? 29  MET B HB3  12 
ATOM 9927  H HG2  . MET B 2 5  ? -8.624  4.930   -7.390  1.00 0.00 ? 29  MET B HG2  12 
ATOM 9928  H HG3  . MET B 2 5  ? -9.011  6.645   -7.257  1.00 0.00 ? 29  MET B HG3  12 
ATOM 9929  H HE1  . MET B 2 5  ? -7.375  3.838   -9.460  1.00 0.00 ? 29  MET B HE1  12 
ATOM 9930  H HE2  . MET B 2 5  ? -6.021  4.922   -9.146  1.00 0.00 ? 29  MET B HE2  12 
ATOM 9931  H HE3  . MET B 2 5  ? -6.678  4.780   -10.777 1.00 0.00 ? 29  MET B HE3  12 
ATOM 9932  N N    . ARG B 2 6  ? -6.600  4.225   -3.826  1.00 0.00 ? 30  ARG B N    12 
ATOM 9933  C CA   . ARG B 2 6  ? -6.647  2.874   -3.290  1.00 0.00 ? 30  ARG B CA   12 
ATOM 9934  C C    . ARG B 2 6  ? -6.720  1.828   -4.389  1.00 0.00 ? 30  ARG B C    12 
ATOM 9935  O O    . ARG B 2 6  ? -7.806  1.365   -4.745  1.00 0.00 ? 30  ARG B O    12 
ATOM 9936  C CB   . ARG B 2 6  ? -7.856  2.739   -2.396  1.00 0.00 ? 30  ARG B CB   12 
ATOM 9937  C CG   . ARG B 2 6  ? -7.584  1.935   -1.152  1.00 0.00 ? 30  ARG B CG   12 
ATOM 9938  C CD   . ARG B 2 6  ? -8.494  0.748   -1.077  1.00 0.00 ? 30  ARG B CD   12 
ATOM 9939  N NE   . ARG B 2 6  ? -8.495  0.153   0.252   1.00 0.00 ? 30  ARG B NE   12 
ATOM 9940  C CZ   . ARG B 2 6  ? -9.481  -0.604  0.725   1.00 0.00 ? 30  ARG B CZ   12 
ATOM 9941  N NH1  . ARG B 2 6  ? -10.544 -0.861  -0.025  1.00 0.00 ? 30  ARG B NH1  12 
ATOM 9942  N NH2  . ARG B 2 6  ? -9.405  -1.102  1.952   1.00 0.00 ? 30  ARG B NH2  12 
ATOM 9943  H H    . ARG B 2 6  ? -6.065  4.893   -3.368  1.00 0.00 ? 30  ARG B H    12 
ATOM 9944  H HA   . ARG B 2 6  ? -5.762  2.706   -2.699  1.00 0.00 ? 30  ARG B HA   12 
ATOM 9945  H HB2  . ARG B 2 6  ? -8.190  3.721   -2.099  1.00 0.00 ? 30  ARG B HB2  12 
ATOM 9946  H HB3  . ARG B 2 6  ? -8.635  2.251   -2.959  1.00 0.00 ? 30  ARG B HB3  12 
ATOM 9947  H HG2  . ARG B 2 6  ? -6.559  1.598   -1.170  1.00 0.00 ? 30  ARG B HG2  12 
ATOM 9948  H HG3  . ARG B 2 6  ? -7.748  2.557   -0.286  1.00 0.00 ? 30  ARG B HG3  12 
ATOM 9949  H HD2  . ARG B 2 6  ? -9.490  1.076   -1.322  1.00 0.00 ? 30  ARG B HD2  12 
ATOM 9950  H HD3  . ARG B 2 6  ? -8.161  0.017   -1.798  1.00 0.00 ? 30  ARG B HD3  12 
ATOM 9951  H HE   . ARG B 2 6  ? -7.723  0.334   0.824   1.00 0.00 ? 30  ARG B HE   12 
ATOM 9952  H HH11 . ARG B 2 6  ? -10.607 -0.484  -0.948  1.00 0.00 ? 30  ARG B HH11 12 
ATOM 9953  H HH12 . ARG B 2 6  ? -11.283 -1.431  0.334   1.00 0.00 ? 30  ARG B HH12 12 
ATOM 9954  H HH21 . ARG B 2 6  ? -8.605  -0.908  2.521   1.00 0.00 ? 30  ARG B HH21 12 
ATOM 9955  H HH22 . ARG B 2 6  ? -10.145 -1.671  2.307   1.00 0.00 ? 30  ARG B HH22 12 
ATOM 9956  N N    . GLU B 2 7  ? -5.571  1.452   -4.924  1.00 0.00 ? 31  GLU B N    12 
ATOM 9957  C CA   . GLU B 2 7  ? -5.541  0.455   -5.978  1.00 0.00 ? 31  GLU B CA   12 
ATOM 9958  C C    . GLU B 2 7  ? -4.997  -0.861  -5.474  1.00 0.00 ? 31  GLU B C    12 
ATOM 9959  O O    . GLU B 2 7  ? -4.228  -0.916  -4.519  1.00 0.00 ? 31  GLU B O    12 
ATOM 9960  C CB   . GLU B 2 7  ? -4.732  0.952   -7.173  1.00 0.00 ? 31  GLU B CB   12 
ATOM 9961  C CG   . GLU B 2 7  ? -3.301  1.303   -6.818  1.00 0.00 ? 31  GLU B CG   12 
ATOM 9962  C CD   . GLU B 2 7  ? -2.449  1.593   -8.038  1.00 0.00 ? 31  GLU B CD   12 
ATOM 9963  O OE1  . GLU B 2 7  ? -2.508  2.736   -8.542  1.00 0.00 ? 31  GLU B OE1  12 
ATOM 9964  O OE2  . GLU B 2 7  ? -1.726  0.682   -8.489  1.00 0.00 ? 31  GLU B OE2  12 
ATOM 9965  H H    . GLU B 2 7  ? -4.733  1.848   -4.607  1.00 0.00 ? 31  GLU B H    12 
ATOM 9966  H HA   . GLU B 2 7  ? -6.557  0.283   -6.285  1.00 0.00 ? 31  GLU B HA   12 
ATOM 9967  H HB2  . GLU B 2 7  ? -4.716  0.183   -7.929  1.00 0.00 ? 31  GLU B HB2  12 
ATOM 9968  H HB3  . GLU B 2 7  ? -5.207  1.834   -7.576  1.00 0.00 ? 31  GLU B HB3  12 
ATOM 9969  H HG2  . GLU B 2 7  ? -3.305  2.176   -6.182  1.00 0.00 ? 31  GLU B HG2  12 
ATOM 9970  H HG3  . GLU B 2 7  ? -2.871  0.471   -6.283  1.00 0.00 ? 31  GLU B HG3  12 
ATOM 9971  N N    . LYS B 2 8  ? -5.410  -1.914  -6.152  1.00 0.00 ? 32  LYS B N    12 
ATOM 9972  C CA   . LYS B 2 8  ? -5.041  -3.266  -5.801  1.00 0.00 ? 32  LYS B CA   12 
ATOM 9973  C C    . LYS B 2 8  ? -3.539  -3.491  -5.843  1.00 0.00 ? 32  LYS B C    12 
ATOM 9974  O O    . LYS B 2 8  ? -2.932  -3.600  -6.909  1.00 0.00 ? 32  LYS B O    12 
ATOM 9975  C CB   . LYS B 2 8  ? -5.760  -4.226  -6.726  1.00 0.00 ? 32  LYS B CB   12 
ATOM 9976  C CG   . LYS B 2 8  ? -7.241  -3.923  -6.831  1.00 0.00 ? 32  LYS B CG   12 
ATOM 9977  C CD   . LYS B 2 8  ? -7.984  -5.017  -7.580  1.00 0.00 ? 32  LYS B CD   12 
ATOM 9978  C CE   . LYS B 2 8  ? -9.481  -4.795  -7.542  1.00 0.00 ? 32  LYS B CE   12 
ATOM 9979  N NZ   . LYS B 2 8  ? -10.223 -5.860  -8.270  1.00 0.00 ? 32  LYS B NZ   12 
ATOM 9980  H H    . LYS B 2 8  ? -5.980  -1.774  -6.930  1.00 0.00 ? 32  LYS B H    12 
ATOM 9981  H HA   . LYS B 2 8  ? -5.383  -3.443  -4.793  1.00 0.00 ? 32  LYS B HA   12 
ATOM 9982  H HB2  . LYS B 2 8  ? -5.323  -4.164  -7.708  1.00 0.00 ? 32  LYS B HB2  12 
ATOM 9983  H HB3  . LYS B 2 8  ? -5.644  -5.220  -6.348  1.00 0.00 ? 32  LYS B HB3  12 
ATOM 9984  H HG2  . LYS B 2 8  ? -7.646  -3.832  -5.839  1.00 0.00 ? 32  LYS B HG2  12 
ATOM 9985  H HG3  . LYS B 2 8  ? -7.371  -2.990  -7.351  1.00 0.00 ? 32  LYS B HG3  12 
ATOM 9986  H HD2  . LYS B 2 8  ? -7.663  -5.022  -8.606  1.00 0.00 ? 32  LYS B HD2  12 
ATOM 9987  H HD3  . LYS B 2 8  ? -7.759  -5.971  -7.123  1.00 0.00 ? 32  LYS B HD3  12 
ATOM 9988  H HE2  . LYS B 2 8  ? -9.796  -4.790  -6.513  1.00 0.00 ? 32  LYS B HE2  12 
ATOM 9989  H HE3  . LYS B 2 8  ? -9.703  -3.839  -7.992  1.00 0.00 ? 32  LYS B HE3  12 
ATOM 9990  H HZ1  . LYS B 2 8  ? -10.045 -6.785  -7.828  1.00 0.00 ? 32  LYS B HZ1  12 
ATOM 9991  H HZ2  . LYS B 2 8  ? -9.913  -5.898  -9.263  1.00 0.00 ? 32  LYS B HZ2  12 
ATOM 9992  H HZ3  . LYS B 2 8  ? -11.244 -5.666  -8.244  1.00 0.00 ? 32  LYS B HZ3  12 
ATOM 9993  N N    . LEU B 2 9  ? -2.962  -3.556  -4.657  1.00 0.00 ? 33  LEU B N    12 
ATOM 9994  C CA   . LEU B 2 9  ? -1.545  -3.780  -4.480  1.00 0.00 ? 33  LEU B CA   12 
ATOM 9995  C C    . LEU B 2 9  ? -1.259  -5.230  -4.103  1.00 0.00 ? 33  LEU B C    12 
ATOM 9996  O O    . LEU B 2 9  ? -1.387  -5.618  -2.942  1.00 0.00 ? 33  LEU B O    12 
ATOM 9997  C CB   . LEU B 2 9  ? -1.029  -2.851  -3.414  1.00 0.00 ? 33  LEU B CB   12 
ATOM 9998  C CG   . LEU B 2 9  ? -1.321  -1.370  -3.657  1.00 0.00 ? 33  LEU B CG   12 
ATOM 9999  C CD1  . LEU B 2 9  ? -0.721  -0.511  -2.559  1.00 0.00 ? 33  LEU B CD1  12 
ATOM 10000 C CD2  . LEU B 2 9  ? -0.800  -0.945  -5.021  1.00 0.00 ? 33  LEU B CD2  12 
ATOM 10001 H H    . LEU B 2 9  ? -3.513  -3.424  -3.867  1.00 0.00 ? 33  LEU B H    12 
ATOM 10002 H HA   . LEU B 2 9  ? -1.037  -3.547  -5.393  1.00 0.00 ? 33  LEU B HA   12 
ATOM 10003 H HB2  . LEU B 2 9  ? -1.438  -3.142  -2.464  1.00 0.00 ? 33  LEU B HB2  12 
ATOM 10004 H HB3  . LEU B 2 9  ? 0.021   -2.982  -3.383  1.00 0.00 ? 33  LEU B HB3  12 
ATOM 10005 H HG   . LEU B 2 9  ? -2.387  -1.219  -3.645  1.00 0.00 ? 33  LEU B HG   12 
ATOM 10006 H HD11 . LEU B 2 9  ? -1.479  -0.290  -1.827  1.00 0.00 ? 33  LEU B HD11 12 
ATOM 10007 H HD12 . LEU B 2 9  ? -0.350  0.412   -2.971  1.00 0.00 ? 33  LEU B HD12 12 
ATOM 10008 H HD13 . LEU B 2 9  ? 0.089   -1.046  -2.086  1.00 0.00 ? 33  LEU B HD13 12 
ATOM 10009 H HD21 . LEU B 2 9  ? -1.298  -0.039  -5.333  1.00 0.00 ? 33  LEU B HD21 12 
ATOM 10010 H HD22 . LEU B 2 9  ? -0.993  -1.732  -5.740  1.00 0.00 ? 33  LEU B HD22 12 
ATOM 10011 H HD23 . LEU B 2 9  ? 0.263   -0.768  -4.960  1.00 0.00 ? 33  LEU B HD23 12 
ATOM 10012 N N    . CYS B 2 10 ? -0.872  -6.027  -5.094  1.00 0.00 ? 34  CYS B N    12 
ATOM 10013 C CA   . CYS B 2 10 ? -0.577  -7.438  -4.874  1.00 0.00 ? 34  CYS B CA   12 
ATOM 10014 C C    . CYS B 2 10 ? 0.909   -7.659  -4.642  1.00 0.00 ? 34  CYS B C    12 
ATOM 10015 O O    . CYS B 2 10 ? 1.639   -8.097  -5.532  1.00 0.00 ? 34  CYS B O    12 
ATOM 10016 C CB   . CYS B 2 10 ? -1.051  -8.258  -6.062  1.00 0.00 ? 34  CYS B CB   12 
ATOM 10017 S SG   . CYS B 2 10 ? -1.388  -10.006 -5.681  1.00 0.00 ? 34  CYS B SG   12 
ATOM 10018 H H    . CYS B 2 10 ? -0.787  -5.658  -5.998  1.00 0.00 ? 34  CYS B H    12 
ATOM 10019 H HA   . CYS B 2 10 ? -1.117  -7.755  -3.993  1.00 0.00 ? 34  CYS B HA   12 
ATOM 10020 H HB2  . CYS B 2 10 ? -1.961  -7.823  -6.426  1.00 0.00 ? 34  CYS B HB2  12 
ATOM 10021 H HB3  . CYS B 2 10 ? -0.303  -8.224  -6.839  1.00 0.00 ? 34  CYS B HB3  12 
ATOM 10022 N N    . GLY B 2 11 ? 1.336   -7.356  -3.430  1.00 0.00 ? 35  GLY B N    12 
ATOM 10023 C CA   . GLY B 2 11 ? 2.731   -7.512  -3.051  1.00 0.00 ? 35  GLY B CA   12 
ATOM 10024 C C    . GLY B 2 11 ? 3.648   -6.546  -3.778  1.00 0.00 ? 35  GLY B C    12 
ATOM 10025 O O    . GLY B 2 11 ? 4.126   -5.585  -3.181  1.00 0.00 ? 35  GLY B O    12 
ATOM 10026 H H    . GLY B 2 11 ? 0.686   -7.022  -2.781  1.00 0.00 ? 35  GLY B H    12 
ATOM 10027 H HA2  . GLY B 2 11 ? 2.821   -7.339  -1.990  1.00 0.00 ? 35  GLY B HA2  12 
ATOM 10028 H HA3  . GLY B 2 11 ? 3.045   -8.518  -3.262  1.00 0.00 ? 35  GLY B HA3  12 
ATOM 10029 N N    . HIS B 2 12 ? 3.920   -6.808  -5.057  1.00 0.00 ? 36  HIS B N    12 
ATOM 10030 C CA   . HIS B 2 12 ? 4.776   -5.933  -5.834  1.00 0.00 ? 36  HIS B CA   12 
ATOM 10031 C C    . HIS B 2 12 ? 4.129   -4.567  -6.023  1.00 0.00 ? 36  HIS B C    12 
ATOM 10032 O O    . HIS B 2 12 ? 4.760   -3.550  -5.766  1.00 0.00 ? 36  HIS B O    12 
ATOM 10033 C CB   . HIS B 2 12 ? 5.125   -6.547  -7.182  1.00 0.00 ? 36  HIS B CB   12 
ATOM 10034 C CG   . HIS B 2 12 ? 6.443   -6.065  -7.688  1.00 0.00 ? 36  HIS B CG   12 
ATOM 10035 N ND1  . HIS B 2 12 ? 6.833   -6.130  -9.003  1.00 0.00 ? 36  HIS B ND1  12 
ATOM 10036 C CD2  . HIS B 2 12 ? 7.471   -5.489  -7.012  1.00 0.00 ? 36  HIS B CD2  12 
ATOM 10037 C CE1  . HIS B 2 12 ? 8.059   -5.603  -9.092  1.00 0.00 ? 36  HIS B CE1  12 
ATOM 10038 N NE2  . HIS B 2 12 ? 8.495   -5.199  -7.910  1.00 0.00 ? 36  HIS B NE2  12 
ATOM 10039 H H    . HIS B 2 12 ? 3.564   -7.612  -5.473  1.00 0.00 ? 36  HIS B H    12 
ATOM 10040 H HA   . HIS B 2 12 ? 5.688   -5.797  -5.271  1.00 0.00 ? 36  HIS B HA   12 
ATOM 10041 H HB2  . HIS B 2 12 ? 5.172   -7.621  -7.083  1.00 0.00 ? 36  HIS B HB2  12 
ATOM 10042 H HB3  . HIS B 2 12 ? 4.368   -6.283  -7.904  1.00 0.00 ? 36  HIS B HB3  12 
ATOM 10043 H HD1  . HIS B 2 12 ? 6.307   -6.497  -9.745  1.00 0.00 ? 36  HIS B HD1  12 
ATOM 10044 H HD2  . HIS B 2 12 ? 7.494   -5.278  -5.943  1.00 0.00 ? 36  HIS B HD2  12 
ATOM 10045 H HE1  . HIS B 2 12 ? 8.614   -5.512  -10.011 1.00 0.00 ? 36  HIS B HE1  12 
ATOM 10046 N N    . HIS B 2 13 ? 2.887   -4.529  -6.504  1.00 0.00 ? 37  HIS B N    12 
ATOM 10047 C CA   . HIS B 2 13 ? 2.200   -3.248  -6.638  1.00 0.00 ? 37  HIS B CA   12 
ATOM 10048 C C    . HIS B 2 13 ? 2.222   -2.598  -5.287  1.00 0.00 ? 37  HIS B C    12 
ATOM 10049 O O    . HIS B 2 13 ? 2.360   -1.386  -5.144  1.00 0.00 ? 37  HIS B O    12 
ATOM 10050 C CB   . HIS B 2 13 ? 0.749   -3.422  -7.053  1.00 0.00 ? 37  HIS B CB   12 
ATOM 10051 C CG   . HIS B 2 13 ? 0.575   -3.770  -8.480  1.00 0.00 ? 37  HIS B CG   12 
ATOM 10052 N ND1  . HIS B 2 13 ? -0.388  -3.226  -9.288  1.00 0.00 ? 37  HIS B ND1  12 
ATOM 10053 C CD2  . HIS B 2 13 ? 1.269   -4.639  -9.239  1.00 0.00 ? 37  HIS B CD2  12 
ATOM 10054 C CE1  . HIS B 2 13 ? -0.257  -3.770  -10.498 1.00 0.00 ? 37  HIS B CE1  12 
ATOM 10055 N NE2  . HIS B 2 13 ? 0.739   -4.639  -10.527 1.00 0.00 ? 37  HIS B NE2  12 
ATOM 10056 H H    . HIS B 2 13 ? 2.436   -5.359  -6.767  1.00 0.00 ? 37  HIS B H    12 
ATOM 10057 H HA   . HIS B 2 13 ? 2.726   -2.636  -7.353  1.00 0.00 ? 37  HIS B HA   12 
ATOM 10058 H HB2  . HIS B 2 13 ? 0.308   -4.211  -6.465  1.00 0.00 ? 37  HIS B HB2  12 
ATOM 10059 H HB3  . HIS B 2 13 ? 0.218   -2.498  -6.863  1.00 0.00 ? 37  HIS B HB3  12 
ATOM 10060 H HD1  . HIS B 2 13 ? -1.055  -2.557  -9.025  1.00 0.00 ? 37  HIS B HD1  12 
ATOM 10061 H HD2  . HIS B 2 13 ? 2.102   -5.237  -8.902  1.00 0.00 ? 37  HIS B HD2  12 
ATOM 10062 H HE1  . HIS B 2 13 ? -0.884  -3.528  -11.338 1.00 0.00 ? 37  HIS B HE1  12 
ATOM 10063 N N    . PHE B 2 14 ? 2.077   -3.458  -4.300  1.00 0.00 ? 38  PHE B N    12 
ATOM 10064 C CA   . PHE B 2 14 ? 2.086   -3.055  -2.927  1.00 0.00 ? 38  PHE B CA   12 
ATOM 10065 C C    . PHE B 2 14 ? 3.460   -2.560  -2.552  1.00 0.00 ? 38  PHE B C    12 
ATOM 10066 O O    . PHE B 2 14 ? 3.613   -1.738  -1.657  1.00 0.00 ? 38  PHE B O    12 
ATOM 10067 C CB   . PHE B 2 14 ? 1.637   -4.226  -2.060  1.00 0.00 ? 38  PHE B CB   12 
ATOM 10068 C CG   . PHE B 2 14 ? 1.807   -3.957  -0.615  1.00 0.00 ? 38  PHE B CG   12 
ATOM 10069 C CD1  . PHE B 2 14 ? 1.122   -2.909  -0.051  1.00 0.00 ? 38  PHE B CD1  12 
ATOM 10070 C CD2  . PHE B 2 14 ? 2.656   -4.718  0.164   1.00 0.00 ? 38  PHE B CD2  12 
ATOM 10071 C CE1  . PHE B 2 14 ? 1.274   -2.608  1.283   1.00 0.00 ? 38  PHE B CE1  12 
ATOM 10072 C CE2  . PHE B 2 14 ? 2.822   -4.425  1.505   1.00 0.00 ? 38  PHE B CE2  12 
ATOM 10073 C CZ   . PHE B 2 14 ? 2.129   -3.364  2.066   1.00 0.00 ? 38  PHE B CZ   12 
ATOM 10074 H H    . PHE B 2 14 ? 1.961   -4.407  -4.513  1.00 0.00 ? 38  PHE B H    12 
ATOM 10075 H HA   . PHE B 2 14 ? 1.383   -2.241  -2.817  1.00 0.00 ? 38  PHE B HA   12 
ATOM 10076 H HB2  . PHE B 2 14 ? 0.590   -4.418  -2.240  1.00 0.00 ? 38  PHE B HB2  12 
ATOM 10077 H HB3  . PHE B 2 14 ? 2.203   -5.097  -2.318  1.00 0.00 ? 38  PHE B HB3  12 
ATOM 10078 H HD1  . PHE B 2 14 ? 0.445   -2.327  -0.677  1.00 0.00 ? 38  PHE B HD1  12 
ATOM 10079 H HD2  . PHE B 2 14 ? 3.192   -5.550  -0.284  1.00 0.00 ? 38  PHE B HD2  12 
ATOM 10080 H HE1  . PHE B 2 14 ? 0.733   -1.779  1.709   1.00 0.00 ? 38  PHE B HE1  12 
ATOM 10081 H HE2  . PHE B 2 14 ? 3.485   -5.025  2.113   1.00 0.00 ? 38  PHE B HE2  12 
ATOM 10082 H HZ   . PHE B 2 14 ? 2.256   -3.126  3.113   1.00 0.00 ? 38  PHE B HZ   12 
ATOM 10083 N N    . VAL B 2 15 ? 4.452   -3.077  -3.252  1.00 0.00 ? 39  VAL B N    12 
ATOM 10084 C CA   . VAL B 2 15 ? 5.820   -2.668  -3.049  1.00 0.00 ? 39  VAL B CA   12 
ATOM 10085 C C    . VAL B 2 15 ? 6.007   -1.275  -3.631  1.00 0.00 ? 39  VAL B C    12 
ATOM 10086 O O    . VAL B 2 15 ? 6.231   -0.321  -2.892  1.00 0.00 ? 39  VAL B O    12 
ATOM 10087 C CB   . VAL B 2 15 ? 6.802   -3.680  -3.689  1.00 0.00 ? 39  VAL B CB   12 
ATOM 10088 C CG1  . VAL B 2 15 ? 8.037   -2.997  -4.252  1.00 0.00 ? 39  VAL B CG1  12 
ATOM 10089 C CG2  . VAL B 2 15 ? 7.200   -4.742  -2.679  1.00 0.00 ? 39  VAL B CG2  12 
ATOM 10090 H H    . VAL B 2 15 ? 4.253   -3.760  -3.924  1.00 0.00 ? 39  VAL B H    12 
ATOM 10091 H HA   . VAL B 2 15 ? 6.003   -2.626  -1.986  1.00 0.00 ? 39  VAL B HA   12 
ATOM 10092 H HB   . VAL B 2 15 ? 6.295   -4.173  -4.504  1.00 0.00 ? 39  VAL B HB   12 
ATOM 10093 H HG11 . VAL B 2 15 ? 7.985   -2.988  -5.330  1.00 0.00 ? 39  VAL B HG11 12 
ATOM 10094 H HG12 . VAL B 2 15 ? 8.914   -3.534  -3.936  1.00 0.00 ? 39  VAL B HG12 12 
ATOM 10095 H HG13 . VAL B 2 15 ? 8.091   -1.983  -3.886  1.00 0.00 ? 39  VAL B HG13 12 
ATOM 10096 H HG21 . VAL B 2 15 ? 6.354   -4.981  -2.052  1.00 0.00 ? 39  VAL B HG21 12 
ATOM 10097 H HG22 . VAL B 2 15 ? 8.009   -4.371  -2.069  1.00 0.00 ? 39  VAL B HG22 12 
ATOM 10098 H HG23 . VAL B 2 15 ? 7.523   -5.631  -3.199  1.00 0.00 ? 39  VAL B HG23 12 
ATOM 10099 N N    . ARG B 2 16 ? 5.902   -1.161  -4.956  1.00 0.00 ? 40  ARG B N    12 
ATOM 10100 C CA   . ARG B 2 16 ? 6.037   0.119   -5.620  1.00 0.00 ? 40  ARG B CA   12 
ATOM 10101 C C    . ARG B 2 16 ? 5.178   1.163   -4.937  1.00 0.00 ? 40  ARG B C    12 
ATOM 10102 O O    . ARG B 2 16 ? 5.708   2.142   -4.449  1.00 0.00 ? 40  ARG B O    12 
ATOM 10103 C CB   . ARG B 2 16 ? 5.660   0.004   -7.090  1.00 0.00 ? 40  ARG B CB   12 
ATOM 10104 C CG   . ARG B 2 16 ? 6.592   -0.899  -7.873  1.00 0.00 ? 40  ARG B CG   12 
ATOM 10105 C CD   . ARG B 2 16 ? 5.930   -2.208  -8.236  1.00 0.00 ? 40  ARG B CD   12 
ATOM 10106 N NE   . ARG B 2 16 ? 6.618   -2.877  -9.335  1.00 0.00 ? 40  ARG B NE   12 
ATOM 10107 C CZ   . ARG B 2 16 ? 6.121   -2.978  -10.565 1.00 0.00 ? 40  ARG B CZ   12 
ATOM 10108 N NH1  . ARG B 2 16 ? 4.936   -2.454  -10.852 1.00 0.00 ? 40  ARG B NH1  12 
ATOM 10109 N NH2  . ARG B 2 16 ? 6.812   -3.601  -11.510 1.00 0.00 ? 40  ARG B NH2  12 
ATOM 10110 H H    . ARG B 2 16 ? 5.749   -1.961  -5.502  1.00 0.00 ? 40  ARG B H    12 
ATOM 10111 H HA   . ARG B 2 16 ? 7.073   0.431   -5.542  1.00 0.00 ? 40  ARG B HA   12 
ATOM 10112 H HB2  . ARG B 2 16 ? 4.658   -0.394  -7.165  1.00 0.00 ? 40  ARG B HB2  12 
ATOM 10113 H HB3  . ARG B 2 16 ? 5.683   0.987   -7.537  1.00 0.00 ? 40  ARG B HB3  12 
ATOM 10114 H HG2  . ARG B 2 16 ? 6.880   -0.402  -8.773  1.00 0.00 ? 40  ARG B HG2  12 
ATOM 10115 H HG3  . ARG B 2 16 ? 7.466   -1.102  -7.275  1.00 0.00 ? 40  ARG B HG3  12 
ATOM 10116 H HD2  . ARG B 2 16 ? 5.951   -2.847  -7.372  1.00 0.00 ? 40  ARG B HD2  12 
ATOM 10117 H HD3  . ARG B 2 16 ? 4.906   -2.018  -8.522  1.00 0.00 ? 40  ARG B HD3  12 
ATOM 10118 H HE   . ARG B 2 16 ? 7.495   -3.270  -9.149  1.00 0.00 ? 40  ARG B HE   12 
ATOM 10119 H HH11 . ARG B 2 16 ? 4.414   -1.980  -10.143 1.00 0.00 ? 40  ARG B HH11 12 
ATOM 10120 H HH12 . ARG B 2 16 ? 4.566   -2.532  -11.778 1.00 0.00 ? 40  ARG B HH12 12 
ATOM 10121 H HH21 . ARG B 2 16 ? 7.705   -3.995  -11.298 1.00 0.00 ? 40  ARG B HH21 12 
ATOM 10122 H HH22 . ARG B 2 16 ? 6.437   -3.676  -12.434 1.00 0.00 ? 40  ARG B HH22 12 
ATOM 10123 N N    . ALA B 2 17 ? 3.859   0.957   -4.872  1.00 0.00 ? 41  ALA B N    12 
ATOM 10124 C CA   . ALA B 2 17 ? 3.004   1.934   -4.227  1.00 0.00 ? 41  ALA B CA   12 
ATOM 10125 C C    . ALA B 2 17 ? 3.584   2.312   -2.872  1.00 0.00 ? 41  ALA B C    12 
ATOM 10126 O O    . ALA B 2 17 ? 3.662   3.486   -2.542  1.00 0.00 ? 41  ALA B O    12 
ATOM 10127 C CB   . ALA B 2 17 ? 1.576   1.411   -4.089  1.00 0.00 ? 41  ALA B CB   12 
ATOM 10128 H H    . ALA B 2 17 ? 3.461   0.140   -5.243  1.00 0.00 ? 41  ALA B H    12 
ATOM 10129 H HA   . ALA B 2 17 ? 2.986   2.826   -4.855  1.00 0.00 ? 41  ALA B HA   12 
ATOM 10130 H HB1  . ALA B 2 17 ? 0.902   2.244   -3.945  1.00 0.00 ? 41  ALA B HB1  12 
ATOM 10131 H HB2  . ALA B 2 17 ? 1.502   0.740   -3.234  1.00 0.00 ? 41  ALA B HB2  12 
ATOM 10132 H HB3  . ALA B 2 17 ? 1.301   0.879   -4.988  1.00 0.00 ? 41  ALA B HB3  12 
ATOM 10133 N N    . LEU B 2 18 ? 4.042   1.316   -2.111  1.00 0.00 ? 42  LEU B N    12 
ATOM 10134 C CA   . LEU B 2 18 ? 4.616   1.573   -0.793  1.00 0.00 ? 42  LEU B CA   12 
ATOM 10135 C C    . LEU B 2 18 ? 5.715   2.623   -0.890  1.00 0.00 ? 42  LEU B C    12 
ATOM 10136 O O    . LEU B 2 18 ? 5.814   3.515   -0.052  1.00 0.00 ? 42  LEU B O    12 
ATOM 10137 C CB   . LEU B 2 18 ? 5.192   0.284   -0.202  1.00 0.00 ? 42  LEU B CB   12 
ATOM 10138 C CG   . LEU B 2 18 ? 4.858   0.024   1.267   1.00 0.00 ? 42  LEU B CG   12 
ATOM 10139 C CD1  . LEU B 2 18 ? 5.539   -1.250  1.743   1.00 0.00 ? 42  LEU B CD1  12 
ATOM 10140 C CD2  . LEU B 2 18 ? 5.280   1.205   2.115   1.00 0.00 ? 42  LEU B CD2  12 
ATOM 10141 H H    . LEU B 2 18 ? 4.002   0.391   -2.445  1.00 0.00 ? 42  LEU B H    12 
ATOM 10142 H HA   . LEU B 2 18 ? 3.823   1.942   -0.154  1.00 0.00 ? 42  LEU B HA   12 
ATOM 10143 H HB2  . LEU B 2 18 ? 4.832   -0.544  -0.782  1.00 0.00 ? 42  LEU B HB2  12 
ATOM 10144 H HB3  . LEU B 2 18 ? 6.267   0.323   -0.298  1.00 0.00 ? 42  LEU B HB3  12 
ATOM 10145 H HG   . LEU B 2 18 ? 3.790   -0.107  1.371   1.00 0.00 ? 42  LEU B HG   12 
ATOM 10146 H HD11 . LEU B 2 18 ? 4.963   -2.107  1.430   1.00 0.00 ? 42  LEU B HD11 12 
ATOM 10147 H HD12 . LEU B 2 18 ? 5.613   -1.236  2.820   1.00 0.00 ? 42  LEU B HD12 12 
ATOM 10148 H HD13 . LEU B 2 18 ? 6.529   -1.308  1.318   1.00 0.00 ? 42  LEU B HD13 12 
ATOM 10149 H HD21 . LEU B 2 18 ? 4.461   1.906   2.192   1.00 0.00 ? 42  LEU B HD21 12 
ATOM 10150 H HD22 . LEU B 2 18 ? 6.123   1.687   1.647   1.00 0.00 ? 42  LEU B HD22 12 
