data_2K7W
# 
_entry.id   2K7W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2K7W         
RCSB  RCSB100787   
WWPDB D_1000100787 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          1F16 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K7W 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-08-27 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gavathiotis, E.' 1  
'Suzuki, M.'      2  
'Davis, M.L.'     3  
'Pitter, K.'      4  
'Bird, G.H.'      5  
'Katz, S.G.'      6  
'Tu, H.C.'        7  
'Kim, H.'         8  
'Cheng, E.H.'     9  
'Tjandra, N.'     10 
'Walensky, L.D.'  11 
# 
_citation.id                        primary 
_citation.title                     'BAX activation is initiated at a novel interaction site.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            455 
_citation.page_first                1076 
_citation.page_last                 1081 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18948948 
_citation.pdbx_database_id_DOI      10.1038/nature07396 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gavathiotis, E.' 1  
primary 'Suzuki, M.'      2  
primary 'Davis, M.L.'     3  
primary 'Pitter, K.'      4  
primary 'Bird, G.H.'      5  
primary 'Katz, S.G.'      6  
primary 'Tu, H.C.'        7  
primary 'Kim, H.'         8  
primary 'Cheng, E.H.'     9  
primary 'Tjandra, N.'     10 
primary 'Walensky, L.D.'  11 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Apoptosis regulator BAX' 21204.355 1 ? ? ?                ? 
2 polymer syn 'Bcl-2-like protein 11'   2459.711  1 ? ? 'BIM BH3 domain' ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Bcl2-interacting mediator of cell death' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
;
;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
;
A ? 
2 'polypeptide(L)' no no EIWIAQELRRIGDEFNAYYA EIWIAQELRRIGDEFNAYYA B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   GLY n 
1 4   SER n 
1 5   GLY n 
1 6   GLU n 
1 7   GLN n 
1 8   PRO n 
1 9   ARG n 
1 10  GLY n 
1 11  GLY n 
1 12  GLY n 
1 13  PRO n 
1 14  THR n 
1 15  SER n 
1 16  SER n 
1 17  GLU n 
1 18  GLN n 
1 19  ILE n 
1 20  MET n 
1 21  LYS n 
1 22  THR n 
1 23  GLY n 
1 24  ALA n 
1 25  LEU n 
1 26  LEU n 
1 27  LEU n 
1 28  GLN n 
1 29  GLY n 
1 30  PHE n 
1 31  ILE n 
1 32  GLN n 
1 33  ASP n 
1 34  ARG n 
1 35  ALA n 
1 36  GLY n 
1 37  ARG n 
1 38  MET n 
1 39  GLY n 
1 40  GLY n 
1 41  GLU n 
1 42  ALA n 
1 43  PRO n 
1 44  GLU n 
1 45  LEU n 
1 46  ALA n 
1 47  LEU n 
1 48  ASP n 
1 49  PRO n 
1 50  VAL n 
1 51  PRO n 
1 52  GLN n 
1 53  ASP n 
1 54  ALA n 
1 55  SER n 
1 56  THR n 
1 57  LYS n 
1 58  LYS n 
1 59  LEU n 
1 60  SER n 
1 61  GLU n 
1 62  CYS n 
1 63  LEU n 
1 64  LYS n 
1 65  ARG n 
1 66  ILE n 
1 67  GLY n 
1 68  ASP n 
1 69  GLU n 
1 70  LEU n 
1 71  ASP n 
1 72  SER n 
1 73  ASN n 
1 74  MET n 
1 75  GLU n 
1 76  LEU n 
1 77  GLN n 
1 78  ARG n 
1 79  MET n 
1 80  ILE n 
1 81  ALA n 
1 82  ALA n 
1 83  VAL n 
1 84  ASP n 
1 85  THR n 
1 86  ASP n 
1 87  SER n 
1 88  PRO n 
1 89  ARG n 
1 90  GLU n 
1 91  VAL n 
1 92  PHE n 
1 93  PHE n 
1 94  ARG n 
1 95  VAL n 
1 96  ALA n 
1 97  ALA n 
1 98  ASP n 
1 99  MET n 
1 100 PHE n 
1 101 SER n 
1 102 ASP n 
1 103 GLY n 
1 104 ASN n 
1 105 PHE n 
1 106 ASN n 
1 107 TRP n 
1 108 GLY n 
1 109 ARG n 
1 110 VAL n 
1 111 VAL n 
1 112 ALA n 
1 113 LEU n 
1 114 PHE n 
1 115 TYR n 
1 116 PHE n 
1 117 ALA n 
1 118 SER n 
1 119 LYS n 
1 120 LEU n 
1 121 VAL n 
1 122 LEU n 
1 123 LYS n 
1 124 ALA n 
1 125 LEU n 
1 126 CYS n 
1 127 THR n 
1 128 LYS n 
1 129 VAL n 
1 130 PRO n 
1 131 GLU n 
1 132 LEU n 
1 133 ILE n 
1 134 ARG n 
1 135 THR n 
1 136 ILE n 
1 137 MET n 
1 138 GLY n 
1 139 TRP n 
1 140 THR n 
1 141 LEU n 
1 142 ASP n 
1 143 PHE n 
1 144 LEU n 
1 145 ARG n 
1 146 GLU n 
1 147 ARG n 
1 148 LEU n 
1 149 LEU n 
1 150 GLY n 
1 151 TRP n 
1 152 ILE n 
1 153 GLN n 
1 154 ASP n 
1 155 GLN n 
1 156 GLY n 
1 157 GLY n 
1 158 TRP n 
1 159 ASP n 
1 160 GLY n 
1 161 LEU n 
1 162 LEU n 
1 163 SER n 
1 164 TYR n 
1 165 PHE n 
1 166 GLY n 
1 167 THR n 
1 168 PRO n 
1 169 THR n 
1 170 TRP n 
1 171 GLN n 
1 172 THR n 
1 173 VAL n 
1 174 THR n 
1 175 ILE n 
1 176 PHE n 
1 177 VAL n 
1 178 ALA n 
1 179 GLY n 
1 180 VAL n 
1 181 LEU n 
1 182 THR n 
1 183 ALA n 
1 184 SER n 
1 185 LEU n 
1 186 THR n 
1 187 ILE n 
1 188 TRP n 
1 189 LYS n 
1 190 LYS n 
1 191 MET n 
1 192 GLY n 
2 1   GLU n 
2 2   ILE n 
2 3   TRP n 
2 4   ILE n 
2 5   ALA n 
2 6   GLN n 
2 7   GLU n 
2 8   LEU n 
2 9   ARG n 
2 10  ARG n 
2 11  ILE n 
2 12  GLY n 
2 13  ASP n 
2 14  GLU n 
2 15  PHE n 
2 16  ASN n 
2 17  ALA n 
2 18  TYR n 
2 19  TYR n 
2 20  ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 BAX 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pTYB1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP BAX_HUMAN Q07812 1 
;MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMI
AAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDG
LLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
;
1   ? 
2 UNP BIM_HUMAN O43521 2 EIWIAQELRRIGDEFNAYYA 145 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2K7W A 1 ? 192 ? Q07812 1   ? 192 ? 1   192 
2 2 2K7W B 1 ? 20  ? O43521 145 ? 164 ? 145 164 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.type            '2D 1H-15N HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         305 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '0.1-0.2 mM [U-99% 15N] protein, 0.1-0.2 mM peptide, 90% H2O/10%D20' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10%D20' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Bruker DRX 1 'Bruker DRX' 
600 Bruker DRX 2 'Bruker DRX' 
# 
_pdbx_nmr_refine.entry_id           2K7W 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'STRUCTURES CALCULATED WITH HADDOCK 2.0' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2K7W 
_pdbx_nmr_details.text       'BAX-BIM SAHB INTERACTION ANALYSIS, PARAMAGNETIC SPIN-LABELING NMR' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K7W 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K7W 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Johnson, B. et al.'  'data analysis' NMRView ? 1 
'Brunger, A. et al.'  refinement      CNS     ? 2 
'Delaglio, F. et al.' processing      NMRPipe ? 3 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K7W 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K7W 
_struct.title                     'BAX Activation is Initiated at a Novel Interaction Site' 
_struct.pdbx_descriptor           'Apoptosis regulator BAX, Bcl-2-like protein 11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K7W 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'BAX, BIM, BH3, BCL-2, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 15  ? GLY A 36  ? SER A 15  GLY A 36  1 ? 22 
HELX_P HELX_P2  2  ARG A 37  ? GLY A 39  ? ARG A 37  GLY A 39  5 ? 3  
HELX_P HELX_P3  3  ALA A 54  ? LEU A 70  ? ALA A 54  LEU A 70  1 ? 17 
HELX_P HELX_P4  4  ASN A 73  ? ALA A 81  ? ASN A 73  ALA A 81  1 ? 9  
HELX_P HELX_P5  5  SER A 87  ? MET A 99  ? SER A 87  MET A 99  1 ? 13 
HELX_P HELX_P6  6  TRP A 107 ? CYS A 126 ? TRP A 107 CYS A 126 1 ? 20 
HELX_P HELX_P7  7  VAL A 129 ? ARG A 147 ? VAL A 129 ARG A 147 1 ? 19 
HELX_P HELX_P8  8  ARG A 147 ? GLN A 155 ? ARG A 147 GLN A 155 1 ? 9  
HELX_P HELX_P9  9  TRP A 158 ? PHE A 165 ? TRP A 158 PHE A 165 1 ? 8  
HELX_P HELX_P10 10 THR A 169 ? LYS A 189 ? THR A 169 LYS A 189 1 ? 21 
HELX_P HELX_P11 11 ILE B 2   ? ALA B 20  ? ILE B 146 ALA B 164 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2K7W 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 39.914  3.935   -2.319  1.00 1.33 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 40.013  5.288   -2.917  1.00 1.17 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 38.672  6.012   -2.888  1.00 1.10 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 38.576  7.129   -2.390  1.00 1.14 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 40.569  5.225   -4.342  1.00 1.33 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 40.647  6.575   -5.041  1.00 1.59 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 41.771  6.575   -6.454  1.00 1.94 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 41.079  5.250   -7.443  1.00 2.23 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 39.222  3.359   -2.837  1.00 1.41 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 39.618  4.004   -1.325  1.00 1.51 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 40.835  3.463   -2.356  1.00 1.44 ? 1   MET A H3   1  
ATOM 12    N N    . ASP A 1 2   ? 37.638  5.370   -3.420  1.00 1.05 ? 2   ASP A N    1  
ATOM 13    C CA   . ASP A 1 2   ? 36.299  5.954   -3.452  1.00 1.04 ? 2   ASP A CA   1  
ATOM 14    C C    . ASP A 1 2   ? 35.766  6.206   -2.041  1.00 1.05 ? 2   ASP A C    1  
ATOM 15    O O    . ASP A 1 2   ? 35.146  7.236   -1.779  1.00 1.09 ? 2   ASP A O    1  
ATOM 16    C CB   . ASP A 1 2   ? 35.330  5.075   -4.254  1.00 1.07 ? 2   ASP A CB   1  
ATOM 17    C CG   . ASP A 1 2   ? 34.954  3.786   -3.546  1.00 1.10 ? 2   ASP A CG   1  
ATOM 18    O OD1  . ASP A 1 2   ? 35.863  3.053   -3.102  1.00 1.21 ? 2   ASP A OD1  1  
ATOM 19    O OD2  . ASP A 1 2   ? 33.746  3.495   -3.433  1.00 1.29 ? 2   ASP A OD2  1  
ATOM 20    H H    . ASP A 1 2   ? 37.778  4.486   -3.819  1.00 1.07 ? 2   ASP A H    1  
ATOM 21    N N    . GLY A 1 3   ? 36.024  5.268   -1.139  1.00 1.07 ? 3   GLY A N    1  
ATOM 22    C CA   . GLY A 1 3   ? 35.580  5.412   0.234   1.00 1.14 ? 3   GLY A CA   1  
ATOM 23    C C    . GLY A 1 3   ? 36.417  6.428   0.981   1.00 1.16 ? 3   GLY A C    1  
ATOM 24    O O    . GLY A 1 3   ? 35.933  7.105   1.889   1.00 1.23 ? 3   GLY A O    1  
ATOM 25    H H    . GLY A 1 3   ? 36.510  4.462   -1.412  1.00 1.07 ? 3   GLY A H    1  
ATOM 26    N N    . SER A 1 4   ? 37.676  6.536   0.582   1.00 1.16 ? 4   SER A N    1  
ATOM 27    C CA   . SER A 1 4   ? 38.603  7.474   1.185   1.00 1.23 ? 4   SER A CA   1  
ATOM 28    C C    . SER A 1 4   ? 38.271  8.903   0.755   1.00 1.23 ? 4   SER A C    1  
ATOM 29    O O    . SER A 1 4   ? 38.774  9.867   1.333   1.00 1.35 ? 4   SER A O    1  
ATOM 30    C CB   . SER A 1 4   ? 40.026  7.115   0.759   1.00 1.34 ? 4   SER A CB   1  
ATOM 31    O OG   . SER A 1 4   ? 40.079  5.783   0.263   1.00 1.40 ? 4   SER A OG   1  
ATOM 32    H H    . SER A 1 4   ? 37.999  5.959   -0.140  1.00 1.14 ? 4   SER A H    1  
ATOM 33    H HG   . SER A 1 4   ? 40.821  5.321   0.671   1.00 1.44 ? 4   SER A HG   1  
ATOM 34    N N    . GLY A 1 5   ? 37.422  9.026   -0.263  1.00 1.19 ? 5   GLY A N    1  
ATOM 35    C CA   . GLY A 1 5   ? 37.024  10.329  -0.753  1.00 1.24 ? 5   GLY A CA   1  
ATOM 36    C C    . GLY A 1 5   ? 36.078  11.021  0.201   1.00 1.22 ? 5   GLY A C    1  
ATOM 37    O O    . GLY A 1 5   ? 35.469  10.375  1.059   1.00 1.30 ? 5   GLY A O    1  
ATOM 38    H H    . GLY A 1 5   ? 37.056  8.217   -0.683  1.00 1.17 ? 5   GLY A H    1  
ATOM 39    N N    . GLU A 1 6   ? 35.959  12.331  0.052   1.00 1.26 ? 6   GLU A N    1  
ATOM 40    C CA   . GLU A 1 6   ? 35.094  13.129  0.907   1.00 1.28 ? 6   GLU A CA   1  
ATOM 41    C C    . GLU A 1 6   ? 33.622  12.848  0.635   1.00 1.22 ? 6   GLU A C    1  
ATOM 42    O O    . GLU A 1 6   ? 33.136  13.041  -0.480  1.00 1.34 ? 6   GLU A O    1  
ATOM 43    C CB   . GLU A 1 6   ? 35.401  14.615  0.735   1.00 1.49 ? 6   GLU A CB   1  
ATOM 44    C CG   . GLU A 1 6   ? 36.730  15.042  1.333   1.00 1.57 ? 6   GLU A CG   1  
ATOM 45    C CD   . GLU A 1 6   ? 37.121  16.446  0.931   1.00 1.62 ? 6   GLU A CD   1  
ATOM 46    O OE1  . GLU A 1 6   ? 36.284  17.361  1.061   1.00 2.00 ? 6   GLU A OE1  1  
ATOM 47    O OE2  . GLU A 1 6   ? 38.268  16.638  0.473   1.00 1.87 ? 6   GLU A OE2  1  
ATOM 48    H H    . GLU A 1 6   ? 36.464  12.776  -0.662  1.00 1.37 ? 6   GLU A H    1  
ATOM 49    N N    . GLN A 1 7   ? 32.924  12.383  1.662   1.00 1.15 ? 7   GLN A N    1  
ATOM 50    C CA   . GLN A 1 7   ? 31.509  12.069  1.557   1.00 1.12 ? 7   GLN A CA   1  
ATOM 51    C C    . GLN A 1 7   ? 30.750  12.662  2.739   1.00 1.11 ? 7   GLN A C    1  
ATOM 52    O O    . GLN A 1 7   ? 31.078  12.392  3.899   1.00 1.15 ? 7   GLN A O    1  
ATOM 53    C CB   . GLN A 1 7   ? 31.297  10.554  1.500   1.00 1.12 ? 7   GLN A CB   1  
ATOM 54    C CG   . GLN A 1 7   ? 31.746  9.913   0.197   1.00 1.27 ? 7   GLN A CG   1  
ATOM 55    C CD   . GLN A 1 7   ? 31.564  8.410   0.195   1.00 1.35 ? 7   GLN A CD   1  
ATOM 56    O OE1  . GLN A 1 7   ? 30.500  7.903   -0.159  1.00 1.63 ? 7   GLN A OE1  1  
ATOM 57    N NE2  . GLN A 1 7   ? 32.603  7.686   0.579   1.00 1.60 ? 7   GLN A NE2  1  
ATOM 58    H H    . GLN A 1 7   ? 33.374  12.247  2.522   1.00 1.20 ? 7   GLN A H    1  
ATOM 59    H HE21 . GLN A 1 7   ? 33.424  8.157   0.842   1.00 1.78 ? 7   GLN A HE21 1  
ATOM 60    H HE22 . GLN A 1 7   ? 32.512  6.712   0.584   1.00 1.81 ? 7   GLN A HE22 1  
ATOM 61    N N    . PRO A 1 8   ? 29.737  13.492  2.460   1.00 1.13 ? 8   PRO A N    1  
ATOM 62    C CA   . PRO A 1 8   ? 28.929  14.136  3.501   1.00 1.17 ? 8   PRO A CA   1  
ATOM 63    C C    . PRO A 1 8   ? 27.962  13.156  4.178   1.00 1.11 ? 8   PRO A C    1  
ATOM 64    O O    . PRO A 1 8   ? 26.823  12.981  3.734   1.00 1.12 ? 8   PRO A O    1  
ATOM 65    C CB   . PRO A 1 8   ? 28.159  15.212  2.728   1.00 1.26 ? 8   PRO A CB   1  
ATOM 66    C CG   . PRO A 1 8   ? 28.052  14.673  1.342   1.00 1.27 ? 8   PRO A CG   1  
ATOM 67    C CD   . PRO A 1 8   ? 29.305  13.879  1.103   1.00 1.18 ? 8   PRO A CD   1  
ATOM 68    N N    . ARG A 1 9   ? 28.447  12.504  5.239   1.00 1.09 ? 9   ARG A N    1  
ATOM 69    C CA   . ARG A 1 9   ? 27.663  11.537  6.022   1.00 1.07 ? 9   ARG A CA   1  
ATOM 70    C C    . ARG A 1 9   ? 27.430  10.227  5.270   1.00 1.00 ? 9   ARG A C    1  
ATOM 71    O O    . ARG A 1 9   ? 27.768  9.147   5.762   1.00 1.16 ? 9   ARG A O    1  
ATOM 72    C CB   . ARG A 1 9   ? 26.338  12.137  6.513   1.00 1.15 ? 9   ARG A CB   1  
ATOM 73    C CG   . ARG A 1 9   ? 25.607  11.284  7.539   1.00 1.28 ? 9   ARG A CG   1  
ATOM 74    C CD   . ARG A 1 9   ? 24.434  12.037  8.148   1.00 1.41 ? 9   ARG A CD   1  
ATOM 75    N NE   . ARG A 1 9   ? 23.342  12.232  7.193   1.00 1.46 ? 9   ARG A NE   1  
ATOM 76    C CZ   . ARG A 1 9   ? 22.329  13.085  7.383   1.00 1.62 ? 9   ARG A CZ   1  
ATOM 77    N NH1  . ARG A 1 9   ? 22.288  13.843  8.473   1.00 1.92 ? 9   ARG A NH1  1  
ATOM 78    N NH2  . ARG A 1 9   ? 21.357  13.180  6.480   1.00 1.99 ? 9   ARG A NH2  1  
ATOM 79    H H    . ARG A 1 9   ? 29.376  12.674  5.504   1.00 1.13 ? 9   ARG A H    1  
ATOM 80    H HE   . ARG A 1 9   ? 23.359  11.689  6.373   1.00 1.78 ? 9   ARG A HE   1  
ATOM 81    H HH11 . ARG A 1 9   ? 23.014  13.782  9.161   1.00 2.02 ? 9   ARG A HH11 1  
ATOM 82    H HH12 . ARG A 1 9   ? 21.524  14.481  8.614   1.00 2.32 ? 9   ARG A HH12 1  
ATOM 83    H HH21 . ARG A 1 9   ? 21.373  12.615  5.654   1.00 2.25 ? 9   ARG A HH21 1  
ATOM 84    H HH22 . ARG A 1 9   ? 20.595  13.825  6.625   1.00 2.24 ? 9   ARG A HH22 1  
ATOM 85    N N    . GLY A 1 10  ? 26.847  10.326  4.088   1.00 0.97 ? 10  GLY A N    1  
ATOM 86    C CA   . GLY A 1 10  ? 26.577  9.154   3.288   1.00 0.99 ? 10  GLY A CA   1  
ATOM 87    C C    . GLY A 1 10  ? 26.905  9.388   1.832   1.00 0.97 ? 10  GLY A C    1  
ATOM 88    O O    . GLY A 1 10  ? 27.751  10.222  1.506   1.00 1.29 ? 10  GLY A O    1  
ATOM 89    H H    . GLY A 1 10  ? 26.612  11.217  3.743   1.00 1.08 ? 10  GLY A H    1  
ATOM 90    N N    . GLY A 1 11  ? 26.230  8.666   0.954   1.00 0.95 ? 11  GLY A N    1  
ATOM 91    C CA   . GLY A 1 11  ? 26.470  8.820   -0.466  1.00 0.94 ? 11  GLY A CA   1  
ATOM 92    C C    . GLY A 1 11  ? 25.190  9.023   -1.245  1.00 0.92 ? 11  GLY A C    1  
ATOM 93    O O    . GLY A 1 11  ? 24.139  9.303   -0.667  1.00 1.14 ? 11  GLY A O    1  
ATOM 94    H H    . GLY A 1 11  ? 25.562  8.021   1.269   1.00 1.17 ? 11  GLY A H    1  
ATOM 95    N N    . GLY A 1 12  ? 25.280  8.888   -2.558  1.00 0.92 ? 12  GLY A N    1  
ATOM 96    C CA   . GLY A 1 12  ? 24.117  9.047   -3.407  1.00 0.92 ? 12  GLY A CA   1  
ATOM 97    C C    . GLY A 1 12  ? 24.036  7.953   -4.450  1.00 0.84 ? 12  GLY A C    1  
ATOM 98    O O    . GLY A 1 12  ? 24.322  8.196   -5.626  1.00 0.92 ? 12  GLY A O    1  
ATOM 99    H H    . GLY A 1 12  ? 26.148  8.669   -2.961  1.00 1.07 ? 12  GLY A H    1  
ATOM 100   N N    . PRO A 1 13  ? 23.677  6.722   -4.046  1.00 0.80 ? 13  PRO A N    1  
ATOM 101   C CA   . PRO A 1 13  ? 23.565  5.591   -4.960  1.00 0.83 ? 13  PRO A CA   1  
ATOM 102   C C    . PRO A 1 13  ? 22.197  5.548   -5.632  1.00 0.79 ? 13  PRO A C    1  
ATOM 103   O O    . PRO A 1 13  ? 21.276  6.273   -5.243  1.00 0.91 ? 13  PRO A O    1  
ATOM 104   C CB   . PRO A 1 13  ? 23.730  4.393   -4.027  1.00 0.94 ? 13  PRO A CB   1  
ATOM 105   C CG   . PRO A 1 13  ? 23.149  4.843   -2.730  1.00 1.01 ? 13  PRO A CG   1  
ATOM 106   C CD   . PRO A 1 13  ? 23.353  6.336   -2.656  1.00 0.87 ? 13  PRO A CD   1  
ATOM 107   N N    . THR A 1 14  ? 22.069  4.701   -6.643  1.00 0.77 ? 14  THR A N    1  
ATOM 108   C CA   . THR A 1 14  ? 20.816  4.561   -7.366  1.00 0.75 ? 14  THR A CA   1  
ATOM 109   C C    . THR A 1 14  ? 19.709  4.034   -6.449  1.00 0.73 ? 14  THR A C    1  
ATOM 110   O O    . THR A 1 14  ? 19.796  2.928   -5.907  1.00 0.98 ? 14  THR A O    1  
ATOM 111   C CB   . THR A 1 14  ? 20.966  3.662   -8.616  1.00 0.85 ? 14  THR A CB   1  
ATOM 112   O OG1  . THR A 1 14  ? 19.677  3.374   -9.175  1.00 0.86 ? 14  THR A OG1  1  
ATOM 113   C CG2  . THR A 1 14  ? 21.682  2.360   -8.279  1.00 0.95 ? 14  THR A CG2  1  
ATOM 114   H H    . THR A 1 14  ? 22.838  4.151   -6.906  1.00 0.89 ? 14  THR A H    1  
ATOM 115   H HG1  . THR A 1 14  ? 19.546  3.902   -9.975  1.00 1.00 ? 14  THR A HG1  1  
ATOM 116   N N    . SER A 1 15  ? 18.679  4.842   -6.259  1.00 0.62 ? 15  SER A N    1  
ATOM 117   C CA   . SER A 1 15  ? 17.565  4.463   -5.407  1.00 0.65 ? 15  SER A CA   1  
ATOM 118   C C    . SER A 1 15  ? 16.309  4.207   -6.233  1.00 0.60 ? 15  SER A C    1  
ATOM 119   O O    . SER A 1 15  ? 15.240  3.943   -5.685  1.00 0.60 ? 15  SER A O    1  
ATOM 120   C CB   . SER A 1 15  ? 17.312  5.558   -4.373  1.00 0.80 ? 15  SER A CB   1  
ATOM 121   O OG   . SER A 1 15  ? 18.536  6.013   -3.815  1.00 0.99 ? 15  SER A OG   1  
ATOM 122   H H    . SER A 1 15  ? 18.667  5.719   -6.697  1.00 0.69 ? 15  SER A H    1  
ATOM 123   H HG   . SER A 1 15  ? 19.266  5.770   -4.398  1.00 0.99 ? 15  SER A HG   1  
ATOM 124   N N    . SER A 1 16  ? 16.450  4.259   -7.552  1.00 0.61 ? 16  SER A N    1  
ATOM 125   C CA   . SER A 1 16  ? 15.333  4.050   -8.464  1.00 0.62 ? 16  SER A CA   1  
ATOM 126   C C    . SER A 1 16  ? 14.688  2.677   -8.260  1.00 0.55 ? 16  SER A C    1  
ATOM 127   O O    . SER A 1 16  ? 13.519  2.579   -7.883  1.00 0.61 ? 16  SER A O    1  
ATOM 128   C CB   . SER A 1 16  ? 15.837  4.201   -9.895  1.00 0.68 ? 16  SER A CB   1  
ATOM 129   O OG   . SER A 1 16  ? 17.124  4.801   -9.889  1.00 0.85 ? 16  SER A OG   1  
ATOM 130   H H    . SER A 1 16  ? 17.337  4.441   -7.932  1.00 0.66 ? 16  SER A H    1  
ATOM 131   H HG   . SER A 1 16  ? 17.119  5.576   -10.466 1.00 1.04 ? 16  SER A HG   1  
ATOM 132   N N    . GLU A 1 17  ? 15.460  1.624   -8.491  1.00 0.50 ? 17  GLU A N    1  
ATOM 133   C CA   . GLU A 1 17  ? 14.964  0.265   -8.324  1.00 0.49 ? 17  GLU A CA   1  
ATOM 134   C C    . GLU A 1 17  ? 14.855  -0.063  -6.840  1.00 0.49 ? 17  GLU A C    1  
ATOM 135   O O    . GLU A 1 17  ? 14.019  -0.867  -6.424  1.00 0.51 ? 17  GLU A O    1  
ATOM 136   C CB   . GLU A 1 17  ? 15.896  -0.729  -9.020  1.00 0.55 ? 17  GLU A CB   1  
ATOM 137   C CG   . GLU A 1 17  ? 15.188  -1.931  -9.626  1.00 0.75 ? 17  GLU A CG   1  
ATOM 138   C CD   . GLU A 1 17  ? 14.071  -1.538  -10.574 1.00 0.97 ? 17  GLU A CD   1  
ATOM 139   O OE1  . GLU A 1 17  ? 14.365  -1.013  -11.673 1.00 1.23 ? 17  GLU A OE1  1  
ATOM 140   O OE2  . GLU A 1 17  ? 12.895  -1.752  -10.225 1.00 1.11 ? 17  GLU A OE2  1  
ATOM 141   H H    . GLU A 1 17  ? 16.388  1.762   -8.778  1.00 0.53 ? 17  GLU A H    1  
ATOM 142   N N    . GLN A 1 18  ? 15.701  0.590   -6.046  1.00 0.52 ? 18  GLN A N    1  
ATOM 143   C CA   . GLN A 1 18  ? 15.719  0.399   -4.601  1.00 0.58 ? 18  GLN A CA   1  
ATOM 144   C C    . GLN A 1 18  ? 14.350  0.704   -3.999  1.00 0.60 ? 18  GLN A C    1  
ATOM 145   O O    . GLN A 1 18  ? 13.820  -0.085  -3.216  1.00 0.64 ? 18  GLN A O    1  
ATOM 146   C CB   . GLN A 1 18  ? 16.795  1.281   -3.961  1.00 0.68 ? 18  GLN A CB   1  
ATOM 147   C CG   . GLN A 1 18  ? 16.978  1.075   -2.465  1.00 0.82 ? 18  GLN A CG   1  
ATOM 148   C CD   . GLN A 1 18  ? 16.625  2.311   -1.662  1.00 0.96 ? 18  GLN A CD   1  
ATOM 149   O OE1  . GLN A 1 18  ? 17.459  3.192   -1.460  1.00 1.27 ? 18  GLN A OE1  1  
ATOM 150   N NE2  . GLN A 1 18  ? 15.387  2.386   -1.191  1.00 1.14 ? 18  GLN A NE2  1  
ATOM 151   H H    . GLN A 1 18  ? 16.340  1.214   -6.450  1.00 0.53 ? 18  GLN A H    1  
ATOM 152   H HE21 . GLN A 1 18  ? 14.771  1.647   -1.384  1.00 1.15 ? 18  GLN A HE21 1  
ATOM 153   H HE22 . GLN A 1 18  ? 15.140  3.175   -0.667  1.00 1.42 ? 18  GLN A HE22 1  
ATOM 154   N N    . ILE A 1 19  ? 13.776  1.842   -4.384  1.00 0.60 ? 19  ILE A N    1  
ATOM 155   C CA   . ILE A 1 19  ? 12.463  2.249   -3.893  1.00 0.66 ? 19  ILE A CA   1  
ATOM 156   C C    . ILE A 1 19  ? 11.409  1.213   -4.279  1.00 0.63 ? 19  ILE A C    1  
ATOM 157   O O    . ILE A 1 19  ? 10.557  0.842   -3.465  1.00 0.67 ? 19  ILE A O    1  
ATOM 158   C CB   . ILE A 1 19  ? 12.054  3.637   -4.440  1.00 0.73 ? 19  ILE A CB   1  
ATOM 159   C CG1  . ILE A 1 19  ? 12.916  4.737   -3.809  1.00 0.78 ? 19  ILE A CG1  1  
ATOM 160   C CG2  . ILE A 1 19  ? 10.577  3.909   -4.185  1.00 0.77 ? 19  ILE A CG2  1  
ATOM 161   C CD1  . ILE A 1 19  ? 12.815  6.074   -4.510  1.00 0.85 ? 19  ILE A CD1  1  
ATOM 162   H H    . ILE A 1 19  ? 14.252  2.428   -5.018  1.00 0.58 ? 19  ILE A H    1  
ATOM 163   N N    . MET A 1 20  ? 11.494  0.733   -5.516  1.00 0.59 ? 20  MET A N    1  
ATOM 164   C CA   . MET A 1 20  ? 10.563  -0.267  -6.021  1.00 0.60 ? 20  MET A CA   1  
ATOM 165   C C    . MET A 1 20  ? 10.636  -1.531  -5.177  1.00 0.56 ? 20  MET A C    1  
ATOM 166   O O    . MET A 1 20  ? 9.614   -2.100  -4.796  1.00 0.57 ? 20  MET A O    1  
ATOM 167   C CB   . MET A 1 20  ? 10.879  -0.596  -7.482  1.00 0.61 ? 20  MET A CB   1  
ATOM 168   C CG   . MET A 1 20  ? 9.803   -1.410  -8.186  1.00 0.71 ? 20  MET A CG   1  
ATOM 169   S SD   . MET A 1 20  ? 8.456   -0.388  -8.818  1.00 0.96 ? 20  MET A SD   1  
ATOM 170   C CE   . MET A 1 20  ? 7.400   -0.271  -7.374  1.00 1.64 ? 20  MET A CE   1  
ATOM 171   H H    . MET A 1 20  ? 12.207  1.061   -6.104  1.00 0.57 ? 20  MET A H    1  
ATOM 172   N N    . LYS A 1 21  ? 11.859  -1.958  -4.882  1.00 0.55 ? 21  LYS A N    1  
ATOM 173   C CA   . LYS A 1 21  ? 12.085  -3.147  -4.071  1.00 0.55 ? 21  LYS A CA   1  
ATOM 174   C C    . LYS A 1 21  ? 11.536  -2.952  -2.660  1.00 0.51 ? 21  LYS A C    1  
ATOM 175   O O    . LYS A 1 21  ? 11.015  -3.886  -2.052  1.00 0.51 ? 21  LYS A O    1  
ATOM 176   C CB   . LYS A 1 21  ? 13.578  -3.484  -4.012  1.00 0.58 ? 21  LYS A CB   1  
ATOM 177   C CG   . LYS A 1 21  ? 14.176  -3.923  -5.341  1.00 0.63 ? 21  LYS A CG   1  
ATOM 178   C CD   . LYS A 1 21  ? 13.518  -5.192  -5.863  1.00 0.69 ? 21  LYS A CD   1  
ATOM 179   C CE   . LYS A 1 21  ? 14.283  -5.751  -7.049  1.00 0.83 ? 21  LYS A CE   1  
ATOM 180   N NZ   . LYS A 1 21  ? 13.674  -7.002  -7.575  1.00 1.15 ? 21  LYS A NZ   1  
ATOM 181   H H    . LYS A 1 21  ? 12.633  -1.461  -5.228  1.00 0.55 ? 21  LYS A H    1  
ATOM 182   H HZ1  . LYS A 1 21  ? 14.272  -7.398  -8.327  1.00 1.46 ? 21  LYS A HZ1  1  
ATOM 183   H HZ2  . LYS A 1 21  ? 12.734  -6.806  -7.967  1.00 1.69 ? 21  LYS A HZ2  1  
ATOM 184   H HZ3  . LYS A 1 21  ? 13.581  -7.711  -6.809  1.00 1.26 ? 21  LYS A HZ3  1  
ATOM 185   N N    . THR A 1 22  ? 11.653  -1.728  -2.150  1.00 0.52 ? 22  THR A N    1  
ATOM 186   C CA   . THR A 1 22  ? 11.162  -1.405  -0.816  1.00 0.51 ? 22  THR A CA   1  
ATOM 187   C C    . THR A 1 22  ? 9.638   -1.540  -0.769  1.00 0.52 ? 22  THR A C    1  
ATOM 188   O O    . THR A 1 22  ? 9.073   -1.995  0.226   1.00 0.52 ? 22  THR A O    1  
ATOM 189   C CB   . THR A 1 22  ? 11.565  0.025   -0.394  1.00 0.56 ? 22  THR A CB   1  
ATOM 190   O OG1  . THR A 1 22  ? 12.937  0.271   -0.745  1.00 0.63 ? 22  THR A OG1  1  
ATOM 191   C CG2  . THR A 1 22  ? 11.400  0.207   1.109   1.00 0.71 ? 22  THR A CG2  1  
ATOM 192   H H    . THR A 1 22  ? 12.075  -1.025  -2.688  1.00 0.55 ? 22  THR A H    1  
ATOM 193   H HG1  . THR A 1 22  ? 13.227  -0.382  -1.393  1.00 0.88 ? 22  THR A HG1  1  
ATOM 194   N N    . GLY A 1 23  ? 8.982   -1.160  -1.864  1.00 0.55 ? 23  GLY A N    1  
ATOM 195   C CA   . GLY A 1 23  ? 7.536   -1.248  -1.940  1.00 0.58 ? 23  GLY A CA   1  
ATOM 196   C C    . GLY A 1 23  ? 7.043   -2.677  -1.809  1.00 0.56 ? 23  GLY A C    1  
ATOM 197   O O    . GLY A 1 23  ? 6.052   -2.942  -1.124  1.00 0.58 ? 23  GLY A O    1  
ATOM 198   H H    . GLY A 1 23  ? 9.490   -0.813  -2.631  1.00 0.55 ? 23  GLY A H    1  
ATOM 199   N N    . ALA A 1 24  ? 7.754   -3.602  -2.447  1.00 0.56 ? 24  ALA A N    1  
ATOM 200   C CA   . ALA A 1 24  ? 7.393   -5.015  -2.399  1.00 0.58 ? 24  ALA A CA   1  
ATOM 201   C C    . ALA A 1 24  ? 7.524   -5.549  -0.977  1.00 0.55 ? 24  ALA A C    1  
ATOM 202   O O    . ALA A 1 24  ? 6.747   -6.404  -0.545  1.00 0.73 ? 24  ALA A O    1  
ATOM 203   C CB   . ALA A 1 24  ? 8.263   -5.821  -3.354  1.00 0.61 ? 24  ALA A CB   1  
ATOM 204   H H    . ALA A 1 24  ? 8.543   -3.326  -2.960  1.00 0.58 ? 24  ALA A H    1  
ATOM 205   N N    . LEU A 1 25  ? 8.505   -5.031  -0.253  1.00 0.44 ? 25  LEU A N    1  
ATOM 206   C CA   . LEU A 1 25  ? 8.742   -5.442  1.125   1.00 0.40 ? 25  LEU A CA   1  
ATOM 207   C C    . LEU A 1 25  ? 7.693   -4.837  2.056   1.00 0.39 ? 25  LEU A C    1  
ATOM 208   O O    . LEU A 1 25  ? 7.182   -5.509  2.953   1.00 0.40 ? 25  LEU A O    1  
ATOM 209   C CB   . LEU A 1 25  ? 10.150  -5.031  1.569   1.00 0.40 ? 25  LEU A CB   1  
ATOM 210   C CG   . LEU A 1 25  ? 10.647  -5.625  2.889   1.00 0.45 ? 25  LEU A CG   1  
ATOM 211   C CD1  . LEU A 1 25  ? 10.600  -7.144  2.845   1.00 0.61 ? 25  LEU A CD1  1  
ATOM 212   C CD2  . LEU A 1 25  ? 12.056  -5.142  3.193   1.00 0.48 ? 25  LEU A CD2  1  
ATOM 213   H H    . LEU A 1 25  ? 9.090   -4.357  -0.659  1.00 0.48 ? 25  LEU A H    1  
ATOM 214   N N    . LEU A 1 26  ? 7.369   -3.569  1.816   1.00 0.39 ? 26  LEU A N    1  
ATOM 215   C CA   . LEU A 1 26  ? 6.381   -2.852  2.614   1.00 0.40 ? 26  LEU A CA   1  
ATOM 216   C C    . LEU A 1 26  ? 5.024   -3.541  2.551   1.00 0.44 ? 26  LEU A C    1  
ATOM 217   O O    . LEU A 1 26  ? 4.373   -3.744  3.577   1.00 0.45 ? 26  LEU A O    1  
ATOM 218   C CB   . LEU A 1 26  ? 6.253   -1.406  2.127   1.00 0.43 ? 26  LEU A CB   1  
ATOM 219   C CG   . LEU A 1 26  ? 7.329   -0.431  2.607   1.00 0.42 ? 26  LEU A CG   1  
ATOM 220   C CD1  . LEU A 1 26  ? 7.192   0.904   1.893   1.00 0.49 ? 26  LEU A CD1  1  
ATOM 221   C CD2  . LEU A 1 26  ? 7.242   -0.244  4.113   1.00 0.39 ? 26  LEU A CD2  1  
ATOM 222   H H    . LEU A 1 26  ? 7.815   -3.098  1.077   1.00 0.40 ? 26  LEU A H    1  
ATOM 223   N N    . LEU A 1 27  ? 4.607   -3.905  1.341   1.00 0.49 ? 27  LEU A N    1  
ATOM 224   C CA   . LEU A 1 27  ? 3.329   -4.579  1.145   1.00 0.56 ? 27  LEU A CA   1  
ATOM 225   C C    . LEU A 1 27  ? 3.284   -5.905  1.896   1.00 0.57 ? 27  LEU A C    1  
ATOM 226   O O    . LEU A 1 27  ? 2.246   -6.278  2.446   1.00 0.61 ? 27  LEU A O    1  
ATOM 227   C CB   . LEU A 1 27  ? 3.037   -4.795  -0.345  1.00 0.63 ? 27  LEU A CB   1  
ATOM 228   C CG   . LEU A 1 27  ? 2.122   -3.767  -1.025  1.00 0.67 ? 27  LEU A CG   1  
ATOM 229   C CD1  . LEU A 1 27  ? 0.754   -3.731  -0.356  1.00 0.71 ? 27  LEU A CD1  1  
ATOM 230   C CD2  . LEU A 1 27  ? 2.761   -2.387  -1.028  1.00 0.64 ? 27  LEU A CD2  1  
ATOM 231   H H    . LEU A 1 27  ? 5.172   -3.708  0.561   1.00 0.50 ? 27  LEU A H    1  
ATOM 232   N N    . GLN A 1 28  ? 4.415   -6.606  1.931   1.00 0.56 ? 28  GLN A N    1  
ATOM 233   C CA   . GLN A 1 28  ? 4.493   -7.886  2.626   1.00 0.59 ? 28  GLN A CA   1  
ATOM 234   C C    . GLN A 1 28  ? 4.235   -7.707  4.115   1.00 0.56 ? 28  GLN A C    1  
ATOM 235   O O    . GLN A 1 28  ? 3.349   -8.347  4.677   1.00 0.60 ? 28  GLN A O    1  
ATOM 236   C CB   . GLN A 1 28  ? 5.857   -8.557  2.419   1.00 0.64 ? 28  GLN A CB   1  
ATOM 237   C CG   . GLN A 1 28  ? 5.988   -9.892  3.143   1.00 0.99 ? 28  GLN A CG   1  
ATOM 238   C CD   . GLN A 1 28  ? 7.366   -10.136 3.730   1.00 1.17 ? 28  GLN A CD   1  
ATOM 239   O OE1  . GLN A 1 28  ? 7.504   -10.751 4.786   1.00 1.46 ? 28  GLN A OE1  1  
ATOM 240   N NE2  . GLN A 1 28  ? 8.395   -9.663  3.052   1.00 1.53 ? 28  GLN A NE2  1  
ATOM 241   H H    . GLN A 1 28  ? 5.212   -6.253  1.485   1.00 0.55 ? 28  GLN A H    1  
ATOM 242   H HE21 . GLN A 1 28  ? 8.221   -9.183  2.217   1.00 1.80 ? 28  GLN A HE21 1  
ATOM 243   H HE22 . GLN A 1 28  ? 9.296   -9.829  3.404   1.00 1.74 ? 28  GLN A HE22 1  
ATOM 244   N N    . GLY A 1 29  ? 4.998   -6.815  4.736   1.00 0.54 ? 29  GLY A N    1  
ATOM 245   C CA   . GLY A 1 29  ? 4.865   -6.565  6.161   1.00 0.54 ? 29  GLY A CA   1  
ATOM 246   C C    . GLY A 1 29  ? 3.456   -6.195  6.576   1.00 0.51 ? 29  GLY A C    1  
ATOM 247   O O    . GLY A 1 29  ? 2.925   -6.741  7.544   1.00 0.53 ? 29  GLY A O    1  
ATOM 248   H H    . GLY A 1 29  ? 5.662   -6.311  4.216   1.00 0.56 ? 29  GLY A H    1  
ATOM 249   N N    . PHE A 1 30  ? 2.846   -5.282  5.832   1.00 0.50 ? 30  PHE A N    1  
ATOM 250   C CA   . PHE A 1 30  ? 1.491   -4.828  6.126   1.00 0.51 ? 30  PHE A CA   1  
ATOM 251   C C    . PHE A 1 30  ? 0.480   -5.972  6.029   1.00 0.51 ? 30  PHE A C    1  
ATOM 252   O O    . PHE A 1 30  ? -0.403  -6.109  6.880   1.00 0.55 ? 30  PHE A O    1  
ATOM 253   C CB   . PHE A 1 30  ? 1.099   -3.681  5.190   1.00 0.54 ? 30  PHE A CB   1  
ATOM 254   C CG   . PHE A 1 30  ? -0.079  -2.877  5.666   1.00 0.54 ? 30  PHE A CG   1  
ATOM 255   C CD1  . PHE A 1 30  ? -0.178  -2.484  6.993   1.00 0.85 ? 30  PHE A CD1  1  
ATOM 256   C CD2  . PHE A 1 30  ? -1.085  -2.511  4.788   1.00 0.83 ? 30  PHE A CD2  1  
ATOM 257   C CE1  . PHE A 1 30  ? -1.257  -1.745  7.432   1.00 0.85 ? 30  PHE A CE1  1  
ATOM 258   C CE2  . PHE A 1 30  ? -2.168  -1.770  5.223   1.00 0.90 ? 30  PHE A CE2  1  
ATOM 259   C CZ   . PHE A 1 30  ? -2.253  -1.386  6.547   1.00 0.65 ? 30  PHE A CZ   1  
ATOM 260   H H    . PHE A 1 30  ? 3.324   -4.893  5.067   1.00 0.51 ? 30  PHE A H    1  
ATOM 261   N N    . ILE A 1 31  ? 0.623   -6.803  5.005   1.00 0.50 ? 31  ILE A N    1  
ATOM 262   C CA   . ILE A 1 31  ? -0.285  -7.927  4.807   1.00 0.52 ? 31  ILE A CA   1  
ATOM 263   C C    . ILE A 1 31  ? -0.051  -9.030  5.842   1.00 0.53 ? 31  ILE A C    1  
ATOM 264   O O    . ILE A 1 31  ? -0.997  -9.507  6.466   1.00 0.56 ? 31  ILE A O    1  
ATOM 265   C CB   . ILE A 1 31  ? -0.187  -8.505  3.377   1.00 0.54 ? 31  ILE A CB   1  
ATOM 266   C CG1  . ILE A 1 31  ? -0.671  -7.469  2.356   1.00 0.54 ? 31  ILE A CG1  1  
ATOM 267   C CG2  . ILE A 1 31  ? -0.997  -9.790  3.255   1.00 0.58 ? 31  ILE A CG2  1  
ATOM 268   C CD1  . ILE A 1 31  ? -0.448  -7.871  0.911   1.00 0.57 ? 31  ILE A CD1  1  
ATOM 269   H H    . ILE A 1 31  ? 1.358   -6.661  4.369   1.00 0.49 ? 31  ILE A H    1  
ATOM 270   N N    . GLN A 1 32  ? 1.211   -9.407  6.038   1.00 0.53 ? 32  GLN A N    1  
ATOM 271   C CA   . GLN A 1 32  ? 1.566   -10.463 6.991   1.00 0.55 ? 32  GLN A CA   1  
ATOM 272   C C    . GLN A 1 32  ? 1.077   -10.135 8.403   1.00 0.54 ? 32  GLN A C    1  
ATOM 273   O O    . GLN A 1 32  ? 0.533   -10.993 9.098   1.00 0.57 ? 32  GLN A O    1  
ATOM 274   C CB   . GLN A 1 32  ? 3.084   -10.683 7.015   1.00 0.57 ? 32  GLN A CB   1  
ATOM 275   C CG   . GLN A 1 32  ? 3.681   -11.218 5.721   1.00 0.68 ? 32  GLN A CG   1  
ATOM 276   C CD   . GLN A 1 32  ? 3.330   -12.668 5.449   1.00 0.90 ? 32  GLN A CD   1  
ATOM 277   O OE1  . GLN A 1 32  ? 3.057   -13.438 6.370   1.00 1.07 ? 32  GLN A OE1  1  
ATOM 278   N NE2  . GLN A 1 32  ? 3.353   -13.057 4.182   1.00 1.12 ? 32  GLN A NE2  1  
ATOM 279   H H    . GLN A 1 32  ? 1.927   -8.963  5.527   1.00 0.52 ? 32  GLN A H    1  
ATOM 280   H HE21 . GLN A 1 32  ? 3.597   -12.396 3.495   1.00 1.19 ? 32  GLN A HE21 1  
ATOM 281   H HE22 . GLN A 1 32  ? 3.132   -13.990 3.982   1.00 1.31 ? 32  GLN A HE22 1  
ATOM 282   N N    . ASP A 1 33  ? 1.257   -8.883  8.805   1.00 0.53 ? 33  ASP A N    1  
ATOM 283   C CA   . ASP A 1 33  ? 0.860   -8.430  10.139  1.00 0.55 ? 33  ASP A CA   1  
ATOM 284   C C    . ASP A 1 33  ? -0.642  -8.561  10.372  1.00 0.58 ? 33  ASP A C    1  
ATOM 285   O O    . ASP A 1 33  ? -1.085  -8.994  11.440  1.00 0.65 ? 33  ASP A O    1  
ATOM 286   C CB   . ASP A 1 33  ? 1.291   -6.980  10.356  1.00 0.57 ? 33  ASP A CB   1  
ATOM 287   C CG   . ASP A 1 33  ? 0.945   -6.476  11.739  1.00 0.61 ? 33  ASP A CG   1  
ATOM 288   O OD1  . ASP A 1 33  ? 1.697   -6.772  12.690  1.00 0.73 ? 33  ASP A OD1  1  
ATOM 289   O OD2  . ASP A 1 33  ? -0.083  -5.779  11.887  1.00 0.74 ? 33  ASP A OD2  1  
ATOM 290   H H    . ASP A 1 33  ? 1.670   -8.238  8.187   1.00 0.53 ? 33  ASP A H    1  
ATOM 291   N N    . ARG A 1 34  ? -1.426  -8.189  9.370   1.00 0.58 ? 34  ARG A N    1  
ATOM 292   C CA   . ARG A 1 34  ? -2.878  -8.247  9.476   1.00 0.63 ? 34  ARG A CA   1  
ATOM 293   C C    . ARG A 1 34  ? -3.423  -9.649  9.208   1.00 0.62 ? 34  ARG A C    1  
ATOM 294   O O    . ARG A 1 34  ? -4.501  -10.008 9.687   1.00 0.67 ? 34  ARG A O    1  
ATOM 295   C CB   . ARG A 1 34  ? -3.531  -7.211  8.559   1.00 0.67 ? 34  ARG A CB   1  
ATOM 296   C CG   . ARG A 1 34  ? -4.224  -6.079  9.305   1.00 0.74 ? 34  ARG A CG   1  
ATOM 297   C CD   . ARG A 1 34  ? -3.293  -5.408  10.308  1.00 0.73 ? 34  ARG A CD   1  
ATOM 298   N NE   . ARG A 1 34  ? -4.034  -4.820  11.427  1.00 0.75 ? 34  ARG A NE   1  
ATOM 299   C CZ   . ARG A 1 34  ? -3.658  -4.915  12.705  1.00 0.74 ? 34  ARG A CZ   1  
ATOM 300   N NH1  . ARG A 1 34  ? -2.500  -5.478  13.027  1.00 0.77 ? 34  ARG A NH1  1  
ATOM 301   N NH2  . ARG A 1 34  ? -4.429  -4.409  13.661  1.00 0.85 ? 34  ARG A NH2  1  
ATOM 302   H H    . ARG A 1 34  ? -1.019  -7.866  8.537   1.00 0.56 ? 34  ARG A H    1  
ATOM 303   H HE   . ARG A 1 34  ? -4.870  -4.349  11.214  1.00 0.86 ? 34  ARG A HE   1  
ATOM 304   H HH11 . ARG A 1 34  ? -1.884  -5.828  12.306  1.00 0.74 ? 34  ARG A HH11 1  
ATOM 305   H HH12 . ARG A 1 34  ? -2.230  -5.564  13.986  1.00 0.90 ? 34  ARG A HH12 1  
ATOM 306   H HH21 . ARG A 1 34  ? -5.294  -3.949  13.430  1.00 0.91 ? 34  ARG A HH21 1  
ATOM 307   H HH22 . ARG A 1 34  ? -4.160  -4.488  14.625  1.00 0.93 ? 34  ARG A HH22 1  
ATOM 308   N N    . ALA A 1 35  ? -2.674  -10.443 8.454   1.00 0.61 ? 35  ALA A N    1  
ATOM 309   C CA   . ALA A 1 35  ? -3.086  -11.809 8.132   1.00 0.64 ? 35  ALA A CA   1  
ATOM 310   C C    . ALA A 1 35  ? -3.042  -12.699 9.366   1.00 0.66 ? 35  ALA A C    1  
ATOM 311   O O    . ALA A 1 35  ? -3.742  -13.713 9.440   1.00 0.68 ? 35  ALA A O    1  
ATOM 312   C CB   . ALA A 1 35  ? -2.213  -12.390 7.029   1.00 0.65 ? 35  ALA A CB   1  
ATOM 313   H H    . ALA A 1 35  ? -1.826  -10.102 8.094   1.00 0.61 ? 35  ALA A H    1  
ATOM 314   N N    . GLY A 1 36  ? -2.227  -12.305 10.340  1.00 0.69 ? 36  GLY A N    1  
ATOM 315   C CA   . GLY A 1 36  ? -2.095  -13.068 11.569  1.00 0.76 ? 36  GLY A CA   1  
ATOM 316   C C    . GLY A 1 36  ? -3.389  -13.136 12.363  1.00 0.78 ? 36  GLY A C    1  
ATOM 317   O O    . GLY A 1 36  ? -3.544  -13.990 13.235  1.00 0.89 ? 36  GLY A O    1  
ATOM 318   H H    . GLY A 1 36  ? -1.698  -11.487 10.216  1.00 0.70 ? 36  GLY A H    1  
ATOM 319   N N    . ARG A 1 37  ? -4.325  -12.244 12.048  1.00 0.75 ? 37  ARG A N    1  
ATOM 320   C CA   . ARG A 1 37  ? -5.613  -12.206 12.733  1.00 0.81 ? 37  ARG A CA   1  
ATOM 321   C C    . ARG A 1 37  ? -6.525  -13.335 12.251  1.00 0.79 ? 37  ARG A C    1  
ATOM 322   O O    . ARG A 1 37  ? -7.620  -13.531 12.778  1.00 0.88 ? 37  ARG A O    1  
ATOM 323   C CB   . ARG A 1 37  ? -6.295  -10.847 12.527  1.00 0.86 ? 37  ARG A CB   1  
ATOM 324   C CG   . ARG A 1 37  ? -7.373  -10.527 13.554  1.00 1.17 ? 37  ARG A CG   1  
ATOM 325   C CD   . ARG A 1 37  ? -7.905  -9.112  13.390  1.00 1.23 ? 37  ARG A CD   1  
ATOM 326   N NE   . ARG A 1 37  ? -9.117  -9.060  12.570  1.00 1.18 ? 37  ARG A NE   1  
ATOM 327   C CZ   . ARG A 1 37  ? -9.714  -7.925  12.197  1.00 1.28 ? 37  ARG A CZ   1  
ATOM 328   N NH1  . ARG A 1 37  ? -9.215  -6.752  12.566  1.00 1.35 ? 37  ARG A NH1  1  
ATOM 329   N NH2  . ARG A 1 37  ? -10.821 -7.966  11.464  1.00 1.73 ? 37  ARG A NH2  1  
ATOM 330   H H    . ARG A 1 37  ? -4.141  -11.590 11.339  1.00 0.71 ? 37  ARG A H    1  
ATOM 331   H HE   . ARG A 1 37  ? -9.511  -9.917  12.294  1.00 1.43 ? 37  ARG A HE   1  
ATOM 332   H HH11 . ARG A 1 37  ? -8.386  -6.708  13.128  1.00 1.52 ? 37  ARG A HH11 1  
ATOM 333   H HH12 . ARG A 1 37  ? -9.672  -5.900  12.295  1.00 1.52 ? 37  ARG A HH12 1  
ATOM 334   H HH21 . ARG A 1 37  ? -11.212 -8.849  11.193  1.00 2.07 ? 37  ARG A HH21 1  
ATOM 335   H HH22 . ARG A 1 37  ? -11.271 -7.114  11.176  1.00 1.89 ? 37  ARG A HH22 1  
ATOM 336   N N    . MET A 1 38  ? -6.069  -14.079 11.248  1.00 0.74 ? 38  MET A N    1  
ATOM 337   C CA   . MET A 1 38  ? -6.846  -15.187 10.704  1.00 0.75 ? 38  MET A CA   1  
ATOM 338   C C    . MET A 1 38  ? -6.381  -16.515 11.295  1.00 0.77 ? 38  MET A C    1  
ATOM 339   O O    . MET A 1 38  ? -7.067  -17.533 11.185  1.00 1.03 ? 38  MET A O    1  
ATOM 340   C CB   . MET A 1 38  ? -6.731  -15.229 9.176   1.00 0.76 ? 38  MET A CB   1  
ATOM 341   C CG   . MET A 1 38  ? -7.085  -13.922 8.480   1.00 0.86 ? 38  MET A CG   1  
ATOM 342   S SD   . MET A 1 38  ? -8.735  -13.324 8.896   1.00 1.19 ? 38  MET A SD   1  
ATOM 343   C CE   . MET A 1 38  ? -8.830  -11.855 7.873   1.00 1.48 ? 38  MET A CE   1  
ATOM 344   H H    . MET A 1 38  ? -5.189  -13.876 10.861  1.00 0.74 ? 38  MET A H    1  
ATOM 345   N N    . GLY A 1 39  ? -5.215  -16.494 11.926  1.00 0.76 ? 39  GLY A N    1  
ATOM 346   C CA   . GLY A 1 39  ? -4.667  -17.697 12.520  1.00 0.78 ? 39  GLY A CA   1  
ATOM 347   C C    . GLY A 1 39  ? -3.551  -18.284 11.679  1.00 0.80 ? 39  GLY A C    1  
ATOM 348   O O    . GLY A 1 39  ? -2.432  -17.765 11.671  1.00 1.17 ? 39  GLY A O    1  
ATOM 349   H H    . GLY A 1 39  ? -4.722  -15.649 11.995  1.00 0.92 ? 39  GLY A H    1  
ATOM 350   N N    . GLY A 1 40  ? -3.851  -19.354 10.959  1.00 0.84 ? 40  GLY A N    1  
ATOM 351   C CA   . GLY A 1 40  ? -2.851  -19.984 10.125  1.00 0.88 ? 40  GLY A CA   1  
ATOM 352   C C    . GLY A 1 40  ? -3.256  -21.373 9.685   1.00 0.88 ? 40  GLY A C    1  
ATOM 353   O O    . GLY A 1 40  ? -4.432  -21.632 9.429   1.00 1.11 ? 40  GLY A O    1  
ATOM 354   H H    . GLY A 1 40  ? -4.763  -19.721 10.993  1.00 1.11 ? 40  GLY A H    1  
ATOM 355   N N    . GLU A 1 41  ? -2.282  -22.270 9.603   1.00 0.82 ? 41  GLU A N    1  
ATOM 356   C CA   . GLU A 1 41  ? -2.530  -23.644 9.184   1.00 0.87 ? 41  GLU A CA   1  
ATOM 357   C C    . GLU A 1 41  ? -1.533  -24.591 9.837   1.00 0.90 ? 41  GLU A C    1  
ATOM 358   O O    . GLU A 1 41  ? -1.060  -25.539 9.211   1.00 1.06 ? 41  GLU A O    1  
ATOM 359   C CB   . GLU A 1 41  ? -2.452  -23.759 7.660   1.00 0.98 ? 41  GLU A CB   1  
ATOM 360   C CG   . GLU A 1 41  ? -1.242  -23.073 7.047   1.00 1.31 ? 41  GLU A CG   1  
ATOM 361   C CD   . GLU A 1 41  ? -1.240  -23.141 5.535   1.00 1.55 ? 41  GLU A CD   1  
ATOM 362   O OE1  . GLU A 1 41  ? -2.231  -22.701 4.910   1.00 2.17 ? 41  GLU A OE1  1  
ATOM 363   O OE2  . GLU A 1 41  ? -0.249  -23.629 4.959   1.00 1.89 ? 41  GLU A OE2  1  
ATOM 364   H H    . GLU A 1 41  ? -1.367  -22.003 9.838   1.00 0.89 ? 41  GLU A H    1  
ATOM 365   N N    . ALA A 1 42  ? -1.233  -24.322 11.105  1.00 0.89 ? 42  ALA A N    1  
ATOM 366   C CA   . ALA A 1 42  ? -0.289  -25.129 11.881  1.00 0.98 ? 42  ALA A CA   1  
ATOM 367   C C    . ALA A 1 42  ? 1.129   -25.033 11.318  1.00 0.90 ? 42  ALA A C    1  
ATOM 368   O O    . ALA A 1 42  ? 1.527   -25.818 10.455  1.00 0.99 ? 42  ALA A O    1  
ATOM 369   C CB   . ALA A 1 42  ? -0.748  -26.580 11.984  1.00 1.21 ? 42  ALA A CB   1  
ATOM 370   H H    . ALA A 1 42  ? -1.665  -23.557 11.538  1.00 0.92 ? 42  ALA A H    1  
ATOM 371   N N    . PRO A 1 43  ? 1.906   -24.052 11.796  1.00 0.86 ? 43  PRO A N    1  
ATOM 372   C CA   . PRO A 1 43  ? 3.279   -23.847 11.347  1.00 0.89 ? 43  PRO A CA   1  
ATOM 373   C C    . PRO A 1 43  ? 4.239   -24.858 11.969  1.00 0.93 ? 43  PRO A C    1  
ATOM 374   O O    . PRO A 1 43  ? 4.789   -24.636 13.050  1.00 1.08 ? 43  PRO A O    1  
ATOM 375   C CB   . PRO A 1 43  ? 3.599   -22.428 11.814  1.00 1.03 ? 43  PRO A CB   1  
ATOM 376   C CG   . PRO A 1 43  ? 2.735   -22.220 13.012  1.00 1.11 ? 43  PRO A CG   1  
ATOM 377   C CD   . PRO A 1 43  ? 1.505   -23.067 12.815  1.00 0.96 ? 43  PRO A CD   1  
ATOM 378   N N    . GLU A 1 44  ? 4.415   -25.975 11.287  1.00 0.91 ? 44  GLU A N    1  
ATOM 379   C CA   . GLU A 1 44  ? 5.310   -27.020 11.746  1.00 0.98 ? 44  GLU A CA   1  
ATOM 380   C C    . GLU A 1 44  ? 6.744   -26.645 11.396  1.00 0.98 ? 44  GLU A C    1  
ATOM 381   O O    . GLU A 1 44  ? 7.674   -26.910 12.158  1.00 1.13 ? 44  GLU A O    1  
ATOM 382   C CB   . GLU A 1 44  ? 4.936   -28.344 11.083  1.00 1.06 ? 44  GLU A CB   1  
ATOM 383   C CG   . GLU A 1 44  ? 5.592   -29.558 11.711  1.00 1.34 ? 44  GLU A CG   1  
ATOM 384   C CD   . GLU A 1 44  ? 6.006   -30.585 10.682  1.00 1.59 ? 44  GLU A CD   1  
ATOM 385   O OE1  . GLU A 1 44  ? 5.141   -31.043 9.910   1.00 1.91 ? 44  GLU A OE1  1  
ATOM 386   O OE2  . GLU A 1 44  ? 7.201   -30.934 10.636  1.00 2.13 ? 44  GLU A OE2  1  
ATOM 387   H H    . GLU A 1 44  ? 3.918   -26.104 10.450  1.00 0.91 ? 44  GLU A H    1  
ATOM 388   N N    . LEU A 1 45  ? 6.904   -26.016 10.239  1.00 0.93 ? 45  LEU A N    1  
ATOM 389   C CA   . LEU A 1 45  ? 8.209   -25.583 9.771   1.00 0.99 ? 45  LEU A CA   1  
ATOM 390   C C    . LEU A 1 45  ? 8.278   -24.059 9.767   1.00 0.93 ? 45  LEU A C    1  
ATOM 391   O O    . LEU A 1 45  ? 8.725   -23.453 10.743  1.00 0.96 ? 45  LEU A O    1  
ATOM 392   C CB   . LEU A 1 45  ? 8.490   -26.138 8.370   1.00 1.11 ? 45  LEU A CB   1  
ATOM 393   C CG   . LEU A 1 45  ? 8.463   -27.662 8.226   1.00 1.39 ? 45  LEU A CG   1  
ATOM 394   C CD1  . LEU A 1 45  ? 8.506   -28.059 6.761   1.00 1.65 ? 45  LEU A CD1  1  
ATOM 395   C CD2  . LEU A 1 45  ? 9.615   -28.296 8.990   1.00 1.60 ? 45  LEU A CD2  1  
ATOM 396   H H    . LEU A 1 45  ? 6.116   -25.829 9.688   1.00 0.92 ? 45  LEU A H    1  
ATOM 397   N N    . ALA A 1 46  ? 7.814   -23.456 8.669   1.00 0.93 ? 46  ALA A N    1  
ATOM 398   C CA   . ALA A 1 46  ? 7.792   -22.001 8.504   1.00 0.95 ? 46  ALA A CA   1  
ATOM 399   C C    . ALA A 1 46  ? 9.193   -21.400 8.388   1.00 0.89 ? 46  ALA A C    1  
ATOM 400   O O    . ALA A 1 46  ? 10.172  -21.957 8.886   1.00 1.04 ? 46  ALA A O    1  
ATOM 401   C CB   . ALA A 1 46  ? 6.987   -21.324 9.609   1.00 1.03 ? 46  ALA A CB   1  
ATOM 402   H H    . ALA A 1 46  ? 7.485   -24.011 7.931   1.00 0.98 ? 46  ALA A H    1  
ATOM 403   N N    . LEU A 1 47  ? 9.281   -20.265 7.720   1.00 0.83 ? 47  LEU A N    1  
ATOM 404   C CA   . LEU A 1 47  ? 10.552  -19.585 7.538   1.00 0.78 ? 47  LEU A CA   1  
ATOM 405   C C    . LEU A 1 47  ? 10.546  -18.249 8.268   1.00 0.69 ? 47  LEU A C    1  
ATOM 406   O O    . LEU A 1 47  ? 9.902   -17.294 7.831   1.00 0.75 ? 47  LEU A O    1  
ATOM 407   C CB   . LEU A 1 47  ? 10.848  -19.384 6.046   1.00 0.89 ? 47  LEU A CB   1  
ATOM 408   C CG   . LEU A 1 47  ? 12.120  -18.604 5.703   1.00 0.92 ? 47  LEU A CG   1  
ATOM 409   C CD1  . LEU A 1 47  ? 13.353  -19.347 6.189   1.00 1.06 ? 47  LEU A CD1  1  
ATOM 410   C CD2  . LEU A 1 47  ? 12.205  -18.343 4.207   1.00 1.09 ? 47  LEU A CD2  1  
ATOM 411   H H    . LEU A 1 47  ? 8.470   -19.865 7.340   1.00 0.92 ? 47  LEU A H    1  
ATOM 412   N N    . ASP A 1 48  ? 11.248  -18.186 9.391   1.00 0.69 ? 48  ASP A N    1  
ATOM 413   C CA   . ASP A 1 48  ? 11.318  -16.960 10.174  1.00 0.67 ? 48  ASP A CA   1  
ATOM 414   C C    . ASP A 1 48  ? 12.761  -16.500 10.321  1.00 0.61 ? 48  ASP A C    1  
ATOM 415   O O    . ASP A 1 48  ? 13.455  -16.894 11.258  1.00 0.63 ? 48  ASP A O    1  
ATOM 416   C CB   . ASP A 1 48  ? 10.690  -17.162 11.555  1.00 0.79 ? 48  ASP A CB   1  
ATOM 417   C CG   . ASP A 1 48  ? 10.348  -15.857 12.253  1.00 1.00 ? 48  ASP A CG   1  
ATOM 418   O OD1  . ASP A 1 48  ? 10.857  -14.788 11.842  1.00 1.31 ? 48  ASP A OD1  1  
ATOM 419   O OD2  . ASP A 1 48  ? 9.554   -15.895 13.216  1.00 1.64 ? 48  ASP A OD2  1  
ATOM 420   H H    . ASP A 1 48  ? 11.730  -18.981 9.704   1.00 0.81 ? 48  ASP A H    1  
ATOM 421   N N    . PRO A 1 49  ? 13.242  -15.679 9.379   1.00 0.64 ? 49  PRO A N    1  
ATOM 422   C CA   . PRO A 1 49  ? 14.602  -15.160 9.406   1.00 0.66 ? 49  PRO A CA   1  
ATOM 423   C C    . PRO A 1 49  ? 14.709  -13.904 10.268  1.00 0.58 ? 49  PRO A C    1  
ATOM 424   O O    . PRO A 1 49  ? 15.804  -13.379 10.464  1.00 0.63 ? 49  PRO A O    1  
ATOM 425   C CB   . PRO A 1 49  ? 14.885  -14.818 7.931   1.00 0.80 ? 49  PRO A CB   1  
ATOM 426   C CG   . PRO A 1 49  ? 13.617  -15.091 7.181   1.00 0.93 ? 49  PRO A CG   1  
ATOM 427   C CD   . PRO A 1 49  ? 12.518  -15.202 8.199   1.00 0.76 ? 49  PRO A CD   1  
ATOM 428   N N    . VAL A 1 50  ? 13.567  -13.453 10.797  1.00 0.56 ? 50  VAL A N    1  
ATOM 429   C CA   . VAL A 1 50  ? 13.502  -12.254 11.635  1.00 0.58 ? 50  VAL A CA   1  
ATOM 430   C C    . VAL A 1 50  ? 13.829  -10.989 10.834  1.00 0.57 ? 50  VAL A C    1  
ATOM 431   O O    . VAL A 1 50  ? 14.949  -10.817 10.359  1.00 0.62 ? 50  VAL A O    1  
ATOM 432   C CB   . VAL A 1 50  ? 14.412  -12.352 12.882  1.00 0.64 ? 50  VAL A CB   1  
ATOM 433   C CG1  . VAL A 1 50  ? 14.336  -11.081 13.717  1.00 0.75 ? 50  VAL A CG1  1  
ATOM 434   C CG2  . VAL A 1 50  ? 14.037  -13.566 13.720  1.00 0.75 ? 50  VAL A CG2  1  
ATOM 435   H H    . VAL A 1 50  ? 12.742  -13.956 10.633  1.00 0.60 ? 50  VAL A H    1  
ATOM 436   N N    . PRO A 1 51  ? 12.839  -10.096 10.660  1.00 0.60 ? 51  PRO A N    1  
ATOM 437   C CA   . PRO A 1 51  ? 13.021  -8.841  9.917   1.00 0.65 ? 51  PRO A CA   1  
ATOM 438   C C    . PRO A 1 51  ? 14.214  -8.036  10.437  1.00 0.66 ? 51  PRO A C    1  
ATOM 439   O O    . PRO A 1 51  ? 14.172  -7.475  11.538  1.00 0.73 ? 51  PRO A O    1  
ATOM 440   C CB   . PRO A 1 51  ? 11.712  -8.086  10.169  1.00 0.77 ? 51  PRO A CB   1  
ATOM 441   C CG   . PRO A 1 51  ? 10.715  -9.158  10.445  1.00 0.92 ? 51  PRO A CG   1  
ATOM 442   C CD   . PRO A 1 51  ? 11.464  -10.242 11.166  1.00 0.72 ? 51  PRO A CD   1  
ATOM 443   N N    . GLN A 1 52  ? 15.278  -7.996  9.637   1.00 0.71 ? 52  GLN A N    1  
ATOM 444   C CA   . GLN A 1 52  ? 16.496  -7.283  10.000  1.00 0.81 ? 52  GLN A CA   1  
ATOM 445   C C    . GLN A 1 52  ? 16.316  -5.781  9.824   1.00 0.77 ? 52  GLN A C    1  
ATOM 446   O O    . GLN A 1 52  ? 16.768  -4.990  10.652  1.00 0.91 ? 52  GLN A O    1  
ATOM 447   C CB   . GLN A 1 52  ? 17.660  -7.754  9.122   1.00 0.97 ? 52  GLN A CB   1  
ATOM 448   C CG   . GLN A 1 52  ? 17.962  -9.243  9.198   1.00 1.18 ? 52  GLN A CG   1  
ATOM 449   C CD   . GLN A 1 52  ? 18.406  -9.684  10.579  1.00 1.30 ? 52  GLN A CD   1  
ATOM 450   O OE1  . GLN A 1 52  ? 19.565  -9.515  10.952  1.00 1.40 ? 52  GLN A OE1  1  
ATOM 451   N NE2  . GLN A 1 52  ? 17.496  -10.273 11.336  1.00 1.51 ? 52  GLN A NE2  1  
ATOM 452   H H    . GLN A 1 52  ? 15.239  -8.460  8.771   1.00 0.75 ? 52  GLN A H    1  
ATOM 453   H HE21 . GLN A 1 52  ? 16.589  -10.395 10.968  1.00 1.58 ? 52  GLN A HE21 1  
ATOM 454   H HE22 . GLN A 1 52  ? 17.761  -10.567 12.233  1.00 1.68 ? 52  GLN A HE22 1  
ATOM 455   N N    . ASP A 1 53  ? 15.648  -5.402  8.741   1.00 0.67 ? 53  ASP A N    1  
ATOM 456   C CA   . ASP A 1 53  ? 15.413  -3.994  8.437   1.00 0.64 ? 53  ASP A CA   1  
ATOM 457   C C    . ASP A 1 53  ? 14.422  -3.362  9.409   1.00 0.62 ? 53  ASP A C    1  
ATOM 458   O O    . ASP A 1 53  ? 13.380  -3.944  9.723   1.00 0.63 ? 53  ASP A O    1  
ATOM 459   C CB   . ASP A 1 53  ? 14.932  -3.810  6.996   1.00 0.64 ? 53  ASP A CB   1  
ATOM 460   C CG   . ASP A 1 53  ? 14.589  -2.367  6.683   1.00 0.60 ? 53  ASP A CG   1  
ATOM 461   O OD1  . ASP A 1 53  ? 15.519  -1.533  6.597   1.00 0.78 ? 53  ASP A OD1  1  
ATOM 462   O OD2  . ASP A 1 53  ? 13.394  -2.054  6.535   1.00 0.69 ? 53  ASP A OD2  1  
ATOM 463   H H    . ASP A 1 53  ? 15.299  -6.088  8.132   1.00 0.69 ? 53  ASP A H    1  
ATOM 464   N N    . ALA A 1 54  ? 14.762  -2.171  9.887   1.00 0.63 ? 54  ALA A N    1  
ATOM 465   C CA   . ALA A 1 54  ? 13.909  -1.449  10.820  1.00 0.64 ? 54  ALA A CA   1  
ATOM 466   C C    . ALA A 1 54  ? 13.088  -0.381  10.103  1.00 0.60 ? 54  ALA A C    1  
ATOM 467   O O    . ALA A 1 54  ? 12.081  0.094   10.627  1.00 0.60 ? 54  ALA A O    1  
ATOM 468   C CB   . ALA A 1 54  ? 14.747  -0.821  11.923  1.00 0.71 ? 54  ALA A CB   1  
ATOM 469   H H    . ALA A 1 54  ? 15.613  -1.770  9.612   1.00 0.67 ? 54  ALA A H    1  
ATOM 470   N N    . SER A 1 55  ? 13.518  -0.023  8.898   1.00 0.58 ? 55  SER A N    1  
ATOM 471   C CA   . SER A 1 55  ? 12.835  0.993   8.101   1.00 0.57 ? 55  SER A CA   1  
ATOM 472   C C    . SER A 1 55  ? 11.409  0.562   7.768   1.00 0.52 ? 55  SER A C    1  
ATOM 473   O O    . SER A 1 55  ? 10.445  1.260   8.092   1.00 0.51 ? 55  SER A O    1  
ATOM 474   C CB   . SER A 1 55  ? 13.618  1.260   6.816   1.00 0.59 ? 55  SER A CB   1  
ATOM 475   O OG   . SER A 1 55  ? 15.009  1.059   7.019   1.00 0.67 ? 55  SER A OG   1  
ATOM 476   H H    . SER A 1 55  ? 14.317  -0.455  8.529   1.00 0.60 ? 55  SER A H    1  
ATOM 477   H HG   . SER A 1 55  ? 15.230  0.135   6.813   1.00 0.67 ? 55  SER A HG   1  
ATOM 478   N N    . THR A 1 56  ? 11.283  -0.595  7.134   1.00 0.51 ? 56  THR A N    1  
ATOM 479   C CA   . THR A 1 56  ? 9.983   -1.128  6.761   1.00 0.49 ? 56  THR A CA   1  
ATOM 480   C C    . THR A 1 56  ? 9.178   -1.471  8.009   1.00 0.48 ? 56  THR A C    1  
ATOM 481   O O    . THR A 1 56  ? 7.958   -1.328  8.034   1.00 0.47 ? 56  THR A O    1  
ATOM 482   C CB   . THR A 1 56  ? 10.124  -2.379  5.869   1.00 0.50 ? 56  THR A CB   1  
ATOM 483   O OG1  . THR A 1 56  ? 11.101  -3.269  6.432   1.00 0.57 ? 56  THR A OG1  1  
ATOM 484   C CG2  . THR A 1 56  ? 10.557  -1.986  4.464   1.00 0.63 ? 56  THR A CG2  1  
ATOM 485   H H    . THR A 1 56  ? 12.100  -1.114  6.909   1.00 0.52 ? 56  THR A H    1  
ATOM 486   H HG1  . THR A 1 56  ? 11.986  -2.868  6.368   1.00 0.55 ? 56  THR A HG1  1  
ATOM 487   N N    . LYS A 1 57  ? 9.887   -1.901  9.046   1.00 0.50 ? 57  LYS A N    1  
ATOM 488   C CA   . LYS A 1 57  ? 9.266   -2.259  10.313  1.00 0.52 ? 57  LYS A CA   1  
ATOM 489   C C    . LYS A 1 57  ? 8.546   -1.051  10.914  1.00 0.52 ? 57  LYS A C    1  
ATOM 490   O O    . LYS A 1 57  ? 7.378   -1.141  11.296  1.00 0.53 ? 57  LYS A O    1  
ATOM 491   C CB   . LYS A 1 57  ? 10.328  -2.787  11.282  1.00 0.56 ? 57  LYS A CB   1  
ATOM 492   C CG   . LYS A 1 57  ? 9.771   -3.453  12.531  1.00 1.01 ? 57  LYS A CG   1  
ATOM 493   C CD   . LYS A 1 57  ? 10.883  -4.068  13.370  1.00 1.09 ? 57  LYS A CD   1  
ATOM 494   C CE   . LYS A 1 57  ? 11.519  -5.259  12.668  1.00 1.30 ? 57  LYS A CE   1  
ATOM 495   N NZ   . LYS A 1 57  ? 12.508  -5.956  13.535  1.00 1.59 ? 57  LYS A NZ   1  
ATOM 496   H H    . LYS A 1 57  ? 10.858  -1.986  8.951   1.00 0.52 ? 57  LYS A H    1  
ATOM 497   H HZ1  . LYS A 1 57  ? 12.043  -6.311  14.397  1.00 1.92 ? 57  LYS A HZ1  1  
ATOM 498   H HZ2  . LYS A 1 57  ? 13.271  -5.308  13.807  1.00 1.99 ? 57  LYS A HZ2  1  
ATOM 499   H HZ3  . LYS A 1 57  ? 12.922  -6.764  13.024  1.00 1.99 ? 57  LYS A HZ3  1  
ATOM 500   N N    . LYS A 1 58  ? 9.248   0.078   10.971  1.00 0.54 ? 58  LYS A N    1  
ATOM 501   C CA   . LYS A 1 58  ? 8.684   1.310   11.512  1.00 0.56 ? 58  LYS A CA   1  
ATOM 502   C C    . LYS A 1 58  ? 7.526   1.805   10.650  1.00 0.54 ? 58  LYS A C    1  
ATOM 503   O O    . LYS A 1 58  ? 6.491   2.218   11.167  1.00 0.55 ? 58  LYS A O    1  
ATOM 504   C CB   . LYS A 1 58  ? 9.762   2.390   11.617  1.00 0.60 ? 58  LYS A CB   1  
ATOM 505   C CG   . LYS A 1 58  ? 9.332   3.624   12.394  1.00 0.70 ? 58  LYS A CG   1  
ATOM 506   C CD   . LYS A 1 58  ? 10.332  4.758   12.234  1.00 0.76 ? 58  LYS A CD   1  
ATOM 507   C CE   . LYS A 1 58  ? 9.943   5.950   13.095  1.00 1.16 ? 58  LYS A CE   1  
ATOM 508   N NZ   . LYS A 1 58  ? 10.757  7.156   12.791  1.00 1.32 ? 58  LYS A NZ   1  
ATOM 509   H H    . LYS A 1 58  ? 10.174  0.081   10.646  1.00 0.54 ? 58  LYS A H    1  
ATOM 510   H HZ1  . LYS A 1 58  ? 10.644  7.865   13.545  1.00 1.74 ? 58  LYS A HZ1  1  
ATOM 511   H HZ2  . LYS A 1 58  ? 10.452  7.575   11.890  1.00 1.67 ? 58  LYS A HZ2  1  
ATOM 512   H HZ3  . LYS A 1 58  ? 11.762  6.902   12.715  1.00 1.54 ? 58  LYS A HZ3  1  
ATOM 513   N N    . LEU A 1 59  ? 7.706   1.753   9.332   1.00 0.52 ? 59  LEU A N    1  
ATOM 514   C CA   . LEU A 1 59  ? 6.670   2.195   8.404   1.00 0.51 ? 59  LEU A CA   1  
ATOM 515   C C    . LEU A 1 59  ? 5.403   1.362   8.545   1.00 0.50 ? 59  LEU A C    1  
ATOM 516   O O    . LEU A 1 59  ? 4.295   1.901   8.569   1.00 0.51 ? 59  LEU A O    1  
ATOM 517   C CB   . LEU A 1 59  ? 7.181   2.161   6.962   1.00 0.50 ? 59  LEU A CB   1  
ATOM 518   C CG   . LEU A 1 59  ? 8.172   3.260   6.581   1.00 0.56 ? 59  LEU A CG   1  
ATOM 519   C CD1  . LEU A 1 59  ? 8.746   3.007   5.196   1.00 0.55 ? 59  LEU A CD1  1  
ATOM 520   C CD2  . LEU A 1 59  ? 7.505   4.625   6.648   1.00 0.72 ? 59  LEU A CD2  1  
ATOM 521   H H    . LEU A 1 59  ? 8.560   1.418   8.978   1.00 0.52 ? 59  LEU A H    1  
ATOM 522   N N    . SER A 1 60  ? 5.572   0.050   8.651   1.00 0.50 ? 60  SER A N    1  
ATOM 523   C CA   . SER A 1 60  ? 4.440   -0.850  8.799   1.00 0.50 ? 60  SER A CA   1  
ATOM 524   C C    . SER A 1 60  ? 3.733   -0.607  10.128  1.00 0.51 ? 60  SER A C    1  
ATOM 525   O O    . SER A 1 60  ? 2.523   -0.777  10.233  1.00 0.53 ? 60  SER A O    1  
ATOM 526   C CB   . SER A 1 60  ? 4.893   -2.304  8.687   1.00 0.50 ? 60  SER A CB   1  
ATOM 527   O OG   . SER A 1 60  ? 5.625   -2.513  7.492   1.00 0.50 ? 60  SER A OG   1  
ATOM 528   H H    . SER A 1 60  ? 6.483   -0.323  8.622   1.00 0.51 ? 60  SER A H    1  
ATOM 529   H HG   . SER A 1 60  ? 6.525   -2.181  7.604   1.00 0.49 ? 60  SER A HG   1  
ATOM 530   N N    . GLU A 1 61  ? 4.500   -0.189  11.134  1.00 0.52 ? 61  GLU A N    1  
ATOM 531   C CA   . GLU A 1 61  ? 3.953   0.092   12.458  1.00 0.55 ? 61  GLU A CA   1  
ATOM 532   C C    . GLU A 1 61  ? 2.907   1.202   12.386  1.00 0.55 ? 61  GLU A C    1  
ATOM 533   O O    . GLU A 1 61  ? 1.751   1.006   12.770  1.00 0.57 ? 61  GLU A O    1  
ATOM 534   C CB   . GLU A 1 61  ? 5.076   0.498   13.419  1.00 0.60 ? 61  GLU A CB   1  
ATOM 535   C CG   . GLU A 1 61  ? 4.898   0.006   14.849  1.00 0.81 ? 61  GLU A CG   1  
ATOM 536   C CD   . GLU A 1 61  ? 3.670   0.572   15.533  1.00 1.12 ? 61  GLU A CD   1  
ATOM 537   O OE1  . GLU A 1 61  ? 3.605   1.805   15.739  1.00 1.35 ? 61  GLU A OE1  1  
ATOM 538   O OE2  . GLU A 1 61  ? 2.766   -0.217  15.875  1.00 1.50 ? 61  GLU A OE2  1  
ATOM 539   H H    . GLU A 1 61  ? 5.466   -0.072  10.983  1.00 0.52 ? 61  GLU A H    1  
ATOM 540   N N    . CYS A 1 62  ? 3.314   2.359   11.870  1.00 0.55 ? 62  CYS A N    1  
ATOM 541   C CA   . CYS A 1 62  ? 2.414   3.498   11.750  1.00 0.57 ? 62  CYS A CA   1  
ATOM 542   C C    . CYS A 1 62  ? 1.231   3.190   10.837  1.00 0.56 ? 62  CYS A C    1  
ATOM 543   O O    . CYS A 1 62  ? 0.091   3.540   11.147  1.00 0.60 ? 62  CYS A O    1  
ATOM 544   C CB   . CYS A 1 62  ? 3.159   4.759   11.296  1.00 0.60 ? 62  CYS A CB   1  
ATOM 545   S SG   . CYS A 1 62  ? 4.512   4.467   10.131  1.00 0.59 ? 62  CYS A SG   1  
ATOM 546   H H    . CYS A 1 62  ? 4.244   2.448   11.564  1.00 0.55 ? 62  CYS A H    1  
ATOM 547   H HG   . CYS A 1 62  ? 4.184   3.426   9.377   1.00 0.98 ? 62  CYS A HG   1  
ATOM 548   N N    . LEU A 1 63  ? 1.498   2.502   9.731   1.00 0.52 ? 63  LEU A N    1  
ATOM 549   C CA   . LEU A 1 63  ? 0.448   2.144   8.784   1.00 0.53 ? 63  LEU A CA   1  
ATOM 550   C C    . LEU A 1 63  ? -0.572  1.209   9.427   1.00 0.52 ? 63  LEU A C    1  
ATOM 551   O O    . LEU A 1 63  ? -1.779  1.384   9.269   1.00 0.53 ? 63  LEU A O    1  
ATOM 552   C CB   . LEU A 1 63  ? 1.041   1.497   7.528   1.00 0.53 ? 63  LEU A CB   1  
ATOM 553   C CG   . LEU A 1 63  ? 1.827   2.424   6.597   1.00 0.55 ? 63  LEU A CG   1  
ATOM 554   C CD1  . LEU A 1 63  ? 2.435   1.636   5.446   1.00 0.57 ? 63  LEU A CD1  1  
ATOM 555   C CD2  . LEU A 1 63  ? 0.936   3.540   6.073   1.00 0.62 ? 63  LEU A CD2  1  
ATOM 556   H H    . LEU A 1 63  ? 2.422   2.224   9.550   1.00 0.50 ? 63  LEU A H    1  
ATOM 557   N N    . LYS A 1 64  ? -0.072  0.230   10.168  1.00 0.52 ? 64  LYS A N    1  
ATOM 558   C CA   . LYS A 1 64  ? -0.921  -0.741  10.839  1.00 0.54 ? 64  LYS A CA   1  
ATOM 559   C C    . LYS A 1 64  ? -1.820  -0.082  11.880  1.00 0.54 ? 64  LYS A C    1  
ATOM 560   O O    . LYS A 1 64  ? -3.028  -0.317  11.898  1.00 0.54 ? 64  LYS A O    1  
ATOM 561   C CB   . LYS A 1 64  ? -0.066  -1.844  11.477  1.00 0.59 ? 64  LYS A CB   1  
ATOM 562   C CG   . LYS A 1 64  ? -0.719  -2.562  12.649  1.00 0.71 ? 64  LYS A CG   1  
ATOM 563   C CD   . LYS A 1 64  ? 0.063   -2.343  13.937  1.00 0.88 ? 64  LYS A CD   1  
ATOM 564   C CE   . LYS A 1 64  ? 1.372   -3.116  13.930  1.00 0.86 ? 64  LYS A CE   1  
ATOM 565   N NZ   . LYS A 1 64  ? 1.152   -4.573  14.104  1.00 0.78 ? 64  LYS A NZ   1  
ATOM 566   H H    . LYS A 1 64  ? 0.904   0.154   10.265  1.00 0.52 ? 64  LYS A H    1  
ATOM 567   H HZ1  . LYS A 1 64  ? 0.520   -4.939  13.354  1.00 0.95 ? 64  LYS A HZ1  1  
ATOM 568   H HZ2  . LYS A 1 64  ? 0.719   -4.764  15.029  1.00 1.03 ? 64  LYS A HZ2  1  
ATOM 569   H HZ3  . LYS A 1 64  ? 2.054   -5.082  14.047  1.00 0.96 ? 64  LYS A HZ3  1  
ATOM 570   N N    . ARG A 1 65  ? -1.238  0.749   12.733  1.00 0.57 ? 65  ARG A N    1  
ATOM 571   C CA   . ARG A 1 65  ? -2.005  1.415   13.776  1.00 0.59 ? 65  ARG A CA   1  
ATOM 572   C C    . ARG A 1 65  ? -3.036  2.383   13.199  1.00 0.57 ? 65  ARG A C    1  
ATOM 573   O O    . ARG A 1 65  ? -4.180  2.409   13.649  1.00 0.60 ? 65  ARG A O    1  
ATOM 574   C CB   . ARG A 1 65  ? -1.101  2.079   14.823  1.00 0.66 ? 65  ARG A CB   1  
ATOM 575   C CG   . ARG A 1 65  ? -0.266  3.244   14.319  1.00 0.66 ? 65  ARG A CG   1  
ATOM 576   C CD   . ARG A 1 65  ? 0.807   3.623   15.327  1.00 0.75 ? 65  ARG A CD   1  
ATOM 577   N NE   . ARG A 1 65  ? 0.258   3.817   16.670  1.00 0.86 ? 65  ARG A NE   1  
ATOM 578   C CZ   . ARG A 1 65  ? 0.652   3.124   17.742  1.00 1.00 ? 65  ARG A CZ   1  
ATOM 579   N NH1  . ARG A 1 65  ? 1.634   2.234   17.640  1.00 1.05 ? 65  ARG A NH1  1  
ATOM 580   N NH2  . ARG A 1 65  ? 0.078   3.335   18.920  1.00 1.19 ? 65  ARG A NH2  1  
ATOM 581   H H    . ARG A 1 65  ? -0.272  0.918   12.656  1.00 0.58 ? 65  ARG A H    1  
ATOM 582   H HE   . ARG A 1 65  ? -0.452  4.489   16.771  1.00 0.91 ? 65  ARG A HE   1  
ATOM 583   H HH11 . ARG A 1 65  ? 2.091   2.076   16.752  1.00 0.95 ? 65  ARG A HH11 1  
ATOM 584   H HH12 . ARG A 1 65  ? 1.915   1.701   18.440  1.00 1.24 ? 65  ARG A HH12 1  
ATOM 585   H HH21 . ARG A 1 65  ? -0.654  4.016   19.013  1.00 1.21 ? 65  ARG A HH21 1  
ATOM 586   H HH22 . ARG A 1 65  ? 0.363   2.804   19.723  1.00 1.36 ? 65  ARG A HH22 1  
ATOM 587   N N    . ILE A 1 66  ? -2.641  3.154   12.188  1.00 0.53 ? 66  ILE A N    1  
ATOM 588   C CA   . ILE A 1 66  ? -3.550  4.104   11.554  1.00 0.52 ? 66  ILE A CA   1  
ATOM 589   C C    . ILE A 1 66  ? -4.675  3.361   10.837  1.00 0.48 ? 66  ILE A C    1  
ATOM 590   O O    . ILE A 1 66  ? -5.849  3.713   10.976  1.00 0.48 ? 66  ILE A O    1  
ATOM 591   C CB   . ILE A 1 66  ? -2.821  5.047   10.572  1.00 0.54 ? 66  ILE A CB   1  
ATOM 592   C CG1  . ILE A 1 66  ? -1.855  5.961   11.335  1.00 0.59 ? 66  ILE A CG1  1  
ATOM 593   C CG2  . ILE A 1 66  ? -3.818  5.879   9.773   1.00 0.55 ? 66  ILE A CG2  1  
ATOM 594   C CD1  . ILE A 1 66  ? -0.955  6.792   10.445  1.00 0.62 ? 66  ILE A CD1  1  
ATOM 595   H H    . ILE A 1 66  ? -1.716  3.089   11.865  1.00 0.54 ? 66  ILE A H    1  
ATOM 596   N N    . GLY A 1 67  ? -4.315  2.322   10.093  1.00 0.47 ? 67  GLY A N    1  
ATOM 597   C CA   . GLY A 1 67  ? -5.309  1.543   9.377   1.00 0.45 ? 67  GLY A CA   1  
ATOM 598   C C    . GLY A 1 67  ? -6.285  0.878   10.325  1.00 0.45 ? 67  GLY A C    1  
ATOM 599   O O    . GLY A 1 67  ? -7.481  0.791   10.043  1.00 0.44 ? 67  GLY A O    1  
ATOM 600   H H    . GLY A 1 67  ? -3.362  2.080   10.025  1.00 0.49 ? 67  GLY A H    1  
ATOM 601   N N    . ASP A 1 68  ? -5.771  0.430   11.463  1.00 0.50 ? 68  ASP A N    1  
ATOM 602   C CA   . ASP A 1 68  ? -6.591  -0.217  12.478  1.00 0.55 ? 68  ASP A CA   1  
ATOM 603   C C    . ASP A 1 68  ? -7.533  0.796   13.120  1.00 0.54 ? 68  ASP A C    1  
ATOM 604   O O    . ASP A 1 68  ? -8.691  0.488   13.417  1.00 0.55 ? 68  ASP A O    1  
ATOM 605   C CB   . ASP A 1 68  ? -5.701  -0.867  13.544  1.00 0.65 ? 68  ASP A CB   1  
ATOM 606   C CG   . ASP A 1 68  ? -6.490  -1.650  14.573  1.00 0.76 ? 68  ASP A CG   1  
ATOM 607   O OD1  . ASP A 1 68  ? -6.903  -1.058  15.588  1.00 1.13 ? 68  ASP A OD1  1  
ATOM 608   O OD2  . ASP A 1 68  ? -6.696  -2.868  14.375  1.00 0.95 ? 68  ASP A OD2  1  
ATOM 609   H H    . ASP A 1 68  ? -4.807  0.538   11.624  1.00 0.53 ? 68  ASP A H    1  
ATOM 610   N N    . GLU A 1 69  ? -7.031  2.013   13.317  1.00 0.55 ? 69  GLU A N    1  
ATOM 611   C CA   . GLU A 1 69  ? -7.818  3.087   13.910  1.00 0.58 ? 69  GLU A CA   1  
ATOM 612   C C    . GLU A 1 69  ? -8.901  3.575   12.950  1.00 0.53 ? 69  GLU A C    1  
ATOM 613   O O    . GLU A 1 69  ? -9.953  4.053   13.374  1.00 0.58 ? 69  GLU A O    1  
ATOM 614   C CB   . GLU A 1 69  ? -6.920  4.252   14.334  1.00 0.63 ? 69  GLU A CB   1  
ATOM 615   C CG   . GLU A 1 69  ? -6.135  4.002   15.609  1.00 0.89 ? 69  GLU A CG   1  
ATOM 616   C CD   . GLU A 1 69  ? -5.557  5.274   16.190  1.00 1.22 ? 69  GLU A CD   1  
ATOM 617   O OE1  . GLU A 1 69  ? -6.340  6.176   16.557  1.00 1.90 ? 69  GLU A OE1  1  
ATOM 618   O OE2  . GLU A 1 69  ? -4.317  5.376   16.293  1.00 1.81 ? 69  GLU A OE2  1  
ATOM 619   H H    . GLU A 1 69  ? -6.097  2.190   13.064  1.00 0.56 ? 69  GLU A H    1  
ATOM 620   N N    . LEU A 1 70  ? -8.646  3.431   11.655  1.00 0.48 ? 70  LEU A N    1  
ATOM 621   C CA   . LEU A 1 70  ? -9.597  3.851   10.630  1.00 0.46 ? 70  LEU A CA   1  
ATOM 622   C C    . LEU A 1 70  ? -10.749 2.858   10.490  1.00 0.41 ? 70  LEU A C    1  
ATOM 623   O O    . LEU A 1 70  ? -11.575 2.970   9.584   1.00 0.38 ? 70  LEU A O    1  
ATOM 624   C CB   . LEU A 1 70  ? -8.891  4.038   9.285   1.00 0.45 ? 70  LEU A CB   1  
ATOM 625   C CG   . LEU A 1 70  ? -7.988  5.266   9.156   1.00 0.51 ? 70  LEU A CG   1  
ATOM 626   C CD1  . LEU A 1 70  ? -7.277  5.267   7.811   1.00 0.51 ? 70  LEU A CD1  1  
ATOM 627   C CD2  . LEU A 1 70  ? -8.792  6.543   9.341   1.00 0.59 ? 70  LEU A CD2  1  
ATOM 628   H H    . LEU A 1 70  ? -7.786  3.045   11.379  1.00 0.48 ? 70  LEU A H    1  
ATOM 629   N N    . ASP A 1 71  ? -10.788 1.873   11.377  1.00 0.43 ? 71  ASP A N    1  
ATOM 630   C CA   . ASP A 1 71  ? -11.850 0.876   11.364  1.00 0.41 ? 71  ASP A CA   1  
ATOM 631   C C    . ASP A 1 71  ? -12.803 1.120   12.526  1.00 0.43 ? 71  ASP A C    1  
ATOM 632   O O    . ASP A 1 71  ? -13.819 0.443   12.668  1.00 0.48 ? 71  ASP A O    1  
ATOM 633   C CB   . ASP A 1 71  ? -11.272 -0.542  11.438  1.00 0.46 ? 71  ASP A CB   1  
ATOM 634   C CG   . ASP A 1 71  ? -12.072 -1.552  10.632  1.00 0.54 ? 71  ASP A CG   1  
ATOM 635   O OD1  . ASP A 1 71  ? -13.131 -1.186  10.075  1.00 0.61 ? 71  ASP A OD1  1  
ATOM 636   O OD2  . ASP A 1 71  ? -11.626 -2.715  10.520  1.00 1.07 ? 71  ASP A OD2  1  
ATOM 637   H H    . ASP A 1 71  ? -10.081 1.811   12.055  1.00 0.48 ? 71  ASP A H    1  
ATOM 638   N N    . SER A 1 72  ? -12.463 2.101   13.362  1.00 0.46 ? 72  SER A N    1  
ATOM 639   C CA   . SER A 1 72  ? -13.285 2.447   14.516  1.00 0.50 ? 72  SER A CA   1  
ATOM 640   C C    . SER A 1 72  ? -14.599 3.079   14.065  1.00 0.47 ? 72  SER A C    1  
ATOM 641   O O    . SER A 1 72  ? -15.649 2.869   14.674  1.00 0.54 ? 72  SER A O    1  
ATOM 642   C CB   . SER A 1 72  ? -12.530 3.416   15.430  1.00 0.58 ? 72  SER A CB   1  
ATOM 643   O OG   . SER A 1 72  ? -11.159 3.063   15.527  1.00 0.65 ? 72  SER A OG   1  
ATOM 644   H H    . SER A 1 72  ? -11.633 2.597   13.202  1.00 0.49 ? 72  SER A H    1  
ATOM 645   H HG   . SER A 1 72  ? -10.659 3.539   14.851  1.00 1.14 ? 72  SER A HG   1  
ATOM 646   N N    . ASN A 1 73  ? -14.522 3.855   12.994  1.00 0.47 ? 73  ASN A N    1  
ATOM 647   C CA   . ASN A 1 73  ? -15.691 4.522   12.438  1.00 0.47 ? 73  ASN A CA   1  
ATOM 648   C C    . ASN A 1 73  ? -16.570 3.526   11.697  1.00 0.45 ? 73  ASN A C    1  
ATOM 649   O O    . ASN A 1 73  ? -16.301 3.176   10.545  1.00 0.45 ? 73  ASN A O    1  
ATOM 650   C CB   . ASN A 1 73  ? -15.280 5.664   11.501  1.00 0.49 ? 73  ASN A CB   1  
ATOM 651   C CG   . ASN A 1 73  ? -13.946 5.428   10.815  1.00 0.49 ? 73  ASN A CG   1  
ATOM 652   O OD1  . ASN A 1 73  ? -12.940 6.042   11.168  1.00 0.70 ? 73  ASN A OD1  1  
ATOM 653   N ND2  . ASN A 1 73  ? -13.922 4.529   9.845   1.00 0.62 ? 73  ASN A ND2  1  
ATOM 654   H H    . ASN A 1 73  ? -13.655 3.977   12.557  1.00 0.53 ? 73  ASN A H    1  
ATOM 655   H HD21 . ASN A 1 73  ? -14.759 4.066   9.620   1.00 0.86 ? 73  ASN A HD21 1  
ATOM 656   H HD22 . ASN A 1 73  ? -13.064 4.349   9.400   1.00 0.63 ? 73  ASN A HD22 1  
ATOM 657   N N    . MET A 1 74  ? -17.618 3.073   12.369  1.00 0.48 ? 74  MET A N    1  
ATOM 658   C CA   . MET A 1 74  ? -18.545 2.110   11.792  1.00 0.49 ? 74  MET A CA   1  
ATOM 659   C C    . MET A 1 74  ? -19.279 2.691   10.590  1.00 0.47 ? 74  MET A C    1  
ATOM 660   O O    . MET A 1 74  ? -19.767 1.947   9.738   1.00 0.46 ? 74  MET A O    1  
ATOM 661   C CB   . MET A 1 74  ? -19.524 1.577   12.841  1.00 0.57 ? 74  MET A CB   1  
ATOM 662   C CG   . MET A 1 74  ? -20.533 2.592   13.354  1.00 0.78 ? 74  MET A CG   1  
ATOM 663   S SD   . MET A 1 74  ? -21.474 1.975   14.767  1.00 0.95 ? 74  MET A SD   1  
ATOM 664   C CE   . MET A 1 74  ? -22.037 0.392   14.140  1.00 1.32 ? 74  MET A CE   1  
ATOM 665   H H    . MET A 1 74  ? -17.772 3.394   13.283  1.00 0.53 ? 74  MET A H    1  
ATOM 666   N N    . GLU A 1 75  ? -19.347 4.020   10.521  1.00 0.49 ? 75  GLU A N    1  
ATOM 667   C CA   . GLU A 1 75  ? -20.001 4.696   9.407   1.00 0.52 ? 75  GLU A CA   1  
ATOM 668   C C    . GLU A 1 75  ? -19.300 4.336   8.103   1.00 0.48 ? 75  GLU A C    1  
ATOM 669   O O    . GLU A 1 75  ? -19.896 3.745   7.203   1.00 0.51 ? 75  GLU A O    1  
ATOM 670   C CB   . GLU A 1 75  ? -19.982 6.220   9.590   1.00 0.61 ? 75  GLU A CB   1  
ATOM 671   C CG   . GLU A 1 75  ? -20.224 6.704   11.009  1.00 0.72 ? 75  GLU A CG   1  
ATOM 672   C CD   . GLU A 1 75  ? -18.957 6.726   11.840  1.00 1.09 ? 75  GLU A CD   1  
ATOM 673   O OE1  . GLU A 1 75  ? -18.143 7.655   11.668  1.00 1.63 ? 75  GLU A OE1  1  
ATOM 674   O OE2  . GLU A 1 75  ? -18.766 5.806   12.662  1.00 1.49 ? 75  GLU A OE2  1  
ATOM 675   H H    . GLU A 1 75  ? -18.954 4.558   11.248  1.00 0.51 ? 75  GLU A H    1  
ATOM 676   N N    . LEU A 1 76  ? -18.018 4.686   8.021   1.00 0.45 ? 76  LEU A N    1  
ATOM 677   C CA   . LEU A 1 76  ? -17.209 4.398   6.843   1.00 0.44 ? 76  LEU A CA   1  
ATOM 678   C C    . LEU A 1 76  ? -17.034 2.890   6.663   1.00 0.40 ? 76  LEU A C    1  
ATOM 679   O O    . LEU A 1 76  ? -16.940 2.395   5.540   1.00 0.39 ? 76  LEU A O    1  
ATOM 680   C CB   . LEU A 1 76  ? -15.841 5.077   6.960   1.00 0.48 ? 76  LEU A CB   1  
ATOM 681   C CG   . LEU A 1 76  ? -14.903 4.941   5.755   1.00 0.49 ? 76  LEU A CG   1  
ATOM 682   C CD1  . LEU A 1 76  ? -15.432 5.730   4.565   1.00 0.53 ? 76  LEU A CD1  1  
ATOM 683   C CD2  . LEU A 1 76  ? -13.497 5.392   6.118   1.00 0.53 ? 76  LEU A CD2  1  
ATOM 684   H H    . LEU A 1 76  ? -17.607 5.164   8.772   1.00 0.48 ? 76  LEU A H    1  
ATOM 685   N N    . GLN A 1 77  ? -17.006 2.167   7.775   1.00 0.39 ? 77  GLN A N    1  
ATOM 686   C CA   . GLN A 1 77  ? -16.845 0.718   7.748   1.00 0.38 ? 77  GLN A CA   1  
ATOM 687   C C    . GLN A 1 77  ? -17.988 0.060   6.977   1.00 0.37 ? 77  GLN A C    1  
ATOM 688   O O    . GLN A 1 77  ? -17.759 -0.783  6.107   1.00 0.38 ? 77  GLN A O    1  
ATOM 689   C CB   . GLN A 1 77  ? -16.776 0.159   9.169   1.00 0.40 ? 77  GLN A CB   1  
ATOM 690   C CG   . GLN A 1 77  ? -16.587 -1.345  9.238   1.00 0.41 ? 77  GLN A CG   1  
ATOM 691   C CD   . GLN A 1 77  ? -16.664 -1.871  10.655  1.00 0.47 ? 77  GLN A CD   1  
ATOM 692   O OE1  . GLN A 1 77  ? -17.738 -2.229  11.141  1.00 0.54 ? 77  GLN A OE1  1  
ATOM 693   N NE2  . GLN A 1 77  ? -15.529 -1.917  11.331  1.00 0.54 ? 77  GLN A NE2  1  
ATOM 694   H H    . GLN A 1 77  ? -17.096 2.619   8.641   1.00 0.41 ? 77  GLN A H    1  
ATOM 695   H HE21 . GLN A 1 77  ? -14.701 -1.613  10.880  1.00 0.57 ? 77  GLN A HE21 1  
ATOM 696   H HE22 . GLN A 1 77  ? -15.552 -2.253  12.249  1.00 0.61 ? 77  GLN A HE22 1  
ATOM 697   N N    . ARG A 1 78  ? -19.215 0.461   7.294   1.00 0.40 ? 78  ARG A N    1  
ATOM 698   C CA   . ARG A 1 78  ? -20.389 -0.086  6.628   1.00 0.42 ? 78  ARG A CA   1  
ATOM 699   C C    . ARG A 1 78  ? -20.428 0.349   5.168   1.00 0.40 ? 78  ARG A C    1  
ATOM 700   O O    . ARG A 1 78  ? -20.956 -0.361  4.314   1.00 0.42 ? 78  ARG A O    1  
ATOM 701   C CB   . ARG A 1 78  ? -21.675 0.336   7.341   1.00 0.49 ? 78  ARG A CB   1  
ATOM 702   C CG   . ARG A 1 78  ? -22.655 -0.807  7.557   1.00 0.97 ? 78  ARG A CG   1  
ATOM 703   C CD   . ARG A 1 78  ? -24.087 -0.305  7.636   1.00 1.17 ? 78  ARG A CD   1  
ATOM 704   N NE   . ARG A 1 78  ? -24.511 0.321   6.386   1.00 1.41 ? 78  ARG A NE   1  
ATOM 705   C CZ   . ARG A 1 78  ? -25.609 -0.018  5.715   1.00 1.68 ? 78  ARG A CZ   1  
ATOM 706   N NH1  . ARG A 1 78  ? -26.399 -0.982  6.171   1.00 1.85 ? 78  ARG A NH1  1  
ATOM 707   N NH2  . ARG A 1 78  ? -25.912 0.601   4.580   1.00 2.19 ? 78  ARG A NH2  1  
ATOM 708   H H    . ARG A 1 78  ? -19.334 1.140   7.997   1.00 0.41 ? 78  ARG A H    1  
ATOM 709   H HE   . ARG A 1 78  ? -23.939 1.037   6.025   1.00 1.72 ? 78  ARG A HE   1  
ATOM 710   H HH11 . ARG A 1 78  ? -26.172 -1.461  7.023   1.00 1.82 ? 78  ARG A HH11 1  
ATOM 711   H HH12 . ARG A 1 78  ? -27.226 -1.237  5.664   1.00 2.25 ? 78  ARG A HH12 1  
ATOM 712   H HH21 . ARG A 1 78  ? -25.311 1.324   4.223   1.00 2.44 ? 78  ARG A HH21 1  
ATOM 713   H HH22 . ARG A 1 78  ? -26.740 0.351   4.074   1.00 2.49 ? 78  ARG A HH22 1  
ATOM 714   N N    . MET A 1 79  ? -19.859 1.518   4.891   1.00 0.41 ? 79  MET A N    1  
ATOM 715   C CA   . MET A 1 79  ? -19.812 2.049   3.532   1.00 0.43 ? 79  MET A CA   1  
ATOM 716   C C    . MET A 1 79  ? -18.962 1.148   2.645   1.00 0.40 ? 79  MET A C    1  
ATOM 717   O O    . MET A 1 79  ? -19.289 0.915   1.480   1.00 0.41 ? 79  MET A O    1  
ATOM 718   C CB   . MET A 1 79  ? -19.252 3.472   3.523   1.00 0.50 ? 79  MET A CB   1  
ATOM 719   C CG   . MET A 1 79  ? -20.210 4.521   4.065   1.00 0.67 ? 79  MET A CG   1  
ATOM 720   S SD   . MET A 1 79  ? -19.391 6.079   4.468   1.00 0.96 ? 79  MET A SD   1  
ATOM 721   C CE   . MET A 1 79  ? -18.768 6.563   2.858   1.00 1.28 ? 79  MET A CE   1  
ATOM 722   H H    . MET A 1 79  ? -19.461 2.038   5.622   1.00 0.42 ? 79  MET A H    1  
ATOM 723   N N    . ILE A 1 80  ? -17.872 0.635   3.208   1.00 0.39 ? 80  ILE A N    1  
ATOM 724   C CA   . ILE A 1 80  ? -16.982 -0.258  2.481   1.00 0.40 ? 80  ILE A CA   1  
ATOM 725   C C    . ILE A 1 80  ? -17.679 -1.595  2.247   1.00 0.39 ? 80  ILE A C    1  
ATOM 726   O O    . ILE A 1 80  ? -17.514 -2.227  1.203   1.00 0.44 ? 80  ILE A O    1  
ATOM 727   C CB   . ILE A 1 80  ? -15.665 -0.497  3.251   1.00 0.43 ? 80  ILE A CB   1  
ATOM 728   C CG1  . ILE A 1 80  ? -14.961 0.831   3.563   1.00 0.46 ? 80  ILE A CG1  1  
ATOM 729   C CG2  . ILE A 1 80  ? -14.742 -1.422  2.472   1.00 0.47 ? 80  ILE A CG2  1  
ATOM 730   C CD1  . ILE A 1 80  ? -14.594 1.643   2.338   1.00 0.49 ? 80  ILE A CD1  1  
ATOM 731   H H    . ILE A 1 80  ? -17.660 0.870   4.138   1.00 0.40 ? 80  ILE A H    1  
ATOM 732   N N    . ALA A 1 81  ? -18.488 -2.003  3.218   1.00 0.39 ? 81  ALA A N    1  
ATOM 733   C CA   . ALA A 1 81  ? -19.228 -3.257  3.134   1.00 0.44 ? 81  ALA A CA   1  
ATOM 734   C C    . ALA A 1 81  ? -20.374 -3.149  2.128   1.00 0.46 ? 81  ALA A C    1  
ATOM 735   O O    . ALA A 1 81  ? -21.069 -4.128  1.850   1.00 0.56 ? 81  ALA A O    1  
ATOM 736   C CB   . ALA A 1 81  ? -19.755 -3.657  4.503   1.00 0.48 ? 81  ALA A CB   1  
ATOM 737   H H    . ALA A 1 81  ? -18.591 -1.442  4.017   1.00 0.40 ? 81  ALA A H    1  
ATOM 738   N N    . ALA A 1 82  ? -20.573 -1.951  1.596   1.00 0.43 ? 82  ALA A N    1  
ATOM 739   C CA   . ALA A 1 82  ? -21.619 -1.708  0.615   1.00 0.48 ? 82  ALA A CA   1  
ATOM 740   C C    . ALA A 1 82  ? -21.013 -1.515  -0.771  1.00 0.45 ? 82  ALA A C    1  
ATOM 741   O O    . ALA A 1 82  ? -21.632 -0.924  -1.662  1.00 0.49 ? 82  ALA A O    1  
ATOM 742   C CB   . ALA A 1 82  ? -22.440 -0.491  1.012   1.00 0.55 ? 82  ALA A CB   1  
ATOM 743   H H    . ALA A 1 82  ? -20.000 -1.205  1.876   1.00 0.44 ? 82  ALA A H    1  
ATOM 744   N N    . VAL A 1 83  ? -19.789 -1.999  -0.944  1.00 0.43 ? 83  VAL A N    1  
ATOM 745   C CA   . VAL A 1 83  ? -19.095 -1.890  -2.220  1.00 0.44 ? 83  VAL A CA   1  
ATOM 746   C C    . VAL A 1 83  ? -19.517 -3.029  -3.148  1.00 0.42 ? 83  VAL A C    1  
ATOM 747   O O    . VAL A 1 83  ? -20.082 -4.029  -2.698  1.00 0.52 ? 83  VAL A O    1  
ATOM 748   C CB   . VAL A 1 83  ? -17.556 -1.888  -2.034  1.00 0.51 ? 83  VAL A CB   1  
ATOM 749   C CG1  . VAL A 1 83  ? -17.007 -3.295  -1.834  1.00 0.54 ? 83  VAL A CG1  1  
ATOM 750   C CG2  . VAL A 1 83  ? -16.857 -1.177  -3.184  1.00 0.58 ? 83  VAL A CG2  1  
ATOM 751   H H    . VAL A 1 83  ? -19.339 -2.442  -0.191  1.00 0.45 ? 83  VAL A H    1  
ATOM 752   N N    . ASP A 1 84  ? -19.263 -2.874  -4.437  1.00 0.49 ? 84  ASP A N    1  
ATOM 753   C CA   . ASP A 1 84  ? -19.626 -3.897  -5.405  1.00 0.54 ? 84  ASP A CA   1  
ATOM 754   C C    . ASP A 1 84  ? -18.399 -4.658  -5.872  1.00 0.45 ? 84  ASP A C    1  
ATOM 755   O O    . ASP A 1 84  ? -17.646 -4.183  -6.721  1.00 0.49 ? 84  ASP A O    1  
ATOM 756   C CB   . ASP A 1 84  ? -20.367 -3.287  -6.596  1.00 0.73 ? 84  ASP A CB   1  
ATOM 757   C CG   . ASP A 1 84  ? -21.764 -2.837  -6.229  1.00 0.86 ? 84  ASP A CG   1  
ATOM 758   O OD1  . ASP A 1 84  ? -22.646 -3.704  -6.059  1.00 1.14 ? 84  ASP A OD1  1  
ATOM 759   O OD2  . ASP A 1 84  ? -21.985 -1.616  -6.086  1.00 0.91 ? 84  ASP A OD2  1  
ATOM 760   H H    . ASP A 1 84  ? -18.817 -2.059  -4.747  1.00 0.60 ? 84  ASP A H    1  
ATOM 761   N N    . THR A 1 85  ? -18.198 -5.843  -5.306  1.00 0.46 ? 85  THR A N    1  
ATOM 762   C CA   . THR A 1 85  ? -17.053 -6.674  -5.656  1.00 0.48 ? 85  THR A CA   1  
ATOM 763   C C    . THR A 1 85  ? -17.324 -7.484  -6.923  1.00 0.48 ? 85  THR A C    1  
ATOM 764   O O    . THR A 1 85  ? -17.252 -8.714  -6.925  1.00 0.73 ? 85  THR A O    1  
ATOM 765   C CB   . THR A 1 85  ? -16.672 -7.614  -4.498  1.00 0.64 ? 85  THR A CB   1  
ATOM 766   O OG1  . THR A 1 85  ? -16.943 -6.953  -3.253  1.00 0.66 ? 85  THR A OG1  1  
ATOM 767   C CG2  . THR A 1 85  ? -15.189 -7.961  -4.561  1.00 0.77 ? 85  THR A CG2  1  
ATOM 768   H H    . THR A 1 85  ? -18.842 -6.173  -4.643  1.00 0.53 ? 85  THR A H    1  
ATOM 769   H HG1  . THR A 1 85  ? -17.261 -6.062  -3.430  1.00 0.70 ? 85  THR A HG1  1  
ATOM 770   N N    . ASP A 1 86  ? -17.649 -6.780  -7.994  1.00 0.40 ? 86  ASP A N    1  
ATOM 771   C CA   . ASP A 1 86  ? -17.923 -7.419  -9.272  1.00 0.44 ? 86  ASP A CA   1  
ATOM 772   C C    . ASP A 1 86  ? -16.675 -7.386  -10.141 1.00 0.41 ? 86  ASP A C    1  
ATOM 773   O O    . ASP A 1 86  ? -16.226 -8.416  -10.648 1.00 0.57 ? 86  ASP A O    1  
ATOM 774   C CB   . ASP A 1 86  ? -19.076 -6.707  -9.981  1.00 0.56 ? 86  ASP A CB   1  
ATOM 775   C CG   . ASP A 1 86  ? -19.535 -7.432  -11.230 1.00 0.67 ? 86  ASP A CG   1  
ATOM 776   O OD1  . ASP A 1 86  ? -18.841 -7.352  -12.264 1.00 0.86 ? 86  ASP A OD1  1  
ATOM 777   O OD2  . ASP A 1 86  ? -20.604 -8.074  -11.189 1.00 0.90 ? 86  ASP A OD2  1  
ATOM 778   H H    . ASP A 1 86  ? -17.708 -5.804  -7.923  1.00 0.49 ? 86  ASP A H    1  
ATOM 779   N N    . SER A 1 87  ? -16.111 -6.195  -10.288 1.00 0.38 ? 87  SER A N    1  
ATOM 780   C CA   . SER A 1 87  ? -14.910 -5.999  -11.086 1.00 0.45 ? 87  SER A CA   1  
ATOM 781   C C    . SER A 1 87  ? -13.766 -5.474  -10.220 1.00 0.36 ? 87  SER A C    1  
ATOM 782   O O    . SER A 1 87  ? -13.628 -4.267  -10.032 1.00 0.44 ? 87  SER A O    1  
ATOM 783   C CB   . SER A 1 87  ? -15.203 -5.015  -12.215 1.00 0.69 ? 87  SER A CB   1  
ATOM 784   O OG   . SER A 1 87  ? -15.853 -5.656  -13.300 1.00 1.31 ? 87  SER A OG   1  
ATOM 785   H H    . SER A 1 87  ? -16.516 -5.422  -9.850  1.00 0.45 ? 87  SER A H    1  
ATOM 786   H HG   . SER A 1 87  ? -15.368 -5.453  -14.120 1.00 1.60 ? 87  SER A HG   1  
ATOM 787   N N    . PRO A 1 88  ? -12.925 -6.376  -9.687  1.00 0.46 ? 88  PRO A N    1  
ATOM 788   C CA   . PRO A 1 88  ? -11.800 -6.005  -8.818  1.00 0.52 ? 88  PRO A CA   1  
ATOM 789   C C    . PRO A 1 88  ? -10.822 -5.026  -9.468  1.00 0.42 ? 88  PRO A C    1  
ATOM 790   O O    . PRO A 1 88  ? -10.459 -4.012  -8.867  1.00 0.37 ? 88  PRO A O    1  
ATOM 791   C CB   . PRO A 1 88  ? -11.108 -7.345  -8.529  1.00 0.74 ? 88  PRO A CB   1  
ATOM 792   C CG   . PRO A 1 88  ? -12.162 -8.369  -8.766  1.00 0.89 ? 88  PRO A CG   1  
ATOM 793   C CD   . PRO A 1 88  ? -13.006 -7.835  -9.886  1.00 0.72 ? 88  PRO A CD   1  
ATOM 794   N N    . ARG A 1 89  ? -10.408 -5.317  -10.698 1.00 0.44 ? 89  ARG A N    1  
ATOM 795   C CA   . ARG A 1 89  ? -9.460  -4.458  -11.404 1.00 0.41 ? 89  ARG A CA   1  
ATOM 796   C C    . ARG A 1 89  ? -10.067 -3.095  -11.719 1.00 0.37 ? 89  ARG A C    1  
ATOM 797   O O    . ARG A 1 89  ? -9.415  -2.067  -11.543 1.00 0.36 ? 89  ARG A O    1  
ATOM 798   C CB   . ARG A 1 89  ? -8.941  -5.135  -12.679 1.00 0.55 ? 89  ARG A CB   1  
ATOM 799   C CG   . ARG A 1 89  ? -7.908  -4.325  -13.463 1.00 0.64 ? 89  ARG A CG   1  
ATOM 800   C CD   . ARG A 1 89  ? -6.692  -3.975  -12.614 1.00 0.91 ? 89  ARG A CD   1  
ATOM 801   N NE   . ARG A 1 89  ? -5.451  -4.012  -13.390 1.00 1.11 ? 89  ARG A NE   1  
ATOM 802   C CZ   . ARG A 1 89  ? -4.363  -3.283  -13.116 1.00 1.40 ? 89  ARG A CZ   1  
ATOM 803   N NH1  . ARG A 1 89  ? -4.362  -2.427  -12.101 1.00 1.83 ? 89  ARG A NH1  1  
ATOM 804   N NH2  . ARG A 1 89  ? -3.270  -3.417  -13.860 1.00 1.64 ? 89  ARG A NH2  1  
ATOM 805   H H    . ARG A 1 89  ? -10.752 -6.124  -11.141 1.00 0.53 ? 89  ARG A H    1  
ATOM 806   H HE   . ARG A 1 89  ? -5.423  -4.632  -14.157 1.00 1.35 ? 89  ARG A HE   1  
ATOM 807   H HH11 . ARG A 1 89  ? -5.178  -2.319  -11.535 1.00 1.95 ? 89  ARG A HH11 1  
ATOM 808   H HH12 . ARG A 1 89  ? -3.539  -1.891  -11.898 1.00 2.22 ? 89  ARG A HH12 1  
ATOM 809   H HH21 . ARG A 1 89  ? -3.257  -4.063  -14.626 1.00 1.80 ? 89  ARG A HH21 1  
ATOM 810   H HH22 . ARG A 1 89  ? -2.441  -2.867  -13.657 1.00 1.87 ? 89  ARG A HH22 1  
ATOM 811   N N    . GLU A 1 90  ? -11.316 -3.093  -12.170 1.00 0.38 ? 90  GLU A N    1  
ATOM 812   C CA   . GLU A 1 90  ? -12.010 -1.853  -12.510 1.00 0.38 ? 90  GLU A CA   1  
ATOM 813   C C    . GLU A 1 90  ? -12.183 -0.951  -11.289 1.00 0.36 ? 90  GLU A C    1  
ATOM 814   O O    . GLU A 1 90  ? -11.963 0.259   -11.368 1.00 0.38 ? 90  GLU A O    1  
ATOM 815   C CB   . GLU A 1 90  ? -13.362 -2.132  -13.180 1.00 0.41 ? 90  GLU A CB   1  
ATOM 816   C CG   . GLU A 1 90  ? -13.262 -2.639  -14.615 1.00 0.55 ? 90  GLU A CG   1  
ATOM 817   C CD   . GLU A 1 90  ? -12.990 -4.128  -14.706 1.00 0.76 ? 90  GLU A CD   1  
ATOM 818   O OE1  . GLU A 1 90  ? -11.830 -4.543  -14.507 1.00 1.10 ? 90  GLU A OE1  1  
ATOM 819   O OE2  . GLU A 1 90  ? -13.936 -4.895  -14.972 1.00 1.46 ? 90  GLU A OE2  1  
ATOM 820   H H    . GLU A 1 90  ? -11.777 -3.948  -12.294 1.00 0.42 ? 90  GLU A H    1  
ATOM 821   N N    . VAL A 1 91  ? -12.564 -1.540  -10.158 1.00 0.34 ? 91  VAL A N    1  
ATOM 822   C CA   . VAL A 1 91  ? -12.745 -0.775  -8.927  1.00 0.36 ? 91  VAL A CA   1  
ATOM 823   C C    . VAL A 1 91  ? -11.429 -0.116  -8.525  1.00 0.32 ? 91  VAL A C    1  
ATOM 824   O O    . VAL A 1 91  ? -11.383 1.083   -8.228  1.00 0.34 ? 91  VAL A O    1  
ATOM 825   C CB   . VAL A 1 91  ? -13.257 -1.658  -7.764  1.00 0.38 ? 91  VAL A CB   1  
ATOM 826   C CG1  . VAL A 1 91  ? -13.262 -0.884  -6.453  1.00 0.44 ? 91  VAL A CG1  1  
ATOM 827   C CG2  . VAL A 1 91  ? -14.653 -2.179  -8.066  1.00 0.45 ? 91  VAL A CG2  1  
ATOM 828   H H    . VAL A 1 91  ? -12.733 -2.508  -10.151 1.00 0.34 ? 91  VAL A H    1  
ATOM 829   N N    . PHE A 1 92  ? -10.360 -0.907  -8.549  1.00 0.30 ? 92  PHE A N    1  
ATOM 830   C CA   . PHE A 1 92  ? -9.035  -0.424  -8.189  1.00 0.30 ? 92  PHE A CA   1  
ATOM 831   C C    . PHE A 1 92  ? -8.548  0.636   -9.174  1.00 0.29 ? 92  PHE A C    1  
ATOM 832   O O    . PHE A 1 92  ? -7.989  1.656   -8.772  1.00 0.29 ? 92  PHE A O    1  
ATOM 833   C CB   . PHE A 1 92  ? -8.042  -1.589  -8.128  1.00 0.33 ? 92  PHE A CB   1  
ATOM 834   C CG   . PHE A 1 92  ? -6.722  -1.235  -7.503  1.00 0.37 ? 92  PHE A CG   1  
ATOM 835   C CD1  . PHE A 1 92  ? -6.584  -1.190  -6.125  1.00 0.45 ? 92  PHE A CD1  1  
ATOM 836   C CD2  . PHE A 1 92  ? -5.618  -0.948  -8.291  1.00 0.46 ? 92  PHE A CD2  1  
ATOM 837   C CE1  . PHE A 1 92  ? -5.375  -0.865  -5.541  1.00 0.53 ? 92  PHE A CE1  1  
ATOM 838   C CE2  . PHE A 1 92  ? -4.406  -0.622  -7.716  1.00 0.54 ? 92  PHE A CE2  1  
ATOM 839   C CZ   . PHE A 1 92  ? -4.284  -0.581  -6.339  1.00 0.55 ? 92  PHE A CZ   1  
ATOM 840   H H    . PHE A 1 92  ? -10.471 -1.847  -8.814  1.00 0.30 ? 92  PHE A H    1  
ATOM 841   N N    . PHE A 1 93  ? -8.774  0.397   -10.462 1.00 0.31 ? 93  PHE A N    1  
ATOM 842   C CA   . PHE A 1 93  ? -8.354  1.334   -11.499 1.00 0.34 ? 93  PHE A CA   1  
ATOM 843   C C    . PHE A 1 93  ? -9.085  2.664   -11.363 1.00 0.34 ? 93  PHE A C    1  
ATOM 844   O O    . PHE A 1 93  ? -8.490  3.729   -11.531 1.00 0.35 ? 93  PHE A O    1  
ATOM 845   C CB   . PHE A 1 93  ? -8.579  0.745   -12.895 1.00 0.42 ? 93  PHE A CB   1  
ATOM 846   C CG   . PHE A 1 93  ? -7.388  0.873   -13.803 1.00 0.60 ? 93  PHE A CG   1  
ATOM 847   C CD1  . PHE A 1 93  ? -7.036  2.100   -14.337 1.00 0.78 ? 93  PHE A CD1  1  
ATOM 848   C CD2  . PHE A 1 93  ? -6.616  -0.235  -14.115 1.00 0.82 ? 93  PHE A CD2  1  
ATOM 849   C CE1  . PHE A 1 93  ? -5.938  2.223   -15.169 1.00 1.02 ? 93  PHE A CE1  1  
ATOM 850   C CE2  . PHE A 1 93  ? -5.516  -0.121  -14.947 1.00 1.06 ? 93  PHE A CE2  1  
ATOM 851   C CZ   . PHE A 1 93  ? -5.176  1.111   -15.474 1.00 1.12 ? 93  PHE A CZ   1  
ATOM 852   H H    . PHE A 1 93  ? -9.233  -0.434  -10.723 1.00 0.32 ? 93  PHE A H    1  
ATOM 853   N N    . ARG A 1 94  ? -10.375 2.593   -11.047 1.00 0.35 ? 94  ARG A N    1  
ATOM 854   C CA   . ARG A 1 94  ? -11.190 3.786   -10.884 1.00 0.37 ? 94  ARG A CA   1  
ATOM 855   C C    . ARG A 1 94  ? -10.653 4.670   -9.770  1.00 0.33 ? 94  ARG A C    1  
ATOM 856   O O    . ARG A 1 94  ? -10.353 5.836   -9.996  1.00 0.34 ? 94  ARG A O    1  
ATOM 857   C CB   . ARG A 1 94  ? -12.645 3.420   -10.602 1.00 0.43 ? 94  ARG A CB   1  
ATOM 858   C CG   . ARG A 1 94  ? -13.588 3.630   -11.778 1.00 0.55 ? 94  ARG A CG   1  
ATOM 859   C CD   . ARG A 1 94  ? -13.733 5.105   -12.145 1.00 0.75 ? 94  ARG A CD   1  
ATOM 860   N NE   . ARG A 1 94  ? -14.012 5.959   -10.984 1.00 0.81 ? 94  ARG A NE   1  
ATOM 861   C CZ   . ARG A 1 94  ? -15.169 5.981   -10.316 1.00 1.17 ? 94  ARG A CZ   1  
ATOM 862   N NH1  . ARG A 1 94  ? -16.189 5.224   -10.705 1.00 1.43 ? 94  ARG A NH1  1  
ATOM 863   N NH2  . ARG A 1 94  ? -15.302 6.777   -9.266  1.00 1.33 ? 94  ARG A NH2  1  
ATOM 864   H H    . ARG A 1 94  ? -10.788 1.709   -10.922 1.00 0.36 ? 94  ARG A H    1  
ATOM 865   H HE   . ARG A 1 94  ? -13.283 6.564   -10.682 1.00 0.69 ? 94  ARG A HE   1  
ATOM 866   H HH11 . ARG A 1 94  ? -16.098 4.628   -11.506 1.00 1.33 ? 94  ARG A HH11 1  
ATOM 867   H HH12 . ARG A 1 94  ? -17.056 5.247   -10.201 1.00 1.75 ? 94  ARG A HH12 1  
ATOM 868   H HH21 . ARG A 1 94  ? -14.530 7.370   -8.972  1.00 1.16 ? 94  ARG A HH21 1  
ATOM 869   H HH22 . ARG A 1 94  ? -16.158 6.795   -8.754  1.00 1.66 ? 94  ARG A HH22 1  
ATOM 870   N N    . VAL A 1 95  ? -10.504 4.107   -8.573  1.00 0.31 ? 95  VAL A N    1  
ATOM 871   C CA   . VAL A 1 95  ? -10.006 4.874   -7.432  1.00 0.30 ? 95  VAL A CA   1  
ATOM 872   C C    . VAL A 1 95  ? -8.565  5.339   -7.639  1.00 0.28 ? 95  VAL A C    1  
ATOM 873   O O    . VAL A 1 95  ? -8.126  6.327   -7.047  1.00 0.30 ? 95  VAL A O    1  
ATOM 874   C CB   . VAL A 1 95  ? -10.144 4.116   -6.093  1.00 0.31 ? 95  VAL A CB   1  
ATOM 875   C CG1  . VAL A 1 95  ? -11.607 3.834   -5.793  1.00 0.37 ? 95  VAL A CG1  1  
ATOM 876   C CG2  . VAL A 1 95  ? -9.337  2.827   -6.099  1.00 0.29 ? 95  VAL A CG2  1  
ATOM 877   H H    . VAL A 1 95  ? -10.730 3.159   -8.456  1.00 0.32 ? 95  VAL A H    1  
ATOM 878   N N    . ALA A 1 96  ? -7.830  4.623   -8.480  1.00 0.27 ? 96  ALA A N    1  
ATOM 879   C CA   . ALA A 1 96  ? -6.453  4.978   -8.777  1.00 0.29 ? 96  ALA A CA   1  
ATOM 880   C C    . ALA A 1 96  ? -6.411  6.231   -9.643  1.00 0.30 ? 96  ALA A C    1  
ATOM 881   O O    . ALA A 1 96  ? -5.629  7.148   -9.387  1.00 0.32 ? 96  ALA A O    1  
ATOM 882   C CB   . ALA A 1 96  ? -5.743  3.827   -9.473  1.00 0.33 ? 96  ALA A CB   1  
ATOM 883   H H    . ALA A 1 96  ? -8.223  3.832   -8.906  1.00 0.28 ? 96  ALA A H    1  
ATOM 884   N N    . ALA A 1 97  ? -7.270  6.268   -10.652 1.00 0.31 ? 97  ALA A N    1  
ATOM 885   C CA   . ALA A 1 97  ? -7.340  7.404   -11.561 1.00 0.34 ? 97  ALA A CA   1  
ATOM 886   C C    . ALA A 1 97  ? -8.130  8.558   -10.951 1.00 0.34 ? 97  ALA A C    1  
ATOM 887   O O    . ALA A 1 97  ? -7.816  9.721   -11.189 1.00 0.38 ? 97  ALA A O    1  
ATOM 888   C CB   . ALA A 1 97  ? -7.943  6.986   -12.895 1.00 0.38 ? 97  ALA A CB   1  
ATOM 889   H H    . ALA A 1 97  ? -7.871  5.505   -10.795 1.00 0.30 ? 97  ALA A H    1  
ATOM 890   N N    . ASP A 1 98  ? -9.141  8.224   -10.153 1.00 0.33 ? 98  ASP A N    1  
ATOM 891   C CA   . ASP A 1 98  ? -9.992  9.221   -9.497  1.00 0.37 ? 98  ASP A CA   1  
ATOM 892   C C    . ASP A 1 98  ? -9.167  10.259  -8.749  1.00 0.35 ? 98  ASP A C    1  
ATOM 893   O O    . ASP A 1 98  ? -9.311  11.465  -8.971  1.00 0.37 ? 98  ASP A O    1  
ATOM 894   C CB   . ASP A 1 98  ? -10.965 8.546   -8.523  1.00 0.45 ? 98  ASP A CB   1  
ATOM 895   C CG   . ASP A 1 98  ? -12.337 8.298   -9.119  1.00 0.57 ? 98  ASP A CG   1  
ATOM 896   O OD1  . ASP A 1 98  ? -12.437 8.106   -10.349 1.00 0.82 ? 98  ASP A OD1  1  
ATOM 897   O OD2  . ASP A 1 98  ? -13.326 8.281   -8.359  1.00 1.16 ? 98  ASP A OD2  1  
ATOM 898   H H    . ASP A 1 98  ? -9.339  7.271   -10.014 1.00 0.32 ? 98  ASP A H    1  
ATOM 899   N N    . MET A 1 99  ? -8.281  9.784   -7.883  1.00 0.35 ? 99  MET A N    1  
ATOM 900   C CA   . MET A 1 99  ? -7.431  10.668  -7.088  1.00 0.38 ? 99  MET A CA   1  
ATOM 901   C C    . MET A 1 99  ? -6.196  11.115  -7.875  1.00 0.39 ? 99  MET A C    1  
ATOM 902   O O    . MET A 1 99  ? -5.232  11.624  -7.303  1.00 0.48 ? 99  MET A O    1  
ATOM 903   C CB   . MET A 1 99  ? -6.988  9.974   -5.797  1.00 0.39 ? 99  MET A CB   1  
ATOM 904   C CG   . MET A 1 99  ? -8.108  9.328   -5.002  1.00 0.38 ? 99  MET A CG   1  
ATOM 905   S SD   . MET A 1 99  ? -7.487  8.185   -3.753  1.00 0.40 ? 99  MET A SD   1  
ATOM 906   C CE   . MET A 1 99  ? -9.024  7.511   -3.123  1.00 0.42 ? 99  MET A CE   1  
ATOM 907   H H    . MET A 1 99  ? -8.200  8.811   -7.774  1.00 0.37 ? 99  MET A H    1  
ATOM 908   N N    . PHE A 1 100 ? -6.226  10.918  -9.186  1.00 0.36 ? 100 PHE A N    1  
ATOM 909   C CA   . PHE A 1 100 ? -5.110  11.296  -10.047 1.00 0.41 ? 100 PHE A CA   1  
ATOM 910   C C    . PHE A 1 100 ? -5.526  12.386  -11.036 1.00 0.44 ? 100 PHE A C    1  
ATOM 911   O O    . PHE A 1 100 ? -4.692  13.166  -11.493 1.00 0.54 ? 100 PHE A O    1  
ATOM 912   C CB   . PHE A 1 100 ? -4.582  10.064  -10.797 1.00 0.46 ? 100 PHE A CB   1  
ATOM 913   C CG   . PHE A 1 100 ? -3.215  10.239  -11.401 1.00 0.62 ? 100 PHE A CG   1  
ATOM 914   C CD1  . PHE A 1 100 ? -2.082  10.188  -10.606 1.00 0.81 ? 100 PHE A CD1  1  
ATOM 915   C CD2  . PHE A 1 100 ? -3.065  10.450  -12.763 1.00 0.80 ? 100 PHE A CD2  1  
ATOM 916   C CE1  . PHE A 1 100 ? -0.822  10.345  -11.156 1.00 0.99 ? 100 PHE A CE1  1  
ATOM 917   C CE2  . PHE A 1 100 ? -1.808  10.608  -13.320 1.00 1.00 ? 100 PHE A CE2  1  
ATOM 918   C CZ   . PHE A 1 100 ? -0.685  10.555  -12.516 1.00 1.03 ? 100 PHE A CZ   1  
ATOM 919   H H    . PHE A 1 100 ? -7.020  10.504  -9.587  1.00 0.35 ? 100 PHE A H    1  
ATOM 920   N N    . SER A 1 101 ? -6.821  12.438  -11.349 1.00 0.53 ? 101 SER A N    1  
ATOM 921   C CA   . SER A 1 101 ? -7.367  13.419  -12.286 1.00 0.58 ? 101 SER A CA   1  
ATOM 922   C C    . SER A 1 101 ? -6.967  14.851  -11.933 1.00 0.42 ? 101 SER A C    1  
ATOM 923   O O    . SER A 1 101 ? -6.560  15.624  -12.801 1.00 0.48 ? 101 SER A O    1  
ATOM 924   C CB   . SER A 1 101 ? -8.891  13.297  -12.322 1.00 0.80 ? 101 SER A CB   1  
ATOM 925   O OG   . SER A 1 101 ? -9.294  11.981  -11.973 1.00 1.20 ? 101 SER A OG   1  
ATOM 926   H H    . SER A 1 101 ? -7.431  11.777  -10.954 1.00 0.65 ? 101 SER A H    1  
ATOM 927   H HG   . SER A 1 101 ? -9.904  12.018  -11.229 1.00 1.33 ? 101 SER A HG   1  
ATOM 928   N N    . ASP A 1 102 ? -7.071  15.193  -10.656 1.00 0.45 ? 102 ASP A N    1  
ATOM 929   C CA   . ASP A 1 102 ? -6.730  16.536  -10.193 1.00 0.53 ? 102 ASP A CA   1  
ATOM 930   C C    . ASP A 1 102 ? -5.218  16.749  -10.135 1.00 0.45 ? 102 ASP A C    1  
ATOM 931   O O    . ASP A 1 102 ? -4.735  17.876  -10.241 1.00 0.63 ? 102 ASP A O    1  
ATOM 932   C CB   . ASP A 1 102 ? -7.352  16.796  -8.818  1.00 0.78 ? 102 ASP A CB   1  
ATOM 933   C CG   . ASP A 1 102 ? -7.150  18.219  -8.339  1.00 1.07 ? 102 ASP A CG   1  
ATOM 934   O OD1  . ASP A 1 102 ? -7.781  19.134  -8.905  1.00 1.62 ? 102 ASP A OD1  1  
ATOM 935   O OD2  . ASP A 1 102 ? -6.384  18.427  -7.377  1.00 1.64 ? 102 ASP A OD2  1  
ATOM 936   H H    . ASP A 1 102 ? -7.389  14.529  -10.009 1.00 0.56 ? 102 ASP A H    1  
ATOM 937   N N    . GLY A 1 103 ? -4.476  15.658  -9.985  1.00 0.40 ? 103 GLY A N    1  
ATOM 938   C CA   . GLY A 1 103 ? -3.029  15.746  -9.906  1.00 0.53 ? 103 GLY A CA   1  
ATOM 939   C C    . GLY A 1 103 ? -2.569  16.337  -8.587  1.00 0.53 ? 103 GLY A C    1  
ATOM 940   O O    . GLY A 1 103 ? -1.483  16.911  -8.498  1.00 0.70 ? 103 GLY A O    1  
ATOM 941   H H    . GLY A 1 103 ? -4.912  14.781  -9.951  1.00 0.46 ? 103 GLY A H    1  
ATOM 942   N N    . ASN A 1 104 ? -3.403  16.197  -7.566  1.00 0.44 ? 104 ASN A N    1  
ATOM 943   C CA   . ASN A 1 104 ? -3.099  16.721  -6.240  1.00 0.47 ? 104 ASN A CA   1  
ATOM 944   C C    . ASN A 1 104 ? -2.093  15.836  -5.512  1.00 0.43 ? 104 ASN A C    1  
ATOM 945   O O    . ASN A 1 104 ? -2.412  14.720  -5.099  1.00 0.45 ? 104 ASN A O    1  
ATOM 946   C CB   . ASN A 1 104 ? -4.381  16.855  -5.412  1.00 0.55 ? 104 ASN A CB   1  
ATOM 947   C CG   . ASN A 1 104 ? -4.230  17.764  -4.204  1.00 0.61 ? 104 ASN A CG   1  
ATOM 948   O OD1  . ASN A 1 104 ? -3.153  17.878  -3.621  1.00 0.69 ? 104 ASN A OD1  1  
ATOM 949   N ND2  . ASN A 1 104 ? -5.315  18.423  -3.822  1.00 0.91 ? 104 ASN A ND2  1  
ATOM 950   H H    . ASN A 1 104 ? -4.251  15.732  -7.710  1.00 0.48 ? 104 ASN A H    1  
ATOM 951   H HD21 . ASN A 1 104 ? -6.145  18.289  -4.332  1.00 1.15 ? 104 ASN A HD21 1  
ATOM 952   H HD22 . ASN A 1 104 ? -5.248  19.012  -3.042  1.00 0.98 ? 104 ASN A HD22 1  
ATOM 953   N N    . PHE A 1 105 ? -0.883  16.344  -5.356  1.00 0.45 ? 105 PHE A N    1  
ATOM 954   C CA   . PHE A 1 105 ? 0.175   15.616  -4.673  1.00 0.48 ? 105 PHE A CA   1  
ATOM 955   C C    . PHE A 1 105 ? 0.115   15.893  -3.173  1.00 0.50 ? 105 PHE A C    1  
ATOM 956   O O    . PHE A 1 105 ? 1.086   16.336  -2.564  1.00 0.60 ? 105 PHE A O    1  
ATOM 957   C CB   . PHE A 1 105 ? 1.540   16.012  -5.238  1.00 0.60 ? 105 PHE A CB   1  
ATOM 958   C CG   . PHE A 1 105 ? 1.732   15.625  -6.675  1.00 0.66 ? 105 PHE A CG   1  
ATOM 959   C CD1  . PHE A 1 105 ? 1.818   14.294  -7.040  1.00 0.66 ? 105 PHE A CD1  1  
ATOM 960   C CD2  . PHE A 1 105 ? 1.826   16.593  -7.663  1.00 0.81 ? 105 PHE A CD2  1  
ATOM 961   C CE1  . PHE A 1 105 ? 1.994   13.931  -8.362  1.00 0.75 ? 105 PHE A CE1  1  
ATOM 962   C CE2  . PHE A 1 105 ? 2.001   16.238  -8.986  1.00 0.91 ? 105 PHE A CE2  1  
ATOM 963   C CZ   . PHE A 1 105 ? 2.086   14.905  -9.337  1.00 0.86 ? 105 PHE A CZ   1  
ATOM 964   H H    . PHE A 1 105 ? -0.697  17.242  -5.704  1.00 0.50 ? 105 PHE A H    1  
ATOM 965   N N    . ASN A 1 106 ? -1.044  15.614  -2.591  1.00 0.45 ? 106 ASN A N    1  
ATOM 966   C CA   . ASN A 1 106 ? -1.279  15.840  -1.168  1.00 0.48 ? 106 ASN A CA   1  
ATOM 967   C C    . ASN A 1 106 ? -0.768  14.692  -0.304  1.00 0.49 ? 106 ASN A C    1  
ATOM 968   O O    . ASN A 1 106 ? -0.877  14.744  0.922   1.00 0.52 ? 106 ASN A O    1  
ATOM 969   C CB   . ASN A 1 106 ? -2.773  16.071  -0.899  1.00 0.48 ? 106 ASN A CB   1  
ATOM 970   C CG   . ASN A 1 106 ? -3.668  14.954  -1.422  1.00 0.43 ? 106 ASN A CG   1  
ATOM 971   O OD1  . ASN A 1 106 ? -3.269  13.791  -1.496  1.00 0.44 ? 106 ASN A OD1  1  
ATOM 972   N ND2  . ASN A 1 106 ? -4.888  15.300  -1.794  1.00 0.55 ? 106 ASN A ND2  1  
ATOM 973   H H    . ASN A 1 106 ? -1.774  15.253  -3.142  1.00 0.42 ? 106 ASN A H    1  
ATOM 974   H HD21 . ASN A 1 106 ? -5.148  16.244  -1.712  1.00 0.69 ? 106 ASN A HD21 1  
ATOM 975   H HD22 . ASN A 1 106 ? -5.480  14.602  -2.134  1.00 0.55 ? 106 ASN A HD22 1  
ATOM 976   N N    . TRP A 1 107 ? -0.236  13.650  -0.952  1.00 0.46 ? 107 TRP A N    1  
ATOM 977   C CA   . TRP A 1 107 ? 0.294   12.462  -0.265  1.00 0.48 ? 107 TRP A CA   1  
ATOM 978   C C    . TRP A 1 107 ? -0.813  11.580  0.324   1.00 0.45 ? 107 TRP A C    1  
ATOM 979   O O    . TRP A 1 107 ? -0.725  10.349  0.287   1.00 0.45 ? 107 TRP A O    1  
ATOM 980   C CB   . TRP A 1 107 ? 1.341   12.820  0.799   1.00 0.54 ? 107 TRP A CB   1  
ATOM 981   C CG   . TRP A 1 107 ? 2.710   12.280  0.514   1.00 0.72 ? 107 TRP A CG   1  
ATOM 982   C CD1  . TRP A 1 107 ? 3.846   13.005  0.279   1.00 1.02 ? 107 TRP A CD1  1  
ATOM 983   C CD2  . TRP A 1 107 ? 3.093   10.899  0.436   1.00 0.84 ? 107 TRP A CD2  1  
ATOM 984   N NE1  . TRP A 1 107 ? 4.906   12.161  0.056   1.00 1.24 ? 107 TRP A NE1  1  
ATOM 985   C CE2  . TRP A 1 107 ? 4.471   10.866  0.146   1.00 1.15 ? 107 TRP A CE2  1  
ATOM 986   C CE3  . TRP A 1 107 ? 2.404   9.690   0.581   1.00 0.91 ? 107 TRP A CE3  1  
ATOM 987   C CZ2  . TRP A 1 107 ? 5.172   9.673   0.001   1.00 1.42 ? 107 TRP A CZ2  1  
ATOM 988   C CZ3  . TRP A 1 107 ? 3.103   8.508   0.435   1.00 1.24 ? 107 TRP A CZ3  1  
ATOM 989   C CH2  . TRP A 1 107 ? 4.473   8.508   0.149   1.00 1.46 ? 107 TRP A CH2  1  
ATOM 990   H H    . TRP A 1 107 ? -0.190  13.687  -1.930  1.00 0.45 ? 107 TRP A H    1  
ATOM 991   H HE1  . TRP A 1 107 ? 5.831   12.441  -0.136  1.00 1.49 ? 107 TRP A HE1  1  
ATOM 992   N N    . GLY A 1 108 ? -1.854  12.216  0.851   1.00 0.46 ? 108 GLY A N    1  
ATOM 993   C CA   . GLY A 1 108 ? -2.971  11.496  1.444   1.00 0.45 ? 108 GLY A CA   1  
ATOM 994   C C    . GLY A 1 108 ? -3.632  10.530  0.479   1.00 0.41 ? 108 GLY A C    1  
ATOM 995   O O    . GLY A 1 108 ? -4.163  9.499   0.893   1.00 0.41 ? 108 GLY A O    1  
ATOM 996   H H    . GLY A 1 108 ? -1.861  13.199  0.847   1.00 0.47 ? 108 GLY A H    1  
ATOM 997   N N    . ARG A 1 109 ? -3.586  10.849  -0.812  1.00 0.39 ? 109 ARG A N    1  
ATOM 998   C CA   . ARG A 1 109 ? -4.181  9.994   -1.835  1.00 0.36 ? 109 ARG A CA   1  
ATOM 999   C C    . ARG A 1 109 ? -3.488  8.631   -1.895  1.00 0.35 ? 109 ARG A C    1  
ATOM 1000  O O    . ARG A 1 109 ? -4.018  7.680   -2.469  1.00 0.35 ? 109 ARG A O    1  
ATOM 1001  C CB   . ARG A 1 109 ? -4.149  10.676  -3.209  1.00 0.36 ? 109 ARG A CB   1  
ATOM 1002  C CG   . ARG A 1 109 ? -2.838  10.518  -3.967  1.00 0.37 ? 109 ARG A CG   1  
ATOM 1003  C CD   . ARG A 1 109 ? -3.050  9.812   -5.301  1.00 0.36 ? 109 ARG A CD   1  
ATOM 1004  N NE   . ARG A 1 109 ? -3.827  8.578   -5.160  1.00 0.36 ? 109 ARG A NE   1  
ATOM 1005  C CZ   . ARG A 1 109 ? -4.367  7.911   -6.183  1.00 0.36 ? 109 ARG A CZ   1  
ATOM 1006  N NH1  . ARG A 1 109 ? -4.187  8.342   -7.427  1.00 0.35 ? 109 ARG A NH1  1  
ATOM 1007  N NH2  . ARG A 1 109 ? -5.090  6.822   -5.954  1.00 0.40 ? 109 ARG A NH2  1  
ATOM 1008  H H    . ARG A 1 109 ? -3.153  11.688  -1.081  1.00 0.39 ? 109 ARG A H    1  
ATOM 1009  H HE   . ARG A 1 109 ? -3.969  8.235   -4.243  1.00 0.38 ? 109 ARG A HE   1  
ATOM 1010  H HH11 . ARG A 1 109 ? -3.644  9.164   -7.603  1.00 0.35 ? 109 ARG A HH11 1  
ATOM 1011  H HH12 . ARG A 1 109 ? -4.606  7.847   -8.201  1.00 0.35 ? 109 ARG A HH12 1  
ATOM 1012  H HH21 . ARG A 1 109 ? -5.231  6.497   -5.015  1.00 0.43 ? 109 ARG A HH21 1  
ATOM 1013  H HH22 . ARG A 1 109 ? -5.506  6.324   -6.717  1.00 0.42 ? 109 ARG A HH22 1  
ATOM 1014  N N    . VAL A 1 110 ? -2.298  8.545   -1.312  1.00 0.37 ? 110 VAL A N    1  
ATOM 1015  C CA   . VAL A 1 110 ? -1.544  7.303   -1.299  1.00 0.38 ? 110 VAL A CA   1  
ATOM 1016  C C    . VAL A 1 110 ? -1.902  6.471   -0.071  1.00 0.38 ? 110 VAL A C    1  
ATOM 1017  O O    . VAL A 1 110 ? -2.208  5.284   -0.185  1.00 0.37 ? 110 VAL A O    1  
ATOM 1018  C CB   . VAL A 1 110 ? -0.021  7.554   -1.334  1.00 0.44 ? 110 VAL A CB   1  
ATOM 1019  C CG1  . VAL A 1 110 ? 0.740   6.240   -1.437  1.00 0.47 ? 110 VAL A CG1  1  
ATOM 1020  C CG2  . VAL A 1 110 ? 0.345   8.476   -2.487  1.00 0.46 ? 110 VAL A CG2  1  
ATOM 1021  H H    . VAL A 1 110 ? -1.921  9.338   -0.869  1.00 0.38 ? 110 VAL A H    1  
ATOM 1022  N N    . VAL A 1 111 ? -1.883  7.103   1.100   1.00 0.40 ? 111 VAL A N    1  
ATOM 1023  C CA   . VAL A 1 111 ? -2.213  6.410   2.343   1.00 0.41 ? 111 VAL A CA   1  
ATOM 1024  C C    . VAL A 1 111 ? -3.670  5.939   2.336   1.00 0.39 ? 111 VAL A C    1  
ATOM 1025  O O    . VAL A 1 111 ? -3.994  4.875   2.868   1.00 0.39 ? 111 VAL A O    1  
ATOM 1026  C CB   . VAL A 1 111 ? -1.899  7.257   3.604   1.00 0.46 ? 111 VAL A CB   1  
ATOM 1027  C CG1  . VAL A 1 111 ? -2.765  8.507   3.681   1.00 0.45 ? 111 VAL A CG1  1  
ATOM 1028  C CG2  . VAL A 1 111 ? -2.022  6.426   4.874   1.00 0.50 ? 111 VAL A CG2  1  
ATOM 1029  H H    . VAL A 1 111 ? -1.638  8.052   1.128   1.00 0.41 ? 111 VAL A H    1  
ATOM 1030  N N    . ALA A 1 112 ? -4.542  6.723   1.706   1.00 0.37 ? 112 ALA A N    1  
ATOM 1031  C CA   . ALA A 1 112 ? -5.952  6.372   1.608   1.00 0.36 ? 112 ALA A CA   1  
ATOM 1032  C C    . ALA A 1 112 ? -6.114  5.138   0.732   1.00 0.34 ? 112 ALA A C    1  
ATOM 1033  O O    . ALA A 1 112 ? -6.940  4.265   1.004   1.00 0.34 ? 112 ALA A O    1  
ATOM 1034  C CB   . ALA A 1 112 ? -6.752  7.534   1.040   1.00 0.36 ? 112 ALA A CB   1  
ATOM 1035  H H    . ALA A 1 112 ? -4.231  7.563   1.303   1.00 0.37 ? 112 ALA A H    1  
ATOM 1036  N N    . LEU A 1 113 ? -5.300  5.065   -0.319  1.00 0.34 ? 113 LEU A N    1  
ATOM 1037  C CA   . LEU A 1 113 ? -5.333  3.938   -1.235  1.00 0.33 ? 113 LEU A CA   1  
ATOM 1038  C C    . LEU A 1 113 ? -4.872  2.671   -0.524  1.00 0.33 ? 113 LEU A C    1  
ATOM 1039  O O    . LEU A 1 113 ? -5.384  1.583   -0.780  1.00 0.33 ? 113 LEU A O    1  
ATOM 1040  C CB   . LEU A 1 113 ? -4.445  4.217   -2.450  1.00 0.34 ? 113 LEU A CB   1  
ATOM 1041  C CG   . LEU A 1 113 ? -4.491  3.185   -3.579  1.00 0.35 ? 113 LEU A CG   1  
ATOM 1042  C CD1  . LEU A 1 113 ? -5.859  3.173   -4.243  1.00 0.35 ? 113 LEU A CD1  1  
ATOM 1043  C CD2  . LEU A 1 113 ? -3.399  3.462   -4.601  1.00 0.36 ? 113 LEU A CD2  1  
ATOM 1044  H H    . LEU A 1 113 ? -4.662  5.790   -0.478  1.00 0.35 ? 113 LEU A H    1  
ATOM 1045  N N    . PHE A 1 114 ? -3.912  2.827   0.383   1.00 0.34 ? 114 PHE A N    1  
ATOM 1046  C CA   . PHE A 1 114 ? -3.390  1.701   1.146   1.00 0.36 ? 114 PHE A CA   1  
ATOM 1047  C C    . PHE A 1 114 ? -4.475  1.082   2.021   1.00 0.35 ? 114 PHE A C    1  
ATOM 1048  O O    . PHE A 1 114 ? -4.568  -0.144  2.134   1.00 0.36 ? 114 PHE A O    1  
ATOM 1049  C CB   . PHE A 1 114 ? -2.201  2.128   2.006   1.00 0.38 ? 114 PHE A CB   1  
ATOM 1050  C CG   . PHE A 1 114 ? -0.866  1.769   1.420   1.00 0.42 ? 114 PHE A CG   1  
ATOM 1051  C CD1  . PHE A 1 114 ? -0.216  2.636   0.557   1.00 0.71 ? 114 PHE A CD1  1  
ATOM 1052  C CD2  . PHE A 1 114 ? -0.261  0.566   1.735   1.00 0.75 ? 114 PHE A CD2  1  
ATOM 1053  C CE1  . PHE A 1 114 ? 1.014   2.307   0.021   1.00 0.89 ? 114 PHE A CE1  1  
ATOM 1054  C CE2  . PHE A 1 114 ? 0.968   0.230   1.203   1.00 0.98 ? 114 PHE A CE2  1  
ATOM 1055  C CZ   . PHE A 1 114 ? 1.608   1.102   0.345   1.00 0.93 ? 114 PHE A CZ   1  
ATOM 1056  H H    . PHE A 1 114 ? -3.539  3.723   0.537   1.00 0.35 ? 114 PHE A H    1  
ATOM 1057  N N    . TYR A 1 115 ? -5.297  1.931   2.632   1.00 0.34 ? 115 TYR A N    1  
ATOM 1058  C CA   . TYR A 1 115 ? -6.383  1.464   3.489   1.00 0.34 ? 115 TYR A CA   1  
ATOM 1059  C C    . TYR A 1 115 ? -7.437  0.741   2.658   1.00 0.33 ? 115 TYR A C    1  
ATOM 1060  O O    . TYR A 1 115 ? -8.002  -0.267  3.082   1.00 0.33 ? 115 TYR A O    1  
ATOM 1061  C CB   . TYR A 1 115 ? -7.016  2.630   4.256   1.00 0.35 ? 115 TYR A CB   1  
ATOM 1062  C CG   . TYR A 1 115 ? -8.181  2.223   5.134   1.00 0.35 ? 115 TYR A CG   1  
ATOM 1063  C CD1  . TYR A 1 115 ? -7.973  1.538   6.323   1.00 0.37 ? 115 TYR A CD1  1  
ATOM 1064  C CD2  . TYR A 1 115 ? -9.492  2.517   4.770   1.00 0.35 ? 115 TYR A CD2  1  
ATOM 1065  C CE1  . TYR A 1 115 ? -9.033  1.158   7.125   1.00 0.39 ? 115 TYR A CE1  1  
ATOM 1066  C CE2  . TYR A 1 115 ? -10.557 2.142   5.567   1.00 0.37 ? 115 TYR A CE2  1  
ATOM 1067  C CZ   . TYR A 1 115 ? -10.321 1.463   6.743   1.00 0.39 ? 115 TYR A CZ   1  
ATOM 1068  O OH   . TYR A 1 115 ? -11.383 1.079   7.536   1.00 0.42 ? 115 TYR A OH   1  
ATOM 1069  H H    . TYR A 1 115 ? -5.166  2.897   2.509   1.00 0.34 ? 115 TYR A H    1  
ATOM 1070  H HH   . TYR A 1 115 ? -11.436 1.664   8.309   1.00 0.43 ? 115 TYR A HH   1  
ATOM 1071  N N    . PHE A 1 116 ? -7.697  1.264   1.469   1.00 0.32 ? 116 PHE A N    1  
ATOM 1072  C CA   . PHE A 1 116 ? -8.673  0.667   0.570   1.00 0.32 ? 116 PHE A CA   1  
ATOM 1073  C C    . PHE A 1 116 ? -8.174  -0.686  0.067   1.00 0.31 ? 116 PHE A C    1  
ATOM 1074  O O    . PHE A 1 116 ? -8.923  -1.664  0.026   1.00 0.31 ? 116 PHE A O    1  
ATOM 1075  C CB   . PHE A 1 116 ? -8.956  1.604   -0.609  1.00 0.32 ? 116 PHE A CB   1  
ATOM 1076  C CG   . PHE A 1 116 ? -10.116 1.181   -1.462  1.00 0.34 ? 116 PHE A CG   1  
ATOM 1077  C CD1  . PHE A 1 116 ? -11.407 1.205   -0.960  1.00 0.38 ? 116 PHE A CD1  1  
ATOM 1078  C CD2  . PHE A 1 116 ? -9.919  0.761   -2.767  1.00 0.34 ? 116 PHE A CD2  1  
ATOM 1079  C CE1  . PHE A 1 116 ? -12.479 0.818   -1.741  1.00 0.41 ? 116 PHE A CE1  1  
ATOM 1080  C CE2  . PHE A 1 116 ? -10.983 0.372   -3.554  1.00 0.37 ? 116 PHE A CE2  1  
ATOM 1081  C CZ   . PHE A 1 116 ? -12.267 0.400   -3.041  1.00 0.40 ? 116 PHE A CZ   1  
ATOM 1082  H H    . PHE A 1 116 ? -7.223  2.078   1.193   1.00 0.33 ? 116 PHE A H    1  
ATOM 1083  N N    . ALA A 1 117 ? -6.898  -0.734  -0.297  1.00 0.32 ? 117 ALA A N    1  
ATOM 1084  C CA   . ALA A 1 117 ? -6.284  -1.954  -0.797  1.00 0.32 ? 117 ALA A CA   1  
ATOM 1085  C C    . ALA A 1 117 ? -6.275  -3.051  0.266   1.00 0.33 ? 117 ALA A C    1  
ATOM 1086  O O    . ALA A 1 117 ? -6.650  -4.190  -0.008  1.00 0.33 ? 117 ALA A O    1  
ATOM 1087  C CB   . ALA A 1 117 ? -4.876  -1.677  -1.301  1.00 0.34 ? 117 ALA A CB   1  
ATOM 1088  H H    . ALA A 1 117 ? -6.353  0.082   -0.236  1.00 0.32 ? 117 ALA A H    1  
ATOM 1089  N N    . SER A 1 118 ? -5.866  -2.698  1.483   1.00 0.34 ? 118 SER A N    1  
ATOM 1090  C CA   . SER A 1 118 ? -5.808  -3.660  2.577   1.00 0.35 ? 118 SER A CA   1  
ATOM 1091  C C    . SER A 1 118 ? -7.189  -4.220  2.899   1.00 0.35 ? 118 SER A C    1  
ATOM 1092  O O    . SER A 1 118 ? -7.325  -5.400  3.225   1.00 0.35 ? 118 SER A O    1  
ATOM 1093  C CB   . SER A 1 118 ? -5.157  -3.047  3.819   1.00 0.37 ? 118 SER A CB   1  
ATOM 1094  O OG   . SER A 1 118 ? -5.618  -1.726  4.038   1.00 0.38 ? 118 SER A OG   1  
ATOM 1095  H H    . SER A 1 118 ? -5.598  -1.767  1.650   1.00 0.34 ? 118 SER A H    1  
ATOM 1096  H HG   . SER A 1 118 ? -5.111  -1.112  3.490   1.00 0.38 ? 118 SER A HG   1  
ATOM 1097  N N    . LYS A 1 119 ? -8.210  -3.372  2.791   1.00 0.34 ? 119 LYS A N    1  
ATOM 1098  C CA   . LYS A 1 119 ? -9.581  -3.790  3.055   1.00 0.35 ? 119 LYS A CA   1  
ATOM 1099  C C    . LYS A 1 119 ? -9.999  -4.859  2.049   1.00 0.34 ? 119 LYS A C    1  
ATOM 1100  O O    . LYS A 1 119 ? -10.660 -5.837  2.403   1.00 0.35 ? 119 LYS A O    1  
ATOM 1101  C CB   . LYS A 1 119 ? -10.537 -2.594  2.983   1.00 0.37 ? 119 LYS A CB   1  
ATOM 1102  C CG   . LYS A 1 119 ? -11.700 -2.660  3.963   1.00 0.40 ? 119 LYS A CG   1  
ATOM 1103  C CD   . LYS A 1 119 ? -11.278 -2.233  5.361   1.00 0.45 ? 119 LYS A CD   1  
ATOM 1104  C CE   . LYS A 1 119 ? -12.472 -2.151  6.306   1.00 0.62 ? 119 LYS A CE   1  
ATOM 1105  N NZ   . LYS A 1 119 ? -12.101 -1.564  7.622   1.00 0.44 ? 119 LYS A NZ   1  
ATOM 1106  H H    . LYS A 1 119 ? -8.033  -2.441  2.532   1.00 0.35 ? 119 LYS A H    1  
ATOM 1107  H HZ1  . LYS A 1 119 ? -12.920 -1.563  8.269   1.00 0.62 ? 119 LYS A HZ1  1  
ATOM 1108  H HZ2  . LYS A 1 119 ? -11.774 -0.579  7.500   1.00 0.46 ? 119 LYS A HZ2  1  
ATOM 1109  H HZ3  . LYS A 1 119 ? -11.338 -2.116  8.060   1.00 0.59 ? 119 LYS A HZ3  1  
ATOM 1110  N N    . LEU A 1 120 ? -9.592  -4.668  0.797   1.00 0.32 ? 120 LEU A N    1  
ATOM 1111  C CA   . LEU A 1 120 ? -9.901  -5.617  -0.265  1.00 0.32 ? 120 LEU A CA   1  
ATOM 1112  C C    . LEU A 1 120 ? -9.131  -6.915  -0.045  1.00 0.32 ? 120 LEU A C    1  
ATOM 1113  O O    . LEU A 1 120 ? -9.672  -8.008  -0.221  1.00 0.33 ? 120 LEU A O    1  
ATOM 1114  C CB   . LEU A 1 120 ? -9.547  -5.026  -1.632  1.00 0.32 ? 120 LEU A CB   1  
ATOM 1115  C CG   . LEU A 1 120 ? -10.305 -3.760  -2.039  1.00 0.32 ? 120 LEU A CG   1  
ATOM 1116  C CD1  . LEU A 1 120 ? -9.777  -3.225  -3.362  1.00 0.34 ? 120 LEU A CD1  1  
ATOM 1117  C CD2  . LEU A 1 120 ? -11.801 -4.026  -2.125  1.00 0.33 ? 120 LEU A CD2  1  
ATOM 1118  H H    . LEU A 1 120 ? -9.066  -3.865  0.582   1.00 0.32 ? 120 LEU A H    1  
ATOM 1119  N N    . VAL A 1 121 ? -7.868  -6.784  0.349   1.00 0.33 ? 121 VAL A N    1  
ATOM 1120  C CA   . VAL A 1 121 ? -7.018  -7.940  0.609   1.00 0.34 ? 121 VAL A CA   1  
ATOM 1121  C C    . VAL A 1 121 ? -7.597  -8.772  1.747   1.00 0.36 ? 121 VAL A C    1  
ATOM 1122  O O    . VAL A 1 121 ? -7.694  -9.992  1.649   1.00 0.37 ? 121 VAL A O    1  
ATOM 1123  C CB   . VAL A 1 121 ? -5.568  -7.519  0.952   1.00 0.36 ? 121 VAL A CB   1  
ATOM 1124  C CG1  . VAL A 1 121 ? -4.735  -8.718  1.386   1.00 0.36 ? 121 VAL A CG1  1  
ATOM 1125  C CG2  . VAL A 1 121 ? -4.920  -6.832  -0.240  1.00 0.37 ? 121 VAL A CG2  1  
ATOM 1126  H H    . VAL A 1 121 ? -7.497  -5.882  0.465   1.00 0.33 ? 121 VAL A H    1  
ATOM 1127  N N    . LEU A 1 122 ? -8.004  -8.097  2.817   1.00 0.37 ? 122 LEU A N    1  
ATOM 1128  C CA   . LEU A 1 122 ? -8.589  -8.773  3.968   1.00 0.40 ? 122 LEU A CA   1  
ATOM 1129  C C    . LEU A 1 122 ? -9.878  -9.485  3.572   1.00 0.39 ? 122 LEU A C    1  
ATOM 1130  O O    . LEU A 1 122 ? -10.134 -10.612 3.999   1.00 0.40 ? 122 LEU A O    1  
ATOM 1131  C CB   . LEU A 1 122 ? -8.856  -7.783  5.104   1.00 0.44 ? 122 LEU A CB   1  
ATOM 1132  C CG   . LEU A 1 122 ? -7.896  -7.847  6.296   1.00 0.85 ? 122 LEU A CG   1  
ATOM 1133  C CD1  . LEU A 1 122 ? -6.470  -7.537  5.866   1.00 1.31 ? 122 LEU A CD1  1  
ATOM 1134  C CD2  . LEU A 1 122 ? -8.347  -6.903  7.399   1.00 0.88 ? 122 LEU A CD2  1  
ATOM 1135  H H    . LEU A 1 122 ? -7.904  -7.118  2.833   1.00 0.37 ? 122 LEU A H    1  
ATOM 1136  N N    . LYS A 1 123 ? -10.676 -8.824  2.743   1.00 0.37 ? 123 LYS A N    1  
ATOM 1137  C CA   . LYS A 1 123 ? -11.934 -9.384  2.266   1.00 0.38 ? 123 LYS A CA   1  
ATOM 1138  C C    . LYS A 1 123 ? -11.679 -10.667 1.476   1.00 0.38 ? 123 LYS A C    1  
ATOM 1139  O O    . LYS A 1 123 ? -12.306 -11.700 1.721   1.00 0.40 ? 123 LYS A O    1  
ATOM 1140  C CB   . LYS A 1 123 ? -12.660 -8.363  1.384   1.00 0.40 ? 123 LYS A CB   1  
ATOM 1141  C CG   . LYS A 1 123 ? -14.041 -8.795  0.922   1.00 0.53 ? 123 LYS A CG   1  
ATOM 1142  C CD   . LYS A 1 123 ? -14.581 -7.852  -0.142  1.00 0.61 ? 123 LYS A CD   1  
ATOM 1143  C CE   . LYS A 1 123 ? -16.014 -8.192  -0.521  1.00 0.89 ? 123 LYS A CE   1  
ATOM 1144  N NZ   . LYS A 1 123 ? -16.154 -9.600  -0.981  1.00 1.13 ? 123 LYS A NZ   1  
ATOM 1145  H H    . LYS A 1 123 ? -10.411 -7.925  2.447   1.00 0.38 ? 123 LYS A H    1  
ATOM 1146  H HZ1  . LYS A 1 123 ? -16.327 -10.222 -0.168  1.00 1.50 ? 123 LYS A HZ1  1  
ATOM 1147  H HZ2  . LYS A 1 123 ? -15.287 -9.912  -1.461  1.00 1.50 ? 123 LYS A HZ2  1  
ATOM 1148  H HZ3  . LYS A 1 123 ? -16.952 -9.687  -1.644  1.00 1.55 ? 123 LYS A HZ3  1  
ATOM 1149  N N    . ALA A 1 124 ? -10.741 -10.592 0.537   1.00 0.37 ? 124 ALA A N    1  
ATOM 1150  C CA   . ALA A 1 124 ? -10.384 -11.737 -0.289  1.00 0.39 ? 124 ALA A CA   1  
ATOM 1151  C C    . ALA A 1 124 ? -9.791  -12.853 0.564   1.00 0.40 ? 124 ALA A C    1  
ATOM 1152  O O    . ALA A 1 124 ? -10.005 -14.037 0.295   1.00 0.42 ? 124 ALA A O    1  
ATOM 1153  C CB   . ALA A 1 124 ? -9.413  -11.322 -1.381  1.00 0.40 ? 124 ALA A CB   1  
ATOM 1154  H H    . ALA A 1 124 ? -10.280 -9.734  0.391   1.00 0.36 ? 124 ALA A H    1  
ATOM 1155  N N    . LEU A 1 125 ? -9.050  -12.469 1.597   1.00 0.40 ? 125 LEU A N    1  
ATOM 1156  C CA   . LEU A 1 125 ? -8.438  -13.432 2.504   1.00 0.42 ? 125 LEU A CA   1  
ATOM 1157  C C    . LEU A 1 125 ? -9.522  -14.208 3.247   1.00 0.44 ? 125 LEU A C    1  
ATOM 1158  O O    . LEU A 1 125 ? -9.379  -15.401 3.512   1.00 0.47 ? 125 LEU A O    1  
ATOM 1159  C CB   . LEU A 1 125 ? -7.507  -12.721 3.491   1.00 0.43 ? 125 LEU A CB   1  
ATOM 1160  C CG   . LEU A 1 125 ? -6.544  -13.609 4.284   1.00 0.47 ? 125 LEU A CG   1  
ATOM 1161  C CD1  . LEU A 1 125 ? -5.635  -14.392 3.344   1.00 0.51 ? 125 LEU A CD1  1  
ATOM 1162  C CD2  . LEU A 1 125 ? -5.719  -12.772 5.250   1.00 0.50 ? 125 LEU A CD2  1  
ATOM 1163  H H    . LEU A 1 125 ? -8.898  -11.508 1.746   1.00 0.39 ? 125 LEU A H    1  
ATOM 1164  N N    . CYS A 1 126 ? -10.623 -13.530 3.547   1.00 0.44 ? 126 CYS A N    1  
ATOM 1165  C CA   . CYS A 1 126 ? -11.743 -14.149 4.243   1.00 0.47 ? 126 CYS A CA   1  
ATOM 1166  C C    . CYS A 1 126 ? -12.504 -15.094 3.315   1.00 0.49 ? 126 CYS A C    1  
ATOM 1167  O O    . CYS A 1 126 ? -13.361 -15.855 3.756   1.00 0.57 ? 126 CYS A O    1  
ATOM 1168  C CB   . CYS A 1 126 ? -12.687 -13.081 4.796   1.00 0.49 ? 126 CYS A CB   1  
ATOM 1169  S SG   . CYS A 1 126 ? -11.914 -11.924 5.947   1.00 0.53 ? 126 CYS A SG   1  
ATOM 1170  H H    . CYS A 1 126 ? -10.682 -12.580 3.299   1.00 0.44 ? 126 CYS A H    1  
ATOM 1171  H HG   . CYS A 1 126 ? -11.104 -11.139 5.245   1.00 0.48 ? 126 CYS A HG   1  
ATOM 1172  N N    . THR A 1 127 ? -12.183 -15.034 2.027   1.00 0.46 ? 127 THR A N    1  
ATOM 1173  C CA   . THR A 1 127 ? -12.822 -15.884 1.033   1.00 0.48 ? 127 THR A CA   1  
ATOM 1174  C C    . THR A 1 127 ? -11.938 -17.098 0.745   1.00 0.49 ? 127 THR A C    1  
ATOM 1175  O O    . THR A 1 127 ? -12.298 -17.982 -0.038  1.00 0.55 ? 127 THR A O    1  
ATOM 1176  C CB   . THR A 1 127 ? -13.070 -15.101 -0.275  1.00 0.49 ? 127 THR A CB   1  
ATOM 1177  O OG1  . THR A 1 127 ? -13.352 -13.730 0.045   1.00 0.53 ? 127 THR A OG1  1  
ATOM 1178  C CG2  . THR A 1 127 ? -14.254 -15.682 -1.035  1.00 0.56 ? 127 THR A CG2  1  
ATOM 1179  H H    . THR A 1 127 ? -11.488 -14.403 1.738   1.00 0.45 ? 127 THR A H    1  
ATOM 1180  H HG1  . THR A 1 127 ? -13.133 -13.565 0.970   1.00 0.87 ? 127 THR A HG1  1  
ATOM 1181  N N    . LYS A 1 128 ? -10.779 -17.127 1.406   1.00 0.47 ? 128 LYS A N    1  
ATOM 1182  C CA   . LYS A 1 128 ? -9.812  -18.209 1.256   1.00 0.50 ? 128 LYS A CA   1  
ATOM 1183  C C    . LYS A 1 128 ? -9.311  -18.336 -0.181  1.00 0.46 ? 128 LYS A C    1  
ATOM 1184  O O    . LYS A 1 128 ? -9.354  -19.415 -0.772  1.00 0.54 ? 128 LYS A O    1  
ATOM 1185  C CB   . LYS A 1 128 ? -10.384 -19.541 1.759   1.00 0.60 ? 128 LYS A CB   1  
ATOM 1186  C CG   . LYS A 1 128 ? -10.706 -19.557 3.245   1.00 0.67 ? 128 LYS A CG   1  
ATOM 1187  C CD   . LYS A 1 128 ? -11.473 -20.811 3.635   1.00 0.98 ? 128 LYS A CD   1  
ATOM 1188  C CE   . LYS A 1 128 ? -12.884 -20.794 3.069   1.00 1.15 ? 128 LYS A CE   1  
ATOM 1189  N NZ   . LYS A 1 128 ? -13.641 -22.023 3.420   1.00 1.40 ? 128 LYS A NZ   1  
ATOM 1190  H H    . LYS A 1 128 ? -10.572 -16.393 2.025   1.00 0.46 ? 128 LYS A H    1  
ATOM 1191  H HZ1  . LYS A 1 128 ? -13.204 -22.853 2.974   1.00 1.68 ? 128 LYS A HZ1  1  
ATOM 1192  H HZ2  . LYS A 1 128 ? -14.626 -21.946 3.094   1.00 1.63 ? 128 LYS A HZ2  1  
ATOM 1193  H HZ3  . LYS A 1 128 ? -13.638 -22.158 4.452   1.00 1.70 ? 128 LYS A HZ3  1  
ATOM 1194  N N    . VAL A 1 129 ? -8.851  -17.225 -0.746  1.00 0.42 ? 129 VAL A N    1  
ATOM 1195  C CA   . VAL A 1 129 ? -8.323  -17.224 -2.106  1.00 0.39 ? 129 VAL A CA   1  
ATOM 1196  C C    . VAL A 1 129 ? -6.978  -16.488 -2.176  1.00 0.35 ? 129 VAL A C    1  
ATOM 1197  O O    . VAL A 1 129 ? -6.916  -15.279 -2.414  1.00 0.34 ? 129 VAL A O    1  
ATOM 1198  C CB   . VAL A 1 129 ? -9.340  -16.684 -3.144  1.00 0.40 ? 129 VAL A CB   1  
ATOM 1199  C CG1  . VAL A 1 129 ? -9.869  -15.308 -2.760  1.00 0.39 ? 129 VAL A CG1  1  
ATOM 1200  C CG2  . VAL A 1 129 ? -8.752  -16.681 -4.552  1.00 0.40 ? 129 VAL A CG2  1  
ATOM 1201  H H    . VAL A 1 129 ? -8.868  -16.385 -0.241  1.00 0.46 ? 129 VAL A H    1  
ATOM 1202  N N    . PRO A 1 130 ? -5.878  -17.222 -1.945  1.00 0.37 ? 130 PRO A N    1  
ATOM 1203  C CA   . PRO A 1 130 ? -4.517  -16.669 -1.961  1.00 0.37 ? 130 PRO A CA   1  
ATOM 1204  C C    . PRO A 1 130 ? -4.132  -16.113 -3.329  1.00 0.33 ? 130 PRO A C    1  
ATOM 1205  O O    . PRO A 1 130 ? -3.342  -15.169 -3.426  1.00 0.32 ? 130 PRO A O    1  
ATOM 1206  C CB   . PRO A 1 130 ? -3.629  -17.870 -1.616  1.00 0.43 ? 130 PRO A CB   1  
ATOM 1207  C CG   . PRO A 1 130 ? -4.545  -18.851 -0.971  1.00 0.47 ? 130 PRO A CG   1  
ATOM 1208  C CD   . PRO A 1 130 ? -5.874  -18.662 -1.636  1.00 0.43 ? 130 PRO A CD   1  
ATOM 1209  N N    . GLU A 1 131 ? -4.695  -16.705 -4.379  1.00 0.34 ? 131 GLU A N    1  
ATOM 1210  C CA   . GLU A 1 131 ? -4.425  -16.280 -5.747  1.00 0.36 ? 131 GLU A CA   1  
ATOM 1211  C C    . GLU A 1 131 ? -4.727  -14.795 -5.925  1.00 0.32 ? 131 GLU A C    1  
ATOM 1212  O O    . GLU A 1 131 ? -3.854  -14.018 -6.322  1.00 0.34 ? 131 GLU A O    1  
ATOM 1213  C CB   . GLU A 1 131 ? -5.256  -17.111 -6.729  1.00 0.43 ? 131 GLU A CB   1  
ATOM 1214  C CG   . GLU A 1 131 ? -4.558  -17.424 -8.045  1.00 0.75 ? 131 GLU A CG   1  
ATOM 1215  C CD   . GLU A 1 131 ? -4.408  -16.209 -8.937  1.00 1.18 ? 131 GLU A CD   1  
ATOM 1216  O OE1  . GLU A 1 131 ? -5.408  -15.492 -9.143  1.00 1.55 ? 131 GLU A OE1  1  
ATOM 1217  O OE2  . GLU A 1 131 ? -3.287  -15.964 -9.433  1.00 1.54 ? 131 GLU A OE2  1  
ATOM 1218  H H    . GLU A 1 131 ? -5.303  -17.460 -4.225  1.00 0.37 ? 131 GLU A H    1  
ATOM 1219  N N    . LEU A 1 132 ? -5.954  -14.403 -5.589  1.00 0.32 ? 132 LEU A N    1  
ATOM 1220  C CA   . LEU A 1 132 ? -6.386  -13.013 -5.716  1.00 0.32 ? 132 LEU A CA   1  
ATOM 1221  C C    . LEU A 1 132 ? -5.537  -12.079 -4.856  1.00 0.31 ? 132 LEU A C    1  
ATOM 1222  O O    . LEU A 1 132 ? -5.292  -10.930 -5.229  1.00 0.34 ? 132 LEU A O    1  
ATOM 1223  C CB   . LEU A 1 132 ? -7.868  -12.868 -5.363  1.00 0.33 ? 132 LEU A CB   1  
ATOM 1224  C CG   . LEU A 1 132 ? -8.501  -11.505 -5.655  1.00 0.34 ? 132 LEU A CG   1  
ATOM 1225  C CD1  . LEU A 1 132 ? -8.455  -11.199 -7.145  1.00 0.36 ? 132 LEU A CD1  1  
ATOM 1226  C CD2  . LEU A 1 132 ? -9.930  -11.453 -5.138  1.00 0.36 ? 132 LEU A CD2  1  
ATOM 1227  H H    . LEU A 1 132 ? -6.586  -15.067 -5.246  1.00 0.34 ? 132 LEU A H    1  
ATOM 1228  N N    . ILE A 1 133 ? -5.078  -12.581 -3.714  1.00 0.31 ? 133 ILE A N    1  
ATOM 1229  C CA   . ILE A 1 133 ? -4.243  -11.792 -2.809  1.00 0.33 ? 133 ILE A CA   1  
ATOM 1230  C C    . ILE A 1 133 ? -2.973  -11.346 -3.526  1.00 0.34 ? 133 ILE A C    1  
ATOM 1231  O O    . ILE A 1 133 ? -2.495  -10.223 -3.342  1.00 0.38 ? 133 ILE A O    1  
ATOM 1232  C CB   . ILE A 1 133 ? -3.853  -12.598 -1.547  1.00 0.34 ? 133 ILE A CB   1  
ATOM 1233  C CG1  . ILE A 1 133 ? -5.099  -13.099 -0.815  1.00 0.36 ? 133 ILE A CG1  1  
ATOM 1234  C CG2  . ILE A 1 133 ? -2.978  -11.768 -0.613  1.00 0.38 ? 133 ILE A CG2  1  
ATOM 1235  C CD1  . ILE A 1 133 ? -6.017  -11.995 -0.338  1.00 0.39 ? 133 ILE A CD1  1  
ATOM 1236  H H    . ILE A 1 133 ? -5.304  -13.505 -3.474  1.00 0.31 ? 133 ILE A H    1  
ATOM 1237  N N    . ARG A 1 134 ? -2.441  -12.225 -4.363  1.00 0.32 ? 134 ARG A N    1  
ATOM 1238  C CA   . ARG A 1 134 ? -1.231  -11.933 -5.114  1.00 0.35 ? 134 ARG A CA   1  
ATOM 1239  C C    . ARG A 1 134 ? -1.536  -10.991 -6.274  1.00 0.37 ? 134 ARG A C    1  
ATOM 1240  O O    . ARG A 1 134 ? -0.694  -10.187 -6.676  1.00 0.40 ? 134 ARG A O    1  
ATOM 1241  C CB   . ARG A 1 134 ? -0.572  -13.221 -5.626  1.00 0.37 ? 134 ARG A CB   1  
ATOM 1242  C CG   . ARG A 1 134 ? -0.435  -14.329 -4.586  1.00 0.67 ? 134 ARG A CG   1  
ATOM 1243  C CD   . ARG A 1 134 ? 0.185   -13.828 -3.287  1.00 1.16 ? 134 ARG A CD   1  
ATOM 1244  N NE   . ARG A 1 134 ? 1.563   -13.370 -3.462  1.00 1.04 ? 134 ARG A NE   1  
ATOM 1245  C CZ   . ARG A 1 134 ? 2.001   -12.160 -3.117  1.00 1.20 ? 134 ARG A CZ   1  
ATOM 1246  N NH1  . ARG A 1 134 ? 1.168   -11.271 -2.586  1.00 1.47 ? 134 ARG A NH1  1  
ATOM 1247  N NH2  . ARG A 1 134 ? 3.276   -11.844 -3.306  1.00 1.35 ? 134 ARG A NH2  1  
ATOM 1248  H H    . ARG A 1 134 ? -2.884  -13.096 -4.482  1.00 0.32 ? 134 ARG A H    1  
ATOM 1249  H HE   . ARG A 1 134 ? 2.207   -14.010 -3.858  1.00 1.07 ? 134 ARG A HE   1  
ATOM 1250  H HH11 . ARG A 1 134 ? 0.206   -11.505 -2.444  1.00 1.53 ? 134 ARG A HH11 1  
ATOM 1251  H HH12 . ARG A 1 134 ? 1.502   -10.360 -2.324  1.00 1.73 ? 134 ARG A HH12 1  
ATOM 1252  H HH21 . ARG A 1 134 ? 3.904   -12.523 -3.710  1.00 1.37 ? 134 ARG A HH21 1  
ATOM 1253  H HH22 . ARG A 1 134 ? 3.620   -10.938 -3.048  1.00 1.59 ? 134 ARG A HH22 1  
ATOM 1254  N N    . THR A 1 135 ? -2.748  -11.091 -6.805  1.00 0.38 ? 135 THR A N    1  
ATOM 1255  C CA   . THR A 1 135 ? -3.165  -10.249 -7.917  1.00 0.42 ? 135 THR A CA   1  
ATOM 1256  C C    . THR A 1 135 ? -3.311  -8.795  -7.475  1.00 0.43 ? 135 THR A C    1  
ATOM 1257  O O    . THR A 1 135 ? -2.815  -7.887  -8.139  1.00 0.47 ? 135 THR A O    1  
ATOM 1258  C CB   . THR A 1 135 ? -4.488  -10.743 -8.523  1.00 0.45 ? 135 THR A CB   1  
ATOM 1259  O OG1  . THR A 1 135 ? -4.569  -12.166 -8.357  1.00 0.51 ? 135 THR A OG1  1  
ATOM 1260  C CG2  . THR A 1 135 ? -4.546  -10.412 -10.006 1.00 0.52 ? 135 THR A CG2  1  
ATOM 1261  H H    . THR A 1 135 ? -3.384  -11.748 -6.440  1.00 0.38 ? 135 THR A H    1  
ATOM 1262  H HG1  . THR A 1 135 ? -4.737  -12.582 -9.214  1.00 0.83 ? 135 THR A HG1  1  
ATOM 1263  N N    . ILE A 1 136 ? -3.975  -8.584  -6.338  1.00 0.42 ? 136 ILE A N    1  
ATOM 1264  C CA   . ILE A 1 136 ? -4.175  -7.234  -5.804  1.00 0.45 ? 136 ILE A CA   1  
ATOM 1265  C C    . ILE A 1 136 ? -2.829  -6.558  -5.551  1.00 0.46 ? 136 ILE A C    1  
ATOM 1266  O O    . ILE A 1 136 ? -2.642  -5.377  -5.861  1.00 0.49 ? 136 ILE A O    1  
ATOM 1267  C CB   . ILE A 1 136 ? -5.003  -7.251  -4.497  1.00 0.45 ? 136 ILE A CB   1  
ATOM 1268  C CG1  . ILE A 1 136 ? -6.347  -7.950  -4.732  1.00 0.44 ? 136 ILE A CG1  1  
ATOM 1269  C CG2  . ILE A 1 136 ? -5.224  -5.834  -3.977  1.00 0.49 ? 136 ILE A CG2  1  
ATOM 1270  C CD1  . ILE A 1 136 ? -7.147  -8.196  -3.469  1.00 0.46 ? 136 ILE A CD1  1  
ATOM 1271  H H    . ILE A 1 136 ? -4.351  -9.355  -5.855  1.00 0.40 ? 136 ILE A H    1  
ATOM 1272  N N    . MET A 1 137 ? -1.886  -7.324  -5.003  1.00 0.45 ? 137 MET A N    1  
ATOM 1273  C CA   . MET A 1 137 ? -0.549  -6.813  -4.724  1.00 0.47 ? 137 MET A CA   1  
ATOM 1274  C C    . MET A 1 137 ? 0.130   -6.381  -6.016  1.00 0.48 ? 137 MET A C    1  
ATOM 1275  O O    . MET A 1 137 ? 0.795   -5.346  -6.064  1.00 0.49 ? 137 MET A O    1  
ATOM 1276  C CB   . MET A 1 137 ? 0.298   -7.873  -4.016  1.00 0.48 ? 137 MET A CB   1  
ATOM 1277  C CG   . MET A 1 137 ? 1.622   -7.356  -3.475  1.00 0.46 ? 137 MET A CG   1  
ATOM 1278  S SD   . MET A 1 137 ? 2.580   -8.649  -2.658  1.00 0.49 ? 137 MET A SD   1  
ATOM 1279  C CE   . MET A 1 137 ? 3.932   -7.693  -1.975  1.00 0.57 ? 137 MET A CE   1  
ATOM 1280  H H    . MET A 1 137 ? -2.102  -8.254  -4.775  1.00 0.44 ? 137 MET A H    1  
ATOM 1281  N N    . GLY A 1 138 ? -0.060  -7.176  -7.066  1.00 0.49 ? 138 GLY A N    1  
ATOM 1282  C CA   . GLY A 1 138 ? 0.523   -6.862  -8.355  1.00 0.51 ? 138 GLY A CA   1  
ATOM 1283  C C    . GLY A 1 138 ? -0.045  -5.573  -8.918  1.00 0.52 ? 138 GLY A C    1  
ATOM 1284  O O    . GLY A 1 138 ? 0.668   -4.800  -9.551  1.00 0.53 ? 138 GLY A O    1  
ATOM 1285  H H    . GLY A 1 138 ? -0.611  -7.982  -6.964  1.00 0.50 ? 138 GLY A H    1  
ATOM 1286  N N    . TRP A 1 139 ? -1.336  -5.347  -8.676  1.00 0.53 ? 139 TRP A N    1  
ATOM 1287  C CA   . TRP A 1 139 ? -2.014  -4.139  -9.142  1.00 0.57 ? 139 TRP A CA   1  
ATOM 1288  C C    . TRP A 1 139 ? -1.521  -2.917  -8.382  1.00 0.53 ? 139 TRP A C    1  
ATOM 1289  O O    . TRP A 1 139 ? -1.359  -1.836  -8.954  1.00 0.54 ? 139 TRP A O    1  
ATOM 1290  C CB   . TRP A 1 139 ? -3.529  -4.260  -8.956  1.00 0.65 ? 139 TRP A CB   1  
ATOM 1291  C CG   . TRP A 1 139 ? -4.178  -5.303  -9.810  1.00 0.69 ? 139 TRP A CG   1  
ATOM 1292  C CD1  . TRP A 1 139 ? -3.719  -5.799  -10.992 1.00 0.72 ? 139 TRP A CD1  1  
ATOM 1293  C CD2  . TRP A 1 139 ? -5.415  -5.970  -9.548  1.00 0.78 ? 139 TRP A CD2  1  
ATOM 1294  N NE1  . TRP A 1 139 ? -4.595  -6.732  -11.485 1.00 0.81 ? 139 TRP A NE1  1  
ATOM 1295  C CE2  . TRP A 1 139 ? -5.646  -6.857  -10.616 1.00 0.84 ? 139 TRP A CE2  1  
ATOM 1296  C CE3  . TRP A 1 139 ? -6.353  -5.903  -8.512  1.00 0.84 ? 139 TRP A CE3  1  
ATOM 1297  C CZ2  . TRP A 1 139 ? -6.774  -7.670  -10.678 1.00 0.95 ? 139 TRP A CZ2  1  
ATOM 1298  C CZ3  . TRP A 1 139 ? -7.472  -6.713  -8.574  1.00 0.95 ? 139 TRP A CZ3  1  
ATOM 1299  C CH2  . TRP A 1 139 ? -7.674  -7.584  -9.650  1.00 1.00 ? 139 TRP A CH2  1  
ATOM 1300  H H    . TRP A 1 139 ? -1.851  -6.023  -8.185  1.00 0.55 ? 139 TRP A H    1  
ATOM 1301  H HE1  . TRP A 1 139 ? -4.482  -7.230  -12.324 1.00 0.86 ? 139 TRP A HE1  1  
ATOM 1302  N N    . THR A 1 140 ? -1.293  -3.100  -7.088  1.00 0.51 ? 140 THR A N    1  
ATOM 1303  C CA   . THR A 1 140 ? -0.818  -2.024  -6.234  1.00 0.51 ? 140 THR A CA   1  
ATOM 1304  C C    . THR A 1 140 ? 0.554   -1.549  -6.703  1.00 0.47 ? 140 THR A C    1  
ATOM 1305  O O    . THR A 1 140 ? 0.813   -0.349  -6.805  1.00 0.53 ? 140 THR A O    1  
ATOM 1306  C CB   . THR A 1 140 ? -0.727  -2.485  -4.767  1.00 0.53 ? 140 THR A CB   1  
ATOM 1307  O OG1  . THR A 1 140 ? -1.949  -3.135  -4.385  1.00 0.55 ? 140 THR A OG1  1  
ATOM 1308  C CG2  . THR A 1 140 ? -0.483  -1.298  -3.847  1.00 0.54 ? 140 THR A CG2  1  
ATOM 1309  H H    . THR A 1 140 ? -1.452  -3.984  -6.698  1.00 0.52 ? 140 THR A H    1  
ATOM 1310  H HG1  . THR A 1 140 ? -2.230  -3.743  -5.078  1.00 0.67 ? 140 THR A HG1  1  
ATOM 1311  N N    . LEU A 1 141 ? 1.425   -2.502  -7.004  1.00 0.41 ? 141 LEU A N    1  
ATOM 1312  C CA   . LEU A 1 141 ? 2.760   -2.182  -7.472  1.00 0.42 ? 141 LEU A CA   1  
ATOM 1313  C C    . LEU A 1 141 ? 2.717   -1.704  -8.920  1.00 0.42 ? 141 LEU A C    1  
ATOM 1314  O O    . LEU A 1 141 ? 3.544   -0.890  -9.333  1.00 0.41 ? 141 LEU A O    1  
ATOM 1315  C CB   . LEU A 1 141 ? 3.685   -3.390  -7.321  1.00 0.44 ? 141 LEU A CB   1  
ATOM 1316  C CG   . LEU A 1 141 ? 3.959   -3.849  -5.884  1.00 0.48 ? 141 LEU A CG   1  
ATOM 1317  C CD1  . LEU A 1 141 ? 4.743   -5.148  -5.876  1.00 0.55 ? 141 LEU A CD1  1  
ATOM 1318  C CD2  . LEU A 1 141 ? 4.702   -2.773  -5.101  1.00 0.53 ? 141 LEU A CD2  1  
ATOM 1319  H H    . LEU A 1 141 ? 1.163   -3.443  -6.906  1.00 0.40 ? 141 LEU A H    1  
ATOM 1320  N N    . ASP A 1 142 ? 1.744   -2.214  -9.679  1.00 0.51 ? 142 ASP A N    1  
ATOM 1321  C CA   . ASP A 1 142 ? 1.567   -1.845  -11.086 1.00 0.54 ? 142 ASP A CA   1  
ATOM 1322  C C    . ASP A 1 142 ? 1.445   -0.334  -11.234 1.00 0.51 ? 142 ASP A C    1  
ATOM 1323  O O    . ASP A 1 142 ? 2.213   0.290   -11.963 1.00 0.53 ? 142 ASP A O    1  
ATOM 1324  C CB   . ASP A 1 142 ? 0.330   -2.546  -11.667 1.00 0.62 ? 142 ASP A CB   1  
ATOM 1325  C CG   . ASP A 1 142 ? 0.040   -2.198  -13.116 1.00 0.82 ? 142 ASP A CG   1  
ATOM 1326  O OD1  . ASP A 1 142 ? 0.961   -2.279  -13.962 1.00 0.96 ? 142 ASP A OD1  1  
ATOM 1327  O OD2  . ASP A 1 142 ? -1.126  -1.858  -13.424 1.00 1.12 ? 142 ASP A OD2  1  
ATOM 1328  H H    . ASP A 1 142 ? 1.131   -2.870  -9.284  1.00 0.59 ? 142 ASP A H    1  
ATOM 1329  N N    . PHE A 1 143 ? 0.504   0.249   -10.499 1.00 0.52 ? 143 PHE A N    1  
ATOM 1330  C CA   . PHE A 1 143 ? 0.279   1.692   -10.536 1.00 0.54 ? 143 PHE A CA   1  
ATOM 1331  C C    . PHE A 1 143 ? 1.493   2.442   -9.987  1.00 0.48 ? 143 PHE A C    1  
ATOM 1332  O O    . PHE A 1 143 ? 1.784   3.573   -10.397 1.00 0.50 ? 143 PHE A O    1  
ATOM 1333  C CB   . PHE A 1 143 ? -0.979  2.052   -9.739  1.00 0.64 ? 143 PHE A CB   1  
ATOM 1334  C CG   . PHE A 1 143 ? -1.427  3.482   -9.897  1.00 0.66 ? 143 PHE A CG   1  
ATOM 1335  C CD1  . PHE A 1 143 ? -1.460  4.081   -11.148 1.00 0.70 ? 143 PHE A CD1  1  
ATOM 1336  C CD2  . PHE A 1 143 ? -1.816  4.226   -8.795  1.00 0.77 ? 143 PHE A CD2  1  
ATOM 1337  C CE1  . PHE A 1 143 ? -1.870  5.393   -11.294 1.00 0.81 ? 143 PHE A CE1  1  
ATOM 1338  C CE2  . PHE A 1 143 ? -2.227  5.538   -8.935  1.00 0.86 ? 143 PHE A CE2  1  
ATOM 1339  C CZ   . PHE A 1 143 ? -2.255  6.123   -10.186 1.00 0.86 ? 143 PHE A CZ   1  
ATOM 1340  H H    . PHE A 1 143 ? -0.055  -0.308  -9.916  1.00 0.56 ? 143 PHE A H    1  
ATOM 1341  N N    . LEU A 1 144 ? 2.207   1.798   -9.070  1.00 0.43 ? 144 LEU A N    1  
ATOM 1342  C CA   . LEU A 1 144 ? 3.394   2.387   -8.467  1.00 0.41 ? 144 LEU A CA   1  
ATOM 1343  C C    . LEU A 1 144 ? 4.492   2.551   -9.517  1.00 0.41 ? 144 LEU A C    1  
ATOM 1344  O O    . LEU A 1 144 ? 5.077   3.623   -9.648  1.00 0.43 ? 144 LEU A O    1  
ATOM 1345  C CB   . LEU A 1 144 ? 3.888   1.530   -7.295  1.00 0.41 ? 144 LEU A CB   1  
ATOM 1346  C CG   . LEU A 1 144 ? 4.352   2.282   -6.041  1.00 0.72 ? 144 LEU A CG   1  
ATOM 1347  C CD1  . LEU A 1 144 ? 4.470   1.327   -4.864  1.00 1.07 ? 144 LEU A CD1  1  
ATOM 1348  C CD2  . LEU A 1 144 ? 5.677   2.994   -6.287  1.00 1.34 ? 144 LEU A CD2  1  
ATOM 1349  H H    . LEU A 1 144 ? 1.927   0.899   -8.794  1.00 0.43 ? 144 LEU A H    1  
ATOM 1350  N N    . ARG A 1 145 ? 4.748   1.493   -10.281 1.00 0.42 ? 145 ARG A N    1  
ATOM 1351  C CA   . ARG A 1 145 ? 5.766   1.538   -11.323 1.00 0.46 ? 145 ARG A CA   1  
ATOM 1352  C C    . ARG A 1 145 ? 5.303   2.428   -12.471 1.00 0.46 ? 145 ARG A C    1  
ATOM 1353  O O    . ARG A 1 145 ? 6.116   3.077   -13.134 1.00 0.55 ? 145 ARG A O    1  
ATOM 1354  C CB   . ARG A 1 145 ? 6.080   0.129   -11.838 1.00 0.54 ? 145 ARG A CB   1  
ATOM 1355  C CG   . ARG A 1 145 ? 7.273   0.051   -12.780 1.00 0.66 ? 145 ARG A CG   1  
ATOM 1356  C CD   . ARG A 1 145 ? 8.507   0.685   -12.161 1.00 1.01 ? 145 ARG A CD   1  
ATOM 1357  N NE   . ARG A 1 145 ? 9.726   0.396   -12.914 1.00 1.10 ? 145 ARG A NE   1  
ATOM 1358  C CZ   . ARG A 1 145 ? 10.801  -0.183  -12.380 1.00 1.24 ? 145 ARG A CZ   1  
ATOM 1359  N NH1  . ARG A 1 145 ? 10.775  -0.570  -11.119 1.00 1.40 ? 145 ARG A NH1  1  
ATOM 1360  N NH2  . ARG A 1 145 ? 11.890  -0.384  -13.104 1.00 1.43 ? 145 ARG A NH2  1  
ATOM 1361  H H    . ARG A 1 145 ? 4.239   0.662   -10.141 1.00 0.42 ? 145 ARG A H    1  
ATOM 1362  H HE   . ARG A 1 145 ? 9.750   0.663   -13.863 1.00 1.24 ? 145 ARG A HE   1  
ATOM 1363  H HH11 . ARG A 1 145 ? 9.955   -0.427  -10.560 1.00 1.42 ? 145 ARG A HH11 1  
ATOM 1364  H HH12 . ARG A 1 145 ? 11.590  -1.020  -10.709 1.00 1.63 ? 145 ARG A HH12 1  
ATOM 1365  H HH21 . ARG A 1 145 ? 11.916  -0.103  -14.066 1.00 1.54 ? 145 ARG A HH21 1  
ATOM 1366  H HH22 . ARG A 1 145 ? 12.704  -0.815  -12.686 1.00 1.57 ? 145 ARG A HH22 1  
ATOM 1367  N N    . GLU A 1 146 ? 3.991   2.451   -12.691 1.00 0.50 ? 146 GLU A N    1  
ATOM 1368  C CA   . GLU A 1 146 ? 3.395   3.257   -13.747 1.00 0.55 ? 146 GLU A CA   1  
ATOM 1369  C C    . GLU A 1 146 ? 3.764   4.731   -13.617 1.00 0.56 ? 146 GLU A C    1  
ATOM 1370  O O    . GLU A 1 146 ? 4.423   5.285   -14.497 1.00 0.74 ? 146 GLU A O    1  
ATOM 1371  C CB   . GLU A 1 146 ? 1.871   3.096   -13.772 1.00 0.62 ? 146 GLU A CB   1  
ATOM 1372  C CG   . GLU A 1 146 ? 1.384   1.850   -14.495 1.00 0.89 ? 146 GLU A CG   1  
ATOM 1373  C CD   . GLU A 1 146 ? 1.042   2.104   -15.949 1.00 1.31 ? 146 GLU A CD   1  
ATOM 1374  O OE1  . GLU A 1 146 ? 1.560   3.080   -16.531 1.00 1.61 ? 146 GLU A OE1  1  
ATOM 1375  O OE2  . GLU A 1 146 ? 0.246   1.327   -16.518 1.00 1.82 ? 146 GLU A OE2  1  
ATOM 1376  H H    . GLU A 1 146 ? 3.408   1.889   -12.135 1.00 0.58 ? 146 GLU A H    1  
ATOM 1377  N N    . ARG A 1 147 ? 3.372   5.363   -12.509 1.00 0.51 ? 147 ARG A N    1  
ATOM 1378  C CA   . ARG A 1 147 ? 3.654   6.785   -12.324 1.00 0.57 ? 147 ARG A CA   1  
ATOM 1379  C C    . ARG A 1 147 ? 4.202   7.141   -10.940 1.00 0.51 ? 147 ARG A C    1  
ATOM 1380  O O    . ARG A 1 147 ? 5.054   8.022   -10.820 1.00 0.53 ? 147 ARG A O    1  
ATOM 1381  C CB   . ARG A 1 147 ? 2.403   7.625   -12.611 1.00 0.73 ? 147 ARG A CB   1  
ATOM 1382  C CG   . ARG A 1 147 ? 1.964   7.653   -14.070 1.00 0.88 ? 147 ARG A CG   1  
ATOM 1383  C CD   . ARG A 1 147 ? 2.889   8.510   -14.920 1.00 1.01 ? 147 ARG A CD   1  
ATOM 1384  N NE   . ARG A 1 147 ? 4.176   7.860   -15.155 1.00 1.03 ? 147 ARG A NE   1  
ATOM 1385  C CZ   . ARG A 1 147 ? 5.323   8.511   -15.322 1.00 1.32 ? 147 ARG A CZ   1  
ATOM 1386  N NH1  . ARG A 1 147 ? 5.350   9.836   -15.281 1.00 1.56 ? 147 ARG A NH1  1  
ATOM 1387  N NH2  . ARG A 1 147 ? 6.445   7.831   -15.519 1.00 1.59 ? 147 ARG A NH2  1  
ATOM 1388  H H    . ARG A 1 147 ? 2.889   4.866   -11.813 1.00 0.55 ? 147 ARG A H    1  
ATOM 1389  H HE   . ARG A 1 147 ? 4.183   6.871   -15.188 1.00 1.04 ? 147 ARG A HE   1  
ATOM 1390  H HH11 . ARG A 1 147 ? 4.505   10.351  -15.124 1.00 1.52 ? 147 ARG A HH11 1  
ATOM 1391  H HH12 . ARG A 1 147 ? 6.212   10.330  -15.416 1.00 1.88 ? 147 ARG A HH12 1  
ATOM 1392  H HH21 . ARG A 1 147 ? 6.431   6.827   -15.540 1.00 1.57 ? 147 ARG A HH21 1  
ATOM 1393  H HH22 . ARG A 1 147 ? 7.313   8.316   -15.654 1.00 1.91 ? 147 ARG A HH22 1  
ATOM 1394  N N    . LEU A 1 148 ? 3.722   6.449   -9.908  1.00 0.48 ? 148 LEU A N    1  
ATOM 1395  C CA   . LEU A 1 148 ? 4.126   6.725   -8.525  1.00 0.47 ? 148 LEU A CA   1  
ATOM 1396  C C    . LEU A 1 148 ? 5.641   6.783   -8.309  1.00 0.41 ? 148 LEU A C    1  
ATOM 1397  O O    . LEU A 1 148 ? 6.128   7.660   -7.593  1.00 0.44 ? 148 LEU A O    1  
ATOM 1398  C CB   . LEU A 1 148 ? 3.480   5.739   -7.548  1.00 0.50 ? 148 LEU A CB   1  
ATOM 1399  C CG   . LEU A 1 148 ? 2.223   6.224   -6.818  1.00 0.59 ? 148 LEU A CG   1  
ATOM 1400  C CD1  . LEU A 1 148 ? 2.519   7.480   -6.012  1.00 0.81 ? 148 LEU A CD1  1  
ATOM 1401  C CD2  . LEU A 1 148 ? 1.083   6.462   -7.793  1.00 0.74 ? 148 LEU A CD2  1  
ATOM 1402  H H    . LEU A 1 148 ? 3.082   5.729   -10.079 1.00 0.51 ? 148 LEU A H    1  
ATOM 1403  N N    . LEU A 1 149 ? 6.373   5.859   -8.925  1.00 0.37 ? 149 LEU A N    1  
ATOM 1404  C CA   . LEU A 1 149 ? 7.830   5.804   -8.792  1.00 0.35 ? 149 LEU A CA   1  
ATOM 1405  C C    . LEU A 1 149 ? 8.494   7.138   -9.136  1.00 0.38 ? 149 LEU A C    1  
ATOM 1406  O O    . LEU A 1 149 ? 9.466   7.540   -8.494  1.00 0.39 ? 149 LEU A O    1  
ATOM 1407  C CB   . LEU A 1 149 ? 8.415   4.681   -9.658  1.00 0.39 ? 149 LEU A CB   1  
ATOM 1408  C CG   . LEU A 1 149 ? 9.894   4.352   -9.426  1.00 0.46 ? 149 LEU A CG   1  
ATOM 1409  C CD1  . LEU A 1 149 ? 10.101  3.756   -8.043  1.00 0.52 ? 149 LEU A CD1  1  
ATOM 1410  C CD2  . LEU A 1 149 ? 10.419  3.413   -10.503 1.00 0.57 ? 149 LEU A CD2  1  
ATOM 1411  H H    . LEU A 1 149 ? 5.918   5.178   -9.468  1.00 0.37 ? 149 LEU A H    1  
ATOM 1412  N N    . GLY A 1 150 ? 7.946   7.831   -10.127 1.00 0.41 ? 150 GLY A N    1  
ATOM 1413  C CA   . GLY A 1 150 ? 8.500   9.105   -10.546 1.00 0.46 ? 150 GLY A CA   1  
ATOM 1414  C C    . GLY A 1 150 ? 8.376   10.179  -9.480  1.00 0.46 ? 150 GLY A C    1  
ATOM 1415  O O    . GLY A 1 150 ? 9.223   11.065  -9.377  1.00 0.52 ? 150 GLY A O    1  
ATOM 1416  H H    . GLY A 1 150 ? 7.146   7.478   -10.570 1.00 0.43 ? 150 GLY A H    1  
ATOM 1417  N N    . TRP A 1 151 ? 7.326   10.099  -8.676  1.00 0.43 ? 151 TRP A N    1  
ATOM 1418  C CA   . TRP A 1 151 ? 7.106   11.076  -7.620  1.00 0.45 ? 151 TRP A CA   1  
ATOM 1419  C C    . TRP A 1 151 ? 7.906   10.720  -6.371  1.00 0.42 ? 151 TRP A C    1  
ATOM 1420  O O    . TRP A 1 151 ? 8.395   11.603  -5.660  1.00 0.44 ? 151 TRP A O    1  
ATOM 1421  C CB   . TRP A 1 151 ? 5.615   11.192  -7.293  1.00 0.50 ? 151 TRP A CB   1  
ATOM 1422  C CG   . TRP A 1 151 ? 5.287   12.313  -6.349  1.00 0.52 ? 151 TRP A CG   1  
ATOM 1423  C CD1  . TRP A 1 151 ? 5.774   13.589  -6.387  1.00 0.61 ? 151 TRP A CD1  1  
ATOM 1424  C CD2  . TRP A 1 151 ? 4.400   12.256  -5.227  1.00 0.52 ? 151 TRP A CD2  1  
ATOM 1425  N NE1  . TRP A 1 151 ? 5.250   14.327  -5.357  1.00 0.63 ? 151 TRP A NE1  1  
ATOM 1426  C CE2  . TRP A 1 151 ? 4.399   13.533  -4.631  1.00 0.57 ? 151 TRP A CE2  1  
ATOM 1427  C CE3  . TRP A 1 151 ? 3.603   11.250  -4.672  1.00 0.59 ? 151 TRP A CE3  1  
ATOM 1428  C CZ2  . TRP A 1 151 ? 3.637   13.826  -3.504  1.00 0.63 ? 151 TRP A CZ2  1  
ATOM 1429  C CZ3  . TRP A 1 151 ? 2.846   11.546  -3.555  1.00 0.70 ? 151 TRP A CZ3  1  
ATOM 1430  C CH2  . TRP A 1 151 ? 2.868   12.824  -2.984  1.00 0.70 ? 151 TRP A CH2  1  
ATOM 1431  H H    . TRP A 1 151 ? 6.684   9.369   -8.795  1.00 0.43 ? 151 TRP A H    1  
ATOM 1432  H HE1  . TRP A 1 151 ? 5.449   15.273  -5.172  1.00 0.71 ? 151 TRP A HE1  1  
ATOM 1433  N N    . ILE A 1 152 ? 8.053   9.428   -6.110  1.00 0.40 ? 152 ILE A N    1  
ATOM 1434  C CA   . ILE A 1 152 ? 8.798   8.972   -4.942  1.00 0.40 ? 152 ILE A CA   1  
ATOM 1435  C C    . ILE A 1 152 ? 10.292  9.245   -5.105  1.00 0.40 ? 152 ILE A C    1  
ATOM 1436  O O    . ILE A 1 152 ? 10.972  9.609   -4.147  1.00 0.45 ? 152 ILE A O    1  
ATOM 1437  C CB   . ILE A 1 152 ? 8.565   7.475   -4.644  1.00 0.40 ? 152 ILE A CB   1  
ATOM 1438  C CG1  . ILE A 1 152 ? 7.067   7.152   -4.632  1.00 0.46 ? 152 ILE A CG1  1  
ATOM 1439  C CG2  . ILE A 1 152 ? 9.204   7.082   -3.317  1.00 0.42 ? 152 ILE A CG2  1  
ATOM 1440  C CD1  . ILE A 1 152 ? 6.267   7.929   -3.604  1.00 0.51 ? 152 ILE A CD1  1  
ATOM 1441  H H    . ILE A 1 152 ? 7.644   8.766   -6.711  1.00 0.41 ? 152 ILE A H    1  
ATOM 1442  N N    . GLN A 1 153 ? 10.797  9.078   -6.321  1.00 0.41 ? 153 GLN A N    1  
ATOM 1443  C CA   . GLN A 1 153 ? 12.208  9.317   -6.591  1.00 0.46 ? 153 GLN A CA   1  
ATOM 1444  C C    . GLN A 1 153 ? 12.542  10.797  -6.422  1.00 0.50 ? 153 GLN A C    1  
ATOM 1445  O O    . GLN A 1 153 ? 13.566  11.150  -5.838  1.00 0.56 ? 153 GLN A O    1  
ATOM 1446  C CB   . GLN A 1 153 ? 12.574  8.843   -8.002  1.00 0.52 ? 153 GLN A CB   1  
ATOM 1447  C CG   . GLN A 1 153 ? 14.068  8.669   -8.244  1.00 0.73 ? 153 GLN A CG   1  
ATOM 1448  C CD   . GLN A 1 153 ? 14.703  9.858   -8.948  1.00 0.99 ? 153 GLN A CD   1  
ATOM 1449  O OE1  . GLN A 1 153 ? 14.760  9.909   -10.177 1.00 1.17 ? 153 GLN A OE1  1  
ATOM 1450  N NE2  . GLN A 1 153 ? 15.185  10.821  -8.181  1.00 1.42 ? 153 GLN A NE2  1  
ATOM 1451  H H    . GLN A 1 153 ? 10.209  8.782   -7.053  1.00 0.41 ? 153 GLN A H    1  
ATOM 1452  H HE21 . GLN A 1 153 ? 15.108  10.727  -7.204  1.00 1.53 ? 153 GLN A HE21 1  
ATOM 1453  H HE22 . GLN A 1 153 ? 15.597  11.596  -8.617  1.00 1.74 ? 153 GLN A HE22 1  
ATOM 1454  N N    . ASP A 1 154 ? 11.649  11.652  -6.909  1.00 0.52 ? 154 ASP A N    1  
ATOM 1455  C CA   . ASP A 1 154 ? 11.842  13.101  -6.840  1.00 0.61 ? 154 ASP A CA   1  
ATOM 1456  C C    . ASP A 1 154 ? 11.979  13.602  -5.403  1.00 0.59 ? 154 ASP A C    1  
ATOM 1457  O O    . ASP A 1 154 ? 12.830  14.440  -5.107  1.00 0.65 ? 154 ASP A O    1  
ATOM 1458  C CB   . ASP A 1 154 ? 10.697  13.829  -7.551  1.00 0.72 ? 154 ASP A CB   1  
ATOM 1459  C CG   . ASP A 1 154 ? 10.649  15.310  -7.225  1.00 0.79 ? 154 ASP A CG   1  
ATOM 1460  O OD1  . ASP A 1 154 ? 11.584  16.042  -7.611  1.00 1.00 ? 154 ASP A OD1  1  
ATOM 1461  O OD2  . ASP A 1 154 ? 9.666   15.748  -6.588  1.00 1.08 ? 154 ASP A OD2  1  
ATOM 1462  H H    . ASP A 1 154 ? 10.834  11.302  -7.323  1.00 0.52 ? 154 ASP A H    1  
ATOM 1463  N N    . GLN A 1 155 ? 11.159  13.068  -4.507  1.00 0.54 ? 155 GLN A N    1  
ATOM 1464  C CA   . GLN A 1 155 ? 11.179  13.488  -3.107  1.00 0.56 ? 155 GLN A CA   1  
ATOM 1465  C C    . GLN A 1 155 ? 12.311  12.841  -2.305  1.00 0.54 ? 155 GLN A C    1  
ATOM 1466  O O    . GLN A 1 155 ? 12.377  12.986  -1.082  1.00 0.65 ? 155 GLN A O    1  
ATOM 1467  C CB   . GLN A 1 155 ? 9.827   13.250  -2.438  1.00 0.58 ? 155 GLN A CB   1  
ATOM 1468  C CG   . GLN A 1 155 ? 9.386   11.800  -2.415  1.00 0.52 ? 155 GLN A CG   1  
ATOM 1469  C CD   . GLN A 1 155 ? 7.936   11.649  -2.015  1.00 0.58 ? 155 GLN A CD   1  
ATOM 1470  O OE1  . GLN A 1 155 ? 7.615   11.533  -0.833  1.00 0.70 ? 155 GLN A OE1  1  
ATOM 1471  N NE2  . GLN A 1 155 ? 7.050   11.663  -2.999  1.00 0.56 ? 155 GLN A NE2  1  
ATOM 1472  H H    . GLN A 1 155 ? 10.524  12.377  -4.791  1.00 0.52 ? 155 GLN A H    1  
ATOM 1473  H HE21 . GLN A 1 155 ? 7.382   11.774  -3.920  1.00 0.53 ? 155 GLN A HE21 1  
ATOM 1474  H HE22 . GLN A 1 155 ? 6.104   11.556  -2.773  1.00 0.63 ? 155 GLN A HE22 1  
ATOM 1475  N N    . GLY A 1 156 ? 13.197  12.135  -2.990  1.00 0.51 ? 156 GLY A N    1  
ATOM 1476  C CA   . GLY A 1 156 ? 14.319  11.504  -2.322  1.00 0.53 ? 156 GLY A CA   1  
ATOM 1477  C C    . GLY A 1 156 ? 13.942  10.238  -1.579  1.00 0.51 ? 156 GLY A C    1  
ATOM 1478  O O    . GLY A 1 156 ? 14.363  10.028  -0.439  1.00 0.67 ? 156 GLY A O    1  
ATOM 1479  H H    . GLY A 1 156 ? 13.091  12.041  -3.959  1.00 0.56 ? 156 GLY A H    1  
ATOM 1480  N N    . GLY A 1 157 ? 13.137  9.402   -2.214  1.00 0.51 ? 157 GLY A N    1  
ATOM 1481  C CA   . GLY A 1 157 ? 12.730  8.156   -1.597  1.00 0.53 ? 157 GLY A CA   1  
ATOM 1482  C C    . GLY A 1 157 ? 11.513  8.327   -0.714  1.00 0.47 ? 157 GLY A C    1  
ATOM 1483  O O    . GLY A 1 157 ? 10.672  9.187   -0.967  1.00 0.49 ? 157 GLY A O    1  
ATOM 1484  H H    . GLY A 1 157 ? 12.792  9.644   -3.100  1.00 0.62 ? 157 GLY A H    1  
ATOM 1485  N N    . TRP A 1 158 ? 11.434  7.532   0.342   1.00 0.48 ? 158 TRP A N    1  
ATOM 1486  C CA   . TRP A 1 158 ? 10.305  7.590   1.261   1.00 0.45 ? 158 TRP A CA   1  
ATOM 1487  C C    . TRP A 1 158 ? 10.505  8.670   2.322   1.00 0.51 ? 158 TRP A C    1  
ATOM 1488  O O    . TRP A 1 158 ? 9.819   8.685   3.349   1.00 0.53 ? 158 TRP A O    1  
ATOM 1489  C CB   . TRP A 1 158 ? 10.071  6.223   1.909   1.00 0.48 ? 158 TRP A CB   1  
ATOM 1490  C CG   . TRP A 1 158 ? 9.822   5.129   0.911   1.00 0.48 ? 158 TRP A CG   1  
ATOM 1491  C CD1  . TRP A 1 158 ? 10.698  4.154   0.525   1.00 0.53 ? 158 TRP A CD1  1  
ATOM 1492  C CD2  . TRP A 1 158 ? 8.619   4.905   0.162   1.00 0.49 ? 158 TRP A CD2  1  
ATOM 1493  N NE1  . TRP A 1 158 ? 10.116  3.338   -0.415  1.00 0.57 ? 158 TRP A NE1  1  
ATOM 1494  C CE2  . TRP A 1 158 ? 8.840   3.777   -0.655  1.00 0.54 ? 158 TRP A CE2  1  
ATOM 1495  C CE3  . TRP A 1 158 ? 7.379   5.548   0.101   1.00 0.51 ? 158 TRP A CE3  1  
ATOM 1496  C CZ2  . TRP A 1 158 ? 7.865   3.278   -1.518  1.00 0.60 ? 158 TRP A CZ2  1  
ATOM 1497  C CZ3  . TRP A 1 158 ? 6.414   5.052   -0.756  1.00 0.56 ? 158 TRP A CZ3  1  
ATOM 1498  C CH2  . TRP A 1 158 ? 6.662   3.929   -1.554  1.00 0.60 ? 158 TRP A CH2  1  
ATOM 1499  H H    . TRP A 1 158 ? 12.153  6.887   0.511   1.00 0.54 ? 158 TRP A H    1  
ATOM 1500  H HE1  . TRP A 1 158 ? 10.544  2.566   -0.843  1.00 0.64 ? 158 TRP A HE1  1  
ATOM 1501  N N    . ASP A 1 159 ? 11.435  9.583   2.058   1.00 0.57 ? 159 ASP A N    1  
ATOM 1502  C CA   . ASP A 1 159 ? 11.719  10.677  2.977   1.00 0.65 ? 159 ASP A CA   1  
ATOM 1503  C C    . ASP A 1 159 ? 10.490  11.563  3.133   1.00 0.59 ? 159 ASP A C    1  
ATOM 1504  O O    . ASP A 1 159 ? 10.202  12.062  4.220   1.00 0.61 ? 159 ASP A O    1  
ATOM 1505  C CB   . ASP A 1 159 ? 12.910  11.506  2.489   1.00 0.77 ? 159 ASP A CB   1  
ATOM 1506  C CG   . ASP A 1 159 ? 13.188  12.705  3.377   1.00 0.97 ? 159 ASP A CG   1  
ATOM 1507  O OD1  . ASP A 1 159 ? 13.773  12.524  4.466   1.00 1.17 ? 159 ASP A OD1  1  
ATOM 1508  O OD2  . ASP A 1 159 ? 12.815  13.830  2.991   1.00 1.15 ? 159 ASP A OD2  1  
ATOM 1509  H H    . ASP A 1 159 ? 11.940  9.519   1.219   1.00 0.59 ? 159 ASP A H    1  
ATOM 1510  N N    . GLY A 1 160 ? 9.757   11.732  2.037   1.00 0.55 ? 160 GLY A N    1  
ATOM 1511  C CA   . GLY A 1 160 ? 8.555   12.540  2.065   1.00 0.52 ? 160 GLY A CA   1  
ATOM 1512  C C    . GLY A 1 160 ? 7.509   11.936  2.976   1.00 0.47 ? 160 GLY A C    1  
ATOM 1513  O O    . GLY A 1 160 ? 6.853   12.646  3.736   1.00 0.49 ? 160 GLY A O    1  
ATOM 1514  H H    . GLY A 1 160 ? 10.036  11.303  1.200   1.00 0.55 ? 160 GLY A H    1  
ATOM 1515  N N    . LEU A 1 161 ? 7.378   10.615  2.920   1.00 0.46 ? 161 LEU A N    1  
ATOM 1516  C CA   . LEU A 1 161 ? 6.417   9.900   3.752   1.00 0.47 ? 161 LEU A CA   1  
ATOM 1517  C C    . LEU A 1 161 ? 6.807   10.010  5.223   1.00 0.52 ? 161 LEU A C    1  
ATOM 1518  O O    . LEU A 1 161 ? 5.959   10.234  6.088   1.00 0.55 ? 161 LEU A O    1  
ATOM 1519  C CB   . LEU A 1 161 ? 6.343   8.428   3.331   1.00 0.51 ? 161 LEU A CB   1  
ATOM 1520  C CG   . LEU A 1 161 ? 5.387   7.538   4.129   1.00 0.60 ? 161 LEU A CG   1  
ATOM 1521  C CD1  . LEU A 1 161 ? 3.952   8.027   3.996   1.00 0.62 ? 161 LEU A CD1  1  
ATOM 1522  C CD2  . LEU A 1 161 ? 5.505   6.091   3.679   1.00 0.67 ? 161 LEU A CD2  1  
ATOM 1523  H H    . LEU A 1 161 ? 7.943   10.108  2.304   1.00 0.47 ? 161 LEU A H    1  
ATOM 1524  N N    . LEU A 1 162 ? 8.102   9.884   5.493   1.00 0.56 ? 162 LEU A N    1  
ATOM 1525  C CA   . LEU A 1 162 ? 8.619   9.974   6.854   1.00 0.64 ? 162 LEU A CA   1  
ATOM 1526  C C    . LEU A 1 162 ? 8.430   11.380  7.424   1.00 0.64 ? 162 LEU A C    1  
ATOM 1527  O O    . LEU A 1 162 ? 8.384   11.568  8.639   1.00 0.72 ? 162 LEU A O    1  
ATOM 1528  C CB   . LEU A 1 162 ? 10.099  9.581   6.895   1.00 0.71 ? 162 LEU A CB   1  
ATOM 1529  C CG   . LEU A 1 162 ? 10.414  8.099   6.677   1.00 0.81 ? 162 LEU A CG   1  
ATOM 1530  C CD1  . LEU A 1 162 ? 11.903  7.897   6.449   1.00 0.90 ? 162 LEU A CD1  1  
ATOM 1531  C CD2  . LEU A 1 162 ? 9.939   7.267   7.860   1.00 0.87 ? 162 LEU A CD2  1  
ATOM 1532  H H    . LEU A 1 162 ? 8.728   9.718   4.754   1.00 0.56 ? 162 LEU A H    1  
ATOM 1533  N N    . SER A 1 163 ? 8.324   12.361  6.541   1.00 0.59 ? 163 SER A N    1  
ATOM 1534  C CA   . SER A 1 163 ? 8.141   13.746  6.954   1.00 0.62 ? 163 SER A CA   1  
ATOM 1535  C C    . SER A 1 163 ? 6.661   14.119  6.981   1.00 0.60 ? 163 SER A C    1  
ATOM 1536  O O    . SER A 1 163 ? 6.267   15.099  7.611   1.00 0.67 ? 163 SER A O    1  
ATOM 1537  C CB   . SER A 1 163 ? 8.912   14.672  6.017   1.00 0.65 ? 163 SER A CB   1  
ATOM 1538  O OG   . SER A 1 163 ? 10.231  14.191  5.815   1.00 0.69 ? 163 SER A OG   1  
ATOM 1539  H H    . SER A 1 163 ? 8.376   12.151  5.585   1.00 0.58 ? 163 SER A H    1  
ATOM 1540  H HG   . SER A 1 163 ? 10.229  13.547  5.091   1.00 0.78 ? 163 SER A HG   1  
ATOM 1541  N N    . TYR A 1 164 ? 5.846   13.327  6.297   1.00 0.57 ? 164 TYR A N    1  
ATOM 1542  C CA   . TYR A 1 164 ? 4.409   13.566  6.240   1.00 0.57 ? 164 TYR A CA   1  
ATOM 1543  C C    . TYR A 1 164 ? 3.744   13.110  7.534   1.00 0.56 ? 164 TYR A C    1  
ATOM 1544  O O    . TYR A 1 164 ? 2.661   13.577  7.890   1.00 0.58 ? 164 TYR A O    1  
ATOM 1545  C CB   . TYR A 1 164 ? 3.796   12.834  5.042   1.00 0.57 ? 164 TYR A CB   1  
ATOM 1546  C CG   . TYR A 1 164 ? 2.398   13.287  4.687   1.00 0.65 ? 164 TYR A CG   1  
ATOM 1547  C CD1  . TYR A 1 164 ? 2.167   14.567  4.203   1.00 0.72 ? 164 TYR A CD1  1  
ATOM 1548  C CD2  . TYR A 1 164 ? 1.307   12.436  4.836   1.00 0.73 ? 164 TYR A CD2  1  
ATOM 1549  C CE1  . TYR A 1 164 ? 0.892   14.990  3.878   1.00 0.84 ? 164 TYR A CE1  1  
ATOM 1550  C CE2  . TYR A 1 164 ? 0.030   12.851  4.512   1.00 0.83 ? 164 TYR A CE2  1  
ATOM 1551  C CZ   . TYR A 1 164 ? -0.173  14.129  4.033   1.00 0.86 ? 164 TYR A CZ   1  
ATOM 1552  O OH   . TYR A 1 164 ? -1.443  14.549  3.703   1.00 0.99 ? 164 TYR A OH   1  
ATOM 1553  H H    . TYR A 1 164 ? 6.222   12.563  5.808   1.00 0.59 ? 164 TYR A H    1  
ATOM 1554  H HH   . TYR A 1 164 ? -1.442  14.878  2.795   1.00 0.96 ? 164 TYR A HH   1  
ATOM 1555  N N    . PHE A 1 165 ? 4.401   12.193  8.229   1.00 0.56 ? 165 PHE A N    1  
ATOM 1556  C CA   . PHE A 1 165 ? 3.889   11.673  9.486   1.00 0.58 ? 165 PHE A CA   1  
ATOM 1557  C C    . PHE A 1 165 ? 3.961   12.748  10.567  1.00 0.61 ? 165 PHE A C    1  
ATOM 1558  O O    . PHE A 1 165 ? 5.019   12.986  11.156  1.00 0.69 ? 165 PHE A O    1  
ATOM 1559  C CB   . PHE A 1 165 ? 4.672   10.427  9.916   1.00 0.63 ? 165 PHE A CB   1  
ATOM 1560  C CG   . PHE A 1 165 ? 4.199   9.813   11.209  1.00 0.63 ? 165 PHE A CG   1  
ATOM 1561  C CD1  . PHE A 1 165 ? 2.927   9.275   11.316  1.00 0.62 ? 165 PHE A CD1  1  
ATOM 1562  C CD2  . PHE A 1 165 ? 5.030   9.777   12.320  1.00 0.72 ? 165 PHE A CD2  1  
ATOM 1563  C CE1  . PHE A 1 165 ? 2.494   8.713   12.503  1.00 0.65 ? 165 PHE A CE1  1  
ATOM 1564  C CE2  . PHE A 1 165 ? 4.603   9.217   13.509  1.00 0.74 ? 165 PHE A CE2  1  
ATOM 1565  C CZ   . PHE A 1 165 ? 3.333   8.685   13.601  1.00 0.67 ? 165 PHE A CZ   1  
ATOM 1566  H H    . PHE A 1 165 ? 5.258   11.864  7.891   1.00 0.59 ? 165 PHE A H    1  
ATOM 1567  N N    . GLY A 1 166 ? 2.841   13.412  10.800  1.00 0.63 ? 166 GLY A N    1  
ATOM 1568  C CA   . GLY A 1 166 ? 2.790   14.451  11.802  1.00 0.70 ? 166 GLY A CA   1  
ATOM 1569  C C    . GLY A 1 166 ? 2.102   13.989  13.068  1.00 0.73 ? 166 GLY A C    1  
ATOM 1570  O O    . GLY A 1 166 ? 2.018   12.790  13.337  1.00 1.05 ? 166 GLY A O    1  
ATOM 1571  H H    . GLY A 1 166 ? 2.041   13.198  10.278  1.00 0.67 ? 166 GLY A H    1  
ATOM 1572  N N    . THR A 1 167 ? 1.612   14.937  13.850  1.00 0.65 ? 167 THR A N    1  
ATOM 1573  C CA   . THR A 1 167 ? 0.929   14.626  15.101  1.00 0.67 ? 167 THR A CA   1  
ATOM 1574  C C    . THR A 1 167 ? -0.108  15.699  15.466  1.00 0.66 ? 167 THR A C    1  
ATOM 1575  O O    . THR A 1 167 ? -1.280  15.379  15.662  1.00 0.68 ? 167 THR A O    1  
ATOM 1576  C CB   . THR A 1 167 ? 1.923   14.404  16.268  1.00 0.74 ? 167 THR A CB   1  
ATOM 1577  O OG1  . THR A 1 167 ? 2.935   13.469  15.859  1.00 0.89 ? 167 THR A OG1  1  
ATOM 1578  C CG2  . THR A 1 167 ? 1.204   13.858  17.495  1.00 0.86 ? 167 THR A CG2  1  
ATOM 1579  H H    . THR A 1 167 ? 1.705   15.874  13.579  1.00 0.77 ? 167 THR A H    1  
ATOM 1580  H HG1  . THR A 1 167 ? 2.641   13.021  15.050  1.00 1.05 ? 167 THR A HG1  1  
ATOM 1581  N N    . PRO A 1 168 ? 0.294   16.987  15.565  1.00 0.68 ? 168 PRO A N    1  
ATOM 1582  C CA   . PRO A 1 168 ? -0.639  18.073  15.900  1.00 0.71 ? 168 PRO A CA   1  
ATOM 1583  C C    . PRO A 1 168 ? -1.763  18.205  14.876  1.00 0.67 ? 168 PRO A C    1  
ATOM 1584  O O    . PRO A 1 168 ? -1.520  18.184  13.670  1.00 0.70 ? 168 PRO A O    1  
ATOM 1585  C CB   . PRO A 1 168 ? 0.237   19.327  15.878  1.00 0.77 ? 168 PRO A CB   1  
ATOM 1586  C CG   . PRO A 1 168 ? 1.621   18.822  16.081  1.00 0.81 ? 168 PRO A CG   1  
ATOM 1587  C CD   . PRO A 1 168 ? 1.669   17.494  15.391  1.00 0.70 ? 168 PRO A CD   1  
ATOM 1588  N N    . THR A 1 169 ? -2.989  18.335  15.374  1.00 0.68 ? 169 THR A N    1  
ATOM 1589  C CA   . THR A 1 169 ? -4.173  18.479  14.526  1.00 0.71 ? 169 THR A CA   1  
ATOM 1590  C C    . THR A 1 169 ? -4.377  17.254  13.628  1.00 0.61 ? 169 THR A C    1  
ATOM 1591  O O    . THR A 1 169 ? -4.877  17.361  12.507  1.00 0.62 ? 169 THR A O    1  
ATOM 1592  C CB   . THR A 1 169 ? -4.124  19.767  13.674  1.00 0.85 ? 169 THR A CB   1  
ATOM 1593  O OG1  . THR A 1 169 ? -3.332  20.761  14.345  1.00 1.01 ? 169 THR A OG1  1  
ATOM 1594  C CG2  . THR A 1 169 ? -5.528  20.315  13.478  1.00 1.02 ? 169 THR A CG2  1  
ATOM 1595  H H    . THR A 1 169 ? -3.105  18.322  16.348  1.00 0.72 ? 169 THR A H    1  
ATOM 1596  H HG1  . THR A 1 169 ? -2.952  20.374  15.141  1.00 1.43 ? 169 THR A HG1  1  
ATOM 1597  N N    . TRP A 1 170 ? -3.998  16.086  14.142  1.00 0.58 ? 170 TRP A N    1  
ATOM 1598  C CA   . TRP A 1 170 ? -4.128  14.835  13.396  1.00 0.54 ? 170 TRP A CA   1  
ATOM 1599  C C    . TRP A 1 170 ? -5.596  14.503  13.123  1.00 0.52 ? 170 TRP A C    1  
ATOM 1600  O O    . TRP A 1 170 ? -5.912  13.744  12.204  1.00 0.49 ? 170 TRP A O    1  
ATOM 1601  C CB   . TRP A 1 170 ? -3.442  13.684  14.145  1.00 0.59 ? 170 TRP A CB   1  
ATOM 1602  C CG   . TRP A 1 170 ? -4.301  13.018  15.181  1.00 0.72 ? 170 TRP A CG   1  
ATOM 1603  C CD1  . TRP A 1 170 ? -4.839  11.765  15.111  1.00 0.94 ? 170 TRP A CD1  1  
ATOM 1604  C CD2  . TRP A 1 170 ? -4.730  13.569  16.432  1.00 0.83 ? 170 TRP A CD2  1  
ATOM 1605  N NE1  . TRP A 1 170 ? -5.575  11.502  16.239  1.00 1.08 ? 170 TRP A NE1  1  
ATOM 1606  C CE2  . TRP A 1 170 ? -5.524  12.593  17.066  1.00 1.03 ? 170 TRP A CE2  1  
ATOM 1607  C CE3  . TRP A 1 170 ? -4.521  14.791  17.078  1.00 0.95 ? 170 TRP A CE3  1  
ATOM 1608  C CZ2  . TRP A 1 170 ? -6.106  12.800  18.312  1.00 1.25 ? 170 TRP A CZ2  1  
ATOM 1609  C CZ3  . TRP A 1 170 ? -5.099  14.995  18.316  1.00 1.22 ? 170 TRP A CZ3  1  
ATOM 1610  C CH2  . TRP A 1 170 ? -5.883  14.007  18.919  1.00 1.33 ? 170 TRP A CH2  1  
ATOM 1611  H H    . TRP A 1 170 ? -3.604  16.067  15.040  1.00 0.63 ? 170 TRP A H    1  
ATOM 1612  H HE1  . TRP A 1 170 ? -6.060  10.665  16.422  1.00 1.27 ? 170 TRP A HE1  1  
ATOM 1613  N N    . GLN A 1 171 ? -6.484  15.084  13.922  1.00 0.55 ? 171 GLN A N    1  
ATOM 1614  C CA   . GLN A 1 171 ? -7.916  14.857  13.780  1.00 0.58 ? 171 GLN A CA   1  
ATOM 1615  C C    . GLN A 1 171 ? -8.392  15.306  12.404  1.00 0.54 ? 171 GLN A C    1  
ATOM 1616  O O    . GLN A 1 171 ? -9.144  14.598  11.736  1.00 0.51 ? 171 GLN A O    1  
ATOM 1617  C CB   . GLN A 1 171 ? -8.677  15.595  14.880  1.00 0.65 ? 171 GLN A CB   1  
ATOM 1618  C CG   . GLN A 1 171 ? -10.117 15.145  15.059  1.00 0.82 ? 171 GLN A CG   1  
ATOM 1619  C CD   . GLN A 1 171 ? -10.689 15.597  16.386  1.00 1.09 ? 171 GLN A CD   1  
ATOM 1620  O OE1  . GLN A 1 171 ? -11.218 16.704  16.506  1.00 1.33 ? 171 GLN A OE1  1  
ATOM 1621  N NE2  . GLN A 1 171 ? -10.583 14.746  17.394  1.00 1.37 ? 171 GLN A NE2  1  
ATOM 1622  H H    . GLN A 1 171 ? -6.165  15.686  14.627  1.00 0.59 ? 171 GLN A H    1  
ATOM 1623  H HE21 . GLN A 1 171 ? -10.154 13.881  17.226  1.00 1.45 ? 171 GLN A HE21 1  
ATOM 1624  H HE22 . GLN A 1 171 ? -10.930 15.018  18.270  1.00 1.64 ? 171 GLN A HE22 1  
ATOM 1625  N N    . THR A 1 172 ? -7.930  16.475  11.975  1.00 0.56 ? 172 THR A N    1  
ATOM 1626  C CA   . THR A 1 172 ? -8.291  17.007  10.673  1.00 0.56 ? 172 THR A CA   1  
ATOM 1627  C C    . THR A 1 172 ? -7.750  16.104  9.571   1.00 0.52 ? 172 THR A C    1  
ATOM 1628  O O    . THR A 1 172 ? -8.394  15.905  8.543   1.00 0.52 ? 172 THR A O    1  
ATOM 1629  C CB   . THR A 1 172 ? -7.742  18.430  10.489  1.00 0.62 ? 172 THR A CB   1  
ATOM 1630  O OG1  . THR A 1 172 ? -7.886  19.144  11.722  1.00 0.72 ? 172 THR A OG1  1  
ATOM 1631  C CG2  . THR A 1 172 ? -8.506  19.162  9.394   1.00 0.75 ? 172 THR A CG2  1  
ATOM 1632  H H    . THR A 1 172 ? -7.336  16.999  12.553  1.00 0.59 ? 172 THR A H    1  
ATOM 1633  H HG1  . THR A 1 172 ? -7.976  20.084  11.535  1.00 1.20 ? 172 THR A HG1  1  
ATOM 1634  N N    . VAL A 1 173 ? -6.570  15.543  9.810   1.00 0.53 ? 173 VAL A N    1  
ATOM 1635  C CA   . VAL A 1 173 ? -5.944  14.639  8.856   1.00 0.52 ? 173 VAL A CA   1  
ATOM 1636  C C    . VAL A 1 173 ? -6.795  13.380  8.707   1.00 0.49 ? 173 VAL A C    1  
ATOM 1637  O O    . VAL A 1 173 ? -6.937  12.834  7.613   1.00 0.47 ? 173 VAL A O    1  
ATOM 1638  C CB   . VAL A 1 173 ? -4.518  14.249  9.301   1.00 0.56 ? 173 VAL A CB   1  
ATOM 1639  C CG1  . VAL A 1 173 ? -3.831  13.407  8.236   1.00 0.57 ? 173 VAL A CG1  1  
ATOM 1640  C CG2  . VAL A 1 173 ? -3.700  15.495  9.610   1.00 0.60 ? 173 VAL A CG2  1  
ATOM 1641  H H    . VAL A 1 173 ? -6.109  15.743  10.653  1.00 0.57 ? 173 VAL A H    1  
ATOM 1642  N N    . THR A 1 174 ? -7.379  12.941  9.816   1.00 0.49 ? 174 THR A N    1  
ATOM 1643  C CA   . THR A 1 174 ? -8.232  11.764  9.817   1.00 0.48 ? 174 THR A CA   1  
ATOM 1644  C C    . THR A 1 174 ? -9.471  12.031  8.962   1.00 0.47 ? 174 THR A C    1  
ATOM 1645  O O    . THR A 1 174 ? -9.886  11.188  8.162   1.00 0.47 ? 174 THR A O    1  
ATOM 1646  C CB   . THR A 1 174 ? -8.664  11.399  11.252  1.00 0.50 ? 174 THR A CB   1  
ATOM 1647  O OG1  . THR A 1 174 ? -7.519  11.439  12.121  1.00 0.58 ? 174 THR A OG1  1  
ATOM 1648  C CG2  . THR A 1 174 ? -9.273  10.005  11.293  1.00 0.54 ? 174 THR A CG2  1  
ATOM 1649  H H    . THR A 1 174 ? -7.232  13.427  10.654  1.00 0.52 ? 174 THR A H    1  
ATOM 1650  H HG1  . THR A 1 174 ? -6.879  12.078  11.788  1.00 1.09 ? 174 THR A HG1  1  
ATOM 1651  N N    . ILE A 1 175 ? -10.041 13.222  9.129   1.00 0.48 ? 175 ILE A N    1  
ATOM 1652  C CA   . ILE A 1 175 ? -11.220 13.629  8.368   1.00 0.49 ? 175 ILE A CA   1  
ATOM 1653  C C    . ILE A 1 175 ? -10.859 13.768  6.892   1.00 0.46 ? 175 ILE A C    1  
ATOM 1654  O O    . ILE A 1 175 ? -11.658 13.459  6.008   1.00 0.45 ? 175 ILE A O    1  
ATOM 1655  C CB   . ILE A 1 175 ? -11.787 14.968  8.890   1.00 0.54 ? 175 ILE A CB   1  
ATOM 1656  C CG1  . ILE A 1 175 ? -12.054 14.881  10.393  1.00 0.57 ? 175 ILE A CG1  1  
ATOM 1657  C CG2  . ILE A 1 175 ? -13.062 15.345  8.149   1.00 0.59 ? 175 ILE A CG2  1  
ATOM 1658  C CD1  . ILE A 1 175 ? -12.297 16.224  11.051  1.00 0.64 ? 175 ILE A CD1  1  
ATOM 1659  H H    . ILE A 1 175 ? -9.658  13.844  9.785   1.00 0.49 ? 175 ILE A H    1  
ATOM 1660  N N    . PHE A 1 176 ? -9.640  14.227  6.641   1.00 0.45 ? 176 PHE A N    1  
ATOM 1661  C CA   . PHE A 1 176 ? -9.141  14.398  5.285   1.00 0.43 ? 176 PHE A CA   1  
ATOM 1662  C C    . PHE A 1 176 ? -9.108  13.058  4.557   1.00 0.40 ? 176 PHE A C    1  
ATOM 1663  O O    . PHE A 1 176 ? -9.648  12.927  3.459   1.00 0.40 ? 176 PHE A O    1  
ATOM 1664  C CB   . PHE A 1 176 ? -7.742  15.023  5.323   1.00 0.45 ? 176 PHE A CB   1  
ATOM 1665  C CG   . PHE A 1 176 ? -7.104  15.205  3.975   1.00 0.49 ? 176 PHE A CG   1  
ATOM 1666  C CD1  . PHE A 1 176 ? -7.545  16.193  3.113   1.00 0.54 ? 176 PHE A CD1  1  
ATOM 1667  C CD2  . PHE A 1 176 ? -6.058  14.388  3.574   1.00 0.53 ? 176 PHE A CD2  1  
ATOM 1668  C CE1  . PHE A 1 176 ? -6.959  16.365  1.874   1.00 0.62 ? 176 PHE A CE1  1  
ATOM 1669  C CE2  . PHE A 1 176 ? -5.466  14.554  2.337   1.00 0.60 ? 176 PHE A CE2  1  
ATOM 1670  C CZ   . PHE A 1 176 ? -5.918  15.545  1.485   1.00 0.64 ? 176 PHE A CZ   1  
ATOM 1671  H H    . PHE A 1 176 ? -9.061  14.469  7.395   1.00 0.46 ? 176 PHE A H    1  
ATOM 1672  N N    . VAL A 1 177 ? -8.490  12.061  5.188   1.00 0.40 ? 177 VAL A N    1  
ATOM 1673  C CA   . VAL A 1 177 ? -8.389  10.726  4.608   1.00 0.38 ? 177 VAL A CA   1  
ATOM 1674  C C    . VAL A 1 177 ? -9.778  10.132  4.373   1.00 0.38 ? 177 VAL A C    1  
ATOM 1675  O O    . VAL A 1 177 ? -10.057 9.573   3.308   1.00 0.38 ? 177 VAL A O    1  
ATOM 1676  C CB   . VAL A 1 177 ? -7.564  9.776   5.507   1.00 0.40 ? 177 VAL A CB   1  
ATOM 1677  C CG1  . VAL A 1 177 ? -7.493  8.379   4.905   1.00 0.41 ? 177 VAL A CG1  1  
ATOM 1678  C CG2  . VAL A 1 177 ? -6.163  10.330  5.727   1.00 0.42 ? 177 VAL A CG2  1  
ATOM 1679  H H    . VAL A 1 177 ? -8.086  12.233  6.067   1.00 0.41 ? 177 VAL A H    1  
ATOM 1680  N N    . ALA A 1 178 ? -10.649 10.275  5.368   1.00 0.40 ? 178 ALA A N    1  
ATOM 1681  C CA   . ALA A 1 178 ? -12.009 9.761   5.273   1.00 0.41 ? 178 ALA A CA   1  
ATOM 1682  C C    . ALA A 1 178 ? -12.764 10.430  4.125   1.00 0.40 ? 178 ALA A C    1  
ATOM 1683  O O    . ALA A 1 178 ? -13.462 9.767   3.357   1.00 0.40 ? 178 ALA A O    1  
ATOM 1684  C CB   . ALA A 1 178 ? -12.750 9.963   6.587   1.00 0.44 ? 178 ALA A CB   1  
ATOM 1685  H H    . ALA A 1 178 ? -10.366 10.736  6.189   1.00 0.41 ? 178 ALA A H    1  
ATOM 1686  N N    . GLY A 1 179 ? -12.610 11.744  4.017   1.00 0.41 ? 179 GLY A N    1  
ATOM 1687  C CA   . GLY A 1 179 ? -13.270 12.502  2.969   1.00 0.42 ? 179 GLY A CA   1  
ATOM 1688  C C    . GLY A 1 179 ? -12.855 12.060  1.581   1.00 0.39 ? 179 GLY A C    1  
ATOM 1689  O O    . GLY A 1 179 ? -13.701 11.874  0.709   1.00 0.39 ? 179 GLY A O    1  
ATOM 1690  H H    . GLY A 1 179 ? -12.047 12.214  4.674   1.00 0.42 ? 179 GLY A H    1  
ATOM 1691  N N    . VAL A 1 180 ? -11.552 11.883  1.381   1.00 0.37 ? 180 VAL A N    1  
ATOM 1692  C CA   . VAL A 1 180 ? -11.027 11.452  0.088   1.00 0.35 ? 180 VAL A CA   1  
ATOM 1693  C C    . VAL A 1 180 ? -11.624 10.104  -0.316  1.00 0.33 ? 180 VAL A C    1  
ATOM 1694  O O    . VAL A 1 180 ? -12.078 9.931   -1.448  1.00 0.33 ? 180 VAL A O    1  
ATOM 1695  C CB   . VAL A 1 180 ? -9.485  11.359  0.102   1.00 0.36 ? 180 VAL A CB   1  
ATOM 1696  C CG1  . VAL A 1 180 ? -8.959  10.819  -1.222  1.00 0.36 ? 180 VAL A CG1  1  
ATOM 1697  C CG2  . VAL A 1 180 ? -8.876  12.724  0.399   1.00 0.39 ? 180 VAL A CG2  1  
ATOM 1698  H H    . VAL A 1 180 ? -10.925 12.052  2.120   1.00 0.38 ? 180 VAL A H    1  
ATOM 1699  N N    . LEU A 1 181 ? -11.634 9.161   0.619   1.00 0.33 ? 181 LEU A N    1  
ATOM 1700  C CA   . LEU A 1 181 ? -12.187 7.837   0.360   1.00 0.33 ? 181 LEU A CA   1  
ATOM 1701  C C    . LEU A 1 181 ? -13.680 7.929   0.067   1.00 0.34 ? 181 LEU A C    1  
ATOM 1702  O O    . LEU A 1 181 ? -14.194 7.271   -0.841  1.00 0.33 ? 181 LEU A O    1  
ATOM 1703  C CB   . LEU A 1 181 ? -11.940 6.904   1.546   1.00 0.36 ? 181 LEU A CB   1  
ATOM 1704  C CG   . LEU A 1 181 ? -10.496 6.451   1.755   1.00 0.37 ? 181 LEU A CG   1  
ATOM 1705  C CD1  . LEU A 1 181 ? -10.338 5.767   3.104   1.00 0.39 ? 181 LEU A CD1  1  
ATOM 1706  C CD2  . LEU A 1 181 ? -10.066 5.525   0.630   1.00 0.40 ? 181 LEU A CD2  1  
ATOM 1707  H H    . LEU A 1 181 ? -11.254 9.360   1.506   1.00 0.34 ? 181 LEU A H    1  
ATOM 1708  N N    . THR A 1 182 ? -14.367 8.764   0.835   1.00 0.37 ? 182 THR A N    1  
ATOM 1709  C CA   . THR A 1 182 ? -15.798 8.961   0.664   1.00 0.39 ? 182 THR A CA   1  
ATOM 1710  C C    . THR A 1 182 ? -16.107 9.533   -0.720  1.00 0.38 ? 182 THR A C    1  
ATOM 1711  O O    . THR A 1 182 ? -17.042 9.089   -1.388  1.00 0.38 ? 182 THR A O    1  
ATOM 1712  C CB   . THR A 1 182 ? -16.356 9.904   1.751   1.00 0.45 ? 182 THR A CB   1  
ATOM 1713  O OG1  . THR A 1 182 ? -16.085 9.353   3.046   1.00 0.45 ? 182 THR A OG1  1  
ATOM 1714  C CG2  . THR A 1 182 ? -17.857 10.087  1.590   1.00 0.53 ? 182 THR A CG2  1  
ATOM 1715  H H    . THR A 1 182 ? -13.898 9.261   1.539   1.00 0.39 ? 182 THR A H    1  
ATOM 1716  H HG1  . THR A 1 182 ? -15.149 9.475   3.257   1.00 0.43 ? 182 THR A HG1  1  
ATOM 1717  N N    . ALA A 1 183 ? -15.301 10.500  -1.147  1.00 0.39 ? 183 ALA A N    1  
ATOM 1718  C CA   . ALA A 1 183 ? -15.476 11.147  -2.443  1.00 0.40 ? 183 ALA A CA   1  
ATOM 1719  C C    . ALA A 1 183 ? -15.492 10.133  -3.587  1.00 0.36 ? 183 ALA A C    1  
ATOM 1720  O O    . ALA A 1 183 ? -16.457 10.067  -4.350  1.00 0.36 ? 183 ALA A O    1  
ATOM 1721  C CB   . ALA A 1 183 ? -14.389 12.187  -2.670  1.00 0.45 ? 183 ALA A CB   1  
ATOM 1722  H H    . ALA A 1 183 ? -14.562 10.793  -0.565  1.00 0.40 ? 183 ALA A H    1  
ATOM 1723  N N    . SER A 1 184 ? -14.436 9.335   -3.690  1.00 0.35 ? 184 SER A N    1  
ATOM 1724  C CA   . SER A 1 184 ? -14.338 8.332   -4.743  1.00 0.34 ? 184 SER A CA   1  
ATOM 1725  C C    . SER A 1 184 ? -15.492 7.330   -4.667  1.00 0.32 ? 184 SER A C    1  
ATOM 1726  O O    . SER A 1 184 ? -16.036 6.915   -5.693  1.00 0.33 ? 184 SER A O    1  
ATOM 1727  C CB   . SER A 1 184 ? -12.990 7.614   -4.671  1.00 0.37 ? 184 SER A CB   1  
ATOM 1728  O OG   . SER A 1 184 ? -11.926 8.552   -4.670  1.00 0.40 ? 184 SER A OG   1  
ATOM 1729  H H    . SER A 1 184 ? -13.698 9.421   -3.042  1.00 0.38 ? 184 SER A H    1  
ATOM 1730  H HG   . SER A 1 184 ? -11.993 9.108   -5.451  1.00 0.76 ? 184 SER A HG   1  
ATOM 1731  N N    . LEU A 1 185 ? -15.875 6.960   -3.447  1.00 0.33 ? 185 LEU A N    1  
ATOM 1732  C CA   . LEU A 1 185 ? -16.966 6.014   -3.244  1.00 0.35 ? 185 LEU A CA   1  
ATOM 1733  C C    . LEU A 1 185 ? -18.299 6.607   -3.698  1.00 0.36 ? 185 LEU A C    1  
ATOM 1734  O O    . LEU A 1 185 ? -19.167 5.893   -4.201  1.00 0.37 ? 185 LEU A O    1  
ATOM 1735  C CB   . LEU A 1 185 ? -17.040 5.582   -1.778  1.00 0.40 ? 185 LEU A CB   1  
ATOM 1736  C CG   . LEU A 1 185 ? -17.920 4.367   -1.476  1.00 0.66 ? 185 LEU A CG   1  
ATOM 1737  C CD1  . LEU A 1 185 ? -17.441 3.150   -2.251  1.00 1.01 ? 185 LEU A CD1  1  
ATOM 1738  C CD2  . LEU A 1 185 ? -17.941 4.078   0.017   1.00 0.77 ? 185 LEU A CD2  1  
ATOM 1739  H H    . LEU A 1 185 ? -15.407 7.329   -2.665  1.00 0.34 ? 185 LEU A H    1  
ATOM 1740  N N    . THR A 1 186 ? -18.442 7.920   -3.537  1.00 0.38 ? 186 THR A N    1  
ATOM 1741  C CA   . THR A 1 186 ? -19.658 8.625   -3.933  1.00 0.41 ? 186 THR A CA   1  
ATOM 1742  C C    . THR A 1 186 ? -19.826 8.593   -5.452  1.00 0.38 ? 186 THR A C    1  
ATOM 1743  O O    . THR A 1 186 ? -20.943 8.542   -5.968  1.00 0.43 ? 186 THR A O    1  
ATOM 1744  C CB   . THR A 1 186 ? -19.629 10.092  -3.451  1.00 0.47 ? 186 THR A CB   1  
ATOM 1745  O OG1  . THR A 1 186 ? -19.354 10.126  -2.043  1.00 0.50 ? 186 THR A OG1  1  
ATOM 1746  C CG2  . THR A 1 186 ? -20.958 10.780  -3.715  1.00 0.54 ? 186 THR A CG2  1  
ATOM 1747  H H    . THR A 1 186 ? -17.706 8.433   -3.137  1.00 0.38 ? 186 THR A H    1  
ATOM 1748  H HG1  . THR A 1 186 ? -18.430 9.879   -1.888  1.00 0.49 ? 186 THR A HG1  1  
ATOM 1749  N N    . ILE A 1 187 ? -18.706 8.623   -6.164  1.00 0.35 ? 187 ILE A N    1  
ATOM 1750  C CA   . ILE A 1 187 ? -18.727 8.588   -7.618  1.00 0.36 ? 187 ILE A CA   1  
ATOM 1751  C C    . ILE A 1 187 ? -18.881 7.149   -8.104  1.00 0.35 ? 187 ILE A C    1  
ATOM 1752  O O    . ILE A 1 187 ? -19.336 6.897   -9.217  1.00 0.45 ? 187 ILE A O    1  
ATOM 1753  C CB   . ILE A 1 187 ? -17.439 9.194   -8.217  1.00 0.38 ? 187 ILE A CB   1  
ATOM 1754  C CG1  . ILE A 1 187 ? -17.102 10.523  -7.534  1.00 0.38 ? 187 ILE A CG1  1  
ATOM 1755  C CG2  . ILE A 1 187 ? -17.588 9.396   -9.720  1.00 0.41 ? 187 ILE A CG2  1  
ATOM 1756  C CD1  . ILE A 1 187 ? -15.733 11.066  -7.890  1.00 0.43 ? 187 ILE A CD1  1  
ATOM 1757  H H    . ILE A 1 187 ? -17.842 8.674   -5.696  1.00 0.36 ? 187 ILE A H    1  
ATOM 1758  N N    . TRP A 1 188 ? -18.494 6.203   -7.257  1.00 0.35 ? 188 TRP A N    1  
ATOM 1759  C CA   . TRP A 1 188 ? -18.590 4.793   -7.598  1.00 0.37 ? 188 TRP A CA   1  
ATOM 1760  C C    . TRP A 1 188 ? -20.013 4.275   -7.423  1.00 0.38 ? 188 TRP A C    1  
ATOM 1761  O O    . TRP A 1 188 ? -20.615 3.759   -8.365  1.00 0.40 ? 188 TRP A O    1  
ATOM 1762  C CB   . TRP A 1 188 ? -17.619 3.959   -6.761  1.00 0.40 ? 188 TRP A CB   1  
ATOM 1763  C CG   . TRP A 1 188 ? -16.699 3.118   -7.590  1.00 0.41 ? 188 TRP A CG   1  
ATOM 1764  C CD1  . TRP A 1 188 ? -15.343 3.237   -7.686  1.00 0.51 ? 188 TRP A CD1  1  
ATOM 1765  C CD2  . TRP A 1 188 ? -17.070 2.031   -8.445  1.00 0.41 ? 188 TRP A CD2  1  
ATOM 1766  N NE1  . TRP A 1 188 ? -14.846 2.292   -8.549  1.00 0.55 ? 188 TRP A NE1  1  
ATOM 1767  C CE2  . TRP A 1 188 ? -15.887 1.539   -9.029  1.00 0.48 ? 188 TRP A CE2  1  
ATOM 1768  C CE3  . TRP A 1 188 ? -18.288 1.423   -8.773  1.00 0.47 ? 188 TRP A CE3  1  
ATOM 1769  C CZ2  . TRP A 1 188 ? -15.885 0.474   -9.924  1.00 0.54 ? 188 TRP A CZ2  1  
ATOM 1770  C CZ3  . TRP A 1 188 ? -18.285 0.365   -9.660  1.00 0.56 ? 188 TRP A CZ3  1  
ATOM 1771  C CH2  . TRP A 1 188 ? -17.090 -0.099  -10.226 1.00 0.57 ? 188 TRP A CH2  1  
ATOM 1772  H H    . TRP A 1 188 ? -18.134 6.463   -6.381  1.00 0.41 ? 188 TRP A H    1  
ATOM 1773  H HE1  . TRP A 1 188 ? -13.900 2.176   -8.786  1.00 0.65 ? 188 TRP A HE1  1  
ATOM 1774  N N    . LYS A 1 189 ? -20.556 4.430   -6.223  1.00 0.39 ? 189 LYS A N    1  
ATOM 1775  C CA   . LYS A 1 189 ? -21.907 3.959   -5.933  1.00 0.43 ? 189 LYS A CA   1  
ATOM 1776  C C    . LYS A 1 189 ? -22.964 4.955   -6.406  1.00 0.46 ? 189 LYS A C    1  
ATOM 1777  O O    . LYS A 1 189 ? -23.691 5.541   -5.600  1.00 0.55 ? 189 LYS A O    1  
ATOM 1778  C CB   . LYS A 1 189 ? -22.076 3.660   -4.442  1.00 0.49 ? 189 LYS A CB   1  
ATOM 1779  C CG   . LYS A 1 189 ? -22.284 2.186   -4.111  1.00 0.71 ? 189 LYS A CG   1  
ATOM 1780  C CD   . LYS A 1 189 ? -23.527 1.631   -4.791  1.00 1.05 ? 189 LYS A CD   1  
ATOM 1781  C CE   . LYS A 1 189 ? -24.139 0.485   -3.998  1.00 0.83 ? 189 LYS A CE   1  
ATOM 1782  N NZ   . LYS A 1 189 ? -23.267 -0.723  -3.959  1.00 0.84 ? 189 LYS A NZ   1  
ATOM 1783  H H    . LYS A 1 189 ? -20.040 4.876   -5.513  1.00 0.40 ? 189 LYS A H    1  
ATOM 1784  H HZ1  . LYS A 1 189 ? -23.835 -1.565  -3.736  1.00 1.14 ? 189 LYS A HZ1  1  
ATOM 1785  H HZ2  . LYS A 1 189 ? -22.531 -0.616  -3.232  1.00 1.13 ? 189 LYS A HZ2  1  
ATOM 1786  H HZ3  . LYS A 1 189 ? -22.806 -0.870  -4.888  1.00 1.03 ? 189 LYS A HZ3  1  
ATOM 1787  N N    . LYS A 1 190 ? -23.039 5.140   -7.715  1.00 0.49 ? 190 LYS A N    1  
ATOM 1788  C CA   . LYS A 1 190 ? -24.005 6.054   -8.317  1.00 0.57 ? 190 LYS A CA   1  
ATOM 1789  C C    . LYS A 1 190 ? -25.370 5.381   -8.457  1.00 0.55 ? 190 LYS A C    1  
ATOM 1790  O O    . LYS A 1 190 ? -25.813 5.073   -9.565  1.00 0.61 ? 190 LYS A O    1  
ATOM 1791  C CB   . LYS A 1 190 ? -23.500 6.567   -9.675  1.00 0.67 ? 190 LYS A CB   1  
ATOM 1792  C CG   . LYS A 1 190 ? -22.535 5.632   -10.398 1.00 0.65 ? 190 LYS A CG   1  
ATOM 1793  C CD   . LYS A 1 190 ? -23.265 4.554   -11.187 1.00 0.69 ? 190 LYS A CD   1  
ATOM 1794  C CE   . LYS A 1 190 ? -22.302 3.497   -11.707 1.00 0.75 ? 190 LYS A CE   1  
ATOM 1795  N NZ   . LYS A 1 190 ? -21.744 2.661   -10.611 1.00 0.73 ? 190 LYS A NZ   1  
ATOM 1796  H H    . LYS A 1 190 ? -22.420 4.646   -8.297  1.00 0.52 ? 190 LYS A H    1  
ATOM 1797  H HZ1  . LYS A 1 190 ? -21.223 1.853   -11.004 1.00 0.85 ? 190 LYS A HZ1  1  
ATOM 1798  H HZ2  . LYS A 1 190 ? -22.519 2.297   -10.007 1.00 0.77 ? 190 LYS A HZ2  1  
ATOM 1799  H HZ3  . LYS A 1 190 ? -21.096 3.223   -10.019 1.00 0.86 ? 190 LYS A HZ3  1  
ATOM 1800  N N    . MET A 1 191 ? -26.006 5.133   -7.308  1.00 0.57 ? 191 MET A N    1  
ATOM 1801  C CA   . MET A 1 191 ? -27.319 4.477   -7.232  1.00 0.61 ? 191 MET A CA   1  
ATOM 1802  C C    . MET A 1 191 ? -27.204 2.965   -7.442  1.00 0.67 ? 191 MET A C    1  
ATOM 1803  O O    . MET A 1 191 ? -28.091 2.201   -7.054  1.00 1.20 ? 191 MET A O    1  
ATOM 1804  C CB   . MET A 1 191 ? -28.344 5.097   -8.192  1.00 0.70 ? 191 MET A CB   1  
ATOM 1805  C CG   . MET A 1 191 ? -29.790 4.765   -7.859  1.00 0.89 ? 191 MET A CG   1  
ATOM 1806  S SD   . MET A 1 191 ? -30.943 5.285   -9.145  1.00 1.20 ? 191 MET A SD   1  
ATOM 1807  C CE   . MET A 1 191 ? -30.552 4.108   -10.439 1.00 1.44 ? 191 MET A CE   1  
ATOM 1808  H H    . MET A 1 191 ? -25.573 5.405   -6.470  1.00 0.63 ? 191 MET A H    1  
ATOM 1809  N N    . GLY A 1 192 ? -26.102 2.544   -8.044  1.00 0.54 ? 192 GLY A N    1  
ATOM 1810  C CA   . GLY A 1 192 ? -25.863 1.143   -8.296  1.00 0.64 ? 192 GLY A CA   1  
ATOM 1811  C C    . GLY A 1 192 ? -24.593 0.955   -9.096  1.00 0.70 ? 192 GLY A C    1  
ATOM 1812  O O    . GLY A 1 192 ? -23.734 1.863   -9.062  1.00 0.80 ? 192 GLY A O    1  
ATOM 1813  O OXT  . GLY A 1 192 ? -24.448 -0.089  -9.765  1.00 1.09 ? 192 GLY A OXT  1  
ATOM 1814  H H    . GLY A 1 192 ? -25.433 3.201   -8.332  1.00 0.80 ? 192 GLY A H    1  
ATOM 1815  N N    . GLU B 2 1   ? -0.346  -1.200  -16.019 1.00 5.01 ? 145 GLU B N    1  
ATOM 1816  C CA   . GLU B 2 1   ? -0.221  -2.017  -17.248 1.00 4.54 ? 145 GLU B CA   1  
ATOM 1817  C C    . GLU B 2 1   ? -0.587  -3.470  -16.943 1.00 3.87 ? 145 GLU B C    1  
ATOM 1818  O O    . GLU B 2 1   ? -1.245  -3.749  -15.944 1.00 3.91 ? 145 GLU B O    1  
ATOM 1819  C CB   . GLU B 2 1   ? 1.202   -1.920  -17.808 1.00 4.66 ? 145 GLU B CB   1  
ATOM 1820  C CG   . GLU B 2 1   ? 1.275   -1.855  -19.328 1.00 5.21 ? 145 GLU B CG   1  
ATOM 1821  C CD   . GLU B 2 1   ? 1.983   -3.050  -19.935 1.00 5.46 ? 145 GLU B CD   1  
ATOM 1822  O OE1  . GLU B 2 1   ? 1.432   -4.166  -19.866 1.00 5.59 ? 145 GLU B OE1  1  
ATOM 1823  O OE2  . GLU B 2 1   ? 3.090   -2.882  -20.475 1.00 5.83 ? 145 GLU B OE2  1  
ATOM 1824  H H1   . GLU B 2 1   ? 0.288   -1.573  -15.273 1.00 4.99 ? 145 GLU B H1   1  
ATOM 1825  H H2   . GLU B 2 1   ? -1.320  -1.234  -15.665 1.00 5.07 ? 145 GLU B H2   1  
ATOM 1826  H H3   . GLU B 2 1   ? -0.087  -0.205  -16.212 1.00 5.51 ? 145 GLU B H3   1  
ATOM 1827  N N    . ILE B 2 2   ? -0.185  -4.385  -17.814 1.00 3.36 ? 146 ILE B N    1  
ATOM 1828  C CA   . ILE B 2 2   ? -0.459  -5.801  -17.626 1.00 2.81 ? 146 ILE B CA   1  
ATOM 1829  C C    . ILE B 2 2   ? 0.853   -6.546  -17.413 1.00 2.31 ? 146 ILE B C    1  
ATOM 1830  O O    . ILE B 2 2   ? 1.009   -7.297  -16.452 1.00 2.12 ? 146 ILE B O    1  
ATOM 1831  C CB   . ILE B 2 2   ? -1.188  -6.400  -18.849 1.00 2.51 ? 146 ILE B CB   1  
ATOM 1832  C CG1  . ILE B 2 2   ? -2.445  -5.583  -19.175 1.00 3.14 ? 146 ILE B CG1  1  
ATOM 1833  C CG2  . ILE B 2 2   ? -1.546  -7.860  -18.603 1.00 2.36 ? 146 ILE B CG2  1  
ATOM 1834  C CD1  . ILE B 2 2   ? -3.099  -5.959  -20.489 1.00 3.05 ? 146 ILE B CD1  1  
ATOM 1835  H H    . ILE B 2 2   ? 0.316   -4.102  -18.618 1.00 3.46 ? 146 ILE B H    1  
ATOM 1836  N N    . TRP B 2 3   ? 1.804   -6.302  -18.305 1.00 2.29 ? 147 TRP B N    1  
ATOM 1837  C CA   . TRP B 2 3   ? 3.112   -6.942  -18.237 1.00 2.19 ? 147 TRP B CA   1  
ATOM 1838  C C    . TRP B 2 3   ? 3.870   -6.465  -17.005 1.00 2.49 ? 147 TRP B C    1  
ATOM 1839  O O    . TRP B 2 3   ? 4.488   -7.260  -16.293 1.00 2.25 ? 147 TRP B O    1  
ATOM 1840  C CB   . TRP B 2 3   ? 3.919   -6.637  -19.506 1.00 2.58 ? 147 TRP B CB   1  
ATOM 1841  C CG   . TRP B 2 3   ? 5.164   -7.462  -19.654 1.00 2.84 ? 147 TRP B CG   1  
ATOM 1842  C CD1  . TRP B 2 3   ? 5.286   -8.646  -20.322 1.00 2.81 ? 147 TRP B CD1  1  
ATOM 1843  C CD2  . TRP B 2 3   ? 6.463   -7.163  -19.125 1.00 3.46 ? 147 TRP B CD2  1  
ATOM 1844  N NE1  . TRP B 2 3   ? 6.577   -9.104  -20.237 1.00 3.38 ? 147 TRP B NE1  1  
ATOM 1845  C CE2  . TRP B 2 3   ? 7.321   -8.212  -19.512 1.00 3.73 ? 147 TRP B CE2  1  
ATOM 1846  C CE3  . TRP B 2 3   ? 6.988   -6.112  -18.367 1.00 3.97 ? 147 TRP B CE3  1  
ATOM 1847  C CZ2  . TRP B 2 3   ? 8.669   -8.243  -19.161 1.00 4.39 ? 147 TRP B CZ2  1  
ATOM 1848  C CZ3  . TRP B 2 3   ? 8.325   -6.144  -18.021 1.00 4.60 ? 147 TRP B CZ3  1  
ATOM 1849  C CH2  . TRP B 2 3   ? 9.151   -7.201  -18.419 1.00 4.76 ? 147 TRP B CH2  1  
ATOM 1850  H H    . TRP B 2 3   ? 1.623   -5.659  -19.034 1.00 2.51 ? 147 TRP B H    1  
ATOM 1851  H HE1  . TRP B 2 3   ? 6.918   -9.934  -20.636 1.00 3.63 ? 147 TRP B HE1  1  
ATOM 1852  N N    . ILE B 2 4   ? 3.801   -5.159  -16.757 1.00 3.10 ? 148 ILE B N    1  
ATOM 1853  C CA   . ILE B 2 4   ? 4.476   -4.553  -15.614 1.00 3.51 ? 148 ILE B CA   1  
ATOM 1854  C C    . ILE B 2 4   ? 3.970   -5.159  -14.305 1.00 3.20 ? 148 ILE B C    1  
ATOM 1855  O O    . ILE B 2 4   ? 4.761   -5.521  -13.429 1.00 3.08 ? 148 ILE B O    1  
ATOM 1856  C CB   . ILE B 2 4   ? 4.290   -3.020  -15.589 1.00 4.34 ? 148 ILE B CB   1  
ATOM 1857  C CG1  . ILE B 2 4   ? 4.699   -2.415  -16.936 1.00 4.68 ? 148 ILE B CG1  1  
ATOM 1858  C CG2  . ILE B 2 4   ? 5.110   -2.401  -14.466 1.00 4.81 ? 148 ILE B CG2  1  
ATOM 1859  C CD1  . ILE B 2 4   ? 4.577   -0.905  -16.997 1.00 5.45 ? 148 ILE B CD1  1  
ATOM 1860  H H    . ILE B 2 4   ? 3.284   -4.589  -17.363 1.00 3.34 ? 148 ILE B H    1  
ATOM 1861  N N    . ALA B 2 5   ? 2.653   -5.292  -14.195 1.00 3.18 ? 149 ALA B N    1  
ATOM 1862  C CA   . ALA B 2 5   ? 2.029   -5.861  -13.005 1.00 3.15 ? 149 ALA B CA   1  
ATOM 1863  C C    . ALA B 2 5   ? 2.523   -7.283  -12.737 1.00 2.43 ? 149 ALA B C    1  
ATOM 1864  O O    . ALA B 2 5   ? 2.630   -7.698  -11.585 1.00 2.45 ? 149 ALA B O    1  
ATOM 1865  C CB   . ALA B 2 5   ? 0.515   -5.838  -13.135 1.00 3.53 ? 149 ALA B CB   1  
ATOM 1866  H H    . ALA B 2 5   ? 2.081   -4.982  -14.926 1.00 3.30 ? 149 ALA B H    1  
ATOM 1867  N N    . GLN B 2 6   ? 2.829   -8.020  -13.803 1.00 1.86 ? 150 GLN B N    1  
ATOM 1868  C CA   . GLN B 2 6   ? 3.316   -9.390  -13.675 1.00 1.28 ? 150 GLN B CA   1  
ATOM 1869  C C    . GLN B 2 6   ? 4.696   -9.415  -13.029 1.00 1.15 ? 150 GLN B C    1  
ATOM 1870  O O    . GLN B 2 6   ? 4.941   -10.177 -12.090 1.00 0.98 ? 150 GLN B O    1  
ATOM 1871  C CB   . GLN B 2 6   ? 3.357   -10.090 -15.036 1.00 1.05 ? 150 GLN B CB   1  
ATOM 1872  C CG   . GLN B 2 6   ? 4.058   -11.440 -15.014 1.00 1.34 ? 150 GLN B CG   1  
ATOM 1873  C CD   . GLN B 2 6   ? 4.070   -12.123 -16.366 1.00 1.76 ? 150 GLN B CD   1  
ATOM 1874  O OE1  . GLN B 2 6   ? 3.146   -11.968 -17.158 1.00 1.81 ? 150 GLN B OE1  1  
ATOM 1875  N NE2  . GLN B 2 6   ? 5.118   -12.883 -16.637 1.00 2.39 ? 150 GLN B NE2  1  
ATOM 1876  H H    . GLN B 2 6   ? 2.730   -7.630  -14.697 1.00 1.92 ? 150 GLN B H    1  
ATOM 1877  H HE21 . GLN B 2 6   ? 5.823   -12.964 -15.956 1.00 2.51 ? 150 GLN B HE21 1  
ATOM 1878  H HE22 . GLN B 2 6   ? 5.148   -13.339 -17.505 1.00 2.81 ? 150 GLN B HE22 1  
ATOM 1879  N N    . GLU B 2 7   ? 5.596   -8.577  -13.533 1.00 1.59 ? 151 GLU B N    1  
ATOM 1880  C CA   . GLU B 2 7   ? 6.944   -8.497  -12.987 1.00 1.93 ? 151 GLU B CA   1  
ATOM 1881  C C    . GLU B 2 7   ? 6.894   -8.024  -11.539 1.00 2.05 ? 151 GLU B C    1  
ATOM 1882  O O    . GLU B 2 7   ? 7.567   -8.575  -10.671 1.00 1.93 ? 151 GLU B O    1  
ATOM 1883  C CB   . GLU B 2 7   ? 7.834   -7.583  -13.844 1.00 2.71 ? 151 GLU B CB   1  
ATOM 1884  C CG   . GLU B 2 7   ? 9.098   -7.068  -13.156 1.00 3.38 ? 151 GLU B CG   1  
ATOM 1885  C CD   . GLU B 2 7   ? 10.077  -8.163  -12.756 1.00 3.37 ? 151 GLU B CD   1  
ATOM 1886  O OE1  . GLU B 2 7   ? 9.801   -9.355  -13.005 1.00 3.26 ? 151 GLU B OE1  1  
ATOM 1887  O OE2  . GLU B 2 7   ? 11.137  -7.833  -12.179 1.00 3.77 ? 151 GLU B OE2  1  
ATOM 1888  H H    . GLU B 2 7   ? 5.343   -7.998  -14.285 1.00 1.84 ? 151 GLU B H    1  
ATOM 1889  N N    . LEU B 2 8   ? 6.067   -7.019  -11.281 1.00 2.45 ? 152 LEU B N    1  
ATOM 1890  C CA   . LEU B 2 8   ? 5.916   -6.478  -9.941  1.00 2.86 ? 152 LEU B CA   1  
ATOM 1891  C C    . LEU B 2 8   ? 5.315   -7.518  -9.006  1.00 2.48 ? 152 LEU B C    1  
ATOM 1892  O O    . LEU B 2 8   ? 5.674   -7.593  -7.830  1.00 2.62 ? 152 LEU B O    1  
ATOM 1893  C CB   . LEU B 2 8   ? 5.070   -5.216  -9.977  1.00 3.54 ? 152 LEU B CB   1  
ATOM 1894  C CG   . LEU B 2 8   ? 5.732   -4.024  -10.660 1.00 4.02 ? 152 LEU B CG   1  
ATOM 1895  C CD1  . LEU B 2 8   ? 4.689   -3.079  -11.213 1.00 4.62 ? 152 LEU B CD1  1  
ATOM 1896  C CD2  . LEU B 2 8   ? 6.654   -3.303  -9.693  1.00 4.35 ? 152 LEU B CD2  1  
ATOM 1897  H H    . LEU B 2 8   ? 5.546   -6.627  -12.016 1.00 2.58 ? 152 LEU B H    1  
ATOM 1898  N N    . ARG B 2 9   ? 4.410   -8.326  -9.542  1.00 2.13 ? 153 ARG B N    1  
ATOM 1899  C CA   . ARG B 2 9   ? 3.784   -9.394  -8.776  1.00 2.11 ? 153 ARG B CA   1  
ATOM 1900  C C    . ARG B 2 9   ? 4.872   -10.362 -8.333  1.00 1.51 ? 153 ARG B C    1  
ATOM 1901  O O    . ARG B 2 9   ? 4.863   -10.865 -7.207  1.00 1.66 ? 153 ARG B O    1  
ATOM 1902  C CB   . ARG B 2 9   ? 2.773   -10.126 -9.660  1.00 2.28 ? 153 ARG B CB   1  
ATOM 1903  C CG   . ARG B 2 9   ? 1.639   -10.805 -8.911  1.00 2.79 ? 153 ARG B CG   1  
ATOM 1904  C CD   . ARG B 2 9   ? 0.593   -11.308 -9.891  1.00 3.22 ? 153 ARG B CD   1  
ATOM 1905  N NE   . ARG B 2 9   ? -0.548  -11.939 -9.228  1.00 3.39 ? 153 ARG B NE   1  
ATOM 1906  C CZ   . ARG B 2 9   ? -1.083  -13.100 -9.618  1.00 3.88 ? 153 ARG B CZ   1  
ATOM 1907  N NH1  . ARG B 2 9   ? -0.558  -13.759 -10.645 1.00 4.32 ? 153 ARG B NH1  1  
ATOM 1908  N NH2  . ARG B 2 9   ? -2.141  -13.600 -8.983  1.00 4.17 ? 153 ARG B NH2  1  
ATOM 1909  H H    . ARG B 2 9   ? 4.148   -8.194  -10.481 1.00 2.05 ? 153 ARG B H    1  
ATOM 1910  H HE   . ARG B 2 9   ? -0.939  -11.466 -8.463  1.00 3.35 ? 153 ARG B HE   1  
ATOM 1911  H HH11 . ARG B 2 9   ? 0.246   -13.392 -11.123 1.00 4.33 ? 153 ARG B HH11 1  
ATOM 1912  H HH12 . ARG B 2 9   ? -0.967  -14.622 -10.956 1.00 4.80 ? 153 ARG B HH12 1  
ATOM 1913  H HH21 . ARG B 2 9   ? -2.548  -13.110 -8.208  1.00 4.15 ? 153 ARG B HH21 1  
ATOM 1914  H HH22 . ARG B 2 9   ? -2.539  -14.484 -9.275  1.00 4.58 ? 153 ARG B HH22 1  
ATOM 1915  N N    . ARG B 2 10  ? 5.826   -10.591 -9.232  1.00 1.01 ? 154 ARG B N    1  
ATOM 1916  C CA   . ARG B 2 10  ? 6.950   -11.471 -8.962  1.00 0.90 ? 154 ARG B CA   1  
ATOM 1917  C C    . ARG B 2 10  ? 7.860   -10.842 -7.909  1.00 1.04 ? 154 ARG B C    1  
ATOM 1918  O O    . ARG B 2 10  ? 8.364   -11.534 -7.028  1.00 1.02 ? 154 ARG B O    1  
ATOM 1919  C CB   . ARG B 2 10  ? 7.738   -11.743 -10.247 1.00 1.34 ? 154 ARG B CB   1  
ATOM 1920  C CG   . ARG B 2 10  ? 8.863   -12.752 -10.082 1.00 2.01 ? 154 ARG B CG   1  
ATOM 1921  C CD   . ARG B 2 10  ? 9.957   -12.545 -11.117 1.00 2.84 ? 154 ARG B CD   1  
ATOM 1922  N NE   . ARG B 2 10  ? 10.518  -11.192 -11.070 1.00 3.10 ? 154 ARG B NE   1  
ATOM 1923  C CZ   . ARG B 2 10  ? 11.413  -10.777 -10.165 1.00 3.57 ? 154 ARG B CZ   1  
ATOM 1924  N NH1  . ARG B 2 10  ? 11.829  -11.593 -9.200  1.00 3.71 ? 154 ARG B NH1  1  
ATOM 1925  N NH2  . ARG B 2 10  ? 11.892  -9.542  -10.225 1.00 4.07 ? 154 ARG B NH2  1  
ATOM 1926  H H    . ARG B 2 10  ? 5.768   -10.146 -10.106 1.00 1.06 ? 154 ARG B H    1  
ATOM 1927  H HE   . ARG B 2 10  ? 10.215  -10.554 -11.768 1.00 3.07 ? 154 ARG B HE   1  
ATOM 1928  H HH11 . ARG B 2 10  ? 11.474  -12.529 -9.141  1.00 3.54 ? 154 ARG B HH11 1  
ATOM 1929  H HH12 . ARG B 2 10  ? 12.501  -11.269 -8.514  1.00 4.08 ? 154 ARG B HH12 1  
ATOM 1930  H HH21 . ARG B 2 10  ? 11.581  -8.912  -10.955 1.00 4.11 ? 154 ARG B HH21 1  
ATOM 1931  H HH22 . ARG B 2 10  ? 12.563  -9.227  -9.548  1.00 4.49 ? 154 ARG B HH22 1  
ATOM 1932  N N    . ILE B 2 11  ? 8.054   -9.525  -8.004  1.00 1.56 ? 155 ILE B N    1  
ATOM 1933  C CA   . ILE B 2 11  ? 8.890   -8.791  -7.049  1.00 2.08 ? 155 ILE B CA   1  
ATOM 1934  C C    . ILE B 2 11  ? 8.262   -8.846  -5.662  1.00 2.01 ? 155 ILE B C    1  
ATOM 1935  O O    . ILE B 2 11  ? 8.953   -9.007  -4.656  1.00 2.10 ? 155 ILE B O    1  
ATOM 1936  C CB   . ILE B 2 11  ? 9.083   -7.309  -7.455  1.00 2.96 ? 155 ILE B CB   1  
ATOM 1937  C CG1  . ILE B 2 11  ? 9.631   -7.206  -8.878  1.00 3.16 ? 155 ILE B CG1  1  
ATOM 1938  C CG2  . ILE B 2 11  ? 10.020  -6.601  -6.481  1.00 3.62 ? 155 ILE B CG2  1  
ATOM 1939  C CD1  . ILE B 2 11  ? 9.627   -5.797  -9.436  1.00 3.96 ? 155 ILE B CD1  1  
ATOM 1940  H H    . ILE B 2 11  ? 7.629   -9.034  -8.745  1.00 1.71 ? 155 ILE B H    1  
ATOM 1941  N N    . GLY B 2 12  ? 6.941   -8.710  -5.625  1.00 2.07 ? 156 GLY B N    1  
ATOM 1942  C CA   . GLY B 2 12  ? 6.219   -8.765  -4.371  1.00 2.48 ? 156 GLY B CA   1  
ATOM 1943  C C    . GLY B 2 12  ? 6.389   -10.110 -3.697  1.00 2.14 ? 156 GLY B C    1  
ATOM 1944  O O    . GLY B 2 12  ? 6.458   -10.201 -2.473  1.00 2.57 ? 156 GLY B O    1  
ATOM 1945  H H    . GLY B 2 12  ? 6.452   -8.557  -6.466  1.00 2.00 ? 156 GLY B H    1  
ATOM 1946  N N    . ASP B 2 13  ? 6.456   -11.160 -4.506  1.00 1.53 ? 157 ASP B N    1  
ATOM 1947  C CA   . ASP B 2 13  ? 6.641   -12.515 -3.999  1.00 1.56 ? 157 ASP B CA   1  
ATOM 1948  C C    . ASP B 2 13  ? 8.111   -12.731 -3.668  1.00 1.01 ? 157 ASP B C    1  
ATOM 1949  O O    . ASP B 2 13  ? 8.455   -13.473 -2.745  1.00 1.21 ? 157 ASP B O    1  
ATOM 1950  C CB   . ASP B 2 13  ? 6.182   -13.534 -5.043  1.00 1.82 ? 157 ASP B CB   1  
ATOM 1951  C CG   . ASP B 2 13  ? 5.295   -14.609 -4.453  1.00 2.23 ? 157 ASP B CG   1  
ATOM 1952  O OD1  . ASP B 2 13  ? 4.105   -14.326 -4.204  1.00 2.73 ? 157 ASP B OD1  1  
ATOM 1953  O OD2  . ASP B 2 13  ? 5.778   -15.742 -4.238  1.00 2.40 ? 157 ASP B OD2  1  
ATOM 1954  H H    . ASP B 2 13  ? 6.370   -11.023 -5.475  1.00 1.27 ? 157 ASP B H    1  
ATOM 1955  N N    . GLU B 2 14  ? 8.964   -12.065 -4.440  1.00 0.71 ? 158 GLU B N    1  
ATOM 1956  C CA   . GLU B 2 14  ? 10.411  -12.128 -4.275  1.00 1.05 ? 158 GLU B CA   1  
ATOM 1957  C C    . GLU B 2 14  ? 10.800  -11.696 -2.866  1.00 1.29 ? 158 GLU B C    1  
ATOM 1958  O O    . GLU B 2 14  ? 11.573  -12.373 -2.189  1.00 1.29 ? 158 GLU B O    1  
ATOM 1959  C CB   . GLU B 2 14  ? 11.065  -11.209 -5.318  1.00 1.84 ? 158 GLU B CB   1  
ATOM 1960  C CG   . GLU B 2 14  ? 12.581  -11.107 -5.275  1.00 2.74 ? 158 GLU B CG   1  
ATOM 1961  C CD   . GLU B 2 14  ? 13.098  -10.049 -6.231  1.00 3.59 ? 158 GLU B CD   1  
ATOM 1962  O OE1  . GLU B 2 14  ? 13.361  -10.378 -7.410  1.00 3.85 ? 158 GLU B OE1  1  
ATOM 1963  O OE2  . GLU B 2 14  ? 13.232  -8.879  -5.819  1.00 4.27 ? 158 GLU B OE2  1  
ATOM 1964  H H    . GLU B 2 14  ? 8.600   -11.507 -5.164  1.00 0.77 ? 158 GLU B H    1  
ATOM 1965  N N    . PHE B 2 15  ? 10.237  -10.582 -2.421  1.00 1.81 ? 159 PHE B N    1  
ATOM 1966  C CA   . PHE B 2 15  ? 10.524  -10.067 -1.093  1.00 2.48 ? 159 PHE B CA   1  
ATOM 1967  C C    . PHE B 2 15  ? 9.683   -10.754 -0.025  1.00 2.47 ? 159 PHE B C    1  
ATOM 1968  O O    . PHE B 2 15  ? 10.100  -10.847 1.129   1.00 2.90 ? 159 PHE B O    1  
ATOM 1969  C CB   . PHE B 2 15  ? 10.348  -8.552  -1.035  1.00 3.29 ? 159 PHE B CB   1  
ATOM 1970  C CG   . PHE B 2 15  ? 11.620  -7.800  -1.292  1.00 3.63 ? 159 PHE B CG   1  
ATOM 1971  C CD1  . PHE B 2 15  ? 11.994  -7.466  -2.582  1.00 3.87 ? 159 PHE B CD1  1  
ATOM 1972  C CD2  . PHE B 2 15  ? 12.448  -7.439  -0.243  1.00 4.07 ? 159 PHE B CD2  1  
ATOM 1973  C CE1  . PHE B 2 15  ? 13.171  -6.785  -2.818  1.00 4.37 ? 159 PHE B CE1  1  
ATOM 1974  C CE2  . PHE B 2 15  ? 13.626  -6.755  -0.471  1.00 4.53 ? 159 PHE B CE2  1  
ATOM 1975  C CZ   . PHE B 2 15  ? 13.987  -6.428  -1.763  1.00 4.61 ? 159 PHE B CZ   1  
ATOM 1976  H H    . PHE B 2 15  ? 9.620   -10.090 -3.005  1.00 1.86 ? 159 PHE B H    1  
ATOM 1977  N N    . ASN B 2 16  ? 8.508   -11.243 -0.410  1.00 2.24 ? 160 ASN B N    1  
ATOM 1978  C CA   . ASN B 2 16  ? 7.618   -11.925 0.528   1.00 2.65 ? 160 ASN B CA   1  
ATOM 1979  C C    . ASN B 2 16  ? 8.283   -13.174 1.096   1.00 2.24 ? 160 ASN B C    1  
ATOM 1980  O O    . ASN B 2 16  ? 8.381   -13.346 2.309   1.00 2.59 ? 160 ASN B O    1  
ATOM 1981  C CB   . ASN B 2 16  ? 6.298   -12.310 -0.154  1.00 2.97 ? 160 ASN B CB   1  
ATOM 1982  C CG   . ASN B 2 16  ? 5.260   -12.853 0.817   1.00 3.76 ? 160 ASN B CG   1  
ATOM 1983  O OD1  . ASN B 2 16  ? 4.483   -12.096 1.399   1.00 4.03 ? 160 ASN B OD1  1  
ATOM 1984  N ND2  . ASN B 2 16  ? 5.236   -14.168 0.997   1.00 4.32 ? 160 ASN B ND2  1  
ATOM 1985  H H    . ASN B 2 16  ? 8.231   -11.142 -1.347  1.00 1.99 ? 160 ASN B H    1  
ATOM 1986  H HD21 . ASN B 2 16  ? 5.879   -14.720 0.506   1.00 4.25 ? 160 ASN B HD21 1  
ATOM 1987  H HD22 . ASN B 2 16  ? 4.569   -14.536 1.617   1.00 4.87 ? 160 ASN B HD22 1  
ATOM 1988  N N    . ALA B 2 17  ? 8.773   -14.026 0.205   1.00 1.59 ? 161 ALA B N    1  
ATOM 1989  C CA   . ALA B 2 17  ? 9.426   -15.268 0.605   1.00 1.42 ? 161 ALA B CA   1  
ATOM 1990  C C    . ALA B 2 17  ? 10.829  -15.019 1.146   1.00 1.04 ? 161 ALA B C    1  
ATOM 1991  O O    . ALA B 2 17  ? 11.537  -15.952 1.522   1.00 1.12 ? 161 ALA B O    1  
ATOM 1992  C CB   . ALA B 2 17  ? 9.479   -16.235 -0.566  1.00 1.66 ? 161 ALA B CB   1  
ATOM 1993  H H    . ALA B 2 17  ? 8.695   -13.813 -0.749  1.00 1.37 ? 161 ALA B H    1  
ATOM 1994  N N    . TYR B 2 18  ? 11.225  -13.757 1.179   1.00 1.36 ? 162 TYR B N    1  
ATOM 1995  C CA   . TYR B 2 18  ? 12.535  -13.380 1.672   1.00 1.82 ? 162 TYR B CA   1  
ATOM 1996  C C    . TYR B 2 18  ? 12.484  -13.178 3.184   1.00 2.42 ? 162 TYR B C    1  
ATOM 1997  O O    . TYR B 2 18  ? 13.504  -13.258 3.869   1.00 2.52 ? 162 TYR B O    1  
ATOM 1998  C CB   . TYR B 2 18  ? 12.994  -12.095 0.969   1.00 2.45 ? 162 TYR B CB   1  
ATOM 1999  C CG   . TYR B 2 18  ? 14.388  -11.630 1.319   1.00 3.23 ? 162 TYR B CG   1  
ATOM 2000  C CD1  . TYR B 2 18  ? 15.505  -12.389 0.990   1.00 3.36 ? 162 TYR B CD1  1  
ATOM 2001  C CD2  . TYR B 2 18  ? 14.588  -10.422 1.974   1.00 4.05 ? 162 TYR B CD2  1  
ATOM 2002  C CE1  . TYR B 2 18  ? 16.781  -11.955 1.303   1.00 4.18 ? 162 TYR B CE1  1  
ATOM 2003  C CE2  . TYR B 2 18  ? 15.858  -9.981  2.292   1.00 4.79 ? 162 TYR B CE2  1  
ATOM 2004  C CZ   . TYR B 2 18  ? 16.950  -10.751 1.955   1.00 4.82 ? 162 TYR B CZ   1  
ATOM 2005  O OH   . TYR B 2 18  ? 18.217  -10.310 2.270   1.00 5.64 ? 162 TYR B OH   1  
ATOM 2006  H H    . TYR B 2 18  ? 10.612  -13.057 0.870   1.00 1.62 ? 162 TYR B H    1  
ATOM 2007  H HH   . TYR B 2 18  ? 18.201  -9.908  3.147   1.00 5.90 ? 162 TYR B HH   1  
ATOM 2008  N N    . TYR B 2 19  ? 11.283  -12.939 3.703   1.00 3.05 ? 163 TYR B N    1  
ATOM 2009  C CA   . TYR B 2 19  ? 11.103  -12.714 5.131   1.00 3.89 ? 163 TYR B CA   1  
ATOM 2010  C C    . TYR B 2 19  ? 10.043  -13.636 5.735   1.00 4.14 ? 163 TYR B C    1  
ATOM 2011  O O    . TYR B 2 19  ? 9.781   -13.585 6.939   1.00 4.36 ? 163 TYR B O    1  
ATOM 2012  C CB   . TYR B 2 19  ? 10.745  -11.247 5.404   1.00 4.80 ? 163 TYR B CB   1  
ATOM 2013  C CG   . TYR B 2 19  ? 11.929  -10.373 5.763   1.00 5.20 ? 163 TYR B CG   1  
ATOM 2014  C CD1  . TYR B 2 19  ? 13.119  -10.928 6.212   1.00 5.67 ? 163 TYR B CD1  1  
ATOM 2015  C CD2  . TYR B 2 19  ? 11.852  -8.990  5.657   1.00 5.29 ? 163 TYR B CD2  1  
ATOM 2016  C CE1  . TYR B 2 19  ? 14.199  -10.132 6.545   1.00 6.11 ? 163 TYR B CE1  1  
ATOM 2017  C CE2  . TYR B 2 19  ? 12.925  -8.186  5.988   1.00 5.82 ? 163 TYR B CE2  1  
ATOM 2018  C CZ   . TYR B 2 19  ? 14.096  -8.762  6.431   1.00 6.18 ? 163 TYR B CZ   1  
ATOM 2019  O OH   . TYR B 2 19  ? 15.166  -7.966  6.766   1.00 6.75 ? 163 TYR B OH   1  
ATOM 2020  H H    . TYR B 2 19  ? 10.499  -12.920 3.111   1.00 3.03 ? 163 TYR B H    1  
ATOM 2021  H HH   . TYR B 2 19  ? 15.894  -8.136  6.154   1.00 7.02 ? 163 TYR B HH   1  
ATOM 2022  N N    . ALA B 2 20  ? 9.444   -14.478 4.905   1.00 4.36 ? 164 ALA B N    1  
ATOM 2023  C CA   . ALA B 2 20  ? 8.414   -15.397 5.362   1.00 4.99 ? 164 ALA B CA   1  
ATOM 2024  C C    . ALA B 2 20  ? 8.428   -16.666 4.526   1.00 5.11 ? 164 ALA B C    1  
ATOM 2025  O O    . ALA B 2 20  ? 8.157   -17.753 5.077   1.00 5.31 ? 164 ALA B O    1  
ATOM 2026  C CB   . ALA B 2 20  ? 7.045   -14.735 5.295   1.00 5.92 ? 164 ALA B CB   1  
ATOM 2027  O OXT  . ALA B 2 20  ? 8.712   -16.571 3.314   1.00 5.35 ? 164 ALA B OXT  1  
ATOM 2028  H H    . ALA B 2 20  ? 9.702   -14.491 3.962   1.00 4.24 ? 164 ALA B H    1  
ATOM 2029  N N    . MET A 1 1   ? 39.606  1.851   -4.021  1.00 1.33 ? 1   MET A N    2  
ATOM 2030  C CA   . MET A 1 1   ? 40.168  3.212   -4.162  1.00 1.17 ? 1   MET A CA   2  
ATOM 2031  C C    . MET A 1 1   ? 39.087  4.287   -4.058  1.00 1.10 ? 1   MET A C    2  
ATOM 2032  O O    . MET A 1 1   ? 39.336  5.374   -3.536  1.00 1.14 ? 1   MET A O    2  
ATOM 2033  C CB   . MET A 1 1   ? 40.926  3.341   -5.487  1.00 1.33 ? 1   MET A CB   2  
ATOM 2034  C CG   . MET A 1 1   ? 41.630  4.675   -5.679  1.00 1.59 ? 1   MET A CG   2  
ATOM 2035  S SD   . MET A 1 1   ? 42.839  5.019   -4.387  1.00 1.94 ? 1   MET A SD   2  
ATOM 2036  C CE   . MET A 1 1   ? 43.101  6.773   -4.643  1.00 2.23 ? 1   MET A CE   2  
ATOM 2037  H H1   . MET A 1 1   ? 40.374  1.154   -3.951  1.00 1.41 ? 1   MET A H1   2  
ATOM 2038  H H2   . MET A 1 1   ? 39.020  1.615   -4.844  1.00 1.51 ? 1   MET A H2   2  
ATOM 2039  H H3   . MET A 1 1   ? 39.021  1.790   -3.164  1.00 1.44 ? 1   MET A H3   2  
ATOM 2040  N N    . ASP A 1 2   ? 37.884  3.975   -4.533  1.00 1.05 ? 2   ASP A N    2  
ATOM 2041  C CA   . ASP A 1 2   ? 36.772  4.926   -4.504  1.00 1.04 ? 2   ASP A CA   2  
ATOM 2042  C C    . ASP A 1 2   ? 36.410  5.352   -3.081  1.00 1.05 ? 2   ASP A C    2  
ATOM 2043  O O    . ASP A 1 2   ? 36.040  6.501   -2.846  1.00 1.09 ? 2   ASP A O    2  
ATOM 2044  C CB   . ASP A 1 2   ? 35.542  4.354   -5.219  1.00 1.07 ? 2   ASP A CB   2  
ATOM 2045  C CG   . ASP A 1 2   ? 34.756  3.381   -4.361  1.00 1.10 ? 2   ASP A CG   2  
ATOM 2046  O OD1  . ASP A 1 2   ? 35.283  2.294   -4.050  1.00 1.21 ? 2   ASP A OD1  2  
ATOM 2047  O OD2  . ASP A 1 2   ? 33.605  3.697   -3.999  1.00 1.29 ? 2   ASP A OD2  2  
ATOM 2048  H H    . ASP A 1 2   ? 37.737  3.085   -4.919  1.00 1.07 ? 2   ASP A H    2  
ATOM 2049  N N    . GLY A 1 3   ? 36.538  4.430   -2.132  1.00 1.07 ? 3   GLY A N    2  
ATOM 2050  C CA   . GLY A 1 3   ? 36.214  4.736   -0.753  1.00 1.14 ? 3   GLY A CA   2  
ATOM 2051  C C    . GLY A 1 3   ? 37.277  5.583   -0.089  1.00 1.16 ? 3   GLY A C    2  
ATOM 2052  O O    . GLY A 1 3   ? 37.003  6.310   0.869   1.00 1.23 ? 3   GLY A O    2  
ATOM 2053  H H    . GLY A 1 3   ? 36.856  3.535   -2.373  1.00 1.07 ? 3   GLY A H    2  
ATOM 2054  N N    . SER A 1 4   ? 38.489  5.510   -0.621  1.00 1.16 ? 4   SER A N    2  
ATOM 2055  C CA   . SER A 1 4   ? 39.611  6.258   -0.085  1.00 1.23 ? 4   SER A CA   2  
ATOM 2056  C C    . SER A 1 4   ? 39.788  7.591   -0.813  1.00 1.23 ? 4   SER A C    2  
ATOM 2057  O O    . SER A 1 4   ? 40.772  8.301   -0.603  1.00 1.35 ? 4   SER A O    2  
ATOM 2058  C CB   . SER A 1 4   ? 40.885  5.415   -0.190  1.00 1.34 ? 4   SER A CB   2  
ATOM 2059  O OG   . SER A 1 4   ? 40.655  4.096   0.287   1.00 1.40 ? 4   SER A OG   2  
ATOM 2060  H H    . SER A 1 4   ? 38.630  4.937   -1.402  1.00 1.14 ? 4   SER A H    2  
ATOM 2061  H HG   . SER A 1 4   ? 40.840  4.064   1.235   1.00 1.44 ? 4   SER A HG   2  
ATOM 2062  N N    . GLY A 1 5   ? 38.831  7.923   -1.669  1.00 1.19 ? 5   GLY A N    2  
ATOM 2063  C CA   . GLY A 1 5   ? 38.895  9.165   -2.408  1.00 1.24 ? 5   GLY A CA   2  
ATOM 2064  C C    . GLY A 1 5   ? 38.160  10.284  -1.696  1.00 1.22 ? 5   GLY A C    2  
ATOM 2065  O O    . GLY A 1 5   ? 38.358  10.508  -0.498  1.00 1.30 ? 5   GLY A O    2  
ATOM 2066  H H    . GLY A 1 5   ? 38.071  7.319   -1.796  1.00 1.17 ? 5   GLY A H    2  
ATOM 2067  N N    . GLU A 1 6   ? 37.307  10.981  -2.427  1.00 1.26 ? 6   GLU A N    2  
ATOM 2068  C CA   . GLU A 1 6   ? 36.539  12.080  -1.870  1.00 1.28 ? 6   GLU A CA   2  
ATOM 2069  C C    . GLU A 1 6   ? 35.050  11.831  -2.039  1.00 1.22 ? 6   GLU A C    2  
ATOM 2070  O O    . GLU A 1 6   ? 34.507  11.960  -3.140  1.00 1.34 ? 6   GLU A O    2  
ATOM 2071  C CB   . GLU A 1 6   ? 36.931  13.392  -2.545  1.00 1.49 ? 6   GLU A CB   2  
ATOM 2072  C CG   . GLU A 1 6   ? 38.366  13.806  -2.289  1.00 1.57 ? 6   GLU A CG   2  
ATOM 2073  C CD   . GLU A 1 6   ? 38.863  14.814  -3.298  1.00 1.62 ? 6   GLU A CD   2  
ATOM 2074  O OE1  . GLU A 1 6   ? 38.454  15.993  -3.220  1.00 2.00 ? 6   GLU A OE1  2  
ATOM 2075  O OE2  . GLU A 1 6   ? 39.661  14.435  -4.178  1.00 1.87 ? 6   GLU A OE2  2  
ATOM 2076  H H    . GLU A 1 6   ? 37.189  10.749  -3.376  1.00 1.37 ? 6   GLU A H    2  
ATOM 2077  N N    . GLN A 1 7   ? 34.396  11.452  -0.952  1.00 1.15 ? 7   GLN A N    2  
ATOM 2078  C CA   . GLN A 1 7   ? 32.967  11.184  -0.972  1.00 1.12 ? 7   GLN A CA   2  
ATOM 2079  C C    . GLN A 1 7   ? 32.261  12.001  0.104   1.00 1.11 ? 7   GLN A C    2  
ATOM 2080  O O    . GLN A 1 7   ? 32.718  12.060  1.248   1.00 1.15 ? 7   GLN A O    2  
ATOM 2081  C CB   . GLN A 1 7   ? 32.694  9.691   -0.766  1.00 1.12 ? 7   GLN A CB   2  
ATOM 2082  C CG   . GLN A 1 7   ? 33.149  8.800   -1.917  1.00 1.27 ? 7   GLN A CG   2  
ATOM 2083  C CD   . GLN A 1 7   ? 32.278  8.940   -3.154  1.00 1.35 ? 7   GLN A CD   2  
ATOM 2084  O OE1  . GLN A 1 7   ? 31.682  9.989   -3.396  1.00 1.63 ? 7   GLN A OE1  2  
ATOM 2085  N NE2  . GLN A 1 7   ? 32.201  7.883   -3.951  1.00 1.60 ? 7   GLN A NE2  2  
ATOM 2086  H H    . GLN A 1 7   ? 34.886  11.355  -0.109  1.00 1.20 ? 7   GLN A H    2  
ATOM 2087  H HE21 . GLN A 1 7   ? 32.703  7.077   -3.704  1.00 1.78 ? 7   GLN A HE21 2  
ATOM 2088  H HE22 . GLN A 1 7   ? 31.645  7.951   -4.758  1.00 1.81 ? 7   GLN A HE22 2  
ATOM 2089  N N    . PRO A 1 8   ? 31.144  12.651  -0.252  1.00 1.13 ? 8   PRO A N    2  
ATOM 2090  C CA   . PRO A 1 8   ? 30.369  13.468  0.687   1.00 1.17 ? 8   PRO A CA   2  
ATOM 2091  C C    . PRO A 1 8   ? 29.547  12.604  1.642   1.00 1.11 ? 8   PRO A C    2  
ATOM 2092  O O    . PRO A 1 8   ? 28.316  12.565  1.561   1.00 1.12 ? 8   PRO A O    2  
ATOM 2093  C CB   . PRO A 1 8   ? 29.452  14.276  -0.233  1.00 1.26 ? 8   PRO A CB   2  
ATOM 2094  C CG   . PRO A 1 8   ? 29.266  13.407  -1.430  1.00 1.27 ? 8   PRO A CG   2  
ATOM 2095  C CD   . PRO A 1 8   ? 30.552  12.647  -1.604  1.00 1.18 ? 8   PRO A CD   2  
ATOM 2096  N N    . ARG A 1 9   ? 30.253  11.904  2.535   1.00 1.09 ? 9   ARG A N    2  
ATOM 2097  C CA   . ARG A 1 9   ? 29.641  11.020  3.526   1.00 1.07 ? 9   ARG A CA   2  
ATOM 2098  C C    . ARG A 1 9   ? 29.061  9.773   2.866   1.00 1.00 ? 9   ARG A C    2  
ATOM 2099  O O    . ARG A 1 9   ? 29.664  8.700   2.903   1.00 1.16 ? 9   ARG A O    2  
ATOM 2100  C CB   . ARG A 1 9   ? 28.575  11.746  4.349   1.00 1.15 ? 9   ARG A CB   2  
ATOM 2101  C CG   . ARG A 1 9   ? 28.074  10.975  5.558   1.00 1.28 ? 9   ARG A CG   2  
ATOM 2102  C CD   . ARG A 1 9   ? 26.741  11.522  6.049   1.00 1.41 ? 9   ARG A CD   2  
ATOM 2103  N NE   . ARG A 1 9   ? 26.609  12.955  5.790   1.00 1.46 ? 9   ARG A NE   2  
ATOM 2104  C CZ   . ARG A 1 9   ? 25.632  13.720  6.267   1.00 1.62 ? 9   ARG A CZ   2  
ATOM 2105  N NH1  . ARG A 1 9   ? 24.705  13.211  7.069   1.00 1.92 ? 9   ARG A NH1  2  
ATOM 2106  N NH2  . ARG A 1 9   ? 25.593  15.005  5.945   1.00 1.99 ? 9   ARG A NH2  2  
ATOM 2107  H H    . ARG A 1 9   ? 31.233  11.983  2.519   1.00 1.13 ? 9   ARG A H    2  
ATOM 2108  H HE   . ARG A 1 9   ? 27.292  13.373  5.219   1.00 1.78 ? 9   ARG A HE   2  
ATOM 2109  H HH11 . ARG A 1 9   ? 24.737  12.243  7.328   1.00 2.02 ? 9   ARG A HH11 2  
ATOM 2110  H HH12 . ARG A 1 9   ? 23.974  13.798  7.430   1.00 2.32 ? 9   ARG A HH12 2  
ATOM 2111  H HH21 . ARG A 1 9   ? 26.301  15.396  5.346   1.00 2.25 ? 9   ARG A HH21 2  
ATOM 2112  H HH22 . ARG A 1 9   ? 24.869  15.595  6.307   1.00 2.24 ? 9   ARG A HH22 2  
ATOM 2113  N N    . GLY A 1 10  ? 27.906  9.931   2.246   1.00 0.97 ? 10  GLY A N    2  
ATOM 2114  C CA   . GLY A 1 10  ? 27.258  8.825   1.581   1.00 0.99 ? 10  GLY A CA   2  
ATOM 2115  C C    . GLY A 1 10  ? 27.165  9.056   0.090   1.00 0.97 ? 10  GLY A C    2  
ATOM 2116  O O    . GLY A 1 10  ? 26.713  10.114  -0.349  1.00 1.29 ? 10  GLY A O    2  
ATOM 2117  H H    . GLY A 1 10  ? 27.498  10.825  2.218   1.00 1.08 ? 10  GLY A H    2  
ATOM 2118  N N    . GLY A 1 11  ? 27.612  8.079   -0.688  1.00 0.95 ? 11  GLY A N    2  
ATOM 2119  C CA   . GLY A 1 11  ? 27.561  8.196   -2.131  1.00 0.94 ? 11  GLY A CA   2  
ATOM 2120  C C    . GLY A 1 11  ? 26.149  8.059   -2.656  1.00 0.92 ? 11  GLY A C    2  
ATOM 2121  O O    . GLY A 1 11  ? 25.247  7.655   -1.923  1.00 1.14 ? 11  GLY A O    2  
ATOM 2122  H H    . GLY A 1 11  ? 27.979  7.268   -0.278  1.00 1.17 ? 11  GLY A H    2  
ATOM 2123  N N    . GLY A 1 12  ? 25.949  8.398   -3.916  1.00 0.92 ? 12  GLY A N    2  
ATOM 2124  C CA   . GLY A 1 12  ? 24.630  8.300   -4.503  1.00 0.92 ? 12  GLY A CA   2  
ATOM 2125  C C    . GLY A 1 12  ? 24.560  7.256   -5.600  1.00 0.84 ? 12  GLY A C    2  
ATOM 2126  O O    . GLY A 1 12  ? 24.826  7.563   -6.761  1.00 0.92 ? 12  GLY A O    2  
ATOM 2127  H H    . GLY A 1 12  ? 26.701  8.723   -4.455  1.00 1.07 ? 12  GLY A H    2  
ATOM 2128  N N    . PRO A 1 13  ? 24.218  6.001   -5.260  1.00 0.80 ? 13  PRO A N    2  
ATOM 2129  C CA   . PRO A 1 13  ? 24.110  4.919   -6.234  1.00 0.83 ? 13  PRO A CA   2  
ATOM 2130  C C    . PRO A 1 13  ? 22.709  4.868   -6.848  1.00 0.79 ? 13  PRO A C    2  
ATOM 2131  O O    . PRO A 1 13  ? 21.992  5.872   -6.857  1.00 0.91 ? 13  PRO A O    2  
ATOM 2132  C CB   . PRO A 1 13  ? 24.360  3.682   -5.373  1.00 0.94 ? 13  PRO A CB   2  
ATOM 2133  C CG   . PRO A 1 13  ? 23.788  4.036   -4.039  1.00 1.01 ? 13  PRO A CG   2  
ATOM 2134  C CD   . PRO A 1 13  ? 23.903  5.535   -3.896  1.00 0.87 ? 13  PRO A CD   2  
ATOM 2135  N N    . THR A 1 14  ? 22.323  3.704   -7.354  1.00 0.77 ? 14  THR A N    2  
ATOM 2136  C CA   . THR A 1 14  ? 21.011  3.534   -7.959  1.00 0.75 ? 14  THR A CA   2  
ATOM 2137  C C    . THR A 1 14  ? 19.904  3.705   -6.916  1.00 0.73 ? 14  THR A C    2  
ATOM 2138  O O    . THR A 1 14  ? 19.942  3.102   -5.842  1.00 0.98 ? 14  THR A O    2  
ATOM 2139  C CB   . THR A 1 14  ? 20.878  2.166   -8.672  1.00 0.85 ? 14  THR A CB   2  
ATOM 2140  O OG1  . THR A 1 14  ? 19.585  2.042   -9.277  1.00 0.86 ? 14  THR A OG1  2  
ATOM 2141  C CG2  . THR A 1 14  ? 21.115  1.003   -7.717  1.00 0.95 ? 14  THR A CG2  2  
ATOM 2142  H H    . THR A 1 14  ? 22.936  2.939   -7.323  1.00 0.89 ? 14  THR A H    2  
ATOM 2143  H HG1  . THR A 1 14  ? 19.678  2.105   -10.236 1.00 1.00 ? 14  THR A HG1  2  
ATOM 2144  N N    . SER A 1 15  ? 18.943  4.561   -7.218  1.00 0.62 ? 15  SER A N    2  
ATOM 2145  C CA   . SER A 1 15  ? 17.835  4.810   -6.309  1.00 0.65 ? 15  SER A CA   2  
ATOM 2146  C C    . SER A 1 15  ? 16.503  4.418   -6.942  1.00 0.60 ? 15  SER A C    2  
ATOM 2147  O O    . SER A 1 15  ? 15.482  4.342   -6.261  1.00 0.60 ? 15  SER A O    2  
ATOM 2148  C CB   . SER A 1 15  ? 17.822  6.281   -5.898  1.00 0.80 ? 15  SER A CB   2  
ATOM 2149  O OG   . SER A 1 15  ? 19.138  6.729   -5.622  1.00 0.99 ? 15  SER A OG   2  
ATOM 2150  H H    . SER A 1 15  ? 18.985  5.052   -8.068  1.00 0.69 ? 15  SER A H    2  
ATOM 2151  H HG   . SER A 1 15  ? 19.736  5.972   -5.602  1.00 0.99 ? 15  SER A HG   2  
ATOM 2152  N N    . SER A 1 16  ? 16.527  4.143   -8.241  1.00 0.61 ? 16  SER A N    2  
ATOM 2153  C CA   . SER A 1 16  ? 15.328  3.772   -8.977  1.00 0.62 ? 16  SER A CA   2  
ATOM 2154  C C    . SER A 1 16  ? 14.753  2.451   -8.472  1.00 0.55 ? 16  SER A C    2  
ATOM 2155  O O    . SER A 1 16  ? 13.669  2.414   -7.888  1.00 0.61 ? 16  SER A O    2  
ATOM 2156  C CB   . SER A 1 16  ? 15.672  3.675   -10.463 1.00 0.68 ? 16  SER A CB   2  
ATOM 2157  O OG   . SER A 1 16  ? 17.075  3.811   -10.650 1.00 0.85 ? 16  SER A OG   2  
ATOM 2158  H H    . SER A 1 16  ? 17.378  4.185   -8.726  1.00 0.66 ? 16  SER A H    2  
ATOM 2159  H HG   . SER A 1 16  ? 17.243  4.291   -11.469 1.00 1.04 ? 16  SER A HG   2  
ATOM 2160  N N    . GLU A 1 17  ? 15.498  1.371   -8.669  1.00 0.50 ? 17  GLU A N    2  
ATOM 2161  C CA   . GLU A 1 17  ? 15.052  0.054   -8.236  1.00 0.49 ? 17  GLU A CA   2  
ATOM 2162  C C    . GLU A 1 17  ? 15.166  -0.082  -6.720  1.00 0.49 ? 17  GLU A C    2  
ATOM 2163  O O    . GLU A 1 17  ? 14.458  -0.875  -6.104  1.00 0.51 ? 17  GLU A O    2  
ATOM 2164  C CB   . GLU A 1 17  ? 15.861  -1.041  -8.933  1.00 0.55 ? 17  GLU A CB   2  
ATOM 2165  C CG   . GLU A 1 17  ? 15.125  -2.366  -9.074  1.00 0.75 ? 17  GLU A CG   2  
ATOM 2166  C CD   . GLU A 1 17  ? 13.902  -2.267  -9.966  1.00 0.97 ? 17  GLU A CD   2  
ATOM 2167  O OE1  . GLU A 1 17  ? 14.068  -2.149  -11.202 1.00 1.23 ? 17  GLU A OE1  2  
ATOM 2168  O OE2  . GLU A 1 17  ? 12.772  -2.315  -9.440  1.00 1.11 ? 17  GLU A OE2  2  
ATOM 2169  H H    . GLU A 1 17  ? 16.365  1.461   -9.121  1.00 0.53 ? 17  GLU A H    2  
ATOM 2170  N N    . GLN A 1 18  ? 16.054  0.712   -6.124  1.00 0.52 ? 18  GLN A N    2  
ATOM 2171  C CA   . GLN A 1 18  ? 16.264  0.687   -4.677  1.00 0.58 ? 18  GLN A CA   2  
ATOM 2172  C C    . GLN A 1 18  ? 14.965  0.977   -3.933  1.00 0.60 ? 18  GLN A C    2  
ATOM 2173  O O    . GLN A 1 18  ? 14.593  0.249   -3.013  1.00 0.64 ? 18  GLN A O    2  
ATOM 2174  C CB   . GLN A 1 18  ? 17.347  1.695   -4.271  1.00 0.68 ? 18  GLN A CB   2  
ATOM 2175  C CG   . GLN A 1 18  ? 17.727  1.657   -2.796  1.00 0.82 ? 18  GLN A CG   2  
ATOM 2176  C CD   . GLN A 1 18  ? 17.144  2.815   -1.999  1.00 0.96 ? 18  GLN A CD   2  
ATOM 2177  O OE1  . GLN A 1 18  ? 17.760  3.873   -1.874  1.00 1.27 ? 18  GLN A OE1  2  
ATOM 2178  N NE2  . GLN A 1 18  ? 15.955  2.620   -1.448  1.00 1.14 ? 18  GLN A NE2  2  
ATOM 2179  H H    . GLN A 1 18  ? 16.580  1.328   -6.672  1.00 0.53 ? 18  GLN A H    2  
ATOM 2180  H HE21 . GLN A 1 18  ? 15.517  1.750   -1.580  1.00 1.15 ? 18  GLN A HE21 2  
ATOM 2181  H HE22 . GLN A 1 18  ? 15.560  3.351   -0.929  1.00 1.42 ? 18  GLN A HE22 2  
ATOM 2182  N N    . ILE A 1 19  ? 14.274  2.035   -4.345  1.00 0.60 ? 19  ILE A N    2  
ATOM 2183  C CA   . ILE A 1 19  ? 13.016  2.420   -3.716  1.00 0.66 ? 19  ILE A CA   2  
ATOM 2184  C C    . ILE A 1 19  ? 11.937  1.373   -3.984  1.00 0.63 ? 19  ILE A C    2  
ATOM 2185  O O    . ILE A 1 19  ? 11.113  1.075   -3.116  1.00 0.67 ? 19  ILE A O    2  
ATOM 2186  C CB   . ILE A 1 19  ? 12.553  3.815   -4.195  1.00 0.73 ? 19  ILE A CB   2  
ATOM 2187  C CG1  . ILE A 1 19  ? 13.505  4.890   -3.657  1.00 0.78 ? 19  ILE A CG1  2  
ATOM 2188  C CG2  . ILE A 1 19  ? 11.121  4.100   -3.762  1.00 0.77 ? 19  ILE A CG2  2  
ATOM 2189  C CD1  . ILE A 1 19  ? 13.215  6.284   -4.166  1.00 0.85 ? 19  ILE A CD1  2  
ATOM 2190  H H    . ILE A 1 19  ? 14.615  2.571   -5.096  1.00 0.58 ? 19  ILE A H    2  
ATOM 2191  N N    . MET A 1 20  ? 11.970  0.796   -5.180  1.00 0.59 ? 20  MET A N    2  
ATOM 2192  C CA   . MET A 1 20  ? 11.000  -0.223  -5.562  1.00 0.60 ? 20  MET A CA   2  
ATOM 2193  C C    . MET A 1 20  ? 11.116  -1.449  -4.661  1.00 0.56 ? 20  MET A C    2  
ATOM 2194  O O    . MET A 1 20  ? 10.108  -2.007  -4.225  1.00 0.57 ? 20  MET A O    2  
ATOM 2195  C CB   . MET A 1 20  ? 11.185  -0.625  -7.023  1.00 0.61 ? 20  MET A CB   2  
ATOM 2196  C CG   . MET A 1 20  ? 10.120  -1.580  -7.542  1.00 0.71 ? 20  MET A CG   2  
ATOM 2197  S SD   . MET A 1 20  ? 8.691   -0.721  -8.237  1.00 0.96 ? 20  MET A SD   2  
ATOM 2198  C CE   . MET A 1 20  ? 7.750   -0.353  -6.757  1.00 1.64 ? 20  MET A CE   2  
ATOM 2199  H H    . MET A 1 20  ? 12.666  1.060   -5.819  1.00 0.57 ? 20  MET A H    2  
ATOM 2200  N N    . LYS A 1 21  ? 12.350  -1.861  -4.381  1.00 0.55 ? 21  LYS A N    2  
ATOM 2201  C CA   . LYS A 1 21  ? 12.596  -3.011  -3.520  1.00 0.55 ? 21  LYS A CA   2  
ATOM 2202  C C    . LYS A 1 21  ? 12.020  -2.769  -2.125  1.00 0.51 ? 21  LYS A C    2  
ATOM 2203  O O    . LYS A 1 21  ? 11.511  -3.689  -1.483  1.00 0.51 ? 21  LYS A O    2  
ATOM 2204  C CB   . LYS A 1 21  ? 14.095  -3.312  -3.422  1.00 0.58 ? 21  LYS A CB   2  
ATOM 2205  C CG   . LYS A 1 21  ? 14.758  -3.715  -4.733  1.00 0.63 ? 21  LYS A CG   2  
ATOM 2206  C CD   . LYS A 1 21  ? 14.223  -5.034  -5.266  1.00 0.69 ? 21  LYS A CD   2  
ATOM 2207  C CE   . LYS A 1 21  ? 15.302  -5.780  -6.035  1.00 0.83 ? 21  LYS A CE   2  
ATOM 2208  N NZ   . LYS A 1 21  ? 14.747  -6.870  -6.880  1.00 1.15 ? 21  LYS A NZ   2  
ATOM 2209  H H    . LYS A 1 21  ? 13.117  -1.382  -4.774  1.00 0.55 ? 21  LYS A H    2  
ATOM 2210  H HZ1  . LYS A 1 21  ? 15.504  -7.527  -7.155  1.00 1.46 ? 21  LYS A HZ1  2  
ATOM 2211  H HZ2  . LYS A 1 21  ? 14.323  -6.476  -7.741  1.00 1.69 ? 21  LYS A HZ2  2  
ATOM 2212  H HZ3  . LYS A 1 21  ? 14.012  -7.405  -6.357  1.00 1.26 ? 21  LYS A HZ3  2  
ATOM 2213  N N    . THR A 1 22  ? 12.092  -1.520  -1.669  1.00 0.52 ? 22  THR A N    2  
ATOM 2214  C CA   . THR A 1 22  ? 11.571  -1.151  -0.362  1.00 0.51 ? 22  THR A CA   2  
ATOM 2215  C C    . THR A 1 22  ? 10.048  -1.296  -0.348  1.00 0.52 ? 22  THR A C    2  
ATOM 2216  O O    . THR A 1 22  ? 9.459   -1.725  0.647   1.00 0.52 ? 22  THR A O    2  
ATOM 2217  C CB   . THR A 1 22  ? 11.953  0.299   -0.006  1.00 0.56 ? 22  THR A CB   2  
ATOM 2218  O OG1  . THR A 1 22  ? 13.282  0.571   -0.477  1.00 0.63 ? 22  THR A OG1  2  
ATOM 2219  C CG2  . THR A 1 22  ? 11.905  0.513   1.498   1.00 0.71 ? 22  THR A CG2  2  
ATOM 2220  H H    . THR A 1 22  ? 12.501  -0.827  -2.232  1.00 0.55 ? 22  THR A H    2  
ATOM 2221  H HG1  . THR A 1 22  ? 13.723  -0.258  -0.679  1.00 0.88 ? 22  THR A HG1  2  
ATOM 2222  N N    . GLY A 1 23  ? 9.423   -0.965  -1.475  1.00 0.55 ? 23  GLY A N    2  
ATOM 2223  C CA   . GLY A 1 23  ? 7.980   -1.063  -1.587  1.00 0.58 ? 23  GLY A CA   2  
ATOM 2224  C C    . GLY A 1 23  ? 7.496   -2.497  -1.486  1.00 0.56 ? 23  GLY A C    2  
ATOM 2225  O O    . GLY A 1 23  ? 6.454   -2.766  -0.885  1.00 0.58 ? 23  GLY A O    2  
ATOM 2226  H H    . GLY A 1 23  ? 9.952   -0.654  -2.243  1.00 0.55 ? 23  GLY A H    2  
ATOM 2227  N N    . ALA A 1 24  ? 8.268   -3.419  -2.058  1.00 0.56 ? 24  ALA A N    2  
ATOM 2228  C CA   . ALA A 1 24  ? 7.921   -4.839  -2.029  1.00 0.58 ? 24  ALA A CA   2  
ATOM 2229  C C    . ALA A 1 24  ? 7.908   -5.362  -0.596  1.00 0.55 ? 24  ALA A C    2  
ATOM 2230  O O    . ALA A 1 24  ? 7.136   -6.260  -0.255  1.00 0.73 ? 24  ALA A O    2  
ATOM 2231  C CB   . ALA A 1 24  ? 8.891   -5.644  -2.880  1.00 0.61 ? 24  ALA A CB   2  
ATOM 2232  H H    . ALA A 1 24  ? 9.090   -3.137  -2.514  1.00 0.58 ? 24  ALA A H    2  
ATOM 2233  N N    . LEU A 1 25  ? 8.763   -4.791  0.243   1.00 0.44 ? 25  LEU A N    2  
ATOM 2234  C CA   . LEU A 1 25  ? 8.843   -5.190  1.638   1.00 0.40 ? 25  LEU A CA   2  
ATOM 2235  C C    . LEU A 1 25  ? 7.723   -4.544  2.446   1.00 0.39 ? 25  LEU A C    2  
ATOM 2236  O O    . LEU A 1 25  ? 7.097   -5.194  3.285   1.00 0.40 ? 25  LEU A O    2  
ATOM 2237  C CB   . LEU A 1 25  ? 10.213  -4.830  2.224   1.00 0.40 ? 25  LEU A CB   2  
ATOM 2238  C CG   . LEU A 1 25  ? 10.444  -5.176  3.700   1.00 0.45 ? 25  LEU A CG   2  
ATOM 2239  C CD1  . LEU A 1 25  ? 10.134  -6.641  3.968   1.00 0.61 ? 25  LEU A CD1  2  
ATOM 2240  C CD2  . LEU A 1 25  ? 11.877  -4.854  4.099   1.00 0.48 ? 25  LEU A CD2  2  
ATOM 2241  H H    . LEU A 1 25  ? 9.357   -4.084  -0.090  1.00 0.48 ? 25  LEU A H    2  
ATOM 2242  N N    . LEU A 1 26  ? 7.466   -3.266  2.174   1.00 0.39 ? 26  LEU A N    2  
ATOM 2243  C CA   . LEU A 1 26  ? 6.419   -2.526  2.867   1.00 0.40 ? 26  LEU A CA   2  
ATOM 2244  C C    . LEU A 1 26  ? 5.056   -3.179  2.668   1.00 0.44 ? 26  LEU A C    2  
ATOM 2245  O O    . LEU A 1 26  ? 4.301   -3.371  3.623   1.00 0.45 ? 26  LEU A O    2  
ATOM 2246  C CB   . LEU A 1 26  ? 6.381   -1.074  2.391   1.00 0.43 ? 26  LEU A CB   2  
ATOM 2247  C CG   . LEU A 1 26  ? 7.481   -0.160  2.934   1.00 0.42 ? 26  LEU A CG   2  
ATOM 2248  C CD1  . LEU A 1 26  ? 7.461   1.182   2.219   1.00 0.49 ? 26  LEU A CD1  2  
ATOM 2249  C CD2  . LEU A 1 26  ? 7.323   0.032   4.437   1.00 0.39 ? 26  LEU A CD2  2  
ATOM 2250  H H    . LEU A 1 26  ? 8.003   -2.806  1.492   1.00 0.40 ? 26  LEU A H    2  
ATOM 2251  N N    . LEU A 1 27  ? 4.757   -3.531  1.424   1.00 0.49 ? 27  LEU A N    2  
ATOM 2252  C CA   . LEU A 1 27  ? 3.489   -4.168  1.091   1.00 0.56 ? 27  LEU A CA   2  
ATOM 2253  C C    . LEU A 1 27  ? 3.335   -5.494  1.830   1.00 0.57 ? 27  LEU A C    2  
ATOM 2254  O O    . LEU A 1 27  ? 2.276   -5.784  2.389   1.00 0.61 ? 27  LEU A O    2  
ATOM 2255  C CB   . LEU A 1 27  ? 3.373   -4.386  -0.422  1.00 0.63 ? 27  LEU A CB   2  
ATOM 2256  C CG   . LEU A 1 27  ? 2.494   -3.394  -1.196  1.00 0.67 ? 27  LEU A CG   2  
ATOM 2257  C CD1  . LEU A 1 27  ? 1.065   -3.412  -0.674  1.00 0.71 ? 27  LEU A CD1  2  
ATOM 2258  C CD2  . LEU A 1 27  ? 3.074   -1.989  -1.139  1.00 0.64 ? 27  LEU A CD2  2  
ATOM 2259  H H    . LEU A 1 27  ? 5.406   -3.352  0.707   1.00 0.50 ? 27  LEU A H    2  
ATOM 2260  N N    . GLN A 1 28  ? 4.406   -6.280  1.849   1.00 0.56 ? 28  GLN A N    2  
ATOM 2261  C CA   . GLN A 1 28  ? 4.396   -7.573  2.517   1.00 0.59 ? 28  GLN A CA   2  
ATOM 2262  C C    . GLN A 1 28  ? 4.155   -7.407  4.013   1.00 0.56 ? 28  GLN A C    2  
ATOM 2263  O O    . GLN A 1 28  ? 3.333   -8.115  4.597   1.00 0.60 ? 28  GLN A O    2  
ATOM 2264  C CB   . GLN A 1 28  ? 5.721   -8.300  2.284   1.00 0.64 ? 28  GLN A CB   2  
ATOM 2265  C CG   . GLN A 1 28  ? 5.666   -9.789  2.578   1.00 0.99 ? 28  GLN A CG   2  
ATOM 2266  C CD   . GLN A 1 28  ? 7.032   -10.387 2.863   1.00 1.17 ? 28  GLN A CD   2  
ATOM 2267  O OE1  . GLN A 1 28  ? 7.141   -11.408 3.534   1.00 1.46 ? 28  GLN A OE1  2  
ATOM 2268  N NE2  . GLN A 1 28  ? 8.082   -9.754  2.361   1.00 1.53 ? 28  GLN A NE2  2  
ATOM 2269  H H    . GLN A 1 28  ? 5.225   -5.980  1.404   1.00 0.55 ? 28  GLN A H    2  
ATOM 2270  H HE21 . GLN A 1 28  ? 7.929   -8.939  1.840   1.00 1.80 ? 28  GLN A HE21 2  
ATOM 2271  H HE22 . GLN A 1 28  ? 8.975   -10.135 2.526   1.00 1.74 ? 28  GLN A HE22 2  
ATOM 2272  N N    . GLY A 1 29  ? 4.866   -6.459  4.618   1.00 0.54 ? 29  GLY A N    2  
ATOM 2273  C CA   . GLY A 1 29  ? 4.733   -6.212  6.042   1.00 0.54 ? 29  GLY A CA   2  
ATOM 2274  C C    . GLY A 1 29  ? 3.333   -5.785  6.436   1.00 0.51 ? 29  GLY A C    2  
ATOM 2275  O O    . GLY A 1 29  ? 2.769   -6.304  7.401   1.00 0.53 ? 29  GLY A O    2  
ATOM 2276  H H    . GLY A 1 29  ? 5.493   -5.917  4.087   1.00 0.56 ? 29  GLY A H    2  
ATOM 2277  N N    . PHE A 1 30  ? 2.765   -4.853  5.678   1.00 0.50 ? 30  PHE A N    2  
ATOM 2278  C CA   . PHE A 1 30  ? 1.425   -4.347  5.947   1.00 0.51 ? 30  PHE A CA   2  
ATOM 2279  C C    . PHE A 1 30  ? 0.379   -5.458  5.858   1.00 0.51 ? 30  PHE A C    2  
ATOM 2280  O O    . PHE A 1 30  ? -0.504  -5.565  6.713   1.00 0.55 ? 30  PHE A O    2  
ATOM 2281  C CB   . PHE A 1 30  ? 1.086   -3.211  4.978   1.00 0.54 ? 30  PHE A CB   2  
ATOM 2282  C CG   . PHE A 1 30  ? -0.139  -2.425  5.352   1.00 0.54 ? 30  PHE A CG   2  
ATOM 2283  C CD1  . PHE A 1 30  ? -0.171  -1.679  6.521   1.00 0.85 ? 30  PHE A CD1  2  
ATOM 2284  C CD2  . PHE A 1 30  ? -1.256  -2.424  4.533   1.00 0.83 ? 30  PHE A CD2  2  
ATOM 2285  C CE1  . PHE A 1 30  ? -1.295  -0.954  6.867   1.00 0.85 ? 30  PHE A CE1  2  
ATOM 2286  C CE2  . PHE A 1 30  ? -2.383  -1.699  4.873   1.00 0.90 ? 30  PHE A CE2  2  
ATOM 2287  C CZ   . PHE A 1 30  ? -2.401  -0.963  6.041   1.00 0.65 ? 30  PHE A CZ   2  
ATOM 2288  H H    . PHE A 1 30  ? 3.266   -4.488  4.916   1.00 0.51 ? 30  PHE A H    2  
ATOM 2289  N N    . ILE A 1 31  ? 0.488   -6.292  4.828   1.00 0.50 ? 31  ILE A N    2  
ATOM 2290  C CA   . ILE A 1 31  ? -0.452  -7.388  4.633   1.00 0.52 ? 31  ILE A CA   2  
ATOM 2291  C C    . ILE A 1 31  ? -0.285  -8.466  5.705   1.00 0.53 ? 31  ILE A C    2  
ATOM 2292  O O    . ILE A 1 31  ? -1.248  -8.842  6.371   1.00 0.56 ? 31  ILE A O    2  
ATOM 2293  C CB   . ILE A 1 31  ? -0.317  -8.019  3.229   1.00 0.54 ? 31  ILE A CB   2  
ATOM 2294  C CG1  . ILE A 1 31  ? -0.659  -6.985  2.152   1.00 0.54 ? 31  ILE A CG1  2  
ATOM 2295  C CG2  . ILE A 1 31  ? -1.211  -9.247  3.092   1.00 0.58 ? 31  ILE A CG2  2  
ATOM 2296  C CD1  . ILE A 1 31  ? -0.394  -7.458  0.737   1.00 0.57 ? 31  ILE A CD1  2  
ATOM 2297  H H    . ILE A 1 31  ? 1.217   -6.165  4.183   1.00 0.49 ? 31  ILE A H    2  
ATOM 2298  N N    . GLN A 1 32  ? 0.948   -8.930  5.888   1.00 0.53 ? 32  GLN A N    2  
ATOM 2299  C CA   . GLN A 1 32  ? 1.245   -9.975  6.866   1.00 0.55 ? 32  GLN A CA   2  
ATOM 2300  C C    . GLN A 1 32  ? 0.870   -9.568  8.288   1.00 0.54 ? 32  GLN A C    2  
ATOM 2301  O O    . GLN A 1 32  ? 0.444   -10.405 9.086   1.00 0.57 ? 32  GLN A O    2  
ATOM 2302  C CB   . GLN A 1 32  ? 2.714   -10.396 6.794   1.00 0.57 ? 32  GLN A CB   2  
ATOM 2303  C CG   . GLN A 1 32  ? 3.008   -11.426 5.714   1.00 0.68 ? 32  GLN A CG   2  
ATOM 2304  C CD   . GLN A 1 32  ? 2.234   -12.718 5.913   1.00 0.90 ? 32  GLN A CD   2  
ATOM 2305  O OE1  . GLN A 1 32  ? 1.917   -13.102 7.039   1.00 1.07 ? 32  GLN A OE1  2  
ATOM 2306  N NE2  . GLN A 1 32  ? 1.922   -13.394 4.818   1.00 1.12 ? 32  GLN A NE2  2  
ATOM 2307  H H    . GLN A 1 32  ? 1.682   -8.558  5.349   1.00 0.52 ? 32  GLN A H    2  
ATOM 2308  H HE21 . GLN A 1 32  ? 2.203   -13.029 3.950   1.00 1.19 ? 32  GLN A HE21 2  
ATOM 2309  H HE22 . GLN A 1 32  ? 1.430   -14.234 4.915   1.00 1.31 ? 32  GLN A HE22 2  
ATOM 2310  N N    . ASP A 1 33  ? 1.019   -8.286  8.598   1.00 0.53 ? 33  ASP A N    2  
ATOM 2311  C CA   . ASP A 1 33  ? 0.698   -7.780  9.929   1.00 0.55 ? 33  ASP A CA   2  
ATOM 2312  C C    . ASP A 1 33  ? -0.774  -8.003  10.273  1.00 0.58 ? 33  ASP A C    2  
ATOM 2313  O O    . ASP A 1 33  ? -1.102  -8.580  11.312  1.00 0.65 ? 33  ASP A O    2  
ATOM 2314  C CB   . ASP A 1 33  ? 1.036   -6.292  10.040  1.00 0.57 ? 33  ASP A CB   2  
ATOM 2315  C CG   . ASP A 1 33  ? 0.814   -5.755  11.438  1.00 0.61 ? 33  ASP A CG   2  
ATOM 2316  O OD1  . ASP A 1 33  ? -0.312  -5.307  11.740  1.00 0.74 ? 33  ASP A OD1  2  
ATOM 2317  O OD2  . ASP A 1 33  ? 1.767   -5.776  12.245  1.00 0.73 ? 33  ASP A OD2  2  
ATOM 2318  H H    . ASP A 1 33  ? 1.364   -7.663  7.918   1.00 0.53 ? 33  ASP A H    2  
ATOM 2319  N N    . ARG A 1 34  ? -1.656  -7.560  9.391   1.00 0.58 ? 34  ARG A N    2  
ATOM 2320  C CA   . ARG A 1 34  ? -3.085  -7.703  9.618   1.00 0.63 ? 34  ARG A CA   2  
ATOM 2321  C C    . ARG A 1 34  ? -3.581  -9.110  9.292   1.00 0.62 ? 34  ARG A C    2  
ATOM 2322  O O    . ARG A 1 34  ? -4.622  -9.538  9.792   1.00 0.67 ? 34  ARG A O    2  
ATOM 2323  C CB   . ARG A 1 34  ? -3.877  -6.636  8.857   1.00 0.67 ? 34  ARG A CB   2  
ATOM 2324  C CG   . ARG A 1 34  ? -4.491  -5.569  9.757   1.00 0.74 ? 34  ARG A CG   2  
ATOM 2325  C CD   . ARG A 1 34  ? -3.437  -4.862  10.595  1.00 0.73 ? 34  ARG A CD   2  
ATOM 2326  N NE   . ARG A 1 34  ? -4.001  -4.306  11.825  1.00 0.75 ? 34  ARG A NE   2  
ATOM 2327  C CZ   . ARG A 1 34  ? -3.638  -4.687  13.050  1.00 0.74 ? 34  ARG A CZ   2  
ATOM 2328  N NH1  . ARG A 1 34  ? -2.675  -5.582  13.214  1.00 0.77 ? 34  ARG A NH1  2  
ATOM 2329  N NH2  . ARG A 1 34  ? -4.219  -4.149  14.112  1.00 0.85 ? 34  ARG A NH2  2  
ATOM 2330  H H    . ARG A 1 34  ? -1.336  -7.127  8.570   1.00 0.56 ? 34  ARG A H    2  
ATOM 2331  H HE   . ARG A 1 34  ? -4.701  -3.602  11.730  1.00 0.86 ? 34  ARG A HE   2  
ATOM 2332  H HH11 . ARG A 1 34  ? -2.200  -5.965  12.415  1.00 0.74 ? 34  ARG A HH11 2  
ATOM 2333  H HH12 . ARG A 1 34  ? -2.423  -5.890  14.135  1.00 0.90 ? 34  ARG A HH12 2  
ATOM 2334  H HH21 . ARG A 1 34  ? -4.937  -3.443  13.997  1.00 0.91 ? 34  ARG A HH21 2  
ATOM 2335  H HH22 . ARG A 1 34  ? -3.943  -4.430  15.037  1.00 0.93 ? 34  ARG A HH22 2  
ATOM 2336  N N    . ALA A 1 35  ? -2.827  -9.831  8.466   1.00 0.61 ? 35  ALA A N    2  
ATOM 2337  C CA   . ALA A 1 35  ? -3.189  -11.196 8.090   1.00 0.64 ? 35  ALA A CA   2  
ATOM 2338  C C    . ALA A 1 35  ? -3.130  -12.119 9.302   1.00 0.66 ? 35  ALA A C    2  
ATOM 2339  O O    . ALA A 1 35  ? -3.819  -13.138 9.355   1.00 0.68 ? 35  ALA A O    2  
ATOM 2340  C CB   . ALA A 1 35  ? -2.278  -11.712 6.987   1.00 0.65 ? 35  ALA A CB   2  
ATOM 2341  H H    . ALA A 1 35  ? -2.014  -9.432  8.086   1.00 0.61 ? 35  ALA A H    2  
ATOM 2342  N N    . GLY A 1 36  ? -2.319  -11.733 10.286  1.00 0.69 ? 36  GLY A N    2  
ATOM 2343  C CA   . GLY A 1 36  ? -2.176  -12.521 11.497  1.00 0.76 ? 36  GLY A CA   2  
ATOM 2344  C C    . GLY A 1 36  ? -3.468  -12.612 12.288  1.00 0.78 ? 36  GLY A C    2  
ATOM 2345  O O    . GLY A 1 36  ? -3.608  -13.463 13.169  1.00 0.89 ? 36  GLY A O    2  
ATOM 2346  H H    . GLY A 1 36  ? -1.806  -10.902 10.183  1.00 0.70 ? 36  GLY A H    2  
ATOM 2347  N N    . ARG A 1 37  ? -4.426  -11.746 11.956  1.00 0.75 ? 37  ARG A N    2  
ATOM 2348  C CA   . ARG A 1 37  ? -5.722  -11.723 12.630  1.00 0.81 ? 37  ARG A CA   2  
ATOM 2349  C C    . ARG A 1 37  ? -6.541  -12.966 12.271  1.00 0.79 ? 37  ARG A C    2  
ATOM 2350  O O    . ARG A 1 37  ? -7.577  -13.243 12.876  1.00 0.88 ? 37  ARG A O    2  
ATOM 2351  C CB   . ARG A 1 37  ? -6.494  -10.449 12.255  1.00 0.86 ? 37  ARG A CB   2  
ATOM 2352  C CG   . ARG A 1 37  ? -7.626  -10.091 13.209  1.00 1.17 ? 37  ARG A CG   2  
ATOM 2353  C CD   . ARG A 1 37  ? -7.319  -8.824  13.993  1.00 1.23 ? 37  ARG A CD   2  
ATOM 2354  N NE   . ARG A 1 37  ? -7.597  -7.608  13.224  1.00 1.18 ? 37  ARG A NE   2  
ATOM 2355  C CZ   . ARG A 1 37  ? -7.192  -6.391  13.587  1.00 1.28 ? 37  ARG A CZ   2  
ATOM 2356  N NH1  . ARG A 1 37  ? -6.471  -6.230  14.689  1.00 1.35 ? 37  ARG A NH1  2  
ATOM 2357  N NH2  . ARG A 1 37  ? -7.511  -5.334  12.845  1.00 1.73 ? 37  ARG A NH2  2  
ATOM 2358  H H    . ARG A 1 37  ? -4.255  -11.104 11.235  1.00 0.71 ? 37  ARG A H    2  
ATOM 2359  H HE   . ARG A 1 37  ? -8.124  -7.707  12.404  1.00 1.43 ? 37  ARG A HE   2  
ATOM 2360  H HH11 . ARG A 1 37  ? -6.221  -7.025  15.252  1.00 1.52 ? 37  ARG A HH11 2  
ATOM 2361  H HH12 . ARG A 1 37  ? -6.172  -5.315  14.970  1.00 1.52 ? 37  ARG A HH12 2  
ATOM 2362  H HH21 . ARG A 1 37  ? -8.051  -5.449  12.011  1.00 2.07 ? 37  ARG A HH21 2  
ATOM 2363  H HH22 . ARG A 1 37  ? -7.218  -4.412  13.122  1.00 1.89 ? 37  ARG A HH22 2  
ATOM 2364  N N    . MET A 1 38  ? -6.066  -13.714 11.284  1.00 0.74 ? 38  MET A N    2  
ATOM 2365  C CA   . MET A 1 38  ? -6.742  -14.924 10.845  1.00 0.75 ? 38  MET A CA   2  
ATOM 2366  C C    . MET A 1 38  ? -6.149  -16.150 11.528  1.00 0.77 ? 38  MET A C    2  
ATOM 2367  O O    . MET A 1 38  ? -6.580  -17.277 11.281  1.00 1.03 ? 38  MET A O    2  
ATOM 2368  C CB   . MET A 1 38  ? -6.638  -15.076 9.327   1.00 0.76 ? 38  MET A CB   2  
ATOM 2369  C CG   . MET A 1 38  ? -7.456  -14.068 8.539   1.00 0.86 ? 38  MET A CG   2  
ATOM 2370  S SD   . MET A 1 38  ? -9.225  -14.229 8.837   1.00 1.19 ? 38  MET A SD   2  
ATOM 2371  C CE   . MET A 1 38  ? -9.873  -13.020 7.685   1.00 1.48 ? 38  MET A CE   2  
ATOM 2372  H H    . MET A 1 38  ? -5.230  -13.447 10.841  1.00 0.74 ? 38  MET A H    2  
ATOM 2373  N N    . GLY A 1 39  ? -5.157  -15.927 12.382  1.00 0.76 ? 39  GLY A N    2  
ATOM 2374  C CA   . GLY A 1 39  ? -4.522  -17.027 13.078  1.00 0.78 ? 39  GLY A CA   2  
ATOM 2375  C C    . GLY A 1 39  ? -3.306  -17.526 12.328  1.00 0.80 ? 39  GLY A C    2  
ATOM 2376  O O    . GLY A 1 39  ? -2.397  -16.749 12.033  1.00 1.17 ? 39  GLY A O    2  
ATOM 2377  H H    . GLY A 1 39  ? -4.846  -15.009 12.536  1.00 0.92 ? 39  GLY A H    2  
ATOM 2378  N N    . GLY A 1 40  ? -3.293  -18.813 12.013  1.00 0.84 ? 40  GLY A N    2  
ATOM 2379  C CA   . GLY A 1 40  ? -2.182  -19.396 11.290  1.00 0.88 ? 40  GLY A CA   2  
ATOM 2380  C C    . GLY A 1 40  ? -2.494  -20.805 10.827  1.00 0.88 ? 40  GLY A C    2  
ATOM 2381  O O    . GLY A 1 40  ? -3.559  -21.341 11.138  1.00 1.11 ? 40  GLY A O    2  
ATOM 2382  H H    . GLY A 1 40  ? -4.046  -19.380 12.282  1.00 1.11 ? 40  GLY A H    2  
ATOM 2383  N N    . GLU A 1 41  ? -1.578  -21.407 10.089  1.00 0.82 ? 41  GLU A N    2  
ATOM 2384  C CA   . GLU A 1 41  ? -1.772  -22.761 9.593   1.00 0.87 ? 41  GLU A CA   2  
ATOM 2385  C C    . GLU A 1 41  ? -0.712  -23.708 10.143  1.00 0.90 ? 41  GLU A C    2  
ATOM 2386  O O    . GLU A 1 41  ? 0.173   -24.160 9.415   1.00 1.06 ? 41  GLU A O    2  
ATOM 2387  C CB   . GLU A 1 41  ? -1.836  -22.807 8.057   1.00 0.98 ? 41  GLU A CB   2  
ATOM 2388  C CG   . GLU A 1 41  ? -1.269  -21.580 7.359   1.00 1.31 ? 41  GLU A CG   2  
ATOM 2389  C CD   . GLU A 1 41  ? 0.202   -21.718 7.031   1.00 1.55 ? 41  GLU A CD   2  
ATOM 2390  O OE1  . GLU A 1 41  ? 1.045   -21.383 7.886   1.00 1.89 ? 41  GLU A OE1  2  
ATOM 2391  O OE2  . GLU A 1 41  ? 0.527   -22.154 5.908   1.00 2.17 ? 41  GLU A OE2  2  
ATOM 2392  H H    . GLU A 1 41  ? -0.746  -20.932 9.872   1.00 0.89 ? 41  GLU A H    2  
ATOM 2393  N N    . ALA A 1 42  ? -0.808  -23.976 11.445  1.00 0.89 ? 42  ALA A N    2  
ATOM 2394  C CA   . ALA A 1 42  ? 0.114   -24.873 12.145  1.00 0.98 ? 42  ALA A CA   2  
ATOM 2395  C C    . ALA A 1 42  ? 1.577   -24.458 11.978  1.00 0.90 ? 42  ALA A C    2  
ATOM 2396  O O    . ALA A 1 42  ? 2.302   -25.020 11.158  1.00 0.99 ? 42  ALA A O    2  
ATOM 2397  C CB   . ALA A 1 42  ? -0.096  -26.323 11.728  1.00 1.21 ? 42  ALA A CB   2  
ATOM 2398  H H    . ALA A 1 42  ? -1.527  -23.551 11.957  1.00 0.92 ? 42  ALA A H    2  
ATOM 2399  N N    . PRO A 1 43  ? 2.028   -23.458 12.752  1.00 0.86 ? 43  PRO A N    2  
ATOM 2400  C CA   . PRO A 1 43  ? 3.407   -22.970 12.695  1.00 0.89 ? 43  PRO A CA   2  
ATOM 2401  C C    . PRO A 1 43  ? 4.364   -23.893 13.452  1.00 0.93 ? 43  PRO A C    2  
ATOM 2402  O O    . PRO A 1 43  ? 4.926   -23.518 14.484  1.00 1.08 ? 43  PRO A O    2  
ATOM 2403  C CB   . PRO A 1 43  ? 3.337   -21.594 13.381  1.00 1.03 ? 43  PRO A CB   2  
ATOM 2404  C CG   . PRO A 1 43  ? 1.891   -21.359 13.687  1.00 1.11 ? 43  PRO A CG   2  
ATOM 2405  C CD   . PRO A 1 43  ? 1.241   -22.710 13.733  1.00 0.96 ? 43  PRO A CD   2  
ATOM 2406  N N    . GLU A 1 44  ? 4.543   -25.102 12.933  1.00 0.91 ? 44  GLU A N    2  
ATOM 2407  C CA   . GLU A 1 44  ? 5.425   -26.086 13.550  1.00 0.98 ? 44  GLU A CA   2  
ATOM 2408  C C    . GLU A 1 44  ? 6.889   -25.693 13.351  1.00 0.98 ? 44  GLU A C    2  
ATOM 2409  O O    . GLU A 1 44  ? 7.740   -25.961 14.199  1.00 1.13 ? 44  GLU A O    2  
ATOM 2410  C CB   . GLU A 1 44  ? 5.164   -27.477 12.959  1.00 1.06 ? 44  GLU A CB   2  
ATOM 2411  C CG   . GLU A 1 44  ? 5.507   -27.589 11.483  1.00 1.34 ? 44  GLU A CG   2  
ATOM 2412  C CD   . GLU A 1 44  ? 5.082   -28.901 10.864  1.00 1.59 ? 44  GLU A CD   2  
ATOM 2413  O OE1  . GLU A 1 44  ? 5.548   -29.964 11.326  1.00 2.13 ? 44  GLU A OE1  2  
ATOM 2414  O OE2  . GLU A 1 44  ? 4.297   -28.870 9.891   1.00 1.91 ? 44  GLU A OE2  2  
ATOM 2415  H H    . GLU A 1 44  ? 4.064   -25.339 12.106  1.00 0.91 ? 44  GLU A H    2  
ATOM 2416  N N    . LEU A 1 45  ? 7.168   -25.044 12.226  1.00 0.93 ? 45  LEU A N    2  
ATOM 2417  C CA   . LEU A 1 45  ? 8.520   -24.614 11.901  1.00 0.99 ? 45  LEU A CA   2  
ATOM 2418  C C    . LEU A 1 45  ? 8.519   -23.164 11.439  1.00 0.93 ? 45  LEU A C    2  
ATOM 2419  O O    . LEU A 1 45  ? 9.122   -22.301 12.081  1.00 0.96 ? 45  LEU A O    2  
ATOM 2420  C CB   . LEU A 1 45  ? 9.116   -25.514 10.813  1.00 1.11 ? 45  LEU A CB   2  
ATOM 2421  C CG   . LEU A 1 45  ? 9.467   -26.943 11.234  1.00 1.39 ? 45  LEU A CG   2  
ATOM 2422  C CD1  . LEU A 1 45  ? 9.850   -27.780 10.025  1.00 1.65 ? 45  LEU A CD1  2  
ATOM 2423  C CD2  . LEU A 1 45  ? 10.596  -26.936 12.252  1.00 1.60 ? 45  LEU A CD2  2  
ATOM 2424  H H    . LEU A 1 45  ? 6.440   -24.842 11.599  1.00 0.92 ? 45  LEU A H    2  
ATOM 2425  N N    . ALA A 1 46  ? 7.820   -22.910 10.331  1.00 0.93 ? 46  ALA A N    2  
ATOM 2426  C CA   . ALA A 1 46  ? 7.710   -21.574 9.753   1.00 0.95 ? 46  ALA A CA   2  
ATOM 2427  C C    . ALA A 1 46  ? 9.076   -20.971 9.417   1.00 0.89 ? 46  ALA A C    2  
ATOM 2428  O O    . ALA A 1 46  ? 10.099  -21.660 9.440   1.00 1.04 ? 46  ALA A O    2  
ATOM 2429  C CB   . ALA A 1 46  ? 6.900   -20.652 10.658  1.00 1.03 ? 46  ALA A CB   2  
ATOM 2430  H H    . ALA A 1 46  ? 7.356   -23.650 9.887   1.00 0.98 ? 46  ALA A H    2  
ATOM 2431  N N    . LEU A 1 47  ? 9.077   -19.691 9.085   1.00 0.83 ? 47  LEU A N    2  
ATOM 2432  C CA   . LEU A 1 47  ? 10.301  -18.986 8.750   1.00 0.78 ? 47  LEU A CA   2  
ATOM 2433  C C    . LEU A 1 47  ? 10.324  -17.624 9.431   1.00 0.69 ? 47  LEU A C    2  
ATOM 2434  O O    . LEU A 1 47  ? 9.361   -16.862 9.344   1.00 0.75 ? 47  LEU A O    2  
ATOM 2435  C CB   . LEU A 1 47  ? 10.417  -18.812 7.234   1.00 0.89 ? 47  LEU A CB   2  
ATOM 2436  C CG   . LEU A 1 47  ? 11.719  -18.188 6.724   1.00 0.92 ? 47  LEU A CG   2  
ATOM 2437  C CD1  . LEU A 1 47  ? 12.869  -19.178 6.829   1.00 1.06 ? 47  LEU A CD1  2  
ATOM 2438  C CD2  . LEU A 1 47  ? 11.555  -17.694 5.294   1.00 1.09 ? 47  LEU A CD2  2  
ATOM 2439  H H    . LEU A 1 47  ? 8.226   -19.204 9.058   1.00 0.92 ? 47  LEU A H    2  
ATOM 2440  N N    . ASP A 1 48  ? 11.411  -17.333 10.127  1.00 0.69 ? 48  ASP A N    2  