ATOM 10151 H HD23 . LEU B 2 18 ? 5.559   0.863   3.101   1.00 0.00 ? 42  LEU B HD23 12 
ATOM 10152 N N    . VAL B 2 19 ? 6.541   2.486   -1.917  1.00 0.00 ? 43  VAL B N    12 
ATOM 10153 C CA   . VAL B 2 19 ? 7.641   3.417   -2.168  1.00 0.00 ? 43  VAL B CA   12 
ATOM 10154 C C    . VAL B 2 19 ? 7.104   4.722   -2.719  1.00 0.00 ? 43  VAL B C    12 
ATOM 10155 O O    . VAL B 2 19 ? 7.331   5.788   -2.144  1.00 0.00 ? 43  VAL B O    12 
ATOM 10156 C CB   . VAL B 2 19 ? 8.672   2.828   -3.163  1.00 0.00 ? 43  VAL B CB   12 
ATOM 10157 C CG1  . VAL B 2 19 ? 10.083  3.172   -2.741  1.00 0.00 ? 43  VAL B CG1  12 
ATOM 10158 C CG2  . VAL B 2 19 ? 8.540   1.328   -3.257  1.00 0.00 ? 43  VAL B CG2  12 
ATOM 10159 H H    . VAL B 2 19 ? 6.410   1.732   -2.517  1.00 0.00 ? 43  VAL B H    12 
ATOM 10160 H HA   . VAL B 2 19 ? 8.129   3.619   -1.227  1.00 0.00 ? 43  VAL B HA   12 
ATOM 10161 H HB   . VAL B 2 19 ? 8.486   3.238   -4.147  1.00 0.00 ? 43  VAL B HB   12 
ATOM 10162 H HG11 . VAL B 2 19 ? 10.696  3.329   -3.617  1.00 0.00 ? 43  VAL B HG11 12 
ATOM 10163 H HG12 . VAL B 2 19 ? 10.481  2.344   -2.164  1.00 0.00 ? 43  VAL B HG12 12 
ATOM 10164 H HG13 . VAL B 2 19 ? 10.075  4.066   -2.135  1.00 0.00 ? 43  VAL B HG13 12 
ATOM 10165 H HG21 . VAL B 2 19 ? 7.571   1.071   -3.652  1.00 0.00 ? 43  VAL B HG21 12 
ATOM 10166 H HG22 . VAL B 2 19 ? 8.660   0.906   -2.269  1.00 0.00 ? 43  VAL B HG22 12 
ATOM 10167 H HG23 . VAL B 2 19 ? 9.310   0.941   -3.909  1.00 0.00 ? 43  VAL B HG23 12 
ATOM 10168 N N    . ARG B 2 20 ? 6.429   4.620   -3.856  1.00 0.00 ? 44  ARG B N    12 
ATOM 10169 C CA   . ARG B 2 20 ? 5.777   5.758   -4.492  1.00 0.00 ? 44  ARG B CA   12 
ATOM 10170 C C    . ARG B 2 20 ? 5.277   6.694   -3.408  1.00 0.00 ? 44  ARG B C    12 
ATOM 10171 O O    . ARG B 2 20 ? 5.360   7.918   -3.503  1.00 0.00 ? 44  ARG B O    12 
ATOM 10172 C CB   . ARG B 2 20 ? 4.592   5.247   -5.314  1.00 0.00 ? 44  ARG B CB   12 
ATOM 10173 C CG   . ARG B 2 20 ? 4.976   4.230   -6.355  1.00 0.00 ? 44  ARG B CG   12 
ATOM 10174 C CD   . ARG B 2 20 ? 4.728   4.756   -7.747  1.00 0.00 ? 44  ARG B CD   12 
ATOM 10175 N NE   . ARG B 2 20 ? 3.368   4.486   -8.202  1.00 0.00 ? 44  ARG B NE   12 
ATOM 10176 C CZ   . ARG B 2 20 ? 2.957   4.681   -9.452  1.00 0.00 ? 44  ARG B CZ   12 
ATOM 10177 N NH1  . ARG B 2 20 ? 3.796   5.154   -10.364 1.00 0.00 ? 44  ARG B NH1  12 
ATOM 10178 N NH2  . ARG B 2 20 ? 1.705   4.401   -9.792  1.00 0.00 ? 44  ARG B NH2  12 
ATOM 10179 H H    . ARG B 2 20 ? 6.387   3.748   -4.292  1.00 0.00 ? 44  ARG B H    12 
ATOM 10180 H HA   . ARG B 2 20 ? 6.482   6.263   -5.134  1.00 0.00 ? 44  ARG B HA   12 
ATOM 10181 H HB2  . ARG B 2 20 ? 3.886   4.782   -4.652  1.00 0.00 ? 44  ARG B HB2  12 
ATOM 10182 H HB3  . ARG B 2 20 ? 4.112   6.071   -5.806  1.00 0.00 ? 44  ARG B HB3  12 
ATOM 10183 H HG2  . ARG B 2 20 ? 6.025   3.996   -6.249  1.00 0.00 ? 44  ARG B HG2  12 
ATOM 10184 H HG3  . ARG B 2 20 ? 4.386   3.338   -6.205  1.00 0.00 ? 44  ARG B HG3  12 
ATOM 10185 H HD2  . ARG B 2 20 ? 4.896   5.823   -7.752  1.00 0.00 ? 44  ARG B HD2  12 
ATOM 10186 H HD3  . ARG B 2 20 ? 5.421   4.281   -8.404  1.00 0.00 ? 44  ARG B HD3  12 
ATOM 10187 H HE   . ARG B 2 20 ? 2.728   4.139   -7.544  1.00 0.00 ? 44  ARG B HE   12 
ATOM 10188 H HH11 . ARG B 2 20 ? 4.740   5.366   -10.113 1.00 0.00 ? 44  ARG B HH11 12 
ATOM 10189 H HH12 . ARG B 2 20 ? 3.484   5.299   -11.303 1.00 0.00 ? 44  ARG B HH12 12 
ATOM 10190 H HH21 . ARG B 2 20 ? 1.069   4.045   -9.107  1.00 0.00 ? 44  ARG B HH21 12 
ATOM 10191 H HH22 . ARG B 2 20 ? 1.397   4.547   -10.732 1.00 0.00 ? 44  ARG B HH22 12 
ATOM 10192 N N    . VAL B 2 21 ? 4.754   6.056   -2.376  1.00 0.00 ? 45  VAL B N    12 
ATOM 10193 C CA   . VAL B 2 21 ? 4.225   6.716   -1.205  1.00 0.00 ? 45  VAL B CA   12 
ATOM 10194 C C    . VAL B 2 21 ? 5.333   7.223   -0.295  1.00 0.00 ? 45  VAL B C    12 
ATOM 10195 O O    . VAL B 2 21 ? 5.516   8.425   -0.105  1.00 0.00 ? 45  VAL B O    12 
ATOM 10196 C CB   . VAL B 2 21 ? 3.388   5.717   -0.393  1.00 0.00 ? 45  VAL B CB   12 
ATOM 10197 C CG1  . VAL B 2 21 ? 2.932   6.317   0.914   1.00 0.00 ? 45  VAL B CG1  12 
ATOM 10198 C CG2  . VAL B 2 21 ? 2.209   5.230   -1.194  1.00 0.00 ? 45  VAL B CG2  12 
ATOM 10199 H H    . VAL B 2 21 ? 4.731   5.078   -2.403  1.00 0.00 ? 45  VAL B H    12 
ATOM 10200 H HA   . VAL B 2 21 ? 3.594   7.533   -1.511  1.00 0.00 ? 45  VAL B HA   12 
ATOM 10201 H HB   . VAL B 2 21 ? 4.008   4.860   -0.164  1.00 0.00 ? 45  VAL B HB   12 
ATOM 10202 H HG11 . VAL B 2 21 ? 3.718   6.931   1.329   1.00 0.00 ? 45  VAL B HG11 12 
ATOM 10203 H HG12 . VAL B 2 21 ? 2.701   5.522   1.602   1.00 0.00 ? 45  VAL B HG12 12 
ATOM 10204 H HG13 . VAL B 2 21 ? 2.052   6.919   0.748   1.00 0.00 ? 45  VAL B HG13 12 
ATOM 10205 H HG21 . VAL B 2 21 ? 1.313   5.694   -0.829  1.00 0.00 ? 45  VAL B HG21 12 
ATOM 10206 H HG22 . VAL B 2 21 ? 2.132   4.159   -1.090  1.00 0.00 ? 45  VAL B HG22 12 
ATOM 10207 H HG23 . VAL B 2 21 ? 2.354   5.480   -2.235  1.00 0.00 ? 45  VAL B HG23 12 
ATOM 10208 N N    . CYS B 2 22 ? 6.063   6.265   0.259   1.00 0.00 ? 46  CYS B N    12 
ATOM 10209 C CA   . CYS B 2 22 ? 7.118   6.532   1.216   1.00 0.00 ? 46  CYS B CA   12 
ATOM 10210 C C    . CYS B 2 22 ? 8.362   5.715   0.921   1.00 0.00 ? 46  CYS B C    12 
ATOM 10211 O O    . CYS B 2 22 ? 9.434   6.257   0.651   1.00 0.00 ? 46  CYS B O    12 
ATOM 10212 C CB   . CYS B 2 22 ? 6.586   6.145   2.585   1.00 0.00 ? 46  CYS B CB   12 
ATOM 10213 S SG   . CYS B 2 22 ? 7.619   6.640   3.997   1.00 0.00 ? 46  CYS B SG   12 
ATOM 10214 H H    . CYS B 2 22 ? 5.887   5.338   0.004   1.00 0.00 ? 46  CYS B H    12 
ATOM 10215 H HA   . CYS B 2 22 ? 7.352   7.583   1.203   1.00 0.00 ? 46  CYS B HA   12 
ATOM 10216 H HB2  . CYS B 2 22 ? 5.619   6.582   2.709   1.00 0.00 ? 46  CYS B HB2  12 
ATOM 10217 H HB3  . CYS B 2 22 ? 6.484   5.069   2.619   1.00 0.00 ? 46  CYS B HB3  12 
ATOM 10218 N N    . GLY B 2 23 ? 8.204   4.399   0.979   1.00 0.00 ? 47  GLY B N    12 
ATOM 10219 C CA   . GLY B 2 23 ? 9.324   3.508   0.741   1.00 0.00 ? 47  GLY B CA   12 
ATOM 10220 C C    . GLY B 2 23 ? 9.625   2.603   1.916   1.00 0.00 ? 47  GLY B C    12 
ATOM 10221 O O    . GLY B 2 23 ? 10.078  3.064   2.964   1.00 0.00 ? 47  GLY B O    12 
ATOM 10222 H H    . GLY B 2 23 ? 7.304   4.031   1.162   1.00 0.00 ? 47  GLY B H    12 
ATOM 10223 H HA2  . GLY B 2 23 ? 9.106   2.893   -0.117  1.00 0.00 ? 47  GLY B HA2  12 
ATOM 10224 H HA3  . GLY B 2 23 ? 10.201  4.102   0.528   1.00 0.00 ? 47  GLY B HA3  12 
ATOM 10225 N N    . GLY B 2 24 ? 9.360   1.313   1.740   1.00 0.00 ? 48  GLY B N    12 
ATOM 10226 C CA   . GLY B 2 24 ? 9.626   0.346   2.787   1.00 0.00 ? 48  GLY B CA   12 
ATOM 10227 C C    . GLY B 2 24 ? 11.083  0.346   3.201   1.00 0.00 ? 48  GLY B C    12 
ATOM 10228 O O    . GLY B 2 24 ? 11.516  1.170   4.005   1.00 0.00 ? 48  GLY B O    12 
ATOM 10229 H H    . GLY B 2 24 ? 8.979   1.015   0.888   1.00 0.00 ? 48  GLY B H    12 
ATOM 10230 H HA2  . GLY B 2 24 ? 9.024   0.559   3.633   1.00 0.00 ? 48  GLY B HA2  12 
ATOM 10231 H HA3  . GLY B 2 24 ? 9.368   -0.635  2.424   1.00 0.00 ? 48  GLY B HA3  12 
ATOM 10232 N N    . PRO B 2 25 ? 11.854  -0.582  2.649   1.00 0.00 ? 49  PRO B N    12 
ATOM 10233 C CA   . PRO B 2 25 ? 13.281  -0.712  2.911   1.00 0.00 ? 49  PRO B CA   12 
ATOM 10234 C C    . PRO B 2 25 ? 14.072  0.363   2.173   1.00 0.00 ? 49  PRO B C    12 
ATOM 10235 O O    . PRO B 2 25 ? 13.512  1.388   1.790   1.00 0.00 ? 49  PRO B O    12 
ATOM 10236 C CB   . PRO B 2 25 ? 13.593  -2.104  2.362   1.00 0.00 ? 49  PRO B CB   12 
ATOM 10237 C CG   . PRO B 2 25 ? 12.615  -2.297  1.261   1.00 0.00 ? 49  PRO B CG   12 
ATOM 10238 C CD   . PRO B 2 25 ? 11.370  -1.578  1.700   1.00 0.00 ? 49  PRO B CD   12 
ATOM 10239 H HA   . PRO B 2 25 ? 13.501  -0.671  3.968   1.00 0.00 ? 49  PRO B HA   12 
ATOM 10240 H HB2  . PRO B 2 25 ? 14.611  -2.140  2.007   1.00 0.00 ? 49  PRO B HB2  12 
ATOM 10241 H HB3  . PRO B 2 25 ? 13.445  -2.833  3.137   1.00 0.00 ? 49  PRO B HB3  12 
ATOM 10242 H HG2  . PRO B 2 25 ? 12.999  -1.865  0.347   1.00 0.00 ? 49  PRO B HG2  12 
ATOM 10243 H HG3  . PRO B 2 25 ? 12.414  -3.349  1.126   1.00 0.00 ? 49  PRO B HG3  12 
ATOM 10244 H HD2  . PRO B 2 25 ? 10.905  -1.093  0.880   1.00 0.00 ? 49  PRO B HD2  12 
ATOM 10245 H HD3  . PRO B 2 25 ? 10.671  -2.243  2.172   1.00 0.00 ? 49  PRO B HD3  12 
ATOM 10246 N N    . ARG B 2 26 ? 15.369  0.149   2.000   1.00 0.00 ? 50  ARG B N    12 
ATOM 10247 C CA   . ARG B 2 26 ? 16.202  1.110   1.296   1.00 0.00 ? 50  ARG B CA   12 
ATOM 10248 C C    . ARG B 2 26 ? 16.185  0.878   -0.212  1.00 0.00 ? 50  ARG B C    12 
ATOM 10249 O O    . ARG B 2 26 ? 16.533  1.768   -0.989  1.00 0.00 ? 50  ARG B O    12 
ATOM 10250 C CB   . ARG B 2 26 ? 17.628  1.046   1.797   1.00 0.00 ? 50  ARG B CB   12 
ATOM 10251 C CG   . ARG B 2 26 ? 18.179  -0.363  1.842   1.00 0.00 ? 50  ARG B CG   12 
ATOM 10252 C CD   . ARG B 2 26 ? 18.594  -0.757  3.250   1.00 0.00 ? 50  ARG B CD   12 
ATOM 10253 N NE   . ARG B 2 26 ? 17.457  -0.791  4.166   1.00 0.00 ? 50  ARG B NE   12 
ATOM 10254 C CZ   . ARG B 2 26 ? 17.500  -0.339  5.414   1.00 0.00 ? 50  ARG B CZ   12 
ATOM 10255 N NH1  . ARG B 2 26 ? 18.620  0.186   5.895   1.00 0.00 ? 50  ARG B NH1  12 
ATOM 10256 N NH2  . ARG B 2 26 ? 16.422  -0.409  6.183   1.00 0.00 ? 50  ARG B NH2  12 
ATOM 10257 H H    . ARG B 2 26 ? 15.778  -0.666  2.352   1.00 0.00 ? 50  ARG B H    12 
ATOM 10258 H HA   . ARG B 2 26 ? 15.812  2.088   1.498   1.00 0.00 ? 50  ARG B HA   12 
ATOM 10259 H HB2  . ARG B 2 26 ? 18.235  1.627   1.133   1.00 0.00 ? 50  ARG B HB2  12 
ATOM 10260 H HB3  . ARG B 2 26 ? 17.678  1.468   2.791   1.00 0.00 ? 50  ARG B HB3  12 
ATOM 10261 H HG2  . ARG B 2 26 ? 17.408  -1.035  1.501   1.00 0.00 ? 50  ARG B HG2  12 
ATOM 10262 H HG3  . ARG B 2 26 ? 19.037  -0.429  1.188   1.00 0.00 ? 50  ARG B HG3  12 
ATOM 10263 H HD2  . ARG B 2 26 ? 19.045  -1.738  3.216   1.00 0.00 ? 50  ARG B HD2  12 
ATOM 10264 H HD3  . ARG B 2 26 ? 19.315  -0.041  3.614   1.00 0.00 ? 50  ARG B HD3  12 
ATOM 10265 H HE   . ARG B 2 26 ? 16.617  -1.172  3.831   1.00 0.00 ? 50  ARG B HE   12 
ATOM 10266 H HH11 . ARG B 2 26 ? 19.433  0.242   5.318   1.00 0.00 ? 50  ARG B HH11 12 
ATOM 10267 H HH12 . ARG B 2 26 ? 18.649  0.525   6.835   1.00 0.00 ? 50  ARG B HH12 12 
ATOM 10268 H HH21 . ARG B 2 26 ? 15.575  -0.802  5.824   1.00 0.00 ? 50  ARG B HH21 12 
ATOM 10269 H HH22 . ARG B 2 26 ? 16.456  -0.069  7.123   1.00 0.00 ? 50  ARG B HH22 12 
ATOM 10270 N N    . TRP B 2 27 ? 15.779  -0.324  -0.617  1.00 0.00 ? 51  TRP B N    12 
ATOM 10271 C CA   . TRP B 2 27 ? 15.717  -0.691  -2.019  1.00 0.00 ? 51  TRP B CA   12 
ATOM 10272 C C    . TRP B 2 27 ? 17.093  -0.657  -2.677  1.00 0.00 ? 51  TRP B C    12 
ATOM 10273 O O    . TRP B 2 27 ? 17.213  -0.828  -3.891  1.00 0.00 ? 51  TRP B O    12 
ATOM 10274 C CB   . TRP B 2 27 ? 14.762  0.224   -2.750  1.00 0.00 ? 51  TRP B CB   12 
ATOM 10275 C CG   . TRP B 2 27 ? 13.496  0.421   -2.004  1.00 0.00 ? 51  TRP B CG   12 
ATOM 10276 C CD1  . TRP B 2 27 ? 13.232  1.342   -1.046  1.00 0.00 ? 51  TRP B CD1  12 
ATOM 10277 C CD2  . TRP B 2 27 ? 12.334  -0.357  -2.149  1.00 0.00 ? 51  TRP B CD2  12 
ATOM 10278 N NE1  . TRP B 2 27 ? 11.948  1.183   -0.586  1.00 0.00 ? 51  TRP B NE1  12 
ATOM 10279 C CE2  . TRP B 2 27 ? 11.374  0.141   -1.260  1.00 0.00 ? 51  TRP B CE2  12 
ATOM 10280 C CE3  . TRP B 2 27 ? 12.020  -1.425  -2.961  1.00 0.00 ? 51  TRP B CE3  12 
ATOM 10281 C CZ2  . TRP B 2 27 ? 10.110  -0.413  -1.163  1.00 0.00 ? 51  TRP B CZ2  12 
ATOM 10282 C CZ3  . TRP B 2 27 ? 10.763  -1.972  -2.867  1.00 0.00 ? 51  TRP B CZ3  12 
ATOM 10283 C CH2  . TRP B 2 27 ? 9.819   -1.458  -1.965  1.00 0.00 ? 51  TRP B CH2  12 
ATOM 10284 H H    . TRP B 2 27 ? 15.491  -0.975  0.045   1.00 0.00 ? 51  TRP B H    12 
ATOM 10285 H HA   . TRP B 2 27 ? 15.323  -1.694  -2.070  1.00 0.00 ? 51  TRP B HA   12 
ATOM 10286 H HB2  . TRP B 2 27 ? 15.216  1.179   -2.911  1.00 0.00 ? 51  TRP B HB2  12 
ATOM 10287 H HB3  . TRP B 2 27 ? 14.521  -0.222  -3.691  1.00 0.00 ? 51  TRP B HB3  12 
ATOM 10288 H HD1  . TRP B 2 27 ? 13.940  2.072   -0.704  1.00 0.00 ? 51  TRP B HD1  12 
ATOM 10289 H HE1  . TRP B 2 27 ? 11.515  1.729   0.105   1.00 0.00 ? 51  TRP B HE1  12 
ATOM 10290 H HE3  . TRP B 2 27 ? 12.745  -1.819  -3.658  1.00 0.00 ? 51  TRP B HE3  12 
ATOM 10291 H HZ2  . TRP B 2 27 ? 9.366   -0.044  -0.486  1.00 0.00 ? 51  TRP B HZ2  12 
ATOM 10292 H HZ3  . TRP B 2 27 ? 10.501  -2.809  -3.487  1.00 0.00 ? 51  TRP B HZ3  12 
ATOM 10293 H HH2  . TRP B 2 27 ? 8.839   -1.893  -1.917  1.00 0.00 ? 51  TRP B HH2  12 
ATOM 10294 N N    . SER B 2 28 ? 18.127  -0.439  -1.872  1.00 0.00 ? 52  SER B N    12 
ATOM 10295 C CA   . SER B 2 28 ? 19.492  -0.377  -2.379  1.00 0.00 ? 52  SER B CA   12 
ATOM 10296 C C    . SER B 2 28 ? 20.321  -1.537  -1.849  1.00 0.00 ? 52  SER B C    12 
ATOM 10297 O O    . SER B 2 28 ? 20.621  -1.606  -0.657  1.00 0.00 ? 52  SER B O    12 
ATOM 10298 C CB   . SER B 2 28 ? 20.150  0.943   -1.985  1.00 0.00 ? 52  SER B CB   12 
ATOM 10299 O OG   . SER B 2 28 ? 19.272  2.035   -2.198  1.00 0.00 ? 52  SER B OG   12 
ATOM 10300 H H    . SER B 2 28 ? 17.970  -0.315  -0.913  1.00 0.00 ? 52  SER B H    12 
ATOM 10301 H HA   . SER B 2 28 ? 19.456  -0.445  -3.456  1.00 0.00 ? 52  SER B HA   12 
ATOM 10302 H HB2  . SER B 2 28 ? 20.419  0.907   -0.941  1.00 0.00 ? 52  SER B HB2  12 
ATOM 10303 H HB3  . SER B 2 28 ? 21.039  1.091   -2.580  1.00 0.00 ? 52  SER B HB3  12 
ATOM 10304 H HG   . SER B 2 28 ? 19.770  2.855   -2.176  1.00 0.00 ? 52  SER B HG   12 
ATOM 10305 N N    . THR B 2 29 ? 20.699  -2.434  -2.749  1.00 0.00 ? 53  THR B N    12 
ATOM 10306 C CA   . THR B 2 29 ? 21.500  -3.596  -2.392  1.00 0.00 ? 53  THR B CA   12 
ATOM 10307 C C    . THR B 2 29 ? 22.283  -4.106  -3.592  1.00 0.00 ? 53  THR B C    12 
ATOM 10308 O O    . THR B 2 29 ? 21.880  -5.063  -4.254  1.00 0.00 ? 53  THR B O    12 
ATOM 10309 C CB   . THR B 2 29 ? 20.651  -4.753  -1.850  1.00 0.00 ? 53  THR B CB   12 
ATOM 10310 O OG1  . THR B 2 29 ? 19.527  -4.986  -2.708  1.00 0.00 ? 53  THR B OG1  12 
ATOM 10311 C CG2  . THR B 2 29 ? 20.171  -4.477  -0.432  1.00 0.00 ? 53  THR B CG2  12 
ATOM 10312 H H    . THR B 2 29 ? 20.431  -2.310  -3.683  1.00 0.00 ? 53  THR B H    12 
ATOM 10313 H HA   . THR B 2 29 ? 22.195  -3.295  -1.621  1.00 0.00 ? 53  THR B HA   12 
ATOM 10314 H HB   . THR B 2 29 ? 21.272  -5.634  -1.838  1.00 0.00 ? 53  THR B HB   12 
ATOM 10315 H HG1  . THR B 2 29 ? 19.809  -4.939  -3.625  1.00 0.00 ? 53  THR B HG1  12 
ATOM 10316 H HG21 . THR B 2 29 ? 19.568  -3.581  -0.423  1.00 0.00 ? 53  THR B HG21 12 
ATOM 10317 H HG22 . THR B 2 29 ? 21.024  -4.343  0.217   1.00 0.00 ? 53  THR B HG22 12 
ATOM 10318 H HG23 . THR B 2 29 ? 19.581  -5.310  -0.082  1.00 0.00 ? 53  THR B HG23 12 
ATOM 10319 N N    . GLU B 2 30 ? 23.407  -3.458  -3.848  1.00 0.00 ? 54  GLU B N    12 
ATOM 10320 C CA   . GLU B 2 30 ? 24.280  -3.802  -4.944  1.00 0.00 ? 54  GLU B CA   12 
ATOM 10321 C C    . GLU B 2 30 ? 23.501  -4.034  -6.231  1.00 0.00 ? 54  GLU B C    12 
ATOM 10322 O O    . GLU B 2 30 ? 22.361  -3.595  -6.379  1.00 0.00 ? 54  GLU B O    12 
ATOM 10323 C CB   . GLU B 2 30 ? 25.096  -5.041  -4.584  1.00 0.00 ? 54  GLU B CB   12 
ATOM 10324 C CG   . GLU B 2 30 ? 25.413  -5.157  -3.100  1.00 0.00 ? 54  GLU B CG   12 
ATOM 10325 C CD   . GLU B 2 30 ? 26.198  -3.970  -2.575  1.00 0.00 ? 54  GLU B CD   12 
ATOM 10326 O OE1  . GLU B 2 30 ? 27.441  -3.984  -2.689  1.00 0.00 ? 54  GLU B OE1  12 
ATOM 10327 O OE2  . GLU B 2 30 ? 25.570  -3.028  -2.050  1.00 0.00 ? 54  GLU B OE2  12 
ATOM 10328 H H    . GLU B 2 30 ? 23.667  -2.737  -3.269  1.00 0.00 ? 54  GLU B H    12 
ATOM 10329 H HA   . GLU B 2 30 ? 24.957  -2.975  -5.096  1.00 0.00 ? 54  GLU B HA   12 
ATOM 10330 H HB2  . GLU B 2 30 ? 24.551  -5.921  -4.886  1.00 0.00 ? 54  GLU B HB2  12 
ATOM 10331 H HB3  . GLU B 2 30 ? 26.026  -4.999  -5.121  1.00 0.00 ? 54  GLU B HB3  12 
ATOM 10332 H HG2  . GLU B 2 30 ? 24.486  -5.225  -2.552  1.00 0.00 ? 54  GLU B HG2  12 
ATOM 10333 H HG3  . GLU B 2 30 ? 25.991  -6.054  -2.938  1.00 0.00 ? 54  GLU B HG3  12 
ATOM 10334 N N    . ALA B 2 31 ? 24.144  -4.718  -7.155  1.00 0.00 ? 55  ALA B N    12 
ATOM 10335 C CA   . ALA B 2 31 ? 23.542  -5.032  -8.447  1.00 0.00 ? 55  ALA B CA   12 
ATOM 10336 C C    . ALA B 2 31 ? 22.528  -6.163  -8.319  1.00 0.00 ? 55  ALA B C    12 
ATOM 10337 O O    . ALA B 2 31 ? 21.324  -5.865  -8.178  1.00 0.00 ? 55  ALA B O    12 
ATOM 10338 C CB   . ALA B 2 31 ? 24.621  -5.398  -9.456  1.00 0.00 ? 55  ALA B CB   12 
ATOM 10339 O OXT  . ALA B 2 31 ? 22.947  -7.340  -8.360  1.00 0.00 ? 55  ALA B OXT  12 
ATOM 10340 H H    . ALA B 2 31 ? 25.052  -5.018  -6.960  1.00 0.00 ? 55  ALA B H    12 
ATOM 10341 H HA   . ALA B 2 31 ? 23.035  -4.146  -8.802  1.00 0.00 ? 55  ALA B HA   12 
ATOM 10342 H HB1  . ALA B 2 31 ? 24.173  -5.525  -10.430 1.00 0.00 ? 55  ALA B HB1  12 
ATOM 10343 H HB2  . ALA B 2 31 ? 25.097  -6.319  -9.155  1.00 0.00 ? 55  ALA B HB2  12 
ATOM 10344 H HB3  . ALA B 2 31 ? 25.356  -4.608  -9.499  1.00 0.00 ? 55  ALA B HB3  12 
ATOM 10345 N N    . ALA A 1 1  ? 0.264   -2.871  9.210   1.00 0.00 ? 106 ALA A N    13 
ATOM 10346 C CA   . ALA A 1 1  ? 1.161   -3.306  10.311  1.00 0.00 ? 106 ALA A CA   13 
ATOM 10347 C C    . ALA A 1 1  ? 0.376   -4.009  11.413  1.00 0.00 ? 106 ALA A C    13 
ATOM 10348 O O    . ALA A 1 1  ? 0.957   -4.638  12.297  1.00 0.00 ? 106 ALA A O    13 
ATOM 10349 C CB   . ALA A 1 1  ? 1.913   -2.111  10.880  1.00 0.00 ? 106 ALA A CB   13 
ATOM 10350 H H1   . ALA A 1 1  ? 0.813   -2.392  8.468   1.00 0.00 ? 106 ALA A H1   13 
ATOM 10351 H H2   . ALA A 1 1  ? -0.454  -2.211  9.573   1.00 0.00 ? 106 ALA A H2   13 
ATOM 10352 H H3   . ALA A 1 1  ? -0.217  -3.694  8.795   1.00 0.00 ? 106 ALA A H3   13 
ATOM 10353 H HA   . ALA A 1 1  ? 1.887   -3.996  9.905   1.00 0.00 ? 106 ALA A HA   13 
ATOM 10354 H HB1  . ALA A 1 1  ? 1.205   -1.383  11.249  1.00 0.00 ? 106 ALA A HB1  13 
ATOM 10355 H HB2  . ALA A 1 1  ? 2.517   -1.664  10.104  1.00 0.00 ? 106 ALA A HB2  13 
ATOM 10356 H HB3  . ALA A 1 1  ? 2.549   -2.438  11.688  1.00 0.00 ? 106 ALA A HB3  13 
ATOM 10357 N N    . ALA A 1 2  ? -0.947  -3.895  11.353  1.00 0.00 ? 107 ALA A N    13 
ATOM 10358 C CA   . ALA A 1 2  ? -1.812  -4.520  12.348  1.00 0.00 ? 107 ALA A CA   13 
ATOM 10359 C C    . ALA A 1 2  ? -3.176  -4.860  11.756  1.00 0.00 ? 107 ALA A C    13 
ATOM 10360 O O    . ALA A 1 2  ? -4.055  -5.367  12.454  1.00 0.00 ? 107 ALA A O    13 
ATOM 10361 C CB   . ALA A 1 2  ? -1.971  -3.608  13.554  1.00 0.00 ? 107 ALA A CB   13 
ATOM 10362 H H    . ALA A 1 2  ? -1.351  -3.379  10.624  1.00 0.00 ? 107 ALA A H    13 
ATOM 10363 H HA   . ALA A 1 2  ? -1.336  -5.433  12.676  1.00 0.00 ? 107 ALA A HA   13 
ATOM 10364 H HB1  . ALA A 1 2  ? -1.002  -3.417  13.992  1.00 0.00 ? 107 ALA A HB1  13 
ATOM 10365 H HB2  . ALA A 1 2  ? -2.608  -4.086  14.284  1.00 0.00 ? 107 ALA A HB2  13 
ATOM 10366 H HB3  . ALA A 1 2  ? -2.416  -2.675  13.244  1.00 0.00 ? 107 ALA A HB3  13 
ATOM 10367 N N    . ALA A 1 3  ? -3.348  -4.578  10.468  1.00 0.00 ? 108 ALA A N    13 
ATOM 10368 C CA   . ALA A 1 3  ? -4.607  -4.856  9.787   1.00 0.00 ? 108 ALA A CA   13 
ATOM 10369 C C    . ALA A 1 3  ? -4.469  -6.031  8.828   1.00 0.00 ? 108 ALA A C    13 
ATOM 10370 O O    . ALA A 1 3  ? -3.570  -6.051  7.986   1.00 0.00 ? 108 ALA A O    13 
ATOM 10371 C CB   . ALA A 1 3  ? -5.091  -3.624  9.041   1.00 0.00 ? 108 ALA A CB   13 
ATOM 10372 H H    . ALA A 1 3  ? -2.611  -4.173  9.964   1.00 0.00 ? 108 ALA A H    13 
ATOM 10373 H HA   . ALA A 1 3  ? -5.343  -5.104  10.539  1.00 0.00 ? 108 ALA A HA   13 
ATOM 10374 H HB1  . ALA A 1 3  ? -6.164  -3.670  8.927   1.00 0.00 ? 108 ALA A HB1  13 
ATOM 10375 H HB2  . ALA A 1 3  ? -4.629  -3.592  8.067   1.00 0.00 ? 108 ALA A HB2  13 