ATOM 2441  C CA   . ASP A 1 48  ? 11.556  -16.057 10.816  1.00 0.67 ? 48  ASP A CA   2  
ATOM 2442  C C    . ASP A 1 48  ? 12.978  -15.528 10.671  1.00 0.61 ? 48  ASP A C    2  
ATOM 2443  O O    . ASP A 1 48  ? 13.822  -15.744 11.542  1.00 0.63 ? 48  ASP A O    2  
ATOM 2444  C CB   . ASP A 1 48  ? 11.177  -16.188 12.293  1.00 0.79 ? 48  ASP A CB   2  
ATOM 2445  C CG   . ASP A 1 48  ? 11.133  -14.857 13.015  1.00 1.00 ? 48  ASP A CG   2  
ATOM 2446  O OD1  . ASP A 1 48  ? 10.461  -13.930 12.522  1.00 1.64 ? 48  ASP A OD1  2  
ATOM 2447  O OD2  . ASP A 1 48  ? 11.754  -14.737 14.093  1.00 1.31 ? 48  ASP A OD2  2  
ATOM 2448  H H    . ASP A 1 48  ? 12.139  -17.992 10.180  1.00 0.81 ? 48  ASP A H    2  
ATOM 2449  N N    . PRO A 1 49  ? 13.266  -14.844 9.550   1.00 0.64 ? 49  PRO A N    2  
ATOM 2450  C CA   . PRO A 1 49  ? 14.594  -14.285 9.274   1.00 0.66 ? 49  PRO A CA   2  
ATOM 2451  C C    . PRO A 1 49  ? 14.871  -13.043 10.113  1.00 0.58 ? 49  PRO A C    2  
ATOM 2452  O O    . PRO A 1 49  ? 16.026  -12.662 10.311  1.00 0.63 ? 49  PRO A O    2  
ATOM 2453  C CB   . PRO A 1 49  ? 14.533  -13.909 7.784   1.00 0.80 ? 49  PRO A CB   2  
ATOM 2454  C CG   . PRO A 1 49  ? 13.243  -14.472 7.276   1.00 0.93 ? 49  PRO A CG   2  
ATOM 2455  C CD   . PRO A 1 49  ? 12.328  -14.565 8.458   1.00 0.76 ? 49  PRO A CD   2  
ATOM 2456  N N    . VAL A 1 50  ? 13.796  -12.432 10.610  1.00 0.56 ? 50  VAL A N    2  
ATOM 2457  C CA   . VAL A 1 50  ? 13.878  -11.226 11.433  1.00 0.58 ? 50  VAL A CA   2  
ATOM 2458  C C    . VAL A 1 50  ? 14.285  -10.005 10.607  1.00 0.57 ? 50  VAL A C    2  
ATOM 2459  O O    . VAL A 1 50  ? 15.420  -9.902  10.142  1.00 0.62 ? 50  VAL A O    2  
ATOM 2460  C CB   . VAL A 1 50  ? 14.823  -11.393 12.644  1.00 0.64 ? 50  VAL A CB   2  
ATOM 2461  C CG1  . VAL A 1 50  ? 14.838  -10.131 13.495  1.00 0.75 ? 50  VAL A CG1  2  
ATOM 2462  C CG2  . VAL A 1 50  ? 14.404  -12.593 13.478  1.00 0.75 ? 50  VAL A CG2  2  
ATOM 2463  H H    . VAL A 1 50  ? 12.913  -12.811 10.420  1.00 0.60 ? 50  VAL A H    2  
ATOM 2464  N N    . PRO A 1 51  ? 13.347  -9.074  10.395  1.00 0.60 ? 51  PRO A N    2  
ATOM 2465  C CA   . PRO A 1 51  ? 13.612  -7.850  9.636   1.00 0.65 ? 51  PRO A CA   2  
ATOM 2466  C C    . PRO A 1 51  ? 14.589  -6.953  10.388  1.00 0.66 ? 51  PRO A C    2  
ATOM 2467  O O    . PRO A 1 51  ? 14.250  -6.380  11.423  1.00 0.73 ? 51  PRO A O    2  
ATOM 2468  C CB   . PRO A 1 51  ? 12.237  -7.174  9.530   1.00 0.77 ? 51  PRO A CB   2  
ATOM 2469  C CG   . PRO A 1 51  ? 11.250  -8.227  9.908   1.00 0.92 ? 51  PRO A CG   2  
ATOM 2470  C CD   . PRO A 1 51  ? 11.959  -9.133  10.870  1.00 0.72 ? 51  PRO A CD   2  
ATOM 2471  N N    . GLN A 1 52  ? 15.806  -6.859  9.870   1.00 0.71 ? 52  GLN A N    2  
ATOM 2472  C CA   . GLN A 1 52  ? 16.848  -6.051  10.494  1.00 0.81 ? 52  GLN A CA   2  
ATOM 2473  C C    . GLN A 1 52  ? 16.649  -4.567  10.212  1.00 0.77 ? 52  GLN A C    2  
ATOM 2474  O O    . GLN A 1 52  ? 17.252  -3.712  10.863  1.00 0.91 ? 52  GLN A O    2  
ATOM 2475  C CB   . GLN A 1 52  ? 18.228  -6.501  10.008  1.00 0.97 ? 52  GLN A CB   2  
ATOM 2476  C CG   . GLN A 1 52  ? 18.455  -8.004  10.087  1.00 1.18 ? 52  GLN A CG   2  
ATOM 2477  C CD   . GLN A 1 52  ? 18.395  -8.541  11.507  1.00 1.30 ? 52  GLN A CD   2  
ATOM 2478  O OE1  . GLN A 1 52  ? 18.744  -7.848  12.464  1.00 1.40 ? 52  GLN A OE1  2  
ATOM 2479  N NE2  . GLN A 1 52  ? 17.950  -9.778  11.650  1.00 1.51 ? 52  GLN A NE2  2  
ATOM 2480  H H    . GLN A 1 52  ? 16.014  -7.352  9.050   1.00 0.75 ? 52  GLN A H    2  
ATOM 2481  H HE21 . GLN A 1 52  ? 17.683  -10.272 10.842  1.00 1.58 ? 52  GLN A HE21 2  
ATOM 2482  H HE22 . GLN A 1 52  ? 17.901  -10.151 12.553  1.00 1.68 ? 52  GLN A HE22 2  
ATOM 2483  N N    . ASP A 1 53  ? 15.807  -4.263  9.233   1.00 0.67 ? 53  ASP A N    2  
ATOM 2484  C CA   . ASP A 1 53  ? 15.532  -2.880  8.875   1.00 0.64 ? 53  ASP A CA   2  
ATOM 2485  C C    . ASP A 1 53  ? 14.363  -2.342  9.689   1.00 0.62 ? 53  ASP A C    2  
ATOM 2486  O O    . ASP A 1 53  ? 13.218  -2.759  9.507   1.00 0.63 ? 53  ASP A O    2  
ATOM 2487  C CB   . ASP A 1 53  ? 15.244  -2.743  7.377   1.00 0.64 ? 53  ASP A CB   2  
ATOM 2488  C CG   . ASP A 1 53  ? 14.922  -1.314  6.980   1.00 0.60 ? 53  ASP A CG   2  
ATOM 2489  O OD1  . ASP A 1 53  ? 15.864  -0.513  6.800   1.00 0.78 ? 53  ASP A OD1  2  
ATOM 2490  O OD2  . ASP A 1 53  ? 13.726  -0.983  6.857   1.00 0.69 ? 53  ASP A OD2  2  
ATOM 2491  H H    . ASP A 1 53  ? 15.355  -4.982  8.750   1.00 0.69 ? 53  ASP A H    2  
ATOM 2492  N N    . ALA A 1 54  ? 14.658  -1.424  10.594  1.00 0.63 ? 54  ALA A N    2  
ATOM 2493  C CA   . ALA A 1 54  ? 13.631  -0.835  11.441  1.00 0.64 ? 54  ALA A CA   2  
ATOM 2494  C C    . ALA A 1 54  ? 12.826  0.219   10.690  1.00 0.60 ? 54  ALA A C    2  
ATOM 2495  O O    . ALA A 1 54  ? 11.710  0.550   11.089  1.00 0.60 ? 54  ALA A O    2  
ATOM 2496  C CB   . ALA A 1 54  ? 14.248  -0.241  12.695  1.00 0.71 ? 54  ALA A CB   2  
ATOM 2497  H H    . ALA A 1 54  ? 15.592  -1.138  10.701  1.00 0.67 ? 54  ALA A H    2  
ATOM 2498  N N    . SER A 1 55  ? 13.391  0.733   9.600   1.00 0.58 ? 55  SER A N    2  
ATOM 2499  C CA   . SER A 1 55  ? 12.731  1.752   8.795   1.00 0.57 ? 55  SER A CA   2  
ATOM 2500  C C    . SER A 1 55  ? 11.382  1.252   8.288   1.00 0.52 ? 55  SER A C    2  
ATOM 2501  O O    . SER A 1 55  ? 10.349  1.892   8.506   1.00 0.51 ? 55  SER A O    2  
ATOM 2502  C CB   . SER A 1 55  ? 13.630  2.141   7.619   1.00 0.59 ? 55  SER A CB   2  
ATOM 2503  O OG   . SER A 1 55  ? 14.987  1.817   7.894   1.00 0.67 ? 55  SER A OG   2  
ATOM 2504  H H    . SER A 1 55  ? 14.276  0.420   9.327   1.00 0.60 ? 55  SER A H    2  
ATOM 2505  H HG   . SER A 1 55  ? 15.237  1.028   7.379   1.00 0.67 ? 55  SER A HG   2  
ATOM 2506  N N    . THR A 1 56  ? 11.397  0.100   7.628   1.00 0.51 ? 56  THR A N    2  
ATOM 2507  C CA   . THR A 1 56  ? 10.181  -0.492  7.094   1.00 0.49 ? 56  THR A CA   2  
ATOM 2508  C C    . THR A 1 56  ? 9.240   -0.911  8.221   1.00 0.48 ? 56  THR A C    2  
ATOM 2509  O O    . THR A 1 56  ? 8.023   -0.749  8.119   1.00 0.47 ? 56  THR A O    2  
ATOM 2510  C CB   . THR A 1 56  ? 10.496  -1.708  6.198   1.00 0.50 ? 56  THR A CB   2  
ATOM 2511  O OG1  . THR A 1 56  ? 11.570  -2.466  6.772   1.00 0.57 ? 56  THR A OG1  2  
ATOM 2512  C CG2  . THR A 1 56  ? 10.889  -1.255  4.800   1.00 0.63 ? 56  THR A CG2  2  
ATOM 2513  H H    . THR A 1 56  ? 12.258  -0.368  7.494   1.00 0.52 ? 56  THR A H    2  
ATOM 2514  H HG1  . THR A 1 56  ? 12.395  -1.951  6.726   1.00 0.55 ? 56  THR A HG1  2  
ATOM 2515  N N    . LYS A 1 57  ? 9.813   -1.436  9.302   1.00 0.50 ? 57  LYS A N    2  
ATOM 2516  C CA   . LYS A 1 57  ? 9.028   -1.871  10.452  1.00 0.52 ? 57  LYS A CA   2  
ATOM 2517  C C    . LYS A 1 57  ? 8.271   -0.706  11.079  1.00 0.52 ? 57  LYS A C    2  
ATOM 2518  O O    . LYS A 1 57  ? 7.067   -0.797  11.318  1.00 0.53 ? 57  LYS A O    2  
ATOM 2519  C CB   . LYS A 1 57  ? 9.915   -2.553  11.497  1.00 0.56 ? 57  LYS A CB   2  
ATOM 2520  C CG   . LYS A 1 57  ? 10.451  -3.906  11.058  1.00 1.01 ? 57  LYS A CG   2  
ATOM 2521  C CD   . LYS A 1 57  ? 11.449  -4.461  12.061  1.00 1.09 ? 57  LYS A CD   2  
ATOM 2522  C CE   . LYS A 1 57  ? 10.833  -5.548  12.928  1.00 1.30 ? 57  LYS A CE   2  
ATOM 2523  N NZ   . LYS A 1 57  ? 10.024  -4.994  14.047  1.00 1.59 ? 57  LYS A NZ   2  
ATOM 2524  H H    . LYS A 1 57  ? 10.789  -1.542  9.321   1.00 0.52 ? 57  LYS A H    2  
ATOM 2525  H HZ1  . LYS A 1 57  ? 9.697   -5.767  14.665  1.00 1.92 ? 57  LYS A HZ1  2  
ATOM 2526  H HZ2  . LYS A 1 57  ? 9.194   -4.488  13.679  1.00 1.99 ? 57  LYS A HZ2  2  
ATOM 2527  H HZ3  . LYS A 1 57  ? 10.597  -4.334  14.612  1.00 1.99 ? 57  LYS A HZ3  2  
ATOM 2528  N N    . LYS A 1 58  ? 8.979   0.391   11.329  1.00 0.54 ? 58  LYS A N    2  
ATOM 2529  C CA   . LYS A 1 58  ? 8.365   1.569   11.925  1.00 0.56 ? 58  LYS A CA   2  
ATOM 2530  C C    . LYS A 1 58  ? 7.321   2.158   10.987  1.00 0.54 ? 58  LYS A C    2  
ATOM 2531  O O    . LYS A 1 58  ? 6.252   2.580   11.428  1.00 0.55 ? 58  LYS A O    2  
ATOM 2532  C CB   . LYS A 1 58  ? 9.418   2.620   12.276  1.00 0.60 ? 58  LYS A CB   2  
ATOM 2533  C CG   . LYS A 1 58  ? 9.000   3.544   13.406  1.00 0.70 ? 58  LYS A CG   2  
ATOM 2534  C CD   . LYS A 1 58  ? 9.707   4.884   13.318  1.00 0.76 ? 58  LYS A CD   2  
ATOM 2535  C CE   . LYS A 1 58  ? 9.298   5.787   14.467  1.00 1.16 ? 58  LYS A CE   2  
ATOM 2536  N NZ   . LYS A 1 58  ? 9.532   7.222   14.160  1.00 1.32 ? 58  LYS A NZ   2  
ATOM 2537  H H    . LYS A 1 58  ? 9.937   0.406   11.109  1.00 0.54 ? 58  LYS A H    2  
ATOM 2538  H HZ1  . LYS A 1 58  ? 9.362   7.798   15.007  1.00 1.74 ? 58  LYS A HZ1  2  
ATOM 2539  H HZ2  . LYS A 1 58  ? 8.889   7.537   13.407  1.00 1.67 ? 58  LYS A HZ2  2  
ATOM 2540  H HZ3  . LYS A 1 58  ? 10.513  7.369   13.847  1.00 1.54 ? 58  LYS A HZ3  2  
ATOM 2541  N N    . LEU A 1 59  ? 7.637   2.171   9.690   1.00 0.52 ? 59  LEU A N    2  
ATOM 2542  C CA   . LEU A 1 59  ? 6.720   2.689   8.682   1.00 0.51 ? 59  LEU A CA   2  
ATOM 2543  C C    . LEU A 1 59  ? 5.425   1.890   8.684   1.00 0.50 ? 59  LEU A C    2  
ATOM 2544  O O    . LEU A 1 59  ? 4.333   2.450   8.563   1.00 0.51 ? 59  LEU A O    2  
ATOM 2545  C CB   . LEU A 1 59  ? 7.360   2.641   7.292   1.00 0.50 ? 59  LEU A CB   2  
ATOM 2546  C CG   . LEU A 1 59  ? 8.127   3.890   6.861   1.00 0.56 ? 59  LEU A CG   2  
ATOM 2547  C CD1  . LEU A 1 59  ? 8.928   3.618   5.598   1.00 0.55 ? 59  LEU A CD1  2  
ATOM 2548  C CD2  . LEU A 1 59  ? 7.169   5.053   6.646   1.00 0.72 ? 59  LEU A CD2  2  
ATOM 2549  H H    . LEU A 1 59  ? 8.514   1.826   9.408   1.00 0.52 ? 59  LEU A H    2  
ATOM 2550  N N    . SER A 1 60  ? 5.557   0.582   8.845   1.00 0.50 ? 60  SER A N    2  
ATOM 2551  C CA   . SER A 1 60  ? 4.407   -0.303  8.872   1.00 0.50 ? 60  SER A CA   2  
ATOM 2552  C C    . SER A 1 60  ? 3.532   -0.029  10.095  1.00 0.51 ? 60  SER A C    2  
ATOM 2553  O O    . SER A 1 60  ? 2.313   -0.155  10.027  1.00 0.53 ? 60  SER A O    2  
ATOM 2554  C CB   . SER A 1 60  ? 4.857   -1.766  8.843   1.00 0.50 ? 60  SER A CB   2  
ATOM 2555  O OG   . SER A 1 60  ? 5.684   -2.018  7.716   1.00 0.50 ? 60  SER A OG   2  
ATOM 2556  H H    . SER A 1 60  ? 6.455   0.201   8.950   1.00 0.51 ? 60  SER A H    2  
ATOM 2557  H HG   . SER A 1 60  ? 6.529   -1.565  7.828   1.00 0.49 ? 60  SER A HG   2  
ATOM 2558  N N    . GLU A 1 61  ? 4.157   0.367   11.203  1.00 0.52 ? 61  GLU A N    2  
ATOM 2559  C CA   . GLU A 1 61  ? 3.417   0.659   12.429  1.00 0.55 ? 61  GLU A CA   2  
ATOM 2560  C C    . GLU A 1 61  ? 2.532   1.888   12.258  1.00 0.55 ? 61  GLU A C    2  
ATOM 2561  O O    . GLU A 1 61  ? 1.334   1.839   12.547  1.00 0.57 ? 61  GLU A O    2  
ATOM 2562  C CB   . GLU A 1 61  ? 4.352   0.828   13.630  1.00 0.60 ? 61  GLU A CB   2  
ATOM 2563  C CG   . GLU A 1 61  ? 3.675   0.570   14.971  1.00 0.81 ? 61  GLU A CG   2  
ATOM 2564  C CD   . GLU A 1 61  ? 3.497   1.824   15.812  1.00 1.12 ? 61  GLU A CD   2  
ATOM 2565  O OE1  . GLU A 1 61  ? 2.618   2.650   15.488  1.00 1.50 ? 61  GLU A OE1  2  
ATOM 2566  O OE2  . GLU A 1 61  ? 4.222   1.977   16.817  1.00 1.35 ? 61  GLU A OE2  2  
ATOM 2567  H H    . GLU A 1 61  ? 5.135   0.460   11.198  1.00 0.52 ? 61  GLU A H    2  
ATOM 2568  N N    . CYS A 1 62  ? 3.113   2.984   11.774  1.00 0.55 ? 62  CYS A N    2  
ATOM 2569  C CA   . CYS A 1 62  ? 2.345   4.208   11.573  1.00 0.57 ? 62  CYS A CA   2  
ATOM 2570  C C    . CYS A 1 62  ? 1.203   3.991   10.585  1.00 0.56 ? 62  CYS A C    2  
ATOM 2571  O O    . CYS A 1 62  ? 0.099   4.496   10.780  1.00 0.60 ? 62  CYS A O    2  
ATOM 2572  C CB   . CYS A 1 62  ? 3.230   5.392   11.169  1.00 0.60 ? 62  CYS A CB   2  
ATOM 2573  S SG   . CYS A 1 62  ? 4.647   4.970   10.134  1.00 0.59 ? 62  CYS A SG   2  
ATOM 2574  H H    . CYS A 1 62  ? 4.071   2.969   11.559  1.00 0.55 ? 62  CYS A H    2  
ATOM 2575  H HG   . CYS A 1 62  ? 4.281   3.986   9.321   1.00 0.98 ? 62  CYS A HG   2  
ATOM 2576  N N    . LEU A 1 63  ? 1.461   3.212   9.544   1.00 0.52 ? 63  LEU A N    2  
ATOM 2577  C CA   . LEU A 1 63  ? 0.440   2.920   8.548   1.00 0.53 ? 63  LEU A CA   2  
ATOM 2578  C C    . LEU A 1 63  ? -0.641  2.024   9.144   1.00 0.52 ? 63  LEU A C    2  
ATOM 2579  O O    . LEU A 1 63  ? -1.835  2.239   8.928   1.00 0.53 ? 63  LEU A O    2  
ATOM 2580  C CB   . LEU A 1 63  ? 1.058   2.256   7.315   1.00 0.53 ? 63  LEU A CB   2  
ATOM 2581  C CG   . LEU A 1 63  ? 1.957   3.142   6.450   1.00 0.55 ? 63  LEU A CG   2  
ATOM 2582  C CD1  . LEU A 1 63  ? 2.641   2.317   5.372   1.00 0.57 ? 63  LEU A CD1  2  
ATOM 2583  C CD2  . LEU A 1 63  ? 1.158   4.278   5.828   1.00 0.62 ? 63  LEU A CD2  2  
ATOM 2584  H H    . LEU A 1 63  ? 2.359   2.828   9.440   1.00 0.50 ? 63  LEU A H    2  
ATOM 2585  N N    . LYS A 1 64  ? -0.208  1.034   9.918   1.00 0.52 ? 64  LYS A N    2  
ATOM 2586  C CA   . LYS A 1 64  ? -1.116  0.090   10.562  1.00 0.54 ? 64  LYS A CA   2  
ATOM 2587  C C    . LYS A 1 64  ? -2.050  0.795   11.539  1.00 0.54 ? 64  LYS A C    2  
ATOM 2588  O O    . LYS A 1 64  ? -3.259  0.583   11.511  1.00 0.54 ? 64  LYS A O    2  
ATOM 2589  C CB   . LYS A 1 64  ? -0.322  -1.013  11.281  1.00 0.59 ? 64  LYS A CB   2  
ATOM 2590  C CG   . LYS A 1 64  ? -1.167  -1.979  12.101  1.00 0.71 ? 64  LYS A CG   2  
ATOM 2591  C CD   . LYS A 1 64  ? -0.836  -1.878  13.583  1.00 0.88 ? 64  LYS A CD   2  
ATOM 2592  C CE   . LYS A 1 64  ? 0.428   -2.649  13.935  1.00 0.86 ? 64  LYS A CE   2  
ATOM 2593  N NZ   . LYS A 1 64  ? 0.166   -4.107  14.060  1.00 0.78 ? 64  LYS A NZ   2  
ATOM 2594  H H    . LYS A 1 64  ? 0.759   0.932   10.060  1.00 0.52 ? 64  LYS A H    2  
ATOM 2595  H HZ1  . LYS A 1 64  ? -0.088  -4.507  13.126  1.00 0.95 ? 64  LYS A HZ1  2  
ATOM 2596  H HZ2  . LYS A 1 64  ? -0.618  -4.274  14.722  1.00 1.03 ? 64  LYS A HZ2  2  
ATOM 2597  H HZ3  . LYS A 1 64  ? 1.012   -4.598  14.413  1.00 0.96 ? 64  LYS A HZ3  2  
ATOM 2598  N N    . ARG A 1 65  ? -1.487  1.644   12.391  1.00 0.57 ? 65  ARG A N    2  
ATOM 2599  C CA   . ARG A 1 65  ? -2.281  2.361   13.384  1.00 0.59 ? 65  ARG A CA   2  
ATOM 2600  C C    . ARG A 1 65  ? -3.291  3.308   12.741  1.00 0.57 ? 65  ARG A C    2  
ATOM 2601  O O    . ARG A 1 65  ? -4.394  3.491   13.257  1.00 0.60 ? 65  ARG A O    2  
ATOM 2602  C CB   . ARG A 1 65  ? -1.400  3.072   14.417  1.00 0.66 ? 65  ARG A CB   2  
ATOM 2603  C CG   . ARG A 1 65  ? -0.623  4.274   13.901  1.00 0.66 ? 65  ARG A CG   2  
ATOM 2604  C CD   . ARG A 1 65  ? 0.305   4.828   14.973  1.00 0.75 ? 65  ARG A CD   2  
ATOM 2605  N NE   . ARG A 1 65  ? -0.395  5.043   16.239  1.00 0.86 ? 65  ARG A NE   2  
ATOM 2606  C CZ   . ARG A 1 65  ? -0.185  4.314   17.337  1.00 1.00 ? 65  ARG A CZ   2  
ATOM 2607  N NH1  . ARG A 1 65  ? 0.755   3.380   17.350  1.00 1.05 ? 65  ARG A NH1  2  
ATOM 2608  N NH2  . ARG A 1 65  ? -0.906  4.537   18.426  1.00 1.19 ? 65  ARG A NH2  2  
ATOM 2609  H H    . ARG A 1 65  ? -0.513  1.789   12.355  1.00 0.58 ? 65  ARG A H    2  
ATOM 2610  H HE   . ARG A 1 65  ? -1.070  5.752   16.263  1.00 0.91 ? 65  ARG A HE   2  
ATOM 2611  H HH11 . ARG A 1 65  ? 1.321   3.209   16.526  1.00 0.95 ? 65  ARG A HH11 2  
ATOM 2612  H HH12 . ARG A 1 65  ? 0.917   2.840   18.178  1.00 1.24 ? 65  ARG A HH12 2  
ATOM 2613  H HH21 . ARG A 1 65  ? -1.606  5.254   18.431  1.00 1.21 ? 65  ARG A HH21 2  
ATOM 2614  H HH22 . ARG A 1 65  ? -0.773  3.971   19.247  1.00 1.36 ? 65  ARG A HH22 2  
ATOM 2615  N N    . ILE A 1 66  ? -2.922  3.902   11.612  1.00 0.53 ? 66  ILE A N    2  
ATOM 2616  C CA   . ILE A 1 66  ? -3.821  4.808   10.911  1.00 0.52 ? 66  ILE A CA   2  
ATOM 2617  C C    . ILE A 1 66  ? -4.928  4.009   10.224  1.00 0.48 ? 66  ILE A C    2  
ATOM 2618  O O    . ILE A 1 66  ? -6.103  4.363   10.302  1.00 0.48 ? 66  ILE A O    2  
ATOM 2619  C CB   . ILE A 1 66  ? -3.079  5.691   9.879   1.00 0.54 ? 66  ILE A CB   2  
ATOM 2620  C CG1  . ILE A 1 66  ? -2.121  6.647   10.594  1.00 0.59 ? 66  ILE A CG1  2  
ATOM 2621  C CG2  . ILE A 1 66  ? -4.065  6.475   9.019   1.00 0.55 ? 66  ILE A CG2  2  
ATOM 2622  C CD1  . ILE A 1 66  ? -1.231  7.446   9.665   1.00 0.62 ? 66  ILE A CD1  2  
ATOM 2623  H H    . ILE A 1 66  ? -2.031  3.725   11.240  1.00 0.54 ? 66  ILE A H    2  
ATOM 2624  N N    . GLY A 1 67  ? -4.542  2.916   9.574   1.00 0.47 ? 67  GLY A N    2  
ATOM 2625  C CA   . GLY A 1 67  ? -5.507  2.077   8.888   1.00 0.45 ? 67  GLY A CA   2  
ATOM 2626  C C    . GLY A 1 67  ? -6.486  1.431   9.850   1.00 0.45 ? 67  GLY A C    2  
ATOM 2627  O O    . GLY A 1 67  ? -7.682  1.345   9.566   1.00 0.44 ? 67  GLY A O    2  
ATOM 2628  H H    . GLY A 1 67  ? -3.589  2.674   9.560   1.00 0.49 ? 67  GLY A H    2  
ATOM 2629  N N    . ASP A 1 68  ? -5.978  0.995   10.998  1.00 0.50 ? 68  ASP A N    2  
ATOM 2630  C CA   . ASP A 1 68  ? -6.806  0.354   12.017  1.00 0.55 ? 68  ASP A CA   2  
ATOM 2631  C C    . ASP A 1 68  ? -7.808  1.343   12.601  1.00 0.54 ? 68  ASP A C    2  
ATOM 2632  O O    . ASP A 1 68  ? -8.947  0.985   12.897  1.00 0.55 ? 68  ASP A O    2  
ATOM 2633  C CB   . ASP A 1 68  ? -5.936  -0.243  13.127  1.00 0.65 ? 68  ASP A CB   2  
ATOM 2634  C CG   . ASP A 1 68  ? -6.031  -1.758  13.205  1.00 0.76 ? 68  ASP A CG   2  
ATOM 2635  O OD1  . ASP A 1 68  ? -5.900  -2.434  12.165  1.00 0.95 ? 68  ASP A OD1  2  
ATOM 2636  O OD2  . ASP A 1 68  ? -6.216  -2.288  14.322  1.00 1.13 ? 68  ASP A OD2  2  
ATOM 2637  H H    . ASP A 1 68  ? -5.015  1.099   11.165  1.00 0.53 ? 68  ASP A H    2  
ATOM 2638  N N    . GLU A 1 69  ? -7.384  2.596   12.757  1.00 0.55 ? 69  GLU A N    2  
ATOM 2639  C CA   . GLU A 1 69  ? -8.258  3.633   13.288  1.00 0.58 ? 69  GLU A CA   2  
ATOM 2640  C C    . GLU A 1 69  ? -9.345  3.988   12.282  1.00 0.53 ? 69  GLU A C    2  
ATOM 2641  O O    . GLU A 1 69  ? -10.406 4.499   12.644  1.00 0.58 ? 69  GLU A O    2  
ATOM 2642  C CB   . GLU A 1 69  ? -7.469  4.881   13.681  1.00 0.63 ? 69  GLU A CB   2  
ATOM 2643  C CG   . GLU A 1 69  ? -6.945  4.854   15.108  1.00 0.89 ? 69  GLU A CG   2  
ATOM 2644  C CD   . GLU A 1 69  ? -8.037  4.614   16.136  1.00 1.22 ? 69  GLU A CD   2  
ATOM 2645  O OE1  . GLU A 1 69  ? -9.222  4.871   15.836  1.00 1.90 ? 69  GLU A OE1  2  
ATOM 2646  O OE2  . GLU A 1 69  ? -7.711  4.167   17.259  1.00 1.81 ? 69  GLU A OE2  2  
ATOM 2647  H H    . GLU A 1 69  ? -6.464  2.827   12.509  1.00 0.56 ? 69  GLU A H    2  
ATOM 2648  N N    . LEU A 1 70  ? -9.081  3.695   11.013  1.00 0.48 ? 70  LEU A N    2  
ATOM 2649  C CA   . LEU A 1 70  ? -10.043 3.962   9.952   1.00 0.46 ? 70  LEU A CA   2  
ATOM 2650  C C    . LEU A 1 70  ? -11.111 2.873   9.918   1.00 0.41 ? 70  LEU A C    2  
ATOM 2651  O O    . LEU A 1 70  ? -11.967 2.844   9.031   1.00 0.38 ? 70  LEU A O    2  
ATOM 2652  C CB   . LEU A 1 70  ? -9.348  4.075   8.593   1.00 0.45 ? 70  LEU A CB   2  
ATOM 2653  C CG   . LEU A 1 70  ? -8.460  5.303   8.379   1.00 0.51 ? 70  LEU A CG   2  
ATOM 2654  C CD1  . LEU A 1 70  ? -7.676  5.174   7.085   1.00 0.51 ? 70  LEU A CD1  2  
ATOM 2655  C CD2  . LEU A 1 70  ? -9.292  6.576   8.379   1.00 0.59 ? 70  LEU A CD2  2  
ATOM 2656  H H    . LEU A 1 70  ? -8.215  3.291   10.785  1.00 0.48 ? 70  LEU A H    2  
ATOM 2657  N N    . ASP A 1 71  ? -11.037 1.966   10.880  1.00 0.43 ? 71  ASP A N    2  
ATOM 2658  C CA   . ASP A 1 71  ? -12.003 0.884   10.997  1.00 0.41 ? 71  ASP A CA   2  
ATOM 2659  C C    . ASP A 1 71  ? -12.898 1.128   12.207  1.00 0.43 ? 71  ASP A C    2  
ATOM 2660  O O    . ASP A 1 71  ? -13.928 0.477   12.381  1.00 0.48 ? 71  ASP A O    2  
ATOM 2661  C CB   . ASP A 1 71  ? -11.294 -0.468  11.116  1.00 0.46 ? 71  ASP A CB   2  
ATOM 2662  C CG   . ASP A 1 71  ? -12.181 -1.634  10.724  1.00 0.54 ? 71  ASP A CG   2  
ATOM 2663  O OD1  . ASP A 1 71  ? -12.864 -1.541  9.678   1.00 0.61 ? 71  ASP A OD1  2  
ATOM 2664  O OD2  . ASP A 1 71  ? -12.192 -2.650  11.446  1.00 1.07 ? 71  ASP A OD2  2  
ATOM 2665  H H    . ASP A 1 71  ? -10.301 2.017   11.525  1.00 0.48 ? 71  ASP A H    2  
ATOM 2666  N N    . SER A 1 72  ? -12.492 2.084   13.041  1.00 0.46 ? 72  SER A N    2  
ATOM 2667  C CA   . SER A 1 72  ? -13.251 2.444   14.233  1.00 0.50 ? 72  SER A CA   2  
ATOM 2668  C C    . SER A 1 72  ? -14.567 3.120   13.845  1.00 0.47 ? 72  SER A C    2  
ATOM 2669  O O    . SER A 1 72  ? -15.570 3.025   14.556  1.00 0.54 ? 72  SER A O    2  
ATOM 2670  C CB   . SER A 1 72  ? -12.423 3.376   15.124  1.00 0.58 ? 72  SER A CB   2  
ATOM 2671  O OG   . SER A 1 72  ? -11.106 2.880   15.307  1.00 0.65 ? 72  SER A OG   2  
ATOM 2672  H H    . SER A 1 72  ? -11.651 2.552   12.857  1.00 0.49 ? 72  SER A H    2  
ATOM 2673  H HG   . SER A 1 72  ? -10.488 3.625   15.376  1.00 1.14 ? 72  SER A HG   2  
ATOM 2674  N N    . ASN A 1 73  ? -14.552 3.797   12.704  1.00 0.47 ? 73  ASN A N    2  
ATOM 2675  C CA   . ASN A 1 73  ? -15.737 4.480   12.205  1.00 0.47 ? 73  ASN A CA   2  
ATOM 2676  C C    . ASN A 1 73  ? -16.651 3.511   11.460  1.00 0.45 ? 73  ASN A C    2  
ATOM 2677  O O    . ASN A 1 73  ? -16.360 3.092   10.337  1.00 0.45 ? 73  ASN A O    2  
ATOM 2678  C CB   . ASN A 1 73  ? -15.377 5.701   11.335  1.00 0.49 ? 73  ASN A CB   2  
ATOM 2679  C CG   . ASN A 1 73  ? -14.169 5.493   10.431  1.00 0.49 ? 73  ASN A CG   2  
ATOM 2680  O OD1  . ASN A 1 73  ? -13.332 6.381   10.288  1.00 0.70 ? 73  ASN A OD1  2  
ATOM 2681  N ND2  . ASN A 1 73  ? -14.077 4.332   9.805   1.00 0.62 ? 73  ASN A ND2  2  
ATOM 2682  H H    . ASN A 1 73  ? -13.723 3.831   12.182  1.00 0.53 ? 73  ASN A H    2  
ATOM 2683  H HD21 . ASN A 1 73  ? -14.788 3.667   9.950   1.00 0.86 ? 73  ASN A HD21 2  
ATOM 2684  H HD22 . ASN A 1 73  ? -13.295 4.174   9.227   1.00 0.63 ? 73  ASN A HD22 2  
ATOM 2685  N N    . MET A 1 74  ? -17.755 3.155   12.100  1.00 0.48 ? 74  MET A N    2  
ATOM 2686  C CA   . MET A 1 74  ? -18.725 2.228   11.520  1.00 0.49 ? 74  MET A CA   2  
ATOM 2687  C C    . MET A 1 74  ? -19.361 2.798   10.252  1.00 0.47 ? 74  MET A C    2  
ATOM 2688  O O    . MET A 1 74  ? -19.805 2.051   9.378   1.00 0.46 ? 74  MET A O    2  
ATOM 2689  C CB   . MET A 1 74  ? -19.807 1.875   12.544  1.00 0.57 ? 74  MET A CB   2  
ATOM 2690  C CG   . MET A 1 74  ? -20.628 3.063   13.023  1.00 0.78 ? 74  MET A CG   2  
ATOM 2691  S SD   . MET A 1 74  ? -21.879 2.612   14.243  1.00 0.95 ? 74  MET A SD   2  
ATOM 2692  C CE   . MET A 1 74  ? -22.854 1.433   13.310  1.00 1.32 ? 74  MET A CE   2  
ATOM 2693  H H    . MET A 1 74  ? -17.924 3.522   12.995  1.00 0.53 ? 74  MET A H    2  
ATOM 2694  N N    . GLU A 1 75  ? -19.384 4.121   10.158  1.00 0.49 ? 75  GLU A N    2  
ATOM 2695  C CA   . GLU A 1 75  ? -19.963 4.814   9.015   1.00 0.52 ? 75  GLU A CA   2  
ATOM 2696  C C    . GLU A 1 75  ? -19.201 4.475   7.736   1.00 0.48 ? 75  GLU A C    2  
ATOM 2697  O O    . GLU A 1 75  ? -19.793 4.091   6.726   1.00 0.51 ? 75  GLU A O    2  
ATOM 2698  C CB   . GLU A 1 75  ? -19.948 6.329   9.256   1.00 0.61 ? 75  GLU A CB   2  
ATOM 2699  C CG   . GLU A 1 75  ? -20.622 6.768   10.553  1.00 0.72 ? 75  GLU A CG   2  
ATOM 2700  C CD   . GLU A 1 75  ? -19.692 6.755   11.756  1.00 1.09 ? 75  GLU A CD   2  
ATOM 2701  O OE1  . GLU A 1 75  ? -18.621 6.115   11.689  1.00 1.49 ? 75  GLU A OE1  2  
ATOM 2702  O OE2  . GLU A 1 75  ? -20.026 7.397   12.777  1.00 1.63 ? 75  GLU A OE2  2  
ATOM 2703  H H    . GLU A 1 75  ? -18.986 4.657   10.888  1.00 0.51 ? 75  GLU A H    2  
ATOM 2704  N N    . LEU A 1 76  ? -17.882 4.590   7.801   1.00 0.45 ? 76  LEU A N    2  
ATOM 2705  C CA   . LEU A 1 76  ? -17.033 4.292   6.655   1.00 0.44 ? 76  LEU A CA   2  
ATOM 2706  C C    . LEU A 1 76  ? -17.033 2.793   6.370   1.00 0.40 ? 76  LEU A C    2  
ATOM 2707  O O    . LEU A 1 76  ? -17.060 2.367   5.215   1.00 0.39 ? 76  LEU A O    2  
ATOM 2708  C CB   . LEU A 1 76  ? -15.600 4.780   6.908   1.00 0.48 ? 76  LEU A CB   2  
ATOM 2709  C CG   . LEU A 1 76  ? -14.610 4.632   5.748   1.00 0.49 ? 76  LEU A CG   2  
ATOM 2710  C CD1  . LEU A 1 76  ? -14.943 5.602   4.622   1.00 0.53 ? 76  LEU A CD1  2  
ATOM 2711  C CD2  . LEU A 1 76  ? -13.186 4.844   6.236   1.00 0.53 ? 76  LEU A CD2  2  
ATOM 2712  H H    . LEU A 1 76  ? -17.471 4.882   8.640   1.00 0.48 ? 76  LEU A H    2  
ATOM 2713  N N    . GLN A 1 77  ? -17.022 2.002   7.437   1.00 0.39 ? 77  GLN A N    2  
ATOM 2714  C CA   . GLN A 1 77  ? -17.016 0.550   7.327   1.00 0.38 ? 77  GLN A CA   2  
ATOM 2715  C C    . GLN A 1 77  ? -18.265 0.044   6.604   1.00 0.37 ? 77  GLN A C    2  
ATOM 2716  O O    . GLN A 1 77  ? -18.182 -0.826  5.734   1.00 0.38 ? 77  GLN A O    2  
ATOM 2717  C CB   . GLN A 1 77  ? -16.916 -0.076  8.722   1.00 0.40 ? 77  GLN A CB   2  
ATOM 2718  C CG   . GLN A 1 77  ? -16.626 -1.568  8.724   1.00 0.41 ? 77  GLN A CG   2  
ATOM 2719  C CD   . GLN A 1 77  ? -16.555 -2.141  10.125  1.00 0.47 ? 77  GLN A CD   2  
ATOM 2720  O OE1  . GLN A 1 77  ? -17.563 -2.578  10.681  1.00 0.54 ? 77  GLN A OE1  2  
ATOM 2721  N NE2  . GLN A 1 77  ? -15.367 -2.144  10.709  1.00 0.54 ? 77  GLN A NE2  2  
ATOM 2722  H H    . GLN A 1 77  ? -17.020 2.409   8.328   1.00 0.41 ? 77  GLN A H    2  
ATOM 2723  H HE21 . GLN A 1 77  ? -14.595 -1.780  10.208  1.00 0.57 ? 77  GLN A HE21 2  
ATOM 2724  H HE22 . GLN A 1 77  ? -15.296 -2.505  11.614  1.00 0.61 ? 77  GLN A HE22 2  
ATOM 2725  N N    . ARG A 1 78  ? -19.416 0.611   6.958   1.00 0.40 ? 78  ARG A N    2  
ATOM 2726  C CA   . ARG A 1 78  ? -20.686 0.222   6.350   1.00 0.42 ? 78  ARG A CA   2  
ATOM 2727  C C    . ARG A 1 78  ? -20.685 0.487   4.847   1.00 0.40 ? 78  ARG A C    2  
ATOM 2728  O O    . ARG A 1 78  ? -21.214 -0.309  4.067   1.00 0.42 ? 78  ARG A O    2  
ATOM 2729  C CB   . ARG A 1 78  ? -21.843 0.980   7.002   1.00 0.49 ? 78  ARG A CB   2  
ATOM 2730  C CG   . ARG A 1 78  ? -23.117 0.164   7.142   1.00 0.97 ? 78  ARG A CG   2  
ATOM 2731  C CD   . ARG A 1 78  ? -24.345 0.975   6.758   1.00 1.17 ? 78  ARG A CD   2  
ATOM 2732  N NE   . ARG A 1 78  ? -24.540 1.025   5.308   1.00 1.41 ? 78  ARG A NE   2  
ATOM 2733  C CZ   . ARG A 1 78  ? -25.160 0.076   4.606   1.00 1.68 ? 78  ARG A CZ   2  
ATOM 2734  N NH1  . ARG A 1 78  ? -25.653 -0.998  5.217   1.00 1.85 ? 78  ARG A NH1  2  
ATOM 2735  N NH2  . ARG A 1 78  ? -25.297 0.205   3.294   1.00 2.19 ? 78  ARG A NH2  2  
ATOM 2736  H H    . ARG A 1 78  ? -19.412 1.306   7.657   1.00 0.41 ? 78  ARG A H    2  
ATOM 2737  H HE   . ARG A 1 78  ? -24.190 1.818   4.831   1.00 1.72 ? 78  ARG A HE   2  
ATOM 2738  H HH11 . ARG A 1 78  ? -25.559 -1.101  6.213   1.00 1.82 ? 78  ARG A HH11 2  
ATOM 2739  H HH12 . ARG A 1 78  ? -26.125 -1.707  4.689   1.00 2.25 ? 78  ARG A HH12 2  
ATOM 2740  H HH21 . ARG A 1 78  ? -24.936 1.019   2.828   1.00 2.44 ? 78  ARG A HH21 2  
ATOM 2741  H HH22 . ARG A 1 78  ? -25.757 -0.508  2.762   1.00 2.49 ? 78  ARG A HH22 2  
ATOM 2742  N N    . MET A 1 79  ? -20.086 1.605   4.448   1.00 0.41 ? 79  MET A N    2  
ATOM 2743  C CA   . MET A 1 79  ? -20.021 1.977   3.040   1.00 0.43 ? 79  MET A CA   2  
ATOM 2744  C C    . MET A 1 79  ? -19.083 1.049   2.272   1.00 0.40 ? 79  MET A C    2  
ATOM 2745  O O    . MET A 1 79  ? -19.360 0.682   1.132   1.00 0.41 ? 79  MET A O    2  
ATOM 2746  C CB   . MET A 1 79  ? -19.589 3.437   2.881   1.00 0.50 ? 79  MET A CB   2  
ATOM 2747  C CG   . MET A 1 79  ? -19.702 3.971   1.460   1.00 0.67 ? 79  MET A CG   2  
ATOM 2748  S SD   . MET A 1 79  ? -19.113 5.670   1.301   1.00 0.96 ? 79  MET A SD   2  
ATOM 2749  C CE   . MET A 1 79  ? -17.438 5.501   1.910   1.00 1.28 ? 79  MET A CE   2  
ATOM 2750  H H    . MET A 1 79  ? -19.681 2.196   5.117   1.00 0.42 ? 79  MET A H    2  
ATOM 2751  N N    . ILE A 1 80  ? -17.983 0.656   2.911   1.00 0.39 ? 80  ILE A N    2  
ATOM 2752  C CA   . ILE A 1 80  ? -17.009 -0.240  2.286   1.00 0.40 ? 80  ILE A CA   2  
ATOM 2753  C C    . ILE A 1 80  ? -17.649 -1.595  1.979   1.00 0.39 ? 80  ILE A C    2  
ATOM 2754  O O    . ILE A 1 80  ? -17.396 -2.195  0.936   1.00 0.44 ? 80  ILE A O    2  
ATOM 2755  C CB   . ILE A 1 80  ? -15.762 -0.445  3.180   1.00 0.43 ? 80  ILE A CB   2  
ATOM 2756  C CG1  . ILE A 1 80  ? -15.008 0.877   3.375   1.00 0.46 ? 80  ILE A CG1  2  
ATOM 2757  C CG2  . ILE A 1 80  ? -14.836 -1.513  2.606   1.00 0.47 ? 80  ILE A CG2  2  
ATOM 2758  C CD1  . ILE A 1 80  ? -14.503 1.500   2.091   1.00 0.49 ? 80  ILE A CD1  2  
ATOM 2759  H H    . ILE A 1 80  ? -17.818 0.980   3.823   1.00 0.40 ? 80  ILE A H    2  
ATOM 2760  N N    . ALA A 1 81  ? -18.506 -2.056  2.882   1.00 0.39 ? 81  ALA A N    2  
ATOM 2761  C CA   . ALA A 1 81  ? -19.187 -3.336  2.714   1.00 0.44 ? 81  ALA A CA   2  
ATOM 2762  C C    . ALA A 1 81  ? -20.238 -3.277  1.604   1.00 0.46 ? 81  ALA A C    2  
ATOM 2763  O O    . ALA A 1 81  ? -20.805 -4.301  1.217   1.00 0.56 ? 81  ALA A O    2  
ATOM 2764  C CB   . ALA A 1 81  ? -19.826 -3.771  4.023   1.00 0.48 ? 81  ALA A CB   2  
ATOM 2765  H H    . ALA A 1 81  ? -18.687 -1.522  3.686   1.00 0.40 ? 81  ALA A H    2  
ATOM 2766  N N    . ALA A 1 82  ? -20.489 -2.080  1.086   1.00 0.43 ? 82  ALA A N    2  
ATOM 2767  C CA   . ALA A 1 82  ? -21.474 -1.899  0.029   1.00 0.48 ? 82  ALA A CA   2  
ATOM 2768  C C    . ALA A 1 82  ? -20.812 -1.634  -1.320  1.00 0.45 ? 82  ALA A C    2  
ATOM 2769  O O    . ALA A 1 82  ? -21.496 -1.369  -2.311  1.00 0.49 ? 82  ALA A O    2  
ATOM 2770  C CB   . ALA A 1 82  ? -22.422 -0.765  0.387   1.00 0.55 ? 82  ALA A CB   2  
ATOM 2771  H H    . ALA A 1 82  ? -19.997 -1.297  1.423   1.00 0.44 ? 82  ALA A H    2  
ATOM 2772  N N    . VAL A 1 83  ? -19.485 -1.718  -1.354  1.00 0.43 ? 83  VAL A N    2  
ATOM 2773  C CA   . VAL A 1 83  ? -18.732 -1.473  -2.579  1.00 0.44 ? 83  VAL A CA   2  
ATOM 2774  C C    . VAL A 1 83  ? -18.967 -2.566  -3.625  1.00 0.42 ? 83  VAL A C    2  
ATOM 2775  O O    . VAL A 1 83  ? -19.130 -3.746  -3.291  1.00 0.52 ? 83  VAL A O    2  
ATOM 2776  C CB   . VAL A 1 83  ? -17.215 -1.292  -2.305  1.00 0.51 ? 83  VAL A CB   2  
ATOM 2777  C CG1  . VAL A 1 83  ? -16.515 -2.627  -2.071  1.00 0.54 ? 83  VAL A CG1  2  
ATOM 2778  C CG2  . VAL A 1 83  ? -16.544 -0.510  -3.427  1.00 0.58 ? 83  VAL A CG2  2  
ATOM 2779  H H    . VAL A 1 83  ? -19.001 -1.948  -0.534  1.00 0.45 ? 83  VAL A H    2  
ATOM 2780  N N    . ASP A 1 84  ? -18.999 -2.156  -4.887  1.00 0.49 ? 84  ASP A N    2  
ATOM 2781  C CA   . ASP A 1 84  ? -19.210 -3.071  -6.003  1.00 0.54 ? 84  ASP A CA   2  
ATOM 2782  C C    . ASP A 1 84  ? -18.052 -4.054  -6.119  1.00 0.45 ? 84  ASP A C    2  
ATOM 2783  O O    . ASP A 1 84  ? -16.983 -3.711  -6.621  1.00 0.49 ? 84  ASP A O    2  
ATOM 2784  C CB   . ASP A 1 84  ? -19.339 -2.283  -7.312  1.00 0.73 ? 84  ASP A CB   2  
ATOM 2785  C CG   . ASP A 1 84  ? -20.608 -1.457  -7.392  1.00 0.86 ? 84  ASP A CG   2  
ATOM 2786  O OD1  . ASP A 1 84  ? -20.741 -0.477  -6.630  1.00 0.91 ? 84  ASP A OD1  2  
ATOM 2787  O OD2  . ASP A 1 84  ? -21.484 -1.781  -8.226  1.00 1.14 ? 84  ASP A OD2  2  
ATOM 2788  H H    . ASP A 1 84  ? -18.888 -1.200  -5.077  1.00 0.60 ? 84  ASP A H    2  
ATOM 2789  N N    . THR A 1 85  ? -18.264 -5.278  -5.664  1.00 0.46 ? 85  THR A N    2  
ATOM 2790  C CA   . THR A 1 85  ? -17.221 -6.290  -5.716  1.00 0.48 ? 85  THR A CA   2  
ATOM 2791  C C    . THR A 1 85  ? -17.359 -7.169  -6.961  1.00 0.48 ? 85  THR A C    2  
ATOM 2792  O O    . THR A 1 85  ? -17.242 -8.389  -6.891  1.00 0.73 ? 85  THR A O    2  
ATOM 2793  C CB   . THR A 1 85  ? -17.220 -7.161  -4.442  1.00 0.64 ? 85  THR A CB   2  
ATOM 2794  O OG1  . THR A 1 85  ? -17.557 -6.342  -3.311  1.00 0.66 ? 85  THR A OG1  2  
ATOM 2795  C CG2  . THR A 1 85  ? -15.843 -7.770  -4.209  1.00 0.77 ? 85  THR A CG2  2  
ATOM 2796  H H    . THR A 1 85  ? -19.140 -5.508  -5.287  1.00 0.53 ? 85  THR A H    2  
ATOM 2797  H HG1  . THR A 1 85  ? -17.910 -5.498  -3.624  1.00 0.70 ? 85  THR A HG1  2  
ATOM 2798  N N    . ASP A 1 86  ? -17.613 -6.536  -8.101  1.00 0.40 ? 86  ASP A N    2  
ATOM 2799  C CA   . ASP A 1 86  ? -17.753 -7.261  -9.359  1.00 0.44 ? 86  ASP A CA   2  
ATOM 2800  C C    . ASP A 1 86  ? -16.405 -7.382  -10.058 1.00 0.41 ? 86  ASP A C    2  
ATOM 2801  O O    . ASP A 1 86  ? -15.877 -8.483  -10.228 1.00 0.57 ? 86  ASP A O    2  
ATOM 2802  C CB   . ASP A 1 86  ? -18.776 -6.578  -10.273 1.00 0.56 ? 86  ASP A CB   2  
ATOM 2803  C CG   . ASP A 1 86  ? -18.624 -6.962  -11.737 1.00 0.67 ? 86  ASP A CG   2  
ATOM 2804  O OD1  . ASP A 1 86  ? -18.991 -8.095  -12.108 1.00 0.86 ? 86  ASP A OD1  2  
ATOM 2805  O OD2  . ASP A 1 86  ? -18.126 -6.127  -12.521 1.00 0.90 ? 86  ASP A OD2  2  
ATOM 2806  H H    . ASP A 1 86  ? -17.711 -5.560  -8.093  1.00 0.49 ? 86  ASP A H    2  
ATOM 2807  N N    . SER A 1 87  ? -15.845 -6.245  -10.439 1.00 0.38 ? 87  SER A N    2  
ATOM 2808  C CA   . SER A 1 87  ? -14.555 -6.215  -11.110 1.00 0.45 ? 87  SER A CA   2  
ATOM 2809  C C    . SER A 1 87  ? -13.522 -5.476  -10.261 1.00 0.36 ? 87  SER A C    2  
ATOM 2810  O O    . SER A 1 87  ? -13.421 -4.250  -10.319 1.00 0.44 ? 87  SER A O    2  
ATOM 2811  C CB   . SER A 1 87  ? -14.691 -5.560  -12.489 1.00 0.69 ? 87  SER A CB   2  
ATOM 2812  O OG   . SER A 1 87  ? -15.642 -6.246  -13.291 1.00 1.31 ? 87  SER A OG   2  
ATOM 2813  H H    . SER A 1 87  ? -16.316 -5.401  -10.275 1.00 0.45 ? 87  SER A H    2  
ATOM 2814  H HG   . SER A 1 87  ? -16.512 -6.215  -12.861 1.00 1.60 ? 87  SER A HG   2  
ATOM 2815  N N    . PRO A 1 88  ? -12.745 -6.217  -9.451  1.00 0.46 ? 88  PRO A N    2  
ATOM 2816  C CA   . PRO A 1 88  ? -11.724 -5.636  -8.572  1.00 0.52 ? 88  PRO A CA   2  
ATOM 2817  C C    . PRO A 1 88  ? -10.724 -4.758  -9.324  1.00 0.42 ? 88  PRO A C    2  
ATOM 2818  O O    . PRO A 1 88  ? -10.368 -3.679  -8.854  1.00 0.37 ? 88  PRO A O    2  
ATOM 2819  C CB   . PRO A 1 88  ? -11.015 -6.860  -7.986  1.00 0.74 ? 88  PRO A CB   2  
ATOM 2820  C CG   . PRO A 1 88  ? -12.024 -7.950  -8.072  1.00 0.89 ? 88  PRO A CG   2  
ATOM 2821  C CD   . PRO A 1 88  ? -12.804 -7.686  -9.327  1.00 0.72 ? 88  PRO A CD   2  
ATOM 2822  N N    . ARG A 1 89  ? -10.286 -5.221  -10.492 1.00 0.44 ? 89  ARG A N    2  
ATOM 2823  C CA   . ARG A 1 89  ? -9.319  -4.481  -11.301 1.00 0.41 ? 89  ARG A CA   2  
ATOM 2824  C C    . ARG A 1 89  ? -9.862  -3.112  -11.699 1.00 0.37 ? 89  ARG A C    2  
ATOM 2825  O O    . ARG A 1 89  ? -9.212  -2.090  -11.480 1.00 0.36 ? 89  ARG A O    2  
ATOM 2826  C CB   . ARG A 1 89  ? -8.937  -5.295  -12.546 1.00 0.55 ? 89  ARG A CB   2  
ATOM 2827  C CG   . ARG A 1 89  ? -8.454  -4.474  -13.736 1.00 0.64 ? 89  ARG A CG   2  
ATOM 2828  C CD   . ARG A 1 89  ? -7.047  -3.930  -13.531 1.00 0.91 ? 89  ARG A CD   2  
ATOM 2829  N NE   . ARG A 1 89  ? -6.740  -2.870  -14.492 1.00 1.11 ? 89  ARG A NE   2  
ATOM 2830  C CZ   . ARG A 1 89  ? -5.745  -2.917  -15.382 1.00 1.40 ? 89  ARG A CZ   2  
ATOM 2831  N NH1  . ARG A 1 89  ? -4.909  -3.951  -15.408 1.00 1.83 ? 89  ARG A NH1  2  
ATOM 2832  N NH2  . ARG A 1 89  ? -5.585  -1.924  -16.246 1.00 1.64 ? 89  ARG A NH2  2  
ATOM 2833  H H    . ARG A 1 89  ? -10.630 -6.078  -10.824 1.00 0.53 ? 89  ARG A H    2  
ATOM 2834  H HE   . ARG A 1 89  ? -7.327  -2.077  -14.485 1.00 1.35 ? 89  ARG A HE   2  
ATOM 2835  H HH11 . ARG A 1 89  ? -5.016  -4.704  -14.761 1.00 1.95 ? 89  ARG A HH11 2  
ATOM 2836  H HH12 . ARG A 1 89  ? -4.152  -3.973  -16.087 1.00 2.22 ? 89  ARG A HH12 2  
ATOM 2837  H HH21 . ARG A 1 89  ? -6.206  -1.138  -16.230 1.00 1.80 ? 89  ARG A HH21 2  
ATOM 2838  H HH22 . ARG A 1 89  ? -4.833  -1.955  -16.929 1.00 1.87 ? 89  ARG A HH22 2  
ATOM 2839  N N    . GLU A 1 90  ? -11.049 -3.105  -12.285 1.00 0.38 ? 90  GLU A N    2  
ATOM 2840  C CA   . GLU A 1 90  ? -11.694 -1.876  -12.727 1.00 0.38 ? 90  GLU A CA   2  
ATOM 2841  C C    . GLU A 1 90  ? -11.887 -0.893  -11.576 1.00 0.36 ? 90  GLU A C    2  
ATOM 2842  O O    . GLU A 1 90  ? -11.573 0.289   -11.707 1.00 0.38 ? 90  GLU A O    2  
ATOM 2843  C CB   . GLU A 1 90  ? -13.039 -2.188  -13.389 1.00 0.41 ? 90  GLU A CB   2  
ATOM 2844  C CG   . GLU A 1 90  ? -12.942 -2.686  -14.827 1.00 0.55 ? 90  GLU A CG   2  
ATOM 2845  C CD   . GLU A 1 90  ? -12.046 -3.899  -14.987 1.00 0.76 ? 90  GLU A CD   2  
ATOM 2846  O OE1  . GLU A 1 90  ? -12.079 -4.792  -14.115 1.00 1.10 ? 90  GLU A OE1  2  
ATOM 2847  O OE2  . GLU A 1 90  ? -11.303 -3.964  -15.989 1.00 1.46 ? 90  GLU A OE2  2  
ATOM 2848  H H    . GLU A 1 90  ? -11.502 -3.961  -12.452 1.00 0.42 ? 90  GLU A H    2  
ATOM 2849  N N    . VAL A 1 91  ? -12.386 -1.392  -10.451 1.00 0.34 ? 91  VAL A N    2  
ATOM 2850  C CA   . VAL A 1 91  ? -12.624 -0.557  -9.278  1.00 0.36 ? 91  VAL A CA   2  
ATOM 2851  C C    . VAL A 1 91  ? -11.316 0.009   -8.720  1.00 0.32 ? 91  VAL A C    2  
ATOM 2852  O O    . VAL A 1 91  ? -11.198 1.217   -8.497  1.00 0.34 ? 91  VAL A O    2  
ATOM 2853  C CB   . VAL A 1 91  ? -13.374 -1.327  -8.166  1.00 0.38 ? 91  VAL A CB   2  
ATOM 2854  C CG1  . VAL A 1 91  ? -13.605 -0.437  -6.953  1.00 0.44 ? 91  VAL A CG1  2  
ATOM 2855  C CG2  . VAL A 1 91  ? -14.699 -1.864  -8.686  1.00 0.45 ? 91  VAL A CG2  2  
ATOM 2856  H H    . VAL A 1 91  ? -12.599 -2.349  -10.410 1.00 0.34 ? 91  VAL A H    2  
ATOM 2857  N N    . PHE A 1 92  ? -10.332 -0.864  -8.524  1.00 0.30 ? 92  PHE A N    2  
ATOM 2858  C CA   . PHE A 1 92  ? -9.036  -0.464  -7.983  1.00 0.30 ? 92  PHE A CA   2  
ATOM 2859  C C    . PHE A 1 92  ? -8.340  0.550   -8.884  1.00 0.29 ? 92  PHE A C    2  
ATOM 2860  O O    . PHE A 1 92  ? -7.856  1.582   -8.415  1.00 0.29 ? 92  PHE A O    2  
ATOM 2861  C CB   . PHE A 1 92  ? -8.136  -1.684  -7.765  1.00 0.33 ? 92  PHE A CB   2  
ATOM 2862  C CG   . PHE A 1 92  ? -6.856  -1.381  -7.039  1.00 0.37 ? 92  PHE A CG   2  
ATOM 2863  C CD1  . PHE A 1 92  ? -6.866  -1.088  -5.687  1.00 0.45 ? 92  PHE A CD1  2  
ATOM 2864  C CD2  . PHE A 1 92  ? -5.643  -1.388  -7.712  1.00 0.46 ? 92  PHE A CD2  2  
ATOM 2865  C CE1  . PHE A 1 92  ? -5.691  -0.805  -5.017  1.00 0.53 ? 92  PHE A CE1  2  
ATOM 2866  C CE2  . PHE A 1 92  ? -4.463  -1.107  -7.049  1.00 0.54 ? 92  PHE A CE2  2  
ATOM 2867  C CZ   . PHE A 1 92  ? -4.488  -0.816  -5.700  1.00 0.55 ? 92  PHE A CZ   2  
ATOM 2868  H H    . PHE A 1 92  ? -10.483 -1.810  -8.748  1.00 0.30 ? 92  PHE A H    2  
ATOM 2869  N N    . PHE A 1 93  ? -8.302  0.260   -10.177 1.00 0.31 ? 93  PHE A N    2  
ATOM 2870  C CA   . PHE A 1 93  ? -7.660  1.149   -11.134 1.00 0.34 ? 93  PHE A CA   2  
ATOM 2871  C C    . PHE A 1 93  ? -8.393  2.483   -11.206 1.00 0.34 ? 93  PHE A C    2  
ATOM 2872  O O    . PHE A 1 93  ? -7.773  3.535   -11.369 1.00 0.35 ? 93  PHE A O    2  
ATOM 2873  C CB   . PHE A 1 93  ? -7.591  0.500   -12.518 1.00 0.42 ? 93  PHE A CB   2  
ATOM 2874  C CG   . PHE A 1 93  ? -6.295  0.740   -13.239 1.00 0.60 ? 93  PHE A CG   2  
ATOM 2875  C CD1  . PHE A 1 93  ? -5.172  -0.017  -12.943 1.00 0.82 ? 93  PHE A CD1  2  
ATOM 2876  C CD2  . PHE A 1 93  ? -6.200  1.721   -14.211 1.00 0.78 ? 93  PHE A CD2  2  
ATOM 2877  C CE1  . PHE A 1 93  ? -3.978  0.197   -13.607 1.00 1.06 ? 93  PHE A CE1  2  
ATOM 2878  C CE2  . PHE A 1 93  ? -5.010  1.940   -14.879 1.00 1.02 ? 93  PHE A CE2  2  
ATOM 2879  C CZ   . PHE A 1 93  ? -3.897  1.179   -14.574 1.00 1.12 ? 93  PHE A CZ   2  
ATOM 2880  H H    . PHE A 1 93  ? -8.717  -0.574  -10.497 1.00 0.32 ? 93  PHE A H    2  
ATOM 2881  N N    . ARG A 1 94  ? -9.713  2.437   -11.058 1.00 0.35 ? 94  ARG A N    2  
ATOM 2882  C CA   . ARG A 1 94  ? -10.522 3.643   -11.104 1.00 0.37 ? 94  ARG A CA   2  
ATOM 2883  C C    . ARG A 1 94  ? -10.221 4.560   -9.927  1.00 0.33 ? 94  ARG A C    2  
ATOM 2884  O O    . ARG A 1 94  ? -9.845  5.706   -10.123 1.00 0.34 ? 94  ARG A O    2  
ATOM 2885  C CB   . ARG A 1 94  ? -12.015 3.320   -11.158 1.00 0.43 ? 94  ARG A CB   2  
ATOM 2886  C CG   . ARG A 1 94  ? -12.582 3.221   -12.566 1.00 0.55 ? 94  ARG A CG   2  
ATOM 2887  C CD   . ARG A 1 94  ? -12.282 4.469   -13.383 1.00 0.75 ? 94  ARG A CD   2  
ATOM 2888  N NE   . ARG A 1 94  ? -12.822 5.687   -12.770 1.00 0.81 ? 94  ARG A NE   2  
ATOM 2889  C CZ   . ARG A 1 94  ? -13.732 6.470   -13.347 1.00 1.17 ? 94  ARG A CZ   2  
ATOM 2890  N NH1  . ARG A 1 94  ? -14.280 6.122   -14.506 1.00 1.43 ? 94  ARG A NH1  2  
ATOM 2891  N NH2  . ARG A 1 94  ? -14.107 7.594   -12.749 1.00 1.33 ? 94  ARG A NH2  2  
ATOM 2892  H H    . ARG A 1 94  ? -10.151 1.569   -10.913 1.00 0.36 ? 94  ARG A H    2  
ATOM 2893  H HE   . ARG A 1 94  ? -12.461 5.954   -11.882 1.00 0.69 ? 94  ARG A HE   2  
ATOM 2894  H HH11 . ARG A 1 94  ? -14.017 5.260   -14.952 1.00 1.33 ? 94  ARG A HH11 2  
ATOM 2895  H HH12 . ARG A 1 94  ? -14.952 6.722   -14.943 1.00 1.75 ? 94  ARG A HH12 2  
ATOM 2896  H HH21 . ARG A 1 94  ? -13.703 7.850   -11.857 1.00 1.16 ? 94  ARG A HH21 2  
ATOM 2897  H HH22 . ARG A 1 94  ? -14.776 8.200   -13.183 1.00 1.66 ? 94  ARG A HH22 2  
ATOM 2898  N N    . VAL A 1 95  ? -10.357 4.046   -8.707  1.00 0.31 ? 95  VAL A N    2  
ATOM 2899  C CA   . VAL A 1 95  ? -10.102 4.852   -7.512  1.00 0.30 ? 95  VAL A CA   2  
ATOM 2900  C C    . VAL A 1 95  ? -8.670  5.387   -7.479  1.00 0.28 ? 95  VAL A C    2  
ATOM 2901  O O    . VAL A 1 95  ? -8.408  6.470   -6.959  1.00 0.30 ? 95  VAL A O    2  
ATOM 2902  C CB   . VAL A 1 95  ? -10.436 4.108   -6.199  1.00 0.31 ? 95  VAL A CB   2  
ATOM 2903  C CG1  . VAL A 1 95  ? -11.920 3.779   -6.132  1.00 0.37 ? 95  VAL A CG1  2  
ATOM 2904  C CG2  . VAL A 1 95  ? -9.595  2.850   -6.042  1.00 0.29 ? 95  VAL A CG2  2  
ATOM 2905  H H    . VAL A 1 95  ? -10.632 3.107   -8.607  1.00 0.32 ? 95  VAL A H    2  
ATOM 2906  N N    . ALA A 1 96  ? -7.747  4.631   -8.057  1.00 0.27 ? 96  ALA A N    2  
ATOM 2907  C CA   . ALA A 1 96  ? -6.352  5.039   -8.105  1.00 0.29 ? 96  ALA A CA   2  
ATOM 2908  C C    . ALA A 1 96  ? -6.172  6.226   -9.045  1.00 0.30 ? 96  ALA A C    2  
ATOM 2909  O O    . ALA A 1 96  ? -5.363  7.120   -8.785  1.00 0.32 ? 96  ALA A O    2  
ATOM 2910  C CB   . ALA A 1 96  ? -5.469  3.878   -8.537  1.00 0.33 ? 96  ALA A CB   2  
ATOM 2911  H H    . ALA A 1 96  ? -8.010  3.775   -8.456  1.00 0.28 ? 96  ALA A H    2  
ATOM 2912  N N    . ALA A 1 97  ? -6.945  6.233   -10.126 1.00 0.31 ? 97  ALA A N    2  
ATOM 2913  C CA   . ALA A 1 97  ? -6.876  7.300   -11.115 1.00 0.34 ? 97  ALA A CA   2  
ATOM 2914  C C    . ALA A 1 97  ? -7.777  8.470   -10.736 1.00 0.34 ? 97  ALA A C    2  
ATOM 2915  O O    . ALA A 1 97  ? -7.437  9.624   -10.982 1.00 0.38 ? 97  ALA A O    2  
ATOM 2916  C CB   . ALA A 1 97  ? -7.234  6.771   -12.497 1.00 0.38 ? 97  ALA A CB   2  
ATOM 2917  H H    . ALA A 1 97  ? -7.583  5.498   -10.261 1.00 0.30 ? 97  ALA A H    2  
ATOM 2918  N N    . ASP A 1 98  ? -8.918  8.169   -10.123 1.00 0.33 ? 98  ASP A N    2  
ATOM 2919  C CA   . ASP A 1 98  ? -9.872  9.203   -9.711  1.00 0.37 ? 98  ASP A CA   2  
ATOM 2920  C C    . ASP A 1 98  ? -9.256  10.167  -8.705  1.00 0.35 ? 98  ASP A C    2  
ATOM 2921  O O    . ASP A 1 98  ? -9.617  11.340  -8.646  1.00 0.37 ? 98  ASP A O    2  
ATOM 2922  C CB   . ASP A 1 98  ? -11.155 8.583   -9.145  1.00 0.45 ? 98  ASP A CB   2  
ATOM 2923  C CG   . ASP A 1 98  ? -12.166 8.241   -10.224 1.00 0.57 ? 98  ASP A CG   2  
ATOM 2924  O OD1  . ASP A 1 98  ? -12.707 9.175   -10.855 1.00 1.16 ? 98  ASP A OD1  2  
ATOM 2925  O OD2  . ASP A 1 98  ? -12.420 7.041   -10.462 1.00 0.82 ? 98  ASP A OD2  2  
ATOM 2926  H H    . ASP A 1 98  ? -9.133  7.221   -9.951  1.00 0.32 ? 98  ASP A H    2  
ATOM 2927  N N    . MET A 1 99  ? -8.317  9.666   -7.916  1.00 0.35 ? 99  MET A N    2  
ATOM 2928  C CA   . MET A 1 99  ? -7.636  10.492  -6.927  1.00 0.38 ? 99  MET A CA   2  
ATOM 2929  C C    . MET A 1 99  ? -6.338  11.044  -7.512  1.00 0.39 ? 99  MET A C    2  
ATOM 2930  O O    . MET A 1 99  ? -5.507  11.599  -6.796  1.00 0.48 ? 99  MET A O    2  
ATOM 2931  C CB   . MET A 1 99  ? -7.310  9.681   -5.670  1.00 0.39 ? 99  MET A CB   2  
ATOM 2932  C CG   . MET A 1 99  ? -8.504  9.058   -4.967  1.00 0.38 ? 99  MET A CG   2  
ATOM 2933  S SD   . MET A 1 99  ? -7.998  7.966   -3.620  1.00 0.40 ? 99  MET A SD   2  
ATOM 2934  C CE   . MET A 1 99  ? -9.586  7.343   -3.074  1.00 0.42 ? 99  MET A CE   2  
ATOM 2935  H H    . MET A 1 99  ? -8.083  8.717   -7.996  1.00 0.37 ? 99  MET A H    2  
ATOM 2936  N N    . PHE A 1 100 ? -6.165  10.878  -8.817  1.00 0.36 ? 100 PHE A N    2  
ATOM 2937  C CA   . PHE A 1 100 ? -4.959  11.338  -9.493  1.00 0.41 ? 100 PHE A CA   2  
ATOM 2938  C C    . PHE A 1 100 ? -5.280  12.393  -10.546 1.00 0.44 ? 100 PHE A C    2  
ATOM 2939  O O    . PHE A 1 100 ? -4.418  13.187  -10.916 1.00 0.54 ? 100 PHE A O    2  
ATOM 2940  C CB   . PHE A 1 100 ? -4.236  10.149  -10.135 1.00 0.46 ? 100 PHE A CB   2  
ATOM 2941  C CG   . PHE A 1 100 ? -2.737  10.263  -10.139 1.00 0.62 ? 100 PHE A CG   2  
ATOM 2942  C CD1  . PHE A 1 100 ? -2.034  10.368  -8.952  1.00 0.81 ? 100 PHE A CD1  2  
ATOM 2943  C CD2  . PHE A 1 100 ? -2.032  10.256  -11.332 1.00 0.80 ? 100 PHE A CD2  2  
ATOM 2944  C CE1  . PHE A 1 100 ? -0.655  10.464  -8.951  1.00 0.99 ? 100 PHE A CE1  2  
ATOM 2945  C CE2  . PHE A 1 100 ? -0.652  10.350  -11.340 1.00 1.00 ? 100 PHE A CE2  2  
ATOM 2946  C CZ   . PHE A 1 100 ? 0.037   10.455  -10.147 1.00 1.03 ? 100 PHE A CZ   2  
ATOM 2947  H H    . PHE A 1 100 ? -6.870  10.437  -9.342  1.00 0.35 ? 100 PHE A H    2  
ATOM 2948  N N    . SER A 1 101 ? -6.527  12.406  -11.011 1.00 0.53 ? 101 SER A N    2  
ATOM 2949  C CA   . SER A 1 101 ? -6.968  13.356  -12.026 1.00 0.58 ? 101 SER A CA   2  
ATOM 2950  C C    . SER A 1 101 ? -6.798  14.802  -11.562 1.00 0.42 ? 101 SER A C    2  
ATOM 2951  O O    . SER A 1 101 ? -6.511  15.692  -12.366 1.00 0.48 ? 101 SER A O    2  
ATOM 2952  C CB   . SER A 1 101 ? -8.427  13.077  -12.388 1.00 0.80 ? 101 SER A CB   2  
ATOM 2953  O OG   . SER A 1 101 ? -8.952  12.045  -11.568 1.00 1.20 ? 101 SER A OG   2  
ATOM 2954  H H    . SER A 1 101 ? -7.173  11.750  -10.671 1.00 0.65 ? 101 SER A H    2  
ATOM 2955  H HG   . SER A 1 101 ? -9.365  11.373  -12.124 1.00 1.33 ? 101 SER A HG   2  
ATOM 2956  N N    . ASP A 1 102 ? -6.958  15.024  -10.261 1.00 0.45 ? 102 ASP A N    2  
ATOM 2957  C CA   . ASP A 1 102 ? -6.820  16.359  -9.685  1.00 0.53 ? 102 ASP A CA   2  
ATOM 2958  C C    . ASP A 1 102 ? -5.364  16.808  -9.687  1.00 0.45 ? 102 ASP A C    2  
ATOM 2959  O O    . ASP A 1 102 ? -5.075  18.004  -9.667  1.00 0.63 ? 102 ASP A O    2  
ATOM 2960  C CB   . ASP A 1 102 ? -7.363  16.390  -8.255  1.00 0.78 ? 102 ASP A CB   2  
ATOM 2961  C CG   . ASP A 1 102 ? -8.289  17.567  -8.008  1.00 1.07 ? 102 ASP A CG   2  
ATOM 2962  O OD1  . ASP A 1 102 ? -7.794  18.693  -7.780  1.00 1.64 ? 102 ASP A OD1  2  
ATOM 2963  O OD2  . ASP A 1 102 ? -9.521  17.371  -8.044  1.00 1.62 ? 102 ASP A OD2  2  
ATOM 2964  H H    . ASP A 1 102 ? -7.183  14.272  -9.677  1.00 0.56 ? 102 ASP A H    2  
ATOM 2965  N N    . GLY A 1 103 ? -4.452  15.838  -9.706  1.00 0.40 ? 103 GLY A N    2  
ATOM 2966  C CA   . GLY A 1 103 ? -3.029  16.139  -9.709  1.00 0.53 ? 103 GLY A CA   2  
ATOM 2967  C C    . GLY A 1 103 ? -2.552  16.733  -8.395  1.00 0.53 ? 103 GLY A C    2  
ATOM 2968  O O    . GLY A 1 103 ? -1.470  17.318  -8.324  1.00 0.70 ? 103 GLY A O    2  
ATOM 2969  H H    . GLY A 1 103 ? -4.750  14.905  -9.739  1.00 0.46 ? 103 GLY A H    2  
ATOM 2970  N N    . ASN A 1 104 ? -3.353  16.570  -7.350  1.00 0.44 ? 104 ASN A N    2  
ATOM 2971  C CA   . ASN A 1 104 ? -3.018  17.105  -6.037  1.00 0.47 ? 104 ASN A CA   2  
ATOM 2972  C C    . ASN A 1 104 ? -2.397  16.036  -5.148  1.00 0.43 ? 104 ASN A C    2  
ATOM 2973  O O    . ASN A 1 104 ? -3.014  15.004  -4.871  1.00 0.45 ? 104 ASN A O    2  
ATOM 2974  C CB   . ASN A 1 104 ? -4.257  17.710  -5.368  1.00 0.55 ? 104 ASN A CB   2  
ATOM 2975  C CG   . ASN A 1 104 ? -3.981  18.233  -3.969  1.00 0.61 ? 104 ASN A CG   2  
ATOM 2976  O OD1  . ASN A 1 104 ? -4.142  17.513  -2.983  1.00 0.69 ? 104 ASN A OD1  2  
ATOM 2977  N ND2  . ASN A 1 104 ? -3.572  19.489  -3.870  1.00 0.91 ? 104 ASN A ND2  2  
ATOM 2978  H H    . ASN A 1 104 ? -4.188  16.074  -7.461  1.00 0.48 ? 104 ASN A H    2  
ATOM 2979  H HD21 . ASN A 1 104 ? -3.468  20.014  -4.695  1.00 1.15 ? 104 ASN A HD21 2  
ATOM 2980  H HD22 . ASN A 1 104 ? -3.386  19.846  -2.973  1.00 0.98 ? 104 ASN A HD22 2  
ATOM 2981  N N    . PHE A 1 105 ? -1.172  16.282  -4.711  1.00 0.45 ? 105 PHE A N    2  
ATOM 2982  C CA   . PHE A 1 105 ? -0.462  15.348  -3.852  1.00 0.48 ? 105 PHE A CA   2  
ATOM 2983  C C    . PHE A 1 105 ? -0.619  15.731  -2.385  1.00 0.50 ? 105 PHE A C    2  
ATOM 2984  O O    . PHE A 1 105 ? 0.295   16.272  -1.763  1.00 0.60 ? 105 PHE A O    2  
ATOM 2985  C CB   . PHE A 1 105 ? 1.014   15.273  -4.239  1.00 0.60 ? 105 PHE A CB   2  
ATOM 2986  C CG   . PHE A 1 105 ? 1.254   14.643  -5.580  1.00 0.66 ? 105 PHE A CG   2  
ATOM 2987  C CD1  . PHE A 1 105 ? 1.124   13.274  -5.747  1.00 0.66 ? 105 PHE A CD1  2  
ATOM 2988  C CD2  . PHE A 1 105 ? 1.611   15.415  -6.672  1.00 0.81 ? 105 PHE A CD2  2  
ATOM 2989  C CE1  . PHE A 1 105 ? 1.346   12.688  -6.977  1.00 0.75 ? 105 PHE A CE1  2  
ATOM 2990  C CE2  . PHE A 1 105 ? 1.835   14.835  -7.907  1.00 0.91 ? 105 PHE A CE2  2  
ATOM 2991  C CZ   . PHE A 1 105 ? 1.703   13.470  -8.059  1.00 0.86 ? 105 PHE A CZ   2  
ATOM 2992  H H    . PHE A 1 105 ? -0.731  17.122  -4.974  1.00 0.50 ? 105 PHE A H    2  
ATOM 2993  N N    . ASN A 1 106 ? -1.790  15.448  -1.843  1.00 0.45 ? 106 ASN A N    2  
ATOM 2994  C CA   . ASN A 1 106 ? -2.101  15.761  -0.451  1.00 0.48 ? 106 ASN A CA   2  
ATOM 2995  C C    . ASN A 1 106 ? -1.618  14.668  0.497   1.00 0.49 ? 106 ASN A C    2  
ATOM 2996  O O    . ASN A 1 106 ? -1.818  14.764  1.708   1.00 0.52 ? 106 ASN A O    2  
ATOM 2997  C CB   . ASN A 1 106 ? -3.611  15.957  -0.272  1.00 0.48 ? 106 ASN A CB   2  
ATOM 2998  C CG   . ASN A 1 106 ? -4.426  14.825  -0.877  1.00 0.43 ? 106 ASN A CG   2  
ATOM 2999  O OD1  . ASN A 1 106 ? -4.454  13.710  -0.355  1.00 0.44 ? 106 ASN A OD1  2  
ATOM 3000  N ND2  . ASN A 1 106 ? -5.087  15.103  -1.988  1.00 0.55 ? 106 ASN A ND2  2  
ATOM 3001  H H    . ASN A 1 106 ? -2.480  15.028  -2.399  1.00 0.42 ? 106 ASN A H    2  
ATOM 3002  H HD21 . ASN A 1 106 ? -5.011  16.017  -2.358  1.00 0.69 ? 106 ASN A HD21 2  
ATOM 3003  H HD22 . ASN A 1 106 ? -5.630  14.398  -2.394  1.00 0.55 ? 106 ASN A HD22 2  
ATOM 3004  N N    . TRP A 1 107 ? -1.004  13.626  -0.065  1.00 0.46 ? 107 TRP A N    2  
ATOM 3005  C CA   . TRP A 1 107 ? -0.485  12.493  0.709   1.00 0.48 ? 107 TRP A CA   2  
ATOM 3006  C C    . TRP A 1 107 ? -1.595  11.587  1.256   1.00 0.45 ? 107 TRP A C    2  
ATOM 3007  O O    . TRP A 1 107 ? -1.471  10.364  1.228   1.00 0.45 ? 107 TRP A O    2  
ATOM 3008  C CB   . TRP A 1 107 ? 0.455   12.940  1.833   1.00 0.54 ? 107 TRP A CB   2  
ATOM 3009  C CG   . TRP A 1 107 ? 1.910   12.850  1.493   1.00 0.72 ? 107 TRP A CG   2  
ATOM 3010  C CD1  . TRP A 1 107 ? 2.787   13.887  1.362   1.00 1.02 ? 107 TRP A CD1  2  
ATOM 3011  C CD2  . TRP A 1 107 ? 2.660   11.656  1.242   1.00 0.84 ? 107 TRP A CD2  2  
ATOM 3012  N NE1  . TRP A 1 107 ? 4.038   13.413  1.044   1.00 1.24 ? 107 TRP A NE1  2  
ATOM 3013  C CE2  . TRP A 1 107 ? 3.985   12.047  0.964   1.00 1.15 ? 107 TRP A CE2  2  
ATOM 3014  C CE3  . TRP A 1 107 ? 2.339   10.296  1.223   1.00 0.91 ? 107 TRP A CE3  2  
ATOM 3015  C CZ2  . TRP A 1 107 ? 4.987   11.126  0.673   1.00 1.42 ? 107 TRP A CZ2  2  
ATOM 3016  C CZ3  . TRP A 1 107 ? 3.335   9.384   0.935   1.00 1.24 ? 107 TRP A CZ3  2  
ATOM 3017  C CH2  . TRP A 1 107 ? 4.644   9.802   0.663   1.00 1.46 ? 107 TRP A CH2  2  
ATOM 3018  H H    . TRP A 1 107 ? -0.886  13.625  -1.036  1.00 0.45 ? 107 TRP A H    2  
ATOM 3019  H HE1  . TRP A 1 107 ? 4.839   13.966  0.899   1.00 1.49 ? 107 TRP A HE1  2  
ATOM 3020  N N    . GLY A 1 108 ? -2.681  12.190  1.737   1.00 0.46 ? 108 GLY A N    2  
ATOM 3021  C CA   . GLY A 1 108 ? -3.794  11.429  2.282   1.00 0.45 ? 108 GLY A CA   2  
ATOM 3022  C C    . GLY A 1 108 ? -4.366  10.428  1.295   1.00 0.41 ? 108 GLY A C    2  
ATOM 3023  O O    . GLY A 1 108 ? -4.793  9.340   1.681   1.00 0.41 ? 108 GLY A O    2  
ATOM 3024  H H    . GLY A 1 108 ? -2.721  13.173  1.731   1.00 0.47 ? 108 GLY A H    2  
ATOM 3025  N N    . ARG A 1 109 ? -4.355  10.788  0.015   1.00 0.39 ? 109 ARG A N    2  
ATOM 3026  C CA   . ARG A 1 109 ? -4.867  9.914   -1.036  1.00 0.36 ? 109 ARG A CA   2  
ATOM 3027  C C    . ARG A 1 109 ? -4.035  8.634   -1.167  1.00 0.35 ? 109 ARG A C    2  
ATOM 3028  O O    . ARG A 1 109 ? -4.446  7.681   -1.828  1.00 0.35 ? 109 ARG A O    2  
ATOM 3029  C CB   . ARG A 1 109 ? -4.929  10.651  -2.378  1.00 0.36 ? 109 ARG A CB   2  
ATOM 3030  C CG   . ARG A 1 109 ? -3.585  10.791  -3.078  1.00 0.37 ? 109 ARG A CG   2  
ATOM 3031  C CD   . ARG A 1 109 ? -3.627  10.191  -4.476  1.00 0.36 ? 109 ARG A CD   2  
ATOM 3032  N NE   . ARG A 1 109 ? -4.110  8.807   -4.476  1.00 0.36 ? 109 ARG A NE   2  
ATOM 3033  C CZ   . ARG A 1 109 ? -4.356  8.104   -5.579  1.00 0.36 ? 109 ARG A CZ   2  
ATOM 3034  N NH1  . ARG A 1 109 ? -4.146  8.642   -6.775  1.00 0.35 ? 109 ARG A NH1  2  
ATOM 3035  N NH2  . ARG A 1 109 ? -4.826  6.865   -5.487  1.00 0.40 ? 109 ARG A NH2  2  
ATOM 3036  H H    . ARG A 1 109 ? -4.014  11.676  -0.225  1.00 0.39 ? 109 ARG A H    2  
ATOM 3037  H HE   . ARG A 1 109 ? -4.274  8.386   -3.599  1.00 0.38 ? 109 ARG A HE   2  
ATOM 3038  H HH11 . ARG A 1 109 ? -3.799  9.580   -6.851  1.00 0.35 ? 109 ARG A HH11 2  
ATOM 3039  H HH12 . ARG A 1 109 ? -4.349  8.118   -7.611  1.00 0.35 ? 109 ARG A HH12 2  
ATOM 3040  H HH21 . ARG A 1 109 ? -4.999  6.455   -4.586  1.00 0.43 ? 109 ARG A HH21 2  
ATOM 3041  H HH22 . ARG A 1 109 ? -5.016  6.335   -6.315  1.00 0.42 ? 109 ARG A HH22 2  
ATOM 3042  N N    . VAL A 1 110 ? -2.860  8.623   -0.548  1.00 0.37 ? 110 VAL A N    2  
ATOM 3043  C CA   . VAL A 1 110 ? -1.987  7.457   -0.590  1.00 0.38 ? 110 VAL A CA   2  
ATOM 3044  C C    . VAL A 1 110 ? -2.385  6.466   0.498   1.00 0.38 ? 110 VAL A C    2  
ATOM 3045  O O    . VAL A 1 110 ? -2.615  5.290   0.221   1.00 0.37 ? 110 VAL A O    2  
ATOM 3046  C CB   . VAL A 1 110 ? -0.501  7.844   -0.430  1.00 0.44 ? 110 VAL A CB   2  
ATOM 3047  C CG1  . VAL A 1 110 ? 0.392   6.613   -0.495  1.00 0.47 ? 110 VAL A CG1  2  
ATOM 3048  C CG2  . VAL A 1 110 ? -0.101  8.850   -1.499  1.00 0.46 ? 110 VAL A CG2  2  
ATOM 3049  H H    . VAL A 1 110 ? -2.580  9.412   -0.036  1.00 0.38 ? 110 VAL A H    2  
ATOM 3050  N N    . VAL A 1 111 ? -2.495  6.957   1.730   1.00 0.40 ? 111 VAL A N    2  
ATOM 3051  C CA   . VAL A 1 111 ? -2.878  6.111   2.857   1.00 0.41 ? 111 VAL A CA   2  
ATOM 3052  C C    . VAL A 1 111 ? -4.314  5.612   2.691   1.00 0.39 ? 111 VAL A C    2  
ATOM 3053  O O    . VAL A 1 111 ? -4.652  4.502   3.104   1.00 0.39 ? 111 VAL A O    2  
ATOM 3054  C CB   . VAL A 1 111 ? -2.686  6.817   4.223   1.00 0.46 ? 111 VAL A CB   2  
ATOM 3055  C CG1  . VAL A 1 111 ? -3.586  8.036   4.365   1.00 0.45 ? 111 VAL A CG1  2  
ATOM 3056  C CG2  . VAL A 1 111 ? -2.890  5.845   5.377   1.00 0.50 ? 111 VAL A CG2  2  
ATOM 3057  H H    . VAL A 1 111 ? -2.313  7.907   1.884   1.00 0.41 ? 111 VAL A H    2  
ATOM 3058  N N    . ALA A 1 112 ? -5.146  6.431   2.052   1.00 0.37 ? 112 ALA A N    2  
ATOM 3059  C CA   . ALA A 1 112 ? -6.534  6.069   1.801   1.00 0.36 ? 112 ALA A CA   2  
ATOM 3060  C C    . ALA A 1 112 ? -6.593  4.859   0.879   1.00 0.34 ? 112 ALA A C    2  
ATOM 3061  O O    . ALA A 1 112 ? -7.435  3.974   1.045   1.00 0.34 ? 112 ALA A O    2  
ATOM 3062  C CB   . ALA A 1 112 ? -7.286  7.241   1.186   1.00 0.36 ? 112 ALA A CB   2  
ATOM 3063  H H    . ALA A 1 112 ? -4.820  7.308   1.753   1.00 0.37 ? 112 ALA A H    2  
ATOM 3064  N N    . LEU A 1 113 ? -5.673  4.822   -0.081  1.00 0.34 ? 113 LEU A N    2  
ATOM 3065  C CA   . LEU A 1 113 ? -5.600  3.724   -1.029  1.00 0.33 ? 113 LEU A CA   2  
ATOM 3066  C C    . LEU A 1 113 ? -5.173  2.446   -0.316  1.00 0.33 ? 113 LEU A C    2  
ATOM 3067  O O    . LEU A 1 113 ? -5.670  1.361   -0.618  1.00 0.33 ? 113 LEU A O    2  
ATOM 3068  C CB   . LEU A 1 113 ? -4.628  4.057   -2.166  1.00 0.34 ? 113 LEU A CB   2  
ATOM 3069  C CG   . LEU A 1 113 ? -4.635  3.104   -3.365  1.00 0.35 ? 113 LEU A CG   2  
ATOM 3070  C CD1  . LEU A 1 113 ? -5.963  3.176   -4.104  1.00 0.35 ? 113 LEU A CD1  2  
ATOM 3071  C CD2  . LEU A 1 113 ? -3.480  3.413   -4.306  1.00 0.36 ? 113 LEU A CD2  2  
ATOM 3072  H H    . LEU A 1 113 ? -5.023  5.552   -0.146  1.00 0.35 ? 113 LEU A H    2  
ATOM 3073  N N    . PHE A 1 114 ? -4.260  2.588   0.639   1.00 0.34 ? 114 PHE A N    2  
ATOM 3074  C CA   . PHE A 1 114 ? -3.776  1.449   1.412   1.00 0.36 ? 114 PHE A CA   2  
ATOM 3075  C C    . PHE A 1 114 ? -4.919  0.817   2.198   1.00 0.35 ? 114 PHE A C    2  
ATOM 3076  O O    . PHE A 1 114 ? -5.017  -0.406  2.298   1.00 0.36 ? 114 PHE A O    2  
ATOM 3077  C CB   . PHE A 1 114 ? -2.659  1.875   2.368   1.00 0.38 ? 114 PHE A CB   2  
ATOM 3078  C CG   . PHE A 1 114 ? -1.290  1.883   1.748   1.00 0.42 ? 114 PHE A CG   2  
ATOM 3079  C CD1  . PHE A 1 114 ? -0.689  0.699   1.354   1.00 0.75 ? 114 PHE A CD1  2  
ATOM 3080  C CD2  . PHE A 1 114 ? -0.603  3.071   1.565   1.00 0.71 ? 114 PHE A CD2  2  
ATOM 3081  C CE1  . PHE A 1 114 ? 0.572   0.697   0.788   1.00 0.98 ? 114 PHE A CE1  2  
ATOM 3082  C CE2  . PHE A 1 114 ? 0.658   3.078   1.001   1.00 0.89 ? 114 PHE A CE2  2  
ATOM 3083  C CZ   . PHE A 1 114 ? 1.247   1.890   0.612   1.00 0.93 ? 114 PHE A CZ   2  
ATOM 3084  H H    . PHE A 1 114 ? -3.902  3.482   0.829   1.00 0.35 ? 114 PHE A H    2  
ATOM 3085  N N    . TYR A 1 115 ? -5.783  1.660   2.748   1.00 0.34 ? 115 TYR A N    2  
ATOM 3086  C CA   . TYR A 1 115 ? -6.929  1.195   3.517   1.00 0.34 ? 115 TYR A CA   2  
ATOM 3087  C C    . TYR A 1 115 ? -7.911  0.454   2.616   1.00 0.33 ? 115 TYR A C    2  
ATOM 3088  O O    . TYR A 1 115 ? -8.469  -0.576  2.998   1.00 0.33 ? 115 TYR A O    2  
ATOM 3089  C CB   . TYR A 1 115 ? -7.627  2.371   4.205   1.00 0.35 ? 115 TYR A CB   2  
ATOM 3090  C CG   . TYR A 1 115 ? -8.875  1.982   4.964   1.00 0.35 ? 115 TYR A CG   2  
ATOM 3091  C CD1  . TYR A 1 115 ? -8.790  1.368   6.206   1.00 0.37 ? 115 TYR A CD1  2  
ATOM 3092  C CD2  . TYR A 1 115 ? -10.138 2.220   4.436   1.00 0.35 ? 115 TYR A CD2  2  
ATOM 3093  C CE1  . TYR A 1 115 ? -9.927  1.002   6.900   1.00 0.39 ? 115 TYR A CE1  2  
ATOM 3094  C CE2  . TYR A 1 115 ? -11.280 1.860   5.124   1.00 0.37 ? 115 TYR A CE2  2  
ATOM 3095  C CZ   . TYR A 1 115 ? -11.169 1.250   6.354   1.00 0.39 ? 115 TYR A CZ   2  
ATOM 3096  O OH   . TYR A 1 115 ? -12.302 0.882   7.040   1.00 0.42 ? 115 TYR A OH   2  
ATOM 3097  H H    . TYR A 1 115 ? -5.641  2.626   2.638   1.00 0.34 ? 115 TYR A H    2  
ATOM 3098  H HH   . TYR A 1 115 ? -12.360 1.400   7.857   1.00 0.43 ? 115 TYR A HH   2  
ATOM 3099  N N    . PHE A 1 116 ? -8.113  0.983   1.418   1.00 0.32 ? 116 PHE A N    2  
ATOM 3100  C CA   . PHE A 1 116 ? -9.018  0.373   0.457   1.00 0.32 ? 116 PHE A CA   2  
ATOM 3101  C C    . PHE A 1 116 ? -8.463  -0.968  -0.010  1.00 0.31 ? 116 PHE A C    2  
ATOM 3102  O O    . PHE A 1 116 ? -9.188  -1.959  -0.092  1.00 0.31 ? 116 PHE A O    2  
ATOM 3103  C CB   . PHE A 1 116 ? -9.231  1.307   -0.738  1.00 0.32 ? 116 PHE A CB   2  
ATOM 3104  C CG   . PHE A 1 116 ? -10.384 0.920   -1.619  1.00 0.34 ? 116 PHE A CG   2  
ATOM 3105  C CD1  . PHE A 1 116 ? -11.682 0.951   -1.136  1.00 0.38 ? 116 PHE A CD1  2  
ATOM 3106  C CD2  . PHE A 1 116 ? -10.170 0.525   -2.929  1.00 0.34 ? 116 PHE A CD2  2  
ATOM 3107  C CE1  . PHE A 1 116 ? -12.746 0.597   -1.943  1.00 0.41 ? 116 PHE A CE1  2  
ATOM 3108  C CE2  . PHE A 1 116 ? -11.229 0.169   -3.742  1.00 0.37 ? 116 PHE A CE2  2  
ATOM 3109  C CZ   . PHE A 1 116 ? -12.519 0.205   -3.247  1.00 0.40 ? 116 PHE A CZ   2  
ATOM 3110  H H    . PHE A 1 116 ? -7.644  1.810   1.174   1.00 0.33 ? 116 PHE A H    2  
ATOM 3111  N N    . ALA A 1 117 ? -7.164  -0.990  -0.287  1.00 0.32 ? 117 ALA A N    2  
ATOM 3112  C CA   . ALA A 1 117 ? -6.490  -2.198  -0.746  1.00 0.32 ? 117 ALA A CA   2  
ATOM 3113  C C    . ALA A 1 117 ? -6.528  -3.299  0.308   1.00 0.33 ? 117 ALA A C    2  
ATOM 3114  O O    . ALA A 1 117 ? -6.834  -4.451  -0.004  1.00 0.33 ? 117 ALA A O    2  
ATOM 3115  C CB   . ALA A 1 117 ? -5.055  -1.894  -1.150  1.00 0.34 ? 117 ALA A CB   2  
ATOM 3116  H H    . ALA A 1 117 ? -6.642  -0.161  -0.188  1.00 0.32 ? 117 ALA A H    2  
ATOM 3117  N N    . SER A 1 118 ? -6.234  -2.945  1.556   1.00 0.34 ? 118 SER A N    2  
ATOM 3118  C CA   . SER A 1 118 ? -6.233  -3.917  2.645   1.00 0.35 ? 118 SER A CA   2  
ATOM 3119  C C    . SER A 1 118 ? -7.618  -4.524  2.849   1.00 0.35 ? 118 SER A C    2  
ATOM 3120  O O    . SER A 1 118 ? -7.751  -5.729  3.076   1.00 0.35 ? 118 SER A O    2  
ATOM 3121  C CB   . SER A 1 118 ? -5.706  -3.295  3.942   1.00 0.37 ? 118 SER A CB   2  
ATOM 3122  O OG   . SER A 1 118 ? -6.216  -1.987  4.131   1.00 0.38 ? 118 SER A OG   2  
ATOM 3123  H H    . SER A 1 118 ? -6.015  -2.008  1.750   1.00 0.34 ? 118 SER A H    2  
ATOM 3124  H HG   . SER A 1 118 ? -5.679  -1.357  3.634   1.00 0.38 ? 118 SER A HG   2  
ATOM 3125  N N    . LYS A 1 119 ? -8.651  -3.692  2.750   1.00 0.34 ? 119 LYS A N    2  
ATOM 3126  C CA   . LYS A 1 119 ? -10.018 -4.164  2.907   1.00 0.35 ? 119 LYS A CA   2  
ATOM 3127  C C    . LYS A 1 119 ? -10.387 -5.123  1.779   1.00 0.34 ? 119 LYS A C    2  
ATOM 3128  O O    . LYS A 1 119 ? -11.102 -6.103  1.994   1.00 0.35 ? 119 LYS A O    2  
ATOM 3129  C CB   . LYS A 1 119 ? -11.010 -3.001  2.991   1.00 0.37 ? 119 LYS A CB   2  
ATOM 3130  C CG   . LYS A 1 119 ? -11.599 -2.794  4.382   1.00 0.40 ? 119 LYS A CG   2  
ATOM 3131  C CD   . LYS A 1 119 ? -10.551 -2.294  5.365   1.00 0.45 ? 119 LYS A CD   2  
ATOM 3132  C CE   . LYS A 1 119 ? -10.971 -2.533  6.810   1.00 0.62 ? 119 LYS A CE   2  
ATOM 3133  N NZ   . LYS A 1 119 ? -12.261 -1.875  7.151   1.00 0.44 ? 119 LYS A NZ   2  
ATOM 3134  H H    . LYS A 1 119 ? -8.486  -2.739  2.572   1.00 0.35 ? 119 LYS A H    2  
ATOM 3135  H HZ1  . LYS A 1 119 ? -13.047 -2.370  6.693   1.00 0.62 ? 119 LYS A HZ1  2  
ATOM 3136  H HZ2  . LYS A 1 119 ? -12.259 -0.880  6.839   1.00 0.46 ? 119 LYS A HZ2  2  
ATOM 3137  H HZ3  . LYS A 1 119 ? -12.413 -1.897  8.189   1.00 0.59 ? 119 LYS A HZ3  2  
ATOM 3138  N N    . LEU A 1 120 ? -9.887  -4.844  0.579   1.00 0.32 ? 120 LEU A N    2  
ATOM 3139  C CA   . LEU A 1 120 ? -10.143 -5.700  -0.572  1.00 0.32 ? 120 LEU A CA   2  
ATOM 3140  C C    . LEU A 1 120 ? -9.439  -7.040  -0.385  1.00 0.32 ? 120 LEU A C    2  
ATOM 3141  O O    . LEU A 1 120 ? -10.011 -8.101  -0.645  1.00 0.33 ? 120 LEU A O    2  
ATOM 3142  C CB   . LEU A 1 120 ? -9.669  -5.036  -1.869  1.00 0.32 ? 120 LEU A CB   2  
ATOM 3143  C CG   . LEU A 1 120 ? -10.472 -3.823  -2.341  1.00 0.32 ? 120 LEU A CG   2  
ATOM 3144  C CD1  . LEU A 1 120 ? -9.871  -3.253  -3.614  1.00 0.34 ? 120 LEU A CD1  2  
ATOM 3145  C CD2  . LEU A 1 120 ? -11.930 -4.194  -2.557  1.00 0.33 ? 120 LEU A CD2  2  
ATOM 3146  H H    . LEU A 1 120 ? -9.337  -4.040  0.465   1.00 0.32 ? 120 LEU A H    2  
ATOM 3147  N N    . VAL A 1 121 ? -8.192  -6.975  0.081   1.00 0.33 ? 121 VAL A N    2  
ATOM 3148  C CA   . VAL A 1 121 ? -7.395  -8.169  0.330   1.00 0.34 ? 121 VAL A CA   2  
ATOM 3149  C C    . VAL A 1 121 ? -8.070  -9.027  1.396   1.00 0.36 ? 121 VAL A C    2  
ATOM 3150  O O    . VAL A 1 121 ? -8.162  -10.246 1.260   1.00 0.37 ? 121 VAL A O    2  
ATOM 3151  C CB   . VAL A 1 121 ? -5.955  -7.808  0.775   1.00 0.36 ? 121 VAL A CB   2  
ATOM 3152  C CG1  . VAL A 1 121 ? -5.217  -9.031  1.305   1.00 0.36 ? 121 VAL A CG1  2  
ATOM 3153  C CG2  . VAL A 1 121 ? -5.181  -7.184  -0.375  1.00 0.37 ? 121 VAL A CG2  2  
ATOM 3154  H H    . VAL A 1 121 ? -7.796  -6.092  0.256   1.00 0.33 ? 121 VAL A H    2  
ATOM 3155  N N    . LEU A 1 122 ? -8.562  -8.377  2.445   1.00 0.37 ? 122 LEU A N    2  
ATOM 3156  C CA   . LEU A 1 122 ? -9.243  -9.072  3.531   1.00 0.40 ? 122 LEU A CA   2  
ATOM 3157  C C    . LEU A 1 122 ? -10.508 -9.755  3.017   1.00 0.39 ? 122 LEU A C    2  
ATOM 3158  O O    . LEU A 1 122 ? -10.819 -10.882 3.406   1.00 0.40 ? 122 LEU A O    2  
ATOM 3159  C CB   . LEU A 1 122 ? -9.592  -8.090  4.653   1.00 0.44 ? 122 LEU A CB   2  
ATOM 3160  C CG   . LEU A 1 122 ? -9.992  -8.712  5.994   1.00 0.85 ? 122 LEU A CG   2  
ATOM 3161  C CD1  . LEU A 1 122 ? -8.816  -9.450  6.614   1.00 1.31 ? 122 LEU A CD1  2  
ATOM 3162  C CD2  . LEU A 1 122 ? -10.523 -7.646  6.941   1.00 0.88 ? 122 LEU A CD2  2  
ATOM 3163  H H    . LEU A 1 122 ? -8.456  -7.401  2.494   1.00 0.37 ? 122 LEU A H    2  
ATOM 3164  N N    . LYS A 1 123 ? -11.220 -9.068  2.130   1.00 0.37 ? 123 LYS A N    2  
ATOM 3165  C CA   . LYS A 1 123 ? -12.445 -9.597  1.544   1.00 0.38 ? 123 LYS A CA   2  
ATOM 3166  C C    . LYS A 1 123 ? -12.145 -10.864 0.746   1.00 0.38 ? 123 LYS A C    2  
ATOM 3167  O O    . LYS A 1 123 ? -12.820 -11.887 0.895   1.00 0.40 ? 123 LYS A O    2  
ATOM 3168  C CB   . LYS A 1 123 ? -13.080 -8.540  0.633   1.00 0.40 ? 123 LYS A CB   2  
ATOM 3169  C CG   . LYS A 1 123 ? -14.576 -8.355  0.821   1.00 0.53 ? 123 LYS A CG   2  
ATOM 3170  C CD   . LYS A 1 123 ? -15.079 -7.142  0.049   1.00 0.61 ? 123 LYS A CD   2  
ATOM 3171  C CE   . LYS A 1 123 ? -16.583 -6.964  0.198   1.00 0.89 ? 123 LYS A CE   2  
ATOM 3172  N NZ   . LYS A 1 123 ? -17.344 -7.700  -0.848  1.00 1.13 ? 123 LYS A NZ   2  
ATOM 3173  H H    . LYS A 1 123 ? -10.911 -8.173  1.864   1.00 0.38 ? 123 LYS A H    2  
ATOM 3174  H HZ1  . LYS A 1 123 ? -18.357 -7.713  -0.612  1.00 1.50 ? 123 LYS A HZ1  2  
ATOM 3175  H HZ2  . LYS A 1 123 ? -17.008 -8.681  -0.916  1.00 1.50 ? 123 LYS A HZ2  2  
ATOM 3176  H HZ3  . LYS A 1 123 ? -17.225 -7.237  -1.775  1.00 1.55 ? 123 LYS A HZ3  2  
ATOM 3177  N N    . ALA A 1 124 ? -11.104 -10.798 -0.077  1.00 0.37 ? 124 ALA A N    2  
ATOM 3178  C CA   . ALA A 1 124 ? -10.698 -11.934 -0.894  1.00 0.39 ? 124 ALA A CA   2  
ATOM 3179  C C    . ALA A 1 124 ? -10.136 -13.055 -0.024  1.00 0.40 ? 124 ALA A C    2  
ATOM 3180  O O    . ALA A 1 124 ? -10.274 -14.237 -0.344  1.00 0.42 ? 124 ALA A O    2  
ATOM 3181  C CB   . ALA A 1 124 ? -9.677  -11.496 -1.930  1.00 0.40 ? 124 ALA A CB   2  
ATOM 3182  H H    . ALA A 1 124 ? -10.598 -9.956  -0.140  1.00 0.36 ? 124 ALA A H    2  
ATOM 3183  N N    . LEU A 1 125 ? -9.517  -12.674 1.088   1.00 0.40 ? 125 LEU A N    2  
ATOM 3184  C CA   . LEU A 1 125 ? -8.942  -13.635 2.018   1.00 0.42 ? 125 LEU A CA   2  
ATOM 3185  C C    . LEU A 1 125 ? -10.039 -14.496 2.639   1.00 0.44 ? 125 LEU A C    2  
ATOM 3186  O O    . LEU A 1 125 ? -9.838  -15.679 2.910   1.00 0.47 ? 125 LEU A O    2  
ATOM 3187  C CB   . LEU A 1 125 ? -8.139  -12.917 3.105   1.00 0.43 ? 125 LEU A CB   2  
ATOM 3188  C CG   . LEU A 1 125 ? -7.213  -13.793 3.957   1.00 0.47 ? 125 LEU A CG   2  
ATOM 3189  C CD1  . LEU A 1 125 ? -6.165  -14.473 3.087   1.00 0.51 ? 125 LEU A CD1  2  
ATOM 3190  C CD2  . LEU A 1 125 ? -6.550  -12.964 5.047   1.00 0.50 ? 125 LEU A CD2  2  
ATOM 3191  H H    . LEU A 1 125 ? -9.433  -11.714 1.281   1.00 0.39 ? 125 LEU A H    2  
ATOM 3192  N N    . CYS A 1 126 ? -11.211 -13.899 2.830   1.00 0.44 ? 126 CYS A N    2  
ATOM 3193  C CA   . CYS A 1 126 ? -12.350 -14.610 3.396   1.00 0.47 ? 126 CYS A CA   2  
ATOM 3194  C C    . CYS A 1 126 ? -12.917 -15.599 2.378   1.00 0.49 ? 126 CYS A C    2  
ATOM 3195  O O    . CYS A 1 126 ? -13.708 -16.479 2.715   1.00 0.57 ? 126 CYS A O    2  
ATOM 3196  C CB   . CYS A 1 126 ? -13.432 -13.621 3.837   1.00 0.49 ? 126 CYS A CB   2  
ATOM 3197  S SG   . CYS A 1 126 ? -12.856 -12.354 4.994   1.00 0.53 ? 126 CYS A SG   2  
ATOM 3198  H H    . CYS A 1 126 ? -11.312 -12.953 2.586   1.00 0.44 ? 126 CYS A H    2  
ATOM 3199  H HG   . CYS A 1 126 ? -11.903 -11.651 4.391   1.00 0.48 ? 126 CYS A HG   2  
ATOM 3200  N N    . THR A 1 127 ? -12.502 -15.445 1.127   1.00 0.46 ? 127 THR A N    2  
ATOM 3201  C CA   . THR A 1 127 ? -12.946 -16.322 0.054   1.00 0.48 ? 127 THR A CA   2  
ATOM 3202  C C    . THR A 1 127 ? -11.917 -17.431 -0.167  1.00 0.49 ? 127 THR A C    2  
ATOM 3203  O O    . THR A 1 127 ? -12.160 -18.394 -0.900  1.00 0.55 ? 127 THR A O    2  
ATOM 3204  C CB   . THR A 1 127 ? -13.147 -15.525 -1.249  1.00 0.49 ? 127 THR A CB   2  
ATOM 3205  O OG1  . THR A 1 127 ? -13.811 -14.290 -0.945  1.00 0.53 ? 127 THR A OG1  2  
ATOM 3206  C CG2  . THR A 1 127 ? -13.996 -16.312 -2.239  1.00 0.56 ? 127 THR A CG2  2  
ATOM 3207  H H    . THR A 1 127 ? -11.869 -14.723 0.919   1.00 0.45 ? 127 THR A H    2  
ATOM 3208  H HG1  . THR A 1 127 ? -13.432 -13.904 -0.148  1.00 0.87 ? 127 THR A HG1  2  
ATOM 3209  N N    . LYS A 1 128 ? -10.768 -17.279 0.490   1.00 0.47 ? 128 LYS A N    2  
ATOM 3210  C CA   . LYS A 1 128 ? -9.674  -18.243 0.411   1.00 0.50 ? 128 LYS A CA   2  
ATOM 3211  C C    . LYS A 1 128 ? -9.086  -18.358 -0.990  1.00 0.46 ? 128 LYS A C    2  
ATOM 3212  O O    . LYS A 1 128 ? -8.887  -19.457 -1.507  1.00 0.54 ? 128 LYS A O    2  
ATOM 3213  C CB   . LYS A 1 128 ? -10.077 -19.608 0.972   1.00 0.60 ? 128 LYS A CB   2  
ATOM 3214  C CG   . LYS A 1 128 ? -10.076 -19.653 2.491   1.00 0.67 ? 128 LYS A CG   2  
ATOM 3215  C CD   . LYS A 1 128 ? -10.849 -20.848 3.022   1.00 0.98 ? 128 LYS A CD   2  
ATOM 3216  C CE   . LYS A 1 128 ? -10.767 -20.917 4.539   1.00 1.15 ? 128 LYS A CE   2  
ATOM 3217  N NZ   . LYS A 1 128 ? -11.947 -21.604 5.123   1.00 1.40 ? 128 LYS A NZ   2  
ATOM 3218  H H    . LYS A 1 128 ? -10.653 -16.488 1.055   1.00 0.46 ? 128 LYS A H    2  
ATOM 3219  H HZ1  . LYS A 1 128 ? -12.815 -21.083 4.887   1.00 1.68 ? 128 LYS A HZ1  2  
ATOM 3220  H HZ2  . LYS A 1 128 ? -11.855 -21.657 6.157   1.00 1.63 ? 128 LYS A HZ2  2  
ATOM 3221  H HZ3  . LYS A 1 128 ? -12.020 -22.571 4.744   1.00 1.70 ? 128 LYS A HZ3  2  
ATOM 3222  N N    . VAL A 1 129 ? -8.809  -17.215 -1.600  1.00 0.42 ? 129 VAL A N    2  
ATOM 3223  C CA   . VAL A 1 129 ? -8.222  -17.190 -2.933  1.00 0.39 ? 129 VAL A CA   2  
ATOM 3224  C C    . VAL A 1 129 ? -6.902  -16.402 -2.924  1.00 0.35 ? 129 VAL A C    2  
ATOM 3225  O O    . VAL A 1 129 ? -6.868  -15.198 -3.192  1.00 0.34 ? 129 VAL A O    2  
ATOM 3226  C CB   . VAL A 1 129 ? -9.209  -16.672 -4.011  1.00 0.40 ? 129 VAL A CB   2  
ATOM 3227  C CG1  . VAL A 1 129 ? -9.838  -15.340 -3.617  1.00 0.39 ? 129 VAL A CG1  2  
ATOM 3228  C CG2  . VAL A 1 129 ? -8.554  -16.598 -5.383  1.00 0.40 ? 129 VAL A CG2  2  
ATOM 3229  H H    . VAL A 1 129 ? -8.997  -16.368 -1.142  1.00 0.46 ? 129 VAL A H    2  
ATOM 3230  N N    . PRO A 1 130 ? -5.790  -17.090 -2.599  1.00 0.37 ? 130 PRO A N    2  
ATOM 3231  C CA   . PRO A 1 130 ? -4.457  -16.472 -2.517  1.00 0.37 ? 130 PRO A CA   2  
ATOM 3232  C C    . PRO A 1 130 ? -4.010  -15.844 -3.831  1.00 0.33 ? 130 PRO A C    2  
ATOM 3233  O O    . PRO A 1 130 ? -3.365  -14.794 -3.838  1.00 0.32 ? 130 PRO A O    2  
ATOM 3234  C CB   . PRO A 1 130 ? -3.536  -17.641 -2.149  1.00 0.43 ? 130 PRO A CB   2  
ATOM 3235  C CG   . PRO A 1 130 ? -4.439  -18.662 -1.547  1.00 0.47 ? 130 PRO A CG   2  
ATOM 3236  C CD   . PRO A 1 130 ? -5.743  -18.530 -2.279  1.00 0.43 ? 130 PRO A CD   2  
ATOM 3237  N N    . GLU A 1 131 ? -4.371  -16.478 -4.941  1.00 0.34 ? 131 GLU A N    2  
ATOM 3238  C CA   . GLU A 1 131 ? -3.998  -15.979 -6.257  1.00 0.36 ? 131 GLU A CA   2  
ATOM 3239  C C    . GLU A 1 131 ? -4.535  -14.574 -6.501  1.00 0.32 ? 131 GLU A C    2  
ATOM 3240  O O    . GLU A 1 131 ? -3.852  -13.738 -7.093  1.00 0.34 ? 131 GLU A O    2  
ATOM 3241  C CB   . GLU A 1 131 ? -4.442  -16.934 -7.362  1.00 0.43 ? 131 GLU A CB   2  
ATOM 3242  C CG   . GLU A 1 131 ? -3.285  -17.514 -8.162  1.00 0.75 ? 131 GLU A CG   2  
ATOM 3243  C CD   . GLU A 1 131 ? -2.366  -16.446 -8.723  1.00 1.18 ? 131 GLU A CD   2  
ATOM 3244  O OE1  . GLU A 1 131 ? -2.780  -15.727 -9.658  1.00 1.55 ? 131 GLU A OE1  2  
ATOM 3245  O OE2  . GLU A 1 131 ? -1.228  -16.317 -8.233  1.00 1.54 ? 131 GLU A OE2  2  
ATOM 3246  H H    . GLU A 1 131 ? -4.897  -17.299 -4.871  1.00 0.37 ? 131 GLU A H    2  
ATOM 3247  N N    . LEU A 1 132 ? -5.749  -14.308 -6.030  1.00 0.32 ? 132 LEU A N    2  
ATOM 3248  C CA   . LEU A 1 132 ? -6.343  -12.990 -6.198  1.00 0.32 ? 132 LEU A CA   2  
ATOM 3249  C C    . LEU A 1 132 ? -5.540  -11.957 -5.416  1.00 0.31 ? 132 LEU A C    2  
ATOM 3250  O O    . LEU A 1 132 ? -5.337  -10.836 -5.878  1.00 0.34 ? 132 LEU A O    2  
ATOM 3251  C CB   . LEU A 1 132 ? -7.808  -12.988 -5.759  1.00 0.33 ? 132 LEU A CB   2  
ATOM 3252  C CG   . LEU A 1 132 ? -8.633  -11.765 -6.165  1.00 0.34 ? 132 LEU A CG   2  
ATOM 3253  C CD1  . LEU A 1 132 ? -8.629  -11.587 -7.675  1.00 0.36 ? 132 LEU A CD1  2  
ATOM 3254  C CD2  . LEU A 1 132 ? -10.057 -11.884 -5.644  1.00 0.36 ? 132 LEU A CD2  2  
ATOM 3255  H H    . LEU A 1 132 ? -6.248  -15.006 -5.557  1.00 0.34 ? 132 LEU A H    2  
ATOM 3256  N N    . ILE A 1 133 ? -5.062  -12.360 -4.241  1.00 0.31 ? 133 ILE A N    2  
ATOM 3257  C CA   . ILE A 1 133 ? -4.260  -11.482 -3.394  1.00 0.33 ? 133 ILE A CA   2  
ATOM 3258  C C    . ILE A 1 133 ? -2.987  -11.084 -4.131  1.00 0.34 ? 133 ILE A C    2  
ATOM 3259  O O    . ILE A 1 133 ? -2.611  -9.911  -4.161  1.00 0.38 ? 133 ILE A O    2  
ATOM 3260  C CB   . ILE A 1 133 ? -3.873  -12.179 -2.069  1.00 0.34 ? 133 ILE A CB   2  
ATOM 3261  C CG1  . ILE A 1 133 ? -5.100  -12.797 -1.385  1.00 0.36 ? 133 ILE A CG1  2  
ATOM 3262  C CG2  . ILE A 1 133 ? -3.149  -11.218 -1.134  1.00 0.38 ? 133 ILE A CG2  2  
ATOM 3263  C CD1  . ILE A 1 133 ? -6.179  -11.801 -1.021  1.00 0.39 ? 133 ILE A CD1  2  
ATOM 3264  H H    . ILE A 1 133 ? -5.253  -13.272 -3.935  1.00 0.31 ? 133 ILE A H    2  
ATOM 3265  N N    . ARG A 1 134 ? -2.340  -12.068 -4.748  1.00 0.32 ? 134 ARG A N    2  
ATOM 3266  C CA   . ARG A 1 134 ? -1.115  -11.824 -5.494  1.00 0.35 ? 134 ARG A CA   2  
ATOM 3267  C C    . ARG A 1 134 ? -1.402  -10.946 -6.707  1.00 0.37 ? 134 ARG A C    2  
ATOM 3268  O O    . ARG A 1 134 ? -0.600  -10.085 -7.069  1.00 0.40 ? 134 ARG A O    2  
ATOM 3269  C CB   . ARG A 1 134 ? -0.474  -13.142 -5.941  1.00 0.37 ? 134 ARG A CB   2  
ATOM 3270  C CG   . ARG A 1 134 ? -0.301  -14.180 -4.837  1.00 0.67 ? 134 ARG A CG   2  
ATOM 3271  C CD   . ARG A 1 134 ? 0.497   -13.636 -3.660  1.00 1.16 ? 134 ARG A CD   2  
ATOM 3272  N NE   . ARG A 1 134 ? 1.874   -13.301 -4.022  1.00 1.04 ? 134 ARG A NE   2  
ATOM 3273  C CZ   . ARG A 1 134 ? 2.621   -12.423 -3.359  1.00 1.20 ? 134 ARG A CZ   2  
ATOM 3274  N NH1  . ARG A 1 134 ? 2.131   -11.805 -2.289  1.00 1.47 ? 134 ARG A NH1  2  
ATOM 3275  N NH2  . ARG A 1 134 ? 3.862   -12.185 -3.757  1.00 1.35 ? 134 ARG A NH2  2  
ATOM 3276  H H    . ARG A 1 134 ? -2.697  -12.982 -4.697  1.00 0.32 ? 134 ARG A H    2  
ATOM 3277  H HE   . ARG A 1 134 ? 2.264   -13.762 -4.803  1.00 1.07 ? 134 ARG A HE   2  
ATOM 3278  H HH11 . ARG A 1 134 ? 1.198   -11.995 -1.985  1.00 1.53 ? 134 ARG A HH11 2  
ATOM 3279  H HH12 . ARG A 1 134 ? 2.695   -11.150 -1.780  1.00 1.73 ? 134 ARG A HH12 2  
ATOM 3280  H HH21 . ARG A 1 134 ? 4.234   -12.673 -4.565  1.00 1.37 ? 134 ARG A HH21 2  
ATOM 3281  H HH22 . ARG A 1 134 ? 4.435   -11.519 -3.273  1.00 1.59 ? 134 ARG A HH22 2  
ATOM 3282  N N    . THR A 1 135 ? -2.560  -11.162 -7.322  1.00 0.38 ? 135 THR A N    2  
ATOM 3283  C CA   . THR A 1 135 ? -2.964  -10.392 -8.489  1.00 0.42 ? 135 THR A CA   2  
ATOM 3284  C C    . THR A 1 135 ? -3.163  -8.916  -8.131  1.00 0.43 ? 135 THR A C    2  
ATOM 3285  O O    . THR A 1 135 ? -2.677  -8.029  -8.835  1.00 0.47 ? 135 THR A O    2  
ATOM 3286  C CB   . THR A 1 135 ? -4.249  -10.962 -9.125  1.00 0.45 ? 135 THR A CB   2  
ATOM 3287  O OG1  . THR A 1 135 ? -4.081  -12.368 -9.370  1.00 0.51 ? 135 THR A OG1  2  
ATOM 3288  C CG2  . THR A 1 135 ? -4.544  -10.267 -10.445 1.00 0.52 ? 135 THR A CG2  2  
ATOM 3289  H H    . THR A 1 135 ? -3.161  -11.860 -6.977  1.00 0.38 ? 135 THR A H    2  
ATOM 3290  H HG1  . THR A 1 135 ? -3.899  -12.824 -8.536  1.00 0.83 ? 135 THR A HG1  2  
ATOM 3291  N N    . ILE A 1 136 ? -3.863  -8.661  -7.025  1.00 0.42 ? 136 ILE A N    2  
ATOM 3292  C CA   . ILE A 1 136 ? -4.107  -7.292  -6.573  1.00 0.45 ? 136 ILE A CA   2  
ATOM 3293  C C    . ILE A 1 136 ? -2.784  -6.610  -6.240  1.00 0.46 ? 136 ILE A C    2  
ATOM 3294  O O    . ILE A 1 136 ? -2.541  -5.469  -6.638  1.00 0.49 ? 136 ILE A O    2  
ATOM 3295  C CB   . ILE A 1 136 ? -5.038  -7.250  -5.338  1.00 0.45 ? 136 ILE A CB   2  
ATOM 3296  C CG1  . ILE A 1 136 ? -6.395  -7.877  -5.674  1.00 0.44 ? 136 ILE A CG1  2  
ATOM 3297  C CG2  . ILE A 1 136 ? -5.221  -5.818  -4.848  1.00 0.49 ? 136 ILE A CG2  2  
ATOM 3298  C CD1  . ILE A 1 136 ? -7.284  -8.119  -4.470  1.00 0.46 ? 136 ILE A CD1  2  
ATOM 3299  H H    . ILE A 1 136 ? -4.229  -9.410  -6.504  1.00 0.40 ? 136 ILE A H    2  
ATOM 3300  N N    . MET A 1 137 ? -1.925  -7.334  -5.528  1.00 0.45 ? 137 MET A N    2  
ATOM 3301  C CA   . MET A 1 137 ? -0.614  -6.820  -5.140  1.00 0.47 ? 137 MET A CA   2  
ATOM 3302  C C    . MET A 1 137 ? 0.195   -6.420  -6.371  1.00 0.48 ? 137 MET A C    2  
ATOM 3303  O O    . MET A 1 137 ? 0.861   -5.384  -6.378  1.00 0.49 ? 137 MET A O    2  
ATOM 3304  C CB   . MET A 1 137 ? 0.149   -7.868  -4.321  1.00 0.48 ? 137 MET A CB   2  
ATOM 3305  C CG   . MET A 1 137 ? 1.460   -7.373  -3.727  1.00 0.46 ? 137 MET A CG   2  
ATOM 3306  S SD   . MET A 1 137 ? 2.266   -8.615  -2.695  1.00 0.49 ? 137 MET A SD   2  
ATOM 3307  C CE   . MET A 1 137 ? 3.713   -7.714  -2.144  1.00 0.57 ? 137 MET A CE   2  
ATOM 3308  H H    . MET A 1 137 ? -2.185  -8.240  -5.245  1.00 0.44 ? 137 MET A H    2  
ATOM 3309  N N    . GLY A 1 138 ? 0.115   -7.240  -7.416  1.00 0.49 ? 138 GLY A N    2  
ATOM 3310  C CA   . GLY A 1 138 ? 0.835   -6.958  -8.645  1.00 0.51 ? 138 GLY A CA   2  
ATOM 3311  C C    . GLY A 1 138 ? 0.391   -5.654  -9.280  1.00 0.52 ? 138 GLY A C    2  
ATOM 3312  O O    . GLY A 1 138 ? 1.214   -4.887  -9.779  1.00 0.53 ? 138 GLY A O    2  
ATOM 3313  H H    . GLY A 1 138 ? -0.436  -8.049  -7.349  1.00 0.50 ? 138 GLY A H    2  
ATOM 3314  N N    . TRP A 1 139 ? -0.911  -5.398  -9.254  1.00 0.53 ? 139 TRP A N    2  
ATOM 3315  C CA   . TRP A 1 139 ? -1.457  -4.169  -9.820  1.00 0.57 ? 139 TRP A CA   2  
ATOM 3316  C C    . TRP A 1 139 ? -1.172  -2.975  -8.914  1.00 0.53 ? 139 TRP A C    2  
ATOM 3317  O O    . TRP A 1 139 ? -1.037  -1.845  -9.384  1.00 0.54 ? 139 TRP A O    2  
ATOM 3318  C CB   . TRP A 1 139 ? -2.960  -4.297  -10.081 1.00 0.65 ? 139 TRP A CB   2  
ATOM 3319  C CG   . TRP A 1 139 ? -3.293  -5.064  -11.327 1.00 0.69 ? 139 TRP A CG   2  
ATOM 3320  C CD1  . TRP A 1 139 ? -2.613  -5.037  -12.510 1.00 0.72 ? 139 TRP A CD1  2  
ATOM 3321  C CD2  . TRP A 1 139 ? -4.393  -5.961  -11.519 1.00 0.78 ? 139 TRP A CD2  2  
ATOM 3322  N NE1  . TRP A 1 139 ? -3.216  -5.866  -13.425 1.00 0.81 ? 139 TRP A NE1  2  
ATOM 3323  C CE2  . TRP A 1 139 ? -4.311  -6.446  -12.840 1.00 0.84 ? 139 TRP A CE2  2  
ATOM 3324  C CE3  . TRP A 1 139 ? -5.436  -6.406  -10.701 1.00 0.84 ? 139 TRP A CE3  2  
ATOM 3325  C CZ2  . TRP A 1 139 ? -5.234  -7.350  -13.362 1.00 0.95 ? 139 TRP A CZ2  2  
ATOM 3326  C CZ3  . TRP A 1 139 ? -6.350  -7.302  -11.220 1.00 0.95 ? 139 TRP A CZ3  2  
ATOM 3327  C CH2  . TRP A 1 139 ? -6.242  -7.767  -12.537 1.00 1.00 ? 139 TRP A CH2  2  
ATOM 3328  H H    . TRP A 1 139 ? -1.521  -6.055  -8.854  1.00 0.55 ? 139 TRP A H    2  
ATOM 3329  H HE1  . TRP A 1 139 ? -2.910  -6.017  -14.345 1.00 0.86 ? 139 TRP A HE1  2  
ATOM 3330  N N    . THR A 1 140 ? -1.084  -3.230  -7.614  1.00 0.51 ? 140 THR A N    2  
ATOM 3331  C CA   . THR A 1 140 ? -0.796  -2.179  -6.649  1.00 0.51 ? 140 THR A CA   2  
ATOM 3332  C C    . THR A 1 140 ? 0.615   -1.641  -6.889  1.00 0.47 ? 140 THR A C    2  
ATOM 3333  O O    . THR A 1 140 ? 0.849   -0.432  -6.872  1.00 0.53 ? 140 THR A O    2  
ATOM 3334  C CB   . THR A 1 140 ? -0.915  -2.706  -5.203  1.00 0.53 ? 140 THR A CB   2  
ATOM 3335  O OG1  . THR A 1 140 ? -2.186  -3.351  -5.027  1.00 0.55 ? 140 THR A OG1  2  
ATOM 3336  C CG2  . THR A 1 140 ? -0.794  -1.566  -4.202  1.00 0.54 ? 140 THR A CG2  2  
ATOM 3337  H H    . THR A 1 140 ? -1.219  -4.148  -7.299  1.00 0.52 ? 140 THR A H    2  
ATOM 3338  H HG1  . THR A 1 140 ? -2.325  -3.997  -5.731  1.00 0.67 ? 140 THR A HG1  2  
ATOM 3339  N N    . LEU A 1 141 ? 1.545   -2.559  -7.135  1.00 0.41 ? 141 LEU A N    2  
ATOM 3340  C CA   . LEU A 1 141 ? 2.929   -2.194  -7.399  1.00 0.42 ? 141 LEU A CA   2  
ATOM 3341  C C    . LEU A 1 141 ? 3.056   -1.618  -8.803  1.00 0.42 ? 141 LEU A C    2  
ATOM 3342  O O    . LEU A 1 141 ? 3.939   -0.801  -9.076  1.00 0.41 ? 141 LEU A O    2  
ATOM 3343  C CB   . LEU A 1 141 ? 3.846   -3.413  -7.241  1.00 0.44 ? 141 LEU A CB   2  
ATOM 3344  C CG   . LEU A 1 141 ? 3.946   -4.009  -5.832  1.00 0.48 ? 141 LEU A CG   2  
ATOM 3345  C CD1  . LEU A 1 141 ? 4.726   -5.314  -5.861  1.00 0.55 ? 141 LEU A CD1  2  
ATOM 3346  C CD2  . LEU A 1 141 ? 4.594   -3.019  -4.875  1.00 0.53 ? 141 LEU A CD2  2  
ATOM 3347  H H    . LEU A 1 141 ? 1.294   -3.508  -7.135  1.00 0.40 ? 141 LEU A H    2  
ATOM 3348  N N    . ASP A 1 142 ? 2.156   -2.048  -9.682  1.00 0.51 ? 142 ASP A N    2  
ATOM 3349  C CA   . ASP A 1 142 ? 2.137   -1.592  -11.066 1.00 0.54 ? 142 ASP A CA   2  
ATOM 3350  C C    . ASP A 1 142 ? 1.900   -0.093  -11.143 1.00 0.51 ? 142 ASP A C    2  
ATOM 3351  O O    . ASP A 1 142 ? 2.720   0.644   -11.688 1.00 0.53 ? 142 ASP A O    2  
ATOM 3352  C CB   . ASP A 1 142 ? 1.067   -2.344  -11.862 1.00 0.62 ? 142 ASP A CB   2  
ATOM 3353  C CG   . ASP A 1 142 ? 1.026   -1.945  -13.320 1.00 0.82 ? 142 ASP A CG   2  
ATOM 3354  O OD1  . ASP A 1 142 ? 2.038   -2.132  -14.025 1.00 0.96 ? 142 ASP A OD1  2  
ATOM 3355  O OD2  . ASP A 1 142 ? -0.023  -1.450  -13.779 1.00 1.12 ? 142 ASP A OD2  2  
ATOM 3356  H H    . ASP A 1 142 ? 1.486   -2.701  -9.392  1.00 0.59 ? 142 ASP A H    2  
ATOM 3357  N N    . PHE A 1 143 ? 0.798   0.361   -10.558 1.00 0.52 ? 143 PHE A N    2  
ATOM 3358  C CA   . PHE A 1 143 ? 0.457   1.782   -10.562 1.00 0.54 ? 143 PHE A CA   2  
ATOM 3359  C C    . PHE A 1 143 ? 1.539   2.592   -9.852  1.00 0.48 ? 143 PHE A C    2  
ATOM 3360  O O    . PHE A 1 143 ? 1.785   3.758   -10.181 1.00 0.50 ? 143 PHE A O    2  
ATOM 3361  C CB   . PHE A 1 143 ? -0.908  2.013   -9.907  1.00 0.64 ? 143 PHE A CB   2  
ATOM 3362  C CG   . PHE A 1 143 ? -1.515  3.350   -10.230 1.00 0.66 ? 143 PHE A CG   2  
ATOM 3363  C CD1  . PHE A 1 143 ? -2.061  3.591   -11.480 1.00 0.70 ? 143 PHE A CD1  2  
ATOM 3364  C CD2  . PHE A 1 143 ? -1.538  4.362   -9.286  1.00 0.77 ? 143 PHE A CD2  2  
ATOM 3365  C CE1  . PHE A 1 143 ? -2.618  4.818   -11.785 1.00 0.81 ? 143 PHE A CE1  2  
ATOM 3366  C CE2  . PHE A 1 143 ? -2.094  5.595   -9.584  1.00 0.86 ? 143 PHE A CE2  2  
ATOM 3367  C CZ   . PHE A 1 143 ? -2.635  5.822   -10.835 1.00 0.86 ? 143 PHE A CZ   2  
ATOM 3368  H H    . PHE A 1 143 ? 0.194   -0.275  -10.117 1.00 0.56 ? 143 PHE A H    2  
ATOM 3369  N N    . LEU A 1 144 ? 2.196   1.958   -8.887  1.00 0.43 ? 144 LEU A N    2  
ATOM 3370  C CA   . LEU A 1 144 ? 3.264   2.601   -8.138  1.00 0.41 ? 144 LEU A CA   2  
ATOM 3371  C C    . LEU A 1 144 ? 4.445   2.873   -9.065  1.00 0.41 ? 144 LEU A C    2  
ATOM 3372  O O    . LEU A 1 144 ? 4.941   3.996   -9.141  1.00 0.43 ? 144 LEU A O    2  
ATOM 3373  C CB   . LEU A 1 144 ? 3.701   1.717   -6.964  1.00 0.41 ? 144 LEU A CB   2  
ATOM 3374  C CG   . LEU A 1 144 ? 4.249   2.435   -5.724  1.00 0.72 ? 144 LEU A CG   2  
ATOM 3375  C CD1  . LEU A 1 144 ? 4.149   1.536   -4.501  1.00 1.07 ? 144 LEU A CD1  2  
ATOM 3376  C CD2  . LEU A 1 144 ? 5.690   2.879   -5.938  1.00 1.34 ? 144 LEU A CD2  2  
ATOM 3377  H H    . LEU A 1 144 ? 1.954   1.029   -8.676  1.00 0.43 ? 144 LEU A H    2  
ATOM 3378  N N    . ARG A 1 145 ? 4.865   1.846   -9.794  1.00 0.42 ? 145 ARG A N    2  
ATOM 3379  C CA   . ARG A 1 145 ? 5.986   1.965   -10.724 1.00 0.46 ? 145 ARG A CA   2  
ATOM 3380  C C    . ARG A 1 145 ? 5.611   2.846   -11.915 1.00 0.46 ? 145 ARG A C    2  
ATOM 3381  O O    . ARG A 1 145 ? 6.474   3.405   -12.592 1.00 0.55 ? 145 ARG A O    2  
ATOM 3382  C CB   . ARG A 1 145 ? 6.413   0.575   -11.205 1.00 0.54 ? 145 ARG A CB   2  
ATOM 3383  C CG   . ARG A 1 145 ? 7.779   0.520   -11.872 1.00 0.66 ? 145 ARG A CG   2  
ATOM 3384  C CD   . ARG A 1 145 ? 8.208   -0.921  -12.105 1.00 1.01 ? 145 ARG A CD   2  
ATOM 3385  N NE   . ARG A 1 145 ? 9.553   -1.026  -12.669 1.00 1.10 ? 145 ARG A NE   2  
ATOM 3386  C CZ   . ARG A 1 145 ? 10.629  -1.399  -11.971 1.00 1.24 ? 145 ARG A CZ   2  
ATOM 3387  N NH1  . ARG A 1 145 ? 10.541  -1.628  -10.672 1.00 1.40 ? 145 ARG A NH1  2  
ATOM 3388  N NH2  . ARG A 1 145 ? 11.803  -1.524  -12.570 1.00 1.43 ? 145 ARG A NH2  2  
ATOM 3389  H H    . ARG A 1 145 ? 4.401   0.981   -9.711  1.00 0.42 ? 145 ARG A H    2  
ATOM 3390  H HE   . ARG A 1 145 ? 9.654   -0.835  -13.630 1.00 1.24 ? 145 ARG A HE   2  
ATOM 3391  H HH11 . ARG A 1 145 ? 9.665   -1.527  -10.202 1.00 1.42 ? 145 ARG A HH11 2  
ATOM 3392  H HH12 . ARG A 1 145 ? 11.364  -1.914  -10.148 1.00 1.63 ? 145 ARG A HH12 2  
ATOM 3393  H HH21 . ARG A 1 145 ? 11.889  -1.351  -13.552 1.00 1.54 ? 145 ARG A HH21 2  
ATOM 3394  H HH22 . ARG A 1 145 ? 12.617  -1.802  -12.035 1.00 1.57 ? 145 ARG A HH22 2  
ATOM 3395  N N    . GLU A 1 146 ? 4.317   2.968   -12.161 1.00 0.50 ? 146 GLU A N    2  
ATOM 3396  C CA   . GLU A 1 146 ? 3.817   3.779   -13.260 1.00 0.55 ? 146 GLU A CA   2  
ATOM 3397  C C    . GLU A 1 146 ? 3.991   5.277   -13.012 1.00 0.56 ? 146 GLU A C    2  
ATOM 3398  O O    . GLU A 1 146 ? 4.363   6.013   -13.924 1.00 0.74 ? 146 GLU A O    2  
ATOM 3399  C CB   . GLU A 1 146 ? 2.352   3.450   -13.561 1.00 0.62 ? 146 GLU A CB   2  
ATOM 3400  C CG   . GLU A 1 146 ? 2.160   2.216   -14.427 1.00 0.89 ? 146 GLU A CG   2  
ATOM 3401  C CD   . GLU A 1 146 ? 2.476   2.469   -15.888 1.00 1.31 ? 146 GLU A CD   2  
ATOM 3402  O OE1  . GLU A 1 146 ? 3.601   2.930   -16.194 1.00 1.61 ? 146 GLU A OE1  2  
ATOM 3403  O OE2  . GLU A 1 146 ? 1.599   2.214   -16.740 1.00 1.82 ? 146 GLU A OE2  2  
ATOM 3404  H H    . GLU A 1 146 ? 3.677   2.478   -11.598 1.00 0.58 ? 146 GLU A H    2  
ATOM 3405  N N    . ARG A 1 147 ? 3.736   5.733   -11.785 1.00 0.51 ? 147 ARG A N    2  
ATOM 3406  C CA   . ARG A 1 147 ? 3.860   7.166   -11.481 1.00 0.57 ? 147 ARG A CA   2  
ATOM 3407  C C    . ARG A 1 147 ? 4.420   7.462   -10.089 1.00 0.51 ? 147 ARG A C    2  
ATOM 3408  O O    . ARG A 1 147 ? 5.312   8.299   -9.943  1.00 0.53 ? 147 ARG A O    2  
ATOM 3409  C CB   . ARG A 1 147 ? 2.525   7.902   -11.675 1.00 0.73 ? 147 ARG A CB   2  
ATOM 3410  C CG   . ARG A 1 147 ? 2.219   8.321   -13.111 1.00 0.88 ? 147 ARG A CG   2  
ATOM 3411  C CD   . ARG A 1 147 ? 3.241   9.320   -13.647 1.00 1.01 ? 147 ARG A CD   2  
ATOM 3412  N NE   . ARG A 1 147 ? 4.530   8.686   -13.923 1.00 1.03 ? 147 ARG A NE   2  
ATOM 3413  C CZ   . ARG A 1 147 ? 5.713   9.292   -13.794 1.00 1.32 ? 147 ARG A CZ   2  
ATOM 3414  N NH1  . ARG A 1 147 ? 5.781   10.565  -13.430 1.00 1.56 ? 147 ARG A NH1  2  
ATOM 3415  N NH2  . ARG A 1 147 ? 6.830   8.612   -14.012 1.00 1.59 ? 147 ARG A NH2  2  
ATOM 3416  H H    . ARG A 1 147 ? 3.470   5.103   -11.081 1.00 0.55 ? 147 ARG A H    2  
ATOM 3417  H HE   . ARG A 1 147 ? 4.513   7.739   -14.205 1.00 1.04 ? 147 ARG A HE   2  
ATOM 3418  H HH11 . ARG A 1 147 ? 4.943   11.089  -13.256 1.00 1.52 ? 147 ARG A HH11 2  
ATOM 3419  H HH12 . ARG A 1 147 ? 6.672   11.014  -13.340 1.00 1.88 ? 147 ARG A HH12 2  
ATOM 3420  H HH21 . ARG A 1 147 ? 6.792   7.646   -14.278 1.00 1.57 ? 147 ARG A HH21 2  
ATOM 3421  H HH22 . ARG A 1 147 ? 7.723   9.062   -13.915 1.00 1.91 ? 147 ARG A HH22 2  
ATOM 3422  N N    . LEU A 1 148 ? 3.896   6.776   -9.079  1.00 0.48 ? 148 LEU A N    2  
ATOM 3423  C CA   . LEU A 1 148 ? 4.308   6.985   -7.688  1.00 0.47 ? 148 LEU A CA   2  
ATOM 3424  C C    . LEU A 1 148 ? 5.821   6.908   -7.476  1.00 0.41 ? 148 LEU A C    2  
ATOM 3425  O O    . LEU A 1 148 ? 6.374   7.670   -6.684  1.00 0.44 ? 148 LEU A O    2  
ATOM 3426  C CB   . LEU A 1 148 ? 3.582   6.015   -6.745  1.00 0.50 ? 148 LEU A CB   2  
ATOM 3427  C CG   . LEU A 1 148 ? 2.153   6.393   -6.328  1.00 0.59 ? 148 LEU A CG   2  
ATOM 3428  C CD1  . LEU A 1 148 ? 2.098   7.813   -5.780  1.00 0.81 ? 148 LEU A CD1  2  
ATOM 3429  C CD2  . LEU A 1 148 ? 1.171   6.209   -7.475  1.00 0.74 ? 148 LEU A CD2  2  
ATOM 3430  H H    . LEU A 1 148 ? 3.211   6.105   -9.269  1.00 0.51 ? 148 LEU A H    2  
ATOM 3431  N N    . LEU A 1 149 ? 6.480   5.997   -8.184  1.00 0.37 ? 149 LEU A N    2  
ATOM 3432  C CA   . LEU A 1 149 ? 7.927   5.818   -8.067  1.00 0.35 ? 149 LEU A CA   2  
ATOM 3433  C C    . LEU A 1 149 ? 8.688   7.134   -8.258  1.00 0.38 ? 149 LEU A C    2  
ATOM 3434  O O    . LEU A 1 149 ? 9.579   7.464   -7.471  1.00 0.39 ? 149 LEU A O    2  
ATOM 3435  C CB   . LEU A 1 149 ? 8.416   4.767   -9.068  1.00 0.39 ? 149 LEU A CB   2  
ATOM 3436  C CG   . LEU A 1 149 ? 9.888   4.362   -8.960  1.00 0.46 ? 149 LEU A CG   2  
ATOM 3437  C CD1  . LEU A 1 149 ? 10.140  3.575   -7.683  1.00 0.52 ? 149 LEU A CD1  2  
ATOM 3438  C CD2  . LEU A 1 149 ? 10.311  3.562   -10.182 1.00 0.57 ? 149 LEU A CD2  2  
ATOM 3439  H H    . LEU A 1 149 ? 5.976   5.416   -8.798  1.00 0.37 ? 149 LEU A H    2  
ATOM 3440  N N    . GLY A 1 150 ? 8.315   7.890   -9.288  1.00 0.41 ? 150 GLY A N    2  
ATOM 3441  C CA   . GLY A 1 150 ? 8.976   9.154   -9.561  1.00 0.46 ? 150 GLY A CA   2  
ATOM 3442  C C    . GLY A 1 150 ? 8.808   10.150  -8.432  1.00 0.46 ? 150 GLY A C    2  
ATOM 3443  O O    . GLY A 1 150 ? 9.747   10.868  -8.080  1.00 0.52 ? 150 GLY A O    2  
ATOM 3444  H H    . GLY A 1 150 ? 7.580   7.590   -9.864  1.00 0.43 ? 150 GLY A H    2  
ATOM 3445  N N    . TRP A 1 151 ? 7.619   10.174  -7.848  1.00 0.43 ? 151 TRP A N    2  
ATOM 3446  C CA   . TRP A 1 151 ? 7.319   11.085  -6.752  1.00 0.45 ? 151 TRP A CA   2  
ATOM 3447  C C    . TRP A 1 151 ? 8.119   10.724  -5.501  1.00 0.42 ? 151 TRP A C    2  
ATOM 3448  O O    . TRP A 1 151 ? 8.596   11.601  -4.780  1.00 0.44 ? 151 TRP A O    2  
ATOM 3449  C CB   . TRP A 1 151 ? 5.816   11.081  -6.453  1.00 0.50 ? 151 TRP A CB   2  
ATOM 3450  C CG   . TRP A 1 151 ? 5.389   12.120  -5.463  1.00 0.52 ? 151 TRP A CG   2  
ATOM 3451  C CD1  . TRP A 1 151 ? 5.825   13.412  -5.386  1.00 0.61 ? 151 TRP A CD1  2  
ATOM 3452  C CD2  . TRP A 1 151 ? 4.432   11.958  -4.413  1.00 0.52 ? 151 TRP A CD2  2  
ATOM 3453  N NE1  . TRP A 1 151 ? 5.206   14.060  -4.348  1.00 0.63 ? 151 TRP A NE1  2  
ATOM 3454  C CE2  . TRP A 1 151 ? 4.343   13.189  -3.734  1.00 0.57 ? 151 TRP A CE2  2  
ATOM 3455  C CE3  . TRP A 1 151 ? 3.642   10.886  -3.979  1.00 0.59 ? 151 TRP A CE3  2  
ATOM 3456  C CZ2  . TRP A 1 151 ? 3.493   13.380  -2.647  1.00 0.63 ? 151 TRP A CZ2  2  
ATOM 3457  C CZ3  . TRP A 1 151 ? 2.801   11.080  -2.902  1.00 0.70 ? 151 TRP A CZ3  2  
ATOM 3458  C CH2  . TRP A 1 151 ? 2.733   12.314  -2.248  1.00 0.70 ? 151 TRP A CH2  2  
ATOM 3459  H H    . TRP A 1 151 ? 6.923   9.557   -8.160  1.00 0.43 ? 151 TRP A H    2  
ATOM 3460  H HE1  . TRP A 1 151 ? 5.354   14.997  -4.091  1.00 0.71 ? 151 TRP A HE1  2  
ATOM 3461  N N    . ILE A 1 152 ? 8.275   9.429   -5.254  1.00 0.40 ? 152 ILE A N    2  
ATOM 3462  C CA   . ILE A 1 152 ? 9.019   8.961   -4.089  1.00 0.40 ? 152 ILE A CA   2  
ATOM 3463  C C    . ILE A 1 152 ? 10.513  9.245   -4.244  1.00 0.40 ? 152 ILE A C    2  
ATOM 3464  O O    . ILE A 1 152 ? 11.199  9.585   -3.279  1.00 0.45 ? 152 ILE A O    2  
ATOM 3465  C CB   . ILE A 1 152 ? 8.785   7.458   -3.817  1.00 0.40 ? 152 ILE A CB   2  
ATOM 3466  C CG1  . ILE A 1 152 ? 7.285   7.155   -3.731  1.00 0.46 ? 152 ILE A CG1  2  
ATOM 3467  C CG2  . ILE A 1 152 ? 9.487   7.022   -2.537  1.00 0.42 ? 152 ILE A CG2  2  
ATOM 3468  C CD1  . ILE A 1 152 ? 6.554   7.928   -2.653  1.00 0.51 ? 152 ILE A CD1  2  
ATOM 3469  H H    . ILE A 1 152 ? 7.878   8.771   -5.867  1.00 0.41 ? 152 ILE A H    2  
ATOM 3470  N N    . GLN A 1 153 ? 11.017  9.120   -5.464  1.00 0.41 ? 153 GLN A N    2  
ATOM 3471  C CA   . GLN A 1 153 ? 12.427  9.377   -5.723  1.00 0.46 ? 153 GLN A CA   2  
ATOM 3472  C C    . GLN A 1 153 ? 12.725  10.870  -5.634  1.00 0.50 ? 153 GLN A C    2  
ATOM 3473  O O    . GLN A 1 153 ? 13.783  11.274  -5.148  1.00 0.56 ? 153 GLN A O    2  
ATOM 3474  C CB   . GLN A 1 153 ? 12.847  8.826   -7.085  1.00 0.52 ? 153 GLN A CB   2  
ATOM 3475  C CG   . GLN A 1 153 ? 14.344  8.586   -7.209  1.00 0.73 ? 153 GLN A CG   2  
ATOM 3476  C CD   . GLN A 1 153 ? 14.971  9.345   -8.360  1.00 0.99 ? 153 GLN A CD   2  
ATOM 3477  O OE1  . GLN A 1 153 ? 15.054  8.840   -9.479  1.00 1.17 ? 153 GLN A OE1  2  
ATOM 3478  N NE2  . GLN A 1 153 ? 15.426  10.558  -8.093  1.00 1.42 ? 153 GLN A NE2  2  
ATOM 3479  H H    . GLN A 1 153 ? 10.431  8.843   -6.202  1.00 0.41 ? 153 GLN A H    2  
ATOM 3480  H HE21 . GLN A 1 153 ? 15.337  10.898  -7.176  1.00 1.53 ? 153 GLN A HE21 2  
ATOM 3481  H HE22 . GLN A 1 153 ? 15.834  11.068  -8.824  1.00 1.74 ? 153 GLN A HE22 2  
ATOM 3482  N N    . ASP A 1 154 ? 11.778  11.682  -6.093  1.00 0.52 ? 154 ASP A N    2  
ATOM 3483  C CA   . ASP A 1 154 ? 11.925  13.135  -6.069  1.00 0.61 ? 154 ASP A CA   2  
ATOM 3484  C C    . ASP A 1 154 ? 12.093  13.660  -4.647  1.00 0.59 ? 154 ASP A C    2  
ATOM 3485  O O    . ASP A 1 154 ? 12.923  14.534  -4.390  1.00 0.65 ? 154 ASP A O    2  
ATOM 3486  C CB   . ASP A 1 154 ? 10.716  13.798  -6.735  1.00 0.72 ? 154 ASP A CB   2  
ATOM 3487  C CG   . ASP A 1 154 ? 10.770  15.313  -6.687  1.00 0.79 ? 154 ASP A CG   2  
ATOM 3488  O OD1  . ASP A 1 154 ? 11.608  15.906  -7.396  1.00 1.00 ? 154 ASP A OD1  2  
ATOM 3489  O OD2  . ASP A 1 154 ? 9.966   15.921  -5.947  1.00 1.08 ? 154 ASP A OD2  2  
ATOM 3490  H H    . ASP A 1 154 ? 10.959  11.293  -6.472  1.00 0.52 ? 154 ASP A H    2  
ATOM 3491  N N    . GLN A 1 155 ? 11.315  13.110  -3.719  1.00 0.54 ? 155 GLN A N    2  
ATOM 3492  C CA   . GLN A 1 155 ? 11.378  13.536  -2.324  1.00 0.56 ? 155 GLN A CA   2  
ATOM 3493  C C    . GLN A 1 155 ? 12.611  12.982  -1.601  1.00 0.54 ? 155 GLN A C    2  
ATOM 3494  O O    . GLN A 1 155 ? 12.942  13.419  -0.498  1.00 0.65 ? 155 GLN A O    2  
ATOM 3495  C CB   . GLN A 1 155 ? 10.088  13.188  -1.575  1.00 0.58 ? 155 GLN A CB   2  
ATOM 3496  C CG   . GLN A 1 155 ? 9.674   11.733  -1.687  1.00 0.52 ? 155 GLN A CG   2  
ATOM 3497  C CD   . GLN A 1 155 ? 8.288   11.473  -1.141  1.00 0.58 ? 155 GLN A CD   2  
ATOM 3498  O OE1  . GLN A 1 155 ? 8.122   11.170  0.041   1.00 0.70 ? 155 GLN A OE1  2  
ATOM 3499  N NE2  . GLN A 1 155 ? 7.283   11.584  -1.999  1.00 0.56 ? 155 GLN A NE2  2  
ATOM 3500  H H    . GLN A 1 155 ? 10.679  12.407  -3.979  1.00 0.52 ? 155 GLN A H    2  
ATOM 3501  H HE21 . GLN A 1 155 ? 7.493   11.823  -2.930  1.00 0.53 ? 155 GLN A HE21 2  
ATOM 3502  H HE22 . GLN A 1 155 ? 6.374   11.428  -1.671  1.00 0.63 ? 155 GLN A HE22 2  
ATOM 3503  N N    . GLY A 1 156 ? 13.286  12.022  -2.225  1.00 0.51 ? 156 GLY A N    2  
ATOM 3504  C CA   . GLY A 1 156 ? 14.481  11.451  -1.630  1.00 0.53 ? 156 GLY A CA   2  
ATOM 3505  C C    . GLY A 1 156 ? 14.214  10.204  -0.812  1.00 0.51 ? 156 GLY A C    2  
ATOM 3506  O O    . GLY A 1 156 ? 14.951  9.906   0.133   1.00 0.67 ? 156 GLY A O    2  
ATOM 3507  H H    . GLY A 1 156 ? 12.973  11.704  -3.099  1.00 0.56 ? 156 GLY A H    2  
ATOM 3508  N N    . GLY A 1 157 ? 13.167  9.473   -1.164  1.00 0.51 ? 157 GLY A N    2  
ATOM 3509  C CA   . GLY A 1 157 ? 12.841  8.260   -0.445  1.00 0.53 ? 157 GLY A CA   2  
ATOM 3510  C C    . GLY A 1 157 ? 11.485  8.339   0.219   1.00 0.47 ? 157 GLY A C    2  
ATOM 3511  O O    . GLY A 1 157 ? 10.681  9.211   -0.102  1.00 0.49 ? 157 GLY A O    2  
ATOM 3512  H H    . GLY A 1 157 ? 12.598  9.762   -1.912  1.00 0.62 ? 157 GLY A H    2  
ATOM 3513  N N    . TRP A 1 158 ? 11.235  7.447   1.165   1.00 0.48 ? 158 TRP A N    2  
ATOM 3514  C CA   . TRP A 1 158 ? 9.963   7.413   1.875   1.00 0.45 ? 158 TRP A CA   2  
ATOM 3515  C C    . TRP A 1 158 ? 9.964   8.391   3.049   1.00 0.51 ? 158 TRP A C    2  
ATOM 3516  O O    . TRP A 1 158 ? 9.155   8.279   3.974   1.00 0.53 ? 158 TRP A O    2  
ATOM 3517  C CB   . TRP A 1 158 ? 9.654   5.989   2.356   1.00 0.48 ? 158 TRP A CB   2  
ATOM 3518  C CG   . TRP A 1 158 ? 9.558   4.995   1.238   1.00 0.48 ? 158 TRP A CG   2  
ATOM 3519  C CD1  . TRP A 1 158 ? 10.556  4.190   0.769   1.00 0.53 ? 158 TRP A CD1  2  
ATOM 3520  C CD2  . TRP A 1 158 ? 8.403   4.707   0.440   1.00 0.49 ? 158 TRP A CD2  2  
ATOM 3521  N NE1  . TRP A 1 158 ? 10.096  3.423   -0.275  1.00 0.57 ? 158 TRP A NE1  2  
ATOM 3522  C CE2  . TRP A 1 158 ? 8.776   3.720   -0.494  1.00 0.54 ? 158 TRP A CE2  2  
ATOM 3523  C CE3  . TRP A 1 158 ? 7.089   5.188   0.423   1.00 0.51 ? 158 TRP A CE3  2  
ATOM 3524  C CZ2  . TRP A 1 158 ? 7.883   3.205   -1.431  1.00 0.60 ? 158 TRP A CZ2  2  
ATOM 3525  C CZ3  . TRP A 1 158 ? 6.206   4.675   -0.507  1.00 0.56 ? 158 TRP A CZ3  2  
ATOM 3526  C CH2  . TRP A 1 158 ? 6.607   3.696   -1.422  1.00 0.60 ? 158 TRP A CH2  2  
ATOM 3527  H H    . TRP A 1 158 ? 11.927  6.792   1.396   1.00 0.54 ? 158 TRP A H    2  
ATOM 3528  H HE1  . TRP A 1 158 ? 10.625  2.770   -0.777  1.00 0.64 ? 158 TRP A HE1  2  
ATOM 3529  N N    . ASP A 1 159 ? 10.871  9.363   2.989   1.00 0.57 ? 159 ASP A N    2  
ATOM 3530  C CA   . ASP A 1 159 ? 11.003  10.374  4.033   1.00 0.65 ? 159 ASP A CA   2  
ATOM 3531  C C    . ASP A 1 159 ? 9.716   11.182  4.172   1.00 0.59 ? 159 ASP A C    2  
ATOM 3532  O O    . ASP A 1 159 ? 9.325   11.560  5.277   1.00 0.61 ? 159 ASP A O    2  
ATOM 3533  C CB   . ASP A 1 159 ? 12.183  11.303  3.724   1.00 0.77 ? 159 ASP A CB   2  
ATOM 3534  C CG   . ASP A 1 159 ? 12.257  12.503  4.648   1.00 0.97 ? 159 ASP A CG   2  
ATOM 3535  O OD1  . ASP A 1 159 ? 12.894  12.400  5.717   1.00 1.17 ? 159 ASP A OD1  2  
ATOM 3536  O OD2  . ASP A 1 159 ? 11.692  13.559  4.307   1.00 1.15 ? 159 ASP A OD2  2  
ATOM 3537  H H    . ASP A 1 159 ? 11.466  9.403   2.213   1.00 0.59 ? 159 ASP A H    2  
ATOM 3538  N N    . GLY A 1 160 ? 9.054   11.421  3.042   1.00 0.55 ? 160 GLY A N    2  
ATOM 3539  C CA   . GLY A 1 160 ? 7.813   12.174  3.046   1.00 0.52 ? 160 GLY A CA   2  
ATOM 3540  C C    . GLY A 1 160 ? 6.723   11.478  3.835   1.00 0.47 ? 160 GLY A C    2  
ATOM 3541  O O    . GLY A 1 160 ? 5.932   12.126  4.518   1.00 0.49 ? 160 GLY A O    2  
ATOM 3542  H H    . GLY A 1 160 ? 9.413   11.083  2.195   1.00 0.55 ? 160 GLY A H    2  
ATOM 3543  N N    . LEU A 1 161 ? 6.692   10.155  3.757   1.00 0.46 ? 161 LEU A N    2  
ATOM 3544  C CA   . LEU A 1 161 ? 5.695   9.375   4.474   1.00 0.47 ? 161 LEU A CA   2  
ATOM 3545  C C    . LEU A 1 161 ? 5.977   9.408   5.973   1.00 0.52 ? 161 LEU A C    2  
ATOM 3546  O O    . LEU A 1 161 ? 5.062   9.522   6.787   1.00 0.55 ? 161 LEU A O    2  
ATOM 3547  C CB   . LEU A 1 161 ? 5.680   7.934   3.960   1.00 0.51 ? 161 LEU A CB   2  
ATOM 3548  C CG   . LEU A 1 161 ? 4.560   7.038   4.489   1.00 0.60 ? 161 LEU A CG   2  
ATOM 3549  C CD1  . LEU A 1 161 ? 3.199   7.654   4.209   1.00 0.62 ? 161 LEU A CD1  2  
ATOM 3550  C CD2  . LEU A 1 161 ? 4.657   5.649   3.877   1.00 0.67 ? 161 LEU A CD2  2  
ATOM 3551  H H    . LEU A 1 161 ? 7.361   9.693   3.209   1.00 0.47 ? 161 LEU A H    2  
ATOM 3552  N N    . LEU A 1 162 ? 7.257   9.321   6.322   1.00 0.56 ? 162 LEU A N    2  
ATOM 3553  C CA   . LEU A 1 162 ? 7.680   9.352   7.717   1.00 0.64 ? 162 LEU A CA   2  
ATOM 3554  C C    . LEU A 1 162 ? 7.375   10.711  8.340   1.00 0.64 ? 162 LEU A C    2  
ATOM 3555  O O    . LEU A 1 162 ? 6.947   10.799  9.491   1.00 0.72 ? 162 LEU A O    2  
ATOM 3556  C CB   . LEU A 1 162 ? 9.180   9.064   7.824   1.00 0.71 ? 162 LEU A CB   2  
ATOM 3557  C CG   . LEU A 1 162 ? 9.597   7.595   7.738   1.00 0.81 ? 162 LEU A CG   2  
ATOM 3558  C CD1  . LEU A 1 162 ? 11.069  7.478   7.375   1.00 0.90 ? 162 LEU A CD1  2  
ATOM 3559  C CD2  . LEU A 1 162 ? 9.312   6.881   9.052   1.00 0.87 ? 162 LEU A CD2  2  
ATOM 3560  H H    . LEU A 1 162 ? 7.934   9.226   5.619   1.00 0.56 ? 162 LEU A H    2  
ATOM 3561  N N    . SER A 1 163 ? 7.595   11.766  7.570   1.00 0.59 ? 163 SER A N    2  
ATOM 3562  C CA   . SER A 1 163 ? 7.352   13.121  8.038   1.00 0.62 ? 163 SER A CA   2  
ATOM 3563  C C    . SER A 1 163 ? 5.863   13.466  8.051   1.00 0.60 ? 163 SER A C    2  
ATOM 3564  O O    . SER A 1 163 ? 5.437   14.376  8.761   1.00 0.67 ? 163 SER A O    2  
ATOM 3565  C CB   . SER A 1 163 ? 8.125   14.117  7.179   1.00 0.65 ? 163 SER A CB   2  
ATOM 3566  O OG   . SER A 1 163 ? 9.497   13.754  7.101   1.00 0.69 ? 163 SER A OG   2  
ATOM 3567  H H    . SER A 1 163 ? 7.942   11.631  6.661   1.00 0.58 ? 163 SER A H    2  
ATOM 3568  H HG   . SER A 1 163 ? 9.721   13.558  6.181   1.00 0.78 ? 163 SER A HG   2  
ATOM 3569  N N    . TYR A 1 164 ? 5.070   12.733  7.276   1.00 0.57 ? 164 TYR A N    2  
ATOM 3570  C CA   . TYR A 1 164 ? 3.637   12.979  7.214   1.00 0.57 ? 164 TYR A CA   2  
ATOM 3571  C C    . TYR A 1 164 ? 2.951   12.511  8.491   1.00 0.56 ? 164 TYR A C    2  
ATOM 3572  O O    . TYR A 1 164 ? 1.907   13.042  8.880   1.00 0.58 ? 164 TYR A O    2  
ATOM 3573  C CB   . TYR A 1 164 ? 3.018   12.292  5.994   1.00 0.57 ? 164 TYR A CB   2  
ATOM 3574  C CG   . TYR A 1 164 ? 1.646   12.810  5.629   1.00 0.65 ? 164 TYR A CG   2  
ATOM 3575  C CD1  . TYR A 1 164 ? 1.464   14.133  5.249   1.00 0.72 ? 164 TYR A CD1  2  
ATOM 3576  C CD2  . TYR A 1 164 ? 0.534   11.978  5.655   1.00 0.73 ? 164 TYR A CD2  2  
ATOM 3577  C CE1  . TYR A 1 164 ? 0.215   14.615  4.909   1.00 0.84 ? 164 TYR A CE1  2  
ATOM 3578  C CE2  . TYR A 1 164 ? -0.722  12.452  5.318   1.00 0.83 ? 164 TYR A CE2  2  
ATOM 3579  C CZ   . TYR A 1 164 ? -0.875  13.771  4.943   1.00 0.86 ? 164 TYR A CZ   2  
ATOM 3580  O OH   . TYR A 1 164 ? -2.120  14.249  4.595   1.00 0.99 ? 164 TYR A OH   2  
ATOM 3581  H H    . TYR A 1 164 ? 5.459   12.019  6.729   1.00 0.59 ? 164 TYR A H    2  
ATOM 3582  H HH   . TYR A 1 164 ? -2.076  14.630  3.708   1.00 0.96 ? 164 TYR A HH   2  
ATOM 3583  N N    . PHE A 1 165 ? 3.541   11.515  9.138   1.00 0.56 ? 165 PHE A N    2  
ATOM 3584  C CA   . PHE A 1 165 ? 2.992   10.973  10.374  1.00 0.58 ? 165 PHE A CA   2  
ATOM 3585  C C    . PHE A 1 165 ? 3.082   11.995  11.501  1.00 0.61 ? 165 PHE A C    2  
ATOM 3586  O O    . PHE A 1 165 ? 4.158   12.251  12.037  1.00 0.69 ? 165 PHE A O    2  
ATOM 3587  C CB   . PHE A 1 165 ? 3.704   9.674   10.776  1.00 0.63 ? 165 PHE A CB   2  
ATOM 3588  C CG   . PHE A 1 165 ? 3.236   9.099   12.086  1.00 0.63 ? 165 PHE A CG   2  
ATOM 3589  C CD1  . PHE A 1 165 ? 1.929   8.665   12.242  1.00 0.62 ? 165 PHE A CD1  2  
ATOM 3590  C CD2  . PHE A 1 165 ? 4.104   8.997   13.162  1.00 0.72 ? 165 PHE A CD2  2  
ATOM 3591  C CE1  . PHE A 1 165 ? 1.497   8.138   13.442  1.00 0.65 ? 165 PHE A CE1  2  
ATOM 3592  C CE2  . PHE A 1 165 ? 3.678   8.472   14.367  1.00 0.74 ? 165 PHE A CE2  2  
ATOM 3593  C CZ   . PHE A 1 165 ? 2.371   8.043   14.508  1.00 0.67 ? 165 PHE A CZ   2  
ATOM 3594  H H    . PHE A 1 165 ? 4.370   11.137  8.776   1.00 0.59 ? 165 PHE A H    2  
ATOM 3595  N N    . GLY A 1 166 ? 1.950   12.583  11.843  1.00 0.63 ? 166 GLY A N    2  
ATOM 3596  C CA   . GLY A 1 166 ? 1.919   13.563  12.905  1.00 0.70 ? 166 GLY A CA   2  
ATOM 3597  C C    . GLY A 1 166 ? 1.273   13.012  14.158  1.00 0.73 ? 166 GLY A C    2  
ATOM 3598  O O    . GLY A 1 166 ? 1.239   11.798  14.365  1.00 1.05 ? 166 GLY A O    2  
ATOM 3599  H H    . GLY A 1 166 ? 1.124   12.348  11.373  1.00 0.67 ? 166 GLY A H    2  
ATOM 3600  N N    . THR A 1 167 ? 0.760   13.896  14.995  1.00 0.65 ? 167 THR A N    2  
ATOM 3601  C CA   . THR A 1 167 ? 0.109   13.489  16.235  1.00 0.67 ? 167 THR A CA   2  
ATOM 3602  C C    . THR A 1 167 ? -1.020  14.453  16.629  1.00 0.66 ? 167 THR A C    2  
ATOM 3603  O O    . THR A 1 167 ? -2.165  14.029  16.795  1.00 0.68 ? 167 THR A O    2  
ATOM 3604  C CB   . THR A 1 167 ? 1.111   13.309  17.399  1.00 0.74 ? 167 THR A CB   2  
ATOM 3605  O OG1  . THR A 1 167 ? 2.223   12.511  16.959  1.00 0.89 ? 167 THR A OG1  2  
ATOM 3606  C CG2  . THR A 1 167 ? 0.440   12.620  18.578  1.00 0.86 ? 167 THR A CG2  2  
ATOM 3607  H H    . THR A 1 167 ? 0.804   14.851  14.769  1.00 0.77 ? 167 THR A H    2  
ATOM 3608  H HG1  . THR A 1 167 ? 2.008   12.109  16.104  1.00 1.05 ? 167 THR A HG1  2  
ATOM 3609  N N    . PRO A 1 168 ? -0.732  15.763  16.793  1.00 0.68 ? 168 PRO A N    2  
ATOM 3610  C CA   . PRO A 1 168 ? -1.757  16.743  17.154  1.00 0.71 ? 168 PRO A CA   2  
ATOM 3611  C C    . PRO A 1 168 ? -2.703  17.004  15.989  1.00 0.67 ? 168 PRO A C    2  
ATOM 3612  O O    . PRO A 1 168 ? -2.285  16.992  14.827  1.00 0.70 ? 168 PRO A O    2  
ATOM 3613  C CB   . PRO A 1 168 ? -0.962  18.018  17.477  1.00 0.77 ? 168 PRO A CB   2  
ATOM 3614  C CG   . PRO A 1 168 ? 0.465   17.593  17.551  1.00 0.81 ? 168 PRO A CG   2  
ATOM 3615  C CD   . PRO A 1 168 ? 0.588   16.396  16.658  1.00 0.70 ? 168 PRO A CD   2  
ATOM 3616  N N    . THR A 1 169 ? -3.973  17.240  16.308  1.00 0.68 ? 169 THR A N    2  
ATOM 3617  C CA   . THR A 1 169 ? -4.998  17.509  15.299  1.00 0.71 ? 169 THR A CA   2  
ATOM 3618  C C    . THR A 1 169 ? -5.187  16.305  14.368  1.00 0.61 ? 169 THR A C    2  
ATOM 3619  O O    . THR A 1 169 ? -5.553  16.454  13.201  1.00 0.62 ? 169 THR A O    2  
ATOM 3620  C CB   . THR A 1 169 ? -4.670  18.772  14.475  1.00 0.85 ? 169 THR A CB   2  
ATOM 3621  O OG1  . THR A 1 169 ? -3.935  19.698  15.288  1.00 1.01 ? 169 THR A OG1  2  
ATOM 3622  C CG2  . THR A 1 169 ? -5.948  19.448  14.005  1.00 1.02 ? 169 THR A CG2  2  
ATOM 3623  H H    . THR A 1 169 ? -4.232  17.238  17.255  1.00 0.72 ? 169 THR A H    2  
ATOM 3624  H HG1  . THR A 1 169 ? -3.626  19.248  16.084  1.00 1.43 ? 169 THR A HG1  2  
ATOM 3625  N N    . TRP A 1 170 ? -4.952  15.112  14.906  1.00 0.58 ? 170 TRP A N    2  
ATOM 3626  C CA   . TRP A 1 170 ? -5.083  13.878  14.137  1.00 0.54 ? 170 TRP A CA   2  
ATOM 3627  C C    . TRP A 1 170 ? -6.519  13.650  13.669  1.00 0.52 ? 170 TRP A C    2  
ATOM 3628  O O    . TRP A 1 170 ? -6.748  13.032  12.629  1.00 0.49 ? 170 TRP A O    2  
ATOM 3629  C CB   . TRP A 1 170 ? -4.553  12.669  14.928  1.00 0.59 ? 170 TRP A CB   2  
ATOM 3630  C CG   . TRP A 1 170 ? -5.484  12.132  15.980  1.00 0.72 ? 170 TRP A CG   2  
ATOM 3631  C CD1  . TRP A 1 170 ? -6.170  10.951  15.936  1.00 0.94 ? 170 TRP A CD1  2  
ATOM 3632  C CD2  . TRP A 1 170 ? -5.826  12.743  17.233  1.00 0.83 ? 170 TRP A CD2  2  
ATOM 3633  N NE1  . TRP A 1 170 ? -6.918  10.793  17.077  1.00 1.08 ? 170 TRP A NE1  2  
ATOM 3634  C CE2  . TRP A 1 170 ? -6.725  11.877  17.889  1.00 1.03 ? 170 TRP A CE2  2  
ATOM 3635  C CE3  . TRP A 1 170 ? -5.461  13.937  17.863  1.00 0.95 ? 170 TRP A CE3  2  
ATOM 3636  C CZ2  . TRP A 1 170 ? -7.261  12.168  19.141  1.00 1.25 ? 170 TRP A CZ2  2  
ATOM 3637  C CZ3  . TRP A 1 170 ? -5.994  14.221  19.103  1.00 1.22 ? 170 TRP A CZ3  2  
ATOM 3638  C CH2  . TRP A 1 170 ? -6.884  13.343  19.731  1.00 1.33 ? 170 TRP A CH2  2  
ATOM 3639  H H    . TRP A 1 170 ? -4.668  15.061  15.841  1.00 0.63 ? 170 TRP A H    2  
ATOM 3640  H HE1  . TRP A 1 170 ? -7.498  10.026  17.278  1.00 1.27 ? 170 TRP A HE1  2  
ATOM 3641  N N    . GLN A 1 171 ? -7.475  14.169  14.434  1.00 0.55 ? 171 GLN A N    2  
ATOM 3642  C CA   . GLN A 1 171 ? -8.889  14.035  14.102  1.00 0.58 ? 171 GLN A CA   2  
ATOM 3643  C C    . GLN A 1 171 ? -9.173  14.591  12.710  1.00 0.54 ? 171 GLN A C    2  
ATOM 3644  O O    . GLN A 1 171 ? -9.863  13.961  11.907  1.00 0.51 ? 171 GLN A O    2  
ATOM 3645  C CB   . GLN A 1 171 ? -9.745  14.767  15.137  1.00 0.65 ? 171 GLN A CB   2  
ATOM 3646  C CG   . GLN A 1 171 ? -11.227 14.804  14.798  1.00 0.82 ? 171 GLN A CG   2  
ATOM 3647  C CD   . GLN A 1 171 ? -11.878 16.108  15.195  1.00 1.09 ? 171 GLN A CD   2  
ATOM 3648  O OE1  . GLN A 1 171 ? -11.877 17.073  14.428  1.00 1.33 ? 171 GLN A OE1  2  
ATOM 3649  N NE2  . GLN A 1 171 ? -12.433 16.153  16.393  1.00 1.37 ? 171 GLN A NE2  2  
ATOM 3650  H H    . GLN A 1 171 ? -7.223  14.646  15.251  1.00 0.59 ? 171 GLN A H    2  
ATOM 3651  H HE21 . GLN A 1 171 ? -12.392 15.348  16.959  1.00 1.45 ? 171 GLN A HE21 2  
ATOM 3652  H HE22 . GLN A 1 171 ? -12.865 16.987  16.670  1.00 1.64 ? 171 GLN A HE22 2  
ATOM 3653  N N    . THR A 1 172 ? -8.622  15.764  12.428  1.00 0.56 ? 172 THR A N    2  
ATOM 3654  C CA   . THR A 1 172 ? -8.808  16.408  11.136  1.00 0.56 ? 172 THR A CA   2  
ATOM 3655  C C    . THR A 1 172 ? -8.263  15.524  10.015  1.00 0.52 ? 172 THR A C    2  
ATOM 3656  O O    . THR A 1 172 ? -8.831  15.464  8.925   1.00 0.52 ? 172 THR A O    2  
ATOM 3657  C CB   . THR A 1 172 ? -8.108  17.780  11.110  1.00 0.62 ? 172 THR A CB   2  
ATOM 3658  O OG1  . THR A 1 172 ? -8.511  18.530  12.265  1.00 0.72 ? 172 THR A OG1  2  
ATOM 3659  C CG2  . THR A 1 172 ? -8.483  18.557  9.857   1.00 0.75 ? 172 THR A CG2  2  
ATOM 3660  H H    . THR A 1 172 ? -8.072  16.209  13.107  1.00 0.59 ? 172 THR A H    2  
ATOM 3661  H HG1  . THR A 1 172 ? -8.321  19.469  12.119  1.00 1.20 ? 172 THR A HG1  2  
ATOM 3662  N N    . VAL A 1 173 ? -7.178  14.812  10.307  1.00 0.53 ? 173 VAL A N    2  
ATOM 3663  C CA   . VAL A 1 173 ? -6.556  13.921  9.337   1.00 0.52 ? 173 VAL A CA   2  
ATOM 3664  C C    . VAL A 1 173 ? -7.469  12.725  9.071   1.00 0.49 ? 173 VAL A C    2  
ATOM 3665  O O    . VAL A 1 173 ? -7.663  12.324  7.925   1.00 0.47 ? 173 VAL A O    2  
ATOM 3666  C CB   . VAL A 1 173 ? -5.171  13.423  9.818   1.00 0.56 ? 173 VAL A CB   2  
ATOM 3667  C CG1  . VAL A 1 173 ? -4.460  12.650  8.716   1.00 0.57 ? 173 VAL A CG1  2  
ATOM 3668  C CG2  . VAL A 1 173 ? -4.311  14.588  10.288  1.00 0.60 ? 173 VAL A CG2  2  
ATOM 3669  H H    . VAL A 1 173 ? -6.795  14.878  11.207  1.00 0.57 ? 173 VAL A H    2  
ATOM 3670  N N    . THR A 1 174 ? -8.037  12.171  10.139  1.00 0.49 ? 174 THR A N    2  
ATOM 3671  C CA   . THR A 1 174 ? -8.941  11.029  10.025  1.00 0.48 ? 174 THR A CA   2  
ATOM 3672  C C    . THR A 1 174 ? -10.146 11.392  9.159   1.00 0.47 ? 174 THR A C    2  
ATOM 3673  O O    . THR A 1 174 ? -10.519 10.646  8.249   1.00 0.47 ? 174 THR A O    2  
ATOM 3674  C CB   . THR A 1 174 ? -9.425  10.570  11.417  1.00 0.50 ? 174 THR A CB   2  
ATOM 3675  O OG1  . THR A 1 174 ? -8.328  10.632  12.339  1.00 0.58 ? 174 THR A OG1  2  
ATOM 3676  C CG2  . THR A 1 174 ? -9.949  9.142   11.367  1.00 0.54 ? 174 THR A CG2  2  
ATOM 3677  H H    . THR A 1 174 ? -7.841  12.538  11.032  1.00 0.52 ? 174 THR A H    2  
ATOM 3678  H HG1  . THR A 1 174 ? -7.641  10.023  12.057  1.00 1.09 ? 174 THR A HG1  2  
ATOM 3679  N N    . ILE A 1 175 ? -10.734 12.557  9.430   1.00 0.48 ? 175 ILE A N    2  
ATOM 3680  C CA   . ILE A 1 175 ? -11.890 13.030  8.674   1.00 0.49 ? 175 ILE A CA   2  
ATOM 3681  C C    . ILE A 1 175 ? -11.505 13.274  7.217   1.00 0.46 ? 175 ILE A C    2  
ATOM 3682  O O    . ILE A 1 175 ? -12.270 12.967  6.302   1.00 0.45 ? 175 ILE A O    2  
ATOM 3683  C CB   . ILE A 1 175 ? -12.480 14.325  9.280   1.00 0.54 ? 175 ILE A CB   2  
ATOM 3684  C CG1  . ILE A 1 175 ? -12.868 14.101  10.745  1.00 0.57 ? 175 ILE A CG1  2  
ATOM 3685  C CG2  . ILE A 1 175 ? -13.686 14.799  8.476   1.00 0.59 ? 175 ILE A CG2  2  
ATOM 3686  C CD1  . ILE A 1 175 ? -13.298 15.359  11.469  1.00 0.64 ? 175 ILE A CD1  2  
ATOM 3687  H H    . ILE A 1 175 ? -10.381 13.110  10.162  1.00 0.49 ? 175 ILE A H    2  
ATOM 3688  N N    . PHE A 1 176 ? -10.304 13.807  7.011   1.00 0.45 ? 176 PHE A N    2  
ATOM 3689  C CA   . PHE A 1 176 ? -9.804  14.085  5.671   1.00 0.43 ? 176 PHE A CA   2  
ATOM 3690  C C    . PHE A 1 176 ? -9.712  12.802  4.848   1.00 0.40 ? 176 PHE A C    2  
ATOM 3691  O O    . PHE A 1 176 ? -10.269 12.718  3.753   1.00 0.40 ? 176 PHE A O    2  
ATOM 3692  C CB   . PHE A 1 176 ? -8.439  14.781  5.740   1.00 0.45 ? 176 PHE A CB   2  
ATOM 3693  C CG   . PHE A 1 176 ? -7.785  14.996  4.405   1.00 0.49 ? 176 PHE A CG   2  
ATOM 3694  C CD1  . PHE A 1 176 ? -8.397  15.771  3.435   1.00 0.54 ? 176 PHE A CD1  2  
ATOM 3695  C CD2  . PHE A 1 176 ? -6.553  14.427  4.125   1.00 0.53 ? 176 PHE A CD2  2  
ATOM 3696  C CE1  . PHE A 1 176 ? -7.795  15.975  2.211   1.00 0.62 ? 176 PHE A CE1  2  
ATOM 3697  C CE2  . PHE A 1 176 ? -5.945  14.627  2.902   1.00 0.60 ? 176 PHE A CE2  2  
ATOM 3698  C CZ   . PHE A 1 176 ? -6.567  15.402  1.944   1.00 0.64 ? 176 PHE A CZ   2  
ATOM 3699  H H    . PHE A 1 176 ? -9.739  14.022  7.784   1.00 0.46 ? 176 PHE A H    2  
ATOM 3700  N N    . VAL A 1 177 ? -9.025  11.801  5.393   1.00 0.40 ? 177 VAL A N    2  
ATOM 3701  C CA   . VAL A 1 177 ? -8.852  10.519  4.713   1.00 0.38 ? 177 VAL A CA   2  
ATOM 3702  C C    . VAL A 1 177 ? -10.202 9.862   4.427   1.00 0.38 ? 177 VAL A C    2  
ATOM 3703  O O    . VAL A 1 177 ? -10.459 9.412   3.308   1.00 0.38 ? 177 VAL A O    2  
ATOM 3704  C CB   . VAL A 1 177 ? -7.963  9.557   5.529   1.00 0.40 ? 177 VAL A CB   2  
ATOM 3705  C CG1  . VAL A 1 177 ? -7.821  8.219   4.818   1.00 0.41 ? 177 VAL A CG1  2  
ATOM 3706  C CG2  . VAL A 1 177 ? -6.592  10.173  5.770   1.00 0.42 ? 177 VAL A CG2  2  
ATOM 3707  H H    . VAL A 1 177 ? -8.620  11.930  6.280   1.00 0.41 ? 177 VAL A H    2  
ATOM 3708  N N    . ALA A 1 178 ? -11.067 9.828   5.439   1.00 0.40 ? 178 ALA A N    2  
ATOM 3709  C CA   . ALA A 1 178 ? -12.390 9.236   5.298   1.00 0.41 ? 178 ALA A CA   2  
ATOM 3710  C C    . ALA A 1 178 ? -13.206 9.988   4.253   1.00 0.40 ? 178 ALA A C    2  
ATOM 3711  O O    . ALA A 1 178 ? -13.912 9.381   3.443   1.00 0.40 ? 178 ALA A O    2  
ATOM 3712  C CB   . ALA A 1 178 ? -13.114 9.218   6.638   1.00 0.44 ? 178 ALA A CB   2  
ATOM 3713  H H    . ALA A 1 178 ? -10.804 10.213  6.306   1.00 0.41 ? 178 ALA A H    2  
ATOM 3714  N N    . GLY A 1 179 ? -13.092 11.313  4.269   1.00 0.41 ? 179 GLY A N    2  
ATOM 3715  C CA   . GLY A 1 179 ? -13.810 12.141  3.320   1.00 0.42 ? 179 GLY A CA   2  
ATOM 3716  C C    . GLY A 1 179 ? -13.444 11.819  1.885   1.00 0.39 ? 179 GLY A C    2  
ATOM 3717  O O    . GLY A 1 179 ? -14.322 11.704  1.027   1.00 0.39 ? 179 GLY A O    2  
ATOM 3718  H H    . GLY A 1 179 ? -12.513 11.736  4.944   1.00 0.42 ? 179 GLY A H    2  
ATOM 3719  N N    . VAL A 1 180 ? -12.148 11.661  1.630   1.00 0.37 ? 180 VAL A N    2  
ATOM 3720  C CA   . VAL A 1 180 ? -11.658 11.338  0.293   1.00 0.35 ? 180 VAL A CA   2  
ATOM 3721  C C    . VAL A 1 180 ? -12.257 10.017  -0.190  1.00 0.33 ? 180 VAL A C    2  
ATOM 3722  O O    . VAL A 1 180 ? -12.811 9.939   -1.289  1.00 0.33 ? 180 VAL A O    2  
ATOM 3723  C CB   . VAL A 1 180 ? -10.113 11.247  0.260   1.00 0.36 ? 180 VAL A CB   2  
ATOM 3724  C CG1  . VAL A 1 180 ? -9.616  10.828  -1.118  1.00 0.36 ? 180 VAL A CG1  2  
ATOM 3725  C CG2  . VAL A 1 180 ? -9.494  12.576  0.663   1.00 0.39 ? 180 VAL A CG2  2  
ATOM 3726  H H    . VAL A 1 180 ? -11.501 11.770  2.362   1.00 0.38 ? 180 VAL A H    2  
ATOM 3727  N N    . LEU A 1 181 ? -12.159 8.991   0.650   1.00 0.33 ? 181 LEU A N    2  
ATOM 3728  C CA   . LEU A 1 181 ? -12.693 7.674   0.320   1.00 0.33 ? 181 LEU A CA   2  
ATOM 3729  C C    . LEU A 1 181 ? -14.195 7.741   0.066   1.00 0.34 ? 181 LEU A C    2  
ATOM 3730  O O    . LEU A 1 181 ? -14.698 7.161   -0.897  1.00 0.33 ? 181 LEU A O    2  
ATOM 3731  C CB   . LEU A 1 181 ? -12.395 6.677   1.440   1.00 0.36 ? 181 LEU A CB   2  
ATOM 3732  C CG   . LEU A 1 181 ? -10.946 6.204   1.551   1.00 0.37 ? 181 LEU A CG   2  
ATOM 3733  C CD1  . LEU A 1 181 ? -10.720 5.494   2.875   1.00 0.39 ? 181 LEU A CD1  2  
ATOM 3734  C CD2  . LEU A 1 181 ? -10.598 5.288   0.388   1.00 0.40 ? 181 LEU A CD2  2  
ATOM 3735  H H    . LEU A 1 181 ? -11.710 9.122   1.514   1.00 0.34 ? 181 LEU A H    2  
ATOM 3736  N N    . THR A 1 182 ? -14.899 8.464   0.927   1.00 0.37 ? 182 THR A N    2  
ATOM 3737  C CA   . THR A 1 182 ? -16.341 8.618   0.801   1.00 0.39 ? 182 THR A CA   2  
ATOM 3738  C C    . THR A 1 182 ? -16.704 9.274   -0.527  1.00 0.38 ? 182 THR A C    2  
ATOM 3739  O O    . THR A 1 182 ? -17.608 8.813   -1.225  1.00 0.38 ? 182 THR A O    2  
ATOM 3740  C CB   . THR A 1 182 ? -16.919 9.441   1.970   1.00 0.45 ? 182 THR A CB   2  
ATOM 3741  O OG1  . THR A 1 182 ? -16.491 8.868   3.211   1.00 0.45 ? 182 THR A OG1  2  
ATOM 3742  C CG2  . THR A 1 182 ? -18.441 9.452   1.925   1.00 0.53 ? 182 THR A CG2  2  
ATOM 3743  H H    . THR A 1 182 ? -14.435 8.907   1.670   1.00 0.39 ? 182 THR A H    2  
ATOM 3744  H HG1  . THR A 1 182 ? -15.554 9.057   3.348   1.00 0.43 ? 182 THR A HG1  2  
ATOM 3745  N N    . ALA A 1 183 ? -15.977 10.327  -0.885  1.00 0.39 ? 183 ALA A N    2  
ATOM 3746  C CA   . ALA A 1 183 ? -16.223 11.045  -2.130  1.00 0.40 ? 183 ALA A CA   2  
ATOM 3747  C C    . ALA A 1 183 ? -16.065 10.124  -3.337  1.00 0.36 ? 183 ALA A C    2  
ATOM 3748  O O    . ALA A 1 183 ? -16.935 10.074  -4.207  1.00 0.36 ? 183 ALA A O    2  
ATOM 3749  C CB   . ALA A 1 183 ? -15.287 12.237  -2.250  1.00 0.45 ? 183 ALA A CB   2  
ATOM 3750  H H    . ALA A 1 183 ? -15.250 10.631  -0.294  1.00 0.40 ? 183 ALA A H    2  
ATOM 3751  N N    . SER A 1 184 ? -14.958 9.389   -3.374  1.00 0.35 ? 184 SER A N    2  
ATOM 3752  C CA   . SER A 1 184 ? -14.683 8.471   -4.473  1.00 0.34 ? 184 SER A CA   2  
ATOM 3753  C C    . SER A 1 184 ? -15.754 7.386   -4.589  1.00 0.32 ? 184 SER A C    2  
ATOM 3754  O O    . SER A 1 184 ? -16.206 7.063   -5.689  1.00 0.33 ? 184 SER A O    2  
ATOM 3755  C CB   . SER A 1 184 ? -13.297 7.847   -4.311  1.00 0.37 ? 184 SER A CB   2  
ATOM 3756  O OG   . SER A 1 184 ? -12.318 8.851   -4.104  1.00 0.40 ? 184 SER A OG   2  
ATOM 3757  H H    . SER A 1 184 ? -14.304 9.470   -2.642  1.00 0.38 ? 184 SER A H    2  
ATOM 3758  H HG   . SER A 1 184 ? -12.584 9.655   -4.555  1.00 0.76 ? 184 SER A HG   2  
ATOM 3759  N N    . LEU A 1 185 ? -16.176 6.839   -3.451  1.00 0.33 ? 185 LEU A N    2  
ATOM 3760  C CA   . LEU A 1 185 ? -17.193 5.793   -3.445  1.00 0.35 ? 185 LEU A CA   2  
ATOM 3761  C C    . LEU A 1 185 ? -18.561 6.335   -3.852  1.00 0.36 ? 185 LEU A C    2  
ATOM 3762  O O    . LEU A 1 185 ? -19.375 5.608   -4.421  1.00 0.37 ? 185 LEU A O    2  
ATOM 3763  C CB   . LEU A 1 185 ? -17.260 5.072   -2.095  1.00 0.40 ? 185 LEU A CB   2  
ATOM 3764  C CG   . LEU A 1 185 ? -16.486 3.751   -2.003  1.00 0.66 ? 185 LEU A CG   2  
ATOM 3765  C CD1  . LEU A 1 185 ? -14.983 3.989   -2.027  1.00 1.01 ? 185 LEU A CD1  2  
ATOM 3766  C CD2  . LEU A 1 185 ? -16.894 2.968   -0.764  1.00 0.77 ? 185 LEU A CD2  2  
ATOM 3767  H H    . LEU A 1 185 ? -15.794 7.143   -2.597  1.00 0.34 ? 185 LEU A H    2  
ATOM 3768  N N    . THR A 1 186 ? -18.802 7.615   -3.572  1.00 0.38 ? 186 THR A N    2  
ATOM 3769  C CA   . THR A 1 186 ? -20.065 8.253   -3.933  1.00 0.41 ? 186 THR A CA   2  
ATOM 3770  C C    . THR A 1 186 ? -20.207 8.277   -5.454  1.00 0.38 ? 186 THR A C    2  
ATOM 3771  O O    . THR A 1 186 ? -21.296 8.086   -5.998  1.00 0.43 ? 186 THR A O    2  
ATOM 3772  C CB   . THR A 1 186 ? -20.141 9.701   -3.399  1.00 0.47 ? 186 THR A CB   2  
ATOM 3773  O OG1  . THR A 1 186 ? -19.927 9.715   -1.982  1.00 0.50 ? 186 THR A OG1  2  
ATOM 3774  C CG2  . THR A 1 186 ? -21.502 10.315  -3.700  1.00 0.54 ? 186 THR A CG2  2  
ATOM 3775  H H    . THR A 1 186 ? -18.116 8.143   -3.109  1.00 0.38 ? 186 THR A H    2  
ATOM 3776  H HG1  . THR A 1 186 ? -19.190 9.129   -1.759  1.00 0.49 ? 186 THR A HG1  2  
ATOM 3777  N N    . ILE A 1 187 ? -19.082 8.490   -6.128  1.00 0.35 ? 187 ILE A N    2  
ATOM 3778  C CA   . ILE A 1 187 ? -19.047 8.539   -7.586  1.00 0.36 ? 187 ILE A CA   2  
ATOM 3779  C C    . ILE A 1 187 ? -19.237 7.140   -8.169  1.00 0.35 ? 187 ILE A C    2  
ATOM 3780  O O    . ILE A 1 187 ? -19.853 6.971   -9.221  1.00 0.45 ? 187 ILE A O    2  
ATOM 3781  C CB   . ILE A 1 187 ? -17.706 9.127   -8.088  1.00 0.38 ? 187 ILE A CB   2  
ATOM 3782  C CG1  . ILE A 1 187 ? -17.460 10.503  -7.460  1.00 0.38 ? 187 ILE A CG1  2  
ATOM 3783  C CG2  . ILE A 1 187 ? -17.688 9.222   -9.607  1.00 0.41 ? 187 ILE A CG2  2  
ATOM 3784  C CD1  . ILE A 1 187 ? -16.079 11.064  -7.726  1.00 0.43 ? 187 ILE A CD1  2  
ATOM 3785  H H    . ILE A 1 187 ? -18.249 8.617   -5.628  1.00 0.36 ? 187 ILE A H    2  
ATOM 3786  N N    . TRP A 1 188 ? -18.714 6.140   -7.469  1.00 0.35 ? 188 TRP A N    2  
ATOM 3787  C CA   . TRP A 1 188 ? -18.822 4.760   -7.917  1.00 0.37 ? 188 TRP A CA   2  
ATOM 3788  C C    . TRP A 1 188 ? -20.240 4.223   -7.762  1.00 0.38 ? 188 TRP A C    2  
ATOM 3789  O O    . TRP A 1 188 ? -20.803 3.665   -8.703  1.00 0.40 ? 188 TRP A O    2  
ATOM 3790  C CB   . TRP A 1 188 ? -17.818 3.864   -7.196  1.00 0.40 ? 188 TRP A CB   2  
ATOM 3791  C CG   . TRP A 1 188 ? -16.700 3.420   -8.084  1.00 0.41 ? 188 TRP A CG   2  
ATOM 3792  C CD1  . TRP A 1 188 ? -15.435 3.925   -8.127  1.00 0.51 ? 188 TRP A CD1  2  
ATOM 3793  C CD2  . TRP A 1 188 ? -16.755 2.384   -9.074  1.00 0.41 ? 188 TRP A CD2  2  
ATOM 3794  N NE1  . TRP A 1 188 ? -14.696 3.265   -9.078  1.00 0.55 ? 188 TRP A NE1  2  
ATOM 3795  C CE2  . TRP A 1 188 ? -15.483 2.313   -9.670  1.00 0.48 ? 188 TRP A CE2  2  
ATOM 3796  C CE3  . TRP A 1 188 ? -17.754 1.505   -9.507  1.00 0.47 ? 188 TRP A CE3  2  
ATOM 3797  C CZ2  . TRP A 1 188 ? -15.186 1.403   -10.681 1.00 0.54 ? 188 TRP A CZ2  2  
ATOM 3798  C CZ3  . TRP A 1 188 ? -17.457 0.602   -10.510 1.00 0.56 ? 188 TRP A CZ3  2  
ATOM 3799  C CH2  . TRP A 1 188 ? -16.181 0.557   -11.085 1.00 0.57 ? 188 TRP A CH2  2  
ATOM 3800  H H    . TRP A 1 188 ? -18.244 6.338   -6.630  1.00 0.41 ? 188 TRP A H    2  
ATOM 3801  H HE1  . TRP A 1 188 ? -13.757 3.444   -9.295  1.00 0.65 ? 188 TRP A HE1  2  
ATOM 3802  N N    . LYS A 1 189 ? -20.821 4.404   -6.584  1.00 0.39 ? 189 LYS A N    2  
ATOM 3803  C CA   . LYS A 1 189 ? -22.175 3.933   -6.323  1.00 0.43 ? 189 LYS A CA   2  
ATOM 3804  C C    . LYS A 1 189 ? -23.203 4.968   -6.765  1.00 0.46 ? 189 LYS A C    2  
ATOM 3805  O O    . LYS A 1 189 ? -24.010 5.450   -5.969  1.00 0.55 ? 189 LYS A O    2  
ATOM 3806  C CB   . LYS A 1 189 ? -22.362 3.566   -4.851  1.00 0.49 ? 189 LYS A CB   2  
ATOM 3807  C CG   . LYS A 1 189 ? -22.616 2.084   -4.620  1.00 0.71 ? 189 LYS A CG   2  
ATOM 3808  C CD   . LYS A 1 189 ? -23.981 1.670   -5.149  1.00 1.05 ? 189 LYS A CD   2  
ATOM 3809  C CE   . LYS A 1 189 ? -24.019 0.189   -5.492  1.00 0.83 ? 189 LYS A CE   2  
ATOM 3810  N NZ   . LYS A 1 189 ? -23.345 -0.098  -6.785  1.00 0.84 ? 189 LYS A NZ   2  
ATOM 3811  H H    . LYS A 1 189 ? -20.328 4.869   -5.870  1.00 0.40 ? 189 LYS A H    2  
ATOM 3812  H HZ1  . LYS A 1 189 ? -23.672 -1.007  -7.166  1.00 1.14 ? 189 LYS A HZ1  2  
ATOM 3813  H HZ2  . LYS A 1 189 ? -22.306 -0.152  -6.649  1.00 1.13 ? 189 LYS A HZ2  2  
ATOM 3814  H HZ3  . LYS A 1 189 ? -23.553 0.654   -7.476  1.00 1.03 ? 189 LYS A HZ3  2  
ATOM 3815  N N    . LYS A 1 190 ? -23.157 5.292   -8.049  1.00 0.49 ? 190 LYS A N    2  
ATOM 3816  C CA   . LYS A 1 190 ? -24.055 6.268   -8.662  1.00 0.57 ? 190 LYS A CA   2  
ATOM 3817  C C    . LYS A 1 190 ? -25.462 5.702   -8.868  1.00 0.55 ? 190 LYS A C    2  
ATOM 3818  O O    . LYS A 1 190 ? -25.931 5.584   -10.002 1.00 0.61 ? 190 LYS A O    2  
ATOM 3819  C CB   . LYS A 1 190 ? -23.469 6.746   -9.999  1.00 0.67 ? 190 LYS A CB   2  
ATOM 3820  C CG   . LYS A 1 190 ? -22.576 5.724   -10.706 1.00 0.65 ? 190 LYS A CG   2  
ATOM 3821  C CD   . LYS A 1 190 ? -23.379 4.578   -11.308 1.00 0.69 ? 190 LYS A CD   2  
ATOM 3822  C CE   . LYS A 1 190 ? -22.475 3.468   -11.820 1.00 0.75 ? 190 LYS A CE   2  
ATOM 3823  N NZ   . LYS A 1 190 ? -22.075 2.517   -10.746 1.00 0.73 ? 190 LYS A NZ   2  
ATOM 3824  H H    . LYS A 1 190 ? -22.481 4.859   -8.612  1.00 0.52 ? 190 LYS A H    2  
ATOM 3825  H HZ1  . LYS A 1 190 ? -21.635 1.672   -11.163 1.00 0.85 ? 190 LYS A HZ1  2  
ATOM 3826  H HZ2  . LYS A 1 190 ? -22.907 2.221   -10.194 1.00 0.77 ? 190 LYS A HZ2  2  
ATOM 3827  H HZ3  . LYS A 1 190 ? -21.391 2.968   -10.102 1.00 0.86 ? 190 LYS A HZ3  2  
ATOM 3828  N N    . MET A 1 191 ? -26.122 5.356   -7.763  1.00 0.57 ? 191 MET A N    2  
ATOM 3829  C CA   . MET A 1 191 ? -27.480 4.796   -7.794  1.00 0.61 ? 191 MET A CA   2  
ATOM 3830  C C    . MET A 1 191 ? -27.494 3.450   -8.521  1.00 0.67 ? 191 MET A C    2  
ATOM 3831  O O    . MET A 1 191 ? -28.514 3.022   -9.063  1.00 1.20 ? 191 MET A O    2  
ATOM 3832  C CB   . MET A 1 191 ? -28.466 5.777   -8.443  1.00 0.70 ? 191 MET A CB   2  
ATOM 3833  C CG   . MET A 1 191 ? -29.926 5.502   -8.127  1.00 0.89 ? 191 MET A CG   2  
ATOM 3834  S SD   . MET A 1 191 ? -31.050 6.340   -9.258  1.00 1.20 ? 191 MET A SD   2  
ATOM 3835  C CE   . MET A 1 191 ? -30.634 5.527   -10.800 1.00 1.44 ? 191 MET A CE   2  
ATOM 3836  H H    . MET A 1 191 ? -25.683 5.485   -6.893  1.00 0.63 ? 191 MET A H    2  
ATOM 3837  N N    . GLY A 1 192 ? -26.348 2.791   -8.515  1.00 0.54 ? 192 GLY A N    2  
ATOM 3838  C CA   . GLY A 1 192 ? -26.210 1.513   -9.168  1.00 0.64 ? 192 GLY A CA   2  
ATOM 3839  C C    . GLY A 1 192 ? -24.759 1.234   -9.477  1.00 0.70 ? 192 GLY A C    2  
ATOM 3840  O O    . GLY A 1 192 ? -23.890 1.770   -8.758  1.00 0.80 ? 192 GLY A O    2  
ATOM 3841  O OXT  . GLY A 1 192 ? -24.472 0.490   -10.433 1.00 1.09 ? 192 GLY A OXT  2  
ATOM 3842  H H    . GLY A 1 192 ? -25.577 3.182   -8.061  1.00 0.80 ? 192 GLY A H    2  
ATOM 3843  N N    . GLU B 2 1   ? 0.656   -1.580  -16.310 1.00 5.01 ? 145 GLU B N    2  
ATOM 3844  C CA   . GLU B 2 1   ? -0.240  -2.578  -16.934 1.00 4.54 ? 145 GLU B CA   2  
ATOM 3845  C C    . GLU B 2 1   ? 0.300   -3.993  -16.714 1.00 3.87 ? 145 GLU B C    2  
ATOM 3846  O O    . GLU B 2 1   ? 1.366   -4.162  -16.130 1.00 3.91 ? 145 GLU B O    2  
ATOM 3847  C CB   . GLU B 2 1   ? -0.426  -2.277  -18.425 1.00 4.66 ? 145 GLU B CB   2  
ATOM 3848  C CG   . GLU B 2 1   ? -1.713  -2.828  -19.032 1.00 5.21 ? 145 GLU B CG   2  
ATOM 3849  C CD   . GLU B 2 1   ? -2.879  -2.806  -18.061 1.00 5.46 ? 145 GLU B CD   2  
ATOM 3850  O OE1  . GLU B 2 1   ? -3.014  -3.766  -17.276 1.00 5.59 ? 145 GLU B OE1  2  
ATOM 3851  O OE2  . GLU B 2 1   ? -3.654  -1.828  -18.075 1.00 5.83 ? 145 GLU B OE2  2  
ATOM 3852  H H1   . GLU B 2 1   ? 1.646   -1.805  -16.524 1.00 4.99 ? 145 GLU B H1   2  
ATOM 3853  H H2   . GLU B 2 1   ? 0.532   -1.590  -15.268 1.00 5.07 ? 145 GLU B H2   2  
ATOM 3854  H H3   . GLU B 2 1   ? 0.439   -0.630  -16.664 1.00 5.51 ? 145 GLU B H3   2  
ATOM 3855  N N    . ILE B 2 2   ? -0.443  -4.989  -17.204 1.00 3.36 ? 146 ILE B N    2  
ATOM 3856  C CA   . ILE B 2 2   ? -0.093  -6.411  -17.071 1.00 2.81 ? 146 ILE B CA   2  
ATOM 3857  C C    . ILE B 2 2   ? 1.403   -6.701  -17.223 1.00 2.31 ? 146 ILE B C    2  
ATOM 3858  O O    . ILE B 2 2   ? 2.004   -7.319  -16.349 1.00 2.12 ? 146 ILE B O    2  
ATOM 3859  C CB   . ILE B 2 2   ? -0.869  -7.274  -18.089 1.00 2.51 ? 146 ILE B CB   2  
ATOM 3860  C CG1  . ILE B 2 2   ? -2.362  -6.927  -18.070 1.00 3.14 ? 146 ILE B CG1  2  
ATOM 3861  C CG2  . ILE B 2 2   ? -0.660  -8.755  -17.801 1.00 2.36 ? 146 ILE B CG2  2  
ATOM 3862  C CD1  . ILE B 2 2   ? -3.123  -7.441  -19.274 1.00 3.05 ? 146 ILE B CD1  2  
ATOM 3863  H H    . ILE B 2 2   ? -1.277  -4.756  -17.671 1.00 3.46 ? 146 ILE B H    2  
ATOM 3864  N N    . TRP B 2 3   ? 1.993   -6.244  -18.323 1.00 2.29 ? 147 TRP B N    2  
ATOM 3865  C CA   . TRP B 2 3   ? 3.414   -6.470  -18.603 1.00 2.19 ? 147 TRP B CA   2  
ATOM 3866  C C    . TRP B 2 3   ? 4.307   -6.017  -17.446 1.00 2.49 ? 147 TRP B C    2  
ATOM 3867  O O    . TRP B 2 3   ? 5.246   -6.713  -17.061 1.00 2.25 ? 147 TRP B O    2  
ATOM 3868  C CB   . TRP B 2 3   ? 3.815   -5.740  -19.891 1.00 2.58 ? 147 TRP B CB   2  
ATOM 3869  C CG   . TRP B 2 3   ? 5.066   -6.266  -20.532 1.00 2.84 ? 147 TRP B CG   2  
ATOM 3870  C CD1  . TRP B 2 3   ? 5.162   -7.308  -21.410 1.00 2.81 ? 147 TRP B CD1  2  
ATOM 3871  C CD2  . TRP B 2 3   ? 6.400   -5.773  -20.347 1.00 3.46 ? 147 TRP B CD2  2  
ATOM 3872  N NE1  . TRP B 2 3   ? 6.472   -7.493  -21.781 1.00 3.38 ? 147 TRP B NE1  2  
ATOM 3873  C CE2  . TRP B 2 3   ? 7.252   -6.565  -21.142 1.00 3.73 ? 147 TRP B CE2  2  
ATOM 3874  C CE3  . TRP B 2 3   ? 6.957   -4.741  -19.586 1.00 3.97 ? 147 TRP B CE3  2  
ATOM 3875  C CZ2  . TRP B 2 3   ? 8.629   -6.356  -21.199 1.00 4.39 ? 147 TRP B CZ2  2  
ATOM 3876  C CZ3  . TRP B 2 3   ? 8.323   -4.537  -19.644 1.00 4.60 ? 147 TRP B CZ3  2  
ATOM 3877  C CH2  . TRP B 2 3   ? 9.144   -5.339  -20.444 1.00 4.76 ? 147 TRP B CH2  2  
ATOM 3878  H H    . TRP B 2 3   ? 1.456   -5.741  -18.975 1.00 2.51 ? 147 TRP B H    2  
ATOM 3879  H HE1  . TRP B 2 3   ? 6.795   -8.181  -22.405 1.00 3.63 ? 147 TRP B HE1  2  
ATOM 3880  N N    . ILE B 2 4   ? 4.000   -4.855  -16.887 1.00 3.10 ? 148 ILE B N    2  
ATOM 3881  C CA   . ILE B 2 4   ? 4.781   -4.308  -15.787 1.00 3.51 ? 148 ILE B CA   2  
ATOM 3882  C C    . ILE B 2 4   ? 4.414   -5.002  -14.476 1.00 3.20 ? 148 ILE B C    2  
ATOM 3883  O O    . ILE B 2 4   ? 5.290   -5.387  -13.698 1.00 3.08 ? 148 ILE B O    2  
ATOM 3884  C CB   . ILE B 2 4   ? 4.577   -2.783  -15.646 1.00 4.34 ? 148 ILE B CB   2  
ATOM 3885  C CG1  . ILE B 2 4   ? 4.496   -2.125  -17.027 1.00 4.68 ? 148 ILE B CG1  2  
ATOM 3886  C CG2  . ILE B 2 4   ? 5.705   -2.165  -14.829 1.00 4.81 ? 148 ILE B CG2  2  
ATOM 3887  C CD1  . ILE B 2 4   ? 4.068   -0.673  -16.992 1.00 5.45 ? 148 ILE B CD1  2  
ATOM 3888  H H    . ILE B 2 4   ? 3.219   -4.363  -17.208 1.00 3.34 ? 148 ILE B H    2  
ATOM 3889  N N    . ALA B 2 5   ? 3.114   -5.178  -14.254 1.00 3.18 ? 149 ALA B N    2  
ATOM 3890  C CA   . ALA B 2 5   ? 2.611   -5.824  -13.043 1.00 3.15 ? 149 ALA B CA   2  
ATOM 3891  C C    . ALA B 2 5   ? 3.156   -7.242  -12.896 1.00 2.43 ? 149 ALA B C    2  
ATOM 3892  O O    . ALA B 2 5   ? 3.320   -7.739  -11.784 1.00 2.45 ? 149 ALA B O    2  
ATOM 3893  C CB   . ALA B 2 5   ? 1.090   -5.835  -13.035 1.00 3.53 ? 149 ALA B CB   2  
ATOM 3894  H H    . ALA B 2 5   ? 2.469   -4.847  -14.919 1.00 3.30 ? 149 ALA B H    2  
ATOM 3895  N N    . GLN B 2 6   ? 3.436   -7.887  -14.023 1.00 1.86 ? 150 GLN B N    2  
ATOM 3896  C CA   . GLN B 2 6   ? 3.974   -9.242  -14.026 1.00 1.28 ? 150 GLN B CA   2  
ATOM 3897  C C    . GLN B 2 6   ? 5.329   -9.291  -13.323 1.00 1.15 ? 150 GLN B C    2  
ATOM 3898  O O    . GLN B 2 6   ? 5.537   -10.093 -12.407 1.00 0.98 ? 150 GLN B O    2  
ATOM 3899  C CB   . GLN B 2 6   ? 4.099   -9.759  -15.460 1.00 1.05 ? 150 GLN B CB   2  
ATOM 3900  C CG   . GLN B 2 6   ? 4.861   -11.068 -15.594 1.00 1.34 ? 150 GLN B CG   2  
ATOM 3901  C CD   . GLN B 2 6   ? 4.782   -11.640 -16.992 1.00 1.76 ? 150 GLN B CD   2  
ATOM 3902  O OE1  . GLN B 2 6   ? 3.763   -11.518 -17.668 1.00 1.81 ? 150 GLN B OE1  2  
ATOM 3903  N NE2  . GLN B 2 6   ? 5.856   -12.261 -17.440 1.00 2.39 ? 150 GLN B NE2  2  
ATOM 3904  H H    . GLN B 2 6   ? 3.268   -7.439  -14.883 1.00 1.92 ? 150 GLN B H    2  
ATOM 3905  H HE21 . GLN B 2 6   ? 6.641   -12.320 -16.852 1.00 2.51 ? 150 GLN B HE21 2  
ATOM 3906  H HE22 . GLN B 2 6   ? 5.826   -12.636 -18.344 1.00 2.81 ? 150 GLN B HE22 2  
ATOM 3907  N N    . GLU B 2 7   ? 6.242   -8.420  -13.747 1.00 1.59 ? 151 GLU B N    2  
ATOM 3908  C CA   . GLU B 2 7   ? 7.574   -8.354  -13.154 1.00 1.93 ? 151 GLU B CA   2  
ATOM 3909  C C    . GLU B 2 7   ? 7.476   -7.846  -11.724 1.00 2.05 ? 151 GLU B C    2  
ATOM 3910  O O    . GLU B 2 7   ? 8.188   -8.306  -10.833 1.00 1.93 ? 151 GLU B O    2  
ATOM 3911  C CB   . GLU B 2 7   ? 8.502   -7.461  -13.989 1.00 2.71 ? 151 GLU B CB   2  
ATOM 3912  C CG   . GLU B 2 7   ? 9.921   -7.323  -13.441 1.00 3.38 ? 151 GLU B CG   2  
ATOM 3913  C CD   . GLU B 2 7   ? 10.595  -8.657  -13.178 1.00 3.37 ? 151 GLU B CD   2  
ATOM 3914  O OE1  . GLU B 2 7   ? 10.299  -9.629  -13.899 1.00 3.26 ? 151 GLU B OE1  2  
ATOM 3915  O OE2  . GLU B 2 7   ? 11.436  -8.736  -12.252 1.00 3.77 ? 151 GLU B OE2  2  
ATOM 3916  H H    . GLU B 2 7   ? 6.010   -7.806  -14.476 1.00 1.84 ? 151 GLU B H    2  
ATOM 3917  N N    . LEU B 2 8   ? 6.565   -6.907  -11.507 1.00 2.45 ? 152 LEU B N    2  
ATOM 3918  C CA   . LEU B 2 8   ? 6.352   -6.341  -10.186 1.00 2.86 ? 152 LEU B CA   2  
ATOM 3919  C C    . LEU B 2 8   ? 5.836   -7.398  -9.221  1.00 2.48 ? 152 LEU B C    2  
ATOM 3920  O O    . LEU B 2 8   ? 6.186   -7.399  -8.040  1.00 2.62 ? 152 LEU B O    2  
ATOM 3921  C CB   . LEU B 2 8   ? 5.406   -5.151  -10.263 1.00 3.54 ? 152 LEU B CB   2  
ATOM 3922  C CG   . LEU B 2 8   ? 6.054   -3.847  -10.718 1.00 4.02 ? 152 LEU B CG   2  
ATOM 3923  C CD1  . LEU B 2 8   ? 5.044   -2.957  -11.411 1.00 4.62 ? 152 LEU B CD1  2  
ATOM 3924  C CD2  . LEU B 2 8   ? 6.679   -3.133  -9.535  1.00 4.35 ? 152 LEU B CD2  2  
ATOM 3925  H H    . LEU B 2 8   ? 6.024   -6.582  -12.262 1.00 2.58 ? 152 LEU B H    2  
ATOM 3926  N N    . ARG B 2 9   ? 5.007   -8.303  -9.735  1.00 2.13 ? 153 ARG B N    2  
ATOM 3927  C CA   . ARG B 2 9   ? 4.471   -9.391  -8.930  1.00 2.11 ? 153 ARG B CA   2  
ATOM 3928  C C    . ARG B 2 9   ? 5.625   -10.262 -8.444  1.00 1.51 ? 153 ARG B C    2  
ATOM 3929  O O    . ARG B 2 9   ? 5.579   -10.817 -7.351  1.00 1.66 ? 153 ARG B O    2  
ATOM 3930  C CB   . ARG B 2 9   ? 3.482   -10.234 -9.742  1.00 2.28 ? 153 ARG B CB   2  
ATOM 3931  C CG   . ARG B 2 9   ? 2.700   -11.245 -8.917  1.00 2.79 ? 153 ARG B CG   2  
ATOM 3932  C CD   . ARG B 2 9   ? 2.289   -12.445 -9.754  1.00 3.22 ? 153 ARG B CD   2  
ATOM 3933  N NE   . ARG B 2 9   ? 0.845   -12.494 -9.994  1.00 3.39 ? 153 ARG B NE   2  
ATOM 3934  C CZ   . ARG B 2 9   ? 0.059   -13.499 -9.600  1.00 3.88 ? 153 ARG B CZ   2  
ATOM 3935  N NH1  . ARG B 2 9   ? 0.566   -14.518 -8.924  1.00 4.32 ? 153 ARG B NH1  2  
ATOM 3936  N NH2  . ARG B 2 9   ? -1.237  -13.489 -9.886  1.00 4.17 ? 153 ARG B NH2  2  
ATOM 3937  H H    . ARG B 2 9   ? 4.734   -8.222  -10.676 1.00 2.05 ? 153 ARG B H    2  
ATOM 3938  H HE   . ARG B 2 9   ? 0.447   -11.744 -10.491 1.00 3.35 ? 153 ARG B HE   2  
ATOM 3939  H HH11 . ARG B 2 9   ? 1.542   -14.542 -8.700  1.00 4.33 ? 153 ARG B HH11 2  
ATOM 3940  H HH12 . ARG B 2 9   ? -0.035  -15.281 -8.630  1.00 4.80 ? 153 ARG B HH12 2  
ATOM 3941  H HH21 . ARG B 2 9   ? -1.639  -12.727 -10.398 1.00 4.15 ? 153 ARG B HH21 2  
ATOM 3942  H HH22 . ARG B 2 9   ? -1.825  -14.261 -9.597  1.00 4.58 ? 153 ARG B HH22 2  
ATOM 3943  N N    . ARG B 2 10  ? 6.667   -10.353 -9.267  1.00 1.01 ? 154 ARG B N    2  
ATOM 3944  C CA   . ARG B 2 10  ? 7.848   -11.134 -8.930  1.00 0.90 ? 154 ARG B CA   2  
ATOM 3945  C C    . ARG B 2 10  ? 8.663   -10.410 -7.858  1.00 1.04 ? 154 ARG B C    2  
ATOM 3946  O O    . ARG B 2 10  ? 9.198   -11.037 -6.946  1.00 1.02 ? 154 ARG B O    2  
ATOM 3947  C CB   . ARG B 2 10  ? 8.707   -11.394 -10.170 1.00 1.34 ? 154 ARG B CB   2  
ATOM 3948  C CG   . ARG B 2 10  ? 9.798   -12.434 -9.962  1.00 2.01 ? 154 ARG B CG   2  
ATOM 3949  C CD   . ARG B 2 10  ? 11.045  -12.102 -10.765 1.00 2.84 ? 154 ARG B CD   2  
ATOM 3950  N NE   . ARG B 2 10  ? 11.549  -10.762 -10.465 1.00 3.10 ? 154 ARG B NE   2  
ATOM 3951  C CZ   . ARG B 2 10  ? 12.259  -10.452 -9.379  1.00 3.57 ? 154 ARG B CZ   2  
ATOM 3952  N NH1  . ARG B 2 10  ? 12.627  -11.395 -8.517  1.00 3.71 ? 154 ARG B NH1  2  
ATOM 3953  N NH2  . ARG B 2 10  ? 12.622  -9.195  -9.171  1.00 4.07 ? 154 ARG B NH2  2  
ATOM 3954  H H    . ARG B 2 10  ? 6.639   -9.875  -10.123 1.00 1.06 ? 154 ARG B H    2  
ATOM 3955  H HE   . ARG B 2 10  ? 11.328  -10.043 -11.111 1.00 3.07 ? 154 ARG B HE   2  
ATOM 3956  H HH11 . ARG B 2 10  ? 12.372  -12.353 -8.674  1.00 3.54 ? 154 ARG B HH11 2  
ATOM 3957  H HH12 . ARG B 2 10  ? 13.167  -11.153 -7.699  1.00 4.08 ? 154 ARG B HH12 2  
ATOM 3958  H HH21 . ARG B 2 10  ? 12.369  -8.484  -9.830  1.00 4.11 ? 154 ARG B HH21 2  
ATOM 3959  H HH22 . ARG B 2 10  ? 13.137  -8.949  -8.343  1.00 4.49 ? 154 ARG B HH22 2  
ATOM 3960  N N    . ILE B 2 11  ? 8.749   -9.082  -7.971  1.00 1.56 ? 155 ILE B N    2  
ATOM 3961  C CA   . ILE B 2 11  ? 9.478   -8.271  -6.992  1.00 2.08 ? 155 ILE B CA   2  
ATOM 3962  C C    . ILE B 2 11  ? 8.805   -8.395  -5.626  1.00 2.01 ? 155 ILE B C    2  
ATOM 3963  O O    . ILE B 2 11  ? 9.466   -8.493  -4.589  1.00 2.10 ? 155 ILE B O    2  
ATOM 3964  C CB   . ILE B 2 11  ? 9.544   -6.780  -7.405  1.00 2.96 ? 155 ILE B CB   2  
ATOM 3965  C CG1  . ILE B 2 11  ? 10.208  -6.639  -8.779  1.00 3.16 ? 155 ILE B CG1  2  
ATOM 3966  C CG2  . ILE B 2 11  ? 10.301  -5.963  -6.365  1.00 3.62 ? 155 ILE B CG2  2  
ATOM 3967  C CD1  . ILE B 2 11  ? 10.177  -5.233  -9.342  1.00 3.96 ? 155 ILE B CD1  2  
ATOM 3968  H H    . ILE B 2 11  ? 8.319   -8.638  -8.736  1.00 1.71 ? 155 ILE B H    2  
ATOM 3969  N N    . GLY B 2 12  ? 7.480   -8.421  -5.641  1.00 2.07 ? 156 GLY B N    2  
ATOM 3970  C CA   . GLY B 2 12  ? 6.728   -8.564  -4.415  1.00 2.48 ? 156 GLY B CA   2  
ATOM 3971  C C    . GLY B 2 12  ? 6.648   -10.017 -3.982  1.00 2.14 ? 156 GLY B C    2  
ATOM 3972  O O    . GLY B 2 12  ? 6.111   -10.333 -2.921  1.00 2.57 ? 156 GLY B O    2  
ATOM 3973  H H    . GLY B 2 12  ? 7.006   -8.332  -6.496  1.00 2.00 ? 156 GLY B H    2  
ATOM 3974  N N    . ASP B 2 13  ? 7.182   -10.899 -4.818  1.00 1.53 ? 157 ASP B N    2  
ATOM 3975  C CA   . ASP B 2 13  ? 7.190   -12.330 -4.539  1.00 1.56 ? 157 ASP B CA   2  
ATOM 3976  C C    . ASP B 2 13  ? 8.524   -12.745 -3.940  1.00 1.01 ? 157 ASP B C    2  
ATOM 3977  O O    . ASP B 2 13  ? 8.571   -13.520 -2.985  1.00 1.21 ? 157 ASP B O    2  
ATOM 3978  C CB   . ASP B 2 13  ? 6.920   -13.132 -5.814  1.00 1.82 ? 157 ASP B CB   2  
ATOM 3979  C CG   . ASP B 2 13  ? 5.894   -14.226 -5.605  1.00 2.23 ? 157 ASP B CG   2  
ATOM 3980  O OD1  . ASP B 2 13  ? 4.686   -13.913 -5.556  1.00 2.73 ? 157 ASP B OD1  2  
ATOM 3981  O OD2  . ASP B 2 13  ? 6.284   -15.402 -5.479  1.00 2.40 ? 157 ASP B OD2  2  
ATOM 3982  H H    . ASP B 2 13  ? 7.577   -10.576 -5.656  1.00 1.27 ? 157 ASP B H    2  
ATOM 3983  N N    . GLU B 2 14  ? 9.607   -12.212 -4.502  1.00 0.71 ? 158 GLU B N    2  
ATOM 3984  C CA   . GLU B 2 14  ? 10.954  -12.519 -4.024  1.00 1.05 ? 158 GLU B CA   2  
ATOM 3985  C C    . GLU B 2 14  ? 11.115  -12.120 -2.561  1.00 1.29 ? 158 GLU B C    2  
ATOM 3986  O O    . GLU B 2 14  ? 11.598  -12.901 -1.742  1.00 1.29 ? 158 GLU B O    2  
ATOM 3987  C CB   . GLU B 2 14  ? 12.023  -11.848 -4.899  1.00 1.84 ? 158 GLU B CB   2  
ATOM 3988  C CG   . GLU B 2 14  ? 11.914  -10.331 -4.995  1.00 2.74 ? 158 GLU B CG   2  
ATOM 3989  C CD   . GLU B 2 14  ? 12.980  -9.716  -5.882  1.00 3.59 ? 158 GLU B CD   2  
ATOM 3990  O OE1  . GLU B 2 14  ? 13.971  -10.407 -6.194  1.00 3.85 ? 158 GLU B OE1  2  
ATOM 3991  O OE2  . GLU B 2 14  ? 12.832  -8.544  -6.285  1.00 4.27 ? 158 GLU B OE2  2  
ATOM 3992  H H    . GLU B 2 14  ? 9.498   -11.607 -5.269  1.00 0.77 ? 158 GLU B H    2  
ATOM 3993  N N    . PHE B 2 15  ? 10.681  -10.907 -2.234  1.00 1.81 ? 159 PHE B N    2  
ATOM 3994  C CA   . PHE B 2 15  ? 10.764  -10.408 -0.871  1.00 2.48 ? 159 PHE B CA   2  
ATOM 3995  C C    . PHE B 2 15  ? 9.842   -11.199 0.041   1.00 2.47 ? 159 PHE B C    2  
ATOM 3996  O O    . PHE B 2 15  ? 10.136  -11.402 1.218   1.00 2.90 ? 159 PHE B O    2  
ATOM 3997  C CB   . PHE B 2 15  ? 10.391  -8.925  -0.818  1.00 3.29 ? 159 PHE B CB   2  
ATOM 3998  C CG   . PHE B 2 15  ? 11.567  -7.998  -0.918  1.00 3.63 ? 159 PHE B CG   2  
ATOM 3999  C CD1  . PHE B 2 15  ? 12.069  -7.626  -2.154  1.00 4.07 ? 159 PHE B CD1  2  
ATOM 4000  C CD2  . PHE B 2 15  ? 12.166  -7.497  0.224   1.00 3.87 ? 159 PHE B CD2  2  
ATOM 4001  C CE1  . PHE B 2 15  ? 13.152  -6.774  -2.248  1.00 4.53 ? 159 PHE B CE1  2  
ATOM 4002  C CE2  . PHE B 2 15  ? 13.250  -6.644  0.137   1.00 4.37 ? 159 PHE B CE2  2  
ATOM 4003  C CZ   . PHE B 2 15  ? 13.742  -6.282  -1.101  1.00 4.61 ? 159 PHE B CZ   2  
ATOM 4004  H H    . PHE B 2 15  ? 10.305  -10.329 -2.934  1.00 1.86 ? 159 PHE B H    2  
ATOM 4005  N N    . ASN B 2 16  ? 8.733   -11.657 -0.521  1.00 2.24 ? 160 ASN B N    2  
ATOM 4006  C CA   . ASN B 2 16  ? 7.748   -12.422 0.229   1.00 2.65 ? 160 ASN B CA   2  
ATOM 4007  C C    . ASN B 2 16  ? 8.285   -13.794 0.611   1.00 2.24 ? 160 ASN B C    2  
ATOM 4008  O O    . ASN B 2 16  ? 8.086   -14.251 1.731   1.00 2.59 ? 160 ASN B O    2  
ATOM 4009  C CB   . ASN B 2 16  ? 6.456   -12.572 -0.579  1.00 2.97 ? 160 ASN B CB   2  
ATOM 4010  C CG   . ASN B 2 16  ? 5.217   -12.717 0.287   1.00 3.76 ? 160 ASN B CG   2  
ATOM 4011  O OD1  . ASN B 2 16  ? 4.136   -12.261 -0.087  1.00 4.03 ? 160 ASN B OD1  2  
ATOM 4012  N ND2  . ASN B 2 16  ? 5.356   -13.349 1.441   1.00 4.32 ? 160 ASN B ND2  2  
ATOM 4013  H H    . ASN B 2 16  ? 8.572   -11.474 -1.470  1.00 1.99 ? 160 ASN B H    2  
ATOM 4014  H HD21 . ASN B 2 16  ? 6.246   -13.694 1.686   1.00 4.25 ? 160 ASN B HD21 2  
ATOM 4015  H HD22 . ASN B 2 16  ? 4.564   -13.448 2.011   1.00 4.87 ? 160 ASN B HD22 2  
ATOM 4016  N N    . ALA B 2 17  ? 8.967   -14.442 -0.319  1.00 1.59 ? 161 ALA B N    2  
ATOM 4017  C CA   . ALA B 2 17  ? 9.521   -15.770 -0.074  1.00 1.42 ? 161 ALA B CA   2  
ATOM 4018  C C    . ALA B 2 17  ? 10.721  -15.705 0.866   1.00 1.04 ? 161 ALA B C    2  
ATOM 4019  O O    . ALA B 2 17  ? 11.072  -16.690 1.513   1.00 1.12 ? 161 ALA B O    2  
ATOM 4020  C CB   . ALA B 2 17  ? 9.912   -16.430 -1.387  1.00 1.66 ? 161 ALA B CB   2  
ATOM 4021  H H    . ALA B 2 17  ? 9.101   -14.020 -1.197  1.00 1.37 ? 161 ALA B H    2  
ATOM 4022  N N    . TYR B 2 18  ? 11.348  -14.539 0.933   1.00 1.36 ? 162 TYR B N    2  
ATOM 4023  C CA   . TYR B 2 18  ? 12.512  -14.343 1.783   1.00 1.82 ? 162 TYR B CA   2  
ATOM 4024  C C    . TYR B 2 18  ? 12.118  -14.149 3.247   1.00 2.42 ? 162 TYR B C    2  
ATOM 4025  O O    . TYR B 2 18  ? 12.901  -14.448 4.149   1.00 2.52 ? 162 TYR B O    2  
ATOM 4026  C CB   . TYR B 2 18  ? 13.337  -13.148 1.280   1.00 2.45 ? 162 TYR B CB   2  
ATOM 4027  C CG   . TYR B 2 18  ? 14.596  -12.870 2.075   1.00 3.23 ? 162 TYR B CG   2  
ATOM 4028  C CD1  . TYR B 2 18  ? 15.723  -13.672 1.939   1.00 3.36 ? 162 TYR B CD1  2  
ATOM 4029  C CD2  . TYR B 2 18  ? 14.658  -11.799 2.957   1.00 4.05 ? 162 TYR B CD2  2  
ATOM 4030  C CE1  . TYR B 2 18  ? 16.873  -13.415 2.661   1.00 4.18 ? 162 TYR B CE1  2  
ATOM 4031  C CE2  . TYR B 2 18  ? 15.804  -11.536 3.681   1.00 4.79 ? 162 TYR B CE2  2  
ATOM 4032  C CZ   . TYR B 2 18  ? 16.908  -12.346 3.529   1.00 4.82 ? 162 TYR B CZ   2  
ATOM 4033  O OH   . TYR B 2 18  ? 18.052  -12.086 4.250   1.00 5.64 ? 162 TYR B OH   2  
ATOM 4034  H H    . TYR B 2 18  ? 11.021  -13.792 0.390   1.00 1.62 ? 162 TYR B H    2  
ATOM 4035  H HH   . TYR B 2 18  ? 17.826  -11.999 5.185   1.00 5.90 ? 162 TYR B HH   2  
ATOM 4036  N N    . TYR B 2 19  ? 10.904  -13.663 3.483   1.00 3.05 ? 163 TYR B N    2  
ATOM 4037  C CA   . TYR B 2 19  ? 10.440  -13.416 4.846   1.00 3.89 ? 163 TYR B CA   2  
ATOM 4038  C C    . TYR B 2 19  ? 9.376   -14.409 5.310   1.00 4.14 ? 163 TYR B C    2  
ATOM 4039  O O    . TYR B 2 19  ? 9.187   -14.603 6.512   1.00 4.36 ? 163 TYR B O    2  
ATOM 4040  C CB   . TYR B 2 19  ? 9.930   -11.979 4.997   1.00 4.80 ? 163 TYR B CB   2  
ATOM 4041  C CG   . TYR B 2 19  ? 11.022  -10.933 5.008   1.00 5.20 ? 163 TYR B CG   2  
ATOM 4042  C CD1  . TYR B 2 19  ? 11.706  -10.631 6.178   1.00 5.67 ? 163 TYR B CD1  2  
ATOM 4043  C CD2  . TYR B 2 19  ? 11.368  -10.247 3.851   1.00 5.29 ? 163 TYR B CD2  2  
ATOM 4044  C CE1  . TYR B 2 19  ? 12.702  -9.675  6.196   1.00 6.11 ? 163 TYR B CE1  2  
ATOM 4045  C CE2  . TYR B 2 19  ? 12.364  -9.288  3.859   1.00 5.82 ? 163 TYR B CE2  2  
ATOM 4046  C CZ   . TYR B 2 19  ? 13.027  -9.006  5.035   1.00 6.18 ? 163 TYR B CZ   2  
ATOM 4047  O OH   . TYR B 2 19  ? 14.017  -8.050  5.048   1.00 6.75 ? 163 TYR B OH   2  
ATOM 4048  H H    . TYR B 2 19  ? 10.310  -13.468 2.729   1.00 3.03 ? 163 TYR B H    2  
ATOM 4049  H HH   . TYR B 2 19  ? 13.716  -7.267  4.576   1.00 7.02 ? 163 TYR B HH   2  
ATOM 4050  N N    . ALA B 2 20  ? 8.682   -15.037 4.373   1.00 4.36 ? 164 ALA B N    2  
ATOM 4051  C CA   . ALA B 2 20  ? 7.637   -15.992 4.717   1.00 4.99 ? 164 ALA B CA   2  
ATOM 4052  C C    . ALA B 2 20  ? 7.856   -17.327 4.017   1.00 5.11 ? 164 ALA B C    2  
ATOM 4053  O O    . ALA B 2 20  ? 8.052   -17.327 2.784   1.00 5.31 ? 164 ALA B O    2  
ATOM 4054  C CB   . ALA B 2 20  ? 6.265   -15.428 4.376   1.00 5.92 ? 164 ALA B CB   2  
ATOM 4055  O OXT  . ALA B 2 20  ? 7.818   -18.372 4.703   1.00 5.35 ? 164 ALA B OXT  2  
ATOM 4056  H H    . ALA B 2 20  ? 8.874   -14.864 3.427   1.00 4.24 ? 164 ALA B H    2  
ATOM 4057  N N    . MET A 1 1   ? 40.050  2.041   -3.913  1.00 1.33 ? 1   MET A N    3  
ATOM 4058  C CA   . MET A 1 1   ? 40.262  3.268   -3.112  1.00 1.17 ? 1   MET A CA   3  
ATOM 4059  C C    . MET A 1 1   ? 39.044  4.191   -3.198  1.00 1.10 ? 1   MET A C    3  
ATOM 4060  O O    . MET A 1 1   ? 39.125  5.376   -2.875  1.00 1.14 ? 1   MET A O    3  
ATOM 4061  C CB   . MET A 1 1   ? 41.522  3.995   -3.589  1.00 1.33 ? 1   MET A CB   3  
ATOM 4062  C CG   . MET A 1 1   ? 42.213  4.824   -2.519  1.00 1.59 ? 1   MET A CG   3  
ATOM 4063  S SD   . MET A 1 1   ? 43.734  5.590   -3.111  1.00 1.94 ? 1   MET A SD   3  
ATOM 4064  C CE   . MET A 1 1   ? 43.078  6.783   -4.278  1.00 2.23 ? 1   MET A CE   3  
ATOM 4065  H H1   . MET A 1 1   ? 40.940  1.511   -3.998  1.00 1.41 ? 1   MET A H1   3  
ATOM 4066  H H2   . MET A 1 1   ? 39.717  2.288   -4.867  1.00 1.51 ? 1   MET A H2   3  
ATOM 4067  H H3   . MET A 1 1   ? 39.340  1.435   -3.457  1.00 1.44 ? 1   MET A H3   3  
ATOM 4068  N N    . ASP A 1 2   ? 37.905  3.638   -3.609  1.00 1.05 ? 2   ASP A N    3  
ATOM 4069  C CA   . ASP A 1 2   ? 36.679  4.420   -3.745  1.00 1.04 ? 2   ASP A CA   3  
ATOM 4070  C C    . ASP A 1 2   ? 36.145  4.855   -2.385  1.00 1.05 ? 2   ASP A C    3  
ATOM 4071  O O    . ASP A 1 2   ? 35.702  5.990   -2.220  1.00 1.09 ? 2   ASP A O    3  
ATOM 4072  C CB   . ASP A 1 2   ? 35.610  3.640   -4.523  1.00 1.07 ? 2   ASP A CB   3  
ATOM 4073  C CG   . ASP A 1 2   ? 35.065  2.450   -3.758  1.00 1.10 ? 2   ASP A CG   3  
ATOM 4074  O OD1  . ASP A 1 2   ? 35.872  1.621   -3.291  1.00 1.21 ? 2   ASP A OD1  3  
ATOM 4075  O OD2  . ASP A 1 2   ? 33.831  2.341   -3.615  1.00 1.29 ? 2   ASP A OD2  3  
ATOM 4076  H H    . ASP A 1 2   ? 37.882  2.680   -3.820  1.00 1.07 ? 2   ASP A H    3  
ATOM 4077  N N    . GLY A 1 3   ? 36.214  3.958   -1.407  1.00 1.07 ? 3   GLY A N    3  
ATOM 4078  C CA   . GLY A 1 3   ? 35.742  4.273   -0.072  1.00 1.14 ? 3   GLY A CA   3  
ATOM 4079  C C    . GLY A 1 3   ? 36.622  5.292   0.619   1.00 1.16 ? 3   GLY A C    3  
ATOM 4080  O O    . GLY A 1 3   ? 36.235  5.884   1.627   1.00 1.23 ? 3   GLY A O    3  
ATOM 4081  H H    . GLY A 1 3   ? 36.572  3.064   -1.600  1.00 1.07 ? 3   GLY A H    3  
ATOM 4082  N N    . SER A 1 4   ? 37.814  5.489   0.077   1.00 1.16 ? 4   SER A N    3  
ATOM 4083  C CA   . SER A 1 4   ? 38.762  6.438   0.625   1.00 1.23 ? 4   SER A CA   3  
ATOM 4084  C C    . SER A 1 4   ? 38.567  7.816   -0.001  1.00 1.23 ? 4   SER A C    3  
ATOM 4085  O O    . SER A 1 4   ? 39.233  8.779   0.376   1.00 1.35 ? 4   SER A O    3  
ATOM 4086  C CB   . SER A 1 4   ? 40.178  5.934   0.359   1.00 1.34 ? 4   SER A CB   3  
ATOM 4087  O OG   . SER A 1 4   ? 40.187  4.512   0.310   1.00 1.40 ? 4   SER A OG   3  
ATOM 4088  H H    . SER A 1 4   ? 38.068  4.971   -0.714  1.00 1.14 ? 4   SER A H    3  
ATOM 4089  H HG   . SER A 1 4   ? 39.779  4.165   1.108   1.00 1.44 ? 4   SER A HG   3  
ATOM 4090  N N    . GLY A 1 5   ? 37.653  7.900   -0.960  1.00 1.19 ? 5   GLY A N    3  
ATOM 4091  C CA   . GLY A 1 5   ? 37.381  9.159   -1.625  1.00 1.24 ? 5   GLY A CA   3  
ATOM 4092  C C    . GLY A 1 5   ? 36.505  10.072  -0.787  1.00 1.22 ? 5   GLY A C    3  
ATOM 4093  O O    . GLY A 1 5   ? 36.139  9.729   0.340   1.00 1.30 ? 5   GLY A O    3  
ATOM 4094  H H    . GLY A 1 5   ? 37.151  7.097   -1.217  1.00 1.17 ? 5   GLY A H    3  
ATOM 4095  N N    . GLU A 1 6   ? 36.157  11.225  -1.337  1.00 1.26 ? 6   GLU A N    3  
ATOM 4096  C CA   . GLU A 1 6   ? 35.322  12.186  -0.630  1.00 1.28 ? 6   GLU A CA   3  
ATOM 4097  C C    . GLU A 1 6   ? 33.849  11.804  -0.720  1.00 1.22 ? 6   GLU A C    3  
ATOM 4098  O O    . GLU A 1 6   ? 33.298  11.661  -1.814  1.00 1.34 ? 6   GLU A O    3  
ATOM 4099  C CB   . GLU A 1 6   ? 35.545  13.596  -1.179  1.00 1.49 ? 6   GLU A CB   3  
ATOM 4100  C CG   . GLU A 1 6   ? 36.974  14.094  -1.026  1.00 1.57 ? 6   GLU A CG   3  
ATOM 4101  C CD   . GLU A 1 6   ? 37.151  15.519  -1.504  1.00 1.62 ? 6   GLU A CD   3  
ATOM 4102  O OE1  . GLU A 1 6   ? 36.535  16.427  -0.911  1.00 1.87 ? 6   GLU A OE1  3  
ATOM 4103  O OE2  . GLU A 1 6   ? 37.916  15.737  -2.466  1.00 2.00 ? 6   GLU A OE2  3  
ATOM 4104  H H    . GLU A 1 6   ? 36.461  11.432  -2.242  1.00 1.37 ? 6   GLU A H    3  
ATOM 4105  N N    . GLN A 1 7   ? 33.229  11.623  0.438   1.00 1.15 ? 7   GLN A N    3  
ATOM 4106  C CA   . GLN A 1 7   ? 31.821  11.258  0.508   1.00 1.12 ? 7   GLN A CA   3  
ATOM 4107  C C    . GLN A 1 7   ? 31.111  12.055  1.598   1.00 1.11 ? 7   GLN A C    3  
ATOM 4108  O O    . GLN A 1 7   ? 31.621  12.187  2.713   1.00 1.15 ? 7   GLN A O    3  
ATOM 4109  C CB   . GLN A 1 7   ? 31.671  9.760   0.789   1.00 1.12 ? 7   GLN A CB   3  
ATOM 4110  C CG   . GLN A 1 7   ? 32.051  8.852   -0.372  1.00 1.27 ? 7   GLN A CG   3  
ATOM 4111  C CD   . GLN A 1 7   ? 31.844  7.385   -0.050  1.00 1.35 ? 7   GLN A CD   3  
ATOM 4112  O OE1  . GLN A 1 7   ? 30.961  7.026   0.731   1.00 1.63 ? 7   GLN A OE1  3  
ATOM 4113  N NE2  . GLN A 1 7   ? 32.660  6.527   -0.640  1.00 1.60 ? 7   GLN A NE2  3  
ATOM 4114  H H    . GLN A 1 7   ? 33.732  11.743  1.276   1.00 1.20 ? 7   GLN A H    3  
ATOM 4115  H HE21 . GLN A 1 7   ? 33.348  6.882   -1.242  1.00 1.78 ? 7   GLN A HE21 3  
ATOM 4116  H HE22 . GLN A 1 7   ? 32.540  5.571   -0.456  1.00 1.81 ? 7   GLN A HE22 3  
ATOM 4117  N N    . PRO A 1 8   ? 29.928  12.604  1.288   1.00 1.13 ? 8   PRO A N    3  
ATOM 4118  C CA   . PRO A 1 8   ? 29.137  13.382  2.240   1.00 1.17 ? 8   PRO A CA   3  
ATOM 4119  C C    . PRO A 1 8   ? 28.235  12.485  3.089   1.00 1.11 ? 8   PRO A C    3  
ATOM 4120  O O    . PRO A 1 8   ? 27.011  12.627  3.073   1.00 1.12 ? 8   PRO A O    3  
ATOM 4121  C CB   . PRO A 1 8   ? 28.292  14.259  1.317   1.00 1.26 ? 8   PRO A CB   3  
ATOM 4122  C CG   . PRO A 1 8   ? 28.065  13.417  0.105   1.00 1.27 ? 8   PRO A CG   3  
ATOM 4123  C CD   . PRO A 1 8   ? 29.271  12.519  -0.031  1.00 1.18 ? 8   PRO A CD   3  
ATOM 4124  N N    . ARG A 1 9   ? 28.857  11.552  3.812   1.00 1.09 ? 9   ARG A N    3  
ATOM 4125  C CA   . ARG A 1 9   ? 28.147  10.603  4.683   1.00 1.07 ? 9   ARG A CA   3  
ATOM 4126  C C    . ARG A 1 9   ? 27.424  9.514   3.891   1.00 1.00 ? 9   ARG A C    3  
ATOM 4127  O O    . ARG A 1 9   ? 27.499  8.332   4.229   1.00 1.16 ? 9   ARG A O    3  
ATOM 4128  C CB   . ARG A 1 9   ? 27.184  11.304  5.649   1.00 1.15 ? 9   ARG A CB   3  
ATOM 4129  C CG   . ARG A 1 9   ? 26.428  10.357  6.569   1.00 1.28 ? 9   ARG A CG   3  
ATOM 4130  C CD   . ARG A 1 9   ? 25.347  11.084  7.353   1.00 1.41 ? 9   ARG A CD   3  
ATOM 4131  N NE   . ARG A 1 9   ? 24.220  11.488  6.507   1.00 1.46 ? 9   ARG A NE   3  
ATOM 4132  C CZ   . ARG A 1 9   ? 23.929  12.755  6.204   1.00 1.62 ? 9   ARG A CZ   3  
ATOM 4133  N NH1  . ARG A 1 9   ? 24.680  13.743  6.670   1.00 1.92 ? 9   ARG A NH1  3  
ATOM 4134  N NH2  . ARG A 1 9   ? 22.883  13.028  5.433   1.00 1.99 ? 9   ARG A NH2  3  
ATOM 4135  H H    . ARG A 1 9   ? 29.834  11.498  3.762   1.00 1.13 ? 9   ARG A H    3  
ATOM 4136  H HE   . ARG A 1 9   ? 23.646  10.770  6.150   1.00 1.78 ? 9   ARG A HE   3  
ATOM 4137  H HH11 . ARG A 1 9   ? 25.472  13.545  7.254   1.00 2.02 ? 9   ARG A HH11 3  
ATOM 4138  H HH12 . ARG A 1 9   ? 24.461  14.695  6.434   1.00 2.32 ? 9   ARG A HH12 3  
ATOM 4139  H HH21 . ARG A 1 9   ? 22.310  12.286  5.078   1.00 2.25 ? 9   ARG A HH21 3  
ATOM 4140  H HH22 . ARG A 1 9   ? 22.662  13.982  5.202   1.00 2.24 ? 9   ARG A HH22 3  
ATOM 4141  N N    . GLY A 1 10  ? 26.723  9.916   2.843   1.00 0.97 ? 10  GLY A N    3  
ATOM 4142  C CA   . GLY A 1 10  ? 26.000  8.961   2.033   1.00 0.99 ? 10  GLY A CA   3  
ATOM 4143  C C    . GLY A 1 10  ? 26.364  9.060   0.572   1.00 0.97 ? 10  GLY A C    3  
ATOM 4144  O O    . GLY A 1 10  ? 26.766  10.122  0.097   1.00 1.29 ? 10  GLY A O    3  
ATOM 4145  H H    . GLY A 1 10  ? 26.697  10.872  2.616   1.00 1.08 ? 10  GLY A H    3  
ATOM 4146  N N    . GLY A 1 11  ? 26.238  7.950   -0.137  1.00 0.95 ? 11  GLY A N    3  
ATOM 4147  C CA   . GLY A 1 11  ? 26.545  7.931   -1.550  1.00 0.94 ? 11  GLY A CA   3  
ATOM 4148  C C    . GLY A 1 11  ? 25.284  7.957   -2.385  1.00 0.92 ? 11  GLY A C    3  
ATOM 4149  O O    . GLY A 1 11  ? 24.191  8.188   -1.858  1.00 1.14 ? 11  GLY A O    3  
ATOM 4150  H H    . GLY A 1 11  ? 25.925  7.131   0.303   1.00 1.17 ? 11  GLY A H    3  
ATOM 4151  N N    . GLY A 1 12  ? 25.420  7.700   -3.675  1.00 0.92 ? 12  GLY A N    3  
ATOM 4152  C CA   . GLY A 1 12  ? 24.267  7.709   -4.551  1.00 0.92 ? 12  GLY A CA   3  
ATOM 4153  C C    . GLY A 1 12  ? 24.115  6.411   -5.317  1.00 0.84 ? 12  GLY A C    3  
ATOM 4154  O O    . GLY A 1 12  ? 24.613  6.294   -6.438  1.00 0.92 ? 12  GLY A O    3  
ATOM 4155  H H    . GLY A 1 12  ? 26.306  7.494   -4.037  1.00 1.07 ? 12  GLY A H    3  
ATOM 4156  N N    . PRO A 1 13  ? 23.435  5.410   -4.737  1.00 0.80 ? 13  PRO A N    3  
ATOM 4157  C CA   . PRO A 1 13  ? 23.221  4.115   -5.382  1.00 0.83 ? 13  PRO A CA   3  
ATOM 4158  C C    . PRO A 1 13  ? 22.003  4.140   -6.304  1.00 0.79 ? 13  PRO A C    3  
ATOM 4159  O O    . PRO A 1 13  ? 21.471  5.208   -6.613  1.00 0.91 ? 13  PRO A O    3  
ATOM 4160  C CB   . PRO A 1 13  ? 22.960  3.194   -4.189  1.00 0.94 ? 13  PRO A CB   3  
ATOM 4161  C CG   . PRO A 1 13  ? 22.285  4.068   -3.185  1.00 1.01 ? 13  PRO A CG   3  
ATOM 4162  C CD   . PRO A 1 13  ? 22.816  5.465   -3.398  1.00 0.87 ? 13  PRO A CD   3  
ATOM 4163  N N    . THR A 1 14  ? 21.564  2.968   -6.746  1.00 0.77 ? 14  THR A N    3  
ATOM 4164  C CA   . THR A 1 14  ? 20.405  2.881   -7.620  1.00 0.75 ? 14  THR A CA   3  
ATOM 4165  C C    . THR A 1 14  ? 19.103  2.974   -6.818  1.00 0.73 ? 14  THR A C    3  
ATOM 4166  O O    . THR A 1 14  ? 18.511  1.970   -6.413  1.00 0.98 ? 14  THR A O    3  
ATOM 4167  C CB   . THR A 1 14  ? 20.431  1.633   -8.538  1.00 0.85 ? 14  THR A CB   3  
ATOM 4168  O OG1  . THR A 1 14  ? 19.258  1.600   -9.365  1.00 0.86 ? 14  THR A OG1  3  
ATOM 4169  C CG2  . THR A 1 14  ? 20.559  0.339   -7.746  1.00 0.95 ? 14  THR A CG2  3  
ATOM 4170  H H    . THR A 1 14  ? 22.026  2.148   -6.478  1.00 0.89 ? 14  THR A H    3  
ATOM 4171  H HG1  . THR A 1 14  ? 19.232  2.403   -9.910  1.00 1.00 ? 14  THR A HG1  3  
ATOM 4172  N N    . SER A 1 15  ? 18.679  4.203   -6.580  1.00 0.62 ? 15  SER A N    3  
ATOM 4173  C CA   . SER A 1 15  ? 17.466  4.477   -5.826  1.00 0.65 ? 15  SER A CA   3  
ATOM 4174  C C    . SER A 1 15  ? 16.228  3.923   -6.525  1.00 0.60 ? 15  SER A C    3  
ATOM 4175  O O    . SER A 1 15  ? 15.275  3.503   -5.869  1.00 0.60 ? 15  SER A O    3  
ATOM 4176  C CB   . SER A 1 15  ? 17.333  5.987   -5.630  1.00 0.80 ? 15  SER A CB   3  
ATOM 4177  O OG   . SER A 1 15  ? 18.241  6.679   -6.476  1.00 0.99 ? 15  SER A OG   3  
ATOM 4178  H H    . SER A 1 15  ? 19.204  4.963   -6.916  1.00 0.69 ? 15  SER A H    3  
ATOM 4179  H HG   . SER A 1 15  ? 18.394  7.566   -6.128  1.00 0.99 ? 15  SER A HG   3  
ATOM 4180  N N    . SER A 1 16  ? 16.265  3.905   -7.853  1.00 0.61 ? 16  SER A N    3  
ATOM 4181  C CA   . SER A 1 16  ? 15.157  3.419   -8.662  1.00 0.62 ? 16  SER A CA   3  
ATOM 4182  C C    . SER A 1 16  ? 14.717  2.014   -8.249  1.00 0.55 ? 16  SER A C    3  
ATOM 4183  O O    . SER A 1 16  ? 13.545  1.785   -7.938  1.00 0.61 ? 16  SER A O    3  
ATOM 4184  C CB   . SER A 1 16  ? 15.571  3.436   -10.134 1.00 0.68 ? 16  SER A CB   3  
ATOM 4185  O OG   . SER A 1 16  ? 16.831  4.080   -10.285 1.00 0.85 ? 16  SER A OG   3  
ATOM 4186  H H    . SER A 1 16  ? 17.069  4.230   -8.312  1.00 0.66 ? 16  SER A H    3  
ATOM 4187  H HG   . SER A 1 16  ? 16.881  4.489   -11.160 1.00 1.04 ? 16  SER A HG   3  
ATOM 4188  N N    . GLU A 1 17  ? 15.660  1.085   -8.218  1.00 0.50 ? 17  GLU A N    3  
ATOM 4189  C CA   . GLU A 1 17  ? 15.351  -0.287  -7.853  1.00 0.49 ? 17  GLU A CA   3  
ATOM 4190  C C    . GLU A 1 17  ? 15.187  -0.446  -6.344  1.00 0.49 ? 17  GLU A C    3  
ATOM 4191  O O    . GLU A 1 17  ? 14.418  -1.293  -5.881  1.00 0.51 ? 17  GLU A O    3  
ATOM 4192  C CB   . GLU A 1 17  ? 16.405  -1.247  -8.405  1.00 0.55 ? 17  GLU A CB   3  
ATOM 4193  C CG   . GLU A 1 17  ? 15.821  -2.419  -9.178  1.00 0.75 ? 17  GLU A CG   3  
ATOM 4194  C CD   . GLU A 1 17  ? 14.687  -2.008  -10.102 1.00 0.97 ? 17  GLU A CD   3  
ATOM 4195  O OE1  . GLU A 1 17  ? 14.966  -1.517  -11.220 1.00 1.23 ? 17  GLU A OE1  3  
ATOM 4196  O OE2  . GLU A 1 17  ? 13.516  -2.174  -9.719  1.00 1.11 ? 17  GLU A OE2  3  
ATOM 4197  H H    . GLU A 1 17  ? 16.581  1.326   -8.445  1.00 0.53 ? 17  GLU A H    3  
ATOM 4198  N N    . GLN A 1 18  ? 15.902  0.372   -5.579  1.00 0.52 ? 18  GLN A N    3  
ATOM 4199  C CA   . GLN A 1 18  ? 15.819  0.315   -4.124  1.00 0.58 ? 18  GLN A CA   3  
ATOM 4200  C C    . GLN A 1 18  ? 14.404  0.623   -3.649  1.00 0.60 ? 18  GLN A C    3  
ATOM 4201  O O    . GLN A 1 18  ? 13.853  -0.090  -2.807  1.00 0.64 ? 18  GLN A O    3  
ATOM 4202  C CB   . GLN A 1 18  ? 16.814  1.275   -3.469  1.00 0.68 ? 18  GLN A CB   3  
ATOM 4203  C CG   . GLN A 1 18  ? 18.194  0.678   -3.240  1.00 0.82 ? 18  GLN A CG   3  
ATOM 4204  C CD   . GLN A 1 18  ? 18.932  1.354   -2.102  1.00 0.96 ? 18  GLN A CD   3  
ATOM 4205  O OE1  . GLN A 1 18  ? 19.665  2.320   -2.305  1.00 1.27 ? 18  GLN A OE1  3  
ATOM 4206  N NE2  . GLN A 1 18  ? 18.752  0.844   -0.893  1.00 1.14 ? 18  GLN A NE2  3  
ATOM 4207  H H    . GLN A 1 18  ? 16.500  1.024   -6.002  1.00 0.53 ? 18  GLN A H    3  
ATOM 4208  H HE21 . GLN A 1 18  ? 18.160  0.064   -0.801  1.00 1.15 ? 18  GLN A HE21 3  
ATOM 4209  H HE22 . GLN A 1 18  ? 19.206  1.272   -0.137  1.00 1.42 ? 18  GLN A HE22 3  
ATOM 4210  N N    . ILE A 1 19  ? 13.814  1.677   -4.204  1.00 0.60 ? 19  ILE A N    3  
ATOM 4211  C CA   . ILE A 1 19  ? 12.457  2.075   -3.846  1.00 0.66 ? 19  ILE A CA   3  
ATOM 4212  C C    . ILE A 1 19  ? 11.465  0.973   -4.217  1.00 0.63 ? 19  ILE A C    3  
ATOM 4213  O O    . ILE A 1 19  ? 10.555  0.657   -3.446  1.00 0.67 ? 19  ILE A O    3  
ATOM 4214  C CB   . ILE A 1 19  ? 12.053  3.395   -4.541  1.00 0.73 ? 19  ILE A CB   3  
ATOM 4215  C CG1  . ILE A 1 19  ? 12.947  4.543   -4.063  1.00 0.78 ? 19  ILE A CG1  3  
ATOM 4216  C CG2  . ILE A 1 19  ? 10.586  3.717   -4.280  1.00 0.77 ? 19  ILE A CG2  3  
ATOM 4217  C CD1  . ILE A 1 19  ? 12.849  5.795   -4.908  1.00 0.85 ? 19  ILE A CD1  3  
ATOM 4218  H H    . ILE A 1 19  ? 14.308  2.205   -4.872  1.00 0.58 ? 19  ILE A H    3  
ATOM 4219  N N    . MET A 1 20  ? 11.675  0.373   -5.387  1.00 0.59 ? 20  MET A N    3  
ATOM 4220  C CA   . MET A 1 20  ? 10.813  -0.698  -5.877  1.00 0.60 ? 20  MET A CA   3  
ATOM 4221  C C    . MET A 1 20  ? 10.791  -1.870  -4.902  1.00 0.56 ? 20  MET A C    3  
ATOM 4222  O O    . MET A 1 20  ? 9.723   -2.360  -4.531  1.00 0.57 ? 20  MET A O    3  
ATOM 4223  C CB   . MET A 1 20  ? 11.294  -1.181  -7.250  1.00 0.61 ? 20  MET A CB   3  
ATOM 4224  C CG   . MET A 1 20  ? 10.455  -2.299  -7.852  1.00 0.71 ? 20  MET A CG   3  
ATOM 4225  S SD   . MET A 1 20  ? 8.970   -1.693  -8.682  1.00 0.96 ? 20  MET A SD   3  
ATOM 4226  C CE   . MET A 1 20  ? 7.751   -1.865  -7.382  1.00 1.64 ? 20  MET A CE   3  
ATOM 4227  H H    . MET A 1 20  ? 12.436  0.660   -5.937  1.00 0.57 ? 20  MET A H    3  
ATOM 4228  N N    . LYS A 1 21  ? 11.975  -2.304  -4.483  1.00 0.55 ? 21  LYS A N    3  
ATOM 4229  C CA   . LYS A 1 21  ? 12.093  -3.421  -3.551  1.00 0.55 ? 21  LYS A CA   3  
ATOM 4230  C C    . LYS A 1 21  ? 11.493  -3.063  -2.193  1.00 0.51 ? 21  LYS A C    3  
ATOM 4231  O O    . LYS A 1 21  ? 10.981  -3.926  -1.481  1.00 0.51 ? 21  LYS A O    3  
ATOM 4232  C CB   . LYS A 1 21  ? 13.552  -3.856  -3.399  1.00 0.58 ? 21  LYS A CB   3  
ATOM 4233  C CG   . LYS A 1 21  ? 14.189  -4.377  -4.680  1.00 0.63 ? 21  LYS A CG   3  
ATOM 4234  C CD   . LYS A 1 21  ? 13.486  -5.625  -5.196  1.00 0.69 ? 21  LYS A CD   3  
ATOM 4235  C CE   . LYS A 1 21  ? 14.174  -6.177  -6.436  1.00 0.83 ? 21  LYS A CE   3  
ATOM 4236  N NZ   . LYS A 1 21  ? 13.452  -7.347  -7.004  1.00 1.15 ? 21  LYS A NZ   3  
ATOM 4237  H H    . LYS A 1 21  ? 12.793  -1.864  -4.811  1.00 0.55 ? 21  LYS A H    3  
ATOM 4238  H HZ1  . LYS A 1 21  ? 13.955  -7.710  -7.837  1.00 1.46 ? 21  LYS A HZ1  3  
ATOM 4239  H HZ2  . LYS A 1 21  ? 12.492  -7.072  -7.287  1.00 1.69 ? 21  LYS A HZ2  3  
ATOM 4240  H HZ3  . LYS A 1 21  ? 13.386  -8.114  -6.295  1.00 1.26 ? 21  LYS A HZ3  3  
ATOM 4241  N N    . THR A 1 22  ? 11.545  -1.777  -1.848  1.00 0.52 ? 22  THR A N    3  
ATOM 4242  C CA   . THR A 1 22  ? 10.994  -1.304  -0.584  1.00 0.51 ? 22  THR A CA   3  
ATOM 4243  C C    . THR A 1 22  ? 9.478   -1.500  -0.560  1.00 0.52 ? 22  THR A C    3  
ATOM 4244  O O    . THR A 1 22  ? 8.908   -1.905  0.455   1.00 0.52 ? 22  THR A O    3  
ATOM 4245  C CB   . THR A 1 22  ? 11.327  0.183   -0.334  1.00 0.56 ? 22  THR A CB   3  
ATOM 4246  O OG1  . THR A 1 22  ? 12.740  0.388   -0.474  1.00 0.63 ? 22  THR A OG1  3  
ATOM 4247  C CG2  . THR A 1 22  ? 10.907  0.601   1.068   1.00 0.71 ? 22  THR A CG2  3  
ATOM 4248  H H    . THR A 1 22  ? 11.964  -1.135  -2.460  1.00 0.55 ? 22  THR A H    3  
ATOM 4249  H HG1  . THR A 1 22  ? 13.009  0.183   -1.381  1.00 0.88 ? 22  THR A HG1  3  
ATOM 4250  N N    . GLY A 1 23  ? 8.834   -1.237  -1.695  1.00 0.55 ? 23  GLY A N    3  
ATOM 4251  C CA   . GLY A 1 23  ? 7.393   -1.399  -1.788  1.00 0.58 ? 23  GLY A CA   3  
ATOM 4252  C C    . GLY A 1 23  ? 6.982   -2.844  -1.591  1.00 0.56 ? 23  GLY A C    3  
ATOM 4253  O O    . GLY A 1 23  ? 5.922   -3.133  -1.032  1.00 0.58 ? 23  GLY A O    3  
ATOM 4254  H H    . GLY A 1 23  ? 9.342   -0.931  -2.477  1.00 0.55 ? 23  GLY A H    3  
ATOM 4255  N N    . ALA A 1 24  ? 7.841   -3.751  -2.032  1.00 0.56 ? 24  ALA A N    3  
ATOM 4256  C CA   . ALA A 1 24  ? 7.586   -5.177  -1.905  1.00 0.58 ? 24  ALA A CA   3  
ATOM 4257  C C    . ALA A 1 24  ? 7.749   -5.635  -0.453  1.00 0.55 ? 24  ALA A C    3  
ATOM 4258  O O    . ALA A 1 24  ? 7.380   -6.751  -0.094  1.00 0.73 ? 24  ALA A O    3  
ATOM 4259  C CB   . ALA A 1 24  ? 8.503   -5.961  -2.830  1.00 0.61 ? 24  ALA A CB   3  
ATOM 4260  H H    . ALA A 1 24  ? 8.673   -3.451  -2.451  1.00 0.58 ? 24  ALA A H    3  
ATOM 4261  N N    . LEU A 1 25  ? 8.303   -4.760  0.377   1.00 0.44 ? 25  LEU A N    3  
ATOM 4262  C CA   . LEU A 1 25  ? 8.508   -5.061  1.784   1.00 0.40 ? 25  LEU A CA   3  
ATOM 4263  C C    . LEU A 1 25  ? 7.457   -4.356  2.640   1.00 0.39 ? 25  LEU A C    3  
ATOM 4264  O O    . LEU A 1 25  ? 6.950   -4.924  3.608   1.00 0.40 ? 25  LEU A O    3  
ATOM 4265  C CB   . LEU A 1 25  ? 9.919   -4.654  2.220   1.00 0.40 ? 25  LEU A CB   3  
ATOM 4266  C CG   . LEU A 1 25  ? 10.309  -4.981  3.665   1.00 0.45 ? 25  LEU A CG   3  
ATOM 4267  C CD1  . LEU A 1 25  ? 10.084  -6.456  3.965   1.00 0.61 ? 25  LEU A CD1  3  
ATOM 4268  C CD2  . LEU A 1 25  ? 11.756  -4.592  3.927   1.00 0.48 ? 25  LEU A CD2  3  
ATOM 4269  H H    . LEU A 1 25  ? 8.579   -3.887  0.030   1.00 0.48 ? 25  LEU A H    3  
ATOM 4270  N N    . LEU A 1 26  ? 7.127   -3.123  2.265   1.00 0.39 ? 26  LEU A N    3  
ATOM 4271  C CA   . LEU A 1 26  ? 6.133   -2.336  2.992   1.00 0.40 ? 26  LEU A CA   3  
ATOM 4272  C C    . LEU A 1 26  ? 4.780   -3.035  3.017   1.00 0.44 ? 26  LEU A C    3  
ATOM 4273  O O    . LEU A 1 26  ? 4.120   -3.098  4.054   1.00 0.45 ? 26  LEU A O    3  
ATOM 4274  C CB   . LEU A 1 26  ? 5.993   -0.939  2.384   1.00 0.43 ? 26  LEU A CB   3  
ATOM 4275  C CG   . LEU A 1 26  ? 7.185   0.001   2.573   1.00 0.42 ? 26  LEU A CG   3  
ATOM 4276  C CD1  . LEU A 1 26  ? 6.902   1.354   1.938   1.00 0.49 ? 26  LEU A CD1  3  
ATOM 4277  C CD2  . LEU A 1 26  ? 7.518   0.158   4.049   1.00 0.39 ? 26  LEU A CD2  3  
ATOM 4278  H H    . LEU A 1 26  ? 7.572   -2.726  1.484   1.00 0.40 ? 26  LEU A H    3  
ATOM 4279  N N    . LEU A 1 27  ? 4.375   -3.570  1.870   1.00 0.49 ? 27  LEU A N    3  
ATOM 4280  C CA   . LEU A 1 27  ? 3.101   -4.270  1.770   1.00 0.56 ? 27  LEU A CA   3  
ATOM 4281  C C    . LEU A 1 27  ? 3.106   -5.537  2.623   1.00 0.57 ? 27  LEU A C    3  
ATOM 4282  O O    . LEU A 1 27  ? 2.090   -5.902  3.213   1.00 0.61 ? 27  LEU A O    3  
ATOM 4283  C CB   . LEU A 1 27  ? 2.778   -4.613  0.312   1.00 0.63 ? 27  LEU A CB   3  
ATOM 4284  C CG   . LEU A 1 27  ? 1.918   -3.602  -0.458  1.00 0.67 ? 27  LEU A CG   3  
ATOM 4285  C CD1  . LEU A 1 27  ? 0.597   -3.358  0.257   1.00 0.71 ? 27  LEU A CD1  3  
ATOM 4286  C CD2  . LEU A 1 27  ? 2.671   -2.298  -0.686  1.00 0.64 ? 27  LEU A CD2  3  
ATOM 4287  H H    . LEU A 1 27  ? 4.941   -3.484  1.073   1.00 0.50 ? 27  LEU A H    3  
ATOM 4288  N N    . GLN A 1 28  ? 4.266   -6.182  2.704   1.00 0.56 ? 28  GLN A N    3  
ATOM 4289  C CA   . GLN A 1 28  ? 4.419   -7.409  3.476   1.00 0.59 ? 28  GLN A CA   3  
ATOM 4290  C C    . GLN A 1 28  ? 4.125   -7.177  4.951   1.00 0.56 ? 28  GLN A C    3  
ATOM 4291  O O    . GLN A 1 28  ? 3.467   -7.998  5.590   1.00 0.60 ? 28  GLN A O    3  
ATOM 4292  C CB   . GLN A 1 28  ? 5.824   -7.981  3.310   1.00 0.64 ? 28  GLN A CB   3  
ATOM 4293  C CG   . GLN A 1 28  ? 6.004   -8.846  2.079   1.00 0.99 ? 28  GLN A CG   3  
ATOM 4294  C CD   . GLN A 1 28  ? 7.325   -9.581  2.091   1.00 1.17 ? 28  GLN A CD   3  
ATOM 4295  O OE1  . GLN A 1 28  ? 7.434   -10.673 2.646   1.00 1.46 ? 28  GLN A OE1  3  
ATOM 4296  N NE2  . GLN A 1 28  ? 8.336   -8.994  1.477   1.00 1.53 ? 28  GLN A NE2  3  
ATOM 4297  H H    . GLN A 1 28  ? 5.049   -5.811  2.245   1.00 0.55 ? 28  GLN A H    3  
ATOM 4298  H HE21 . GLN A 1 28  ? 8.178   -8.123  1.048   1.00 1.80 ? 28  GLN A HE21 3  
ATOM 4299  H HE22 . GLN A 1 28  ? 9.202   -9.457  1.467   1.00 1.74 ? 28  GLN A HE22 3  
ATOM 4300  N N    . GLY A 1 29  ? 4.604   -6.053  5.478   1.00 0.54 ? 29  GLY A N    3  
ATOM 4301  C CA   . GLY A 1 29  ? 4.389   -5.731  6.877   1.00 0.54 ? 29  GLY A CA   3  
ATOM 4302  C C    . GLY A 1 29  ? 2.918   -5.642  7.237   1.00 0.51 ? 29  GLY A C    3  
ATOM 4303  O O    . GLY A 1 29  ? 2.503   -6.080  8.312   1.00 0.53 ? 29  GLY A O    3  
ATOM 4304  H H    . GLY A 1 29  ? 5.116   -5.434  4.907   1.00 0.56 ? 29  GLY A H    3  
ATOM 4305  N N    . PHE A 1 30  ? 2.127   -5.083  6.333   1.00 0.50 ? 30  PHE A N    3  
ATOM 4306  C CA   . PHE A 1 30  ? 0.695   -4.938  6.556   1.00 0.51 ? 30  PHE A CA   3  
ATOM 4307  C C    . PHE A 1 30  ? -0.029  -6.262  6.317   1.00 0.51 ? 30  PHE A C    3  
ATOM 4308  O O    . PHE A 1 30  ? -0.928  -6.640  7.076   1.00 0.55 ? 30  PHE A O    3  
ATOM 4309  C CB   . PHE A 1 30  ? 0.118   -3.843  5.655   1.00 0.54 ? 30  PHE A CB   3  
ATOM 4310  C CG   . PHE A 1 30  ? -0.931  -3.001  6.326   1.00 0.54 ? 30  PHE A CG   3  
ATOM 4311  C CD1  . PHE A 1 30  ? -2.254  -3.411  6.362   1.00 0.85 ? 30  PHE A CD1  3  
ATOM 4312  C CD2  . PHE A 1 30  ? -0.591  -1.798  6.927   1.00 0.83 ? 30  PHE A CD2  3  
ATOM 4313  C CE1  . PHE A 1 30  ? -3.216  -2.640  6.984   1.00 0.85 ? 30  PHE A CE1  3  
ATOM 4314  C CE2  . PHE A 1 30  ? -1.549  -1.023  7.548   1.00 0.90 ? 30  PHE A CE2  3  
ATOM 4315  C CZ   . PHE A 1 30  ? -2.864  -1.445  7.578   1.00 0.65 ? 30  PHE A CZ   3  
ATOM 4316  H H    . PHE A 1 30  ? 2.519   -4.754  5.496   1.00 0.51 ? 30  PHE A H    3  
ATOM 4317  N N    . ILE A 1 31  ? 0.376   -6.969  5.269   1.00 0.50 ? 31  ILE A N    3  
ATOM 4318  C CA   . ILE A 1 31  ? -0.235  -8.248  4.925   1.00 0.52 ? 31  ILE A CA   3  
ATOM 4319  C C    . ILE A 1 31  ? 0.011   -9.297  6.009   1.00 0.53 ? 31  ILE A C    3  
ATOM 4320  O O    . ILE A 1 31  ? -0.924  -9.954  6.464   1.00 0.56 ? 31  ILE A O    3  
ATOM 4321  C CB   . ILE A 1 31  ? 0.255   -8.775  3.554   1.00 0.54 ? 31  ILE A CB   3  
ATOM 4322  C CG1  . ILE A 1 31  ? -0.221  -7.849  2.432   1.00 0.54 ? 31  ILE A CG1  3  
ATOM 4323  C CG2  . ILE A 1 31  ? -0.237  -10.197 3.308   1.00 0.58 ? 31  ILE A CG2  3  
ATOM 4324  C CD1  . ILE A 1 31  ? 0.391   -8.160  1.082   1.00 0.57 ? 31  ILE A CD1  3  
ATOM 4325  H H    . ILE A 1 31  ? 1.104   -6.618  4.706   1.00 0.49 ? 31  ILE A H    3  
ATOM 4326  N N    . GLN A 1 32  ? 1.264   -9.427  6.438   1.00 0.53 ? 32  GLN A N    3  
ATOM 4327  C CA   . GLN A 1 32  ? 1.632   -10.398 7.464   1.00 0.55 ? 32  GLN A CA   3  
ATOM 4328  C C    . GLN A 1 32  ? 0.868   -10.163 8.762   1.00 0.54 ? 32  GLN A C    3  
ATOM 4329  O O    . GLN A 1 32  ? 0.380   -11.107 9.381   1.00 0.57 ? 32  GLN A O    3  
ATOM 4330  C CB   . GLN A 1 32  ? 3.140   -10.368 7.724   1.00 0.57 ? 32  GLN A CB   3  
ATOM 4331  C CG   . GLN A 1 32  ? 3.958   -11.225 6.767   1.00 0.68 ? 32  GLN A CG   3  
ATOM 4332  C CD   . GLN A 1 32  ? 3.687   -12.708 6.936   1.00 0.90 ? 32  GLN A CD   3  
ATOM 4333  O OE1  . GLN A 1 32  ? 3.348   -13.173 8.022   1.00 1.07 ? 32  GLN A OE1  3  
ATOM 4334  N NE2  . GLN A 1 32  ? 3.845   -13.466 5.864   1.00 1.12 ? 32  GLN A NE2  3  
ATOM 4335  H H    . GLN A 1 32  ? 1.964   -8.848  6.057   1.00 0.52 ? 32  GLN A H    3  
ATOM 4336  H HE21 . GLN A 1 32  ? 4.127   -13.034 5.033   1.00 1.19 ? 32  GLN A HE21 3  
ATOM 4337  H HE22 . GLN A 1 32  ? 3.673   -14.429 5.947   1.00 1.31 ? 32  GLN A HE22 3  
ATOM 4338  N N    . ASP A 1 33  ? 0.754   -8.902  9.160   1.00 0.53 ? 33  ASP A N    3  
ATOM 4339  C CA   . ASP A 1 33  ? 0.047   -8.550  10.387  1.00 0.55 ? 33  ASP A CA   3  
ATOM 4340  C C    . ASP A 1 33  ? -1.421  -8.954  10.318  1.00 0.58 ? 33  ASP A C    3  
ATOM 4341  O O    . ASP A 1 33  ? -1.946  -9.595  11.232  1.00 0.65 ? 33  ASP A O    3  
ATOM 4342  C CB   . ASP A 1 33  ? 0.160   -7.051  10.664  1.00 0.57 ? 33  ASP A CB   3  
ATOM 4343  C CG   . ASP A 1 33  ? -0.757  -6.598  11.780  1.00 0.61 ? 33  ASP A CG   3  
ATOM 4344  O OD1  . ASP A 1 33  ? -0.451  -6.874  12.959  1.00 0.73 ? 33  ASP A OD1  3  
ATOM 4345  O OD2  . ASP A 1 33  ? -1.782  -5.950  11.491  1.00 0.74 ? 33  ASP A OD2  3  
ATOM 4346  H H    . ASP A 1 33  ? 1.153   -8.190  8.616   1.00 0.53 ? 33  ASP A H    3  
ATOM 4347  N N    . ARG A 1 34  ? -2.070  -8.598  9.218   1.00 0.58 ? 34  ARG A N    3  
ATOM 4348  C CA   . ARG A 1 34  ? -3.480  -8.914  9.024   1.00 0.63 ? 34  ARG A CA   3  
ATOM 4349  C C    . ARG A 1 34  ? -3.704  -10.416 8.835   1.00 0.62 ? 34  ARG A C    3  
ATOM 4350  O O    . ARG A 1 34  ? -4.713  -10.962 9.282   1.00 0.67 ? 34  ARG A O    3  
ATOM 4351  C CB   . ARG A 1 34  ? -4.057  -8.121  7.848   1.00 0.67 ? 34  ARG A CB   3  
ATOM 4352  C CG   . ARG A 1 34  ? -4.919  -6.935  8.260   1.00 0.74 ? 34  ARG A CG   3  
ATOM 4353  C CD   . ARG A 1 34  ? -4.138  -5.920  9.085   1.00 0.73 ? 34  ARG A CD   3  
ATOM 4354  N NE   . ARG A 1 34  ? -4.985  -4.803  9.505   1.00 0.75 ? 34  ARG A NE   3  
ATOM 4355  C CZ   . ARG A 1 34  ? -4.896  -4.196  10.692  1.00 0.74 ? 34  ARG A CZ   3  
ATOM 4356  N NH1  . ARG A 1 34  ? -3.952  -4.546  11.553  1.00 0.77 ? 34  ARG A NH1  3  
ATOM 4357  N NH2  . ARG A 1 34  ? -5.736  -3.223  11.006  1.00 0.85 ? 34  ARG A NH2  3  
ATOM 4358  H H    . ARG A 1 34  ? -1.585  -8.111  8.514   1.00 0.56 ? 34  ARG A H    3  
ATOM 4359  H HE   . ARG A 1 34  ? -5.670  -4.500  8.873   1.00 0.86 ? 34  ARG A HE   3  
ATOM 4360  H HH11 . ARG A 1 34  ? -3.283  -5.272  11.320  1.00 0.74 ? 34  ARG A HH11 3  
ATOM 4361  H HH12 . ARG A 1 34  ? -3.901  -4.101  12.447  1.00 0.90 ? 34  ARG A HH12 3  
ATOM 4362  H HH21 . ARG A 1 34  ? -6.441  -2.933  10.354  1.00 0.91 ? 34  ARG A HH21 3  
ATOM 4363  H HH22 . ARG A 1 34  ? -5.678  -2.771  11.910  1.00 0.93 ? 34  ARG A HH22 3  
ATOM 4364  N N    . ALA A 1 35  ? -2.756  -11.079 8.182   1.00 0.61 ? 35  ALA A N    3  
ATOM 4365  C CA   . ALA A 1 35  ? -2.850  -12.514 7.942   1.00 0.64 ? 35  ALA A CA   3  
ATOM 4366  C C    . ALA A 1 35  ? -2.673  -13.299 9.237   1.00 0.66 ? 35  ALA A C    3  
ATOM 4367  O O    . ALA A 1 35  ? -3.219  -14.391 9.390   1.00 0.68 ? 35  ALA A O    3  
ATOM 4368  C CB   . ALA A 1 35  ? -1.821  -12.954 6.912   1.00 0.65 ? 35  ALA A CB   3  
ATOM 4369  H H    . ALA A 1 35  ? -1.974  -10.588 7.845   1.00 0.61 ? 35  ALA A H    3  
ATOM 4370  N N    . GLY A 1 36  ? -1.923  -12.724 10.170  1.00 0.69 ? 36  GLY A N    3  
ATOM 4371  C CA   . GLY A 1 36  ? -1.684  -13.373 11.446  1.00 0.76 ? 36  GLY A CA   3  
ATOM 4372  C C    . GLY A 1 36  ? -2.962  -13.578 12.240  1.00 0.78 ? 36  GLY A C    3  
ATOM 4373  O O    . GLY A 1 36  ? -3.035  -14.459 13.096  1.00 0.89 ? 36  GLY A O    3  
ATOM 4374  H H    . GLY A 1 36  ? -1.517  -11.848 9.986   1.00 0.70 ? 36  GLY A H    3  
ATOM 4375  N N    . ARG A 1 37  ? -3.977  -12.771 11.940  1.00 0.75 ? 37  ARG A N    3  
ATOM 4376  C CA   . ARG A 1 37  ? -5.270  -12.856 12.618  1.00 0.81 ? 37  ARG A CA   3  
ATOM 4377  C C    . ARG A 1 37  ? -6.046  -14.095 12.160  1.00 0.79 ? 37  ARG A C    3  
ATOM 4378  O O    . ARG A 1 37  ? -7.071  -14.451 12.737  1.00 0.88 ? 37  ARG A O    3  
ATOM 4379  C CB   . ARG A 1 37  ? -6.087  -11.582 12.352  1.00 0.86 ? 37  ARG A CB   3  
ATOM 4380  C CG   . ARG A 1 37  ? -7.321  -11.426 13.227  1.00 1.17 ? 37  ARG A CG   3  
ATOM 4381  C CD   . ARG A 1 37  ? -7.683  -9.962  13.428  1.00 1.23 ? 37  ARG A CD   3  
ATOM 4382  N NE   . ARG A 1 37  ? -8.653  -9.471  12.444  1.00 1.18 ? 37  ARG A NE   3  
ATOM 4383  C CZ   . ARG A 1 37  ? -9.029  -8.192  12.346  1.00 1.28 ? 37  ARG A CZ   3  
ATOM 4384  N NH1  . ARG A 1 37  ? -8.472  -7.278  13.128  1.00 1.35 ? 37  ARG A NH1  3  
ATOM 4385  N NH2  . ARG A 1 37  ? -9.945  -7.825  11.456  1.00 1.73 ? 37  ARG A NH2  3  
ATOM 4386  H H    . ARG A 1 37  ? -3.852  -12.092 11.242  1.00 0.71 ? 37  ARG A H    3  
ATOM 4387  H HE   . ARG A 1 37  ? -9.058  -10.134 11.839  1.00 1.43 ? 37  ARG A HE   3  
ATOM 4388  H HH11 . ARG A 1 37  ? -7.767  -7.544  13.789  1.00 1.52 ? 37  ARG A HH11 3  
ATOM 4389  H HH12 . ARG A 1 37  ? -8.759  -6.318  13.068  1.00 1.52 ? 37  ARG A HH12 3  
ATOM 4390  H HH21 . ARG A 1 37  ? -10.364 -8.508  10.851  1.00 2.07 ? 37  ARG A HH21 3  
ATOM 4391  H HH22 . ARG A 1 37  ? -10.230 -6.863  11.390  1.00 1.89 ? 37  ARG A HH22 3  
ATOM 4392  N N    . MET A 1 38  ? -5.543  -14.752 11.123  1.00 0.74 ? 38  MET A N    3  
ATOM 4393  C CA   . MET A 1 38  ? -6.188  -15.944 10.586  1.00 0.75 ? 38  MET A CA   3  
ATOM 4394  C C    . MET A 1 38  ? -5.557  -17.215 11.154  1.00 0.77 ? 38  MET A C    3  
ATOM 4395  O O    . MET A 1 38  ? -5.877  -18.325 10.728  1.00 1.03 ? 38  MET A O    3  
ATOM 4396  C CB   . MET A 1 38  ? -6.116  -15.958 9.058   1.00 0.76 ? 38  MET A CB   3  
ATOM 4397  C CG   . MET A 1 38  ? -6.645  -14.692 8.408   1.00 0.86 ? 38  MET A CG   3  
ATOM 4398  S SD   . MET A 1 38  ? -8.359  -14.346 8.841   1.00 1.19 ? 38  MET A SD   3  
ATOM 4399  C CE   . MET A 1 38  ? -8.507  -12.653 8.279   1.00 1.48 ? 38  MET A CE   3  
ATOM 4400  H H    . MET A 1 38  ? -4.718  -14.422 10.703  1.00 0.74 ? 38  MET A H    3  
ATOM 4401  N N    . GLY A 1 39  ? -4.666  -17.040 12.117  1.00 0.76 ? 39  GLY A N    3  
ATOM 4402  C CA   . GLY A 1 39  ? -4.005  -18.174 12.731  1.00 0.78 ? 39  GLY A CA   3  
ATOM 4403  C C    . GLY A 1 39  ? -2.860  -18.693 11.887  1.00 0.80 ? 39  GLY A C    3  
ATOM 4404  O O    . GLY A 1 39  ? -1.868  -17.994 11.685  1.00 1.17 ? 39  GLY A O    3  
ATOM 4405  H H    . GLY A 1 39  ? -4.454  -16.132 12.417  1.00 0.92 ? 39  GLY A H    3  
ATOM 4406  N N    . GLY A 1 40  ? -2.998  -19.911 11.391  1.00 0.84 ? 40  GLY A N    3  
ATOM 4407  C CA   . GLY A 1 40  ? -1.959  -20.497 10.575  1.00 0.88 ? 40  GLY A CA   3  
ATOM 4408  C C    . GLY A 1 40  ? -2.267  -21.935 10.240  1.00 0.88 ? 40  GLY A C    3  
ATOM 4409  O O    . GLY A 1 40  ? -3.264  -22.483 10.713  1.00 1.11 ? 40  GLY A O    3  
ATOM 4410  H H    . GLY A 1 40  ? -3.814  -20.421 11.579  1.00 1.11 ? 40  GLY A H    3  
ATOM 4411  N N    . GLU A 1 41  ? -1.410  -22.550 9.439   1.00 0.82 ? 41  GLU A N    3  
ATOM 4412  C CA   . GLU A 1 41  ? -1.600  -23.938 9.034   1.00 0.87 ? 41  GLU A CA   3  
ATOM 4413  C C    . GLU A 1 41  ? -0.592  -24.843 9.736   1.00 0.90 ? 41  GLU A C    3  
ATOM 4414  O O    . GLU A 1 41  ? -0.030  -25.755 9.126   1.00 1.06 ? 41  GLU A O    3  
ATOM 4415  C CB   . GLU A 1 41  ? -1.478  -24.072 7.512   1.00 0.98 ? 41  GLU A CB   3  
ATOM 4416  C CG   . GLU A 1 41  ? -2.502  -23.255 6.735   1.00 1.31 ? 41  GLU A CG   3  
ATOM 4417  C CD   . GLU A 1 41  ? -2.323  -23.359 5.235   1.00 1.55 ? 41  GLU A CD   3  
ATOM 4418  O OE1  . GLU A 1 41  ? -1.243  -22.990 4.734   1.00 1.89 ? 41  GLU A OE1  3  
ATOM 4419  O OE2  . GLU A 1 41  ? -3.269  -23.798 4.546   1.00 2.17 ? 41  GLU A OE2  3  
ATOM 4420  H H    . GLU A 1 41  ? -0.622  -22.060 9.110   1.00 0.89 ? 41  GLU A H    3  
ATOM 4421  N N    . ALA A 1 42  ? -0.376  -24.578 11.027  1.00 0.89 ? 42  ALA A N    3  
ATOM 4422  C CA   . ALA A 1 42  ? 0.558   -25.349 11.851  1.00 0.98 ? 42  ALA A CA   3  
ATOM 4423  C C    . ALA A 1 42  ? 1.998   -25.211 11.363  1.00 0.90 ? 42  ALA A C    3  
ATOM 4424  O O    . ALA A 1 42  ? 2.480   -26.022 10.569  1.00 0.99 ? 42  ALA A O    3  
ATOM 4425  C CB   . ALA A 1 42  ? 0.144   -26.813 11.956  1.00 1.21 ? 42  ALA A CB   3  
ATOM 4426  H H    . ALA A 1 42  ? -0.863  -23.833 11.437  1.00 0.92 ? 42  ALA A H    3  
ATOM 4427  N N    . PRO A 1 43  ? 2.701   -24.166 11.820  1.00 0.86 ? 43  PRO A N    3  
ATOM 4428  C CA   . PRO A 1 43  ? 4.085   -23.908 11.440  1.00 0.89 ? 43  PRO A CA   3  
ATOM 4429  C C    . PRO A 1 43  ? 5.056   -24.786 12.227  1.00 0.93 ? 43  PRO A C    3  
ATOM 4430  O O    . PRO A 1 43  ? 5.502   -24.415 13.315  1.00 1.08 ? 43  PRO A O    3  
ATOM 4431  C CB   . PRO A 1 43  ? 4.293   -22.426 11.800  1.00 1.03 ? 43  PRO A CB   3  
ATOM 4432  C CG   . PRO A 1 43  ? 2.973   -21.933 12.302  1.00 1.11 ? 43  PRO A CG   3  
ATOM 4433  C CD   . PRO A 1 43  ? 2.206   -23.143 12.744  1.00 0.96 ? 43  PRO A CD   3  
ATOM 4434  N N    . GLU A 1 44  ? 5.359   -25.952 11.675  1.00 0.91 ? 44  GLU A N    3  
ATOM 4435  C CA   . GLU A 1 44  ? 6.270   -26.897 12.307  1.00 0.98 ? 44  GLU A CA   3  
ATOM 4436  C C    . GLU A 1 44  ? 7.682   -26.323 12.367  1.00 0.98 ? 44  GLU A C    3  
ATOM 4437  O O    . GLU A 1 44  ? 8.260   -26.177 13.444  1.00 1.13 ? 44  GLU A O    3  
ATOM 4438  C CB   . GLU A 1 44  ? 6.269   -28.219 11.534  1.00 1.06 ? 44  GLU A CB   3  
ATOM 4439  C CG   . GLU A 1 44  ? 7.329   -29.211 11.983  1.00 1.34 ? 44  GLU A CG   3  
ATOM 4440  C CD   . GLU A 1 44  ? 7.570   -30.308 10.968  1.00 1.59 ? 44  GLU A CD   3  
ATOM 4441  O OE1  . GLU A 1 44  ? 7.038   -30.219 9.841   1.00 1.91 ? 44  GLU A OE1  3  
ATOM 4442  O OE2  . GLU A 1 44  ? 8.290   -31.270 11.297  1.00 2.13 ? 44  GLU A OE2  3  
ATOM 4443  H H    . GLU A 1 44  ? 4.962   -26.182 10.806  1.00 0.91 ? 44  GLU A H    3  
ATOM 4444  N N    . LEU A 1 45  ? 8.226   -25.991 11.205  1.00 0.93 ? 45  LEU A N    3  
ATOM 4445  C CA   . LEU A 1 45  ? 9.565   -25.436 11.117  1.00 0.99 ? 45  LEU A CA   3  
ATOM 4446  C C    . LEU A 1 45  ? 9.508   -23.942 10.831  1.00 0.93 ? 45  LEU A C    3  
ATOM 4447  O O    . LEU A 1 45  ? 10.011  -23.138 11.614  1.00 0.96 ? 45  LEU A O    3  
ATOM 4448  C CB   . LEU A 1 45  ? 10.375  -26.150 10.034  1.00 1.11 ? 45  LEU A CB   3  
ATOM 4449  C CG   . LEU A 1 45  ? 10.629  -27.641 10.258  1.00 1.39 ? 45  LEU A CG   3  
ATOM 4450  C CD1  . LEU A 1 45  ? 11.256  -28.264 9.021   1.00 1.65 ? 45  LEU A CD1  3  
ATOM 4451  C CD2  . LEU A 1 45  ? 11.509  -27.863 11.482  1.00 1.60 ? 45  LEU A CD2  3  
ATOM 4452  H H    . LEU A 1 45  ? 7.707   -26.120 10.383  1.00 0.92 ? 45  LEU A H    3  
ATOM 4453  N N    . ALA A 1 46  ? 8.885   -23.589 9.705   1.00 0.93 ? 46  ALA A N    3  
ATOM 4454  C CA   . ALA A 1 46  ? 8.741   -22.194 9.282   1.00 0.95 ? 46  ALA A CA   3  
ATOM 4455  C C    . ALA A 1 46  ? 10.092  -21.517 9.048   1.00 0.89 ? 46  ALA A C    3  
ATOM 4456  O O    . ALA A 1 46  ? 11.144  -22.154 9.133   1.00 1.04 ? 46  ALA A O    3  
ATOM 4457  C CB   . ALA A 1 46  ? 7.882   -21.399 10.258  1.00 1.03 ? 46  ALA A CB   3  
ATOM 4458  H H    . ALA A 1 46  ? 8.513   -24.292 9.130   1.00 0.98 ? 46  ALA A H    3  
ATOM 4459  N N    . LEU A 1 47  ? 10.057  -20.230 8.737   1.00 0.83 ? 47  LEU A N    3  
ATOM 4460  C CA   . LEU A 1 47  ? 11.272  -19.471 8.491   1.00 0.78 ? 47  LEU A CA   3  
ATOM 4461  C C    . LEU A 1 47  ? 11.088  -18.014 8.889   1.00 0.69 ? 47  LEU A C    3  
ATOM 4462  O O    . LEU A 1 47  ? 10.179  -17.336 8.404   1.00 0.75 ? 47  LEU A O    3  
ATOM 4463  C CB   . LEU A 1 47  ? 11.672  -19.562 7.015   1.00 0.89 ? 47  LEU A CB   3  
ATOM 4464  C CG   . LEU A 1 47  ? 12.973  -18.859 6.622   1.00 0.92 ? 47  LEU A CG   3  
ATOM 4465  C CD1  . LEU A 1 47  ? 14.179  -19.589 7.197   1.00 1.06 ? 47  LEU A CD1  3  
ATOM 4466  C CD2  . LEU A 1 47  ? 13.086  -18.733 5.111   1.00 1.09 ? 47  LEU A CD2  3  
ATOM 4467  H H    . LEU A 1 47  ? 9.189   -19.778 8.666   1.00 0.92 ? 47  LEU A H    3  
ATOM 4468  N N    . ASP A 1 48  ? 11.936  -17.540 9.786   1.00 0.69 ? 48  ASP A N    3  
ATOM 4469  C CA   . ASP A 1 48  ? 11.875  -16.155 10.235  1.00 0.67 ? 48  ASP A CA   3  
ATOM 4470  C C    . ASP A 1 48  ? 13.241  -15.506 10.067  1.00 0.61 ? 48  ASP A C    3  
ATOM 4471  O O    . ASP A 1 48  ? 14.166  -15.788 10.831  1.00 0.63 ? 48  ASP A O    3  
ATOM 4472  C CB   . ASP A 1 48  ? 11.432  -16.072 11.697  1.00 0.79 ? 48  ASP A CB   3  
ATOM 4473  C CG   . ASP A 1 48  ? 10.839  -14.722 12.059  1.00 1.00 ? 48  ASP A CG   3  
ATOM 4474  O OD1  . ASP A 1 48  ? 11.378  -13.680 11.617  1.00 1.31 ? 48  ASP A OD1  3  
ATOM 4475  O OD2  . ASP A 1 48  ? 9.824   -14.693 12.788  1.00 1.64 ? 48  ASP A OD2  3  
ATOM 4476  H H    . ASP A 1 48  ? 12.624  -18.134 10.156  1.00 0.81 ? 48  ASP A H    3  
ATOM 4477  N N    . PRO A 1 49  ? 13.391  -14.653 9.043   1.00 0.64 ? 49  PRO A N    3  
ATOM 4478  C CA   . PRO A 1 49  ? 14.657  -13.969 8.762   1.00 0.66 ? 49  PRO A CA   3  
ATOM 4479  C C    . PRO A 1 49  ? 14.957  -12.858 9.770   1.00 0.58 ? 49  PRO A C    3  
ATOM 4480  O O    . PRO A 1 49  ? 16.087  -12.375 9.848   1.00 0.63 ? 49  PRO A O    3  
ATOM 4481  C CB   . PRO A 1 49  ? 14.434  -13.380 7.364   1.00 0.80 ? 49  PRO A CB   3  
ATOM 4482  C CG   . PRO A 1 49  ? 12.960  -13.186 7.270   1.00 0.93 ? 49  PRO A CG   3  
ATOM 4483  C CD   . PRO A 1 49  ? 12.337  -14.294 8.074   1.00 0.76 ? 49  PRO A CD   3  
ATOM 4484  N N    . VAL A 1 50  ? 13.937  -12.480 10.545  1.00 0.56 ? 50  VAL A N    3  
ATOM 4485  C CA   . VAL A 1 50  ? 14.058  -11.424 11.552  1.00 0.58 ? 50  VAL A CA   3  
ATOM 4486  C C    . VAL A 1 50  ? 14.560  -10.112 10.943  1.00 0.57 ? 50  VAL A C    3  
ATOM 4487  O O    . VAL A 1 50  ? 15.768  -9.883  10.846  1.00 0.62 ? 50  VAL A O    3  
ATOM 4488  C CB   . VAL A 1 50  ? 14.956  -11.841 12.738  1.00 0.64 ? 50  VAL A CB   3  
ATOM 4489  C CG1  . VAL A 1 50  ? 14.971  -10.760 13.810  1.00 0.75 ? 50  VAL A CG1  3  
ATOM 4490  C CG2  . VAL A 1 50  ? 14.486  -13.163 13.325  1.00 0.75 ? 50  VAL A CG2  3  
ATOM 4491  H H    . VAL A 1 50  ? 13.074  -12.937 10.447  1.00 0.60 ? 50  VAL A H    3  
ATOM 4492  N N    . PRO A 1 51  ? 13.634  -9.243  10.510  1.00 0.60 ? 51  PRO A N    3  
ATOM 4493  C CA   . PRO A 1 51  ? 13.980  -7.950  9.909   1.00 0.65 ? 51  PRO A CA   3  
ATOM 4494  C C    . PRO A 1 51  ? 14.766  -7.083  10.888  1.00 0.66 ? 51  PRO A C    3  
ATOM 4495  O O    . PRO A 1 51  ? 14.318  -6.831  12.008  1.00 0.73 ? 51  PRO A O    3  
ATOM 4496  C CB   . PRO A 1 51  ? 12.618  -7.309  9.615   1.00 0.77 ? 51  PRO A CB   3  
ATOM 4497  C CG   . PRO A 1 51  ? 11.663  -8.450  9.579   1.00 0.92 ? 51  PRO A CG   3  
ATOM 4498  C CD   . PRO A 1 51  ? 12.177  -9.444  10.577  1.00 0.72 ? 51  PRO A CD   3  
ATOM 4499  N N    . GLN A 1 52  ? 15.940  -6.635  10.467  1.00 0.71 ? 52  GLN A N    3  
ATOM 4500  C CA   . GLN A 1 52  ? 16.790  -5.814  11.320  1.00 0.81 ? 52  GLN A CA   3  
ATOM 4501  C C    . GLN A 1 52  ? 16.583  -4.324  11.069  1.00 0.77 ? 52  GLN A C    3  
ATOM 4502  O O    . GLN A 1 52  ? 17.189  -3.482  11.739  1.00 0.91 ? 52  GLN A O    3  
ATOM 4503  C CB   . GLN A 1 52  ? 18.259  -6.188  11.122  1.00 0.97 ? 52  GLN A CB   3  
ATOM 4504  C CG   . GLN A 1 52  ? 18.621  -7.569  11.641  1.00 1.18 ? 52  GLN A CG   3  
ATOM 4505  C CD   . GLN A 1 52  ? 18.432  -7.697  13.141  1.00 1.30 ? 52  GLN A CD   3  
ATOM 4506  O OE1  . GLN A 1 52  ? 18.572  -6.724  13.885  1.00 1.40 ? 52  GLN A OE1  3  
ATOM 4507  N NE2  . GLN A 1 52  ? 18.119  -8.898  13.597  1.00 1.51 ? 52  GLN A NE2  3  
ATOM 4508  H H    . GLN A 1 52  ? 16.251  -6.875  9.565   1.00 0.75 ? 52  GLN A H    3  
ATOM 4509  H HE21 . GLN A 1 52  ? 18.025  -9.632  12.949  1.00 1.58 ? 52  GLN A HE21 3  
ATOM 4510  H HE22 . GLN A 1 52  ? 18.001  -9.010  14.562  1.00 1.68 ? 52  GLN A HE22 3  
ATOM 4511  N N    . ASP A 1 53  ? 15.729  -4.001  10.114  1.00 0.67 ? 53  ASP A N    3  
ATOM 4512  C CA   . ASP A 1 53  ? 15.449  -2.610  9.791   1.00 0.64 ? 53  ASP A CA   3  
ATOM 4513  C C    . ASP A 1 53  ? 14.274  -2.090  10.609  1.00 0.62 ? 53  ASP A C    3  
ATOM 4514  O O    . ASP A 1 53  ? 13.218  -2.722  10.674  1.00 0.63 ? 53  ASP A O    3  
ATOM 4515  C CB   . ASP A 1 53  ? 15.171  -2.429  8.297   1.00 0.64 ? 53  ASP A CB   3  
ATOM 4516  C CG   . ASP A 1 53  ? 14.773  -1.007  7.958   1.00 0.60 ? 53  ASP A CG   3  
ATOM 4517  O OD1  . ASP A 1 53  ? 15.515  -0.071  8.321   1.00 0.78 ? 53  ASP A OD1  3  
ATOM 4518  O OD2  . ASP A 1 53  ? 13.714  -0.813  7.327   1.00 0.69 ? 53  ASP A OD2  3  
ATOM 4519  H H    . ASP A 1 53  ? 15.266  -4.712  9.625   1.00 0.69 ? 53  ASP A H    3  
ATOM 4520  N N    . ALA A 1 54  ? 14.465  -0.941  11.237  1.00 0.63 ? 54  ALA A N    3  
ATOM 4521  C CA   . ALA A 1 54  ? 13.423  -0.337  12.052  1.00 0.64 ? 54  ALA A CA   3  
ATOM 4522  C C    . ALA A 1 54  ? 12.614  0.666   11.240  1.00 0.60 ? 54  ALA A C    3  
ATOM 4523  O O    . ALA A 1 54  ? 11.491  1.010   11.607  1.00 0.60 ? 54  ALA A O    3  
ATOM 4524  C CB   . ALA A 1 54  ? 14.027  0.332   13.276  1.00 0.71 ? 54  ALA A CB   3  
ATOM 4525  H H    . ALA A 1 54  ? 15.328  -0.482  11.146  1.00 0.67 ? 54  ALA A H    3  
ATOM 4526  N N    . SER A 1 55  ? 13.190  1.122   10.132  1.00 0.58 ? 55  SER A N    3  
ATOM 4527  C CA   . SER A 1 55  ? 12.534  2.090   9.262   1.00 0.57 ? 55  SER A CA   3  
ATOM 4528  C C    . SER A 1 55  ? 11.230  1.529   8.705   1.00 0.52 ? 55  SER A C    3  
ATOM 4529  O O    . SER A 1 55  ? 10.173  2.152   8.832   1.00 0.51 ? 55  SER A O    3  
ATOM 4530  C CB   . SER A 1 55  ? 13.473  2.491   8.123   1.00 0.59 ? 55  SER A CB   3  
ATOM 4531  O OG   . SER A 1 55  ? 14.826  2.424   8.546   1.00 0.67 ? 55  SER A OG   3  
ATOM 4532  H H    . SER A 1 55  ? 14.085  0.799   9.893   1.00 0.60 ? 55  SER A H    3  
ATOM 4533  H HG   . SER A 1 55  ? 15.141  1.505   8.465   1.00 0.67 ? 55  SER A HG   3  
ATOM 4534  N N    . THR A 1 56  ? 11.305  0.348   8.097   1.00 0.51 ? 56  THR A N    3  
ATOM 4535  C CA   . THR A 1 56  ? 10.127  -0.296  7.533   1.00 0.49 ? 56  THR A CA   3  
ATOM 4536  C C    . THR A 1 56  ? 9.125   -0.635  8.634   1.00 0.48 ? 56  THR A C    3  
ATOM 4537  O O    . THR A 1 56  ? 7.912   -0.562  8.432   1.00 0.47 ? 56  THR A O    3  
ATOM 4538  C CB   . THR A 1 56  ? 10.495  -1.572  6.751   1.00 0.50 ? 56  THR A CB   3  
ATOM 4539  O OG1  . THR A 1 56  ? 11.554  -2.262  7.428   1.00 0.57 ? 56  THR A OG1  3  
ATOM 4540  C CG2  . THR A 1 56  ? 10.944  -1.219  5.342   1.00 0.63 ? 56  THR A CG2  3  
ATOM 4541  H H    . THR A 1 56  ? 12.182  -0.098  8.017   1.00 0.52 ? 56  THR A H    3  
ATOM 4542  H HG1  . THR A 1 56  ? 12.394  -1.799  7.273   1.00 0.55 ? 56  THR A HG1  3  
ATOM 4543  N N    . LYS A 1 57  ? 9.649   -0.987  9.804   1.00 0.50 ? 57  LYS A N    3  
ATOM 4544  C CA   . LYS A 1 57  ? 8.813   -1.319  10.949  1.00 0.52 ? 57  LYS A CA   3  
ATOM 4545  C C    . LYS A 1 57  ? 8.021   -0.091  11.388  1.00 0.52 ? 57  LYS A C    3  
ATOM 4546  O O    . LYS A 1 57  ? 6.819   -0.172  11.635  1.00 0.53 ? 57  LYS A O    3  
ATOM 4547  C CB   . LYS A 1 57  ? 9.671   -1.851  12.104  1.00 0.56 ? 57  LYS A CB   3  
ATOM 4548  C CG   . LYS A 1 57  ? 8.883   -2.245  13.342  1.00 1.01 ? 57  LYS A CG   3  
ATOM 4549  C CD   . LYS A 1 57  ? 9.768   -2.937  14.367  1.00 1.09 ? 57  LYS A CD   3  
ATOM 4550  C CE   . LYS A 1 57  ? 10.129  -4.348  13.930  1.00 1.30 ? 57  LYS A CE   3  
ATOM 4551  N NZ   . LYS A 1 57  ? 10.803  -5.100  15.013  1.00 1.59 ? 57  LYS A NZ   3  
ATOM 4552  H H    . LYS A 1 57  ? 10.625  -1.030  9.895   1.00 0.52 ? 57  LYS A H    3  
ATOM 4553  H HZ1  . LYS A 1 57  ? 10.905  -6.101  14.745  1.00 1.92 ? 57  LYS A HZ1  3  
ATOM 4554  H HZ2  . LYS A 1 57  ? 10.250  -5.041  15.888  1.00 1.99 ? 57  LYS A HZ2  3  
ATOM 4555  H HZ3  . LYS A 1 57  ? 11.747  -4.707  15.187  1.00 1.99 ? 57  LYS A HZ3  3  
ATOM 4556  N N    . LYS A 1 58  ? 8.705   1.048   11.468  1.00 0.54 ? 58  LYS A N    3  
ATOM 4557  C CA   . LYS A 1 58  ? 8.070   2.303   11.857  1.00 0.56 ? 58  LYS A CA   3  
ATOM 4558  C C    . LYS A 1 58  ? 6.990   2.680   10.847  1.00 0.54 ? 58  LYS A C    3  
ATOM 4559  O O    . LYS A 1 58  ? 5.885   3.080   11.221  1.00 0.55 ? 58  LYS A O    3  
ATOM 4560  C CB   . LYS A 1 58  ? 9.113   3.423   11.965  1.00 0.60 ? 58  LYS A CB   3  
ATOM 4561  C CG   . LYS A 1 58  ? 8.523   4.790   12.275  1.00 0.70 ? 58  LYS A CG   3  
ATOM 4562  C CD   . LYS A 1 58  ? 9.594   5.865   12.353  1.00 0.76 ? 58  LYS A CD   3  
ATOM 4563  C CE   . LYS A 1 58  ? 8.970   7.233   12.579  1.00 1.16 ? 58  LYS A CE   3  
ATOM 4564  N NZ   . LYS A 1 58  ? 9.990   8.273   12.870  1.00 1.32 ? 58  LYS A NZ   3  
ATOM 4565  H H    . LYS A 1 58  ? 9.670   1.041   11.268  1.00 0.54 ? 58  LYS A H    3  
ATOM 4566  H HZ1  . LYS A 1 58  ? 10.682  7.915   13.556  1.00 1.74 ? 58  LYS A HZ1  3  
ATOM 4567  H HZ2  . LYS A 1 58  ? 9.534   9.118   13.267  1.00 1.67 ? 58  LYS A HZ2  3  
ATOM 4568  H HZ3  . LYS A 1 58  ? 10.488  8.543   11.997  1.00 1.54 ? 58  LYS A HZ3  3  
ATOM 4569  N N    . LEU A 1 59  ? 7.314   2.531   9.567   1.00 0.52 ? 59  LEU A N    3  
ATOM 4570  C CA   . LEU A 1 59  ? 6.377   2.841   8.495   1.00 0.51 ? 59  LEU A CA   3  
ATOM 4571  C C    . LEU A 1 59  ? 5.135   1.963   8.592   1.00 0.50 ? 59  LEU A C    3  
ATOM 4572  O O    . LEU A 1 59  ? 4.010   2.449   8.480   1.00 0.51 ? 59  LEU A O    3  
ATOM 4573  C CB   . LEU A 1 59  ? 7.044   2.674   7.127   1.00 0.50 ? 59  LEU A CB   3  
ATOM 4574  C CG   . LEU A 1 59  ? 7.979   3.805   6.697   1.00 0.56 ? 59  LEU A CG   3  
ATOM 4575  C CD1  . LEU A 1 59  ? 8.745   3.420   5.439   1.00 0.55 ? 59  LEU A CD1  3  
ATOM 4576  C CD2  . LEU A 1 59  ? 7.197   5.092   6.477   1.00 0.72 ? 59  LEU A CD2  3  
ATOM 4577  H H    . LEU A 1 59  ? 8.214   2.208   9.337   1.00 0.52 ? 59  LEU A H    3  
ATOM 4578  N N    . SER A 1 60  ? 5.346   0.674   8.824   1.00 0.50 ? 60  SER A N    3  
ATOM 4579  C CA   . SER A 1 60  ? 4.242   -0.267  8.948   1.00 0.50 ? 60  SER A CA   3  
ATOM 4580  C C    . SER A 1 60  ? 3.396   0.053   10.177  1.00 0.51 ? 60  SER A C    3  
ATOM 4581  O O    . SER A 1 60  ? 2.170   0.014   10.120  1.00 0.53 ? 60  SER A O    3  
ATOM 4582  C CB   . SER A 1 60  ? 4.765   -1.707  9.011   1.00 0.50 ? 60  SER A CB   3  
ATOM 4583  O OG   . SER A 1 60  ? 5.643   -1.980  7.929   1.00 0.50 ? 60  SER A OG   3  
ATOM 4584  H H    . SER A 1 60  ? 6.266   0.347   8.912   1.00 0.51 ? 60  SER A H    3  
ATOM 4585  H HG   . SER A 1 60  ? 6.483   -1.525  8.074   1.00 0.49 ? 60  SER A HG   3  
ATOM 4586  N N    . GLU A 1 61  ? 4.063   0.398   11.276  1.00 0.52 ? 61  GLU A N    3  
ATOM 4587  C CA   . GLU A 1 61  ? 3.382   0.726   12.522  1.00 0.55 ? 61  GLU A CA   3  
ATOM 4588  C C    . GLU A 1 61  ? 2.504   1.965   12.368  1.00 0.55 ? 61  GLU A C    3  
ATOM 4589  O O    . GLU A 1 61  ? 1.325   1.941   12.727  1.00 0.57 ? 61  GLU A O    3  
ATOM 4590  C CB   . GLU A 1 61  ? 4.398   0.921   13.653  1.00 0.60 ? 61  GLU A CB   3  
ATOM 4591  C CG   . GLU A 1 61  ? 3.984   0.305   14.981  1.00 0.81 ? 61  GLU A CG   3  
ATOM 4592  C CD   . GLU A 1 61  ? 2.729   0.932   15.558  1.00 1.12 ? 61  GLU A CD   3  
ATOM 4593  O OE1  . GLU A 1 61  ? 2.665   2.179   15.628  1.00 1.35 ? 61  GLU A OE1  3  
ATOM 4594  O OE2  . GLU A 1 61  ? 1.808   0.184   15.944  1.00 1.50 ? 61  GLU A OE2  3  
ATOM 4595  H H    . GLU A 1 61  ? 5.047   0.430   11.250  1.00 0.52 ? 61  GLU A H    3  
ATOM 4596  N N    . CYS A 1 62  ? 3.067   3.040   11.818  1.00 0.55 ? 62  CYS A N    3  
ATOM 4597  C CA   . CYS A 1 62  ? 2.310   4.274   11.634  1.00 0.57 ? 62  CYS A CA   3  
ATOM 4598  C C    . CYS A 1 62  ? 1.086   4.059   10.748  1.00 0.56 ? 62  CYS A C    3  
ATOM 4599  O O    . CYS A 1 62  ? 0.026   4.633   10.997  1.00 0.60 ? 62  CYS A O    3  
ATOM 4600  C CB   . CYS A 1 62  ? 3.184   5.433   11.140  1.00 0.60 ? 62  CYS A CB   3  
ATOM 4601  S SG   . CYS A 1 62  ? 3.926   5.217   9.508   1.00 0.59 ? 62  CYS A SG   3  
ATOM 4602  H H    . CYS A 1 62  ? 4.012   3.004   11.543  1.00 0.55 ? 62  CYS A H    3  
ATOM 4603  H HG   . CYS A 1 62  ? 3.820   3.940   9.168   1.00 0.98 ? 62  CYS A HG   3  
ATOM 4604  N N    . LEU A 1 63  ? 1.228   3.215   9.734   1.00 0.52 ? 63  LEU A N    3  
ATOM 4605  C CA   . LEU A 1 63  ? 0.120   2.916   8.839   1.00 0.53 ? 63  LEU A CA   3  
ATOM 4606  C C    . LEU A 1 63  ? -0.886  2.014   9.545   1.00 0.52 ? 63  LEU A C    3  
ATOM 4607  O O    . LEU A 1 63  ? -2.095  2.148   9.358   1.00 0.53 ? 63  LEU A O    3  
ATOM 4608  C CB   . LEU A 1 63  ? 0.620   2.248   7.555   1.00 0.53 ? 63  LEU A CB   3  
ATOM 4609  C CG   . LEU A 1 63  ? 1.464   3.119   6.620   1.00 0.55 ? 63  LEU A CG   3  
ATOM 4610  C CD1  . LEU A 1 63  ? 1.955   2.305   5.433   1.00 0.57 ? 63  LEU A CD1  3  
ATOM 4611  C CD2  . LEU A 1 63  ? 0.672   4.331   6.153   1.00 0.62 ? 63  LEU A CD2  3  
ATOM 4612  H H    . LEU A 1 63  ? 2.096   2.783   9.585   1.00 0.50 ? 63  LEU A H    3  
ATOM 4613  N N    . LYS A 1 64  ? -0.369  1.106   10.365  1.00 0.52 ? 64  LYS A N    3  
ATOM 4614  C CA   . LYS A 1 64  ? -1.194  0.170   11.120  1.00 0.54 ? 64  LYS A CA   3  
ATOM 4615  C C    . LYS A 1 64  ? -2.155  0.901   12.049  1.00 0.54 ? 64  LYS A C    3  
ATOM 4616  O O    . LYS A 1 64  ? -3.349  0.608   12.071  1.00 0.54 ? 64  LYS A O    3  
ATOM 4617  C CB   . LYS A 1 64  ? -0.306  -0.788  11.922  1.00 0.59 ? 64  LYS A CB   3  
ATOM 4618  C CG   . LYS A 1 64  ? -1.034  -1.579  12.999  1.00 0.71 ? 64  LYS A CG   3  
ATOM 4619  C CD   . LYS A 1 64  ? -0.055  -2.197  13.986  1.00 0.88 ? 64  LYS A CD   3  
ATOM 4620  C CE   . LYS A 1 64  ? 0.203   -3.661  13.671  1.00 0.86 ? 64  LYS A CE   3  
ATOM 4621  N NZ   . LYS A 1 64  ? -0.935  -4.526  14.078  1.00 0.78 ? 64  LYS A NZ   3  
ATOM 4622  H H    . LYS A 1 64  ? 0.608   1.056   10.461  1.00 0.52 ? 64  LYS A H    3  
ATOM 4623  H HZ1  . LYS A 1 64  ? -1.833  -4.115  13.758  1.00 0.95 ? 64  LYS A HZ1  3  
ATOM 4624  H HZ2  . LYS A 1 64  ? -0.960  -4.625  15.111  1.00 1.03 ? 64  LYS A HZ2  3  
ATOM 4625  H HZ3  . LYS A 1 64  ? -0.833  -5.478  13.652  1.00 0.96 ? 64  LYS A HZ3  3  
ATOM 4626  N N    . ARG A 1 65  ? -1.635  1.857   12.811  1.00 0.57 ? 65  ARG A N    3  
ATOM 4627  C CA   . ARG A 1 65  ? -2.463  2.613   13.743  1.00 0.59 ? 65  ARG A CA   3  
ATOM 4628  C C    . ARG A 1 65  ? -3.506  3.472   13.026  1.00 0.57 ? 65  ARG A C    3  
ATOM 4629  O O    . ARG A 1 65  ? -4.660  3.539   13.451  1.00 0.60 ? 65  ARG A O    3  
ATOM 4630  C CB   . ARG A 1 65  ? -1.622  3.419   14.738  1.00 0.66 ? 65  ARG A CB   3  
ATOM 4631  C CG   . ARG A 1 65  ? -0.581  4.330   14.112  1.00 0.66 ? 65  ARG A CG   3  
ATOM 4632  C CD   . ARG A 1 65  ? 0.609   4.529   15.035  1.00 0.75 ? 65  ARG A CD   3  
ATOM 4633  N NE   . ARG A 1 65  ? 0.213   5.054   16.339  1.00 0.86 ? 65  ARG A NE   3  
ATOM 4634  C CZ   . ARG A 1 65  ? 0.609   4.541   17.501  1.00 1.00 ? 65  ARG A CZ   3  
ATOM 4635  N NH1  . ARG A 1 65  ? 1.422   3.495   17.539  1.00 1.05 ? 65  ARG A NH1  3  
ATOM 4636  N NH2  . ARG A 1 65  ? 0.185   5.077   18.641  1.00 1.19 ? 65  ARG A NH2  3  
ATOM 4637  H H    . ARG A 1 65  ? -0.671  2.051   12.753  1.00 0.58 ? 65  ARG A H    3  
ATOM 4638  H HE   . ARG A 1 65  ? -0.388  5.832   16.346  1.00 0.91 ? 65  ARG A HE   3  
ATOM 4639  H HH11 . ARG A 1 65  ? 1.755   3.070   16.677  1.00 0.95 ? 65  ARG A HH11 3  
ATOM 4640  H HH12 . ARG A 1 65  ? 1.712   3.118   18.419  1.00 1.24 ? 65  ARG A HH12 3  
ATOM 4641  H HH21 . ARG A 1 65  ? -0.436  5.863   18.630  1.00 1.21 ? 65  ARG A HH21 3  
ATOM 4642  H HH22 . ARG A 1 65  ? 0.489   4.694   19.519  1.00 1.36 ? 65  ARG A HH22 3  
ATOM 4643  N N    . ILE A 1 66  ? -3.106  4.098   11.924  1.00 0.53 ? 66  ILE A N    3  
ATOM 4644  C CA   . ILE A 1 66  ? -4.017  4.938   11.154  1.00 0.52 ? 66  ILE A CA   3  
ATOM 4645  C C    . ILE A 1 66  ? -5.112  4.085   10.510  1.00 0.48 ? 66  ILE A C    3  
ATOM 4646  O O    . ILE A 1 66  ? -6.300  4.395   10.620  1.00 0.48 ? 66  ILE A O    3  
ATOM 4647  C CB   . ILE A 1 66  ? -3.275  5.758   10.069  1.00 0.54 ? 66  ILE A CB   3  
ATOM 4648  C CG1  . ILE A 1 66  ? -2.306  6.753   10.721  1.00 0.59 ? 66  ILE A CG1  3  
ATOM 4649  C CG2  . ILE A 1 66  ? -4.263  6.491   9.170   1.00 0.55 ? 66  ILE A CG2  3  
ATOM 4650  C CD1  . ILE A 1 66  ? -1.431  7.501   9.735   1.00 0.62 ? 66  ILE A CD1  3  
ATOM 4651  H H    . ILE A 1 66  ? -2.181  3.988   11.617  1.00 0.54 ? 66  ILE A H    3  
ATOM 4652  N N    . GLY A 1 67  ? -4.705  2.990   9.870   1.00 0.47 ? 67  GLY A N    3  
ATOM 4653  C CA   . GLY A 1 67  ? -5.656  2.101   9.226   1.00 0.45 ? 67  GLY A CA   3  
ATOM 4654  C C    . GLY A 1 67  ? -6.565  1.415   10.225  1.00 0.45 ? 67  GLY A C    3  
ATOM 4655  O O    . GLY A 1 67  ? -7.680  1.009   9.894   1.00 0.44 ? 67  GLY A O    3  
ATOM 4656  H H    . GLY A 1 67  ? -3.745  2.783   9.832   1.00 0.49 ? 67  GLY A H    3  
ATOM 4657  N N    . ASP A 1 68  ? -6.085  1.285   11.454  1.00 0.50 ? 68  ASP A N    3  
ATOM 4658  C CA   . ASP A 1 68  ? -6.859  0.655   12.516  1.00 0.55 ? 68  ASP A CA   3  
ATOM 4659  C C    . ASP A 1 68  ? -7.959  1.589   12.998  1.00 0.54 ? 68  ASP A C    3  
ATOM 4660  O O    . ASP A 1 68  ? -9.087  1.163   13.251  1.00 0.55 ? 68  ASP A O    3  
ATOM 4661  C CB   . ASP A 1 68  ? -5.957  0.275   13.688  1.00 0.65 ? 68  ASP A CB   3  
ATOM 4662  C CG   . ASP A 1 68  ? -6.223  -1.128  14.195  1.00 0.76 ? 68  ASP A CG   3  
ATOM 4663  O OD1  . ASP A 1 68  ? -5.883  -2.096  13.479  1.00 0.95 ? 68  ASP A OD1  3  
ATOM 4664  O OD2  . ASP A 1 68  ? -6.758  -1.272  15.315  1.00 1.13 ? 68  ASP A OD2  3  
ATOM 4665  H H    . ASP A 1 68  ? -5.181  1.610   11.648  1.00 0.53 ? 68  ASP A H    3  
ATOM 4666  N N    . GLU A 1 69  ? -7.625  2.869   13.125  1.00 0.55 ? 69  GLU A N    3  
ATOM 4667  C CA   . GLU A 1 69  ? -8.586  3.873   13.565  1.00 0.58 ? 69  GLU A CA   3  
ATOM 4668  C C    . GLU A 1 69  ? -9.620  4.152   12.478  1.00 0.53 ? 69  GLU A C    3  
ATOM 4669  O O    . GLU A 1 69  ? -10.769 4.482   12.767  1.00 0.58 ? 69  GLU A O    3  
ATOM 4670  C CB   . GLU A 1 69  ? -7.878  5.161   13.987  1.00 0.63 ? 69  GLU A CB   3  
ATOM 4671  C CG   . GLU A 1 69  ? -7.160  5.049   15.321  1.00 0.89 ? 69  GLU A CG   3  
ATOM 4672  C CD   . GLU A 1 69  ? -6.460  6.329   15.733  1.00 1.22 ? 69  GLU A CD   3  
ATOM 4673  O OE1  . GLU A 1 69  ? -7.111  7.205   16.341  1.00 1.81 ? 69  GLU A OE1  3  
ATOM 4674  O OE2  . GLU A 1 69  ? -5.246  6.452   15.479  1.00 1.90 ? 69  GLU A OE2  3  
ATOM 4675  H H    . GLU A 1 69  ? -6.704  3.144   12.928  1.00 0.56 ? 69  GLU A H    3  
ATOM 4676  N N    . LEU A 1 70  ? -9.209  3.990   11.223  1.00 0.48 ? 70  LEU A N    3  
ATOM 4677  C CA   . LEU A 1 70  ? -10.099 4.207   10.084  1.00 0.46 ? 70  LEU A CA   3  
ATOM 4678  C C    . LEU A 1 70  ? -11.112 3.070   9.970   1.00 0.41 ? 70  LEU A C    3  
ATOM 4679  O O    . LEU A 1 70  ? -11.985 3.079   9.097   1.00 0.38 ? 70  LEU A O    3  
ATOM 4680  C CB   . LEU A 1 70  ? -9.293  4.327   8.787   1.00 0.45 ? 70  LEU A CB   3  
ATOM 4681  C CG   . LEU A 1 70  ? -8.530  5.637   8.574   1.00 0.51 ? 70  LEU A CG   3  
ATOM 4682  C CD1  . LEU A 1 70  ? -7.597  5.521   7.379   1.00 0.51 ? 70  LEU A CD1  3  
ATOM 4683  C CD2  . LEU A 1 70  ? -9.496  6.796   8.385   1.00 0.59 ? 70  LEU A CD2  3  
ATOM 4684  H H    . LEU A 1 70  ? -8.278  3.725   11.058  1.00 0.48 ? 70  LEU A H    3  
ATOM 4685  N N    . ASP A 1 71  ? -10.981 2.086   10.848  1.00 0.43 ? 71  ASP A N    3  
ATOM 4686  C CA   . ASP A 1 71  ? -11.880 0.940   10.867  1.00 0.41 ? 71  ASP A CA   3  
ATOM 4687  C C    . ASP A 1 71  ? -12.840 1.048   12.050  1.00 0.43 ? 71  ASP A C    3  
ATOM 4688  O O    . ASP A 1 71  ? -13.779 0.262   12.184  1.00 0.48 ? 71  ASP A O    3  
ATOM 4689  C CB   . ASP A 1 71  ? -11.075 -0.362  10.947  1.00 0.46 ? 71  ASP A CB   3  
ATOM 4690  C CG   . ASP A 1 71  ? -11.919 -1.601  10.705  1.00 0.54 ? 71  ASP A CG   3  
ATOM 4691  O OD1  . ASP A 1 71  ? -12.688 -1.615  9.721   1.00 0.61 ? 71  ASP A OD1  3  
ATOM 4692  O OD2  . ASP A 1 71  ? -11.810 -2.562  11.495  1.00 1.07 ? 71  ASP A OD2  3  
ATOM 4693  H H    . ASP A 1 71  ? -10.251 2.129   11.502  1.00 0.48 ? 71  ASP A H    3  
ATOM 4694  N N    . SER A 1 72  ? -12.603 2.039   12.900  1.00 0.46 ? 72  SER A N    3  
ATOM 4695  C CA   . SER A 1 72  ? -13.433 2.265   14.071  1.00 0.50 ? 72  SER A CA   3  
ATOM 4696  C C    . SER A 1 72  ? -14.772 2.891   13.689  1.00 0.47 ? 72  SER A C    3  
ATOM 4697  O O    . SER A 1 72  ? -15.812 2.547   14.253  1.00 0.54 ? 72  SER A O    3  
ATOM 4698  C CB   . SER A 1 72  ? -12.692 3.146   15.080  1.00 0.58 ? 72  SER A CB   3  
ATOM 4699  O OG   . SER A 1 72  ? -11.425 2.585   15.394  1.00 0.65 ? 72  SER A OG   3  
ATOM 4700  H H    . SER A 1 72  ? -11.841 2.637   12.738  1.00 0.49 ? 72  SER A H    3  
ATOM 4701  H HG   . SER A 1 72  ? -11.550 1.694   15.744  1.00 1.14 ? 72  SER A HG   3  
ATOM 4702  N N    . ASN A 1 73  ? -14.745 3.807   12.723  1.00 0.47 ? 73  ASN A N    3  
ATOM 4703  C CA   . ASN A 1 73  ? -15.965 4.468   12.267  1.00 0.47 ? 73  ASN A CA   3  
ATOM 4704  C C    . ASN A 1 73  ? -16.861 3.503   11.498  1.00 0.45 ? 73  ASN A C    3  
ATOM 4705  O O    . ASN A 1 73  ? -16.486 2.995   10.437  1.00 0.45 ? 73  ASN A O    3  
ATOM 4706  C CB   . ASN A 1 73  ? -15.669 5.730   11.441  1.00 0.49 ? 73  ASN A CB   3  
ATOM 4707  C CG   . ASN A 1 73  ? -14.455 5.621   10.530  1.00 0.49 ? 73  ASN A CG   3  
ATOM 4708  O OD1  . ASN A 1 73  ? -13.705 6.579   10.373  1.00 0.70 ? 73  ASN A OD1  3  
ATOM 4709  N ND2  . ASN A 1 73  ? -14.257 4.465   9.914   1.00 0.62 ? 73  ASN A ND2  3  
ATOM 4710  H H    . ASN A 1 73  ? -13.887 4.040   12.306  1.00 0.53 ? 73  ASN A H    3  
ATOM 4711  H HD21 . ASN A 1 73  ? -14.902 3.740   10.069  1.00 0.86 ? 73  ASN A HD21 3  
ATOM 4712  H HD22 . ASN A 1 73  ? -13.469 4.378   9.332   1.00 0.63 ? 73  ASN A HD22 3  
ATOM 4713  N N    . MET A 1 74  ? -18.044 3.255   12.040  1.00 0.48 ? 74  MET A N    3  
ATOM 4714  C CA   . MET A 1 74  ? -18.996 2.336   11.429  1.00 0.49 ? 74  MET A CA   3  
ATOM 4715  C C    . MET A 1 74  ? -19.507 2.837   10.077  1.00 0.47 ? 74  MET A C    3  
ATOM 4716  O O    . MET A 1 74  ? -19.822 2.037   9.200   1.00 0.46 ? 74  MET A O    3  
ATOM 4717  C CB   . MET A 1 74  ? -20.165 2.032   12.374  1.00 0.57 ? 74  MET A CB   3  
ATOM 4718  C CG   . MET A 1 74  ? -21.110 3.202   12.602  1.00 0.78 ? 74  MET A CG   3  
ATOM 4719  S SD   . MET A 1 74  ? -22.489 2.786   13.686  1.00 0.95 ? 74  MET A SD   3  
ATOM 4720  C CE   . MET A 1 74  ? -23.226 1.416   12.795  1.00 1.32 ? 74  MET A CE   3  
ATOM 4721  H H    . MET A 1 74  ? -18.283 3.702   12.883  1.00 0.53 ? 74  MET A H    3  
ATOM 4722  N N    . GLU A 1 75  ? -19.578 4.154   9.911   1.00 0.49 ? 75  GLU A N    3  
ATOM 4723  C CA   . GLU A 1 75  ? -20.054 4.743   8.659   1.00 0.52 ? 75  GLU A CA   3  
ATOM 4724  C C    . GLU A 1 75  ? -19.188 4.324   7.480   1.00 0.48 ? 75  GLU A C    3  
ATOM 4725  O O    . GLU A 1 75  ? -19.674 3.722   6.523   1.00 0.51 ? 75  GLU A O    3  
ATOM 4726  C CB   . GLU A 1 75  ? -20.109 6.268   8.745   1.00 0.61 ? 75  GLU A CB   3  
ATOM 4727  C CG   . GLU A 1 75  ? -20.797 6.796   9.989   1.00 0.72 ? 75  GLU A CG   3  
ATOM 4728  C CD   . GLU A 1 75  ? -19.809 7.147   11.077  1.00 1.09 ? 75  GLU A CD   3  
ATOM 4729  O OE1  . GLU A 1 75  ? -19.345 6.227   11.783  1.00 1.49 ? 75  GLU A OE1  3  
ATOM 4730  O OE2  . GLU A 1 75  ? -19.487 8.340   11.226  1.00 1.63 ? 75  GLU A OE2  3  
ATOM 4731  H H    . GLU A 1 75  ? -19.316 4.749   10.654  1.00 0.51 ? 75  GLU A H    3  
ATOM 4732  N N    . LEU A 1 76  ? -17.898 4.626   7.566   1.00 0.45 ? 76  LEU A N    3  
ATOM 4733  C CA   . LEU A 1 76  ? -16.961 4.290   6.504   1.00 0.44 ? 76  LEU A CA   3  
ATOM 4734  C C    . LEU A 1 76  ? -16.870 2.779   6.304   1.00 0.40 ? 76  LEU A C    3  
ATOM 4735  O O    . LEU A 1 76  ? -16.812 2.294   5.174   1.00 0.39 ? 76  LEU A O    3  
ATOM 4736  C CB   . LEU A 1 76  ? -15.580 4.869   6.814   1.00 0.48 ? 76  LEU A CB   3  
ATOM 4737  C CG   . LEU A 1 76  ? -14.517 4.722   5.724   1.00 0.49 ? 76  LEU A CG   3  
ATOM 4738  C CD1  . LEU A 1 76  ? -14.904 5.507   4.479   1.00 0.53 ? 76  LEU A CD1  3  
ATOM 4739  C CD2  . LEU A 1 76  ? -13.160 5.169   6.243   1.00 0.53 ? 76  LEU A CD2  3  
ATOM 4740  H H    . LEU A 1 76  ? -17.568 5.089   8.364   1.00 0.48 ? 76  LEU A H    3  
ATOM 4741  N N    . GLN A 1 77  ? -16.880 2.036   7.405   1.00 0.39 ? 77  GLN A N    3  
ATOM 4742  C CA   . GLN A 1 77  ? -16.797 0.582   7.344   1.00 0.38 ? 77  GLN A CA   3  
ATOM 4743  C C    . GLN A 1 77  ? -17.995 -0.006  6.602   1.00 0.37 ? 77  GLN A C    3  
ATOM 4744  O O    . GLN A 1 77  ? -17.841 -0.887  5.752   1.00 0.38 ? 77  GLN A O    3  
ATOM 4745  C CB   . GLN A 1 77  ? -16.683 -0.015  8.746   1.00 0.40 ? 77  GLN A CB   3  
ATOM 4746  C CG   . GLN A 1 77  ? -16.351 -1.497  8.761   1.00 0.41 ? 77  GLN A CG   3  
ATOM 4747  C CD   . GLN A 1 77  ? -16.375 -2.081  10.157  1.00 0.47 ? 77  GLN A CD   3  
ATOM 4748  O OE1  . GLN A 1 77  ? -17.422 -2.501  10.646  1.00 0.54 ? 77  GLN A OE1  3  
ATOM 4749  N NE2  . GLN A 1 77  ? -15.227 -2.125  10.807  1.00 0.54 ? 77  GLN A NE2  3  
ATOM 4750  H H    . GLN A 1 77  ? -16.944 2.477   8.279   1.00 0.41 ? 77  GLN A H    3  
ATOM 4751  H HE21 . GLN A 1 77  ? -14.416 -1.782  10.358  1.00 0.57 ? 77  GLN A HE21 3  
ATOM 4752  H HE22 . GLN A 1 77  ? -15.224 -2.503  11.711  1.00 0.61 ? 77  GLN A HE22 3  
ATOM 4753  N N    . ARG A 1 78  ? -19.185 0.499   6.916   1.00 0.40 ? 78  ARG A N    3  
ATOM 4754  C CA   . ARG A 1 78  ? -20.411 0.033   6.278   1.00 0.42 ? 78  ARG A CA   3  
ATOM 4755  C C    . ARG A 1 78  ? -20.397 0.331   4.788   1.00 0.40 ? 78  ARG A C    3  
ATOM 4756  O O    . ARG A 1 78  ? -20.903 -0.449  3.982   1.00 0.42 ? 78  ARG A O    3  
ATOM 4757  C CB   . ARG A 1 78  ? -21.631 0.690   6.917   1.00 0.49 ? 78  ARG A CB   3  
ATOM 4758  C CG   . ARG A 1 78  ? -22.147 -0.026  8.151   1.00 0.97 ? 78  ARG A CG   3  
ATOM 4759  C CD   . ARG A 1 78  ? -23.406 0.638   8.684   1.00 1.17 ? 78  ARG A CD   3  
ATOM 4760  N NE   . ARG A 1 78  ? -24.434 0.771   7.651   1.00 1.41 ? 78  ARG A NE   3  
ATOM 4761  C CZ   . ARG A 1 78  ? -25.531 0.017   7.589   1.00 1.68 ? 78  ARG A CZ   3  
ATOM 4762  N NH1  . ARG A 1 78  ? -25.729 -0.948  8.480   1.00 1.85 ? 78  ARG A NH1  3  
ATOM 4763  N NH2  . ARG A 1 78  ? -26.423 0.218   6.625   1.00 2.19 ? 78  ARG A NH2  3  
ATOM 4764  H H    . ARG A 1 78  ? -19.239 1.205   7.601   1.00 0.41 ? 78  ARG A H    3  
ATOM 4765  H HE   . ARG A 1 78  ? -24.297 1.466   6.968   1.00 1.72 ? 78  ARG A HE   3  
ATOM 4766  H HH11 . ARG A 1 78  ? -25.051 -1.117  9.202   1.00 1.82 ? 78  ARG A HH11 3  
ATOM 4767  H HH12 . ARG A 1 78  ? -26.556 -1.513  8.437   1.00 2.25 ? 78  ARG A HH12 3  
ATOM 4768  H HH21 . ARG A 1 78  ? -26.277 0.938   5.941   1.00 2.44 ? 78  ARG A HH21 3  
ATOM 4769  H HH22 . ARG A 1 78  ? -27.247 -0.351  6.571   1.00 2.49 ? 78  ARG A HH22 3  
ATOM 4770  N N    . MET A 1 79  ? -19.810 1.466   4.428   1.00 0.41 ? 79  MET A N    3  
ATOM 4771  C CA   . MET A 1 79  ? -19.717 1.875   3.035   1.00 0.43 ? 79  MET A CA   3  
ATOM 4772  C C    . MET A 1 79  ? -18.823 0.920   2.254   1.00 0.40 ? 79  MET A C    3  
ATOM 4773  O O    . MET A 1 79  ? -19.076 0.631   1.083   1.00 0.41 ? 79  MET A O    3  
ATOM 4774  C CB   . MET A 1 79  ? -19.198 3.308   2.932   1.00 0.50 ? 79  MET A CB   3  
ATOM 4775  C CG   . MET A 1 79  ? -20.233 4.360   3.295   1.00 0.67 ? 79  MET A CG   3  
ATOM 4776  S SD   . MET A 1 79  ? -19.547 6.026   3.381   1.00 0.96 ? 79  MET A SD   3  
ATOM 4777  C CE   . MET A 1 79  ? -18.932 6.226   1.708   1.00 1.28 ? 79  MET A CE   3  
ATOM 4778  H H    . MET A 1 79  ? -19.431 2.048   5.122   1.00 0.42 ? 79  MET A H    3  
ATOM 4779  N N    . ILE A 1 80  ? -17.782 0.422   2.912   1.00 0.39 ? 80  ILE A N    3  
ATOM 4780  C CA   . ILE A 1 80  ? -16.859 -0.519  2.285   1.00 0.40 ? 80  ILE A CA   3  
ATOM 4781  C C    . ILE A 1 80  ? -17.571 -1.844  2.017   1.00 0.39 ? 80  ILE A C    3  
ATOM 4782  O O    . ILE A 1 80  ? -17.323 -2.507  1.012   1.00 0.44 ? 80  ILE A O    3  
ATOM 4783  C CB   . ILE A 1 80  ? -15.611 -0.771  3.168   1.00 0.43 ? 80  ILE A CB   3  
ATOM 4784  C CG1  . ILE A 1 80  ? -14.844 0.534   3.405   1.00 0.46 ? 80  ILE A CG1  3  
ATOM 4785  C CG2  . ILE A 1 80  ? -14.697 -1.824  2.549   1.00 0.47 ? 80  ILE A CG2  3  
ATOM 4786  C CD1  . ILE A 1 80  ? -14.330 1.190   2.141   1.00 0.49 ? 80  ILE A CD1  3  
ATOM 4787  H H    . ILE A 1 80  ? -17.631 0.696   3.843   1.00 0.40 ? 80  ILE A H    3  
ATOM 4788  N N    . ALA A 1 81  ? -18.487 -2.200  2.907   1.00 0.39 ? 81  ALA A N    3  
ATOM 4789  C CA   . ALA A 1 81  ? -19.245 -3.439  2.778   1.00 0.44 ? 81  ALA A CA   3  
ATOM 4790  C C    . ALA A 1 81  ? -20.370 -3.298  1.752   1.00 0.46 ? 81  ALA A C    3  
ATOM 4791  O O    . ALA A 1 81  ? -21.149 -4.228  1.531   1.00 0.56 ? 81  ALA A O    3  
ATOM 4792  C CB   . ALA A 1 81  ? -19.796 -3.865  4.128   1.00 0.48 ? 81  ALA A CB   3  
ATOM 4793  H H    . ALA A 1 81  ? -18.663 -1.611  3.673   1.00 0.40 ? 81  ALA A H    3  
ATOM 4794  N N    . ALA A 1 82  ? -20.457 -2.127  1.133   1.00 0.43 ? 82  ALA A N    3  
ATOM 4795  C CA   . ALA A 1 82  ? -21.476 -1.861  0.128   1.00 0.48 ? 82  ALA A CA   3  
ATOM 4796  C C    . ALA A 1 82  ? -20.850 -1.783  -1.263  1.00 0.45 ? 82  ALA A C    3  
ATOM 4797  O O    . ALA A 1 82  ? -21.501 -1.394  -2.237  1.00 0.49 ? 82  ALA A O    3  
ATOM 4798  C CB   . ALA A 1 82  ? -22.208 -0.570  0.456   1.00 0.55 ? 82  ALA A CB   3  
ATOM 4799  H H    . ALA A 1 82  ? -19.822 -1.417  1.363   1.00 0.44 ? 82  ALA A H    3  
ATOM 4800  N N    . VAL A 1 83  ? -19.580 -2.159  -1.352  1.00 0.43 ? 83  VAL A N    3  
ATOM 4801  C CA   . VAL A 1 83  ? -18.869 -2.132  -2.619  1.00 0.44 ? 83  VAL A CA   3  
ATOM 4802  C C    . VAL A 1 83  ? -19.163 -3.393  -3.431  1.00 0.42 ? 83  VAL A C    3  
ATOM 4803  O O    . VAL A 1 83  ? -19.458 -4.450  -2.873  1.00 0.52 ? 83  VAL A O    3  
ATOM 4804  C CB   . VAL A 1 83  ? -17.341 -1.959  -2.425  1.00 0.51 ? 83  VAL A CB   3  
ATOM 4805  C CG1  . VAL A 1 83  ? -16.670 -3.269  -2.032  1.00 0.54 ? 83  VAL A CG1  3  
ATOM 4806  C CG2  . VAL A 1 83  ? -16.696 -1.362  -3.668  1.00 0.58 ? 83  VAL A CG2  3  
ATOM 4807  H H    . VAL A 1 83  ? -19.113 -2.467  -0.546  1.00 0.45 ? 83  VAL A H    3  
ATOM 4808  N N    . ASP A 1 84  ? -19.105 -3.273  -4.747  1.00 0.49 ? 84  ASP A N    3  
ATOM 4809  C CA   . ASP A 1 84  ? -19.358 -4.404  -5.623  1.00 0.54 ? 84  ASP A CA   3  
ATOM 4810  C C    . ASP A 1 84  ? -18.043 -5.027  -6.057  1.00 0.45 ? 84  ASP A C    3  
ATOM 4811  O O    . ASP A 1 84  ? -17.315 -4.456  -6.867  1.00 0.49 ? 84  ASP A O    3  
ATOM 4812  C CB   . ASP A 1 84  ? -20.170 -3.976  -6.851  1.00 0.73 ? 84  ASP A CB   3  
ATOM 4813  C CG   . ASP A 1 84  ? -21.578 -3.542  -6.502  1.00 0.86 ? 84  ASP A CG   3  
ATOM 4814  O OD1  . ASP A 1 84  ? -22.385 -4.397  -6.085  1.00 1.14 ? 84  ASP A OD1  3  
ATOM 4815  O OD2  . ASP A 1 84  ? -21.886 -2.335  -6.631  1.00 0.91 ? 84  ASP A OD2  3  
ATOM 4816  H H    . ASP A 1 84  ? -18.879 -2.404  -5.141  1.00 0.60 ? 84  ASP A H    3  
ATOM 4817  N N    . THR A 1 85  ? -17.736 -6.200  -5.518  1.00 0.46 ? 85  THR A N    3  
ATOM 4818  C CA   . THR A 1 85  ? -16.496 -6.890  -5.851  1.00 0.48 ? 85  THR A CA   3  
ATOM 4819  C C    . THR A 1 85  ? -16.647 -7.669  -7.159  1.00 0.48 ? 85  THR A C    3  
ATOM 4820  O O    . THR A 1 85  ? -16.240 -8.824  -7.266  1.00 0.73 ? 85  THR A O    3  
ATOM 4821  C CB   . THR A 1 85  ? -16.075 -7.841  -4.714  1.00 0.64 ? 85  THR A CB   3  
ATOM 4822  O OG1  . THR A 1 85  ? -16.504 -7.286  -3.460  1.00 0.66 ? 85  THR A OG1  3  
ATOM 4823  C CG2  . THR A 1 85  ? -14.560 -8.003  -4.688  1.00 0.77 ? 85  THR A CG2  3  
ATOM 4824  H H    . THR A 1 85  ? -18.365 -6.624  -4.894  1.00 0.53 ? 85  THR A H    3  
ATOM 4825  H HG1  . THR A 1 85  ? -16.774 -6.370  -3.598  1.00 0.70 ? 85  THR A HG1  3  
ATOM 4826  N N    . ASP A 1 86  ? -17.239 -7.015  -8.146  1.00 0.40 ? 86  ASP A N    3  
ATOM 4827  C CA   . ASP A 1 86  ? -17.463 -7.619  -9.453  1.00 0.44 ? 86  ASP A CA   3  
ATOM 4828  C C    . ASP A 1 86  ? -16.311 -7.290  -10.393 1.00 0.41 ? 86  ASP A C    3  
ATOM 4829  O O    . ASP A 1 86  ? -15.831 -8.145  -11.136 1.00 0.57 ? 86  ASP A O    3  
ATOM 4830  C CB   . ASP A 1 86  ? -18.788 -7.106  -10.038 1.00 0.56 ? 86  ASP A CB   3  
ATOM 4831  C CG   . ASP A 1 86  ? -18.849 -7.174  -11.551 1.00 0.67 ? 86  ASP A CG   3  
ATOM 4832  O OD1  . ASP A 1 86  ? -18.432 -6.197  -12.213 1.00 0.90 ? 86  ASP A OD1  3  
ATOM 4833  O OD2  . ASP A 1 86  ? -19.332 -8.193  -12.087 1.00 0.86 ? 86  ASP A OD2  3  
ATOM 4834  H H    . ASP A 1 86  ? -17.532 -6.091  -7.992  1.00 0.49 ? 86  ASP A H    3  
ATOM 4835  N N    . SER A 1 87  ? -15.868 -6.043  -10.347 1.00 0.38 ? 87  SER A N    3  
ATOM 4836  C CA   . SER A 1 87  ? -14.782 -5.578  -11.192 1.00 0.45 ? 87  SER A CA   3  
ATOM 4837  C C    . SER A 1 87  ? -13.492 -5.452  -10.379 1.00 0.36 ? 87  SER A C    3  
ATOM 4838  O O    . SER A 1 87  ? -13.353 -4.548  -9.558  1.00 0.44 ? 87  SER A O    3  
ATOM 4839  C CB   . SER A 1 87  ? -15.168 -4.233  -11.806 1.00 0.69 ? 87  SER A CB   3  
ATOM 4840  O OG   . SER A 1 87  ? -16.541 -4.222  -12.173 1.00 1.31 ? 87  SER A OG   3  
ATOM 4841  H H    . SER A 1 87  ? -16.281 -5.416  -9.718  1.00 0.45 ? 87  SER A H    3  
ATOM 4842  H HG   . SER A 1 87  ? -16.903 -5.115  -12.087 1.00 1.60 ? 87  SER A HG   3  
ATOM 4843  N N    . PRO A 1 88  ? -12.539 -6.371  -10.593 1.00 0.46 ? 88  PRO A N    3  
ATOM 4844  C CA   . PRO A 1 88  ? -11.266 -6.385  -9.864  1.00 0.52 ? 88  PRO A CA   3  
ATOM 4845  C C    . PRO A 1 88  ? -10.370 -5.176  -10.154 1.00 0.42 ? 88  PRO A C    3  
ATOM 4846  O O    . PRO A 1 88  ? -10.271 -4.254  -9.342  1.00 0.37 ? 88  PRO A O    3  
ATOM 4847  C CB   . PRO A 1 88  ? -10.587 -7.680  -10.335 1.00 0.74 ? 88  PRO A CB   3  
ATOM 4848  C CG   . PRO A 1 88  ? -11.668 -8.477  -10.987 1.00 0.89 ? 88  PRO A CG   3  
ATOM 4849  C CD   . PRO A 1 88  ? -12.626 -7.476  -11.559 1.00 0.72 ? 88  PRO A CD   3  
ATOM 4850  N N    . ARG A 1 89  ? -9.726  -5.176  -11.316 1.00 0.44 ? 89  ARG A N    3  
ATOM 4851  C CA   . ARG A 1 89  ? -8.820  -4.091  -11.679 1.00 0.41 ? 89  ARG A CA   3  
ATOM 4852  C C    . ARG A 1 89  ? -9.563  -2.805  -12.025 1.00 0.37 ? 89  ARG A C    3  
ATOM 4853  O O    . ARG A 1 89  ? -9.042  -1.713  -11.820 1.00 0.36 ? 89  ARG A O    3  
ATOM 4854  C CB   . ARG A 1 89  ? -7.868  -4.504  -12.814 1.00 0.55 ? 89  ARG A CB   3  
ATOM 4855  C CG   . ARG A 1 89  ? -6.887  -3.415  -13.234 1.00 0.64 ? 89  ARG A CG   3  
ATOM 4856  C CD   . ARG A 1 89  ? -5.785  -3.955  -14.136 1.00 0.91 ? 89  ARG A CD   3  
ATOM 4857  N NE   . ARG A 1 89  ? -5.142  -2.886  -14.906 1.00 1.11 ? 89  ARG A NE   3  
ATOM 4858  C CZ   . ARG A 1 89  ? -3.992  -2.291  -14.565 1.00 1.40 ? 89  ARG A CZ   3  
ATOM 4859  N NH1  . ARG A 1 89  ? -3.333  -2.669  -13.477 1.00 1.83 ? 89  ARG A NH1  3  
ATOM 4860  N NH2  . ARG A 1 89  ? -3.490  -1.319  -15.320 1.00 1.64 ? 89  ARG A NH2  3  
ATOM 4861  H H    . ARG A 1 89  ? -9.869  -5.915  -11.946 1.00 0.53 ? 89  ARG A H    3  
ATOM 4862  H HE   . ARG A 1 89  ? -5.599  -2.595  -15.729 1.00 1.35 ? 89  ARG A HE   3  
ATOM 4863  H HH11 . ARG A 1 89  ? -3.692  -3.400  -12.898 1.00 1.95 ? 89  ARG A HH11 3  
ATOM 4864  H HH12 . ARG A 1 89  ? -2.454  -2.225  -13.239 1.00 2.22 ? 89  ARG A HH12 3  
ATOM 4865  H HH21 . ARG A 1 89  ? -3.968  -1.022  -16.162 1.00 1.80 ? 89  ARG A HH21 3  
ATOM 4866  H HH22 . ARG A 1 89  ? -2.632  -0.866  -15.055 1.00 1.87 ? 89  ARG A HH22 3  
ATOM 4867  N N    . GLU A 1 90  ? -10.778 -2.939  -12.535 1.00 0.38 ? 90  GLU A N    3  
ATOM 4868  C CA   . GLU A 1 90  ? -11.586 -1.788  -12.917 1.00 0.38 ? 90  GLU A CA   3  
ATOM 4869  C C    . GLU A 1 90  ? -11.779 -0.818  -11.756 1.00 0.36 ? 90  GLU A C    3  
ATOM 4870  O O    . GLU A 1 90  ? -11.541 0.382   -11.897 1.00 0.38 ? 90  GLU A O    3  
ATOM 4871  C CB   . GLU A 1 90  ? -12.941 -2.231  -13.472 1.00 0.41 ? 90  GLU A CB   3  
ATOM 4872  C CG   . GLU A 1 90  ? -12.876 -2.939  -14.820 1.00 0.55 ? 90  GLU A CG   3  
ATOM 4873  C CD   . GLU A 1 90  ? -12.482 -4.403  -14.724 1.00 0.76 ? 90  GLU A CD   3  
ATOM 4874  O OE1  . GLU A 1 90  ? -12.186 -4.880  -13.605 1.00 1.10 ? 90  GLU A OE1  3  
ATOM 4875  O OE2  . GLU A 1 90  ? -12.461 -5.082  -15.769 1.00 1.46 ? 90  GLU A OE2  3  
ATOM 4876  H H    . GLU A 1 90  ? -11.146 -3.847  -12.671 1.00 0.42 ? 90  GLU A H    3  
ATOM 4877  N N    . VAL A 1 91  ? -12.192 -1.337  -10.607 1.00 0.34 ? 91  VAL A N    3  
ATOM 4878  C CA   . VAL A 1 91  ? -12.411 -0.501  -9.430  1.00 0.36 ? 91  VAL A CA   3  
ATOM 4879  C C    . VAL A 1 91  ? -11.088 0.067   -8.920  1.00 0.32 ? 91  VAL A C    3  
ATOM 4880  O O    . VAL A 1 91  ? -10.979 1.265   -8.645  1.00 0.34 ? 91  VAL A O    3  
ATOM 4881  C CB   . VAL A 1 91  ? -13.124 -1.270  -8.292  1.00 0.38 ? 91  VAL A CB   3  
ATOM 4882  C CG1  . VAL A 1 91  ? -13.261 -0.398  -7.050  1.00 0.44 ? 91  VAL A CG1  3  
ATOM 4883  C CG2  . VAL A 1 91  ? -14.491 -1.755  -8.747  1.00 0.45 ? 91  VAL A CG2  3  
ATOM 4884  H H    . VAL A 1 91  ? -12.349 -2.305  -10.547 1.00 0.34 ? 91  VAL A H    3  
ATOM 4885  N N    . PHE A 1 92  ? -10.083 -0.795  -8.830  1.00 0.30 ? 92  PHE A N    3  
ATOM 4886  C CA   . PHE A 1 92  ? -8.765  -0.398  -8.345  1.00 0.30 ? 92  PHE A CA   3  
ATOM 4887  C C    . PHE A 1 92  ? -8.150  0.688   -9.226  1.00 0.29 ? 92  PHE A C    3  
ATOM 4888  O O    . PHE A 1 92  ? -7.648  1.692   -8.726  1.00 0.29 ? 92  PHE A O    3  
ATOM 4889  C CB   . PHE A 1 92  ? -7.835  -1.613  -8.267  1.00 0.33 ? 92  PHE A CB   3  
ATOM 4890  C CG   . PHE A 1 92  ? -6.695  -1.451  -7.300  1.00 0.37 ? 92  PHE A CG   3  
ATOM 4891  C CD1  . PHE A 1 92  ? -6.842  -1.813  -5.970  1.00 0.45 ? 92  PHE A CD1  3  
ATOM 4892  C CD2  . PHE A 1 92  ? -5.479  -0.938  -7.721  1.00 0.46 ? 92  PHE A CD2  3  
ATOM 4893  C CE1  . PHE A 1 92  ? -5.796  -1.669  -5.079  1.00 0.53 ? 92  PHE A CE1  3  
ATOM 4894  C CE2  . PHE A 1 92  ? -4.430  -0.790  -6.835  1.00 0.54 ? 92  PHE A CE2  3  
ATOM 4895  C CZ   . PHE A 1 92  ? -4.589  -1.157  -5.512  1.00 0.55 ? 92  PHE A CZ   3  
ATOM 4896  H H    . PHE A 1 92  ? -10.232 -1.725  -9.096  1.00 0.30 ? 92  PHE A H    3  
ATOM 4897  N N    . PHE A 1 93  ? -8.205  0.488   -10.536 1.00 0.31 ? 93  PHE A N    3  
ATOM 4898  C CA   . PHE A 1 93  ? -7.647  1.449   -11.482 1.00 0.34 ? 93  PHE A CA   3  
ATOM 4899  C C    . PHE A 1 93  ? -8.426  2.759   -11.439 1.00 0.34 ? 93  PHE A C    3  
ATOM 4900  O O    . PHE A 1 93  ? -7.844  3.841   -11.523 1.00 0.35 ? 93  PHE A O    3  
ATOM 4901  C CB   . PHE A 1 93  ? -7.652  0.870   -12.900 1.00 0.42 ? 93  PHE A CB   3  
ATOM 4902  C CG   . PHE A 1 93  ? -6.850  1.661   -13.894 1.00 0.60 ? 93  PHE A CG   3  
ATOM 4903  C CD1  . PHE A 1 93  ? -5.467  1.577   -13.908 1.00 0.82 ? 93  PHE A CD1  3  
ATOM 4904  C CD2  . PHE A 1 93  ? -7.478  2.481   -14.816 1.00 0.78 ? 93  PHE A CD2  3  
ATOM 4905  C CE1  . PHE A 1 93  ? -4.724  2.299   -14.822 1.00 1.06 ? 93  PHE A CE1  3  
ATOM 4906  C CE2  . PHE A 1 93  ? -6.742  3.205   -15.732 1.00 1.02 ? 93  PHE A CE2  3  
ATOM 4907  C CZ   . PHE A 1 93  ? -5.363  3.113   -15.735 1.00 1.12 ? 93  PHE A CZ   3  
ATOM 4908  H H    . PHE A 1 93  ? -8.632  -0.332  -10.881 1.00 0.32 ? 93  PHE A H    3  
ATOM 4909  N N    . ARG A 1 94  ? -9.743  2.654   -11.295 1.00 0.35 ? 94  ARG A N    3  
ATOM 4910  C CA   . ARG A 1 94  ? -10.601 3.827   -11.238 1.00 0.37 ? 94  ARG A CA   3  
ATOM 4911  C C    . ARG A 1 94  ? -10.264 4.706   -10.042 1.00 0.33 ? 94  ARG A C    3  
ATOM 4912  O O    . ARG A 1 94  ? -10.042 5.901   -10.195 1.00 0.34 ? 94  ARG A O    3  
ATOM 4913  C CB   . ARG A 1 94  ? -12.076 3.429   -11.199 1.00 0.43 ? 94  ARG A CB   3  
ATOM 4914  C CG   . ARG A 1 94  ? -12.852 3.743   -12.471 1.00 0.55 ? 94  ARG A CG   3  
ATOM 4915  C CD   . ARG A 1 94  ? -12.968 5.244   -12.714 1.00 0.75 ? 94  ARG A CD   3  
ATOM 4916  N NE   . ARG A 1 94  ? -13.501 5.964   -11.555 1.00 0.81 ? 94  ARG A NE   3  
ATOM 4917  C CZ   . ARG A 1 94  ? -14.792 6.014   -11.225 1.00 1.17 ? 94  ARG A CZ   3  
ATOM 4918  N NH1  . ARG A 1 94  ? -15.715 5.445   -11.996 1.00 1.43 ? 94  ARG A NH1  3  
ATOM 4919  N NH2  . ARG A 1 94  ? -15.153 6.662   -10.131 1.00 1.33 ? 94  ARG A NH2  3  
ATOM 4920  H H    . ARG A 1 94  ? -10.147 1.759   -11.227 1.00 0.36 ? 94  ARG A H    3  
ATOM 4921  H HE   . ARG A 1 94  ? -12.850 6.439   -10.979 1.00 0.69 ? 94  ARG A HE   3  
ATOM 4922  H HH11 . ARG A 1 94  ? -15.446 4.968   -12.836 1.00 1.33 ? 94  ARG A HH11 3  
ATOM 4923  H HH12 . ARG A 1 94  ? -16.685 5.490   -11.747 1.00 1.75 ? 94  ARG A HH12 3  
ATOM 4924  H HH21 . ARG A 1 94  ? -14.447 7.115   -9.554  1.00 1.16 ? 94  ARG A HH21 3  
ATOM 4925  H HH22 . ARG A 1 94  ? -16.113 6.710   -9.864  1.00 1.66 ? 94  ARG A HH22 3  
ATOM 4926  N N    . VAL A 1 95  ? -10.204 4.109   -8.852  1.00 0.31 ? 95  VAL A N    3  
ATOM 4927  C CA   . VAL A 1 95  ? -9.895  4.866   -7.641  1.00 0.30 ? 95  VAL A CA   3  
ATOM 4928  C C    . VAL A 1 95  ? -8.462  5.397   -7.664  1.00 0.28 ? 95  VAL A C    3  
ATOM 4929  O O    . VAL A 1 95  ? -8.159  6.433   -7.074  1.00 0.30 ? 95  VAL A O    3  
ATOM 4930  C CB   . VAL A 1 95  ? -10.161 4.074   -6.338  1.00 0.31 ? 95  VAL A CB   3  
ATOM 4931  C CG1  . VAL A 1 95  ? -11.628 3.687   -6.236  1.00 0.37 ? 95  VAL A CG1  3  
ATOM 4932  C CG2  . VAL A 1 95  ? -9.268  2.845   -6.234  1.00 0.29 ? 95  VAL A CG2  3  
ATOM 4933  H H    . VAL A 1 95  ? -10.368 3.140   -8.789  1.00 0.32 ? 95  VAL A H    3  
ATOM 4934  N N    . ALA A 1 96  ? -7.585  4.689   -8.367  1.00 0.27 ? 96  ALA A N    3  
ATOM 4935  C CA   . ALA A 1 96  ? -6.195  5.099   -8.480  1.00 0.29 ? 96  ALA A CA   3  
ATOM 4936  C C    . ALA A 1 96  ? -6.085  6.362   -9.325  1.00 0.30 ? 96  ALA A C    3  
ATOM 4937  O O    . ALA A 1 96  ? -5.277  7.246   -9.036  1.00 0.32 ? 96  ALA A O    3  
ATOM 4938  C CB   . ALA A 1 96  ? -5.351  3.985   -9.077  1.00 0.33 ? 96  ALA A CB   3  
ATOM 4939  H H    . ALA A 1 96  ? -7.882  3.865   -8.814  1.00 0.28 ? 96  ALA A H    3  
ATOM 4940  N N    . ALA A 1 97  ? -6.917  6.442   -10.359 1.00 0.31 ? 97  ALA A N    3  
ATOM 4941  C CA   . ALA A 1 97  ? -6.927  7.591   -11.251 1.00 0.34 ? 97  ALA A CA   3  
ATOM 4942  C C    . ALA A 1 97  ? -7.821  8.702   -10.707 1.00 0.34 ? 97  ALA A C    3  
ATOM 4943  O O    . ALA A 1 97  ? -7.554  9.882   -10.926 1.00 0.38 ? 97  ALA A O    3  
ATOM 4944  C CB   . ALA A 1 97  ? -7.369  7.179   -12.647 1.00 0.38 ? 97  ALA A CB   3  
ATOM 4945  H H    . ALA A 1 97  ? -7.540  5.699   -10.528 1.00 0.30 ? 97  ALA A H    3  
ATOM 4946  N N    . ASP A 1 98  ? -8.870  8.316   -9.983  1.00 0.33 ? 98  ASP A N    3  
ATOM 4947  C CA   . ASP A 1 98  ? -9.816  9.270   -9.398  1.00 0.37 ? 98  ASP A CA   3  
ATOM 4948  C C    . ASP A 1 98  ? -9.112  10.265  -8.489  1.00 0.35 ? 98  ASP A C    3  
ATOM 4949  O O    . ASP A 1 98  ? -9.441  11.450  -8.468  1.00 0.37 ? 98  ASP A O    3  
ATOM 4950  C CB   . ASP A 1 98  ? -10.908 8.542   -8.604  1.00 0.45 ? 98  ASP A CB   3  
ATOM 4951  C CG   . ASP A 1 98  ? -12.148 8.235   -9.425  1.00 0.57 ? 98  ASP A CG   3  
ATOM 4952  O OD1  . ASP A 1 98  ? -12.136 8.476   -10.652 1.00 0.82 ? 98  ASP A OD1  3  
ATOM 4953  O OD2  . ASP A 1 98  ? -13.142 7.744   -8.846  1.00 1.16 ? 98  ASP A OD2  3  
ATOM 4954  H H    . ASP A 1 98  ? -9.026  7.355   -9.847  1.00 0.32 ? 98  ASP A H    3  
ATOM 4955  N N    . MET A 1 99  ? -8.130  9.779   -7.743  1.00 0.35 ? 99  MET A N    3  
ATOM 4956  C CA   . MET A 1 99  ? -7.373  10.626  -6.830  1.00 0.38 ? 99  MET A CA   3  
ATOM 4957  C C    . MET A 1 99  ? -6.103  11.148  -7.498  1.00 0.39 ? 99  MET A C    3  
ATOM 4958  O O    . MET A 1 99  ? -5.213  11.676  -6.832  1.00 0.48 ? 99  MET A O    3  
ATOM 4959  C CB   . MET A 1 99  ? -6.996  9.842   -5.571  1.00 0.39 ? 99  MET A CB   3  
ATOM 4960  C CG   . MET A 1 99  ? -8.157  9.143   -4.884  1.00 0.38 ? 99  MET A CG   3  
ATOM 4961  S SD   . MET A 1 99  ? -7.605  7.949   -3.649  1.00 0.40 ? 99  MET A SD   3  
ATOM 4962  C CE   . MET A 1 99  ? -9.173  7.243   -3.145  1.00 0.42 ? 99  MET A CE   3  
ATOM 4963  H H    . MET A 1 99  ? -7.915  8.822   -7.802  1.00 0.37 ? 99  MET A H    3  
ATOM 4964  N N    . PHE A 1 100 ? -6.015  10.993  -8.813  1.00 0.36 ? 100 PHE A N    3  