ATOM 10376 H HB3  . ALA A 1 3  ? -4.826  -2.736  9.596   1.00 0.00 ? 108 ALA A HB3  13 
ATOM 10377 N N    . THR A 1 4  ? -5.376  -7.000  8.963   1.00 0.00 ? 109 THR A N    13 
ATOM 10378 C CA   . THR A 1 4  ? -5.388  -8.201  8.123   1.00 0.00 ? 109 THR A CA   13 
ATOM 10379 C C    . THR A 1 4  ? -3.979  -8.649  7.729   1.00 0.00 ? 109 THR A C    13 
ATOM 10380 O O    . THR A 1 4  ? -3.287  -9.304  8.510   1.00 0.00 ? 109 THR A O    13 
ATOM 10381 C CB   . THR A 1 4  ? -6.271  -8.019  6.863   1.00 0.00 ? 109 THR A CB   13 
ATOM 10382 O OG1  . THR A 1 4  ? -5.916  -8.981  5.862   1.00 0.00 ? 109 THR A OG1  13 
ATOM 10383 C CG2  . THR A 1 4  ? -6.158  -6.612  6.292   1.00 0.00 ? 109 THR A CG2  13 
ATOM 10384 H H    . THR A 1 4  ? -6.065  -6.901  9.651   1.00 0.00 ? 109 THR A H    13 
ATOM 10385 H HA   . THR A 1 4  ? -5.828  -8.991  8.711   1.00 0.00 ? 109 THR A HA   13 
ATOM 10386 H HB   . THR A 1 4  ? -7.297  -8.183  7.148   1.00 0.00 ? 109 THR A HB   13 
ATOM 10387 H HG1  . THR A 1 4  ? -6.276  -9.839  6.100   1.00 0.00 ? 109 THR A HG1  13 
ATOM 10388 H HG21 . THR A 1 4  ? -5.167  -6.232  6.465   1.00 0.00 ? 109 THR A HG21 13 
ATOM 10389 H HG22 . THR A 1 4  ? -6.880  -5.969  6.775   1.00 0.00 ? 109 THR A HG22 13 
ATOM 10390 H HG23 . THR A 1 4  ? -6.353  -6.639  5.230   1.00 0.00 ? 109 THR A HG23 13 
ATOM 10391 N N    . ASN A 1 5  ? -3.560  -8.294  6.520   1.00 0.00 ? 110 ASN A N    13 
ATOM 10392 C CA   . ASN A 1 5  ? -2.235  -8.651  6.026   1.00 0.00 ? 110 ASN A CA   13 
ATOM 10393 C C    . ASN A 1 5  ? -1.784  -7.672  4.952   1.00 0.00 ? 110 ASN A C    13 
ATOM 10394 O O    . ASN A 1 5  ? -2.139  -7.829  3.786   1.00 0.00 ? 110 ASN A O    13 
ATOM 10395 C CB   . ASN A 1 5  ? -2.240  -10.069 5.450   1.00 0.00 ? 110 ASN A CB   13 
ATOM 10396 C CG   . ASN A 1 5  ? -1.862  -11.115 6.472   1.00 0.00 ? 110 ASN A CG   13 
ATOM 10397 O OD1  . ASN A 1 5  ? -2.710  -11.619 7.210   1.00 0.00 ? 110 ASN A OD1  13 
ATOM 10398 N ND2  . ASN A 1 5  ? -0.583  -11.451 6.517   1.00 0.00 ? 110 ASN A ND2  13 
ATOM 10399 H H    . ASN A 1 5  ? -4.160  -7.789  5.940   1.00 0.00 ? 110 ASN A H    13 
ATOM 10400 H HA   . ASN A 1 5  ? -1.546  -8.609  6.855   1.00 0.00 ? 110 ASN A HA   13 
ATOM 10401 H HB2  . ASN A 1 5  ? -3.224  -10.301 5.077   1.00 0.00 ? 110 ASN A HB2  13 
ATOM 10402 H HB3  . ASN A 1 5  ? -1.532  -10.120 4.636   1.00 0.00 ? 110 ASN A HB3  13 
ATOM 10403 H HD21 . ASN A 1 5  ? 0.036   -11.009 5.894   1.00 0.00 ? 110 ASN A HD21 13 
ATOM 10404 H HD22 . ASN A 1 5  ? -0.308  -12.128 7.166   1.00 0.00 ? 110 ASN A HD22 13 
ATOM 10405 N N    . PRO A 1 6  ? -0.984  -6.653  5.321   1.00 0.00 ? 111 PRO A N    13 
ATOM 10406 C CA   . PRO A 1 6  ? -0.502  -5.659  4.361   1.00 0.00 ? 111 PRO A CA   13 
ATOM 10407 C C    . PRO A 1 6  ? 0.292   -6.316  3.238   1.00 0.00 ? 111 PRO A C    13 
ATOM 10408 O O    . PRO A 1 6  ? 1.505   -6.491  3.339   1.00 0.00 ? 111 PRO A O    13 
ATOM 10409 C CB   . PRO A 1 6  ? 0.376   -4.729  5.202   1.00 0.00 ? 111 PRO A CB   13 
ATOM 10410 C CG   . PRO A 1 6  ? 0.729   -5.528  6.409   1.00 0.00 ? 111 PRO A CG   13 
ATOM 10411 C CD   . PRO A 1 6  ? -0.464  -6.400  6.675   1.00 0.00 ? 111 PRO A CD   13 
ATOM 10412 H HA   . PRO A 1 6  ? -1.322  -5.097  3.934   1.00 0.00 ? 111 PRO A HA   13 
ATOM 10413 H HB2  . PRO A 1 6  ? 1.251   -4.445  4.638   1.00 0.00 ? 111 PRO A HB2  13 
ATOM 10414 H HB3  . PRO A 1 6  ? -0.186  -3.848  5.468   1.00 0.00 ? 111 PRO A HB3  13 
ATOM 10415 H HG2  . PRO A 1 6  ? 1.601   -6.134  6.209   1.00 0.00 ? 111 PRO A HG2  13 
ATOM 10416 H HG3  . PRO A 1 6  ? 0.910   -4.872  7.247   1.00 0.00 ? 111 PRO A HG3  13 
ATOM 10417 H HD2  . PRO A 1 6  ? -0.164  -7.320  7.155   1.00 0.00 ? 111 PRO A HD2  13 
ATOM 10418 H HD3  . PRO A 1 6  ? -1.191  -5.875  7.277   1.00 0.00 ? 111 PRO A HD3  13 
ATOM 10419 N N    . ALA A 1 7  ? -0.439  -6.686  2.187   1.00 0.00 ? 112 ALA A N    13 
ATOM 10420 C CA   . ALA A 1 7  ? 0.099   -7.352  0.999   1.00 0.00 ? 112 ALA A CA   13 
ATOM 10421 C C    . ALA A 1 7  ? -1.055  -8.021  0.279   1.00 0.00 ? 112 ALA A C    13 
ATOM 10422 O O    . ALA A 1 7  ? -1.388  -7.683  -0.858  1.00 0.00 ? 112 ALA A O    13 
ATOM 10423 C CB   . ALA A 1 7  ? 1.154   -8.382  1.363   1.00 0.00 ? 112 ALA A CB   13 
ATOM 10424 H H    . ALA A 1 7  ? -1.401  -6.499  2.211   1.00 0.00 ? 112 ALA A H    13 
ATOM 10425 H HA   . ALA A 1 7  ? 0.541   -6.605  0.355   1.00 0.00 ? 112 ALA A HA   13 
ATOM 10426 H HB1  . ALA A 1 7  ? 0.729   -9.113  2.037   1.00 0.00 ? 112 ALA A HB1  13 
ATOM 10427 H HB2  . ALA A 1 7  ? 1.981   -7.888  1.844   1.00 0.00 ? 112 ALA A HB2  13 
ATOM 10428 H HB3  . ALA A 1 7  ? 1.502   -8.877  0.468   1.00 0.00 ? 112 ALA A HB3  13 
ATOM 10429 N N    . ARG A 1 8  ? -1.656  -8.979  0.969   1.00 0.00 ? 113 ARG A N    13 
ATOM 10430 C CA   . ARG A 1 8  ? -2.824  -9.681  0.461   1.00 0.00 ? 113 ARG A CA   13 
ATOM 10431 C C    . ARG A 1 8  ? -4.035  -8.778  0.652   1.00 0.00 ? 113 ARG A C    13 
ATOM 10432 O O    . ARG A 1 8  ? -5.093  -8.970  0.050   1.00 0.00 ? 113 ARG A O    13 
ATOM 10433 C CB   . ARG A 1 8  ? -3.021  -10.992 1.224   1.00 0.00 ? 113 ARG A CB   13 
ATOM 10434 C CG   . ARG A 1 8  ? -2.455  -12.212 0.511   1.00 0.00 ? 113 ARG A CG   13 
ATOM 10435 C CD   . ARG A 1 8  ? -0.943  -12.129 0.368   1.00 0.00 ? 113 ARG A CD   13 
ATOM 10436 N NE   . ARG A 1 8  ? -0.391  -13.306 -0.298  1.00 0.00 ? 113 ARG A NE   13 
ATOM 10437 C CZ   . ARG A 1 8  ? 0.908   -13.588 -0.347  1.00 0.00 ? 113 ARG A CZ   13 
ATOM 10438 N NH1  . ARG A 1 8  ? 1.787   -12.787 0.239   1.00 0.00 ? 113 ARG A NH1  13 
ATOM 10439 N NH2  . ARG A 1 8  ? 1.328   -14.676 -0.978  1.00 0.00 ? 113 ARG A NH2  13 
ATOM 10440 H H    . ARG A 1 8  ? -1.294  -9.226  1.846   1.00 0.00 ? 113 ARG A H    13 
ATOM 10441 H HA   . ARG A 1 8  ? -2.680  -9.882  -0.588  1.00 0.00 ? 113 ARG A HA   13 
ATOM 10442 H HB2  . ARG A 1 8  ? -2.536  -10.908 2.185   1.00 0.00 ? 113 ARG A HB2  13 
ATOM 10443 H HB3  . ARG A 1 8  ? -4.077  -11.150 1.381   1.00 0.00 ? 113 ARG A HB3  13 
ATOM 10444 H HG2  . ARG A 1 8  ? -2.703  -13.096 1.080   1.00 0.00 ? 113 ARG A HG2  13 
ATOM 10445 H HG3  . ARG A 1 8  ? -2.897  -12.279 -0.472  1.00 0.00 ? 113 ARG A HG3  13 
ATOM 10446 H HD2  . ARG A 1 8  ? -0.697  -11.251 -0.210  1.00 0.00 ? 113 ARG A HD2  13 
ATOM 10447 H HD3  . ARG A 1 8  ? -0.505  -12.045 1.352   1.00 0.00 ? 113 ARG A HD3  13 
ATOM 10448 H HE   . ARG A 1 8  ? -1.022  -13.916 -0.736  1.00 0.00 ? 113 ARG A HE   13 
ATOM 10449 H HH11 . ARG A 1 8  ? 1.476   -11.966 0.719   1.00 0.00 ? 113 ARG A HH11 13 
ATOM 10450 H HH12 . ARG A 1 8  ? 2.764   -13.003 0.201   1.00 0.00 ? 113 ARG A HH12 13 
ATOM 10451 H HH21 . ARG A 1 8  ? 0.667   -15.284 -1.419  1.00 0.00 ? 113 ARG A HH21 13 
ATOM 10452 H HH22 . ARG A 1 8  ? 2.304   -14.887 -1.015  1.00 0.00 ? 113 ARG A HH22 13 
ATOM 10453 N N    . TYR A 1 9  ? -3.832  -7.781  1.506   1.00 0.00 ? 114 TYR A N    13 
ATOM 10454 C CA   . TYR A 1 9  ? -4.841  -6.789  1.840   1.00 0.00 ? 114 TYR A CA   13 
ATOM 10455 C C    . TYR A 1 9  ? -5.042  -5.815  0.680   1.00 0.00 ? 114 TYR A C    13 
ATOM 10456 O O    . TYR A 1 9  ? -6.175  -5.525  0.298   1.00 0.00 ? 114 TYR A O    13 
ATOM 10457 C CB   . TYR A 1 9  ? -4.397  -6.088  3.137   1.00 0.00 ? 114 TYR A CB   13 
ATOM 10458 C CG   . TYR A 1 9  ? -4.866  -4.665  3.336   1.00 0.00 ? 114 TYR A CG   13 
ATOM 10459 C CD1  . TYR A 1 9  ? -6.118  -4.242  2.915   1.00 0.00 ? 114 TYR A CD1  13 
ATOM 10460 C CD2  . TYR A 1 9  ? -4.038  -3.743  3.966   1.00 0.00 ? 114 TYR A CD2  13 
ATOM 10461 C CE1  . TYR A 1 9  ? -6.534  -2.946  3.109   1.00 0.00 ? 114 TYR A CE1  13 
ATOM 10462 C CE2  . TYR A 1 9  ? -4.444  -2.441  4.168   1.00 0.00 ? 114 TYR A CE2  13 
ATOM 10463 C CZ   . TYR A 1 9  ? -5.695  -2.043  3.737   1.00 0.00 ? 114 TYR A CZ   13 
ATOM 10464 O OH   . TYR A 1 9  ? -6.107  -0.746  3.932   1.00 0.00 ? 114 TYR A OH   13 
ATOM 10465 H H    . TYR A 1 9  ? -2.955  -7.711  1.935   1.00 0.00 ? 114 TYR A H    13 
ATOM 10466 H HA   . TYR A 1 9  ? -5.774  -7.298  2.025   1.00 0.00 ? 114 TYR A HA   13 
ATOM 10467 H HB2  . TYR A 1 9  ? -4.758  -6.660  3.976   1.00 0.00 ? 114 TYR A HB2  13 
ATOM 10468 H HB3  . TYR A 1 9  ? -3.315  -6.080  3.167   1.00 0.00 ? 114 TYR A HB3  13 
ATOM 10469 H HD1  . TYR A 1 9  ? -6.772  -4.947  2.424   1.00 0.00 ? 114 TYR A HD1  13 
ATOM 10470 H HD2  . TYR A 1 9  ? -3.058  -4.058  4.300   1.00 0.00 ? 114 TYR A HD2  13 
ATOM 10471 H HE1  . TYR A 1 9  ? -7.509  -2.642  2.765   1.00 0.00 ? 114 TYR A HE1  13 
ATOM 10472 H HE2  . TYR A 1 9  ? -3.780  -1.742  4.660   1.00 0.00 ? 114 TYR A HE2  13 
ATOM 10473 H HH   . TYR A 1 9  ? -7.010  -0.741  4.261   1.00 0.00 ? 114 TYR A HH   13 
ATOM 10474 N N    . CYS A 1 10 ? -3.947  -5.324  0.107   1.00 0.00 ? 115 CYS A N    13 
ATOM 10475 C CA   . CYS A 1 10 ? -4.041  -4.394  -1.011  1.00 0.00 ? 115 CYS A CA   13 
ATOM 10476 C C    . CYS A 1 10 ? -4.234  -5.143  -2.324  1.00 0.00 ? 115 CYS A C    13 
ATOM 10477 O O    . CYS A 1 10 ? -4.704  -4.580  -3.308  1.00 0.00 ? 115 CYS A O    13 
ATOM 10478 C CB   . CYS A 1 10 ? -2.795  -3.514  -1.102  1.00 0.00 ? 115 CYS A CB   13 
ATOM 10479 S SG   . CYS A 1 10 ? -2.106  -3.016  0.508   1.00 0.00 ? 115 CYS A SG   13 
ATOM 10480 H H    . CYS A 1 10 ? -3.065  -5.593  0.440   1.00 0.00 ? 115 CYS A H    13 
ATOM 10481 H HA   . CYS A 1 10 ? -4.902  -3.764  -0.842  1.00 0.00 ? 115 CYS A HA   13 
ATOM 10482 H HB2  . CYS A 1 10 ? -2.021  -4.044  -1.641  1.00 0.00 ? 115 CYS A HB2  13 
ATOM 10483 H HB3  . CYS A 1 10 ? -3.046  -2.614  -1.645  1.00 0.00 ? 115 CYS A HB3  13 
ATOM 10484 N N    . CYS A 1 11 ? -3.872  -6.418  -2.340  1.00 0.00 ? 116 CYS A N    13 
ATOM 10485 C CA   . CYS A 1 11 ? -4.010  -7.222  -3.545  1.00 0.00 ? 116 CYS A CA   13 
ATOM 10486 C C    . CYS A 1 11 ? -5.478  -7.487  -3.857  1.00 0.00 ? 116 CYS A C    13 
ATOM 10487 O O    . CYS A 1 11 ? -5.934  -7.276  -4.981  1.00 0.00 ? 116 CYS A O    13 
ATOM 10488 C CB   . CYS A 1 11 ? -3.267  -8.553  -3.390  1.00 0.00 ? 116 CYS A CB   13 
ATOM 10489 S SG   . CYS A 1 11 ? -3.384  -9.651  -4.842  1.00 0.00 ? 116 CYS A SG   13 
ATOM 10490 H H    . CYS A 1 11 ? -3.507  -6.826  -1.527  1.00 0.00 ? 116 CYS A H    13 
ATOM 10491 H HA   . CYS A 1 11 ? -3.574  -6.662  -4.362  1.00 0.00 ? 116 CYS A HA   13 
ATOM 10492 H HB2  . CYS A 1 11 ? -2.226  -8.358  -3.209  1.00 0.00 ? 116 CYS A HB2  13 
ATOM 10493 H HB3  . CYS A 1 11 ? -3.675  -9.085  -2.545  1.00 0.00 ? 116 CYS A HB3  13 
ATOM 10494 N N    . LEU A 1 12 ? -6.212  -7.953  -2.854  1.00 0.00 ? 117 LEU A N    13 
ATOM 10495 C CA   . LEU A 1 12 ? -7.623  -8.263  -3.013  1.00 0.00 ? 117 LEU A CA   13 
ATOM 10496 C C    . LEU A 1 12 ? -8.497  -7.015  -2.922  1.00 0.00 ? 117 LEU A C    13 
ATOM 10497 O O    . LEU A 1 12 ? -9.669  -7.044  -3.299  1.00 0.00 ? 117 LEU A O    13 
ATOM 10498 C CB   . LEU A 1 12 ? -8.047  -9.269  -1.950  1.00 0.00 ? 117 LEU A CB   13 
ATOM 10499 C CG   . LEU A 1 12 ? -7.902  -10.742 -2.344  1.00 0.00 ? 117 LEU A CG   13 
ATOM 10500 C CD1  . LEU A 1 12 ? -8.261  -11.643 -1.172  1.00 0.00 ? 117 LEU A CD1  13 
ATOM 10501 C CD2  . LEU A 1 12 ? -8.774  -11.064 -3.550  1.00 0.00 ? 117 LEU A CD2  13 
ATOM 10502 H H    . LEU A 1 12 ? -5.794  -8.095  -1.979  1.00 0.00 ? 117 LEU A H    13 
ATOM 10503 H HA   . LEU A 1 12 ? -7.756  -8.710  -3.983  1.00 0.00 ? 117 LEU A HA   13 
ATOM 10504 H HB2  . LEU A 1 12 ? -7.446  -9.094  -1.073  1.00 0.00 ? 117 LEU A HB2  13 
ATOM 10505 H HB3  . LEU A 1 12 ? -9.076  -9.082  -1.701  1.00 0.00 ? 117 LEU A HB3  13 
ATOM 10506 H HG   . LEU A 1 12 ? -6.873  -10.937 -2.611  1.00 0.00 ? 117 LEU A HG   13 
ATOM 10507 H HD11 . LEU A 1 12 ? -8.149  -12.676 -1.465  1.00 0.00 ? 117 LEU A HD11 13 
ATOM 10508 H HD12 . LEU A 1 12 ? -9.283  -11.461 -0.878  1.00 0.00 ? 117 LEU A HD12 13 
ATOM 10509 H HD13 . LEU A 1 12 ? -7.604  -11.432 -0.341  1.00 0.00 ? 117 LEU A HD13 13 
ATOM 10510 H HD21 . LEU A 1 12 ? -8.456  -10.469 -4.394  1.00 0.00 ? 117 LEU A HD21 13 
ATOM 10511 H HD22 . LEU A 1 12 ? -9.805  -10.841 -3.320  1.00 0.00 ? 117 LEU A HD22 13 
ATOM 10512 H HD23 . LEU A 1 12 ? -8.678  -12.113 -3.793  1.00 0.00 ? 117 LEU A HD23 13 
ATOM 10513 N N    . SER A 1 13 ? -7.931  -5.920  -2.422  1.00 0.00 ? 118 SER A N    13 
ATOM 10514 C CA   . SER A 1 13 ? -8.688  -4.678  -2.277  1.00 0.00 ? 118 SER A CA   13 
ATOM 10515 C C    . SER A 1 13 ? -7.930  -3.473  -2.830  1.00 0.00 ? 118 SER A C    13 
ATOM 10516 O O    . SER A 1 13 ? -8.410  -2.790  -3.736  1.00 0.00 ? 118 SER A O    13 
ATOM 10517 C CB   . SER A 1 13 ? -9.025  -4.434  -0.804  1.00 0.00 ? 118 SER A CB   13 
ATOM 10518 O OG   . SER A 1 13 ? -9.865  -3.303  -0.655  1.00 0.00 ? 118 SER A OG   13 
ATOM 10519 H H    . SER A 1 13 ? -6.993  -5.950  -2.141  1.00 0.00 ? 118 SER A H    13 
ATOM 10520 H HA   . SER A 1 13 ? -9.609  -4.789  -2.829  1.00 0.00 ? 118 SER A HA   13 
ATOM 10521 H HB2  . SER A 1 13 ? -9.529  -5.297  -0.401  1.00 0.00 ? 118 SER A HB2  13 
ATOM 10522 H HB3  . SER A 1 13 ? -8.111  -4.261  -0.254  1.00 0.00 ? 118 SER A HB3  13 
ATOM 10523 H HG   . SER A 1 13 ? -10.333 -3.140  -1.477  1.00 0.00 ? 118 SER A HG   13 
ATOM 10524 N N    . GLY A 1 14 ? -6.747  -3.217  -2.282  1.00 0.00 ? 119 GLY A N    13 
ATOM 10525 C CA   . GLY A 1 14 ? -5.958  -2.079  -2.707  1.00 0.00 ? 119 GLY A CA   13 
ATOM 10526 C C    . GLY A 1 14 ? -5.700  -1.141  -1.547  1.00 0.00 ? 119 GLY A C    13 
ATOM 10527 O O    . GLY A 1 14 ? -6.539  -1.022  -0.655  1.00 0.00 ? 119 GLY A O    13 
ATOM 10528 H H    . GLY A 1 14 ? -6.401  -3.811  -1.583  1.00 0.00 ? 119 GLY A H    13 
ATOM 10529 H HA2  . GLY A 1 14 ? -5.012  -2.432  -3.092  1.00 0.00 ? 119 GLY A HA2  13 
ATOM 10530 H HA3  . GLY A 1 14 ? -6.485  -1.549  -3.491  1.00 0.00 ? 119 GLY A HA3  13 
ATOM 10531 N N    . CYS A 1 15 ? -4.548  -0.474  -1.538  1.00 0.00 ? 120 CYS A N    13 
ATOM 10532 C CA   . CYS A 1 15 ? -4.228  0.420   -0.430  1.00 0.00 ? 120 CYS A CA   13 
ATOM 10533 C C    . CYS A 1 15 ? -3.941  1.842   -0.871  1.00 0.00 ? 120 CYS A C    13 
ATOM 10534 O O    . CYS A 1 15 ? -3.377  2.086   -1.937  1.00 0.00 ? 120 CYS A O    13 
ATOM 10535 C CB   . CYS A 1 15 ? -3.063  -0.130  0.392   1.00 0.00 ? 120 CYS A CB   13 
ATOM 10536 S SG   . CYS A 1 15 ? -3.455  -1.695  1.237   1.00 0.00 ? 120 CYS A SG   13 
ATOM 10537 H H    . CYS A 1 15 ? -3.915  -0.579  -2.280  1.00 0.00 ? 120 CYS A H    13 
ATOM 10538 H HA   . CYS A 1 15 ? -5.090  0.449   0.199   1.00 0.00 ? 120 CYS A HA   13 
ATOM 10539 H HB2  . CYS A 1 15 ? -2.216  -0.299  -0.249  1.00 0.00 ? 120 CYS A HB2  13 
ATOM 10540 H HB3  . CYS A 1 15 ? -2.795  0.593   1.148   1.00 0.00 ? 120 CYS A HB3  13 
ATOM 10541 N N    . THR A 1 16 ? -4.354  2.779   -0.019  1.00 0.00 ? 121 THR A N    13 
ATOM 10542 C CA   . THR A 1 16 ? -4.156  4.196   -0.268  1.00 0.00 ? 121 THR A CA   13 
ATOM 10543 C C    . THR A 1 16 ? -2.771  4.618   0.132   1.00 0.00 ? 121 THR A C    13 
ATOM 10544 O O    . THR A 1 16 ? -2.131  3.975   0.962   1.00 0.00 ? 121 THR A O    13 
ATOM 10545 C CB   . THR A 1 16 ? -5.131  5.066   0.540   1.00 0.00 ? 121 THR A CB   13 
ATOM 10546 O OG1  . THR A 1 16 ? -4.829  4.979   1.936   1.00 0.00 ? 121 THR A OG1  13 
ATOM 10547 C CG2  . THR A 1 16 ? -6.550  4.635   0.302   1.00 0.00 ? 121 THR A CG2  13 
ATOM 10548 H H    . THR A 1 16 ? -4.804  2.502   0.806   1.00 0.00 ? 121 THR A H    13 
ATOM 10549 H HA   . THR A 1 16 ? -4.306  4.388   -1.319  1.00 0.00 ? 121 THR A HA   13 
ATOM 10550 H HB   . THR A 1 16 ? -5.023  6.090   0.216   1.00 0.00 ? 121 THR A HB   13 
ATOM 10551 H HG1  . THR A 1 16 ? -4.823  4.058   2.206   1.00 0.00 ? 121 THR A HG1  13 
ATOM 10552 H HG21 . THR A 1 16 ? -6.668  4.445   -0.744  1.00 0.00 ? 121 THR A HG21 13 
ATOM 10553 H HG22 . THR A 1 16 ? -7.225  5.419   0.610   1.00 0.00 ? 121 THR A HG22 13 
ATOM 10554 H HG23 . THR A 1 16 ? -6.756  3.734   0.861   1.00 0.00 ? 121 THR A HG23 13 
ATOM 10555 N N    . GLN A 1 17 ? -2.322  5.716   -0.440  1.00 0.00 ? 122 GLN A N    13 
ATOM 10556 C CA   . GLN A 1 17 ? -1.023  6.246   -0.103  1.00 0.00 ? 122 GLN A CA   13 
ATOM 10557 C C    . GLN A 1 17 ? -0.977  6.491   1.392   1.00 0.00 ? 122 GLN A C    13 
ATOM 10558 O O    . GLN A 1 17 ? 0.085   6.605   1.973   1.00 0.00 ? 122 GLN A O    13 
ATOM 10559 C CB   . GLN A 1 17 ? -0.758  7.531   -0.880  1.00 0.00 ? 122 GLN A CB   13 
ATOM 10560 C CG   . GLN A 1 17 ? -0.137  7.288   -2.245  1.00 0.00 ? 122 GLN A CG   13 
ATOM 10561 C CD   . GLN A 1 17 ? -0.248  8.488   -3.168  1.00 0.00 ? 122 GLN A CD   13 
ATOM 10562 O OE1  . GLN A 1 17 ? 0.601   8.698   -4.033  1.00 0.00 ? 122 GLN A OE1  13 
ATOM 10563 N NE2  . GLN A 1 17 ? -1.298  9.281   -2.988  1.00 0.00 ? 122 GLN A NE2  13 
ATOM 10564 H H    . GLN A 1 17 ? -2.884  6.185   -1.091  1.00 0.00 ? 122 GLN A H    13 
ATOM 10565 H HA   . GLN A 1 17 ? -0.264  5.502   -0.353  1.00 0.00 ? 122 GLN A HA   13 
ATOM 10566 H HB2  . GLN A 1 17 ? -1.693  8.053   -1.020  1.00 0.00 ? 122 GLN A HB2  13 
ATOM 10567 H HB3  . GLN A 1 17 ? -0.092  8.152   -0.308  1.00 0.00 ? 122 GLN A HB3  13 
ATOM 10568 H HG2  . GLN A 1 17 ? 0.908   7.055   -2.111  1.00 0.00 ? 122 GLN A HG2  13 
ATOM 10569 H HG3  . GLN A 1 17 ? -0.631  6.446   -2.705  1.00 0.00 ? 122 GLN A HG3  13 
ATOM 10570 H HE21 . GLN A 1 17 ? -1.936  9.053   -2.280  1.00 0.00 ? 122 GLN A HE21 13 
ATOM 10571 H HE22 . GLN A 1 17 ? -1.394  10.062  -3.572  1.00 0.00 ? 122 GLN A HE22 13 
ATOM 10572 N N    . GLN A 1 18 ? -2.142  6.565   2.024   1.00 0.00 ? 123 GLN A N    13 
ATOM 10573 C CA   . GLN A 1 18 ? -2.177  6.743   3.453   1.00 0.00 ? 123 GLN A CA   13 
ATOM 10574 C C    . GLN A 1 18 ? -1.742  5.445   4.098   1.00 0.00 ? 123 GLN A C    13 
ATOM 10575 O O    . GLN A 1 18 ? -0.828  5.426   4.917   1.00 0.00 ? 123 GLN A O    13 
ATOM 10576 C CB   . GLN A 1 18 ? -3.571  7.127   3.921   1.00 0.00 ? 123 GLN A CB   13 
ATOM 10577 C CG   . GLN A 1 18 ? -4.002  8.520   3.496   1.00 0.00 ? 123 GLN A CG   13 
ATOM 10578 C CD   . GLN A 1 18 ? -5.355  8.907   4.062   1.00 0.00 ? 123 GLN A CD   13 
ATOM 10579 O OE1  . GLN A 1 18 ? -5.447  9.483   5.146   1.00 0.00 ? 123 GLN A OE1  13 
ATOM 10580 N NE2  . GLN A 1 18 ? -6.416  8.588   3.329   1.00 0.00 ? 123 GLN A NE2  13 
ATOM 10581 H H    . GLN A 1 18 ? -2.985  6.488   1.526   1.00 0.00 ? 123 GLN A H    13 
ATOM 10582 H HA   . GLN A 1 18 ? -1.477  7.518   3.716   1.00 0.00 ? 123 GLN A HA   13 
ATOM 10583 H HB2  . GLN A 1 18 ? -4.275  6.419   3.521   1.00 0.00 ? 123 GLN A HB2  13 
ATOM 10584 H HB3  . GLN A 1 18 ? -3.594  7.074   4.992   1.00 0.00 ? 123 GLN A HB3  13 
ATOM 10585 H HG2  . GLN A 1 18 ? -3.267  9.232   3.843   1.00 0.00 ? 123 GLN A HG2  13 
ATOM 10586 H HG3  . GLN A 1 18 ? -4.056  8.554   2.418   1.00 0.00 ? 123 GLN A HG3  13 
ATOM 10587 H HE21 . GLN A 1 18 ? -6.267  8.128   2.476   1.00 0.00 ? 123 GLN A HE21 13 
ATOM 10588 H HE22 . GLN A 1 18 ? -7.303  8.825   3.671   1.00 0.00 ? 123 GLN A HE22 13 
ATOM 10589 N N    . ASP A 1 19 ? -2.388  4.354   3.691   1.00 0.00 ? 124 ASP A N    13 
ATOM 10590 C CA   . ASP A 1 19 ? -2.046  3.039   4.206   1.00 0.00 ? 124 ASP A CA   13 
ATOM 10591 C C    . ASP A 1 19 ? -0.562  2.801   3.989   1.00 0.00 ? 124 ASP A C    13 
ATOM 10592 O O    . ASP A 1 19 ? 0.198   2.574   4.932   1.00 0.00 ? 124 ASP A O    13 
ATOM 10593 C CB   . ASP A 1 19 ? -2.866  1.960   3.488   1.00 0.00 ? 124 ASP A CB   13 
ATOM 10594 C CG   . ASP A 1 19 ? -3.920  1.344   4.387   1.00 0.00 ? 124 ASP A CG   13 
ATOM 10595 O OD1  . ASP A 1 19 ? -3.573  0.438   5.174   1.00 0.00 ? 124 ASP A OD1  13 
ATOM 10596 O OD2  . ASP A 1 19 ? -5.091  1.769   4.305   1.00 0.00 ? 124 ASP A OD2  13 
ATOM 10597 H H    . ASP A 1 19 ? -3.101  4.436   3.018   1.00 0.00 ? 124 ASP A H    13 
ATOM 10598 H HA   . ASP A 1 19 ? -2.264  3.019   5.263   1.00 0.00 ? 124 ASP A HA   13 
ATOM 10599 H HB2  . ASP A 1 19 ? -3.365  2.405   2.640   1.00 0.00 ? 124 ASP A HB2  13 