ATOM 4965  C CA   . PHE A 1 100 ? -4.839  11.442  -9.554  1.00 0.41 ? 100 PHE A CA   3  
ATOM 4966  C C    . PHE A 1 100 ? -5.212  12.375  -10.705 1.00 0.44 ? 100 PHE A C    3  
ATOM 4967  O O    . PHE A 1 100 ? -4.349  13.047  -11.272 1.00 0.54 ? 100 PHE A O    3  
ATOM 4968  C CB   . PHE A 1 100 ? -4.056  10.235  -10.083 1.00 0.46 ? 100 PHE A CB   3  
ATOM 4969  C CG   . PHE A 1 100 ? -2.564  10.435  -10.112 1.00 0.62 ? 100 PHE A CG   3  
ATOM 4970  C CD1  . PHE A 1 100 ? -1.808  10.287  -8.959  1.00 0.81 ? 100 PHE A CD1  3  
ATOM 4971  C CD2  . PHE A 1 100 ? -1.919  10.767  -11.290 1.00 0.80 ? 100 PHE A CD2  3  
ATOM 4972  C CE1  . PHE A 1 100 ? -0.437  10.466  -8.984  1.00 0.99 ? 100 PHE A CE1  3  
ATOM 4973  C CE2  . PHE A 1 100 ? -0.549  10.949  -11.323 1.00 1.00 ? 100 PHE A CE2  3  
ATOM 4974  C CZ   . PHE A 1 100 ? 0.194   10.798  -10.169 1.00 1.03 ? 100 PHE A CZ   3  
ATOM 4975  H H    . PHE A 1 100 ? -6.755  10.559  -9.298  1.00 0.35 ? 100 PHE A H    3  
ATOM 4976  N N    . SER A 1 101 ? -6.496  12.421  -11.039 1.00 0.53 ? 101 SER A N    3  
ATOM 4977  C CA   . SER A 1 101 ? -6.982  13.257  -12.129 1.00 0.58 ? 101 SER A CA   3  
ATOM 4978  C C    . SER A 1 101 ? -6.787  14.746  -11.841 1.00 0.42 ? 101 SER A C    3  
ATOM 4979  O O    . SER A 1 101 ? -6.535  15.537  -12.750 1.00 0.48 ? 101 SER A O    3  
ATOM 4980  C CB   . SER A 1 101 ? -8.454  12.944  -12.417 1.00 0.80 ? 101 SER A CB   3  
ATOM 4981  O OG   . SER A 1 101 ? -9.092  12.421  -11.262 1.00 1.20 ? 101 SER A OG   3  
ATOM 4982  H H    . SER A 1 101 ? -7.138  11.865  -10.547 1.00 0.65 ? 101 SER A H    3  
ATOM 4983  H HG   . SER A 1 101 ? -9.588  11.623  -11.500 1.00 1.33 ? 101 SER A HG   3  
ATOM 4984  N N    . ASP A 1 102 ? -6.899  15.119  -10.574 1.00 0.45 ? 102 ASP A N    3  
ATOM 4985  C CA   . ASP A 1 102 ? -6.730  16.513  -10.173 1.00 0.53 ? 102 ASP A CA   3  
ATOM 4986  C C    . ASP A 1 102 ? -5.251  16.876  -10.083 1.00 0.45 ? 102 ASP A C    3  
ATOM 4987  O O    . ASP A 1 102 ? -4.880  18.045  -10.169 1.00 0.63 ? 102 ASP A O    3  
ATOM 4988  C CB   . ASP A 1 102 ? -7.427  16.781  -8.836  1.00 0.78 ? 102 ASP A CB   3  
ATOM 4989  C CG   . ASP A 1 102 ? -7.590  18.262  -8.544  1.00 1.07 ? 102 ASP A CG   3  
ATOM 4990  O OD1  . ASP A 1 102 ? -8.454  18.905  -9.177  1.00 1.62 ? 102 ASP A OD1  3  
ATOM 4991  O OD2  . ASP A 1 102 ? -6.869  18.784  -7.671  1.00 1.64 ? 102 ASP A OD2  3  
ATOM 4992  H H    . ASP A 1 102 ? -7.116  14.447  -9.895  1.00 0.56 ? 102 ASP A H    3  
ATOM 4993  N N    . GLY A 1 103 ? -4.413  15.861  -9.921  1.00 0.40 ? 103 GLY A N    3  
ATOM 4994  C CA   . GLY A 1 103 ? -2.980  16.081  -9.826  1.00 0.53 ? 103 GLY A CA   3  
ATOM 4995  C C    . GLY A 1 103 ? -2.574  16.720  -8.513  1.00 0.53 ? 103 GLY A C    3  
ATOM 4996  O O    . GLY A 1 103 ? -1.595  17.465  -8.453  1.00 0.70 ? 103 GLY A O    3  
ATOM 4997  H H    . GLY A 1 103 ? -4.769  14.952  -9.883  1.00 0.46 ? 103 GLY A H    3  
ATOM 4998  N N    . ASN A 1 104 ? -3.324  16.430  -7.461  1.00 0.44 ? 104 ASN A N    3  
ATOM 4999  C CA   . ASN A 1 104 ? -3.037  16.989  -6.146  1.00 0.47 ? 104 ASN A CA   3  
ATOM 5000  C C    . ASN A 1 104 ? -2.232  16.013  -5.296  1.00 0.43 ? 104 ASN A C    3  
ATOM 5001  O O    . ASN A 1 104 ? -2.725  14.951  -4.906  1.00 0.45 ? 104 ASN A O    3  
ATOM 5002  C CB   . ASN A 1 104 ? -4.331  17.363  -5.419  1.00 0.55 ? 104 ASN A CB   3  
ATOM 5003  C CG   . ASN A 1 104 ? -4.099  18.249  -4.205  1.00 0.61 ? 104 ASN A CG   3  
ATOM 5004  O OD1  . ASN A 1 104 ? -2.981  18.368  -3.702  1.00 0.69 ? 104 ASN A OD1  3  
ATOM 5005  N ND2  . ASN A 1 104 ? -5.162  18.865  -3.714  1.00 0.91 ? 104 ASN A ND2  3  
ATOM 5006  H H    . ASN A 1 104 ? -4.086  15.828  -7.569  1.00 0.48 ? 104 ASN A H    3  
ATOM 5007  H HD21 . ASN A 1 104 ? -6.030  18.714  -4.152  1.00 1.15 ? 104 ASN A HD21 3  
ATOM 5008  H HD22 . ASN A 1 104 ? -5.045  19.452  -2.936  1.00 0.98 ? 104 ASN A HD22 3  
ATOM 5009  N N    . PHE A 1 105 ? -0.993  16.375  -5.014  1.00 0.45 ? 105 PHE A N    3  
ATOM 5010  C CA   . PHE A 1 105 ? -0.121  15.545  -4.198  1.00 0.48 ? 105 PHE A CA   3  
ATOM 5011  C C    . PHE A 1 105 ? -0.309  15.888  -2.722  1.00 0.50 ? 105 PHE A C    3  
ATOM 5012  O O    . PHE A 1 105 ? 0.609   16.338  -2.042  1.00 0.60 ? 105 PHE A O    3  
ATOM 5013  C CB   . PHE A 1 105 ? 1.338   15.720  -4.622  1.00 0.60 ? 105 PHE A CB   3  
ATOM 5014  C CG   . PHE A 1 105 ? 1.640   15.178  -5.994  1.00 0.66 ? 105 PHE A CG   3  
ATOM 5015  C CD1  . PHE A 1 105 ? 1.600   13.816  -6.238  1.00 0.66 ? 105 PHE A CD1  3  
ATOM 5016  C CD2  . PHE A 1 105 ? 1.970   16.032  -7.033  1.00 0.81 ? 105 PHE A CD2  3  
ATOM 5017  C CE1  . PHE A 1 105 ? 1.884   13.311  -7.494  1.00 0.75 ? 105 PHE A CE1  3  
ATOM 5018  C CE2  . PHE A 1 105 ? 2.253   15.535  -8.292  1.00 0.91 ? 105 PHE A CE2  3  
ATOM 5019  C CZ   . PHE A 1 105 ? 2.211   14.173  -8.523  1.00 0.86 ? 105 PHE A CZ   3  
ATOM 5020  H H    . PHE A 1 105 ? -0.654  17.228  -5.364  1.00 0.50 ? 105 PHE A H    3  
ATOM 5021  N N    . ASN A 1 106 ? -1.521  15.658  -2.241  1.00 0.45 ? 106 ASN A N    3  
ATOM 5022  C CA   . ASN A 1 106 ? -1.882  15.950  -0.858  1.00 0.48 ? 106 ASN A CA   3  
ATOM 5023  C C    . ASN A 1 106 ? -1.435  14.865  0.120   1.00 0.49 ? 106 ASN A C    3  
ATOM 5024  O O    . ASN A 1 106 ? -1.676  14.982  1.322   1.00 0.52 ? 106 ASN A O    3  
ATOM 5025  C CB   . ASN A 1 106 ? -3.396  16.180  -0.738  1.00 0.48 ? 106 ASN A CB   3  
ATOM 5026  C CG   . ASN A 1 106 ? -4.239  15.023  -1.264  1.00 0.43 ? 106 ASN A CG   3  
ATOM 5027  O OD1  . ASN A 1 106 ? -3.843  13.857  -1.190  1.00 0.44 ? 106 ASN A OD1  3  
ATOM 5028  N ND2  . ASN A 1 106 ? -5.410  15.340  -1.808  1.00 0.55 ? 106 ASN A ND2  3  
ATOM 5029  H H    . ASN A 1 106 ? -2.201  15.287  -2.843  1.00 0.42 ? 106 ASN A H    3  
ATOM 5030  H HD21 . ASN A 1 106 ? -5.665  16.289  -1.842  1.00 0.69 ? 106 ASN A HD21 3  
ATOM 5031  H HD22 . ASN A 1 106 ? -5.975  14.614  -2.149  1.00 0.55 ? 106 ASN A HD22 3  
ATOM 5032  N N    . TRP A 1 107 ? -0.814  13.808  -0.402  1.00 0.46 ? 107 TRP A N    3  
ATOM 5033  C CA   . TRP A 1 107 ? -0.329  12.684  0.412   1.00 0.48 ? 107 TRP A CA   3  
ATOM 5034  C C    . TRP A 1 107 ? -1.461  11.798  0.933   1.00 0.45 ? 107 TRP A C    3  
ATOM 5035  O O    . TRP A 1 107 ? -1.336  10.575  0.956   1.00 0.45 ? 107 TRP A O    3  
ATOM 5036  C CB   . TRP A 1 107 ? 0.575   13.139  1.565   1.00 0.54 ? 107 TRP A CB   3  
ATOM 5037  C CG   . TRP A 1 107 ? 2.025   13.243  1.204   1.00 0.72 ? 107 TRP A CG   3  
ATOM 5038  C CD1  . TRP A 1 107 ? 2.758   14.385  1.086   1.00 1.02 ? 107 TRP A CD1  3  
ATOM 5039  C CD2  . TRP A 1 107 ? 2.919   12.160  0.920   1.00 0.84 ? 107 TRP A CD2  3  
ATOM 5040  N NE1  . TRP A 1 107 ? 4.053   14.081  0.744   1.00 1.24 ? 107 TRP A NE1  3  
ATOM 5041  C CE2  . TRP A 1 107 ? 4.177   12.722  0.637   1.00 1.15 ? 107 TRP A CE2  3  
ATOM 5042  C CE3  . TRP A 1 107 ? 2.776   10.771  0.878   1.00 0.91 ? 107 TRP A CE3  3  
ATOM 5043  C CZ2  . TRP A 1 107 ? 5.285   11.945  0.315   1.00 1.42 ? 107 TRP A CZ2  3  
ATOM 5044  C CZ3  . TRP A 1 107 ? 3.876   9.999   0.559   1.00 1.24 ? 107 TRP A CZ3  3  
ATOM 5045  C CH2  . TRP A 1 107 ? 5.114   10.588  0.281   1.00 1.46 ? 107 TRP A CH2  3  
ATOM 5046  H H    . TRP A 1 107 ? -0.677  13.779  -1.370  1.00 0.45 ? 107 TRP A H    3  
ATOM 5047  H HE1  . TRP A 1 107 ? 4.774   14.736  0.600   1.00 1.49 ? 107 TRP A HE1  3  
ATOM 5048  N N    . GLY A 1 108 ? -2.568  12.416  1.339   1.00 0.46 ? 108 GLY A N    3  
ATOM 5049  C CA   . GLY A 1 108 ? -3.707  11.675  1.851   1.00 0.45 ? 108 GLY A CA   3  
ATOM 5050  C C    . GLY A 1 108 ? -4.228  10.649  0.864   1.00 0.41 ? 108 GLY A C    3  
ATOM 5051  O O    . GLY A 1 108 ? -4.701  9.584   1.260   1.00 0.41 ? 108 GLY A O    3  
ATOM 5052  H H    . GLY A 1 108 ? -2.604  13.398  1.300   1.00 0.47 ? 108 GLY A H    3  
ATOM 5053  N N    . ARG A 1 109 ? -4.122  10.960  -0.423  1.00 0.39 ? 109 ARG A N    3  
ATOM 5054  C CA   . ARG A 1 109 ? -4.579  10.054  -1.470  1.00 0.36 ? 109 ARG A CA   3  
ATOM 5055  C C    . ARG A 1 109 ? -3.750  8.766   -1.500  1.00 0.35 ? 109 ARG A C    3  
ATOM 5056  O O    . ARG A 1 109 ? -4.149  7.770   -2.108  1.00 0.35 ? 109 ARG A O    3  
ATOM 5057  C CB   . ARG A 1 109 ? -4.541  10.743  -2.840  1.00 0.36 ? 109 ARG A CB   3  
ATOM 5058  C CG   . ARG A 1 109 ? -3.161  10.790  -3.485  1.00 0.37 ? 109 ARG A CG   3  
ATOM 5059  C CD   . ARG A 1 109 ? -3.146  10.056  -4.819  1.00 0.36 ? 109 ARG A CD   3  
ATOM 5060  N NE   . ARG A 1 109 ? -3.727  8.713   -4.723  1.00 0.36 ? 109 ARG A NE   3  
ATOM 5061  C CZ   . ARG A 1 109 ? -4.117  7.992   -5.772  1.00 0.36 ? 109 ARG A CZ   3  
ATOM 5062  N NH1  . ARG A 1 109 ? -3.940  8.462   -7.004  1.00 0.35 ? 109 ARG A NH1  3  
ATOM 5063  N NH2  . ARG A 1 109 ? -4.686  6.807   -5.589  1.00 0.40 ? 109 ARG A NH2  3  
ATOM 5064  H H    . ARG A 1 109 ? -3.743  11.831  -0.674  1.00 0.39 ? 109 ARG A H    3  
ATOM 5065  H HE   . ARG A 1 109 ? -3.852  8.337   -3.818  1.00 0.38 ? 109 ARG A HE   3  
ATOM 5066  H HH11 . ARG A 1 109 ? -3.513  9.356   -7.143  1.00 0.35 ? 109 ARG A HH11 3  
ATOM 5067  H HH12 . ARG A 1 109 ? -4.246  7.927   -7.803  1.00 0.35 ? 109 ARG A HH12 3  
ATOM 5068  H HH21 . ARG A 1 109 ? -4.826  6.455   -4.661  1.00 0.43 ? 109 ARG A HH21 3  
ATOM 5069  H HH22 . ARG A 1 109 ? -4.979  6.258   -6.375  1.00 0.42 ? 109 ARG A HH22 3  
ATOM 5070  N N    . VAL A 1 110 ? -2.589  8.793   -0.852  1.00 0.37 ? 110 VAL A N    3  
ATOM 5071  C CA   . VAL A 1 110 ? -1.712  7.632   -0.807  1.00 0.38 ? 110 VAL A CA   3  
ATOM 5072  C C    . VAL A 1 110 ? -2.136  6.692   0.318   1.00 0.38 ? 110 VAL A C    3  
ATOM 5073  O O    . VAL A 1 110 ? -2.360  5.501   0.093   1.00 0.37 ? 110 VAL A O    3  
ATOM 5074  C CB   . VAL A 1 110 ? -0.232  8.037   -0.621  1.00 0.44 ? 110 VAL A CB   3  
ATOM 5075  C CG1  . VAL A 1 110 ? 0.675   6.816   -0.676  1.00 0.47 ? 110 VAL A CG1  3  
ATOM 5076  C CG2  . VAL A 1 110 ? 0.183   9.057   -1.673  1.00 0.46 ? 110 VAL A CG2  3  
ATOM 5077  H H    . VAL A 1 110 ? -2.320  9.615   -0.383  1.00 0.38 ? 110 VAL A H    3  
ATOM 5078  N N    . VAL A 1 111 ? -2.275  7.237   1.522   1.00 0.40 ? 111 VAL A N    3  
ATOM 5079  C CA   . VAL A 1 111 ? -2.676  6.440   2.676   1.00 0.41 ? 111 VAL A CA   3  
ATOM 5080  C C    . VAL A 1 111 ? -4.101  5.903   2.504   1.00 0.39 ? 111 VAL A C    3  
ATOM 5081  O O    . VAL A 1 111 ? -4.420  4.800   2.953   1.00 0.39 ? 111 VAL A O    3  
ATOM 5082  C CB   . VAL A 1 111 ? -2.527  7.214   4.009   1.00 0.46 ? 111 VAL A CB   3  
ATOM 5083  C CG1  . VAL A 1 111 ? -3.415  8.447   4.044   1.00 0.45 ? 111 VAL A CG1  3  
ATOM 5084  C CG2  . VAL A 1 111 ? -2.792  6.311   5.205   1.00 0.50 ? 111 VAL A CG2  3  
ATOM 5085  H H    . VAL A 1 111 ? -2.106  8.196   1.635   1.00 0.41 ? 111 VAL A H    3  
ATOM 5086  N N    . ALA A 1 112 ? -4.945  6.679   1.830   1.00 0.37 ? 112 ALA A N    3  
ATOM 5087  C CA   . ALA A 1 112 ? -6.321  6.273   1.574   1.00 0.36 ? 112 ALA A CA   3  
ATOM 5088  C C    . ALA A 1 112 ? -6.339  5.024   0.700   1.00 0.34 ? 112 ALA A C    3  
ATOM 5089  O O    . ALA A 1 112 ? -7.134  4.110   0.916   1.00 0.34 ? 112 ALA A O    3  
ATOM 5090  C CB   . ALA A 1 112 ? -7.090  7.399   0.900   1.00 0.36 ? 112 ALA A CB   3  
ATOM 5091  H H    . ALA A 1 112 ? -4.636  7.554   1.508   1.00 0.37 ? 112 ALA A H    3  
ATOM 5092  N N    . LEU A 1 113 ? -5.433  4.987   -0.273  1.00 0.34 ? 113 LEU A N    3  
ATOM 5093  C CA   . LEU A 1 113 ? -5.328  3.855   -1.181  1.00 0.33 ? 113 LEU A CA   3  
ATOM 5094  C C    . LEU A 1 113 ? -4.878  2.612   -0.420  1.00 0.33 ? 113 LEU A C    3  
ATOM 5095  O O    . LEU A 1 113 ? -5.336  1.504   -0.699  1.00 0.33 ? 113 LEU A O    3  
ATOM 5096  C CB   . LEU A 1 113 ? -4.350  4.167   -2.319  1.00 0.34 ? 113 LEU A CB   3  
ATOM 5097  C CG   . LEU A 1 113 ? -4.249  3.120   -3.431  1.00 0.35 ? 113 LEU A CG   3  
ATOM 5098  C CD1  . LEU A 1 113 ? -5.556  3.029   -4.205  1.00 0.35 ? 113 LEU A CD1  3  
ATOM 5099  C CD2  . LEU A 1 113 ? -3.089  3.434   -4.362  1.00 0.36 ? 113 LEU A CD2  3  
ATOM 5100  H H    . LEU A 1 113 ? -4.817  5.742   -0.378  1.00 0.35 ? 113 LEU A H    3  
ATOM 5101  N N    . PHE A 1 114 ? -3.987  2.808   0.547   1.00 0.34 ? 114 PHE A N    3  
ATOM 5102  C CA   . PHE A 1 114 ? -3.480  1.706   1.363   1.00 0.36 ? 114 PHE A CA   3  
ATOM 5103  C C    . PHE A 1 114 ? -4.602  1.074   2.180   1.00 0.35 ? 114 PHE A C    3  
ATOM 5104  O O    . PHE A 1 114 ? -4.684  -0.152  2.300   1.00 0.36 ? 114 PHE A O    3  
ATOM 5105  C CB   . PHE A 1 114 ? -2.349  2.174   2.285   1.00 0.38 ? 114 PHE A CB   3  
ATOM 5106  C CG   . PHE A 1 114 ? -0.990  2.171   1.640   1.00 0.42 ? 114 PHE A CG   3  
ATOM 5107  C CD1  . PHE A 1 114 ? -0.390  0.980   1.262   1.00 0.75 ? 114 PHE A CD1  3  
ATOM 5108  C CD2  . PHE A 1 114 ? -0.312  3.359   1.415   1.00 0.71 ? 114 PHE A CD2  3  
ATOM 5109  C CE1  . PHE A 1 114 ? 0.859   0.975   0.669   1.00 0.98 ? 114 PHE A CE1  3  
ATOM 5110  C CE2  . PHE A 1 114 ? 0.938   3.360   0.823   1.00 0.89 ? 114 PHE A CE2  3  
ATOM 5111  C CZ   . PHE A 1 114 ? 1.524   2.167   0.450   1.00 0.93 ? 114 PHE A CZ   3  
ATOM 5112  H H    . PHE A 1 114 ? -3.656  3.717   0.712   1.00 0.35 ? 114 PHE A H    3  
ATOM 5113  N N    . TYR A 1 115 ? -5.467  1.915   2.737   1.00 0.34 ? 115 TYR A N    3  
ATOM 5114  C CA   . TYR A 1 115 ? -6.589  1.437   3.536   1.00 0.34 ? 115 TYR A CA   3  
ATOM 5115  C C    . TYR A 1 115 ? -7.581  0.680   2.661   1.00 0.33 ? 115 TYR A C    3  
ATOM 5116  O O    . TYR A 1 115 ? -8.110  -0.359  3.057   1.00 0.33 ? 115 TYR A O    3  
ATOM 5117  C CB   . TYR A 1 115 ? -7.289  2.600   4.247   1.00 0.35 ? 115 TYR A CB   3  
ATOM 5118  C CG   . TYR A 1 115 ? -8.512  2.185   5.035   1.00 0.35 ? 115 TYR A CG   3  
ATOM 5119  C CD1  . TYR A 1 115 ? -8.391  1.600   6.289   1.00 0.37 ? 115 TYR A CD1  3  
ATOM 5120  C CD2  . TYR A 1 115 ? -9.790  2.377   4.524   1.00 0.35 ? 115 TYR A CD2  3  
ATOM 5121  C CE1  . TYR A 1 115 ? -9.507  1.216   7.010   1.00 0.39 ? 115 TYR A CE1  3  
ATOM 5122  C CE2  . TYR A 1 115 ? -10.911 1.997   5.236   1.00 0.37 ? 115 TYR A CE2  3  
ATOM 5123  C CZ   . TYR A 1 115 ? -10.764 1.420   6.479   1.00 0.39 ? 115 TYR A CZ   3  
ATOM 5124  O OH   . TYR A 1 115 ? -11.879 1.039   7.192   1.00 0.42 ? 115 TYR A OH   3  
ATOM 5125  H H    . TYR A 1 115 ? -5.344  2.884   2.611   1.00 0.34 ? 115 TYR A H    3  
ATOM 5126  H HH   . TYR A 1 115 ? -12.026 1.674   7.912   1.00 0.43 ? 115 TYR A HH   3  
ATOM 5127  N N    . PHE A 1 116 ? -7.824  1.207   1.471   1.00 0.32 ? 116 PHE A N    3  
ATOM 5128  C CA   . PHE A 1 116 ? -8.745  0.579   0.534   1.00 0.32 ? 116 PHE A CA   3  
ATOM 5129  C C    . PHE A 1 116 ? -8.197  -0.770  0.072   1.00 0.31 ? 116 PHE A C    3  
ATOM 5130  O O    . PHE A 1 116 ? -8.919  -1.767  0.034   1.00 0.31 ? 116 PHE A O    3  
ATOM 5131  C CB   . PHE A 1 116 ? -8.982  1.499   -0.669  1.00 0.32 ? 116 PHE A CB   3  
ATOM 5132  C CG   . PHE A 1 116 ? -10.098 1.055   -1.570  1.00 0.34 ? 116 PHE A CG   3  
ATOM 5133  C CD1  . PHE A 1 116 ? -11.408 1.052   -1.119  1.00 0.38 ? 116 PHE A CD1  3  
ATOM 5134  C CD2  . PHE A 1 116 ? -9.840  0.642   -2.867  1.00 0.34 ? 116 PHE A CD2  3  
ATOM 5135  C CE1  . PHE A 1 116 ? -12.439 0.649   -1.943  1.00 0.41 ? 116 PHE A CE1  3  
ATOM 5136  C CE2  . PHE A 1 116 ? -10.867 0.236   -3.698  1.00 0.37 ? 116 PHE A CE2  3  
ATOM 5137  C CZ   . PHE A 1 116 ? -12.168 0.239   -3.236  1.00 0.40 ? 116 PHE A CZ   3  
ATOM 5138  H H    . PHE A 1 116 ? -7.378  2.045   1.218   1.00 0.33 ? 116 PHE A H    3  
ATOM 5139  N N    . ALA A 1 117 ? -6.910  -0.792  -0.256  1.00 0.32 ? 117 ALA A N    3  
ATOM 5140  C CA   . ALA A 1 117 ? -6.250  -2.007  -0.717  1.00 0.32 ? 117 ALA A CA   3  
ATOM 5141  C C    . ALA A 1 117 ? -6.243  -3.085  0.358   1.00 0.33 ? 117 ALA A C    3  
ATOM 5142  O O    . ALA A 1 117 ? -6.567  -4.241  0.084   1.00 0.33 ? 117 ALA A O    3  
ATOM 5143  C CB   . ALA A 1 117 ? -4.830  -1.707  -1.176  1.00 0.34 ? 117 ALA A CB   3  
ATOM 5144  H H    . ALA A 1 117 ? -6.389  0.040   -0.193  1.00 0.32 ? 117 ALA A H    3  
ATOM 5145  N N    . SER A 1 118 ? -5.884  -2.709  1.582   1.00 0.34 ? 118 SER A N    3  
ATOM 5146  C CA   . SER A 1 118 ? -5.835  -3.662  2.685   1.00 0.35 ? 118 SER A CA   3  
ATOM 5147  C C    . SER A 1 118 ? -7.208  -4.260  2.973   1.00 0.35 ? 118 SER A C    3  
ATOM 5148  O O    . SER A 1 118 ? -7.322  -5.438  3.313   1.00 0.35 ? 118 SER A O    3  
ATOM 5149  C CB   . SER A 1 118 ? -5.235  -3.027  3.940   1.00 0.37 ? 118 SER A CB   3  
ATOM 5150  O OG   . SER A 1 118 ? -5.776  -1.740  4.171   1.00 0.38 ? 118 SER A OG   3  
ATOM 5151  H H    . SER A 1 118 ? -5.647  -1.769  1.747   1.00 0.34 ? 118 SER A H    3  
ATOM 5152  H HG   . SER A 1 118 ? -5.311  -1.095  3.623   1.00 0.38 ? 118 SER A HG   3  
ATOM 5153  N N    . LYS A 1 119 ? -8.251  -3.449  2.822   1.00 0.34 ? 119 LYS A N    3  
ATOM 5154  C CA   . LYS A 1 119 ? -9.610  -3.915  3.051   1.00 0.35 ? 119 LYS A CA   3  
ATOM 5155  C C    . LYS A 1 119 ? -10.005 -4.945  1.994   1.00 0.34 ? 119 LYS A C    3  
ATOM 5156  O O    . LYS A 1 119 ? -10.686 -5.926  2.293   1.00 0.35 ? 119 LYS A O    3  
ATOM 5157  C CB   . LYS A 1 119 ? -10.597 -2.746  3.078   1.00 0.37 ? 119 LYS A CB   3  
ATOM 5158  C CG   . LYS A 1 119 ? -11.292 -2.559  4.420   1.00 0.40 ? 119 LYS A CG   3  
ATOM 5159  C CD   . LYS A 1 119 ? -10.297 -2.210  5.515   1.00 0.45 ? 119 LYS A CD   3  
ATOM 5160  C CE   . LYS A 1 119 ? -10.863 -2.498  6.899   1.00 0.62 ? 119 LYS A CE   3  
ATOM 5161  N NZ   . LYS A 1 119 ? -12.073 -1.684  7.194   1.00 0.44 ? 119 LYS A NZ   3  
ATOM 5162  H H    . LYS A 1 119 ? -8.099  -2.514  2.555   1.00 0.35 ? 119 LYS A H    3  
ATOM 5163  H HZ1  . LYS A 1 119 ? -12.855 -1.965  6.572   1.00 0.62 ? 119 LYS A HZ1  3  
ATOM 5164  H HZ2  . LYS A 1 119 ? -11.874 -0.672  7.046   1.00 0.46 ? 119 LYS A HZ2  3  
ATOM 5165  H HZ3  . LYS A 1 119 ? -12.368 -1.824  8.191   1.00 0.59 ? 119 LYS A HZ3  3  
ATOM 5166  N N    . LEU A 1 120 ? -9.555  -4.725  0.763   1.00 0.32 ? 120 LEU A N    3  
ATOM 5167  C CA   . LEU A 1 120 ? -9.842  -5.646  -0.330  1.00 0.32 ? 120 LEU A CA   3  
ATOM 5168  C C    . LEU A 1 120 ? -9.115  -6.963  -0.091  1.00 0.32 ? 120 LEU A C    3  
ATOM 5169  O O    . LEU A 1 120 ? -9.674  -8.041  -0.297  1.00 0.33 ? 120 LEU A O    3  
ATOM 5170  C CB   . LEU A 1 120 ? -9.413  -5.049  -1.672  1.00 0.32 ? 120 LEU A CB   3  
ATOM 5171  C CG   . LEU A 1 120 ? -10.161 -3.798  -2.133  1.00 0.32 ? 120 LEU A CG   3  
ATOM 5172  C CD1  . LEU A 1 120 ? -9.569  -3.275  -3.433  1.00 0.34 ? 120 LEU A CD1  3  
ATOM 5173  C CD2  . LEU A 1 120 ? -11.646 -4.087  -2.292  1.00 0.33 ? 120 LEU A CD2  3  
ATOM 5174  H H    . LEU A 1 120 ? -9.018  -3.922  0.587   1.00 0.32 ? 120 LEU A H    3  
ATOM 5175  N N    . VAL A 1 121 ? -7.869  -6.859  0.367   1.00 0.33 ? 121 VAL A N    3  
ATOM 5176  C CA   . VAL A 1 121 ? -7.048  -8.032  0.660   1.00 0.34 ? 121 VAL A CA   3  
ATOM 5177  C C    . VAL A 1 121 ? -7.687  -8.843  1.781   1.00 0.36 ? 121 VAL A C    3  
ATOM 5178  O O    . VAL A 1 121 ? -7.786  -10.068 1.699   1.00 0.37 ? 121 VAL A O    3  
ATOM 5179  C CB   . VAL A 1 121 ? -5.607  -7.628  1.062   1.00 0.36 ? 121 VAL A CB   3  
ATOM 5180  C CG1  . VAL A 1 121 ? -4.813  -8.830  1.561   1.00 0.36 ? 121 VAL A CG1  3  
ATOM 5181  C CG2  . VAL A 1 121 ? -4.887  -6.970  -0.105  1.00 0.37 ? 121 VAL A CG2  3  
ATOM 5182  H H    . VAL A 1 121 ? -7.490  -5.962  0.512   1.00 0.33 ? 121 VAL A H    3  
ATOM 5183  N N    . LEU A 1 122 ? -8.139  -8.147  2.822   1.00 0.37 ? 122 LEU A N    3  
ATOM 5184  C CA   . LEU A 1 122 ? -8.782  -8.799  3.955   1.00 0.40 ? 122 LEU A CA   3  
ATOM 5185  C C    . LEU A 1 122 ? -10.048 -9.519  3.503   1.00 0.39 ? 122 LEU A C    3  
ATOM 5186  O O    . LEU A 1 122 ? -10.347 -10.623 3.960   1.00 0.40 ? 122 LEU A O    3  
ATOM 5187  C CB   . LEU A 1 122 ? -9.114  -7.773  5.044   1.00 0.44 ? 122 LEU A CB   3  
ATOM 5188  C CG   . LEU A 1 122 ? -9.494  -8.335  6.416   1.00 0.85 ? 122 LEU A CG   3  
ATOM 5189  C CD1  . LEU A 1 122 ? -8.320  -9.080  7.033   1.00 1.31 ? 122 LEU A CD1  3  
ATOM 5190  C CD2  . LEU A 1 122 ? -9.970  -7.224  7.337   1.00 0.88 ? 122 LEU A CD2  3  
ATOM 5191  H H    . LEU A 1 122 ? -8.030  -7.169  2.829   1.00 0.37 ? 122 LEU A H    3  
ATOM 5192  N N    . LYS A 1 123 ? -10.779 -8.890  2.592   1.00 0.37 ? 123 LYS A N    3  
ATOM 5193  C CA   . LYS A 1 123 ? -12.007 -9.466  2.062   1.00 0.38 ? 123 LYS A CA   3  
ATOM 5194  C C    . LYS A 1 123 ? -11.700 -10.716 1.240   1.00 0.38 ? 123 LYS A C    3  
ATOM 5195  O O    . LYS A 1 123 ? -12.323 -11.763 1.425   1.00 0.40 ? 123 LYS A O    3  
ATOM 5196  C CB   . LYS A 1 123 ? -12.754 -8.438  1.208   1.00 0.40 ? 123 LYS A CB   3  
ATOM 5197  C CG   . LYS A 1 123 ? -14.147 -8.871  0.787   1.00 0.53 ? 123 LYS A CG   3  
ATOM 5198  C CD   . LYS A 1 123 ? -14.893 -7.740  0.099   1.00 0.61 ? 123 LYS A CD   3  
ATOM 5199  C CE   . LYS A 1 123 ? -16.339 -8.120  -0.177  1.00 0.89 ? 123 LYS A CE   3  
ATOM 5200  N NZ   . LYS A 1 123 ? -16.467 -9.053  -1.327  1.00 1.13 ? 123 LYS A NZ   3  
ATOM 5201  H H    . LYS A 1 123 ? -10.485 -8.008  2.269   1.00 0.38 ? 123 LYS A H    3  
ATOM 5202  H HZ1  . LYS A 1 123 ? -15.754 -9.806  -1.262  1.00 1.50 ? 123 LYS A HZ1  3  
ATOM 5203  H HZ2  . LYS A 1 123 ? -16.335 -8.539  -2.223  1.00 1.50 ? 123 LYS A HZ2  3  
ATOM 5204  H HZ3  . LYS A 1 123 ? -17.412 -9.490  -1.330  1.00 1.55 ? 123 LYS A HZ3  3  
ATOM 5205  N N    . ALA A 1 124 ? -10.724 -10.602 0.344   1.00 0.37 ? 124 ALA A N    3  
ATOM 5206  C CA   . ALA A 1 124 ? -10.326 -11.720 -0.505  1.00 0.39 ? 124 ALA A CA   3  
ATOM 5207  C C    . ALA A 1 124 ? -9.794  -12.877 0.338   1.00 0.40 ? 124 ALA A C    3  
ATOM 5208  O O    . ALA A 1 124 ? -10.012 -14.045 0.018   1.00 0.42 ? 124 ALA A O    3  
ATOM 5209  C CB   . ALA A 1 124 ? -9.286  -11.273 -1.520  1.00 0.40 ? 124 ALA A CB   3  
ATOM 5210  H H    . ALA A 1 124 ? -10.261 -9.738  0.248   1.00 0.36 ? 124 ALA A H    3  
ATOM 5211  N N    . LEU A 1 125 ? -9.104  -12.542 1.422   1.00 0.40 ? 125 LEU A N    3  
ATOM 5212  C CA   . LEU A 1 125 ? -8.556  -13.547 2.322   1.00 0.42 ? 125 LEU A CA   3  
ATOM 5213  C C    . LEU A 1 125 ? -9.682  -14.369 2.947   1.00 0.44 ? 125 LEU A C    3  
ATOM 5214  O O    . LEU A 1 125 ? -9.583  -15.590 3.066   1.00 0.47 ? 125 LEU A O    3  
ATOM 5215  C CB   . LEU A 1 125 ? -7.704  -12.885 3.404   1.00 0.43 ? 125 LEU A CB   3  
ATOM 5216  C CG   . LEU A 1 125 ? -6.768  -13.803 4.196   1.00 0.47 ? 125 LEU A CG   3  
ATOM 5217  C CD1  . LEU A 1 125 ? -5.819  -14.541 3.260   1.00 0.51 ? 125 LEU A CD1  3  
ATOM 5218  C CD2  . LEU A 1 125 ? -5.986  -13.000 5.224   1.00 0.50 ? 125 LEU A CD2  3  
ATOM 5219  H H    . LEU A 1 125 ? -8.945  -11.589 1.613   1.00 0.39 ? 125 LEU A H    3  
ATOM 5220  N N    . CYS A 1 126 ? -10.768 -13.695 3.310   1.00 0.44 ? 126 CYS A N    3  
ATOM 5221  C CA   . CYS A 1 126 ? -11.922 -14.357 3.906   1.00 0.47 ? 126 CYS A CA   3  
ATOM 5222  C C    . CYS A 1 126 ? -12.685 -15.159 2.855   1.00 0.49 ? 126 CYS A C    3  
ATOM 5223  O O    . CYS A 1 126 ? -13.570 -15.951 3.179   1.00 0.57 ? 126 CYS A O    3  
ATOM 5224  C CB   . CYS A 1 126 ? -12.850 -13.333 4.562   1.00 0.49 ? 126 CYS A CB   3  
ATOM 5225  S SG   . CYS A 1 126 ? -12.033 -12.254 5.762   1.00 0.53 ? 126 CYS A SG   3  
ATOM 5226  H H    . CYS A 1 126 ? -10.792 -12.723 3.180   1.00 0.44 ? 126 CYS A H    3  
ATOM 5227  H HG   . CYS A 1 126 ? -11.214 -11.446 5.095   1.00 0.48 ? 126 CYS A HG   3  
ATOM 5228  N N    . THR A 1 127 ? -12.329 -14.954 1.592   1.00 0.46 ? 127 THR A N    3  
ATOM 5229  C CA   . THR A 1 127 ? -12.965 -15.662 0.492   1.00 0.48 ? 127 THR A CA   3  
ATOM 5230  C C    . THR A 1 127 ? -12.170 -16.930 0.162   1.00 0.49 ? 127 THR A C    3  
ATOM 5231  O O    . THR A 1 127 ? -12.558 -17.724 -0.702  1.00 0.55 ? 127 THR A O    3  
ATOM 5232  C CB   . THR A 1 127 ? -13.067 -14.756 -0.756  1.00 0.49 ? 127 THR A CB   3  
ATOM 5233  O OG1  . THR A 1 127 ? -13.467 -13.438 -0.349  1.00 0.53 ? 127 THR A OG1  3  
ATOM 5234  C CG2  . THR A 1 127 ? -14.094 -15.296 -1.739  1.00 0.56 ? 127 THR A CG2  3  
ATOM 5235  H H    . THR A 1 127 ? -11.613 -14.312 1.396   1.00 0.45 ? 127 THR A H    3  
ATOM 5236  H HG1  . THR A 1 127 ? -12.884 -13.131 0.359   1.00 0.87 ? 127 THR A HG1  3  
ATOM 5237  N N    . LYS A 1 128 ? -11.057 -17.109 0.879   1.00 0.47 ? 128 LYS A N    3  
ATOM 5238  C CA   . LYS A 1 128 ? -10.174 -18.261 0.708   1.00 0.50 ? 128 LYS A CA   3  
ATOM 5239  C C    . LYS A 1 128 ? -9.552  -18.309 -0.683  1.00 0.46 ? 128 LYS A C    3  
ATOM 5240  O O    . LYS A 1 128 ? -9.559  -19.346 -1.346  1.00 0.54 ? 128 LYS A O    3  
ATOM 5241  C CB   . LYS A 1 128 ? -10.870 -19.583 1.059   1.00 0.60 ? 128 LYS A CB   3  
ATOM 5242  C CG   . LYS A 1 128 ? -11.116 -19.774 2.549   1.00 0.67 ? 128 LYS A CG   3  
ATOM 5243  C CD   . LYS A 1 128 ? -11.450 -21.218 2.883   1.00 0.98 ? 128 LYS A CD   3  
ATOM 5244  C CE   . LYS A 1 128 ? -11.578 -21.420 4.383   1.00 1.15 ? 128 LYS A CE   3  
ATOM 5245  N NZ   . LYS A 1 128 ? -11.631 -22.860 4.747   1.00 1.40 ? 128 LYS A NZ   3  
ATOM 5246  H H    . LYS A 1 128 ? -10.819 -16.434 1.554   1.00 0.46 ? 128 LYS A H    3  
ATOM 5247  H HZ1  . LYS A 1 128 ? -12.423 -23.324 4.261   1.00 1.68 ? 128 LYS A HZ1  3  
ATOM 5248  H HZ2  . LYS A 1 128 ? -11.764 -22.966 5.774   1.00 1.63 ? 128 LYS A HZ2  3  
ATOM 5249  H HZ3  . LYS A 1 128 ? -10.745 -23.333 4.477   1.00 1.70 ? 128 LYS A HZ3  3  
ATOM 5250  N N    . VAL A 1 129 ? -9.018  -17.180 -1.131  1.00 0.42 ? 129 VAL A N    3  
ATOM 5251  C CA   . VAL A 1 129 ? -8.381  -17.111 -2.439  1.00 0.39 ? 129 VAL A CA   3  
ATOM 5252  C C    . VAL A 1 129 ? -7.033  -16.380 -2.374  1.00 0.35 ? 129 VAL A C    3  
ATOM 5253  O O    . VAL A 1 129 ? -6.937  -15.174 -2.622  1.00 0.34 ? 129 VAL A O    3  
ATOM 5254  C CB   . VAL A 1 129 ? -9.314  -16.529 -3.533  1.00 0.40 ? 129 VAL A CB   3  
ATOM 5255  C CG1  . VAL A 1 129 ? -9.884  -15.171 -3.141  1.00 0.39 ? 129 VAL A CG1  3  
ATOM 5256  C CG2  . VAL A 1 129 ? -8.624  -16.472 -4.890  1.00 0.40 ? 129 VAL A CG2  3  
ATOM 5257  H H    . VAL A 1 129 ? -9.048  -16.373 -0.568  1.00 0.46 ? 129 VAL A H    3  
ATOM 5258  N N    . PRO A 1 130 ? -5.967  -17.113 -2.005  1.00 0.37 ? 130 PRO A N    3  
ATOM 5259  C CA   . PRO A 1 130 ? -4.609  -16.558 -1.897  1.00 0.37 ? 130 PRO A CA   3  
ATOM 5260  C C    . PRO A 1 130 ? -4.105  -15.990 -3.219  1.00 0.33 ? 130 PRO A C    3  
ATOM 5261  O O    . PRO A 1 130 ? -3.317  -15.041 -3.237  1.00 0.32 ? 130 PRO A O    3  
ATOM 5262  C CB   . PRO A 1 130 ? -3.753  -17.761 -1.482  1.00 0.43 ? 130 PRO A CB   3  
ATOM 5263  C CG   . PRO A 1 130 ? -4.720  -18.725 -0.886  1.00 0.47 ? 130 PRO A CG   3  
ATOM 5264  C CD   . PRO A 1 130 ? -6.002  -18.542 -1.644  1.00 0.43 ? 130 PRO A CD   3  
ATOM 5265  N N    . GLU A 1 131 ? -4.560  -16.576 -4.325  1.00 0.34 ? 131 GLU A N    3  
ATOM 5266  C CA   . GLU A 1 131 ? -4.164  -16.132 -5.655  1.00 0.36 ? 131 GLU A CA   3  
ATOM 5267  C C    . GLU A 1 131 ? -4.520  -14.664 -5.867  1.00 0.32 ? 131 GLU A C    3  
ATOM 5268  O O    . GLU A 1 131 ? -3.688  -13.871 -6.306  1.00 0.34 ? 131 GLU A O    3  
ATOM 5269  C CB   . GLU A 1 131 ? -4.830  -16.997 -6.728  1.00 0.43 ? 131 GLU A CB   3  
ATOM 5270  C CG   . GLU A 1 131 ? -3.857  -17.667 -7.684  1.00 0.75 ? 131 GLU A CG   3  
ATOM 5271  C CD   . GLU A 1 131 ? -3.203  -16.689 -8.636  1.00 1.18 ? 131 GLU A CD   3  
ATOM 5272  O OE1  . GLU A 1 131 ? -3.864  -16.258 -9.605  1.00 1.55 ? 131 GLU A OE1  3  
ATOM 5273  O OE2  . GLU A 1 131 ? -2.023  -16.348 -8.429  1.00 1.54 ? 131 GLU A OE2  3  
ATOM 5274  H H    . GLU A 1 131 ? -5.174  -17.339 -4.240  1.00 0.37 ? 131 GLU A H    3  
ATOM 5275  N N    . LEU A 1 132 ? -5.754  -14.305 -5.523  1.00 0.32 ? 132 LEU A N    3  
ATOM 5276  C CA   . LEU A 1 132 ? -6.225  -12.935 -5.673  1.00 0.32 ? 132 LEU A CA   3  
ATOM 5277  C C    . LEU A 1 132 ? -5.394  -11.978 -4.827  1.00 0.31 ? 132 LEU A C    3  
ATOM 5278  O O    . LEU A 1 132 ? -5.106  -10.859 -5.249  1.00 0.34 ? 132 LEU A O    3  
ATOM 5279  C CB   . LEU A 1 132 ? -7.709  -12.825 -5.305  1.00 0.33 ? 132 LEU A CB   3  
ATOM 5280  C CG   . LEU A 1 132 ? -8.404  -11.510 -5.669  1.00 0.34 ? 132 LEU A CG   3  
ATOM 5281  C CD1  . LEU A 1 132 ? -8.288  -11.233 -7.162  1.00 0.36 ? 132 LEU A CD1  3  
ATOM 5282  C CD2  . LEU A 1 132 ? -9.861  -11.538 -5.242  1.00 0.36 ? 132 LEU A CD2  3  
ATOM 5283  H H    . LEU A 1 132 ? -6.359  -14.981 -5.156  1.00 0.34 ? 132 LEU A H    3  
ATOM 5284  N N    . ILE A 1 133 ? -4.997  -12.437 -3.640  1.00 0.31 ? 133 ILE A N    3  
ATOM 5285  C CA   . ILE A 1 133 ? -4.185  -11.633 -2.726  1.00 0.33 ? 133 ILE A CA   3  
ATOM 5286  C C    . ILE A 1 133 ? -2.907  -11.171 -3.421  1.00 0.34 ? 133 ILE A C    3  
ATOM 5287  O O    . ILE A 1 133 ? -2.501  -10.011 -3.307  1.00 0.38 ? 133 ILE A O    3  
ATOM 5288  C CB   . ILE A 1 133 ? -3.797  -12.437 -1.465  1.00 0.34 ? 133 ILE A CB   3  
ATOM 5289  C CG1  . ILE A 1 133 ? -5.036  -13.007 -0.773  1.00 0.36 ? 133 ILE A CG1  3  
ATOM 5290  C CG2  . ILE A 1 133 ? -2.987  -11.581 -0.501  1.00 0.38 ? 133 ILE A CG2  3  
ATOM 5291  C CD1  . ILE A 1 133 ? -6.001  -11.954 -0.278  1.00 0.39 ? 133 ILE A CD1  3  
ATOM 5292  H H    . ILE A 1 133 ? -5.259  -13.345 -3.371  1.00 0.31 ? 133 ILE A H    3  
ATOM 5293  N N    . ARG A 1 134 ? -2.291  -12.086 -4.158  1.00 0.32 ? 134 ARG A N    3  
ATOM 5294  C CA   . ARG A 1 134 ? -1.064  -11.788 -4.876  1.00 0.35 ? 134 ARG A CA   3  
ATOM 5295  C C    . ARG A 1 134 ? -1.329  -10.851 -6.050  1.00 0.37 ? 134 ARG A C    3  
ATOM 5296  O O    . ARG A 1 134 ? -0.544  -9.944  -6.323  1.00 0.40 ? 134 ARG A O    3  
ATOM 5297  C CB   . ARG A 1 134 ? -0.393  -13.077 -5.362  1.00 0.37 ? 134 ARG A CB   3  
ATOM 5298  C CG   . ARG A 1 134 ? 0.114   -13.989 -4.252  1.00 0.67 ? 134 ARG A CG   3  
ATOM 5299  C CD   . ARG A 1 134 ? 1.079   -13.263 -3.326  1.00 1.16 ? 134 ARG A CD   3  
ATOM 5300  N NE   . ARG A 1 134 ? 2.050   -12.463 -4.067  1.00 1.04 ? 134 ARG A NE   3  
ATOM 5301  C CZ   . ARG A 1 134 ? 2.466   -11.255 -3.696  1.00 1.20 ? 134 ARG A CZ   3  
ATOM 5302  N NH1  . ARG A 1 134 ? 2.057   -10.718 -2.550  1.00 1.47 ? 134 ARG A NH1  3  
ATOM 5303  N NH2  . ARG A 1 134 ? 3.306   -10.590 -4.474  1.00 1.35 ? 134 ARG A NH2  3  
ATOM 5304  H H    . ARG A 1 134 ? -2.679  -12.986 -4.227  1.00 0.32 ? 134 ARG A H    3  
ATOM 5305  H HE   . ARG A 1 134 ? 2.407   -12.846 -4.912  1.00 1.07 ? 134 ARG A HE   3  
ATOM 5306  H HH11 . ARG A 1 134 ? 1.432   -11.221 -1.954  1.00 1.53 ? 134 ARG A HH11 3  
ATOM 5307  H HH12 . ARG A 1 134 ? 2.378   -9.807  -2.276  1.00 1.73 ? 134 ARG A HH12 3  
ATOM 5308  H HH21 . ARG A 1 134 ? 3.625   -11.008 -5.340  1.00 1.37 ? 134 ARG A HH21 3  
ATOM 5309  H HH22 . ARG A 1 134 ? 3.626   -9.679  -4.213  1.00 1.59 ? 134 ARG A HH22 3  
ATOM 5310  N N    . THR A 1 135 ? -2.445  -11.067 -6.734  1.00 0.38 ? 135 THR A N    3  
ATOM 5311  C CA   . THR A 1 135 ? -2.813  -10.245 -7.881  1.00 0.42 ? 135 THR A CA   3  
ATOM 5312  C C    . THR A 1 135 ? -3.080  -8.796  -7.477  1.00 0.43 ? 135 THR A C    3  
ATOM 5313  O O    . THR A 1 135 ? -2.684  -7.870  -8.186  1.00 0.47 ? 135 THR A O    3  
ATOM 5314  C CB   . THR A 1 135 ? -4.036  -10.824 -8.611  1.00 0.45 ? 135 THR A CB   3  
ATOM 5315  O OG1  . THR A 1 135 ? -3.932  -12.253 -8.611  1.00 0.51 ? 135 THR A OG1  3  
ATOM 5316  C CG2  . THR A 1 135 ? -4.073  -10.335 -10.049 1.00 0.52 ? 135 THR A CG2  3  
ATOM 5317  H H    . THR A 1 135 ? -3.040  -11.802 -6.464  1.00 0.38 ? 135 THR A H    3  
ATOM 5318  H HG1  . THR A 1 135 ? -4.583  -12.624 -9.225  1.00 0.83 ? 135 THR A HG1  3  
ATOM 5319  N N    . ILE A 1 136 ? -3.736  -8.606  -6.331  1.00 0.42 ? 136 ILE A N    3  
ATOM 5320  C CA   . ILE A 1 136 ? -4.040  -7.266  -5.829  1.00 0.45 ? 136 ILE A CA   3  
ATOM 5321  C C    . ILE A 1 136 ? -2.758  -6.457  -5.655  1.00 0.46 ? 136 ILE A C    3  
ATOM 5322  O O    . ILE A 1 136 ? -2.684  -5.297  -6.065  1.00 0.49 ? 136 ILE A O    3  
ATOM 5323  C CB   . ILE A 1 136 ? -4.816  -7.305  -4.490  1.00 0.45 ? 136 ILE A CB   3  
ATOM 5324  C CG1  . ILE A 1 136 ? -6.158  -8.017  -4.676  1.00 0.44 ? 136 ILE A CG1  3  
ATOM 5325  C CG2  . ILE A 1 136 ? -5.037  -5.896  -3.952  1.00 0.49 ? 136 ILE A CG2  3  
ATOM 5326  C CD1  . ILE A 1 136 ? -6.886  -8.307  -3.379  1.00 0.46 ? 136 ILE A CD1  3  
ATOM 5327  H H    . ILE A 1 136 ? -4.036  -9.388  -5.816  1.00 0.40 ? 136 ILE A H    3  
ATOM 5328  N N    . MET A 1 137 ? -1.741  -7.092  -5.072  1.00 0.45 ? 137 MET A N    3  
ATOM 5329  C CA   . MET A 1 137 ? -0.453  -6.438  -4.846  1.00 0.47 ? 137 MET A CA   3  
ATOM 5330  C C    . MET A 1 137 ? 0.191   -6.047  -6.173  1.00 0.48 ? 137 MET A C    3  
ATOM 5331  O O    . MET A 1 137 ? 0.909   -5.048  -6.259  1.00 0.49 ? 137 MET A O    3  
ATOM 5332  C CB   . MET A 1 137 ? 0.489   -7.347  -4.053  1.00 0.48 ? 137 MET A CB   3  
ATOM 5333  C CG   . MET A 1 137 ? 1.770   -6.662  -3.596  1.00 0.46 ? 137 MET A CG   3  
ATOM 5334  S SD   . MET A 1 137 ? 2.924   -7.791  -2.787  1.00 0.49 ? 137 MET A SD   3  
ATOM 5335  C CE   . MET A 1 137 ? 4.243   -6.667  -2.337  1.00 0.57 ? 137 MET A CE   3  
ATOM 5336  H H    . MET A 1 137 ? -1.863  -8.022  -4.785  1.00 0.44 ? 137 MET A H    3  
ATOM 5337  N N    . GLY A 1 138 ? -0.074  -6.842  -7.204  1.00 0.49 ? 138 GLY A N    3  
ATOM 5338  C CA   . GLY A 1 138 ? 0.466   -6.567  -8.518  1.00 0.51 ? 138 GLY A CA   3  
ATOM 5339  C C    . GLY A 1 138 ? -0.057  -5.259  -9.069  1.00 0.52 ? 138 GLY A C    3  
ATOM 5340  O O    . GLY A 1 138 ? 0.659   -4.542  -9.763  1.00 0.53 ? 138 GLY A O    3  
ATOM 5341  H H    . GLY A 1 138 ? -0.647  -7.624  -7.070  1.00 0.50 ? 138 GLY A H    3  
ATOM 5342  N N    . TRP A 1 139 ? -1.310  -4.944  -8.746  1.00 0.53 ? 139 TRP A N    3  
ATOM 5343  C CA   . TRP A 1 139 ? -1.931  -3.705  -9.205  1.00 0.57 ? 139 TRP A CA   3  
ATOM 5344  C C    . TRP A 1 139 ? -1.403  -2.519  -8.405  1.00 0.53 ? 139 TRP A C    3  
ATOM 5345  O O    . TRP A 1 139 ? -1.288  -1.408  -8.923  1.00 0.54 ? 139 TRP A O    3  
ATOM 5346  C CB   . TRP A 1 139 ? -3.455  -3.775  -9.073  1.00 0.65 ? 139 TRP A CB   3  
ATOM 5347  C CG   . TRP A 1 139 ? -4.092  -4.916  -9.806  1.00 0.69 ? 139 TRP A CG   3  
ATOM 5348  C CD1  . TRP A 1 139 ? -3.732  -5.420  -11.023 1.00 0.72 ? 139 TRP A CD1  3  
ATOM 5349  C CD2  . TRP A 1 139 ? -5.215  -5.688  -9.370  1.00 0.78 ? 139 TRP A CD2  3  
ATOM 5350  N NE1  . TRP A 1 139 ? -4.558  -6.462  -11.367 1.00 0.81 ? 139 TRP A NE1  3  
ATOM 5351  C CE2  . TRP A 1 139 ? -5.477  -6.646  -10.367 1.00 0.84 ? 139 TRP A CE2  3  
ATOM 5352  C CE3  . TRP A 1 139 ? -6.020  -5.663  -8.229  1.00 0.84 ? 139 TRP A CE3  3  
ATOM 5353  C CZ2  . TRP A 1 139 ? -6.513  -7.571  -10.257 1.00 0.95 ? 139 TRP A CZ2  3  
ATOM 5354  C CZ3  . TRP A 1 139 ? -7.047  -6.581  -8.122  1.00 0.95 ? 139 TRP A CZ3  3  
ATOM 5355  C CH2  . TRP A 1 139 ? -7.285  -7.521  -9.129  1.00 1.00 ? 139 TRP A CH2  3  
ATOM 5356  H H    . TRP A 1 139 ? -1.832  -5.563  -8.188  1.00 0.55 ? 139 TRP A H    3  
ATOM 5357  H HE1  . TRP A 1 139 ? -4.498  -6.992  -12.195 1.00 0.86 ? 139 TRP A HE1  3  
ATOM 5358  N N    . THR A 1 140 ? -1.082  -2.766  -7.138  1.00 0.51 ? 140 THR A N    3  
ATOM 5359  C CA   . THR A 1 140 ? -0.560  -1.725  -6.264  1.00 0.51 ? 140 THR A CA   3  
ATOM 5360  C C    . THR A 1 140 ? 0.819   -1.283  -6.746  1.00 0.47 ? 140 THR A C    3  
ATOM 5361  O O    . THR A 1 140 ? 1.121   -0.092  -6.797  1.00 0.53 ? 140 THR A O    3  
ATOM 5362  C CB   . THR A 1 140 ? -0.447  -2.229  -4.813  1.00 0.53 ? 140 THR A CB   3  
ATOM 5363  O OG1  . THR A 1 140 ? -1.447  -3.227  -4.568  1.00 0.55 ? 140 THR A OG1  3  
ATOM 5364  C CG2  . THR A 1 140 ? -0.634  -1.086  -3.829  1.00 0.54 ? 140 THR A CG2  3  
ATOM 5365  H H    . THR A 1 140 ? -1.193  -3.674  -6.785  1.00 0.52 ? 140 THR A H    3  
ATOM 5366  H HG1  . THR A 1 140 ? -2.195  -3.088  -5.155  1.00 0.67 ? 140 THR A HG1  3  
ATOM 5367  N N    . LEU A 1 141 ? 1.645   -2.255  -7.116  1.00 0.41 ? 141 LEU A N    3  
ATOM 5368  C CA   . LEU A 1 141 ? 2.989   -1.971  -7.599  1.00 0.42 ? 141 LEU A CA   3  
ATOM 5369  C C    . LEU A 1 141 ? 2.949   -1.452  -9.034  1.00 0.42 ? 141 LEU A C    3  
ATOM 5370  O O    . LEU A 1 141 ? 3.841   -0.718  -9.466  1.00 0.41 ? 141 LEU A O    3  
ATOM 5371  C CB   . LEU A 1 141 ? 3.866   -3.223  -7.502  1.00 0.44 ? 141 LEU A CB   3  
ATOM 5372  C CG   . LEU A 1 141 ? 3.996   -3.848  -6.109  1.00 0.48 ? 141 LEU A CG   3  
ATOM 5373  C CD1  . LEU A 1 141 ? 4.771   -5.153  -6.179  1.00 0.55 ? 141 LEU A CD1  3  
ATOM 5374  C CD2  . LEU A 1 141 ? 4.660   -2.883  -5.138  1.00 0.53 ? 141 LEU A CD2  3  
ATOM 5375  H H    . LEU A 1 141 ? 1.341   -3.191  -7.061  1.00 0.40 ? 141 LEU A H    3  
ATOM 5376  N N    . ASP A 1 142 ? 1.889   -1.823  -9.750  1.00 0.51 ? 142 ASP A N    3  
ATOM 5377  C CA   . ASP A 1 142 ? 1.692   -1.417  -11.141 1.00 0.54 ? 142 ASP A CA   3  
ATOM 5378  C C    . ASP A 1 142 ? 1.681   0.104   -11.272 1.00 0.51 ? 142 ASP A C    3  
ATOM 5379  O O    . ASP A 1 142 ? 2.504   0.682   -11.981 1.00 0.53 ? 142 ASP A O    3  
ATOM 5380  C CB   . ASP A 1 142 ? 0.383   -2.012  -11.674 1.00 0.62 ? 142 ASP A CB   3  
ATOM 5381  C CG   . ASP A 1 142 ? 0.185   -1.825  -13.165 1.00 0.82 ? 142 ASP A CG   3  
ATOM 5382  O OD1  . ASP A 1 142 ? 1.124   -2.101  -13.939 1.00 0.96 ? 142 ASP A OD1  3  
ATOM 5383  O OD2  . ASP A 1 142 ? -0.924  -1.419  -13.576 1.00 1.12 ? 142 ASP A OD2  3  
ATOM 5384  H H    . ASP A 1 142 ? 1.216   -2.397  -9.331  1.00 0.59 ? 142 ASP A H    3  
ATOM 5385  N N    . PHE A 1 143 ? 0.775   0.753   -10.549 1.00 0.52 ? 143 PHE A N    3  
ATOM 5386  C CA   . PHE A 1 143 ? 0.665   2.208   -10.592 1.00 0.54 ? 143 PHE A CA   3  
ATOM 5387  C C    . PHE A 1 143 ? 1.861   2.865   -9.900  1.00 0.48 ? 143 PHE A C    3  
ATOM 5388  O O    . PHE A 1 143 ? 2.214   4.013   -10.187 1.00 0.50 ? 143 PHE A O    3  
ATOM 5389  C CB   . PHE A 1 143 ? -0.644  2.660   -9.938  1.00 0.64 ? 143 PHE A CB   3  
ATOM 5390  C CG   . PHE A 1 143 ? -1.170  3.968   -10.458 1.00 0.66 ? 143 PHE A CG   3  
ATOM 5391  C CD1  . PHE A 1 143 ? -1.910  4.015   -11.628 1.00 0.70 ? 143 PHE A CD1  3  
ATOM 5392  C CD2  . PHE A 1 143 ? -0.926  5.149   -9.777  1.00 0.77 ? 143 PHE A CD2  3  
ATOM 5393  C CE1  . PHE A 1 143 ? -2.396  5.214   -12.109 1.00 0.81 ? 143 PHE A CE1  3  
ATOM 5394  C CE2  . PHE A 1 143 ? -1.410  6.352   -10.250 1.00 0.86 ? 143 PHE A CE2  3  
ATOM 5395  C CZ   . PHE A 1 143 ? -2.147  6.386   -11.418 1.00 0.86 ? 143 PHE A CZ   3  
ATOM 5396  H H    . PHE A 1 143 ? 0.165   0.240   -9.975  1.00 0.56 ? 143 PHE A H    3  
ATOM 5397  N N    . LEU A 1 144 ? 2.484   2.126   -8.990  1.00 0.43 ? 144 LEU A N    3  
ATOM 5398  C CA   . LEU A 1 144 ? 3.637   2.623   -8.253  1.00 0.41 ? 144 LEU A CA   3  
ATOM 5399  C C    . LEU A 1 144 ? 4.827   2.839   -9.183  1.00 0.41 ? 144 LEU A C    3  
ATOM 5400  O O    . LEU A 1 144 ? 5.406   3.926   -9.224  1.00 0.43 ? 144 LEU A O    3  
ATOM 5401  C CB   . LEU A 1 144 ? 4.016   1.645   -7.134  1.00 0.41 ? 144 LEU A CB   3  
ATOM 5402  C CG   . LEU A 1 144 ? 5.115   2.101   -6.169  1.00 0.72 ? 144 LEU A CG   3  
ATOM 5403  C CD1  . LEU A 1 144 ? 4.543   3.000   -5.083  1.00 1.07 ? 144 LEU A CD1  3  
ATOM 5404  C CD2  . LEU A 1 144 ? 5.824   0.902   -5.558  1.00 1.34 ? 144 LEU A CD2  3  
ATOM 5405  H H    . LEU A 1 144 ? 2.153   1.221   -8.806  1.00 0.43 ? 144 LEU A H    3  
ATOM 5406  N N    . ARG A 1 145 ? 5.167   1.813   -9.956  1.00 0.42 ? 145 ARG A N    3  
ATOM 5407  C CA   . ARG A 1 145 ? 6.299   1.883   -10.874 1.00 0.46 ? 145 ARG A CA   3  
ATOM 5408  C C    . ARG A 1 145 ? 6.015   2.816   -12.048 1.00 0.46 ? 145 ARG A C    3  
ATOM 5409  O O    . ARG A 1 145 ? 6.924   3.449   -12.581 1.00 0.55 ? 145 ARG A O    3  
ATOM 5410  C CB   . ARG A 1 145 ? 6.652   0.485   -11.393 1.00 0.54 ? 145 ARG A CB   3  
ATOM 5411  C CG   . ARG A 1 145 ? 7.937   0.410   -12.209 1.00 0.66 ? 145 ARG A CG   3  
ATOM 5412  C CD   . ARG A 1 145 ? 9.159   0.606   -11.326 1.00 1.01 ? 145 ARG A CD   3  
ATOM 5413  N NE   . ARG A 1 145 ? 10.420  0.542   -12.071 1.00 1.10 ? 145 ARG A NE   3  
ATOM 5414  C CZ   . ARG A 1 145 ? 11.500  -0.109  -11.643 1.00 1.24 ? 145 ARG A CZ   3  
ATOM 5415  N NH1  . ARG A 1 145 ? 11.441  -0.848  -10.546 1.00 1.40 ? 145 ARG A NH1  3  
ATOM 5416  N NH2  . ARG A 1 145 ? 12.637  -0.049  -12.325 1.00 1.43 ? 145 ARG A NH2  3  
ATOM 5417  H H    . ARG A 1 145 ? 4.635   0.984   -9.913  1.00 0.42 ? 145 ARG A H    3  
ATOM 5418  H HE   . ARG A 1 145 ? 10.471  1.037   -12.920 1.00 1.24 ? 145 ARG A HE   3  
ATOM 5419  H HH11 . ARG A 1 145 ? 10.584  -0.924  -10.033 1.00 1.42 ? 145 ARG A HH11 3  
ATOM 5420  H HH12 . ARG A 1 145 ? 12.267  -1.344  -10.221 1.00 1.63 ? 145 ARG A HH12 3  
ATOM 5421  H HH21 . ARG A 1 145 ? 12.690  0.485   -13.176 1.00 1.54 ? 145 ARG A HH21 3  
ATOM 5422  H HH22 . ARG A 1 145 ? 13.455  -0.536  -11.988 1.00 1.57 ? 145 ARG A HH22 3  
ATOM 5423  N N    . GLU A 1 146 ? 4.751   2.907   -12.438 1.00 0.50 ? 146 GLU A N    3  
ATOM 5424  C CA   . GLU A 1 146 ? 4.365   3.742   -13.566 1.00 0.55 ? 146 GLU A CA   3  
ATOM 5425  C C    . GLU A 1 146 ? 4.277   5.233   -13.231 1.00 0.56 ? 146 GLU A C    3  
ATOM 5426  O O    . GLU A 1 146 ? 4.418   6.071   -14.120 1.00 0.74 ? 146 GLU A O    3  
ATOM 5427  C CB   . GLU A 1 146 ? 3.059   3.250   -14.200 1.00 0.62 ? 146 GLU A CB   3  
ATOM 5428  C CG   . GLU A 1 146 ? 3.167   1.891   -14.874 1.00 0.89 ? 146 GLU A CG   3  
ATOM 5429  C CD   . GLU A 1 146 ? 2.235   1.761   -16.061 1.00 1.31 ? 146 GLU A CD   3  
ATOM 5430  O OE1  . GLU A 1 146 ? 2.527   2.356   -17.118 1.00 1.61 ? 146 GLU A OE1  3  
ATOM 5431  O OE2  . GLU A 1 146 ? 1.197   1.078   -15.946 1.00 1.82 ? 146 GLU A OE2  3  
ATOM 5432  H H    . GLU A 1 146 ? 4.062   2.388   -11.965 1.00 0.58 ? 146 GLU A H    3  
ATOM 5433  N N    . ARG A 1 147 ? 4.050   5.579   -11.963 1.00 0.51 ? 147 ARG A N    3  
ATOM 5434  C CA   . ARG A 1 147 ? 3.933   6.991   -11.591 1.00 0.57 ? 147 ARG A CA   3  
ATOM 5435  C C    . ARG A 1 147 ? 4.617   7.343   -10.273 1.00 0.51 ? 147 ARG A C    3  
ATOM 5436  O O    . ARG A 1 147 ? 5.543   8.152   -10.247 1.00 0.53 ? 147 ARG A O    3  
ATOM 5437  C CB   . ARG A 1 147 ? 2.460   7.418   -11.531 1.00 0.73 ? 147 ARG A CB   3  
ATOM 5438  C CG   . ARG A 1 147 ? 1.870   7.891   -12.853 1.00 0.88 ? 147 ARG A CG   3  
ATOM 5439  C CD   . ARG A 1 147 ? 2.610   9.105   -13.396 1.00 1.01 ? 147 ARG A CD   3  
ATOM 5440  N NE   . ARG A 1 147 ? 3.774   8.721   -14.192 1.00 1.03 ? 147 ARG A NE   3  
ATOM 5441  C CZ   . ARG A 1 147 ? 4.667   9.580   -14.676 1.00 1.32 ? 147 ARG A CZ   3  
ATOM 5442  N NH1  . ARG A 1 147 ? 4.556   10.878  -14.421 1.00 1.56 ? 147 ARG A NH1  3  
ATOM 5443  N NH2  . ARG A 1 147 ? 5.673   9.136   -15.418 1.00 1.59 ? 147 ARG A NH2  3  
ATOM 5444  H H    . ARG A 1 147 ? 3.966   4.884   -11.276 1.00 0.55 ? 147 ARG A H    3  
ATOM 5445  H HE   . ARG A 1 147 ? 3.889   7.757   -14.387 1.00 1.04 ? 147 ARG A HE   3  
ATOM 5446  H HH11 . ARG A 1 147 ? 3.794   11.222  -13.861 1.00 1.52 ? 147 ARG A HH11 3  
ATOM 5447  H HH12 . ARG A 1 147 ? 5.234   11.524  -14.780 1.00 1.88 ? 147 ARG A HH12 3  
ATOM 5448  H HH21 . ARG A 1 147 ? 5.761   8.154   -15.617 1.00 1.57 ? 147 ARG A HH21 3  
ATOM 5449  H HH22 . ARG A 1 147 ? 6.349   9.778   -15.786 1.00 1.91 ? 147 ARG A HH22 3  
ATOM 5450  N N    . LEU A 1 148 ? 4.150   6.734   -9.186  1.00 0.48 ? 148 LEU A N    3  
ATOM 5451  C CA   . LEU A 1 148 ? 4.669   7.008   -7.839  1.00 0.47 ? 148 LEU A CA   3  
ATOM 5452  C C    . LEU A 1 148 ? 6.195   7.025   -7.733  1.00 0.41 ? 148 LEU A C    3  
ATOM 5453  O O    . LEU A 1 148 ? 6.751   7.838   -6.993  1.00 0.44 ? 148 LEU A O    3  
ATOM 5454  C CB   . LEU A 1 148 ? 4.063   6.059   -6.803  1.00 0.50 ? 148 LEU A CB   3  
ATOM 5455  C CG   . LEU A 1 148 ? 2.679   6.428   -6.255  1.00 0.59 ? 148 LEU A CG   3  
ATOM 5456  C CD1  . LEU A 1 148 ? 2.641   7.875   -5.785  1.00 0.81 ? 148 LEU A CD1  3  
ATOM 5457  C CD2  . LEU A 1 148 ? 1.590   6.158   -7.280  1.00 0.74 ? 148 LEU A CD2  3  
ATOM 5458  H H    . LEU A 1 148 ? 3.430   6.076   -9.288  1.00 0.51 ? 148 LEU A H    3  
ATOM 5459  N N    . LEU A 1 149 ? 6.859   6.135   -8.463  1.00 0.37 ? 149 LEU A N    3  
ATOM 5460  C CA   . LEU A 1 149 ? 8.319   6.044   -8.441  1.00 0.35 ? 149 LEU A CA   3  
ATOM 5461  C C    . LEU A 1 149 ? 8.985   7.396   -8.702  1.00 0.38 ? 149 LEU A C    3  
ATOM 5462  O O    . LEU A 1 149 ? 9.938   7.768   -8.016  1.00 0.39 ? 149 LEU A O    3  
ATOM 5463  C CB   . LEU A 1 149 ? 8.807   5.011   -9.463  1.00 0.39 ? 149 LEU A CB   3  
ATOM 5464  C CG   . LEU A 1 149 ? 10.315  4.733   -9.482  1.00 0.46 ? 149 LEU A CG   3  
ATOM 5465  C CD1  . LEU A 1 149 ? 10.742  3.978   -8.232  1.00 0.52 ? 149 LEU A CD1  3  
ATOM 5466  C CD2  . LEU A 1 149 ? 10.704  3.963   -10.733 1.00 0.57 ? 149 LEU A CD2  3  
ATOM 5467  H H    . LEU A 1 149 ? 6.352   5.515   -9.032  1.00 0.37 ? 149 LEU A H    3  
ATOM 5468  N N    . GLY A 1 150 ? 8.463   8.134   -9.676  1.00 0.41 ? 150 GLY A N    3  
ATOM 5469  C CA   . GLY A 1 150 ? 9.024   9.428   -10.012 1.00 0.46 ? 150 GLY A CA   3  
ATOM 5470  C C    . GLY A 1 150 ? 8.879   10.436  -8.891  1.00 0.46 ? 150 GLY A C    3  
ATOM 5471  O O    . GLY A 1 150 ? 9.764   11.265  -8.671  1.00 0.52 ? 150 GLY A O    3  
ATOM 5472  H H    . GLY A 1 150 ? 7.683   7.798   -10.168 1.00 0.43 ? 150 GLY A H    3  
ATOM 5473  N N    . TRP A 1 151 ? 7.765   10.363  -8.174  1.00 0.43 ? 151 TRP A N    3  
ATOM 5474  C CA   . TRP A 1 151 ? 7.503   11.284  -7.075  1.00 0.45 ? 151 TRP A CA   3  
ATOM 5475  C C    . TRP A 1 151 ? 8.357   10.941  -5.857  1.00 0.42 ? 151 TRP A C    3  
ATOM 5476  O O    . TRP A 1 151 ? 8.892   11.830  -5.195  1.00 0.44 ? 151 TRP A O    3  
ATOM 5477  C CB   . TRP A 1 151 ? 6.018   11.271  -6.710  1.00 0.50 ? 151 TRP A CB   3  
ATOM 5478  C CG   . TRP A 1 151 ? 5.612   12.359  -5.757  1.00 0.52 ? 151 TRP A CG   3  
ATOM 5479  C CD1  . TRP A 1 151 ? 6.084   13.641  -5.716  1.00 0.61 ? 151 TRP A CD1  3  
ATOM 5480  C CD2  . TRP A 1 151 ? 4.641   12.260  -4.712  1.00 0.52 ? 151 TRP A CD2  3  
ATOM 5481  N NE1  . TRP A 1 151 ? 5.464   14.343  -4.713  1.00 0.63 ? 151 TRP A NE1  3  
ATOM 5482  C CE2  . TRP A 1 151 ? 4.576   13.516  -4.078  1.00 0.57 ? 151 TRP A CE2  3  
ATOM 5483  C CE3  . TRP A 1 151 ? 3.820   11.228  -4.251  1.00 0.59 ? 151 TRP A CE3  3  
ATOM 5484  C CZ2  . TRP A 1 151 ? 3.719   13.768  -3.010  1.00 0.63 ? 151 TRP A CZ2  3  
ATOM 5485  C CZ3  . TRP A 1 151 ? 2.973   11.480  -3.190  1.00 0.70 ? 151 TRP A CZ3  3  
ATOM 5486  C CH2  . TRP A 1 151 ? 2.928   12.740  -2.582  1.00 0.70 ? 151 TRP A CH2  3  
ATOM 5487  H H    . TRP A 1 151 ? 7.107   9.665   -8.383  1.00 0.43 ? 151 TRP A H    3  
ATOM 5488  H HE1  . TRP A 1 151 ? 5.632   15.286  -4.484  1.00 0.71 ? 151 TRP A HE1  3  
ATOM 5489  N N    . ILE A 1 152 ? 8.481   9.650   -5.570  1.00 0.40 ? 152 ILE A N    3  
ATOM 5490  C CA   . ILE A 1 152 ? 9.275   9.189   -4.433  1.00 0.40 ? 152 ILE A CA   3  
ATOM 5491  C C    . ILE A 1 152 ? 10.759  9.490   -4.654  1.00 0.40 ? 152 ILE A C    3  
ATOM 5492  O O    . ILE A 1 152 ? 11.468  9.893   -3.731  1.00 0.45 ? 152 ILE A O    3  
ATOM 5493  C CB   . ILE A 1 152 ? 9.076   7.678   -4.170  1.00 0.40 ? 152 ILE A CB   3  
ATOM 5494  C CG1  . ILE A 1 152 ? 7.594   7.360   -3.942  1.00 0.46 ? 152 ILE A CG1  3  
ATOM 5495  C CG2  . ILE A 1 152 ? 9.906   7.211   -2.983  1.00 0.42 ? 152 ILE A CG2  3  
ATOM 5496  C CD1  . ILE A 1 152 ? 6.975   8.098   -2.771  1.00 0.51 ? 152 ILE A CD1  3  
ATOM 5497  H H    . ILE A 1 152 ? 8.022   8.987   -6.133  1.00 0.41 ? 152 ILE A H    3  
ATOM 5498  N N    . GLN A 1 153 ? 11.218  9.303   -5.886  1.00 0.41 ? 153 GLN A N    3  
ATOM 5499  C CA   . GLN A 1 153 ? 12.611  9.563   -6.229  1.00 0.46 ? 153 GLN A CA   3  
ATOM 5500  C C    . GLN A 1 153 ? 12.918  11.058  -6.142  1.00 0.50 ? 153 GLN A C    3  
ATOM 5501  O O    . GLN A 1 153 ? 13.986  11.457  -5.681  1.00 0.56 ? 153 GLN A O    3  
ATOM 5502  C CB   . GLN A 1 153 ? 12.913  9.051   -7.640  1.00 0.52 ? 153 GLN A CB   3  
ATOM 5503  C CG   . GLN A 1 153 ? 14.379  9.132   -8.031  1.00 0.73 ? 153 GLN A CG   3  
ATOM 5504  C CD   . GLN A 1 153 ? 14.586  9.125   -9.533  1.00 0.99 ? 153 GLN A CD   3  
ATOM 5505  O OE1  . GLN A 1 153 ? 13.790  8.560   -10.286 1.00 1.17 ? 153 GLN A OE1  3  
ATOM 5506  N NE2  . GLN A 1 153 ? 15.656  9.759   -9.978  1.00 1.42 ? 153 GLN A NE2  3  
ATOM 5507  H H    . GLN A 1 153 ? 10.605  8.972   -6.581  1.00 0.41 ? 153 GLN A H    3  
ATOM 5508  H HE21 . GLN A 1 153 ? 16.243  10.195  -9.323  1.00 1.53 ? 153 GLN A HE21 3  
ATOM 5509  H HE22 . GLN A 1 153 ? 15.820  9.773   -10.945 1.00 1.74 ? 153 GLN A HE22 3  
ATOM 5510  N N    . ASP A 1 154 ? 11.954  11.873  -6.563  1.00 0.52 ? 154 ASP A N    3  
ATOM 5511  C CA   . ASP A 1 154 ? 12.103  13.328  -6.558  1.00 0.61 ? 154 ASP A CA   3  
ATOM 5512  C C    . ASP A 1 154 ? 12.292  13.883  -5.148  1.00 0.59 ? 154 ASP A C    3  
ATOM 5513  O O    . ASP A 1 154 ? 13.139  14.748  -4.922  1.00 0.65 ? 154 ASP A O    3  
ATOM 5514  C CB   . ASP A 1 154 ? 10.894  13.992  -7.221  1.00 0.72 ? 154 ASP A CB   3  
ATOM 5515  C CG   . ASP A 1 154 ? 11.047  15.493  -7.349  1.00 0.79 ? 154 ASP A CG   3  
ATOM 5516  O OD1  . ASP A 1 154 ? 11.931  15.943  -8.107  1.00 1.00 ? 154 ASP A OD1  3  
ATOM 5517  O OD2  . ASP A 1 154 ? 10.275  16.232  -6.705  1.00 1.08 ? 154 ASP A OD2  3  
ATOM 5518  H H    . ASP A 1 154 ? 11.117  11.484  -6.892  1.00 0.52 ? 154 ASP A H    3  
ATOM 5519  N N    . GLN A 1 155 ? 11.515  13.374  -4.198  1.00 0.54 ? 155 GLN A N    3  
ATOM 5520  C CA   . GLN A 1 155 ? 11.600  13.834  -2.811  1.00 0.56 ? 155 GLN A CA   3  
ATOM 5521  C C    . GLN A 1 155 ? 12.820  13.260  -2.088  1.00 0.54 ? 155 GLN A C    3  
ATOM 5522  O O    . GLN A 1 155 ? 13.147  13.673  -0.971  1.00 0.65 ? 155 GLN A O    3  
ATOM 5523  C CB   . GLN A 1 155 ? 10.312  13.523  -2.043  1.00 0.58 ? 155 GLN A CB   3  
ATOM 5524  C CG   . GLN A 1 155 ? 9.896   12.063  -2.090  1.00 0.52 ? 155 GLN A CG   3  
ATOM 5525  C CD   . GLN A 1 155 ? 8.532   11.825  -1.482  1.00 0.58 ? 155 GLN A CD   3  
ATOM 5526  O OE1  . GLN A 1 155 ? 8.409   11.550  -0.289  1.00 0.70 ? 155 GLN A OE1  3  
ATOM 5527  N NE2  . GLN A 1 155 ? 7.498   11.928  -2.300  1.00 0.56 ? 155 GLN A NE2  3  
ATOM 5528  H H    . GLN A 1 155 ? 10.863  12.679  -4.435  1.00 0.52 ? 155 GLN A H    3  
ATOM 5529  H HE21 . GLN A 1 155 ? 7.669   12.153  -3.239  1.00 0.53 ? 155 GLN A HE21 3  
ATOM 5530  H HE22 . GLN A 1 155 ? 6.602   11.778  -1.934  1.00 0.63 ? 155 GLN A HE22 3  
ATOM 5531  N N    . GLY A 1 156 ? 13.487  12.311  -2.729  1.00 0.51 ? 156 GLY A N    3  
ATOM 5532  C CA   . GLY A 1 156 ? 14.669  11.713  -2.145  1.00 0.53 ? 156 GLY A CA   3  
ATOM 5533  C C    . GLY A 1 156 ? 14.371  10.496  -1.291  1.00 0.51 ? 156 GLY A C    3  
ATOM 5534  O O    . GLY A 1 156 ? 15.080  10.229  -0.323  1.00 0.67 ? 156 GLY A O    3  
ATOM 5535  H H    . GLY A 1 156 ? 13.179  12.021  -3.613  1.00 0.56 ? 156 GLY A H    3  
ATOM 5536  N N    . GLY A 1 157 ? 13.323  9.761   -1.633  1.00 0.51 ? 157 GLY A N    3  
ATOM 5537  C CA   . GLY A 1 157 ? 12.984  8.574   -0.876  1.00 0.53 ? 157 GLY A CA   3  
ATOM 5538  C C    . GLY A 1 157 ? 11.653  8.695   -0.168  1.00 0.47 ? 157 GLY A C    3  
ATOM 5539  O O    . GLY A 1 157 ? 10.809  9.496   -0.555  1.00 0.49 ? 157 GLY A O    3  
ATOM 5540  H H    . GLY A 1 157 ? 12.765  10.031  -2.396  1.00 0.62 ? 157 GLY A H    3  
ATOM 5541  N N    . TRP A 1 158 ? 11.476  7.915   0.889   1.00 0.48 ? 158 TRP A N    3  
ATOM 5542  C CA   . TRP A 1 158 ? 10.232  7.922   1.647   1.00 0.45 ? 158 TRP A CA   3  
ATOM 5543  C C    . TRP A 1 158 ? 10.280  8.946   2.775   1.00 0.51 ? 158 TRP A C    3  
ATOM 5544  O O    . TRP A 1 158 ? 9.430   8.947   3.672   1.00 0.53 ? 158 TRP A O    3  
ATOM 5545  C CB   . TRP A 1 158 ? 9.930   6.526   2.198   1.00 0.48 ? 158 TRP A CB   3  
ATOM 5546  C CG   . TRP A 1 158 ? 9.775   5.485   1.128   1.00 0.48 ? 158 TRP A CG   3  
ATOM 5547  C CD1  . TRP A 1 158 ? 10.756  4.694   0.606   1.00 0.53 ? 158 TRP A CD1  3  
ATOM 5548  C CD2  . TRP A 1 158 ? 8.566   5.128   0.446   1.00 0.49 ? 158 TRP A CD2  3  
ATOM 5549  N NE1  . TRP A 1 158 ? 10.235  3.869   -0.362  1.00 0.57 ? 158 TRP A NE1  3  
ATOM 5550  C CE2  . TRP A 1 158 ? 8.891   4.113   -0.477  1.00 0.54 ? 158 TRP A CE2  3  
ATOM 5551  C CE3  . TRP A 1 158 ? 7.241   5.567   0.529   1.00 0.51 ? 158 TRP A CE3  3  
ATOM 5552  C CZ2  . TRP A 1 158 ? 7.938   3.534   -1.313  1.00 0.60 ? 158 TRP A CZ2  3  
ATOM 5553  C CZ3  . TRP A 1 158 ? 6.298   4.989   -0.300  1.00 0.56 ? 158 TRP A CZ3  3  
ATOM 5554  C CH2  . TRP A 1 158 ? 6.651   3.984   -1.210  1.00 0.60 ? 158 TRP A CH2  3  
ATOM 5555  H H    . TRP A 1 158 ? 12.205  7.326   1.173   1.00 0.54 ? 158 TRP A H    3  
ATOM 5556  H HE1  . TRP A 1 158 ? 10.742  3.211   -0.884  1.00 0.64 ? 158 TRP A HE1  3  
ATOM 5557  N N    . ASP A 1 159 ? 11.281  9.820   2.714   1.00 0.57 ? 159 ASP A N    3  
ATOM 5558  C CA   . ASP A 1 159 ? 11.463  10.868  3.712   1.00 0.65 ? 159 ASP A CA   3  
ATOM 5559  C C    . ASP A 1 159 ? 10.234  11.766  3.792   1.00 0.59 ? 159 ASP A C    3  
ATOM 5560  O O    . ASP A 1 159 ? 9.874   12.242  4.868   1.00 0.61 ? 159 ASP A O    3  
ATOM 5561  C CB   . ASP A 1 159 ? 12.710  11.697  3.395   1.00 0.77 ? 159 ASP A CB   3  
ATOM 5562  C CG   . ASP A 1 159 ? 12.839  12.926  4.273   1.00 0.97 ? 159 ASP A CG   3  
ATOM 5563  O OD1  . ASP A 1 159 ? 13.271  12.791  5.437   1.00 1.17 ? 159 ASP A OD1  3  
ATOM 5564  O OD2  . ASP A 1 159 ? 12.510  14.032  3.800   1.00 1.15 ? 159 ASP A OD2  3  
ATOM 5565  H H    . ASP A 1 159 ? 11.919  9.752   1.975   1.00 0.59 ? 159 ASP A H    3  
ATOM 5566  N N    . GLY A 1 160 ? 9.585   11.975  2.652   1.00 0.55 ? 160 GLY A N    3  
ATOM 5567  C CA   . GLY A 1 160 ? 8.393   12.802  2.617   1.00 0.52 ? 160 GLY A CA   3  
ATOM 5568  C C    . GLY A 1 160 ? 7.288   12.221  3.473   1.00 0.47 ? 160 GLY A C    3  
ATOM 5569  O O    . GLY A 1 160 ? 6.678   12.925  4.277   1.00 0.49 ? 160 GLY A O    3  
ATOM 5570  H H    . GLY A 1 160 ? 9.915   11.559  1.826   1.00 0.55 ? 160 GLY A H    3  
ATOM 5571  N N    . LEU A 1 161 ? 7.049   10.923  3.318   1.00 0.46 ? 161 LEU A N    3  
ATOM 5572  C CA   . LEU A 1 161 ? 6.019   10.233  4.089   1.00 0.47 ? 161 LEU A CA   3  
ATOM 5573  C C    . LEU A 1 161 ? 6.382   10.239  5.571   1.00 0.52 ? 161 LEU A C    3  
ATOM 5574  O O    . LEU A 1 161 ? 5.528   10.447  6.434   1.00 0.55 ? 161 LEU A O    3  
ATOM 5575  C CB   . LEU A 1 161 ? 5.852   8.793   3.592   1.00 0.51 ? 161 LEU A CB   3  
ATOM 5576  C CG   . LEU A 1 161 ? 4.767   7.955   4.275   1.00 0.60 ? 161 LEU A CG   3  
ATOM 5577  C CD1  . LEU A 1 161 ? 3.392   8.567   4.055   1.00 0.62 ? 161 LEU A CD1  3  
ATOM 5578  C CD2  . LEU A 1 161 ? 4.803   6.520   3.771   1.00 0.67 ? 161 LEU A CD2  3  
ATOM 5579  H H    . LEU A 1 161 ? 7.578   10.417  2.667   1.00 0.47 ? 161 LEU A H    3  
ATOM 5580  N N    . LEU A 1 162 ? 7.664   10.035  5.853   1.00 0.56 ? 162 LEU A N    3  
ATOM 5581  C CA   . LEU A 1 162 ? 8.162   10.021  7.224   1.00 0.64 ? 162 LEU A CA   3  
ATOM 5582  C C    . LEU A 1 162 ? 8.052   11.397  7.875   1.00 0.64 ? 162 LEU A C    3  
ATOM 5583  O O    . LEU A 1 162 ? 8.080   11.520  9.099   1.00 0.72 ? 162 LEU A O    3  
ATOM 5584  C CB   . LEU A 1 162 ? 9.610   9.529   7.266   1.00 0.71 ? 162 LEU A CB   3  
ATOM 5585  C CG   . LEU A 1 162 ? 9.808   8.013   7.188   1.00 0.81 ? 162 LEU A CG   3  
ATOM 5586  C CD1  . LEU A 1 162 ? 11.266  7.675   6.912   1.00 0.90 ? 162 LEU A CD1  3  
ATOM 5587  C CD2  . LEU A 1 162 ? 9.344   7.357   8.479   1.00 0.87 ? 162 LEU A CD2  3  
ATOM 5588  H H    . LEU A 1 162 ? 8.294   9.882   5.116   1.00 0.56 ? 162 LEU A H    3  
ATOM 5589  N N    . SER A 1 163 ? 7.931   12.427  7.053   1.00 0.59 ? 163 SER A N    3  
ATOM 5590  C CA   . SER A 1 163 ? 7.808   13.786  7.554   1.00 0.62 ? 163 SER A CA   3  
ATOM 5591  C C    . SER A 1 163 ? 6.354   14.251  7.523   1.00 0.60 ? 163 SER A C    3  
ATOM 5592  O O    . SER A 1 163 ? 6.034   15.357  7.963   1.00 0.67 ? 163 SER A O    3  
ATOM 5593  C CB   . SER A 1 163 ? 8.689   14.731  6.740   1.00 0.65 ? 163 SER A CB   3  
ATOM 5594  O OG   . SER A 1 163 ? 10.011  14.225  6.652   1.00 0.69 ? 163 SER A OG   3  
ATOM 5595  H H    . SER A 1 163 ? 7.936   12.272  6.084   1.00 0.58 ? 163 SER A H    3  
ATOM 5596  H HG   . SER A 1 163 ? 10.065  13.606  5.909   1.00 0.78 ? 163 SER A HG   3  
ATOM 5597  N N    . TYR A 1 164 ? 5.479   13.403  6.998   1.00 0.57 ? 164 TYR A N    3  
ATOM 5598  C CA   . TYR A 1 164 ? 4.062   13.724  6.914   1.00 0.57 ? 164 TYR A CA   3  
ATOM 5599  C C    . TYR A 1 164 ? 3.338   13.228  8.160   1.00 0.56 ? 164 TYR A C    3  
ATOM 5600  O O    . TYR A 1 164 ? 2.280   13.742  8.525   1.00 0.58 ? 164 TYR A O    3  
ATOM 5601  C CB   . TYR A 1 164 ? 3.443   13.108  5.658   1.00 0.57 ? 164 TYR A CB   3  
ATOM 5602  C CG   . TYR A 1 164 ? 2.124   13.725  5.257   1.00 0.65 ? 164 TYR A CG   3  
ATOM 5603  C CD1  . TYR A 1 164 ? 2.073   14.984  4.672   1.00 0.72 ? 164 TYR A CD1  3  
ATOM 5604  C CD2  . TYR A 1 164 ? 0.929   13.048  5.456   1.00 0.73 ? 164 TYR A CD2  3  
ATOM 5605  C CE1  . TYR A 1 164 ? 0.871   15.550  4.295   1.00 0.84 ? 164 TYR A CE1  3  
ATOM 5606  C CE2  . TYR A 1 164 ? -0.278  13.604  5.084   1.00 0.83 ? 164 TYR A CE2  3  
ATOM 5607  C CZ   . TYR A 1 164 ? -0.302  14.854  4.503   1.00 0.86 ? 164 TYR A CZ   3  
ATOM 5608  O OH   . TYR A 1 164 ? -1.505  15.408  4.124   1.00 0.99 ? 164 TYR A OH   3  
ATOM 5609  H H    . TYR A 1 164 ? 5.794   12.541  6.655   1.00 0.59 ? 164 TYR A H    3  
ATOM 5610  H HH   . TYR A 1 164 ? -1.478  15.611  3.179   1.00 0.96 ? 164 TYR A HH   3  
ATOM 5611  N N    . PHE A 1 165 ? 3.909   12.221  8.804   1.00 0.56 ? 165 PHE A N    3  
ATOM 5612  C CA   . PHE A 1 165 ? 3.323   11.661  10.013  1.00 0.58 ? 165 PHE A CA   3  
ATOM 5613  C C    . PHE A 1 165 ? 3.562   12.590  11.202  1.00 0.61 ? 165 PHE A C    3  
ATOM 5614  O O    . PHE A 1 165 ? 4.582   12.496  11.888  1.00 0.69 ? 165 PHE A O    3  
ATOM 5615  C CB   . PHE A 1 165 ? 3.879   10.259  10.292  1.00 0.63 ? 165 PHE A CB   3  
ATOM 5616  C CG   . PHE A 1 165 ? 3.266   9.581   11.489  1.00 0.63 ? 165 PHE A CG   3  
ATOM 5617  C CD1  . PHE A 1 165 ? 1.907   9.316   11.535  1.00 0.62 ? 165 PHE A CD1  3  
ATOM 5618  C CD2  . PHE A 1 165 ? 4.052   9.213   12.566  1.00 0.72 ? 165 PHE A CD2  3  
ATOM 5619  C CE1  . PHE A 1 165 ? 1.340   8.699   12.636  1.00 0.65 ? 165 PHE A CE1  3  
ATOM 5620  C CE2  . PHE A 1 165 ? 3.495   8.596   13.672  1.00 0.74 ? 165 PHE A CE2  3  
ATOM 5621  C CZ   . PHE A 1 165 ? 2.136   8.337   13.707  1.00 0.67 ? 165 PHE A CZ   3  
ATOM 5622  H H    . PHE A 1 165 ? 4.741   11.840  8.456   1.00 0.59 ? 165 PHE A H    3  
ATOM 5623  N N    . GLY A 1 166 ? 2.622   13.504  11.419  1.00 0.63 ? 166 GLY A N    3  
ATOM 5624  C CA   . GLY A 1 166 ? 2.732   14.440  12.517  1.00 0.70 ? 166 GLY A CA   3  
ATOM 5625  C C    . GLY A 1 166 ? 2.099   13.912  13.789  1.00 0.73 ? 166 GLY A C    3  
ATOM 5626  O O    . GLY A 1 166 ? 2.169   12.718  14.080  1.00 1.05 ? 166 GLY A O    3  
ATOM 5627  H H    . GLY A 1 166 ? 1.851   13.549  10.816  1.00 0.67 ? 166 GLY A H    3  
ATOM 5628  N N    . THR A 1 167 ? 1.484   14.802  14.555  1.00 0.65 ? 167 THR A N    3  
ATOM 5629  C CA   . THR A 1 167 ? 0.837   14.422  15.806  1.00 0.67 ? 167 THR A CA   3  
ATOM 5630  C C    . THR A 1 167 ? -0.356  15.336  16.127  1.00 0.66 ? 167 THR A C    3  
ATOM 5631  O O    . THR A 1 167 ? -1.481  14.853  16.283  1.00 0.68 ? 167 THR A O    3  
ATOM 5632  C CB   . THR A 1 167 ? 1.827   14.381  16.993  1.00 0.74 ? 167 THR A CB   3  
ATOM 5633  O OG1  . THR A 1 167 ? 2.994   13.631  16.616  1.00 0.89 ? 167 THR A OG1  3  
ATOM 5634  C CG2  . THR A 1 167 ? 1.184   13.723  18.204  1.00 0.86 ? 167 THR A CG2  3  
ATOM 5635  H H    . THR A 1 167 ? 1.455   15.739  14.267  1.00 0.77 ? 167 THR A H    3  
ATOM 5636  H HG1  . THR A 1 167 ? 2.824   13.185  15.771  1.00 1.05 ? 167 THR A HG1  3  
ATOM 5637  N N    . PRO A 1 168 ? -0.141  16.667  16.232  1.00 0.68 ? 168 PRO A N    3  
ATOM 5638  C CA   . PRO A 1 168 ? -1.226  17.608  16.520  1.00 0.71 ? 168 PRO A CA   3  
ATOM 5639  C C    . PRO A 1 168 ? -2.158  17.753  15.324  1.00 0.67 ? 168 PRO A C    3  
ATOM 5640  O O    . PRO A 1 168 ? -1.736  17.573  14.179  1.00 0.70 ? 168 PRO A O    3  
ATOM 5641  C CB   . PRO A 1 168 ? -0.511  18.943  16.776  1.00 0.77 ? 168 PRO A CB   3  
ATOM 5642  C CG   . PRO A 1 168 ? 0.936   18.611  16.890  1.00 0.81 ? 168 PRO A CG   3  
ATOM 5643  C CD   . PRO A 1 168 ? 1.149   17.360  16.096  1.00 0.70 ? 168 PRO A CD   3  
ATOM 5644  N N    . THR A 1 169 ? -3.421  18.076  15.595  1.00 0.68 ? 169 THR A N    3  
ATOM 5645  C CA   . THR A 1 169 ? -4.421  18.250  14.543  1.00 0.71 ? 169 THR A CA   3  
ATOM 5646  C C    . THR A 1 169 ? -4.631  16.942  13.773  1.00 0.61 ? 169 THR A C    3  
ATOM 5647  O O    . THR A 1 169 ? -5.012  16.942  12.602  1.00 0.62 ? 169 THR A O    3  
ATOM 5648  C CB   . THR A 1 169 ? -4.020  19.386  13.572  1.00 0.85 ? 169 THR A CB   3  
ATOM 5649  O OG1  . THR A 1 169 ? -3.242  20.368  14.276  1.00 1.01 ? 169 THR A OG1  3  
ATOM 5650  C CG2  . THR A 1 169 ? -5.255  20.065  13.003  1.00 1.02 ? 169 THR A CG2  3  
ATOM 5651  H H    . THR A 1 169 ? -3.688  18.209  16.529  1.00 0.72 ? 169 THR A H    3  
ATOM 5652  H HG1  . THR A 1 169 ? -2.545  20.693  13.695  1.00 1.43 ? 169 THR A HG1  3  
ATOM 5653  N N    . TRP A 1 170 ? -4.402  15.823  14.461  1.00 0.58 ? 170 TRP A N    3  
ATOM 5654  C CA   . TRP A 1 170 ? -4.538  14.499  13.860  1.00 0.54 ? 170 TRP A CA   3  
ATOM 5655  C C    . TRP A 1 170 ? -5.974  14.219  13.424  1.00 0.52 ? 170 TRP A C    3  
ATOM 5656  O O    . TRP A 1 170 ? -6.203  13.502  12.452  1.00 0.49 ? 170 TRP A O    3  
ATOM 5657  C CB   . TRP A 1 170 ? -4.032  13.399  14.809  1.00 0.59 ? 170 TRP A CB   3  
ATOM 5658  C CG   . TRP A 1 170 ? -5.010  13.006  15.877  1.00 0.72 ? 170 TRP A CG   3  
ATOM 5659  C CD1  . TRP A 1 170 ? -5.863  11.937  15.856  1.00 0.94 ? 170 TRP A CD1  3  
ATOM 5660  C CD2  . TRP A 1 170 ? -5.244  13.674  17.125  1.00 0.83 ? 170 TRP A CD2  3  
ATOM 5661  N NE1  . TRP A 1 170 ? -6.612  11.904  17.002  1.00 1.08 ? 170 TRP A NE1  3  
ATOM 5662  C CE2  . TRP A 1 170 ? -6.250  12.956  17.800  1.00 1.03 ? 170 TRP A CE2  3  
ATOM 5663  C CE3  . TRP A 1 170 ? -4.699  14.808  17.733  1.00 0.95 ? 170 TRP A CE3  3  
ATOM 5664  C CZ2  . TRP A 1 170 ? -6.722  13.335  19.052  1.00 1.25 ? 170 TRP A CZ2  3  
ATOM 5665  C CZ3  . TRP A 1 170 ? -5.170  15.178  18.977  1.00 1.22 ? 170 TRP A CZ3  3  
ATOM 5666  C CH2  . TRP A 1 170 ? -6.172  14.446  19.622  1.00 1.33 ? 170 TRP A CH2  3  
ATOM 5667  H H    . TRP A 1 170 ? -4.132  15.893  15.402  1.00 0.63 ? 170 TRP A H    3  
ATOM 5668  H HE1  . TRP A 1 170 ? -7.298  11.231  17.219  1.00 1.27 ? 170 TRP A HE1  3  
ATOM 5669  N N    . GLN A 1 171 ? -6.934  14.807  14.132  1.00 0.55 ? 171 GLN A N    3  
ATOM 5670  C CA   . GLN A 1 171 ? -8.344  14.612  13.820  1.00 0.58 ? 171 GLN A CA   3  
ATOM 5671  C C    . GLN A 1 171 ? -8.655  15.060  12.396  1.00 0.54 ? 171 GLN A C    3  
ATOM 5672  O O    . GLN A 1 171 ? -9.358  14.369  11.654  1.00 0.51 ? 171 GLN A O    3  
ATOM 5673  C CB   . GLN A 1 171 ? -9.224  15.356  14.826  1.00 0.65 ? 171 GLN A CB   3  
ATOM 5674  C CG   . GLN A 1 171 ? -10.715 15.153  14.614  1.00 0.82 ? 171 GLN A CG   3  
ATOM 5675  C CD   . GLN A 1 171 ? -11.552 15.832  15.676  1.00 1.09 ? 171 GLN A CD   3  
ATOM 5676  O OE1  . GLN A 1 171 ? -11.904 17.004  15.550  1.00 1.33 ? 171 GLN A OE1  3  
ATOM 5677  N NE2  . GLN A 1 171 ? -11.883 15.098  16.726  1.00 1.37 ? 171 GLN A NE2  3  
ATOM 5678  H H    . GLN A 1 171 ? -6.684  15.388  14.881  1.00 0.59 ? 171 GLN A H    3  
ATOM 5679  H HE21 . GLN A 1 171 ? -11.572 14.166  16.757  1.00 1.45 ? 171 GLN A HE21 3  
ATOM 5680  H HE22 . GLN A 1 171 ? -12.426 15.509  17.429  1.00 1.64 ? 171 GLN A HE22 3  
ATOM 5681  N N    . THR A 1 172 ? -8.110  16.207  12.012  1.00 0.56 ? 172 THR A N    3  
ATOM 5682  C CA   . THR A 1 172 ? -8.322  16.744  10.679  1.00 0.56 ? 172 THR A CA   3  
ATOM 5683  C C    . THR A 1 172 ? -7.720  15.815  9.627   1.00 0.52 ? 172 THR A C    3  
ATOM 5684  O O    . THR A 1 172 ? -8.228  15.708  8.512   1.00 0.52 ? 172 THR A O    3  
ATOM 5685  C CB   . THR A 1 172 ? -7.708  18.150  10.551  1.00 0.62 ? 172 THR A CB   3  
ATOM 5686  O OG1  . THR A 1 172 ? -7.981  18.884  11.752  1.00 0.72 ? 172 THR A OG1  3  
ATOM 5687  C CG2  . THR A 1 172 ? -8.306  18.895  9.366   1.00 0.75 ? 172 THR A CG2  3  
ATOM 5688  H H    . THR A 1 172 ? -7.548  16.706  12.643  1.00 0.59 ? 172 THR A H    3  
ATOM 5689  H HG1  . THR A 1 172 ? -8.841  18.613  12.102  1.00 1.20 ? 172 THR A HG1  3  
ATOM 5690  N N    . VAL A 1 173 ? -6.646  15.129  10.001  1.00 0.53 ? 173 VAL A N    3  
ATOM 5691  C CA   . VAL A 1 173 ? -5.982  14.199  9.098   1.00 0.52 ? 173 VAL A CA   3  
ATOM 5692  C C    . VAL A 1 173 ? -6.867  12.977  8.860   1.00 0.49 ? 173 VAL A C    3  
ATOM 5693  O O    . VAL A 1 173 ? -7.077  12.563  7.720   1.00 0.47 ? 173 VAL A O    3  
ATOM 5694  C CB   . VAL A 1 173 ? -4.612  13.746  9.647   1.00 0.56 ? 173 VAL A CB   3  
ATOM 5695  C CG1  . VAL A 1 173 ? -3.887  12.872  8.634   1.00 0.57 ? 173 VAL A CG1  3  
ATOM 5696  C CG2  . VAL A 1 173 ? -3.761  14.952  10.025  1.00 0.60 ? 173 VAL A CG2  3  
ATOM 5697  H H    . VAL A 1 173 ? -6.291  15.248  10.909  1.00 0.57 ? 173 VAL A H    3  
ATOM 5698  N N    . THR A 1 174 ? -7.393  12.414  9.941   1.00 0.49 ? 174 THR A N    3  
ATOM 5699  C CA   . THR A 1 174 ? -8.264  11.251  9.851   1.00 0.48 ? 174 THR A CA   3  
ATOM 5700  C C    . THR A 1 174 ? -9.500  11.568  9.005   1.00 0.47 ? 174 THR A C    3  
ATOM 5701  O O    . THR A 1 174 ? -9.889  10.787  8.134   1.00 0.47 ? 174 THR A O    3  
ATOM 5702  C CB   . THR A 1 174 ? -8.707  10.789  11.250  1.00 0.50 ? 174 THR A CB   3  
ATOM 5703  O OG1  . THR A 1 174 ? -7.594  10.880  12.151  1.00 0.58 ? 174 THR A OG1  3  
ATOM 5704  C CG2  . THR A 1 174 ? -9.198  9.351   11.206  1.00 0.54 ? 174 THR A CG2  3  
ATOM 5705  H H    . THR A 1 174 ? -7.179  12.780  10.828  1.00 0.52 ? 174 THR A H    3  
ATOM 5706  H HG1  . THR A 1 174 ? -7.481  10.042  12.607  1.00 1.09 ? 174 THR A HG1  3  
ATOM 5707  N N    . ILE A 1 175 ? -10.099 12.730  9.257   1.00 0.48 ? 175 ILE A N    3  
ATOM 5708  C CA   . ILE A 1 175 ? -11.283 13.161  8.517   1.00 0.49 ? 175 ILE A CA   3  
ATOM 5709  C C    . ILE A 1 175 ? -10.948 13.361  7.040   1.00 0.46 ? 175 ILE A C    3  
ATOM 5710  O O    . ILE A 1 175 ? -11.750 13.047  6.159   1.00 0.45 ? 175 ILE A O    3  
ATOM 5711  C CB   . ILE A 1 175 ? -11.882 14.460  9.103   1.00 0.54 ? 175 ILE A CB   3  
ATOM 5712  C CG1  . ILE A 1 175 ? -12.305 14.231  10.557  1.00 0.57 ? 175 ILE A CG1  3  
ATOM 5713  C CG2  . ILE A 1 175 ? -13.070 14.936  8.273   1.00 0.59 ? 175 ILE A CG2  3  
ATOM 5714  C CD1  . ILE A 1 175 ? -12.738 15.488  11.279  1.00 0.64 ? 175 ILE A CD1  3  
ATOM 5715  H H    . ILE A 1 175 ? -9.735  13.311  9.965   1.00 0.49 ? 175 ILE A H    3  
ATOM 5716  N N    . PHE A 1 176 ? -9.748  13.867  6.779   1.00 0.45 ? 176 PHE A N    3  
ATOM 5717  C CA   . PHE A 1 176 ? -9.294  14.102  5.416   1.00 0.43 ? 176 PHE A CA   3  
ATOM 5718  C C    . PHE A 1 176 ? -9.240  12.793  4.634   1.00 0.40 ? 176 PHE A C    3  
ATOM 5719  O O    . PHE A 1 176 ? -9.785  12.696  3.535   1.00 0.40 ? 176 PHE A O    3  
ATOM 5720  C CB   . PHE A 1 176 ? -7.919  14.779  5.416   1.00 0.45 ? 176 PHE A CB   3  
ATOM 5721  C CG   . PHE A 1 176 ? -7.440  15.200  4.057   1.00 0.49 ? 176 PHE A CG   3  
ATOM 5722  C CD1  . PHE A 1 176 ? -8.001  16.294  3.418   1.00 0.54 ? 176 PHE A CD1  3  
ATOM 5723  C CD2  . PHE A 1 176 ? -6.420  14.509  3.422   1.00 0.53 ? 176 PHE A CD2  3  
ATOM 5724  C CE1  . PHE A 1 176 ? -7.556  16.689  2.172   1.00 0.62 ? 176 PHE A CE1  3  
ATOM 5725  C CE2  . PHE A 1 176 ? -5.970  14.897  2.176   1.00 0.60 ? 176 PHE A CE2  3  
ATOM 5726  C CZ   . PHE A 1 176 ? -6.538  15.990  1.552   1.00 0.64 ? 176 PHE A CZ   3  
ATOM 5727  H H    . PHE A 1 176 ? -9.155  14.097  7.528   1.00 0.46 ? 176 PHE A H    3  
ATOM 5728  N N    . VAL A 1 177 ? -8.602  11.784  5.221   1.00 0.40 ? 177 VAL A N    3  
ATOM 5729  C CA   . VAL A 1 177 ? -8.479  10.474  4.587   1.00 0.38 ? 177 VAL A CA   3  
ATOM 5730  C C    . VAL A 1 177 ? -9.858  9.870   4.329   1.00 0.38 ? 177 VAL A C    3  
ATOM 5731  O O    . VAL A 1 177 ? -10.138 9.370   3.235   1.00 0.38 ? 177 VAL A O    3  
ATOM 5732  C CB   . VAL A 1 177 ? -7.648  9.501   5.452   1.00 0.40 ? 177 VAL A CB   3  
ATOM 5733  C CG1  . VAL A 1 177 ? -7.456  8.177   4.731   1.00 0.41 ? 177 VAL A CG1  3  
ATOM 5734  C CG2  . VAL A 1 177 ? -6.300  10.112  5.802   1.00 0.42 ? 177 VAL A CG2  3  
ATOM 5735  H H    . VAL A 1 177 ? -8.200  11.924  6.107   1.00 0.41 ? 177 VAL A H    3  
ATOM 5736  N N    . ALA A 1 178 ? -10.720 9.936   5.336   1.00 0.40 ? 178 ALA A N    3  
ATOM 5737  C CA   . ALA A 1 178 ? -12.072 9.403   5.224   1.00 0.41 ? 178 ALA A CA   3  
ATOM 5738  C C    . ALA A 1 178 ? -12.850 10.114  4.119   1.00 0.40 ? 178 ALA A C    3  
ATOM 5739  O O    . ALA A 1 178 ? -13.582 9.481   3.360   1.00 0.40 ? 178 ALA A O    3  
ATOM 5740  C CB   . ALA A 1 178 ? -12.804 9.513   6.551   1.00 0.44 ? 178 ALA A CB   3  
ATOM 5741  H H    . ALA A 1 178 ? -10.435 10.348  6.183   1.00 0.41 ? 178 ALA A H    3  
ATOM 5742  N N    . GLY A 1 179 ? -12.670 11.427  4.032   1.00 0.41 ? 179 GLY A N    3  
ATOM 5743  C CA   . GLY A 1 179 ? -13.349 12.215  3.017   1.00 0.42 ? 179 GLY A CA   3  
ATOM 5744  C C    . GLY A 1 179 ? -12.978 11.792  1.612   1.00 0.39 ? 179 GLY A C    3  
ATOM 5745  O O    . GLY A 1 179 ? -13.848 11.634  0.755   1.00 0.39 ? 179 GLY A O    3  
ATOM 5746  H H    . GLY A 1 179 ? -12.073 11.871  4.674   1.00 0.42 ? 179 GLY A H    3  
ATOM 5747  N N    . VAL A 1 180 ? -11.684 11.587  1.383   1.00 0.37 ? 180 VAL A N    3  
ATOM 5748  C CA   . VAL A 1 180 ? -11.192 11.170  0.073   1.00 0.35 ? 180 VAL A CA   3  
ATOM 5749  C C    . VAL A 1 180 ? -11.797 9.824   -0.318  1.00 0.33 ? 180 VAL A C    3  
ATOM 5750  O O    . VAL A 1 180 ? -12.256 9.637   -1.447  1.00 0.33 ? 180 VAL A O    3  
ATOM 5751  C CB   . VAL A 1 180 ? -9.649  11.072  0.051   1.00 0.36 ? 180 VAL A CB   3  
ATOM 5752  C CG1  . VAL A 1 180 ? -9.151  10.639  -1.320  1.00 0.36 ? 180 VAL A CG1  3  
ATOM 5753  C CG2  . VAL A 1 180 ? -9.020  12.400  0.447   1.00 0.39 ? 180 VAL A CG2  3  
ATOM 5754  H H    . VAL A 1 180 ? -11.042 11.719  2.115   1.00 0.38 ? 180 VAL A H    3  
ATOM 5755  N N    . LEU A 1 181 ? -11.812 8.897   0.632   1.00 0.33 ? 181 LEU A N    3  
ATOM 5756  C CA   . LEU A 1 181 ? -12.370 7.568   0.403   1.00 0.33 ? 181 LEU A CA   3  
ATOM 5757  C C    . LEU A 1 181 ? -13.864 7.647   0.113   1.00 0.34 ? 181 LEU A C    3  
ATOM 5758  O O    . LEU A 1 181 ? -14.369 6.982   -0.794  1.00 0.33 ? 181 LEU A O    3  
ATOM 5759  C CB   . LEU A 1 181 ? -12.117 6.667   1.613   1.00 0.36 ? 181 LEU A CB   3  
ATOM 5760  C CG   . LEU A 1 181 ? -10.675 6.209   1.819   1.00 0.37 ? 181 LEU A CG   3  
ATOM 5761  C CD1  . LEU A 1 181 ? -10.476 5.690   3.233   1.00 0.39 ? 181 LEU A CD1  3  
ATOM 5762  C CD2  . LEU A 1 181 ? -10.307 5.141   0.798   1.00 0.40 ? 181 LEU A CD2  3  
ATOM 5763  H H    . LEU A 1 181 ? -11.431 9.112   1.512   1.00 0.34 ? 181 LEU A H    3  
ATOM 5764  N N    . THR A 1 182 ? -14.560 8.479   0.881   1.00 0.37 ? 182 THR A N    3  
ATOM 5765  C CA   . THR A 1 182 ? -15.996 8.660   0.724   1.00 0.39 ? 182 THR A CA   3  
ATOM 5766  C C    . THR A 1 182 ? -16.335 9.175   -0.676  1.00 0.38 ? 182 THR A C    3  
ATOM 5767  O O    . THR A 1 182 ? -17.306 8.729   -1.292  1.00 0.38 ? 182 THR A O    3  
ATOM 5768  C CB   . THR A 1 182 ? -16.547 9.634   1.789   1.00 0.45 ? 182 THR A CB   3  
ATOM 5769  O OG1  . THR A 1 182 ? -16.216 9.144   3.096   1.00 0.45 ? 182 THR A OG1  3  
ATOM 5770  C CG2  . THR A 1 182 ? -18.060 9.773   1.676   1.00 0.53 ? 182 THR A CG2  3  
ATOM 5771  H H    . THR A 1 182 ? -14.093 8.986   1.579   1.00 0.39 ? 182 THR A H    3  
ATOM 5772  H HG1  . THR A 1 182 ? -15.266 9.223   3.239   1.00 0.43 ? 182 THR A HG1  3  
ATOM 5773  N N    . ALA A 1 183 ? -15.514 10.092  -1.180  1.00 0.39 ? 183 ALA A N    3  
ATOM 5774  C CA   . ALA A 1 183 ? -15.726 10.675  -2.501  1.00 0.40 ? 183 ALA A CA   3  
ATOM 5775  C C    . ALA A 1 183 ? -15.736 9.613   -3.598  1.00 0.36 ? 183 ALA A C    3  
ATOM 5776  O O    . ALA A 1 183 ? -16.775 9.351   -4.205  1.00 0.36 ? 183 ALA A O    3  
ATOM 5777  C CB   . ALA A 1 183 ? -14.673 11.734  -2.791  1.00 0.45 ? 183 ALA A CB   3  
ATOM 5778  H H    . ALA A 1 183 ? -14.747 10.389  -0.643  1.00 0.40 ? 183 ALA A H    3  
ATOM 5779  N N    . SER A 1 184 ? -14.586 8.983   -3.820  1.00 0.35 ? 184 SER A N    3  
ATOM 5780  C CA   . SER A 1 184 ? -14.444 7.962   -4.852  1.00 0.34 ? 184 SER A CA   3  
ATOM 5781  C C    . SER A 1 184 ? -15.454 6.825   -4.700  1.00 0.32 ? 184 SER A C    3  
ATOM 5782  O O    . SER A 1 184 ? -15.989 6.329   -5.693  1.00 0.33 ? 184 SER A O    3  
ATOM 5783  C CB   . SER A 1 184 ? -13.017 7.415   -4.861  1.00 0.37 ? 184 SER A CB   3  
ATOM 5784  O OG   . SER A 1 184 ? -12.078 8.477   -4.790  1.00 0.40 ? 184 SER A OG   3  
ATOM 5785  H H    . SER A 1 184 ? -13.801 9.211   -3.272  1.00 0.38 ? 184 SER A H    3  
ATOM 5786  H HG   . SER A 1 184 ? -12.024 8.908   -5.648  1.00 0.76 ? 184 SER A HG   3  
ATOM 5787  N N    . LEU A 1 185 ? -15.727 6.428   -3.460  1.00 0.33 ? 185 LEU A N    3  
ATOM 5788  C CA   . LEU A 1 185 ? -16.670 5.350   -3.195  1.00 0.35 ? 185 LEU A CA   3  
ATOM 5789  C C    . LEU A 1 185 ? -18.087 5.724   -3.624  1.00 0.36 ? 185 LEU A C    3  
ATOM 5790  O O    . LEU A 1 185 ? -18.769 4.943   -4.291  1.00 0.37 ? 185 LEU A O    3  
ATOM 5791  C CB   . LEU A 1 185 ? -16.637 4.955   -1.717  1.00 0.40 ? 185 LEU A CB   3  
ATOM 5792  C CG   . LEU A 1 185 ? -17.213 3.580   -1.368  1.00 0.66 ? 185 LEU A CG   3  
ATOM 5793  C CD1  . LEU A 1 185 ? -16.568 2.496   -2.218  1.00 1.01 ? 185 LEU A CD1  3  
ATOM 5794  C CD2  . LEU A 1 185 ? -17.014 3.284   0.109   1.00 0.77 ? 185 LEU A CD2  3  
ATOM 5795  H H    . LEU A 1 185 ? -15.281 6.870   -2.703  1.00 0.34 ? 185 LEU A H    3  
ATOM 5796  N N    . THR A 1 186 ? -18.525 6.924   -3.257  1.00 0.38 ? 186 THR A N    3  
ATOM 5797  C CA   . THR A 1 186 ? -19.858 7.386   -3.620  1.00 0.41 ? 186 THR A CA   3  
ATOM 5798  C C    . THR A 1 186 ? -19.963 7.588   -5.132  1.00 0.38 ? 186 THR A C    3  
ATOM 5799  O O    . THR A 1 186 ? -21.004 7.321   -5.734  1.00 0.43 ? 186 THR A O    3  
ATOM 5800  C CB   . THR A 1 186 ? -20.234 8.691   -2.889  1.00 0.47 ? 186 THR A CB   3  
ATOM 5801  O OG1  . THR A 1 186 ? -19.919 8.566   -1.497  1.00 0.50 ? 186 THR A OG1  3  
ATOM 5802  C CG2  . THR A 1 186 ? -21.720 8.971   -3.037  1.00 0.54 ? 186 THR A CG2  3  
ATOM 5803  H H    . THR A 1 186 ? -17.939 7.511   -2.732  1.00 0.38 ? 186 THR A H    3  
ATOM 5804  H HG1  . THR A 1 186 ? -18.987 8.786   -1.361  1.00 0.49 ? 186 THR A HG1  3  
ATOM 5805  N N    . ILE A 1 187 ? -18.873 8.047   -5.739  1.00 0.35 ? 187 ILE A N    3  
ATOM 5806  C CA   . ILE A 1 187 ? -18.835 8.267   -7.179  1.00 0.36 ? 187 ILE A CA   3  
ATOM 5807  C C    . ILE A 1 187 ? -19.003 6.936   -7.911  1.00 0.35 ? 187 ILE A C    3  
ATOM 5808  O O    . ILE A 1 187 ? -19.644 6.866   -8.963  1.00 0.45 ? 187 ILE A O    3  
ATOM 5809  C CB   . ILE A 1 187 ? -17.511 8.942   -7.608  1.00 0.38 ? 187 ILE A CB   3  
ATOM 5810  C CG1  . ILE A 1 187 ? -17.441 10.367  -7.056  1.00 0.38 ? 187 ILE A CG1  3  
ATOM 5811  C CG2  . ILE A 1 187 ? -17.363 8.954   -9.123  1.00 0.41 ? 187 ILE A CG2  3  
ATOM 5812  C CD1  . ILE A 1 187 ? -16.095 11.035  -7.249  1.00 0.43 ? 187 ILE A CD1  3  
ATOM 5813  H H    . ILE A 1 187 ? -18.073 8.245   -5.202  1.00 0.36 ? 187 ILE A H    3  
ATOM 5814  N N    . TRP A 1 188 ? -18.431 5.884   -7.337  1.00 0.35 ? 188 TRP A N    3  
ATOM 5815  C CA   . TRP A 1 188 ? -18.518 4.551   -7.917  1.00 0.37 ? 188 TRP A CA   3  
ATOM 5816  C C    . TRP A 1 188 ? -19.934 4.008   -7.813  1.00 0.38 ? 188 TRP A C    3  
ATOM 5817  O O    . TRP A 1 188 ? -20.516 3.567   -8.807  1.00 0.40 ? 188 TRP A O    3  
ATOM 5818  C CB   . TRP A 1 188 ? -17.541 3.597   -7.231  1.00 0.40 ? 188 TRP A CB   3  
ATOM 5819  C CG   . TRP A 1 188 ? -16.444 3.130   -8.130  1.00 0.41 ? 188 TRP A CG   3  
ATOM 5820  C CD1  . TRP A 1 188 ? -15.144 3.536   -8.109  1.00 0.51 ? 188 TRP A CD1  3  
ATOM 5821  C CD2  . TRP A 1 188 ? -16.552 2.173   -9.190  1.00 0.41 ? 188 TRP A CD2  3  
ATOM 5822  N NE1  . TRP A 1 188 ? -14.434 2.890   -9.088  1.00 0.55 ? 188 TRP A NE1  3  
ATOM 5823  C CE2  . TRP A 1 188 ? -15.275 2.050   -9.769  1.00 0.48 ? 188 TRP A CE2  3  
ATOM 5824  C CE3  . TRP A 1 188 ? -17.604 1.409   -9.707  1.00 0.47 ? 188 TRP A CE3  3  
ATOM 5825  C CZ2  . TRP A 1 188 ? -15.019 1.192   -10.836 1.00 0.54 ? 188 TRP A CZ2  3  
ATOM 5826  C CZ3  . TRP A 1 188 ? -17.347 0.559   -10.766 1.00 0.56 ? 188 TRP A CZ3  3  
ATOM 5827  C CH2  . TRP A 1 188 ? -16.066 0.457   -11.321 1.00 0.57 ? 188 TRP A CH2  3  
ATOM 5828  H H    . TRP A 1 188 ? -17.934 6.010   -6.499  1.00 0.41 ? 188 TRP A H    3  
ATOM 5829  H HE1  . TRP A 1 188 ? -13.478 3.013   -9.271  1.00 0.65 ? 188 TRP A HE1  3  
ATOM 5830  N N    . LYS A 1 189 ? -20.487 4.051   -6.607  1.00 0.39 ? 189 LYS A N    3  
ATOM 5831  C CA   . LYS A 1 189 ? -21.839 3.559   -6.366  1.00 0.43 ? 189 LYS A CA   3  
ATOM 5832  C C    . LYS A 1 189 ? -22.891 4.598   -6.745  1.00 0.46 ? 189 LYS A C    3  
ATOM 5833  O O    . LYS A 1 189 ? -23.684 5.037   -5.910  1.00 0.55 ? 189 LYS A O    3  
ATOM 5834  C CB   . LYS A 1 189 ? -22.016 3.114   -4.910  1.00 0.49 ? 189 LYS A CB   3  
ATOM 5835  C CG   . LYS A 1 189 ? -21.909 1.611   -4.705  1.00 0.71 ? 189 LYS A CG   3  
ATOM 5836  C CD   . LYS A 1 189 ? -22.883 0.866   -5.603  1.00 1.05 ? 189 LYS A CD   3  
ATOM 5837  C CE   . LYS A 1 189 ? -23.802 -0.042  -4.805  1.00 0.83 ? 189 LYS A CE   3  
ATOM 5838  N NZ   . LYS A 1 189 ? -23.146 -1.328  -4.453  1.00 0.84 ? 189 LYS A NZ   3  
ATOM 5839  H H    . LYS A 1 189 ? -19.973 4.429   -5.858  1.00 0.40 ? 189 LYS A H    3  
ATOM 5840  H HZ1  . LYS A 1 189 ? -23.860 -2.025  -4.157  1.00 1.14 ? 189 LYS A HZ1  3  
ATOM 5841  H HZ2  . LYS A 1 189 ? -22.473 -1.189  -3.669  1.00 1.13 ? 189 LYS A HZ2  3  
ATOM 5842  H HZ3  . LYS A 1 189 ? -22.630 -1.706  -5.279  1.00 1.03 ? 189 LYS A HZ3  3  
ATOM 5843  N N    . LYS A 1 190 ? -22.883 4.988   -8.010  1.00 0.49 ? 190 LYS A N    3  
ATOM 5844  C CA   . LYS A 1 190 ? -23.829 5.967   -8.529  1.00 0.57 ? 190 LYS A CA   3  
ATOM 5845  C C    . LYS A 1 190 ? -25.207 5.335   -8.723  1.00 0.55 ? 190 LYS A C    3  
ATOM 5846  O O    . LYS A 1 190 ? -25.610 5.032   -9.846  1.00 0.61 ? 190 LYS A O    3  
ATOM 5847  C CB   . LYS A 1 190 ? -23.311 6.573   -9.844  1.00 0.67 ? 190 LYS A CB   3  
ATOM 5848  C CG   . LYS A 1 190 ? -22.408 5.651   -10.660 1.00 0.65 ? 190 LYS A CG   3  
ATOM 5849  C CD   . LYS A 1 190 ? -23.206 4.739   -11.578 1.00 0.69 ? 190 LYS A CD   3  
ATOM 5850  C CE   . LYS A 1 190 ? -22.348 3.617   -12.136 1.00 0.75 ? 190 LYS A CE   3  
ATOM 5851  N NZ   . LYS A 1 190 ? -21.903 2.675   -11.075 1.00 0.73 ? 190 LYS A NZ   3  
ATOM 5852  H H    . LYS A 1 190 ? -22.213 4.605   -8.617  1.00 0.52 ? 190 LYS A H    3  
ATOM 5853  H HZ1  . LYS A 1 190 ? -21.439 1.848   -11.501 1.00 0.85 ? 190 LYS A HZ1  3  
ATOM 5854  H HZ2  . LYS A 1 190 ? -22.722 2.348   -10.509 1.00 0.77 ? 190 LYS A HZ2  3  
ATOM 5855  H HZ3  . LYS A 1 190 ? -21.228 3.146   -10.440 1.00 0.86 ? 190 LYS A HZ3  3  
ATOM 5856  N N    . MET A 1 191 ? -25.900 5.101   -7.603  1.00 0.57 ? 191 MET A N    3  
ATOM 5857  C CA   . MET A 1 191 ? -27.234 4.486   -7.596  1.00 0.61 ? 191 MET A CA   3  
ATOM 5858  C C    . MET A 1 191 ? -27.144 2.972   -7.814  1.00 0.67 ? 191 MET A C    3  
ATOM 5859  O O    . MET A 1 191 ? -27.965 2.205   -7.310  1.00 1.20 ? 191 MET A O    3  
ATOM 5860  C CB   . MET A 1 191 ? -28.171 5.135   -8.624  1.00 0.70 ? 191 MET A CB   3  
ATOM 5861  C CG   . MET A 1 191 ? -29.555 4.511   -8.699  1.00 0.89 ? 191 MET A CG   3  
ATOM 5862  S SD   . MET A 1 191 ? -30.286 4.638   -10.345 1.00 1.20 ? 191 MET A SD   3  
ATOM 5863  C CE   . MET A 1 191 ? -29.192 3.567   -11.278 1.00 1.44 ? 191 MET A CE   3  
ATOM 5864  H H    . MET A 1 191 ? -25.489 5.340   -6.742  1.00 0.63 ? 191 MET A H    3  
ATOM 5865  N N    . GLY A 1 192 ? -26.131 2.554   -8.556  1.00 0.54 ? 192 GLY A N    3  
ATOM 5866  C CA   . GLY A 1 192 ? -25.924 1.156   -8.835  1.00 0.64 ? 192 GLY A CA   3  
ATOM 5867  C C    . GLY A 1 192 ? -24.479 0.911   -9.195  1.00 0.70 ? 192 GLY A C    3  
ATOM 5868  O O    . GLY A 1 192 ? -23.752 1.902   -9.409  1.00 0.80 ? 192 GLY A O    3  
ATOM 5869  O OXT  . GLY A 1 192 ? -24.067 -0.263  -9.274  1.00 1.09 ? 192 GLY A OXT  3  
ATOM 5870  H H    . GLY A 1 192 ? -25.505 3.215   -8.928  1.00 0.80 ? 192 GLY A H    3  
ATOM 5871  N N    . GLU B 2 1   ? 0.425   -1.395  -16.352 1.00 5.01 ? 145 GLU B N    3  
ATOM 5872  C CA   . GLU B 2 1   ? -0.729  -2.033  -17.032 1.00 4.54 ? 145 GLU B CA   3  
ATOM 5873  C C    . GLU B 2 1   ? -0.747  -3.531  -16.746 1.00 3.87 ? 145 GLU B C    3  
ATOM 5874  O O    . GLU B 2 1   ? 0.083   -4.014  -15.987 1.00 3.91 ? 145 GLU B O    3  
ATOM 5875  C CB   . GLU B 2 1   ? -0.678  -1.772  -18.539 1.00 4.66 ? 145 GLU B CB   3  
ATOM 5876  C CG   . GLU B 2 1   ? -1.828  -0.919  -19.053 1.00 5.21 ? 145 GLU B CG   3  
ATOM 5877  C CD   . GLU B 2 1   ? -3.165  -1.373  -18.506 1.00 5.46 ? 145 GLU B CD   3  
ATOM 5878  O OE1  . GLU B 2 1   ? -3.516  -2.554  -18.688 1.00 5.83 ? 145 GLU B OE1  3  
ATOM 5879  O OE2  . GLU B 2 1   ? -3.863  -0.554  -17.876 1.00 5.59 ? 145 GLU B OE2  3  
ATOM 5880  H H1   . GLU B 2 1   ? 1.313   -1.734  -16.759 1.00 4.99 ? 145 GLU B H1   3  
ATOM 5881  H H2   . GLU B 2 1   ? 0.420   -1.635  -15.331 1.00 5.07 ? 145 GLU B H2   3  
ATOM 5882  H H3   . GLU B 2 1   ? 0.384   -0.356  -16.448 1.00 5.51 ? 145 GLU B H3   3  
ATOM 5883  N N    . ILE B 2 2   ? -1.680  -4.257  -17.362 1.00 3.36 ? 146 ILE B N    3  
ATOM 5884  C CA   . ILE B 2 2   ? -1.806  -5.707  -17.156 1.00 2.81 ? 146 ILE B CA   3  
ATOM 5885  C C    . ILE B 2 2   ? -0.465  -6.441  -17.261 1.00 2.31 ? 146 ILE B C    3  
ATOM 5886  O O    . ILE B 2 2   ? -0.066  -7.145  -16.335 1.00 2.12 ? 146 ILE B O    3  
ATOM 5887  C CB   . ILE B 2 2   ? -2.821  -6.346  -18.127 1.00 2.51 ? 146 ILE B CB   3  
ATOM 5888  C CG1  . ILE B 2 2   ? -4.180  -5.653  -18.008 1.00 3.14 ? 146 ILE B CG1  3  
ATOM 5889  C CG2  . ILE B 2 2   ? -2.959  -7.840  -17.853 1.00 2.36 ? 146 ILE B CG2  3  
ATOM 5890  C CD1  . ILE B 2 2   ? -5.166  -6.043  -19.088 1.00 3.05 ? 146 ILE B CD1  3  
ATOM 5891  H H    . ILE B 2 2   ? -2.315  -3.803  -17.969 1.00 3.46 ? 146 ILE B H    3  
ATOM 5892  N N    . TRP B 2 3   ? 0.233   -6.258  -18.380 1.00 2.29 ? 147 TRP B N    3  
ATOM 5893  C CA   . TRP B 2 3   ? 1.525   -6.915  -18.589 1.00 2.19 ? 147 TRP B CA   3  
ATOM 5894  C C    . TRP B 2 3   ? 2.573   -6.422  -17.595 1.00 2.49 ? 147 TRP B C    3  
ATOM 5895  O O    . TRP B 2 3   ? 3.378   -7.200  -17.083 1.00 2.25 ? 147 TRP B O    3  
ATOM 5896  C CB   . TRP B 2 3   ? 2.013   -6.715  -20.030 1.00 2.58 ? 147 TRP B CB   3  
ATOM 5897  C CG   . TRP B 2 3   ? 3.402   -7.222  -20.277 1.00 2.84 ? 147 TRP B CG   3  
ATOM 5898  C CD1  . TRP B 2 3   ? 3.793   -8.525  -20.400 1.00 2.81 ? 147 TRP B CD1  3  
ATOM 5899  C CD2  . TRP B 2 3   ? 4.587   -6.432  -20.431 1.00 3.46 ? 147 TRP B CD2  3  
ATOM 5900  N NE1  . TRP B 2 3   ? 5.147   -8.596  -20.618 1.00 3.38 ? 147 TRP B NE1  3  
ATOM 5901  C CE2  . TRP B 2 3   ? 5.658   -7.323  -20.643 1.00 3.73 ? 147 TRP B CE2  3  
ATOM 5902  C CE3  . TRP B 2 3   ? 4.845   -5.057  -20.410 1.00 3.97 ? 147 TRP B CE3  3  
ATOM 5903  C CZ2  . TRP B 2 3   ? 6.964   -6.881  -20.832 1.00 4.39 ? 147 TRP B CZ2  3  
ATOM 5904  C CZ3  . TRP B 2 3   ? 6.142   -4.623  -20.599 1.00 4.60 ? 147 TRP B CZ3  3  
ATOM 5905  C CH2  . TRP B 2 3   ? 7.186   -5.532  -20.806 1.00 4.76 ? 147 TRP B CH2  3  
ATOM 5906  H H    . TRP B 2 3   ? -0.130  -5.674  -19.081 1.00 2.51 ? 147 TRP B H    3  
ATOM 5907  H HE1  . TRP B 2 3   ? 5.664   -9.425  -20.737 1.00 3.63 ? 147 TRP B HE1  3  
ATOM 5908  N N    . ILE B 2 4   ? 2.551   -5.128  -17.310 1.00 3.10 ? 148 ILE B N    3  
ATOM 5909  C CA   . ILE B 2 4   ? 3.506   -4.537  -16.380 1.00 3.51 ? 148 ILE B CA   3  
ATOM 5910  C C    . ILE B 2 4   ? 3.295   -5.074  -14.963 1.00 3.20 ? 148 ILE B C    3  
ATOM 5911  O O    . ILE B 2 4   ? 4.257   -5.401  -14.261 1.00 3.08 ? 148 ILE B O    3  
ATOM 5912  C CB   . ILE B 2 4   ? 3.412   -2.999  -16.380 1.00 4.34 ? 148 ILE B CB   3  
ATOM 5913  C CG1  . ILE B 2 4   ? 3.520   -2.475  -17.815 1.00 4.68 ? 148 ILE B CG1  3  
ATOM 5914  C CG2  . ILE B 2 4   ? 4.507   -2.399  -15.510 1.00 4.81 ? 148 ILE B CG2  3  
ATOM 5915  C CD1  . ILE B 2 4   ? 3.508   -0.965  -17.930 1.00 5.45 ? 148 ILE B CD1  3  
ATOM 5916  H H    . ILE B 2 4   ? 1.875   -4.560  -17.730 1.00 3.34 ? 148 ILE B H    3  
ATOM 5917  N N    . ALA B 2 5   ? 2.031   -5.186  -14.565 1.00 3.18 ? 149 ALA B N    3  
ATOM 5918  C CA   . ALA B 2 5   ? 1.672   -5.683  -13.244 1.00 3.15 ? 149 ALA B CA   3  
ATOM 5919  C C    . ALA B 2 5   ? 2.148   -7.117  -13.042 1.00 2.43 ? 149 ALA B C    3  
ATOM 5920  O O    . ALA B 2 5   ? 2.391   -7.538  -11.914 1.00 2.45 ? 149 ALA B O    3  
ATOM 5921  C CB   . ALA B 2 5   ? 0.170   -5.588  -13.026 1.00 3.53 ? 149 ALA B CB   3  
ATOM 5922  H H    . ALA B 2 5   ? 1.315   -4.911  -15.179 1.00 3.30 ? 149 ALA B H    3  
ATOM 5923  N N    . GLN B 2 6   ? 2.280   -7.862  -14.136 1.00 1.86 ? 150 GLN B N    3  
ATOM 5924  C CA   . GLN B 2 6   ? 2.739   -9.245  -14.070 1.00 1.28 ? 150 GLN B CA   3  
ATOM 5925  C C    . GLN B 2 6   ? 4.140   -9.319  -13.461 1.00 1.15 ? 150 GLN B C    3  
ATOM 5926  O O    . GLN B 2 6   ? 4.360   -10.007 -12.463 1.00 0.98 ? 150 GLN B O    3  
ATOM 5927  C CB   . GLN B 2 6   ? 2.735   -9.889  -15.459 1.00 1.05 ? 150 GLN B CB   3  
ATOM 5928  C CG   . GLN B 2 6   ? 3.269   -11.314 -15.481 1.00 1.34 ? 150 GLN B CG   3  
ATOM 5929  C CD   . GLN B 2 6   ? 3.678   -11.776 -16.868 1.00 1.76 ? 150 GLN B CD   3  
ATOM 5930  O OE1  . GLN B 2 6   ? 3.090   -11.373 -17.872 1.00 1.81 ? 150 GLN B OE1  3  
ATOM 5931  N NE2  . GLN B 2 6   ? 4.692   -12.627 -16.931 1.00 2.39 ? 150 GLN B NE2  3  
ATOM 5932  H H    . GLN B 2 6   ? 2.059   -7.471  -15.008 1.00 1.92 ? 150 GLN B H    3  
ATOM 5933  H HE21 . GLN B 2 6   ? 5.117   -12.905 -16.089 1.00 2.51 ? 150 GLN B HE21 3  
ATOM 5934  H HE22 . GLN B 2 6   ? 4.979   -12.941 -17.814 1.00 2.81 ? 150 GLN B HE22 3  
ATOM 5935  N N    . GLU B 2 7   ? 5.076   -8.592  -14.059 1.00 1.59 ? 151 GLU B N    3  
ATOM 5936  C CA   . GLU B 2 7   ? 6.451   -8.572  -13.578 1.00 1.93 ? 151 GLU B CA   3  
ATOM 5937  C C    . GLU B 2 7   ? 6.534   -7.879  -12.221 1.00 2.05 ? 151 GLU B C    3  
ATOM 5938  O O    . GLU B 2 7   ? 7.229   -8.343  -11.317 1.00 1.93 ? 151 GLU B O    3  
ATOM 5939  C CB   . GLU B 2 7   ? 7.366   -7.901  -14.611 1.00 2.71 ? 151 GLU B CB   3  
ATOM 5940  C CG   . GLU B 2 7   ? 8.713   -7.411  -14.089 1.00 3.38 ? 151 GLU B CG   3  
ATOM 5941  C CD   . GLU B 2 7   ? 9.544   -8.484  -13.406 1.00 3.37 ? 151 GLU B CD   3  
ATOM 5942  O OE1  . GLU B 2 7   ? 9.456   -9.666  -13.797 1.00 3.26 ? 151 GLU B OE1  3  
ATOM 5943  O OE2  . GLU B 2 7   ? 10.302  -8.140  -12.477 1.00 3.77 ? 151 GLU B OE2  3  
ATOM 5944  H H    . GLU B 2 7   ? 4.836   -8.055  -14.845 1.00 1.84 ? 151 GLU B H    3  
ATOM 5945  N N    . LEU B 2 8   ? 5.801   -6.782  -12.073 1.00 2.45 ? 152 LEU B N    3  
ATOM 5946  C CA   . LEU B 2 8   ? 5.799   -6.038  -10.821 1.00 2.86 ? 152 LEU B CA   3  
ATOM 5947  C C    . LEU B 2 8   ? 5.288   -6.901  -9.675  1.00 2.48 ? 152 LEU B C    3  
ATOM 5948  O O    . LEU B 2 8   ? 5.811   -6.841  -8.562  1.00 2.62 ? 152 LEU B O    3  
ATOM 5949  C CB   . LEU B 2 8   ? 4.992   -4.746  -10.951 1.00 3.54 ? 152 LEU B CB   3  
ATOM 5950  C CG   . LEU B 2 8   ? 5.554   -3.722  -11.939 1.00 4.02 ? 152 LEU B CG   3  
ATOM 5951  C CD1  . LEU B 2 8   ? 4.658   -2.504  -12.017 1.00 4.62 ? 152 LEU B CD1  3  
ATOM 5952  C CD2  . LEU B 2 8   ? 6.970   -3.321  -11.557 1.00 4.35 ? 152 LEU B CD2  3  
ATOM 5953  H H    . LEU B 2 8   ? 5.248   -6.466  -12.824 1.00 2.58 ? 152 LEU B H    3  
ATOM 5954  N N    . ARG B 2 9   ? 4.278   -7.719  -9.958  1.00 2.13 ? 153 ARG B N    3  
ATOM 5955  C CA   . ARG B 2 9   ? 3.718   -8.617  -8.961  1.00 2.11 ? 153 ARG B CA   3  
ATOM 5956  C C    . ARG B 2 9   ? 4.789   -9.606  -8.525  1.00 1.51 ? 153 ARG B C    3  
ATOM 5957  O O    . ARG B 2 9   ? 4.908   -9.929  -7.343  1.00 1.66 ? 153 ARG B O    3  
ATOM 5958  C CB   . ARG B 2 9   ? 2.518   -9.374  -9.537  1.00 2.28 ? 153 ARG B CB   3  
ATOM 5959  C CG   . ARG B 2 9   ? 1.785   -10.256 -8.539  1.00 2.79 ? 153 ARG B CG   3  
ATOM 5960  C CD   . ARG B 2 9   ? 1.507   -11.631 -9.124  1.00 3.22 ? 153 ARG B CD   3  
ATOM 5961  N NE   . ARG B 2 9   ? 0.153   -12.102 -8.824  1.00 3.39 ? 153 ARG B NE   3  
ATOM 5962  C CZ   . ARG B 2 9   ? -0.243  -13.371 -8.974  1.00 3.88 ? 153 ARG B CZ   3  
ATOM 5963  N NH1  . ARG B 2 9   ? 0.626   -14.290 -9.387  1.00 4.32 ? 153 ARG B NH1  3  
ATOM 5964  N NH2  . ARG B 2 9   ? -1.501  -13.720 -8.717  1.00 4.17 ? 153 ARG B NH2  3  
ATOM 5965  H H    . ARG B 2 9   ? 3.891   -7.706  -10.863 1.00 2.05 ? 153 ARG B H    3  
ATOM 5966  H HE   . ARG B 2 9   ? -0.492  -11.437 -8.505  1.00 3.35 ? 153 ARG B HE   3  
ATOM 5967  H HH11 . ARG B 2 9   ? 1.578   -14.037 -9.580  1.00 4.33 ? 153 ARG B HH11 3  
ATOM 5968  H HH12 . ARG B 2 9   ? 0.325   -15.240 -9.524  1.00 4.80 ? 153 ARG B HH12 3  
ATOM 5969  H HH21 . ARG B 2 9   ? -2.173  -13.036 -8.415  1.00 4.15 ? 153 ARG B HH21 3  
ATOM 5970  H HH22 . ARG B 2 9   ? -1.786  -14.688 -8.809  1.00 4.58 ? 153 ARG B HH22 3  
ATOM 5971  N N    . ARG B 2 10  ? 5.584   -10.062 -9.492  1.00 1.01 ? 154 ARG B N    3  
ATOM 5972  C CA   . ARG B 2 10  ? 6.657   -11.008 -9.221  1.00 0.90 ? 154 ARG B CA   3  
ATOM 5973  C C    . ARG B 2 10  ? 7.703   -10.390 -8.298  1.00 1.04 ? 154 ARG B C    3  
ATOM 5974  O O    . ARG B 2 10  ? 8.301   -11.085 -7.483  1.00 1.02 ? 154 ARG B O    3  
ATOM 5975  C CB   . ARG B 2 10  ? 7.315   -11.486 -10.515 1.00 1.34 ? 154 ARG B CB   3  
ATOM 5976  C CG   . ARG B 2 10  ? 8.397   -12.527 -10.285 1.00 2.01 ? 154 ARG B CG   3  
ATOM 5977  C CD   . ARG B 2 10  ? 9.579   -12.328 -11.217 1.00 2.84 ? 154 ARG B CD   3  
ATOM 5978  N NE   . ARG B 2 10  ? 10.106  -10.965 -11.174 1.00 3.10 ? 154 ARG B NE   3  
ATOM 5979  C CZ   . ARG B 2 10  ? 10.982  -10.518 -10.268 1.00 3.57 ? 154 ARG B CZ   3  
ATOM 5980  N NH1  . ARG B 2 10  ? 11.422  -11.316 -9.303  1.00 3.71 ? 154 ARG B NH1  3  
ATOM 5981  N NH2  . ARG B 2 10  ? 11.413  -9.272  -10.341 1.00 4.07 ? 154 ARG B NH2  3  
ATOM 5982  H H    . ARG B 2 10  ? 5.443   -9.750  -10.412 1.00 1.06 ? 154 ARG B H    3  
ATOM 5983  H HE   . ARG B 2 10  ? 9.796   -10.340 -11.877 1.00 3.07 ? 154 ARG B HE   3  
ATOM 5984  H HH11 . ARG B 2 10  ? 11.107  -12.263 -9.246  1.00 3.54 ? 154 ARG B HH11 3  
ATOM 5985  H HH12 . ARG B 2 10  ? 12.072  -10.961 -8.609  1.00 4.08 ? 154 ARG B HH12 3  
ATOM 5986  H HH21 . ARG B 2 10  ? 11.075  -8.665  -11.080 1.00 4.11 ? 154 ARG B HH21 3  
ATOM 5987  H HH22 . ARG B 2 10  ? 12.082  -8.924  -9.676  1.00 4.49 ? 154 ARG B HH22 3  
ATOM 5988  N N    . ILE B 2 11  ? 7.928   -9.086  -8.436  1.00 1.56 ? 155 ILE B N    3  
ATOM 5989  C CA   . ILE B 2 11  ? 8.888   -8.386  -7.586  1.00 2.08 ? 155 ILE B CA   3  
ATOM 5990  C C    . ILE B 2 11  ? 8.440   -8.498  -6.133  1.00 2.01 ? 155 ILE B C    3  
ATOM 5991  O O    . ILE B 2 11  ? 9.243   -8.754  -5.234  1.00 2.10 ? 155 ILE B O    3  
ATOM 5992  C CB   . ILE B 2 11  ? 9.022   -6.896  -7.973  1.00 2.96 ? 155 ILE B CB   3  
ATOM 5993  C CG1  . ILE B 2 11  ? 9.479   -6.765  -9.428  1.00 3.16 ? 155 ILE B CG1  3  
ATOM 5994  C CG2  . ILE B 2 11  ? 9.994   -6.183  -7.041  1.00 3.62 ? 155 ILE B CG2  3  
ATOM 5995  C CD1  . ILE B 2 11  ? 9.561   -5.339  -9.932  1.00 3.96 ? 155 ILE B CD1  3  
ATOM 5996  H H    . ILE B 2 11  ? 7.444   -8.586  -9.130  1.00 1.71 ? 155 ILE B H    3  
ATOM 5997  N N    . GLY B 2 12  ? 7.142   -8.321  -5.919  1.00 2.07 ? 156 GLY B N    3  
ATOM 5998  C CA   . GLY B 2 12  ? 6.590   -8.432  -4.589  1.00 2.48 ? 156 GLY B CA   3  
ATOM 5999  C C    . GLY B 2 12  ? 6.562   -9.876  -4.136  1.00 2.14 ? 156 GLY B C    3  
ATOM 6000  O O    . GLY B 2 12  ? 6.738   -10.167 -2.959  1.00 2.57 ? 156 GLY B O    3  
ATOM 6001  H H    . GLY B 2 12  ? 6.557   -8.114  -6.678  1.00 2.00 ? 156 GLY B H    3  
ATOM 6002  N N    . ASP B 2 13  ? 6.340   -10.775 -5.091  1.00 1.53 ? 157 ASP B N    3  
ATOM 6003  C CA   . ASP B 2 13  ? 6.298   -12.213 -4.827  1.00 1.56 ? 157 ASP B CA   3  
ATOM 6004  C C    . ASP B 2 13  ? 7.662   -12.692 -4.356  1.00 1.01 ? 157 ASP B C    3  
ATOM 6005  O O    . ASP B 2 13  ? 7.779   -13.407 -3.359  1.00 1.21 ? 157 ASP B O    3  
ATOM 6006  C CB   . ASP B 2 13  ? 5.938   -12.962 -6.113  1.00 1.82 ? 157 ASP B CB   3  
ATOM 6007  C CG   . ASP B 2 13  ? 4.507   -13.444 -6.156  1.00 2.23 ? 157 ASP B CG   3  
ATOM 6008  O OD1  . ASP B 2 13  ? 3.593   -12.603 -6.290  1.00 2.73 ? 157 ASP B OD1  3  
ATOM 6009  O OD2  . ASP B 2 13  ? 4.292   -14.668 -6.080  1.00 2.40 ? 157 ASP B OD2  3  
ATOM 6010  H H    . ASP B 2 13  ? 6.192   -10.459 -6.012  1.00 1.27 ? 157 ASP B H    3  
ATOM 6011  N N    . GLU B 2 14  ? 8.687   -12.281 -5.090  1.00 0.71 ? 158 GLU B N    3  
ATOM 6012  C CA   . GLU B 2 14  ? 10.064  -12.635 -4.789  1.00 1.05 ? 158 GLU B CA   3  
ATOM 6013  C C    . GLU B 2 14  ? 10.450  -12.160 -3.391  1.00 1.29 ? 158 GLU B C    3  
ATOM 6014  O O    . GLU B 2 14  ? 11.100  -12.884 -2.632  1.00 1.29 ? 158 GLU B O    3  
ATOM 6015  C CB   . GLU B 2 14  ? 10.980  -12.025 -5.853  1.00 1.84 ? 158 GLU B CB   3  
ATOM 6016  C CG   . GLU B 2 14  ? 12.340  -11.579 -5.354  1.00 2.74 ? 158 GLU B CG   3  
ATOM 6017  C CD   . GLU B 2 14  ? 12.807  -10.316 -6.043  1.00 3.59 ? 158 GLU B CD   3  
ATOM 6018  O OE1  . GLU B 2 14  ? 12.823  -10.284 -7.291  1.00 3.85 ? 158 GLU B OE1  3  
ATOM 6019  O OE2  . GLU B 2 14  ? 13.157  -9.347  -5.343  1.00 4.27 ? 158 GLU B OE2  3  
ATOM 6020  H H    . GLU B 2 14  ? 8.505   -11.719 -5.878  1.00 0.77 ? 158 GLU B H    3  
ATOM 6021  N N    . PHE B 2 15  ? 10.030  -10.953 -3.049  1.00 1.81 ? 159 PHE B N    3  
ATOM 6022  C CA   . PHE B 2 15  ? 10.326  -10.391 -1.744  1.00 2.48 ? 159 PHE B CA   3  
ATOM 6023  C C    . PHE B 2 15  ? 9.486   -11.066 -0.667  1.00 2.47 ? 159 PHE B C    3  
ATOM 6024  O O    . PHE B 2 15  ? 9.959   -11.308 0.443   1.00 2.90 ? 159 PHE B O    3  
ATOM 6025  C CB   . PHE B 2 15  ? 10.073  -8.883  -1.744  1.00 3.29 ? 159 PHE B CB   3  
ATOM 6026  C CG   . PHE B 2 15  ? 11.256  -8.070  -1.307  1.00 3.63 ? 159 PHE B CG   3  
ATOM 6027  C CD1  . PHE B 2 15  ? 12.399  -8.011  -2.089  1.00 3.87 ? 159 PHE B CD1  3  
ATOM 6028  C CD2  . PHE B 2 15  ? 11.227  -7.362  -0.119  1.00 4.07 ? 159 PHE B CD2  3  
ATOM 6029  C CE1  . PHE B 2 15  ? 13.491  -7.263  -1.692  1.00 4.37 ? 159 PHE B CE1  3  
ATOM 6030  C CE2  . PHE B 2 15  ? 12.315  -6.611  0.284   1.00 4.53 ? 159 PHE B CE2  3  
ATOM 6031  C CZ   . PHE B 2 15  ? 13.448  -6.561  -0.502  1.00 4.61 ? 159 PHE B CZ   3  
ATOM 6032  H H    . PHE B 2 15  ? 9.510   -10.424 -3.693  1.00 1.86 ? 159 PHE B H    3  
ATOM 6033  N N    . ASN B 2 16  ? 8.243   -11.382 -1.008  1.00 2.24 ? 160 ASN B N    3  
ATOM 6034  C CA   . ASN B 2 16  ? 7.324   -12.027 -0.078  1.00 2.65 ? 160 ASN B CA   3  
ATOM 6035  C C    . ASN B 2 16  ? 7.827   -13.407 0.320   1.00 2.24 ? 160 ASN B C    3  
ATOM 6036  O O    . ASN B 2 16  ? 7.691   -13.821 1.468   1.00 2.59 ? 160 ASN B O    3  
ATOM 6037  C CB   . ASN B 2 16  ? 5.925   -12.137 -0.692  1.00 2.97 ? 160 ASN B CB   3  
ATOM 6038  C CG   . ASN B 2 16  ? 4.804   -12.112 0.335   1.00 3.76 ? 160 ASN B CG   3  
ATOM 6039  O OD1  . ASN B 2 16  ? 3.686   -11.693 0.037   1.00 4.03 ? 160 ASN B OD1  3  
ATOM 6040  N ND2  . ASN B 2 16  ? 5.085   -12.560 1.550   1.00 4.32 ? 160 ASN B ND2  3  
ATOM 6041  H H    . ASN B 2 16  ? 7.927   -11.166 -1.913  1.00 1.99 ? 160 ASN B H    3  
ATOM 6042  H HD21 . ASN B 2 16  ? 5.996   -12.886 1.729   1.00 4.25 ? 160 ASN B HD21 3  
ATOM 6043  H HD22 . ASN B 2 16  ? 4.377   -12.546 2.219   1.00 4.87 ? 160 ASN B HD22 3  
ATOM 6044  N N    . ALA B 2 17  ? 8.428   -14.105 -0.635  1.00 1.59 ? 161 ALA B N    3  
ATOM 6045  C CA   . ALA B 2 17  ? 8.952   -15.442 -0.392  1.00 1.42 ? 161 ALA B CA   3  
ATOM 6046  C C    . ALA B 2 17  ? 10.305  -15.397 0.316   1.00 1.04 ? 161 ALA B C    3  
ATOM 6047  O O    . ALA B 2 17  ? 10.912  -16.437 0.581   1.00 1.12 ? 161 ALA B O    3  
ATOM 6048  C CB   . ALA B 2 17  ? 9.063   -16.211 -1.700  1.00 1.66 ? 161 ALA B CB   3  
ATOM 6049  H H    . ALA B 2 17  ? 8.518   -13.709 -1.531  1.00 1.37 ? 161 ALA B H    3  
ATOM 6050  N N    . TYR B 2 18  ? 10.778  -14.192 0.615   1.00 1.36 ? 162 TYR B N    3  
ATOM 6051  C CA   . TYR B 2 18  ? 12.055  -14.020 1.293   1.00 1.82 ? 162 TYR B CA   3  
ATOM 6052  C C    . TYR B 2 18  ? 11.841  -13.691 2.770   1.00 2.42 ? 162 TYR B C    3  
ATOM 6053  O O    . TYR B 2 18  ? 12.746  -13.839 3.590   1.00 2.52 ? 162 TYR B O    3  
ATOM 6054  C CB   . TYR B 2 18  ? 12.882  -12.925 0.603   1.00 2.45 ? 162 TYR B CB   3  
ATOM 6055  C CG   . TYR B 2 18  ? 14.272  -12.727 1.171   1.00 3.23 ? 162 TYR B CG   3  
ATOM 6056  C CD1  . TYR B 2 18  ? 15.138  -13.802 1.357   1.00 3.36 ? 162 TYR B CD1  3  
ATOM 6057  C CD2  . TYR B 2 18  ? 14.722  -11.462 1.523   1.00 4.05 ? 162 TYR B CD2  3  
ATOM 6058  C CE1  . TYR B 2 18  ? 16.405  -13.620 1.880   1.00 4.18 ? 162 TYR B CE1  3  
ATOM 6059  C CE2  . TYR B 2 18  ? 15.989  -11.270 2.044   1.00 4.79 ? 162 TYR B CE2  3  
ATOM 6060  C CZ   . TYR B 2 18  ? 16.825  -12.351 2.221   1.00 4.82 ? 162 TYR B CZ   3  
ATOM 6061  O OH   . TYR B 2 18  ? 18.089  -12.164 2.744   1.00 5.64 ? 162 TYR B OH   3  
ATOM 6062  H H    . TYR B 2 18  ? 10.257  -13.396 0.369   1.00 1.62 ? 162 TYR B H    3  
ATOM 6063  H HH   . TYR B 2 18  ? 18.086  -11.392 3.320   1.00 5.90 ? 162 TYR B HH   3  
ATOM 6064  N N    . TYR B 2 19  ? 10.631  -13.264 3.106   1.00 3.05 ? 163 TYR B N    3  
ATOM 6065  C CA   . TYR B 2 19  ? 10.304  -12.911 4.480   1.00 3.89 ? 163 TYR B CA   3  
ATOM 6066  C C    . TYR B 2 19  ? 9.178   -13.783 5.026   1.00 4.14 ? 163 TYR B C    3  
ATOM 6067  O O    . TYR B 2 19  ? 8.534   -13.440 6.018   1.00 4.36 ? 163 TYR B O    3  
ATOM 6068  C CB   . TYR B 2 19  ? 9.942   -11.425 4.588   1.00 4.80 ? 163 TYR B CB   3  
ATOM 6069  C CG   . TYR B 2 19  ? 11.108  -10.494 4.331   1.00 5.20 ? 163 TYR B CG   3  
ATOM 6070  C CD1  . TYR B 2 19  ? 12.001  -10.176 5.346   1.00 5.67 ? 163 TYR B CD1  3  
ATOM 6071  C CD2  . TYR B 2 19  ? 11.318  -9.939  3.076   1.00 5.29 ? 163 TYR B CD2  3  
ATOM 6072  C CE1  . TYR B 2 19  ? 13.068  -9.328  5.118   1.00 6.11 ? 163 TYR B CE1  3  
ATOM 6073  C CE2  . TYR B 2 19  ? 12.382  -9.092  2.838   1.00 5.82 ? 163 TYR B CE2  3  
ATOM 6074  C CZ   . TYR B 2 19  ? 13.254  -8.791  3.861   1.00 6.18 ? 163 TYR B CZ   3  
ATOM 6075  O OH   . TYR B 2 19  ? 14.315  -7.946  3.628   1.00 6.75 ? 163 TYR B OH   3  
ATOM 6076  H H    . TYR B 2 19  ? 9.937   -13.192 2.417   1.00 3.03 ? 163 TYR B H    3  
ATOM 6077  H HH   . TYR B 2 19  ? 13.998  -7.153  3.183   1.00 7.02 ? 163 TYR B HH   3  
ATOM 6078  N N    . ALA B 2 20  ? 8.953   -14.916 4.378   1.00 4.36 ? 164 ALA B N    3  
ATOM 6079  C CA   . ALA B 2 20  ? 7.912   -15.844 4.791   1.00 4.99 ? 164 ALA B CA   3  
ATOM 6080  C C    . ALA B 2 20  ? 8.315   -17.269 4.451   1.00 5.11 ? 164 ALA B C    3  
ATOM 6081  O O    . ALA B 2 20  ? 8.602   -17.537 3.265   1.00 5.31 ? 164 ALA B O    3  
ATOM 6082  C CB   . ALA B 2 20  ? 6.592   -15.494 4.121   1.00 5.92 ? 164 ALA B CB   3  
ATOM 6083  O OXT  . ALA B 2 20  ? 8.347   -18.117 5.368   1.00 5.35 ? 164 ALA B OXT  3  
ATOM 6084  H H    . ALA B 2 20  ? 9.508   -15.144 3.603   1.00 4.24 ? 164 ALA B H    3  
ATOM 6085  N N    . MET A 1 1   ? 39.878  2.467   -2.515  1.00 1.33 ? 1   MET A N    4  
ATOM 6086  C CA   . MET A 1 1   ? 40.139  3.930   -2.506  1.00 1.17 ? 1   MET A CA   4  
ATOM 6087  C C    . MET A 1 1   ? 38.849  4.749   -2.610  1.00 1.10 ? 1   MET A C    4  
ATOM 6088  O O    . MET A 1 1   ? 38.756  5.844   -2.057  1.00 1.14 ? 1   MET A O    4  
ATOM 6089  C CB   . MET A 1 1   ? 41.087  4.317   -3.646  1.00 1.33 ? 1   MET A CB   4  
ATOM 6090  C CG   . MET A 1 1   ? 41.536  5.769   -3.606  1.00 1.59 ? 1   MET A CG   4  
ATOM 6091  S SD   . MET A 1 1   ? 42.365  6.298   -5.120  1.00 1.94 ? 1   MET A SD   4  
ATOM 6092  C CE   . MET A 1 1   ? 40.998  6.307   -6.279  1.00 2.23 ? 1   MET A CE   4  
ATOM 6093  H H1   . MET A 1 1   ? 40.741  1.949   -2.256  1.00 1.41 ? 1   MET A H1   4  
ATOM 6094  H H2   . MET A 1 1   ? 39.584  2.160   -3.461  1.00 1.51 ? 1   MET A H2   4  
ATOM 6095  H H3   . MET A 1 1   ? 39.127  2.228   -1.836  1.00 1.44 ? 1   MET A H3   4  
ATOM 6096  N N    . ASP A 1 2   ? 37.850  4.219   -3.315  1.00 1.05 ? 2   ASP A N    4  
ATOM 6097  C CA   . ASP A 1 2   ? 36.576  4.920   -3.501  1.00 1.04 ? 2   ASP A CA   4  
ATOM 6098  C C    . ASP A 1 2   ? 35.855  5.174   -2.181  1.00 1.05 ? 2   ASP A C    4  
ATOM 6099  O O    . ASP A 1 2   ? 35.213  6.208   -2.002  1.00 1.09 ? 2   ASP A O    4  
ATOM 6100  C CB   . ASP A 1 2   ? 35.662  4.187   -4.494  1.00 1.07 ? 2   ASP A CB   4  
ATOM 6101  C CG   . ASP A 1 2   ? 35.249  2.800   -4.040  1.00 1.10 ? 2   ASP A CG   4  
ATOM 6102  O OD1  . ASP A 1 2   ? 35.973  1.830   -4.354  1.00 1.21 ? 2   ASP A OD1  4  
ATOM 6103  O OD2  . ASP A 1 2   ? 34.197  2.670   -3.383  1.00 1.29 ? 2   ASP A OD2  4  
ATOM 6104  H H    . ASP A 1 2   ? 37.969  3.337   -3.723  1.00 1.07 ? 2   ASP A H    4  
ATOM 6105  N N    . GLY A 1 3   ? 35.980  4.238   -1.250  1.00 1.07 ? 3   GLY A N    4  
ATOM 6106  C CA   . GLY A 1 3   ? 35.344  4.391   0.043   1.00 1.14 ? 3   GLY A CA   4  
ATOM 6107  C C    . GLY A 1 3   ? 36.154  5.288   0.959   1.00 1.16 ? 3   GLY A C    4  
ATOM 6108  O O    . GLY A 1 3   ? 35.771  5.541   2.099   1.00 1.23 ? 3   GLY A O    4  
ATOM 6109  H H    . GLY A 1 3   ? 36.499  3.431   -1.446  1.00 1.07 ? 3   GLY A H    4  
ATOM 6110  N N    . SER A 1 4   ? 37.286  5.752   0.459   1.00 1.16 ? 4   SER A N    4  
ATOM 6111  C CA   . SER A 1 4   ? 38.159  6.627   1.217   1.00 1.23 ? 4   SER A CA   4  
ATOM 6112  C C    . SER A 1 4   ? 38.057  8.054   0.688   1.00 1.23 ? 4   SER A C    4  
ATOM 6113  O O    . SER A 1 4   ? 38.804  8.944   1.106   1.00 1.35 ? 4   SER A O    4  
ATOM 6114  C CB   . SER A 1 4   ? 39.598  6.124   1.100   1.00 1.34 ? 4   SER A CB   4  
ATOM 6115  O OG   . SER A 1 4   ? 39.623  4.720   0.885   1.00 1.40 ? 4   SER A OG   4  
ATOM 6116  H H    . SER A 1 4   ? 37.551  5.494   -0.449  1.00 1.14 ? 4   SER A H    4  
ATOM 6117  H HG   . SER A 1 4   ? 39.922  4.279   1.689   1.00 1.44 ? 4   SER A HG   4  
ATOM 6118  N N    . GLY A 1 5   ? 37.118  8.266   -0.229  1.00 1.19 ? 5   GLY A N    4  
ATOM 6119  C CA   . GLY A 1 5   ? 36.925  9.575   -0.817  1.00 1.24 ? 5   GLY A CA   4  
ATOM 6120  C C    . GLY A 1 5   ? 35.992  10.443  0.002   1.00 1.22 ? 5   GLY A C    4  
ATOM 6121  O O    . GLY A 1 5   ? 35.721  10.149  1.167   1.00 1.30 ? 5   GLY A O    4  
ATOM 6122  H H    . GLY A 1 5   ? 36.539  7.522   -0.502  1.00 1.17 ? 5   GLY A H    4  
ATOM 6123  N N    . GLU A 1 6   ? 35.491  11.505  -0.610  1.00 1.26 ? 6   GLU A N    4  
ATOM 6124  C CA   . GLU A 1 6   ? 34.594  12.428  0.065   1.00 1.28 ? 6   GLU A CA   4  
ATOM 6125  C C    . GLU A 1 6   ? 33.144  12.007  -0.134  1.00 1.22 ? 6   GLU A C    4  
ATOM 6126  O O    . GLU A 1 6   ? 32.681  11.860  -1.266  1.00 1.34 ? 6   GLU A O    4  
ATOM 6127  C CB   . GLU A 1 6   ? 34.793  13.846  -0.474  1.00 1.49 ? 6   GLU A CB   4  
ATOM 6128  C CG   . GLU A 1 6   ? 36.248  14.277  -0.564  1.00 1.57 ? 6   GLU A CG   4  
ATOM 6129  C CD   . GLU A 1 6   ? 36.486  15.299  -1.654  1.00 1.62 ? 6   GLU A CD   4  
ATOM 6130  O OE1  . GLU A 1 6   ? 36.469  14.918  -2.843  1.00 1.87 ? 6   GLU A OE1  4  
ATOM 6131  O OE2  . GLU A 1 6   ? 36.702  16.484  -1.331  1.00 2.00 ? 6   GLU A OE2  4  
ATOM 6132  H H    . GLU A 1 6   ? 35.724  11.669  -1.547  1.00 1.37 ? 6   GLU A H    4  
ATOM 6133  N N    . GLN A 1 7   ? 32.442  11.795  0.967   1.00 1.15 ? 7   GLN A N    4  
ATOM 6134  C CA   . GLN A 1 7   ? 31.040  11.405  0.922   1.00 1.12 ? 7   GLN A CA   4  
ATOM 6135  C C    . GLN A 1 7   ? 30.240  12.253  1.897   1.00 1.11 ? 7   GLN A C    4  
ATOM 6136  O O    . GLN A 1 7   ? 30.635  12.416  3.049   1.00 1.15 ? 7   GLN A O    4  
ATOM 6137  C CB   . GLN A 1 7   ? 30.867  9.921   1.261   1.00 1.12 ? 7   GLN A CB   4  
ATOM 6138  C CG   . GLN A 1 7   ? 31.338  8.972   0.169   1.00 1.27 ? 7   GLN A CG   4  
ATOM 6139  C CD   . GLN A 1 7   ? 30.748  7.584   0.310   1.00 1.35 ? 7   GLN A CD   4  
ATOM 6140  O OE1  . GLN A 1 7   ? 29.616  7.418   0.769   1.00 1.63 ? 7   GLN A OE1  4  
ATOM 6141  N NE2  . GLN A 1 7   ? 31.508  6.575   -0.080  1.00 1.60 ? 7   GLN A NE2  4  
ATOM 6142  H H    . GLN A 1 7   ? 32.875  11.910  1.842   1.00 1.20 ? 7   GLN A H    4  
ATOM 6143  H HE21 . GLN A 1 7   ? 32.398  6.773   -0.436  1.00 1.78 ? 7   GLN A HE21 4  
ATOM 6144  H HE22 . GLN A 1 7   ? 31.147  5.667   0.006   1.00 1.81 ? 7   GLN A HE22 4  
ATOM 6145  N N    . PRO A 1 8   ? 29.108  12.814  1.450   1.00 1.13 ? 8   PRO A N    4  
ATOM 6146  C CA   . PRO A 1 8   ? 28.258  13.646  2.300   1.00 1.17 ? 8   PRO A CA   4  
ATOM 6147  C C    . PRO A 1 8   ? 27.405  12.801  3.245   1.00 1.11 ? 8   PRO A C    4  
ATOM 6148  O O    . PRO A 1 8   ? 26.176  12.785  3.142   1.00 1.12 ? 8   PRO A O    4  
ATOM 6149  C CB   . PRO A 1 8   ? 27.379  14.382  1.288   1.00 1.26 ? 8   PRO A CB   4  
ATOM 6150  C CG   . PRO A 1 8   ? 27.270  13.442  0.137   1.00 1.27 ? 8   PRO A CG   4  
ATOM 6151  C CD   . PRO A 1 8   ? 28.570  12.683  0.081   1.00 1.18 ? 8   PRO A CD   4  
ATOM 6152  N N    . ARG A 1 9   ? 28.081  12.083  4.149   1.00 1.09 ? 9   ARG A N    4  
ATOM 6153  C CA   . ARG A 1 9   ? 27.432  11.211  5.138   1.00 1.07 ? 9   ARG A CA   4  
ATOM 6154  C C    . ARG A 1 9   ? 26.902  9.925   4.503   1.00 1.00 ? 9   ARG A C    4  
ATOM 6155  O O    . ARG A 1 9   ? 27.107  8.831   5.030   1.00 1.16 ? 9   ARG A O    4  
ATOM 6156  C CB   . ARG A 1 9   ? 26.340  11.942  5.924   1.00 1.15 ? 9   ARG A CB   4  
ATOM 6157  C CG   . ARG A 1 9   ? 25.815  11.181  7.131   1.00 1.28 ? 9   ARG A CG   4  
ATOM 6158  C CD   . ARG A 1 9   ? 24.813  12.017  7.910   1.00 1.41 ? 9   ARG A CD   4  
ATOM 6159  N NE   . ARG A 1 9   ? 23.522  12.109  7.227   1.00 1.46 ? 9   ARG A NE   4  
ATOM 6160  C CZ   . ARG A 1 9   ? 23.102  13.180  6.550   1.00 1.62 ? 9   ARG A CZ   4  
ATOM 6161  N NH1  . ARG A 1 9   ? 23.867  14.262  6.459   1.00 1.92 ? 9   ARG A NH1  4  
ATOM 6162  N NH2  . ARG A 1 9   ? 21.912  13.169  5.965   1.00 1.99 ? 9   ARG A NH2  4  
ATOM 6163  H H    . ARG A 1 9   ? 29.064  12.134  4.145   1.00 1.13 ? 9   ARG A H    4  
ATOM 6164  H HE   . ARG A 1 9   ? 22.929  11.322  7.281   1.00 1.78 ? 9   ARG A HE   4  
ATOM 6165  H HH11 . ARG A 1 9   ? 24.769  14.282  6.898   1.00 2.02 ? 9   ARG A HH11 4  
ATOM 6166  H HH12 . ARG A 1 9   ? 23.550  15.062  5.940   1.00 2.32 ? 9   ARG A HH12 4  
ATOM 6167  H HH21 . ARG A 1 9   ? 21.327  12.354  6.024   1.00 2.25 ? 9   ARG A HH21 4  
ATOM 6168  H HH22 . ARG A 1 9   ? 21.588  13.977  5.463   1.00 2.24 ? 9   ARG A HH22 4  
ATOM 6169  N N    . GLY A 1 10  ? 26.224  10.059  3.374   1.00 0.97 ? 10  GLY A N    4  
ATOM 6170  C CA   . GLY A 1 10  ? 25.687  8.906   2.687   1.00 0.99 ? 10  GLY A CA   4  
ATOM 6171  C C    . GLY A 1 10  ? 25.739  9.078   1.186   1.00 0.97 ? 10  GLY A C    4  
ATOM 6172  O O    . GLY A 1 10  ? 25.295  10.100  0.660   1.00 1.29 ? 10  GLY A O    4  
ATOM 6173  H H    . GLY A 1 10  ? 26.082  10.960  3.002   1.00 1.08 ? 10  GLY A H    4  
ATOM 6174  N N    . GLY A 1 11  ? 26.296  8.091   0.498   1.00 0.95 ? 11  GLY A N    4  
ATOM 6175  C CA   . GLY A 1 11  ? 26.394  8.149   -0.948  1.00 0.94 ? 11  GLY A CA   4  
ATOM 6176  C C    . GLY A 1 11  ? 25.061  7.894   -1.629  1.00 0.92 ? 11  GLY A C    4  
ATOM 6177  O O    . GLY A 1 11  ? 24.067  7.582   -0.969  1.00 1.14 ? 11  GLY A O    4  
ATOM 6178  H H    . GLY A 1 11  ? 26.654  7.318   0.977   1.00 1.17 ? 11  GLY A H    4  
ATOM 6179  N N    . GLY A 1 12  ? 25.035  8.023   -2.948  1.00 0.92 ? 12  GLY A N    4  
ATOM 6180  C CA   . GLY A 1 12  ? 23.809  7.806   -3.689  1.00 0.92 ? 12  GLY A CA   4  
ATOM 6181  C C    . GLY A 1 12  ? 23.856  6.563   -4.560  1.00 0.84 ? 12  GLY A C    4  
ATOM 6182  O O    . GLY A 1 12  ? 24.411  6.597   -5.657  1.00 0.92 ? 12  GLY A O    4  
ATOM 6183  H H    . GLY A 1 12  ? 25.856  8.274   -3.425  1.00 1.07 ? 12  GLY A H    4  
ATOM 6184  N N    . PRO A 1 13  ? 23.294  5.441   -4.085  1.00 0.80 ? 13  PRO A N    4  
ATOM 6185  C CA   . PRO A 1 13  ? 23.257  4.192   -4.840  1.00 0.83 ? 13  PRO A CA   4  
ATOM 6186  C C    . PRO A 1 13  ? 21.996  4.112   -5.695  1.00 0.79 ? 13  PRO A C    4  
ATOM 6187  O O    . PRO A 1 13  ? 21.239  5.082   -5.784  1.00 0.91 ? 13  PRO A O    4  
ATOM 6188  C CB   . PRO A 1 13  ? 23.204  3.145   -3.727  1.00 0.94 ? 13  PRO A CB   4  
ATOM 6189  C CG   . PRO A 1 13  ? 22.444  3.807   -2.622  1.00 1.01 ? 13  PRO A CG   4  
ATOM 6190  C CD   . PRO A 1 13  ? 22.655  5.294   -2.765  1.00 0.87 ? 13  PRO A CD   4  
ATOM 6191  N N    . THR A 1 14  ? 21.761  2.967   -6.318  1.00 0.77 ? 14  THR A N    4  
ATOM 6192  C CA   . THR A 1 14  ? 20.582  2.794   -7.150  1.00 0.75 ? 14  THR A CA   4  
ATOM 6193  C C    . THR A 1 14  ? 19.310  2.735   -6.296  1.00 0.73 ? 14  THR A C    4  
ATOM 6194  O O    . THR A 1 14  ? 19.030  1.743   -5.624  1.00 0.98 ? 14  THR A O    4  
ATOM 6195  C CB   . THR A 1 14  ? 20.692  1.568   -8.090  1.00 0.85 ? 14  THR A CB   4  
ATOM 6196  O OG1  . THR A 1 14  ? 19.467  1.385   -8.812  1.00 0.86 ? 14  THR A OG1  4  
ATOM 6197  C CG2  . THR A 1 14  ? 21.041  0.297   -7.326  1.00 0.95 ? 14  THR A CG2  4  
ATOM 6198  H H    . THR A 1 14  ? 22.393  2.222   -6.215  1.00 0.89 ? 14  THR A H    4  
ATOM 6199  H HG1  . THR A 1 14  ? 19.491  1.911   -9.623  1.00 1.00 ? 14  THR A HG1  4  
ATOM 6200  N N    . SER A 1 15  ? 18.557  3.825   -6.301  1.00 0.62 ? 15  SER A N    4  
ATOM 6201  C CA   . SER A 1 15  ? 17.329  3.902   -5.528  1.00 0.65 ? 15  SER A CA   4  
ATOM 6202  C C    . SER A 1 15  ? 16.119  3.515   -6.375  1.00 0.60 ? 15  SER A C    4  
ATOM 6203  O O    . SER A 1 15  ? 15.026  3.308   -5.851  1.00 0.60 ? 15  SER A O    4  
ATOM 6204  C CB   . SER A 1 15  ? 17.157  5.318   -4.979  1.00 0.80 ? 15  SER A CB   4  
ATOM 6205  O OG   . SER A 1 15  ? 18.405  5.993   -4.948  1.00 0.99 ? 15  SER A OG   4  
ATOM 6206  H H    . SER A 1 15  ? 18.842  4.602   -6.829  1.00 0.69 ? 15  SER A H    4  
ATOM 6207  H HG   . SER A 1 15  ? 19.113  5.351   -4.825  1.00 0.99 ? 15  SER A HG   4  
ATOM 6208  N N    . SER A 1 16  ? 16.331  3.399   -7.681  1.00 0.61 ? 16  SER A N    4  
ATOM 6209  C CA   . SER A 1 16  ? 15.269  3.054   -8.620  1.00 0.62 ? 16  SER A CA   4  
ATOM 6210  C C    . SER A 1 16  ? 14.572  1.745   -8.244  1.00 0.55 ? 16  SER A C    4  
ATOM 6211  O O    . SER A 1 16  ? 13.388  1.738   -7.896  1.00 0.61 ? 16  SER A O    4  
ATOM 6212  C CB   . SER A 1 16  ? 15.863  2.965   -10.020 1.00 0.68 ? 16  SER A CB   4  
ATOM 6213  O OG   . SER A 1 16  ? 17.190  3.468   -10.011 1.00 0.85 ? 16  SER A OG   4  
ATOM 6214  H H    . SER A 1 16  ? 17.234  3.548   -8.033  1.00 0.66 ? 16  SER A H    4  
ATOM 6215  H HG   . SER A 1 16  ? 17.552  3.430   -10.903 1.00 1.04 ? 16  SER A HG   4  
ATOM 6216  N N    . GLU A 1 17  ? 15.312  0.644   -8.294  1.00 0.50 ? 17  GLU A N    4  
ATOM 6217  C CA   . GLU A 1 17  ? 14.754  -0.661  -7.958  1.00 0.49 ? 17  GLU A CA   4  
ATOM 6218  C C    . GLU A 1 17  ? 14.576  -0.780  -6.447  1.00 0.49 ? 17  GLU A C    4  
ATOM 6219  O O    . GLU A 1 17  ? 13.721  -1.524  -5.966  1.00 0.51 ? 17  GLU A O    4  
ATOM 6220  C CB   . GLU A 1 17  ? 15.657  -1.783  -8.483  1.00 0.55 ? 17  GLU A CB   4  
ATOM 6221  C CG   . GLU A 1 17  ? 14.938  -3.105  -8.717  1.00 0.75 ? 17  GLU A CG   4  
ATOM 6222  C CD   . GLU A 1 17  ? 13.890  -3.012  -9.809  1.00 0.97 ? 17  GLU A CD   4  
ATOM 6223  O OE1  . GLU A 1 17  ? 14.268  -2.853  -10.989 1.00 1.23 ? 17  GLU A OE1  4  
ATOM 6224  O OE2  . GLU A 1 17  ? 12.686  -3.100  -9.494  1.00 1.11 ? 17  GLU A OE2  4  
ATOM 6225  H H    . GLU A 1 17  ? 16.251  0.711   -8.566  1.00 0.53 ? 17  GLU A H    4  
ATOM 6226  N N    . GLN A 1 18  ? 15.381  -0.018  -5.708  1.00 0.52 ? 18  GLN A N    4  
ATOM 6227  C CA   . GLN A 1 18  ? 15.328  -0.015  -4.252  1.00 0.58 ? 18  GLN A CA   4  
ATOM 6228  C C    . GLN A 1 18  ? 13.931  0.358   -3.762  1.00 0.60 ? 18  GLN A C    4  
ATOM 6229  O O    . GLN A 1 18  ? 13.364  -0.322  -2.905  1.00 0.64 ? 18  GLN A O    4  
ATOM 6230  C CB   . GLN A 1 18  ? 16.373  0.952   -3.691  1.00 0.68 ? 18  GLN A CB   4  
ATOM 6231  C CG   . GLN A 1 18  ? 16.460  0.993   -2.173  1.00 0.82 ? 18  GLN A CG   4  
ATOM 6232  C CD   . GLN A 1 18  ? 16.145  2.368   -1.616  1.00 0.96 ? 18  GLN A CD   4  
ATOM 6233  O OE1  . GLN A 1 18  ? 17.018  3.233   -1.533  1.00 1.27 ? 18  GLN A OE1  4  
ATOM 6234  N NE2  . GLN A 1 18  ? 14.898  2.578   -1.221  1.00 1.14 ? 18  GLN A NE2  4  
ATOM 6235  H H    . GLN A 1 18  ? 16.030  0.558   -6.161  1.00 0.53 ? 18  GLN A H    4  
ATOM 6236  H HE21 . GLN A 1 18  ? 14.253  1.844   -1.304  1.00 1.15 ? 18  GLN A HE21 4  
ATOM 6237  H HE22 . GLN A 1 18  ? 14.671  3.462   -0.859  1.00 1.42 ? 18  GLN A HE22 4  
ATOM 6238  N N    . ILE A 1 19  ? 13.375  1.431   -4.323  1.00 0.60 ? 19  ILE A N    4  
ATOM 6239  C CA   . ILE A 1 19  ? 12.038  1.891   -3.952  1.00 0.66 ? 19  ILE A CA   4  
ATOM 6240  C C    . ILE A 1 19  ? 10.999  0.820   -4.268  1.00 0.63 ? 19  ILE A C    4  
ATOM 6241  O O    . ILE A 1 19  ? 10.120  0.534   -3.453  1.00 0.67 ? 19  ILE A O    4  
ATOM 6242  C CB   . ILE A 1 19  ? 11.671  3.201   -4.682  1.00 0.73 ? 19  ILE A CB   4  
ATOM 6243  C CG1  . ILE A 1 19  ? 12.598  4.337   -4.237  1.00 0.78 ? 19  ILE A CG1  4  
ATOM 6244  C CG2  . ILE A 1 19  ? 10.214  3.577   -4.433  1.00 0.77 ? 19  ILE A CG2  4  
ATOM 6245  C CD1  . ILE A 1 19  ? 12.600  5.524   -5.175  1.00 0.85 ? 19  ILE A CD1  4  
ATOM 6246  H H    . ILE A 1 19  ? 13.881  1.931   -5.004  1.00 0.58 ? 19  ILE A H    4  
ATOM 6247  N N    . MET A 1 20  ? 11.126  0.216   -5.443  1.00 0.59 ? 20  MET A N    4  
ATOM 6248  C CA   . MET A 1 20  ? 10.209  -0.831  -5.878  1.00 0.60 ? 20  MET A CA   4  
ATOM 6249  C C    . MET A 1 20  ? 10.236  -2.012  -4.908  1.00 0.56 ? 20  MET A C    4  
ATOM 6250  O O    . MET A 1 20  ? 9.194   -2.571  -4.561  1.00 0.57 ? 20  MET A O    4  
ATOM 6251  C CB   . MET A 1 20  ? 10.579  -1.299  -7.287  1.00 0.61 ? 20  MET A CB   4  
ATOM 6252  C CG   . MET A 1 20  ? 9.706   -2.423  -7.820  1.00 0.71 ? 20  MET A CG   4  
ATOM 6253  S SD   . MET A 1 20  ? 8.149   -1.835  -8.512  1.00 0.96 ? 20  MET A SD   4  
ATOM 6254  C CE   . MET A 1 20  ? 7.276   -3.385  -8.713  1.00 1.64 ? 20  MET A CE   4  
ATOM 6255  H H    . MET A 1 20  ? 11.859  0.483   -6.039  1.00 0.57 ? 20  MET A H    4  
ATOM 6256  N N    . LYS A 1 21  ? 11.433  -2.376  -4.460  1.00 0.55 ? 21  LYS A N    4  
ATOM 6257  C CA   . LYS A 1 21  ? 11.593  -3.486  -3.532  1.00 0.55 ? 21  LYS A CA   4  
ATOM 6258  C C    . LYS A 1 21  ? 11.036  -3.138  -2.154  1.00 0.51 ? 21  LYS A C    4  
ATOM 6259  O O    . LYS A 1 21  ? 10.608  -4.020  -1.411  1.00 0.51 ? 21  LYS A O    4  
ATOM 6260  C CB   . LYS A 1 21  ? 13.060  -3.913  -3.432  1.00 0.58 ? 21  LYS A CB   4  
ATOM 6261  C CG   . LYS A 1 21  ? 13.652  -4.443  -4.733  1.00 0.63 ? 21  LYS A CG   4  
ATOM 6262  C CD   . LYS A 1 21  ? 12.992  -5.742  -5.168  1.00 0.69 ? 21  LYS A CD   4  
ATOM 6263  C CE   . LYS A 1 21  ? 13.544  -6.224  -6.502  1.00 0.83 ? 21  LYS A CE   4  
ATOM 6264  N NZ   . LYS A 1 21  ? 12.994  -7.552  -6.890  1.00 1.15 ? 21  LYS A NZ   4  
ATOM 6265  H H    . LYS A 1 21  ? 12.231  -1.886  -4.768  1.00 0.55 ? 21  LYS A H    4  
ATOM 6266  H HZ1  . LYS A 1 21  ? 13.419  -8.307  -6.300  1.00 1.46 ? 21  LYS A HZ1  4  
ATOM 6267  H HZ2  . LYS A 1 21  ? 13.211  -7.757  -7.888  1.00 1.69 ? 21  LYS A HZ2  4  
ATOM 6268  H HZ3  . LYS A 1 21  ? 11.961  -7.570  -6.764  1.00 1.26 ? 21  LYS A HZ3  4  
ATOM 6269  N N    . THR A 1 22  ? 11.023  -1.846  -1.825  1.00 0.52 ? 22  THR A N    4  
ATOM 6270  C CA   . THR A 1 22  ? 10.507  -1.394  -0.536  1.00 0.51 ? 22  THR A CA   4  
ATOM 6271  C C    . THR A 1 22  ? 9.011   -1.683  -0.441  1.00 0.52 ? 22  THR A C    4  
ATOM 6272  O O    . THR A 1 22  ? 8.511   -2.110  0.601   1.00 0.52 ? 22  THR A O    4  
ATOM 6273  C CB   . THR A 1 22  ? 10.742  0.118   -0.315  1.00 0.56 ? 22  THR A CB   4  
ATOM 6274  O OG1  . THR A 1 22  ? 12.071  0.479   -0.722  1.00 0.63 ? 22  THR A OG1  4  
ATOM 6275  C CG2  . THR A 1 22  ? 10.563  0.478   1.154   1.00 0.71 ? 22  THR A CG2  4  
ATOM 6276  H H    . THR A 1 22  ? 11.354  -1.184  -2.470  1.00 0.55 ? 22  THR A H    4  
ATOM 6277  H HG1  . THR A 1 22  ? 12.431  -0.200  -1.305  1.00 0.88 ? 22  THR A HG1  4  
ATOM 6278  N N    . GLY A 1 23  ? 8.309   -1.468  -1.551  1.00 0.55 ? 23  GLY A N    4  
ATOM 6279  C CA   . GLY A 1 23  ? 6.877   -1.708  -1.591  1.00 0.58 ? 23  GLY A CA   4  
ATOM 6280  C C    . GLY A 1 23  ? 6.531   -3.164  -1.348  1.00 0.56 ? 23  GLY A C    4  
ATOM 6281  O O    . GLY A 1 23  ? 5.507   -3.476  -0.736  1.00 0.58 ? 23  GLY A O    4  
ATOM 6282  H H    . GLY A 1 23  ? 8.771   -1.139  -2.355  1.00 0.55 ? 23  GLY A H    4  
ATOM 6283  N N    . ALA A 1 24  ? 7.399   -4.054  -1.815  1.00 0.56 ? 24  ALA A N    4  
ATOM 6284  C CA   . ALA A 1 24  ? 7.192   -5.487  -1.651  1.00 0.58 ? 24  ALA A CA   4  
ATOM 6285  C C    . ALA A 1 24  ? 7.241   -5.873  -0.177  1.00 0.55 ? 24  ALA A C    4  
ATOM 6286  O O    . ALA A 1 24  ? 6.466   -6.714  0.281   1.00 0.73 ? 24  ALA A O    4  
ATOM 6287  C CB   . ALA A 1 24  ? 8.229   -6.267  -2.444  1.00 0.61 ? 24  ALA A CB   4  
ATOM 6288  H H    . ALA A 1 24  ? 8.200   -3.738  -2.282  1.00 0.58 ? 24  ALA A H    4  
ATOM 6289  N N    . LEU A 1 25  ? 8.143   -5.246  0.565   1.00 0.44 ? 25  LEU A N    4  
ATOM 6290  C CA   . LEU A 1 25  ? 8.286   -5.523  1.986   1.00 0.40 ? 25  LEU A CA   4  
ATOM 6291  C C    . LEU A 1 25  ? 7.174   -4.851  2.782   1.00 0.39 ? 25  LEU A C    4  
ATOM 6292  O O    . LEU A 1 25  ? 6.635   -5.431  3.723   1.00 0.40 ? 25  LEU A O    4  
ATOM 6293  C CB   . LEU A 1 25  ? 9.655   -5.056  2.490   1.00 0.40 ? 25  LEU A CB   4  
ATOM 6294  C CG   . LEU A 1 25  ? 10.026  -5.453  3.920   1.00 0.45 ? 25  LEU A CG   4  
ATOM 6295  C CD1  . LEU A 1 25  ? 9.897   -6.958  4.109   1.00 0.61 ? 25  LEU A CD1  4  
ATOM 6296  C CD2  . LEU A 1 25  ? 11.438  -4.993  4.249   1.00 0.48 ? 25  LEU A CD2  4  
ATOM 6297  H H    . LEU A 1 25  ? 8.731   -4.582  0.146   1.00 0.48 ? 25  LEU A H    4  
ATOM 6298  N N    . LEU A 1 26  ? 6.827   -3.629  2.387   1.00 0.39 ? 26  LEU A N    4  
ATOM 6299  C CA   . LEU A 1 26  ? 5.779   -2.873  3.063   1.00 0.40 ? 26  LEU A CA   4  
ATOM 6300  C C    . LEU A 1 26  ? 4.450   -3.618  3.039   1.00 0.44 ? 26  LEU A C    4  
ATOM 6301  O O    . LEU A 1 26  ? 3.797   -3.768  4.072   1.00 0.45 ? 26  LEU A O    4  
ATOM 6302  C CB   . LEU A 1 26  ? 5.619   -1.481  2.446   1.00 0.43 ? 26  LEU A CB   4  
ATOM 6303  C CG   . LEU A 1 26  ? 6.741   -0.480  2.737   1.00 0.42 ? 26  LEU A CG   4  
ATOM 6304  C CD1  . LEU A 1 26  ? 6.487   0.831   2.008   1.00 0.49 ? 26  LEU A CD1  4  
ATOM 6305  C CD2  . LEU A 1 26  ? 6.884   -0.245  4.233   1.00 0.39 ? 26  LEU A CD2  4  
ATOM 6306  H H    . LEU A 1 26  ? 7.294   -3.224  1.622   1.00 0.40 ? 26  LEU A H    4  
ATOM 6307  N N    . LEU A 1 27  ? 4.060   -4.094  1.861   1.00 0.49 ? 27  LEU A N    4  
ATOM 6308  C CA   . LEU A 1 27  ? 2.809   -4.826  1.716   1.00 0.56 ? 27  LEU A CA   4  
ATOM 6309  C C    . LEU A 1 27  ? 2.863   -6.142  2.484   1.00 0.57 ? 27  LEU A C    4  
ATOM 6310  O O    . LEU A 1 27  ? 1.876   -6.561  3.087   1.00 0.61 ? 27  LEU A O    4  
ATOM 6311  C CB   . LEU A 1 27  ? 2.493   -5.082  0.239   1.00 0.63 ? 27  LEU A CB   4  
ATOM 6312  C CG   . LEU A 1 27  ? 1.543   -4.088  -0.445  1.00 0.67 ? 27  LEU A CG   4  
ATOM 6313  C CD1  . LEU A 1 27  ? 0.204   -4.034  0.275   1.00 0.71 ? 27  LEU A CD1  4  
ATOM 6314  C CD2  . LEU A 1 27  ? 2.168   -2.704  -0.540  1.00 0.64 ? 27  LEU A CD2  4  
ATOM 6315  H H    . LEU A 1 27  ? 4.627   -3.948  1.073   1.00 0.50 ? 27  LEU A H    4  
ATOM 6316  N N    . GLN A 1 28  ? 4.028   -6.776  2.472   1.00 0.56 ? 28  GLN A N    4  
ATOM 6317  C CA   . GLN A 1 28  ? 4.223   -8.044  3.163   1.00 0.59 ? 28  GLN A CA   4  
ATOM 6318  C C    . GLN A 1 28  ? 3.977   -7.898  4.664   1.00 0.56 ? 28  GLN A C    4  
ATOM 6319  O O    . GLN A 1 28  ? 3.154   -8.613  5.239   1.00 0.60 ? 28  GLN A O    4  
ATOM 6320  C CB   . GLN A 1 28  ? 5.640   -8.569  2.914   1.00 0.64 ? 28  GLN A CB   4  
ATOM 6321  C CG   . GLN A 1 28  ? 5.951   -9.886  3.604   1.00 0.99 ? 28  GLN A CG   4  
ATOM 6322  C CD   . GLN A 1 28  ? 7.440   -10.117 3.766   1.00 1.17 ? 28  GLN A CD   4  
ATOM 6323  O OE1  . GLN A 1 28  ? 8.031   -9.751  4.783   1.00 1.46 ? 28  GLN A OE1  4  
ATOM 6324  N NE2  . GLN A 1 28  ? 8.059   -10.724 2.763   1.00 1.53 ? 28  GLN A NE2  4  
ATOM 6325  H H    . GLN A 1 28  ? 4.781   -6.377  1.988   1.00 0.55 ? 28  GLN A H    4  
ATOM 6326  H HE21 . GLN A 1 28  ? 7.530   -10.985 1.982   1.00 1.80 ? 28  GLN A HE21 4  
ATOM 6327  H HE22 . GLN A 1 28  ? 9.020   -10.894 2.848   1.00 1.74 ? 28  GLN A HE22 4  
ATOM 6328  N N    . GLY A 1 29  ? 4.683   -6.958  5.284   1.00 0.54 ? 29  GLY A N    4  
ATOM 6329  C CA   . GLY A 1 29  ? 4.544   -6.740  6.712   1.00 0.54 ? 29  GLY A CA   4  
ATOM 6330  C C    . GLY A 1 29  ? 3.165   -6.255  7.105   1.00 0.51 ? 29  GLY A C    4  
ATOM 6331  O O    . GLY A 1 29  ? 2.585   -6.744  8.076   1.00 0.53 ? 29  GLY A O    4  
ATOM 6332  H H    . GLY A 1 29  ? 5.305   -6.402  4.764   1.00 0.56 ? 29  GLY A H    4  
ATOM 6333  N N    . PHE A 1 30  ? 2.635   -5.305  6.340   1.00 0.50 ? 30  PHE A N    4  
ATOM 6334  C CA   . PHE A 1 30  ? 1.321   -4.735  6.611   1.00 0.51 ? 30  PHE A CA   4  
ATOM 6335  C C    . PHE A 1 30  ? 0.232   -5.803  6.601   1.00 0.51 ? 30  PHE A C    4  
ATOM 6336  O O    . PHE A 1 30  ? -0.611  -5.854  7.499   1.00 0.55 ? 30  PHE A O    4  
ATOM 6337  C CB   . PHE A 1 30  ? 1.003   -3.641  5.589   1.00 0.54 ? 30  PHE A CB   4  
ATOM 6338  C CG   . PHE A 1 30  ? -0.114  -2.718  5.994   1.00 0.54 ? 30  PHE A CG   4  
ATOM 6339  C CD1  . PHE A 1 30  ? -0.102  -2.089  7.229   1.00 0.85 ? 30  PHE A CD1  4  
ATOM 6340  C CD2  . PHE A 1 30  ? -1.172  -2.474  5.135   1.00 0.83 ? 30  PHE A CD2  4  
ATOM 6341  C CE1  . PHE A 1 30  ? -1.123  -1.238  7.595   1.00 0.85 ? 30  PHE A CE1  4  
ATOM 6342  C CE2  . PHE A 1 30  ? -2.198  -1.624  5.497   1.00 0.90 ? 30  PHE A CE2  4  
ATOM 6343  C CZ   . PHE A 1 30  ? -2.174  -1.004  6.730   1.00 0.65 ? 30  PHE A CZ   4  
ATOM 6344  H H    . PHE A 1 30  ? 3.150   -4.970  5.571   1.00 0.51 ? 30  PHE A H    4  
ATOM 6345  N N    . ILE A 1 31  ? 0.255   -6.661  5.589   1.00 0.50 ? 31  ILE A N    4  
ATOM 6346  C CA   . ILE A 1 31  ? -0.735  -7.720  5.474   1.00 0.52 ? 31  ILE A CA   4  
ATOM 6347  C C    . ILE A 1 31  ? -0.537  -8.788  6.549   1.00 0.53 ? 31  ILE A C    4  
ATOM 6348  O O    . ILE A 1 31  ? -1.491  -9.187  7.210   1.00 0.56 ? 31  ILE A O    4  
ATOM 6349  C CB   . ILE A 1 31  ? -0.733  -8.369  4.072   1.00 0.54 ? 31  ILE A CB   4  
ATOM 6350  C CG1  . ILE A 1 31  ? -1.147  -7.341  3.013   1.00 0.54 ? 31  ILE A CG1  4  
ATOM 6351  C CG2  . ILE A 1 31  ? -1.661  -9.577  4.031   1.00 0.58 ? 31  ILE A CG2  4  
ATOM 6352  C CD1  . ILE A 1 31  ? -0.926  -7.806  1.590   1.00 0.57 ? 31  ILE A CD1  4  
ATOM 6353  H H    . ILE A 1 31  ? 0.955   -6.580  4.904   1.00 0.49 ? 31  ILE A H    4  
ATOM 6354  N N    . GLN A 1 32  ? 0.705   -9.227  6.738   1.00 0.53 ? 32  GLN A N    4  
ATOM 6355  C CA   . GLN A 1 32  ? 1.016   -10.261 7.728   1.00 0.55 ? 32  GLN A CA   4  
ATOM 6356  C C    . GLN A 1 32  ? 0.598   -9.868  9.143   1.00 0.54 ? 32  GLN A C    4  
ATOM 6357  O O    . GLN A 1 32  ? 0.032   -10.679 9.879   1.00 0.57 ? 32  GLN A O    4  
ATOM 6358  C CB   . GLN A 1 32  ? 2.500   -10.634 7.692   1.00 0.57 ? 32  GLN A CB   4  
ATOM 6359  C CG   . GLN A 1 32  ? 2.849   -11.677 6.644   1.00 0.68 ? 32  GLN A CG   4  
ATOM 6360  C CD   . GLN A 1 32  ? 2.139   -12.999 6.877   1.00 0.90 ? 32  GLN A CD   4  
ATOM 6361  O OE1  . GLN A 1 32  ? 1.886   -13.392 8.014   1.00 1.07 ? 32  GLN A OE1  4  
ATOM 6362  N NE2  . GLN A 1 32  ? 1.802   -13.690 5.801   1.00 1.12 ? 32  GLN A NE2  4  
ATOM 6363  H H    . GLN A 1 32  ? 1.434   -8.846  6.199   1.00 0.52 ? 32  GLN A H    4  
ATOM 6364  H HE21 . GLN A 1 32  ? 2.028   -13.320 4.923   1.00 1.19 ? 32  GLN A HE21 4  
ATOM 6365  H HE22 . GLN A 1 32  ? 1.341   -14.545 5.924   1.00 1.31 ? 32  GLN A HE22 4  
ATOM 6366  N N    . ASP A 1 33  ? 0.861   -8.623  9.514   1.00 0.53 ? 33  ASP A N    4  
ATOM 6367  C CA   . ASP A 1 33  ? 0.511   -8.131  10.846  1.00 0.55 ? 33  ASP A CA   4  
ATOM 6368  C C    . ASP A 1 33  ? -0.999  -8.173  11.073  1.00 0.58 ? 33  ASP A C    4  
ATOM 6369  O O    . ASP A 1 33  ? -1.465  -8.471  12.171  1.00 0.65 ? 33  ASP A O    4  
ATOM 6370  C CB   . ASP A 1 33  ? 1.044   -6.712  11.068  1.00 0.57 ? 33  ASP A CB   4  
ATOM 6371  C CG   . ASP A 1 33  ? 0.656   -6.141  12.418  1.00 0.61 ? 33  ASP A CG   4  
ATOM 6372  O OD1  . ASP A 1 33  ? 1.108   -6.672  13.454  1.00 0.73 ? 33  ASP A OD1  4  
ATOM 6373  O OD2  . ASP A 1 33  ? -0.107  -5.156  12.452  1.00 0.74 ? 33  ASP A OD2  4  
ATOM 6374  H H    . ASP A 1 33  ? 1.304   -8.018  8.880   1.00 0.53 ? 33  ASP A H    4  
ATOM 6375  N N    . ARG A 1 34  ? -1.765  -7.891  10.028  1.00 0.58 ? 34  ARG A N    4  
ATOM 6376  C CA   . ARG A 1 34  ? -3.219  -7.897  10.136  1.00 0.63 ? 34  ARG A CA   4  
ATOM 6377  C C    . ARG A 1 34  ? -3.804  -9.290  9.901   1.00 0.62 ? 34  ARG A C    4  
ATOM 6378  O O    . ARG A 1 34  ? -4.906  -9.599  10.361  1.00 0.67 ? 34  ARG A O    4  
ATOM 6379  C CB   . ARG A 1 34  ? -3.847  -6.869  9.193   1.00 0.67 ? 34  ARG A CB   4  
ATOM 6380  C CG   . ARG A 1 34  ? -4.528  -5.716  9.912   1.00 0.74 ? 34  ARG A CG   4  
ATOM 6381  C CD   . ARG A 1 34  ? -3.582  -5.035  10.889  1.00 0.73 ? 34  ARG A CD   4  
ATOM 6382  N NE   . ARG A 1 34  ? -4.271  -4.622  12.110  1.00 0.75 ? 34  ARG A NE   4  
ATOM 6383  C CZ   . ARG A 1 34  ? -3.891  -4.985  13.333  1.00 0.74 ? 34  ARG A CZ   4  
ATOM 6384  N NH1  . ARG A 1 34  ? -2.772  -5.675  13.504  1.00 0.77 ? 34  ARG A NH1  4  
ATOM 6385  N NH2  . ARG A 1 34  ? -4.618  -4.632  14.387  1.00 0.85 ? 34  ARG A NH2  4  
ATOM 6386  H H    . ARG A 1 34  ? -1.344  -7.677  9.167   1.00 0.56 ? 34  ARG A H    4  
ATOM 6387  H HE   . ARG A 1 34  ? -5.081  -4.058  12.009  1.00 0.86 ? 34  ARG A HE   4  
ATOM 6388  H HH11 . ARG A 1 34  ? -2.202  -5.919  12.716  1.00 0.74 ? 34  ARG A HH11 4  
ATOM 6389  H HH12 . ARG A 1 34  ? -2.488  -5.954  14.426  1.00 0.90 ? 34  ARG A HH12 4  
ATOM 6390  H HH21 . ARG A 1 34  ? -5.457  -4.086  14.266  1.00 0.91 ? 34  ARG A HH21 4  
ATOM 6391  H HH22 . ARG A 1 34  ? -4.338  -4.915  15.309  1.00 0.93 ? 34  ARG A HH22 4  
ATOM 6392  N N    . ALA A 1 35  ? -3.057  -10.133 9.196   1.00 0.61 ? 35  ALA A N    4  
ATOM 6393  C CA   . ALA A 1 35  ? -3.492  -11.496 8.904   1.00 0.64 ? 35  ALA A CA   4  
ATOM 6394  C C    . ALA A 1 35  ? -3.385  -12.371 10.147  1.00 0.66 ? 35  ALA A C    4  
ATOM 6395  O O    . ALA A 1 35  ? -4.073  -13.387 10.271  1.00 0.68 ? 35  ALA A O    4  
ATOM 6396  C CB   . ALA A 1 35  ? -2.680  -12.090 7.762   1.00 0.65 ? 35  ALA A CB   4  
ATOM 6397  H H    . ALA A 1 35  ? -2.188  -9.825  8.849   1.00 0.61 ? 35  ALA A H    4  
ATOM 6398  N N    . GLY A 1 36  ? -2.520  -11.962 11.072  1.00 0.69 ? 36  GLY A N    4  
ATOM 6399  C CA   . GLY A 1 36  ? -2.331  -12.700 12.309  1.00 0.76 ? 36  GLY A CA   4  
ATOM 6400  C C    . GLY A 1 36  ? -3.573  -12.699 13.181  1.00 0.78 ? 36  GLY A C    4  
ATOM 6401  O O    . GLY A 1 36  ? -3.670  -13.462 14.141  1.00 0.89 ? 36  GLY A O    4  
ATOM 6402  H H    . GLY A 1 36  ? -1.992  -11.153 10.902  1.00 0.70 ? 36  GLY A H    4  
ATOM 6403  N N    . ARG A 1 37  ? -4.535  -11.857 12.824  1.00 0.75 ? 37  ARG A N    4  
ATOM 6404  C CA   . ARG A 1 37  ? -5.787  -11.746 13.561  1.00 0.81 ? 37  ARG A CA   4  
ATOM 6405  C C    . ARG A 1 37  ? -6.673  -12.974 13.320  1.00 0.79 ? 37  ARG A C    4  
ATOM 6406  O O    . ARG A 1 37  ? -7.694  -13.161 13.986  1.00 0.88 ? 37  ARG A O    4  
ATOM 6407  C CB   . ARG A 1 37  ? -6.521  -10.462 13.146  1.00 0.86 ? 37  ARG A CB   4  
ATOM 6408  C CG   . ARG A 1 37  ? -7.645  -10.035 14.079  1.00 1.17 ? 37  ARG A CG   4  
ATOM 6409  C CD   . ARG A 1 37  ? -7.549  -8.557  14.429  1.00 1.23 ? 37  ARG A CD   4  
ATOM 6410  N NE   . ARG A 1 37  ? -7.520  -7.699  13.243  1.00 1.18 ? 37  ARG A NE   4  
ATOM 6411  C CZ   . ARG A 1 37  ? -7.496  -6.364  13.293  1.00 1.28 ? 37  ARG A CZ   4  
ATOM 6412  N NH1  . ARG A 1 37  ? -7.546  -5.742  14.464  1.00 1.35 ? 37  ARG A NH1  4  
ATOM 6413  N NH2  . ARG A 1 37  ? -7.428  -5.650  12.175  1.00 1.73 ? 37  ARG A NH2  4  
ATOM 6414  H H    . ARG A 1 37  ? -4.397  -11.291 12.037  1.00 0.71 ? 37  ARG A H    4  
ATOM 6415  H HE   . ARG A 1 37  ? -7.503  -8.141  12.370  1.00 1.43 ? 37  ARG A HE   4  
ATOM 6416  H HH11 . ARG A 1 37  ? -7.598  -6.269  15.316  1.00 1.52 ? 37  ARG A HH11 4  
ATOM 6417  H HH12 . ARG A 1 37  ? -7.535  -4.735  14.504  1.00 1.52 ? 37  ARG A HH12 4  
ATOM 6418  H HH21 . ARG A 1 37  ? -7.397  -6.104  11.286  1.00 2.07 ? 37  ARG A HH21 4  
ATOM 6419  H HH22 . ARG A 1 37  ? -7.398  -4.638  12.221  1.00 1.89 ? 37  ARG A HH22 4  
ATOM 6420  N N    . MET A 1 38  ? -6.283  -13.806 12.362  1.00 0.74 ? 38  MET A N    4  
ATOM 6421  C CA   . MET A 1 38  ? -7.038  -15.016 12.046  1.00 0.75 ? 38  MET A CA   4  
ATOM 6422  C C    . MET A 1 38  ? -6.455  -16.241 12.745  1.00 0.77 ? 38  MET A C    4  
ATOM 6423  O O    . MET A 1 38  ? -7.160  -17.223 12.985  1.00 1.03 ? 38  MET A O    4  
ATOM 6424  C CB   . MET A 1 38  ? -7.107  -15.245 10.536  1.00 0.76 ? 38  MET A CB   4  
ATOM 6425  C CG   . MET A 1 38  ? -8.259  -14.528 9.848   1.00 0.86 ? 38  MET A CG   4  
ATOM 6426  S SD   . MET A 1 38  ? -9.870  -15.038 10.482  1.00 1.19 ? 38  MET A SD   4  
ATOM 6427  C CE   . MET A 1 38  ? -10.960 -14.051 9.461   1.00 1.48 ? 38  MET A CE   4  
ATOM 6428  H H    . MET A 1 38  ? -5.469  -13.601 11.851  1.00 0.74 ? 38  MET A H    4  
ATOM 6429  N N    . GLY A 1 39  ? -5.173  -16.182 13.075  1.00 0.76 ? 39  GLY A N    4  
ATOM 6430  C CA   . GLY A 1 39  ? -4.527  -17.292 13.749  1.00 0.78 ? 39  GLY A CA   4  
ATOM 6431  C C    . GLY A 1 39  ? -3.432  -17.925 12.913  1.00 0.80 ? 39  GLY A C    4  
ATOM 6432  O O    . GLY A 1 39  ? -2.595  -17.222 12.337  1.00 1.17 ? 39  GLY A O    4  
ATOM 6433  H H    . GLY A 1 39  ? -4.657  -15.381 12.854  1.00 0.92 ? 39  GLY A H    4  
ATOM 6434  N N    . GLY A 1 40  ? -3.430  -19.247 12.856  1.00 0.84 ? 40  GLY A N    4  
ATOM 6435  C CA   . GLY A 1 40  ? -2.432  -19.959 12.086  1.00 0.88 ? 40  GLY A CA   4  
ATOM 6436  C C    . GLY A 1 40  ? -2.731  -21.439 12.024  1.00 0.88 ? 40  GLY A C    4  
ATOM 6437  O O    . GLY A 1 40  ? -3.378  -21.980 12.919  1.00 1.11 ? 40  GLY A O    4  
ATOM 6438  H H    . GLY A 1 40  ? -4.116  -19.752 13.347  1.00 1.11 ? 40  GLY A H    4  
ATOM 6439  N N    . GLU A 1 41  ? -2.266  -22.099 10.976  1.00 0.82 ? 41  GLU A N    4  
ATOM 6440  C CA   . GLU A 1 41  ? -2.499  -23.532 10.802  1.00 0.87 ? 41  GLU A CA   4  
ATOM 6441  C C    . GLU A 1 41  ? -1.523  -24.379 11.624  1.00 0.90 ? 41  GLU A C    4  
ATOM 6442  O O    . GLU A 1 41  ? -0.838  -25.252 11.091  1.00 1.06 ? 41  GLU A O    4  
ATOM 6443  C CB   . GLU A 1 41  ? -2.466  -23.931 9.322   1.00 0.98 ? 41  GLU A CB   4  
ATOM 6444  C CG   . GLU A 1 41  ? -1.413  -23.213 8.486   1.00 1.31 ? 41  GLU A CG   4  
ATOM 6445  C CD   . GLU A 1 41  ? -1.884  -21.858 8.002   1.00 1.55 ? 41  GLU A CD   4  
ATOM 6446  O OE1  . GLU A 1 41  ? -2.654  -21.808 7.019   1.00 1.89 ? 41  GLU A OE1  4  
ATOM 6447  O OE2  . GLU A 1 41  ? -1.505  -20.839 8.618   1.00 2.17 ? 41  GLU A OE2  4  
ATOM 6448  H H    . GLU A 1 41  ? -1.750  -21.610 10.292  1.00 0.89 ? 41  GLU A H    4  
ATOM 6449  N N    . ALA A 1 42  ? -1.486  -24.105 12.930  1.00 0.89 ? 42  ALA A N    4  
ATOM 6450  C CA   . ALA A 1 42  ? -0.617  -24.815 13.868  1.00 0.98 ? 42  ALA A CA   4  
ATOM 6451  C C    . ALA A 1 42  ? 0.833   -24.868 13.383  1.00 0.90 ? 42  ALA A C    4  
ATOM 6452  O O    . ALA A 1 42  ? 1.306   -25.915 12.932  1.00 0.99 ? 42  ALA A O    4  
ATOM 6453  C CB   . ALA A 1 42  ? -1.154  -26.210 14.157  1.00 1.21 ? 42  ALA A CB   4  
ATOM 6454  H H    . ALA A 1 42  ? -2.075  -23.398 13.274  1.00 0.92 ? 42  ALA A H    4  
ATOM 6455  N N    . PRO A 1 43  ? 1.550   -23.734 13.467  1.00 0.86 ? 43  PRO A N    4  
ATOM 6456  C CA   . PRO A 1 43  ? 2.949   -23.640 13.026  1.00 0.89 ? 43  PRO A CA   4  
ATOM 6457  C C    . PRO A 1 43  ? 3.867   -24.557 13.830  1.00 0.93 ? 43  PRO A C    4  
ATOM 6458  O O    . PRO A 1 43  ? 4.209   -24.264 14.978  1.00 1.08 ? 43  PRO A O    4  
ATOM 6459  C CB   . PRO A 1 43  ? 3.313   -22.167 13.270  1.00 1.03 ? 43  PRO A CB   4  
ATOM 6460  C CG   . PRO A 1 43  ? 2.004   -21.465 13.398  1.00 1.11 ? 43  PRO A CG   4  
ATOM 6461  C CD   . PRO A 1 43  ? 1.064   -22.458 14.011  1.00 0.96 ? 43  PRO A CD   4  
ATOM 6462  N N    . GLU A 1 44  ? 4.254   -25.668 13.217  1.00 0.91 ? 44  GLU A N    4  
ATOM 6463  C CA   . GLU A 1 44  ? 5.129   -26.636 13.858  1.00 0.98 ? 44  GLU A CA   4  
ATOM 6464  C C    . GLU A 1 44  ? 6.584   -26.281 13.587  1.00 0.98 ? 44  GLU A C    4  
ATOM 6465  O O    . GLU A 1 44  ? 7.380   -26.121 14.513  1.00 1.13 ? 44  GLU A O    4  
ATOM 6466  C CB   . GLU A 1 44  ? 4.815   -28.048 13.350  1.00 1.06 ? 44  GLU A CB   4  
ATOM 6467  C CG   . GLU A 1 44  ? 5.522   -29.163 14.102  1.00 1.34 ? 44  GLU A CG   4  
ATOM 6468  C CD   . GLU A 1 44  ? 4.891   -30.516 13.850  1.00 1.59 ? 44  GLU A CD   4  
ATOM 6469  O OE1  . GLU A 1 44  ? 5.176   -31.127 12.798  1.00 1.91 ? 44  GLU A OE1  4  
ATOM 6470  O OE2  . GLU A 1 44  ? 4.102   -30.978 14.702  1.00 2.13 ? 44  GLU A OE2  4  
ATOM 6471  H H    . GLU A 1 44  ? 3.939   -25.839 12.304  1.00 0.91 ? 44  GLU A H    4  
ATOM 6472  N N    . LEU A 1 45  ? 6.923   -26.145 12.312  1.00 0.93 ? 45  LEU A N    4  
ATOM 6473  C CA   . LEU A 1 45  ? 8.280   -25.795 11.917  1.00 0.99 ? 45  LEU A CA   4  
ATOM 6474  C C    . LEU A 1 45  ? 8.371   -24.300 11.629  1.00 0.93 ? 45  LEU A C    4  
ATOM 6475  O O    . LEU A 1 45  ? 9.166   -23.586 12.247  1.00 0.96 ? 45  LEU A O    4  
ATOM 6476  C CB   . LEU A 1 45  ? 8.714   -26.601 10.687  1.00 1.11 ? 45  LEU A CB   4  
ATOM 6477  C CG   . LEU A 1 45  ? 8.736   -28.126 10.846  1.00 1.39 ? 45  LEU A CG   4  
ATOM 6478  C CD1  . LEU A 1 45  ? 9.123   -28.800 9.538   1.00 1.65 ? 45  LEU A CD1  4  
ATOM 6479  C CD2  . LEU A 1 45  ? 9.683   -28.540 11.961  1.00 1.60 ? 45  LEU A CD2  4  
ATOM 6480  H H    . LEU A 1 45  ? 6.241   -26.274 11.618  1.00 0.92 ? 45  LEU A H    4  
ATOM 6481  N N    . ALA A 1 46  ? 7.539   -23.841 10.692  1.00 0.93 ? 46  ALA A N    4  
ATOM 6482  C CA   . ALA A 1 46  ? 7.487   -22.433 10.299  1.00 0.95 ? 46  ALA A CA   4  
ATOM 6483  C C    . ALA A 1 46  ? 8.844   -21.907 9.825   1.00 0.89 ? 46  ALA A C    4  
ATOM 6484  O O    . ALA A 1 46  ? 9.760   -22.678 9.525   1.00 1.04 ? 46  ALA A O    4  
ATOM 6485  C CB   . ALA A 1 46  ? 6.925   -21.576 11.429  1.00 1.03 ? 46  ALA A CB   4  
ATOM 6486  H H    . ALA A 1 46  ? 6.940   -24.475 10.243  1.00 0.98 ? 46  ALA A H    4  
ATOM 6487  N N    . LEU A 1 47  ? 8.960   -20.589 9.745   1.00 0.83 ? 47  LEU A N    4  
ATOM 6488  C CA   . LEU A 1 47  ? 10.191  -19.946 9.313   1.00 0.78 ? 47  LEU A CA   4  
ATOM 6489  C C    . LEU A 1 47  ? 10.281  -18.547 9.908   1.00 0.69 ? 47  LEU A C    4  
ATOM 6490  O O    . LEU A 1 47  ? 9.257   -17.889 10.116  1.00 0.75 ? 47  LEU A O    4  
ATOM 6491  C CB   . LEU A 1 47  ? 10.240  -19.869 7.785   1.00 0.89 ? 47  LEU A CB   4  
ATOM 6492  C CG   . LEU A 1 47  ? 11.612  -19.601 7.164   1.00 0.92 ? 47  LEU A CG   4  
ATOM 6493  C CD1  . LEU A 1 47  ? 12.496  -20.836 7.255   1.00 1.06 ? 47  LEU A CD1  4  
ATOM 6494  C CD2  . LEU A 1 47  ? 11.467  -19.145 5.720   1.00 1.09 ? 47  LEU A CD2  4  
ATOM 6495  H H    . LEU A 1 47  ? 8.194   -20.026 9.989   1.00 0.92 ? 47  LEU A H    4  
ATOM 6496  N N    . ASP A 1 48  ? 11.497  -18.102 10.193  1.00 0.69 ? 48  ASP A N    4  
ATOM 6497  C CA   . ASP A 1 48  ? 11.715  -16.778 10.759  1.00 0.67 ? 48  ASP A CA   4  
ATOM 6498  C C    . ASP A 1 48  ? 13.016  -16.182 10.234  1.00 0.61 ? 48  ASP A C    4  
ATOM 6499  O O    . ASP A 1 48  ? 14.098  -16.512 10.715  1.00 0.63 ? 48  ASP A O    4  
ATOM 6500  C CB   . ASP A 1 48  ? 11.751  -16.848 12.288  1.00 0.79 ? 48  ASP A CB   4  
ATOM 6501  C CG   . ASP A 1 48  ? 11.534  -15.503 12.955  1.00 1.00 ? 48  ASP A CG   4  
ATOM 6502  O OD1  . ASP A 1 48  ? 11.666  -14.456 12.281  1.00 1.31 ? 48  ASP A OD1  4  
ATOM 6503  O OD2  . ASP A 1 48  ? 11.221  -15.487 14.166  1.00 1.64 ? 48  ASP A OD2  4  
ATOM 6504  H H    . ASP A 1 48  ? 12.274  -18.679 10.021  1.00 0.81 ? 48  ASP A H    4  
ATOM 6505  N N    . PRO A 1 49  ? 12.928  -15.313 9.215   1.00 0.64 ? 49  PRO A N    4  
ATOM 6506  C CA   . PRO A 1 49  ? 14.105  -14.671 8.625   1.00 0.66 ? 49  PRO A CA   4  
ATOM 6507  C C    . PRO A 1 49  ? 14.685  -13.599 9.542   1.00 0.58 ? 49  PRO A C    4  
ATOM 6508  O O    . PRO A 1 49  ? 15.811  -13.143 9.339   1.00 0.63 ? 49  PRO A O    4  
ATOM 6509  C CB   . PRO A 1 49  ? 13.555  -14.032 7.347   1.00 0.80 ? 49  PRO A CB   4  
ATOM 6510  C CG   . PRO A 1 49  ? 12.114  -13.791 7.637   1.00 0.93 ? 49  PRO A CG   4  
ATOM 6511  C CD   . PRO A 1 49  ? 11.678  -14.901 8.552   1.00 0.76 ? 49  PRO A CD   4  
ATOM 6512  N N    . VAL A 1 50  ? 13.910  -13.230 10.566  1.00 0.56 ? 50  VAL A N    4  
ATOM 6513  C CA   . VAL A 1 50  ? 14.306  -12.208 11.532  1.00 0.58 ? 50  VAL A CA   4  
ATOM 6514  C C    . VAL A 1 50  ? 14.685  -10.895 10.839  1.00 0.57 ? 50  VAL A C    4  
ATOM 6515  O O    . VAL A 1 50  ? 15.869  -10.589 10.680  1.00 0.62 ? 50  VAL A O    4  
ATOM 6516  C CB   . VAL A 1 50  ? 15.454  -12.673 12.459  1.00 0.64 ? 50  VAL A CB   4  
ATOM 6517  C CG1  . VAL A 1 50  ? 15.578  -11.743 13.656  1.00 0.75 ? 50  VAL A CG1  4  
ATOM 6518  C CG2  . VAL A 1 50  ? 15.229  -14.105 12.924  1.00 0.75 ? 50  VAL A CG2  4  
ATOM 6519  H H    . VAL A 1 50  ? 13.043  -13.675 10.685  1.00 0.60 ? 50  VAL A H    4  
ATOM 6520  N N    . PRO A 1 51  ? 13.677  -10.110 10.414  1.00 0.60 ? 51  PRO A N    4  
ATOM 6521  C CA   . PRO A 1 51  ? 13.904  -8.831  9.731   1.00 0.65 ? 51  PRO A CA   4  
ATOM 6522  C C    . PRO A 1 51  ? 14.784  -7.895  10.554  1.00 0.66 ? 51  PRO A C    4  
ATOM 6523  O O    . PRO A 1 51  ? 14.477  -7.581  11.707  1.00 0.73 ? 51  PRO A O    4  
ATOM 6524  C CB   . PRO A 1 51  ? 12.495  -8.245  9.584   1.00 0.77 ? 51  PRO A CB   4  
ATOM 6525  C CG   . PRO A 1 51  ? 11.590  -9.427  9.631   1.00 0.92 ? 51  PRO A CG   4  
ATOM 6526  C CD   . PRO A 1 51  ? 12.239  -10.402 10.571  1.00 0.72 ? 51  PRO A CD   4  
ATOM 6527  N N    . GLN A 1 52  ? 15.880  -7.459  9.954   1.00 0.71 ? 52  GLN A N    4  
ATOM 6528  C CA   . GLN A 1 52  ? 16.822  -6.566  10.620  1.00 0.81 ? 52  GLN A CA   4  
ATOM 6529  C C    . GLN A 1 52  ? 16.628  -5.117  10.179  1.00 0.77 ? 52  GLN A C    4  
ATOM 6530  O O    . GLN A 1 52  ? 17.573  -4.325  10.188  1.00 0.91 ? 52  GLN A O    4  
ATOM 6531  C CB   . GLN A 1 52  ? 18.262  -7.007  10.336  1.00 0.97 ? 52  GLN A CB   4  
ATOM 6532  C CG   . GLN A 1 52  ? 18.591  -8.414  10.811  1.00 1.18 ? 52  GLN A CG   4  
ATOM 6533  C CD   . GLN A 1 52  ? 18.463  -8.574  12.313  1.00 1.30 ? 52  GLN A CD   4  
ATOM 6534  O OE1  . GLN A 1 52  ? 18.660  -7.622  13.073  1.00 1.40 ? 52  GLN A OE1  4  
ATOM 6535  N NE2  . GLN A 1 52  ? 18.122  -9.777  12.752  1.00 1.51 ? 52  GLN A NE2  4  
ATOM 6536  H H    . GLN A 1 52  ? 16.072  -7.757  9.039   1.00 0.75 ? 52  GLN A H    4  
ATOM 6537  H HE21 . GLN A 1 52  ? 17.965  -10.485 12.088  1.00 1.58 ? 52  GLN A HE21 4  
ATOM 6538  H HE22 . GLN A 1 52  ? 18.046  -9.915  13.717  1.00 1.68 ? 52  GLN A HE22 4  
ATOM 6539  N N    . ASP A 1 53  ? 15.410  -4.762  9.800   1.00 0.67 ? 53  ASP A N    4  
ATOM 6540  C CA   . ASP A 1 53  ? 15.129  -3.401  9.360   1.00 0.64 ? 53  ASP A CA   4  
ATOM 6541  C C    . ASP A 1 53  ? 14.085  -2.731  10.241  1.00 0.62 ? 53  ASP A C    4  
ATOM 6542  O O    . ASP A 1 53  ? 13.009  -3.281  10.481  1.00 0.63 ? 53  ASP A O    4  
ATOM 6543  C CB   . ASP A 1 53  ? 14.695  -3.364  7.896   1.00 0.64 ? 53  ASP A CB   4  
ATOM 6544  C CG   . ASP A 1 53  ? 14.684  -1.952  7.350   1.00 0.60 ? 53  ASP A CG   4  
ATOM 6545  O OD1  . ASP A 1 53  ? 15.762  -1.449  6.976   1.00 0.78 ? 53  ASP A OD1  4  
ATOM 6546  O OD2  . ASP A 1 53  ? 13.604  -1.331  7.309   1.00 0.69 ? 53  ASP A OD2  4  
ATOM 6547  H H    . ASP A 1 53  ? 14.686  -5.421  9.823   1.00 0.69 ? 53  ASP A H    4  
ATOM 6548  N N    . ALA A 1 54  ? 14.412  -1.542  10.726  1.00 0.63 ? 54  ALA A N    4  
ATOM 6549  C CA   . ALA A 1 54  ? 13.513  -0.792  11.589  1.00 0.64 ? 54  ALA A CA   4  
ATOM 6550  C C    . ALA A 1 54  ? 12.773  0.286   10.806  1.00 0.60 ? 54  ALA A C    4  
ATOM 6551  O O    . ALA A 1 54  ? 11.709  0.746   11.225  1.00 0.60 ? 54  ALA A O    4  
ATOM 6552  C CB   . ALA A 1 54  ? 14.283  -0.179  12.750  1.00 0.71 ? 54  ALA A CB   4  
ATOM 6553  H H    . ALA A 1 54  ? 15.286  -1.158  10.496  1.00 0.67 ? 54  ALA A H    4  
ATOM 6554  N N    . SER A 1 55  ? 13.334  0.673   9.664   1.00 0.58 ? 55  SER A N    4  
ATOM 6555  C CA   . SER A 1 55  ? 12.733  1.698   8.819   1.00 0.57 ? 55  SER A CA   4  
ATOM 6556  C C    . SER A 1 55  ? 11.365  1.253   8.309   1.00 0.52 ? 55  SER A C    4  
ATOM 6557  O O    . SER A 1 55  ? 10.365  1.959   8.475   1.00 0.51 ? 55  SER A O    4  
ATOM 6558  C CB   . SER A 1 55  ? 13.662  2.018   7.645   1.00 0.59 ? 55  SER A CB   4  
ATOM 6559  O OG   . SER A 1 55  ? 14.798  1.168   7.658   1.00 0.67 ? 55  SER A OG   4  
ATOM 6560  H H    . SER A 1 55  ? 14.180  0.263   9.381   1.00 0.60 ? 55  SER A H    4  
ATOM 6561  H HG   . SER A 1 55  ? 14.547  0.287   7.329   1.00 0.67 ? 55  SER A HG   4  
ATOM 6562  N N    . THR A 1 56  ? 11.323  0.074   7.707   1.00 0.51 ? 56  THR A N    4  
ATOM 6563  C CA   . THR A 1 56  ? 10.082  -0.466  7.176   1.00 0.49 ? 56  THR A CA   4  
ATOM 6564  C C    . THR A 1 56  ? 9.135   -0.829  8.314   1.00 0.48 ? 56  THR A C    4  
ATOM 6565  O O    . THR A 1 56  ? 7.913   -0.725  8.182   1.00 0.47 ? 56  THR A O    4  
ATOM 6566  C CB   . THR A 1 56  ? 10.339  -1.709  6.302   1.00 0.50 ? 56  THR A CB   4  
ATOM 6567  O OG1  . THR A 1 56  ? 11.313  -2.550  6.935   1.00 0.57 ? 56  THR A OG1  4  
ATOM 6568  C CG2  . THR A 1 56  ? 10.843  -1.300  4.926   1.00 0.63 ? 56  THR A CG2  4  
ATOM 6569  H H    . THR A 1 56  ? 12.154  -0.455  7.623   1.00 0.52 ? 56  THR A H    4  
ATOM 6570  H HG1  . THR A 1 56  ? 12.183  -2.116  6.917   1.00 0.55 ? 56  THR A HG1  4  
ATOM 6571  N N    . LYS A 1 57  ? 9.714   -1.238  9.436   1.00 0.50 ? 57  LYS A N    4  
ATOM 6572  C CA   . LYS A 1 57  ? 8.939   -1.611  10.610  1.00 0.52 ? 57  LYS A CA   4  
ATOM 6573  C C    . LYS A 1 57  ? 8.151   -0.416  11.129  1.00 0.52 ? 57  LYS A C    4  
ATOM 6574  O O    . LYS A 1 57  ? 6.959   -0.528  11.418  1.00 0.53 ? 57  LYS A O    4  
ATOM 6575  C CB   . LYS A 1 57  ? 9.860   -2.150  11.703  1.00 0.56 ? 57  LYS A CB   4  
ATOM 6576  C CG   . LYS A 1 57  ? 9.260   -3.279  12.521  1.00 1.01 ? 57  LYS A CG   4  
ATOM 6577  C CD   . LYS A 1 57  ? 10.270  -3.826  13.515  1.00 1.09 ? 57  LYS A CD   4  
ATOM 6578  C CE   . LYS A 1 57  ? 9.815   -5.150  14.100  1.00 1.30 ? 57  LYS A CE   4  
ATOM 6579  N NZ   . LYS A 1 57  ? 10.801  -5.689  15.072  1.00 1.59 ? 57  LYS A NZ   4  
ATOM 6580  H H    . LYS A 1 57  ? 10.693  -1.299  9.470   1.00 0.52 ? 57  LYS A H    4  
ATOM 6581  H HZ1  . LYS A 1 57  ? 10.555  -6.667  15.325  1.00 1.92 ? 57  LYS A HZ1  4  
ATOM 6582  H HZ2  . LYS A 1 57  ? 10.802  -5.109  15.938  1.00 1.99 ? 57  LYS A HZ2  4  
ATOM 6583  H HZ3  . LYS A 1 57  ? 11.755  -5.678  14.659  1.00 1.99 ? 57  LYS A HZ3  4  
ATOM 6584  N N    . LYS A 1 58  ? 8.825   0.728   11.233  1.00 0.54 ? 58  LYS A N    4  
ATOM 6585  C CA   . LYS A 1 58  ? 8.192   1.953   11.705  1.00 0.56 ? 58  LYS A CA   4  
ATOM 6586  C C    . LYS A 1 58  ? 7.020   2.327   10.805  1.00 0.54 ? 58  LYS A C    4  
ATOM 6587  O O    . LYS A 1 58  ? 5.933   2.649   11.288  1.00 0.55 ? 58  LYS A O    4  
ATOM 6588  C CB   . LYS A 1 58  ? 9.204   3.106   11.754  1.00 0.60 ? 58  LYS A CB   4  
ATOM 6589  C CG   . LYS A 1 58  ? 8.575   4.469   12.007  1.00 0.70 ? 58  LYS A CG   4  
ATOM 6590  C CD   . LYS A 1 58  ? 9.603   5.588   11.954  1.00 0.76 ? 58  LYS A CD   4  
ATOM 6591  C CE   . LYS A 1 58  ? 8.924   6.939   11.777  1.00 1.16 ? 58  LYS A CE   4  
ATOM 6592  N NZ   . LYS A 1 58  ? 9.850   8.069   12.045  1.00 1.32 ? 58  LYS A NZ   4  
ATOM 6593  H H    . LYS A 1 58  ? 9.780   0.743   10.993  1.00 0.54 ? 58  LYS A H    4  
ATOM 6594  H HZ1  . LYS A 1 58  ? 10.115  8.083   13.052  1.00 1.74 ? 58  LYS A HZ1  4  
ATOM 6595  H HZ2  . LYS A 1 58  ? 9.394   8.972   11.812  1.00 1.67 ? 58  LYS A HZ2  4  
ATOM 6596  H HZ3  . LYS A 1 58  ? 10.715  7.969   11.473  1.00 1.54 ? 58  LYS A HZ3  4  
ATOM 6597  N N    . LEU A 1 59  ? 7.250   2.270   9.498   1.00 0.52 ? 59  LEU A N    4  
ATOM 6598  C CA   . LEU A 1 59  ? 6.220   2.592   8.520   1.00 0.51 ? 59  LEU A CA   4  
ATOM 6599  C C    . LEU A 1 59  ? 5.012   1.680   8.684   1.00 0.50 ? 59  LEU A C    4  
ATOM 6600  O O    . LEU A 1 59  ? 3.876   2.145   8.736   1.00 0.51 ? 59  LEU A O    4  
ATOM 6601  C CB   . LEU A 1 59  ? 6.778   2.489   7.100   1.00 0.50 ? 59  LEU A CB   4  
ATOM 6602  C CG   . LEU A 1 59  ? 7.732   3.609   6.675   1.00 0.56 ? 59  LEU A CG   4  
ATOM 6603  C CD1  . LEU A 1 59  ? 8.348   3.305   5.319   1.00 0.55 ? 59  LEU A CD1  4  
ATOM 6604  C CD2  . LEU A 1 59  ? 7.005   4.945   6.649   1.00 0.72 ? 59  LEU A CD2  4  
ATOM 6605  H H    . LEU A 1 59  ? 8.140   2.004   9.183   1.00 0.52 ? 59  LEU A H    4  
ATOM 6606  N N    . SER A 1 60  ? 5.270   0.387   8.806   1.00 0.50 ? 60  SER A N    4  
ATOM 6607  C CA   . SER A 1 60  ? 4.203   -0.588  8.971   1.00 0.50 ? 60  SER A CA   4  
ATOM 6608  C C    . SER A 1 60  ? 3.411   -0.321  10.252  1.00 0.51 ? 60  SER A C    4  
ATOM 6609  O O    . SER A 1 60  ? 2.182   -0.314  10.241  1.00 0.53 ? 60  SER A O    4  
ATOM 6610  C CB   . SER A 1 60  ? 4.776   -2.007  8.973   1.00 0.50 ? 60  SER A CB   4  
ATOM 6611  O OG   . SER A 1 60  ? 5.627   -2.213  7.854   1.00 0.50 ? 60  SER A OG   4  
ATOM 6612  H H    . SER A 1 60  ? 6.202   0.079   8.786   1.00 0.51 ? 60  SER A H    4  
ATOM 6613  H HG   . SER A 1 60  ? 6.462   -1.749  7.992   1.00 0.49 ? 60  SER A HG   4  
ATOM 6614  N N    . GLU A 1 61  ? 4.122   -0.062  11.344  1.00 0.52 ? 61  GLU A N    4  
ATOM 6615  C CA   . GLU A 1 61  ? 3.487   0.197   12.632  1.00 0.55 ? 61  GLU A CA   4  
ATOM 6616  C C    . GLU A 1 61  ? 2.685   1.498   12.636  1.00 0.55 ? 61  GLU A C    4  
ATOM 6617  O O    . GLU A 1 61  ? 1.608   1.569   13.233  1.00 0.57 ? 61  GLU A O    4  
ATOM 6618  C CB   . GLU A 1 61  ? 4.530   0.202   13.749  1.00 0.60 ? 61  GLU A CB   4  
ATOM 6619  C CG   . GLU A 1 61  ? 5.094   -1.174  14.071  1.00 0.81 ? 61  GLU A CG   4  
ATOM 6620  C CD   . GLU A 1 61  ? 4.179   -1.985  14.968  1.00 1.12 ? 61  GLU A CD   4  
ATOM 6621  O OE1  . GLU A 1 61  ? 3.003   -2.197  14.603  1.00 1.35 ? 61  GLU A OE1  4  
ATOM 6622  O OE2  . GLU A 1 61  ? 4.630   -2.407  16.054  1.00 1.50 ? 61  GLU A OE2  4  
ATOM 6623  H H    . GLU A 1 61  ? 5.104   -0.051  11.286  1.00 0.52 ? 61  GLU A H    4  
ATOM 6624  N N    . CYS A 1 62  ? 3.204   2.531   11.979  1.00 0.55 ? 62  CYS A N    4  
ATOM 6625  C CA   . CYS A 1 62  ? 2.503   3.809   11.927  1.00 0.57 ? 62  CYS A CA   4  
ATOM 6626  C C    . CYS A 1 62  ? 1.261   3.740   11.040  1.00 0.56 ? 62  CYS A C    4  
ATOM 6627  O O    . CYS A 1 62  ? 0.220   4.301   11.377  1.00 0.60 ? 62  CYS A O    4  
ATOM 6628  C CB   . CYS A 1 62  ? 3.427   4.967   11.532  1.00 0.60 ? 62  CYS A CB   4  
ATOM 6629  S SG   . CYS A 1 62  ? 4.078   4.907   9.848   1.00 0.59 ? 62  CYS A SG   4  
ATOM 6630  H H    . CYS A 1 62  ? 4.074   2.433   11.529  1.00 0.55 ? 62  CYS A H    4  
ATOM 6631  H HG   . CYS A 1 62  ? 3.852   3.692   9.365   1.00 0.98 ? 62  CYS A HG   4  
ATOM 6632  N N    . LEU A 1 63  ? 1.362   3.024   9.927   1.00 0.52 ? 63  LEU A N    4  
ATOM 6633  C CA   . LEU A 1 63  ? 0.237   2.884   9.012   1.00 0.53 ? 63  LEU A CA   4  
ATOM 6634  C C    . LEU A 1 63  ? -0.828  1.966   9.597   1.00 0.52 ? 63  LEU A C    4  
ATOM 6635  O O    . LEU A 1 63  ? -2.024  2.226   9.467   1.00 0.53 ? 63  LEU A O    4  
ATOM 6636  C CB   . LEU A 1 63  ? 0.702   2.359   7.651   1.00 0.53 ? 63  LEU A CB   4  
ATOM 6637  C CG   . LEU A 1 63  ? 1.636   3.278   6.856   1.00 0.55 ? 63  LEU A CG   4  
ATOM 6638  C CD1  . LEU A 1 63  ? 2.098   2.596   5.579   1.00 0.57 ? 63  LEU A CD1  4  
ATOM 6639  C CD2  . LEU A 1 63  ? 0.956   4.601   6.539   1.00 0.62 ? 63  LEU A CD2  4  
ATOM 6640  H H    . LEU A 1 63  ? 2.213   2.583   9.713   1.00 0.50 ? 63  LEU A H    4  
ATOM 6641  N N    . LYS A 1 64  ? -0.380  0.900   10.251  1.00 0.52 ? 64  LYS A N    4  
ATOM 6642  C CA   . LYS A 1 64  ? -1.280  -0.071  10.860  1.00 0.54 ? 64  LYS A CA   4  
ATOM 6643  C C    . LYS A 1 64  ? -2.181  0.578   11.904  1.00 0.54 ? 64  LYS A C    4  
ATOM 6644  O O    . LYS A 1 64  ? -3.388  0.336   11.927  1.00 0.54 ? 64  LYS A O    4  
ATOM 6645  C CB   . LYS A 1 64  ? -0.478  -1.222  11.482  1.00 0.59 ? 64  LYS A CB   4  
ATOM 6646  C CG   . LYS A 1 64  ? -1.314  -2.349  12.079  1.00 0.71 ? 64  LYS A CG   4  
ATOM 6647  C CD   . LYS A 1 64  ? -1.502  -2.186  13.585  1.00 0.88 ? 64  LYS A CD   4  
ATOM 6648  C CE   . LYS A 1 64  ? -0.168  -2.108  14.318  1.00 0.86 ? 64  LYS A CE   4  
ATOM 6649  N NZ   . LYS A 1 64  ? 0.537   -3.419  14.368  1.00 0.78 ? 64  LYS A NZ   4  
ATOM 6650  H H    . LYS A 1 64  ? 0.591   0.753   10.313  1.00 0.52 ? 64  LYS A H    4  
ATOM 6651  H HZ1  . LYS A 1 64  ? 0.349   -3.970  13.496  1.00 0.95 ? 64  LYS A HZ1  4  
ATOM 6652  H HZ2  . LYS A 1 64  ? 0.214   -3.969  15.187  1.00 1.03 ? 64  LYS A HZ2  4  
ATOM 6653  H HZ3  . LYS A 1 64  ? 1.568   -3.265  14.451  1.00 0.96 ? 64  LYS A HZ3  4  
ATOM 6654  N N    . ARG A 1 65  ? -1.596  1.411   12.761  1.00 0.57 ? 65  ARG A N    4  
ATOM 6655  C CA   . ARG A 1 65  ? -2.362  2.079   13.808  1.00 0.59 ? 65  ARG A CA   4  
ATOM 6656  C C    . ARG A 1 65  ? -3.436  2.991   13.221  1.00 0.57 ? 65  ARG A C    4  
ATOM 6657  O O    . ARG A 1 65  ? -4.536  3.077   13.753  1.00 0.60 ? 65  ARG A O    4  
ATOM 6658  C CB   . ARG A 1 65  ? -1.452  2.836   14.782  1.00 0.66 ? 65  ARG A CB   4  
ATOM 6659  C CG   . ARG A 1 65  ? -0.966  4.193   14.297  1.00 0.66 ? 65  ARG A CG   4  
ATOM 6660  C CD   . ARG A 1 65  ? 0.388   4.544   14.893  1.00 0.75 ? 65  ARG A CD   4  
ATOM 6661  N NE   . ARG A 1 65  ? 0.398   4.443   16.351  1.00 0.86 ? 65  ARG A NE   4  
ATOM 6662  C CZ   . ARG A 1 65  ? 1.088   3.520   17.030  1.00 1.00 ? 65  ARG A CZ   4  
ATOM 6663  N NH1  . ARG A 1 65  ? 1.811   2.608   16.380  1.00 1.05 ? 65  ARG A NH1  4  
ATOM 6664  N NH2  . ARG A 1 65  ? 1.048   3.501   18.356  1.00 1.19 ? 65  ARG A NH2  4  
ATOM 6665  H H    . ARG A 1 65  ? -0.632  1.583   12.685  1.00 0.58 ? 65  ARG A H    4  
ATOM 6666  H HE   . ARG A 1 65  ? -0.136  5.103   16.852  1.00 0.91 ? 65  ARG A HE   4  
ATOM 6667  H HH11 . ARG A 1 65  ? 1.843   2.608   15.378  1.00 0.95 ? 65  ARG A HH11 4  
ATOM 6668  H HH12 . ARG A 1 65  ? 2.329   1.916   16.893  1.00 1.24 ? 65  ARG A HH12 4  
ATOM 6669  H HH21 . ARG A 1 65  ? 0.501   4.177   18.857  1.00 1.21 ? 65  ARG A HH21 4  
ATOM 6670  H HH22 . ARG A 1 65  ? 1.559   2.803   18.866  1.00 1.36 ? 65  ARG A HH22 4  
ATOM 6671  N N    . ILE A 1 66  ? -3.122  3.647   12.110  1.00 0.53 ? 66  ILE A N    4  
ATOM 6672  C CA   . ILE A 1 66  ? -4.075  4.539   11.463  1.00 0.52 ? 66  ILE A CA   4  
ATOM 6673  C C    . ILE A 1 66  ? -5.153  3.725   10.755  1.00 0.48 ? 66  ILE A C    4  
ATOM 6674  O O    . ILE A 1 66  ? -6.340  4.025   10.856  1.00 0.48 ? 66  ILE A O    4  
ATOM 6675  C CB   . ILE A 1 66  ? -3.384  5.475   10.444  1.00 0.54 ? 66  ILE A CB   4  
ATOM 6676  C CG1  . ILE A 1 66  ? -2.326  6.332   11.143  1.00 0.59 ? 66  ILE A CG1  4  
ATOM 6677  C CG2  . ILE A 1 66  ? -4.405  6.362   9.744   1.00 0.55 ? 66  ILE A CG2  4  
ATOM 6678  C CD1  . ILE A 1 66  ? -1.480  7.156   10.194  1.00 0.62 ? 66  ILE A CD1  4  
ATOM 6679  H H    . ILE A 1 66  ? -2.236  3.526   11.714  1.00 0.54 ? 66  ILE A H    4  
ATOM 6680  N N    . GLY A 1 67  ? -4.722  2.678   10.061  1.00 0.47 ? 67  GLY A N    4  
ATOM 6681  C CA   . GLY A 1 67  ? -5.645  1.822   9.338   1.00 0.45 ? 67  GLY A CA   4  
ATOM 6682  C C    . GLY A 1 67  ? -6.662  1.148   10.239  1.00 0.45 ? 67  GLY A C    4  
ATOM 6683  O O    . GLY A 1 67  ? -7.856  1.164   9.950   1.00 0.44 ? 67  GLY A O    4  
ATOM 6684  H H    . GLY A 1 67  ? -3.757  2.487   10.031  1.00 0.49 ? 67  GLY A H    4  
ATOM 6685  N N    . ASP A 1 68  ? -6.192  0.564   11.339  1.00 0.50 ? 68  ASP A N    4  
ATOM 6686  C CA   . ASP A 1 68  ? -7.078  -0.123  12.277  1.00 0.55 ? 68  ASP A CA   4  
ATOM 6687  C C    . ASP A 1 68  ? -8.026  0.864   12.957  1.00 0.54 ? 68  ASP A C    4  
ATOM 6688  O O    . ASP A 1 68  ? -9.179  0.543   13.235  1.00 0.55 ? 68  ASP A O    4  
ATOM 6689  C CB   . ASP A 1 68  ? -6.271  -0.911  13.314  1.00 0.65 ? 68  ASP A CB   4  
ATOM 6690  C CG   . ASP A 1 68  ? -6.605  -2.396  13.327  1.00 0.76 ? 68  ASP A CG   4  
ATOM 6691  O OD1  . ASP A 1 68  ? -6.486  -3.058  12.274  1.00 0.95 ? 68  ASP A OD1  4  
ATOM 6692  O OD2  . ASP A 1 68  ? -6.964  -2.922  14.403  1.00 1.13 ? 68  ASP A OD2  4  
ATOM 6693  H H    . ASP A 1 68  ? -5.227  0.596   11.524  1.00 0.53 ? 68  ASP A H    4  
ATOM 6694  N N    . GLU A 1 69  ? -7.534  2.075   13.213  1.00 0.55 ? 69  GLU A N    4  
ATOM 6695  C CA   . GLU A 1 69  ? -8.345  3.116   13.836  1.00 0.58 ? 69  GLU A CA   4  
ATOM 6696  C C    . GLU A 1 69  ? -9.410  3.615   12.862  1.00 0.53 ? 69  GLU A C    4  
ATOM 6697  O O    . GLU A 1 69  ? -10.481 4.070   13.270  1.00 0.58 ? 69  GLU A O    4  
ATOM 6698  C CB   . GLU A 1 69  ? -7.471  4.286   14.296  1.00 0.63 ? 69  GLU A CB   4  
ATOM 6699  C CG   . GLU A 1 69  ? -6.833  4.097   15.664  1.00 0.89 ? 69  GLU A CG   4  
ATOM 6700  C CD   . GLU A 1 69  ? -7.823  4.238   16.800  1.00 1.22 ? 69  GLU A CD   4  
ATOM 6701  O OE1  . GLU A 1 69  ? -8.736  5.084   16.701  1.00 1.81 ? 69  GLU A OE1  4  
ATOM 6702  O OE2  . GLU A 1 69  ? -7.689  3.510   17.807  1.00 1.90 ? 69  GLU A OE2  4  
ATOM 6703  H H    . GLU A 1 69  ? -6.601  2.270   12.980  1.00 0.56 ? 69  GLU A H    4  
ATOM 6704  N N    . LEU A 1 70  ? -9.117  3.500   11.570  1.00 0.48 ? 70  LEU A N    4  
ATOM 6705  C CA   . LEU A 1 70  ? -10.035 3.936   10.522  1.00 0.46 ? 70  LEU A CA   4  
ATOM 6706  C C    . LEU A 1 70  ? -11.195 2.959   10.329  1.00 0.41 ? 70  LEU A C    4  
ATOM 6707  O O    . LEU A 1 70  ? -11.942 3.058   9.356   1.00 0.38 ? 70  LEU A O    4  
ATOM 6708  C CB   . LEU A 1 70  ? -9.293  4.140   9.198   1.00 0.45 ? 70  LEU A CB   4  
ATOM 6709  C CG   . LEU A 1 70  ? -8.600  5.489   9.005   1.00 0.51 ? 70  LEU A CG   4  
ATOM 6710  C CD1  . LEU A 1 70  ? -7.725  5.462   7.760   1.00 0.51 ? 70  LEU A CD1  4  
ATOM 6711  C CD2  . LEU A 1 70  ? -9.628  6.606   8.908   1.00 0.59 ? 70  LEU A CD2  4  
ATOM 6712  H H    . LEU A 1 70  ? -8.249  3.117   11.312  1.00 0.48 ? 70  LEU A H    4  
ATOM 6713  N N    . ASP A 1 71  ? -11.325 2.002   11.236  1.00 0.43 ? 71  ASP A N    4  
ATOM 6714  C CA   . ASP A 1 71  ? -12.408 1.032   11.170  1.00 0.41 ? 71  ASP A CA   4  
ATOM 6715  C C    . ASP A 1 71  ? -13.425 1.310   12.272  1.00 0.43 ? 71  ASP A C    4  
ATOM 6716  O O    . ASP A 1 71  ? -14.515 0.737   12.293  1.00 0.48 ? 71  ASP A O    4  
ATOM 6717  C CB   . ASP A 1 71  ? -11.876 -0.401  11.277  1.00 0.46 ? 71  ASP A CB   4  
ATOM 6718  C CG   . ASP A 1 71  ? -12.864 -1.429  10.756  1.00 0.54 ? 71  ASP A CG   4  
ATOM 6719  O OD1  . ASP A 1 71  ? -12.962 -1.590  9.519   1.00 1.07 ? 71  ASP A OD1  4  
ATOM 6720  O OD2  . ASP A 1 71  ? -13.545 -2.086  11.573  1.00 0.61 ? 71  ASP A OD2  4  
ATOM 6721  H H    . ASP A 1 71  ? -10.666 1.934   11.961  1.00 0.48 ? 71  ASP A H    4  
ATOM 6722  N N    . SER A 1 72  ? -13.061 2.211   13.182  1.00 0.46 ? 72  SER A N    4  
ATOM 6723  C CA   . SER A 1 72  ? -13.938 2.582   14.288  1.00 0.50 ? 72  SER A CA   4  
ATOM 6724  C C    . SER A 1 72  ? -15.204 3.251   13.766  1.00 0.47 ? 72  SER A C    4  
ATOM 6725  O O    . SER A 1 72  ? -16.287 3.096   14.330  1.00 0.54 ? 72  SER A O    4  
ATOM 6726  C CB   . SER A 1 72  ? -13.210 3.524   15.245  1.00 0.58 ? 72  SER A CB   4  
ATOM 6727  O OG   . SER A 1 72  ? -11.850 3.150   15.378  1.00 0.65 ? 72  SER A OG   4  
ATOM 6728  H H    . SER A 1 72  ? -12.180 2.631   13.113  1.00 0.49 ? 72  SER A H    4  
ATOM 6729  H HG   . SER A 1 72  ? -11.321 3.626   14.721  1.00 1.14 ? 72  SER A HG   4  
ATOM 6730  N N    . ASN A 1 73  ? -15.055 3.996   12.680  1.00 0.47 ? 73  ASN A N    4  
ATOM 6731  C CA   . ASN A 1 73  ? -16.172 4.687   12.056  1.00 0.47 ? 73  ASN A CA   4  
ATOM 6732  C C    . ASN A 1 73  ? -17.062 3.687   11.329  1.00 0.45 ? 73  ASN A C    4  
ATOM 6733  O O    . ASN A 1 73  ? -16.756 3.268   10.206  1.00 0.45 ? 73  ASN A O    4  
ATOM 6734  C CB   . ASN A 1 73  ? -15.664 5.757   11.079  1.00 0.49 ? 73  ASN A CB   4  
ATOM 6735  C CG   . ASN A 1 73  ? -14.304 5.420   10.494  1.00 0.49 ? 73  ASN A CG   4  
ATOM 6736  O OD1  . ASN A 1 73  ? -13.287 5.995   10.881  1.00 0.70 ? 73  ASN A OD1  4  
ATOM 6737  N ND2  . ASN A 1 73  ? -14.271 4.465   9.580   1.00 0.62 ? 73  ASN A ND2  4  
ATOM 6738  H H    . ASN A 1 73  ? -14.163 4.080   12.284  1.00 0.53 ? 73  ASN A H    4  
ATOM 6739  H HD21 . ASN A 1 73  ? -15.114 4.030   9.332   1.00 0.86 ? 73  ASN A HD21 4  
ATOM 6740  H HD22 . ASN A 1 73  ? -13.399 4.221   9.193   1.00 0.63 ? 73  ASN A HD22 4  
ATOM 6741  N N    . MET A 1 74  ? -18.163 3.312   11.970  1.00 0.48 ? 74  MET A N    4  
ATOM 6742  C CA   . MET A 1 74  ? -19.101 2.346   11.403  1.00 0.49 ? 74  MET A CA   4  
ATOM 6743  C C    . MET A 1 74  ? -19.636 2.801   10.049  1.00 0.47 ? 74  MET A C    4  
ATOM 6744  O O    . MET A 1 74  ? -19.948 1.975   9.191   1.00 0.46 ? 74  MET A O    4  
ATOM 6745  C CB   . MET A 1 74  ? -20.253 2.066   12.370  1.00 0.57 ? 74  MET A CB   4  
ATOM 6746  C CG   . MET A 1 74  ? -21.195 0.964   11.911  1.00 0.78 ? 74  MET A CG   4  
ATOM 6747  S SD   . MET A 1 74  ? -22.534 0.651   13.077  1.00 0.95 ? 74  MET A SD   4  
ATOM 6748  C CE   . MET A 1 74  ? -21.617 -0.001  14.472  1.00 1.32 ? 74  MET A CE   4  
ATOM 6749  H H    . MET A 1 74  ? -18.353 3.699   12.854  1.00 0.53 ? 74  MET A H    4  
ATOM 6750  N N    . GLU A 1 75  ? -19.734 4.113   9.857   1.00 0.49 ? 75  GLU A N    4  
ATOM 6751  C CA   . GLU A 1 75  ? -20.221 4.670   8.599   1.00 0.52 ? 75  GLU A CA   4  
ATOM 6752  C C    . GLU A 1 75  ? -19.382 4.156   7.434   1.00 0.48 ? 75  GLU A C    4  
ATOM 6753  O O    . GLU A 1 75  ? -19.889 3.482   6.538   1.00 0.51 ? 75  GLU A O    4  
ATOM 6754  C CB   . GLU A 1 75  ? -20.188 6.204   8.619   1.00 0.61 ? 75  GLU A CB   4  
ATOM 6755  C CG   . GLU A 1 75  ? -20.643 6.835   9.925   1.00 0.72 ? 75  GLU A CG   4  
ATOM 6756  C CD   . GLU A 1 75  ? -19.495 7.086   10.878  1.00 1.09 ? 75  GLU A CD   4  
ATOM 6757  O OE1  . GLU A 1 75  ? -18.864 8.162   10.790  1.00 1.63 ? 75  GLU A OE1  4  
ATOM 6758  O OE2  . GLU A 1 75  ? -19.213 6.207   11.716  1.00 1.49 ? 75  GLU A OE2  4  
ATOM 6759  H H    . GLU A 1 75  ? -19.478 4.724   10.586  1.00 0.51 ? 75  GLU A H    4  
ATOM 6760  N N    . LEU A 1 76  ? -18.090 4.457   7.475   1.00 0.45 ? 76  LEU A N    4  
ATOM 6761  C CA   . LEU A 1 76  ? -17.171 4.032   6.425   1.00 0.44 ? 76  LEU A CA   4  
ATOM 6762  C C    . LEU A 1 76  ? -17.012 2.514   6.420   1.00 0.40 ? 76  LEU A C    4  
ATOM 6763  O O    . LEU A 1 76  ? -16.902 1.899   5.362   1.00 0.39 ? 76  LEU A O    4  
ATOM 6764  C CB   . LEU A 1 76  ? -15.810 4.712   6.593   1.00 0.48 ? 76  LEU A CB   4  
ATOM 6765  C CG   . LEU A 1 76  ? -14.795 4.487   5.468   1.00 0.49 ? 76  LEU A CG   4  
ATOM 6766  C CD1  . LEU A 1 76  ? -15.282 5.113   4.169   1.00 0.53 ? 76  LEU A CD1  4  
ATOM 6767  C CD2  . LEU A 1 76  ? -13.434 5.044   5.858   1.00 0.53 ? 76  LEU A CD2  4  
ATOM 6768  H H    . LEU A 1 76  ? -17.744 4.977   8.229   1.00 0.48 ? 76  LEU A H    4  
ATOM 6769  N N    . GLN A 1 77  ? -17.018 1.917   7.612   1.00 0.39 ? 77  GLN A N    4  
ATOM 6770  C CA   . GLN A 1 77  ? -16.883 0.470   7.751   1.00 0.38 ? 77  GLN A CA   4  
ATOM 6771  C C    . GLN A 1 77  ? -17.969 -0.251  6.958   1.00 0.37 ? 77  GLN A C    4  
ATOM 6772  O O    . GLN A 1 77  ? -17.692 -1.212  6.239   1.00 0.38 ? 77  GLN A O    4  
ATOM 6773  C CB   . GLN A 1 77  ? -16.952 0.069   9.229   1.00 0.40 ? 77  GLN A CB   4  
ATOM 6774  C CG   . GLN A 1 77  ? -16.920 -1.431  9.474   1.00 0.41 ? 77  GLN A CG   4  
ATOM 6775  C CD   . GLN A 1 77  ? -17.346 -1.802  10.879  1.00 0.47 ? 77  GLN A CD   4  
ATOM 6776  O OE1  . GLN A 1 77  ? -18.534 -1.995  11.150  1.00 0.54 ? 77  GLN A OE1  4  
ATOM 6777  N NE2  . GLN A 1 77  ? -16.384 -1.911  11.783  1.00 0.54 ? 77  GLN A NE2  4  
ATOM 6778  H H    . GLN A 1 77  ? -17.117 2.465   8.420   1.00 0.41 ? 77  GLN A H    4  
ATOM 6779  H HE21 . GLN A 1 77  ? -15.453 -1.745  11.497  1.00 0.57 ? 77  GLN A HE21 4  
ATOM 6780  H HE22 . GLN A 1 77  ? -16.632 -2.154  12.698  1.00 0.61 ? 77  GLN A HE22 4  
ATOM 6781  N N    . ARG A 1 78  ? -19.200 0.233   7.083   1.00 0.40 ? 78  ARG A N    4  
ATOM 6782  C CA   . ARG A 1 78  ? -20.329 -0.352  6.375   1.00 0.42 ? 78  ARG A CA   4  
ATOM 6783  C C    . ARG A 1 78  ? -20.306 0.028   4.898   1.00 0.40 ? 78  ARG A C    4  
ATOM 6784  O O    . ARG A 1 78  ? -20.655 -0.777  4.037   1.00 0.42 ? 78  ARG A O    4  
ATOM 6785  C CB   . ARG A 1 78  ? -21.651 0.080   7.015   1.00 0.49 ? 78  ARG A CB   4  
ATOM 6786  C CG   . ARG A 1 78  ? -22.878 -0.415  6.269   1.00 0.97 ? 78  ARG A CG   4  
ATOM 6787  C CD   . ARG A 1 78  ? -24.162 0.151   6.848   1.00 1.17 ? 78  ARG A CD   4  
ATOM 6788  N NE   . ARG A 1 78  ? -25.304 -0.129  5.981   1.00 1.41 ? 78  ARG A NE   4  
ATOM 6789  C CZ   . ARG A 1 78  ? -26.086 -1.199  6.100   1.00 1.68 ? 78  ARG A CZ   4  
ATOM 6790  N NH1  . ARG A 1 78  ? -25.862 -2.085  7.064   1.00 1.85 ? 78  ARG A NH1  4  
ATOM 6791  N NH2  . ARG A 1 78  ? -27.088 -1.381  5.249   1.00 2.19 ? 78  ARG A NH2  4  
ATOM 6792  H H    . ARG A 1 78  ? -19.354 1.002   7.677   1.00 0.41 ? 78  ARG A H    4  
ATOM 6793  H HE   . ARG A 1 78  ? -25.490 0.517   5.262   1.00 1.72 ? 78  ARG A HE   4  
ATOM 6794  H HH11 . ARG A 1 78  ? -25.100 -1.947  7.706   1.00 1.82 ? 78  ARG A HH11 4  
ATOM 6795  H HH12 . ARG A 1 78  ? -26.451 -2.890  7.160   1.00 2.25 ? 78  ARG A HH12 4  
ATOM 6796  H HH21 . ARG A 1 78  ? -27.259 -0.712  4.520   1.00 2.44 ? 78  ARG A HH21 4  
ATOM 6797  H HH22 . ARG A 1 78  ? -27.673 -2.191  5.322   1.00 2.49 ? 78  ARG A HH22 4  
ATOM 6798  N N    . MET A 1 79  ? -19.884 1.255   4.610   1.00 0.41 ? 79  MET A N    4  
ATOM 6799  C CA   . MET A 1 79  ? -19.817 1.739   3.234   1.00 0.43 ? 79  MET A CA   4  
ATOM 6800  C C    . MET A 1 79  ? -18.916 0.858   2.376   1.00 0.40 ? 79  MET A C    4  
ATOM 6801  O O    . MET A 1 79  ? -19.212 0.610   1.209   1.00 0.41 ? 79  MET A O    4  
ATOM 6802  C CB   . MET A 1 79  ? -19.359 3.199   3.183   1.00 0.50 ? 79  MET A CB   4  
ATOM 6803  C CG   . MET A 1 79  ? -20.450 4.204   3.522   1.00 0.67 ? 79  MET A CG   4  
ATOM 6804  S SD   . MET A 1 79  ? -19.833 5.894   3.673   1.00 0.96 ? 79  MET A SD   4  
ATOM 6805  C CE   . MET A 1 79  ? -19.442 6.262   1.964   1.00 1.28 ? 79  MET A CE   4  
ATOM 6806  H H    . MET A 1 79  ? -19.614 1.852   5.342   1.00 0.42 ? 79  MET A H    4  
ATOM 6807  N N    . ILE A 1 80  ? -17.824 0.377   2.966   1.00 0.39 ? 80  ILE A N    4  
ATOM 6808  C CA   . ILE A 1 80  ? -16.885 -0.493  2.260   1.00 0.40 ? 80  ILE A CA   4  
ATOM 6809  C C    . ILE A 1 80  ? -17.538 -1.845  1.955   1.00 0.39 ? 80  ILE A C    4  
ATOM 6810  O O    . ILE A 1 80  ? -17.228 -2.495  0.959   1.00 0.44 ? 80  ILE A O    4  
ATOM 6811  C CB   . ILE A 1 80  ? -15.591 -0.714  3.084   1.00 0.43 ? 80  ILE A CB   4  
ATOM 6812  C CG1  . ILE A 1 80  ? -14.879 0.618   3.356   1.00 0.46 ? 80  ILE A CG1  4  
ATOM 6813  C CG2  . ILE A 1 80  ? -14.649 -1.693  2.391   1.00 0.47 ? 80  ILE A CG2  4  
ATOM 6814  C CD1  . ILE A 1 80  ? -14.460 1.367   2.108   1.00 0.49 ? 80  ILE A CD1  4  
ATOM 6815  H H    . ILE A 1 80  ? -17.641 0.621   3.898   1.00 0.40 ? 80  ILE A H    4  
ATOM 6816  N N    . ALA A 1 81  ? -18.472 -2.243  2.810   1.00 0.39 ? 81  ALA A N    4  
ATOM 6817  C CA   . ALA A 1 81  ? -19.175 -3.509  2.650   1.00 0.44 ? 81  ALA A CA   4  
ATOM 6818  C C    . ALA A 1 81  ? -20.288 -3.395  1.609   1.00 0.46 ? 81  ALA A C    4  
ATOM 6819  O O    . ALA A 1 81  ? -20.904 -4.394  1.235   1.00 0.56 ? 81  ALA A O    4  
ATOM 6820  C CB   . ALA A 1 81  ? -19.740 -3.972  3.984   1.00 0.48 ? 81  ALA A CB   4  
ATOM 6821  H H    . ALA A 1 81  ? -18.706 -1.662  3.564   1.00 0.40 ? 81  ALA A H    4  
ATOM 6822  N N    . ALA A 1 82  ? -20.535 -2.173  1.146   1.00 0.43 ? 82  ALA A N    4  
ATOM 6823  C CA   . ALA A 1 82  ? -21.565 -1.924  0.147   1.00 0.48 ? 82  ALA A CA   4  
ATOM 6824  C C    . ALA A 1 82  ? -20.946 -1.810  -1.242  1.00 0.45 ? 82  ALA A C    4  
ATOM 6825  O O    . ALA A 1 82  ? -21.616 -1.434  -2.208  1.00 0.49 ? 82  ALA A O    4  
ATOM 6826  C CB   . ALA A 1 82  ? -22.343 -0.661  0.494   1.00 0.55 ? 82  ALA A CB   4  
ATOM 6827  H H    . ALA A 1 82  ? -20.010 -1.417  1.487   1.00 0.44 ? 82  ALA A H    4  
ATOM 6828  N N    . VAL A 1 83  ? -19.662 -2.138  -1.334  1.00 0.43 ? 83  VAL A N    4  
ATOM 6829  C CA   . VAL A 1 83  ? -18.946 -2.077  -2.602  1.00 0.44 ? 83  VAL A CA   4  
ATOM 6830  C C    . VAL A 1 83  ? -19.331 -3.256  -3.495  1.00 0.42 ? 83  VAL A C    4  
ATOM 6831  O O    . VAL A 1 83  ? -19.720 -4.319  -3.006  1.00 0.52 ? 83  VAL A O    4  
ATOM 6832  C CB   . VAL A 1 83  ? -17.412 -2.038  -2.394  1.00 0.51 ? 83  VAL A CB   4  
ATOM 6833  C CG1  . VAL A 1 83  ? -16.850 -3.420  -2.084  1.00 0.54 ? 83  VAL A CG1  4  
ATOM 6834  C CG2  . VAL A 1 83  ? -16.709 -1.417  -3.592  1.00 0.58 ? 83  VAL A CG2  4  
ATOM 6835  H H    . VAL A 1 83  ? -19.186 -2.436  -0.531  1.00 0.45 ? 83  VAL A H    4  
ATOM 6836  N N    . ASP A 1 84  ? -19.231 -3.061  -4.799  1.00 0.49 ? 84  ASP A N    4  
ATOM 6837  C CA   . ASP A 1 84  ? -19.568 -4.100  -5.757  1.00 0.54 ? 84  ASP A CA   4  
ATOM 6838  C C    . ASP A 1 84  ? -18.362 -4.977  -6.055  1.00 0.45 ? 84  ASP A C    4  
ATOM 6839  O O    . ASP A 1 84  ? -17.431 -4.563  -6.751  1.00 0.49 ? 84  ASP A O    4  
ATOM 6840  C CB   . ASP A 1 84  ? -20.114 -3.490  -7.049  1.00 0.73 ? 84  ASP A CB   4  
ATOM 6841  C CG   . ASP A 1 84  ? -21.520 -2.955  -6.881  1.00 0.86 ? 84  ASP A CG   4  
ATOM 6842  O OD1  . ASP A 1 84  ? -21.672 -1.797  -6.439  1.00 0.91 ? 84  ASP A OD1  4  
ATOM 6843  O OD2  . ASP A 1 84  ? -22.482 -3.698  -7.172  1.00 1.14 ? 84  ASP A OD2  4  
ATOM 6844  H H    . ASP A 1 84  ? -18.924 -2.193  -5.131  1.00 0.60 ? 84  ASP A H    4  
ATOM 6845  N N    . THR A 1 85  ? -18.380 -6.187  -5.519  1.00 0.46 ? 85  THR A N    4  
ATOM 6846  C CA   . THR A 1 85  ? -17.294 -7.132  -5.726  1.00 0.48 ? 85  THR A CA   4  
ATOM 6847  C C    . THR A 1 85  ? -17.460 -7.825  -7.076  1.00 0.48 ? 85  THR A C    4  
ATOM 6848  O O    . THR A 1 85  ? -17.880 -8.981  -7.151  1.00 0.73 ? 85  THR A O    4  
ATOM 6849  C CB   . THR A 1 85  ? -17.243 -8.195  -4.607  1.00 0.64 ? 85  THR A CB   4  
ATOM 6850  O OG1  . THR A 1 85  ? -17.502 -7.580  -3.332  1.00 0.66 ? 85  THR A OG1  4  
ATOM 6851  C CG2  . THR A 1 85  ? -15.877 -8.869  -4.570  1.00 0.77 ? 85  THR A CG2  4  
ATOM 6852  H H    . THR A 1 85  ? -19.153 -6.457  -4.978  1.00 0.53 ? 85  THR A H    4  
ATOM 6853  H HG1  . THR A 1 85  ? -18.417 -7.273  -3.307  1.00 0.70 ? 85  THR A HG1  4  
ATOM 6854  N N    . ASP A 1 86  ? -17.155 -7.098  -8.143  1.00 0.40 ? 86  ASP A N    4  
ATOM 6855  C CA   . ASP A 1 86  ? -17.282 -7.641  -9.487  1.00 0.44 ? 86  ASP A CA   4  
ATOM 6856  C C    . ASP A 1 86  ? -16.012 -7.461  -10.312 1.00 0.41 ? 86  ASP A C    4  
ATOM 6857  O O    . ASP A 1 86  ? -15.374 -8.436  -10.697 1.00 0.57 ? 86  ASP A O    4  
ATOM 6858  C CB   . ASP A 1 86  ? -18.478 -7.030  -10.213 1.00 0.56 ? 86  ASP A CB   4  
ATOM 6859  C CG   . ASP A 1 86  ? -18.778 -7.747  -11.509 1.00 0.67 ? 86  ASP A CG   4  
ATOM 6860  O OD1  . ASP A 1 86  ? -19.425 -8.812  -11.463 1.00 0.86 ? 86  ASP A OD1  4  
ATOM 6861  O OD2  . ASP A 1 86  ? -18.357 -7.258  -12.576 1.00 0.90 ? 86  ASP A OD2  4  
ATOM 6862  H H    . ASP A 1 86  ? -16.850 -6.173  -8.021  1.00 0.49 ? 86  ASP A H    4  
ATOM 6863  N N    . SER A 1 87  ? -15.651 -6.215  -10.588 1.00 0.38 ? 87  SER A N    4  
ATOM 6864  C CA   . SER A 1 87  ? -14.461 -5.921  -11.375 1.00 0.45 ? 87  SER A CA   4  
ATOM 6865  C C    . SER A 1 87  ? -13.360 -5.340  -10.485 1.00 0.36 ? 87  SER A C    4  
ATOM 6866  O O    . SER A 1 87  ? -13.319 -4.136  -10.239 1.00 0.44 ? 87  SER A O    4  
ATOM 6867  C CB   . SER A 1 87  ? -14.823 -4.942  -12.491 1.00 0.69 ? 87  SER A CB   4  
ATOM 6868  O OG   . SER A 1 87  ? -16.124 -5.210  -12.996 1.00 1.31 ? 87  SER A OG   4  
ATOM 6869  H H    . SER A 1 87  ? -16.195 -5.473  -10.254 1.00 0.45 ? 87  SER A H    4  
ATOM 6870  H HG   . SER A 1 87  ? -16.385 -6.108  -12.750 1.00 1.60 ? 87  SER A HG   4  
ATOM 6871  N N    . PRO A 1 88  ? -12.449 -6.196  -9.990  1.00 0.46 ? 88  PRO A N    4  
ATOM 6872  C CA   . PRO A 1 88  ? -11.360 -5.780  -9.097  1.00 0.52 ? 88  PRO A CA   4  
ATOM 6873  C C    . PRO A 1 88  ? -10.401 -4.764  -9.720  1.00 0.42 ? 88  PRO A C    4  
ATOM 6874  O O    . PRO A 1 88  ? -10.130 -3.721  -9.125  1.00 0.37 ? 88  PRO A O    4  
ATOM 6875  C CB   . PRO A 1 88  ? -10.626 -7.088  -8.779  1.00 0.74 ? 88  PRO A CB   4  
ATOM 6876  C CG   . PRO A 1 88  ? -11.592 -8.168  -9.122  1.00 0.89 ? 88  PRO A CG   4  
ATOM 6877  C CD   . PRO A 1 88  ? -12.405 -7.642  -10.265 1.00 0.72 ? 88  PRO A CD   4  
ATOM 6878  N N    . ARG A 1 89  ? -9.892  -5.063  -10.912 1.00 0.44 ? 89  ARG A N    4  
ATOM 6879  C CA   . ARG A 1 89  ? -8.956  -4.164  -11.581 1.00 0.41 ? 89  ARG A CA   4  
ATOM 6880  C C    . ARG A 1 89  ? -9.620  -2.837  -11.913 1.00 0.37 ? 89  ARG A C    4  
ATOM 6881  O O    . ARG A 1 89  ? -9.029  -1.778  -11.721 1.00 0.36 ? 89  ARG A O    4  
ATOM 6882  C CB   . ARG A 1 89  ? -8.369  -4.812  -12.842 1.00 0.55 ? 89  ARG A CB   4  
ATOM 6883  C CG   . ARG A 1 89  ? -7.530  -3.879  -13.712 1.00 0.64 ? 89  ARG A CG   4  
ATOM 6884  C CD   . ARG A 1 89  ? -6.229  -3.469  -13.033 1.00 0.91 ? 89  ARG A CD   4  
ATOM 6885  N NE   . ARG A 1 89  ? -5.297  -2.827  -13.968 1.00 1.11 ? 89  ARG A NE   4  
ATOM 6886  C CZ   . ARG A 1 89  ? -4.045  -2.469  -13.657 1.00 1.40 ? 89  ARG A CZ   4  
ATOM 6887  N NH1  . ARG A 1 89  ? -3.590  -2.638  -12.419 1.00 1.83 ? 89  ARG A NH1  4  
ATOM 6888  N NH2  . ARG A 1 89  ? -3.249  -1.938  -14.581 1.00 1.64 ? 89  ARG A NH2  4  
ATOM 6889  H H    . ARG A 1 89  ? -10.165 -5.896  -11.360 1.00 0.53 ? 89  ARG A H    4  
ATOM 6890  H HE   . ARG A 1 89  ? -5.622  -2.666  -14.887 1.00 1.35 ? 89  ARG A HE   4  
ATOM 6891  H HH11 . ARG A 1 89  ? -4.181  -3.034  -11.715 1.00 1.95 ? 89  ARG A HH11 4  
ATOM 6892  H HH12 . ARG A 1 89  ? -2.653  -2.363  -12.186 1.00 2.22 ? 89  ARG A HH12 4  
ATOM 6893  H HH21 . ARG A 1 89  ? -3.587  -1.798  -15.518 1.00 1.80 ? 89  ARG A HH21 4  
ATOM 6894  H HH22 . ARG A 1 89  ? -2.296  -1.677  -14.350 1.00 1.87 ? 89  ARG A HH22 4  
ATOM 6895  N N    . GLU A 1 90  ? -10.851 -2.905  -12.397 1.00 0.38 ? 90  GLU A N    4  
ATOM 6896  C CA   . GLU A 1 90  ? -11.609 -1.716  -12.761 1.00 0.38 ? 90  GLU A CA   4  
ATOM 6897  C C    . GLU A 1 90  ? -11.823 -0.799  -11.559 1.00 0.36 ? 90  GLU A C    4  
ATOM 6898  O O    . GLU A 1 90  ? -11.613 0.411   -11.649 1.00 0.38 ? 90  GLU A O    4  
ATOM 6899  C CB   . GLU A 1 90  ? -12.948 -2.103  -13.396 1.00 0.41 ? 90  GLU A CB   4  
ATOM 6900  C CG   . GLU A 1 90  ? -12.844 -2.668  -14.811 1.00 0.55 ? 90  GLU A CG   4  
ATOM 6901  C CD   . GLU A 1 90  ? -12.034 -3.950  -14.894 1.00 0.76 ? 90  GLU A CD   4  
ATOM 6902  O OE1  . GLU A 1 90  ? -12.115 -4.775  -13.959 1.00 1.10 ? 90  GLU A OE1  4  
ATOM 6903  O OE2  . GLU A 1 90  ? -11.312 -4.137  -15.895 1.00 1.46 ? 90  GLU A OE2  4  
ATOM 6904  H H    . GLU A 1 90  ? -11.262 -3.789  -12.535 1.00 0.42 ? 90  GLU A H    4  
ATOM 6905  N N    . VAL A 1 91  ? -12.234 -1.376  -10.435 1.00 0.34 ? 91  VAL A N    4  
ATOM 6906  C CA   . VAL A 1 91  ? -12.462 -0.603  -9.217  1.00 0.36 ? 91  VAL A CA   4  
ATOM 6907  C C    . VAL A 1 91  ? -11.163 0.047   -8.746  1.00 0.32 ? 91  VAL A C    4  
ATOM 6908  O O    . VAL A 1 91  ? -11.134 1.240   -8.421  1.00 0.34 ? 91  VAL A O    4  
ATOM 6909  C CB   . VAL A 1 91  ? -13.056 -1.469  -8.083  1.00 0.38 ? 91  VAL A CB   4  
ATOM 6910  C CG1  . VAL A 1 91  ? -13.072 -0.704  -6.764  1.00 0.44 ? 91  VAL A CG1  4  
ATOM 6911  C CG2  . VAL A 1 91  ? -14.463 -1.925  -8.440  1.00 0.45 ? 91  VAL A CG2  4  
ATOM 6912  H H    . VAL A 1 91  ? -12.392 -2.346  -10.426 1.00 0.34 ? 91  VAL A H    4  
ATOM 6913  N N    . PHE A 1 92  ? -10.088 -0.736  -8.747  1.00 0.30 ? 92  PHE A N    4  
ATOM 6914  C CA   . PHE A 1 92  ? -8.780  -0.252  -8.321  1.00 0.30 ? 92  PHE A CA   4  
ATOM 6915  C C    . PHE A 1 92  ? -8.266  0.840   -9.257  1.00 0.29 ? 92  PHE A C    4  
ATOM 6916  O O    . PHE A 1 92  ? -7.748  1.862   -8.808  1.00 0.29 ? 92  PHE A O    4  
ATOM 6917  C CB   . PHE A 1 92  ? -7.775  -1.408  -8.244  1.00 0.33 ? 92  PHE A CB   4  
ATOM 6918  C CG   . PHE A 1 92  ? -6.549  -1.088  -7.438  1.00 0.37 ? 92  PHE A CG   4  
ATOM 6919  C CD1  . PHE A 1 92  ? -6.599  -1.087  -6.054  1.00 0.45 ? 92  PHE A CD1  4  
ATOM 6920  C CD2  . PHE A 1 92  ? -5.350  -0.785  -8.062  1.00 0.46 ? 92  PHE A CD2  4  
ATOM 6921  C CE1  . PHE A 1 92  ? -5.478  -0.791  -5.304  1.00 0.53 ? 92  PHE A CE1  4  
ATOM 6922  C CE2  . PHE A 1 92  ? -4.225  -0.489  -7.319  1.00 0.54 ? 92  PHE A CE2  4  
ATOM 6923  C CZ   . PHE A 1 92  ? -4.289  -0.489  -5.938  1.00 0.55 ? 92  PHE A CZ   4  
ATOM 6924  H H    . PHE A 1 92  ? -10.176 -1.669  -9.044  1.00 0.30 ? 92  PHE A H    4  
ATOM 6925  N N    . PHE A 1 93  ? -8.421  0.619   -10.557 1.00 0.31 ? 93  PHE A N    4  
ATOM 6926  C CA   . PHE A 1 93  ? -7.976  1.581   -11.557 1.00 0.34 ? 93  PHE A CA   4  
ATOM 6927  C C    . PHE A 1 93  ? -8.764  2.882   -11.426 1.00 0.34 ? 93  PHE A C    4  
ATOM 6928  O O    . PHE A 1 93  ? -8.218  3.975   -11.587 1.00 0.35 ? 93  PHE A O    4  
ATOM 6929  C CB   . PHE A 1 93  ? -8.132  0.999   -12.968 1.00 0.42 ? 93  PHE A CB   4  
ATOM 6930  C CG   . PHE A 1 93  ? -7.188  1.584   -13.981 1.00 0.60 ? 93  PHE A CG   4  
ATOM 6931  C CD1  . PHE A 1 93  ? -5.865  1.174   -14.033 1.00 0.82 ? 93  PHE A CD1  4  
ATOM 6932  C CD2  . PHE A 1 93  ? -7.624  2.539   -14.883 1.00 0.78 ? 93  PHE A CD2  4  
ATOM 6933  C CE1  . PHE A 1 93  ? -4.995  1.706   -14.965 1.00 1.06 ? 93  PHE A CE1  4  
ATOM 6934  C CE2  . PHE A 1 93  ? -6.761  3.078   -15.816 1.00 1.02 ? 93  PHE A CE2  4  
ATOM 6935  C CZ   . PHE A 1 93  ? -5.444  2.662   -15.858 1.00 1.12 ? 93  PHE A CZ   4  
ATOM 6936  H H    . PHE A 1 93  ? -8.844  -0.220  -10.852 1.00 0.32 ? 93  PHE A H    4  
ATOM 6937  N N    . ARG A 1 94  ? -10.048 2.751   -11.113 1.00 0.35 ? 94  ARG A N    4  
ATOM 6938  C CA   . ARG A 1 94  ? -10.917 3.904   -10.951 1.00 0.37 ? 94  ARG A CA   4  
ATOM 6939  C C    . ARG A 1 94  ? -10.452 4.775   -9.791  1.00 0.33 ? 94  ARG A C    4  
ATOM 6940  O O    . ARG A 1 94  ? -10.197 5.959   -9.970  1.00 0.34 ? 94  ARG A O    4  
ATOM 6941  C CB   . ARG A 1 94  ? -12.365 3.466   -10.730 1.00 0.43 ? 94  ARG A CB   4  
ATOM 6942  C CG   . ARG A 1 94  ? -13.292 3.723   -11.910 1.00 0.55 ? 94  ARG A CG   4  
ATOM 6943  C CD   . ARG A 1 94  ? -13.542 5.211   -12.131 1.00 0.75 ? 94  ARG A CD   4  
ATOM 6944  N NE   . ARG A 1 94  ? -13.886 5.926   -10.898 1.00 0.81 ? 94  ARG A NE   4  
ATOM 6945  C CZ   . ARG A 1 94  ? -15.072 5.856   -10.283 1.00 1.17 ? 94  ARG A CZ   4  
ATOM 6946  N NH1  . ARG A 1 94  ? -16.051 5.117   -10.793 1.00 1.43 ? 94  ARG A NH1  4  
ATOM 6947  N NH2  . ARG A 1 94  ? -15.276 6.542   -9.167  1.00 1.33 ? 94  ARG A NH2  4  
ATOM 6948  H H    . ARG A 1 94  ? -10.421 1.849   -10.993 1.00 0.36 ? 94  ARG A H    4  
ATOM 6949  H HE   . ARG A 1 94  ? -13.183 6.509   -10.505 1.00 0.69 ? 94  ARG A HE   4  
ATOM 6950  H HH11 . ARG A 1 94  ? -15.904 4.608   -11.645 1.00 1.33 ? 94  ARG A HH11 4  
ATOM 6951  H HH12 . ARG A 1 94  ? -16.938 5.062   -10.331 1.00 1.75 ? 94  ARG A HH12 4  
ATOM 6952  H HH21 . ARG A 1 94  ? -14.532 7.119   -8.781  1.00 1.16 ? 94  ARG A HH21 4  
ATOM 6953  H HH22 . ARG A 1 94  ? -16.158 6.498   -8.701  1.00 1.66 ? 94  ARG A HH22 4  
ATOM 6954  N N    . VAL A 1 95  ? -10.309 4.180   -8.609  1.00 0.31 ? 95  VAL A N    4  
ATOM 6955  C CA   . VAL A 1 95  ? -9.878  4.935   -7.434  1.00 0.30 ? 95  VAL A CA   4  
ATOM 6956  C C    . VAL A 1 95  ? -8.462  5.487   -7.600  1.00 0.28 ? 95  VAL A C    4  
ATOM 6957  O O    . VAL A 1 95  ? -8.106  6.508   -7.008  1.00 0.30 ? 95  VAL A O    4  
ATOM 6958  C CB   . VAL A 1 95  ? -10.001 4.136   -6.117  1.00 0.31 ? 95  VAL A CB   4  
ATOM 6959  C CG1  . VAL A 1 95  ? -11.460 3.816   -5.821  1.00 0.37 ? 95  VAL A CG1  4  
ATOM 6960  C CG2  . VAL A 1 95  ? -9.164  2.867   -6.162  1.00 0.29 ? 95  VAL A CG2  4  
ATOM 6961  H H    . VAL A 1 95  ? -10.493 3.217   -8.527  1.00 0.32 ? 95  VAL A H    4  
ATOM 6962  N N    . ALA A 1 96  ? -7.658  4.814   -8.415  1.00 0.27 ? 96  ALA A N    4  
ATOM 6963  C CA   . ALA A 1 96  ? -6.296  5.252   -8.672  1.00 0.29 ? 96  ALA A CA   4  
ATOM 6964  C C    . ALA A 1 96  ? -6.298  6.545   -9.482  1.00 0.30 ? 96  ALA A C    4  
ATOM 6965  O O    . ALA A 1 96  ? -5.511  7.458   -9.219  1.00 0.32 ? 96  ALA A O    4  
ATOM 6966  C CB   . ALA A 1 96  ? -5.510  4.169   -9.396  1.00 0.33 ? 96  ALA A CB   4  
ATOM 6967  H H    . ALA A 1 96  ? -7.989  3.997   -8.850  1.00 0.28 ? 96  ALA A H    4  
ATOM 6968  N N    . ALA A 1 97  ? -7.198  6.614   -10.458 1.00 0.31 ? 97  ALA A N    4  
ATOM 6969  C CA   . ALA A 1 97  ? -7.318  7.787   -11.315 1.00 0.34 ? 97  ALA A CA   4  
ATOM 6970  C C    . ALA A 1 97  ? -8.194  8.857   -10.668 1.00 0.34 ? 97  ALA A C    4  
ATOM 6971  O O    . ALA A 1 97  ? -8.007  10.051  -10.906 1.00 0.38 ? 97  ALA A O    4  
ATOM 6972  C CB   . ALA A 1 97  ? -7.864  7.396   -12.681 1.00 0.38 ? 97  ALA A CB   4  
ATOM 6973  H H    . ALA A 1 97  ? -7.803  5.851   -10.605 1.00 0.30 ? 97  ALA A H    4  
ATOM 6974  N N    . ASP A 1 98  ? -9.146  8.422   -9.848  1.00 0.33 ? 98  ASP A N    4  
ATOM 6975  C CA   . ASP A 1 98  ? -10.054 9.333   -9.151  1.00 0.37 ? 98  ASP A CA   4  
ATOM 6976  C C    . ASP A 1 98  ? -9.277  10.329  -8.307  1.00 0.35 ? 98  ASP A C    4  
ATOM 6977  O O    . ASP A 1 98  ? -9.529  11.533  -8.350  1.00 0.37 ? 98  ASP A O    4  
ATOM 6978  C CB   . ASP A 1 98  ? -11.020 8.550   -8.255  1.00 0.45 ? 98  ASP A CB   4  
ATOM 6979  C CG   . ASP A 1 98  ? -12.332 8.218   -8.939  1.00 0.57 ? 98  ASP A CG   4  
ATOM 6980  O OD1  . ASP A 1 98  ? -12.338 8.020   -10.171 1.00 0.82 ? 98  ASP A OD1  4  
ATOM 6981  O OD2  . ASP A 1 98  ? -13.369 8.141   -8.247  1.00 1.16 ? 98  ASP A OD2  4  
ATOM 6982  H H    . ASP A 1 98  ? -9.261  7.452   -9.726  1.00 0.32 ? 98  ASP A H    4  
ATOM 6983  N N    . MET A 1 99  ? -8.310  9.818   -7.557  1.00 0.35 ? 99  MET A N    4  
ATOM 6984  C CA   . MET A 1 99  ? -7.484  10.655  -6.696  1.00 0.38 ? 99  MET A CA   4  
ATOM 6985  C C    . MET A 1 99  ? -6.290  11.215  -7.466  1.00 0.39 ? 99  MET A C    4  
ATOM 6986  O O    . MET A 1 99  ? -5.356  11.763  -6.879  1.00 0.48 ? 99  MET A O    4  
ATOM 6987  C CB   . MET A 1 99  ? -6.985  9.849   -5.494  1.00 0.39 ? 99  MET A CB   4  
ATOM 6988  C CG   . MET A 1 99  ? -8.073  9.125   -4.720  1.00 0.38 ? 99  MET A CG   4  
ATOM 6989  S SD   . MET A 1 99  ? -7.400  7.948   -3.532  1.00 0.40 ? 99  MET A SD   4  
ATOM 6990  C CE   . MET A 1 99  ? -8.905  7.220   -2.891  1.00 0.42 ? 99  MET A CE   4  
ATOM 6991  H H    . MET A 1 99  ? -8.153  8.850   -7.579  1.00 0.37 ? 99  MET A H    4  
ATOM 6992  N N    . PHE A 1 100 ? -6.317  11.067  -8.783  1.00 0.36 ? 100 PHE A N    4  
ATOM 6993  C CA   . PHE A 1 100 ? -5.238  11.557  -9.629  1.00 0.41 ? 100 PHE A CA   4  
ATOM 6994  C C    . PHE A 1 100 ? -5.788  12.479  -10.711 1.00 0.44 ? 100 PHE A C    4  
ATOM 6995  O O    . PHE A 1 100 ? -5.103  12.789  -11.683 1.00 0.54 ? 100 PHE A O    4  
ATOM 6996  C CB   . PHE A 1 100 ? -4.481  10.384  -10.260 1.00 0.46 ? 100 PHE A CB   4  
ATOM 6997  C CG   . PHE A 1 100 ? -3.027  10.662  -10.518 1.00 0.62 ? 100 PHE A CG   4  
ATOM 6998  C CD1  . PHE A 1 100 ? -2.127  10.729  -9.468  1.00 0.81 ? 100 PHE A CD1  4  
ATOM 6999  C CD2  . PHE A 1 100 ? -2.561  10.859  -11.809 1.00 0.80 ? 100 PHE A CD2  4  
ATOM 7000  C CE1  . PHE A 1 100 ? -0.789  10.986  -9.698  1.00 0.99 ? 100 PHE A CE1  4  
ATOM 7001  C CE2  . PHE A 1 100 ? -1.225  11.117  -12.046 1.00 1.00 ? 100 PHE A CE2  4  
ATOM 7002  C CZ   . PHE A 1 100 ? -0.338  11.181  -10.988 1.00 1.03 ? 100 PHE A CZ   4  
ATOM 7003  H H    . PHE A 1 100 ? -7.086  10.617  -9.199  1.00 0.35 ? 100 PHE A H    4  
ATOM 7004  N N    . SER A 1 101 ? -7.028  12.918  -10.524 1.00 0.53 ? 101 SER A N    4  
ATOM 7005  C CA   . SER A 1 101 ? -7.682  13.808  -11.471 1.00 0.58 ? 101 SER A CA   4  
ATOM 7006  C C    . SER A 1 101 ? -6.932  15.134  -11.565 1.00 0.42 ? 101 SER A C    4  
ATOM 7007  O O    . SER A 1 101 ? -6.398  15.489  -12.619 1.00 0.48 ? 101 SER A O    4  
ATOM 7008  C CB   . SER A 1 101 ? -9.125  14.043  -11.023 1.00 0.80 ? 101 SER A CB   4  
ATOM 7009  O OG   . SER A 1 101 ? -9.214  13.984  -9.607  1.00 1.20 ? 101 SER A OG   4  
ATOM 7010  H H    . SER A 1 101 ? -7.521  12.636  -9.726  1.00 0.65 ? 101 SER A H    4  
ATOM 7011  H HG   . SER A 1 101 ? -9.730  13.207  -9.346  1.00 1.33 ? 101 SER A HG   4  
ATOM 7012  N N    . ASP A 1 102 ? -6.881  15.852  -10.451 1.00 0.45 ? 102 ASP A N    4  
ATOM 7013  C CA   . ASP A 1 102 ? -6.188  17.137  -10.391 1.00 0.53 ? 102 ASP A CA   4  
ATOM 7014  C C    . ASP A 1 102 ? -4.683  16.934  -10.382 1.00 0.45 ? 102 ASP A C    4  
ATOM 7015  O O    . ASP A 1 102 ? -3.922  17.827  -10.752 1.00 0.63 ? 102 ASP A O    4  
ATOM 7016  C CB   . ASP A 1 102 ? -6.588  17.904  -9.128  1.00 0.78 ? 102 ASP A CB   4  
ATOM 7017  C CG   . ASP A 1 102 ? -8.041  18.320  -9.118  1.00 1.07 ? 102 ASP A CG   4  
ATOM 7018  O OD1  . ASP A 1 102 ? -8.458  19.060  -10.027 1.00 1.64 ? 102 ASP A OD1  4  
ATOM 7019  O OD2  . ASP A 1 102 ? -8.771  17.907  -8.195  1.00 1.62 ? 102 ASP A OD2  4  
ATOM 7020  H H    . ASP A 1 102 ? -7.338  15.517  -9.649  1.00 0.56 ? 102 ASP A H    4  
ATOM 7021  N N    . GLY A 1 103 ? -4.261  15.751  -9.952  1.00 0.40 ? 103 GLY A N    4  
ATOM 7022  C CA   . GLY A 1 103 ? -2.844  15.452  -9.876  1.00 0.53 ? 103 GLY A CA   4  
ATOM 7023  C C    . GLY A 1 103 ? -2.231  16.090  -8.648  1.00 0.53 ? 103 GLY A C    4  
ATOM 7024  O O    . GLY A 1 103 ? -1.025  16.337  -8.592  1.00 0.70 ? 103 GLY A O    4  
ATOM 7025  H H    . GLY A 1 103 ? -4.916  15.076  -9.692  1.00 0.46 ? 103 GLY A H    4  
ATOM 7026  N N    . ASN A 1 104 ? -3.082  16.365  -7.669  1.00 0.44 ? 104 ASN A N    4  
ATOM 7027  C CA   . ASN A 1 104 ? -2.662  16.990  -6.425  1.00 0.47 ? 104 ASN A CA   4  
ATOM 7028  C C    . ASN A 1 104 ? -1.915  16.001  -5.536  1.00 0.43 ? 104 ASN A C    4  
ATOM 7029  O O    . ASN A 1 104 ? -2.415  14.912  -5.245  1.00 0.45 ? 104 ASN A O    4  
ATOM 7030  C CB   . ASN A 1 104 ? -3.879  17.554  -5.688  1.00 0.55 ? 104 ASN A CB   4  
ATOM 7031  C CG   . ASN A 1 104 ? -3.519  18.269  -4.400  1.00 0.61 ? 104 ASN A CG   4  
ATOM 7032  O OD1  . ASN A 1 104 ? -3.479  17.663  -3.332  1.00 0.69 ? 104 ASN A OD1  4  
ATOM 7033  N ND2  . ASN A 1 104 ? -3.263  19.562  -4.489  1.00 0.91 ? 104 ASN A ND2  4  
ATOM 7034  H H    . ASN A 1 104 ? -4.025  16.138  -7.788  1.00 0.48 ? 104 ASN A H    4  
ATOM 7035  H HD21 . ASN A 1 104 ? -3.320  19.985  -5.375  1.00 1.15 ? 104 ASN A HD21 4  
ATOM 7036  H HD22 . ASN A 1 104 ? -3.029  20.047  -3.671  1.00 0.98 ? 104 ASN A HD22 4  
ATOM 7037  N N    . PHE A 1 105 ? -0.723  16.388  -5.103  1.00 0.45 ? 105 PHE A N    4  
ATOM 7038  C CA   . PHE A 1 105 ? 0.098   15.536  -4.255  1.00 0.48 ? 105 PHE A CA   4  
ATOM 7039  C C    . PHE A 1 105 ? -0.120  15.852  -2.777  1.00 0.50 ? 105 PHE A C    4  
ATOM 7040  O O    . PHE A 1 105 ? 0.783   16.325  -2.090  1.00 0.60 ? 105 PHE A O    4  
ATOM 7041  C CB   . PHE A 1 105 ? 1.579   15.675  -4.619  1.00 0.60 ? 105 PHE A CB   4  
ATOM 7042  C CG   . PHE A 1 105 ? 1.923   15.161  -5.989  1.00 0.66 ? 105 PHE A CG   4  
ATOM 7043  C CD1  . PHE A 1 105 ? 1.520   13.898  -6.395  1.00 0.66 ? 105 PHE A CD1  4  
ATOM 7044  C CD2  . PHE A 1 105 ? 2.653   15.941  -6.870  1.00 0.81 ? 105 PHE A CD2  4  
ATOM 7045  C CE1  . PHE A 1 105 ? 1.836   13.424  -7.653  1.00 0.75 ? 105 PHE A CE1  4  
ATOM 7046  C CE2  . PHE A 1 105 ? 2.973   15.472  -8.130  1.00 0.91 ? 105 PHE A CE2  4  
ATOM 7047  C CZ   . PHE A 1 105 ? 2.564   14.213  -8.521  1.00 0.86 ? 105 PHE A CZ   4  
ATOM 7048  H H    . PHE A 1 105 ? -0.392  17.279  -5.351  1.00 0.50 ? 105 PHE A H    4  
ATOM 7049  N N    . ASN A 1 106 ? -1.322  15.573  -2.292  1.00 0.45 ? 106 ASN A N    4  
ATOM 7050  C CA   . ASN A 1 106 ? -1.674  15.831  -0.893  1.00 0.48 ? 106 ASN A CA   4  
ATOM 7051  C C    . ASN A 1 106 ? -1.148  14.749  0.047   1.00 0.49 ? 106 ASN A C    4  
ATOM 7052  O O    . ASN A 1 106 ? -1.319  14.846  1.264   1.00 0.52 ? 106 ASN A O    4  
ATOM 7053  C CB   . ASN A 1 106 ? -3.192  15.982  -0.730  1.00 0.48 ? 106 ASN A CB   4  
ATOM 7054  C CG   . ASN A 1 106 ? -3.987  14.801  -1.267  1.00 0.43 ? 106 ASN A CG   4  
ATOM 7055  O OD1  . ASN A 1 106 ? -3.534  13.655  -1.240  1.00 0.44 ? 106 ASN A OD1  4  
ATOM 7056  N ND2  . ASN A 1 106 ? -5.181  15.075  -1.768  1.00 0.55 ? 106 ASN A ND2  4  
ATOM 7057  H H    . ASN A 1 106 ? -2.001  15.198  -2.893  1.00 0.42 ? 106 ASN A H    4  
ATOM 7058  H HD21 . ASN A 1 106 ? -5.488  16.013  -1.762  1.00 0.69 ? 106 ASN A HD21 4  
ATOM 7059  H HD22 . ASN A 1 106 ? -5.715  14.336  -2.119  1.00 0.55 ? 106 ASN A HD22 4  
ATOM 7060  N N    . TRP A 1 107 ? -0.528  13.715  -0.529  1.00 0.46 ? 107 TRP A N    4  
ATOM 7061  C CA   . TRP A 1 107 ? 0.031   12.586  0.230   1.00 0.48 ? 107 TRP A CA   4  
ATOM 7062  C C    . TRP A 1 107 ? -1.052  11.664  0.796   1.00 0.45 ? 107 TRP A C    4  
ATOM 7063  O O    . TRP A 1 107 ? -0.905  10.441  0.780   1.00 0.45 ? 107 TRP A O    4  
ATOM 7064  C CB   . TRP A 1 107 ? 0.996   13.043  1.328   1.00 0.54 ? 107 TRP A CB   4  
ATOM 7065  C CG   . TRP A 1 107 ? 2.442   12.824  0.998   1.00 0.72 ? 107 TRP A CG   4  
ATOM 7066  C CD1  . TRP A 1 107 ? 3.413   13.776  0.904   1.00 1.02 ? 107 TRP A CD1  4  
ATOM 7067  C CD2  . TRP A 1 107 ? 3.079   11.572  0.721   1.00 0.84 ? 107 TRP A CD2  4  
ATOM 7068  N NE1  . TRP A 1 107 ? 4.618   13.197  0.587   1.00 1.24 ? 107 TRP A NE1  4  
ATOM 7069  C CE2  . TRP A 1 107 ? 4.439   11.841  0.468   1.00 1.15 ? 107 TRP A CE2  4  
ATOM 7070  C CE3  . TRP A 1 107 ? 2.632   10.249  0.662   1.00 0.91 ? 107 TRP A CE3  4  
ATOM 7071  C CZ2  . TRP A 1 107 ? 5.354   10.835  0.163   1.00 1.42 ? 107 TRP A CZ2  4  
ATOM 7072  C CZ3  . TRP A 1 107 ? 3.542   9.254   0.358   1.00 1.24 ? 107 TRP A CZ3  4  
ATOM 7073  C CH2  . TRP A 1 107 ? 4.885   9.551   0.113   1.00 1.46 ? 107 TRP A CH2  4  
ATOM 7074  H H    . TRP A 1 107 ? -0.442  13.714  -1.502  1.00 0.45 ? 107 TRP A H    4  
ATOM 7075  H HE1  . TRP A 1 107 ? 5.467   13.676  0.464   1.00 1.49 ? 107 TRP A HE1  4  
ATOM 7076  N N    . GLY A 1 108 ? -2.136  12.255  1.288   1.00 0.46 ? 108 GLY A N    4  
ATOM 7077  C CA   . GLY A 1 108 ? -3.235  11.485  1.848   1.00 0.45 ? 108 GLY A CA   4  
ATOM 7078  C C    . GLY A 1 108 ? -3.820  10.496  0.859   1.00 0.41 ? 108 GLY A C    4  
ATOM 7079  O O    . GLY A 1 108 ? -4.278  9.421   1.242   1.00 0.41 ? 108 GLY A O    4  
ATOM 7080  H H    . GLY A 1 108 ? -2.185  13.236  1.282   1.00 0.47 ? 108 GLY A H    4  
ATOM 7081  N N    . ARG A 1 109 ? -3.776  10.848  -0.422  1.00 0.39 ? 109 ARG A N    4  
ATOM 7082  C CA   . ARG A 1 109 ? -4.302  9.981   -1.475  1.00 0.36 ? 109 ARG A CA   4  
ATOM 7083  C C    . ARG A 1 109 ? -3.493  8.688   -1.589  1.00 0.35 ? 109 ARG A C    4  
ATOM 7084  O O    . ARG A 1 109 ? -3.924  7.730   -2.233  1.00 0.35 ? 109 ARG A O    4  
ATOM 7085  C CB   . ARG A 1 109 ? -4.335  10.712  -2.824  1.00 0.36 ? 109 ARG A CB   4  
ATOM 7086  C CG   . ARG A 1 109 ? -2.998  10.758  -3.548  1.00 0.37 ? 109 ARG A CG   4  
ATOM 7087  C CD   . ARG A 1 109 ? -3.091  10.119  -4.928  1.00 0.36 ? 109 ARG A CD   4  
ATOM 7088  N NE   . ARG A 1 109 ? -3.684  8.780   -4.877  1.00 0.36 ? 109 ARG A NE   4  
ATOM 7089  C CZ   . ARG A 1 109 ? -4.132  8.120   -5.945  1.00 0.36 ? 109 ARG A CZ   4  
ATOM 7090  N NH1  . ARG A 1 109 ? -4.037  8.665   -7.153  1.00 0.35 ? 109 ARG A NH1  4  
ATOM 7091  N NH2  . ARG A 1 109 ? -4.691  6.924   -5.800  1.00 0.40 ? 109 ARG A NH2  4  
ATOM 7092  H H    . ARG A 1 109 ? -3.395  11.722  -0.663  1.00 0.39 ? 109 ARG A H    4  
ATOM 7093  H HE   . ARG A 1 109 ? -3.765  8.357   -3.988  1.00 0.38 ? 109 ARG A HE   4  
ATOM 7094  H HH11 . ARG A 1 109 ? -3.626  9.570   -7.262  1.00 0.35 ? 109 ARG A HH11 4  
ATOM 7095  H HH12 . ARG A 1 109 ? -4.382  8.175   -7.963  1.00 0.35 ? 109 ARG A HH12 4  
ATOM 7096  H HH21 . ARG A 1 109 ? -4.777  6.519   -4.888  1.00 0.43 ? 109 ARG A HH21 4  
ATOM 7097  H HH22 . ARG A 1 109 ? -5.030  6.425   -6.597  1.00 0.42 ? 109 ARG A HH22 4  
ATOM 7098  N N    . VAL A 1 110 ? -2.313  8.671   -0.978  1.00 0.37 ? 110 VAL A N    4  
ATOM 7099  C CA   . VAL A 1 110 ? -1.453  7.496   -1.007  1.00 0.38 ? 110 VAL A CA   4  
ATOM 7100  C C    . VAL A 1 110 ? -1.792  6.572   0.157   1.00 0.38 ? 110 VAL A C    4  
ATOM 7101  O O    . VAL A 1 110 ? -2.007  5.376   -0.032  1.00 0.37 ? 110 VAL A O    4  
ATOM 7102  C CB   . VAL A 1 110 ? 0.043   7.876   -0.960  1.00 0.44 ? 110 VAL A CB   4  
ATOM 7103  C CG1  . VAL A 1 110 ? 0.925   6.640   -1.087  1.00 0.47 ? 110 VAL A CG1  4  
ATOM 7104  C CG2  . VAL A 1 110 ? 0.373   8.882   -2.052  1.00 0.46 ? 110 VAL A CG2  4  
ATOM 7105  H H    . VAL A 1 110 ? -2.017  9.467   -0.482  1.00 0.38 ? 110 VAL A H    4  
ATOM 7106  N N    . VAL A 1 111 ? -1.864  7.138   1.363   1.00 0.40 ? 111 VAL A N    4  
ATOM 7107  C CA   . VAL A 1 111 ? -2.190  6.355   2.551   1.00 0.41 ? 111 VAL A CA   4  
ATOM 7108  C C    . VAL A 1 111 ? -3.621  5.819   2.468   1.00 0.39 ? 111 VAL A C    4  
ATOM 7109  O O    . VAL A 1 111 ? -3.906  4.710   2.921   1.00 0.39 ? 111 VAL A O    4  
ATOM 7110  C CB   . VAL A 1 111 ? -1.961  7.144   3.866   1.00 0.46 ? 111 VAL A CB   4  
ATOM 7111  C CG1  . VAL A 1 111 ? -2.827  8.394   3.932   1.00 0.45 ? 111 VAL A CG1  4  
ATOM 7112  C CG2  . VAL A 1 111 ? -2.183  6.262   5.086   1.00 0.50 ? 111 VAL A CG2  4  
ATOM 7113  H H    . VAL A 1 111 ? -1.692  8.099   1.453   1.00 0.41 ? 111 VAL A H    4  
ATOM 7114  N N    . ALA A 1 112 ? -4.508  6.599   1.858   1.00 0.37 ? 112 ALA A N    4  
ATOM 7115  C CA   . ALA A 1 112 ? -5.896  6.193   1.691   1.00 0.36 ? 112 ALA A CA   4  
ATOM 7116  C C    . ALA A 1 112 ? -5.971  4.980   0.772   1.00 0.34 ? 112 ALA A C    4  
ATOM 7117  O O    . ALA A 1 112 ? -6.778  4.074   0.979   1.00 0.34 ? 112 ALA A O    4  
ATOM 7118  C CB   . ALA A 1 112 ? -6.728  7.338   1.131   1.00 0.36 ? 112 ALA A CB   4  
ATOM 7119  H H    . ALA A 1 112 ? -4.224  7.478   1.523   1.00 0.37 ? 112 ALA A H    4  
ATOM 7120  N N    . LEU A 1 113 ? -5.101  4.967   -0.232  1.00 0.34 ? 113 LEU A N    4  
ATOM 7121  C CA   . LEU A 1 113 ? -5.045  3.869   -1.183  1.00 0.33 ? 113 LEU A CA   4  
ATOM 7122  C C    . LEU A 1 113 ? -4.584  2.593   -0.485  1.00 0.33 ? 113 LEU A C    4  
ATOM 7123  O O    . LEU A 1 113 ? -5.074  1.504   -0.773  1.00 0.33 ? 113 LEU A O    4  
ATOM 7124  C CB   . LEU A 1 113 ? -4.108  4.214   -2.344  1.00 0.34 ? 113 LEU A CB   4  
ATOM 7125  C CG   . LEU A 1 113 ? -4.109  3.243   -3.526  1.00 0.35 ? 113 LEU A CG   4  
ATOM 7126  C CD1  . LEU A 1 113 ? -5.466  3.231   -4.214  1.00 0.35 ? 113 LEU A CD1  4  
ATOM 7127  C CD2  . LEU A 1 113 ? -3.008  3.599   -4.513  1.00 0.36 ? 113 LEU A CD2  4  
ATOM 7128  H H    . LEU A 1 113 ? -4.480  5.720   -0.334  1.00 0.35 ? 113 LEU A H    4  
ATOM 7129  N N    . PHE A 1 114 ? -3.645  2.746   0.447   1.00 0.34 ? 114 PHE A N    4  
ATOM 7130  C CA   . PHE A 1 114 ? -3.126  1.612   1.204   1.00 0.36 ? 114 PHE A CA   4  
ATOM 7131  C C    . PHE A 1 114 ? -4.222  0.996   2.065   1.00 0.35 ? 114 PHE A C    4  
ATOM 7132  O O    . PHE A 1 114 ? -4.326  -0.227  2.170   1.00 0.36 ? 114 PHE A O    4  
ATOM 7133  C CB   . PHE A 1 114 ? -1.940  2.031   2.079   1.00 0.38 ? 114 PHE A CB   4  
ATOM 7134  C CG   . PHE A 1 114 ? -0.641  2.154   1.333   1.00 0.42 ? 114 PHE A CG   4  
ATOM 7135  C CD1  . PHE A 1 114 ? -0.172  1.104   0.562   1.00 0.75 ? 114 PHE A CD1  4  
ATOM 7136  C CD2  . PHE A 1 114 ? 0.109   3.314   1.405   1.00 0.71 ? 114 PHE A CD2  4  
ATOM 7137  C CE1  . PHE A 1 114 ? 1.022   1.209   -0.124  1.00 0.98 ? 114 PHE A CE1  4  
ATOM 7138  C CE2  . PHE A 1 114 ? 1.305   3.426   0.722   1.00 0.89 ? 114 PHE A CE2  4  
ATOM 7139  C CZ   . PHE A 1 114 ? 1.761   2.372   -0.044  1.00 0.93 ? 114 PHE A CZ   4  
ATOM 7140  H H    . PHE A 1 114 ? -3.290  3.643   0.624   1.00 0.35 ? 114 PHE A H    4  
ATOM 7141  N N    . TYR A 1 115 ? -5.041  1.852   2.671   1.00 0.34 ? 115 TYR A N    4  
ATOM 7142  C CA   . TYR A 1 115 ? -6.140  1.398   3.515   1.00 0.34 ? 115 TYR A CA   4  
ATOM 7143  C C    . TYR A 1 115 ? -7.184  0.667   2.677   1.00 0.33 ? 115 TYR A C    4  
ATOM 7144  O O    . TYR A 1 115 ? -7.736  -0.349  3.097   1.00 0.33 ? 115 TYR A O    4  
ATOM 7145  C CB   . TYR A 1 115 ? -6.781  2.582   4.249   1.00 0.35 ? 115 TYR A CB   4  
ATOM 7146  C CG   . TYR A 1 115 ? -8.010  2.219   5.060   1.00 0.35 ? 115 TYR A CG   4  
ATOM 7147  C CD1  . TYR A 1 115 ? -7.894  1.603   6.298   1.00 0.37 ? 115 TYR A CD1  4  
ATOM 7148  C CD2  . TYR A 1 115 ? -9.287  2.495   4.584   1.00 0.35 ? 115 TYR A CD2  4  
ATOM 7149  C CE1  . TYR A 1 115 ? -9.014  1.271   7.037   1.00 0.39 ? 115 TYR A CE1  4  
ATOM 7150  C CE2  . TYR A 1 115 ? -10.412 2.167   5.317   1.00 0.37 ? 115 TYR A CE2  4  
ATOM 7151  C CZ   . TYR A 1 115 ? -10.270 1.556   6.544   1.00 0.39 ? 115 TYR A CZ   4  
ATOM 7152  O OH   . TYR A 1 115 ? -11.388 1.225   7.277   1.00 0.42 ? 115 TYR A OH   4  
ATOM 7153  H H    . TYR A 1 115 ? -4.902  2.815   2.546   1.00 0.34 ? 115 TYR A H    4  
ATOM 7154  H HH   . TYR A 1 115 ? -11.455 1.814   8.045   1.00 0.43 ? 115 TYR A HH   4  
ATOM 7155  N N    . PHE A 1 116 ? -7.447  1.200   1.493   1.00 0.32 ? 116 PHE A N    4  
ATOM 7156  C CA   . PHE A 1 116 ? -8.415  0.604   0.582   1.00 0.32 ? 116 PHE A CA   4  
ATOM 7157  C C    . PHE A 1 116 ? -7.915  -0.749  0.079   1.00 0.31 ? 116 PHE A C    4  
ATOM 7158  O O    . PHE A 1 116 ? -8.662  -1.729  0.055   1.00 0.31 ? 116 PHE A O    4  
ATOM 7159  C CB   . PHE A 1 116 ? -8.676  1.544   -0.598  1.00 0.32 ? 116 PHE A CB   4  
ATOM 7160  C CG   . PHE A 1 116 ? -9.877  1.173   -1.426  1.00 0.34 ? 116 PHE A CG   4  
ATOM 7161  C CD1  . PHE A 1 116 ? -11.156 1.280   -0.903  1.00 0.38 ? 116 PHE A CD1  4  
ATOM 7162  C CD2  . PHE A 1 116 ? -9.726  0.719   -2.728  1.00 0.34 ? 116 PHE A CD2  4  
ATOM 7163  C CE1  . PHE A 1 116 ? -12.258 0.940   -1.661  1.00 0.41 ? 116 PHE A CE1  4  
ATOM 7164  C CE2  . PHE A 1 116 ? -10.825 0.378   -3.491  1.00 0.37 ? 116 PHE A CE2  4  
ATOM 7165  C CZ   . PHE A 1 116 ? -12.094 0.489   -2.956  1.00 0.40 ? 116 PHE A CZ   4  
ATOM 7166  H H    . PHE A 1 116 ? -6.984  2.023   1.226   1.00 0.33 ? 116 PHE A H    4  
ATOM 7167  N N    . ALA A 1 117 ? -6.642  -0.795  -0.300  1.00 0.32 ? 117 ALA A N    4  
ATOM 7168  C CA   . ALA A 1 117 ? -6.029  -2.017  -0.802  1.00 0.32 ? 117 ALA A CA   4  
ATOM 7169  C C    . ALA A 1 117 ? -6.021  -3.120  0.254   1.00 0.33 ? 117 ALA A C    4  
ATOM 7170  O O    . ALA A 1 117 ? -6.386  -4.262  -0.031  1.00 0.33 ? 117 ALA A O    4  
ATOM 7171  C CB   . ALA A 1 117 ? -4.617  -1.738  -1.292  1.00 0.34 ? 117 ALA A CB   4  
ATOM 7172  H H    . ALA A 1 117 ? -6.098  0.023   -0.247  1.00 0.32 ? 117 ALA A H    4  
ATOM 7173  N N    . SER A 1 118 ? -5.622  -2.776  1.474   1.00 0.34 ? 118 SER A N    4  
ATOM 7174  C CA   . SER A 1 118 ? -5.568  -3.749  2.558   1.00 0.35 ? 118 SER A CA   4  
ATOM 7175  C C    . SER A 1 118 ? -6.949  -4.315  2.869   1.00 0.35 ? 118 SER A C    4  
ATOM 7176  O O    . SER A 1 118 ? -7.091  -5.509  3.140   1.00 0.35 ? 118 SER A O    4  
ATOM 7177  C CB   . SER A 1 118 ? -4.926  -3.151  3.809   1.00 0.37 ? 118 SER A CB   4  
ATOM 7178  O OG   . SER A 1 118 ? -5.375  -1.827  4.032   1.00 0.38 ? 118 SER A OG   4  
ATOM 7179  H H    . SER A 1 118 ? -5.362  -1.847  1.648   1.00 0.34 ? 118 SER A H    4  
ATOM 7180  H HG   . SER A 1 118 ? -4.873  -1.219  3.474   1.00 0.38 ? 118 SER A HG   4  
ATOM 7181  N N    . LYS A 1 119 ? -7.964  -3.458  2.814   1.00 0.34 ? 119 LYS A N    4  
ATOM 7182  C CA   . LYS A 1 119 ? -9.333  -3.884  3.074   1.00 0.35 ? 119 LYS A CA   4  
ATOM 7183  C C    . LYS A 1 119 ? -9.773  -4.908  2.035   1.00 0.34 ? 119 LYS A C    4  
ATOM 7184  O O    . LYS A 1 119 ? -10.447 -5.887  2.361   1.00 0.35 ? 119 LYS A O    4  
ATOM 7185  C CB   . LYS A 1 119 ? -10.289 -2.688  3.090   1.00 0.37 ? 119 LYS A CB   4  
ATOM 7186  C CG   . LYS A 1 119 ? -11.098 -2.561  4.376   1.00 0.40 ? 119 LYS A CG   4  
ATOM 7187  C CD   . LYS A 1 119 ? -10.205 -2.232  5.564   1.00 0.45 ? 119 LYS A CD   4  
ATOM 7188  C CE   . LYS A 1 119 ? -10.933 -2.415  6.890   1.00 0.62 ? 119 LYS A CE   4  
ATOM 7189  N NZ   . LYS A 1 119 ? -12.027 -1.423  7.087   1.00 0.44 ? 119 LYS A NZ   4  
ATOM 7190  H H    . LYS A 1 119 ? -7.785  -2.516  2.602   1.00 0.35 ? 119 LYS A H    4  
ATOM 7191  H HZ1  . LYS A 1 119 ? -12.779 -1.566  6.383   1.00 0.62 ? 119 LYS A HZ1  4  
ATOM 7192  H HZ2  . LYS A 1 119 ? -11.658 -0.455  6.994   1.00 0.46 ? 119 LYS A HZ2  4  
ATOM 7193  H HZ3  . LYS A 1 119 ? -12.439 -1.529  8.045   1.00 0.59 ? 119 LYS A HZ3  4  
ATOM 7194  N N    . LEU A 1 120 ? -9.371  -4.681  0.787   1.00 0.32 ? 120 LEU A N    4  
ATOM 7195  C CA   . LEU A 1 120 ? -9.700  -5.590  -0.303  1.00 0.32 ? 120 LEU A CA   4  
ATOM 7196  C C    . LEU A 1 120 ? -8.955  -6.909  -0.126  1.00 0.32 ? 120 LEU A C    4  
ATOM 7197  O O    . LEU A 1 120 ? -9.520  -7.987  -0.316  1.00 0.33 ? 120 LEU A O    4  
ATOM 7198  C CB   . LEU A 1 120 ? -9.341  -4.968  -1.657  1.00 0.32 ? 120 LEU A CB   4  
ATOM 7199  C CG   . LEU A 1 120 ? -10.099 -3.694  -2.047  1.00 0.32 ? 120 LEU A CG   4  
ATOM 7200  C CD1  . LEU A 1 120 ? -9.578  -3.142  -3.366  1.00 0.34 ? 120 LEU A CD1  4  
ATOM 7201  C CD2  . LEU A 1 120 ? -11.595 -3.960  -2.131  1.00 0.33 ? 120 LEU A CD2  4  
ATOM 7202  H H    . LEU A 1 120 ? -8.843  -3.876  0.593   1.00 0.32 ? 120 LEU A H    4  
ATOM 7203  N N    . VAL A 1 121 ? -7.684  -6.809  0.255   1.00 0.33 ? 121 VAL A N    4  
ATOM 7204  C CA   . VAL A 1 121 ? -6.847  -7.984  0.479   1.00 0.34 ? 121 VAL A CA   4  
ATOM 7205  C C    . VAL A 1 121 ? -7.428  -8.850  1.592   1.00 0.36 ? 121 VAL A C    4  
ATOM 7206  O O    . VAL A 1 121 ? -7.550  -10.063 1.445   1.00 0.37 ? 121 VAL A O    4  
ATOM 7207  C CB   . VAL A 1 121 ? -5.391  -7.593  0.817   1.00 0.36 ? 121 VAL A CB   4  
ATOM 7208  C CG1  . VAL A 1 121 ? -4.596  -8.804  1.282   1.00 0.36 ? 121 VAL A CG1  4  
ATOM 7209  C CG2  . VAL A 1 121 ? -4.721  -6.962  -0.393  1.00 0.37 ? 121 VAL A CG2  4  
ATOM 7210  H H    . VAL A 1 121 ? -7.296  -5.915  0.384   1.00 0.33 ? 121 VAL A H    4  
ATOM 7211  N N    . LEU A 1 122 ? -7.810  -8.215  2.694   1.00 0.37 ? 122 LEU A N    4  
ATOM 7212  C CA   . LEU A 1 122 ? -8.390  -8.929  3.827   1.00 0.40 ? 122 LEU A CA   4  
ATOM 7213  C C    . LEU A 1 122 ? -9.704  -9.600  3.433   1.00 0.39 ? 122 LEU A C    4  
ATOM 7214  O O    . LEU A 1 122 ? -10.033 -10.681 3.926   1.00 0.40 ? 122 LEU A O    4  
ATOM 7215  C CB   . LEU A 1 122 ? -8.599  -7.989  5.017   1.00 0.44 ? 122 LEU A CB   4  
ATOM 7216  C CG   . LEU A 1 122 ? -7.547  -8.055  6.132   1.00 0.85 ? 122 LEU A CG   4  
ATOM 7217  C CD1  . LEU A 1 122 ? -6.162  -7.694  5.611   1.00 1.31 ? 122 LEU A CD1  4  
ATOM 7218  C CD2  . LEU A 1 122 ? -7.937  -7.154  7.293   1.00 0.88 ? 122 LEU A CD2  4  
ATOM 7219  H H    . LEU A 1 122 ? -7.697  -7.239  2.750   1.00 0.37 ? 122 LEU A H    4  
ATOM 7220  N N    . LYS A 1 123 ? -10.444 -8.959  2.534   1.00 0.37 ? 123 LYS A N    4  
ATOM 7221  C CA   . LYS A 1 123 ? -11.712 -9.496  2.062   1.00 0.38 ? 123 LYS A CA   4  
ATOM 7222  C C    . LYS A 1 123 ? -11.468 -10.751 1.228   1.00 0.38 ? 123 LYS A C    4  
ATOM 7223  O O    . LYS A 1 123 ? -12.140 -11.770 1.399   1.00 0.40 ? 123 LYS A O    4  
ATOM 7224  C CB   . LYS A 1 123 ? -12.452 -8.438  1.231   1.00 0.40 ? 123 LYS A CB   4  
ATOM 7225  C CG   . LYS A 1 123 ? -13.911 -8.761  0.939   1.00 0.53 ? 123 LYS A CG   4  
ATOM 7226  C CD   . LYS A 1 123 ? -14.578 -7.628  0.166   1.00 0.61 ? 123 LYS A CD   4  
ATOM 7227  C CE   . LYS A 1 123 ? -16.092 -7.789  0.128   1.00 0.89 ? 123 LYS A CE   4  
ATOM 7228  N NZ   . LYS A 1 123 ? -16.523 -8.809  -0.863  1.00 1.13 ? 123 LYS A NZ   4  
ATOM 7229  H H    . LYS A 1 123 ? -10.125 -8.100  2.177   1.00 0.38 ? 123 LYS A H    4  
ATOM 7230  H HZ1  . LYS A 1 123 ? -17.527 -9.039  -0.720  1.00 1.50 ? 123 LYS A HZ1  4  
ATOM 7231  H HZ2  . LYS A 1 123 ? -15.964 -9.679  -0.753  1.00 1.50 ? 123 LYS A HZ2  4  
ATOM 7232  H HZ3  . LYS A 1 123 ? -16.398 -8.443  -1.829  1.00 1.55 ? 123 LYS A HZ3  4  
ATOM 7233  N N    . ALA A 1 124 ? -10.481 -10.675 0.343   1.00 0.37 ? 124 ALA A N    4  
ATOM 7234  C CA   . ALA A 1 124 ? -10.133 -11.796 -0.521  1.00 0.39 ? 124 ALA A CA   4  
ATOM 7235  C C    . ALA A 1 124 ? -9.456  -12.911 0.273   1.00 0.40 ? 124 ALA A C    4  
ATOM 7236  O O    . ALA A 1 124 ? -9.580  -14.090 -0.060  1.00 0.42 ? 124 ALA A O    4  
ATOM 7237  C CB   . ALA A 1 124 ? -9.239  -11.320 -1.655  1.00 0.40 ? 124 ALA A CB   4  
ATOM 7238  H H    . ALA A 1 124 ? -9.969  -9.838  0.268   1.00 0.36 ? 124 ALA A H    4  
ATOM 7239  N N    . LEU A 1 125 ? -8.748  -12.530 1.328   1.00 0.40 ? 125 LEU A N    4  
ATOM 7240  C CA   . LEU A 1 125 ? -8.059  -13.490 2.183   1.00 0.42 ? 125 LEU A CA   4  
ATOM 7241  C C    . LEU A 1 125 ? -9.063  -14.443 2.822   1.00 0.44 ? 125 LEU A C    4  
ATOM 7242  O O    . LEU A 1 125 ? -8.834  -15.651 2.893   1.00 0.47 ? 125 LEU A O    4  
ATOM 7243  C CB   . LEU A 1 125 ? -7.255  -12.764 3.267   1.00 0.43 ? 125 LEU A CB   4  
ATOM 7244  C CG   . LEU A 1 125 ? -6.372  -13.638 4.160   1.00 0.47 ? 125 LEU A CG   4  
ATOM 7245  C CD1  . LEU A 1 125 ? -5.222  -14.235 3.361   1.00 0.51 ? 125 LEU A CD1  4  
ATOM 7246  C CD2  . LEU A 1 125 ? -5.851  -12.838 5.346   1.00 0.50 ? 125 LEU A CD2  4  
ATOM 7247  H H    . LEU A 1 125 ? -8.673  -11.569 1.530   1.00 0.39 ? 125 LEU A H    4  
ATOM 7248  N N    . CYS A 1 126 ? -10.193 -13.890 3.254   1.00 0.44 ? 126 CYS A N    4  
ATOM 7249  C CA   . CYS A 1 126 ? -11.248 -14.683 3.874   1.00 0.47 ? 126 CYS A CA   4  
ATOM 7250  C C    . CYS A 1 126 ? -11.883 -15.626 2.854   1.00 0.49 ? 126 CYS A C    4  
ATOM 7251  O O    . CYS A 1 126 ? -12.520 -16.619 3.217   1.00 0.57 ? 126 CYS A O    4  
ATOM 7252  C CB   . CYS A 1 126 ? -12.312 -13.769 4.487   1.00 0.49 ? 126 CYS A CB   4  
ATOM 7253  S SG   . CYS A 1 126 ? -11.661 -12.550 5.654   1.00 0.53 ? 126 CYS A SG   4  
ATOM 7254  H H    . CYS A 1 126 ? -10.317 -12.922 3.158   1.00 0.44 ? 126 CYS A H    4  
ATOM 7255  H HG   . CYS A 1 126 ? -10.987 -11.637 4.962   1.00 0.48 ? 126 CYS A HG   4  
ATOM 7256  N N    . THR A 1 127 ? -11.694 -15.313 1.578   1.00 0.46 ? 127 THR A N    4  
ATOM 7257  C CA   . THR A 1 127 ? -12.229 -16.121 0.494   1.00 0.48 ? 127 THR A CA   4  
ATOM 7258  C C    . THR A 1 127 ? -11.277 -17.279 0.177   1.00 0.49 ? 127 THR A C    4  
ATOM 7259  O O    . THR A 1 127 ? -11.583 -18.141 -0.646  1.00 0.55 ? 127 THR A O    4  
ATOM 7260  C CB   . THR A 1 127 ? -12.446 -15.261 -0.768  1.00 0.49 ? 127 THR A CB   4  
ATOM 7261  O OG1  . THR A 1 127 ? -12.929 -13.969 -0.372  1.00 0.53 ? 127 THR A OG1  4  
ATOM 7262  C CG2  . THR A 1 127 ? -13.468 -15.904 -1.692  1.00 0.56 ? 127 THR A CG2  4  
ATOM 7263  H H    . THR A 1 127 ? -11.173 -14.512 1.356   1.00 0.45 ? 127 THR A H    4  
ATOM 7264  H HG1  . THR A 1 127 ? -13.140 -13.984 0.571   1.00 0.87 ? 127 THR A HG1  4  
ATOM 7265  N N    . LYS A 1 128 ? -10.123 -17.287 0.849   1.00 0.47 ? 128 LYS A N    4  
ATOM 7266  C CA   . LYS A 1 128 ? -9.112  -18.333 0.675   1.00 0.50 ? 128 LYS A CA   4  
ATOM 7267  C C    . LYS A 1 128 ? -8.570  -18.387 -0.753  1.00 0.46 ? 128 LYS A C    4  
ATOM 7268  O O    . LYS A 1 128 ? -8.583  -19.440 -1.398  1.00 0.54 ? 128 LYS A O    4  
ATOM 7269  C CB   . LYS A 1 128 ? -9.646  -19.708 1.093   1.00 0.60 ? 128 LYS A CB   4  
ATOM 7270  C CG   . LYS A 1 128 ? -10.210 -19.769 2.502   1.00 0.67 ? 128 LYS A CG   4  
ATOM 7271  C CD   . LYS A 1 128 ? -10.755 -21.155 2.802   1.00 0.98 ? 128 LYS A CD   4  
ATOM 7272  C CE   . LYS A 1 128 ? -11.599 -21.164 4.064   1.00 1.15 ? 128 LYS A CE   4  
ATOM 7273  N NZ   . LYS A 1 128 ? -12.157 -22.512 4.343   1.00 1.40 ? 128 LYS A NZ   4  
ATOM 7274  H H    . LYS A 1 128 ? -9.945  -16.561 1.490   1.00 0.46 ? 128 LYS A H    4  
ATOM 7275  H HZ1  . LYS A 1 128 ? -12.614 -22.894 3.492   1.00 1.68 ? 128 LYS A HZ1  4  
ATOM 7276  H HZ2  . LYS A 1 128 ? -12.864 -22.458 5.105   1.00 1.63 ? 128 LYS A HZ2  4  
ATOM 7277  H HZ3  . LYS A 1 128 ? -11.398 -23.160 4.636   1.00 1.70 ? 128 LYS A HZ3  4  
ATOM 7278  N N    . VAL A 1 129 ? -8.097  -17.252 -1.245  1.00 0.42 ? 129 VAL A N    4  
ATOM 7279  C CA   . VAL A 1 129 ? -7.546  -17.184 -2.590  1.00 0.39 ? 129 VAL A CA   4  
ATOM 7280  C C    . VAL A 1 129 ? -6.256  -16.350 -2.630  1.00 0.35 ? 129 VAL A C    4  
ATOM 7281  O O    . VAL A 1 129 ? -6.281  -15.133 -2.824  1.00 0.34 ? 129 VAL A O    4  
ATOM 7282  C CB   . VAL A 1 129 ? -8.585  -16.706 -3.632  1.00 0.40 ? 129 VAL A CB   4  
ATOM 7283  C CG1  . VAL A 1 129 ? -9.220  -15.382 -3.232  1.00 0.39 ? 129 VAL A CG1  4  
ATOM 7284  C CG2  . VAL A 1 129 ? -7.982  -16.642 -5.026  1.00 0.40 ? 129 VAL A CG2  4  
ATOM 7285  H H    . VAL A 1 129 ? -8.123  -16.441 -0.695  1.00 0.46 ? 129 VAL A H    4  
ATOM 7286  N N    . PRO A 1 130 ? -5.106  -17.014 -2.425  1.00 0.37 ? 130 PRO A N    4  
ATOM 7287  C CA   . PRO A 1 130 ? -3.787  -16.361 -2.429  1.00 0.37 ? 130 PRO A CA   4  
ATOM 7288  C C    . PRO A 1 130 ? -3.452  -15.738 -3.783  1.00 0.33 ? 130 PRO A C    4  
ATOM 7289  O O    . PRO A 1 130 ? -2.799  -14.694 -3.849  1.00 0.32 ? 130 PRO A O    4  
ATOM 7290  C CB   . PRO A 1 130 ? -2.815  -17.503 -2.112  1.00 0.43 ? 130 PRO A CB   4  
ATOM 7291  C CG   . PRO A 1 130 ? -3.656  -18.568 -1.496  1.00 0.47 ? 130 PRO A CG   4  
ATOM 7292  C CD   . PRO A 1 130 ? -4.998  -18.456 -2.153  1.00 0.43 ? 130 PRO A CD   4  
ATOM 7293  N N    . GLU A 1 131 ? -3.911  -16.379 -4.856  1.00 0.34 ? 131 GLU A N    4  
ATOM 7294  C CA   . GLU A 1 131 ? -3.667  -15.895 -6.213  1.00 0.36 ? 131 GLU A CA   4  
ATOM 7295  C C    . GLU A 1 131 ? -4.176  -14.467 -6.366  1.00 0.32 ? 131 GLU A C    4  
ATOM 7296  O O    . GLU A 1 131 ? -3.460  -13.591 -6.854  1.00 0.34 ? 131 GLU A O    4  
ATOM 7297  C CB   . GLU A 1 131 ? -4.337  -16.815 -7.240  1.00 0.43 ? 131 GLU A CB   4  
ATOM 7298  C CG   . GLU A 1 131 ? -3.532  -17.033 -8.516  1.00 0.75 ? 131 GLU A CG   4  
ATOM 7299  C CD   . GLU A 1 131 ? -3.538  -15.833 -9.445  1.00 1.18 ? 131 GLU A CD   4  
ATOM 7300  O OE1  . GLU A 1 131 ? -4.611  -15.509 -10.002 1.00 1.55 ? 131 GLU A OE1  4  
ATOM 7301  O OE2  . GLU A 1 131 ? -2.469  -15.215 -9.631  1.00 1.54 ? 131 GLU A OE2  4  
ATOM 7302  H H    . GLU A 1 131 ? -4.414  -17.211 -4.731  1.00 0.37 ? 131 GLU A H    4  
ATOM 7303  N N    . LEU A 1 132 ? -5.404  -14.233 -5.915  1.00 0.32 ? 132 LEU A N    4  
ATOM 7304  C CA   . LEU A 1 132 ? -6.008  -12.911 -5.994  1.00 0.32 ? 132 LEU A CA   4  
ATOM 7305  C C    . LEU A 1 132 ? -5.209  -11.913 -5.165  1.00 0.31 ? 132 LEU A C    4  
ATOM 7306  O O    . LEU A 1 132 ? -5.027  -10.765 -5.566  1.00 0.34 ? 132 LEU A O    4  
ATOM 7307  C CB   . LEU A 1 132 ? -7.467  -12.951 -5.538  1.00 0.33 ? 132 LEU A CB   4  
ATOM 7308  C CG   . LEU A 1 132 ? -8.314  -11.716 -5.856  1.00 0.34 ? 132 LEU A CG   4  
ATOM 7309  C CD1  . LEU A 1 132 ? -8.264  -11.393 -7.343  1.00 0.36 ? 132 LEU A CD1  4  
ATOM 7310  C CD2  . LEU A 1 132 ? -9.752  -11.926 -5.403  1.00 0.36 ? 132 LEU A CD2  4  
ATOM 7311  H H    . LEU A 1 132 ? -5.916  -14.968 -5.519  1.00 0.34 ? 132 LEU A H    4  
ATOM 7312  N N    . ILE A 1 133 ? -4.711  -12.370 -4.020  1.00 0.31 ? 133 ILE A N    4  
ATOM 7313  C CA   . ILE A 1 133 ? -3.912  -11.528 -3.137  1.00 0.33 ? 133 ILE A CA   4  
ATOM 7314  C C    . ILE A 1 133 ? -2.661  -11.046 -3.866  1.00 0.34 ? 133 ILE A C    4  
ATOM 7315  O O    . ILE A 1 133 ? -2.298  -9.869  -3.800  1.00 0.38 ? 133 ILE A O    4  
ATOM 7316  C CB   . ILE A 1 133 ? -3.487  -12.287 -1.860  1.00 0.34 ? 133 ILE A CB   4  
ATOM 7317  C CG1  . ILE A 1 133 ? -4.710  -12.845 -1.125  1.00 0.36 ? 133 ILE A CG1  4  
ATOM 7318  C CG2  . ILE A 1 133 ? -2.665  -11.392 -0.940  1.00 0.38 ? 133 ILE A CG2  4  
ATOM 7319  C CD1  . ILE A 1 133 ? -5.725  -11.798 -0.726  1.00 0.39 ? 133 ILE A CD1  4  
ATOM 7320  H H    . ILE A 1 133 ? -4.887  -13.299 -3.762  1.00 0.31 ? 133 ILE A H    4  
ATOM 7321  N N    . ARG A 1 134 ? -2.010  -11.962 -4.574  1.00 0.32 ? 134 ARG A N    4  
ATOM 7322  C CA   . ARG A 1 134 ? -0.808  -11.622 -5.322  1.00 0.35 ? 134 ARG A CA   4  
ATOM 7323  C C    . ARG A 1 134 ? -1.167  -10.722 -6.501  1.00 0.37 ? 134 ARG A C    4  
ATOM 7324  O O    . ARG A 1 134 ? -0.430  -9.794  -6.833  1.00 0.40 ? 134 ARG A O    4  
ATOM 7325  C CB   . ARG A 1 134 ? -0.070  -12.877 -5.810  1.00 0.37 ? 134 ARG A CB   4  
ATOM 7326  C CG   . ARG A 1 134 ? 0.166   -13.942 -4.743  1.00 0.67 ? 134 ARG A CG   4  
ATOM 7327  C CD   . ARG A 1 134 ? 0.709   -13.356 -3.443  1.00 1.16 ? 134 ARG A CD   4  
ATOM 7328  N NE   . ARG A 1 134 ? 2.086   -12.879 -3.567  1.00 1.04 ? 134 ARG A NE   4  
ATOM 7329  C CZ   . ARG A 1 134 ? 2.511   -11.695 -3.130  1.00 1.20 ? 134 ARG A CZ   4  
ATOM 7330  N NH1  . ARG A 1 134 ? 1.662   -10.846 -2.562  1.00 1.47 ? 134 ARG A NH1  4  
ATOM 7331  N NH2  . ARG A 1 134 ? 3.785   -11.366 -3.262  1.00 1.35 ? 134 ARG A NH2  4  
ATOM 7332  H H    . ARG A 1 134 ? -2.349  -12.886 -4.594  1.00 0.32 ? 134 ARG A H    4  
ATOM 7333  H HE   . ARG A 1 134 ? 2.739   -13.485 -3.994  1.00 1.07 ? 134 ARG A HE   4  
ATOM 7334  H HH11 . ARG A 1 134 ? 0.698   -11.090 -2.460  1.00 1.53 ? 134 ARG A HH11 4  
ATOM 7335  H HH12 . ARG A 1 134 ? 1.987   -9.953  -2.239  1.00 1.73 ? 134 ARG A HH12 4  
ATOM 7336  H HH21 . ARG A 1 134 ? 4.431   -12.019 -3.694  1.00 1.37 ? 134 ARG A HH21 4  
ATOM 7337  H HH22 . ARG A 1 134 ? 4.116   -10.478 -2.941  1.00 1.59 ? 134 ARG A HH22 4  
ATOM 7338  N N    . THR A 1 135 ? -2.316  -10.992 -7.110  1.00 0.38 ? 135 THR A N    4  
ATOM 7339  C CA   . THR A 1 135 ? -2.785  -10.209 -8.247  1.00 0.42 ? 135 THR A CA   4  
ATOM 7340  C C    . THR A 1 135 ? -3.024  -8.752  -7.847  1.00 0.43 ? 135 THR A C    4  
ATOM 7341  O O    . THR A 1 135 ? -2.573  -7.833  -8.533  1.00 0.47 ? 135 THR A O    4  
ATOM 7342  C CB   . THR A 1 135 ? -4.079  -10.795 -8.843  1.00 0.45 ? 135 THR A CB   4  
ATOM 7343  O OG1  . THR A 1 135 ? -3.907  -12.198 -9.076  1.00 0.51 ? 135 THR A OG1  4  
ATOM 7344  C CG2  . THR A 1 135 ? -4.412  -10.118 -10.163 1.00 0.52 ? 135 THR A CG2  4  
ATOM 7345  H H    . THR A 1 135 ? -2.863  -11.741 -6.789  1.00 0.38 ? 135 THR A H    4  
ATOM 7346  H HG1  . THR A 1 135 ? -3.698  -12.646 -8.243  1.00 0.83 ? 135 THR A HG1  4  
ATOM 7347  N N    . ILE A 1 136 ? -3.725  -8.549  -6.729  1.00 0.42 ? 136 ILE A N    4  
ATOM 7348  C CA   . ILE A 1 136 ? -4.010  -7.202  -6.234  1.00 0.45 ? 136 ILE A CA   4  
ATOM 7349  C C    . ILE A 1 136 ? -2.708  -6.447  -5.997  1.00 0.46 ? 136 ILE A C    4  
ATOM 7350  O O    . ILE A 1 136 ? -2.584  -5.270  -6.346  1.00 0.49 ? 136 ILE A O    4  
ATOM 7351  C CB   . ILE A 1 136 ? -4.844  -7.230  -4.931  1.00 0.45 ? 136 ILE A CB   4  
ATOM 7352  C CG1  . ILE A 1 136 ? -6.211  -7.871  -5.189  1.00 0.44 ? 136 ILE A CG1  4  
ATOM 7353  C CG2  . ILE A 1 136 ? -5.014  -5.825  -4.360  1.00 0.49 ? 136 ILE A CG2  4  
ATOM 7354  C CD1  . ILE A 1 136 ? -7.011  -8.148  -3.931  1.00 0.46 ? 136 ILE A CD1  4  
ATOM 7355  H H    . ILE A 1 136 ? -4.065  -9.325  -6.227  1.00 0.40 ? 136 ILE A H    4  
ATOM 7356  N N    . MET A 1 137 ? -1.733  -7.141  -5.413  1.00 0.45 ? 137 MET A N    4  
ATOM 7357  C CA   . MET A 1 137 ? -0.429  -6.548  -5.147  1.00 0.47 ? 137 MET A CA   4  
ATOM 7358  C C    . MET A 1 137 ? 0.245   -6.150  -6.458  1.00 0.48 ? 137 MET A C    4  
ATOM 7359  O O    . MET A 1 137 ? 0.821   -5.068  -6.562  1.00 0.49 ? 137 MET A O    4  
ATOM 7360  C CB   . MET A 1 137 ? 0.462   -7.510  -4.357  1.00 0.48 ? 137 MET A CB   4  
ATOM 7361  C CG   . MET A 1 137 ? 1.783   -6.904  -3.913  1.00 0.46 ? 137 MET A CG   4  
ATOM 7362  S SD   . MET A 1 137 ? 2.794   -8.061  -2.971  1.00 0.49 ? 137 MET A SD   4  
ATOM 7363  C CE   . MET A 1 137 ? 4.218   -7.038  -2.606  1.00 0.57 ? 137 MET A CE   4  
ATOM 7364  H H    . MET A 1 137 ? -1.899  -8.073  -5.152  1.00 0.44 ? 137 MET A H    4  
ATOM 7365  N N    . GLY A 1 138 ? 0.143   -7.023  -7.459  1.00 0.49 ? 138 GLY A N    4  
ATOM 7366  C CA   . GLY A 1 138 ? 0.725   -6.741  -8.759  1.00 0.51 ? 138 GLY A CA   4  
ATOM 7367  C C    . GLY A 1 138 ? 0.107   -5.509  -9.385  1.00 0.52 ? 138 GLY A C    4  
ATOM 7368  O O    . GLY A 1 138 ? 0.801   -4.698  -9.994  1.00 0.53 ? 138 GLY A O    4  
ATOM 7369  H H    . GLY A 1 138 ? -0.336  -7.870  -7.311  1.00 0.50 ? 138 GLY A H    4  
ATOM 7370  N N    . TRP A 1 139 ? -1.204  -5.364  -9.215  1.00 0.53 ? 139 TRP A N    4  
ATOM 7371  C CA   . TRP A 1 139 ? -1.924  -4.214  -9.746  1.00 0.57 ? 139 TRP A CA   4  
ATOM 7372  C C    . TRP A 1 139 ? -1.484  -2.940  -9.035  1.00 0.53 ? 139 TRP A C    4  
ATOM 7373  O O    . TRP A 1 139 ? -1.394  -1.874  -9.645  1.00 0.54 ? 139 TRP A O    4  
ATOM 7374  C CB   . TRP A 1 139 ? -3.433  -4.400  -9.576  1.00 0.65 ? 139 TRP A CB   4  
ATOM 7375  C CG   . TRP A 1 139 ? -4.032  -5.431  -10.482 1.00 0.69 ? 139 TRP A CG   4  
ATOM 7376  C CD1  . TRP A 1 139 ? -3.526  -5.889  -11.665 1.00 0.72 ? 139 TRP A CD1  4  
ATOM 7377  C CD2  . TRP A 1 139 ? -5.266  -6.126  -10.277 1.00 0.78 ? 139 TRP A CD2  4  
ATOM 7378  N NE1  . TRP A 1 139 ? -4.370  -6.830  -12.203 1.00 0.81 ? 139 TRP A NE1  4  
ATOM 7379  C CE2  . TRP A 1 139 ? -5.443  -6.994  -11.370 1.00 0.84 ? 139 TRP A CE2  4  
ATOM 7380  C CE3  . TRP A 1 139 ? -6.232  -6.104  -9.269  1.00 0.84 ? 139 TRP A CE3  4  
ATOM 7381  C CZ2  . TRP A 1 139 ? -6.554  -7.824  -11.491 1.00 0.95 ? 139 TRP A CZ2  4  
ATOM 7382  C CZ3  . TRP A 1 139 ? -7.331  -6.928  -9.389  1.00 0.95 ? 139 TRP A CZ3  4  
ATOM 7383  C CH2  . TRP A 1 139 ? -7.482  -7.780  -10.489 1.00 1.00 ? 139 TRP A CH2  4  
ATOM 7384  H H    . TRP A 1 139 ? -1.702  -6.058  -8.726  1.00 0.55 ? 139 TRP A H    4  
ATOM 7385  H HE1  . TRP A 1 139 ? -4.222  -7.313  -13.047 1.00 0.86 ? 139 TRP A HE1  4  
ATOM 7386  N N    . THR A 1 140 ? -1.213  -3.068  -7.741  1.00 0.51 ? 140 THR A N    4  
ATOM 7387  C CA   . THR A 1 140 ? -0.766  -1.942  -6.936  1.00 0.51 ? 140 THR A CA   4  
ATOM 7388  C C    . THR A 1 140 ? 0.647   -1.533  -7.351  1.00 0.47 ? 140 THR A C    4  
ATOM 7389  O O    . THR A 1 140 ? 0.946   -0.347  -7.513  1.00 0.53 ? 140 THR A O    4  
ATOM 7390  C CB   . THR A 1 140 ? -0.782  -2.297  -5.435  1.00 0.53 ? 140 THR A CB   4  
ATOM 7391  O OG1  . THR A 1 140 ? -2.049  -2.879  -5.094  1.00 0.55 ? 140 THR A OG1  4  
ATOM 7392  C CG2  . THR A 1 140 ? -0.561  -1.051  -4.588  1.00 0.54 ? 140 THR A CG2  4  
ATOM 7393  H H    . THR A 1 140 ? -1.320  -3.947  -7.318  1.00 0.52 ? 140 THR A H    4  
ATOM 7394  H HG1  . THR A 1 140 ? -2.229  -3.629  -5.673  1.00 0.67 ? 140 THR A HG1  4  
ATOM 7395  N N    . LEU A 1 141 ? 1.505   -2.533  -7.539  1.00 0.41 ? 141 LEU A N    4  
ATOM 7396  C CA   . LEU A 1 141 ? 2.884   -2.301  -7.945  1.00 0.42 ? 141 LEU A CA   4  
ATOM 7397  C C    . LEU A 1 141 ? 2.936   -1.702  -9.346  1.00 0.42 ? 141 LEU A C    4  
ATOM 7398  O O    . LEU A 1 141 ? 3.839   -0.928  -9.666  1.00 0.41 ? 141 LEU A O    4  
ATOM 7399  C CB   . LEU A 1 141 ? 3.682   -3.608  -7.898  1.00 0.44 ? 141 LEU A CB   4  
ATOM 7400  C CG   . LEU A 1 141 ? 3.874   -4.239  -6.515  1.00 0.48 ? 141 LEU A CG   4  
ATOM 7401  C CD1  . LEU A 1 141 ? 4.490   -5.625  -6.637  1.00 0.55 ? 141 LEU A CD1  4  
ATOM 7402  C CD2  . LEU A 1 141 ? 4.728   -3.346  -5.629  1.00 0.53 ? 141 LEU A CD2  4  
ATOM 7403  H H    . LEU A 1 141 ? 1.200   -3.456  -7.394  1.00 0.40 ? 141 LEU A H    4  
ATOM 7404  N N    . ASP A 1 142 ? 1.954   -2.064  -10.166 1.00 0.51 ? 142 ASP A N    4  
ATOM 7405  C CA   . ASP A 1 142 ? 1.862   -1.569  -11.534 1.00 0.54 ? 142 ASP A CA   4  
ATOM 7406  C C    . ASP A 1 142 ? 1.798   -0.046  -11.557 1.00 0.51 ? 142 ASP A C    4  
ATOM 7407  O O    . ASP A 1 142 ? 2.701   0.615   -12.072 1.00 0.53 ? 142 ASP A O    4  
ATOM 7408  C CB   . ASP A 1 142 ? 0.637   -2.161  -12.237 1.00 0.62 ? 142 ASP A CB   4  
ATOM 7409  C CG   . ASP A 1 142 ? 0.471   -1.671  -13.663 1.00 0.82 ? 142 ASP A CG   4  
ATOM 7410  O OD1  . ASP A 1 142 ? 1.476   -1.620  -14.404 1.00 0.96 ? 142 ASP A OD1  4  
ATOM 7411  O OD2  . ASP A 1 142 ? -0.676  -1.341  -14.056 1.00 1.12 ? 142 ASP A OD2  4  
ATOM 7412  H H    . ASP A 1 142 ? 1.275   -2.692  -9.843  1.00 0.59 ? 142 ASP A H    4  
ATOM 7413  N N    . PHE A 1 143 ? 0.750   0.501   -10.946 1.00 0.52 ? 143 PHE A N    4  
ATOM 7414  C CA   . PHE A 1 143 ? 0.551   1.948   -10.892 1.00 0.54 ? 143 PHE A CA   4  
ATOM 7415  C C    . PHE A 1 143 ? 1.705   2.636   -10.162 1.00 0.48 ? 143 PHE A C    4  
ATOM 7416  O O    . PHE A 1 143 ? 2.025   3.798   -10.431 1.00 0.50 ? 143 PHE A O    4  
ATOM 7417  C CB   . PHE A 1 143 ? -0.783  2.277   -10.215 1.00 0.64 ? 143 PHE A CB   4  
ATOM 7418  C CG   . PHE A 1 143 ? -1.203  3.717   -10.335 1.00 0.66 ? 143 PHE A CG   4  
ATOM 7419  C CD1  . PHE A 1 143 ? -1.274  4.335   -11.574 1.00 0.70 ? 143 PHE A CD1  4  
ATOM 7420  C CD2  . PHE A 1 143 ? -1.528  4.454   -9.207  1.00 0.77 ? 143 PHE A CD2  4  
ATOM 7421  C CE1  . PHE A 1 143 ? -1.663  5.658   -11.685 1.00 0.81 ? 143 PHE A CE1  4  
ATOM 7422  C CE2  . PHE A 1 143 ? -1.918  5.775   -9.311  1.00 0.86 ? 143 PHE A CE2  4  
ATOM 7423  C CZ   . PHE A 1 143 ? -1.985  6.380   -10.552 1.00 0.86 ? 143 PHE A CZ   4  
ATOM 7424  H H    . PHE A 1 143 ? 0.090   -0.087  -10.518 1.00 0.56 ? 143 PHE A H    4  
ATOM 7425  N N    . LEU A 1 144 ? 2.334   1.902   -9.252  1.00 0.43 ? 144 LEU A N    4  
ATOM 7426  C CA   . LEU A 1 144 ? 3.455   2.423   -8.484  1.00 0.41 ? 144 LEU A CA   4  
ATOM 7427  C C    . LEU A 1 144 ? 4.608   2.824   -9.401  1.00 0.41 ? 144 LEU A C    4  
ATOM 7428  O O    . LEU A 1 144 ? 5.106   3.943   -9.330  1.00 0.43 ? 144 LEU A O    4  
ATOM 7429  C CB   . LEU A 1 144 ? 3.928   1.392   -7.458  1.00 0.41 ? 144 LEU A CB   4  
ATOM 7430  C CG   . LEU A 1 144 ? 5.026   1.845   -6.490  1.00 0.72 ? 144 LEU A CG   4  
ATOM 7431  C CD1  . LEU A 1 144 ? 4.460   2.778   -5.429  1.00 1.07 ? 144 LEU A CD1  4  
ATOM 7432  C CD2  . LEU A 1 144 ? 5.703   0.644   -5.848  1.00 1.34 ? 144 LEU A CD2  4  
ATOM 7433  H H    . LEU A 1 144 ? 2.035   0.981   -9.093  1.00 0.43 ? 144 LEU A H    4  
ATOM 7434  N N    . ARG A 1 145 ? 5.009   1.921   -10.285 1.00 0.42 ? 145 ARG A N    4  
ATOM 7435  C CA   . ARG A 1 145 ? 6.108   2.203   -11.200 1.00 0.46 ? 145 ARG A CA   4  
ATOM 7436  C C    . ARG A 1 145 ? 5.645   3.038   -12.393 1.00 0.46 ? 145 ARG A C    4  
ATOM 7437  O O    . ARG A 1 145 ? 6.464   3.595   -13.127 1.00 0.55 ? 145 ARG A O    4  
ATOM 7438  C CB   . ARG A 1 145 ? 6.791   0.912   -11.662 1.00 0.54 ? 145 ARG A CB   4  
ATOM 7439  C CG   . ARG A 1 145 ? 8.254   1.088   -12.041 1.00 0.66 ? 145 ARG A CG   4  
ATOM 7440  C CD   . ARG A 1 145 ? 8.938   -0.252  -12.251 1.00 1.01 ? 145 ARG A CD   4  
ATOM 7441  N NE   . ARG A 1 145 ? 10.393  -0.123  -12.359 1.00 1.10 ? 145 ARG A NE   4  
ATOM 7442  C CZ   . ARG A 1 145 ? 11.262  -0.926  -11.742 1.00 1.24 ? 145 ARG A CZ   4  
ATOM 7443  N NH1  . ARG A 1 145 ? 10.832  -1.881  -10.933 1.00 1.40 ? 145 ARG A NH1  4  
ATOM 7444  N NH2  . ARG A 1 145 ? 12.563  -0.763  -11.925 1.00 1.43 ? 145 ARG A NH2  4  
ATOM 7445  H H    . ARG A 1 145 ? 4.556   1.050   -10.329 1.00 0.42 ? 145 ARG A H    4  
ATOM 7446  H HE   . ARG A 1 145 ? 10.739  0.599   -12.934 1.00 1.24 ? 145 ARG A HE   4  
ATOM 7447  H HH11 . ARG A 1 145 ? 9.853   -2.009  -10.783 1.00 1.42 ? 145 ARG A HH11 4  
ATOM 7448  H HH12 . ARG A 1 145 ? 11.499  -2.474  -10.448 1.00 1.63 ? 145 ARG A HH12 4  
ATOM 7449  H HH21 . ARG A 1 145 ? 12.900  -0.031  -12.521 1.00 1.54 ? 145 ARG A HH21 4  
ATOM 7450  H HH22 . ARG A 1 145 ? 13.219  -1.385  -11.473 1.00 1.57 ? 145 ARG A HH22 4  
ATOM 7451  N N    . GLU A 1 146 ? 4.332   3.120   -12.588 1.00 0.50 ? 146 GLU A N    4  
ATOM 7452  C CA   . GLU A 1 146 ? 3.774   3.897   -13.690 1.00 0.55 ? 146 GLU A CA   4  
ATOM 7453  C C    . GLU A 1 146 ? 3.869   5.397   -13.417 1.00 0.56 ? 146 GLU A C    4  
ATOM 7454  O O    . GLU A 1 146 ? 4.205   6.174   -14.310 1.00 0.74 ? 146 GLU A O    4  
ATOM 7455  C CB   . GLU A 1 146 ? 2.312   3.517   -13.961 1.00 0.62 ? 146 GLU A CB   4  
ATOM 7456  C CG   . GLU A 1 146 ? 2.098   2.136   -14.568 1.00 0.89 ? 146 GLU A CG   4  
ATOM 7457  C CD   . GLU A 1 146 ? 2.555   2.030   -16.010 1.00 1.31 ? 146 GLU A CD   4  
ATOM 7458  O OE1  . GLU A 1 146 ? 3.743   2.300   -16.282 1.00 1.61 ? 146 GLU A OE1  4  
ATOM 7459  O OE2  . GLU A 1 146 ? 1.728   1.673   -16.880 1.00 1.82 ? 146 GLU A OE2  4  
ATOM 7460  H H    . GLU A 1 146 ? 3.726   2.631   -11.990 1.00 0.58 ? 146 GLU A H    4  
ATOM 7461  N N    . ARG A 1 147 ? 3.579   5.810   -12.184 1.00 0.51 ? 147 ARG A N    4  
ATOM 7462  C CA   . ARG A 1 147 ? 3.617   7.234   -11.849 1.00 0.57 ? 147 ARG A CA   4  
ATOM 7463  C C    . ARG A 1 147 ? 4.240   7.547   -10.491 1.00 0.51 ? 147 ARG A C    4  
ATOM 7464  O O    . ARG A 1 147 ? 4.974   8.524   -10.358 1.00 0.53 ? 147 ARG A O    4  
ATOM 7465  C CB   . ARG A 1 147 ? 2.211   7.846   -11.926 1.00 0.73 ? 147 ARG A CB   4  
ATOM 7466  C CG   . ARG A 1 147 ? 1.636   7.963   -13.333 1.00 0.88 ? 147 ARG A CG   4  
ATOM 7467  C CD   . ARG A 1 147 ? 2.258   9.118   -14.103 1.00 1.01 ? 147 ARG A CD   4  
ATOM 7468  N NE   . ARG A 1 147 ? 3.700   8.959   -14.263 1.00 1.03 ? 147 ARG A NE   4  
ATOM 7469  C CZ   . ARG A 1 147 ? 4.586   9.924   -14.030 1.00 1.32 ? 147 ARG A CZ   4  
ATOM 7470  N NH1  . ARG A 1 147 ? 4.174   11.143  -13.701 1.00 1.56 ? 147 ARG A NH1  4  
ATOM 7471  N NH2  . ARG A 1 147 ? 5.881   9.670   -14.144 1.00 1.59 ? 147 ARG A NH2  4  
ATOM 7472  H H    . ARG A 1 147 ? 3.337   5.151   -11.496 1.00 0.55 ? 147 ARG A H    4  
ATOM 7473  H HE   . ARG A 1 147 ? 4.027   8.068   -14.541 1.00 1.04 ? 147 ARG A HE   4  
ATOM 7474  H HH11 . ARG A 1 147 ? 3.193   11.343  -13.632 1.00 1.52 ? 147 ARG A HH11 4  
ATOM 7475  H HH12 . ARG A 1 147 ? 4.839   11.874  -13.526 1.00 1.88 ? 147 ARG A HH12 4  
ATOM 7476  H HH21 . ARG A 1 147 ? 6.194   8.753   -14.407 1.00 1.57 ? 147 ARG A HH21 4  
ATOM 7477  H HH22 . ARG A 1 147 ? 6.557   10.393  -13.970 1.00 1.91 ? 147 ARG A HH22 4  
ATOM 7478  N N    . LEU A 1 148 ? 3.948   6.729   -9.488  1.00 0.48 ? 148 LEU A N    4  
ATOM 7479  C CA   . LEU A 1 148 ? 4.455   6.967   -8.133  1.00 0.47 ? 148 LEU A CA   4  
ATOM 7480  C C    . LEU A 1 148 ? 5.981   7.014   -8.037  1.00 0.41 ? 148 LEU A C    4  
ATOM 7481  O O    . LEU A 1 148 ? 6.528   7.849   -7.315  1.00 0.44 ? 148 LEU A O    4  
ATOM 7482  C CB   . LEU A 1 148 ? 3.888   5.950   -7.137  1.00 0.50 ? 148 LEU A CB   4  
ATOM 7483  C CG   . LEU A 1 148 ? 2.506   6.258   -6.549  1.00 0.59 ? 148 LEU A CG   4  
ATOM 7484  C CD1  . LEU A 1 148 ? 2.465   7.657   -5.955  1.00 0.81 ? 148 LEU A CD1  4  
ATOM 7485  C CD2  . LEU A 1 148 ? 1.412   6.071   -7.587  1.00 0.74 ? 148 LEU A CD2  4  
ATOM 7486  H H    . LEU A 1 148 ? 3.382   5.947   -9.657  1.00 0.51 ? 148 LEU A H    4  
ATOM 7487  N N    . LEU A 1 149 ? 6.657   6.127   -8.761  1.00 0.37 ? 149 LEU A N    4  
ATOM 7488  C CA   . LEU A 1 149 ? 8.120   6.051   -8.739  1.00 0.35 ? 149 LEU A CA   4  
ATOM 7489  C C    . LEU A 1 149 ? 8.786   7.405   -8.975  1.00 0.38 ? 149 LEU A C    4  