ATOM 10600 H HB3  . ASP A 1 19 ? -2.206  1.175   3.139   1.00 0.00 ? 124 ASP A HB3  13 
ATOM 10601 N N    . LEU A 1 20 ? -0.158  2.899   2.733   1.00 0.00 ? 125 LEU A N    13 
ATOM 10602 C CA   . LEU A 1 20 ? 1.226   2.705   2.353   1.00 0.00 ? 125 LEU A CA   13 
ATOM 10603 C C    . LEU A 1 20 ? 2.142   3.706   3.069   1.00 0.00 ? 125 LEU A C    13 
ATOM 10604 O O    . LEU A 1 20 ? 3.308   3.401   3.340   1.00 0.00 ? 125 LEU A O    13 
ATOM 10605 C CB   . LEU A 1 20 ? 1.346   2.778   0.824   1.00 0.00 ? 125 LEU A CB   13 
ATOM 10606 C CG   . LEU A 1 20 ? 0.550   1.700   0.091   1.00 0.00 ? 125 LEU A CG   13 
ATOM 10607 C CD1  . LEU A 1 20 ? -0.560  2.322   -0.730  1.00 0.00 ? 125 LEU A CD1  13 
ATOM 10608 C CD2  . LEU A 1 20 ? 1.452   0.895   -0.807  1.00 0.00 ? 125 LEU A CD2  13 
ATOM 10609 H H    . LEU A 1 20 ? -0.815  3.108   2.038   1.00 0.00 ? 125 LEU A H    13 
ATOM 10610 H HA   . LEU A 1 20 ? 1.505   1.711   2.669   1.00 0.00 ? 125 LEU A HA   13 
ATOM 10611 H HB2  . LEU A 1 20 ? 1.001   3.735   0.484   1.00 0.00 ? 125 LEU A HB2  13 
ATOM 10612 H HB3  . LEU A 1 20 ? 2.375   2.682   0.553   1.00 0.00 ? 125 LEU A HB3  13 
ATOM 10613 H HG   . LEU A 1 20 ? 0.104   1.031   0.817   1.00 0.00 ? 125 LEU A HG   13 
ATOM 10614 H HD11 . LEU A 1 20 ? -1.513  1.926   -0.410  1.00 0.00 ? 125 LEU A HD11 13 
ATOM 10615 H HD12 . LEU A 1 20 ? -0.403  2.085   -1.773  1.00 0.00 ? 125 LEU A HD12 13 
ATOM 10616 H HD13 . LEU A 1 20 ? -0.551  3.394   -0.598  1.00 0.00 ? 125 LEU A HD13 13 
ATOM 10617 H HD21 . LEU A 1 20 ? 2.294   0.528   -0.240  1.00 0.00 ? 125 LEU A HD21 13 
ATOM 10618 H HD22 . LEU A 1 20 ? 1.801   1.533   -1.609  1.00 0.00 ? 125 LEU A HD22 13 
ATOM 10619 H HD23 . LEU A 1 20 ? 0.902   0.063   -1.220  1.00 0.00 ? 125 LEU A HD23 13 
ATOM 10620 N N    . LEU A 1 21 ? 1.609   4.889   3.401   1.00 0.00 ? 126 LEU A N    13 
ATOM 10621 C CA   . LEU A 1 21 ? 2.392   5.894   4.118   1.00 0.00 ? 126 LEU A CA   13 
ATOM 10622 C C    . LEU A 1 21 ? 2.712   5.403   5.522   1.00 0.00 ? 126 LEU A C    13 
ATOM 10623 O O    . LEU A 1 21 ? 3.713   5.801   6.117   1.00 0.00 ? 126 LEU A O    13 
ATOM 10624 C CB   . LEU A 1 21 ? 1.633   7.224   4.202   1.00 0.00 ? 126 LEU A CB   13 
ATOM 10625 C CG   . LEU A 1 21 ? 2.019   8.266   3.149   1.00 0.00 ? 126 LEU A CG   13 
ATOM 10626 C CD1  . LEU A 1 21 ? 1.150   9.506   3.285   1.00 0.00 ? 126 LEU A CD1  13 
ATOM 10627 C CD2  . LEU A 1 21 ? 3.492   8.633   3.262   1.00 0.00 ? 126 LEU A CD2  13 
ATOM 10628 H H    . LEU A 1 21 ? 0.680   5.092   3.156   1.00 0.00 ? 126 LEU A H    13 
ATOM 10629 H HA   . LEU A 1 21 ? 3.314   6.045   3.579   1.00 0.00 ? 126 LEU A HA   13 
ATOM 10630 H HB2  . LEU A 1 21 ? 0.579   7.016   4.097   1.00 0.00 ? 126 LEU A HB2  13 
ATOM 10631 H HB3  . LEU A 1 21 ? 1.799   7.651   5.177   1.00 0.00 ? 126 LEU A HB3  13 
ATOM 10632 H HG   . LEU A 1 21 ? 1.849   7.848   2.167   1.00 0.00 ? 126 LEU A HG   13 
ATOM 10633 H HD11 . LEU A 1 21 ? 1.267   9.923   4.274   1.00 0.00 ? 126 LEU A HD11 13 
ATOM 10634 H HD12 . LEU A 1 21 ? 0.115   9.241   3.127   1.00 0.00 ? 126 LEU A HD12 13 
ATOM 10635 H HD13 . LEU A 1 21 ? 1.449   10.238  2.549   1.00 0.00 ? 126 LEU A HD13 13 
ATOM 10636 H HD21 . LEU A 1 21 ? 3.750   9.331   2.479   1.00 0.00 ? 126 LEU A HD21 13 
ATOM 10637 H HD22 . LEU A 1 21 ? 4.094   7.743   3.164   1.00 0.00 ? 126 LEU A HD22 13 
ATOM 10638 H HD23 . LEU A 1 21 ? 3.678   9.088   4.224   1.00 0.00 ? 126 LEU A HD23 13 
ATOM 10639 N N    . THR A 1 22 ? 1.851   4.535   6.048   1.00 0.00 ? 127 THR A N    13 
ATOM 10640 C CA   . THR A 1 22 ? 2.043   3.989   7.382   1.00 0.00 ? 127 THR A CA   13 
ATOM 10641 C C    . THR A 1 22 ? 2.626   2.579   7.327   1.00 0.00 ? 127 THR A C    13 
ATOM 10642 O O    . THR A 1 22 ? 2.920   1.986   8.366   1.00 0.00 ? 127 THR A O    13 
ATOM 10643 C CB   . THR A 1 22 ? 0.729   3.943   8.193   1.00 0.00 ? 127 THR A CB   13 
ATOM 10644 O OG1  . THR A 1 22 ? 0.156   2.631   8.123   1.00 0.00 ? 127 THR A OG1  13 
ATOM 10645 C CG2  . THR A 1 22 ? -0.283  4.957   7.683   1.00 0.00 ? 127 THR A CG2  13 
ATOM 10646 H H    . THR A 1 22 ? 1.070   4.260   5.525   1.00 0.00 ? 127 THR A H    13 
ATOM 10647 H HA   . THR A 1 22 ? 2.739   4.630   7.905   1.00 0.00 ? 127 THR A HA   13 
ATOM 10648 H HB   . THR A 1 22 ? 0.953   4.174   9.223   1.00 0.00 ? 127 THR A HB   13 
ATOM 10649 H HG1  . THR A 1 22 ? 0.713   2.013   8.601   1.00 0.00 ? 127 THR A HG1  13 
ATOM 10650 H HG21 . THR A 1 22 ? 0.225   5.856   7.373   1.00 0.00 ? 127 THR A HG21 13 
ATOM 10651 H HG22 . THR A 1 22 ? -0.982  5.195   8.473   1.00 0.00 ? 127 THR A HG22 13 
ATOM 10652 H HG23 . THR A 1 22 ? -0.820  4.539   6.845   1.00 0.00 ? 127 THR A HG23 13 
ATOM 10653 N N    . LEU A 1 23 ? 2.796   2.037   6.119   1.00 0.00 ? 128 LEU A N    13 
ATOM 10654 C CA   . LEU A 1 23 ? 3.336   0.699   5.971   1.00 0.00 ? 128 LEU A CA   13 
ATOM 10655 C C    . LEU A 1 23 ? 4.846   0.755   5.778   1.00 0.00 ? 128 LEU A C    13 
ATOM 10656 O O    . LEU A 1 23 ? 5.549   -0.230  6.007   1.00 0.00 ? 128 LEU A O    13 
ATOM 10657 C CB   . LEU A 1 23 ? 2.646   -0.007  4.810   1.00 0.00 ? 128 LEU A CB   13 
ATOM 10658 C CG   . LEU A 1 23 ? 1.142   -0.197  5.002   1.00 0.00 ? 128 LEU A CG   13 
ATOM 10659 C CD1  . LEU A 1 23 ? 0.460   -0.457  3.676   1.00 0.00 ? 128 LEU A CD1  13 
ATOM 10660 C CD2  . LEU A 1 23 ? 0.883   -1.332  5.965   1.00 0.00 ? 128 LEU A CD2  13 
ATOM 10661 H H    . LEU A 1 23 ? 2.568   2.547   5.309   1.00 0.00 ? 128 LEU A H    13 
ATOM 10662 H HA   . LEU A 1 23 ? 3.122   0.153   6.880   1.00 0.00 ? 128 LEU A HA   13 
ATOM 10663 H HB2  . LEU A 1 23 ? 2.807   0.562   3.914   1.00 0.00 ? 128 LEU A HB2  13 
ATOM 10664 H HB3  . LEU A 1 23 ? 3.095   -0.976  4.688   1.00 0.00 ? 128 LEU A HB3  13 
ATOM 10665 H HG   . LEU A 1 23 ? 0.723   0.701   5.425   1.00 0.00 ? 128 LEU A HG   13 
ATOM 10666 H HD11 . LEU A 1 23 ? -0.446  -1.021  3.840   1.00 0.00 ? 128 LEU A HD11 13 
ATOM 10667 H HD12 . LEU A 1 23 ? 1.125   -1.015  3.041   1.00 0.00 ? 128 LEU A HD12 13 
ATOM 10668 H HD13 . LEU A 1 23 ? 0.217   0.484   3.205   1.00 0.00 ? 128 LEU A HD13 13 
ATOM 10669 H HD21 . LEU A 1 23 ? 1.003   -0.982  6.979   1.00 0.00 ? 128 LEU A HD21 13 
ATOM 10670 H HD22 . LEU A 1 23 ? 1.590   -2.116  5.770   1.00 0.00 ? 128 LEU A HD22 13 
ATOM 10671 H HD23 . LEU A 1 23 ? -0.122  -1.705  5.825   1.00 0.00 ? 128 LEU A HD23 13 
ATOM 10672 N N    . CYS A 1 24 ? 5.341   1.918   5.352   1.00 0.00 ? 129 CYS A N    13 
ATOM 10673 C CA   . CYS A 1 24 ? 6.777   2.109   5.160   1.00 0.00 ? 129 CYS A CA   13 
ATOM 10674 C C    . CYS A 1 24 ? 7.506   2.056   6.503   1.00 0.00 ? 129 CYS A C    13 
ATOM 10675 O O    . CYS A 1 24 ? 6.913   2.328   7.548   1.00 0.00 ? 129 CYS A O    13 
ATOM 10676 C CB   . CYS A 1 24 ? 7.057   3.448   4.470   1.00 0.00 ? 129 CYS A CB   13 
ATOM 10677 S SG   . CYS A 1 24 ? 6.473   4.909   5.394   1.00 0.00 ? 129 CYS A SG   13 
ATOM 10678 H H    . CYS A 1 24 ? 4.725   2.657   5.144   1.00 0.00 ? 129 CYS A H    13 
ATOM 10679 H HA   . CYS A 1 24 ? 7.137   1.306   4.535   1.00 0.00 ? 129 CYS A HA   13 
ATOM 10680 H HB2  . CYS A 1 24 ? 8.123   3.554   4.332   1.00 0.00 ? 129 CYS A HB2  13 
ATOM 10681 H HB3  . CYS A 1 24 ? 6.574   3.450   3.506   1.00 0.00 ? 129 CYS A HB3  13 
ATOM 10682 N N    . PRO A 1 25 ? 8.807   1.704   6.495   1.00 0.00 ? 130 PRO A N    13 
ATOM 10683 C CA   . PRO A 1 25 ? 9.618   1.610   7.711   1.00 0.00 ? 130 PRO A CA   13 
ATOM 10684 C C    . PRO A 1 25 ? 10.051  2.979   8.223   1.00 0.00 ? 130 PRO A C    13 
ATOM 10685 O O    . PRO A 1 25 ? 10.047  3.959   7.478   1.00 0.00 ? 130 PRO A O    13 
ATOM 10686 C CB   . PRO A 1 25 ? 10.847  0.793   7.272   1.00 0.00 ? 130 PRO A CB   13 
ATOM 10687 C CG   . PRO A 1 25 ? 10.581  0.376   5.858   1.00 0.00 ? 130 PRO A CG   13 
ATOM 10688 C CD   . PRO A 1 25 ? 9.597   1.364   5.309   1.00 0.00 ? 130 PRO A CD   13 
ATOM 10689 H HA   . PRO A 1 25 ? 9.095   1.084   8.495   1.00 0.00 ? 130 PRO A HA   13 
ATOM 10690 H HB2  . PRO A 1 25 ? 11.730  1.409   7.338   1.00 0.00 ? 130 PRO A HB2  13 
ATOM 10691 H HB3  . PRO A 1 25 ? 10.956  -0.066  7.919   1.00 0.00 ? 130 PRO A HB3  13 
ATOM 10692 H HG2  . PRO A 1 25 ? 11.499  0.407   5.289   1.00 0.00 ? 130 PRO A HG2  13 
ATOM 10693 H HG3  . PRO A 1 25 ? 10.163  -0.620  5.841   1.00 0.00 ? 130 PRO A HG3  13 
ATOM 10694 H HD2  . PRO A 1 25 ? 10.107  2.233   4.920   1.00 0.00 ? 130 PRO A HD2  13 
ATOM 10695 H HD3  . PRO A 1 25 ? 8.978   0.911   4.548   1.00 0.00 ? 130 PRO A HD3  13 
ATOM 10696 N N    . TYR A 1 26 ? 10.432  3.036   9.499   1.00 0.00 ? 131 TYR A N    13 
ATOM 10697 C CA   . TYR A 1 26 ? 10.868  4.282   10.119  1.00 0.00 ? 131 TYR A CA   13 
ATOM 10698 C C    . TYR A 1 26 ? 9.817   5.376   9.952   1.00 0.00 ? 131 TYR A C    13 
ATOM 10699 O O    . TYR A 1 26 ? 9.918   6.152   8.979   1.00 0.00 ? 131 TYR A O    13 
ATOM 10700 C CB   . TYR A 1 26 ? 12.199  4.735   9.519   1.00 0.00 ? 131 TYR A CB   13 
ATOM 10701 C CG   . TYR A 1 26 ? 13.321  3.737   9.698   1.00 0.00 ? 131 TYR A CG   13 
ATOM 10702 C CD1  . TYR A 1 26 ? 14.092  3.733   10.853  1.00 0.00 ? 131 TYR A CD1  13 
ATOM 10703 C CD2  . TYR A 1 26 ? 13.609  2.802   8.713   1.00 0.00 ? 131 TYR A CD2  13 
ATOM 10704 C CE1  . TYR A 1 26 ? 15.119  2.823   11.022  1.00 0.00 ? 131 TYR A CE1  13 
ATOM 10705 C CE2  . TYR A 1 26 ? 14.634  1.889   8.874   1.00 0.00 ? 131 TYR A CE2  13 
ATOM 10706 C CZ   . TYR A 1 26 ? 15.386  1.904   10.030  1.00 0.00 ? 131 TYR A CZ   13 
ATOM 10707 O OH   . TYR A 1 26 ? 16.408  0.998   10.194  1.00 0.00 ? 131 TYR A OH   13 
ATOM 10708 O OXT  . TYR A 1 26 ? 8.901   5.447   10.797  1.00 0.00 ? 131 TYR A OXT  13 
ATOM 10709 H H    . TYR A 1 26 ? 10.423  2.219   10.034  1.00 0.00 ? 131 TYR A H    13 
ATOM 10710 H HA   . TYR A 1 26 ? 11.007  4.093   11.173  1.00 0.00 ? 131 TYR A HA   13 
ATOM 10711 H HB2  . TYR A 1 26 ? 12.070  4.902   8.460   1.00 0.00 ? 131 TYR A HB2  13 
ATOM 10712 H HB3  . TYR A 1 26 ? 12.496  5.658   9.989   1.00 0.00 ? 131 TYR A HB3  13 
ATOM 10713 H HD1  . TYR A 1 26 ? 13.881  4.454   11.629  1.00 0.00 ? 131 TYR A HD1  13 
ATOM 10714 H HD2  . TYR A 1 26 ? 13.019  2.793   7.808   1.00 0.00 ? 131 TYR A HD2  13 
ATOM 10715 H HE1  . TYR A 1 26 ? 15.708  2.836   11.927  1.00 0.00 ? 131 TYR A HE1  13 
ATOM 10716 H HE2  . TYR A 1 26 ? 14.843  1.169   8.097   1.00 0.00 ? 131 TYR A HE2  13 
ATOM 10717 H HH   . TYR A 1 26 ? 16.947  0.975   9.401   1.00 0.00 ? 131 TYR A HH   13 
ATOM 10718 N N    . PRO B 2 1  ? 0.328   16.312  -4.852  1.00 0.00 ? 25  PRO B N    13 
ATOM 10719 C CA   . PRO B 2 1  ? -1.056  16.749  -5.165  1.00 0.00 ? 25  PRO B CA   13 
ATOM 10720 C C    . PRO B 2 1  ? -2.003  15.558  -5.292  1.00 0.00 ? 25  PRO B C    13 
ATOM 10721 O O    . PRO B 2 1  ? -3.220  15.730  -5.378  1.00 0.00 ? 25  PRO B O    13 
ATOM 10722 C CB   . PRO B 2 1  ? -1.039  17.541  -6.465  1.00 0.00 ? 25  PRO B CB   13 
ATOM 10723 C CG   . PRO B 2 1  ? 0.364   17.402  -6.947  1.00 0.00 ? 25  PRO B CG   13 
ATOM 10724 C CD   . PRO B 2 1  ? 1.207   17.112  -5.726  1.00 0.00 ? 25  PRO B CD   13 
ATOM 10725 H H2   . PRO B 2 1  ? 0.335   15.288  -4.988  1.00 0.00 ? 25  PRO B H2   13 
ATOM 10726 H H3   . PRO B 2 1  ? 0.410   16.418  -3.813  1.00 0.00 ? 25  PRO B H3   13 
ATOM 10727 H HA   . PRO B 2 1  ? -1.402  17.388  -4.366  1.00 0.00 ? 25  PRO B HA   13 
ATOM 10728 H HB2  . PRO B 2 1  ? -1.746  17.114  -7.162  1.00 0.00 ? 25  PRO B HB2  13 
ATOM 10729 H HB3  . PRO B 2 1  ? -1.290  18.573  -6.268  1.00 0.00 ? 25  PRO B HB3  13 
ATOM 10730 H HG2  . PRO B 2 1  ? 0.429   16.584  -7.650  1.00 0.00 ? 25  PRO B HG2  13 
ATOM 10731 H HG3  . PRO B 2 1  ? 0.684   18.322  -7.412  1.00 0.00 ? 25  PRO B HG3  13 
ATOM 10732 H HD2  . PRO B 2 1  ? 2.085   16.547  -6.003  1.00 0.00 ? 25  PRO B HD2  13 
ATOM 10733 H HD3  . PRO B 2 1  ? 1.490   18.033  -5.238  1.00 0.00 ? 25  PRO B HD3  13 
ATOM 10734 N N    . THR B 2 2  ? -1.441  14.353  -5.301  1.00 0.00 ? 26  THR B N    13 
ATOM 10735 C CA   . THR B 2 2  ? -2.240  13.139  -5.418  1.00 0.00 ? 26  THR B CA   13 
ATOM 10736 C C    . THR B 2 2  ? -2.992  12.846  -4.120  1.00 0.00 ? 26  THR B C    13 
ATOM 10737 O O    . THR B 2 2  ? -2.463  13.056  -3.029  1.00 0.00 ? 26  THR B O    13 
ATOM 10738 C CB   . THR B 2 2  ? -1.368  11.922  -5.777  1.00 0.00 ? 26  THR B CB   13 
ATOM 10739 O OG1  . THR B 2 2  ? -2.142  10.720  -5.684  1.00 0.00 ? 26  THR B OG1  13 
ATOM 10740 C CG2  . THR B 2 2  ? -0.161  11.828  -4.857  1.00 0.00 ? 26  THR B CG2  13 
ATOM 10741 H H    . THR B 2 2  ? -0.467  14.278  -5.228  1.00 0.00 ? 26  THR B H    13 
ATOM 10742 H HA   . THR B 2 2  ? -2.955  13.290  -6.213  1.00 0.00 ? 26  THR B HA   13 
ATOM 10743 H HB   . THR B 2 2  ? -1.020  12.038  -6.793  1.00 0.00 ? 26  THR B HB   13 
ATOM 10744 H HG1  . THR B 2 2  ? -1.751  10.042  -6.240  1.00 0.00 ? 26  THR B HG1  13 
ATOM 10745 H HG21 . THR B 2 2  ? 0.419   10.954  -5.113  1.00 0.00 ? 26  THR B HG21 13 
ATOM 10746 H HG22 . THR B 2 2  ? -0.494  11.752  -3.832  1.00 0.00 ? 26  THR B HG22 13 
ATOM 10747 H HG23 . THR B 2 2  ? 0.449   12.711  -4.972  1.00 0.00 ? 26  THR B HG23 13 
ATOM 10748 N N    . PRO B 2 3  ? -4.243  12.356  -4.225  1.00 0.00 ? 27  PRO B N    13 
ATOM 10749 C CA   . PRO B 2 3  ? -5.071  12.038  -3.073  1.00 0.00 ? 27  PRO B CA   13 
ATOM 10750 C C    . PRO B 2 3  ? -4.966  10.573  -2.669  1.00 0.00 ? 27  PRO B C    13 
ATOM 10751 O O    . PRO B 2 3  ? -4.008  9.886   -3.026  1.00 0.00 ? 27  PRO B O    13 
ATOM 10752 C CB   . PRO B 2 3  ? -6.469  12.354  -3.595  1.00 0.00 ? 27  PRO B CB   13 
ATOM 10753 C CG   . PRO B 2 3  ? -6.417  12.039  -5.059  1.00 0.00 ? 27  PRO B CG   13 
ATOM 10754 C CD   . PRO B 2 3  ? -4.962  12.074  -5.477  1.00 0.00 ? 27  PRO B CD   13 
ATOM 10755 H HA   . PRO B 2 3  ? -4.844  12.669  -2.227  1.00 0.00 ? 27  PRO B HA   13 
ATOM 10756 H HB2  . PRO B 2 3  ? -7.194  11.738  -3.083  1.00 0.00 ? 27  PRO B HB2  13 
ATOM 10757 H HB3  . PRO B 2 3  ? -6.691  13.397  -3.426  1.00 0.00 ? 27  PRO B HB3  13 
ATOM 10758 H HG2  . PRO B 2 3  ? -6.827  11.056  -5.233  1.00 0.00 ? 27  PRO B HG2  13 
ATOM 10759 H HG3  . PRO B 2 3  ? -6.979  12.779  -5.609  1.00 0.00 ? 27  PRO B HG3  13 
ATOM 10760 H HD2  . PRO B 2 3  ? -4.664  11.119  -5.883  1.00 0.00 ? 27  PRO B HD2  13 
ATOM 10761 H HD3  . PRO B 2 3  ? -4.797  12.858  -6.199  1.00 0.00 ? 27  PRO B HD3  13 
ATOM 10762 N N    . GLU B 2 4  ? -5.959  10.102  -1.924  1.00 0.00 ? 28  GLU B N    13 
ATOM 10763 C CA   . GLU B 2 4  ? -5.985  8.717   -1.469  1.00 0.00 ? 28  GLU B CA   13 
ATOM 10764 C C    . GLU B 2 4  ? -6.568  7.801   -2.518  1.00 0.00 ? 28  GLU B C    13 
ATOM 10765 O O    . GLU B 2 4  ? -7.538  7.078   -2.286  1.00 0.00 ? 28  GLU B O    13 
ATOM 10766 C CB   . GLU B 2 4  ? -6.760  8.585   -0.192  1.00 0.00 ? 28  GLU B CB   13 
ATOM 10767 C CG   . GLU B 2 4  ? -7.964  9.486   -0.119  1.00 0.00 ? 28  GLU B CG   13 
ATOM 10768 C CD   . GLU B 2 4  ? -8.872  9.382   -1.330  1.00 0.00 ? 28  GLU B CD   13 
ATOM 10769 O OE1  . GLU B 2 4  ? -9.743  8.487   -1.343  1.00 0.00 ? 28  GLU B OE1  13 
ATOM 10770 O OE2  . GLU B 2 4  ? -8.713  10.196  -2.263  1.00 0.00 ? 28  GLU B OE2  13 
ATOM 10771 H H    . GLU B 2 4  ? -6.695  10.700  -1.682  1.00 0.00 ? 28  GLU B H    13 
ATOM 10772 H HA   . GLU B 2 4  ? -4.973  8.419   -1.279  1.00 0.00 ? 28  GLU B HA   13 
ATOM 10773 H HB2  . GLU B 2 4  ? -7.091  7.562   -0.084  1.00 0.00 ? 28  GLU B HB2  13 
ATOM 10774 H HB3  . GLU B 2 4  ? -6.101  8.827   0.617   1.00 0.00 ? 28  GLU B HB3  13 
ATOM 10775 H HG2  . GLU B 2 4  ? -8.515  9.206   0.739   1.00 0.00 ? 28  GLU B HG2  13 
ATOM 10776 H HG3  . GLU B 2 4  ? -7.631  10.506  -0.019  1.00 0.00 ? 28  GLU B HG3  13 
ATOM 10777 N N    . MET B 2 5  ? -5.951  7.844   -3.663  1.00 0.00 ? 29  MET B N    13 
ATOM 10778 C CA   . MET B 2 5  ? -6.362  7.027   -4.793  1.00 0.00 ? 29  MET B CA   13 
ATOM 10779 C C    . MET B 2 5  ? -5.938  5.588   -4.567  1.00 0.00 ? 29  MET B C    13 
ATOM 10780 O O    . MET B 2 5  ? -4.752  5.260   -4.588  1.00 0.00 ? 29  MET B O    13 
ATOM 10781 C CB   . MET B 2 5  ? -5.756  7.554   -6.090  1.00 0.00 ? 29  MET B CB   13 
ATOM 10782 C CG   . MET B 2 5  ? -6.790  7.993   -7.113  1.00 0.00 ? 29  MET B CG   13 
ATOM 10783 S SD   . MET B 2 5  ? -7.860  6.639   -7.639  1.00 0.00 ? 29  MET B SD   13 
ATOM 10784 C CE   . MET B 2 5  ? -8.912  7.475   -8.824  1.00 0.00 ? 29  MET B CE   13 
ATOM 10785 H H    . MET B 2 5  ? -5.198  8.450   -3.747  1.00 0.00 ? 29  MET B H    13 
ATOM 10786 H HA   . MET B 2 5  ? -7.439  7.063   -4.861  1.00 0.00 ? 29  MET B HA   13 
ATOM 10787 H HB2  . MET B 2 5  ? -5.122  8.400   -5.862  1.00 0.00 ? 29  MET B HB2  13 
ATOM 10788 H HB3  . MET B 2 5  ? -5.156  6.773   -6.527  1.00 0.00 ? 29  MET B HB3  13 
ATOM 10789 H HG2  . MET B 2 5  ? -7.401  8.769   -6.678  1.00 0.00 ? 29  MET B HG2  13 
ATOM 10790 H HG3  . MET B 2 5  ? -6.276  8.384   -7.979  1.00 0.00 ? 29  MET B HG3  13 
ATOM 10791 H HE1  . MET B 2 5  ? -8.301  7.921   -9.595  1.00 0.00 ? 29  MET B HE1  13 
ATOM 10792 H HE2  . MET B 2 5  ? -9.479  8.244   -8.323  1.00 0.00 ? 29  MET B HE2  13 
ATOM 10793 H HE3  . MET B 2 5  ? -9.588  6.761   -9.272  1.00 0.00 ? 29  MET B HE3  13 
ATOM 10794 N N    . ARG B 2 6  ? -6.926  4.738   -4.351  1.00 0.00 ? 30  ARG B N    13 
ATOM 10795 C CA   . ARG B 2 6  ? -6.687  3.332   -4.087  1.00 0.00 ? 30  ARG B CA   13 
ATOM 10796 C C    . ARG B 2 6  ? -6.314  2.568   -5.349  1.00 0.00 ? 30  ARG B C    13 
ATOM 10797 O O    . ARG B 2 6  ? -6.558  3.019   -6.468  1.00 0.00 ? 30  ARG B O    13 
ATOM 10798 C CB   . ARG B 2 6  ? -7.913  2.709   -3.441  1.00 0.00 ? 30  ARG B CB   13 
ATOM 10799 C CG   . ARG B 2 6  ? -7.822  2.675   -1.935  1.00 0.00 ? 30  ARG B CG   13 
ATOM 10800 C CD   . ARG B 2 6  ? -8.357  1.381   -1.376  1.00 0.00 ? 30  ARG B CD   13 
ATOM 10801 N NE   . ARG B 2 6  ? -8.256  1.338   0.076   1.00 0.00 ? 30  ARG B NE   13 
ATOM 10802 C CZ   . ARG B 2 6  ? -8.713  0.337   0.822   1.00 0.00 ? 30  ARG B CZ   13 
ATOM 10803 N NH1  . ARG B 2 6  ? -9.305  -0.705  0.251   1.00 0.00 ? 30  ARG B NH1  13 
ATOM 10804 N NH2  . ARG B 2 6  ? -8.579  0.375   2.141   1.00 0.00 ? 30  ARG B NH2  13 
ATOM 10805 H H    . ARG B 2 6  ? -7.847  5.067   -4.377  1.00 0.00 ? 30  ARG B H    13 
ATOM 10806 H HA   . ARG B 2 6  ? -5.867  3.263   -3.386  1.00 0.00 ? 30  ARG B HA   13 
ATOM 10807 H HB2  . ARG B 2 6  ? -8.785  3.283   -3.712  1.00 0.00 ? 30  ARG B HB2  13 
ATOM 10808 H HB3  . ARG B 2 6  ? -8.027  1.701   -3.801  1.00 0.00 ? 30  ARG B HB3  13 
ATOM 10809 H HG2  . ARG B 2 6  ? -6.787  2.776   -1.646  1.00 0.00 ? 30  ARG B HG2  13 
ATOM 10810 H HG3  . ARG B 2 6  ? -8.393  3.497   -1.529  1.00 0.00 ? 30  ARG B HG3  13 
ATOM 10811 H HD2  . ARG B 2 6  ? -9.390  1.288   -1.660  1.00 0.00 ? 30  ARG B HD2  13 
ATOM 10812 H HD3  . ARG B 2 6  ? -7.787  0.567   -1.797  1.00 0.00 ? 30  ARG B HD3  13 
ATOM 10813 H HE   . ARG B 2 6  ? -7.828  2.098   0.518   1.00 0.00 ? 30  ARG B HE   13 
ATOM 10814 H HH11 . ARG B 2 6  ? -9.409  -0.738  -0.744  1.00 0.00 ? 30  ARG B HH11 13 
ATOM 10815 H HH12 . ARG B 2 6  ? -9.647  -1.456  0.814   1.00 0.00 ? 30  ARG B HH12 13 
ATOM 10816 H HH21 . ARG B 2 6  ? -8.134  1.159   2.575   1.00 0.00 ? 30  ARG B HH21 13 
ATOM 10817 H HH22 . ARG B 2 6  ? -8.923  -0.378  2.701   1.00 0.00 ? 30  ARG B HH22 13 
ATOM 10818 N N    . GLU B 2 7  ? -5.717  1.401   -5.143  1.00 0.00 ? 31  GLU B N    13 
ATOM 10819 C CA   . GLU B 2 7  ? -5.288  0.534   -6.231  1.00 0.00 ? 31  GLU B CA   13 
ATOM 10820 C C    . GLU B 2 7  ? -4.889  -0.814  -5.683  1.00 0.00 ? 31  GLU B C    13 
ATOM 10821 O O    . GLU B 2 7  ? -4.289  -0.905  -4.619  1.00 0.00 ? 31  GLU B O    13 
ATOM 10822 C CB   . GLU B 2 7  ? -4.116  1.157   -6.987  1.00 0.00 ? 31  GLU B CB   13 
ATOM 10823 C CG   . GLU B 2 7  ? -3.520  0.235   -8.036  1.00 0.00 ? 31  GLU B CG   13 
ATOM 10824 C CD   . GLU B 2 7  ? -4.404  0.094   -9.260  1.00 0.00 ? 31  GLU B CD   13 
ATOM 10825 O OE1  . GLU B 2 7  ? -4.254  0.905   -10.198 1.00 0.00 ? 31  GLU B OE1  13 
ATOM 10826 O OE2  . GLU B 2 7  ? -5.245  -0.830  -9.281  1.00 0.00 ? 31  GLU B OE2  13 
ATOM 10827 H H    . GLU B 2 7  ? -5.558  1.111   -4.221  1.00 0.00 ? 31  GLU B H    13 
ATOM 10828 H HA   . GLU B 2 7  ? -6.117  0.392   -6.906  1.00 0.00 ? 31  GLU B HA   13 
ATOM 10829 H HB2  . GLU B 2 7  ? -4.456  2.057   -7.478  1.00 0.00 ? 31  GLU B HB2  13 
ATOM 10830 H HB3  . GLU B 2 7  ? -3.341  1.411   -6.281  1.00 0.00 ? 31  GLU B HB3  13 
ATOM 10831 H HG2  . GLU B 2 7  ? -2.568  0.632   -8.340  1.00 0.00 ? 31  GLU B HG2  13 
ATOM 10832 H HG3  . GLU B 2 7  ? -3.377  -0.741  -7.600  1.00 0.00 ? 31  GLU B HG3  13 
ATOM 10833 N N    . LYS B 2 8  ? -5.223  -1.855  -6.422  1.00 0.00 ? 32  LYS B N    13 
ATOM 10834 C CA   . LYS B 2 8  ? -4.930  -3.208  -6.012  1.00 0.00 ? 32  LYS B CA   13 
ATOM 10835 C C    . LYS B 2 8  ? -3.435  -3.500  -6.067  1.00 0.00 ? 32  LYS B C    13 
ATOM 10836 O O    . LYS B 2 8  ? -2.859  -3.725  -7.131  1.00 0.00 ? 32  LYS B O    13 
ATOM 10837 C CB   . LYS B 2 8  ? -5.717  -4.162  -6.886  1.00 0.00 ? 32  LYS B CB   13 
ATOM 10838 C CG   . LYS B 2 8  ? -7.169  -3.740  -7.028  1.00 0.00 ? 32  LYS B CG   13 
ATOM 10839 C CD   . LYS B 2 8  ? -8.020  -4.835  -7.641  1.00 0.00 ? 32  LYS B CD   13 
ATOM 10840 C CE   . LYS B 2 8  ? -8.276  -5.935  -6.638  1.00 0.00 ? 32  LYS B CE   13 
ATOM 10841 N NZ   . LYS B 2 8  ? -8.422  -7.266  -7.289  1.00 0.00 ? 32  LYS B NZ   13 
ATOM 10842 H H    . LYS B 2 8  ? -5.684  -1.710  -7.271  1.00 0.00 ? 32  LYS B H    13 
ATOM 10843 H HA   . LYS B 2 8  ? -5.263  -3.319  -4.993  1.00 0.00 ? 32  LYS B HA   13 
ATOM 10844 H HB2  . LYS B 2 8  ? -5.267  -4.198  -7.866  1.00 0.00 ? 32  LYS B HB2  13 
ATOM 10845 H HB3  . LYS B 2 8  ? -5.690  -5.137  -6.446  1.00 0.00 ? 32  LYS B HB3  13 
ATOM 10846 H HG2  . LYS B 2 8  ? -7.554  -3.497  -6.050  1.00 0.00 ? 32  LYS B HG2  13 
ATOM 10847 H HG3  . LYS B 2 8  ? -7.216  -2.870  -7.646  1.00 0.00 ? 32  LYS B HG3  13 
ATOM 10848 H HD2  . LYS B 2 8  ? -8.964  -4.417  -7.952  1.00 0.00 ? 32  LYS B HD2  13 
ATOM 10849 H HD3  . LYS B 2 8  ? -7.504  -5.249  -8.496  1.00 0.00 ? 32  LYS B HD3  13 
ATOM 10850 H HE2  . LYS B 2 8  ? -7.445  -5.960  -5.956  1.00 0.00 ? 32  LYS B HE2  13 
ATOM 10851 H HE3  . LYS B 2 8  ? -9.181  -5.706  -6.094  1.00 0.00 ? 32  LYS B HE3  13 
ATOM 10852 H HZ1  . LYS B 2 8  ? -7.563  -7.495  -7.830  1.00 0.00 ? 32  LYS B HZ1  13 
ATOM 10853 H HZ2  . LYS B 2 8  ? -9.234  -7.260  -7.937  1.00 0.00 ? 32  LYS B HZ2  13 
ATOM 10854 H HZ3  . LYS B 2 8  ? -8.572  -8.001  -6.569  1.00 0.00 ? 32  LYS B HZ3  13 
ATOM 10855 N N    . LEU B 2 9  ? -2.833  -3.491  -4.889  1.00 0.00 ? 33  LEU B N    13 
ATOM 10856 C CA   . LEU B 2 9  ? -1.410  -3.731  -4.717  1.00 0.00 ? 33  LEU B CA   13 
ATOM 10857 C C    . LEU B 2 9  ? -1.131  -5.149  -4.251  1.00 0.00 ? 33  LEU B C    13 
ATOM 10858 O O    . LEU B 2 9  ? -1.292  -5.477  -3.076  1.00 0.00 ? 33  LEU B O    13 
ATOM 10859 C CB   . LEU B 2 9  ? -0.875  -2.734  -3.726  1.00 0.00 ? 33  LEU B CB   13 
ATOM 10860 C CG   . LEU B 2 9  ? -1.541  -1.374  -3.802  1.00 0.00 ? 33  LEU B CG   13 
ATOM 10861 C CD1  . LEU B 2 9  ? -1.156  -0.499  -2.617  1.00 0.00 ? 33  LEU B CD1  13 
ATOM 10862 C CD2  . LEU B 2 9  ? -1.177  -0.711  -5.120  1.00 0.00 ? 33  LEU B CD2  13 
ATOM 10863 H H    . LEU B 2 9  ? -3.368  -3.296  -4.098  1.00 0.00 ? 33  LEU B H    13 
ATOM 10864 H HA   . LEU B 2 9  ? -0.907  -3.567  -5.649  1.00 0.00 ? 33  LEU B HA   13 
ATOM 10865 H HB2  . LEU B 2 9  ? -0.981  -3.128  -2.730  1.00 0.00 ? 33  LEU B HB2  13 
ATOM 10866 H HB3  . LEU B 2 9  ? 0.161   -2.606  -3.942  1.00 0.00 ? 33  LEU B HB3  13 
ATOM 10867 H HG   . LEU B 2 9  ? -2.606  -1.514  -3.781  1.00 0.00 ? 33  LEU B HG   13 
ATOM 10868 H HD11 . LEU B 2 9  ? -1.950  0.204   -2.420  1.00 0.00 ? 33  LEU B HD11 13 
ATOM 10869 H HD12 . LEU B 2 9  ? -0.249  0.040   -2.842  1.00 0.00 ? 33  LEU B HD12 13 
ATOM 10870 H HD13 . LEU B 2 9  ? -1.002  -1.121  -1.748  1.00 0.00 ? 33  LEU B HD13 13 
ATOM 10871 H HD21 . LEU B 2 9  ? -2.007  -0.112  -5.465  1.00 0.00 ? 33  LEU B HD21 13 
ATOM 10872 H HD22 . LEU B 2 9  ? -0.953  -1.480  -5.852  1.00 0.00 ? 33  LEU B HD22 13 
ATOM 10873 H HD23 . LEU B 2 9  ? -0.311  -0.082  -4.979  1.00 0.00 ? 33  LEU B HD23 13 
ATOM 10874 N N    . CYS B 2 10 ? -0.715  -5.987  -5.189  1.00 0.00 ? 34  CYS B N    13 
ATOM 10875 C CA   . CYS B 2 10 ? -0.411  -7.377  -4.887  1.00 0.00 ? 34  CYS B CA   13 
ATOM 10876 C C    . CYS B 2 10 ? 1.079   -7.587  -4.700  1.00 0.00 ? 34  CYS B C    13 
ATOM 10877 O O    . CYS B 2 10 ? 1.811   -7.861  -5.650  1.00 0.00 ? 34  CYS B O    13 
ATOM 10878 C CB   . CYS B 2 10 ? -0.937  -8.282  -5.989  1.00 0.00 ? 34  CYS B CB   13 
ATOM 10879 S SG   . CYS B 2 10 ? -1.452  -9.929  -5.412  1.00 0.00 ? 34  CYS B SG   13 
ATOM 10880 H H    . CYS B 2 10 ? -0.615  -5.661  -6.108  1.00 0.00 ? 34  CYS B H    13 
ATOM 10881 H HA   . CYS B 2 10 ? -0.910  -7.626  -3.965  1.00 0.00 ? 34  CYS B HA   13 
ATOM 10882 H HB2  . CYS B 2 10 ? -1.791  -7.809  -6.432  1.00 0.00 ? 34  CYS B HB2  13 
ATOM 10883 H HB3  . CYS B 2 10 ? -0.169  -8.413  -6.738  1.00 0.00 ? 34  CYS B HB3  13 
ATOM 10884 N N    . GLY B 2 11 ? 1.506   -7.460  -3.456  1.00 0.00 ? 35  GLY B N    13 
ATOM 10885 C CA   . GLY B 2 11 ? 2.908   -7.628  -3.111  1.00 0.00 ? 35  GLY B CA   13 
ATOM 10886 C C    . GLY B 2 11 ? 3.815   -6.648  -3.831  1.00 0.00 ? 35  GLY B C    13 
ATOM 10887 O O    . GLY B 2 11 ? 4.242   -5.657  -3.244  1.00 0.00 ? 35  GLY B O    13 
ATOM 10888 H H    . GLY B 2 11 ? 0.853   -7.252  -2.760  1.00 0.00 ? 35  GLY B H    13 
ATOM 10889 H HA2  . GLY B 2 11 ? 3.021   -7.484  -2.047  1.00 0.00 ? 35  GLY B HA2  13 
ATOM 10890 H HA3  . GLY B 2 11 ? 3.212   -8.630  -3.354  1.00 0.00 ? 35  GLY B HA3  13 
ATOM 10891 N N    . HIS B 2 12 ? 4.131   -6.929  -5.095  1.00 0.00 ? 36  HIS B N    13 
ATOM 10892 C CA   . HIS B 2 12 ? 4.984   -6.051  -5.873  1.00 0.00 ? 36  HIS B CA   13 
ATOM 10893 C C    . HIS B 2 12 ? 4.335   -4.687  -6.072  1.00 0.00 ? 36  HIS B C    13 
ATOM 10894 O O    . HIS B 2 12 ? 4.947   -3.670  -5.772  1.00 0.00 ? 36  HIS B O    13 
ATOM 10895 C CB   . HIS B 2 12 ? 5.334   -6.676  -7.215  1.00 0.00 ? 36  HIS B CB   13 
ATOM 10896 C CG   . HIS B 2 12 ? 6.681   -6.259  -7.698  1.00 0.00 ? 36  HIS B CG   13 
ATOM 10897 N ND1  . HIS B 2 12 ? 7.116   -6.421  -8.992  1.00 0.00 ? 36  HIS B ND1  13 
ATOM 10898 C CD2  . HIS B 2 12 ? 7.705   -5.671  -7.024  1.00 0.00 ? 36  HIS B CD2  13 
ATOM 10899 C CE1  . HIS B 2 12 ? 8.361   -5.940  -9.067  1.00 0.00 ? 36  HIS B CE1  13 
ATOM 10900 N NE2  . HIS B 2 12 ? 8.767   -5.471  -7.900  1.00 0.00 ? 36  HIS B NE2  13 
ATOM 10901 H H    . HIS B 2 12 ? 3.806   -7.751  -5.501  1.00 0.00 ? 36  HIS B H    13 
ATOM 10902 H HA   . HIS B 2 12 ? 5.895   -5.911  -5.310  1.00 0.00 ? 36  HIS B HA   13 
ATOM 10903 H HB2  . HIS B 2 12 ? 5.327   -7.751  -7.121  1.00 0.00 ? 36  HIS B HB2  13 
ATOM 10904 H HB3  . HIS B 2 12 ? 4.605   -6.373  -7.951  1.00 0.00 ? 36  HIS B HB3  13 
ATOM 10905 H HD1  . HIS B 2 12 ? 6.604   -6.819  -9.727  1.00 0.00 ? 36  HIS B HD1  13 
ATOM 10906 H HD2  . HIS B 2 12 ? 7.698   -5.391  -5.970  1.00 0.00 ? 36  HIS B HD2  13 
ATOM 10907 H HE1  . HIS B 2 12 ? 8.948   -5.922  -9.971  1.00 0.00 ? 36  HIS B HE1  13 
ATOM 10908 N N    . HIS B 2 13 ? 3.115   -4.649  -6.610  1.00 0.00 ? 37  HIS B N    13 
ATOM 10909 C CA   . HIS B 2 13 ? 2.428   -3.370  -6.764  1.00 0.00 ? 37  HIS B CA   13 
ATOM 10910 C C    . HIS B 2 13 ? 2.389   -2.719  -5.416  1.00 0.00 ? 37  HIS B C    13 
ATOM 10911 O O    . HIS B 2 13 ? 2.539   -1.507  -5.265  1.00 0.00 ? 37  HIS B O    13 
ATOM 10912 C CB   . HIS B 2 13 ? 0.995   -3.550  -7.244  1.00 0.00 ? 37  HIS B CB   13 
ATOM 10913 C CG   . HIS B 2 13 ? 0.873   -3.612  -8.717  1.00 0.00 ? 37  HIS B CG   13 
ATOM 10914 N ND1  . HIS B 2 13 ? -0.056  -2.907  -9.440  1.00 0.00 ? 37  HIS B ND1  13 
ATOM 10915 C CD2  . HIS B 2 13 ? 1.596   -4.318  -9.604  1.00 0.00 ? 37  HIS B CD2  13 
ATOM 10916 C CE1  . HIS B 2 13 ? 0.127   -3.201  -10.729 1.00 0.00 ? 37  HIS B CE1  13 
ATOM 10917 N NE2  . HIS B 2 13 ? 1.122   -4.057  -10.888 1.00 0.00 ? 37  HIS B NE2  13 
ATOM 10918 H H    . HIS B 2 13 ? 2.682   -5.478  -6.903  1.00 0.00 ? 37  HIS B H    13 
ATOM 10919 H HA   . HIS B 2 13 ? 2.981   -2.753  -7.457  1.00 0.00 ? 37  HIS B HA   13 
ATOM 10920 H HB2  . HIS B 2 13 ? 0.600   -4.467  -6.839  1.00 0.00 ? 37  HIS B HB2  13 
ATOM 10921 H HB3  . HIS B 2 13 ? 0.402   -2.716  -6.890  1.00 0.00 ? 37  HIS B HB3  13 
ATOM 10922 H HD1  . HIS B 2 13 ? -0.731  -2.299  -9.076  1.00 0.00 ? 37  HIS B HD1  13 
ATOM 10923 H HD2  . HIS B 2 13 ? 2.416   -4.976  -9.357  1.00 0.00 ? 37  HIS B HD2  13 
ATOM 10924 H HE1  . HIS B 2 13 ? -0.462  -2.788  -11.530 1.00 0.00 ? 37  HIS B HE1  13 
ATOM 10925 N N    . PHE B 2 14 ? 2.180   -3.573  -4.437  1.00 0.00 ? 38  PHE B N    13 
ATOM 10926 C CA   . PHE B 2 14 ? 2.123   -3.169  -3.066  1.00 0.00 ? 38  PHE B CA   13 
ATOM 10927 C C    . PHE B 2 14 ? 3.470   -2.650  -2.635  1.00 0.00 ? 38  PHE B C    13 
ATOM 10928 O O    . PHE B 2 14 ? 3.568   -1.829  -1.731  1.00 0.00 ? 38  PHE B O    13 
ATOM 10929 C CB   . PHE B 2 14 ? 1.651   -4.345  -2.227  1.00 0.00 ? 38  PHE B CB   13 
ATOM 10930 C CG   . PHE B 2 14 ? 1.698   -4.071  -0.772  1.00 0.00 ? 38  PHE B CG   13 
ATOM 10931 C CD1  . PHE B 2 14 ? 1.072   -2.947  -0.281  1.00 0.00 ? 38  PHE B CD1  13 
ATOM 10932 C CD2  . PHE B 2 14 ? 2.370   -4.910  0.096   1.00 0.00 ? 38  PHE B CD2  13 
ATOM 10933 C CE1  . PHE B 2 14 ? 1.107   -2.656  1.062   1.00 0.00 ? 38  PHE B CE1  13 
ATOM 10934 C CE2  . PHE B 2 14 ? 2.415   -4.627  1.445   1.00 0.00 ? 38  PHE B CE2  13 
ATOM 10935 C CZ   . PHE B 2 14 ? 1.782   -3.495  1.932   1.00 0.00 ? 38  PHE B CZ   13 
ATOM 10936 H H    . PHE B 2 14 ? 2.059   -4.520  -4.656  1.00 0.00 ? 38  PHE B H    13 
ATOM 10937 H HA   . PHE B 2 14 ? 1.409   -2.365  -2.984  1.00 0.00 ? 38  PHE B HA   13 
ATOM 10938 H HB2  . PHE B 2 14 ? 0.627   -4.571  -2.486  1.00 0.00 ? 38  PHE B HB2  13 
ATOM 10939 H HB3  . PHE B 2 14 ? 2.263   -5.201  -2.440  1.00 0.00 ? 38  PHE B HB3  13 
ATOM 10940 H HD1  . PHE B 2 14 ? 0.541   -2.295  -0.971  1.00 0.00 ? 38  PHE B HD1  13 
ATOM 10941 H HD2  . PHE B 2 14 ? 2.859   -5.800  -0.290  1.00 0.00 ? 38  PHE B HD2  13 
ATOM 10942 H HE1  . PHE B 2 14 ? 0.609   -1.775  1.431   1.00 0.00 ? 38  PHE B HE1  13 
ATOM 10943 H HE2  . PHE B 2 14 ? 2.939   -5.290  2.119   1.00 0.00 ? 38  PHE B HE2  13 
ATOM 10944 H HZ   . PHE B 2 14 ? 1.814   -3.267  2.987   1.00 0.00 ? 38  PHE B HZ   13 
ATOM 10945 N N    . VAL B 2 15 ? 4.504   -3.142  -3.293  1.00 0.00 ? 39  VAL B N    13 
ATOM 10946 C CA   . VAL B 2 15 ? 5.850   -2.692  -3.032  1.00 0.00 ? 39  VAL B CA   13 
ATOM 10947 C C    . VAL B 2 15 ? 6.028   -1.307  -3.638  1.00 0.00 ? 39  VAL B C    13 
ATOM 10948 O O    . VAL B 2 15 ? 6.210   -0.337  -2.911  1.00 0.00 ? 39  VAL B O    13 
ATOM 10949 C CB   . VAL B 2 15 ? 6.899   -3.686  -3.590  1.00 0.00 ? 39  VAL B CB   13 
ATOM 10950 C CG1  . VAL B 2 15 ? 8.118   -2.967  -4.142  1.00 0.00 ? 39  VAL B CG1  13 
ATOM 10951 C CG2  . VAL B 2 15 ? 7.316   -4.679  -2.516  1.00 0.00 ? 39  VAL B CG2  13 
ATOM 10952 H H    . VAL B 2 15 ? 4.353   -3.830  -3.972  1.00 0.00 ? 39  VAL B H    13 
ATOM 10953 H HA   . VAL B 2 15 ? 5.972   -2.618  -1.961  1.00 0.00 ? 39  VAL B HA   13 
ATOM 10954 H HB   . VAL B 2 15 ? 6.445   -4.240  -4.397  1.00 0.00 ? 39  VAL B HB   13 
ATOM 10955 H HG11 . VAL B 2 15 ? 8.012   -2.842  -5.209  1.00 0.00 ? 39  VAL B HG11 13 
ATOM 10956 H HG12 . VAL B 2 15 ? 9.000   -3.547  -3.931  1.00 0.00 ? 39  VAL B HG12 13 
ATOM 10957 H HG13 . VAL B 2 15 ? 8.209   -1.998  -3.675  1.00 0.00 ? 39  VAL B HG13 13 
ATOM 10958 H HG21 . VAL B 2 15 ? 6.616   -4.638  -1.695  1.00 0.00 ? 39  VAL B HG21 13 
ATOM 10959 H HG22 . VAL B 2 15 ? 8.305   -4.429  -2.163  1.00 0.00 ? 39  VAL B HG22 13 
ATOM 10960 H HG23 . VAL B 2 15 ? 7.324   -5.676  -2.933  1.00 0.00 ? 39  VAL B HG23 13 
ATOM 10961 N N    . ARG B 2 16 ? 5.953   -1.221  -4.972  1.00 0.00 ? 40  ARG B N    13 
ATOM 10962 C CA   . ARG B 2 16 ? 6.083   0.048   -5.663  1.00 0.00 ? 40  ARG B CA   13 
ATOM 10963 C C    . ARG B 2 16 ? 5.289   1.125   -4.958  1.00 0.00 ? 40  ARG B C    13 
ATOM 10964 O O    . ARG B 2 16 ? 5.871   2.085   -4.476  1.00 0.00 ? 40  ARG B O    13 
ATOM 10965 C CB   . ARG B 2 16 ? 5.611   -0.079  -7.105  1.00 0.00 ? 40  ARG B CB   13 
ATOM 10966 C CG   . ARG B 2 16 ? 6.493   -0.963  -7.954  1.00 0.00 ? 40  ARG B CG   13 
ATOM 10967 C CD   . ARG B 2 16 ? 5.839   -2.298  -8.227  1.00 0.00 ? 40  ARG B CD   13 
ATOM 10968 N NE   . ARG B 2 16 ? 6.144   -2.791  -9.566  1.00 0.00 ? 40  ARG B NE   13 
ATOM 10969 C CZ   . ARG B 2 16 ? 7.373   -3.054  -10.002 1.00 0.00 ? 40  ARG B CZ   13 
ATOM 10970 N NH1  . ARG B 2 16 ? 8.420   -2.878  -9.207  1.00 0.00 ? 40  ARG B NH1  13 
ATOM 10971 N NH2  . ARG B 2 16 ? 7.555   -3.496  -11.240 1.00 0.00 ? 40  ARG B NH2  13 
ATOM 10972 H H    . ARG B 2 16 ? 5.823   -2.032  -5.505  1.00 0.00 ? 40  ARG B H    13 
ATOM 10973 H HA   . ARG B 2 16 ? 7.129   0.333   -5.653  1.00 0.00 ? 40  ARG B HA   13 
ATOM 10974 H HB2  . ARG B 2 16 ? 4.616   -0.498  -7.109  1.00 0.00 ? 40  ARG B HB2  13 
ATOM 10975 H HB3  . ARG B 2 16 ? 5.582   0.903   -7.554  1.00 0.00 ? 40  ARG B HB3  13 
ATOM 10976 H HG2  . ARG B 2 16 ? 6.681   -0.474  -8.885  1.00 0.00 ? 40  ARG B HG2  13 
ATOM 10977 H HG3  . ARG B 2 16 ? 7.425   -1.130  -7.438  1.00 0.00 ? 40  ARG B HG3  13 
ATOM 10978 H HD2  . ARG B 2 16 ? 6.195   -3.004  -7.499  1.00 0.00 ? 40  ARG B HD2  13 
ATOM 10979 H HD3  . ARG B 2 16 ? 4.769   -2.187  -8.128  1.00 0.00 ? 40  ARG B HD3  13 
ATOM 10980 H HE   . ARG B 2 16 ? 5.391   -2.931  -10.176 1.00 0.00 ? 40  ARG B HE   13 
ATOM 10981 H HH11 . ARG B 2 16 ? 8.290   -2.546  -8.273  1.00 0.00 ? 40  ARG B HH11 13 
ATOM 10982 H HH12 . ARG B 2 16 ? 9.341   -3.078  -9.542  1.00 0.00 ? 40  ARG B HH12 13 
ATOM 10983 H HH21 . ARG B 2 16 ? 6.768   -3.631  -11.843 1.00 0.00 ? 40  ARG B HH21 13 
ATOM 10984 H HH22 . ARG B 2 16 ? 8.478   -3.695  -11.570 1.00 0.00 ? 40  ARG B HH22 13 
ATOM 10985 N N    . ALA B 2 17 ? 3.964   0.973   -4.876  1.00 0.00 ? 41  ALA B N    13 
ATOM 10986 C CA   . ALA B 2 17 ? 3.166   1.978   -4.215  1.00 0.00 ? 41  ALA B CA   13 
ATOM 10987 C C    . ALA B 2 17 ? 3.768   2.270   -2.849  1.00 0.00 ? 41  ALA B C    13 
ATOM 10988 O O    . ALA B 2 17 ? 4.047   3.407   -2.543  1.00 0.00 ? 41  ALA B O    13 
ATOM 10989 C CB   . ALA B 2 17 ? 1.701   1.547   -4.110  1.00 0.00 ? 41  ALA B CB   13 
ATOM 10990 H H    . ALA B 2 17 ? 3.527   0.171   -5.239  1.00 0.00 ? 41  ALA B H    13 
ATOM 10991 H HA   . ALA B 2 17 ? 3.216   2.891   -4.819  1.00 0.00 ? 41  ALA B HA   13 
ATOM 10992 H HB1  . ALA B 2 17 ? 1.113   2.372   -3.739  1.00 0.00 ? 41  ALA B HB1  13 
ATOM 10993 H HB2  . ALA B 2 17 ? 1.606   0.706   -3.432  1.00 0.00 ? 41  ALA B HB2  13 
ATOM 10994 H HB3  . ALA B 2 17 ? 1.342   1.262   -5.087  1.00 0.00 ? 41  ALA B HB3  13 
ATOM 10995 N N    . LEU B 2 18 ? 4.031   1.233   -2.052  1.00 0.00 ? 42  LEU B N    13 
ATOM 10996 C CA   . LEU B 2 18 ? 4.619   1.430   -0.727  1.00 0.00 ? 42  LEU B CA   13 
ATOM 10997 C C    . LEU B 2 18 ? 5.728   2.477   -0.791  1.00 0.00 ? 42  LEU B C    13 
ATOM 10998 O O    . LEU B 2 18 ? 5.883   3.302   0.109   1.00 0.00 ? 42  LEU B O    13 
ATOM 10999 C CB   . LEU B 2 18 ? 5.184   0.110   -0.201  1.00 0.00 ? 42  LEU B CB   13 
ATOM 11000 C CG   . LEU B 2 18 ? 4.895   -0.193  1.267   1.00 0.00 ? 42  LEU B CG   13 
ATOM 11001 C CD1  . LEU B 2 18 ? 5.549   -1.502  1.677   1.00 0.00 ? 42  LEU B CD1  13 
ATOM 11002 C CD2  . LEU B 2 18 ? 5.387   0.945   2.140   1.00 0.00 ? 42  LEU B CD2  13 
ATOM 11003 H H    . LEU B 2 18 ? 3.828   0.321   -2.357  1.00 0.00 ? 42  LEU B H    13 
ATOM 11004 H HA   . LEU B 2 18 ? 3.840   1.782   -0.063  1.00 0.00 ? 42  LEU B HA   13 
ATOM 11005 H HB2  . LEU B 2 18 ? 4.780   -0.689  -0.795  1.00 0.00 ? 42  LEU B HB2  13 
ATOM 11006 H HB3  . LEU B 2 18 ? 6.254   0.126   -0.336  1.00 0.00 ? 42  LEU B HB3  13 
ATOM 11007 H HG   . LEU B 2 18 ? 3.827   -0.292  1.407   1.00 0.00 ? 42  LEU B HG   13 
ATOM 11008 H HD11 . LEU B 2 18 ? 4.916   -2.329  1.386   1.00 0.00 ? 42  LEU B HD11 13 
ATOM 11009 H HD12 . LEU B 2 18 ? 5.689   -1.514  2.748   1.00 0.00 ? 42  LEU B HD12 13 
ATOM 11010 H HD13 . LEU B 2 18 ? 6.508   -1.594  1.189   1.00 0.00 ? 42  LEU B HD13 13 
ATOM 11011 H HD21 . LEU B 2 18 ? 4.583   1.646   2.306   1.00 0.00 ? 42  LEU B HD21 13 
ATOM 11012 H HD22 . LEU B 2 18 ? 6.200   1.442   1.634   1.00 0.00 ? 42  LEU B HD22 13 
ATOM 11013 H HD23 . LEU B 2 18 ? 5.732   0.554   3.086   1.00 0.00 ? 42  LEU B HD23 13 
ATOM 11014 N N    . VAL B 2 19 ? 6.489   2.421   -1.873  1.00 0.00 ? 43  VAL B N    13 
ATOM 11015 C CA   . VAL B 2 19 ? 7.584   3.356   -2.116  1.00 0.00 ? 43  VAL B CA   13 
ATOM 11016 C C    . VAL B 2 19 ? 7.041   4.683   -2.624  1.00 0.00 ? 43  VAL B C    13 
ATOM 11017 O O    . VAL B 2 19 ? 7.140   5.707   -1.948  1.00 0.00 ? 43  VAL B O    13 
ATOM 11018 C CB   . VAL B 2 19 ? 8.581   2.788   -3.154  1.00 0.00 ? 43  VAL B CB   13 
ATOM 11019 C CG1  . VAL B 2 19 ? 9.995   3.201   -2.826  1.00 0.00 ? 43  VAL B CG1  13 
ATOM 11020 C CG2  . VAL B 2 19 ? 8.499   1.287   -3.193  1.00 0.00 ? 43  VAL B CG2  13 
ATOM 11021 H H    . VAL B 2 19 ? 6.314   1.719   -2.527  1.00 0.00 ? 43  VAL B H    13 
ATOM 11022 H HA   . VAL B 2 19 ? 8.099   3.519   -1.181  1.00 0.00 ? 43  VAL B HA   13 
ATOM 11023 H HB   . VAL B 2 19 ? 8.319   3.161   -4.136  1.00 0.00 ? 43  VAL B HB   13 
ATOM 11024 H HG11 . VAL B 2 19 ? 10.594  3.196   -3.725  1.00 0.00 ? 43  VAL B HG11 13 
ATOM 11025 H HG12 . VAL B 2 19 ? 10.401  2.488   -2.118  1.00 0.00 ? 43  VAL B HG12 13 
ATOM 11026 H HG13 . VAL B 2 19 ? 9.997   4.189   -2.390  1.00 0.00 ? 43  VAL B HG13 13 
ATOM 11027 H HG21 . VAL B 2 19 ? 7.561   0.986   -3.627  1.00 0.00 ? 43  VAL B HG21 13 
ATOM 11028 H HG22 . VAL B 2 19 ? 8.573   0.913   -2.182  1.00 0.00 ? 43  VAL B HG22 13 
ATOM 11029 H HG23 . VAL B 2 19 ? 9.316   0.896   -3.783  1.00 0.00 ? 43  VAL B HG23 13 
ATOM 11030 N N    . ARG B 2 20 ? 6.493   4.642   -3.836  1.00 0.00 ? 44  ARG B N    13 
ATOM 11031 C CA   . ARG B 2 20 ? 5.869   5.799   -4.474  1.00 0.00 ? 44  ARG B CA   13 
ATOM 11032 C C    . ARG B 2 20 ? 5.230   6.699   -3.428  1.00 0.00 ? 44  ARG B C    13 
ATOM 11033 O O    . ARG B 2 20 ? 5.326   7.926   -3.466  1.00 0.00 ? 44  ARG B O    13 
ATOM 11034 C CB   . ARG B 2 20 ? 4.776   5.291   -5.415  1.00 0.00 ? 44  ARG B CB   13 
ATOM 11035 C CG   . ARG B 2 20 ? 5.239   4.198   -6.356  1.00 0.00 ? 44  ARG B CG   13 
ATOM 11036 C CD   . ARG B 2 20 ? 4.647   4.379   -7.734  1.00 0.00 ? 44  ARG B CD   13 
ATOM 11037 N NE   . ARG B 2 20 ? 4.580   3.122   -8.474  1.00 0.00 ? 44  ARG B NE   13 
ATOM 11038 C CZ   . ARG B 2 20 ? 4.545   3.050   -9.801  1.00 0.00 ? 44  ARG B CZ   13 
ATOM 11039 N NH1  . ARG B 2 20 ? 4.570   4.159   -10.528 1.00 0.00 ? 44  ARG B NH1  13 
ATOM 11040 N NH2  . ARG B 2 20 ? 4.484   1.869   -10.401 1.00 0.00 ? 44  ARG B NH2  13 
ATOM 11041 H H    . ARG B 2 20 ? 6.522   3.796   -4.331  1.00 0.00 ? 44  ARG B H    13 
ATOM 11042 H HA   . ARG B 2 20 ? 6.610   6.343   -5.035  1.00 0.00 ? 44  ARG B HA   13 
ATOM 11043 H HB2  . ARG B 2 20 ? 3.969   4.894   -4.818  1.00 0.00 ? 44  ARG B HB2  13 
ATOM 11044 H HB3  . ARG B 2 20 ? 4.399   6.105   -6.001  1.00 0.00 ? 44  ARG B HB3  13 
ATOM 11045 H HG2  . ARG B 2 20 ? 6.316   4.227   -6.429  1.00 0.00 ? 44  ARG B HG2  13 
ATOM 11046 H HG3  . ARG B 2 20 ? 4.927   3.244   -5.963  1.00 0.00 ? 44  ARG B HG3  13 
ATOM 11047 H HD2  . ARG B 2 20 ? 3.653   4.785   -7.632  1.00 0.00 ? 44  ARG B HD2  13 
ATOM 11048 H HD3  . ARG B 2 20 ? 5.263   5.072   -8.275  1.00 0.00 ? 44  ARG B HD3  13 
ATOM 11049 H HE   . ARG B 2 20 ? 4.558   2.290   -7.954  1.00 0.00 ? 44  ARG B HE   13 