ATOM 7490  O O    . LEU A 1 149 ? 9.696   7.793   -8.238  1.00 0.39 ? 149 LEU A O    4  
ATOM 7491  C CB   . LEU A 1 149 ? 8.630   5.025   -9.755  1.00 0.39 ? 149 LEU A CB   4  
ATOM 7492  C CG   . LEU A 1 149 ? 10.124  4.696   -9.686  1.00 0.46 ? 149 LEU A CG   4  
ATOM 7493  C CD1  . LEU A 1 149 ? 10.461  3.993   -8.379  1.00 0.52 ? 149 LEU A CD1  4  
ATOM 7494  C CD2  . LEU A 1 149 ? 10.545  3.849   -10.878 1.00 0.57 ? 149 LEU A CD2  4  
ATOM 7495  H H    . LEU A 1 149 ? 6.153   5.493   -9.321  1.00 0.37 ? 149 LEU A H    4  
ATOM 7496  N N    . GLY A 1 150 ? 8.322   8.125   -9.992  1.00 0.41 ? 150 GLY A N    4  
ATOM 7497  C CA   . GLY A 1 150 ? 8.884   9.424   -10.309 1.00 0.46 ? 150 GLY A CA   4  
ATOM 7498  C C    . GLY A 1 150 ? 8.789   10.403  -9.153  1.00 0.46 ? 150 GLY A C    4  
ATOM 7499  O O    . GLY A 1 150 ? 9.728   11.154  -8.886  1.00 0.52 ? 150 GLY A O    4  
ATOM 7500  H H    . GLY A 1 150 ? 7.590   7.764   -10.539 1.00 0.43 ? 150 GLY A H    4  
ATOM 7501  N N    . TRP A 1 151 ? 7.661   10.380  -8.456  1.00 0.43 ? 151 TRP A N    4  
ATOM 7502  C CA   . TRP A 1 151 ? 7.442   11.272  -7.325  1.00 0.45 ? 151 TRP A CA   4  
ATOM 7503  C C    . TRP A 1 151 ? 8.328   10.889  -6.142  1.00 0.42 ? 151 TRP A C    4  
ATOM 7504  O O    . TRP A 1 151 ? 8.881   11.757  -5.464  1.00 0.44 ? 151 TRP A O    4  
ATOM 7505  C CB   . TRP A 1 151 ? 5.965   11.272  -6.911  1.00 0.50 ? 151 TRP A CB   4  
ATOM 7506  C CG   . TRP A 1 151 ? 5.629   12.284  -5.856  1.00 0.52 ? 151 TRP A CG   4  
ATOM 7507  C CD1  . TRP A 1 151 ? 6.211   13.505  -5.671  1.00 0.61 ? 151 TRP A CD1  4  
ATOM 7508  C CD2  . TRP A 1 151 ? 4.626   12.161  -4.845  1.00 0.52 ? 151 TRP A CD2  4  
ATOM 7509  N NE1  . TRP A 1 151 ? 5.639   14.145  -4.602  1.00 0.63 ? 151 TRP A NE1  4  
ATOM 7510  C CE2  . TRP A 1 151 ? 4.661   13.342  -4.077  1.00 0.57 ? 151 TRP A CE2  4  
ATOM 7511  C CE3  . TRP A 1 151 ? 3.704   11.165  -4.513  1.00 0.59 ? 151 TRP A CE3  4  
ATOM 7512  C CZ2  . TRP A 1 151 ? 3.805   13.551  -2.999  1.00 0.63 ? 151 TRP A CZ2  4  
ATOM 7513  C CZ3  . TRP A 1 151 ? 2.857   11.377  -3.445  1.00 0.70 ? 151 TRP A CZ3  4  
ATOM 7514  C CH2  . TRP A 1 151 ? 2.913   12.560  -2.701  1.00 0.70 ? 151 TRP A CH2  4  
ATOM 7515  H H    . TRP A 1 151 ? 6.960   9.741   -8.706  1.00 0.43 ? 151 TRP A H    4  
ATOM 7516  H HE1  . TRP A 1 151 ? 5.893   15.038  -4.270  1.00 0.71 ? 151 TRP A HE1  4  
ATOM 7517  N N    . ILE A 1 152 ? 8.461   9.592   -5.896  1.00 0.40 ? 152 ILE A N    4  
ATOM 7518  C CA   . ILE A 1 152 ? 9.291   9.110   -4.795  1.00 0.40 ? 152 ILE A CA   4  
ATOM 7519  C C    . ILE A 1 152 ? 10.762  9.447   -5.046  1.00 0.40 ? 152 ILE A C    4  
ATOM 7520  O O    . ILE A 1 152 ? 11.517  9.744   -4.117  1.00 0.45 ? 152 ILE A O    4  
ATOM 7521  C CB   . ILE A 1 152 ? 9.128   7.591   -4.572  1.00 0.40 ? 152 ILE A CB   4  
ATOM 7522  C CG1  . ILE A 1 152 ? 7.645   7.214   -4.461  1.00 0.46 ? 152 ILE A CG1  4  
ATOM 7523  C CG2  . ILE A 1 152 ? 9.885   7.139   -3.331  1.00 0.42 ? 152 ILE A CG2  4  
ATOM 7524  C CD1  . ILE A 1 152 ? 6.902   7.913   -3.338  1.00 0.51 ? 152 ILE A CD1  4  
ATOM 7525  H H    . ILE A 1 152 ? 7.984   8.941   -6.463  1.00 0.41 ? 152 ILE A H    4  
ATOM 7526  N N    . GLN A 1 153 ? 11.166  9.408   -6.308  1.00 0.41 ? 153 GLN A N    4  
ATOM 7527  C CA   . GLN A 1 153 ? 12.537  9.726   -6.667  1.00 0.46 ? 153 GLN A CA   4  
ATOM 7528  C C    . GLN A 1 153 ? 12.784  11.224  -6.517  1.00 0.50 ? 153 GLN A C    4  
ATOM 7529  O O    . GLN A 1 153 ? 13.853  11.647  -6.081  1.00 0.56 ? 153 GLN A O    4  
ATOM 7530  C CB   . GLN A 1 153 ? 12.841  9.280   -8.099  1.00 0.52 ? 153 GLN A CB   4  
ATOM 7531  C CG   . GLN A 1 153 ? 14.319  9.044   -8.372  1.00 0.73 ? 153 GLN A CG   4  
ATOM 7532  C CD   . GLN A 1 153 ? 14.773  9.635   -9.690  1.00 0.99 ? 153 GLN A CD   4  
ATOM 7533  O OE1  . GLN A 1 153 ? 14.682  8.995   -10.737 1.00 1.17 ? 153 GLN A OE1  4  
ATOM 7534  N NE2  . GLN A 1 153 ? 15.269  10.863  -9.652  1.00 1.42 ? 153 GLN A NE2  4  
ATOM 7535  H H    . GLN A 1 153 ? 10.527  9.151   -7.012  1.00 0.41 ? 153 GLN A H    4  
ATOM 7536  H HE21 . GLN A 1 153 ? 15.311  11.321  -8.786  1.00 1.53 ? 153 GLN A HE21 4  
ATOM 7537  H HE22 . GLN A 1 153 ? 15.582  11.264  -10.493 1.00 1.74 ? 153 GLN A HE22 4  
ATOM 7538  N N    . ASP A 1 154 ? 11.775  12.019  -6.867  1.00 0.52 ? 154 ASP A N    4  
ATOM 7539  C CA   . ASP A 1 154 ? 11.863  13.473  -6.771  1.00 0.61 ? 154 ASP A CA   4  
ATOM 7540  C C    . ASP A 1 154 ? 12.040  13.928  -5.325  1.00 0.59 ? 154 ASP A C    4  
ATOM 7541  O O    . ASP A 1 154 ? 12.883  14.775  -5.029  1.00 0.65 ? 154 ASP A O    4  
ATOM 7542  C CB   . ASP A 1 154 ? 10.616  14.128  -7.370  1.00 0.72 ? 154 ASP A CB   4  
ATOM 7543  C CG   . ASP A 1 154 ? 10.502  15.596  -7.009  1.00 0.79 ? 154 ASP A CG   4  
ATOM 7544  O OD1  . ASP A 1 154 ? 11.321  16.396  -7.500  1.00 1.00 ? 154 ASP A OD1  4  
ATOM 7545  O OD2  . ASP A 1 154 ? 9.596   15.955  -6.228  1.00 1.08 ? 154 ASP A OD2  4  
ATOM 7546  H H    . ASP A 1 154 ? 10.948  11.615  -7.211  1.00 0.52 ? 154 ASP A H    4  
ATOM 7547  N N    . GLN A 1 155 ? 11.249  13.359  -4.424  1.00 0.54 ? 155 GLN A N    4  
ATOM 7548  C CA   . GLN A 1 155 ? 11.323  13.719  -3.009  1.00 0.56 ? 155 GLN A CA   4  
ATOM 7549  C C    . GLN A 1 155 ? 12.590  13.181  -2.350  1.00 0.54 ? 155 GLN A C    4  
ATOM 7550  O O    . GLN A 1 155 ? 12.973  13.626  -1.267  1.00 0.65 ? 155 GLN A O    4  
ATOM 7551  C CB   . GLN A 1 155 ? 10.073  13.262  -2.252  1.00 0.58 ? 155 GLN A CB   4  
ATOM 7552  C CG   . GLN A 1 155 ? 9.795   11.776  -2.341  1.00 0.52 ? 155 GLN A CG   4  
ATOM 7553  C CD   . GLN A 1 155 ? 8.474   11.393  -1.711  1.00 0.58 ? 155 GLN A CD   4  
ATOM 7554  O OE1  . GLN A 1 155 ? 8.409   11.067  -0.529  1.00 0.70 ? 155 GLN A OE1  4  
ATOM 7555  N NE2  . GLN A 1 155 ? 7.410   11.441  -2.496  1.00 0.56 ? 155 GLN A NE2  4  
ATOM 7556  H H    . GLN A 1 155 ? 10.594  12.686  -4.717  1.00 0.52 ? 155 GLN A H    4  
ATOM 7557  H HE21 . GLN A 1 155 ? 7.535   11.720  -3.429  1.00 0.53 ? 155 GLN A HE21 4  
ATOM 7558  H HE22 . GLN A 1 155 ? 6.544   11.195  -2.114  1.00 0.63 ? 155 GLN A HE22 4  
ATOM 7559  N N    . GLY A 1 156 ? 13.243  12.235  -3.011  1.00 0.51 ? 156 GLY A N    4  
ATOM 7560  C CA   . GLY A 1 156 ? 14.467  11.669  -2.479  1.00 0.53 ? 156 GLY A CA   4  
ATOM 7561  C C    . GLY A 1 156 ? 14.224  10.486  -1.565  1.00 0.51 ? 156 GLY A C    4  
ATOM 7562  O O    . GLY A 1 156 ? 14.767  10.424  -0.460  1.00 0.67 ? 156 GLY A O    4  
ATOM 7563  H H    . GLY A 1 156 ? 12.890  11.918  -3.867  1.00 0.56 ? 156 GLY A H    4  
ATOM 7564  N N    . GLY A 1 157 ? 13.400  9.554   -2.020  1.00 0.51 ? 157 GLY A N    4  
ATOM 7565  C CA   . GLY A 1 157 ? 13.107  8.374   -1.230  1.00 0.53 ? 157 GLY A CA   4  
ATOM 7566  C C    . GLY A 1 157 ? 11.801  8.498   -0.482  1.00 0.47 ? 157 GLY A C    4  
ATOM 7567  O O    . GLY A 1 157 ? 10.926  9.265   -0.875  1.00 0.49 ? 157 GLY A O    4  
ATOM 7568  H H    . GLY A 1 157 ? 12.967  9.675   -2.893  1.00 0.62 ? 157 GLY A H    4  
ATOM 7569  N N    . TRP A 1 158 ? 11.672  7.764   0.612   1.00 0.48 ? 158 TRP A N    4  
ATOM 7570  C CA   . TRP A 1 158 ? 10.455  7.792   1.411   1.00 0.45 ? 158 TRP A CA   4  
ATOM 7571  C C    . TRP A 1 158 ? 10.521  8.880   2.476   1.00 0.51 ? 158 TRP A C    4  
ATOM 7572  O O    . TRP A 1 158 ? 9.733   8.895   3.425   1.00 0.53 ? 158 TRP A O    4  
ATOM 7573  C CB   . TRP A 1 158 ? 10.189  6.423   2.041   1.00 0.48 ? 158 TRP A CB   4  
ATOM 7574  C CG   . TRP A 1 158 ? 9.934   5.350   1.028   1.00 0.48 ? 158 TRP A CG   4  
ATOM 7575  C CD1  . TRP A 1 158 ? 10.818  4.405   0.595   1.00 0.53 ? 158 TRP A CD1  4  
ATOM 7576  C CD2  . TRP A 1 158 ? 8.716   5.119   0.308   1.00 0.49 ? 158 TRP A CD2  4  
ATOM 7577  N NE1  . TRP A 1 158 ? 10.225  3.597   -0.344  1.00 0.57 ? 158 TRP A NE1  4  
ATOM 7578  C CE2  . TRP A 1 158 ? 8.934   4.014   -0.539  1.00 0.54 ? 158 TRP A CE2  4  
ATOM 7579  C CE3  . TRP A 1 158 ? 7.462   5.738   0.298   1.00 0.51 ? 158 TRP A CE3  4  
ATOM 7580  C CZ2  . TRP A 1 158 ? 7.944   3.516   -1.383  1.00 0.60 ? 158 TRP A CZ2  4  
ATOM 7581  C CZ3  . TRP A 1 158 ? 6.482   5.242   -0.542  1.00 0.56 ? 158 TRP A CZ3  4  
ATOM 7582  C CH2  . TRP A 1 158 ? 6.727   4.142   -1.372  1.00 0.60 ? 158 TRP A CH2  4  
ATOM 7583  H H    . TRP A 1 158 ? 12.419  7.192   0.894   1.00 0.54 ? 158 TRP A H    4  
ATOM 7584  H HE1  . TRP A 1 158 ? 10.657  2.845   -0.800  1.00 0.64 ? 158 TRP A HE1  4  
ATOM 7585  N N    . ASP A 1 159 ? 11.464  9.798   2.289   1.00 0.57 ? 159 ASP A N    4  
ATOM 7586  C CA   . ASP A 1 159 ? 11.675  10.913  3.209   1.00 0.65 ? 159 ASP A CA   4  
ATOM 7587  C C    . ASP A 1 159 ? 10.405  11.747  3.347   1.00 0.59 ? 159 ASP A C    4  
ATOM 7588  O O    . ASP A 1 159 ? 10.086  12.240  4.431   1.00 0.61 ? 159 ASP A O    4  
ATOM 7589  C CB   . ASP A 1 159 ? 12.831  11.790  2.714   1.00 0.77 ? 159 ASP A CB   4  
ATOM 7590  C CG   . ASP A 1 159 ? 13.251  12.855  3.711   1.00 0.97 ? 159 ASP A CG   4  
ATOM 7591  O OD1  . ASP A 1 159 ? 14.143  12.580  4.541   1.00 1.17 ? 159 ASP A OD1  4  
ATOM 7592  O OD2  . ASP A 1 159 ? 12.709  13.978  3.654   1.00 1.15 ? 159 ASP A OD2  4  
ATOM 7593  H H    . ASP A 1 159 ? 12.047  9.714   1.504   1.00 0.59 ? 159 ASP A H    4  
ATOM 7594  N N    . GLY A 1 160 ? 9.671   11.875  2.246   1.00 0.55 ? 160 GLY A N    4  
ATOM 7595  C CA   . GLY A 1 160 ? 8.440   12.640  2.256   1.00 0.52 ? 160 GLY A CA   4  
ATOM 7596  C C    . GLY A 1 160 ? 7.386   12.010  3.144   1.00 0.47 ? 160 GLY A C    4  
ATOM 7597  O O    . GLY A 1 160 ? 6.718   12.700  3.914   1.00 0.49 ? 160 GLY A O    4  
ATOM 7598  H H    . GLY A 1 160 ? 9.971   11.447  1.416   1.00 0.55 ? 160 GLY A H    4  
ATOM 7599  N N    . LEU A 1 161 ? 7.252   10.696  3.056   1.00 0.46 ? 161 LEU A N    4  
ATOM 7600  C CA   . LEU A 1 161 ? 6.274   9.975   3.859   1.00 0.47 ? 161 LEU A CA   4  
ATOM 7601  C C    . LEU A 1 161 ? 6.638   10.051  5.340   1.00 0.52 ? 161 LEU A C    4  
ATOM 7602  O O    . LEU A 1 161 ? 5.774   10.253  6.197   1.00 0.55 ? 161 LEU A O    4  
ATOM 7603  C CB   . LEU A 1 161 ? 6.169   8.519   3.403   1.00 0.51 ? 161 LEU A CB   4  
ATOM 7604  C CG   . LEU A 1 161 ? 5.106   7.661   4.096   1.00 0.60 ? 161 LEU A CG   4  
ATOM 7605  C CD1  . LEU A 1 161 ? 3.721   8.270   3.927   1.00 0.62 ? 161 LEU A CD1  4  
ATOM 7606  C CD2  . LEU A 1 161 ? 5.134   6.237   3.556   1.00 0.67 ? 161 LEU A CD2  4  
ATOM 7607  H H    . LEU A 1 161 ? 7.828   10.197  2.441   1.00 0.47 ? 161 LEU A H    4  
ATOM 7608  N N    . LEU A 1 162 ? 7.928   9.915   5.627   1.00 0.56 ? 162 LEU A N    4  
ATOM 7609  C CA   . LEU A 1 162 ? 8.426   9.973   6.996   1.00 0.64 ? 162 LEU A CA   4  
ATOM 7610  C C    . LEU A 1 162 ? 8.175   11.348  7.611   1.00 0.64 ? 162 LEU A C    4  
ATOM 7611  O O    . LEU A 1 162 ? 7.920   11.469  8.809   1.00 0.72 ? 162 LEU A O    4  
ATOM 7612  C CB   . LEU A 1 162 ? 9.922   9.657   7.034   1.00 0.71 ? 162 LEU A CB   4  
ATOM 7613  C CG   . LEU A 1 162 ? 10.336  8.274   6.520   1.00 0.81 ? 162 LEU A CG   4  
ATOM 7614  C CD1  . LEU A 1 162 ? 11.850  8.174   6.414   1.00 0.90 ? 162 LEU A CD1  4  
ATOM 7615  C CD2  . LEU A 1 162 ? 9.786   7.180   7.423   1.00 0.87 ? 162 LEU A CD2  4  
ATOM 7616  H H    . LEU A 1 162 ? 8.564   9.766   4.893   1.00 0.56 ? 162 LEU A H    4  
ATOM 7617  N N    . SER A 1 163 ? 8.243   12.377  6.778   1.00 0.59 ? 163 SER A N    4  
ATOM 7618  C CA   . SER A 1 163 ? 8.028   13.742  7.227   1.00 0.62 ? 163 SER A CA   4  
ATOM 7619  C C    . SER A 1 163 ? 6.544   14.096  7.272   1.00 0.60 ? 163 SER A C    4  
ATOM 7620  O O    . SER A 1 163 ? 6.127   14.951  8.056   1.00 0.67 ? 163 SER A O    4  
ATOM 7621  C CB   . SER A 1 163 ? 8.777   14.718  6.319   1.00 0.65 ? 163 SER A CB   4  
ATOM 7622  O OG   . SER A 1 163 ? 10.134  14.332  6.177   1.00 0.69 ? 163 SER A OG   4  
ATOM 7623  H H    . SER A 1 163 ? 8.454   12.213  5.833   1.00 0.58 ? 163 SER A H    4  
ATOM 7624  H HG   . SER A 1 163 ? 10.196  13.602  5.544   1.00 0.78 ? 163 SER A HG   4  
ATOM 7625  N N    . TYR A 1 164 ? 5.750   13.440  6.429   1.00 0.57 ? 164 TYR A N    4  
ATOM 7626  C CA   . TYR A 1 164 ? 4.316   13.691  6.373   1.00 0.57 ? 164 TYR A CA   4  
ATOM 7627  C C    . TYR A 1 164 ? 3.632   13.237  7.655   1.00 0.56 ? 164 TYR A C    4  
ATOM 7628  O O    . TYR A 1 164 ? 2.709   13.892  8.141   1.00 0.58 ? 164 TYR A O    4  
ATOM 7629  C CB   . TYR A 1 164 ? 3.690   12.994  5.162   1.00 0.57 ? 164 TYR A CB   4  
ATOM 7630  C CG   . TYR A 1 164 ? 2.234   13.341  4.938   1.00 0.65 ? 164 TYR A CG   4  
ATOM 7631  C CD1  . TYR A 1 164 ? 1.850   14.633  4.600   1.00 0.72 ? 164 TYR A CD1  4  
ATOM 7632  C CD2  . TYR A 1 164 ? 1.242   12.375  5.059   1.00 0.73 ? 164 TYR A CD2  4  
ATOM 7633  C CE1  . TYR A 1 164 ? 0.521   14.953  4.393   1.00 0.84 ? 164 TYR A CE1  4  
ATOM 7634  C CE2  . TYR A 1 164 ? -0.089  12.685  4.853   1.00 0.83 ? 164 TYR A CE2  4  
ATOM 7635  C CZ   . TYR A 1 164 ? -0.444  13.975  4.520   1.00 0.86 ? 164 TYR A CZ   4  
ATOM 7636  O OH   . TYR A 1 164 ? -1.769  14.286  4.310   1.00 0.99 ? 164 TYR A OH   4  
ATOM 7637  H H    . TYR A 1 164 ? 6.141   12.775  5.821   1.00 0.59 ? 164 TYR A H    4  
ATOM 7638  H HH   . TYR A 1 164 ? -1.850  14.791  3.492   1.00 0.96 ? 164 TYR A HH   4  
ATOM 7639  N N    . PHE A 1 165 ? 4.086   12.110  8.192   1.00 0.56 ? 165 PHE A N    4  
ATOM 7640  C CA   . PHE A 1 165 ? 3.527   11.569  9.425   1.00 0.58 ? 165 PHE A CA   4  
ATOM 7641  C C    . PHE A 1 165 ? 3.861   12.479  10.608  1.00 0.61 ? 165 PHE A C    4  
ATOM 7642  O O    . PHE A 1 165 ? 5.009   12.538  11.053  1.00 0.69 ? 165 PHE A O    4  
ATOM 7643  C CB   . PHE A 1 165 ? 4.048   10.148  9.677   1.00 0.63 ? 165 PHE A CB   4  
ATOM 7644  C CG   . PHE A 1 165 ? 3.498   9.501   10.923  1.00 0.63 ? 165 PHE A CG   4  
ATOM 7645  C CD1  . PHE A 1 165 ? 2.166   9.121   10.996  1.00 0.62 ? 165 PHE A CD1  4  
ATOM 7646  C CD2  . PHE A 1 165 ? 4.313   9.274   12.021  1.00 0.72 ? 165 PHE A CD2  4  
ATOM 7647  C CE1  . PHE A 1 165 ? 1.657   8.530   12.137  1.00 0.65 ? 165 PHE A CE1  4  
ATOM 7648  C CE2  . PHE A 1 165 ? 3.809   8.683   13.165  1.00 0.74 ? 165 PHE A CE2  4  
ATOM 7649  C CZ   . PHE A 1 165 ? 2.481   8.310   13.223  1.00 0.67 ? 165 PHE A CZ   4  
ATOM 7650  H H    . PHE A 1 165 ? 4.817   11.630  7.747   1.00 0.59 ? 165 PHE A H    4  
ATOM 7651  N N    . GLY A 1 166 ? 2.860   13.197  11.096  1.00 0.63 ? 166 GLY A N    4  
ATOM 7652  C CA   . GLY A 1 166 ? 3.065   14.094  12.213  1.00 0.70 ? 166 GLY A CA   4  
ATOM 7653  C C    . GLY A 1 166 ? 2.320   13.646  13.451  1.00 0.73 ? 166 GLY A C    4  
ATOM 7654  O O    . GLY A 1 166 ? 2.258   12.452  13.747  1.00 1.05 ? 166 GLY A O    4  
ATOM 7655  H H    . GLY A 1 166 ? 1.968   13.114  10.699  1.00 0.67 ? 166 GLY A H    4  
ATOM 7656  N N    . THR A 1 167 ? 1.755   14.598  14.180  1.00 0.65 ? 167 THR A N    4  
ATOM 7657  C CA   . THR A 1 167 ? 1.012   14.298  15.398  1.00 0.67 ? 167 THR A CA   4  
ATOM 7658  C C    . THR A 1 167 ? -0.042  15.373  15.719  1.00 0.66 ? 167 THR A C    4  
ATOM 7659  O O    . THR A 1 167 ? -1.223  15.052  15.852  1.00 0.68 ? 167 THR A O    4  
ATOM 7660  C CB   . THR A 1 167 ? 1.935   14.088  16.618  1.00 0.74 ? 167 THR A CB   4  
ATOM 7661  O OG1  . THR A 1 167 ? 3.075   13.301  16.244  1.00 0.89 ? 167 THR A OG1  4  
ATOM 7662  C CG2  . THR A 1 167 ? 1.184   13.375  17.732  1.00 0.86 ? 167 THR A CG2  4  
ATOM 7663  H H    . THR A 1 167 ? 1.830   15.531  13.884  1.00 0.77 ? 167 THR A H    4  
ATOM 7664  H HG1  . THR A 1 167 ? 2.862   12.791  15.449  1.00 1.05 ? 167 THR A HG1  4  
ATOM 7665  N N    . PRO A 1 168 ? 0.361   16.661  15.858  1.00 0.68 ? 168 PRO A N    4  
ATOM 7666  C CA   . PRO A 1 168 ? -0.574  17.753  16.175  1.00 0.71 ? 168 PRO A CA   4  
ATOM 7667  C C    . PRO A 1 168 ? -1.781  17.799  15.242  1.00 0.67 ? 168 PRO A C    4  
ATOM 7668  O O    . PRO A 1 168 ? -1.636  17.827  14.015  1.00 0.70 ? 168 PRO A O    4  
ATOM 7669  C CB   . PRO A 1 168 ? 0.273   19.015  16.005  1.00 0.77 ? 168 PRO A CB   4  
ATOM 7670  C CG   . PRO A 1 168 ? 1.667   18.562  16.259  1.00 0.81 ? 168 PRO A CG   4  
ATOM 7671  C CD   . PRO A 1 168 ? 1.747   17.159  15.733  1.00 0.70 ? 168 PRO A CD   4  
ATOM 7672  N N    . THR A 1 169 ? -2.969  17.802  15.845  1.00 0.68 ? 169 THR A N    4  
ATOM 7673  C CA   . THR A 1 169 ? -4.230  17.856  15.109  1.00 0.71 ? 169 THR A CA   4  
ATOM 7674  C C    . THR A 1 169 ? -4.379  16.666  14.158  1.00 0.61 ? 169 THR A C    4  
ATOM 7675  O O    . THR A 1 169 ? -4.832  16.812  13.021  1.00 0.62 ? 169 THR A O    4  
ATOM 7676  C CB   . THR A 1 169 ? -4.384  19.185  14.337  1.00 0.85 ? 169 THR A CB   4  
ATOM 7677  O OG1  . THR A 1 169 ? -3.594  20.199  14.976  1.00 1.01 ? 169 THR A OG1  4  
ATOM 7678  C CG2  . THR A 1 169 ? -5.839  19.634  14.331  1.00 1.02 ? 169 THR A CG2  4  
ATOM 7679  H H    . THR A 1 169 ? -2.996  17.755  16.824  1.00 0.72 ? 169 THR A H    4  
ATOM 7680  H HG1  . THR A 1 169 ? -2.816  20.376  14.431  1.00 1.43 ? 169 THR A HG1  4  
ATOM 7681  N N    . TRP A 1 170 ? -4.014  15.483  14.645  1.00 0.58 ? 170 TRP A N    4  
ATOM 7682  C CA   . TRP A 1 170 ? -4.093  14.259  13.852  1.00 0.54 ? 170 TRP A CA   4  
ATOM 7683  C C    . TRP A 1 170 ? -5.519  13.957  13.393  1.00 0.52 ? 170 TRP A C    4  
ATOM 7684  O O    . TRP A 1 170 ? -5.715  13.281  12.384  1.00 0.49 ? 170 TRP A O    4  
ATOM 7685  C CB   . TRP A 1 170 ? -3.512  13.065  14.620  1.00 0.59 ? 170 TRP A CB   4  
ATOM 7686  C CG   . TRP A 1 170 ? -4.343  12.617  15.790  1.00 0.72 ? 170 TRP A CG   4  
ATOM 7687  C CD1  . TRP A 1 170 ? -5.285  11.628  15.793  1.00 0.94 ? 170 TRP A CD1  4  
ATOM 7688  C CD2  . TRP A 1 170 ? -4.306  13.137  17.126  1.00 0.83 ? 170 TRP A CD2  4  
ATOM 7689  N NE1  . TRP A 1 170 ? -5.839  11.504  17.044  1.00 1.08 ? 170 TRP A NE1  4  
ATOM 7690  C CE2  . TRP A 1 170 ? -5.252  12.417  17.880  1.00 1.03 ? 170 TRP A CE2  4  
ATOM 7691  C CE3  . TRP A 1 170 ? -3.566  14.141  17.757  1.00 0.95 ? 170 TRP A CE3  4  
ATOM 7692  C CZ2  . TRP A 1 170 ? -5.476  12.666  19.230  1.00 1.25 ? 170 TRP A CZ2  4  
ATOM 7693  C CZ3  . TRP A 1 170 ? -3.791  14.387  19.096  1.00 1.22 ? 170 TRP A CZ3  4  
ATOM 7694  C CH2  . TRP A 1 170 ? -4.738  13.652  19.819  1.00 1.33 ? 170 TRP A CH2  4  
ATOM 7695  H H    . TRP A 1 170 ? -3.668  15.432  15.561  1.00 0.63 ? 170 TRP A H    4  
ATOM 7696  H HE1  . TRP A 1 170 ? -6.538  10.864  17.297  1.00 1.27 ? 170 TRP A HE1  4  
ATOM 7697  N N    . GLN A 1 171 ? -6.507  14.476  14.126  1.00 0.55 ? 171 GLN A N    4  
ATOM 7698  C CA   . GLN A 1 171 ? -7.910  14.261  13.790  1.00 0.58 ? 171 GLN A CA   4  
ATOM 7699  C C    . GLN A 1 171 ? -8.208  14.735  12.369  1.00 0.54 ? 171 GLN A C    4  
ATOM 7700  O O    . GLN A 1 171 ? -8.980  14.105  11.644  1.00 0.51 ? 171 GLN A O    4  
ATOM 7701  C CB   . GLN A 1 171 ? -8.822  14.976  14.788  1.00 0.65 ? 171 GLN A CB   4  
ATOM 7702  C CG   . GLN A 1 171 ? -10.300 14.665  14.607  1.00 0.82 ? 171 GLN A CG   4  
ATOM 7703  C CD   . GLN A 1 171 ? -11.198 15.696  15.259  1.00 1.09 ? 171 GLN A CD   4  
ATOM 7704  O OE1  . GLN A 1 171 ? -11.513 16.726  14.662  1.00 1.33 ? 171 GLN A OE1  4  
ATOM 7705  N NE2  . GLN A 1 171 ? -11.628 15.430  16.478  1.00 1.37 ? 171 GLN A NE2  4  
ATOM 7706  H H    . GLN A 1 171 ? -6.285  15.019  14.909  1.00 0.59 ? 171 GLN A H    4  
ATOM 7707  H HE21 . GLN A 1 171 ? -11.349 14.586  16.898  1.00 1.45 ? 171 GLN A HE21 4  
ATOM 7708  H HE22 . GLN A 1 171 ? -12.217 16.086  16.914  1.00 1.64 ? 171 GLN A HE22 4  
ATOM 7709  N N    . THR A 1 172 ? -7.588  15.843  11.974  1.00 0.56 ? 172 THR A N    4  
ATOM 7710  C CA   . THR A 1 172 ? -7.781  16.386  10.640  1.00 0.56 ? 172 THR A CA   4  
ATOM 7711  C C    . THR A 1 172 ? -7.303  15.390  9.591   1.00 0.52 ? 172 THR A C    4  
ATOM 7712  O O    . THR A 1 172 ? -7.937  15.222  8.553   1.00 0.52 ? 172 THR A O    4  
ATOM 7713  C CB   . THR A 1 172 ? -7.024  17.719  10.474  1.00 0.62 ? 172 THR A CB   4  
ATOM 7714  O OG1  . THR A 1 172 ? -7.438  18.625  11.503  1.00 0.72 ? 172 THR A OG1  4  
ATOM 7715  C CG2  . THR A 1 172 ? -7.306  18.343  9.116   1.00 0.75 ? 172 THR A CG2  4  
ATOM 7716  H H    . THR A 1 172 ? -6.988  16.310  12.596  1.00 0.59 ? 172 THR A H    4  
ATOM 7717  H HG1  . THR A 1 172 ? -8.395  18.757  11.444  1.00 1.20 ? 172 THR A HG1  4  
ATOM 7718  N N    . VAL A 1 173 ? -6.200  14.710  9.887   1.00 0.53 ? 173 VAL A N    4  
ATOM 7719  C CA   . VAL A 1 173 ? -5.639  13.722  8.979   1.00 0.52 ? 173 VAL A CA   4  
ATOM 7720  C C    . VAL A 1 173 ? -6.615  12.560  8.819   1.00 0.49 ? 173 VAL A C    4  
ATOM 7721  O O    . VAL A 1 173 ? -6.888  12.110  7.706   1.00 0.47 ? 173 VAL A O    4  
ATOM 7722  C CB   . VAL A 1 173 ? -4.285  13.185  9.495   1.00 0.56 ? 173 VAL A CB   4  
ATOM 7723  C CG1  . VAL A 1 173 ? -3.639  12.263  8.471   1.00 0.57 ? 173 VAL A CG1  4  
ATOM 7724  C CG2  . VAL A 1 173 ? -3.352  14.335  9.847   1.00 0.60 ? 173 VAL A CG2  4  
ATOM 7725  H H    . VAL A 1 173 ? -5.759  14.871  10.749  1.00 0.57 ? 173 VAL A H    4  
ATOM 7726  N N    . THR A 1 174 ? -7.149  12.096  9.942   1.00 0.49 ? 174 THR A N    4  
ATOM 7727  C CA   . THR A 1 174 ? -8.108  11.000  9.946   1.00 0.48 ? 174 THR A CA   4  
ATOM 7728  C C    . THR A 1 174 ? -9.337  11.358  9.108   1.00 0.47 ? 174 THR A C    4  
ATOM 7729  O O    . THR A 1 174 ? -9.789  10.564  8.279   1.00 0.47 ? 174 THR A O    4  
ATOM 7730  C CB   . THR A 1 174 ? -8.544  10.679  11.388  1.00 0.50 ? 174 THR A CB   4  
ATOM 7731  O OG1  . THR A 1 174 ? -7.414  10.821  12.263  1.00 0.58 ? 174 THR A OG1  4  
ATOM 7732  C CG2  . THR A 1 174 ? -9.081  9.258   11.485  1.00 0.54 ? 174 THR A CG2  4  
ATOM 7733  H H    . THR A 1 174 ? -6.884  12.496  10.801  1.00 0.52 ? 174 THR A H    4  
ATOM 7734  H HG1  . THR A 1 174 ? -7.156  9.958   12.599  1.00 1.09 ? 174 THR A HG1  4  
ATOM 7735  N N    . ILE A 1 175 ? -9.861  12.563  9.318   1.00 0.48 ? 175 ILE A N    4  
ATOM 7736  C CA   . ILE A 1 175 ? -11.028 13.031  8.579   1.00 0.49 ? 175 ILE A CA   4  
ATOM 7737  C C    . ILE A 1 175 ? -10.694 13.200  7.096   1.00 0.46 ? 175 ILE A C    4  
ATOM 7738  O O    . ILE A 1 175 ? -11.495 12.855  6.225   1.00 0.45 ? 175 ILE A O    4  
ATOM 7739  C CB   . ILE A 1 175 ? -11.564 14.362  9.152   1.00 0.54 ? 175 ILE A CB   4  
ATOM 7740  C CG1  . ILE A 1 175 ? -11.985 14.173  10.612  1.00 0.57 ? 175 ILE A CG1  4  
ATOM 7741  C CG2  . ILE A 1 175 ? -12.733 14.883  8.325   1.00 0.59 ? 175 ILE A CG2  4  
ATOM 7742  C CD1  . ILE A 1 175 ? -12.319 15.463  11.330  1.00 0.64 ? 175 ILE A CD1  4  
ATOM 7743  H H    . ILE A 1 175 ? -9.451  13.152  9.992   1.00 0.49 ? 175 ILE A H    4  
ATOM 7744  N N    . PHE A 1 176 ? -9.498  13.707  6.823   1.00 0.45 ? 176 PHE A N    4  
ATOM 7745  C CA   . PHE A 1 176 ? -9.042  13.925  5.456   1.00 0.43 ? 176 PHE A CA   4  
ATOM 7746  C C    . PHE A 1 176 ? -8.978  12.611  4.682   1.00 0.40 ? 176 PHE A C    4  
ATOM 7747  O O    . PHE A 1 176 ? -9.547  12.494  3.594   1.00 0.40 ? 176 PHE A O    4  
ATOM 7748  C CB   . PHE A 1 176 ? -7.673  14.613  5.461   1.00 0.45 ? 176 PHE A CB   4  
ATOM 7749  C CG   . PHE A 1 176 ? -7.072  14.811  4.100   1.00 0.49 ? 176 PHE A CG   4  
ATOM 7750  C CD1  . PHE A 1 176 ? -7.577  15.768  3.236   1.00 0.54 ? 176 PHE A CD1  4  
ATOM 7751  C CD2  . PHE A 1 176 ? -5.996  14.042  3.686   1.00 0.53 ? 176 PHE A CD2  4  
ATOM 7752  C CE1  . PHE A 1 176 ? -7.023  15.955  1.983   1.00 0.62 ? 176 PHE A CE1  4  
ATOM 7753  C CE2  . PHE A 1 176 ? -5.438  14.224  2.435   1.00 0.60 ? 176 PHE A CE2  4  
ATOM 7754  C CZ   . PHE A 1 176 ? -5.953  15.182  1.583   1.00 0.64 ? 176 PHE A CZ   4  
ATOM 7755  H H    . PHE A 1 176 ? -8.903  13.951  7.569   1.00 0.46 ? 176 PHE A H    4  
ATOM 7756  N N    . VAL A 1 177 ? -8.294  11.626  5.253   1.00 0.40 ? 177 VAL A N    4  
ATOM 7757  C CA   . VAL A 1 177 ? -8.154  10.318  4.620   1.00 0.38 ? 177 VAL A CA   4  
ATOM 7758  C C    . VAL A 1 177 ? -9.526  9.691   4.369   1.00 0.38 ? 177 VAL A C    4  
ATOM 7759  O O    . VAL A 1 177 ? -9.806  9.203   3.272   1.00 0.38 ? 177 VAL A O    4  
ATOM 7760  C CB   . VAL A 1 177 ? -7.291  9.363   5.477   1.00 0.40 ? 177 VAL A CB   4  
ATOM 7761  C CG1  . VAL A 1 177 ? -7.231  7.977   4.850   1.00 0.41 ? 177 VAL A CG1  4  
ATOM 7762  C CG2  . VAL A 1 177 ? -5.887  9.926   5.642   1.00 0.42 ? 177 VAL A CG2  4  
ATOM 7763  H H    . VAL A 1 177 ? -7.872  11.783  6.129   1.00 0.41 ? 177 VAL A H    4  
ATOM 7764  N N    . ALA A 1 178 ? -10.377 9.725   5.387   1.00 0.40 ? 178 ALA A N    4  
ATOM 7765  C CA   . ALA A 1 178 ? -11.718 9.168   5.278   1.00 0.41 ? 178 ALA A CA   4  
ATOM 7766  C C    . ALA A 1 178 ? -12.529 9.926   4.234   1.00 0.40 ? 178 ALA A C    4  
ATOM 7767  O O    . ALA A 1 178 ? -13.276 9.327   3.461   1.00 0.40 ? 178 ALA A O    4  
ATOM 7768  C CB   . ALA A 1 178 ? -12.419 9.203   6.626   1.00 0.44 ? 178 ALA A CB   4  
ATOM 7769  H H    . ALA A 1 178 ? -10.096 10.135  6.235   1.00 0.41 ? 178 ALA A H    4  
ATOM 7770  N N    . GLY A 1 179 ? -12.366 11.246  4.216   1.00 0.41 ? 179 GLY A N    4  
ATOM 7771  C CA   . GLY A 1 179 ? -13.078 12.086  3.270   1.00 0.42 ? 179 GLY A CA   4  
ATOM 7772  C C    . GLY A 1 179 ? -12.757 11.737  1.833   1.00 0.39 ? 179 GLY A C    4  
ATOM 7773  O O    . GLY A 1 179 ? -13.664 11.584  1.014   1.00 0.39 ? 179 GLY A O    4  
ATOM 7774  H H    . GLY A 1 179 ? -11.755 11.662  4.866   1.00 0.42 ? 179 GLY A H    4  
ATOM 7775  N N    . VAL A 1 180 ? -11.470 11.595  1.532   1.00 0.37 ? 180 VAL A N    4  
ATOM 7776  C CA   . VAL A 1 180 ? -11.029 11.250  0.184   1.00 0.35 ? 180 VAL A CA   4  
ATOM 7777  C C    . VAL A 1 180 ? -11.639 9.916   -0.242  1.00 0.33 ? 180 VAL A C    4  
ATOM 7778  O O    . VAL A 1 180 ? -12.152 9.780   -1.353  1.00 0.33 ? 180 VAL A O    4  
ATOM 7779  C CB   . VAL A 1 180 ? -9.488  11.169  0.092   1.00 0.36 ? 180 VAL A CB   4  
ATOM 7780  C CG1  . VAL A 1 180 ? -9.054  10.770  -1.311  1.00 0.36 ? 180 VAL A CG1  4  
ATOM 7781  C CG2  . VAL A 1 180 ? -8.859  12.500  0.477   1.00 0.39 ? 180 VAL A CG2  4  
ATOM 7782  H H    . VAL A 1 180 ? -10.797 11.732  2.237   1.00 0.38 ? 180 VAL A H    4  
ATOM 7783  N N    . LEU A 1 181 ? -11.600 8.943   0.665   1.00 0.33 ? 181 LEU A N    4  
ATOM 7784  C CA   . LEU A 1 181 ? -12.157 7.621   0.404   1.00 0.33 ? 181 LEU A CA   4  
ATOM 7785  C C    . LEU A 1 181 ? -13.661 7.710   0.164   1.00 0.34 ? 181 LEU A C    4  
ATOM 7786  O O    . LEU A 1 181 ? -14.195 7.074   -0.746  1.00 0.33 ? 181 LEU A O    4  
ATOM 7787  C CB   . LEU A 1 181 ? -11.865 6.679   1.577   1.00 0.36 ? 181 LEU A CB   4  
ATOM 7788  C CG   . LEU A 1 181 ? -10.404 6.264   1.758   1.00 0.37 ? 181 LEU A CG   4  
ATOM 7789  C CD1  . LEU A 1 181 ? -10.189 5.635   3.124   1.00 0.39 ? 181 LEU A CD1  4  
ATOM 7790  C CD2  . LEU A 1 181 ? -9.982  5.308   0.653   1.00 0.40 ? 181 LEU A CD2  4  
ATOM 7791  H H    . LEU A 1 181 ? -11.179 9.119   1.534   1.00 0.34 ? 181 LEU A H    4  
ATOM 7792  N N    . THR A 1 182 ? -14.332 8.519   0.978   1.00 0.37 ? 182 THR A N    4  
ATOM 7793  C CA   . THR A 1 182 ? -15.771 8.709   0.860   1.00 0.39 ? 182 THR A CA   4  
ATOM 7794  C C    . THR A 1 182 ? -16.112 9.309   -0.501  1.00 0.38 ? 182 THR A C    4  
ATOM 7795  O O    . THR A 1 182 ? -17.038 8.855   -1.172  1.00 0.38 ? 182 THR A O    4  
ATOM 7796  C CB   . THR A 1 182 ? -16.309 9.637   1.971   1.00 0.45 ? 182 THR A CB   4  
ATOM 7797  O OG1  . THR A 1 182 ? -15.887 9.156   3.254   1.00 0.45 ? 182 THR A OG1  4  
ATOM 7798  C CG2  . THR A 1 182 ? -17.829 9.696   1.939   1.00 0.53 ? 182 THR A CG2  4  
ATOM 7799  H H    . THR A 1 182 ? -13.843 9.005   1.673   1.00 0.39 ? 182 THR A H    4  
ATOM 7800  H HG1  . THR A 1 182 ? -14.929 9.030   3.251   1.00 0.43 ? 182 THR A HG1  4  
ATOM 7801  N N    . ALA A 1 183 ? -15.337 10.313  -0.907  1.00 0.39 ? 183 ALA A N    4  
ATOM 7802  C CA   . ALA A 1 183 ? -15.547 10.986  -2.186  1.00 0.40 ? 183 ALA A CA   4  
ATOM 7803  C C    . ALA A 1 183 ? -15.568 9.997   -3.345  1.00 0.36 ? 183 ALA A C    4  
ATOM 7804  O O    . ALA A 1 183 ? -16.567 9.897   -4.064  1.00 0.36 ? 183 ALA A O    4  
ATOM 7805  C CB   . ALA A 1 183 ? -14.478 12.044  -2.414  1.00 0.45 ? 183 ALA A CB   4  
ATOM 7806  H H    . ALA A 1 183 ? -14.600 10.614  -0.325  1.00 0.40 ? 183 ALA A H    4  
ATOM 7807  N N    . SER A 1 184 ? -14.480 9.255   -3.506  1.00 0.35 ? 184 SER A N    4  
ATOM 7808  C CA   . SER A 1 184 ? -14.368 8.281   -4.587  1.00 0.34 ? 184 SER A CA   4  
ATOM 7809  C C    . SER A 1 184 ? -15.446 7.200   -4.499  1.00 0.32 ? 184 SER A C    4  
ATOM 7810  O O    . SER A 1 184 ? -16.024 6.803   -5.514  1.00 0.33 ? 184 SER A O    4  
ATOM 7811  C CB   . SER A 1 184 ? -12.976 7.653   -4.595  1.00 0.37 ? 184 SER A CB   4  
ATOM 7812  O OG   . SER A 1 184 ? -11.974 8.652   -4.519  1.00 0.40 ? 184 SER A OG   4  
ATOM 7813  H H    . SER A 1 184 ? -13.725 9.365   -2.882  1.00 0.38 ? 184 SER A H    4  
ATOM 7814  H HG   . SER A 1 184 ? -12.067 9.253   -5.262  1.00 0.76 ? 184 SER A HG   4  
ATOM 7815  N N    . LEU A 1 185 ? -15.731 6.740   -3.281  1.00 0.33 ? 185 LEU A N    4  
ATOM 7816  C CA   . LEU A 1 185 ? -16.740 5.705   -3.069  1.00 0.35 ? 185 LEU A CA   4  
ATOM 7817  C C    . LEU A 1 185 ? -18.127 6.180   -3.499  1.00 0.36 ? 185 LEU A C    4  
ATOM 7818  O O    . LEU A 1 185 ? -18.910 5.410   -4.058  1.00 0.37 ? 185 LEU A O    4  
ATOM 7819  C CB   . LEU A 1 185 ? -16.751 5.242   -1.610  1.00 0.40 ? 185 LEU A CB   4  
ATOM 7820  C CG   . LEU A 1 185 ? -17.448 3.909   -1.324  1.00 0.66 ? 185 LEU A CG   4  
ATOM 7821  C CD1  . LEU A 1 185 ? -16.828 2.790   -2.146  1.00 1.01 ? 185 LEU A CD1  4  
ATOM 7822  C CD2  . LEU A 1 185 ? -17.381 3.583   0.158   1.00 0.77 ? 185 LEU A CD2  4  
ATOM 7823  H H    . LEU A 1 185 ? -15.244 7.099   -2.506  1.00 0.34 ? 185 LEU A H    4  
ATOM 7824  N N    . THR A 1 186 ? -18.417 7.455   -3.259  1.00 0.38 ? 186 THR A N    4  
ATOM 7825  C CA   . THR A 1 186 ? -19.706 8.029   -3.631  1.00 0.41 ? 186 THR A CA   4  
ATOM 7826  C C    . THR A 1 186 ? -19.847 8.088   -5.156  1.00 0.38 ? 186 THR A C    4  
ATOM 7827  O O    . THR A 1 186 ? -20.951 8.038   -5.694  1.00 0.43 ? 186 THR A O    4  
ATOM 7828  C CB   . THR A 1 186 ? -19.896 9.442   -3.030  1.00 0.47 ? 186 THR A CB   4  
ATOM 7829  O OG1  . THR A 1 186 ? -19.568 9.424   -1.632  1.00 0.50 ? 186 THR A OG1  4  
ATOM 7830  C CG2  . THR A 1 186 ? -21.337 9.905   -3.188  1.00 0.54 ? 186 THR A CG2  4  
ATOM 7831  H H    . THR A 1 186 ? -17.748 8.025   -2.822  1.00 0.38 ? 186 THR A H    4  
ATOM 7832  H HG1  . THR A 1 186 ? -18.638 9.182   -1.521  1.00 0.49 ? 186 THR A HG1  4  
ATOM 7833  N N    . ILE A 1 187 ? -18.717 8.184   -5.850  1.00 0.35 ? 187 ILE A N    4  
ATOM 7834  C CA   . ILE A 1 187 ? -18.724 8.232   -7.310  1.00 0.36 ? 187 ILE A CA   4  
ATOM 7835  C C    . ILE A 1 187 ? -18.852 6.817   -7.874  1.00 0.35 ? 187 ILE A C    4  
ATOM 7836  O O    . ILE A 1 187 ? -19.219 6.619   -9.033  1.00 0.45 ? 187 ILE A O    4  
ATOM 7837  C CB   . ILE A 1 187 ? -17.445 8.894   -7.871  1.00 0.38 ? 187 ILE A CB   4  
ATOM 7838  C CG1  . ILE A 1 187 ? -17.123 10.174  -7.095  1.00 0.38 ? 187 ILE A CG1  4  
ATOM 7839  C CG2  . ILE A 1 187 ? -17.610 9.206   -9.355  1.00 0.41 ? 187 ILE A CG2  4  
ATOM 7840  C CD1  . ILE A 1 187 ? -15.762 10.761  -7.412  1.00 0.43 ? 187 ILE A CD1  4  
ATOM 7841  H H    . ILE A 1 187 ? -17.861 8.226   -5.372  1.00 0.36 ? 187 ILE A H    4  
ATOM 7842  N N    . TRP A 1 188 ? -18.543 5.831   -7.041  1.00 0.35 ? 188 TRP A N    4  
ATOM 7843  C CA   . TRP A 1 188 ? -18.629 4.440   -7.447  1.00 0.37 ? 188 TRP A CA   4  
ATOM 7844  C C    . TRP A 1 188 ? -20.043 3.905   -7.274  1.00 0.38 ? 188 TRP A C    4  
ATOM 7845  O O    . TRP A 1 188 ? -20.652 3.426   -8.230  1.00 0.40 ? 188 TRP A O    4  
ATOM 7846  C CB   . TRP A 1 188 ? -17.631 3.578   -6.675  1.00 0.40 ? 188 TRP A CB   4  
ATOM 7847  C CG   . TRP A 1 188 ? -16.559 2.997   -7.545  1.00 0.41 ? 188 TRP A CG   4  
ATOM 7848  C CD1  . TRP A 1 188 ? -15.213 3.180   -7.423  1.00 0.51 ? 188 TRP A CD1  4  
ATOM 7849  C CD2  . TRP A 1 188 ? -16.746 2.140   -8.678  1.00 0.41 ? 188 TRP A CD2  4  
ATOM 7850  N NE1  . TRP A 1 188 ? -14.550 2.491   -8.409  1.00 0.55 ? 188 TRP A NE1  4  
ATOM 7851  C CE2  . TRP A 1 188 ? -15.470 1.845   -9.194  1.00 0.48 ? 188 TRP A CE2  4  
ATOM 7852  C CE3  . TRP A 1 188 ? -17.869 1.592   -9.308  1.00 0.47 ? 188 TRP A CE3  4  
ATOM 7853  C CZ2  . TRP A 1 188 ? -15.284 1.029   -10.307 1.00 0.54 ? 188 TRP A CZ2  4  
ATOM 7854  C CZ3  . TRP A 1 188 ? -17.682 0.783   -10.413 1.00 0.56 ? 188 TRP A CZ3  4  
ATOM 7855  C CH2  . TRP A 1 188 ? -16.400 0.508   -10.902 1.00 0.57 ? 188 TRP A CH2  4  
ATOM 7856  H H    . TRP A 1 188 ? -18.258 6.049   -6.130  1.00 0.41 ? 188 TRP A H    4  
ATOM 7857  H HE1  . TRP A 1 188 ? -13.577 2.464   -8.531  1.00 0.65 ? 188 TRP A HE1  4  
ATOM 7858  N N    . LYS A 1 189 ? -20.568 4.001   -6.059  1.00 0.39 ? 189 LYS A N    4  
ATOM 7859  C CA   . LYS A 1 189 ? -21.915 3.520   -5.780  1.00 0.43 ? 189 LYS A CA   4  
ATOM 7860  C C    . LYS A 1 189 ? -22.957 4.565   -6.164  1.00 0.46 ? 189 LYS A C    4  
ATOM 7861  O O    . LYS A 1 189 ? -23.498 5.270   -5.315  1.00 0.55 ? 189 LYS A O    4  
ATOM 7862  C CB   . LYS A 1 189 ? -22.068 3.109   -4.314  1.00 0.49 ? 189 LYS A CB   4  
ATOM 7863  C CG   . LYS A 1 189 ? -22.389 1.634   -4.106  1.00 0.71 ? 189 LYS A CG   4  
ATOM 7864  C CD   . LYS A 1 189 ? -23.593 1.205   -4.932  1.00 1.05 ? 189 LYS A CD   4  
ATOM 7865  C CE   . LYS A 1 189 ? -24.206 -0.090  -4.417  1.00 0.83 ? 189 LYS A CE   4  
ATOM 7866  N NZ   . LYS A 1 189 ? -23.243 -1.222  -4.427  1.00 0.84 ? 189 LYS A NZ   4  
ATOM 7867  H H    . LYS A 1 189 ? -20.044 4.417   -5.338  1.00 0.40 ? 189 LYS A H    4  
ATOM 7868  H HZ1  . LYS A 1 189 ? -23.750 -2.120  -4.304  1.00 1.14 ? 189 LYS A HZ1  4  
ATOM 7869  H HZ2  . LYS A 1 189 ? -22.555 -1.121  -3.650  1.00 1.13 ? 189 LYS A HZ2  4  
ATOM 7870  H HZ3  . LYS A 1 189 ? -22.721 -1.254  -5.336  1.00 1.03 ? 189 LYS A HZ3  4  
ATOM 7871  N N    . LYS A 1 190 ? -23.239 4.645   -7.454  1.00 0.49 ? 190 LYS A N    4  
ATOM 7872  C CA   . LYS A 1 190 ? -24.206 5.598   -7.982  1.00 0.57 ? 190 LYS A CA   4  
ATOM 7873  C C    . LYS A 1 190 ? -25.519 4.889   -8.297  1.00 0.55 ? 190 LYS A C    4  
ATOM 7874  O O    . LYS A 1 190 ? -25.945 4.826   -9.452  1.00 0.61 ? 190 LYS A O    4  
ATOM 7875  C CB   . LYS A 1 190 ? -23.643 6.292   -9.233  1.00 0.67 ? 190 LYS A CB   4  
ATOM 7876  C CG   . LYS A 1 190 ? -22.588 5.489   -9.990  1.00 0.65 ? 190 LYS A CG   4  
ATOM 7877  C CD   . LYS A 1 190 ? -23.211 4.377   -10.819 1.00 0.69 ? 190 LYS A CD   4  
ATOM 7878  C CE   . LYS A 1 190 ? -22.160 3.532   -11.525 1.00 0.75 ? 190 LYS A CE   4  
ATOM 7879  N NZ   . LYS A 1 190 ? -21.581 2.483   -10.642 1.00 0.73 ? 190 LYS A NZ   4  
ATOM 7880  H H    . LYS A 1 190 ? -22.789 4.027   -8.075  1.00 0.52 ? 190 LYS A H    4  
ATOM 7881  H HZ1  . LYS A 1 190 ? -20.897 1.909   -11.170 1.00 0.85 ? 190 LYS A HZ1  4  
ATOM 7882  H HZ2  . LYS A 1 190 ? -22.339 1.855   -10.285 1.00 0.77 ? 190 LYS A HZ2  4  
ATOM 7883  H HZ3  . LYS A 1 190 ? -21.102 2.919   -9.825  1.00 0.86 ? 190 LYS A HZ3  4  
ATOM 7884  N N    . MET A 1 191 ? -26.143 4.342   -7.249  1.00 0.57 ? 191 MET A N    4  
ATOM 7885  C CA   . MET A 1 191 ? -27.400 3.594   -7.384  1.00 0.61 ? 191 MET A CA   4  
ATOM 7886  C C    . MET A 1 191 ? -27.163 2.362   -8.259  1.00 0.67 ? 191 MET A C    4  
ATOM 7887  O O    . MET A 1 191 ? -28.070 1.833   -8.903  1.00 1.20 ? 191 MET A O    4  
ATOM 7888  C CB   . MET A 1 191 ? -28.522 4.475   -7.955  1.00 0.70 ? 191 MET A CB   4  
ATOM 7889  C CG   . MET A 1 191 ? -29.924 3.919   -7.740  1.00 0.89 ? 191 MET A CG   4  
ATOM 7890  S SD   . MET A 1 191 ? -31.213 4.978   -8.426  1.00 1.20 ? 191 MET A SD   4  
ATOM 7891  C CE   . MET A 1 191 ? -30.814 4.914   -10.173 1.00 1.44 ? 191 MET A CE   4  
ATOM 7892  H H    . MET A 1 191 ? -25.747 4.448   -6.356  1.00 0.63 ? 191 MET A H    4  
ATOM 7893  N N    . GLY A 1 192 ? -25.915 1.926   -8.269  1.00 0.54 ? 192 GLY A N    4  
ATOM 7894  C CA   . GLY A 1 192 ? -25.504 0.791   -9.053  1.00 0.64 ? 192 GLY A CA   4  
ATOM 7895  C C    . GLY A 1 192 ? -24.083 1.003   -9.509  1.00 0.70 ? 192 GLY A C    4  
ATOM 7896  O O    . GLY A 1 192 ? -23.349 1.733   -8.808  1.00 0.80 ? 192 GLY A O    4  
ATOM 7897  O OXT  . GLY A 1 192 ? -23.696 0.487   -10.574 1.00 1.09 ? 192 GLY A OXT  4  
ATOM 7898  H H    . GLY A 1 192 ? -25.244 2.401   -7.736  1.00 0.80 ? 192 GLY A H    4  
ATOM 7899  N N    . GLU B 2 1   ? 0.358   -0.643  -16.570 1.00 5.01 ? 145 GLU B N    4  
ATOM 7900  C CA   . GLU B 2 1   ? -0.351  -1.417  -17.616 1.00 4.54 ? 145 GLU B CA   4  
ATOM 7901  C C    . GLU B 2 1   ? -0.455  -2.889  -17.225 1.00 3.87 ? 145 GLU B C    4  
ATOM 7902  O O    . GLU B 2 1   ? 0.302   -3.362  -16.384 1.00 3.91 ? 145 GLU B O    4  
ATOM 7903  C CB   . GLU B 2 1   ? 0.339   -1.273  -18.972 1.00 4.66 ? 145 GLU B CB   4  
ATOM 7904  C CG   . GLU B 2 1   ? -0.522  -0.602  -20.030 1.00 5.21 ? 145 GLU B CG   4  
ATOM 7905  C CD   . GLU B 2 1   ? -1.961  -1.069  -19.977 1.00 5.46 ? 145 GLU B CD   4  
ATOM 7906  O OE1  . GLU B 2 1   ? -2.204  -2.279  -20.154 1.00 5.83 ? 145 GLU B OE1  4  
ATOM 7907  O OE2  . GLU B 2 1   ? -2.851  -0.230  -19.729 1.00 5.59 ? 145 GLU B OE2  4  
ATOM 7908  H H1   . GLU B 2 1   ? 1.147   -1.203  -16.178 1.00 4.99 ? 145 GLU B H1   4  
ATOM 7909  H H2   . GLU B 2 1   ? -0.291  -0.415  -15.791 1.00 5.07 ? 145 GLU B H2   4  
ATOM 7910  H H3   . GLU B 2 1   ? 0.740   0.246   -16.964 1.00 5.51 ? 145 GLU B H3   4  
ATOM 7911  N N    . ILE B 2 2   ? -1.375  -3.612  -17.857 1.00 3.36 ? 146 ILE B N    4  
ATOM 7912  C CA   . ILE B 2 2   ? -1.587  -5.030  -17.560 1.00 2.81 ? 146 ILE B CA   4  
ATOM 7913  C C    . ILE B 2 2   ? -0.308  -5.849  -17.737 1.00 2.31 ? 146 ILE B C    4  
ATOM 7914  O O    . ILE B 2 2   ? 0.078   -6.611  -16.849 1.00 2.12 ? 146 ILE B O    4  
ATOM 7915  C CB   . ILE B 2 2   ? -2.720  -5.632  -18.420 1.00 2.51 ? 146 ILE B CB   4  
ATOM 7916  C CG1  . ILE B 2 2   ? -4.011  -4.830  -18.223 1.00 3.14 ? 146 ILE B CG1  4  
ATOM 7917  C CG2  . ILE B 2 2   ? -2.943  -7.096  -18.062 1.00 2.36 ? 146 ILE B CG2  4  
ATOM 7918  C CD1  . ILE B 2 2   ? -5.143  -5.244  -19.138 1.00 3.05 ? 146 ILE B CD1  4  
ATOM 7919  H H    . ILE B 2 2   ? -1.924  -3.181  -18.556 1.00 3.46 ? 146 ILE B H    4  
ATOM 7920  N N    . TRP B 2 3   ? 0.354   -5.673  -18.873 1.00 2.29 ? 147 TRP B N    4  
ATOM 7921  C CA   . TRP B 2 3   ? 1.585   -6.397  -19.154 1.00 2.19 ? 147 TRP B CA   4  
ATOM 7922  C C    . TRP B 2 3   ? 2.659   -6.066  -18.117 1.00 2.49 ? 147 TRP B C    4  
ATOM 7923  O O    . TRP B 2 3   ? 3.397   -6.942  -17.669 1.00 2.25 ? 147 TRP B O    4  
ATOM 7924  C CB   . TRP B 2 3   ? 2.085   -6.060  -20.561 1.00 2.58 ? 147 TRP B CB   4  
ATOM 7925  C CG   . TRP B 2 3   ? 3.274   -6.862  -20.991 1.00 2.84 ? 147 TRP B CG   4  
ATOM 7926  C CD1  . TRP B 2 3   ? 3.259   -8.083  -21.598 1.00 2.81 ? 147 TRP B CD1  4  
ATOM 7927  C CD2  . TRP B 2 3   ? 4.652   -6.500  -20.850 1.00 3.46 ? 147 TRP B CD2  4  
ATOM 7928  N NE1  . TRP B 2 3   ? 4.540   -8.508  -21.841 1.00 3.38 ? 147 TRP B NE1  4  
ATOM 7929  C CE2  . TRP B 2 3   ? 5.416   -7.553  -21.390 1.00 3.73 ? 147 TRP B CE2  4  
ATOM 7930  C CE3  . TRP B 2 3   ? 5.314   -5.390  -20.312 1.00 3.97 ? 147 TRP B CE3  4  
ATOM 7931  C CZ2  . TRP B 2 3   ? 6.807   -7.523  -21.416 1.00 4.39 ? 147 TRP B CZ2  4  
ATOM 7932  C CZ3  . TRP B 2 3   ? 6.695   -5.364  -20.340 1.00 4.60 ? 147 TRP B CZ3  4  
ATOM 7933  C CH2  . TRP B 2 3   ? 7.427   -6.425  -20.885 1.00 4.76 ? 147 TRP B CH2  4  
ATOM 7934  H H    . TRP B 2 3   ? 0.002   -5.045  -19.542 1.00 2.51 ? 147 TRP B H    4  
ATOM 7935  H HE1  . TRP B 2 3   ? 4.789   -9.356  -22.271 1.00 3.63 ? 147 TRP B HE1  4  
ATOM 7936  N N    . ILE B 2 4   ? 2.721   -4.799  -17.725 1.00 3.10 ? 148 ILE B N    4  
ATOM 7937  C CA   . ILE B 2 4   ? 3.700   -4.350  -16.745 1.00 3.51 ? 148 ILE B CA   4  
ATOM 7938  C C    . ILE B 2 4   ? 3.395   -4.936  -15.370 1.00 3.20 ? 148 ILE B C    4  
ATOM 7939  O O    . ILE B 2 4   ? 4.295   -5.411  -14.680 1.00 3.08 ? 148 ILE B O    4  
ATOM 7940  C CB   . ILE B 2 4   ? 3.766   -2.811  -16.658 1.00 4.34 ? 148 ILE B CB   4  
ATOM 7941  C CG1  . ILE B 2 4   ? 3.796   -2.206  -18.065 1.00 4.68 ? 148 ILE B CG1  4  
ATOM 7942  C CG2  . ILE B 2 4   ? 5.002   -2.386  -15.882 1.00 4.81 ? 148 ILE B CG2  4  
ATOM 7943  C CD1  . ILE B 2 4   ? 3.864   -0.694  -18.085 1.00 5.45 ? 148 ILE B CD1  4  
ATOM 7944  H H    . ILE B 2 4   ? 2.092   -4.153  -18.101 1.00 3.34 ? 148 ILE B H    4  
ATOM 7945  N N    . ALA B 2 5   ? 2.120   -4.922  -14.995 1.00 3.18 ? 149 ALA B N    4  
ATOM 7946  C CA   . ALA B 2 5   ? 1.677   -5.461  -13.710 1.00 3.15 ? 149 ALA B CA   4  
ATOM 7947  C C    . ALA B 2 5   ? 2.102   -6.915  -13.548 1.00 2.43 ? 149 ALA B C    4  
ATOM 7948  O O    . ALA B 2 5   ? 2.432   -7.356  -12.449 1.00 2.45 ? 149 ALA B O    4  
ATOM 7949  C CB   . ALA B 2 5   ? 0.167   -5.339  -13.572 1.00 3.53 ? 149 ALA B CB   4  
ATOM 7950  H H    . ALA B 2 5   ? 1.453   -4.520  -15.595 1.00 3.30 ? 149 ALA B H    4  
ATOM 7951  N N    . GLN B 2 6   ? 2.099   -7.649  -14.654 1.00 1.86 ? 150 GLN B N    4  
ATOM 7952  C CA   . GLN B 2 6   ? 2.492   -9.050  -14.649 1.00 1.28 ? 150 GLN B CA   4  
ATOM 7953  C C    . GLN B 2 6   ? 3.954   -9.200  -14.230 1.00 1.15 ? 150 GLN B C    4  
ATOM 7954  O O    . GLN B 2 6   ? 4.309   -10.102 -13.467 1.00 0.98 ? 150 GLN B O    4  
ATOM 7955  C CB   . GLN B 2 6   ? 2.258   -9.666  -16.031 1.00 1.05 ? 150 GLN B CB   4  
ATOM 7956  C CG   . GLN B 2 6   ? 2.537   -11.158 -16.110 1.00 1.34 ? 150 GLN B CG   4  
ATOM 7957  C CD   . GLN B 2 6   ? 1.926   -11.794 -17.342 1.00 1.76 ? 150 GLN B CD   4  
ATOM 7958  O OE1  . GLN B 2 6   ? 0.881   -11.359 -17.826 1.00 1.81 ? 150 GLN B OE1  4  
ATOM 7959  N NE2  . GLN B 2 6   ? 2.575   -12.823 -17.860 1.00 2.39 ? 150 GLN B NE2  4  
ATOM 7960  H H    . GLN B 2 6   ? 1.818   -7.236  -15.499 1.00 1.92 ? 150 GLN B H    4  
ATOM 7961  H HE21 . GLN B 2 6   ? 3.407   -13.112 -17.431 1.00 2.51 ? 150 GLN B HE21 4  
ATOM 7962  H HE22 . GLN B 2 6   ? 2.193   -13.262 -18.647 1.00 2.81 ? 150 GLN B HE22 4  
ATOM 7963  N N    . GLU B 2 7   ? 4.798   -8.309  -14.724 1.00 1.59 ? 151 GLU B N    4  
ATOM 7964  C CA   . GLU B 2 7   ? 6.212   -8.341  -14.389 1.00 1.93 ? 151 GLU B CA   4  
ATOM 7965  C C    . GLU B 2 7   ? 6.438   -7.732  -13.009 1.00 2.05 ? 151 GLU B C    4  
ATOM 7966  O O    . GLU B 2 7   ? 7.170   -8.284  -12.184 1.00 1.93 ? 151 GLU B O    4  
ATOM 7967  C CB   . GLU B 2 7   ? 7.030   -7.590  -15.445 1.00 2.71 ? 151 GLU B CB   4  
ATOM 7968  C CG   . GLU B 2 7   ? 8.512   -7.480  -15.123 1.00 3.38 ? 151 GLU B CG   4  
ATOM 7969  C CD   . GLU B 2 7   ? 9.175   -8.828  -14.929 1.00 3.37 ? 151 GLU B CD   4  
ATOM 7970  O OE1  . GLU B 2 7   ? 9.228   -9.614  -15.901 1.00 3.26 ? 151 GLU B OE1  4  
ATOM 7971  O OE2  . GLU B 2 7   ? 9.663   -9.104  -13.812 1.00 3.77 ? 151 GLU B OE2  4  
ATOM 7972  H H    . GLU B 2 7   ? 4.462   -7.608  -15.322 1.00 1.84 ? 151 GLU B H    4  
ATOM 7973  N N    . LEU B 2 8   ? 5.786   -6.604  -12.756 1.00 2.45 ? 152 LEU B N    4  
ATOM 7974  C CA   . LEU B 2 8   ? 5.915   -5.913  -11.480 1.00 2.86 ? 152 LEU B CA   4  
ATOM 7975  C C    . LEU B 2 8   ? 5.472   -6.797  -10.322 1.00 2.48 ? 152 LEU B C    4  
ATOM 7976  O O    . LEU B 2 8   ? 6.060   -6.749  -9.238  1.00 2.62 ? 152 LEU B O    4  
ATOM 7977  C CB   . LEU B 2 8   ? 5.165   -4.580  -11.492 1.00 3.54 ? 152 LEU B CB   4  
ATOM 7978  C CG   . LEU B 2 8   ? 5.639   -3.566  -12.540 1.00 4.02 ? 152 LEU B CG   4  
ATOM 7979  C CD1  . LEU B 2 8   ? 4.996   -2.212  -12.318 1.00 4.62 ? 152 LEU B CD1  4  
ATOM 7980  C CD2  . LEU B 2 8   ? 7.154   -3.442  -12.538 1.00 4.35 ? 152 LEU B CD2  4  
ATOM 7981  H H    . LEU B 2 8   ? 5.202   -6.220  -13.452 1.00 2.58 ? 152 LEU B H    4  
ATOM 7982  N N    . ARG B 2 9   ? 4.443   -7.608  -10.557 1.00 2.13 ? 153 ARG B N    4  
ATOM 7983  C CA   . ARG B 2 9   ? 3.952   -8.529  -9.545  1.00 2.11 ? 153 ARG B CA   4  
ATOM 7984  C C    . ARG B 2 9   ? 5.079   -9.475  -9.152  1.00 1.51 ? 153 ARG B C    4  
ATOM 7985  O O    . ARG B 2 9   ? 5.304   -9.731  -7.974  1.00 1.66 ? 153 ARG B O    4  
ATOM 7986  C CB   . ARG B 2 9   ? 2.757   -9.333  -10.072 1.00 2.28 ? 153 ARG B CB   4  
ATOM 7987  C CG   . ARG B 2 9   ? 2.005   -10.096 -8.993  1.00 2.79 ? 153 ARG B CG   4  
ATOM 7988  C CD   . ARG B 2 9   ? 1.531   -11.453 -9.486  1.00 3.22 ? 153 ARG B CD   4  
ATOM 7989  N NE   . ARG B 2 9   ? 0.353   -11.362 -10.349 1.00 3.39 ? 153 ARG B NE   4  
ATOM 7990  C CZ   . ARG B 2 9   ? -0.609  -12.284 -10.390 1.00 3.88 ? 153 ARG B CZ   4  
ATOM 7991  N NH1  . ARG B 2 9   ? -0.532  -13.369 -9.631  1.00 4.32 ? 153 ARG B NH1  4  
ATOM 7992  N NH2  . ARG B 2 9   ? -1.645  -12.122 -11.198 1.00 4.17 ? 153 ARG B NH2  4  
ATOM 7993  H H    . ARG B 2 9   ? 3.994   -7.575  -11.432 1.00 2.05 ? 153 ARG B H    4  
ATOM 7994  H HE   . ARG B 2 9   ? 0.276   -10.571 -10.933 1.00 3.35 ? 153 ARG B HE   4  
ATOM 7995  H HH11 . ARG B 2 9   ? 0.251   -13.507 -9.025  1.00 4.33 ? 153 ARG B HH11 4  
ATOM 7996  H HH12 . ARG B 2 9   ? -1.271  -14.066 -9.661  1.00 4.80 ? 153 ARG B HH12 4  
ATOM 7997  H HH21 . ARG B 2 9   ? -1.708  -11.308 -11.781 1.00 4.15 ? 153 ARG B HH21 4  
ATOM 7998  H HH22 . ARG B 2 9   ? -2.370  -12.815 -11.233 1.00 4.58 ? 153 ARG B HH22 4  
ATOM 7999  N N    . ARG B 2 10  ? 5.811   -9.953  -10.155 1.00 1.01 ? 154 ARG B N    4  
ATOM 8000  C CA   . ARG B 2 10  ? 6.926   -10.861 -9.931  1.00 0.90 ? 154 ARG B CA   4  
ATOM 8001  C C    . ARG B 2 10  ? 8.040   -10.152 -9.169  1.00 1.04 ? 154 ARG B C    4  
ATOM 8002  O O    . ARG B 2 10  ? 8.635   -10.718 -8.257  1.00 1.02 ? 154 ARG B O    4  
ATOM 8003  C CB   . ARG B 2 10  ? 7.466   -11.388 -11.264 1.00 1.34 ? 154 ARG B CB   4  
ATOM 8004  C CG   . ARG B 2 10  ? 8.609   -12.381 -11.118 1.00 2.01 ? 154 ARG B CG   4  
ATOM 8005  C CD   . ARG B 2 10  ? 9.741   -12.085 -12.094 1.00 2.84 ? 154 ARG B CD   4  
ATOM 8006  N NE   . ARG B 2 10  ? 10.427  -10.822 -11.797 1.00 3.10 ? 154 ARG B NE   4  
ATOM 8007  C CZ   . ARG B 2 10  ? 11.349  -10.676 -10.840 1.00 3.57 ? 154 ARG B CZ   4  
ATOM 8008  N NH1  . ARG B 2 10  ? 11.703  -11.708 -10.085 1.00 3.71 ? 154 ARG B NH1  4  
ATOM 8009  N NH2  . ARG B 2 10  ? 11.944  -9.507  -10.650 1.00 4.07 ? 154 ARG B NH2  4  
ATOM 8010  H H    . ARG B 2 10  ? 5.600   -9.679  -11.070 1.00 1.06 ? 154 ARG B H    4  
ATOM 8011  H HE   . ARG B 2 10  ? 10.186  -10.037 -12.357 1.00 3.07 ? 154 ARG B HE   4  
ATOM 8012  H HH11 . ARG B 2 10  ? 11.280  -12.608 -10.226 1.00 3.54 ? 154 ARG B HH11 4  
ATOM 8013  H HH12 . ARG B 2 10  ? 12.394  -11.590 -9.368  1.00 4.08 ? 154 ARG B HH12 4  
ATOM 8014  H HH21 . ARG B 2 10  ? 11.708  -8.718  -11.226 1.00 4.11 ? 154 ARG B HH21 4  
ATOM 8015  H HH22 . ARG B 2 10  ? 12.633  -9.406  -9.922  1.00 4.49 ? 154 ARG B HH22 4  
ATOM 8016  N N    . ILE B 2 11  ? 8.308   -8.904  -9.543  1.00 1.56 ? 155 ILE B N    4  
ATOM 8017  C CA   . ILE B 2 11  ? 9.347   -8.109  -8.894  1.00 2.08 ? 155 ILE B CA   4  
ATOM 8018  C C    . ILE B 2 11  ? 9.068   -7.966  -7.394  1.00 2.01 ? 155 ILE B C    4  
ATOM 8019  O O    . ILE B 2 11  ? 9.982   -8.060  -6.569  1.00 2.10 ? 155 ILE B O    4  
ATOM 8020  C CB   . ILE B 2 11  ? 9.493   -6.715  -9.546  1.00 2.96 ? 155 ILE B CB   4  
ATOM 8021  C CG1  . ILE B 2 11  ? 9.846   -6.856  -11.032 1.00 3.16 ? 155 ILE B CG1  4  
ATOM 8022  C CG2  . ILE B 2 11  ? 10.551  -5.887  -8.828  1.00 3.62 ? 155 ILE B CG2  4  
ATOM 8023  C CD1  . ILE B 2 11  ? 9.990   -5.535  -11.760 1.00 3.96 ? 155 ILE B CD1  4  
ATOM 8024  H H    . ILE B 2 11  ? 7.794   -8.508  -10.281 1.00 1.71 ? 155 ILE B H    4  
ATOM 8025  N N    . GLY B 2 12  ? 7.801   -7.744  -7.052  1.00 2.07 ? 156 GLY B N    4  
ATOM 8026  C CA   . GLY B 2 12  ? 7.416   -7.610  -5.661  1.00 2.48 ? 156 GLY B CA   4  
ATOM 8027  C C    . GLY B 2 12  ? 7.315   -8.958  -4.973  1.00 2.14 ? 156 GLY B C    4  
ATOM 8028  O O    . GLY B 2 12  ? 7.685   -9.098  -3.808  1.00 2.57 ? 156 GLY B O    4  
ATOM 8029  H H    . GLY B 2 12  ? 7.121   -7.661  -7.757  1.00 2.00 ? 156 GLY B H    4  
ATOM 8030  N N    . ASP B 2 13  ? 6.825   -9.953  -5.707  1.00 1.53 ? 157 ASP B N    4  
ATOM 8031  C CA   . ASP B 2 13  ? 6.670   -11.307 -5.183  1.00 1.56 ? 157 ASP B CA   4  
ATOM 8032  C C    . ASP B 2 13  ? 8.028   -11.917 -4.863  1.00 1.01 ? 157 ASP B C    4  
ATOM 8033  O O    . ASP B 2 13  ? 8.195   -12.596 -3.851  1.00 1.21 ? 157 ASP B O    4  
ATOM 8034  C CB   . ASP B 2 13  ? 5.928   -12.186 -6.190  1.00 1.82 ? 157 ASP B CB   4  
ATOM 8035  C CG   . ASP B 2 13  ? 5.422   -13.474 -5.582  1.00 2.23 ? 157 ASP B CG   4  
ATOM 8036  O OD1  . ASP B 2 13  ? 4.957   -13.444 -4.426  1.00 2.73 ? 157 ASP B OD1  4  
ATOM 8037  O OD2  . ASP B 2 13  ? 5.469   -14.519 -6.265  1.00 2.40 ? 157 ASP B OD2  4  
ATOM 8038  H H    . ASP B 2 13  ? 6.553   -9.771  -6.634  1.00 1.27 ? 157 ASP B H    4  
ATOM 8039  N N    . GLU B 2 14  ? 8.990   -11.660 -5.738  1.00 0.71 ? 158 GLU B N    4  
ATOM 8040  C CA   . GLU B 2 14  ? 10.350  -12.146 -5.570  1.00 1.05 ? 158 GLU B CA   4  
ATOM 8041  C C    . GLU B 2 14  ? 10.929  -11.653 -4.247  1.00 1.29 ? 158 GLU B C    4  
ATOM 8042  O O    . GLU B 2 14  ? 11.551  -12.413 -3.508  1.00 1.29 ? 158 GLU B O    4  
ATOM 8043  C CB   . GLU B 2 14  ? 11.203  -11.672 -6.747  1.00 1.84 ? 158 GLU B CB   4  
ATOM 8044  C CG   . GLU B 2 14  ? 12.704  -11.774 -6.547  1.00 2.74 ? 158 GLU B CG   4  
ATOM 8045  C CD   . GLU B 2 14  ? 13.406  -10.504 -6.978  1.00 3.59 ? 158 GLU B CD   4  
ATOM 8046  O OE1  . GLU B 2 14  ? 13.283  -10.122 -8.165  1.00 4.27 ? 158 GLU B OE1  4  
ATOM 8047  O OE2  . GLU B 2 14  ? 14.051  -9.858  -6.127  1.00 3.85 ? 158 GLU B OE2  4  
ATOM 8048  H H    . GLU B 2 14  ? 8.774   -11.137 -6.540  1.00 0.77 ? 158 GLU B H    4  
ATOM 8049  N N    . PHE B 2 15  ? 10.695  -10.382 -3.936  1.00 1.81 ? 159 PHE B N    4  
ATOM 8050  C CA   . PHE B 2 15  ? 11.189  -9.803  -2.695  1.00 2.48 ? 159 PHE B CA   4  
ATOM 8051  C C    . PHE B 2 15  ? 10.381  -10.326 -1.514  1.00 2.47 ? 159 PHE B C    4  
ATOM 8052  O O    . PHE B 2 15  ? 10.901  -10.494 -0.410  1.00 2.90 ? 159 PHE B O    4  
ATOM 8053  C CB   . PHE B 2 15  ? 11.142  -8.276  -2.748  1.00 3.29 ? 159 PHE B CB   4  
ATOM 8054  C CG   . PHE B 2 15  ? 11.954  -7.608  -1.677  1.00 3.63 ? 159 PHE B CG   4  
ATOM 8055  C CD1  . PHE B 2 15  ? 13.326  -7.470  -1.816  1.00 3.87 ? 159 PHE B CD1  4  
ATOM 8056  C CD2  . PHE B 2 15  ? 11.349  -7.119  -0.532  1.00 4.07 ? 159 PHE B CD2  4  
ATOM 8057  C CE1  . PHE B 2 15  ? 14.080  -6.859  -0.834  1.00 4.37 ? 159 PHE B CE1  4  
ATOM 8058  C CE2  . PHE B 2 15  ? 12.097  -6.506  0.455   1.00 4.53 ? 159 PHE B CE2  4  
ATOM 8059  C CZ   . PHE B 2 15  ? 13.464  -6.376  0.304   1.00 4.61 ? 159 PHE B CZ   4  
ATOM 8060  H H    . PHE B 2 15  ? 10.176  -9.826  -4.551  1.00 1.86 ? 159 PHE B H    4  
ATOM 8061  N N    . ASN B 2 16  ? 9.107   -10.596 -1.763  1.00 2.24 ? 160 ASN B N    4  
ATOM 8062  C CA   . ASN B 2 16  ? 8.218   -11.120 -0.736  1.00 2.65 ? 160 ASN B CA   4  
ATOM 8063  C C    . ASN B 2 16  ? 8.688   -12.505 -0.305  1.00 2.24 ? 160 ASN B C    4  
ATOM 8064  O O    . ASN B 2 16  ? 8.710   -12.816 0.882   1.00 2.59 ? 160 ASN B O    4  
ATOM 8065  C CB   . ASN B 2 16  ? 6.780   -11.192 -1.259  1.00 2.97 ? 160 ASN B CB   4  
ATOM 8066  C CG   . ASN B 2 16  ? 5.722   -11.310 -0.170  1.00 3.76 ? 160 ASN B CG   4  
ATOM 8067  O OD1  . ASN B 2 16  ? 4.657   -10.701 -0.267  1.00 4.03 ? 160 ASN B OD1  4  
ATOM 8068  N ND2  . ASN B 2 16  ? 5.980   -12.112 0.856   1.00 4.32 ? 160 ASN B ND2  4  
ATOM 8069  H H    . ASN B 2 16  ? 8.753   -10.434 -2.664  1.00 1.99 ? 160 ASN B H    4  
ATOM 8070  H HD21 . ASN B 2 16  ? 6.838   -12.596 0.870   1.00 4.25 ? 160 ASN B HD21 4  
ATOM 8071  H HD22 . ASN B 2 16  ? 5.301   -12.195 1.559   1.00 4.87 ? 160 ASN B HD22 4  
ATOM 8072  N N    . ALA B 2 17  ? 9.070   -13.321 -1.278  1.00 1.59 ? 161 ALA B N    4  
ATOM 8073  C CA   . ALA B 2 17  ? 9.547   -14.675 -1.005  1.00 1.42 ? 161 ALA B CA   4  
ATOM 8074  C C    . ALA B 2 17  ? 11.003  -14.657 -0.548  1.00 1.04 ? 161 ALA B C    4  
ATOM 8075  O O    . ALA B 2 17  ? 11.528  -15.657 -0.059  1.00 1.12 ? 161 ALA B O    4  
ATOM 8076  C CB   . ALA B 2 17  ? 9.377   -15.560 -2.233  1.00 1.66 ? 161 ALA B CB   4  
ATOM 8077  H H    . ALA B 2 17  ? 9.020   -13.009 -2.212  1.00 1.37 ? 161 ALA B H    4  
ATOM 8078  N N    . TYR B 2 18  ? 11.650  -13.514 -0.720  1.00 1.36 ? 162 TYR B N    4  
ATOM 8079  C CA   . TYR B 2 18  ? 13.041  -13.348 -0.321  1.00 1.82 ? 162 TYR B CA   4  
ATOM 8080  C C    . TYR B 2 18  ? 13.124  -12.949 1.150   1.00 2.42 ? 162 TYR B C    4  
ATOM 8081  O O    . TYR B 2 18  ? 14.088  -13.271 1.840   1.00 2.52 ? 162 TYR B O    4  
ATOM 8082  C CB   . TYR B 2 18  ? 13.720  -12.295 -1.208  1.00 2.45 ? 162 TYR B CB   4  
ATOM 8083  C CG   . TYR B 2 18  ? 15.112  -11.893 -0.771  1.00 3.23 ? 162 TYR B CG   4  
ATOM 8084  C CD1  . TYR B 2 18  ? 16.161  -12.803 -0.791  1.00 3.36 ? 162 TYR B CD1  4  
ATOM 8085  C CD2  . TYR B 2 18  ? 15.374  -10.599 -0.341  1.00 4.05 ? 162 TYR B CD2  4  
ATOM 8086  C CE1  . TYR B 2 18  ? 17.432  -12.434 -0.393  1.00 4.18 ? 162 TYR B CE1  4  
ATOM 8087  C CE2  . TYR B 2 18  ? 16.640  -10.222 0.057   1.00 4.79 ? 162 TYR B CE2  4  
ATOM 8088  C CZ   . TYR B 2 18  ? 17.666  -11.143 0.029   1.00 4.82 ? 162 TYR B CZ   4  
ATOM 8089  O OH   . TYR B 2 18  ? 18.929  -10.771 0.426   1.00 5.64 ? 162 TYR B OH   4  
ATOM 8090  H H    . TYR B 2 18  ? 11.179  -12.762 -1.137  1.00 1.62 ? 162 TYR B H    4  
ATOM 8091  H HH   . TYR B 2 18  ? 19.564  -11.015 -0.258  1.00 5.90 ? 162 TYR B HH   4  
ATOM 8092  N N    . TYR B 2 19  ? 12.097  -12.265 1.629   1.00 3.05 ? 163 TYR B N    4  
ATOM 8093  C CA   . TYR B 2 19  ? 12.059  -11.822 3.015   1.00 3.89 ? 163 TYR B CA   4  
ATOM 8094  C C    . TYR B 2 19  ? 11.039  -12.618 3.823   1.00 4.14 ? 163 TYR B C    4  
ATOM 8095  O O    . TYR B 2 19  ? 10.627  -12.198 4.906   1.00 4.36 ? 163 TYR B O    4  
ATOM 8096  C CB   . TYR B 2 19  ? 11.741  -10.327 3.084   1.00 4.80 ? 163 TYR B CB   4  
ATOM 8097  C CG   . TYR B 2 19  ? 12.789  -9.508  3.805   1.00 5.20 ? 163 TYR B CG   4  
ATOM 8098  C CD1  . TYR B 2 19  ? 13.897  -9.012  3.131   1.00 5.29 ? 163 TYR B CD1  4  
ATOM 8099  C CD2  . TYR B 2 19  ? 12.664  -9.227  5.161   1.00 5.67 ? 163 TYR B CD2  4  
ATOM 8100  C CE1  . TYR B 2 19  ? 14.853  -8.260  3.787   1.00 5.82 ? 163 TYR B CE1  4  
ATOM 8101  C CE2  . TYR B 2 19  ? 13.615  -8.477  5.823   1.00 6.11 ? 163 TYR B CE2  4  
ATOM 8102  C CZ   . TYR B 2 19  ? 14.707  -7.995  5.133   1.00 6.18 ? 163 TYR B CZ   4  
ATOM 8103  O OH   . TYR B 2 19  ? 15.656  -7.246  5.792   1.00 6.75 ? 163 TYR B OH   4  
ATOM 8104  H H    . TYR B 2 19  ? 11.346  -12.048 1.036   1.00 3.03 ? 163 TYR B H    4  
ATOM 8105  H HH   . TYR B 2 19  ? 15.926  -6.504  5.237   1.00 7.02 ? 163 TYR B HH   4  
ATOM 8106  N N    . ALA B 2 20  ? 10.632  -13.766 3.294   1.00 4.36 ? 164 ALA B N    4  
ATOM 8107  C CA   . ALA B 2 20  ? 9.665   -14.624 3.967   1.00 4.99 ? 164 ALA B CA   4  
ATOM 8108  C C    . ALA B 2 20  ? 9.759   -16.046 3.425   1.00 5.11 ? 164 ALA B C    4  
ATOM 8109  O O    . ALA B 2 20  ? 8.713   -16.639 3.098   1.00 5.31 ? 164 ALA B O    4  
ATOM 8110  C CB   . ALA B 2 20  ? 8.252   -14.075 3.818   1.00 5.92 ? 164 ALA B CB   4  
ATOM 8111  O OXT  . ALA B 2 20  ? 10.895  -16.556 3.318   1.00 5.35 ? 164 ALA B OXT  4  
ATOM 8112  H H    . ALA B 2 20  ? 10.998  -14.053 2.431   1.00 4.24 ? 164 ALA B H    4  
ATOM 8113  N N    . MET A 1 1   ? 39.482  1.242   -2.061  1.00 1.33 ? 1   MET A N    5  
ATOM 8114  C CA   . MET A 1 1   ? 40.115  2.573   -2.218  1.00 1.17 ? 1   MET A CA   5  
ATOM 8115  C C    . MET A 1 1   ? 39.090  3.695   -2.059  1.00 1.10 ? 1   MET A C    5  
ATOM 8116  O O    . MET A 1 1   ? 39.375  4.725   -1.448  1.00 1.14 ? 1   MET A O    5  
ATOM 8117  C CB   . MET A 1 1   ? 40.815  2.664   -3.573  1.00 1.33 ? 1   MET A CB   5  
ATOM 8118  C CG   . MET A 1 1   ? 41.445  4.012   -3.872  1.00 1.59 ? 1   MET A CG   5  
ATOM 8119  S SD   . MET A 1 1   ? 42.212  4.051   -5.501  1.00 1.94 ? 1   MET A SD   5  
ATOM 8120  C CE   . MET A 1 1   ? 42.544  5.801   -5.674  1.00 2.23 ? 1   MET A CE   5  
ATOM 8121  H H1   . MET A 1 1   ? 40.208  0.516   -1.897  1.00 1.41 ? 1   MET A H1   5  
ATOM 8122  H H2   . MET A 1 1   ? 38.951  0.993   -2.920  1.00 1.51 ? 1   MET A H2   5  
ATOM 8123  H H3   . MET A 1 1   ? 38.828  1.248   -1.254  1.00 1.44 ? 1   MET A H3   5  
ATOM 8124  N N    . ASP A 1 2   ? 37.894  3.490   -2.601  1.00 1.05 ? 2   ASP A N    5  
ATOM 8125  C CA   . ASP A 1 2   ? 36.824  4.483   -2.520  1.00 1.04 ? 2   ASP A CA   5  
ATOM 8126  C C    . ASP A 1 2   ? 36.329  4.672   -1.089  1.00 1.05 ? 2   ASP A C    5  
ATOM 8127  O O    . ASP A 1 2   ? 35.894  5.758   -0.713  1.00 1.09 ? 2   ASP A O    5  
ATOM 8128  C CB   . ASP A 1 2   ? 35.656  4.106   -3.440  1.00 1.07 ? 2   ASP A CB   5  
ATOM 8129  C CG   . ASP A 1 2   ? 35.121  2.712   -3.174  1.00 1.10 ? 2   ASP A CG   5  
ATOM 8130  O OD1  . ASP A 1 2   ? 35.686  1.743   -3.721  1.00 1.21 ? 2   ASP A OD1  5  
ATOM 8131  O OD2  . ASP A 1 2   ? 34.148  2.571   -2.404  1.00 1.29 ? 2   ASP A OD2  5  
ATOM 8132  H H    . ASP A 1 2   ? 37.724  2.649   -3.081  1.00 1.07 ? 2   ASP A H    5  
ATOM 8133  N N    . GLY A 1 3   ? 36.413  3.615   -0.289  1.00 1.07 ? 3   GLY A N    5  
ATOM 8134  C CA   . GLY A 1 3   ? 35.968  3.688   1.091   1.00 1.14 ? 3   GLY A CA   5  
ATOM 8135  C C    . GLY A 1 3   ? 36.878  4.547   1.944   1.00 1.16 ? 3   GLY A C    5  
ATOM 8136  O O    . GLY A 1 3   ? 36.473  5.043   2.993   1.00 1.23 ? 3   GLY A O    5  
ATOM 8137  H H    . GLY A 1 3   ? 36.773  2.773   -0.640  1.00 1.07 ? 3   GLY A H    5  
ATOM 8138  N N    . SER A 1 4   ? 38.112  4.726   1.489   1.00 1.16 ? 4   SER A N    5  
ATOM 8139  C CA   . SER A 1 4   ? 39.084  5.533   2.207   1.00 1.23 ? 4   SER A CA   5  
ATOM 8140  C C    . SER A 1 4   ? 39.063  6.972   1.693   1.00 1.23 ? 4   SER A C    5  
ATOM 8141  O O    . SER A 1 4   ? 39.886  7.801   2.087   1.00 1.35 ? 4   SER A O    5  
ATOM 8142  C CB   . SER A 1 4   ? 40.480  4.929   2.042   1.00 1.34 ? 4   SER A CB   5  
ATOM 8143  O OG   . SER A 1 4   ? 40.453  3.528   2.261   1.00 1.40 ? 4   SER A OG   5  
ATOM 8144  H H    . SER A 1 4   ? 38.376  4.302   0.646   1.00 1.14 ? 4   SER A H    5  
ATOM 8145  H HG   . SER A 1 4   ? 39.546  3.207   2.179   1.00 1.44 ? 4   SER A HG   5  
ATOM 8146  N N    . GLY A 1 5   ? 38.108  7.257   0.815   1.00 1.19 ? 5   GLY A N    5  
ATOM 8147  C CA   . GLY A 1 5   ? 37.982  8.584   0.249   1.00 1.24 ? 5   GLY A CA   5  
ATOM 8148  C C    . GLY A 1 5   ? 37.052  9.465   1.057   1.00 1.22 ? 5   GLY A C    5  
ATOM 8149  O O    . GLY A 1 5   ? 36.710  9.138   2.197   1.00 1.30 ? 5   GLY A O    5  
ATOM 8150  H H    . GLY A 1 5   ? 37.471  6.557   0.555   1.00 1.17 ? 5   GLY A H    5  
ATOM 8151  N N    . GLU A 1 6   ? 36.623  10.568  0.464   1.00 1.26 ? 6   GLU A N    5  
ATOM 8152  C CA   . GLU A 1 6   ? 35.735  11.506  1.134   1.00 1.28 ? 6   GLU A CA   5  
ATOM 8153  C C    . GLU A 1 6   ? 34.280  11.078  1.010   1.00 1.22 ? 6   GLU A C    5  
ATOM 8154  O O    . GLU A 1 6   ? 33.663  11.248  -0.043  1.00 1.34 ? 6   GLU A O    5  
ATOM 8155  C CB   . GLU A 1 6   ? 35.901  12.911  0.554   1.00 1.49 ? 6   GLU A CB   5  
ATOM 8156  C CG   . GLU A 1 6   ? 37.147  13.647  1.016   1.00 1.57 ? 6   GLU A CG   5  
ATOM 8157  C CD   . GLU A 1 6   ? 37.264  15.024  0.396   1.00 1.62 ? 6   GLU A CD   5  
ATOM 8158  O OE1  . GLU A 1 6   ? 36.218  15.638  0.091   1.00 2.00 ? 6   GLU A OE1  5  
ATOM 8159  O OE2  . GLU A 1 6   ? 38.401  15.496  0.198   1.00 1.87 ? 6   GLU A OE2  5  
ATOM 8160  H H    . GLU A 1 6   ? 36.900  10.749  -0.460  1.00 1.37 ? 6   GLU A H    5  
ATOM 8161  N N    . GLN A 1 7   ? 33.737  10.517  2.077   1.00 1.15 ? 7   GLN A N    5  
ATOM 8162  C CA   . GLN A 1 7   ? 32.347  10.086  2.087   1.00 1.12 ? 7   GLN A CA   5  
ATOM 8163  C C    . GLN A 1 7   ? 31.574  10.798  3.191   1.00 1.11 ? 7   GLN A C    5  
ATOM 8164  O O    . GLN A 1 7   ? 31.792  10.551  4.378   1.00 1.15 ? 7   GLN A O    5  
ATOM 8165  C CB   . GLN A 1 7   ? 32.236  8.567   2.225   1.00 1.12 ? 7   GLN A CB   5  
ATOM 8166  C CG   . GLN A 1 7   ? 32.678  7.810   0.985   1.00 1.27 ? 7   GLN A CG   5  
ATOM 8167  C CD   . GLN A 1 7   ? 32.309  6.342   1.028   1.00 1.35 ? 7   GLN A CD   5  
ATOM 8168  O OE1  . GLN A 1 7   ? 31.315  5.954   1.644   1.00 1.63 ? 7   GLN A OE1  5  
ATOM 8169  N NE2  . GLN A 1 7   ? 33.107  5.516   0.372   1.00 1.60 ? 7   GLN A NE2  5  
ATOM 8170  H H    . GLN A 1 7   ? 34.281  10.393  2.883   1.00 1.20 ? 7   GLN A H    5  
ATOM 8171  H HE21 . GLN A 1 7   ? 33.884  5.895   -0.096  1.00 1.78 ? 7   GLN A HE21 5  
ATOM 8172  H HE22 . GLN A 1 7   ? 32.885  4.562   0.370   1.00 1.81 ? 7   GLN A HE22 5  
ATOM 8173  N N    . PRO A 1 8   ? 30.672  11.711  2.808   1.00 1.13 ? 8   PRO A N    5  
ATOM 8174  C CA   . PRO A 1 8   ? 29.865  12.484  3.752   1.00 1.17 ? 8   PRO A CA   5  
ATOM 8175  C C    . PRO A 1 8   ? 28.732  11.653  4.343   1.00 1.11 ? 8   PRO A C    5  
ATOM 8176  O O    . PRO A 1 8   ? 27.621  11.636  3.805   1.00 1.12 ? 8   PRO A O    5  
ATOM 8177  C CB   . PRO A 1 8   ? 29.291  13.628  2.898   1.00 1.26 ? 8   PRO A CB   5  
ATOM 8178  C CG   . PRO A 1 8   ? 29.905  13.484  1.541   1.00 1.27 ? 8   PRO A CG   5  
ATOM 8179  C CD   . PRO A 1 8   ? 30.359  12.060  1.420   1.00 1.18 ? 8   PRO A CD   5  
ATOM 8180  N N    . ARG A 1 9   ? 29.036  10.947  5.438   1.00 1.09 ? 9   ARG A N    5  
ATOM 8181  C CA   . ARG A 1 9   ? 28.069  10.097  6.136   1.00 1.07 ? 9   ARG A CA   5  
ATOM 8182  C C    . ARG A 1 9   ? 27.746  8.837   5.330   1.00 1.00 ? 9   ARG A C    5  
ATOM 8183  O O    . ARG A 1 9   ? 28.000  7.718   5.779   1.00 1.16 ? 9   ARG A O    5  
ATOM 8184  C CB   . ARG A 1 9   ? 26.793  10.869  6.511   1.00 1.15 ? 9   ARG A CB   5  
ATOM 8185  C CG   . ARG A 1 9   ? 25.675  10.009  7.079   1.00 1.28 ? 9   ARG A CG   5  
ATOM 8186  C CD   . ARG A 1 9   ? 24.458  10.852  7.428   1.00 1.41 ? 9   ARG A CD   5  
ATOM 8187  N NE   . ARG A 1 9   ? 23.292  10.031  7.748   1.00 1.46 ? 9   ARG A NE   5  
ATOM 8188  C CZ   . ARG A 1 9   ? 22.226  10.477  8.412   1.00 1.62 ? 9   ARG A CZ   5  
ATOM 8189  N NH1  . ARG A 1 9   ? 22.197  11.725  8.862   1.00 1.92 ? 9   ARG A NH1  5  
ATOM 8190  N NH2  . ARG A 1 9   ? 21.192  9.673   8.624   1.00 1.99 ? 9   ARG A NH2  5  
ATOM 8191  H H    . ARG A 1 9   ? 29.958  10.988  5.779   1.00 1.13 ? 9   ARG A H    5  
ATOM 8192  H HE   . ARG A 1 9   ? 23.303  9.095   7.440   1.00 1.78 ? 9   ARG A HE   5  
ATOM 8193  H HH11 . ARG A 1 9   ? 22.973  12.336  8.705   1.00 2.02 ? 9   ARG A HH11 5  
ATOM 8194  H HH12 . ARG A 1 9   ? 21.395  12.062  9.368   1.00 2.32 ? 9   ARG A HH12 5  
ATOM 8195  H HH21 . ARG A 1 9   ? 21.208  8.727   8.288   1.00 2.25 ? 9   ARG A HH21 5  
ATOM 8196  H HH22 . ARG A 1 9   ? 20.388  10.003  9.124   1.00 2.24 ? 9   ARG A HH22 5  
ATOM 8197  N N    . GLY A 1 10  ? 27.209  9.026   4.135   1.00 0.97 ? 10  GLY A N    5  
ATOM 8198  C CA   . GLY A 1 10  ? 26.863  7.910   3.289   1.00 0.99 ? 10  GLY A CA   5  
ATOM 8199  C C    . GLY A 1 10  ? 27.005  8.257   1.825   1.00 0.97 ? 10  GLY A C    5  
ATOM 8200  O O    . GLY A 1 10  ? 27.256  9.412   1.478   1.00 1.29 ? 10  GLY A O    5  
ATOM 8201  H H    . GLY A 1 10  ? 27.061  9.947   3.813   1.00 1.08 ? 10  GLY A H    5  
ATOM 8202  N N    . GLY A 1 11  ? 26.844  7.263   0.969   1.00 0.95 ? 11  GLY A N    5  
ATOM 8203  C CA   . GLY A 1 11  ? 26.955  7.486   -0.454  1.00 0.94 ? 11  GLY A CA   5  
ATOM 8204  C C    . GLY A 1 11  ? 25.673  7.134   -1.178  1.00 0.92 ? 11  GLY A C    5  
ATOM 8205  O O    . GLY A 1 11  ? 25.001  6.168   -0.820  1.00 1.14 ? 11  GLY A O    5  
ATOM 8206  H H    . GLY A 1 11  ? 26.638  6.364   1.307   1.00 1.17 ? 11  GLY A H    5  
ATOM 8207  N N    . GLY A 1 12  ? 25.332  7.916   -2.190  1.00 0.92 ? 12  GLY A N    5  
ATOM 8208  C CA   . GLY A 1 12  ? 24.120  7.659   -2.943  1.00 0.92 ? 12  GLY A CA   5  
ATOM 8209  C C    . GLY A 1 12  ? 24.407  7.312   -4.391  1.00 0.84 ? 12  GLY A C    5  
ATOM 8210  O O    . GLY A 1 12  ? 24.555  8.209   -5.220  1.00 0.92 ? 12  GLY A O    5  
ATOM 8211  H H    . GLY A 1 12  ? 25.909  8.671   -2.433  1.00 1.07 ? 12  GLY A H    5  
ATOM 8212  N N    . PRO A 1 13  ? 24.526  6.013   -4.715  1.00 0.80 ? 13  PRO A N    5  
ATOM 8213  C CA   . PRO A 1 13  ? 24.793  5.554   -6.078  1.00 0.83 ? 13  PRO A CA   5  
ATOM 8214  C C    . PRO A 1 13  ? 23.514  5.465   -6.907  1.00 0.79 ? 13  PRO A C    5  
ATOM 8215  O O    . PRO A 1 13  ? 23.399  6.081   -7.966  1.00 0.91 ? 13  PRO A O    5  
ATOM 8216  C CB   . PRO A 1 13  ? 25.387  4.146   -5.876  1.00 0.94 ? 13  PRO A CB   5  
ATOM 8217  C CG   . PRO A 1 13  ? 25.406  3.905   -4.396  1.00 1.01 ? 13  PRO A CG   5  
ATOM 8218  C CD   . PRO A 1 13  ? 24.446  4.885   -3.784  1.00 0.87 ? 13  PRO A CD   5  
ATOM 8219  N N    . THR A 1 14  ? 22.551  4.696   -6.421  1.00 0.77 ? 14  THR A N    5  
ATOM 8220  C CA   . THR A 1 14  ? 21.284  4.529   -7.109  1.00 0.75 ? 14  THR A CA   5  
ATOM 8221  C C    . THR A 1 14  ? 20.131  4.839   -6.159  1.00 0.73 ? 14  THR A C    5  
ATOM 8222  O O    . THR A 1 14  ? 20.333  4.942   -4.950  1.00 0.98 ? 14  THR A O    5  
ATOM 8223  C CB   . THR A 1 14  ? 21.137  3.098   -7.687  1.00 0.85 ? 14  THR A CB   5  
ATOM 8224  O OG1  . THR A 1 14  ? 19.993  3.031   -8.548  1.00 0.86 ? 14  THR A OG1  5  
ATOM 8225  C CG2  . THR A 1 14  ? 20.997  2.063   -6.578  1.00 0.95 ? 14  THR A CG2  5  
ATOM 8226  H H    . THR A 1 14  ? 22.692  4.232   -5.571  1.00 0.89 ? 14  THR A H    5  
ATOM 8227  H HG1  . THR A 1 14  ? 20.278  2.797   -9.436  1.00 1.00 ? 14  THR A HG1  5  
ATOM 8228  N N    . SER A 1 15  ? 18.931  5.015   -6.701  1.00 0.62 ? 15  SER A N    5  
ATOM 8229  C CA   . SER A 1 15  ? 17.766  5.320   -5.877  1.00 0.65 ? 15  SER A CA   5  
ATOM 8230  C C    . SER A 1 15  ? 16.485  4.733   -6.466  1.00 0.60 ? 15  SER A C    5  
ATOM 8231  O O    . SER A 1 15  ? 15.704  4.102   -5.758  1.00 0.60 ? 15  SER A O    5  
ATOM 8232  C CB   . SER A 1 15  ? 17.613  6.836   -5.713  1.00 0.80 ? 15  SER A CB   5  
ATOM 8233  O OG   . SER A 1 15  ? 18.872  7.452   -5.499  1.00 0.99 ? 15  SER A OG   5  
ATOM 8234  H H    . SER A 1 15  ? 18.828  4.938   -7.673  1.00 0.69 ? 15  SER A H    5  
ATOM 8235  H HG   . SER A 1 15  ? 19.450  6.834   -5.035  1.00 0.99 ? 15  SER A HG   5  
ATOM 8236  N N    . SER A 1 16  ? 16.300  4.933   -7.765  1.00 0.61 ? 16  SER A N    5  
ATOM 8237  C CA   . SER A 1 16  ? 15.115  4.470   -8.482  1.00 0.62 ? 16  SER A CA   5  
ATOM 8238  C C    . SER A 1 16  ? 14.737  3.017   -8.188  1.00 0.55 ? 16  SER A C    5  
ATOM 8239  O O    . SER A 1 16  ? 13.715  2.750   -7.553  1.00 0.61 ? 16  SER A O    5  
ATOM 8240  C CB   . SER A 1 16  ? 15.327  4.680   -9.979  1.00 0.68 ? 16  SER A CB   5  
ATOM 8241  O OG   . SER A 1 16  ? 16.714  4.762   -10.272 1.00 0.85 ? 16  SER A OG   5  
ATOM 8242  H H    . SER A 1 16  ? 16.986  5.418   -8.272  1.00 0.66 ? 16  SER A H    5  
ATOM 8243  H HG   . SER A 1 16  ? 16.863  4.500   -11.188 1.00 1.04 ? 16  SER A HG   5  
ATOM 8244  N N    . GLU A 1 17  ? 15.568  2.084   -8.639  1.00 0.50 ? 17  GLU A N    5  
ATOM 8245  C CA   . GLU A 1 17  ? 15.307  0.660   -8.449  1.00 0.49 ? 17  GLU A CA   5  
ATOM 8246  C C    . GLU A 1 17  ? 15.346  0.263   -6.974  1.00 0.49 ? 17  GLU A C    5  
ATOM 8247  O O    . GLU A 1 17  ? 14.630  -0.643  -6.547  1.00 0.51 ? 17  GLU A O    5  
ATOM 8248  C CB   . GLU A 1 17  ? 16.300  -0.178  -9.256  1.00 0.55 ? 17  GLU A CB   5  
ATOM 8249  C CG   . GLU A 1 17  ? 15.768  -1.541  -9.672  1.00 0.75 ? 17  GLU A CG   5  
ATOM 8250  C CD   . GLU A 1 17  ? 14.497  -1.446  -10.495 1.00 0.97 ? 17  GLU A CD   5  
ATOM 8251  O OE1  . GLU A 1 17  ? 14.553  -0.912  -11.623 1.00 1.23 ? 17  GLU A OE1  5  
ATOM 8252  O OE2  . GLU A 1 17  ? 13.439  -1.913  -10.023 1.00 1.11 ? 17  GLU A OE2  5  
ATOM 8253  H H    . GLU A 1 17  ? 16.376  2.359   -9.118  1.00 0.53 ? 17  GLU A H    5  
ATOM 8254  N N    . GLN A 1 18  ? 16.168  0.955   -6.195  1.00 0.52 ? 18  GLN A N    5  
ATOM 8255  C CA   . GLN A 1 18  ? 16.291  0.658   -4.774  1.00 0.58 ? 18  GLN A CA   5  
ATOM 8256  C C    . GLN A 1 18  ? 14.976  0.930   -4.048  1.00 0.60 ? 18  GLN A C    5  
ATOM 8257  O O    . GLN A 1 18  ? 14.547  0.138   -3.207  1.00 0.64 ? 18  GLN A O    5  
ATOM 8258  C CB   . GLN A 1 18  ? 17.437  1.455   -4.145  1.00 0.68 ? 18  GLN A CB   5  
ATOM 8259  C CG   . GLN A 1 18  ? 17.907  0.898   -2.809  1.00 0.82 ? 18  GLN A CG   5  
ATOM 8260  C CD   . GLN A 1 18  ? 17.486  1.756   -1.635  1.00 0.96 ? 18  GLN A CD   5  
ATOM 8261  O OE1  . GLN A 1 18  ? 18.231  2.630   -1.195  1.00 1.27 ? 18  GLN A OE1  5  
ATOM 8262  N NE2  . GLN A 1 18  ? 16.290  1.512   -1.120  1.00 1.14 ? 18  GLN A NE2  5  
ATOM 8263  H H    . GLN A 1 18  ? 16.695  1.684   -6.581  1.00 0.53 ? 18  GLN A H    5  
ATOM 8264  H HE21 . GLN A 1 18  ? 15.748  0.798   -1.521  1.00 1.15 ? 18  GLN A HE21 5  
ATOM 8265  H HE22 . GLN A 1 18  ? 15.995  2.056   -0.360  1.00 1.42 ? 18  GLN A HE22 5  
ATOM 8266  N N    . ILE A 1 19  ? 14.339  2.050   -4.382  1.00 0.60 ? 19  ILE A N    5  
ATOM 8267  C CA   . ILE A 1 19  ? 13.067  2.427   -3.772  1.00 0.66 ? 19  ILE A CA   5  
ATOM 8268  C C    . ILE A 1 19  ? 11.981  1.415   -4.134  1.00 0.63 ? 19  ILE A C    5  
ATOM 8269  O O    . ILE A 1 19  ? 11.133  1.066   -3.306  1.00 0.67 ? 19  ILE A O    5  
ATOM 8270  C CB   . ILE A 1 19  ? 12.635  3.856   -4.194  1.00 0.73 ? 19  ILE A CB   5  
ATOM 8271  C CG1  . ILE A 1 19  ? 13.552  4.900   -3.542  1.00 0.78 ? 19  ILE A CG1  5  
ATOM 8272  C CG2  . ILE A 1 19  ? 11.179  4.125   -3.828  1.00 0.77 ? 19  ILE A CG2  5  
ATOM 8273  C CD1  . ILE A 1 19  ? 13.334  6.312   -4.039  1.00 0.85 ? 19  ILE A CD1  5  
ATOM 8274  H H    . ILE A 1 19  ? 14.739  2.643   -5.058  1.00 0.58 ? 19  ILE A H    5  
ATOM 8275  N N    . MET A 1 20  ? 12.032  0.932   -5.369  1.00 0.59 ? 20  MET A N    5  
ATOM 8276  C CA   . MET A 1 20  ? 11.070  -0.051  -5.851  1.00 0.60 ? 20  MET A CA   5  
ATOM 8277  C C    . MET A 1 20  ? 11.132  -1.315  -5.000  1.00 0.56 ? 20  MET A C    5  
ATOM 8278  O O    . MET A 1 20  ? 10.105  -1.911  -4.671  1.00 0.57 ? 20  MET A O    5  
ATOM 8279  C CB   . MET A 1 20  ? 11.349  -0.393  -7.315  1.00 0.61 ? 20  MET A CB   5  
ATOM 8280  C CG   . MET A 1 20  ? 10.471  -1.503  -7.879  1.00 0.71 ? 20  MET A CG   5  
ATOM 8281  S SD   . MET A 1 20  ? 8.922   -0.895  -8.577  1.00 0.96 ? 20  MET A SD   5  
ATOM 8282  C CE   . MET A 1 20  ? 7.909   -0.746  -7.104  1.00 1.64 ? 20  MET A CE   5  
ATOM 8283  H H    . MET A 1 20  ? 12.738  1.246   -5.976  1.00 0.57 ? 20  MET A H    5  
ATOM 8284  N N    . LYS A 1 21  ? 12.347  -1.703  -4.632  1.00 0.55 ? 21  LYS A N    5  
ATOM 8285  C CA   . LYS A 1 21  ? 12.559  -2.886  -3.812  1.00 0.55 ? 21  LYS A CA   5  
ATOM 8286  C C    . LYS A 1 21  ? 11.942  -2.699  -2.428  1.00 0.51 ? 21  LYS A C    5  
ATOM 8287  O O    . LYS A 1 21  ? 11.344  -3.623  -1.871  1.00 0.51 ? 21  LYS A O    5  
ATOM 8288  C CB   . LYS A 1 21  ? 14.053  -3.196  -3.698  1.00 0.58 ? 21  LYS A CB   5  
ATOM 8289  C CG   . LYS A 1 21  ? 14.691  -3.667  -4.998  1.00 0.63 ? 21  LYS A CG   5  
ATOM 8290  C CD   . LYS A 1 21  ? 13.982  -4.898  -5.546  1.00 0.69 ? 21  LYS A CD   5  
ATOM 8291  C CE   . LYS A 1 21  ? 14.691  -5.453  -6.770  1.00 0.83 ? 21  LYS A CE   5  
ATOM 8292  N NZ   . LYS A 1 21  ? 13.949  -6.592  -7.380  1.00 1.15 ? 21  LYS A NZ   5  
ATOM 8293  H H    . LYS A 1 21  ? 13.123  -1.176  -4.922  1.00 0.55 ? 21  LYS A H    5  
ATOM 8294  H HZ1  . LYS A 1 21  ? 14.475  -6.968  -8.193  1.00 1.46 ? 21  LYS A HZ1  5  
ATOM 8295  H HZ2  . LYS A 1 21  ? 13.013  -6.277  -7.701  1.00 1.69 ? 21  LYS A HZ2  5  
ATOM 8296  H HZ3  . LYS A 1 21  ? 13.826  -7.360  -6.677  1.00 1.26 ? 21  LYS A HZ3  5  
ATOM 8297  N N    . THR A 1 22  ? 12.073  -1.493  -1.887  1.00 0.52 ? 22  THR A N    5  
ATOM 8298  C CA   . THR A 1 22  ? 11.522  -1.179  -0.577  1.00 0.51 ? 22  THR A CA   5  
ATOM 8299  C C    . THR A 1 22  ? 10.000  -1.278  -0.610  1.00 0.52 ? 22  THR A C    5  
ATOM 8300  O O    . THR A 1 22  ? 9.372   -1.712  0.358   1.00 0.52 ? 22  THR A O    5  
ATOM 8301  C CB   . THR A 1 22  ? 11.930  0.239   -0.136  1.00 0.56 ? 22  THR A CB   5  
ATOM 8302  O OG1  . THR A 1 22  ? 13.288  0.480   -0.530  1.00 0.63 ? 22  THR A OG1  5  
ATOM 8303  C CG2  . THR A 1 22  ? 11.816  0.383   1.374   1.00 0.71 ? 22  THR A CG2  5  
ATOM 8304  H H    . THR A 1 22  ? 12.551  -0.793  -2.385  1.00 0.55 ? 22  THR A H    5  
ATOM 8305  H HG1  . THR A 1 22  ? 13.829  -0.287  -0.302  1.00 0.88 ? 22  THR A HG1  5  
ATOM 8306  N N    . GLY A 1 23  ? 9.417   -0.885  -1.740  1.00 0.55 ? 23  GLY A N    5  
ATOM 8307  C CA   . GLY A 1 23  ? 7.978   -0.945  -1.898  1.00 0.58 ? 23  GLY A CA   5  
ATOM 8308  C C    . GLY A 1 23  ? 7.456   -2.368  -1.821  1.00 0.56 ? 23  GLY A C    5  
ATOM 8309  O O    . GLY A 1 23  ? 6.393   -2.614  -1.250  1.00 0.58 ? 23  GLY A O    5  
ATOM 8310  H H    . GLY A 1 23  ? 9.974   -0.541  -2.473  1.00 0.55 ? 23  GLY A H    5  
ATOM 8311  N N    . ALA A 1 24  ? 8.213   -3.305  -2.382  1.00 0.56 ? 24  ALA A N    5  
ATOM 8312  C CA   . ALA A 1 24  ? 7.829   -4.713  -2.372  1.00 0.58 ? 24  ALA A CA   5  
ATOM 8313  C C    . ALA A 1 24  ? 7.815   -5.254  -0.947  1.00 0.55 ? 24  ALA A C    5  
ATOM 8314  O O    . ALA A 1 24  ? 6.968   -6.073  -0.587  1.00 0.73 ? 24  ALA A O    5  
ATOM 8315  C CB   . ALA A 1 24  ? 8.772   -5.532  -3.242  1.00 0.61 ? 24  ALA A CB   5  
ATOM 8316  H H    . ALA A 1 24  ? 9.056   -3.044  -2.814  1.00 0.58 ? 24  ALA A H    5  
ATOM 8317  N N    . LEU A 1 25  ? 8.760   -4.782  -0.141  1.00 0.44 ? 25  LEU A N    5  
ATOM 8318  C CA   . LEU A 1 25  ? 8.859   -5.200  1.249   1.00 0.40 ? 25  LEU A CA   5  
ATOM 8319  C C    . LEU A 1 25  ? 7.746   -4.560  2.074   1.00 0.39 ? 25  LEU A C    5  
ATOM 8320  O O    . LEU A 1 25  ? 7.158   -5.203  2.944   1.00 0.40 ? 25  LEU A O    5  
ATOM 8321  C CB   . LEU A 1 25  ? 10.235  -4.833  1.816   1.00 0.40 ? 25  LEU A CB   5  
ATOM 8322  C CG   . LEU A 1 25  ? 10.534  -5.280  3.251   1.00 0.45 ? 25  LEU A CG   5  
ATOM 8323  C CD1  . LEU A 1 25  ? 10.175  -6.743  3.450   1.00 0.61 ? 25  LEU A CD1  5  
ATOM 8324  C CD2  . LEU A 1 25  ? 12.001  -5.042  3.584   1.00 0.48 ? 25  LEU A CD2  5  
ATOM 8325  H H    . LEU A 1 25  ? 9.412   -4.140  -0.496  1.00 0.48 ? 25  LEU A H    5  
ATOM 8326  N N    . LEU A 1 26  ? 7.460   -3.293  1.786   1.00 0.39 ? 26  LEU A N    5  
ATOM 8327  C CA   . LEU A 1 26  ? 6.413   -2.559  2.490   1.00 0.40 ? 26  LEU A CA   5  
ATOM 8328  C C    . LEU A 1 26  ? 5.058   -3.221  2.297   1.00 0.44 ? 26  LEU A C    5  
ATOM 8329  O O    . LEU A 1 26  ? 4.320   -3.436  3.260   1.00 0.45 ? 26  LEU A O    5  
ATOM 8330  C CB   . LEU A 1 26  ? 6.357   -1.108  2.009   1.00 0.43 ? 26  LEU A CB   5  
ATOM 8331  C CG   . LEU A 1 26  ? 7.419   -0.172  2.580   1.00 0.42 ? 26  LEU A CG   5  
ATOM 8332  C CD1  . LEU A 1 26  ? 7.320   1.202   1.937   1.00 0.49 ? 26  LEU A CD1  5  
ATOM 8333  C CD2  . LEU A 1 26  ? 7.274   -0.067  4.089   1.00 0.39 ? 26  LEU A CD2  5  
ATOM 8334  H H    . LEU A 1 26  ? 7.971   -2.836  1.084   1.00 0.40 ? 26  LEU A H    5  
ATOM 8335  N N    . LEU A 1 27  ? 4.741   -3.555  1.050   1.00 0.49 ? 27  LEU A N    5  
ATOM 8336  C CA   . LEU A 1 27  ? 3.475   -4.197  0.730   1.00 0.56 ? 27  LEU A CA   5  
ATOM 8337  C C    . LEU A 1 27  ? 3.351   -5.541  1.440   1.00 0.57 ? 27  LEU A C    5  
ATOM 8338  O O    . LEU A 1 27  ? 2.293   -5.870  1.977   1.00 0.61 ? 27  LEU A O    5  
ATOM 8339  C CB   . LEU A 1 27  ? 3.313   -4.374  -0.783  1.00 0.63 ? 27  LEU A CB   5  
ATOM 8340  C CG   . LEU A 1 27  ? 2.416   -3.357  -1.498  1.00 0.67 ? 27  LEU A CG   5  
ATOM 8341  C CD1  . LEU A 1 27  ? 1.012   -3.362  -0.910  1.00 0.71 ? 27  LEU A CD1  5  
ATOM 8342  C CD2  . LEU A 1 27  ? 3.022   -1.960  -1.445  1.00 0.64 ? 27  LEU A CD2  5  
ATOM 8343  H H    . LEU A 1 27  ? 5.380   -3.370  0.326   1.00 0.50 ? 27  LEU A H    5  
ATOM 8344  N N    . GLN A 1 28  ? 4.441   -6.303  1.454   1.00 0.56 ? 28  GLN A N    5  
ATOM 8345  C CA   . GLN A 1 28  ? 4.450   -7.605  2.108   1.00 0.59 ? 28  GLN A CA   5  
ATOM 8346  C C    . GLN A 1 28  ? 4.208   -7.456  3.606   1.00 0.56 ? 28  GLN A C    5  
ATOM 8347  O O    . GLN A 1 28  ? 3.328   -8.109  4.166   1.00 0.60 ? 28  GLN A O    5  
ATOM 8348  C CB   . GLN A 1 28  ? 5.776   -8.331  1.867   1.00 0.64 ? 28  GLN A CB   5  
ATOM 8349  C CG   . GLN A 1 28  ? 5.915   -9.630  2.648   1.00 0.99 ? 28  GLN A CG   5  
ATOM 8350  C CD   . GLN A 1 28  ? 7.353   -10.083 2.792   1.00 1.17 ? 28  GLN A CD   5  
ATOM 8351  O OE1  . GLN A 1 28  ? 8.277   -9.277  2.752   1.00 1.46 ? 28  GLN A OE1  5  
ATOM 8352  N NE2  . GLN A 1 28  ? 7.549   -11.379 2.966   1.00 1.53 ? 28  GLN A NE2  5  
ATOM 8353  H H    . GLN A 1 28  ? 5.260   -5.978  1.020   1.00 0.55 ? 28  GLN A H    5  
ATOM 8354  H HE21 . GLN A 1 28  ? 6.766   -11.966 2.994   1.00 1.80 ? 28  GLN A HE21 5  
ATOM 8355  H HE22 . GLN A 1 28  ? 8.469   -11.700 3.058   1.00 1.74 ? 28  GLN A HE22 5  
ATOM 8356  N N    . GLY A 1 29  ? 4.983   -6.580  4.238   1.00 0.54 ? 29  GLY A N    5  
ATOM 8357  C CA   . GLY A 1 29  ? 4.858   -6.354  5.667   1.00 0.54 ? 29  GLY A CA   5  
ATOM 8358  C C    . GLY A 1 29  ? 3.468   -5.911  6.077   1.00 0.51 ? 29  GLY A C    5  
ATOM 8359  O O    . GLY A 1 29  ? 2.902   -6.446  7.030   1.00 0.53 ? 29  GLY A O    5  
ATOM 8360  H H    . GLY A 1 29  ? 5.656   -6.076  3.723   1.00 0.56 ? 29  GLY A H    5  
ATOM 8361  N N    . PHE A 1 30  ? 2.915   -4.951  5.348   1.00 0.50 ? 30  PHE A N    5  
ATOM 8362  C CA   . PHE A 1 30  ? 1.585   -4.429  5.643   1.00 0.51 ? 30  PHE A CA   5  
ATOM 8363  C C    . PHE A 1 30  ? 0.524   -5.526  5.568   1.00 0.51 ? 30  PHE A C    5  
ATOM 8364  O O    . PHE A 1 30  ? -0.336  -5.634  6.447   1.00 0.55 ? 30  PHE A O    5  
ATOM 8365  C CB   . PHE A 1 30  ? 1.237   -3.279  4.691   1.00 0.54 ? 30  PHE A CB   5  
ATOM 8366  C CG   . PHE A 1 30  ? 0.053   -2.461  5.124   1.00 0.54 ? 30  PHE A CG   5  
ATOM 8367  C CD1  . PHE A 1 30  ? 0.073   -1.765  6.321   1.00 0.85 ? 30  PHE A CD1  5  
ATOM 8368  C CD2  . PHE A 1 30  ? -1.079  -2.386  4.329   1.00 0.83 ? 30  PHE A CD2  5  
ATOM 8369  C CE1  . PHE A 1 30  ? -1.014  -1.010  6.720   1.00 0.85 ? 30  PHE A CE1  5  
ATOM 8370  C CE2  . PHE A 1 30  ? -2.171  -1.632  4.720   1.00 0.90 ? 30  PHE A CE2  5  
ATOM 8371  C CZ   . PHE A 1 30  ? -2.138  -0.944  5.918   1.00 0.65 ? 30  PHE A CZ   5  
ATOM 8372  H H    . PHE A 1 30  ? 3.420   -4.574  4.592   1.00 0.51 ? 30  PHE A H    5  
ATOM 8373  N N    . ILE A 1 31  ? 0.597   -6.347  4.524   1.00 0.50 ? 31  ILE A N    5  
ATOM 8374  C CA   . ILE A 1 31  ? -0.360  -7.432  4.338   1.00 0.52 ? 31  ILE A CA   5  
ATOM 8375  C C    . ILE A 1 31  ? -0.164  -8.525  5.387   1.00 0.53 ? 31  ILE A C    5  
ATOM 8376  O O    . ILE A 1 31  ? -1.121  -8.958  6.025   1.00 0.56 ? 31  ILE A O    5  
ATOM 8377  C CB   . ILE A 1 31  ? -0.282  -8.042  2.919   1.00 0.54 ? 31  ILE A CB   5  
ATOM 8378  C CG1  . ILE A 1 31  ? -0.660  -6.992  1.868   1.00 0.54 ? 31  ILE A CG1  5  
ATOM 8379  C CG2  . ILE A 1 31  ? -1.188  -9.263  2.802   1.00 0.58 ? 31  ILE A CG2  5  
ATOM 8380  C CD1  . ILE A 1 31  ? -0.451  -7.450  0.437   1.00 0.57 ? 31  ILE A CD1  5  
ATOM 8381  H H    . ILE A 1 31  ? 1.312   -6.219  3.862   1.00 0.49 ? 31  ILE A H    5  
ATOM 8382  N N    . GLN A 1 32  ? 1.085   -8.946  5.575   1.00 0.53 ? 32  GLN A N    5  
ATOM 8383  C CA   . GLN A 1 32  ? 1.416   -9.994  6.541   1.00 0.55 ? 32  GLN A CA   5  
ATOM 8384  C C    . GLN A 1 32  ? 0.979   -9.621  7.955   1.00 0.54 ? 32  GLN A C    5  
ATOM 8385  O O    . GLN A 1 32  ? 0.394   -10.436 8.669   1.00 0.57 ? 32  GLN A O    5  
ATOM 8386  C CB   . GLN A 1 32  ? 2.918   -10.287 6.523   1.00 0.57 ? 32  GLN A CB   5  
ATOM 8387  C CG   . GLN A 1 32  ? 3.376   -11.123 5.338   1.00 0.68 ? 32  GLN A CG   5  
ATOM 8388  C CD   . GLN A 1 32  ? 3.058   -12.597 5.502   1.00 0.90 ? 32  GLN A CD   5  
ATOM 8389  O OE1  . GLN A 1 32  ? 3.099   -13.137 6.607   1.00 1.07 ? 32  GLN A OE1  5  
ATOM 8390  N NE2  . GLN A 1 32  ? 2.742   -13.260 4.402   1.00 1.12 ? 32  GLN A NE2  5  
ATOM 8391  H H    . GLN A 1 32  ? 1.811   -8.536  5.049   1.00 0.52 ? 32  GLN A H    5  
ATOM 8392  H HE21 . GLN A 1 32  ? 2.734   -12.772 3.552   1.00 1.19 ? 32  GLN A HE21 5  
ATOM 8393  H HE22 . GLN A 1 32  ? 2.522   -14.215 4.482   1.00 1.31 ? 32  GLN A HE22 5  
ATOM 8394  N N    . ASP A 1 33  ? 1.249   -8.382  8.344   1.00 0.53 ? 33  ASP A N    5  
ATOM 8395  C CA   . ASP A 1 33  ? 0.896   -7.900  9.675   1.00 0.55 ? 33  ASP A CA   5  
ATOM 8396  C C    . ASP A 1 33  ? -0.608  -7.969  9.933   1.00 0.58 ? 33  ASP A C    5  
ATOM 8397  O O    . ASP A 1 33  ? -1.049  -8.378  11.010  1.00 0.65 ? 33  ASP A O    5  
ATOM 8398  C CB   . ASP A 1 33  ? 1.398   -6.469  9.870   1.00 0.57 ? 33  ASP A CB   5  
ATOM 8399  C CG   . ASP A 1 33  ? 0.969   -5.875  11.194  1.00 0.61 ? 33  ASP A CG   5  
ATOM 8400  O OD1  . ASP A 1 33  ? -0.126  -5.280  11.259  1.00 0.74 ? 33  ASP A OD1  5  
ATOM 8401  O OD2  . ASP A 1 33  ? 1.725   -5.998  12.183  1.00 0.73 ? 33  ASP A OD2  5  
ATOM 8402  H H    . ASP A 1 33  ? 1.701   -7.769  7.718   1.00 0.53 ? 33  ASP A H    5  
ATOM 8403  N N    . ARG A 1 34  ? -1.397  -7.578  8.943   1.00 0.58 ? 34  ARG A N    5  
ATOM 8404  C CA   . ARG A 1 34  ? -2.846  -7.592  9.087   1.00 0.63 ? 34  ARG A CA   5  
ATOM 8405  C C    . ARG A 1 34  ? -3.426  -8.991  8.894   1.00 0.62 ? 34  ARG A C    5  
ATOM 8406  O O    . ARG A 1 34  ? -4.485  -9.313  9.436   1.00 0.67 ? 34  ARG A O    5  
ATOM 8407  C CB   . ARG A 1 34  ? -3.507  -6.568  8.162   1.00 0.67 ? 34  ARG A CB   5  
ATOM 8408  C CG   . ARG A 1 34  ? -4.106  -5.375  8.899   1.00 0.74 ? 34  ARG A CG   5  
ATOM 8409  C CD   . ARG A 1 34  ? -3.081  -4.699  9.801   1.00 0.73 ? 34  ARG A CD   5  
ATOM 8410  N NE   . ARG A 1 34  ? -3.658  -4.311  11.093  1.00 0.75 ? 34  ARG A NE   5  
ATOM 8411  C CZ   . ARG A 1 34  ? -3.492  -5.000  12.224  1.00 0.74 ? 34  ARG A CZ   5  
ATOM 8412  N NH1  . ARG A 1 34  ? -2.687  -6.057  12.257  1.00 0.77 ? 34  ARG A NH1  5  
ATOM 8413  N NH2  . ARG A 1 34  ? -4.098  -4.597  13.334  1.00 0.85 ? 34  ARG A NH2  5  
ATOM 8414  H H    . ARG A 1 34  ? -0.997  -7.275  8.099   1.00 0.56 ? 34  ARG A H    5  
ATOM 8415  H HE   . ARG A 1 34  ? -4.220  -3.493  11.114  1.00 0.86 ? 34  ARG A HE   5  
ATOM 8416  H HH11 . ARG A 1 34  ? -2.189  -6.341  11.432  1.00 0.74 ? 34  ARG A HH11 5  
ATOM 8417  H HH12 . ARG A 1 34  ? -2.571  -6.577  13.109  1.00 0.90 ? 34  ARG A HH12 5  
ATOM 8418  H HH21 . ARG A 1 34  ? -4.677  -3.764  13.322  1.00 0.91 ? 34  ARG A HH21 5  
ATOM 8419  H HH22 . ARG A 1 34  ? -3.992  -5.115  14.192  1.00 0.93 ? 34  ARG A HH22 5  
ATOM 8420  N N    . ALA A 1 35  ? -2.720  -9.825  8.138   1.00 0.61 ? 35  ALA A N    5  
ATOM 8421  C CA   . ALA A 1 35  ? -3.162  -11.196 7.889   1.00 0.64 ? 35  ALA A CA   5  
ATOM 8422  C C    . ALA A 1 35  ? -3.016  -12.042 9.146   1.00 0.66 ? 35  ALA A C    5  
ATOM 8423  O O    . ALA A 1 35  ? -3.669  -13.080 9.293   1.00 0.68 ? 35  ALA A O    5  
ATOM 8424  C CB   . ALA A 1 35  ? -2.384  -11.813 6.739   1.00 0.65 ? 35  ALA A CB   5  
ATOM 8425  H H    . ALA A 1 35  ? -1.885  -9.507  7.723   1.00 0.61 ? 35  ALA A H    5  
ATOM 8426  N N    . GLY A 1 36  ? -2.183  -11.569 10.069  1.00 0.69 ? 36  GLY A N    5  
ATOM 8427  C CA   . GLY A 1 36  ? -1.952  -12.275 11.317  1.00 0.76 ? 36  GLY A CA   5  
ATOM 8428  C C    . GLY A 1 36  ? -3.157  -12.246 12.244  1.00 0.78 ? 36  GLY A C    5  
ATOM 8429  O O    . GLY A 1 36  ? -3.091  -12.729 13.373  1.00 0.89 ? 36  GLY A O    5  
ATOM 8430  H H    . GLY A 1 36  ? -1.708  -10.728 9.894   1.00 0.70 ? 36  GLY A H    5  
ATOM 8431  N N    . ARG A 1 37  ? -4.256  -11.667 11.772  1.00 0.75 ? 37  ARG A N    5  
ATOM 8432  C CA   . ARG A 1 37  ? -5.484  -11.595 12.550  1.00 0.81 ? 37  ARG A CA   5  
ATOM 8433  C C    . ARG A 1 37  ? -6.376  -12.799 12.258  1.00 0.79 ? 37  ARG A C    5  
ATOM 8434  O O    . ARG A 1 37  ? -7.445  -12.954 12.851  1.00 0.88 ? 37  ARG A O    5  
ATOM 8435  C CB   . ARG A 1 37  ? -6.236  -10.297 12.237  1.00 0.86 ? 37  ARG A CB   5  
ATOM 8436  C CG   . ARG A 1 37  ? -5.764  -9.092  13.037  1.00 1.17 ? 37  ARG A CG   5  
ATOM 8437  C CD   . ARG A 1 37  ? -5.978  -7.789  12.276  1.00 1.23 ? 37  ARG A CD   5  
ATOM 8438  N NE   . ARG A 1 37  ? -7.396  -7.494  12.043  1.00 1.18 ? 37  ARG A NE   5  
ATOM 8439  C CZ   . ARG A 1 37  ? -7.920  -6.264  12.089  1.00 1.28 ? 37  ARG A CZ   5  
ATOM 8440  N NH1  . ARG A 1 37  ? -7.163  -5.224  12.414  1.00 1.35 ? 37  ARG A NH1  5  
ATOM 8441  N NH2  . ARG A 1 37  ? -9.209  -6.081  11.816  1.00 1.73 ? 37  ARG A NH2  5  
ATOM 8442  H H    . ARG A 1 37  ? -4.236  -11.270 10.874  1.00 0.71 ? 37  ARG A H    5  
ATOM 8443  H HE   . ARG A 1 37  ? -7.985  -8.256  11.827  1.00 1.43 ? 37  ARG A HE   5  
ATOM 8444  H HH11 . ARG A 1 37  ? -6.193  -5.351  12.627  1.00 1.52 ? 37  ARG A HH11 5  
ATOM 8445  H HH12 . ARG A 1 37  ? -7.559  -4.301  12.453  1.00 1.52 ? 37  ARG A HH12 5  
ATOM 8446  H HH21 . ARG A 1 37  ? -9.790  -6.864  11.574  1.00 2.07 ? 37  ARG A HH21 5  
ATOM 8447  H HH22 . ARG A 1 37  ? -9.609  -5.157  11.853  1.00 1.89 ? 37  ARG A HH22 5  
ATOM 8448  N N    . MET A 1 38  ? -5.925  -13.655 11.345  1.00 0.74 ? 38  MET A N    5  
ATOM 8449  C CA   . MET A 1 38  ? -6.687  -14.836 10.964  1.00 0.75 ? 38  MET A CA   5  
ATOM 8450  C C    . MET A 1 38  ? -6.159  -16.089 11.660  1.00 0.77 ? 38  MET A C    5  
ATOM 8451  O O    . MET A 1 38  ? -6.897  -16.766 12.378  1.00 1.03 ? 38  MET A O    5  
ATOM 8452  C CB   . MET A 1 38  ? -6.673  -15.018 9.443   1.00 0.76 ? 38  MET A CB   5  
ATOM 8453  C CG   . MET A 1 38  ? -7.108  -13.783 8.670   1.00 0.86 ? 38  MET A CG   5  
ATOM 8454  S SD   . MET A 1 38  ? -8.771  -13.231 9.107   1.00 1.19 ? 38  MET A SD   5  
ATOM 8455  C CE   . MET A 1 38  ? -8.853  -11.669 8.226   1.00 1.48 ? 38  MET A CE   5  
ATOM 8456  H H    . MET A 1 38  ? -5.053  -13.491 10.923  1.00 0.74 ? 38  MET A H    5  
ATOM 8457  N N    . GLY A 1 39  ? -4.884  -16.393 11.448  1.00 0.76 ? 39  GLY A N    5  
ATOM 8458  C CA   . GLY A 1 39  ? -4.286  -17.563 12.060  1.00 0.78 ? 39  GLY A CA   5  
ATOM 8459  C C    . GLY A 1 39  ? -3.164  -18.137 11.216  1.00 0.80 ? 39  GLY A C    5  
ATOM 8460  O O    . GLY A 1 39  ? -2.408  -17.388 10.595  1.00 1.17 ? 39  GLY A O    5  
ATOM 8461  H H    . GLY A 1 39  ? -4.341  -15.820 10.869  1.00 0.92 ? 39  GLY A H    5  
ATOM 8462  N N    . GLY A 1 40  ? -3.061  -19.461 11.178  1.00 0.84 ? 40  GLY A N    5  
ATOM 8463  C CA   . GLY A 1 40  ? -2.024  -20.106 10.398  1.00 0.88 ? 40  GLY A CA   5  
ATOM 8464  C C    . GLY A 1 40  ? -2.318  -21.575 10.176  1.00 0.88 ? 40  GLY A C    5  
ATOM 8465  O O    . GLY A 1 40  ? -2.911  -22.225 11.036  1.00 1.11 ? 40  GLY A O    5  
ATOM 8466  H H    . GLY A 1 40  ? -3.700  -20.009 11.682  1.00 1.11 ? 40  GLY A H    5  
ATOM 8467  N N    . GLU A 1 41  ? -1.891  -22.103 9.035   1.00 0.82 ? 41  GLU A N    5  
ATOM 8468  C CA   . GLU A 1 41  ? -2.123  -23.506 8.702   1.00 0.87 ? 41  GLU A CA   5  
ATOM 8469  C C    . GLU A 1 41  ? -1.033  -24.396 9.299   1.00 0.90 ? 41  GLU A C    5  
ATOM 8470  O O    . GLU A 1 41  ? -0.346  -25.115 8.569   1.00 1.06 ? 41  GLU A O    5  
ATOM 8471  C CB   . GLU A 1 41  ? -2.179  -23.714 7.181   1.00 0.98 ? 41  GLU A CB   5  
ATOM 8472  C CG   . GLU A 1 41  ? -2.712  -22.535 6.381   1.00 1.31 ? 41  GLU A CG   5  
ATOM 8473  C CD   . GLU A 1 41  ? -4.125  -22.140 6.760   1.00 1.55 ? 41  GLU A CD   5  
ATOM 8474  O OE1  . GLU A 1 41  ? -5.023  -23.010 6.731   1.00 1.89 ? 41  GLU A OE1  5  
ATOM 8475  O OE2  . GLU A 1 41  ? -4.345  -20.951 7.068   1.00 2.17 ? 41  GLU A OE2  5  
ATOM 8476  H H    . GLU A 1 41  ? -1.408  -21.535 8.398   1.00 0.89 ? 41  GLU A H    5  
ATOM 8477  N N    . ALA A 1 42  ? -0.887  -24.327 10.620  1.00 0.89 ? 42  ALA A N    5  
ATOM 8478  C CA   . ALA A 1 42  ? 0.110   -25.112 11.355  1.00 0.98 ? 42  ALA A CA   5  
ATOM 8479  C C    . ALA A 1 42  ? 1.539   -24.851 10.871  1.00 0.90 ? 42  ALA A C    5  
ATOM 8480  O O    . ALA A 1 42  ? 2.030   -25.513 9.957   1.00 0.99 ? 42  ALA A O    5  
ATOM 8481  C CB   . ALA A 1 42  ? -0.220  -26.599 11.330  1.00 1.21 ? 42  ALA A CB   5  
ATOM 8482  H H    . ALA A 1 42  ? -1.477  -23.724 11.125  1.00 0.92 ? 42  ALA A H    5  
ATOM 8483  N N    . PRO A 1 43  ? 2.225   -23.872 11.480  1.00 0.86 ? 43  PRO A N    5  
ATOM 8484  C CA   . PRO A 1 43  ? 3.600   -23.528 11.117  1.00 0.89 ? 43  PRO A CA   5  
ATOM 8485  C C    . PRO A 1 43  ? 4.600   -24.531 11.694  1.00 0.93 ? 43  PRO A C    5  
ATOM 8486  O O    . PRO A 1 43  ? 5.039   -24.394 12.839  1.00 1.08 ? 43  PRO A O    5  
ATOM 8487  C CB   . PRO A 1 43  ? 3.812   -22.142 11.755  1.00 1.03 ? 43  PRO A CB   5  
ATOM 8488  C CG   . PRO A 1 43  ? 2.490   -21.748 12.337  1.00 1.11 ? 43  PRO A CG   5  
ATOM 8489  C CD   . PRO A 1 43  ? 1.730   -23.022 12.564  1.00 0.96 ? 43  PRO A CD   5  
ATOM 8490  N N    . GLU A 1 44  ? 4.950   -25.536 10.897  1.00 0.91 ? 44  GLU A N    5  
ATOM 8491  C CA   . GLU A 1 44  ? 5.889   -26.569 11.325  1.00 0.98 ? 44  GLU A CA   5  
ATOM 8492  C C    . GLU A 1 44  ? 7.291   -26.001 11.509  1.00 0.98 ? 44  GLU A C    5  
ATOM 8493  O O    . GLU A 1 44  ? 7.852   -26.038 12.602  1.00 1.13 ? 44  GLU A O    5  
ATOM 8494  C CB   . GLU A 1 44  ? 5.920   -27.726 10.320  1.00 1.06 ? 44  GLU A CB   5  
ATOM 8495  C CG   . GLU A 1 44  ? 4.574   -28.398 10.090  1.00 1.34 ? 44  GLU A CG   5  
ATOM 8496  C CD   . GLU A 1 44  ? 4.674   -29.615 9.191   1.00 1.59 ? 44  GLU A CD   5  
ATOM 8497  O OE1  . GLU A 1 44  ? 5.615   -29.681 8.371   1.00 2.13 ? 44  GLU A OE1  5  
ATOM 8498  O OE2  . GLU A 1 44  ? 3.806   -30.510 9.296   1.00 1.91 ? 44  GLU A OE2  5  
ATOM 8499  H H    . GLU A 1 44  ? 4.563   -25.589 9.999   1.00 0.91 ? 44  GLU A H    5  
ATOM 8500  N N    . LEU A 1 45  ? 7.845   -25.466 10.434  1.00 0.93 ? 45  LEU A N    5  
ATOM 8501  C CA   . LEU A 1 45  ? 9.180   -24.891 10.471  1.00 0.99 ? 45  LEU A CA   5  
ATOM 8502  C C    . LEU A 1 45  ? 9.133   -23.398 10.179  1.00 0.93 ? 45  LEU A C    5  
ATOM 8503  O O    . LEU A 1 45  ? 9.775   -22.603 10.868  1.00 0.96 ? 45  LEU A O    5  
ATOM 8504  C CB   . LEU A 1 45  ? 10.100  -25.597 9.470   1.00 1.11 ? 45  LEU A CB   5  
ATOM 8505  C CG   . LEU A 1 45  ? 10.374  -27.080 9.734   1.00 1.39 ? 45  LEU A CG   5  
ATOM 8506  C CD1  . LEU A 1 45  ? 11.209  -27.675 8.612   1.00 1.65 ? 45  LEU A CD1  5  
ATOM 8507  C CD2  . LEU A 1 45  ? 11.066  -27.270 11.077  1.00 1.60 ? 45  LEU A CD2  5  
ATOM 8508  H H    . LEU A 1 45  ? 7.342   -25.454 9.594   1.00 0.92 ? 45  LEU A H    5  
ATOM 8509  N N    . ALA A 1 46  ? 8.357   -23.031 9.156   1.00 0.93 ? 46  ALA A N    5  
ATOM 8510  C CA   . ALA A 1 46  ? 8.198   -21.635 8.739   1.00 0.95 ? 46  ALA A CA   5  
ATOM 8511  C C    . ALA A 1 46  ? 9.528   -21.019 8.298   1.00 0.89 ? 46  ALA A C    5  
ATOM 8512  O O    . ALA A 1 46  ? 10.530  -21.722 8.137   1.00 1.04 ? 46  ALA A O    5  
ATOM 8513  C CB   . ALA A 1 46  ? 7.543   -20.804 9.836   1.00 1.03 ? 46  ALA A CB   5  
ATOM 8514  H H    . ALA A 1 46  ? 7.878   -23.725 8.659   1.00 0.98 ? 46  ALA A H    5  
ATOM 8515  N N    . LEU A 1 47  ? 9.530   -19.711 8.086   1.00 0.83 ? 47  LEU A N    5  
ATOM 8516  C CA   . LEU A 1 47  ? 10.731  -19.007 7.669   1.00 0.78 ? 47  LEU A CA   5  
ATOM 8517  C C    . LEU A 1 47  ? 10.701  -17.561 8.142   1.00 0.69 ? 47  LEU A C    5  
ATOM 8518  O O    . LEU A 1 47  ? 9.867   -16.770 7.703   1.00 0.75 ? 47  LEU A O    5  
ATOM 8519  C CB   . LEU A 1 47  ? 10.878  -19.058 6.143   1.00 0.89 ? 47  LEU A CB   5  
ATOM 8520  C CG   . LEU A 1 47  ? 12.078  -18.314 5.550   1.00 0.92 ? 47  LEU A CG   5  
ATOM 8521  C CD1  . LEU A 1 47  ? 13.386  -18.928 6.024   1.00 1.06 ? 47  LEU A CD1  5  
ATOM 8522  C CD2  . LEU A 1 47  ? 12.001  -18.308 4.033   1.00 1.09 ? 47  LEU A CD2  5  
ATOM 8523  H H    . LEU A 1 47  ? 8.698   -19.203 8.210   1.00 0.92 ? 47  LEU A H    5  
ATOM 8524  N N    . ASP A 1 48  ? 11.595  -17.226 9.057   1.00 0.69 ? 48  ASP A N    5  
ATOM 8525  C CA   . ASP A 1 48  ? 11.680  -15.870 9.577   1.00 0.67 ? 48  ASP A CA   5  
ATOM 8526  C C    . ASP A 1 48  ? 13.140  -15.457 9.725   1.00 0.61 ? 48  ASP A C    5  
ATOM 8527  O O    . ASP A 1 48  ? 13.791  -15.778 10.718  1.00 0.63 ? 48  ASP A O    5  
ATOM 8528  C CB   . ASP A 1 48  ? 10.938  -15.742 10.912  1.00 0.79 ? 48  ASP A CB   5  
ATOM 8529  C CG   . ASP A 1 48  ? 10.682  -14.299 11.300  1.00 1.00 ? 48  ASP A CG   5  
ATOM 8530  O OD1  . ASP A 1 48  ? 9.657   -13.730 10.862  1.00 1.31 ? 48  ASP A OD1  5  
ATOM 8531  O OD2  . ASP A 1 48  ? 11.498  -13.726 12.050  1.00 1.64 ? 48  ASP A OD2  5  
ATOM 8532  H H    . ASP A 1 48  ? 12.215  -17.909 9.396   1.00 0.81 ? 48  ASP A H    5  
ATOM 8533  N N    . PRO A 1 49  ? 13.685  -14.773 8.706   1.00 0.64 ? 49  PRO A N    5  
ATOM 8534  C CA   . PRO A 1 49  ? 15.078  -14.316 8.712   1.00 0.66 ? 49  PRO A CA   5  
ATOM 8535  C C    . PRO A 1 49  ? 15.263  -13.063 9.562   1.00 0.58 ? 49  PRO A C    5  
ATOM 8536  O O    . PRO A 1 49  ? 16.388  -12.595 9.754   1.00 0.63 ? 49  PRO A O    5  
ATOM 8537  C CB   . PRO A 1 49  ? 15.333  -13.988 7.239   1.00 0.80 ? 49  PRO A CB   5  
ATOM 8538  C CG   . PRO A 1 49  ? 14.001  -13.581 6.715   1.00 0.93 ? 49  PRO A CG   5  
ATOM 8539  C CD   . PRO A 1 49  ? 12.987  -14.407 7.458   1.00 0.76 ? 49  PRO A CD   5  
ATOM 8540  N N    . VAL A 1 50  ? 14.150  -12.544 10.074  1.00 0.56 ? 50  VAL A N    5  
ATOM 8541  C CA   . VAL A 1 50  ? 14.143  -11.339 10.898  1.00 0.58 ? 50  VAL A CA   5  
ATOM 8542  C C    . VAL A 1 50  ? 14.571  -10.113 10.089  1.00 0.57 ? 50  VAL A C    5  
ATOM 8543  O O    . VAL A 1 50  ? 15.761  -9.903  9.836   1.00 0.62 ? 50  VAL A O    5  
ATOM 8544  C CB   . VAL A 1 50  ? 15.016  -11.475 12.168  1.00 0.64 ? 50  VAL A CB   5  
ATOM 8545  C CG1  . VAL A 1 50  ? 14.933  -10.218 13.023  1.00 0.75 ? 50  VAL A CG1  5  
ATOM 8546  C CG2  . VAL A 1 50  ? 14.609  -12.699 12.976  1.00 0.75 ? 50  VAL A CG2  5  
ATOM 8547  H H    . VAL A 1 50  ? 13.298  -12.994 9.895   1.00 0.60 ? 50  VAL A H    5  
ATOM 8548  N N    . PRO A 1 51  ? 13.594  -9.306  9.648   1.00 0.60 ? 51  PRO A N    5  
ATOM 8549  C CA   . PRO A 1 51  ? 13.863  -8.090  8.873   1.00 0.65 ? 51  PRO A CA   5  
ATOM 8550  C C    . PRO A 1 51  ? 14.768  -7.136  9.648   1.00 0.66 ? 51  PRO A C    5  
ATOM 8551  O O    . PRO A 1 51  ? 14.346  -6.528  10.635  1.00 0.73 ? 51  PRO A O    5  
ATOM 8552  C CB   . PRO A 1 51  ? 12.471  -7.470  8.680   1.00 0.77 ? 51  PRO A CB   5  
ATOM 8553  C CG   . PRO A 1 51  ? 11.525  -8.610  8.841   1.00 0.92 ? 51  PRO A CG   5  
ATOM 8554  C CD   . PRO A 1 51  ? 12.153  -9.518  9.859   1.00 0.72 ? 51  PRO A CD   5  
ATOM 8555  N N    . GLN A 1 52  ? 16.018  -7.033  9.211   1.00 0.71 ? 52  GLN A N    5  
ATOM 8556  C CA   . GLN A 1 52  ? 16.990  -6.166  9.869   1.00 0.81 ? 52  GLN A CA   5  
ATOM 8557  C C    . GLN A 1 52  ? 16.676  -4.693  9.633   1.00 0.77 ? 52  GLN A C    5  
ATOM 8558  O O    . GLN A 1 52  ? 16.937  -3.846  10.491  1.00 0.91 ? 52  GLN A O    5  
ATOM 8559  C CB   . GLN A 1 52  ? 18.413  -6.483  9.401   1.00 0.97 ? 52  GLN A CB   5  
ATOM 8560  C CG   . GLN A 1 52  ? 18.817  -7.940  9.568   1.00 1.18 ? 52  GLN A CG   5  
ATOM 8561  C CD   . GLN A 1 52  ? 18.819  -8.401  11.012  1.00 1.30 ? 52  GLN A CD   5  
ATOM 8562  O OE1  . GLN A 1 52  ? 19.115  -7.629  11.928  1.00 1.40 ? 52  GLN A OE1  5  
ATOM 8563  N NE2  . GLN A 1 52  ? 18.476  -9.665  11.224  1.00 1.51 ? 52  GLN A NE2  5  
ATOM 8564  H H    . GLN A 1 52  ? 16.298  -7.563  8.434   1.00 0.75 ? 52  GLN A H    5  
ATOM 8565  H HE21 . GLN A 1 52  ? 18.237  -10.217 10.446  1.00 1.58 ? 52  GLN A HE21 5  
ATOM 8566  H HE22 . GLN A 1 52  ? 18.479  -10.000 12.146  1.00 1.68 ? 52  GLN A HE22 5  
ATOM 8567  N N    . ASP A 1 53  ? 16.114  -4.400  8.467   1.00 0.67 ? 53  ASP A N    5  
ATOM 8568  C CA   . ASP A 1 53  ? 15.766  -3.031  8.111   1.00 0.64 ? 53  ASP A CA   5  
ATOM 8569  C C    . ASP A 1 53  ? 14.688  -2.475  9.031   1.00 0.62 ? 53  ASP A C    5  
ATOM 8570  O O    . ASP A 1 53  ? 13.610  -3.057  9.177   1.00 0.63 ? 53  ASP A O    5  
ATOM 8571  C CB   . ASP A 1 53  ? 15.325  -2.921  6.650   1.00 0.64 ? 53  ASP A CB   5  
ATOM 8572  C CG   . ASP A 1 53  ? 14.856  -1.521  6.302   1.00 0.60 ? 53  ASP A CG   5  
ATOM 8573  O OD1  . ASP A 1 53  ? 15.511  -0.546  6.730   1.00 0.78 ? 53  ASP A OD1  5  
ATOM 8574  O OD2  . ASP A 1 53  ? 13.824  -1.388  5.607   1.00 0.69 ? 53  ASP A OD2  5  
ATOM 8575  H H    . ASP A 1 53  ? 15.923  -5.120  7.836   1.00 0.69 ? 53  ASP A H    5  
ATOM 8576  N N    . ALA A 1 54  ? 14.995  -1.349  9.652   1.00 0.63 ? 54  ALA A N    5  
ATOM 8577  C CA   . ALA A 1 54  ? 14.072  -0.704  10.564  1.00 0.64 ? 54  ALA A CA   5  
ATOM 8578  C C    . ALA A 1 54  ? 13.183  0.291   9.830   1.00 0.60 ? 54  ALA A C    5  
ATOM 8579  O O    . ALA A 1 54  ? 12.126  0.670   10.330  1.00 0.60 ? 54  ALA A O    5  
ATOM 8580  C CB   . ALA A 1 54  ? 14.833  -0.019  11.685  1.00 0.71 ? 54  ALA A CB   5  
ATOM 8581  H H    . ALA A 1 54  ? 15.869  -0.940  9.487   1.00 0.67 ? 54  ALA A H    5  
ATOM 8582  N N    . SER A 1 55  ? 13.604  0.694   8.636   1.00 0.58 ? 55  SER A N    5  
ATOM 8583  C CA   . SER A 1 55  ? 12.849  1.654   7.844   1.00 0.57 ? 55  SER A CA   5  
ATOM 8584  C C    . SER A 1 55  ? 11.486  1.088   7.469   1.00 0.52 ? 55  SER A C    5  
ATOM 8585  O O    . SER A 1 55  ? 10.456  1.725   7.699   1.00 0.51 ? 55  SER A O    5  
ATOM 8586  C CB   . SER A 1 55  ? 13.632  2.036   6.588   1.00 0.59 ? 55  SER A CB   5  
ATOM 8587  O OG   . SER A 1 55  ? 15.026  2.034   6.851   1.00 0.67 ? 55  SER A OG   5  
ATOM 8588  H H    . SER A 1 55  ? 14.440  0.328   8.270   1.00 0.60 ? 55  SER A H    5  
ATOM 8589  H HG   . SER A 1 55  ? 15.375  1.137   6.705   1.00 0.67 ? 55  SER A HG   5  
ATOM 8590  N N    . THR A 1 56  ? 11.480  -0.117  6.911   1.00 0.51 ? 56  THR A N    5  
ATOM 8591  C CA   . THR A 1 56  ? 10.241  -0.764  6.513   1.00 0.49 ? 56  THR A CA   5  
ATOM 8592  C C    . THR A 1 56  ? 9.361   -1.056  7.723   1.00 0.48 ? 56  THR A C    5  
ATOM 8593  O O    . THR A 1 56  ? 8.146   -0.858  7.677   1.00 0.47 ? 56  THR A O    5  
ATOM 8594  C CB   . THR A 1 56  ? 10.508  -2.062  5.732   1.00 0.50 ? 56  THR A CB   5  
ATOM 8595  O OG1  . THR A 1 56  ? 11.668  -2.711  6.268   1.00 0.57 ? 56  THR A OG1  5  
ATOM 8596  C CG2  . THR A 1 56  ? 10.739  -1.750  4.262   1.00 0.63 ? 56  THR A CG2  5  
ATOM 8597  H H    . THR A 1 56  ? 12.335  -0.582  6.757   1.00 0.52 ? 56  THR A H    5  
ATOM 8598  H HG1  . THR A 1 56  ? 12.469  -2.291  5.908   1.00 0.55 ? 56  THR A HG1  5  
ATOM 8599  N N    . LYS A 1 57  ? 9.980   -1.510  8.809   1.00 0.50 ? 57  LYS A N    5  
ATOM 8600  C CA   . LYS A 1 57  ? 9.252   -1.814  10.034  1.00 0.52 ? 57  LYS A CA   5  
ATOM 8601  C C    . LYS A 1 57  ? 8.613   -0.552  10.609  1.00 0.52 ? 57  LYS A C    5  
ATOM 8602  O O    . LYS A 1 57  ? 7.468   -0.574  11.058  1.00 0.53 ? 57  LYS A O    5  
ATOM 8603  C CB   . LYS A 1 57  ? 10.174  -2.465  11.071  1.00 0.56 ? 57  LYS A CB   5  
ATOM 8604  C CG   . LYS A 1 57  ? 10.330  -3.968  10.909  1.00 1.01 ? 57  LYS A CG   5  
ATOM 8605  C CD   . LYS A 1 57  ? 11.191  -4.557  12.017  1.00 1.09 ? 57  LYS A CD   5  
ATOM 8606  C CE   . LYS A 1 57  ? 11.165  -6.079  11.994  1.00 1.30 ? 57  LYS A CE   5  
ATOM 8607  N NZ   . LYS A 1 57  ? 9.850   -6.624  12.432  1.00 1.59 ? 57  LYS A NZ   5  
ATOM 8608  H H    . LYS A 1 57  ? 10.952  -1.646  8.780   1.00 0.52 ? 57  LYS A H    5  
ATOM 8609  H HZ1  . LYS A 1 57  ? 9.651   -6.334  13.411  1.00 1.92 ? 57  LYS A HZ1  5  
ATOM 8610  H HZ2  . LYS A 1 57  ? 9.856   -7.662  12.386  1.00 1.99 ? 57  LYS A HZ2  5  
ATOM 8611  H HZ3  . LYS A 1 57  ? 9.090   -6.267  11.818  1.00 1.99 ? 57  LYS A HZ3  5  
ATOM 8612  N N    . LYS A 1 58  ? 9.356   0.546   10.570  1.00 0.54 ? 58  LYS A N    5  
ATOM 8613  C CA   . LYS A 1 58  ? 8.872   1.823   11.075  1.00 0.56 ? 58  LYS A CA   5  
ATOM 8614  C C    . LYS A 1 58  ? 7.736   2.339   10.198  1.00 0.54 ? 58  LYS A C    5  
ATOM 8615  O O    . LYS A 1 58  ? 6.712   2.798   10.703  1.00 0.55 ? 58  LYS A O    5  
ATOM 8616  C CB   . LYS A 1 58  ? 10.019  2.839   11.116  1.00 0.60 ? 58  LYS A CB   5  
ATOM 8617  C CG   . LYS A 1 58  ? 9.717   4.108   11.895  1.00 0.70 ? 58  LYS A CG   5  
ATOM 8618  C CD   . LYS A 1 58  ? 10.957  4.977   12.011  1.00 0.76 ? 58  LYS A CD   5  
ATOM 8619  C CE   . LYS A 1 58  ? 10.684  6.227   12.830  1.00 1.16 ? 58  LYS A CE   5  
ATOM 8620  N NZ   . LYS A 1 58  ? 11.922  7.002   13.099  1.00 1.32 ? 58  LYS A NZ   5  
ATOM 8621  H H    . LYS A 1 58  ? 10.262  0.497   10.191  1.00 0.54 ? 58  LYS A H    5  
ATOM 8622  H HZ1  . LYS A 1 58  ? 12.663  6.374   13.468  1.00 1.74 ? 58  LYS A HZ1  5  
ATOM 8623  H HZ2  . LYS A 1 58  ? 11.733  7.742   13.805  1.00 1.67 ? 58  LYS A HZ2  5  
ATOM 8624  H HZ3  . LYS A 1 58  ? 12.262  7.450   12.224  1.00 1.54 ? 58  LYS A HZ3  5  
ATOM 8625  N N    . LEU A 1 59  ? 7.925   2.242   8.885   1.00 0.52 ? 59  LEU A N    5  
ATOM 8626  C CA   . LEU A 1 59  ? 6.921   2.690   7.928   1.00 0.51 ? 59  LEU A CA   5  
ATOM 8627  C C    . LEU A 1 59  ? 5.634   1.888   8.074   1.00 0.50 ? 59  LEU A C    5  
ATOM 8628  O O    . LEU A 1 59  ? 4.535   2.450   8.073   1.00 0.51 ? 59  LEU A O    5  
ATOM 8629  C CB   . LEU A 1 59  ? 7.446   2.586   6.495   1.00 0.50 ? 59  LEU A CB   5  
ATOM 8630  C CG   . LEU A 1 59  ? 8.397   3.696   6.042   1.00 0.56 ? 59  LEU A CG   5  
ATOM 8631  C CD1  . LEU A 1 59  ? 9.107   3.298   4.756   1.00 0.55 ? 59  LEU A CD1  5  
ATOM 8632  C CD2  . LEU A 1 59  ? 7.636   4.997   5.849   1.00 0.72 ? 59  LEU A CD2  5  
ATOM 8633  H H    . LEU A 1 59  ? 8.770   1.865   8.550   1.00 0.52 ? 59  LEU A H    5  
ATOM 8634  N N    . SER A 1 60  ? 5.776   0.577   8.214   1.00 0.50 ? 60  SER A N    5  
ATOM 8635  C CA   . SER A 1 60  ? 4.624   -0.301  8.372   1.00 0.50 ? 60  SER A CA   5  
ATOM 8636  C C    . SER A 1 60  ? 3.869   0.013   9.659   1.00 0.51 ? 60  SER A C    5  
ATOM 8637  O O    . SER A 1 60  ? 2.646   -0.103  9.714   1.00 0.53 ? 60  SER A O    5  
ATOM 8638  C CB   . SER A 1 60  ? 5.050   -1.769  8.337   1.00 0.50 ? 60  SER A CB   5  
ATOM 8639  O OG   . SER A 1 60  ? 5.810   -2.049  7.172   1.00 0.50 ? 60  SER A OG   5  
ATOM 8640  H H    . SER A 1 60  ? 6.679   0.188   8.202   1.00 0.51 ? 60  SER A H    5  
ATOM 8641  H HG   . SER A 1 60  ? 6.703   -1.699  7.280   1.00 0.49 ? 60  SER A HG   5  
ATOM 8642  N N    . GLU A 1 61  ? 4.607   0.434   10.685  1.00 0.52 ? 61  GLU A N    5  
ATOM 8643  C CA   . GLU A 1 61  ? 4.014   0.778   11.969  1.00 0.55 ? 61  GLU A CA   5  
ATOM 8644  C C    . GLU A 1 61  ? 3.052   1.948   11.806  1.00 0.55 ? 61  GLU A C    5  
ATOM 8645  O O    . GLU A 1 61  ? 1.868   1.838   12.125  1.00 0.57 ? 61  GLU A O    5  
ATOM 8646  C CB   . GLU A 1 61  ? 5.105   1.137   12.983  1.00 0.60 ? 61  GLU A CB   5  
ATOM 8647  C CG   . GLU A 1 61  ? 4.836   0.664   14.406  1.00 0.81 ? 61  GLU A CG   5  
ATOM 8648  C CD   . GLU A 1 61  ? 3.470   1.070   14.932  1.00 1.12 ? 61  GLU A CD   5  
ATOM 8649  O OE1  . GLU A 1 61  ? 3.237   2.279   15.130  1.00 1.35 ? 61  GLU A OE1  5  
ATOM 8650  O OE2  . GLU A 1 61  ? 2.628   0.172   15.151  1.00 1.50 ? 61  GLU A OE2  5  
ATOM 8651  H H    . GLU A 1 61  ? 5.579   0.511   10.575  1.00 0.52 ? 61  GLU A H    5  
ATOM 8652  N N    . CYS A 1 62  ? 3.559   3.064   11.285  1.00 0.55 ? 62  CYS A N    5  
ATOM 8653  C CA   . CYS A 1 62  ? 2.733   4.247   11.091  1.00 0.57 ? 62  CYS A CA   5  
ATOM 8654  C C    . CYS A 1 62  ? 1.567   3.978   10.146  1.00 0.56 ? 62  CYS A C    5  
ATOM 8655  O O    . CYS A 1 62  ? 0.459   4.459   10.366  1.00 0.60 ? 62  CYS A O    5  
ATOM 8656  C CB   . CYS A 1 62  ? 3.556   5.453   10.635  1.00 0.60 ? 62  CYS A CB   5  
ATOM 8657  S SG   . CYS A 1 62  ? 4.866   5.085   9.448   1.00 0.59 ? 62  CYS A SG   5  
ATOM 8658  H H    . CYS A 1 62  ? 4.509   3.092   11.035  1.00 0.55 ? 62  CYS A H    5  
ATOM 8659  H HG   . CYS A 1 62  ? 4.501   4.017   8.749   1.00 0.98 ? 62  CYS A HG   5  
ATOM 8660  N N    . LEU A 1 63  ? 1.813   3.192   9.109   1.00 0.52 ? 63  LEU A N    5  
ATOM 8661  C CA   . LEU A 1 63  ? 0.770   2.861   8.148   1.00 0.53 ? 63  LEU A CA   5  
ATOM 8662  C C    . LEU A 1 63  ? -0.317  2.011   8.797   1.00 0.52 ? 63  LEU A C    5  
ATOM 8663  O O    . LEU A 1 63  ? -1.511  2.266   8.618   1.00 0.53 ? 63  LEU A O    5  
ATOM 8664  C CB   . LEU A 1 63  ? 1.353   2.143   6.929   1.00 0.53 ? 63  LEU A CB   5  
ATOM 8665  C CG   . LEU A 1 63  ? 2.216   2.995   5.993   1.00 0.55 ? 63  LEU A CG   5  
ATOM 8666  C CD1  . LEU A 1 63  ? 2.808   2.142   4.882   1.00 0.57 ? 63  LEU A CD1  5  
ATOM 8667  C CD2  . LEU A 1 63  ? 1.404   4.142   5.410   1.00 0.62 ? 63  LEU A CD2  5  
ATOM 8668  H H    . LEU A 1 63  ? 2.716   2.826   8.986   1.00 0.50 ? 63  LEU A H    5  
ATOM 8669  N N    . LYS A 1 64  ? 0.103   1.017   9.568   1.00 0.52 ? 64  LYS A N    5  
ATOM 8670  C CA   . LYS A 1 64  ? -0.824  0.124   10.244  1.00 0.54 ? 64  LYS A CA   5  
ATOM 8671  C C    . LYS A 1 64  ? -1.623  0.853   11.319  1.00 0.54 ? 64  LYS A C    5  
ATOM 8672  O O    . LYS A 1 64  ? -2.841  0.710   11.393  1.00 0.54 ? 64  LYS A O    5  
ATOM 8673  C CB   . LYS A 1 64  ? -0.087  -1.080  10.838  1.00 0.59 ? 64  LYS A CB   5  
ATOM 8674  C CG   . LYS A 1 64  ? -0.986  -2.077  11.554  1.00 0.71 ? 64  LYS A CG   5  
ATOM 8675  C CD   . LYS A 1 64  ? -0.825  -1.984  13.063  1.00 0.88 ? 64  LYS A CD   5  
ATOM 8676  C CE   . LYS A 1 64  ? 0.463   -2.646  13.525  1.00 0.86 ? 64  LYS A CE   5  
ATOM 8677  N NZ   . LYS A 1 64  ? 0.331   -4.124  13.590  1.00 0.78 ? 64  LYS A NZ   5  
ATOM 8678  H H    . LYS A 1 64  ? 1.070   0.873   9.679   1.00 0.52 ? 64  LYS A H    5  
ATOM 8679  H HZ1  . LYS A 1 64  ? -0.052  -4.493  12.687  1.00 0.95 ? 64  LYS A HZ1  5  
ATOM 8680  H HZ2  . LYS A 1 64  ? -0.308  -4.396  14.362  1.00 1.03 ? 64  LYS A HZ2  5  
ATOM 8681  H HZ3  . LYS A 1 64  ? 1.260   -4.562  13.756  1.00 0.96 ? 64  LYS A HZ3  5  
ATOM 8682  N N    . ARG A 1 65  ? -0.941  1.643   12.144  1.00 0.57 ? 65  ARG A N    5  
ATOM 8683  C CA   . ARG A 1 65  ? -1.614  2.374   13.211  1.00 0.59 ? 65  ARG A CA   5  
ATOM 8684  C C    . ARG A 1 65  ? -2.644  3.363   12.667  1.00 0.57 ? 65  ARG A C    5  
ATOM 8685  O O    . ARG A 1 65  ? -3.656  3.629   13.311  1.00 0.60 ? 65  ARG A O    5  
ATOM 8686  C CB   . ARG A 1 65  ? -0.620  3.047   14.166  1.00 0.66 ? 65  ARG A CB   5  
ATOM 8687  C CG   . ARG A 1 65  ? 0.117   4.244   13.591  1.00 0.66 ? 65  ARG A CG   5  
ATOM 8688  C CD   . ARG A 1 65  ? 1.232   4.700   14.521  1.00 0.75 ? 65  ARG A CD   5  
ATOM 8689  N NE   . ARG A 1 65  ? 0.722   5.141   15.822  1.00 0.86 ? 65  ARG A NE   5  
ATOM 8690  C CZ   . ARG A 1 65  ? 1.075   4.596   16.988  1.00 1.00 ? 65  ARG A CZ   5  
ATOM 8691  N NH1  . ARG A 1 65  ? 1.932   3.579   17.026  1.00 1.05 ? 65  ARG A NH1  5  
ATOM 8692  N NH2  . ARG A 1 65  ? 0.565   5.073   18.117  1.00 1.19 ? 65  ARG A NH2  5  
ATOM 8693  H H    . ARG A 1 65  ? 0.033   1.731   12.036  1.00 0.58 ? 65  ARG A H    5  
ATOM 8694  H HE   . ARG A 1 65  ? 0.083   5.891   15.824  1.00 0.91 ? 65  ARG A HE   5  
ATOM 8695  H HH11 . ARG A 1 65  ? 2.327   3.203   16.168  1.00 0.95 ? 65  ARG A HH11 5  
ATOM 8696  H HH12 . ARG A 1 65  ? 2.203   3.179   17.905  1.00 1.24 ? 65  ARG A HH12 5  
ATOM 8697  H HH21 . ARG A 1 65  ? -0.083  5.840   18.096  1.00 1.21 ? 65  ARG A HH21 5  
ATOM 8698  H HH22 . ARG A 1 65  ? 0.829   4.671   18.998  1.00 1.36 ? 65  ARG A HH22 5  
ATOM 8699  N N    . ILE A 1 66  ? -2.393  3.900   11.477  1.00 0.53 ? 66  ILE A N    5  
ATOM 8700  C CA   . ILE A 1 66  ? -3.329  4.833   10.861  1.00 0.52 ? 66  ILE A CA   5  
ATOM 8701  C C    . ILE A 1 66  ? -4.526  4.063   10.304  1.00 0.48 ? 66  ILE A C    5  
ATOM 8702  O O    . ILE A 1 66  ? -5.678  4.430   10.541  1.00 0.48 ? 66  ILE A O    5  
ATOM 8703  C CB   . ILE A 1 66  ? -2.664  5.677   9.744   1.00 0.54 ? 66  ILE A CB   5  
ATOM 8704  C CG1  . ILE A 1 66  ? -1.674  6.676   10.358  1.00 0.59 ? 66  ILE A CG1  5  
ATOM 8705  C CG2  . ILE A 1 66  ? -3.713  6.411   8.917   1.00 0.55 ? 66  ILE A CG2  5  
ATOM 8706  C CD1  . ILE A 1 66  ? -0.863  7.446   9.337   1.00 0.62 ? 66  ILE A CD1  5  
ATOM 8707  H H    . ILE A 1 66  ? -1.567  3.661   11.004  1.00 0.54 ? 66  ILE A H    5  
ATOM 8708  N N    . GLY A 1 67  ? -4.241  2.969   9.601   1.00 0.47 ? 67  GLY A N    5  
ATOM 8709  C CA   . GLY A 1 67  ? -5.293  2.151   9.030   1.00 0.45 ? 67  GLY A CA   5  
ATOM 8710  C C    . GLY A 1 67  ? -6.171  1.531   10.098  1.00 0.45 ? 67  GLY A C    5  
ATOM 8711  O O    . GLY A 1 67  ? -7.390  1.467   9.949   1.00 0.44 ? 67  GLY A O    5  
ATOM 8712  H H    . GLY A 1 67  ? -3.304  2.713   9.468   1.00 0.49 ? 67  GLY A H    5  
ATOM 8713  N N    . ASP A 1 68  ? -5.543  1.096   11.186  1.00 0.50 ? 68  ASP A N    5  
ATOM 8714  C CA   . ASP A 1 68  ? -6.258  0.479   12.303  1.00 0.55 ? 68  ASP A CA   5  
ATOM 8715  C C    . ASP A 1 68  ? -7.190  1.483   12.977  1.00 0.54 ? 68  ASP A C    5  
ATOM 8716  O O    . ASP A 1 68  ? -8.217  1.111   13.546  1.00 0.55 ? 68  ASP A O    5  
ATOM 8717  C CB   . ASP A 1 68  ? -5.274  -0.097  13.323  1.00 0.65 ? 68  ASP A CB   5  
ATOM 8718  C CG   . ASP A 1 68  ? -5.308  -1.612  13.398  1.00 0.76 ? 68  ASP A CG   5  
ATOM 8719  O OD1  . ASP A 1 68  ? -5.247  -2.279  12.341  1.00 0.95 ? 68  ASP A OD1  5  
ATOM 8720  O OD2  . ASP A 1 68  ? -5.375  -2.152  14.523  1.00 1.13 ? 68  ASP A OD2  5  
ATOM 8721  H H    . ASP A 1 68  ? -4.561  1.178   11.236  1.00 0.53 ? 68  ASP A H    5  
ATOM 8722  N N    . GLU A 1 69  ? -6.826  2.761   12.919  1.00 0.55 ? 69  GLU A N    5  
ATOM 8723  C CA   . GLU A 1 69  ? -7.648  3.811   13.507  1.00 0.58 ? 69  GLU A CA   5  
ATOM 8724  C C    . GLU A 1 69  ? -8.793  4.177   12.572  1.00 0.53 ? 69  GLU A C    5  
ATOM 8725  O O    . GLU A 1 69  ? -9.833  4.669   13.001  1.00 0.58 ? 69  GLU A O    5  
ATOM 8726  C CB   . GLU A 1 69  ? -6.813  5.052   13.838  1.00 0.63 ? 69  GLU A CB   5  
ATOM 8727  C CG   . GLU A 1 69  ? -5.970  4.923   15.098  1.00 0.89 ? 69  GLU A CG   5  
ATOM 8728  C CD   . GLU A 1 69  ? -6.795  4.868   16.371  1.00 1.22 ? 69  GLU A CD   5  
ATOM 8729  O OE1  . GLU A 1 69  ? -7.999  4.538   16.301  1.00 1.90 ? 69  GLU A OE1  5  
ATOM 8730  O OE2  . GLU A 1 69  ? -6.234  5.139   17.457  1.00 1.81 ? 69  GLU A OE2  5  
ATOM 8731  H H    . GLU A 1 69  ? -5.985  3.001   12.471  1.00 0.56 ? 69  GLU A H    5  
ATOM 8732  N N    . LEU A 1 70  ? -8.600  3.902   11.287  1.00 0.48 ? 70  LEU A N    5  
ATOM 8733  C CA   . LEU A 1 70  ? -9.608  4.186   10.272  1.00 0.46 ? 70  LEU A CA   5  
ATOM 8734  C C    . LEU A 1 70  ? -10.680 3.101   10.253  1.00 0.41 ? 70  LEU A C    5  
ATOM 8735  O O    . LEU A 1 70  ? -11.585 3.118   9.418   1.00 0.38 ? 70  LEU A O    5  
ATOM 8736  C CB   . LEU A 1 70  ? -8.962  4.308   8.888   1.00 0.45 ? 70  LEU A CB   5  
ATOM 8737  C CG   . LEU A 1 70  ? -8.075  5.535   8.654   1.00 0.51 ? 70  LEU A CG   5  
ATOM 8738  C CD1  . LEU A 1 70  ? -7.357  5.422   7.318   1.00 0.51 ? 70  LEU A CD1  5  
ATOM 8739  C CD2  . LEU A 1 70  ? -8.896  6.816   8.716   1.00 0.59 ? 70  LEU A CD2  5  
ATOM 8740  H H    . LEU A 1 70  ? -7.755  3.489   11.013  1.00 0.48 ? 70  LEU A H    5  
ATOM 8741  N N    . ASP A 1 71  ? -10.559 2.148   11.169  1.00 0.43 ? 71  ASP A N    5  
ATOM 8742  C CA   . ASP A 1 71  ? -11.520 1.058   11.280  1.00 0.41 ? 71  ASP A CA   5  
ATOM 8743  C C    . ASP A 1 71  ? -12.380 1.247   12.522  1.00 0.43 ? 71  ASP A C    5  
ATOM 8744  O O    . ASP A 1 71  ? -13.318 0.492   12.769  1.00 0.48 ? 71  ASP A O    5  
ATOM 8745  C CB   . ASP A 1 71  ? -10.797 -0.291  11.342  1.00 0.46 ? 71  ASP A CB   5  
ATOM 8746  C CG   . ASP A 1 71  ? -11.546 -1.390  10.614  1.00 0.54 ? 71  ASP A CG   5  
ATOM 8747  O OD1  . ASP A 1 71  ? -12.587 -1.096  9.987   1.00 0.61 ? 71  ASP A OD1  5  
ATOM 8748  O OD2  . ASP A 1 71  ? -11.086 -2.548  10.640  1.00 1.07 ? 71  ASP A OD2  5  
ATOM 8749  H H    . ASP A 1 71  ? -9.792  2.172   11.781  1.00 0.48 ? 71  ASP A H    5  
ATOM 8750  N N    . SER A 1 72  ? -12.043 2.268   13.306  1.00 0.46 ? 72  SER A N    5  
ATOM 8751  C CA   . SER A 1 72  ? -12.777 2.569   14.527  1.00 0.50 ? 72  SER A CA   5  