ATOM 11050 H HH11 . ARG B 2 20 ? 4.617   5.050   -10.080 1.00 0.00 ? 44  ARG B HH11 13 
ATOM 11051 H HH12 . ARG B 2 20 ? 4.544   4.102   -11.527 1.00 0.00 ? 44  ARG B HH12 13 
ATOM 11052 H HH21 . ARG B 2 20 ? 4.464   1.031   -9.855  1.00 0.00 ? 44  ARG B HH21 13 
ATOM 11053 H HH22 . ARG B 2 20 ? 4.456   1.817   -11.399 1.00 0.00 ? 44  ARG B HH22 13 
ATOM 11054 N N    . VAL B 2 21 ? 4.578   6.031   -2.501  1.00 0.00 ? 45  VAL B N    13 
ATOM 11055 C CA   . VAL B 2 21 ? 3.865   6.637   -1.402  1.00 0.00 ? 45  VAL B CA   13 
ATOM 11056 C C    . VAL B 2 21 ? 4.791   7.209   -0.338  1.00 0.00 ? 45  VAL B C    13 
ATOM 11057 O O    . VAL B 2 21 ? 4.769   8.406   -0.049  1.00 0.00 ? 45  VAL B O    13 
ATOM 11058 C CB   . VAL B 2 21 ? 2.995   5.570   -0.720  1.00 0.00 ? 45  VAL B CB   13 
ATOM 11059 C CG1  . VAL B 2 21 ? 2.267   6.144   0.464   1.00 0.00 ? 45  VAL B CG1  13 
ATOM 11060 C CG2  . VAL B 2 21 ? 2.025   4.936   -1.697  1.00 0.00 ? 45  VAL B CG2  13 
ATOM 11061 H H    . VAL B 2 21 ? 4.587   5.059   -2.554  1.00 0.00 ? 45  VAL B H    13 
ATOM 11062 H HA   . VAL B 2 21 ? 3.222   7.411   -1.784  1.00 0.00 ? 45  VAL B HA   13 
ATOM 11063 H HB   . VAL B 2 21 ? 3.650   4.793   -0.356  1.00 0.00 ? 45  VAL B HB   13 
ATOM 11064 H HG11 . VAL B 2 21 ? 2.003   7.173   0.264   1.00 0.00 ? 45  VAL B HG11 13 
ATOM 11065 H HG12 . VAL B 2 21 ? 2.907   6.095   1.329   1.00 0.00 ? 45  VAL B HG12 13 
ATOM 11066 H HG13 . VAL B 2 21 ? 1.372   5.572   0.646   1.00 0.00 ? 45  VAL B HG13 13 
ATOM 11067 H HG21 . VAL B 2 21 ? 1.016   5.053   -1.336  1.00 0.00 ? 45  VAL B HG21 13 
ATOM 11068 H HG22 . VAL B 2 21 ? 2.257   3.886   -1.781  1.00 0.00 ? 45  VAL B HG22 13 
ATOM 11069 H HG23 . VAL B 2 21 ? 2.124   5.406   -2.664  1.00 0.00 ? 45  VAL B HG23 13 
ATOM 11070 N N    . CYS B 2 22 ? 5.606   6.333   0.236   1.00 0.00 ? 46  CYS B N    13 
ATOM 11071 C CA   . CYS B 2 22 ? 6.493   6.706   1.326   1.00 0.00 ? 46  CYS B CA   13 
ATOM 11072 C C    . CYS B 2 22 ? 7.943   6.418   1.005   1.00 0.00 ? 46  CYS B C    13 
ATOM 11073 O O    . CYS B 2 22 ? 8.809   7.286   1.109   1.00 0.00 ? 46  CYS B O    13 
ATOM 11074 C CB   . CYS B 2 22 ? 6.101   5.888   2.552   1.00 0.00 ? 46  CYS B CB   13 
ATOM 11075 S SG   . CYS B 2 22 ? 6.808   6.466   4.127   1.00 0.00 ? 46  CYS B SG   13 
ATOM 11076 H H    . CYS B 2 22 ? 5.627   5.407   -0.098  1.00 0.00 ? 46  CYS B H    13 
ATOM 11077 H HA   . CYS B 2 22 ? 6.365   7.754   1.540   1.00 0.00 ? 46  CYS B HA   13 
ATOM 11078 H HB2  . CYS B 2 22 ? 5.031   5.892   2.645   1.00 0.00 ? 46  CYS B HB2  13 
ATOM 11079 H HB3  . CYS B 2 22 ? 6.430   4.869   2.403   1.00 0.00 ? 46  CYS B HB3  13 
ATOM 11080 N N    . GLY B 2 23 ? 8.187   5.183   0.612   1.00 0.00 ? 47  GLY B N    13 
ATOM 11081 C CA   . GLY B 2 23 ? 9.539   4.750   0.321   1.00 0.00 ? 47  GLY B CA   13 
ATOM 11082 C C    . GLY B 2 23 ? 10.018  3.741   1.339   1.00 0.00 ? 47  GLY B C    13 
ATOM 11083 O O    . GLY B 2 23 ? 10.477  4.110   2.419   1.00 0.00 ? 47  GLY B O    13 
ATOM 11084 H H    . GLY B 2 23 ? 7.429   4.557   0.501   1.00 0.00 ? 47  GLY B H    13 
ATOM 11085 H HA2  . GLY B 2 23 ? 9.562   4.302   -0.660  1.00 0.00 ? 47  GLY B HA2  13 
ATOM 11086 H HA3  . GLY B 2 23 ? 10.200  5.603   0.334   1.00 0.00 ? 47  GLY B HA3  13 
ATOM 11087 N N    . GLY B 2 24 ? 9.885   2.466   0.996   1.00 0.00 ? 48  GLY B N    13 
ATOM 11088 C CA   . GLY B 2 24 ? 10.297  1.397   1.887   1.00 0.00 ? 48  GLY B CA   13 
ATOM 11089 C C    . GLY B 2 24 ? 11.773  1.449   2.260   1.00 0.00 ? 48  GLY B C    13 
ATOM 11090 O O    . GLY B 2 24 ? 12.299  2.503   2.612   1.00 0.00 ? 48  GLY B O    13 
ATOM 11091 H H    . GLY B 2 24 ? 9.500   2.245   0.123   1.00 0.00 ? 48  GLY B H    13 
ATOM 11092 H HA2  . GLY B 2 24 ? 9.713   1.442   2.784   1.00 0.00 ? 48  GLY B HA2  13 
ATOM 11093 H HA3  . GLY B 2 24 ? 10.096  0.456   1.398   1.00 0.00 ? 48  GLY B HA3  13 
ATOM 11094 N N    . PRO B 2 25 ? 12.463  0.303   2.190   1.00 0.00 ? 49  PRO B N    13 
ATOM 11095 C CA   . PRO B 2 25 ? 13.882  0.191   2.531   1.00 0.00 ? 49  PRO B CA   13 
ATOM 11096 C C    . PRO B 2 25 ? 14.847  0.526   1.386   1.00 0.00 ? 49  PRO B C    13 
ATOM 11097 O O    . PRO B 2 25 ? 15.041  -0.275  0.476   1.00 0.00 ? 49  PRO B O    13 
ATOM 11098 C CB   . PRO B 2 25 ? 13.990  -1.287  2.881   1.00 0.00 ? 49  PRO B CB   13 
ATOM 11099 C CG   . PRO B 2 25 ? 13.068  -1.939  1.917   1.00 0.00 ? 49  PRO B CG   13 
ATOM 11100 C CD   . PRO B 2 25 ? 11.901  -1.000  1.800   1.00 0.00 ? 49  PRO B CD   13 
ATOM 11101 H HA   . PRO B 2 25 ? 14.132  0.783   3.398   1.00 0.00 ? 49  PRO B HA   13 
ATOM 11102 H HB2  . PRO B 2 25 ? 15.008  -1.625  2.757   1.00 0.00 ? 49  PRO B HB2  13 
ATOM 11103 H HB3  . PRO B 2 25 ? 13.665  -1.443  3.892   1.00 0.00 ? 49  PRO B HB3  13 
ATOM 11104 H HG2  . PRO B 2 25 ? 13.556  -2.052  0.959   1.00 0.00 ? 49  PRO B HG2  13 
ATOM 11105 H HG3  . PRO B 2 25 ? 12.746  -2.896  2.298   1.00 0.00 ? 49  PRO B HG3  13 
ATOM 11106 H HD2  . PRO B 2 25 ? 11.549  -0.965  0.796   1.00 0.00 ? 49  PRO B HD2  13 
ATOM 11107 H HD3  . PRO B 2 25 ? 11.103  -1.289  2.465   1.00 0.00 ? 49  PRO B HD3  13 
ATOM 11108 N N    . ARG B 2 26 ? 15.451  1.714   1.464   1.00 0.00 ? 50  ARG B N    13 
ATOM 11109 C CA   . ARG B 2 26 ? 16.452  2.182   0.503   1.00 0.00 ? 50  ARG B CA   13 
ATOM 11110 C C    . ARG B 2 26 ? 16.043  2.094   -0.973  1.00 0.00 ? 50  ARG B C    13 
ATOM 11111 O O    . ARG B 2 26 ? 15.817  3.122   -1.613  1.00 0.00 ? 50  ARG B O    13 
ATOM 11112 C CB   . ARG B 2 26 ? 17.717  1.381   0.711   1.00 0.00 ? 50  ARG B CB   13 
ATOM 11113 C CG   . ARG B 2 26 ? 18.160  1.302   2.163   1.00 0.00 ? 50  ARG B CG   13 
ATOM 11114 C CD   . ARG B 2 26 ? 19.372  0.399   2.328   1.00 0.00 ? 50  ARG B CD   13 
ATOM 11115 N NE   . ARG B 2 26 ? 19.723  0.207   3.732   1.00 0.00 ? 50  ARG B NE   13 
ATOM 11116 C CZ   . ARG B 2 26 ? 20.810  -0.439  4.141   1.00 0.00 ? 50  ARG B CZ   13 
ATOM 11117 N NH1  . ARG B 2 26 ? 21.657  -0.949  3.255   1.00 0.00 ? 50  ARG B NH1  13 
ATOM 11118 N NH2  . ARG B 2 26 ? 21.055  -0.576  5.437   1.00 0.00 ? 50  ARG B NH2  13 
ATOM 11119 H H    . ARG B 2 26 ? 15.233  2.295   2.208   1.00 0.00 ? 50  ARG B H    13 
ATOM 11120 H HA   . ARG B 2 26 ? 16.666  3.209   0.733   1.00 0.00 ? 50  ARG B HA   13 
ATOM 11121 H HB2  . ARG B 2 26 ? 17.539  0.383   0.353   1.00 0.00 ? 50  ARG B HB2  13 
ATOM 11122 H HB3  . ARG B 2 26 ? 18.505  1.830   0.138   1.00 0.00 ? 50  ARG B HB3  13 
ATOM 11123 H HG2  . ARG B 2 26 ? 18.412  2.294   2.506   1.00 0.00 ? 50  ARG B HG2  13 
ATOM 11124 H HG3  . ARG B 2 26 ? 17.346  0.909   2.755   1.00 0.00 ? 50  ARG B HG3  13 
ATOM 11125 H HD2  . ARG B 2 26 ? 19.152  -0.562  1.887   1.00 0.00 ? 50  ARG B HD2  13 
ATOM 11126 H HD3  . ARG B 2 26 ? 20.210  0.847   1.815   1.00 0.00 ? 50  ARG B HD3  13 
ATOM 11127 H HE   . ARG B 2 26 ? 19.114  0.577   4.407   1.00 0.00 ? 50  ARG B HE   13 
ATOM 11128 H HH11 . ARG B 2 26 ? 21.477  -0.848  2.276   1.00 0.00 ? 50  ARG B HH11 13 
ATOM 11129 H HH12 . ARG B 2 26 ? 22.475  -1.434  3.565   1.00 0.00 ? 50  ARG B HH12 13 
ATOM 11130 H HH21 . ARG B 2 26 ? 20.420  -0.193  6.108   1.00 0.00 ? 50  ARG B HH21 13 
ATOM 11131 H HH22 . ARG B 2 26 ? 21.872  -1.063  5.743   1.00 0.00 ? 50  ARG B HH22 13 
ATOM 11132 N N    . TRP B 2 27 ? 15.972  0.870   -1.509  1.00 0.00 ? 51  TRP B N    13 
ATOM 11133 C CA   . TRP B 2 27 ? 15.641  0.634   -2.901  1.00 0.00 ? 51  TRP B CA   13 
ATOM 11134 C C    . TRP B 2 27 ? 16.800  1.014   -3.818  1.00 0.00 ? 51  TRP B C    13 
ATOM 11135 O O    . TRP B 2 27 ? 16.679  0.966   -5.042  1.00 0.00 ? 51  TRP B O    13 
ATOM 11136 C CB   . TRP B 2 27 ? 14.402  1.393   -3.296  1.00 0.00 ? 51  TRP B CB   13 
ATOM 11137 C CG   . TRP B 2 27 ? 13.289  1.221   -2.335  1.00 0.00 ? 51  TRP B CG   13 
ATOM 11138 C CD1  . TRP B 2 27 ? 13.046  1.932   -1.209  1.00 0.00 ? 51  TRP B CD1  13 
ATOM 11139 C CD2  . TRP B 2 27 ? 12.275  0.253   -2.426  1.00 0.00 ? 51  TRP B CD2  13 
ATOM 11140 N NE1  . TRP B 2 27 ? 11.910  1.477   -0.607  1.00 0.00 ? 51  TRP B NE1  13 
ATOM 11141 C CE2  . TRP B 2 27 ? 11.414  0.436   -1.338  1.00 0.00 ? 51  TRP B CE2  13 
ATOM 11142 C CE3  . TRP B 2 27 ? 12.016  -0.741  -3.337  1.00 0.00 ? 51  TRP B CE3  13 
ATOM 11143 C CZ2  . TRP B 2 27 ? 10.297  -0.359  -1.145  1.00 0.00 ? 51  TRP B CZ2  13 
ATOM 11144 C CZ3  . TRP B 2 27 ? 10.908  -1.531  -3.150  1.00 0.00 ? 51  TRP B CZ3  13 
ATOM 11145 C CH2  . TRP B 2 27 ? 10.057  -1.327  -2.051  1.00 0.00 ? 51  TRP B CH2  13 
ATOM 11146 H H    . TRP B 2 27 ? 16.111  0.102   -0.946  1.00 0.00 ? 51  TRP B H    13 
ATOM 11147 H HA   . TRP B 2 27 ? 15.434  -0.422  -3.010  1.00 0.00 ? 51  TRP B HA   13 
ATOM 11148 H HB2  . TRP B 2 27 ? 14.622  2.437   -3.378  1.00 0.00 ? 51  TRP B HB2  13 
ATOM 11149 H HB3  . TRP B 2 27 ? 14.075  1.022   -4.242  1.00 0.00 ? 51  TRP B HB3  13 
ATOM 11150 H HD1  . TRP B 2 27 ? 13.665  2.731   -0.860  1.00 0.00 ? 51  TRP B HD1  13 
ATOM 11151 H HE1  . TRP B 2 27 ? 11.521  1.837   0.209   1.00 0.00 ? 51  TRP B HE1  13 
ATOM 11152 H HE3  . TRP B 2 27 ? 12.675  -0.897  -4.177  1.00 0.00 ? 51  TRP B HE3  13 
ATOM 11153 H HZ2  . TRP B 2 27 ? 9.627   -0.228  -0.318  1.00 0.00 ? 51  TRP B HZ2  13 
ATOM 11154 H HZ3  . TRP B 2 27 ? 10.691  -2.315  -3.848  1.00 0.00 ? 51  TRP B HZ3  13 
ATOM 11155 H HH2  . TRP B 2 27 ? 9.189   -1.943  -1.935  1.00 0.00 ? 51  TRP B HH2  13 
ATOM 11156 N N    . SER B 2 28 ? 17.925  1.394   -3.215  1.00 0.00 ? 52  SER B N    13 
ATOM 11157 C CA   . SER B 2 28 ? 19.105  1.790   -3.978  1.00 0.00 ? 52  SER B CA   13 
ATOM 11158 C C    . SER B 2 28 ? 20.139  0.669   -4.010  1.00 0.00 ? 52  SER B C    13 
ATOM 11159 O O    . SER B 2 28 ? 20.286  -0.083  -3.048  1.00 0.00 ? 52  SER B O    13 
ATOM 11160 C CB   . SER B 2 28 ? 19.727  3.051   -3.375  1.00 0.00 ? 52  SER B CB   13 
ATOM 11161 O OG   . SER B 2 28 ? 18.792  4.115   -3.339  1.00 0.00 ? 52  SER B OG   13 
ATOM 11162 H H    . SER B 2 28 ? 17.962  1.408   -2.236  1.00 0.00 ? 52  SER B H    13 
ATOM 11163 H HA   . SER B 2 28 ? 18.790  2.003   -4.988  1.00 0.00 ? 52  SER B HA   13 
ATOM 11164 H HB2  . SER B 2 28 ? 20.055  2.842   -2.368  1.00 0.00 ? 52  SER B HB2  13 
ATOM 11165 H HB3  . SER B 2 28 ? 20.574  3.353   -3.974  1.00 0.00 ? 52  SER B HB3  13 
ATOM 11166 H HG   . SER B 2 28 ? 18.942  4.646   -2.554  1.00 0.00 ? 52  SER B HG   13 
ATOM 11167 N N    . THR B 2 29 ? 20.855  0.568   -5.126  1.00 0.00 ? 53  THR B N    13 
ATOM 11168 C CA   . THR B 2 29 ? 21.880  -0.458  -5.291  1.00 0.00 ? 53  THR B CA   13 
ATOM 11169 C C    . THR B 2 29 ? 22.864  -0.081  -6.390  1.00 0.00 ? 53  THR B C    13 
ATOM 11170 O O    . THR B 2 29 ? 24.071  0.001   -6.157  1.00 0.00 ? 53  THR B O    13 
ATOM 11171 C CB   . THR B 2 29 ? 21.265  -1.830  -5.614  1.00 0.00 ? 53  THR B CB   13 
ATOM 11172 O OG1  . THR B 2 29 ? 22.178  -2.612  -6.394  1.00 0.00 ? 53  THR B OG1  13 
ATOM 11173 C CG2  . THR B 2 29 ? 19.960  -1.658  -6.358  1.00 0.00 ? 53  THR B CG2  13 
ATOM 11174 H H    . THR B 2 29 ? 20.690  1.198   -5.858  1.00 0.00 ? 53  THR B H    13 
ATOM 11175 H HA   . THR B 2 29 ? 22.405  -0.540  -4.360  1.00 0.00 ? 53  THR B HA   13 
ATOM 11176 H HB   . THR B 2 29 ? 21.067  -2.344  -4.687  1.00 0.00 ? 53  THR B HB   13 
ATOM 11177 H HG1  . THR B 2 29 ? 21.691  -3.101  -7.062  1.00 0.00 ? 53  THR B HG1  13 
ATOM 11178 H HG21 . THR B 2 29 ? 19.415  -0.845  -5.909  1.00 0.00 ? 53  THR B HG21 13 
ATOM 11179 H HG22 . THR B 2 29 ? 19.380  -2.566  -6.288  1.00 0.00 ? 53  THR B HG22 13 
ATOM 11180 H HG23 . THR B 2 29 ? 20.160  -1.433  -7.395  1.00 0.00 ? 53  THR B HG23 13 
ATOM 11181 N N    . GLU B 2 30 ? 22.339  0.146   -7.590  1.00 0.00 ? 54  GLU B N    13 
ATOM 11182 C CA   . GLU B 2 30 ? 23.164  0.519   -8.732  1.00 0.00 ? 54  GLU B CA   13 
ATOM 11183 C C    . GLU B 2 30 ? 23.475  2.014   -8.717  1.00 0.00 ? 54  GLU B C    13 
ATOM 11184 O O    . GLU B 2 30 ? 23.489  2.664   -9.763  1.00 0.00 ? 54  GLU B O    13 
ATOM 11185 C CB   . GLU B 2 30 ? 22.459  0.145   -10.036 1.00 0.00 ? 54  GLU B CB   13 
ATOM 11186 C CG   . GLU B 2 30 ? 22.184  -1.343  -10.179 1.00 0.00 ? 54  GLU B CG   13 
ATOM 11187 C CD   . GLU B 2 30 ? 21.475  -1.682  -11.474 1.00 0.00 ? 54  GLU B CD   13 
ATOM 11188 O OE1  . GLU B 2 30 ? 20.230  -1.591  -11.510 1.00 0.00 ? 54  GLU B OE1  13 
ATOM 11189 O OE2  . GLU B 2 30 ? 22.163  -2.039  -12.454 1.00 0.00 ? 54  GLU B OE2  13 
ATOM 11190 H H    . GLU B 2 30 ? 21.371  0.055   -7.709  1.00 0.00 ? 54  GLU B H    13 
ATOM 11191 H HA   . GLU B 2 30 ? 24.092  -0.030  -8.665  1.00 0.00 ? 54  GLU B HA   13 
ATOM 11192 H HB2  . GLU B 2 30 ? 21.515  0.668   -10.084 1.00 0.00 ? 54  GLU B HB2  13 
ATOM 11193 H HB3  . GLU B 2 30 ? 23.075  0.456   -10.866 1.00 0.00 ? 54  GLU B HB3  13 
ATOM 11194 H HG2  . GLU B 2 30 ? 23.125  -1.874  -10.153 1.00 0.00 ? 54  GLU B HG2  13 
ATOM 11195 H HG3  . GLU B 2 30 ? 21.568  -1.664  -9.352  1.00 0.00 ? 54  GLU B HG3  13 
ATOM 11196 N N    . ALA B 2 31 ? 23.726  2.550   -7.525  1.00 0.00 ? 55  ALA B N    13 
ATOM 11197 C CA   . ALA B 2 31 ? 24.033  3.969   -7.367  1.00 0.00 ? 55  ALA B CA   13 
ATOM 11198 C C    . ALA B 2 31 ? 22.941  4.843   -7.977  1.00 0.00 ? 55  ALA B C    13 
ATOM 11199 O O    . ALA B 2 31 ? 23.095  5.256   -9.146  1.00 0.00 ? 55  ALA B O    13 
ATOM 11200 C CB   . ALA B 2 31 ? 25.383  4.290   -7.994  1.00 0.00 ? 55  ALA B CB   13 
ATOM 11201 O OXT  . ALA B 2 31 ? 21.939  5.106   -7.279  1.00 0.00 ? 55  ALA B OXT  13 
ATOM 11202 H H    . ALA B 2 31 ? 23.707  1.978   -6.731  1.00 0.00 ? 55  ALA B H    13 
ATOM 11203 H HA   . ALA B 2 31 ? 24.097  4.179   -6.309  1.00 0.00 ? 55  ALA B HA   13 
ATOM 11204 H HB1  . ALA B 2 31 ? 25.349  4.077   -9.052  1.00 0.00 ? 55  ALA B HB1  13 
ATOM 11205 H HB2  . ALA B 2 31 ? 26.148  3.687   -7.529  1.00 0.00 ? 55  ALA B HB2  13 
ATOM 11206 H HB3  . ALA B 2 31 ? 25.609  5.335   -7.844  1.00 0.00 ? 55  ALA B HB3  13 
ATOM 11207 N N    . ALA A 1 1  ? -3.995  2.243   11.553  1.00 0.00 ? 106 ALA A N    14 
ATOM 11208 C CA   . ALA A 1 1  ? -4.614  1.839   12.841  1.00 0.00 ? 106 ALA A CA   14 
ATOM 11209 C C    . ALA A 1 1  ? -4.695  0.320   12.957  1.00 0.00 ? 106 ALA A C    14 
ATOM 11210 O O    . ALA A 1 1  ? -5.771  -0.237  13.179  1.00 0.00 ? 106 ALA A O    14 
ATOM 11211 C CB   . ALA A 1 1  ? -5.997  2.455   12.977  1.00 0.00 ? 106 ALA A CB   14 
ATOM 11212 H H1   . ALA A 1 1  ? -4.558  1.879   10.757  1.00 0.00 ? 106 ALA A H1   14 
ATOM 11213 H H2   . ALA A 1 1  ? -3.030  1.859   11.485  1.00 0.00 ? 106 ALA A H2   14 
ATOM 11214 H H3   . ALA A 1 1  ? -3.950  3.279   11.488  1.00 0.00 ? 106 ALA A H3   14 
ATOM 11215 H HA   . ALA A 1 1  ? -3.999  2.216   13.646  1.00 0.00 ? 106 ALA A HA   14 
ATOM 11216 H HB1  . ALA A 1 1  ? -6.425  2.176   13.929  1.00 0.00 ? 106 ALA A HB1  14 
ATOM 11217 H HB2  . ALA A 1 1  ? -6.632  2.096   12.178  1.00 0.00 ? 106 ALA A HB2  14 
ATOM 11218 H HB3  . ALA A 1 1  ? -5.920  3.530   12.917  1.00 0.00 ? 106 ALA A HB3  14 
ATOM 11219 N N    . ALA A 1 2  ? -3.549  -0.339  12.803  1.00 0.00 ? 107 ALA A N    14 
ATOM 11220 C CA   . ALA A 1 2  ? -3.474  -1.796  12.889  1.00 0.00 ? 107 ALA A CA   14 
ATOM 11221 C C    . ALA A 1 2  ? -4.289  -2.463  11.784  1.00 0.00 ? 107 ALA A C    14 
ATOM 11222 O O    . ALA A 1 2  ? -5.519  -2.405  11.780  1.00 0.00 ? 107 ALA A O    14 
ATOM 11223 C CB   . ALA A 1 2  ? -3.941  -2.274  14.256  1.00 0.00 ? 107 ALA A CB   14 
ATOM 11224 H H    . ALA A 1 2  ? -2.730  0.168   12.626  1.00 0.00 ? 107 ALA A H    14 
ATOM 11225 H HA   . ALA A 1 2  ? -2.439  -2.079  12.772  1.00 0.00 ? 107 ALA A HA   14 
ATOM 11226 H HB1  . ALA A 1 2  ? -3.366  -1.782  15.026  1.00 0.00 ? 107 ALA A HB1  14 
ATOM 11227 H HB2  . ALA A 1 2  ? -3.801  -3.343  14.331  1.00 0.00 ? 107 ALA A HB2  14 
ATOM 11228 H HB3  . ALA A 1 2  ? -4.988  -2.039  14.383  1.00 0.00 ? 107 ALA A HB3  14 
ATOM 11229 N N    . ALA A 1 3  ? -3.591  -3.099  10.850  1.00 0.00 ? 108 ALA A N    14 
ATOM 11230 C CA   . ALA A 1 3  ? -4.238  -3.784  9.738   1.00 0.00 ? 108 ALA A CA   14 
ATOM 11231 C C    . ALA A 1 3  ? -4.245  -5.293  9.956   1.00 0.00 ? 108 ALA A C    14 
ATOM 11232 O O    . ALA A 1 3  ? -4.765  -5.786  10.957  1.00 0.00 ? 108 ALA A O    14 
ATOM 11233 C CB   . ALA A 1 3  ? -3.548  -3.428  8.426   1.00 0.00 ? 108 ALA A CB   14 
ATOM 11234 H H    . ALA A 1 3  ? -2.612  -3.109  10.910  1.00 0.00 ? 108 ALA A H    14 
ATOM 11235 H HA   . ALA A 1 3  ? -5.254  -3.445  9.679   1.00 0.00 ? 108 ALA A HA   14 
ATOM 11236 H HB1  . ALA A 1 3  ? -2.477  -3.461  8.560   1.00 0.00 ? 108 ALA A HB1  14 
ATOM 11237 H HB2  . ALA A 1 3  ? -3.843  -2.435  8.118   1.00 0.00 ? 108 ALA A HB2  14 
ATOM 11238 H HB3  . ALA A 1 3  ? -3.835  -4.138  7.664   1.00 0.00 ? 108 ALA A HB3  14 
ATOM 11239 N N    . THR A 1 4  ? -3.666  -6.014  9.012   1.00 0.00 ? 109 THR A N    14 
ATOM 11240 C CA   . THR A 1 4  ? -3.596  -7.468  9.080   1.00 0.00 ? 109 THR A CA   14 
ATOM 11241 C C    . THR A 1 4  ? -2.486  -7.988  8.177   1.00 0.00 ? 109 THR A C    14 
ATOM 11242 O O    . THR A 1 4  ? -1.561  -8.666  8.624   1.00 0.00 ? 109 THR A O    14 
ATOM 11243 C CB   . THR A 1 4  ? -4.939  -8.103  8.666   1.00 0.00 ? 109 THR A CB   14 
ATOM 11244 O OG1  . THR A 1 4  ? -4.767  -9.504  8.432   1.00 0.00 ? 109 THR A OG1  14 
ATOM 11245 C CG2  . THR A 1 4  ? -5.500  -7.435  7.414   1.00 0.00 ? 109 THR A CG2  14 
ATOM 11246 H H    . THR A 1 4  ? -3.286  -5.555  8.239   1.00 0.00 ? 109 THR A H    14 
ATOM 11247 H HA   . THR A 1 4  ? -3.382  -7.747  10.094  1.00 0.00 ? 109 THR A HA   14 
ATOM 11248 H HB   . THR A 1 4  ? -5.644  -7.966  9.473   1.00 0.00 ? 109 THR A HB   14 
ATOM 11249 H HG1  . THR A 1 4  ? -4.496  -9.934  9.247   1.00 0.00 ? 109 THR A HG1  14 
ATOM 11250 H HG21 . THR A 1 4  ? -5.088  -6.436  7.312   1.00 0.00 ? 109 THR A HG21 14 
ATOM 11251 H HG22 . THR A 1 4  ? -6.577  -7.374  7.491   1.00 0.00 ? 109 THR A HG22 14 
ATOM 11252 H HG23 . THR A 1 4  ? -5.236  -8.021  6.545   1.00 0.00 ? 109 THR A HG23 14 
ATOM 11253 N N    . ASN A 1 5  ? -2.600  -7.645  6.910   1.00 0.00 ? 110 ASN A N    14 
ATOM 11254 C CA   . ASN A 1 5  ? -1.635  -8.025  5.890   1.00 0.00 ? 110 ASN A CA   14 
ATOM 11255 C C    . ASN A 1 5  ? -1.742  -7.038  4.739   1.00 0.00 ? 110 ASN A C    14 
ATOM 11256 O O    . ASN A 1 5  ? -2.448  -7.284  3.766   1.00 0.00 ? 110 ASN A O    14 
ATOM 11257 C CB   . ASN A 1 5  ? -1.892  -9.451  5.394   1.00 0.00 ? 110 ASN A CB   14 
ATOM 11258 C CG   . ASN A 1 5  ? -1.590  -10.496 6.445   1.00 0.00 ? 110 ASN A CG   14 
ATOM 11259 O OD1  . ASN A 1 5  ? -2.453  -10.859 7.242   1.00 0.00 ? 110 ASN A OD1  14 
ATOM 11260 N ND2  . ASN A 1 5  ? -0.360  -10.988 6.449   1.00 0.00 ? 110 ASN A ND2  14 
ATOM 11261 H H    . ASN A 1 5  ? -3.370  -7.108  6.646   1.00 0.00 ? 110 ASN A H    14 
ATOM 11262 H HA   . ASN A 1 5  ? -0.645  -7.963  6.320   1.00 0.00 ? 110 ASN A HA   14 
ATOM 11263 H HB2  . ASN A 1 5  ? -2.927  -9.548  5.115   1.00 0.00 ? 110 ASN A HB2  14 
ATOM 11264 H HB3  . ASN A 1 5  ? -1.270  -9.643  4.532   1.00 0.00 ? 110 ASN A HB3  14 
ATOM 11265 H HD21 . ASN A 1 5  ? 0.276   -10.652 5.783   1.00 0.00 ? 110 ASN A HD21 14 
ATOM 11266 H HD22 . ASN A 1 5  ? -0.140  -11.666 7.115   1.00 0.00 ? 110 ASN A HD22 14 
ATOM 11267 N N    . PRO A 1 6  ? -1.039  -5.901  4.836   1.00 0.00 ? 111 PRO A N    14 
ATOM 11268 C CA   . PRO A 1 6  ? -1.096  -4.851  3.817   1.00 0.00 ? 111 PRO A CA   14 
ATOM 11269 C C    . PRO A 1 6  ? -0.641  -5.318  2.440   1.00 0.00 ? 111 PRO A C    14 
ATOM 11270 O O    . PRO A 1 6  ? -0.788  -4.600  1.453   1.00 0.00 ? 111 PRO A O    14 
ATOM 11271 C CB   . PRO A 1 6  ? -0.181  -3.765  4.375   1.00 0.00 ? 111 PRO A CB   14 
ATOM 11272 C CG   . PRO A 1 6  ? 0.737   -4.484  5.299   1.00 0.00 ? 111 PRO A CG   14 
ATOM 11273 C CD   . PRO A 1 6  ? -0.103  -5.557  5.922   1.00 0.00 ? 111 PRO A CD   14 
ATOM 11274 H HA   . PRO A 1 6  ? -2.090  -4.456  3.730   1.00 0.00 ? 111 PRO A HA   14 
ATOM 11275 H HB2  . PRO A 1 6  ? 0.346   -3.295  3.568   1.00 0.00 ? 111 PRO A HB2  14 
ATOM 11276 H HB3  . PRO A 1 6  ? -0.772  -3.033  4.901   1.00 0.00 ? 111 PRO A HB3  14 
ATOM 11277 H HG2  . PRO A 1 6  ? 1.555   -4.919  4.744   1.00 0.00 ? 111 PRO A HG2  14 
ATOM 11278 H HG3  . PRO A 1 6  ? 1.106   -3.808  6.055   1.00 0.00 ? 111 PRO A HG3  14 
ATOM 11279 H HD2  . PRO A 1 6  ? 0.507   -6.406  6.195   1.00 0.00 ? 111 PRO A HD2  14 
ATOM 11280 H HD3  . PRO A 1 6  ? -0.633  -5.175  6.781   1.00 0.00 ? 111 PRO A HD3  14 
ATOM 11281 N N    . ALA A 1 7  ? -0.099  -6.525  2.373   1.00 0.00 ? 112 ALA A N    14 
ATOM 11282 C CA   . ALA A 1 7  ? 0.351   -7.085  1.108   1.00 0.00 ? 112 ALA A CA   14 
ATOM 11283 C C    . ALA A 1 7  ? -0.776  -7.862  0.449   1.00 0.00 ? 112 ALA A C    14 
ATOM 11284 O O    . ALA A 1 7  ? -1.024  -7.739  -0.751  1.00 0.00 ? 112 ALA A O    14 
ATOM 11285 C CB   . ALA A 1 7  ? 1.553   -7.981  1.330   1.00 0.00 ? 112 ALA A CB   14 
ATOM 11286 H H    . ALA A 1 7  ? 0.001   -7.053  3.193   1.00 0.00 ? 112 ALA A H    14 
ATOM 11287 H HA   . ALA A 1 7  ? 0.644   -6.271  0.461   1.00 0.00 ? 112 ALA A HA   14 
ATOM 11288 H HB1  . ALA A 1 7  ? 1.222   -8.957  1.653   1.00 0.00 ? 112 ALA A HB1  14 
ATOM 11289 H HB2  . ALA A 1 7  ? 2.179   -7.546  2.091   1.00 0.00 ? 112 ALA A HB2  14 
ATOM 11290 H HB3  . ALA A 1 7  ? 2.112   -8.074  0.410   1.00 0.00 ? 112 ALA A HB3  14 
ATOM 11291 N N    . ARG A 1 8  ? -1.454  -8.665  1.255   1.00 0.00 ? 113 ARG A N    14 
ATOM 11292 C CA   . ARG A 1 8  ? -2.570  -9.474  0.788   1.00 0.00 ? 113 ARG A CA   14 
ATOM 11293 C C    . ARG A 1 8  ? -3.850  -8.647  0.676   1.00 0.00 ? 113 ARG A C    14 
ATOM 11294 O O    . ARG A 1 8  ? -4.490  -8.616  -0.379  1.00 0.00 ? 113 ARG A O    14 
ATOM 11295 C CB   . ARG A 1 8  ? -2.793  -10.646 1.741   1.00 0.00 ? 113 ARG A CB   14 
ATOM 11296 C CG   . ARG A 1 8  ? -1.983  -11.886 1.385   1.00 0.00 ? 113 ARG A CG   14 
ATOM 11297 C CD   . ARG A 1 8  ? -0.489  -11.634 1.506   1.00 0.00 ? 113 ARG A CD   14 
ATOM 11298 N NE   . ARG A 1 8  ? 0.297   -12.765 1.020   1.00 0.00 ? 113 ARG A NE   14 
ATOM 11299 C CZ   . ARG A 1 8  ? 1.607   -12.713 0.798   1.00 0.00 ? 113 ARG A CZ   14 
ATOM 11300 N NH1  . ARG A 1 8  ? 2.279   -11.592 1.023   1.00 0.00 ? 113 ARG A NH1  14 
ATOM 11301 N NH2  . ARG A 1 8  ? 2.245   -13.785 0.348   1.00 0.00 ? 113 ARG A NH2  14 
ATOM 11302 H H    . ARG A 1 8  ? -1.182  -8.727  2.195   1.00 0.00 ? 113 ARG A H    14 
ATOM 11303 H HA   . ARG A 1 8  ? -2.316  -9.859  -0.187  1.00 0.00 ? 113 ARG A HA   14 
ATOM 11304 H HB2  . ARG A 1 8  ? -2.517  -10.338 2.737   1.00 0.00 ? 113 ARG A HB2  14 
ATOM 11305 H HB3  . ARG A 1 8  ? -3.836  -10.908 1.730   1.00 0.00 ? 113 ARG A HB3  14 
ATOM 11306 H HG2  . ARG A 1 8  ? -2.256  -12.687 2.055   1.00 0.00 ? 113 ARG A HG2  14 
ATOM 11307 H HG3  . ARG A 1 8  ? -2.211  -12.172 0.368   1.00 0.00 ? 113 ARG A HG3  14 
ATOM 11308 H HD2  . ARG A 1 8  ? -0.235  -10.758 0.926   1.00 0.00 ? 113 ARG A HD2  14 
ATOM 11309 H HD3  . ARG A 1 8  ? -0.248  -11.460 2.544   1.00 0.00 ? 113 ARG A HD3  14 
ATOM 11310 H HE   . ARG A 1 8  ? -0.176  -13.606 0.847   1.00 0.00 ? 113 ARG A HE   14 
ATOM 11311 H HH11 . ARG A 1 8  ? 1.802   -10.782 1.362   1.00 0.00 ? 113 ARG A HH11 14 
ATOM 11312 H HH12 . ARG A 1 8  ? 3.265   -11.559 0.854   1.00 0.00 ? 113 ARG A HH12 14 
ATOM 11313 H HH21 . ARG A 1 8  ? 1.742   -14.633 0.178   1.00 0.00 ? 113 ARG A HH21 14 
ATOM 11314 H HH22 . ARG A 1 8  ? 3.231   -13.746 0.182   1.00 0.00 ? 113 ARG A HH22 14 
ATOM 11315 N N    . TYR A 1 9  ? -4.218  -7.983  1.771   1.00 0.00 ? 114 TYR A N    14 
ATOM 11316 C CA   . TYR A 1 9  ? -5.425  -7.164  1.806   1.00 0.00 ? 114 TYR A CA   14 
ATOM 11317 C C    . TYR A 1 9  ? -5.469  -6.199  0.627   1.00 0.00 ? 114 TYR A C    14 
ATOM 11318 O O    . TYR A 1 9  ? -6.547  -5.884  0.120   1.00 0.00 ? 114 TYR A O    14 
ATOM 11319 C CB   . TYR A 1 9  ? -5.546  -6.433  3.169   1.00 0.00 ? 114 TYR A CB   14 
ATOM 11320 C CG   . TYR A 1 9  ? -5.373  -4.915  3.157   1.00 0.00 ? 114 TYR A CG   14 
ATOM 11321 C CD1  . TYR A 1 9  ? -6.224  -4.087  2.428   1.00 0.00 ? 114 TYR A CD1  14 
ATOM 11322 C CD2  . TYR A 1 9  ? -4.367  -4.307  3.907   1.00 0.00 ? 114 TYR A CD2  14 
ATOM 11323 C CE1  . TYR A 1 9  ? -6.075  -2.714  2.441   1.00 0.00 ? 114 TYR A CE1  14 
ATOM 11324 C CE2  . TYR A 1 9  ? -4.212  -2.935  3.924   1.00 0.00 ? 114 TYR A CE2  14 
ATOM 11325 C CZ   . TYR A 1 9  ? -5.068  -2.142  3.189   1.00 0.00 ? 114 TYR A CZ   14 
ATOM 11326 O OH   . TYR A 1 9  ? -4.920  -0.774  3.204   1.00 0.00 ? 114 TYR A OH   14 
ATOM 11327 H H    . TYR A 1 9  ? -3.668  -8.054  2.576   1.00 0.00 ? 114 TYR A H    14 
ATOM 11328 H HA   . TYR A 1 9  ? -6.264  -7.836  1.711   1.00 0.00 ? 114 TYR A HA   14 
ATOM 11329 H HB2  . TYR A 1 9  ? -6.523  -6.635  3.578   1.00 0.00 ? 114 TYR A HB2  14 
ATOM 11330 H HB3  . TYR A 1 9  ? -4.804  -6.840  3.840   1.00 0.00 ? 114 TYR A HB3  14 
ATOM 11331 H HD1  . TYR A 1 9  ? -7.012  -4.536  1.841   1.00 0.00 ? 114 TYR A HD1  14 
ATOM 11332 H HD2  . TYR A 1 9  ? -3.687  -4.924  4.480   1.00 0.00 ? 114 TYR A HD2  14 
ATOM 11333 H HE1  . TYR A 1 9  ? -6.744  -2.095  1.862   1.00 0.00 ? 114 TYR A HE1  14 
ATOM 11334 H HE2  . TYR A 1 9  ? -3.421  -2.488  4.515   1.00 0.00 ? 114 TYR A HE2  14 
ATOM 11335 H HH   . TYR A 1 9  ? -5.780  -0.359  3.295   1.00 0.00 ? 114 TYR A HH   14 
ATOM 11336 N N    . CYS A 1 10 ? -4.306  -5.741  0.173   1.00 0.00 ? 115 CYS A N    14 
ATOM 11337 C CA   . CYS A 1 10 ? -4.264  -4.813  -0.947  1.00 0.00 ? 115 CYS A CA   14 
ATOM 11338 C C    . CYS A 1 10 ? -4.283  -5.545  -2.281  1.00 0.00 ? 115 CYS A C    14 
ATOM 11339 O O    . CYS A 1 10 ? -4.866  -5.061  -3.249  1.00 0.00 ? 115 CYS A O    14 
ATOM 11340 C CB   . CYS A 1 10 ? -3.059  -3.879  -0.859  1.00 0.00 ? 115 CYS A CB   14 
ATOM 11341 S SG   . CYS A 1 10 ? -3.025  -2.893  0.662   1.00 0.00 ? 115 CYS A SG   14 
ATOM 11342 H H    . CYS A 1 10 ? -3.470  -6.033  0.594   1.00 0.00 ? 115 CYS A H    14 
ATOM 11343 H HA   . CYS A 1 10 ? -5.161  -4.214  -0.887  1.00 0.00 ? 115 CYS A HA   14 
ATOM 11344 H HB2  . CYS A 1 10 ? -2.131  -4.440  -0.914  1.00 0.00 ? 115 CYS A HB2  14 
ATOM 11345 H HB3  . CYS A 1 10 ? -3.099  -3.189  -1.689  1.00 0.00 ? 115 CYS A HB3  14 
ATOM 11346 N N    . CYS A 1 11 ? -3.653  -6.710  -2.332  1.00 0.00 ? 116 CYS A N    14 
ATOM 11347 C CA   . CYS A 1 11 ? -3.630  -7.501  -3.555  1.00 0.00 ? 116 CYS A CA   14 
ATOM 11348 C C    . CYS A 1 11 ? -5.050  -7.669  -4.082  1.00 0.00 ? 116 CYS A C    14 
ATOM 11349 O O    . CYS A 1 11 ? -5.286  -7.671  -5.289  1.00 0.00 ? 116 CYS A O    14 
ATOM 11350 C CB   . CYS A 1 11 ? -3.007  -8.872  -3.285  1.00 0.00 ? 116 CYS A CB   14 
ATOM 11351 S SG   . CYS A 1 11 ? -2.962  -9.981  -4.731  1.00 0.00 ? 116 CYS A SG   14 
ATOM 11352 H H    . CYS A 1 11 ? -3.196  -7.047  -1.533  1.00 0.00 ? 116 CYS A H    14 
ATOM 11353 H HA   . CYS A 1 11 ? -3.036  -6.969  -4.295  1.00 0.00 ? 116 CYS A HA   14 
ATOM 11354 H HB2  . CYS A 1 11 ? -1.992  -8.737  -2.943  1.00 0.00 ? 116 CYS A HB2  14 
ATOM 11355 H HB3  . CYS A 1 11 ? -3.573  -9.367  -2.511  1.00 0.00 ? 116 CYS A HB3  14 
ATOM 11356 N N    . LEU A 1 12 ? -5.989  -7.809  -3.151  1.00 0.00 ? 117 LEU A N    14 
ATOM 11357 C CA   . LEU A 1 12 ? -7.390  -7.965  -3.484  1.00 0.00 ? 117 LEU A CA   14 
ATOM 11358 C C    . LEU A 1 12 ? -8.043  -6.616  -3.775  1.00 0.00 ? 117 LEU A C    14 
ATOM 11359 O O    . LEU A 1 12 ? -8.569  -6.391  -4.866  1.00 0.00 ? 117 LEU A O    14 
ATOM 11360 C CB   . LEU A 1 12 ? -8.108  -8.653  -2.332  1.00 0.00 ? 117 LEU A CB   14 
ATOM 11361 C CG   . LEU A 1 12 ? -7.792  -10.139 -2.152  1.00 0.00 ? 117 LEU A CG   14 
ATOM 11362 C CD1  . LEU A 1 12 ? -8.469  -10.678 -0.900  1.00 0.00 ? 117 LEU A CD1  14 
ATOM 11363 C CD2  . LEU A 1 12 ? -8.224  -10.931 -3.377  1.00 0.00 ? 117 LEU A CD2  14 
ATOM 11364 H H    . LEU A 1 12 ? -5.730  -7.818  -2.206  1.00 0.00 ? 117 LEU A H    14 
ATOM 11365 H HA   . LEU A 1 12 ? -7.459  -8.586  -4.357  1.00 0.00 ? 117 LEU A HA   14 
ATOM 11366 H HB2  . LEU A 1 12 ? -7.841  -8.140  -1.426  1.00 0.00 ? 117 LEU A HB2  14 
ATOM 11367 H HB3  . LEU A 1 12 ? -9.164  -8.547  -2.484  1.00 0.00 ? 117 LEU A HB3  14 
ATOM 11368 H HG   . LEU A 1 12 ? -6.725  -10.262 -2.033  1.00 0.00 ? 117 LEU A HG   14 
ATOM 11369 H HD11 . LEU A 1 12 ? -8.113  -10.136 -0.037  1.00 0.00 ? 117 LEU A HD11 14 
ATOM 11370 H HD12 . LEU A 1 12 ? -8.236  -11.726 -0.788  1.00 0.00 ? 117 LEU A HD12 14 
ATOM 11371 H HD13 . LEU A 1 12 ? -9.539  -10.555 -0.988  1.00 0.00 ? 117 LEU A HD13 14 
ATOM 11372 H HD21 . LEU A 1 12 ? -7.664  -10.600 -4.239  1.00 0.00 ? 117 LEU A HD21 14 
ATOM 11373 H HD22 . LEU A 1 12 ? -9.280  -10.776 -3.553  1.00 0.00 ? 117 LEU A HD22 14 
ATOM 11374 H HD23 . LEU A 1 12 ? -8.039  -11.983 -3.211  1.00 0.00 ? 117 LEU A HD23 14 
ATOM 11375 N N    . SER A 1 13 ? -8.004  -5.719  -2.791  1.00 0.00 ? 118 SER A N    14 
ATOM 11376 C CA   . SER A 1 13 ? -8.601  -4.396  -2.931  1.00 0.00 ? 118 SER A CA   14 
ATOM 11377 C C    . SER A 1 13 ? -7.550  -3.326  -3.215  1.00 0.00 ? 118 SER A C    14 
ATOM 11378 O O    . SER A 1 13 ? -7.632  -2.617  -4.218  1.00 0.00 ? 118 SER A O    14 
ATOM 11379 C CB   . SER A 1 13 ? -9.372  -4.040  -1.662  1.00 0.00 ? 118 SER A CB   14 
ATOM 11380 O OG   . SER A 1 13 ? -10.504 -4.879  -1.499  1.00 0.00 ? 118 SER A OG   14 
ATOM 11381 H H    . SER A 1 13 ? -7.570  -5.953  -1.946  1.00 0.00 ? 118 SER A H    14 
ATOM 11382 H HA   . SER A 1 13 ? -9.292  -4.433  -3.759  1.00 0.00 ? 118 SER A HA   14 
ATOM 11383 H HB2  . SER A 1 13 ? -8.726  -4.159  -0.805  1.00 0.00 ? 118 SER A HB2  14 
ATOM 11384 H HB3  . SER A 1 13 ? -9.703  -3.018  -1.723  1.00 0.00 ? 118 SER A HB3  14 
ATOM 11385 H HG   . SER A 1 13 ? -10.216 -5.764  -1.260  1.00 0.00 ? 118 SER A HG   14 
ATOM 11386 N N    . GLY A 1 14 ? -6.565  -3.205  -2.327  1.00 0.00 ? 119 GLY A N    14 
ATOM 11387 C CA   . GLY A 1 14 ? -5.524  -2.209  -2.507  1.00 0.00 ? 119 GLY A CA   14 
ATOM 11388 C C    . GLY A 1 14 ? -5.391  -1.279  -1.311  1.00 0.00 ? 119 GLY A C    14 
ATOM 11389 O O    . GLY A 1 14 ? -6.290  -1.214  -0.473  1.00 0.00 ? 119 GLY A O    14 
ATOM 11390 H H    . GLY A 1 14 ? -6.539  -3.800  -1.550  1.00 0.00 ? 119 GLY A H    14 
ATOM 11391 H HA2  . GLY A 1 14 ? -4.584  -2.717  -2.654  1.00 0.00 ? 119 GLY A HA2  14 
ATOM 11392 H HA3  . GLY A 1 14 ? -5.751  -1.625  -3.392  1.00 0.00 ? 119 GLY A HA3  14 
ATOM 11393 N N    . CYS A 1 15 ? -4.263  -0.566  -1.219  1.00 0.00 ? 120 CYS A N    14 
ATOM 11394 C CA   . CYS A 1 15 ? -4.040  0.363   -0.105  1.00 0.00 ? 120 CYS A CA   14 
ATOM 11395 C C    . CYS A 1 15 ? -4.039  1.801   -0.576  1.00 0.00 ? 120 CYS A C    14 
ATOM 11396 O O    . CYS A 1 15 ? -3.987  2.085   -1.773  1.00 0.00 ? 120 CYS A O    14 
ATOM 11397 C CB   . CYS A 1 15 ? -2.713  0.112   0.626   1.00 0.00 ? 120 CYS A CB   14 
ATOM 11398 S SG   . CYS A 1 15 ? -1.806  -1.387  0.156   1.00 0.00 ? 120 CYS A SG   14 
ATOM 11399 H H    . CYS A 1 15 ? -3.581  -0.656  -1.916  1.00 0.00 ? 120 CYS A H    14 
ATOM 11400 H HA   . CYS A 1 15 ? -4.846  0.242   0.594   1.00 0.00 ? 120 CYS A HA   14 
ATOM 11401 H HB2  . CYS A 1 15 ? -2.056  0.944   0.430   1.00 0.00 ? 120 CYS A HB2  14 
ATOM 11402 H HB3  . CYS A 1 15 ? -2.903  0.060   1.687   1.00 0.00 ? 120 CYS A HB3  14 
ATOM 11403 N N    . THR A 1 16 ? -4.094  2.701   0.392   1.00 0.00 ? 121 THR A N    14 
ATOM 11404 C CA   . THR A 1 16 ? -4.064  4.121   0.117   1.00 0.00 ? 121 THR A CA   14 
ATOM 11405 C C    . THR A 1 16 ? -2.700  4.664   0.433   1.00 0.00 ? 121 THR A C    14 
ATOM 11406 O O    . THR A 1 16 ? -1.978  4.107   1.259   1.00 0.00 ? 121 THR A O    14 
ATOM 11407 C CB   . THR A 1 16 ? -5.082  4.900   0.960   1.00 0.00 ? 121 THR A CB   14 
ATOM 11408 O OG1  . THR A 1 16 ? -4.710  4.870   2.343   1.00 0.00 ? 121 THR A OG1  14 
ATOM 11409 C CG2  . THR A 1 16 ? -6.457  4.319   0.788   1.00 0.00 ? 121 THR A CG2  14 
ATOM 11410 H H    . THR A 1 16 ? -4.158  2.398   1.321   1.00 0.00 ? 121 THR A H    14 
ATOM 11411 H HA   . THR A 1 16 ? -4.284  4.276   -0.929  1.00 0.00 ? 121 THR A HA   14 
ATOM 11412 H HB   . THR A 1 16 ? -5.097  5.921   0.614   1.00 0.00 ? 121 THR A HB   14 
ATOM 11413 H HG1  . THR A 1 16 ? -5.136  4.125   2.774   1.00 0.00 ? 121 THR A HG1  14 
ATOM 11414 H HG21 . THR A 1 16 ? -6.620  4.154   -0.257  1.00 0.00 ? 121 THR A HG21 14 
ATOM 11415 H HG22 . THR A 1 16 ? -7.196  5.010   1.169   1.00 0.00 ? 121 THR A HG22 14 
ATOM 11416 H HG23 . THR A 1 16 ? -6.526  3.381   1.319   1.00 0.00 ? 121 THR A HG23 14 
ATOM 11417 N N    . GLN A 1 17 ? -2.351  5.761   -0.205  1.00 0.00 ? 122 GLN A N    14 
ATOM 11418 C CA   . GLN A 1 17 ? -1.068  6.383   0.041   1.00 0.00 ? 122 GLN A CA   14 
ATOM 11419 C C    . GLN A 1 17 ? -0.955  6.748   1.506   1.00 0.00 ? 122 GLN A C    14 
ATOM 11420 O O    . GLN A 1 17 ? 0.078   7.213   1.952   1.00 0.00 ? 122 GLN A O    14 
ATOM 11421 C CB   . GLN A 1 17 ? -0.887  7.607   -0.848  1.00 0.00 ? 122 GLN A CB   14 
ATOM 11422 C CG   . GLN A 1 17 ? -0.169  7.292   -2.147  1.00 0.00 ? 122 GLN A CG   14 
ATOM 11423 C CD   . GLN A 1 17 ? -0.209  8.439   -3.137  1.00 0.00 ? 122 GLN A CD   14 
ATOM 11424 O OE1  . GLN A 1 17 ? -1.162  9.218   -3.163  1.00 0.00 ? 122 GLN A OE1  14 
ATOM 11425 N NE2  . GLN A 1 17 ? 0.830   8.550   -3.955  1.00 0.00 ? 122 GLN A NE2  14 
ATOM 11426 H H    . GLN A 1 17 ? -2.977  6.165   -0.844  1.00 0.00 ? 122 GLN A H    14 
ATOM 11427 H HA   . GLN A 1 17 ? -0.283  5.655   -0.184  1.00 0.00 ? 122 GLN A HA   14 
ATOM 11428 H HB2  . GLN A 1 17 ? -1.860  8.011   -1.087  1.00 0.00 ? 122 GLN A HB2  14 
ATOM 11429 H HB3  . GLN A 1 17 ? -0.321  8.348   -0.313  1.00 0.00 ? 122 GLN A HB3  14 
ATOM 11430 H HG2  . GLN A 1 17 ? 0.864   7.063   -1.923  1.00 0.00 ? 122 GLN A HG2  14 
ATOM 11431 H HG3  . GLN A 1 17 ? -0.630  6.427   -2.595  1.00 0.00 ? 122 GLN A HG3  14 
ATOM 11432 H HE21 . GLN A 1 17 ? 1.553   7.895   -3.878  1.00 0.00 ? 122 GLN A HE21 14 
ATOM 11433 H HE22 . GLN A 1 17 ? 0.829   9.283   -4.607  1.00 0.00 ? 122 GLN A HE22 14 
ATOM 11434 N N    . GLN A 1 18 ? -2.036  6.561   2.251   1.00 0.00 ? 123 GLN A N    14 
ATOM 11435 C CA   . GLN A 1 18 ? -1.994  6.804   3.672   1.00 0.00 ? 123 GLN A CA   14 
ATOM 11436 C C    . GLN A 1 18 ? -1.552  5.525   4.353   1.00 0.00 ? 123 GLN A C    14 
ATOM 11437 O O    . GLN A 1 18 ? -0.602  5.525   5.132   1.00 0.00 ? 123 GLN A O    14 
ATOM 11438 C CB   . GLN A 1 18 ? -3.343  7.262   4.196   1.00 0.00 ? 123 GLN A CB   14 
ATOM 11439 C CG   . GLN A 1 18 ? -3.500  8.773   4.201   1.00 0.00 ? 123 GLN A CG   14 
ATOM 11440 C CD   . GLN A 1 18 ? -3.319  9.387   2.826   1.00 0.00 ? 123 GLN A CD   14 
ATOM 11441 O OE1  . GLN A 1 18 ? -4.278  9.536   2.069   1.00 0.00 ? 123 GLN A OE1  14 
ATOM 11442 N NE2  . GLN A 1 18 ? -2.085  9.746   2.497   1.00 0.00 ? 123 GLN A NE2  14 
ATOM 11443 H H    . GLN A 1 18 ? -2.876  6.262   1.837   1.00 0.00 ? 123 GLN A H    14 
ATOM 11444 H HA   . GLN A 1 18 ? -1.257  7.573   3.859   1.00 0.00 ? 123 GLN A HA   14 
ATOM 11445 H HB2  . GLN A 1 18 ? -4.120  6.840   3.579   1.00 0.00 ? 123 GLN A HB2  14 
ATOM 11446 H HB3  . GLN A 1 18 ? -3.457  6.904   5.207   1.00 0.00 ? 123 GLN A HB3  14 
ATOM 11447 H HG2  . GLN A 1 18 ? -4.485  9.018   4.557   1.00 0.00 ? 123 GLN A HG2  14 
ATOM 11448 H HG3  . GLN A 1 18 ? -2.763  9.196   4.867   1.00 0.00 ? 123 GLN A HG3  14 
ATOM 11449 H HE21 . GLN A 1 18 ? -1.370  9.599   3.150   1.00 0.00 ? 123 GLN A HE21 14 
ATOM 11450 H HE22 . GLN A 1 18 ? -1.939  10.147  1.614   1.00 0.00 ? 123 GLN A HE22 14 
ATOM 11451 N N    . ASP A 1 19 ? -2.230  4.421   4.032   1.00 0.00 ? 124 ASP A N    14 
ATOM 11452 C CA   . ASP A 1 19 ? -1.858  3.130   4.589   1.00 0.00 ? 124 ASP A CA   14 
ATOM 11453 C C    . ASP A 1 19 ? -0.390  2.887   4.278   1.00 0.00 ? 124 ASP A C    14 
ATOM 11454 O O    . ASP A 1 19 ? 0.433   2.688   5.174   1.00 0.00 ? 124 ASP A O    14 
ATOM 11455 C CB   . ASP A 1 19 ? -2.706  1.997   3.988   1.00 0.00 ? 124 ASP A CB   14 
ATOM 11456 C CG   . ASP A 1 19 ? -2.556  0.697   4.752   1.00 0.00 ? 124 ASP A CG   14 
ATOM 11457 O OD1  . ASP A 1 19 ? -2.607  0.732   5.999   1.00 0.00 ? 124 ASP A OD1  14 
ATOM 11458 O OD2  . ASP A 1 19 ? -2.387  -0.356  4.103   1.00 0.00 ? 124 ASP A OD2  14 
ATOM 11459 H H    . ASP A 1 19 ? -2.990  4.480   3.407   1.00 0.00 ? 124 ASP A H    14 
ATOM 11460 H HA   . ASP A 1 19 ? -2.000  3.164   5.659   1.00 0.00 ? 124 ASP A HA   14 
ATOM 11461 H HB2  . ASP A 1 19 ? -3.748  2.278   3.995   1.00 0.00 ? 124 ASP A HB2  14 
ATOM 11462 H HB3  . ASP A 1 19 ? -2.393  1.830   2.968   1.00 0.00 ? 124 ASP A HB3  14 
ATOM 11463 N N    . LEU A 1 20 ? -0.071  2.943   2.990   1.00 0.00 ? 125 LEU A N    14 
ATOM 11464 C CA   . LEU A 1 20 ? 1.288   2.747   2.522   1.00 0.00 ? 125 LEU A CA   14 
ATOM 11465 C C    . LEU A 1 20 ? 2.244   3.733   3.204   1.00 0.00 ? 125 LEU A C    14 
ATOM 11466 O O    . LEU A 1 20 ? 3.408   3.408   3.450   1.00 0.00 ? 125 LEU A O    14 
ATOM 11467 C CB   . LEU A 1 20 ? 1.337   2.866   0.991   1.00 0.00 ? 125 LEU A CB   14 
ATOM 11468 C CG   . LEU A 1 20 ? 0.513   1.829   0.240   1.00 0.00 ? 125 LEU A CG   14 
ATOM 11469 C CD1  . LEU A 1 20 ? -0.476  2.513   -0.680  1.00 0.00 ? 125 LEU A CD1  14 
ATOM 11470 C CD2  . LEU A 1 20 ? 1.420   0.944   -0.573  1.00 0.00 ? 125 LEU A CD2  14 
ATOM 11471 H H    . LEU A 1 20 ? -0.776  3.119   2.335   1.00 0.00 ? 125 LEU A H    14 
ATOM 11472 H HA   . LEU A 1 20 ? 1.583   1.747   2.799   1.00 0.00 ? 125 LEU A HA   14 
ATOM 11473 H HB2  . LEU A 1 20 ? 0.985   3.832   0.693   1.00 0.00 ? 125 LEU A HB2  14 
ATOM 11474 H HB3  . LEU A 1 20 ? 2.353   2.774   0.674   1.00 0.00 ? 125 LEU A HB3  14 
ATOM 11475 H HG   . LEU A 1 20 ? -0.032  1.215   0.941   1.00 0.00 ? 125 LEU A HG   14 
ATOM 11476 H HD11 . LEU A 1 20 ? -1.393  1.946   -0.715  1.00 0.00 ? 125 LEU A HD11 14 
ATOM 11477 H HD12 . LEU A 1 20 ? -0.051  2.569   -1.666  1.00 0.00 ? 125 LEU A HD12 14 
ATOM 11478 H HD13 . LEU A 1 20 ? -0.678  3.509   -0.319  1.00 0.00 ? 125 LEU A HD13 14 
ATOM 11479 H HD21 . LEU A 1 20 ? 2.325   0.748   -0.017  1.00 0.00 ? 125 LEU A HD21 14 
ATOM 11480 H HD22 . LEU A 1 20 ? 1.661   1.456   -1.498  1.00 0.00 ? 125 LEU A HD22 14 
ATOM 11481 H HD23 . LEU A 1 20 ? 0.919   0.016   -0.790  1.00 0.00 ? 125 LEU A HD23 14 
ATOM 11482 N N    . LEU A 1 21 ? 1.745   4.931   3.526   1.00 0.00 ? 126 LEU A N    14 
ATOM 11483 C CA   . LEU A 1 21 ? 2.557   5.934   4.208   1.00 0.00 ? 126 LEU A CA   14 
ATOM 11484 C C    . LEU A 1 21 ? 2.982   5.423   5.579   1.00 0.00 ? 126 LEU A C    14 
ATOM 11485 O O    . LEU A 1 21 ? 4.044   5.779   6.087   1.00 0.00 ? 126 LEU A O    14 
ATOM 11486 C CB   . LEU A 1 21 ? 1.776   7.240   4.377   1.00 0.00 ? 126 LEU A CB   14 
ATOM 11487 C CG   . LEU A 1 21 ? 2.107   8.340   3.370   1.00 0.00 ? 126 LEU A CG   14 
ATOM 11488 C CD1  . LEU A 1 21 ? 1.172   9.529   3.556   1.00 0.00 ? 126 LEU A CD1  14 
ATOM 11489 C CD2  . LEU A 1 21 ? 3.560   8.772   3.500   1.00 0.00 ? 126 LEU A CD2  14 
ATOM 11490 H H    . LEU A 1 21 ? 0.816   5.147   3.295   1.00 0.00 ? 126 LEU A H    14 
ATOM 11491 H HA   . LEU A 1 21 ? 3.437   6.119   3.612   1.00 0.00 ? 126 LEU A HA   14 
ATOM 11492 H HB2  . LEU A 1 21 ? 0.723   7.016   4.293   1.00 0.00 ? 126 LEU A HB2  14 
ATOM 11493 H HB3  . LEU A 1 21 ? 1.963   7.624   5.368   1.00 0.00 ? 126 LEU A HB3  14 
ATOM 11494 H HG   . LEU A 1 21 ? 1.959   7.952   2.370   1.00 0.00 ? 126 LEU A HG   14 
ATOM 11495 H HD11 . LEU A 1 21 ? 1.381   10.007  4.502   1.00 0.00 ? 126 LEU A HD11 14 
ATOM 11496 H HD12 . LEU A 1 21 ? 0.145   9.186   3.546   1.00 0.00 ? 126 LEU A HD12 14 
ATOM 11497 H HD13 . LEU A 1 21 ? 1.322   10.236  2.754   1.00 0.00 ? 126 LEU A HD13 14 
ATOM 11498 H HD21 . LEU A 1 21 ? 3.739   9.131   4.503   1.00 0.00 ? 126 LEU A HD21 14 
ATOM 11499 H HD22 . LEU A 1 21 ? 3.767   9.561   2.793   1.00 0.00 ? 126 LEU A HD22 14 
ATOM 11500 H HD23 . LEU A 1 21 ? 4.205   7.930   3.301   1.00 0.00 ? 126 LEU A HD23 14 
ATOM 11501 N N    . THR A 1 22 ? 2.135   4.587   6.174   1.00 0.00 ? 127 THR A N    14 
ATOM 11502 C CA   . THR A 1 22 ? 2.415   4.028   7.490   1.00 0.00 ? 127 THR A CA   14 
ATOM 11503 C C    . THR A 1 22 ? 3.041   2.639   7.388   1.00 0.00 ? 127 THR A C    14 
ATOM 11504 O O    . THR A 1 22 ? 3.428   2.057   8.400   1.00 0.00 ? 127 THR A O    14 
ATOM 11505 C CB   . THR A 1 22 ? 1.141   3.927   8.358   1.00 0.00 ? 127 THR A CB   14 
ATOM 11506 O OG1  . THR A 1 22 ? 0.684   2.570   8.401   1.00 0.00 ? 127 THR A OG1  14 
ATOM 11507 C CG2  . THR A 1 22 ? 0.027   4.814   7.822   1.00 0.00 ? 127 THR A CG2  14 
ATOM 11508 H H    . THR A 1 22 ? 1.302   4.347   5.719   1.00 0.00 ? 127 THR A H    14 
ATOM 11509 H HA   . THR A 1 22 ? 3.109   4.688   7.989   1.00 0.00 ? 127 THR A HA   14 
ATOM 11510 H HB   . THR A 1 22 ? 1.383   4.248   9.362   1.00 0.00 ? 127 THR A HB   14 
ATOM 11511 H HG1  . THR A 1 22 ? -0.187  2.537   8.804   1.00 0.00 ? 127 THR A HG1  14 
ATOM 11512 H HG21 . THR A 1 22 ? 0.433   5.766   7.516   1.00 0.00 ? 127 THR A HG21 14 
ATOM 11513 H HG22 . THR A 1 22 ? -0.712  4.970   8.595   1.00 0.00 ? 127 THR A HG22 14 
ATOM 11514 H HG23 . THR A 1 22 ? -0.437  4.332   6.974   1.00 0.00 ? 127 THR A HG23 14 
ATOM 11515 N N    . LEU A 1 23 ? 3.139   2.103   6.170   1.00 0.00 ? 128 LEU A N    14 
ATOM 11516 C CA   . LEU A 1 23 ? 3.709   0.783   5.979   1.00 0.00 ? 128 LEU A CA   14 
ATOM 11517 C C    . LEU A 1 23 ? 5.205   0.870   5.691   1.00 0.00 ? 128 LEU A C    14 
ATOM 11518 O O    . LEU A 1 23 ? 5.940   -0.098  5.887   1.00 0.00 ? 128 LEU A O    14 
ATOM 11519 C CB   . LEU A 1 23 ? 2.975   0.066   4.853   1.00 0.00 ? 128 LEU A CB   14 
ATOM 11520 C CG   . LEU A 1 23 ? 1.474   -0.088  5.084   1.00 0.00 ? 128 LEU A CG   14 
ATOM 11521 C CD1  . LEU A 1 23 ? 0.763   -0.446  3.795   1.00 0.00 ? 128 LEU A CD1  14 
ATOM 11522 C CD2  . LEU A 1 23 ? 1.225   -1.141  6.138   1.00 0.00 ? 128 LEU A CD2  14 
ATOM 11523 H H    . LEU A 1 23 ? 2.830   2.605   5.382   1.00 0.00 ? 128 LEU A H    14 
ATOM 11524 H HA   . LEU A 1 23 ? 3.565   0.226   6.893   1.00 0.00 ? 128 LEU A HA   14 
ATOM 11525 H HB2  . LEU A 1 23 ? 3.124   0.609   3.940   1.00 0.00 ? 128 LEU A HB2  14 
ATOM 11526 H HB3  . LEU A 1 23 ? 3.399   -0.916  4.741   1.00 0.00 ? 128 LEU A HB3  14 
ATOM 11527 H HG   . LEU A 1 23 ? 1.073   0.844   5.442   1.00 0.00 ? 128 LEU A HG   14 
ATOM 11528 H HD11 . LEU A 1 23 ? 0.792   -1.516  3.657   1.00 0.00 ? 128 LEU A HD11 14 
ATOM 11529 H HD12 . LEU A 1 23 ? 1.257   0.036   2.965   1.00 0.00 ? 128 LEU A HD12 14 
ATOM 11530 H HD13 . LEU A 1 23 ? -0.263  -0.117  3.846   1.00 0.00 ? 128 LEU A HD13 14 
ATOM 11531 H HD21 . LEU A 1 23 ? 1.453   -0.739  7.113   1.00 0.00 ? 128 LEU A HD21 14 
ATOM 11532 H HD22 . LEU A 1 23 ? 1.863   -1.982  5.936   1.00 0.00 ? 128 LEU A HD22 14 
ATOM 11533 H HD23 . LEU A 1 23 ? 0.191   -1.452  6.104   1.00 0.00 ? 128 LEU A HD23 14 
ATOM 11534 N N    . CYS A 1 24 ? 5.654   2.037   5.231   1.00 0.00 ? 129 CYS A N    14 
ATOM 11535 C CA   . CYS A 1 24 ? 7.069   2.241   4.939   1.00 0.00 ? 129 CYS A CA   14 
ATOM 11536 C C    . CYS A 1 24 ? 7.898   2.202   6.222   1.00 0.00 ? 129 CYS A C    14 
ATOM 11537 O O    . CYS A 1 24 ? 7.393   2.503   7.304   1.00 0.00 ? 129 CYS A O    14 
ATOM 11538 C CB   . CYS A 1 24 ? 7.294   3.568   4.212   1.00 0.00 ? 129 CYS A CB   14 
ATOM 11539 S SG   . CYS A 1 24 ? 6.843   5.052   5.176   1.00 0.00 ? 129 CYS A SG   14 
ATOM 11540 H H    . CYS A 1 24 ? 5.018   2.769   5.072   1.00 0.00 ? 129 CYS A H    14 
ATOM 11541 H HA   . CYS A 1 24 ? 7.390   1.433   4.298   1.00 0.00 ? 129 CYS A HA   14 
ATOM 11542 H HB2  . CYS A 1 24 ? 8.340   3.654   3.955   1.00 0.00 ? 129 CYS A HB2  14 
ATOM 11543 H HB3  . CYS A 1 24 ? 6.708   3.572   3.307   1.00 0.00 ? 129 CYS A HB3  14 
ATOM 11544 N N    . PRO A 1 25 ? 9.185   1.826   6.114   1.00 0.00 ? 130 PRO A N    14 
ATOM 11545 C CA   . PRO A 1 25 ? 10.092  1.734   7.261   1.00 0.00 ? 130 PRO A CA   14 
ATOM 11546 C C    . PRO A 1 25 ? 10.609  3.099   7.707   1.00 0.00 ? 130 PRO A C    14 
ATOM 11547 O O    . PRO A 1 25 ? 11.469  3.188   8.583   1.00 0.00 ? 130 PRO A O    14 
ATOM 11548 C CB   . PRO A 1 25 ? 11.254  0.867   6.739   1.00 0.00 ? 130 PRO A CB   14 
ATOM 11549 C CG   . PRO A 1 25 ? 10.861  0.439   5.359   1.00 0.00 ? 130 PRO A CG   14 
ATOM 11550 C CD   . PRO A 1 25 ? 9.869   1.454   4.874   1.00 0.00 ? 130 PRO A CD   14 
ATOM 11551 H HA   . PRO A 1 25 ? 9.620   1.241   8.097   1.00 0.00 ? 130 PRO A HA   14 
ATOM 11552 H HB2  . PRO A 1 25 ? 12.160  1.454   6.724   1.00 0.00 ? 130 PRO A HB2  14 
ATOM 11553 H HB3  . PRO A 1 25 ? 11.387  0.016   7.391   1.00 0.00 ? 130 PRO A HB3  14 
ATOM 11554 H HG2  . PRO A 1 25 ? 11.730  0.427   4.717   1.00 0.00 ? 130 PRO A HG2  14 
ATOM 11555 H HG3  . PRO A 1 25 ? 10.408  -0.542  5.395   1.00 0.00 ? 130 PRO A HG3  14 
ATOM 11556 H HD2  . PRO A 1 25 ? 10.376  2.301   4.439   1.00 0.00 ? 130 PRO A HD2  14 
ATOM 11557 H HD3  . PRO A 1 25 ? 9.180   1.014   4.168   1.00 0.00 ? 130 PRO A HD3  14 
ATOM 11558 N N    . TYR A 1 26 ? 10.082  4.156   7.096   1.00 0.00 ? 131 TYR A N    14 
ATOM 11559 C CA   . TYR A 1 26 ? 10.492  5.515   7.432   1.00 0.00 ? 131 TYR A CA   14 
ATOM 11560 C C    . TYR A 1 26 ? 9.276   6.405   7.674   1.00 0.00 ? 131 TYR A C    14 
ATOM 11561 O O    . TYR A 1 26 ? 8.766   6.990   6.696   1.00 0.00 ? 131 TYR A O    14 
ATOM 11562 C CB   . TYR A 1 26 ? 11.355  6.105   6.313   1.00 0.00 ? 131 TYR A CB   14 
ATOM 11563 C CG   . TYR A 1 26 ? 12.696  5.424   6.154   1.00 0.00 ? 131 TYR A CG   14 
ATOM 11564 C CD1  . TYR A 1 26 ? 12.818  4.244   5.429   1.00 0.00 ? 131 TYR A CD1  14 
ATOM 11565 C CD2  . TYR A 1 26 ? 13.841  5.960   6.730   1.00 0.00 ? 131 TYR A CD2  14 
ATOM 11566 C CE1  . TYR A 1 26 ? 14.043  3.620   5.283   1.00 0.00 ? 131 TYR A CE1  14 
ATOM 11567 C CE2  . TYR A 1 26 ? 15.069  5.344   6.586   1.00 0.00 ? 131 TYR A CE2  14 
ATOM 11568 C CZ   . TYR A 1 26 ? 15.164  4.175   5.863   1.00 0.00 ? 131 TYR A CZ   14 
ATOM 11569 O OH   . TYR A 1 26 ? 16.385  3.556   5.718   1.00 0.00 ? 131 TYR A OH   14 
ATOM 11570 O OXT  . TYR A 1 26 ? 8.845   6.508   8.842   1.00 0.00 ? 131 TYR A OXT  14 
ATOM 11571 H H    . TYR A 1 26 ? 9.403   4.019   6.404   1.00 0.00 ? 131 TYR A H    14 
ATOM 11572 H HA   . TYR A 1 26 ? 11.077  5.471   8.338   1.00 0.00 ? 131 TYR A HA   14 
ATOM 11573 H HB2  . TYR A 1 26 ? 10.827  6.017   5.376   1.00 0.00 ? 131 TYR A HB2  14 
ATOM 11574 H HB3  . TYR A 1 26 ? 11.535  7.149   6.520   1.00 0.00 ? 131 TYR A HB3  14 
ATOM 11575 H HD1  . TYR A 1 26 ? 11.938  3.814   4.976   1.00 0.00 ? 131 TYR A HD1  14 
ATOM 11576 H HD2  . TYR A 1 26 ? 13.763  6.877   7.297   1.00 0.00 ? 131 TYR A HD2  14 
ATOM 11577 H HE1  . TYR A 1 26 ? 14.117  2.704   4.715   1.00 0.00 ? 131 TYR A HE1  14 
ATOM 11578 H HE2  . TYR A 1 26 ? 15.947  5.776   7.041   1.00 0.00 ? 131 TYR A HE2  14 
ATOM 11579 H HH   . TYR A 1 26 ? 16.841  3.546   6.563   1.00 0.00 ? 131 TYR A HH   14 
ATOM 11580 N N    . PRO B 2 1  ? -1.711  17.576  -4.654  1.00 0.00 ? 25  PRO B N    14 
ATOM 11581 C CA   . PRO B 2 1  ? -2.908  17.072  -5.375  1.00 0.00 ? 25  PRO B CA   14 
ATOM 11582 C C    . PRO B 2 1  ? -3.101  15.578  -5.143  1.00 0.00 ? 25  PRO B C    14 
ATOM 11583 O O    . PRO B 2 1  ? -2.336  14.956  -4.406  1.00 0.00 ? 25  PRO B O    14 
ATOM 11584 C CB   . PRO B 2 1  ? -2.741  17.353  -6.862  1.00 0.00 ? 25  PRO B CB   14 
ATOM 11585 C CG   . PRO B 2 1  ? -1.335  17.829  -6.975  1.00 0.00 ? 25  PRO B CG   14 
ATOM 11586 C CD   . PRO B 2 1  ? -0.974  18.409  -5.627  1.00 0.00 ? 25  PRO B CD   14 
ATOM 11587 H H2   . PRO B 2 1  ? -1.231  16.736  -4.294  1.00 0.00 ? 25  PRO B H2   14 
ATOM 11588 H H3   . PRO B 2 1  ? -2.094  18.026  -3.789  1.00 0.00 ? 25  PRO B H3   14 
ATOM 11589 H HA   . PRO B 2 1  ? -3.777  17.599  -5.009  1.00 0.00 ? 25  PRO B HA   14 
ATOM 11590 H HB2  . PRO B 2 1  ? -2.904  16.445  -7.427  1.00 0.00 ? 25  PRO B HB2  14 
ATOM 11591 H HB3  . PRO B 2 1  ? -3.442  18.113  -7.173  1.00 0.00 ? 25  PRO B HB3  14 
ATOM 11592 H HG2  . PRO B 2 1  ? -0.685  16.998  -7.211  1.00 0.00 ? 25  PRO B HG2  14 
ATOM 11593 H HG3  . PRO B 2 1  ? -1.265  18.589  -7.739  1.00 0.00 ? 25  PRO B HG3  14 
ATOM 11594 H HD2  . PRO B 2 1  ? 0.091   18.334  -5.460  1.00 0.00 ? 25  PRO B HD2  14 
ATOM 11595 H HD3  . PRO B 2 1  ? -1.292  19.439  -5.564  1.00 0.00 ? 25  PRO B HD3  14 
ATOM 11596 N N    . THR B 2 2  ? -4.130  15.015  -5.780  1.00 0.00 ? 26  THR B N    14 
ATOM 11597 C CA   . THR B 2 2  ? -4.450  13.590  -5.666  1.00 0.00 ? 26  THR B CA   14 
ATOM 11598 C C    . THR B 2 2  ? -4.796  13.203  -4.224  1.00 0.00 ? 26  THR B C    14 
ATOM 11599 O O    . THR B 2 2  ? -4.088  13.570  -3.288  1.00 0.00 ? 26  THR B O    14 
ATOM 11600 C CB   . THR B 2 2  ? -3.296  12.694  -6.165  1.00 0.00 ? 26  THR B CB   14 
ATOM 11601 O OG1  . THR B 2 2  ? -2.239  12.655  -5.200  1.00 0.00 ? 26  THR B OG1  14 
ATOM 11602 C CG2  . THR B 2 2  ? -2.754  13.198  -7.494  1.00 0.00 ? 26  THR B CG2  14 
ATOM 11603 H H    . THR B 2 2  ? -4.696  15.579  -6.346  1.00 0.00 ? 26  THR B H    14 
ATOM 11604 H HA   . THR B 2 2  ? -5.311  13.403  -6.290  1.00 0.00 ? 26  THR B HA   14 
ATOM 11605 H HB   . THR B 2 2  ? -3.677  11.693  -6.308  1.00 0.00 ? 26  THR B HB   14 
ATOM 11606 H HG1  . THR B 2 2  ? -2.232  11.797  -4.769  1.00 0.00 ? 26  THR B HG1  14 
ATOM 11607 H HG21 . THR B 2 2  ? -1.965  12.544  -7.834  1.00 0.00 ? 26  THR B HG21 14 
ATOM 11608 H HG22 . THR B 2 2  ? -2.362  14.196  -7.367  1.00 0.00 ? 26  THR B HG22 14 
ATOM 11609 H HG23 . THR B 2 2  ? -3.549  13.214  -8.226  1.00 0.00 ? 26  THR B HG23 14 
ATOM 11610 N N    . PRO B 2 3  ? -5.895  12.447  -4.025  1.00 0.00 ? 27  PRO B N    14 
ATOM 11611 C CA   . PRO B 2 3  ? -6.333  12.013  -2.711  1.00 0.00 ? 27  PRO B CA   14 
ATOM 11612 C C    . PRO B 2 3  ? -5.863  10.602  -2.398  1.00 0.00 ? 27  PRO B C    14 
ATOM 11613 O O    . PRO B 2 3  ? -4.892  10.120  -2.986  1.00 0.00 ? 27  PRO B O    14 
ATOM 11614 C CB   . PRO B 2 3  ? -7.851  12.050  -2.863  1.00 0.00 ? 27  PRO B CB   14 
ATOM 11615 C CG   . PRO B 2 3  ? -8.108  11.721  -4.305  1.00 0.00 ? 27  PRO B CG   14 
ATOM 11616 C CD   . PRO B 2 3  ? -6.812  11.943  -5.059  1.00 0.00 ? 27  PRO B CD   14 
ATOM 11617 H HA   . PRO B 2 3  ? -6.023  12.689  -1.930  1.00 0.00 ? 27  PRO B HA   14 
ATOM 11618 H HB2  . PRO B 2 3  ? -8.300  11.319  -2.204  1.00 0.00 ? 27  PRO B HB2  14 
ATOM 11619 H HB3  . PRO B 2 3  ? -8.215  13.035  -2.616  1.00 0.00 ? 27  PRO B HB3  14 
ATOM 11620 H HG2  . PRO B 2 3  ? -8.413  10.688  -4.392  1.00 0.00 ? 27  PRO B HG2  14 
ATOM 11621 H HG3  . PRO B 2 3  ? -8.879  12.369  -4.693  1.00 0.00 ? 27  PRO B HG3  14 
ATOM 11622 H HD2  . PRO B 2 3  ? -6.451  11.010  -5.472  1.00 0.00 ? 27  PRO B HD2  14 
ATOM 11623 H HD3  . PRO B 2 3  ? -6.952  12.674  -5.841  1.00 0.00 ? 27  PRO B HD3  14 
ATOM 11624 N N    . GLU B 2 4  ? -6.548  9.939   -1.477  1.00 0.00 ? 28  GLU B N    14 
ATOM 11625 C CA   . GLU B 2 4  ? -6.191  8.575   -1.116  1.00 0.00 ? 28  GLU B CA   14 
ATOM 11626 C C    . GLU B 2 4  ? -6.756  7.602   -2.126  1.00 0.00 ? 28  GLU B C    14 
ATOM 11627 O O    . GLU B 2 4  ? -7.752  6.922   -1.879  1.00 0.00 ? 28  GLU B O    14 
ATOM 11628 C CB   . GLU B 2 4  ? -6.678  8.215   0.278   1.00 0.00 ? 28  GLU B CB   14 
ATOM 11629 C CG   . GLU B 2 4  ? -8.048  8.770   0.625   1.00 0.00 ? 28  GLU B CG   14 
ATOM 11630 C CD   . GLU B 2 4  ? -8.593  8.210   1.923   1.00 0.00 ? 28  GLU B CD   14 
ATOM 11631 O OE1  . GLU B 2 4  ? -8.325  8.807   2.988   1.00 0.00 ? 28  GLU B OE1  14 
ATOM 11632 O OE2  . GLU B 2 4  ? -9.286  7.173   1.876   1.00 0.00 ? 28  GLU B OE2  14 
ATOM 11633 H H    . GLU B 2 4  ? -7.304  10.376  -1.034  1.00 0.00 ? 28  GLU B H    14 
ATOM 11634 H HA   . GLU B 2 4  ? -5.114  8.505   -1.138  1.00 0.00 ? 28  GLU B HA   14 
ATOM 11635 H HB2  . GLU B 2 4  ? -6.722  7.139   0.362   1.00 0.00 ? 28  GLU B HB2  14 
ATOM 11636 H HB3  . GLU B 2 4  ? -5.966  8.589   0.985   1.00 0.00 ? 28  GLU B HB3  14 
ATOM 11637 H HG2  . GLU B 2 4  ? -7.973  9.843   0.718   1.00 0.00 ? 28  GLU B HG2  14 
ATOM 11638 H HG3  . GLU B 2 4  ? -8.734  8.527   -0.172  1.00 0.00 ? 28  GLU B HG3  14 
ATOM 11639 N N    . MET B 2 5  ? -6.101  7.552   -3.265  1.00 0.00 ? 29  MET B N    14 
ATOM 11640 C CA   . MET B 2 5  ? -6.515  6.670   -4.343  1.00 0.00 ? 29  MET B CA   14 
ATOM 11641 C C    . MET B 2 5  ? -6.019  5.265   -4.087  1.00 0.00 ? 29  MET B C    14 
ATOM 11642 O O    . MET B 2 5  ? -4.818  4.997   -4.062  1.00 0.00 ? 29  MET B O    14 
ATOM 11643 C CB   . MET B 2 5  ? -6.003  7.165   -5.685  1.00 0.00 ? 29  MET B CB   14 
ATOM 11644 C CG   . MET B 2 5  ? -6.913  6.809   -6.849  1.00 0.00 ? 29  MET B CG   14 
ATOM 11645 S SD   . MET B 2 5  ? -6.241  7.323   -8.441  1.00 0.00 ? 29  MET B SD   14 
ATOM 11646 C CE   . MET B 2 5  ? -7.447  6.615   -9.558  1.00 0.00 ? 29  MET B CE   14 
ATOM 11647 H H    . MET B 2 5  ? -5.308  8.114   -3.375  1.00 0.00 ? 29  MET B H    14 
ATOM 11648 H HA   . MET B 2 5  ? -7.595  6.646   -4.360  1.00 0.00 ? 29  MET B HA   14 
ATOM 11649 H HB2  . MET B 2 5  ? -5.893  8.242   -5.651  1.00 0.00 ? 29  MET B HB2  14 
ATOM 11650 H HB3  . MET B 2 5  ? -5.043  6.713   -5.863  1.00 0.00 ? 29  MET B HB3  14 
ATOM 11651 H HG2  . MET B 2 5  ? -7.053  5.738   -6.864  1.00 0.00 ? 29  MET B HG2  14 
ATOM 11652 H HG3  . MET B 2 5  ? -7.868  7.294   -6.703  1.00 0.00 ? 29  MET B HG3  14 
ATOM 11653 H HE1  . MET B 2 5  ? -8.418  7.045   -9.361  1.00 0.00 ? 29  MET B HE1  14 
ATOM 11654 H HE2  . MET B 2 5  ? -7.491  5.546   -9.410  1.00 0.00 ? 29  MET B HE2  14 
ATOM 11655 H HE3  . MET B 2 5  ? -7.161  6.826   -10.578 1.00 0.00 ? 29  MET B HE3  14 
ATOM 11656 N N    . ARG B 2 6  ? -6.972  4.384   -3.900  1.00 0.00 ? 30  ARG B N    14 
ATOM 11657 C CA   . ARG B 2 6  ? -6.700  2.990   -3.625  1.00 0.00 ? 30  ARG B CA   14 
ATOM 11658 C C    . ARG B 2 6  ? -6.376  2.222   -4.901  1.00 0.00 ? 30  ARG B C    14 
ATOM 11659 O O    . ARG B 2 6  ? -6.839  2.577   -5.985  1.00 0.00 ? 30  ARG B O    14 
ATOM 11660 C CB   . ARG B 2 6  ? -7.901  2.373   -2.930  1.00 0.00 ? 30  ARG B CB   14 
ATOM 11661 C CG   . ARG B 2 6  ? -7.755  2.344   -1.427  1.00 0.00 ? 30  ARG B CG   14 
ATOM 11662 C CD   . ARG B 2 6  ? -8.273  1.050   -0.853  1.00 0.00 ? 30  ARG B CD   14 
ATOM 11663 N NE   . ARG B 2 6  ? -8.108  0.995   0.592   1.00 0.00 ? 30  ARG B NE   14 
ATOM 11664 C CZ   . ARG B 2 6  ? -8.449  -0.050  1.338   1.00 0.00 ? 30  ARG B CZ   14 
ATOM 11665 N NH1  . ARG B 2 6  ? -8.975  -1.129  0.771   1.00 0.00 ? 30  ARG B NH1  14 
ATOM 11666 N NH2  . ARG B 2 6  ? -8.267  -0.019  2.650   1.00 0.00 ? 30  ARG B NH2  14 
ATOM 11667 H H    . ARG B 2 6  ? -7.898  4.684   -3.970  1.00 0.00 ? 30  ARG B H    14 
ATOM 11668 H HA   . ARG B 2 6  ? -5.852  2.941   -2.952  1.00 0.00 ? 30  ARG B HA   14 
ATOM 11669 H HB2  . ARG B 2 6  ? -8.779  2.951   -3.170  1.00 0.00 ? 30  ARG B HB2  14 
ATOM 11670 H HB3  . ARG B 2 6  ? -8.032  1.370   -3.284  1.00 0.00 ? 30  ARG B HB3  14 
ATOM 11671 H HG2  . ARG B 2 6  ? -6.709  2.443   -1.175  1.00 0.00 ? 30  ARG B HG2  14 
ATOM 11672 H HG3  . ARG B 2 6  ? -8.310  3.165   -1.004  1.00 0.00 ? 30  ARG B HG3  14 
ATOM 11673 H HD2  . ARG B 2 6  ? -9.318  0.964   -1.091  1.00 0.00 ? 30  ARG B HD2  14 
ATOM 11674 H HD3  . ARG B 2 6  ? -7.727  0.237   -1.303  1.00 0.00 ? 30  ARG B HD3  14 
ATOM 11675 H HE   . ARG B 2 6  ? -7.725  1.782   1.029   1.00 0.00 ? 30  ARG B HE   14 
ATOM 11676 H HH11 . ARG B 2 6  ? -9.115  -1.157  -0.219  1.00 0.00 ? 30  ARG B HH11 14 
ATOM 11677 H HH12 . ARG B 2 6  ? -9.230  -1.916  1.335   1.00 0.00 ? 30  ARG B HH12 14 
ATOM 11678 H HH21 . ARG B 2 6  ? -7.874  0.792   3.081   1.00 0.00 ? 30  ARG B HH21 14 
ATOM 11679 H HH22 . ARG B 2 6  ? -8.526  -0.807  3.210   1.00 0.00 ? 30  ARG B HH22 14 
ATOM 11680 N N    . GLU B 2 7  ? -5.580  1.165   -4.765  1.00 0.00 ? 31  GLU B N    14 
ATOM 11681 C CA   . GLU B 2 7  ? -5.204  0.339   -5.905  1.00 0.00 ? 31  GLU B CA   14 
ATOM 11682 C C    . GLU B 2 7  ? -4.642  -0.990  -5.448  1.00 0.00 ? 31  GLU B C    14 
ATOM 11683 O O    . GLU B 2 7  ? -3.833  -1.064  -4.526  1.00 0.00 ? 31  GLU B O    14 
ATOM 11684 C CB   . GLU B 2 7  ? -4.204  1.067   -6.802  1.00 0.00 ? 31  GLU B CB   14 
ATOM 11685 C CG   . GLU B 2 7  ? -2.869  1.314   -6.132  1.00 0.00 ? 31  GLU B CG   14 
ATOM 11686 C CD   . GLU B 2 7  ? -1.837  1.897   -7.076  1.00 0.00 ? 31  GLU B CD   14 
ATOM 11687 O OE1  . GLU B 2 7  ? -1.784  3.140   -7.204  1.00 0.00 ? 31  GLU B OE1  14 
ATOM 11688 O OE2  . GLU B 2 7  ? -1.082  1.113   -7.689  1.00 0.00 ? 31  GLU B OE2  14 
ATOM 11689 H H    . GLU B 2 7  ? -5.239  0.936   -3.874  1.00 0.00 ? 31  GLU B H    14 
ATOM 11690 H HA   . GLU B 2 7  ? -6.096  0.129   -6.468  1.00 0.00 ? 31  GLU B HA   14 
ATOM 11691 H HB2  . GLU B 2 7  ? -4.036  0.474   -7.688  1.00 0.00 ? 31  GLU B HB2  14 
ATOM 11692 H HB3  . GLU B 2 7  ? -4.622  2.021   -7.089  1.00 0.00 ? 31  GLU B HB3  14 
ATOM 11693 H HG2  . GLU B 2 7  ? -3.014  1.998   -5.310  1.00 0.00 ? 31  GLU B HG2  14 
ATOM 11694 H HG3  . GLU B 2 7  ? -2.502  0.374   -5.754  1.00 0.00 ? 31  GLU B HG3  14 
ATOM 11695 N N    . LYS B 2 8  ? -5.083  -2.029  -6.129  1.00 0.00 ? 32  LYS B N    14 
ATOM 11696 C CA   . LYS B 2 8  ? -4.698  -3.390  -5.826  1.00 0.00 ? 32  LYS B CA   14 
ATOM 11697 C C    . LYS B 2 8  ? -3.192  -3.582  -5.831  1.00 0.00 ? 32  LYS B C    14 
ATOM 11698 O O    . LYS B 2 8  ? -2.522  -3.408  -6.849  1.00 0.00 ? 32  LYS B O    14 
ATOM 11699 C CB   . LYS B 2 8  ? -5.377  -4.316  -6.812  1.00 0.00 ? 32  LYS B CB   14 
ATOM 11700 C CG   . LYS B 2 8  ? -6.867  -4.057  -6.892  1.00 0.00 ? 32  LYS B CG   14 
ATOM 11701 C CD   . LYS B 2 8  ? -7.587  -5.161  -7.645  1.00 0.00 ? 32  LYS B CD   14 
ATOM 11702 C CE   . LYS B 2 8  ? -9.061  -4.855  -7.803  1.00 0.00 ? 32  LYS B CE   14 
ATOM 11703 N NZ   . LYS B 2 8  ? -9.788  -5.955  -8.494  1.00 0.00 ? 32  LYS B NZ   14 
ATOM 11704 H H    . LYS B 2 8  ? -5.690  -1.874  -6.876  1.00 0.00 ? 32  LYS B H    14 
ATOM 11705 H HA   . LYS B 2 8  ? -5.065  -3.615  -4.838  1.00 0.00 ? 32  LYS B HA   14 
ATOM 11706 H HB2  . LYS B 2 8  ? -4.949  -4.170  -7.793  1.00 0.00 ? 32  LYS B HB2  14 
ATOM 11707 H HB3  . LYS B 2 8  ? -5.225  -5.331  -6.502  1.00 0.00 ? 32  LYS B HB3  14 
ATOM 11708 H HG2  . LYS B 2 8  ? -7.255  -3.990  -5.891  1.00 0.00 ? 32  LYS B HG2  14 
ATOM 11709 H HG3  . LYS B 2 8  ? -7.030  -3.119  -7.396  1.00 0.00 ? 32  LYS B HG3  14 
ATOM 11710 H HD2  . LYS B 2 8  ? -7.149  -5.262  -8.623  1.00 0.00 ? 32  LYS B HD2  14 
ATOM 11711 H HD3  . LYS B 2 8  ? -7.477  -6.087  -7.102  1.00 0.00 ? 32  LYS B HD3  14 
ATOM 11712 H HE2  . LYS B 2 8  ? -9.484  -4.713  -6.825  1.00 0.00 ? 32  LYS B HE2  14 
ATOM 11713 H HE3  . LYS B 2 8  ? -9.168  -3.947  -8.376  1.00 0.00 ? 32  LYS B HE3  14 
ATOM 11714 H HZ1  . LYS B 2 8  ? -10.790 -5.700  -8.616  1.00 0.00 ? 32  LYS B HZ1  14 
ATOM 11715 H HZ2  . LYS B 2 8  ? -9.731  -6.829  -7.934  1.00 0.00 ? 32  LYS B HZ2  14 
ATOM 11716 H HZ3  . LYS B 2 8  ? -9.369  -6.128  -9.430  1.00 0.00 ? 32  LYS B HZ3  14 
ATOM 11717 N N    . LEU B 2 9  ? -2.685  -3.947  -4.665  1.00 0.00 ? 33  LEU B N    14 
ATOM 11718 C CA   . LEU B 2 9  ? -1.273  -4.171  -4.458  1.00 0.00 ? 33  LEU B CA   14 
ATOM 11719 C C    . LEU B 2 9  ? -0.970  -5.611  -4.080  1.00 0.00 ? 33  LEU B C    14 
ATOM 11720 O O    . LEU B 2 9  ? -1.132  -6.010  -2.927  1.00 0.00 ? 33  LEU B O    14 
ATOM 11721 C CB   . LEU B 2 9  ? -0.801  -3.253  -3.376  1.00 0.00 ? 33  LEU B CB   14 
ATOM 11722 C CG   . LEU B 2 9  ? -1.031  -1.769  -3.646  1.00 0.00 ? 33  LEU B CG   14 
ATOM 11723 C CD1  . LE