ATOM 8752  C C    . SER A 1 72  ? -14.139 3.182   14.206  1.00 0.47 ? 72  SER A C    5  
ATOM 8753  O O    . SER A 1 72  ? -15.117 2.960   14.922  1.00 0.54 ? 72  SER A O    5  
ATOM 8754  C CB   . SER A 1 72  ? -11.968 3.520   15.408  1.00 0.58 ? 72  SER A CB   5  
ATOM 8755  O OG   . SER A 1 72  ? -10.589 3.193   15.383  1.00 0.65 ? 72  SER A OG   5  
ATOM 8756  H H    . SER A 1 72  ? -11.280 2.829   13.060  1.00 0.49 ? 72  SER A H    5  
ATOM 8757  H HG   . SER A 1 72  ? -10.070 4.005   15.329  1.00 1.14 ? 72  SER A HG   5  
ATOM 8758  N N    . ASN A 1 73  ? -14.194 3.946   13.120  1.00 0.47 ? 73  ASN A N    5  
ATOM 8759  C CA   . ASN A 1 73  ? -15.431 4.593   12.696  1.00 0.47 ? 73  ASN A CA   5  
ATOM 8760  C C    . ASN A 1 73  ? -16.343 3.617   11.956  1.00 0.45 ? 73  ASN A C    5  
ATOM 8761  O O    . ASN A 1 73  ? -15.960 3.041   10.936  1.00 0.45 ? 73  ASN A O    5  
ATOM 8762  C CB   . ASN A 1 73  ? -15.150 5.840   11.842  1.00 0.49 ? 73  ASN A CB   5  
ATOM 8763  C CG   . ASN A 1 73  ? -13.968 5.698   10.895  1.00 0.49 ? 73  ASN A CG   5  
ATOM 8764  O OD1  . ASN A 1 73  ? -13.209 6.640   10.697  1.00 0.70 ? 73  ASN A OD1  5  
ATOM 8765  N ND2  . ASN A 1 73  ? -13.814 4.530   10.289  1.00 0.62 ? 73  ASN A ND2  5  
ATOM 8766  H H    . ASN A 1 73  ? -13.381 4.071   12.584  1.00 0.53 ? 73  ASN A H    5  
ATOM 8767  H HD21 . ASN A 1 73  ? -14.466 3.817   10.479  1.00 0.86 ? 73  ASN A HD21 5  
ATOM 8768  H HD22 . ASN A 1 73  ? -13.048 4.420   9.680   1.00 0.63 ? 73  ASN A HD22 5  
ATOM 8769  N N    . MET A 1 74  ? -17.551 3.442   12.474  1.00 0.48 ? 74  MET A N    5  
ATOM 8770  C CA   . MET A 1 74  ? -18.521 2.530   11.881  1.00 0.49 ? 74  MET A CA   5  
ATOM 8771  C C    . MET A 1 74  ? -19.010 3.022   10.525  1.00 0.47 ? 74  MET A C    5  
ATOM 8772  O O    . MET A 1 74  ? -19.335 2.221   9.653   1.00 0.46 ? 74  MET A O    5  
ATOM 8773  C CB   . MET A 1 74  ? -19.706 2.291   12.823  1.00 0.57 ? 74  MET A CB   5  
ATOM 8774  C CG   . MET A 1 74  ? -20.505 3.540   13.166  1.00 0.78 ? 74  MET A CG   5  
ATOM 8775  S SD   . MET A 1 74  ? -21.862 3.212   14.310  1.00 0.95 ? 74  MET A SD   5  
ATOM 8776  C CE   . MET A 1 74  ? -22.859 2.088   13.334  1.00 1.32 ? 74  MET A CE   5  
ATOM 8777  H H    . MET A 1 74  ? -17.801 3.946   13.280  1.00 0.53 ? 74  MET A H    5  
ATOM 8778  N N    . GLU A 1 75  ? -19.051 4.339   10.352  1.00 0.49 ? 75  GLU A N    5  
ATOM 8779  C CA   . GLU A 1 75  ? -19.509 4.938   9.103   1.00 0.52 ? 75  GLU A CA   5  
ATOM 8780  C C    . GLU A 1 75  ? -18.663 4.459   7.928   1.00 0.48 ? 75  GLU A C    5  
ATOM 8781  O O    . GLU A 1 75  ? -19.171 3.848   6.990   1.00 0.51 ? 75  GLU A O    5  
ATOM 8782  C CB   . GLU A 1 75  ? -19.457 6.467   9.175   1.00 0.61 ? 75  GLU A CB   5  
ATOM 8783  C CG   . GLU A 1 75  ? -19.923 7.055   10.495  1.00 0.72 ? 75  GLU A CG   5  
ATOM 8784  C CD   . GLU A 1 75  ? -18.798 7.179   11.500  1.00 1.09 ? 75  GLU A CD   5  
ATOM 8785  O OE1  . GLU A 1 75  ? -18.541 6.205   12.237  1.00 1.49 ? 75  GLU A OE1  5  
ATOM 8786  O OE2  . GLU A 1 75  ? -18.163 8.253   11.558  1.00 1.63 ? 75  GLU A OE2  5  
ATOM 8787  H H    . GLU A 1 75  ? -18.771 4.929   11.093  1.00 0.51 ? 75  GLU A H    5  
ATOM 8788  N N    . LEU A 1 76  ? -17.364 4.722   8.008   1.00 0.45 ? 76  LEU A N    5  
ATOM 8789  C CA   . LEU A 1 76  ? -16.432 4.337   6.955   1.00 0.44 ? 76  LEU A CA   5  
ATOM 8790  C C    . LEU A 1 76  ? -16.340 2.821   6.808   1.00 0.40 ? 76  LEU A C    5  
ATOM 8791  O O    . LEU A 1 76  ? -16.207 2.306   5.700   1.00 0.39 ? 76  LEU A O    5  
ATOM 8792  C CB   . LEU A 1 76  ? -15.049 4.933   7.228   1.00 0.48 ? 76  LEU A CB   5  
ATOM 8793  C CG   . LEU A 1 76  ? -13.995 4.756   6.131   1.00 0.49 ? 76  LEU A CG   5  
ATOM 8794  C CD1  . LEU A 1 76  ? -14.392 5.526   4.879   1.00 0.53 ? 76  LEU A CD1  5  
ATOM 8795  C CD2  . LEU A 1 76  ? -12.626 5.198   6.627   1.00 0.53 ? 76  LEU A CD2  5  
ATOM 8796  H H    . LEU A 1 76  ? -17.024 5.190   8.796   1.00 0.48 ? 76  LEU A H    5  
ATOM 8797  N N    . GLN A 1 77  ? -16.421 2.111   7.928   1.00 0.39 ? 77  GLN A N    5  
ATOM 8798  C CA   . GLN A 1 77  ? -16.343 0.653   7.914   1.00 0.38 ? 77  GLN A CA   5  
ATOM 8799  C C    . GLN A 1 77  ? -17.534 0.049   7.171   1.00 0.37 ? 77  GLN A C    5  
ATOM 8800  O O    . GLN A 1 77  ? -17.365 -0.791  6.284   1.00 0.38 ? 77  GLN A O    5  
ATOM 8801  C CB   . GLN A 1 77  ? -16.270 0.100   9.337   1.00 0.40 ? 77  GLN A CB   5  
ATOM 8802  C CG   . GLN A 1 77  ? -16.003 -1.394  9.408   1.00 0.41 ? 77  GLN A CG   5  
ATOM 8803  C CD   . GLN A 1 77  ? -15.952 -1.911  10.829  1.00 0.47 ? 77  GLN A CD   5  
ATOM 8804  O OE1  . GLN A 1 77  ? -16.965 -2.333  11.387  1.00 0.54 ? 77  GLN A OE1  5  
ATOM 8805  N NE2  . GLN A 1 77  ? -14.776 -1.876  11.427  1.00 0.54 ? 77  GLN A NE2  5  
ATOM 8806  H H    . GLN A 1 77  ? -16.539 2.577   8.783   1.00 0.41 ? 77  GLN A H    5  
ATOM 8807  H HE21 . GLN A 1 77  ? -14.001 -1.526  10.916  1.00 0.57 ? 77  GLN A HE21 5  
ATOM 8808  H HE22 . GLN A 1 77  ? -14.714 -2.194  12.348  1.00 0.61 ? 77  GLN A HE22 5  
ATOM 8809  N N    . ARG A 1 78  ? -18.732 0.496   7.527   1.00 0.40 ? 78  ARG A N    5  
ATOM 8810  C CA   . ARG A 1 78  ? -19.950 0.008   6.893   1.00 0.42 ? 78  ARG A CA   5  
ATOM 8811  C C    . ARG A 1 78  ? -19.989 0.396   5.419   1.00 0.40 ? 78  ARG A C    5  
ATOM 8812  O O    . ARG A 1 78  ? -20.576 -0.309  4.599   1.00 0.42 ? 78  ARG A O    5  
ATOM 8813  C CB   . ARG A 1 78  ? -21.186 0.539   7.612   1.00 0.49 ? 78  ARG A CB   5  
ATOM 8814  C CG   . ARG A 1 78  ? -21.647 -0.328  8.772   1.00 0.97 ? 78  ARG A CG   5  
ATOM 8815  C CD   . ARG A 1 78  ? -22.914 0.224   9.410   1.00 1.17 ? 78  ARG A CD   5  
ATOM 8816  N NE   . ARG A 1 78  ? -23.878 0.692   8.410   1.00 1.41 ? 78  ARG A NE   5  
ATOM 8817  C CZ   . ARG A 1 78  ? -24.711 -0.108  7.741   1.00 1.68 ? 78  ARG A CZ   5  
ATOM 8818  N NH1  . ARG A 1 78  ? -24.749 -1.407  8.009   1.00 1.85 ? 78  ARG A NH1  5  
ATOM 8819  N NH2  . ARG A 1 78  ? -25.518 0.393   6.815   1.00 2.19 ? 78  ARG A NH2  5  
ATOM 8820  H H    . ARG A 1 78  ? -18.801 1.173   8.239   1.00 0.41 ? 78  ARG A H    5  
ATOM 8821  H HE   . ARG A 1 78  ? -23.893 1.660   8.222   1.00 1.72 ? 78  ARG A HE   5  
ATOM 8822  H HH11 . ARG A 1 78  ? -24.156 -1.792  8.722   1.00 1.82 ? 78  ARG A HH11 5  
ATOM 8823  H HH12 . ARG A 1 78  ? -25.368 -2.010  7.500   1.00 2.25 ? 78  ARG A HH12 5  
ATOM 8824  H HH21 . ARG A 1 78  ? -25.510 1.376   6.613   1.00 2.44 ? 78  ARG A HH21 5  
ATOM 8825  H HH22 . ARG A 1 78  ? -26.141 -0.213  6.311   1.00 2.49 ? 78  ARG A HH22 5  
ATOM 8826  N N    . MET A 1 79  ? -19.352 1.515   5.095   1.00 0.41 ? 79  MET A N    5  
ATOM 8827  C CA   . MET A 1 79  ? -19.292 2.000   3.722   1.00 0.43 ? 79  MET A CA   5  
ATOM 8828  C C    . MET A 1 79  ? -18.554 1.009   2.832   1.00 0.40 ? 79  MET A C    5  
ATOM 8829  O O    . MET A 1 79  ? -18.936 0.784   1.686   1.00 0.41 ? 79  MET A O    5  
ATOM 8830  C CB   . MET A 1 79  ? -18.607 3.365   3.663   1.00 0.50 ? 79  MET A CB   5  
ATOM 8831  C CG   . MET A 1 79  ? -19.536 4.538   3.918   1.00 0.67 ? 79  MET A CG   5  
ATOM 8832  S SD   . MET A 1 79  ? -18.651 6.078   4.239   1.00 0.96 ? 79  MET A SD   5  
ATOM 8833  C CE   . MET A 1 79  ? -17.594 6.173   2.796   1.00 1.28 ? 79  MET A CE   5  
ATOM 8834  H H    . MET A 1 79  ? -18.914 2.036   5.805   1.00 0.42 ? 79  MET A H    5  
ATOM 8835  N N    . ILE A 1 80  ? -17.502 0.405   3.378   1.00 0.39 ? 80  ILE A N    5  
ATOM 8836  C CA   . ILE A 1 80  ? -16.710 -0.567  2.639   1.00 0.40 ? 80  ILE A CA   5  
ATOM 8837  C C    . ILE A 1 80  ? -17.516 -1.841  2.399   1.00 0.39 ? 80  ILE A C    5  
ATOM 8838  O O    . ILE A 1 80  ? -17.461 -2.433  1.322   1.00 0.44 ? 80  ILE A O    5  
ATOM 8839  C CB   . ILE A 1 80  ? -15.404 -0.921  3.385   1.00 0.43 ? 80  ILE A CB   5  
ATOM 8840  C CG1  . ILE A 1 80  ? -14.604 0.343   3.725   1.00 0.46 ? 80  ILE A CG1  5  
ATOM 8841  C CG2  . ILE A 1 80  ? -14.557 -1.888  2.567   1.00 0.47 ? 80  ILE A CG2  5  
ATOM 8842  C CD1  . ILE A 1 80  ? -14.207 1.172   2.520   1.00 0.49 ? 80  ILE A CD1  5  
ATOM 8843  H H    . ILE A 1 80  ? -17.255 0.620   4.304   1.00 0.40 ? 80  ILE A H    5  
ATOM 8844  N N    . ALA A 1 81  ? -18.287 -2.242  3.402   1.00 0.39 ? 81  ALA A N    5  
ATOM 8845  C CA   . ALA A 1 81  ? -19.108 -3.444  3.304   1.00 0.44 ? 81  ALA A CA   5  
ATOM 8846  C C    . ALA A 1 81  ? -20.239 -3.261  2.292   1.00 0.46 ? 81  ALA A C    5  
ATOM 8847  O O    . ALA A 1 81  ? -20.794 -4.237  1.779   1.00 0.56 ? 81  ALA A O    5  
ATOM 8848  C CB   . ALA A 1 81  ? -19.668 -3.821  4.668   1.00 0.48 ? 81  ALA A CB   5  
ATOM 8849  H H    . ALA A 1 81  ? -18.305 -1.718  4.232   1.00 0.40 ? 81  ALA A H    5  
ATOM 8850  N N    . ALA A 1 82  ? -20.568 -2.010  2.000   1.00 0.43 ? 82  ALA A N    5  
ATOM 8851  C CA   . ALA A 1 82  ? -21.634 -1.697  1.060   1.00 0.48 ? 82  ALA A CA   5  
ATOM 8852  C C    . ALA A 1 82  ? -21.152 -1.734  -0.392  1.00 0.45 ? 82  ALA A C    5  
ATOM 8853  O O    . ALA A 1 82  ? -21.956 -1.636  -1.320  1.00 0.49 ? 82  ALA A O    5  
ATOM 8854  C CB   . ALA A 1 82  ? -22.246 -0.345  1.389   1.00 0.55 ? 82  ALA A CB   5  
ATOM 8855  H H    . ALA A 1 82  ? -20.085 -1.274  2.437   1.00 0.44 ? 82  ALA A H    5  
ATOM 8856  N N    . VAL A 1 83  ? -19.846 -1.876  -0.589  1.00 0.43 ? 83  VAL A N    5  
ATOM 8857  C CA   . VAL A 1 83  ? -19.289 -1.918  -1.937  1.00 0.44 ? 83  VAL A CA   5  
ATOM 8858  C C    . VAL A 1 83  ? -19.435 -3.311  -2.550  1.00 0.42 ? 83  VAL A C    5  
ATOM 8859  O O    . VAL A 1 83  ? -19.387 -4.323  -1.844  1.00 0.52 ? 83  VAL A O    5  
ATOM 8860  C CB   . VAL A 1 83  ? -17.811 -1.446  -1.985  1.00 0.51 ? 83  VAL A CB   5  
ATOM 8861  C CG1  . VAL A 1 83  ? -16.838 -2.581  -1.693  1.00 0.54 ? 83  VAL A CG1  5  
ATOM 8862  C CG2  . VAL A 1 83  ? -17.495 -0.789  -3.320  1.00 0.58 ? 83  VAL A CG2  5  
ATOM 8863  H H    . VAL A 1 83  ? -19.247 -1.963  0.184   1.00 0.45 ? 83  VAL A H    5  
ATOM 8864  N N    . ASP A 1 84  ? -19.640 -3.355  -3.861  1.00 0.49 ? 84  ASP A N    5  
ATOM 8865  C CA   . ASP A 1 84  ? -19.796 -4.617  -4.570  1.00 0.54 ? 84  ASP A CA   5  
ATOM 8866  C C    . ASP A 1 84  ? -18.481 -5.036  -5.204  1.00 0.45 ? 84  ASP A C    5  
ATOM 8867  O O    . ASP A 1 84  ? -17.937 -4.331  -6.058  1.00 0.49 ? 84  ASP A O    5  
ATOM 8868  C CB   . ASP A 1 84  ? -20.882 -4.506  -5.646  1.00 0.73 ? 84  ASP A CB   5  
ATOM 8869  C CG   . ASP A 1 84  ? -22.138 -3.831  -5.136  1.00 0.86 ? 84  ASP A CG   5  
ATOM 8870  O OD1  . ASP A 1 84  ? -23.001 -4.521  -4.556  1.00 1.14 ? 84  ASP A OD1  5  
ATOM 8871  O OD2  . ASP A 1 84  ? -22.258 -2.600  -5.298  1.00 0.91 ? 84  ASP A OD2  5  
ATOM 8872  H H    . ASP A 1 84  ? -19.694 -2.518  -4.365  1.00 0.60 ? 84  ASP A H    5  
ATOM 8873  N N    . THR A 1 85  ? -17.968 -6.180  -4.789  1.00 0.46 ? 85  THR A N    5  
ATOM 8874  C CA   . THR A 1 85  ? -16.712 -6.687  -5.313  1.00 0.48 ? 85  THR A CA   5  
ATOM 8875  C C    . THR A 1 85  ? -16.945 -7.453  -6.618  1.00 0.48 ? 85  THR A C    5  
ATOM 8876  O O    . THR A 1 85  ? -16.580 -8.622  -6.749  1.00 0.73 ? 85  THR A O    5  
ATOM 8877  C CB   . THR A 1 85  ? -16.023 -7.590  -4.275  1.00 0.64 ? 85  THR A CB   5  
ATOM 8878  O OG1  . THR A 1 85  ? -16.309 -7.081  -2.961  1.00 0.66 ? 85  THR A OG1  5  
ATOM 8879  C CG2  . THR A 1 85  ? -14.515 -7.603  -4.490  1.00 0.77 ? 85  THR A CG2  5  
ATOM 8880  H H    . THR A 1 85  ? -18.457 -6.710  -4.120  1.00 0.53 ? 85  THR A H    5  
ATOM 8881  H HG1  . THR A 1 85  ? -16.656 -6.183  -3.038  1.00 0.70 ? 85  THR A HG1  5  
ATOM 8882  N N    . ASP A 1 86  ? -17.561 -6.775  -7.579  1.00 0.40 ? 86  ASP A N    5  
ATOM 8883  C CA   . ASP A 1 86  ? -17.861 -7.371  -8.878  1.00 0.44 ? 86  ASP A CA   5  
ATOM 8884  C C    . ASP A 1 86  ? -16.631 -7.411  -9.773  1.00 0.41 ? 86  ASP A C    5  
ATOM 8885  O O    . ASP A 1 86  ? -16.319 -8.437  -10.376 1.00 0.57 ? 86  ASP A O    5  
ATOM 8886  C CB   . ASP A 1 86  ? -18.986 -6.597  -9.580  1.00 0.56 ? 86  ASP A CB   5  
ATOM 8887  C CG   . ASP A 1 86  ? -19.150 -6.993  -11.035 1.00 0.67 ? 86  ASP A CG   5  
ATOM 8888  O OD1  . ASP A 1 86  ? -19.806 -8.019  -11.309 1.00 0.86 ? 86  ASP A OD1  5  
ATOM 8889  O OD2  . ASP A 1 86  ? -18.617 -6.284  -11.912 1.00 0.90 ? 86  ASP A OD2  5  
ATOM 8890  H H    . ASP A 1 86  ? -17.827 -5.845  -7.407  1.00 0.49 ? 86  ASP A H    5  
ATOM 8891  N N    . SER A 1 87  ? -15.934 -6.288  -9.856  1.00 0.38 ? 87  SER A N    5  
ATOM 8892  C CA   . SER A 1 87  ? -14.748 -6.185  -10.691 1.00 0.45 ? 87  SER A CA   5  
ATOM 8893  C C    . SER A 1 87  ? -13.587 -5.579  -9.902  1.00 0.36 ? 87  SER A C    5  
ATOM 8894  O O    . SER A 1 87  ? -13.474 -4.357  -9.790  1.00 0.44 ? 87  SER A O    5  
ATOM 8895  C CB   . SER A 1 87  ? -15.075 -5.347  -11.926 1.00 0.69 ? 87  SER A CB   5  
ATOM 8896  O OG   . SER A 1 87  ? -16.389 -4.807  -11.840 1.00 1.31 ? 87  SER A OG   5  
ATOM 8897  H H    . SER A 1 87  ? -16.221 -5.507  -9.343  1.00 0.45 ? 87  SER A H    5  
ATOM 8898  H HG   . SER A 1 87  ? -17.040 -5.530  -11.865 1.00 1.60 ? 87  SER A HG   5  
ATOM 8899  N N    . PRO A 1 88  ? -12.718 -6.435  -9.333  1.00 0.46 ? 88  PRO A N    5  
ATOM 8900  C CA   . PRO A 1 88  ? -11.565 -6.005  -8.523  1.00 0.52 ? 88  PRO A CA   5  
ATOM 8901  C C    . PRO A 1 88  ? -10.674 -4.963  -9.208  1.00 0.42 ? 88  PRO A C    5  
ATOM 8902  O O    . PRO A 1 88  ? -10.492 -3.861  -8.687  1.00 0.37 ? 88  PRO A O    5  
ATOM 8903  C CB   . PRO A 1 88  ? -10.789 -7.303  -8.294  1.00 0.74 ? 88  PRO A CB   5  
ATOM 8904  C CG   . PRO A 1 88  ? -11.817 -8.373  -8.392  1.00 0.89 ? 88  PRO A CG   5  
ATOM 8905  C CD   . PRO A 1 88  ? -12.795 -7.906  -9.433  1.00 0.72 ? 88  PRO A CD   5  
ATOM 8906  N N    . ARG A 1 89  ? -10.125 -5.307  -10.374 1.00 0.44 ? 89  ARG A N    5  
ATOM 8907  C CA   . ARG A 1 89  ? -9.246  -4.391  -11.109 1.00 0.41 ? 89  ARG A CA   5  
ATOM 8908  C C    . ARG A 1 89  ? -9.956  -3.091  -11.482 1.00 0.37 ? 89  ARG A C    5  
ATOM 8909  O O    . ARG A 1 89  ? -9.377  -2.012  -11.368 1.00 0.36 ? 89  ARG A O    5  
ATOM 8910  C CB   . ARG A 1 89  ? -8.641  -5.064  -12.353 1.00 0.55 ? 89  ARG A CB   5  
ATOM 8911  C CG   . ARG A 1 89  ? -7.744  -4.165  -13.202 1.00 0.64 ? 89  ARG A CG   5  
ATOM 8912  C CD   . ARG A 1 89  ? -6.479  -3.730  -12.465 1.00 0.91 ? 89  ARG A CD   5  
ATOM 8913  N NE   . ARG A 1 89  ? -5.536  -3.053  -13.362 1.00 1.11 ? 89  ARG A NE   5  
ATOM 8914  C CZ   . ARG A 1 89  ? -4.299  -2.683  -13.017 1.00 1.40 ? 89  ARG A CZ   5  
ATOM 8915  N NH1  . ARG A 1 89  ? -3.867  -2.857  -11.774 1.00 1.83 ? 89  ARG A NH1  5  
ATOM 8916  N NH2  . ARG A 1 89  ? -3.495  -2.126  -13.917 1.00 1.64 ? 89  ARG A NH2  5  
ATOM 8917  H H    . ARG A 1 89  ? -10.310 -6.195  -10.747 1.00 0.53 ? 89  ARG A H    5  
ATOM 8918  H HE   . ARG A 1 89  ? -5.840  -2.882  -14.283 1.00 1.35 ? 89  ARG A HE   5  
ATOM 8919  H HH11 . ARG A 1 89  ? -4.466  -3.272  -11.088 1.00 1.95 ? 89  ARG A HH11 5  
ATOM 8920  H HH12 . ARG A 1 89  ? -2.939  -2.573  -11.518 1.00 2.22 ? 89  ARG A HH12 5  
ATOM 8921  H HH21 . ARG A 1 89  ? -3.813  -1.981  -14.858 1.00 1.80 ? 89  ARG A HH21 5  
ATOM 8922  H HH22 . ARG A 1 89  ? -2.549  -1.860  -13.662 1.00 1.87 ? 89  ARG A HH22 5  
ATOM 8923  N N    . GLU A 1 90  ? -11.206 -3.204  -11.922 1.00 0.38 ? 90  GLU A N    5  
ATOM 8924  C CA   . GLU A 1 90  ? -12.004 -2.043  -12.308 1.00 0.38 ? 90  GLU A CA   5  
ATOM 8925  C C    . GLU A 1 90  ? -12.144 -1.060  -11.153 1.00 0.36 ? 90  GLU A C    5  
ATOM 8926  O O    . GLU A 1 90  ? -11.854 0.127   -11.300 1.00 0.38 ? 90  GLU A O    5  
ATOM 8927  C CB   . GLU A 1 90  ? -13.394 -2.472  -12.787 1.00 0.41 ? 90  GLU A CB   5  
ATOM 8928  C CG   . GLU A 1 90  ? -13.452 -2.952  -14.230 1.00 0.55 ? 90  GLU A CG   5  
ATOM 8929  C CD   . GLU A 1 90  ? -12.525 -4.116  -14.510 1.00 0.76 ? 90  GLU A CD   5  
ATOM 8930  O OE1  . GLU A 1 90  ? -12.424 -5.030  -13.662 1.00 1.10 ? 90  GLU A OE1  5  
ATOM 8931  O OE2  . GLU A 1 90  ? -11.899 -4.126  -15.591 1.00 1.46 ? 90  GLU A OE2  5  
ATOM 8932  H H    . GLU A 1 90  ? -11.602 -4.099  -12.007 1.00 0.42 ? 90  GLU A H    5  
ATOM 8933  N N    . VAL A 1 91  ? -12.585 -1.560  -10.004 1.00 0.34 ? 91  VAL A N    5  
ATOM 8934  C CA   . VAL A 1 91  ? -12.764 -0.721  -8.825  1.00 0.36 ? 91  VAL A CA   5  
ATOM 8935  C C    . VAL A 1 91  ? -11.441 -0.088  -8.405  1.00 0.32 ? 91  VAL A C    5  
ATOM 8936  O O    . VAL A 1 91  ? -11.378 1.108   -8.107  1.00 0.34 ? 91  VAL A O    5  
ATOM 8937  C CB   . VAL A 1 91  ? -13.371 -1.509  -7.642  1.00 0.38 ? 91  VAL A CB   5  
ATOM 8938  C CG1  . VAL A 1 91  ? -13.486 -0.630  -6.404  1.00 0.44 ? 91  VAL A CG1  5  
ATOM 8939  C CG2  . VAL A 1 91  ? -14.733 -2.072  -8.021  1.00 0.45 ? 91  VAL A CG2  5  
ATOM 8940  H H    . VAL A 1 91  ? -12.799 -2.521  -9.950  1.00 0.34 ? 91  VAL A H    5  
ATOM 8941  N N    . PHE A 1 92  ? -10.386 -0.895  -8.412  1.00 0.30 ? 92  PHE A N    5  
ATOM 8942  C CA   . PHE A 1 92  ? -9.059  -0.430  -8.035  1.00 0.30 ? 92  PHE A CA   5  
ATOM 8943  C C    . PHE A 1 92  ? -8.557  0.642   -8.999  1.00 0.29 ? 92  PHE A C    5  
ATOM 8944  O O    . PHE A 1 92  ? -8.049  1.677   -8.574  1.00 0.29 ? 92  PHE A O    5  
ATOM 8945  C CB   . PHE A 1 92  ? -8.073  -1.599  -7.983  1.00 0.33 ? 92  PHE A CB   5  
ATOM 8946  C CG   . PHE A 1 92  ? -6.704  -1.222  -7.489  1.00 0.37 ? 92  PHE A CG   5  
ATOM 8947  C CD1  . PHE A 1 92  ? -6.482  -0.976  -6.144  1.00 0.45 ? 92  PHE A CD1  5  
ATOM 8948  C CD2  . PHE A 1 92  ? -5.641  -1.115  -8.371  1.00 0.46 ? 92  PHE A CD2  5  
ATOM 8949  C CE1  . PHE A 1 92  ? -5.224  -0.630  -5.687  1.00 0.53 ? 92  PHE A CE1  5  
ATOM 8950  C CE2  . PHE A 1 92  ? -4.381  -0.769  -7.922  1.00 0.54 ? 92  PHE A CE2  5  
ATOM 8951  C CZ   . PHE A 1 92  ? -4.171  -0.527  -6.576  1.00 0.55 ? 92  PHE A CZ   5  
ATOM 8952  H H    . PHE A 1 92  ? -10.508 -1.833  -8.677  1.00 0.30 ? 92  PHE A H    5  
ATOM 8953  N N    . PHE A 1 93  ? -8.706  0.390   -10.293 1.00 0.31 ? 93  PHE A N    5  
ATOM 8954  C CA   . PHE A 1 93  ? -8.265  1.333   -11.308 1.00 0.34 ? 93  PHE A CA   5  
ATOM 8955  C C    . PHE A 1 93  ? -9.066  2.623   -11.218 1.00 0.34 ? 93  PHE A C    5  
ATOM 8956  O O    . PHE A 1 93  ? -8.515  3.718   -11.344 1.00 0.35 ? 93  PHE A O    5  
ATOM 8957  C CB   . PHE A 1 93  ? -8.400  0.720   -12.703 1.00 0.42 ? 93  PHE A CB   5  
ATOM 8958  C CG   . PHE A 1 93  ? -7.533  1.378   -13.740 1.00 0.60 ? 93  PHE A CG   5  
ATOM 8959  C CD1  . PHE A 1 93  ? -6.202  1.019   -13.878 1.00 0.82 ? 93  PHE A CD1  5  
ATOM 8960  C CD2  . PHE A 1 93  ? -8.048  2.355   -14.578 1.00 0.78 ? 93  PHE A CD2  5  
ATOM 8961  C CE1  . PHE A 1 93  ? -5.401  1.621   -14.827 1.00 1.06 ? 93  PHE A CE1  5  
ATOM 8962  C CE2  . PHE A 1 93  ? -7.253  2.963   -15.530 1.00 1.02 ? 93  PHE A CE2  5  
ATOM 8963  C CZ   . PHE A 1 93  ? -5.927  2.595   -15.654 1.00 1.12 ? 93  PHE A CZ   5  
ATOM 8964  H H    . PHE A 1 93  ? -9.126  -0.455  -10.576 1.00 0.32 ? 93  PHE A H    5  
ATOM 8965  N N    . ARG A 1 94  ? -10.366 2.486   -10.983 1.00 0.35 ? 94  ARG A N    5  
ATOM 8966  C CA   . ARG A 1 94  ? -11.249 3.636   -10.867 1.00 0.37 ? 94  ARG A CA   5  
ATOM 8967  C C    . ARG A 1 94  ? -10.819 4.549   -9.730  1.00 0.33 ? 94  ARG A C    5  
ATOM 8968  O O    . ARG A 1 94  ? -10.595 5.735   -9.940  1.00 0.34 ? 94  ARG A O    5  
ATOM 8969  C CB   . ARG A 1 94  ? -12.697 3.199   -10.659 1.00 0.43 ? 94  ARG A CB   5  
ATOM 8970  C CG   . ARG A 1 94  ? -13.605 3.435   -11.858 1.00 0.55 ? 94  ARG A CG   5  
ATOM 8971  C CD   . ARG A 1 94  ? -13.770 4.919   -12.170 1.00 0.75 ? 94  ARG A CD   5  
ATOM 8972  N NE   . ARG A 1 94  ? -14.133 5.719   -10.993 1.00 0.81 ? 94  ARG A NE   5  
ATOM 8973  C CZ   . ARG A 1 94  ? -15.318 5.670   -10.374 1.00 1.17 ? 94  ARG A CZ   5  
ATOM 8974  N NH1  . ARG A 1 94  ? -16.282 4.872   -10.815 1.00 1.43 ? 94  ARG A NH1  5  
ATOM 8975  N NH2  . ARG A 1 94  ? -15.542 6.439   -9.318  1.00 1.33 ? 94  ARG A NH2  5  
ATOM 8976  H H    . ARG A 1 94  ? -10.745 1.581   -10.894 1.00 0.36 ? 94  ARG A H    5  
ATOM 8977  H HE   . ARG A 1 94  ? -13.447 6.349   -10.648 1.00 0.69 ? 94  ARG A HE   5  
ATOM 8978  H HH11 . ARG A 1 94  ? -16.132 4.293   -11.623 1.00 1.33 ? 94  ARG A HH11 5  
ATOM 8979  H HH12 . ARG A 1 94  ? -17.169 4.849   -10.350 1.00 1.75 ? 94  ARG A HH12 5  
ATOM 8980  H HH21 . ARG A 1 94  ? -14.816 7.064   -8.981  1.00 1.16 ? 94  ARG A HH21 5  
ATOM 8981  H HH22 . ARG A 1 94  ? -16.426 6.414   -8.853  1.00 1.66 ? 94  ARG A HH22 5  
ATOM 8982  N N    . VAL A 1 95  ? -10.674 3.992   -8.531  1.00 0.31 ? 95  VAL A N    5  
ATOM 8983  C CA   . VAL A 1 95  ? -10.278 4.787   -7.372  1.00 0.30 ? 95  VAL A CA   5  
ATOM 8984  C C    . VAL A 1 95  ? -8.859  5.341   -7.521  1.00 0.28 ? 95  VAL A C    5  
ATOM 8985  O O    . VAL A 1 95  ? -8.554  6.427   -7.030  1.00 0.30 ? 95  VAL A O    5  
ATOM 8986  C CB   . VAL A 1 95  ? -10.440 4.039   -6.029  1.00 0.31 ? 95  VAL A CB   5  
ATOM 8987  C CG1  . VAL A 1 95  ? -11.900 3.685   -5.785  1.00 0.37 ? 95  VAL A CG1  5  
ATOM 8988  C CG2  . VAL A 1 95  ? -9.561  2.798   -5.969  1.00 0.29 ? 95  VAL A CG2  5  
ATOM 8989  H H    . VAL A 1 95  ? -10.828 3.027   -8.424  1.00 0.32 ? 95  VAL A H    5  
ATOM 8990  N N    . ALA A 1 96  ? -8.006  4.601   -8.223  1.00 0.27 ? 96  ALA A N    5  
ATOM 8991  C CA   . ALA A 1 96  ? -6.631  5.030   -8.443  1.00 0.29 ? 96  ALA A CA   5  
ATOM 8992  C C    . ALA A 1 96  ? -6.596  6.282   -9.314  1.00 0.30 ? 96  ALA A C    5  
ATOM 8993  O O    . ALA A 1 96  ? -5.821  7.208   -9.059  1.00 0.32 ? 96  ALA A O    5  
ATOM 8994  C CB   . ALA A 1 96  ? -5.810  3.914   -9.075  1.00 0.33 ? 96  ALA A CB   5  
ATOM 8995  H H    . ALA A 1 96  ? -8.307  3.743   -8.596  1.00 0.28 ? 96  ALA A H    5  
ATOM 8996  N N    . ALA A 1 97  ? -7.450  6.305   -10.329 1.00 0.31 ? 97  ALA A N    5  
ATOM 8997  C CA   . ALA A 1 97  ? -7.532  7.438   -11.241 1.00 0.34 ? 97  ALA A CA   5  
ATOM 8998  C C    . ALA A 1 97  ? -8.434  8.531   -10.679 1.00 0.34 ? 97  ALA A C    5  
ATOM 8999  O O    . ALA A 1 97  ? -8.231  9.712   -10.949 1.00 0.38 ? 97  ALA A O    5  
ATOM 9000  C CB   . ALA A 1 97  ? -8.031  6.983   -12.604 1.00 0.38 ? 97  ALA A CB   5  
ATOM 9001  H H    . ALA A 1 97  ? -8.042  5.531   -10.474 1.00 0.30 ? 97  ALA A H    5  
ATOM 9002  N N    . ASP A 1 98  ? -9.422  8.129   -9.887  1.00 0.33 ? 98  ASP A N    5  
ATOM 9003  C CA   . ASP A 1 98  ? -10.364 9.068   -9.275  1.00 0.37 ? 98  ASP A CA   5  
ATOM 9004  C C    . ASP A 1 98  ? -9.641  10.069  -8.388  1.00 0.35 ? 98  ASP A C    5  
ATOM 9005  O O    . ASP A 1 98  ? -10.027 11.236  -8.297  1.00 0.37 ? 98  ASP A O    5  
ATOM 9006  C CB   . ASP A 1 98  ? -11.405 8.318   -8.442  1.00 0.45 ? 98  ASP A CB   5  
ATOM 9007  C CG   . ASP A 1 98  ? -12.748 8.190   -9.129  1.00 0.57 ? 98  ASP A CG   5  
ATOM 9008  O OD1  . ASP A 1 98  ? -12.789 8.081   -10.372 1.00 0.82 ? 98  ASP A OD1  5  
ATOM 9009  O OD2  . ASP A 1 98  ? -13.773 8.172   -8.421  1.00 1.16 ? 98  ASP A OD2  5  
ATOM 9010  H H    . ASP A 1 98  ? -9.540  7.167   -9.725  1.00 0.32 ? 98  ASP A H    5  
ATOM 9011  N N    . MET A 1 99  ? -8.592  9.603   -7.727  1.00 0.35 ? 99  MET A N    5  
ATOM 9012  C CA   . MET A 1 99  ? -7.798  10.452  -6.849  1.00 0.38 ? 99  MET A CA   5  
ATOM 9013  C C    . MET A 1 99  ? -6.621  11.052  -7.618  1.00 0.39 ? 99  MET A C    5  
ATOM 9014  O O    . MET A 1 99  ? -5.681  11.587  -7.028  1.00 0.48 ? 99  MET A O    5  
ATOM 9015  C CB   . MET A 1 99  ? -7.282  9.648   -5.650  1.00 0.39 ? 99  MET A CB   5  
ATOM 9016  C CG   . MET A 1 99  ? -8.362  8.963   -4.826  1.00 0.38 ? 99  MET A CG   5  
ATOM 9017  S SD   . MET A 1 99  ? -7.677  7.781   -3.649  1.00 0.40 ? 99  MET A SD   5  
ATOM 9018  C CE   . MET A 1 99  ? -9.177  7.128   -2.918  1.00 0.42 ? 99  MET A CE   5  
ATOM 9019  H H    . MET A 1 99  ? -8.351  8.655   -7.826  1.00 0.37 ? 99  MET A H    5  
ATOM 9020  N N    . PHE A 1 100 ? -6.671  10.947  -8.938  1.00 0.36 ? 100 PHE A N    5  
ATOM 9021  C CA   . PHE A 1 100 ? -5.617  11.476  -9.792  1.00 0.41 ? 100 PHE A CA   5  
ATOM 9022  C C    . PHE A 1 100 ? -6.213  12.209  -10.989 1.00 0.44 ? 100 PHE A C    5  
ATOM 9023  O O    . PHE A 1 100 ? -5.527  12.476  -11.977 1.00 0.54 ? 100 PHE A O    5  
ATOM 9024  C CB   . PHE A 1 100 ? -4.709  10.339  -10.268 1.00 0.46 ? 100 PHE A CB   5  
ATOM 9025  C CG   . PHE A 1 100 ? -3.242  10.601  -10.075 1.00 0.62 ? 100 PHE A CG   5  
ATOM 9026  C CD1  . PHE A 1 100 ? -2.803  11.524  -9.139  1.00 0.81 ? 100 PHE A CD1  5  
ATOM 9027  C CD2  . PHE A 1 100 ? -2.301  9.921   -10.832 1.00 0.80 ? 100 PHE A CD2  5  
ATOM 9028  C CE1  . PHE A 1 100 ? -1.455  11.764  -8.960  1.00 0.99 ? 100 PHE A CE1  5  
ATOM 9029  C CE2  . PHE A 1 100 ? -0.950  10.156  -10.658 1.00 1.00 ? 100 PHE A CE2  5  
ATOM 9030  C CZ   . PHE A 1 100 ? -0.527  11.079  -9.720  1.00 1.03 ? 100 PHE A CZ   5  
ATOM 9031  H H    . PHE A 1 100 ? -7.438  10.495  -9.354  1.00 0.35 ? 100 PHE A H    5  
ATOM 9032  N N    . SER A 1 101 ? -7.495  12.539  -10.887 1.00 0.53 ? 101 SER A N    5  
ATOM 9033  C CA   . SER A 1 101 ? -8.193  13.236  -11.951 1.00 0.58 ? 101 SER A CA   5  
ATOM 9034  C C    . SER A 1 101 ? -7.714  14.676  -12.044 1.00 0.42 ? 101 SER A C    5  
ATOM 9035  O O    . SER A 1 101 ? -7.471  15.198  -13.136 1.00 0.48 ? 101 SER A O    5  
ATOM 9036  C CB   . SER A 1 101 ? -9.698  13.200  -11.682 1.00 0.80 ? 101 SER A CB   5  
ATOM 9037  O OG   . SER A 1 101 ? -9.955  13.209  -10.287 1.00 1.20 ? 101 SER A OG   5  
ATOM 9038  H H    . SER A 1 101 ? -7.985  12.311  -10.070 1.00 0.65 ? 101 SER A H    5  
ATOM 9039  H HG   . SER A 1 101 ? -10.647 12.568  -10.090 1.00 1.33 ? 101 SER A HG   5  
ATOM 9040  N N    . ASP A 1 102 ? -7.560  15.306  -10.889 1.00 0.45 ? 102 ASP A N    5  
ATOM 9041  C CA   . ASP A 1 102 ? -7.107  16.685  -10.824 1.00 0.53 ? 102 ASP A CA   5  
ATOM 9042  C C    . ASP A 1 102 ? -5.586  16.730  -10.786 1.00 0.45 ? 102 ASP A C    5  
ATOM 9043  O O    . ASP A 1 102 ? -4.965  17.644  -11.328 1.00 0.63 ? 102 ASP A O    5  
ATOM 9044  C CB   . ASP A 1 102 ? -7.683  17.369  -9.584  1.00 0.78 ? 102 ASP A CB   5  
ATOM 9045  C CG   . ASP A 1 102 ? -7.717  18.878  -9.708  1.00 1.07 ? 102 ASP A CG   5  
ATOM 9046  O OD1  . ASP A 1 102 ? -6.666  19.521  -9.520  1.00 1.64 ? 102 ASP A OD1  5  
ATOM 9047  O OD2  . ASP A 1 102 ? -8.807  19.428  -9.982  1.00 1.62 ? 102 ASP A OD2  5  
ATOM 9048  H H    . ASP A 1 102 ? -7.759  14.827  -10.055 1.00 0.56 ? 102 ASP A H    5  
ATOM 9049  N N    . GLY A 1 103 ? -4.994  15.724  -10.156 1.00 0.40 ? 103 GLY A N    5  
ATOM 9050  C CA   . GLY A 1 103 ? -3.551  15.655  -10.054 1.00 0.53 ? 103 GLY A CA   5  
ATOM 9051  C C    . GLY A 1 103 ? -3.052  16.334  -8.797  1.00 0.53 ? 103 GLY A C    5  
ATOM 9052  O O    . GLY A 1 103 ? -1.943  16.870  -8.765  1.00 0.70 ? 103 GLY A O    5  
ATOM 9053  H H    . GLY A 1 103 ? -5.545  15.026  -9.745  1.00 0.46 ? 103 GLY A H    5  
ATOM 9054  N N    . ASN A 1 104 ? -3.875  16.313  -7.761  1.00 0.44 ? 104 ASN A N    5  
ATOM 9055  C CA   . ASN A 1 104 ? -3.525  16.934  -6.494  1.00 0.47 ? 104 ASN A CA   5  
ATOM 9056  C C    . ASN A 1 104 ? -2.734  15.972  -5.615  1.00 0.43 ? 104 ASN A C    5  
ATOM 9057  O O    . ASN A 1 104 ? -3.245  14.940  -5.182  1.00 0.45 ? 104 ASN A O    5  
ATOM 9058  C CB   . ASN A 1 104 ? -4.785  17.426  -5.772  1.00 0.55 ? 104 ASN A CB   5  
ATOM 9059  C CG   . ASN A 1 104 ? -4.490  18.089  -4.440  1.00 0.61 ? 104 ASN A CG   5  
ATOM 9060  O OD1  . ASN A 1 104 ? -4.570  17.456  -3.389  1.00 0.69 ? 104 ASN A OD1  5  
ATOM 9061  N ND2  . ASN A 1 104 ? -4.142  19.364  -4.469  1.00 0.91 ? 104 ASN A ND2  5  
ATOM 9062  H H    . ASN A 1 104 ? -4.740  15.859  -7.848  1.00 0.48 ? 104 ASN A H    5  
ATOM 9063  H HD21 . ASN A 1 104 ? -4.090  19.813  -5.343  1.00 1.15 ? 104 ASN A HD21 5  
ATOM 9064  H HD22 . ASN A 1 104 ? -3.951  19.812  -3.619  1.00 0.98 ? 104 ASN A HD22 5  
ATOM 9065  N N    . PHE A 1 105 ? -1.478  16.307  -5.370  1.00 0.45 ? 105 PHE A N    5  
ATOM 9066  C CA   . PHE A 1 105 ? -0.606  15.480  -4.548  1.00 0.48 ? 105 PHE A CA   5  
ATOM 9067  C C    . PHE A 1 105 ? -0.786  15.823  -3.073  1.00 0.50 ? 105 PHE A C    5  
ATOM 9068  O O    . PHE A 1 105 ? 0.068   16.460  -2.458  1.00 0.60 ? 105 PHE A O    5  
ATOM 9069  C CB   . PHE A 1 105 ? 0.856   15.667  -4.963  1.00 0.60 ? 105 PHE A CB   5  
ATOM 9070  C CG   . PHE A 1 105 ? 1.147   15.270  -6.382  1.00 0.66 ? 105 PHE A CG   5  
ATOM 9071  C CD1  . PHE A 1 105 ? 1.426   13.951  -6.701  1.00 0.66 ? 105 PHE A CD1  5  
ATOM 9072  C CD2  . PHE A 1 105 ? 1.144   16.213  -7.397  1.00 0.81 ? 105 PHE A CD2  5  
ATOM 9073  C CE1  . PHE A 1 105 ? 1.696   13.580  -8.004  1.00 0.75 ? 105 PHE A CE1  5  
ATOM 9074  C CE2  . PHE A 1 105 ? 1.413   15.849  -8.703  1.00 0.91 ? 105 PHE A CE2  5  
ATOM 9075  C CZ   . PHE A 1 105 ? 1.689   14.530  -9.008  1.00 0.86 ? 105 PHE A CZ   5  
ATOM 9076  H H    . PHE A 1 105 ? -1.127  17.141  -5.748  1.00 0.50 ? 105 PHE A H    5  
ATOM 9077  N N    . ASN A 1 106 ? -1.910  15.402  -2.514  1.00 0.45 ? 106 ASN A N    5  
ATOM 9078  C CA   . ASN A 1 106 ? -2.230  15.670  -1.114  1.00 0.48 ? 106 ASN A CA   5  
ATOM 9079  C C    . ASN A 1 106 ? -1.656  14.625  -0.165  1.00 0.49 ? 106 ASN A C    5  
ATOM 9080  O O    . ASN A 1 106 ? -1.810  14.746  1.052   1.00 0.52 ? 106 ASN A O    5  
ATOM 9081  C CB   . ASN A 1 106 ? -3.745  15.758  -0.924  1.00 0.48 ? 106 ASN A CB   5  
ATOM 9082  C CG   . ASN A 1 106 ? -4.490  14.579  -1.523  1.00 0.43 ? 106 ASN A CG   5  
ATOM 9083  O OD1  . ASN A 1 106 ? -4.276  13.425  -1.141  1.00 0.44 ? 106 ASN A OD1  5  
ATOM 9084  N ND2  . ASN A 1 106 ? -5.357  14.864  -2.480  1.00 0.55 ? 106 ASN A ND2  5  
ATOM 9085  H H    . ASN A 1 106 ? -2.559  14.913  -3.066  1.00 0.42 ? 106 ASN A H    5  
ATOM 9086  H HD21 . ASN A 1 106 ? -5.458  15.809  -2.743  1.00 0.69 ? 106 ASN A HD21 5  
ATOM 9087  H HD22 . ASN A 1 106 ? -5.870  14.131  -2.883  1.00 0.55 ? 106 ASN A HD22 5  
ATOM 9088  N N    . TRP A 1 107 ? -1.024  13.589  -0.728  1.00 0.46 ? 107 TRP A N    5  
ATOM 9089  C CA   . TRP A 1 107 ? -0.421  12.499  0.054   1.00 0.48 ? 107 TRP A CA   5  
ATOM 9090  C C    . TRP A 1 107 ? -1.472  11.563  0.655   1.00 0.45 ? 107 TRP A C    5  
ATOM 9091  O O    . TRP A 1 107 ? -1.315  10.345  0.620   1.00 0.45 ? 107 TRP A O    5  
ATOM 9092  C CB   . TRP A 1 107 ? 0.526   13.019  1.142   1.00 0.54 ? 107 TRP A CB   5  
ATOM 9093  C CG   . TRP A 1 107 ? 1.982   12.836  0.840   1.00 0.72 ? 107 TRP A CG   5  
ATOM 9094  C CD1  . TRP A 1 107 ? 2.935   13.812  0.784   1.00 1.02 ? 107 TRP A CD1  5  
ATOM 9095  C CD2  . TRP A 1 107 ? 2.654   11.600  0.556   1.00 0.84 ? 107 TRP A CD2  5  
ATOM 9096  N NE1  . TRP A 1 107 ? 4.157   13.263  0.489   1.00 1.24 ? 107 TRP A NE1  5  
ATOM 9097  C CE2  . TRP A 1 107 ? 4.012   11.905  0.342   1.00 1.15 ? 107 TRP A CE2  5  
ATOM 9098  C CE3  . TRP A 1 107 ? 2.239   10.265  0.463   1.00 0.91 ? 107 TRP A CE3  5  
ATOM 9099  C CZ2  . TRP A 1 107 ? 4.955   10.925  0.041   1.00 1.42 ? 107 TRP A CZ2  5  
ATOM 9100  C CZ3  . TRP A 1 107 ? 3.178   9.297   0.164   1.00 1.24 ? 107 TRP A CZ3  5  
ATOM 9101  C CH2  . TRP A 1 107 ? 4.520   9.632   -0.041  1.00 1.46 ? 107 TRP A CH2  5  
ATOM 9102  H H    . TRP A 1 107 ? -0.961  13.555  -1.703  1.00 0.45 ? 107 TRP A H    5  
ATOM 9103  H HE1  . TRP A 1 107 ? 4.998   13.761  0.397   1.00 1.49 ? 107 TRP A HE1  5  
ATOM 9104  N N    . GLY A 1 108 ? -2.543  12.141  1.195   1.00 0.46 ? 108 GLY A N    5  
ATOM 9105  C CA   . GLY A 1 108 ? -3.607  11.359  1.803   1.00 0.45 ? 108 GLY A CA   5  
ATOM 9106  C C    . GLY A 1 108 ? -4.200  10.332  0.859   1.00 0.41 ? 108 GLY A C    5  
ATOM 9107  O O    . GLY A 1 108 ? -4.575  9.239   1.278   1.00 0.41 ? 108 GLY A O    5  
ATOM 9108  H H    . GLY A 1 108 ? -2.607  13.122  1.187   1.00 0.47 ? 108 GLY A H    5  
ATOM 9109  N N    . ARG A 1 109 ? -4.261  10.677  -0.424  1.00 0.39 ? 109 ARG A N    5  
ATOM 9110  C CA   . ARG A 1 109 ? -4.803  9.780   -1.441  1.00 0.36 ? 109 ARG A CA   5  
ATOM 9111  C C    . ARG A 1 109 ? -3.954  8.515   -1.599  1.00 0.35 ? 109 ARG A C    5  
ATOM 9112  O O    . ARG A 1 109 ? -4.354  7.571   -2.278  1.00 0.35 ? 109 ARG A O    5  
ATOM 9113  C CB   . ARG A 1 109 ? -4.932  10.504  -2.785  1.00 0.36 ? 109 ARG A CB   5  
ATOM 9114  C CG   . ARG A 1 109 ? -3.607  10.763  -3.487  1.00 0.37 ? 109 ARG A CG   5  
ATOM 9115  C CD   . ARG A 1 109 ? -3.595  10.161  -4.884  1.00 0.36 ? 109 ARG A CD   5  
ATOM 9116  N NE   . ARG A 1 109 ? -3.985  8.747   -4.885  1.00 0.36 ? 109 ARG A NE   5  
ATOM 9117  C CZ   . ARG A 1 109 ? -4.314  8.063   -5.980  1.00 0.36 ? 109 ARG A CZ   5  
ATOM 9118  N NH1  . ARG A 1 109 ? -4.282  8.650   -7.172  1.00 0.35 ? 109 ARG A NH1  5  
ATOM 9119  N NH2  . ARG A 1 109 ? -4.688  6.793   -5.878  1.00 0.40 ? 109 ARG A NH2  5  
ATOM 9120  H H    . ARG A 1 109 ? -3.950  11.570  -0.691  1.00 0.39 ? 109 ARG A H    5  
ATOM 9121  H HE   . ARG A 1 109 ? -4.016  8.289   -4.011  1.00 0.38 ? 109 ARG A HE   5  
ATOM 9122  H HH11 . ARG A 1 109 ? -4.008  9.612   -7.252  1.00 0.35 ? 109 ARG A HH11 5  
ATOM 9123  H HH12 . ARG A 1 109 ? -4.539  8.136   -7.998  1.00 0.35 ? 109 ARG A HH12 5  
ATOM 9124  H HH21 . ARG A 1 109 ? -4.723  6.350   -4.977  1.00 0.43 ? 109 ARG A HH21 5  
ATOM 9125  H HH22 . ARG A 1 109 ? -4.941  6.274   -6.695  1.00 0.42 ? 109 ARG A HH22 5  
ATOM 9126  N N    . VAL A 1 110 ? -2.772  8.514   -0.992  1.00 0.37 ? 110 VAL A N    5  
ATOM 9127  C CA   . VAL A 1 110 ? -1.880  7.363   -1.060  1.00 0.38 ? 110 VAL A CA   5  
ATOM 9128  C C    . VAL A 1 110 ? -2.168  6.414   0.097   1.00 0.38 ? 110 VAL A C    5  
ATOM 9129  O O    . VAL A 1 110 ? -2.376  5.219   -0.106  1.00 0.37 ? 110 VAL A O    5  
ATOM 9130  C CB   . VAL A 1 110 ? -0.392  7.779   -1.043  1.00 0.44 ? 110 VAL A CB   5  
ATOM 9131  C CG1  . VAL A 1 110 ? 0.513   6.563   -1.187  1.00 0.47 ? 110 VAL A CG1  5  
ATOM 9132  C CG2  . VAL A 1 110 ? -0.109  8.786   -2.150  1.00 0.46 ? 110 VAL A CG2  5  
ATOM 9133  H H    . VAL A 1 110 ? -2.494  9.306   -0.483  1.00 0.38 ? 110 VAL A H    5  
ATOM 9134  N N    . VAL A 1 111 ? -2.218  6.959   1.309   1.00 0.40 ? 111 VAL A N    5  
ATOM 9135  C CA   . VAL A 1 111 ? -2.491  6.152   2.491   1.00 0.41 ? 111 VAL A CA   5  
ATOM 9136  C C    . VAL A 1 111 ? -3.929  5.627   2.464   1.00 0.39 ? 111 VAL A C    5  
ATOM 9137  O O    . VAL A 1 111 ? -4.206  4.516   2.919   1.00 0.39 ? 111 VAL A O    5  
ATOM 9138  C CB   . VAL A 1 111 ? -2.200  6.912   3.809   1.00 0.46 ? 111 VAL A CB   5  
ATOM 9139  C CG1  . VAL A 1 111 ? -3.125  8.109   3.987   1.00 0.45 ? 111 VAL A CG1  5  
ATOM 9140  C CG2  . VAL A 1 111 ? -2.273  5.978   5.008   1.00 0.50 ? 111 VAL A CG2  5  
ATOM 9141  H H    . VAL A 1 111 ? -2.072  7.923   1.408   1.00 0.41 ? 111 VAL A H    5  
ATOM 9142  N N    . ALA A 1 112 ? -4.835  6.422   1.904   1.00 0.37 ? 112 ALA A N    5  
ATOM 9143  C CA   . ALA A 1 112 ? -6.233  6.029   1.793   1.00 0.36 ? 112 ALA A CA   5  
ATOM 9144  C C    . ALA A 1 112 ? -6.364  4.841   0.851   1.00 0.34 ? 112 ALA A C    5  
ATOM 9145  O O    . ALA A 1 112 ? -7.201  3.957   1.052   1.00 0.34 ? 112 ALA A O    5  
ATOM 9146  C CB   . ALA A 1 112 ? -7.075  7.192   1.296   1.00 0.36 ? 112 ALA A CB   5  
ATOM 9147  H H    . ALA A 1 112 ? -4.559  7.304   1.566   1.00 0.37 ? 112 ALA A H    5  
ATOM 9148  N N    . LEU A 1 113 ? -5.517  4.823   -0.174  1.00 0.34 ? 113 LEU A N    5  
ATOM 9149  C CA   . LEU A 1 113 ? -5.515  3.742   -1.148  1.00 0.33 ? 113 LEU A CA   5  
ATOM 9150  C C    . LEU A 1 113 ? -5.064  2.450   -0.480  1.00 0.33 ? 113 LEU A C    5  
ATOM 9151  O O    . LEU A 1 113 ? -5.600  1.377   -0.755  1.00 0.33 ? 113 LEU A O    5  
ATOM 9152  C CB   . LEU A 1 113 ? -4.596  4.083   -2.328  1.00 0.34 ? 113 LEU A CB   5  
ATOM 9153  C CG   . LEU A 1 113 ? -4.710  3.182   -3.561  1.00 0.35 ? 113 LEU A CG   5  
ATOM 9154  C CD1  . LEU A 1 113 ? -6.065  3.354   -4.229  1.00 0.35 ? 113 LEU A CD1  5  
ATOM 9155  C CD2  . LEU A 1 113 ? -3.583  3.466   -4.543  1.00 0.36 ? 113 LEU A CD2  5  
ATOM 9156  H H    . LEU A 1 113 ? -4.877  5.558   -0.278  1.00 0.35 ? 113 LEU A H    5  
ATOM 9157  N N    . PHE A 1 114 ? -4.088  2.565   0.417   1.00 0.34 ? 114 PHE A N    5  
ATOM 9158  C CA   . PHE A 1 114 ? -3.577  1.408   1.140   1.00 0.36 ? 114 PHE A CA   5  
ATOM 9159  C C    . PHE A 1 114 ? -4.666  0.810   2.023   1.00 0.35 ? 114 PHE A C    5  
ATOM 9160  O O    . PHE A 1 114 ? -4.808  -0.410  2.111   1.00 0.36 ? 114 PHE A O    5  
ATOM 9161  C CB   . PHE A 1 114 ? -2.365  1.784   1.993   1.00 0.38 ? 114 PHE A CB   5  
ATOM 9162  C CG   . PHE A 1 114 ? -1.118  2.064   1.207   1.00 0.42 ? 114 PHE A CG   5  
ATOM 9163  C CD1  . PHE A 1 114 ? -0.744  1.243   0.156   1.00 0.75 ? 114 PHE A CD1  5  
ATOM 9164  C CD2  . PHE A 1 114 ? -0.316  3.146   1.523   1.00 0.71 ? 114 PHE A CD2  5  
ATOM 9165  C CE1  . PHE A 1 114 ? 0.407   1.497   -0.565  1.00 0.98 ? 114 PHE A CE1  5  
ATOM 9166  C CE2  . PHE A 1 114 ? 0.836   3.407   0.809   1.00 0.89 ? 114 PHE A CE2  5  
ATOM 9167  C CZ   . PHE A 1 114 ? 1.199   2.580   -0.237  1.00 0.93 ? 114 PHE A CZ   5  
ATOM 9168  H H    . PHE A 1 114 ? -3.704  3.452   0.595   1.00 0.35 ? 114 PHE A H    5  
ATOM 9169  N N    . TYR A 1 115 ? -5.434  1.681   2.672   1.00 0.34 ? 115 TYR A N    5  
ATOM 9170  C CA   . TYR A 1 115 ? -6.524  1.248   3.543   1.00 0.34 ? 115 TYR A CA   5  
ATOM 9171  C C    . TYR A 1 115 ? -7.604  0.530   2.737   1.00 0.33 ? 115 TYR A C    5  
ATOM 9172  O O    . TYR A 1 115 ? -8.138  -0.495  3.162   1.00 0.33 ? 115 TYR A O    5  
ATOM 9173  C CB   . TYR A 1 115 ? -7.126  2.447   4.286   1.00 0.35 ? 115 TYR A CB   5  
ATOM 9174  C CG   . TYR A 1 115 ? -8.343  2.105   5.119   1.00 0.35 ? 115 TYR A CG   5  
ATOM 9175  C CD1  . TYR A 1 115 ? -8.210  1.506   6.366   1.00 0.37 ? 115 TYR A CD1  5  
ATOM 9176  C CD2  . TYR A 1 115 ? -9.625  2.375   4.657   1.00 0.35 ? 115 TYR A CD2  5  
ATOM 9177  C CE1  . TYR A 1 115 ? -9.320  1.184   7.125   1.00 0.39 ? 115 TYR A CE1  5  
ATOM 9178  C CE2  . TYR A 1 115 ? -10.740 2.059   5.409   1.00 0.37 ? 115 TYR A CE2  5  
ATOM 9179  C CZ   . TYR A 1 115 ? -10.581 1.463   6.642   1.00 0.39 ? 115 TYR A CZ   5  
ATOM 9180  O OH   . TYR A 1 115 ? -11.689 1.137   7.392   1.00 0.42 ? 115 TYR A OH   5  
ATOM 9181  H H    . TYR A 1 115 ? -5.260  2.642   2.567   1.00 0.34 ? 115 TYR A H    5  
ATOM 9182  H HH   . TYR A 1 115 ? -11.722 1.700   8.180   1.00 0.43 ? 115 TYR A HH   5  
ATOM 9183  N N    . PHE A 1 116 ? -7.917  1.076   1.571   1.00 0.32 ? 116 PHE A N    5  
ATOM 9184  C CA   . PHE A 1 116 ? -8.923  0.488   0.700   1.00 0.32 ? 116 PHE A CA   5  
ATOM 9185  C C    . PHE A 1 116 ? -8.445  -0.864  0.175   1.00 0.31 ? 116 PHE A C    5  
ATOM 9186  O O    . PHE A 1 116 ? -9.196  -1.841  0.167   1.00 0.31 ? 116 PHE A O    5  
ATOM 9187  C CB   . PHE A 1 116 ? -9.236  1.435   -0.465  1.00 0.32 ? 116 PHE A CB   5  
ATOM 9188  C CG   . PHE A 1 116 ? -10.482 1.085   -1.228  1.00 0.34 ? 116 PHE A CG   5  
ATOM 9189  C CD1  . PHE A 1 116 ? -11.725 1.150   -0.620  1.00 0.38 ? 116 PHE A CD1  5  
ATOM 9190  C CD2  . PHE A 1 116 ? -10.410 0.688   -2.554  1.00 0.34 ? 116 PHE A CD2  5  
ATOM 9191  C CE1  . PHE A 1 116 ? -12.873 0.831   -1.320  1.00 0.41 ? 116 PHE A CE1  5  
ATOM 9192  C CE2  . PHE A 1 116 ? -11.552 0.367   -3.260  1.00 0.37 ? 116 PHE A CE2  5  
ATOM 9193  C CZ   . PHE A 1 116 ? -12.787 0.437   -2.641  1.00 0.40 ? 116 PHE A CZ   5  
ATOM 9194  H H    . PHE A 1 116 ? -7.459  1.898   1.289   1.00 0.33 ? 116 PHE A H    5  
ATOM 9195  N N    . ALA A 1 117 ? -7.181  -0.916  -0.237  1.00 0.32 ? 117 ALA A N    5  
ATOM 9196  C CA   . ALA A 1 117 ? -6.593  -2.140  -0.766  1.00 0.32 ? 117 ALA A CA   5  
ATOM 9197  C C    . ALA A 1 117 ? -6.537  -3.242  0.289   1.00 0.33 ? 117 ALA A C    5  
ATOM 9198  O O    . ALA A 1 117 ? -6.893  -4.390  0.016   1.00 0.33 ? 117 ALA A O    5  
ATOM 9199  C CB   . ALA A 1 117 ? -5.207  -1.871  -1.331  1.00 0.34 ? 117 ALA A CB   5  
ATOM 9200  H H    . ALA A 1 117 ? -6.629  -0.105  -0.190  1.00 0.32 ? 117 ALA A H    5  
ATOM 9201  N N    . SER A 1 118 ? -6.097  -2.890  1.494   1.00 0.34 ? 118 SER A N    5  
ATOM 9202  C CA   . SER A 1 118 ? -5.993  -3.857  2.581   1.00 0.35 ? 118 SER A CA   5  
ATOM 9203  C C    . SER A 1 118 ? -7.357  -4.446  2.936   1.00 0.35 ? 118 SER A C    5  
ATOM 9204  O O    . SER A 1 118 ? -7.475  -5.643  3.203   1.00 0.35 ? 118 SER A O    5  
ATOM 9205  C CB   . SER A 1 118 ? -5.316  -3.247  3.812   1.00 0.37 ? 118 SER A CB   5  
ATOM 9206  O OG   . SER A 1 118 ? -5.802  -1.943  4.072   1.00 0.38 ? 118 SER A OG   5  
ATOM 9207  H H    . SER A 1 118 ? -5.834  -1.958  1.654   1.00 0.34 ? 118 SER A H    5  
ATOM 9208  H HG   . SER A 1 118 ? -5.368  -1.314  3.481   1.00 0.38 ? 118 SER A HG   5  
ATOM 9209  N N    . LYS A 1 119 ? -8.388  -3.604  2.923   1.00 0.34 ? 119 LYS A N    5  
ATOM 9210  C CA   . LYS A 1 119 ? -9.736  -4.056  3.232   1.00 0.35 ? 119 LYS A CA   5  
ATOM 9211  C C    . LYS A 1 119 ? -10.216 -5.051  2.179   1.00 0.34 ? 119 LYS A C    5  
ATOM 9212  O O    . LYS A 1 119 ? -10.890 -6.031  2.500   1.00 0.35 ? 119 LYS A O    5  
ATOM 9213  C CB   . LYS A 1 119 ? -10.704 -2.876  3.353   1.00 0.37 ? 119 LYS A CB   5  
ATOM 9214  C CG   . LYS A 1 119 ? -11.306 -2.704  4.743   1.00 0.40 ? 119 LYS A CG   5  
ATOM 9215  C CD   . LYS A 1 119 ? -10.262 -2.248  5.754   1.00 0.45 ? 119 LYS A CD   5  
ATOM 9216  C CE   . LYS A 1 119 ? -10.756 -2.409  7.188   1.00 0.62 ? 119 LYS A CE   5  
ATOM 9217  N NZ   . LYS A 1 119 ? -11.972 -1.598  7.467   1.00 0.44 ? 119 LYS A NZ   5  
ATOM 9218  H H    . LYS A 1 119 ? -8.234  -2.660  2.705   1.00 0.35 ? 119 LYS A H    5  
ATOM 9219  H HZ1  . LYS A 1 119 ? -12.776 -1.954  6.915   1.00 0.62 ? 119 LYS A HZ1  5  
ATOM 9220  H HZ2  . LYS A 1 119 ? -11.810 -0.598  7.221   1.00 0.46 ? 119 LYS A HZ2  5  
ATOM 9221  H HZ3  . LYS A 1 119 ? -12.213 -1.654  8.486   1.00 0.59 ? 119 LYS A HZ3  5  
ATOM 9222  N N    . LEU A 1 120 ? -9.845  -4.802  0.925   1.00 0.32 ? 120 LEU A N    5  
ATOM 9223  C CA   . LEU A 1 120 ? -10.213 -5.688  -0.171  1.00 0.32 ? 120 LEU A CA   5  
ATOM 9224  C C    . LEU A 1 120 ? -9.477  -7.017  -0.028  1.00 0.32 ? 120 LEU A C    5  
ATOM 9225  O O    . LEU A 1 120 ? -10.049 -8.085  -0.248  1.00 0.33 ? 120 LEU A O    5  
ATOM 9226  C CB   . LEU A 1 120 ? -9.894  -5.045  -1.524  1.00 0.32 ? 120 LEU A CB   5  
ATOM 9227  C CG   . LEU A 1 120 ? -10.712 -3.803  -1.896  1.00 0.32 ? 120 LEU A CG   5  
ATOM 9228  C CD1  . LEU A 1 120 ? -10.256 -3.246  -3.237  1.00 0.34 ? 120 LEU A CD1  5  
ATOM 9229  C CD2  . LEU A 1 120 ? -12.200 -4.130  -1.929  1.00 0.33 ? 120 LEU A CD2  5  
ATOM 9230  H H    . LEU A 1 120 ? -9.314  -3.998  0.732   1.00 0.32 ? 120 LEU A H    5  
ATOM 9231  N N    . VAL A 1 121 ? -8.204  -6.937  0.353   1.00 0.33 ? 121 VAL A N    5  
ATOM 9232  C CA   . VAL A 1 121 ? -7.384  -8.123  0.553   1.00 0.34 ? 121 VAL A CA   5  
ATOM 9233  C C    . VAL A 1 121 ? -7.975  -8.987  1.661   1.00 0.36 ? 121 VAL A C    5  
ATOM 9234  O O    . VAL A 1 121 ? -8.124  -10.197 1.509   1.00 0.37 ? 121 VAL A O    5  
ATOM 9235  C CB   . VAL A 1 121 ? -5.925  -7.751  0.903   1.00 0.36 ? 121 VAL A CB   5  
ATOM 9236  C CG1  . VAL A 1 121 ? -5.142  -8.972  1.368   1.00 0.36 ? 121 VAL A CG1  5  
ATOM 9237  C CG2  . VAL A 1 121 ? -5.239  -7.110  -0.292  1.00 0.37 ? 121 VAL A CG2  5  
ATOM 9238  H H    . VAL A 1 121 ? -7.804  -6.050  0.494   1.00 0.33 ? 121 VAL A H    5  
ATOM 9239  N N    . LEU A 1 122 ? -8.333  -8.346  2.769   1.00 0.37 ? 122 LEU A N    5  
ATOM 9240  C CA   . LEU A 1 122 ? -8.916  -9.048  3.907   1.00 0.40 ? 122 LEU A CA   5  
ATOM 9241  C C    . LEU A 1 122 ? -10.235 -9.713  3.522   1.00 0.39 ? 122 LEU A C    5  
ATOM 9242  O O    . LEU A 1 122 ? -10.554 -10.806 3.994   1.00 0.40 ? 122 LEU A O    5  
ATOM 9243  C CB   . LEU A 1 122 ? -9.117  -8.100  5.093   1.00 0.44 ? 122 LEU A CB   5  
ATOM 9244  C CG   . LEU A 1 122 ? -8.074  -8.181  6.215   1.00 0.85 ? 122 LEU A CG   5  
ATOM 9245  C CD1  . LEU A 1 122 ? -6.686  -7.824  5.701   1.00 1.31 ? 122 LEU A CD1  5  
ATOM 9246  C CD2  . LEU A 1 122 ? -8.467  -7.281  7.379   1.00 0.88 ? 122 LEU A CD2  5  
ATOM 9247  H H    . LEU A 1 122 ? -8.193  -7.374  2.827   1.00 0.37 ? 122 LEU A H    5  
ATOM 9248  N N    . LYS A 1 123 ? -10.991 -9.055  2.651   1.00 0.37 ? 123 LYS A N    5  
ATOM 9249  C CA   . LYS A 1 123 ? -12.268 -9.587  2.194   1.00 0.38 ? 123 LYS A CA   5  
ATOM 9250  C C    . LYS A 1 123 ? -12.049 -10.838 1.345   1.00 0.38 ? 123 LYS A C    5  
ATOM 9251  O O    . LYS A 1 123 ? -12.703 -11.862 1.545   1.00 0.40 ? 123 LYS A O    5  
ATOM 9252  C CB   . LYS A 1 123 ? -13.028 -8.524  1.394   1.00 0.40 ? 123 LYS A CB   5  
ATOM 9253  C CG   . LYS A 1 123 ? -14.495 -8.844  1.144   1.00 0.53 ? 123 LYS A CG   5  
ATOM 9254  C CD   . LYS A 1 123 ? -15.210 -7.658  0.512   1.00 0.61 ? 123 LYS A CD   5  
ATOM 9255  C CE   . LYS A 1 123 ? -16.720 -7.841  0.516   1.00 0.89 ? 123 LYS A CE   5  
ATOM 9256  N NZ   . LYS A 1 123 ? -17.220 -8.428  -0.756  1.00 1.13 ? 123 LYS A NZ   5  
ATOM 9257  H H    . LYS A 1 123 ? -10.685 -8.185  2.311   1.00 0.38 ? 123 LYS A H    5  
ATOM 9258  H HZ1  . LYS A 1 123 ? -17.040 -9.451  -0.777  1.00 1.50 ? 123 LYS A HZ1  5  
ATOM 9259  H HZ2  . LYS A 1 123 ? -16.739 -7.990  -1.570  1.00 1.50 ? 123 LYS A HZ2  5  
ATOM 9260  H HZ3  . LYS A 1 123 ? -18.246 -8.263  -0.847  1.00 1.55 ? 123 LYS A HZ3  5  
ATOM 9261  N N    . ALA A 1 124 ? -11.100 -10.754 0.415   1.00 0.37 ? 124 ALA A N    5  
ATOM 9262  C CA   . ALA A 1 124 ? -10.784 -11.876 -0.467  1.00 0.39 ? 124 ALA A CA   5  
ATOM 9263  C C    . ALA A 1 124 ? -10.140 -13.018 0.311   1.00 0.40 ? 124 ALA A C    5  
ATOM 9264  O O    . ALA A 1 124 ? -10.272 -14.186 -0.051  1.00 0.42 ? 124 ALA A O    5  
ATOM 9265  C CB   . ALA A 1 124 ? -9.873  -11.420 -1.598  1.00 0.40 ? 124 ALA A CB   5  
ATOM 9266  H H    . ALA A 1 124 ? -10.597 -9.913  0.317   1.00 0.36 ? 124 ALA A H    5  
ATOM 9267  N N    . LEU A 1 125 ? -9.445  -12.671 1.386   1.00 0.40 ? 125 LEU A N    5  
ATOM 9268  C CA   . LEU A 1 125 ? -8.789  -13.665 2.225   1.00 0.42 ? 125 LEU A CA   5  
ATOM 9269  C C    . LEU A 1 125 ? -9.823  -14.559 2.899   1.00 0.44 ? 125 LEU A C    5  
ATOM 9270  O O    . LEU A 1 125 ? -9.566  -15.728 3.180   1.00 0.47 ? 125 LEU A O    5  
ATOM 9271  C CB   . LEU A 1 125 ? -7.900  -12.991 3.273   1.00 0.43 ? 125 LEU A CB   5  
ATOM 9272  C CG   . LEU A 1 125 ? -6.913  -13.899 4.013   1.00 0.47 ? 125 LEU A CG   5  
ATOM 9273  C CD1  . LEU A 1 125 ? -5.957  -14.561 3.032   1.00 0.51 ? 125 LEU A CD1  5  
ATOM 9274  C CD2  . LEU A 1 125 ? -6.144  -13.104 5.056   1.00 0.50 ? 125 LEU A CD2  5  
ATOM 9275  H H    . LEU A 1 125 ? -9.358  -11.718 1.613   1.00 0.39 ? 125 LEU A H    5  
ATOM 9276  N N    . CYS A 1 126 ? -11.008 -14.003 3.133   1.00 0.44 ? 126 CYS A N    5  
ATOM 9277  C CA   . CYS A 1 126 ? -12.093 -14.748 3.757   1.00 0.47 ? 126 CYS A CA   5  
ATOM 9278  C C    . CYS A 1 126 ? -12.695 -15.741 2.766   1.00 0.49 ? 126 CYS A C    5  
ATOM 9279  O O    . CYS A 1 126 ? -13.419 -16.658 3.147   1.00 0.57 ? 126 CYS A O    5  
ATOM 9280  C CB   . CYS A 1 126 ? -13.166 -13.790 4.281   1.00 0.49 ? 126 CYS A CB   5  
ATOM 9281  S SG   . CYS A 1 126 ? -12.545 -12.549 5.442   1.00 0.53 ? 126 CYS A SG   5  
ATOM 9282  H H    . CYS A 1 126 ? -11.155 -13.067 2.875   1.00 0.44 ? 126 CYS A H    5  
ATOM 9283  H HG   . CYS A 1 126 ? -11.804 -11.680 4.758   1.00 0.48 ? 126 CYS A HG   5  
ATOM 9284  N N    . THR A 1 127 ? -12.378 -15.546 1.489   1.00 0.46 ? 127 THR A N    5  
ATOM 9285  C CA   . THR A 1 127 ? -12.858 -16.419 0.430   1.00 0.48 ? 127 THR A CA   5  
ATOM 9286  C C    . THR A 1 127 ? -11.862 -17.562 0.218   1.00 0.49 ? 127 THR A C    5  
ATOM 9287  O O    . THR A 1 127 ? -12.109 -18.485 -0.560  1.00 0.55 ? 127 THR A O    5  
ATOM 9288  C CB   . THR A 1 127 ? -13.023 -15.623 -0.881  1.00 0.49 ? 127 THR A CB   5  
ATOM 9289  O OG1  . THR A 1 127 ? -13.470 -14.292 -0.572  1.00 0.53 ? 127 THR A OG1  5  
ATOM 9290  C CG2  . THR A 1 127 ? -14.042 -16.287 -1.794  1.00 0.56 ? 127 THR A CG2  5  
ATOM 9291  H H    . THR A 1 127 ? -11.802 -14.788 1.250   1.00 0.45 ? 127 THR A H    5  
ATOM 9292  H HG1  . THR A 1 127 ? -13.927 -14.293 0.277   1.00 0.87 ? 127 THR A HG1  5  
ATOM 9293  N N    . LYS A 1 128 ? -10.734 -17.483 0.931   1.00 0.47 ? 128 LYS A N    5  
ATOM 9294  C CA   . LYS A 1 128 ? -9.682  -18.493 0.859   1.00 0.50 ? 128 LYS A CA   5  
ATOM 9295  C C    . LYS A 1 128 ? -9.049  -18.580 -0.527  1.00 0.46 ? 128 LYS A C    5  
ATOM 9296  O O    . LYS A 1 128 ? -8.738  -19.665 -1.014  1.00 0.54 ? 128 LYS A O    5  
ATOM 9297  C CB   . LYS A 1 128 ? -10.183 -19.862 1.324   1.00 0.60 ? 128 LYS A CB   5  
ATOM 9298  C CG   . LYS A 1 128 ? -9.892  -20.171 2.783   1.00 0.67 ? 128 LYS A CG   5  
ATOM 9299  C CD   . LYS A 1 128 ? -10.627 -19.222 3.717   1.00 0.98 ? 128 LYS A CD   5  
ATOM 9300  C CE   . LYS A 1 128 ? -10.512 -19.672 5.165   1.00 1.15 ? 128 LYS A CE   5  
ATOM 9301  N NZ   . LYS A 1 128 ? -11.190 -20.975 5.403   1.00 1.40 ? 128 LYS A NZ   5  
ATOM 9302  H H    . LYS A 1 128 ? -10.608 -16.715 1.530   1.00 0.46 ? 128 LYS A H    5  
ATOM 9303  H HZ1  . LYS A 1 128 ? -12.152 -20.960 5.002   1.00 1.68 ? 128 LYS A HZ1  5  
ATOM 9304  H HZ2  . LYS A 1 128 ? -11.257 -21.162 6.423   1.00 1.63 ? 128 LYS A HZ2  5  
ATOM 9305  H HZ3  . LYS A 1 128 ? -10.654 -21.746 4.958   1.00 1.70 ? 128 LYS A HZ3  5  
ATOM 9306  N N    . VAL A 1 129 ? -8.857  -17.431 -1.155  1.00 0.42 ? 129 VAL A N    5  
ATOM 9307  C CA   . VAL A 1 129 ? -8.245  -17.378 -2.476  1.00 0.39 ? 129 VAL A CA   5  
ATOM 9308  C C    . VAL A 1 129 ? -6.908  -16.630 -2.426  1.00 0.35 ? 129 VAL A C    5  
ATOM 9309  O O    . VAL A 1 129 ? -6.853  -15.403 -2.533  1.00 0.34 ? 129 VAL A O    5  
ATOM 9310  C CB   . VAL A 1 129 ? -9.199  -16.788 -3.548  1.00 0.40 ? 129 VAL A CB   5  
ATOM 9311  C CG1  . VAL A 1 129 ? -9.814  -15.469 -3.097  1.00 0.39 ? 129 VAL A CG1  5  
ATOM 9312  C CG2  . VAL A 1 129 ? -8.499  -16.640 -4.894  1.00 0.40 ? 129 VAL A CG2  5  
ATOM 9313  H H    . VAL A 1 129 ? -9.136  -16.598 -0.723  1.00 0.46 ? 129 VAL A H    5  
ATOM 9314  N N    . PRO A 1 130 ? -5.803  -17.371 -2.240  1.00 0.37 ? 130 PRO A N    5  
ATOM 9315  C CA   . PRO A 1 130 ? -4.457  -16.792 -2.159  1.00 0.37 ? 130 PRO A CA   5  
ATOM 9316  C C    . PRO A 1 130 ? -4.022  -16.162 -3.477  1.00 0.33 ? 130 PRO A C    5  
ATOM 9317  O O    . PRO A 1 130 ? -3.269  -15.189 -3.488  1.00 0.32 ? 130 PRO A O    5  
ATOM 9318  C CB   . PRO A 1 130 ? -3.559  -17.991 -1.827  1.00 0.43 ? 130 PRO A CB   5  
ATOM 9319  C CG   . PRO A 1 130 ? -4.488  -19.058 -1.353  1.00 0.47 ? 130 PRO A CG   5  
ATOM 9320  C CD   . PRO A 1 130 ? -5.776  -18.834 -2.085  1.00 0.43 ? 130 PRO A CD   5  
ATOM 9321  N N    . GLU A 1 131 ? -4.511  -16.716 -4.584  1.00 0.34 ? 131 GLU A N    5  
ATOM 9322  C CA   . GLU A 1 131 ? -4.183  -16.214 -5.911  1.00 0.36 ? 131 GLU A CA   5  
ATOM 9323  C C    . GLU A 1 131 ? -4.536  -14.738 -6.039  1.00 0.32 ? 131 GLU A C    5  
ATOM 9324  O O    . GLU A 1 131 ? -3.669  -13.910 -6.328  1.00 0.34 ? 131 GLU A O    5  
ATOM 9325  C CB   . GLU A 1 131 ? -4.918  -17.021 -6.983  1.00 0.43 ? 131 GLU A CB   5  
ATOM 9326  C CG   . GLU A 1 131 ? -4.004  -17.690 -7.994  1.00 0.75 ? 131 GLU A CG   5  
ATOM 9327  C CD   . GLU A 1 131 ? -3.078  -16.709 -8.682  1.00 1.18 ? 131 GLU A CD   5  
ATOM 9328  O OE1  . GLU A 1 131 ? -3.570  -15.703 -9.231  1.00 1.55 ? 131 GLU A OE1  5  
ATOM 9329  O OE2  . GLU A 1 131 ? -1.852  -16.938 -8.673  1.00 1.54 ? 131 GLU A OE2  5  
ATOM 9330  H H    . GLU A 1 131 ? -5.105  -17.491 -4.502  1.00 0.37 ? 131 GLU A H    5  
ATOM 9331  N N    . LEU A 1 132 ? -5.805  -14.413 -5.784  1.00 0.32 ? 132 LEU A N    5  
ATOM 9332  C CA   . LEU A 1 132 ? -6.292  -13.041 -5.877  1.00 0.32 ? 132 LEU A CA   5  
ATOM 9333  C C    . LEU A 1 132 ? -5.488  -12.094 -4.994  1.00 0.31 ? 132 LEU A C    5  
ATOM 9334  O O    . LEU A 1 132 ? -5.246  -10.946 -5.361  1.00 0.34 ? 132 LEU A O    5  
ATOM 9335  C CB   . LEU A 1 132 ? -7.782  -12.969 -5.527  1.00 0.33 ? 132 LEU A CB   5  
ATOM 9336  C CG   . LEU A 1 132 ? -8.488  -11.646 -5.838  1.00 0.34 ? 132 LEU A CG   5  
ATOM 9337  C CD1  . LEU A 1 132 ? -8.389  -11.315 -7.321  1.00 0.36 ? 132 LEU A CD1  5  
ATOM 9338  C CD2  . LEU A 1 132 ? -9.942  -11.700 -5.400  1.00 0.36 ? 132 LEU A CD2  5  
ATOM 9339  H H    . LEU A 1 132 ? -6.431  -15.121 -5.530  1.00 0.34 ? 132 LEU A H    5  
ATOM 9340  N N    . ILE A 1 133 ? -5.065  -12.583 -3.837  1.00 0.31 ? 133 ILE A N    5  
ATOM 9341  C CA   . ILE A 1 133 ? -4.280  -11.776 -2.913  1.00 0.33 ? 133 ILE A CA   5  
ATOM 9342  C C    . ILE A 1 133 ? -2.970  -11.345 -3.573  1.00 0.34 ? 133 ILE A C    5  
ATOM 9343  O O    . ILE A 1 133 ? -2.534  -10.200 -3.437  1.00 0.38 ? 133 ILE A O    5  
ATOM 9344  C CB   . ILE A 1 133 ? -3.967  -12.549 -1.612  1.00 0.34 ? 133 ILE A CB   5  
ATOM 9345  C CG1  . ILE A 1 133 ? -5.254  -13.084 -0.968  1.00 0.36 ? 133 ILE A CG1  5  
ATOM 9346  C CG2  . ILE A 1 133 ? -3.189  -11.680 -0.632  1.00 0.38 ? 133 ILE A CG2  5  
ATOM 9347  C CD1  . ILE A 1 133 ? -6.283  -12.020 -0.645  1.00 0.39 ? 133 ILE A CD1  5  
ATOM 9348  H H    . ILE A 1 133 ? -5.282  -13.509 -3.601  1.00 0.31 ? 133 ILE A H    5  
ATOM 9349  N N    . ARG A 1 134 ? -2.357  -12.265 -4.308  1.00 0.32 ? 134 ARG A N    5  
ATOM 9350  C CA   . ARG A 1 134 ? -1.105  -11.980 -4.995  1.00 0.35 ? 134 ARG A CA   5  
ATOM 9351  C C    . ARG A 1 134 ? -1.349  -11.046 -6.178  1.00 0.37 ? 134 ARG A C    5  
ATOM 9352  O O    . ARG A 1 134 ? -0.484  -10.251 -6.548  1.00 0.40 ? 134 ARG A O    5  
ATOM 9353  C CB   . ARG A 1 134 ? -0.422  -13.269 -5.463  1.00 0.37 ? 134 ARG A CB   5  
ATOM 9354  C CG   . ARG A 1 134 ? -0.285  -14.345 -4.392  1.00 0.67 ? 134 ARG A CG   5  
ATOM 9355  C CD   . ARG A 1 134 ? 0.380   -13.815 -3.128  1.00 1.16 ? 134 ARG A CD   5  
ATOM 9356  N NE   . ARG A 1 134 ? 1.805   -13.552 -3.313  1.00 1.04 ? 134 ARG A NE   5  
ATOM 9357  C CZ   . ARG A 1 134 ? 2.403   -12.415 -2.966  1.00 1.20 ? 134 ARG A CZ   5  
ATOM 9358  N NH1  . ARG A 1 134 ? 1.694   -11.436 -2.414  1.00 1.47 ? 134 ARG A NH1  5  
ATOM 9359  N NH2  . ARG A 1 134 ? 3.705   -12.259 -3.168  1.00 1.35 ? 134 ARG A NH2  5  
ATOM 9360  H H    . ARG A 1 134 ? -2.762  -13.155 -4.397  1.00 0.32 ? 134 ARG A H    5  
ATOM 9361  H HE   . ARG A 1 134 ? 2.348   -14.267 -3.721  1.00 1.07 ? 134 ARG A HE   5  
ATOM 9362  H HH11 . ARG A 1 134 ? 0.713   -11.550 -2.257  1.00 1.53 ? 134 ARG A HH11 5  
ATOM 9363  H HH12 . ARG A 1 134 ? 2.140   -10.572 -2.158  1.00 1.73 ? 134 ARG A HH12 5  
ATOM 9364  H HH21 . ARG A 1 134 ? 4.242   -13.009 -3.588  1.00 1.37 ? 134 ARG A HH21 5  
ATOM 9365  H HH22 . ARG A 1 134 ? 4.161   -11.402 -2.915  1.00 1.59 ? 134 ARG A HH22 5  
ATOM 9366  N N    . THR A 1 135 ? -2.537  -11.143 -6.770  1.00 0.38 ? 135 THR A N    5  
ATOM 9367  C CA   . THR A 1 135 ? -2.896  -10.296 -7.899  1.00 0.42 ? 135 THR A CA   5  
ATOM 9368  C C    . THR A 1 135 ? -3.075  -8.850  -7.449  1.00 0.43 ? 135 THR A C    5  
ATOM 9369  O O    . THR A 1 135 ? -2.576  -7.928  -8.095  1.00 0.47 ? 135 THR A O    5  
ATOM 9370  C CB   . THR A 1 135 ? -4.188  -10.781 -8.582  1.00 0.45 ? 135 THR A CB   5  
ATOM 9371  O OG1  . THR A 1 135 ? -4.351  -12.177 -8.329  1.00 0.51 ? 135 THR A OG1  5  
ATOM 9372  C CG2  . THR A 1 135 ? -4.105  -10.561 -10.085 1.00 0.52 ? 135 THR A CG2  5  
ATOM 9373  H H    . THR A 1 135 ? -3.188  -11.804 -6.439  1.00 0.38 ? 135 THR A H    5  
ATOM 9374  H HG1  . THR A 1 135 ? -4.993  -12.546 -8.952  1.00 0.83 ? 135 THR A HG1  5  
ATOM 9375  N N    . ILE A 1 136 ? -3.774  -8.660  -6.331  1.00 0.42 ? 136 ILE A N    5  
ATOM 9376  C CA   . ILE A 1 136 ? -4.000  -7.324  -5.790  1.00 0.45 ? 136 ILE A CA   5  
ATOM 9377  C C    . ILE A 1 136 ? -2.664  -6.646  -5.497  1.00 0.46 ? 136 ILE A C    5  
ATOM 9378  O O    . ILE A 1 136 ? -2.474  -5.467  -5.799  1.00 0.49 ? 136 ILE A O    5  
ATOM 9379  C CB   . ILE A 1 136 ? -4.870  -7.357  -4.514  1.00 0.45 ? 136 ILE A CB   5  
ATOM 9380  C CG1  . ILE A 1 136 ? -6.230  -7.996  -4.816  1.00 0.44 ? 136 ILE A CG1  5  
ATOM 9381  C CG2  . ILE A 1 136 ? -5.055  -5.954  -3.949  1.00 0.49 ? 136 ILE A CG2  5  
ATOM 9382  C CD1  . ILE A 1 136 ? -7.084  -8.237  -3.587  1.00 0.46 ? 136 ILE A CD1  5  
ATOM 9383  H H    . ILE A 1 136 ? -4.153  -9.439  -5.861  1.00 0.40 ? 136 ILE A H    5  
ATOM 9384  N N    . MET A 1 137 ? -1.732  -7.408  -4.926  1.00 0.45 ? 137 MET A N    5  
ATOM 9385  C CA   . MET A 1 137 ? -0.404  -6.885  -4.616  1.00 0.47 ? 137 MET A CA   5  
ATOM 9386  C C    . MET A 1 137 ? 0.296   -6.443  -5.899  1.00 0.48 ? 137 MET A C    5  
ATOM 9387  O O    . MET A 1 137 ? 0.920   -5.380  -5.945  1.00 0.49 ? 137 MET A O    5  
ATOM 9388  C CB   . MET A 1 137 ? 0.443   -7.928  -3.883  1.00 0.48 ? 137 MET A CB   5  
ATOM 9389  C CG   . MET A 1 137 ? 1.770   -7.394  -3.361  1.00 0.46 ? 137 MET A CG   5  
ATOM 9390  S SD   . MET A 1 137 ? 2.726   -8.648  -2.484  1.00 0.49 ? 137 MET A SD   5  
ATOM 9391  C CE   . MET A 1 137 ? 4.132   -7.682  -1.937  1.00 0.57 ? 137 MET A CE   5  
ATOM 9392  H H    . MET A 1 137 ? -1.947  -8.339  -4.699  1.00 0.44 ? 137 MET A H    5  
ATOM 9393  N N    . GLY A 1 138 ? 0.173   -7.261  -6.941  1.00 0.49 ? 138 GLY A N    5  
ATOM 9394  C CA   . GLY A 1 138 ? 0.776   -6.933  -8.218  1.00 0.51 ? 138 GLY A CA   5  
ATOM 9395  C C    . GLY A 1 138 ? 0.164   -5.680  -8.813  1.00 0.52 ? 138 GLY A C    5  
ATOM 9396  O O    . GLY A 1 138 ? 0.853   -4.881  -9.441  1.00 0.53 ? 138 GLY A O    5  
ATOM 9397  H H    . GLY A 1 138 ? -0.332  -8.097  -6.839  1.00 0.50 ? 138 GLY A H    5  
ATOM 9398  N N    . TRP A 1 139 ? -1.141  -5.512  -8.603  1.00 0.53 ? 139 TRP A N    5  
ATOM 9399  C CA   . TRP A 1 139 ? -1.863  -4.346  -9.098  1.00 0.57 ? 139 TRP A CA   5  
ATOM 9400  C C    . TRP A 1 139 ? -1.414  -3.091  -8.364  1.00 0.53 ? 139 TRP A C    5  
ATOM 9401  O O    . TRP A 1 139 ? -1.307  -2.017  -8.957  1.00 0.54 ? 139 TRP A O    5  
ATOM 9402  C CB   . TRP A 1 139 ? -3.373  -4.524  -8.913  1.00 0.65 ? 139 TRP A CB   5  
ATOM 9403  C CG   . TRP A 1 139 ? -3.985  -5.573  -9.790  1.00 0.69 ? 139 TRP A CG   5  
ATOM 9404  C CD1  . TRP A 1 139 ? -3.488  -6.061  -10.962 1.00 0.72 ? 139 TRP A CD1  5  
ATOM 9405  C CD2  . TRP A 1 139 ? -5.222  -6.258  -9.561  1.00 0.78 ? 139 TRP A CD2  5  
ATOM 9406  N NE1  . TRP A 1 139 ? -4.338  -7.006  -11.479 1.00 0.81 ? 139 TRP A NE1  5  
ATOM 9407  C CE2  . TRP A 1 139 ? -5.409  -7.148  -10.635 1.00 0.84 ? 139 TRP A CE2  5  
ATOM 9408  C CE3  . TRP A 1 139 ? -6.185  -6.205  -8.552  1.00 0.84 ? 139 TRP A CE3  5  
ATOM 9409  C CZ2  . TRP A 1 139 ? -6.524  -7.979  -10.730 1.00 0.95 ? 139 TRP A CZ2  5  
ATOM 9410  C CZ3  . TRP A 1 139 ? -7.288  -7.031  -8.646  1.00 0.95 ? 139 TRP A CZ3  5  
ATOM 9411  C CH2  . TRP A 1 139 ? -7.447  -7.906  -9.726  1.00 1.00 ? 139 TRP A CH2  5  
ATOM 9412  H H    . TRP A 1 139 ? -1.634  -6.200  -8.106  1.00 0.55 ? 139 TRP A H    5  
ATOM 9413  H HE1  . TRP A 1 139 ? -4.199  -7.501  -12.313 1.00 0.86 ? 139 TRP A HE1  5  
ATOM 9414  N N    . THR A 1 140 ? -1.159  -3.236  -7.069  1.00 0.51 ? 140 THR A N    5  
ATOM 9415  C CA   . THR A 1 140 ? -0.714  -2.118  -6.248  1.00 0.51 ? 140 THR A CA   5  
ATOM 9416  C C    . THR A 1 140 ? 0.679   -1.673  -6.684  1.00 0.47 ? 140 THR A C    5  
ATOM 9417  O O    . THR A 1 140 ? 0.956   -0.479  -6.811  1.00 0.53 ? 140 THR A O    5  
ATOM 9418  C CB   . THR A 1 140 ? -0.694  -2.499  -4.756  1.00 0.53 ? 140 THR A CB   5  
ATOM 9419  O OG1  . THR A 1 140 ? -1.917  -3.167  -4.419  1.00 0.55 ? 140 THR A OG1  5  
ATOM 9420  C CG2  . THR A 1 140 ? -0.549  -1.257  -3.889  1.00 0.54 ? 140 THR A CG2  5  
ATOM 9421  H H    . THR A 1 140 ? -1.273  -4.119  -6.657  1.00 0.52 ? 140 THR A H    5  
ATOM 9422  H HG1  . THR A 1 140 ? -2.059  -3.908  -5.019  1.00 0.67 ? 140 THR A HG1  5  
ATOM 9423  N N    . LEU A 1 141 ? 1.548   -2.648  -6.923  1.00 0.41 ? 141 LEU A N    5  
ATOM 9424  C CA   . LEU A 1 141 ? 2.905   -2.366  -7.364  1.00 0.42 ? 141 LEU A CA   5  
ATOM 9425  C C    . LEU A 1 141 ? 2.894   -1.821  -8.789  1.00 0.42 ? 141 LEU A C    5  
ATOM 9426  O O    . LEU A 1 141 ? 3.759   -1.029  -9.169  1.00 0.41 ? 141 LEU A O    5  
ATOM 9427  C CB   . LEU A 1 141 ? 3.776   -3.620  -7.272  1.00 0.44 ? 141 LEU A CB   5  
ATOM 9428  C CG   . LEU A 1 141 ? 4.039   -4.155  -5.858  1.00 0.48 ? 141 LEU A CG   5  
ATOM 9429  C CD1  . LEU A 1 141 ? 4.740   -5.503  -5.911  1.00 0.55 ? 141 LEU A CD1  5  
ATOM 9430  C CD2  . LEU A 1 141 ? 4.854   -3.162  -5.045  1.00 0.53 ? 141 LEU A CD2  5  
ATOM 9431  H H    . LEU A 1 141 ? 1.266   -3.583  -6.794  1.00 0.40 ? 141 LEU A H    5  
ATOM 9432  N N    . ASP A 1 142 ? 1.899   -2.248  -9.562  1.00 0.51 ? 142 ASP A N    5  
ATOM 9433  C CA   . ASP A 1 142 ? 1.737   -1.809  -10.945 1.00 0.54 ? 142 ASP A CA   5  
ATOM 9434  C C    . ASP A 1 142 ? 1.614   -0.295  -11.000 1.00 0.51 ? 142 ASP A C    5  
ATOM 9435  O O    . ASP A 1 142 ? 2.443   0.380   -11.606 1.00 0.53 ? 142 ASP A O    5  
ATOM 9436  C CB   . ASP A 1 142 ? 0.495   -2.459  -11.563 1.00 0.62 ? 142 ASP A CB   5  
ATOM 9437  C CG   . ASP A 1 142 ? 0.269   -2.075  -13.011 1.00 0.82 ? 142 ASP A CG   5  
ATOM 9438  O OD1  . ASP A 1 142 ? 1.238   -2.100  -13.797 1.00 0.96 ? 142 ASP A OD1  5  
ATOM 9439  O OD2  . ASP A 1 142 ? -0.893  -1.760  -13.376 1.00 1.12 ? 142 ASP A OD2  5  
ATOM 9440  H H    . ASP A 1 142 ? 1.255   -2.891  -9.194  1.00 0.59 ? 142 ASP A H    5  
ATOM 9441  N N    . PHE A 1 143 ? 0.610   0.231   -10.308 1.00 0.52 ? 143 PHE A N    5  
ATOM 9442  C CA   . PHE A 1 143 ? 0.367   1.669   -10.270 1.00 0.54 ? 143 PHE A CA   5  
ATOM 9443  C C    . PHE A 1 143 ? 1.575   2.415   -9.698  1.00 0.48 ? 143 PHE A C    5  
ATOM 9444  O O    . PHE A 1 143 ? 1.826   3.578   -10.038 1.00 0.50 ? 143 PHE A O    5  
ATOM 9445  C CB   . PHE A 1 143 ? -0.890  1.972   -9.448  1.00 0.64 ? 143 PHE A CB   5  
ATOM 9446  C CG   . PHE A 1 143 ? -1.473  3.337   -9.691  1.00 0.66 ? 143 PHE A CG   5  
ATOM 9447  C CD1  . PHE A 1 143 ? -1.915  3.700   -10.953 1.00 0.70 ? 143 PHE A CD1  5  
ATOM 9448  C CD2  . PHE A 1 143 ? -1.581  4.251   -8.657  1.00 0.77 ? 143 PHE A CD2  5  
ATOM 9449  C CE1  . PHE A 1 143 ? -2.455  4.951   -11.178 1.00 0.81 ? 143 PHE A CE1  5  
ATOM 9450  C CE2  . PHE A 1 143 ? -2.121  5.504   -8.875  1.00 0.86 ? 143 PHE A CE2  5  
ATOM 9451  C CZ   . PHE A 1 143 ? -2.558  5.855   -10.138 1.00 0.86 ? 143 PHE A CZ   5  
ATOM 9452  H H    . PHE A 1 143 ? 0.017   -0.367  -9.805  1.00 0.56 ? 143 PHE A H    5  
ATOM 9453  N N    . LEU A 1 144 ? 2.322   1.734   -8.834  1.00 0.43 ? 144 LEU A N    5  
ATOM 9454  C CA   . LEU A 1 144 ? 3.506   2.312   -8.217  1.00 0.41 ? 144 LEU A CA   5  
ATOM 9455  C C    . LEU A 1 144 ? 4.582   2.566   -9.273  1.00 0.41 ? 144 LEU A C    5  
ATOM 9456  O O    . LEU A 1 144 ? 5.076   3.684   -9.406  1.00 0.43 ? 144 LEU A O    5  
ATOM 9457  C CB   . LEU A 1 144 ? 4.038   1.390   -7.113  1.00 0.41 ? 144 LEU A CB   5  
ATOM 9458  C CG   . LEU A 1 144 ? 4.640   2.079   -5.883  1.00 0.72 ? 144 LEU A CG   5  
ATOM 9459  C CD1  . LEU A 1 144 ? 4.726   1.110   -4.714  1.00 1.07 ? 144 LEU A CD1  5  
ATOM 9460  C CD2  . LEU A 1 144 ? 6.012   2.651   -6.203  1.00 1.34 ? 144 LEU A CD2  5  
ATOM 9461  H H    . LEU A 1 144 ? 2.071   0.812   -8.612  1.00 0.43 ? 144 LEU A H    5  
ATOM 9462  N N    . ARG A 1 145 ? 4.916   1.537   -10.040 1.00 0.42 ? 145 ARG A N    5  
ATOM 9463  C CA   . ARG A 1 145 ? 5.932   1.658   -11.079 1.00 0.46 ? 145 ARG A CA   5  
ATOM 9464  C C    . ARG A 1 145 ? 5.456   2.579   -12.197 1.00 0.46 ? 145 ARG A C    5  
ATOM 9465  O O    . ARG A 1 145 ? 6.258   3.279   -12.818 1.00 0.55 ? 145 ARG A O    5  
ATOM 9466  C CB   . ARG A 1 145 ? 6.290   0.283   -11.653 1.00 0.54 ? 145 ARG A CB   5  
ATOM 9467  C CG   . ARG A 1 145 ? 7.554   0.267   -12.507 1.00 0.66 ? 145 ARG A CG   5  
ATOM 9468  C CD   . ARG A 1 145 ? 8.791   0.483   -11.649 1.00 1.01 ? 145 ARG A CD   5  
ATOM 9469  N NE   . ARG A 1 145 ? 10.028  0.545   -12.430 1.00 1.10 ? 145 ARG A NE   5  
ATOM 9470  C CZ   . ARG A 1 145 ? 11.174  -0.031  -12.056 1.00 1.24 ? 145 ARG A CZ   5  
ATOM 9471  N NH1  . ARG A 1 145 ? 11.220  -0.774  -10.959 1.00 1.40 ? 145 ARG A NH1  5  
ATOM 9472  N NH2  . ARG A 1 145 ? 12.268  0.134   -12.780 1.00 1.43 ? 145 ARG A NH2  5  
ATOM 9473  H H    . ARG A 1 145 ? 4.462   0.673   -9.910  1.00 0.42 ? 145 ARG A H    5  
ATOM 9474  H HE   . ARG A 1 145 ? 10.011  1.067   -13.265 1.00 1.24 ? 145 ARG A HE   5  
ATOM 9475  H HH11 . ARG A 1 145 ? 10.398  -0.909  -10.404 1.00 1.42 ? 145 ARG A HH11 5  
ATOM 9476  H HH12 . ARG A 1 145 ? 12.095  -1.207  -10.674 1.00 1.63 ? 145 ARG A HH12 5  
ATOM 9477  H HH21 . ARG A 1 145 ? 12.244  0.692   -13.615 1.00 1.54 ? 145 ARG A HH21 5  
ATOM 9478  H HH22 . ARG A 1 145 ? 13.135  -0.300  -12.491 1.00 1.57 ? 145 ARG A HH22 5  
ATOM 9479  N N    . GLU A 1 146 ? 4.151   2.570   -12.443 1.00 0.50 ? 146 GLU A N    5  
ATOM 9480  C CA   . GLU A 1 146 ? 3.550   3.392   -13.485 1.00 0.55 ? 146 GLU A CA   5  
ATOM 9481  C C    . GLU A 1 146 ? 3.748   4.891   -13.252 1.00 0.56 ? 146 GLU A C    5  
ATOM 9482  O O    . GLU A 1 146 ? 4.220   5.601   -14.144 1.00 0.74 ? 146 GLU A O    5  
ATOM 9483  C CB   . GLU A 1 146 ? 2.057   3.078   -13.638 1.00 0.62 ? 146 GLU A CB   5  
ATOM 9484  C CG   . GLU A 1 146 ? 1.758   1.692   -14.193 1.00 0.89 ? 146 GLU A CG   5  
ATOM 9485  C CD   . GLU A 1 146 ? 1.817   1.629   -15.703 1.00 1.31 ? 146 GLU A CD   5  
ATOM 9486  O OE1  . GLU A 1 146 ? 2.757   2.205   -16.292 1.00 1.61 ? 146 GLU A OE1  5  
ATOM 9487  O OE2  . GLU A 1 146 ? 0.911   1.015   -16.313 1.00 1.82 ? 146 GLU A OE2  5  
ATOM 9488  H H    . GLU A 1 146 ? 3.571   1.977   -11.914 1.00 0.58 ? 146 GLU A H    5  
ATOM 9489  N N    . ARG A 1 147 ? 3.401   5.379   -12.059 1.00 0.51 ? 147 ARG A N    5  
ATOM 9490  C CA   . ARG A 1 147 ? 3.523   6.812   -11.779 1.00 0.57 ? 147 ARG A CA   5  
ATOM 9491  C C    . ARG A 1 147 ? 4.076   7.142   -10.392 1.00 0.51 ? 147 ARG A C    5  
ATOM 9492  O O    . ARG A 1 147 ? 4.915   8.032   -10.258 1.00 0.53 ? 147 ARG A O    5  
ATOM 9493  C CB   . ARG A 1 147 ? 2.169   7.509   -11.965 1.00 0.73 ? 147 ARG A CB   5  
ATOM 9494  C CG   . ARG A 1 147 ? 1.653   7.535   -13.398 1.00 0.88 ? 147 ARG A CG   5  
ATOM 9495  C CD   . ARG A 1 147 ? 2.289   8.656   -14.207 1.00 1.01 ? 147 ARG A CD   5  
ATOM 9496  N NE   . ARG A 1 147 ? 3.738   8.505   -14.325 1.00 1.03 ? 147 ARG A NE   5  
ATOM 9497  C CZ   . ARG A 1 147 ? 4.615   9.459   -14.012 1.00 1.32 ? 147 ARG A CZ   5  
ATOM 9498  N NH1  . ARG A 1 147 ? 4.189   10.645  -13.581 1.00 1.56 ? 147 ARG A NH1  5  
ATOM 9499  N NH2  . ARG A 1 147 ? 5.913   9.238   -14.140 1.00 1.59 ? 147 ARG A NH2  5  
ATOM 9500  H H    . ARG A 1 147 ? 3.063   4.772   -11.364 1.00 0.55 ? 147 ARG A H    5  
ATOM 9501  H HE   . ARG A 1 147 ? 4.075   7.637   -14.654 1.00 1.04 ? 147 ARG A HE   5  
ATOM 9502  H HH11 . ARG A 1 147 ? 3.206   10.827  -13.492 1.00 1.52 ? 147 ARG A HH11 5  
ATOM 9503  H HH12 . ARG A 1 147 ? 4.850   11.365  -13.342 1.00 1.88 ? 147 ARG A HH12 5  
ATOM 9504  H HH21 . ARG A 1 147 ? 6.247   8.350   -14.474 1.00 1.57 ? 147 ARG A HH21 5  
ATOM 9505  H HH22 . ARG A 1 147 ? 6.571   9.954   -13.899 1.00 1.91 ? 147 ARG A HH22 5  
ATOM 9506  N N    . LEU A 1 148 ? 3.607   6.429   -9.372  1.00 0.48 ? 148 LEU A N    5  
ATOM 9507  C CA   . LEU A 1 148 ? 4.023   6.680   -7.987  1.00 0.47 ? 148 LEU A CA   5  
ATOM 9508  C C    . LEU A 1 148 ? 5.541   6.761   -7.785  1.00 0.41 ? 148 LEU A C    5  
ATOM 9509  O O    . LEU A 1 148 ? 6.030   7.653   -7.091  1.00 0.44 ? 148 LEU A O    5  
ATOM 9510  C CB   . LEU A 1 148 ? 3.401   5.658   -7.030  1.00 0.50 ? 148 LEU A CB   5  
ATOM 9511  C CG   . LEU A 1 148 ? 2.211   6.142   -6.193  1.00 0.59 ? 148 LEU A CG   5  
ATOM 9512  C CD1  . LEU A 1 148 ? 2.611   7.315   -5.310  1.00 0.81 ? 148 LEU A CD1  5  
ATOM 9513  C CD2  . LEU A 1 148 ? 1.038   6.515   -7.087  1.00 0.74 ? 148 LEU A CD2  5  
ATOM 9514  H H    . LEU A 1 148 ? 2.963   5.711   -9.552  1.00 0.51 ? 148 LEU A H    5  
ATOM 9515  N N    . LEU A 1 149 ? 6.272   5.838   -8.398  1.00 0.37 ? 149 LEU A N    5  
ATOM 9516  C CA   . LEU A 1 149 ? 7.729   5.785   -8.276  1.00 0.35 ? 149 LEU A CA   5  
ATOM 9517  C C    . LEU A 1 149 ? 8.392   7.119   -8.620  1.00 0.38 ? 149 LEU A C    5  
ATOM 9518  O O    . LEU A 1 149 ? 9.372   7.512   -7.984  1.00 0.39 ? 149 LEU A O    5  
ATOM 9519  C CB   . LEU A 1 149 ? 8.302   4.668   -9.155  1.00 0.39 ? 149 LEU A CB   5  
ATOM 9520  C CG   . LEU A 1 149 ? 9.796   4.375   -8.987  1.00 0.46 ? 149 LEU A CG   5  
ATOM 9521  C CD1  . LEU A 1 149 ? 10.068  3.692   -7.656  1.00 0.52 ? 149 LEU A CD1  5  
ATOM 9522  C CD2  . LEU A 1 149 ? 10.317  3.536   -10.145 1.00 0.57 ? 149 LEU A CD2  5  
ATOM 9523  H H    . LEU A 1 149 ? 5.817   5.163   -8.950  1.00 0.37 ? 149 LEU A H    5  
ATOM 9524  N N    . GLY A 1 150 ? 7.842   7.814   -9.610  1.00 0.41 ? 150 GLY A N    5  
ATOM 9525  C CA   . GLY A 1 150 ? 8.396   9.091   -10.026 1.00 0.46 ? 150 GLY A CA   5  
ATOM 9526  C C    . GLY A 1 150 ? 8.376   10.125  -8.918  1.00 0.46 ? 150 GLY A C    5  
ATOM 9527  O O    . GLY A 1 150 ? 9.385   10.780  -8.653  1.00 0.52 ? 150 GLY A O    5  
ATOM 9528  H H    . GLY A 1 150 ? 7.044   7.461   -10.054 1.00 0.43 ? 150 GLY A H    5  
ATOM 9529  N N    . TRP A 1 151 ? 7.234   10.251  -8.257  1.00 0.43 ? 151 TRP A N    5  
ATOM 9530  C CA   . TRP A 1 151 ? 7.070   11.213  -7.176  1.00 0.45 ? 151 TRP A CA   5  
ATOM 9531  C C    . TRP A 1 151 ? 7.883   10.811  -5.947  1.00 0.42 ? 151 TRP A C    5  
ATOM 9532  O O    . TRP A 1 151 ? 8.439   11.664  -5.251  1.00 0.44 ? 151 TRP A O    5  
ATOM 9533  C CB   . TRP A 1 151 ? 5.585   11.346  -6.817  1.00 0.50 ? 151 TRP A CB   5  
ATOM 9534  C CG   . TRP A 1 151 ? 5.284   12.454  -5.853  1.00 0.52 ? 151 TRP A CG   5  
ATOM 9535  C CD1  . TRP A 1 151 ? 5.904   13.668  -5.777  1.00 0.61 ? 151 TRP A CD1  5  
ATOM 9536  C CD2  . TRP A 1 151 ? 4.275   12.454  -4.836  1.00 0.52 ? 151 TRP A CD2  5  
ATOM 9537  N NE1  . TRP A 1 151 ? 5.355   14.417  -4.766  1.00 0.63 ? 151 TRP A NE1  5  
ATOM 9538  C CE2  . TRP A 1 151 ? 4.348   13.697  -4.176  1.00 0.57 ? 151 TRP A CE2  5  
ATOM 9539  C CE3  . TRP A 1 151 ? 3.320   11.522  -4.418  1.00 0.59 ? 151 TRP A CE3  5  
ATOM 9540  C CZ2  . TRP A 1 151 ? 3.502   14.033  -3.123  1.00 0.63 ? 151 TRP A CZ2  5  
ATOM 9541  C CZ3  . TRP A 1 151 ? 2.481   11.859  -3.376  1.00 0.70 ? 151 TRP A CZ3  5  
ATOM 9542  C CH2  . TRP A 1 151 ? 2.579   13.101  -2.741  1.00 0.70 ? 151 TRP A CH2  5  
ATOM 9543  H H    . TRP A 1 151 ? 6.479   9.677   -8.500  1.00 0.43 ? 151 TRP A H    5  
ATOM 9544  H HE1  . TRP A 1 151 ? 5.633   15.326  -4.511  1.00 0.71 ? 151 TRP A HE1  5  
ATOM 9545  N N    . ILE A 1 152 ? 7.958   9.511   -5.689  1.00 0.40 ? 152 ILE A N    5  
ATOM 9546  C CA   . ILE A 1 152 ? 8.696   9.003   -4.538  1.00 0.40 ? 152 ILE A CA   5  
ATOM 9547  C C    . ILE A 1 152 ? 10.195  9.260   -4.679  1.00 0.40 ? 152 ILE A C    5  
ATOM 9548  O O    . ILE A 1 152 ? 10.838  9.753   -3.754  1.00 0.45 ? 152 ILE A O    5  
ATOM 9549  C CB   . ILE A 1 152 ? 8.434   7.499   -4.292  1.00 0.40 ? 152 ILE A CB   5  
ATOM 9550  C CG1  . ILE A 1 152 ? 6.935   7.228   -4.117  1.00 0.46 ? 152 ILE A CG1  5  
ATOM 9551  C CG2  . ILE A 1 152 ? 9.209   7.007   -3.077  1.00 0.42 ? 152 ILE A CG2  5  
ATOM 9552  C CD1  . ILE A 1 152 ? 6.294   7.993   -2.974  1.00 0.51 ? 152 ILE A CD1  5  
ATOM 9553  H H    . ILE A 1 152 ? 7.506   8.877   -6.288  1.00 0.41 ? 152 ILE A H    5  
ATOM 9554  N N    . GLN A 1 153 ? 10.750  8.944   -5.844  1.00 0.41 ? 153 GLN A N    5  
ATOM 9555  C CA   . GLN A 1 153 ? 12.177  9.143   -6.069  1.00 0.46 ? 153 GLN A CA   5  
ATOM 9556  C C    . GLN A 1 153 ? 12.521  10.626  -6.163  1.00 0.50 ? 153 GLN A C    5  
ATOM 9557  O O    . GLN A 1 153 ? 13.620  11.041  -5.793  1.00 0.56 ? 153 GLN A O    5  
ATOM 9558  C CB   . GLN A 1 153 ? 12.658  8.398   -7.315  1.00 0.52 ? 153 GLN A CB   5  
ATOM 9559  C CG   . GLN A 1 153 ? 14.153  8.108   -7.310  1.00 0.73 ? 153 GLN A CG   5  
ATOM 9560  C CD   . GLN A 1 153 ? 14.904  8.862   -8.388  1.00 0.99 ? 153 GLN A CD   5  
ATOM 9561  O OE1  . GLN A 1 153 ? 15.083  8.361   -9.495  1.00 1.17 ? 153 GLN A OE1  5  
ATOM 9562  N NE2  . GLN A 1 153 ? 15.350  10.068  -8.076  1.00 1.42 ? 153 GLN A NE2  5  
ATOM 9563  H H    . GLN A 1 153 ? 10.192  8.573   -6.563  1.00 0.41 ? 153 GLN A H    5  
ATOM 9564  H HE21 . GLN A 1 153 ? 15.170  10.412  -7.172  1.00 1.53 ? 153 GLN A HE21 5  
ATOM 9565  H HE22 . GLN A 1 153 ? 15.834  10.575  -8.764  1.00 1.74 ? 153 GLN A HE22 5  
ATOM 9566  N N    . ASP A 1 154 ? 11.571  11.416  -6.649  1.00 0.52 ? 154 ASP A N    5  
ATOM 9567  C CA   . ASP A 1 154 ? 11.755  12.858  -6.793  1.00 0.61 ? 154 ASP A CA   5  
ATOM 9568  C C    . ASP A 1 154 ? 11.976  13.537  -5.443  1.00 0.59 ? 154 ASP A C    5  
ATOM 9569  O O    . ASP A 1 154 ? 12.912  14.321  -5.280  1.00 0.65 ? 154 ASP A O    5  
ATOM 9570  C CB   . ASP A 1 154 ? 10.543  13.483  -7.493  1.00 0.72 ? 154 ASP A CB   5  
ATOM 9571  C CG   . ASP A 1 154 ? 10.559  14.999  -7.463  1.00 0.79 ? 154 ASP A CG   5  
ATOM 9572  O OD1  . ASP A 1 154 ? 11.281  15.610  -8.280  1.00 1.00 ? 154 ASP A OD1  5  
ATOM 9573  O OD2  . ASP A 1 154 ? 9.838   15.587  -6.627  1.00 1.08 ? 154 ASP A OD2  5  
ATOM 9574  H H    . ASP A 1 154 ? 10.719  11.017  -6.928  1.00 0.52 ? 154 ASP A H    5  
ATOM 9575  N N    . GLN A 1 155 ? 11.119  13.215  -4.479  1.00 0.54 ? 155 GLN A N    5  
ATOM 9576  C CA   . GLN A 1 155 ? 11.209  13.806  -3.143  1.00 0.56 ? 155 GLN A CA   5  
ATOM 9577  C C    . GLN A 1 155 ? 12.443  13.334  -2.379  1.00 0.54 ? 155 GLN A C    5  
ATOM 9578  O O    . GLN A 1 155 ? 12.906  14.009  -1.461  1.00 0.65 ? 155 GLN A O    5  
ATOM 9579  C CB   . GLN A 1 155 ? 9.935   13.546  -2.336  1.00 0.58 ? 155 GLN A CB   5  
ATOM 9580  C CG   . GLN A 1 155 ? 9.579   12.076  -2.189  1.00 0.52 ? 155 GLN A CG   5  
ATOM 9581  C CD   . GLN A 1 155 ? 8.184   11.868  -1.645  1.00 0.58 ? 155 GLN A CD   5  
ATOM 9582  O OE1  . GLN A 1 155 ? 7.988   11.756  -0.437  1.00 0.70 ? 155 GLN A OE1  5  
ATOM 9583  N NE2  . GLN A 1 155 ? 7.201   11.817  -2.532  1.00 0.56 ? 155 GLN A NE2  5  
ATOM 9584  H H    . GLN A 1 155 ? 10.404  12.573  -4.670  1.00 0.52 ? 155 GLN A H    5  
ATOM 9585  H HE21 . GLN A 1 155 ? 7.429   11.916  -3.484  1.00 0.53 ? 155 GLN A HE21 5  
ATOM 9586  H HE22 . GLN A 1 155 ? 6.288   11.683  -2.203  1.00 0.63 ? 155 GLN A HE22 5  
ATOM 9587  N N    . GLY A 1 156 ? 12.969  12.174  -2.757  1.00 0.51 ? 156 GLY A N    5  
ATOM 9588  C CA   . GLY A 1 156 ? 14.151  11.653  -2.098  1.00 0.53 ? 156 GLY A CA   5  
ATOM 9589  C C    . GLY A 1 156 ? 13.927  10.292  -1.472  1.00 0.51 ? 156 GLY A C    5  
ATOM 9590  O O    . GLY A 1 156 ? 14.835  9.731   -0.856  1.00 0.67 ? 156 GLY A O    5  
ATOM 9591  H H    . GLY A 1 156 ? 12.557  11.676  -3.492  1.00 0.56 ? 156 GLY A H    5  
ATOM 9592  N N    . GLY A 1 157 ? 12.726  9.756   -1.627  1.00 0.51 ? 157 GLY A N    5  
ATOM 9593  C CA   . GLY A 1 157 ? 12.425  8.459   -1.067  1.00 0.53 ? 157 GLY A CA   5  
ATOM 9594  C C    . GLY A 1 157 ? 11.166  8.462   -0.236  1.00 0.47 ? 157 GLY A C    5  
ATOM 9595  O O    . GLY A 1 157 ? 10.222  9.193   -0.530  1.00 0.49 ? 157 GLY A O    5  
ATOM 9596  H H    . GLY A 1 157 ? 12.037  10.244  -2.128  1.00 0.62 ? 157 GLY A H    5  
ATOM 9597  N N    . TRP A 1 158 ? 11.164  7.665   0.821   1.00 0.48 ? 158 TRP A N    5  
ATOM 9598  C CA   . TRP A 1 158 ? 10.006  7.554   1.696   1.00 0.45 ? 158 TRP A CA   5  
ATOM 9599  C C    . TRP A 1 158 ? 10.073  8.562   2.838   1.00 0.51 ? 158 TRP A C    5  
ATOM 9600  O O    . TRP A 1 158 ? 9.151   8.657   3.653   1.00 0.53 ? 158 TRP A O    5  
ATOM 9601  C CB   . TRP A 1 158 ? 9.888   6.128   2.245   1.00 0.48 ? 158 TRP A CB   5  
ATOM 9602  C CG   . TRP A 1 158 ? 9.964   5.073   1.181   1.00 0.48 ? 158 TRP A CG   5  
ATOM 9603  C CD1  . TRP A 1 158 ? 11.068  4.357   0.811   1.00 0.53 ? 158 TRP A CD1  5  
ATOM 9604  C CD2  . TRP A 1 158 ? 8.893   4.617   0.346   1.00 0.49 ? 158 TRP A CD2  5  
ATOM 9605  N NE1  . TRP A 1 158 ? 10.749  3.489   -0.207  1.00 0.57 ? 158 TRP A NE1  5  
ATOM 9606  C CE2  . TRP A 1 158 ? 9.419   3.627   -0.507  1.00 0.54 ? 158 TRP A CE2  5  
ATOM 9607  C CE3  . TRP A 1 158 ? 7.539   4.949   0.239   1.00 0.51 ? 158 TRP A CE3  5  
ATOM 9608  C CZ2  . TRP A 1 158 ? 8.641   2.970   -1.458  1.00 0.60 ? 158 TRP A CZ2  5  
ATOM 9609  C CZ3  . TRP A 1 158 ? 6.769   4.295   -0.705  1.00 0.56 ? 158 TRP A CZ3  5  
ATOM 9610  C CH2  . TRP A 1 158 ? 7.321   3.314   -1.538  1.00 0.60 ? 158 TRP A CH2  5  
ATOM 9611  H H    . TRP A 1 158 ? 11.967  7.142   1.024   1.00 0.54 ? 158 TRP A H    5  
ATOM 9612  H HE1  . TRP A 1 158 ? 11.375  2.869   -0.645  1.00 0.64 ? 158 TRP A HE1  5  
ATOM 9613  N N    . ASP A 1 159 ? 11.164  9.323   2.886   1.00 0.57 ? 159 ASP A N    5  
ATOM 9614  C CA   . ASP A 1 159 ? 11.350  10.335  3.924   1.00 0.65 ? 159 ASP A CA   5  
ATOM 9615  C C    . ASP A 1 159 ? 10.248  11.389  3.854   1.00 0.59 ? 159 ASP A C    5  
ATOM 9616  O O    . ASP A 1 159 ? 9.861   11.975  4.869   1.00 0.61 ? 159 ASP A O    5  
ATOM 9617  C CB   . ASP A 1 159 ? 12.722  10.999  3.793   1.00 0.77 ? 159 ASP A CB   5  
ATOM 9618  C CG   . ASP A 1 159 ? 13.327  11.371  5.133   1.00 0.97 ? 159 ASP A CG   5  
ATOM 9619  O OD1  . ASP A 1 159 ? 13.054  12.482  5.630   1.00 1.15 ? 159 ASP A OD1  5  
ATOM 9620  O OD2  . ASP A 1 159 ? 14.090  10.557  5.696   1.00 1.17 ? 159 ASP A OD2  5  
ATOM 9621  H H    . ASP A 1 159 ? 11.868  9.192   2.213   1.00 0.59 ? 159 ASP A H    5  
ATOM 9622  N N    . GLY A 1 160 ? 9.725   11.605  2.649   1.00 0.55 ? 160 GLY A N    5  
ATOM 9623  C CA   . GLY A 1 160 ? 8.662   12.572  2.460   1.00 0.52 ? 160 GLY A CA   5  
ATOM 9624  C C    . GLY A 1 160 ? 7.385   12.138  3.153   1.00 0.47 ? 160 GLY A C    5  
ATOM 9625  O O    . GLY A 1 160 ? 6.628   12.971  3.656   1.00 0.49 ? 160 GLY A O    5  
ATOM 9626  H H    . GLY A 1 160 ? 10.064  11.097  1.882   1.00 0.55 ? 160 GLY A H    5  
ATOM 9627  N N    . LEU A 1 161 ? 7.152   10.828  3.187   1.00 0.46 ? 161 LEU A N    5  
ATOM 9628  C CA   . LEU A 1 161 ? 5.969   10.275  3.838   1.00 0.47 ? 161 LEU A CA   5  
ATOM 9629  C C    . LEU A 1 161 ? 6.134   10.358  5.350   1.00 0.52 ? 161 LEU A C    5  
ATOM 9630  O O    . LEU A 1 161 ? 5.188   10.663  6.077   1.00 0.55 ? 161 LEU A O    5  
ATOM 9631  C CB   . LEU A 1 161 ? 5.749   8.820   3.407   1.00 0.51 ? 161 LEU A CB   5  
ATOM 9632  C CG   . LEU A 1 161 ? 4.598   8.068   4.087   1.00 0.60 ? 161 LEU A CG   5  
ATOM 9633  C CD1  . LEU A 1 161 ? 3.259   8.733   3.792   1.00 0.62 ? 161 LEU A CD1  5  
ATOM 9634  C CD2  . LEU A 1 161 ? 4.583   6.610   3.657   1.00 0.67 ? 161 LEU A CD2  5  
ATOM 9635  H H    . LEU A 1 161 ? 7.796   10.217  2.769   1.00 0.47 ? 161 LEU A H    5  
ATOM 9636  N N    . LEU A 1 162 ? 7.352   10.102  5.813   1.00 0.56 ? 162 LEU A N    5  
ATOM 9637  C CA   . LEU A 1 162 ? 7.660   10.164  7.238   1.00 0.64 ? 162 LEU A CA   5  
ATOM 9638  C C    . LEU A 1 162 ? 7.465   11.586  7.755   1.00 0.64 ? 162 LEU A C    5  
ATOM 9639  O O    . LEU A 1 162 ? 6.978   11.799  8.868   1.00 0.72 ? 162 LEU A O    5  
ATOM 9640  C CB   . LEU A 1 162 ? 9.102   9.712   7.490   1.00 0.71 ? 162 LEU A CB   5  
ATOM 9641  C CG   . LEU A 1 162 ? 9.398   8.226   7.270   1.00 0.81 ? 162 LEU A CG   5  
ATOM 9642  C CD1  . LEU A 1 162 ? 10.896  7.992   7.169   1.00 0.90 ? 162 LEU A CD1  5  
ATOM 9643  C CD2  . LEU A 1 162 ? 8.800   7.392   8.394   1.00 0.87 ? 162 LEU A CD2  5  
ATOM 9644  H H    . LEU A 1 162 ? 8.062   9.861   5.180   1.00 0.56 ? 162 LEU A H    5  
ATOM 9645  N N    . SER A 1 163 ? 7.829   12.554  6.924   1.00 0.59 ? 163 SER A N    5  
ATOM 9646  C CA   . SER A 1 163 ? 7.699   13.960  7.274   1.00 0.62 ? 163 SER A CA   5  
ATOM 9647  C C    . SER A 1 163 ? 6.256   14.448  7.106   1.00 0.60 ? 163 SER A C    5  
ATOM 9648  O O    . SER A 1 163 ? 5.934   15.597  7.420   1.00 0.67 ? 163 SER A O    5  
ATOM 9649  C CB   . SER A 1 163 ? 8.656   14.796  6.421   1.00 0.65 ? 163 SER A CB   5  
ATOM 9650  O OG   . SER A 1 163 ? 9.965   14.240  6.445   1.00 0.69 ? 163 SER A OG   5  
ATOM 9651  H H    . SER A 1 163 ? 8.206   12.315  6.051   1.00 0.58 ? 163 SER A H    5  
ATOM 9652  H HG   . SER A 1 163 ? 10.043  13.562  5.757   1.00 0.78 ? 163 SER A HG   5  
ATOM 9653  N N    . TYR A 1 164 ? 5.386   13.573  6.607   1.00 0.57 ? 164 TYR A N    5  
ATOM 9654  C CA   . TYR A 1 164 ? 3.984   13.915  6.409   1.00 0.57 ? 164 TYR A CA   5  
ATOM 9655  C C    . TYR A 1 164 ? 3.167   13.556  7.644   1.00 0.56 ? 164 TYR A C    5  
ATOM 9656  O O    . TYR A 1 164 ? 2.053   14.049  7.830   1.00 0.58 ? 164 TYR A O    5  
ATOM 9657  C CB   . TYR A 1 164 ? 3.423   13.203  5.172   1.00 0.57 ? 164 TYR A CB   5  
ATOM 9658  C CG   . TYR A 1 164 ? 2.002   13.589  4.826   1.00 0.65 ? 164 TYR A CG   5  
ATOM 9659  C CD1  . TYR A 1 164 ? 1.705   14.852  4.330   1.00 0.72 ? 164 TYR A CD1  5  
ATOM 9660  C CD2  . TYR A 1 164 ? 0.955   12.690  4.996   1.00 0.73 ? 164 TYR A CD2  5  
ATOM 9661  C CE1  . TYR A 1 164 ? 0.408   15.210  4.016   1.00 0.84 ? 164 TYR A CE1  5  
ATOM 9662  C CE2  . TYR A 1 164 ? -0.345  13.041  4.683   1.00 0.83 ? 164 TYR A CE2  5  
ATOM 9663  C CZ   . TYR A 1 164 ? -0.614  14.302  4.194   1.00 0.86 ? 164 TYR A CZ   5  
ATOM 9664  O OH   . TYR A 1 164 ? -1.909  14.654  3.879   1.00 0.99 ? 164 TYR A OH   5  
ATOM 9665  H H    . TYR A 1 164 ? 5.698   12.674  6.365   1.00 0.59 ? 164 TYR A H    5  
ATOM 9666  H HH   . TYR A 1 164 ? -1.946  14.961  2.963   1.00 0.96 ? 164 TYR A HH   5  
ATOM 9667  N N    . PHE A 1 165 ? 3.732   12.697  8.485   1.00 0.56 ? 165 PHE A N    5  
ATOM 9668  C CA   . PHE A 1 165 ? 3.066   12.270  9.711   1.00 0.58 ? 165 PHE A CA   5  
ATOM 9669  C C    . PHE A 1 165 ? 2.803   13.470  10.619  1.00 0.61 ? 165 PHE A C    5  
ATOM 9670  O O    . PHE A 1 165 ? 3.734   14.070  11.160  1.00 0.69 ? 165 PHE A O    5  
ATOM 9671  C CB   . PHE A 1 165 ? 3.914   11.224  10.441  1.00 0.63 ? 165 PHE A CB   5  
ATOM 9672  C CG   . PHE A 1 165 ? 3.251   10.622  11.648  1.00 0.63 ? 165 PHE A CG   5  
ATOM 9673  C CD1  . PHE A 1 165 ? 2.232   9.693   11.502  1.00 0.62 ? 165 PHE A CD1  5  
ATOM 9674  C CD2  . PHE A 1 165 ? 3.648   10.980  12.925  1.00 0.72 ? 165 PHE A CD2  5  
ATOM 9675  C CE1  . PHE A 1 165 ? 1.623   9.135   12.608  1.00 0.65 ? 165 PHE A CE1  5  
ATOM 9676  C CE2  . PHE A 1 165 ? 3.043   10.426  14.036  1.00 0.74 ? 165 PHE A CE2  5  
ATOM 9677  C CZ   . PHE A 1 165 ? 2.030   9.502   13.877  1.00 0.67 ? 165 PHE A CZ   5  
ATOM 9678  H H    . PHE A 1 165 ? 4.621   12.341  8.276   1.00 0.59 ? 165 PHE A H    5  
ATOM 9679  N N    . GLY A 1 166 ? 1.538   13.832  10.761  1.00 0.63 ? 166 GLY A N    5  
ATOM 9680  C CA   . GLY A 1 166 ? 1.181   14.958  11.590  1.00 0.70 ? 166 GLY A CA   5  
ATOM 9681  C C    . GLY A 1 166 ? 0.728   14.554  12.976  1.00 0.73 ? 166 GLY A C    5  
ATOM 9682  O O    . GLY A 1 166 ? 0.042   13.545  13.153  1.00 1.05 ? 166 GLY A O    5  
ATOM 9683  H H    . GLY A 1 166 ? 0.837   13.335  10.288  1.00 0.67 ? 166 GLY A H    5  
ATOM 9684  N N    . THR A 1 167 ? 1.136   15.332  13.960  1.00 0.65 ? 167 THR A N    5  
ATOM 9685  C CA   . THR A 1 167 ? 0.762   15.084  15.342  1.00 0.67 ? 167 THR A CA   5  
ATOM 9686  C C    . THR A 1 167 ? -0.218  16.155  15.853  1.00 0.66 ? 167 THR A C    5  
ATOM 9687  O O    . THR A 1 167 ? -1.277  15.815  16.371  1.00 0.68 ? 167 THR A O    5  
ATOM 9688  C CB   . THR A 1 167 ? 1.993   14.972  16.261  1.00 0.74 ? 167 THR A CB   5  
ATOM 9689  O OG1  . THR A 1 167 ? 2.993   14.172  15.605  1.00 0.89 ? 167 THR A OG1  5  
ATOM 9690  C CG2  . THR A 1 167 ? 1.614   14.314  17.581  1.00 0.86 ? 167 THR A CG2  5  
ATOM 9691  H H    . THR A 1 167 ? 1.716   16.097  13.756  1.00 0.77 ? 167 THR A H    5  
ATOM 9692  H HG1  . THR A 1 167 ? 2.558   13.459  15.122  1.00 1.05 ? 167 THR A HG1  5  
ATOM 9693  N N    . PRO A 1 168 ? 0.110   17.466  15.718  1.00 0.68 ? 168 PRO A N    5  
ATOM 9694  C CA   . PRO A 1 168 ? -0.788  18.543  16.166  1.00 0.71 ? 168 PRO A CA   5  
ATOM 9695  C C    . PRO A 1 168 ? -2.115  18.519  15.412  1.00 0.67 ? 168 PRO A C    5  
ATOM 9696  O O    . PRO A 1 168 ? -2.168  18.819  14.216  1.00 0.70 ? 168 PRO A O    5  
ATOM 9697  C CB   . PRO A 1 168 ? -0.021  19.829  15.839  1.00 0.77 ? 168 PRO A CB   5  
ATOM 9698  C CG   . PRO A 1 168 ? 1.400   19.405  15.710  1.00 0.81 ? 168 PRO A CG   5  
ATOM 9699  C CD   . PRO A 1 168 ? 1.363   18.010  15.160  1.00 0.70 ? 168 PRO A CD   5  
ATOM 9700  N N    . THR A 1 169 ? -3.171  18.144  16.125  1.00 0.68 ? 169 THR A N    5  
ATOM 9701  C CA   . THR A 1 169 ? -4.513  18.061  15.560  1.00 0.71 ? 169 THR A CA   5  
ATOM 9702  C C    . THR A 1 169 ? -4.601  17.016  14.443  1.00 0.61 ? 169 THR A C    5  
ATOM 9703  O O    . THR A 1 169 ? -4.573  17.342  13.258  1.00 0.62 ? 169 THR A O    5  
ATOM 9704  C CB   . THR A 1 169 ? -5.024  19.434  15.070  1.00 0.85 ? 169 THR A CB   5  
ATOM 9705  O OG1  . THR A 1 169 ? -4.754  20.419  16.081  1.00 1.01 ? 169 THR A OG1  5  
ATOM 9706  C CG2  . THR A 1 169 ? -6.525  19.382  14.813  1.00 1.02 ? 169 THR A CG2  5  
ATOM 9707  H H    . THR A 1 169 ? -3.041  17.918  17.071  1.00 0.72 ? 169 THR A H    5  
ATOM 9708  H HG1  . THR A 1 169 ? -4.914  21.301  15.719  1.00 1.43 ? 169 THR A HG1  5  
ATOM 9709  N N    . TRP A 1 170 ? -4.706  15.753  14.838  1.00 0.58 ? 170 TRP A N    5  
ATOM 9710  C CA   . TRP A 1 170 ? -4.797  14.659  13.875  1.00 0.54 ? 170 TRP A CA   5  
ATOM 9711  C C    . TRP A 1 170 ? -6.245  14.425  13.455  1.00 0.52 ? 170 TRP A C    5  
ATOM 9712  O O    . TRP A 1 170 ? -6.512  13.686  12.509  1.00 0.49 ? 170 TRP A O    5  
ATOM 9713  C CB   . TRP A 1 170 ? -4.191  13.376  14.450  1.00 0.59 ? 170 TRP A CB   5  
ATOM 9714  C CG   . TRP A 1 170 ? -4.798  12.936  15.751  1.00 0.72 ? 170 TRP A CG   5  
ATOM 9715  C CD1  . TRP A 1 170 ? -5.956  12.231  15.921  1.00 0.94 ? 170 TRP A CD1  5  
ATOM 9716  C CD2  . TRP A 1 170 ? -4.276  13.169  17.066  1.00 0.83 ? 170 TRP A CD2  5  
ATOM 9717  N NE1  . TRP A 1 170 ? -6.186  12.014  17.257  1.00 1.08 ? 170 TRP A NE1  5  
ATOM 9718  C CE2  . TRP A 1 170 ? -5.169  12.579  17.981  1.00 1.03 ? 170 TRP A CE2  5  
ATOM 9719  C CE3  . TRP A 1 170 ? -3.142  13.819  17.557  1.00 0.95 ? 170 TRP A CE3  5  
ATOM 9720  C CZ2  . TRP A 1 170 ? -4.959  12.619  19.358  1.00 1.25 ? 170 TRP A CZ2  5  
ATOM 9721  C CZ3  . TRP A 1 170 ? -2.936  13.857  18.923  1.00 1.22 ? 170 TRP A CZ3  5  
ATOM 9722  C CH2  . TRP A 1 170 ? -3.840  13.262  19.807  1.00 1.33 ? 170 TRP A CH2  5  
ATOM 9723  H H    . TRP A 1 170 ? -4.715  15.547  15.796  1.00 0.63 ? 170 TRP A H    5  
ATOM 9724  H HE1  . TRP A 1 170 ? -6.954  11.531  17.633  1.00 1.27 ? 170 TRP A HE1  5  
ATOM 9725  N N    . GLN A 1 171 ? -7.168  15.075  14.161  1.00 0.55 ? 171 GLN A N    5  
ATOM 9726  C CA   . GLN A 1 171 ? -8.597  14.948  13.885  1.00 0.58 ? 171 GLN A CA   5  
ATOM 9727  C C    . GLN A 1 171 ? -8.937  15.353  12.454  1.00 0.54 ? 171 GLN A C    5  
ATOM 9728  O O    . GLN A 1 171 ? -9.718  14.685  11.776  1.00 0.51 ? 171 GLN A O    5  
ATOM 9729  C CB   . GLN A 1 171 ? -9.399  15.798  14.873  1.00 0.65 ? 171 GLN A CB   5  
ATOM 9730  C CG   . GLN A 1 171 ? -10.873 15.931  14.526  1.00 0.82 ? 171 GLN A CG   5  
ATOM 9731  C CD   . GLN A 1 171 ? -11.586 16.936  15.403  1.00 1.09 ? 171 GLN A CD   5  
ATOM 9732  O OE1  . GLN A 1 171 ? -11.625 18.127  15.099  1.00 1.33 ? 171 GLN A OE1  5  
ATOM 9733  N NE2  . GLN A 1 171 ? -12.159 16.464  16.494  1.00 1.37 ? 171 GLN A NE2  5  
ATOM 9734  H H    . GLN A 1 171 ? -6.877  15.656  14.891  1.00 0.59 ? 171 GLN A H    5  
ATOM 9735  H HE21 . GLN A 1 171 ? -12.090 15.501  16.676  1.00 1.45 ? 171 GLN A HE21 5  
ATOM 9736  H HE22 . GLN A 1 171 ? -12.629 17.094  17.080  1.00 1.64 ? 171 GLN A HE22 5  
ATOM 9737  N N    . THR A 1 172 ? -8.339  16.443  11.998  1.00 0.56 ? 172 THR A N    5  
ATOM 9738  C CA   . THR A 1 172 ? -8.581  16.940  10.655  1.00 0.56 ? 172 THR A CA   5  
ATOM 9739  C C    . THR A 1 172 ? -8.055  15.962  9.610   1.00 0.52 ? 172 THR A C    5  
ATOM 9740  O O    . THR A 1 172 ? -8.586  15.873  8.502   1.00 0.52 ? 172 THR A O    5  
ATOM 9741  C CB   . THR A 1 172 ? -7.915  18.311  10.467  1.00 0.62 ? 172 THR A CB   5  
ATOM 9742  O OG1  . THR A 1 172 ? -6.895  18.474  11.464  1.00 0.72 ? 172 THR A OG1  5  
ATOM 9743  C CG2  . THR A 1 172 ? -8.942  19.425  10.615  1.00 0.75 ? 172 THR A CG2  5  
ATOM 9744  H H    . THR A 1 172 ? -7.711  16.926  12.575  1.00 0.59 ? 172 THR A H    5  
ATOM 9745  H HG1  . THR A 1 172 ? -6.212  19.065  11.125  1.00 1.20 ? 172 THR A HG1  5  
ATOM 9746  N N    . VAL A 1 173 ? -7.027  15.209  9.985   1.00 0.53 ? 173 VAL A N    5  
ATOM 9747  C CA   . VAL A 1 173 ? -6.422  14.232  9.088   1.00 0.52 ? 173 VAL A CA   5  
ATOM 9748  C C    . VAL A 1 173 ? -7.397  13.093  8.811   1.00 0.49 ? 173 VAL A C    5  
ATOM 9749  O O    . VAL A 1 173 ? -7.579  12.684  7.661   1.00 0.47 ? 173 VAL A O    5  
ATOM 9750  C CB   . VAL A 1 173 ? -5.103  13.669  9.657   1.00 0.56 ? 173 VAL A CB   5  
ATOM 9751  C CG1  . VAL A 1 173 ? -4.407  12.783  8.631   1.00 0.57 ? 173 VAL A CG1  5  
ATOM 9752  C CG2  . VAL A 1 173 ? -4.186  14.800  10.101  1.00 0.60 ? 173 VAL A CG2  5  
ATOM 9753  H H    . VAL A 1 173 ? -6.675  15.304  10.893  1.00 0.57 ? 173 VAL A H    5  
ATOM 9754  N N    . THR A 1 174 ? -8.036  12.594  9.866   1.00 0.49 ? 174 THR A N    5  
ATOM 9755  C CA   . THR A 1 174 ? -9.001  11.518  9.728   1.00 0.48 ? 174 THR A CA   5  
ATOM 9756  C C    . THR A 1 174 ? -10.165 11.963  8.847   1.00 0.47 ? 174 THR A C    5  
ATOM 9757  O O    . THR A 1 174 ? -10.612 11.221  7.969   1.00 0.47 ? 174 THR A O    5  
ATOM 9758  C CB   . THR A 1 174 ? -9.534  11.067  11.098  1.00 0.50 ? 174 THR A CB   5  
ATOM 9759  O OG1  . THR A 1 174 ? -9.013  11.927  12.122  1.00 0.58 ? 174 THR A OG1  5  
ATOM 9760  C CG2  . THR A 1 174 ? -9.117  9.632   11.381  1.00 0.54 ? 174 THR A CG2  5  
ATOM 9761  H H    . THR A 1 174 ? -7.847  12.951  10.761  1.00 0.52 ? 174 THR A H    5  
ATOM 9762  H HG1  . THR A 1 174 ? -9.750  12.317  12.610  1.00 1.09 ? 174 THR A HG1  5  
ATOM 9763  N N    . ILE A 1 175 ? -10.634 13.191  9.073   1.00 0.48 ? 175 ILE A N    5  
ATOM 9764  C CA   . ILE A 1 175 ? -11.733 13.752  8.295   1.00 0.49 ? 175 ILE A CA   5  
ATOM 9765  C C    . ILE A 1 175 ? -11.315 13.890  6.831   1.00 0.46 ? 175 ILE A C    5  
ATOM 9766  O O    . ILE A 1 175 ? -12.107 13.654  5.916   1.00 0.45 ? 175 ILE A O    5  
ATOM 9767  C CB   . ILE A 1 175 ? -12.165 15.132  8.844   1.00 0.54 ? 175 ILE A CB   5  
ATOM 9768  C CG1  . ILE A 1 175 ? -12.599 15.016  10.308  1.00 0.57 ? 175 ILE A CG1  5  
ATOM 9769  C CG2  . ILE A 1 175 ? -13.289 15.721  8.003   1.00 0.59 ? 175 ILE A CG2  5  
ATOM 9770  C CD1  . ILE A 1 175 ? -12.838 16.348  10.986  1.00 0.64 ? 175 ILE A CD1  5  
ATOM 9771  H H    . ILE A 1 175 ? -10.227 13.734  9.787   1.00 0.49 ? 175 ILE A H    5  
ATOM 9772  N N    . PHE A 1 176 ? -10.058 14.261  6.619   1.00 0.45 ? 176 PHE A N    5  
ATOM 9773  C CA   . PHE A 1 176 ? -9.513  14.424  5.279   1.00 0.43 ? 176 PHE A CA   5  
ATOM 9774  C C    . PHE A 1 176 ? -9.509  13.091  4.532   1.00 0.40 ? 176 PHE A C    5  
ATOM 9775  O O    . PHE A 1 176 ? -10.013 12.994  3.414   1.00 0.40 ? 176 PHE A O    5  
ATOM 9776  C CB   . PHE A 1 176 ? -8.096  15.006  5.349   1.00 0.45 ? 176 PHE A CB   5  
ATOM 9777  C CG   . PHE A 1 176 ? -7.433  15.172  4.012   1.00 0.49 ? 176 PHE A CG   5  
ATOM 9778  C CD1  . PHE A 1 176 ? -7.891  16.115  3.108   1.00 0.54 ? 176 PHE A CD1  5  
ATOM 9779  C CD2  . PHE A 1 176 ? -6.347  14.384  3.659   1.00 0.53 ? 176 PHE A CD2  5  
ATOM 9780  C CE1  . PHE A 1 176 ? -7.283  16.271  1.877   1.00 0.62 ? 176 PHE A CE1  5  
ATOM 9781  C CE2  . PHE A 1 176 ? -5.735  14.535  2.430   1.00 0.60 ? 176 PHE A CE2  5  
ATOM 9782  C CZ   . PHE A 1 176 ? -6.205  15.480  1.538   1.00 0.64 ? 176 PHE A CZ   5  
ATOM 9783  H H    . PHE A 1 176 ? -9.478  14.440  7.393   1.00 0.46 ? 176 PHE A H    5  
ATOM 9784  N N    . VAL A 1 177 ? -8.955  12.064  5.167   1.00 0.40 ? 177 VAL A N    5  
ATOM 9785  C CA   . VAL A 1 177 ? -8.890  10.736  4.565   1.00 0.38 ? 177 VAL A CA   5  
ATOM 9786  C C    . VAL A 1 177 ? -10.290 10.196  4.290   1.00 0.38 ? 177 VAL A C    5  
ATOM 9787  O O    . VAL A 1 177 ? -10.567 9.681   3.204   1.00 0.38 ? 177 VAL A O    5  
ATOM 9788  C CB   . VAL A 1 177 ? -8.115  9.742   5.458   1.00 0.40 ? 177 VAL A CB   5  
ATOM 9789  C CG1  . VAL A 1 177 ? -8.084  8.354   4.830   1.00 0.41 ? 177 VAL A CG1  5  
ATOM 9790  C CG2  . VAL A 1 177 ? -6.703  10.244  5.709   1.00 0.42 ? 177 VAL A CG2  5  
ATOM 9791  H H    . VAL A 1 177 ? -8.581  12.204  6.068   1.00 0.41 ? 177 VAL A H    5  
ATOM 9792  N N    . ALA A 1 178 ? -11.175 10.335  5.274   1.00 0.40 ? 178 ALA A N    5  
ATOM 9793  C CA   . ALA A 1 178 ? -12.549 9.868   5.142   1.00 0.41 ? 178 ALA A CA   5  
ATOM 9794  C C    . ALA A 1 178 ? -13.261 10.577  3.992   1.00 0.40 ? 178 ALA A C    5  
ATOM 9795  O O    . ALA A 1 178 ? -13.990 9.947   3.224   1.00 0.40 ? 178 ALA A O    5  
ATOM 9796  C CB   . ALA A 1 178 ? -13.305 10.066  6.449   1.00 0.44 ? 178 ALA A CB   5  
ATOM 9797  H H    . ALA A 1 178 ? -10.895 10.760  6.118   1.00 0.41 ? 178 ALA A H    5  
ATOM 9798  N N    . GLY A 1 179 ? -13.034 11.881  3.875   1.00 0.41 ? 179 GLY A N    5  
ATOM 9799  C CA   . GLY A 1 179 ? -13.656 12.661  2.819   1.00 0.42 ? 179 GLY A CA   5  
ATOM 9800  C C    . GLY A 1 179 ? -13.280 12.165  1.436   1.00 0.39 ? 179 GLY A C    5  
ATOM 9801  O O    . GLY A 1 179 ? -14.137 12.047  0.556   1.00 0.39 ? 179 GLY A O    5  
ATOM 9802  H H    . GLY A 1 179 ? -12.438 12.324  4.519   1.00 0.42 ? 179 GLY A H    5  
ATOM 9803  N N    . VAL A 1 180 ? -11.999 11.863  1.247   1.00 0.37 ? 180 VAL A N    5  
ATOM 9804  C CA   . VAL A 1 180 ? -11.510 11.368  -0.033  1.00 0.35 ? 180 VAL A CA   5  
ATOM 9805  C C    . VAL A 1 180 ? -12.136 10.011  -0.357  1.00 0.33 ? 180 VAL A C    5  
ATOM 9806  O O    . VAL A 1 180 ? -12.623 9.787   -1.467  1.00 0.33 ? 180 VAL A O    5  
ATOM 9807  C CB   . VAL A 1 180 ? -9.966  11.248  -0.052  1.00 0.36 ? 180 VAL A CB   5  
ATOM 9808  C CG1  . VAL A 1 180 ? -9.474  10.780  -1.415  1.00 0.36 ? 180 VAL A CG1  5  
ATOM 9809  C CG2  . VAL A 1 180 ? -9.320  12.577  0.315   1.00 0.39 ? 180 VAL A CG2  5  
ATOM 9810  H H    . VAL A 1 180 ? -11.366 11.979  1.987   1.00 0.38 ? 180 VAL A H    5  
ATOM 9811  N N    . LEU A 1 181 ? -12.143 9.117   0.628   1.00 0.33 ? 181 LEU A N    5  
ATOM 9812  C CA   . LEU A 1 181 ? -12.709 7.782   0.448   1.00 0.33 ? 181 LEU A CA   5  
ATOM 9813  C C    . LEU A 1 181 ? -14.204 7.844   0.153   1.00 0.34 ? 181 LEU A C    5  
ATOM 9814  O O    . LEU A 1 181 ? -14.708 7.116   -0.702  1.00 0.33 ? 181 LEU A O    5  
ATOM 9815  C CB   . LEU A 1 181 ? -12.439 6.908   1.677   1.00 0.36 ? 181 LEU A CB   5  
ATOM 9816  C CG   . LEU A 1 181 ? -10.984 6.482   1.887   1.00 0.37 ? 181 LEU A CG   5  
ATOM 9817  C CD1  . LEU A 1 181 ? -10.809 5.830   3.249   1.00 0.39 ? 181 LEU A CD1  5  
ATOM 9818  C CD2  . LEU A 1 181 ? -10.539 5.540   0.782   1.00 0.40 ? 181 LEU A CD2  5  
ATOM 9819  H H    . LEU A 1 181 ? -11.750 9.360   1.497   1.00 0.34 ? 181 LEU A H    5  
ATOM 9820  N N    . THR A 1 182 ? -14.907 8.721   0.860   1.00 0.37 ? 182 THR A N    5  
ATOM 9821  C CA   . THR A 1 182 ? -16.342 8.879   0.667   1.00 0.39 ? 182 THR A CA   5  
ATOM 9822  C C    . THR A 1 182 ? -16.642 9.402   -0.736  1.00 0.38 ? 182 THR A C    5  
ATOM 9823  O O    . THR A 1 182 ? -17.605 8.971   -1.376  1.00 0.38 ? 182 THR A O    5  
ATOM 9824  C CB   . THR A 1 182 ? -16.956 9.826   1.721   1.00 0.45 ? 182 THR A CB   5  
ATOM 9825  O OG1  . THR A 1 182 ? -16.550 9.409   3.032   1.00 0.45 ? 182 THR A OG1  5  
ATOM 9826  C CG2  . THR A 1 182 ? -18.475 9.800   1.646   1.00 0.53 ? 182 THR A CG2  5  
ATOM 9827  H H    . THR A 1 182 ? -14.449 9.277   1.529   1.00 0.39 ? 182 THR A H    5  
ATOM 9828  H HG1  . THR A 1 182 ? -15.602 9.571   3.138   1.00 0.43 ? 182 THR A HG1  5  
ATOM 9829  N N    . ALA A 1 183 ? -15.795 10.308  -1.217  1.00 0.39 ? 183 ALA A N    5  
ATOM 9830  C CA   . ALA A 1 183 ? -15.961 10.889  -2.544  1.00 0.40 ? 183 ALA A CA   5  
ATOM 9831  C C    . ALA A 1 183 ? -15.962 9.811   -3.623  1.00 0.36 ? 183 ALA A C    5  
ATOM 9832  O O    . ALA A 1 183 ? -16.933 9.668   -4.368  1.00 0.36 ? 183 ALA A O    5  
ATOM 9833  C CB   . ALA A 1 183 ? -14.875 11.917  -2.823  1.00 0.45 ? 183 ALA A CB   5  
ATOM 9834  H H    . ALA A 1 183 ? -15.040 10.597  -0.663  1.00 0.40 ? 183 ALA A H    5  
ATOM 9835  N N    . SER A 1 184 ? -14.884 9.037   -3.683  1.00 0.35 ? 184 SER A N    5  
ATOM 9836  C CA   . SER A 1 184 ? -14.753 7.975   -4.675  1.00 0.34 ? 184 SER A CA   5  
ATOM 9837  C C    . SER A 1 184 ? -15.893 6.959   -4.583  1.00 0.32 ? 184 SER A C    5  
ATOM 9838  O O    . SER A 1 184 ? -16.377 6.467   -5.605  1.00 0.33 ? 184 SER A O    5  
ATOM 9839  C CB   . SER A 1 184 ? -13.400 7.278   -4.532  1.00 0.37 ? 184 SER A CB   5  
ATOM 9840  O OG   . SER A 1 184 ? -12.346 8.224   -4.587  1.00 0.40 ? 184 SER A OG   5  
ATOM 9841  H H    . SER A 1 184 ? -14.150 9.186   -3.041  1.00 0.38 ? 184 SER A H    5  
ATOM 9842  H HG   . SER A 1 184 ? -12.394 8.704   -5.420  1.00 0.76 ? 184 SER A HG   5  
ATOM 9843  N N    . LEU A 1 185 ? -16.338 6.664   -3.362  1.00 0.33 ? 185 LEU A N    5  
ATOM 9844  C CA   . LEU A 1 185 ? -17.421 5.705   -3.165  1.00 0.35 ? 185 LEU A CA   5  
ATOM 9845  C C    . LEU A 1 185 ? -18.738 6.250   -3.710  1.00 0.36 ? 185 LEU A C    5  
ATOM 9846  O O    . LEU A 1 185 ? -19.561 5.500   -4.238  1.00 0.37 ? 185 LEU A O    5  
ATOM 9847  C CB   . LEU A 1 185 ? -17.566 5.338   -1.688  1.00 0.40 ? 185 LEU A CB   5  
ATOM 9848  C CG   . LEU A 1 185 ? -18.406 4.092   -1.392  1.00 0.66 ? 185 LEU A CG   5  
ATOM 9849  C CD1  . LEU A 1 185 ? -17.667 2.830   -1.814  1.00 1.01 ? 185 LEU A CD1  5  
ATOM 9850  C CD2  . LEU A 1 185 ? -18.782 4.030   0.078   1.00 0.77 ? 185 LEU A CD2  5  
ATOM 9851  H H    . LEU A 1 185 ? -15.931 7.101   -2.581  1.00 0.34 ? 185 LEU A H    5  
ATOM 9852  N N    . THR A 1 186 ? -18.920 7.560   -3.597  1.00 0.38 ? 186 THR A N    5  
ATOM 9853  C CA   . THR A 1 186 ? -20.132 8.212   -4.081  1.00 0.41 ? 186 THR A CA   5  
ATOM 9854  C C    . THR A 1 186 ? -20.193 8.158   -5.610  1.00 0.38 ? 186 THR A C    5  
ATOM 9855  O O    . THR A 1 186 ? -21.269 8.194   -6.208  1.00 0.43 ? 186 THR A O    5  
ATOM 9856  C CB   . THR A 1 186 ? -20.220 9.674   -3.590  1.00 0.47 ? 186 THR A CB   5  
ATOM 9857  O OG1  . THR A 1 186 ? -20.048 9.706   -2.165  1.00 0.50 ? 186 THR A OG1  5  
ATOM 9858  C CG2  . THR A 1 186 ? -21.573 10.281  -3.936  1.00 0.54 ? 186 THR A CG2  5  
ATOM 9859  H H    . THR A 1 186 ? -18.218 8.107   -3.182  1.00 0.38 ? 186 THR A H    5  
ATOM 9860  H HG1  . THR A 1 186 ? -19.166 9.374   -1.938  1.00 0.49 ? 186 THR A HG1  5  
ATOM 9861  N N    . ILE A 1 187 ? -19.029 8.043   -6.239  1.00 0.35 ? 187 ILE A N    5  
ATOM 9862  C CA   . ILE A 1 187 ? -18.949 7.965   -7.692  1.00 0.36 ? 187 ILE A CA   5  
ATOM 9863  C C    . ILE A 1 187 ? -18.915 6.497   -8.127  1.00 0.35 ? 187 ILE A C    5  
ATOM 9864  O O    . ILE A 1 187 ? -18.619 6.173   -9.278  1.00 0.45 ? 187 ILE A O    5  
ATOM 9865  C CB   . ILE A 1 187 ? -17.713 8.713   -8.248  1.00 0.38 ? 187 ILE A CB   5  
ATOM 9866  C CG1  . ILE A 1 187 ? -17.414 9.953   -7.399  1.00 0.38 ? 187 ILE A CG1  5  
ATOM 9867  C CG2  . ILE A 1 187 ? -17.953 9.126   -9.694  1.00 0.41 ? 187 ILE A CG2  5  
ATOM 9868  C CD1  . ILE A 1 187 ? -16.121 10.652  -7.762  1.00 0.43 ? 187 ILE A CD1  5  
ATOM 9869  H H    . ILE A 1 187 ? -18.200 8.011   -5.713  1.00 0.36 ? 187 ILE A H    5  
ATOM 9870  N N    . TRP A 1 188 ? -19.210 5.613   -7.185  1.00 0.35 ? 188 TRP A N    5  
ATOM 9871  C CA   . TRP A 1 188 ? -19.239 4.185   -7.455  1.00 0.37 ? 188 TRP A CA   5  
ATOM 9872  C C    . TRP A 1 188 ? -20.636 3.638   -7.202  1.00 0.38 ? 188 TRP A C    5  
ATOM 9873  O O    . TRP A 1 188 ? -21.284 3.116   -8.112  1.00 0.40 ? 188 TRP A O    5  
ATOM 9874  C CB   . TRP A 1 188 ? -18.204 3.447   -6.603  1.00 0.40 ? 188 TRP A CB   5  
ATOM 9875  C CG   . TRP A 1 188 ? -17.049 2.916   -7.396  1.00 0.41 ? 188 TRP A CG   5  
ATOM 9876  C CD1  . TRP A 1 188 ? -15.726 3.196   -7.205  1.00 0.51 ? 188 TRP A CD1  5  
ATOM 9877  C CD2  . TRP A 1 188 ? -17.114 2.017   -8.509  1.00 0.41 ? 188 TRP A CD2  5  
ATOM 9878  N NE1  . TRP A 1 188 ? -14.962 2.523   -8.127  1.00 0.55 ? 188 TRP A NE1  5  
ATOM 9879  C CE2  . TRP A 1 188 ? -15.793 1.790   -8.942  1.00 0.48 ? 188 TRP A CE2  5  
ATOM 9880  C CE3  . TRP A 1 188 ? -18.161 1.376   -9.181  1.00 0.47 ? 188 TRP A CE3  5  
ATOM 9881  C CZ2  . TRP A 1 188 ? -15.493 0.953   -10.015 1.00 0.54 ? 188 TRP A CZ2  5  
ATOM 9882  C CZ3  . TRP A 1 188 ? -17.861 0.547   -10.245 1.00 0.56 ? 188 TRP A CZ3  5  
ATOM 9883  C CH2  . TRP A 1 188 ? -16.537 0.341   -10.651 1.00 0.57 ? 188 TRP A CH2  5  
ATOM 9884  H H    . TRP A 1 188 ? -19.413 5.931   -6.278  1.00 0.41 ? 188 TRP A H    5  
ATOM 9885  H HE1  . TRP A 1 188 ? -13.982 2.562   -8.193  1.00 0.65 ? 188 TRP A HE1  5  
ATOM 9886  N N    . LYS A 1 189 ? -21.108 3.792   -5.968  1.00 0.39 ? 189 LYS A N    5  
ATOM 9887  C CA   . LYS A 1 189 ? -22.438 3.330   -5.586  1.00 0.43 ? 189 LYS A CA   5  
ATOM 9888  C C    . LYS A 1 189 ? -23.472 4.391   -5.944  1.00 0.46 ? 189 LYS A C    5  
ATOM 9889  O O    . LYS A 1 189 ? -24.267 4.815   -5.107  1.00 0.55 ? 189 LYS A O    5  
ATOM 9890  C CB   . LYS A 1 189 ? -22.487 3.036   -4.083  1.00 0.49 ? 189 LYS A CB   5  
ATOM 9891  C CG   . LYS A 1 189 ? -21.540 1.939   -3.620  1.00 0.71 ? 189 LYS A CG   5  
ATOM 9892  C CD   . LYS A 1 189 ? -21.991 0.565   -4.094  1.00 1.05 ? 189 LYS A CD   5  
ATOM 9893  C CE   . LYS A 1 189 ? -23.370 0.210   -3.556  1.00 0.83 ? 189 LYS A CE   5  
ATOM 9894  N NZ   . LYS A 1 189 ? -23.587 -1.257  -3.522  1.00 0.84 ? 189 LYS A NZ   5  
ATOM 9895  H H    . LYS A 1 189 ? -20.546 4.235   -5.292  1.00 0.40 ? 189 LYS A H    5  
ATOM 9896  H HZ1  . LYS A 1 189 ? -24.602 -1.474  -3.485  1.00 1.14 ? 189 LYS A HZ1  5  
ATOM 9897  H HZ2  . LYS A 1 189 ? -23.125 -1.668  -2.682  1.00 1.13 ? 189 LYS A HZ2  5  
ATOM 9898  H HZ3  . LYS A 1 189 ? -23.178 -1.703  -4.375  1.00 1.03 ? 189 LYS A HZ3  5  
ATOM 9899  N N    . LYS A 1 190 ? -23.457 4.797   -7.205  1.00 0.49 ? 190 LYS A N    5  
ATOM 9900  C CA   . LYS A 1 190 ? -24.358 5.824   -7.711  1.00 0.57 ? 190 LYS A CA   5  
ATOM 9901  C C    . LYS A 1 190 ? -25.759 5.285   -8.006  1.00 0.55 ? 190 LYS A C    5  
ATOM 9902  O O    . LYS A 1 190 ? -26.313 5.529   -9.081  1.00 0.61 ? 190 LYS A O    5  
ATOM 9903  C CB   . LYS A 1 190 ? -23.753 6.483   -8.959  1.00 0.67 ? 190 LYS A CB   5  
ATOM 9904  C CG   . LYS A 1 190 ? -22.879 5.566   -9.811  1.00 0.65 ? 190 LYS A CG   5  
ATOM 9905  C CD   . LYS A 1 190 ? -23.711 4.634   -10.684 1.00 0.69 ? 190 LYS A CD   5  
ATOM 9906  C CE   . LYS A 1 190 ? -22.834 3.702   -11.505 1.00 0.75 ? 190 LYS A CE   5  
ATOM 9907  N NZ   . LYS A 1 190 ? -22.361 2.532   -10.718 1.00 0.73 ? 190 LYS A NZ   5  
ATOM 9908  H H    . LYS A 1 190 ? -22.819 4.381   -7.823  1.00 0.52 ? 190 LYS A H    5  
ATOM 9909  H HZ1  . LYS A 1 190 ? -21.805 1.896   -11.325 1.00 0.85 ? 190 LYS A HZ1  5  
ATOM 9910  H HZ2  . LYS A 1 190 ? -23.177 1.999   -10.333 1.00 0.77 ? 190 LYS A HZ2  5  
ATOM 9911  H HZ3  . LYS A 1 190 ? -21.767 2.845   -9.925  1.00 0.86 ? 190 LYS A HZ3  5  
ATOM 9912  N N    . MET A 1 191 ? -26.326 4.571   -7.034  1.00 0.57 ? 191 MET A N    5  
ATOM 9913  C CA   . MET A 1 191 ? -27.660 3.984   -7.165  1.00 0.61 ? 191 MET A CA   5  
ATOM 9914  C C    . MET A 1 191 ? -27.703 2.983   -8.318  1.00 0.67 ? 191 MET A C    5  
ATOM 9915  O O    . MET A 1 191 ? -28.700 2.869   -9.032  1.00 1.20 ? 191 MET A O    5  
ATOM 9916  C CB   . MET A 1 191 ? -28.714 5.083   -7.354  1.00 0.70 ? 191 MET A CB   5  
ATOM 9917  C CG   . MET A 1 191 ? -30.135 4.663   -7.017  1.00 0.89 ? 191 MET A CG   5  
ATOM 9918  S SD   . MET A 1 191 ? -31.342 5.946   -7.410  1.00 1.20 ? 191 MET A SD   5  
ATOM 9919  C CE   . MET A 1 191 ? -31.128 6.081   -9.186  1.00 1.44 ? 191 MET A CE   5  
ATOM 9920  H H    . MET A 1 191 ? -25.836 4.448   -6.194  1.00 0.63 ? 191 MET A H    5  
ATOM 9921  N N    . GLY A 1 192 ? -26.605 2.263   -8.493  1.00 0.54 ? 192 GLY A N    5  
ATOM 9922  C CA   . GLY A 1 192 ? -26.507 1.284   -9.551  1.00 0.64 ? 192 GLY A CA   5  
ATOM 9923  C C    . GLY A 1 192 ? -25.070 1.112   -9.978  1.00 0.70 ? 192 GLY A C    5  
ATOM 9924  O O    . GLY A 1 192 ? -24.175 1.353   -9.139  1.00 0.80 ? 192 GLY A O    5  
ATOM 9925  O OXT  . GLY A 1 192 ? -24.819 0.767   -11.146 1.00 1.09 ? 192 GLY A OXT  5  
ATOM 9926  H H    . GLY A 1 192 ? -25.840 2.403   -7.898  1.00 0.80 ? 192 GLY A H    5  
ATOM 9927  N N    . GLU B 2 1   ? -0.008  -1.496  -15.998 1.00 5.01 ? 145 GLU B N    5  
ATOM 9928  C CA   . GLU B 2 1   ? -0.534  -2.374  -17.070 1.00 4.54 ? 145 GLU B CA   5  
ATOM 9929  C C    . GLU B 2 1   ? -0.379  -3.845  -16.688 1.00 3.87 ? 145 GLU B C    5  
ATOM 9930  O O    . GLU B 2 1   ? 0.238   -4.162  -15.675 1.00 3.91 ? 145 GLU B O    5  
ATOM 9931  C CB   . GLU B 2 1   ? 0.155   -2.084  -18.402 1.00 4.66 ? 145 GLU B CB   5  
ATOM 9932  C CG   . GLU B 2 1   ? -0.310  -0.801  -19.071 1.00 5.21 ? 145 GLU B CG   5  
ATOM 9933  C CD   . GLU B 2 1   ? -1.809  -0.761  -19.275 1.00 5.46 ? 145 GLU B CD   5  
ATOM 9934  O OE1  . GLU B 2 1   ? -2.345  -1.644  -19.970 1.00 5.59 ? 145 GLU B OE1  5  
ATOM 9935  O OE2  . GLU B 2 1   ? -2.463  0.152   -18.730 1.00 5.83 ? 145 GLU B OE2  5  
ATOM 9936  H H1   . GLU B 2 1   ? 0.209   -0.543  -16.368 1.00 4.99 ? 145 GLU B H1   5  
ATOM 9937  H H2   . GLU B 2 1   ? 0.861   -1.905  -15.589 1.00 5.07 ? 145 GLU B H2   5  
ATOM 9938  H H3   . GLU B 2 1   ? -0.707  -1.406  -15.232 1.00 5.51 ? 145 GLU B H3   5  
ATOM 9939  N N    . ILE B 2 2   ? -0.924  -4.737  -17.512 1.00 3.36 ? 146 ILE B N    5  
ATOM 9940  C CA   . ILE B 2 2   ? -0.866  -6.176  -17.246 1.00 2.81 ? 146 ILE B CA   5  
ATOM 9941  C C    . ILE B 2 2   ? 0.571   -6.706  -17.195 1.00 2.31 ? 146 ILE B C    5  
ATOM 9942  O O    . ILE B 2 2   ? 0.980   -7.303  -16.201 1.00 2.12 ? 146 ILE B O    5  
ATOM 9943  C CB   . ILE B 2 2   ? -1.682  -6.983  -18.278 1.00 2.51 ? 146 ILE B CB   5  
ATOM 9944  C CG1  . ILE B 2 2   ? -3.137  -6.496  -18.304 1.00 3.14 ? 146 ILE B CG1  5  
ATOM 9945  C CG2  . ILE B 2 2   ? -1.622  -8.472  -17.959 1.00 2.36 ? 146 ILE B CG2  5  
ATOM 9946  C CD1  . ILE B 2 2   ? -3.969  -7.085  -19.424 1.00 3.05 ? 146 ILE B CD1  5  
ATOM 9947  H H    . ILE B 2 2   ? -1.382  -4.423  -18.324 1.00 3.46 ? 146 ILE B H    5  
ATOM 9948  N N    . TRP B 2 3   ? 1.325   -6.478  -18.265 1.00 2.29 ? 147 TRP B N    5  
ATOM 9949  C CA   . TRP B 2 3   ? 2.707   -6.943  -18.352 1.00 2.19 ? 147 TRP B CA   5  
ATOM 9950  C C    . TRP B 2 3   ? 3.553   -6.369  -17.220 1.00 2.49 ? 147 TRP B C    5  
ATOM 9951  O O    . TRP B 2 3   ? 4.406   -7.053  -16.656 1.00 2.25 ? 147 TRP B O    5  
ATOM 9952  C CB   . TRP B 2 3   ? 3.309   -6.565  -19.709 1.00 2.58 ? 147 TRP B CB   5  
ATOM 9953  C CG   . TRP B 2 3   ? 4.637   -7.200  -19.987 1.00 2.84 ? 147 TRP B CG   5  
ATOM 9954  C CD1  . TRP B 2 3   ? 4.859   -8.455  -20.475 1.00 2.81 ? 147 TRP B CD1  5  
ATOM 9955  C CD2  . TRP B 2 3   ? 5.930   -6.611  -19.799 1.00 3.46 ? 147 TRP B CD2  5  
ATOM 9956  N NE1  . TRP B 2 3   ? 6.207   -8.682  -20.598 1.00 3.38 ? 147 TRP B NE1  5  
ATOM 9957  C CE2  . TRP B 2 3   ? 6.886   -7.567  -20.189 1.00 3.73 ? 147 TRP B CE2  5  
ATOM 9958  C CE3  . TRP B 2 3   ? 6.371   -5.368  -19.335 1.00 3.97 ? 147 TRP B CE3  5  
ATOM 9959  C CZ2  . TRP B 2 3   ? 8.255   -7.320  -20.131 1.00 4.39 ? 147 TRP B CZ2  5  
ATOM 9960  C CZ3  . TRP B 2 3   ? 7.731   -5.123  -19.278 1.00 4.60 ? 147 TRP B CZ3  5  
ATOM 9961  C CH2  . TRP B 2 3   ? 8.657   -6.094  -19.674 1.00 4.76 ? 147 TRP B CH2  5  
ATOM 9962  H H    . TRP B 2 3   ? 0.942   -5.982  -19.020 1.00 2.51 ? 147 TRP B H    5  
ATOM 9963  H HE1  . TRP B 2 3   ? 6.618   -9.514  -20.925 1.00 3.63 ? 147 TRP B HE1  5  
ATOM 9964  N N    . ILE B 2 4   ? 3.299   -5.113  -16.886 1.00 3.10 ? 148 ILE B N    5  
ATOM 9965  C CA   . ILE B 2 4   ? 4.031   -4.439  -15.822 1.00 3.51 ? 148 ILE B CA   5  
ATOM 9966  C C    . ILE B 2 4   ? 3.720   -5.073  -14.469 1.00 3.20 ? 148 ILE B C    5  
ATOM 9967  O O    . ILE B 2 4   ? 4.631   -5.432  -13.721 1.00 3.08 ? 148 ILE B O    5  
ATOM 9968  C CB   . ILE B 2 4   ? 3.725   -2.928  -15.799 1.00 4.34 ? 148 ILE B CB   5  
ATOM 9969  C CG1  . ILE B 2 4   ? 3.884   -2.354  -17.211 1.00 4.68 ? 148 ILE B CG1  5  
ATOM 9970  C CG2  . ILE B 2 4   ? 4.657   -2.210  -14.830 1.00 4.81 ? 148 ILE B CG2  5  
ATOM 9971  C CD1  . ILE B 2 4   ? 3.499   -0.898  -17.337 1.00 5.45 ? 148 ILE B CD1  5  
ATOM 9972  H H    . ILE B 2 4   ? 2.599   -4.626  -17.364 1.00 3.34 ? 148 ILE B H    5  
ATOM 9973  N N    . ALA B 2 5   ? 2.433   -5.240  -14.173 1.00 3.18 ? 149 ALA B N    5  
ATOM 9974  C CA   . ALA B 2 5   ? 2.003   -5.853  -12.917 1.00 3.15 ? 149 ALA B CA   5  
ATOM 9975  C C    . ALA B 2 5   ? 2.494   -7.296  -12.824 1.00 2.43 ? 149 ALA B C    5  
ATOM 9976  O O    . ALA B 2 5   ? 2.705   -7.820  -11.734 1.00 2.45 ? 149 ALA B O    5  
ATOM 9977  C CB   . ALA B 2 5   ? 0.488   -5.805  -12.794 1.00 3.53 ? 149 ALA B CB   5  
ATOM 9978  H H    . ALA B 2 5   ? 1.750   -4.928  -14.809 1.00 3.30 ? 149 ALA B H    5  
ATOM 9979  N N    . GLN B 2 6   ? 2.669   -7.927  -13.982 1.00 1.86 ? 150 GLN B N    5  
ATOM 9980  C CA   . GLN B 2 6   ? 3.147   -9.304  -14.054 1.00 1.28 ? 150 GLN B CA   5  
ATOM 9981  C C    . GLN B 2 6   ? 4.554   -9.420  -13.472 1.00 1.15 ? 150 GLN B C    5  
ATOM 9982  O O    . GLN B 2 6   ? 4.818   -10.273 -12.625 1.00 0.98 ? 150 GLN B O    5  
ATOM 9983  C CB   . GLN B 2 6   ? 3.133   -9.787  -15.506 1.00 1.05 ? 150 GLN B CB   5  
ATOM 9984  C CG   . GLN B 2 6   ? 3.599   -11.218 -15.699 1.00 1.34 ? 150 GLN B CG   5  
ATOM 9985  C CD   . GLN B 2 6   ? 3.899   -11.530 -17.150 1.00 1.76 ? 150 GLN B CD   5  
ATOM 9986  O OE1  . GLN B 2 6   ? 3.024   -11.967 -17.899 1.00 1.81 ? 150 GLN B OE1  5  
ATOM 9987  N NE2  . GLN B 2 6   ? 5.135   -11.297 -17.559 1.00 2.39 ? 150 GLN B NE2  5  
ATOM 9988  H H    . GLN B 2 6   ? 2.459   -7.453  -14.815 1.00 1.92 ? 150 GLN B H    5  
ATOM 9989  H HE21 . GLN B 2 6   ? 5.780   -10.938 -16.915 1.00 2.51 ? 150 GLN B HE21 5  
ATOM 9990  H HE22 . GLN B 2 6   ? 5.364   -11.503 -18.491 1.00 2.81 ? 150 GLN B HE22 5  
ATOM 9991  N N    . GLU B 2 7   ? 5.454   -8.555  -13.927 1.00 1.59 ? 151 GLU B N    5  
ATOM 9992  C CA   . GLU B 2 7   ? 6.828   -8.556  -13.432 1.00 1.93 ? 151 GLU B CA   5  
ATOM 9993  C C    . GLU B 2 7   ? 6.856   -8.061  -11.987 1.00 2.05 ? 151 GLU B C    5  
ATOM 9994  O O    . GLU B 2 7   ? 7.593   -8.580  -11.150 1.00 1.93 ? 151 GLU B O    5  
ATOM 9995  C CB   . GLU B 2 7   ? 7.723   -7.685  -14.323 1.00 2.71 ? 151 GLU B CB   5  
ATOM 9996  C CG   . GLU B 2 7   ? 9.136   -7.461  -13.794 1.00 3.38 ? 151 GLU B CG   5  
ATOM 9997  C CD   . GLU B 2 7   ? 9.950   -8.739  -13.689 1.00 3.37 ? 151 GLU B CD   5  
ATOM 9998  O OE1  . GLU B 2 7   ? 10.116  -9.429  -14.716 1.00 3.26 ? 151 GLU B OE1  5  
ATOM 9999  O OE2  . GLU B 2 7   ? 10.447  -9.046  -12.584 1.00 3.77 ? 151 GLU B OE2  5  
ATOM 10000 H H    . GLU B 2 7   ? 5.190   -7.902  -14.611 1.00 1.84 ? 151 GLU B H    5  
ATOM 10001 N N    . LEU B 2 8   ? 6.023   -7.070  -11.701 1.00 2.45 ? 152 LEU B N    5  
ATOM 10002 C CA   . LEU B 2 8   ? 5.940   -6.506  -10.362 1.00 2.86 ? 152 LEU B CA   5  
ATOM 10003 C C    . LEU B 2 8   ? 5.431   -7.529  -9.356  1.00 2.48 ? 152 LEU B C    5  
ATOM 10004 O O    . LEU B 2 8   ? 5.832   -7.515  -8.192  1.00 2.62 ? 152 LEU B O    5  
ATOM 10005 C CB   . LEU B 2 8   ? 5.087   -5.244  -10.358 1.00 3.54 ? 152 LEU B CB   5  
ATOM 10006 C CG   . LEU B 2 8   ? 5.788   -3.992  -10.881 1.00 4.02 ? 152 LEU B CG   5  
ATOM 10007 C CD1  . LEU B 2 8   ? 4.782   -3.014  -11.452 1.00 4.62 ? 152 LEU B CD1  5  
ATOM 10008 C CD2  . LEU B 2 8   ? 6.604   -3.339  -9.779  1.00 4.35 ? 152 LEU B CD2  5  
ATOM 10009 H H    . LEU B 2 8   ? 5.455   -6.704  -12.413 1.00 2.58 ? 152 LEU B H    5  
ATOM 10010 N N    . ARG B 2 9   ? 4.558   -8.425  -9.812  1.00 2.13 ? 153 ARG B N    5  
ATOM 10011 C CA   . ARG B 2 9   ? 4.030   -9.479  -8.958  1.00 2.11 ? 153 ARG B CA   5  
ATOM 10012 C C    . ARG B 2 9   ? 5.185   -10.359 -8.499  1.00 1.51 ? 153 ARG B C    5  
ATOM 10013 O O    . ARG B 2 9   ? 5.194   -10.864 -7.377  1.00 1.66 ? 153 ARG B O    5  
ATOM 10014 C CB   . ARG B 2 9   ? 3.003   -10.323 -9.718  1.00 2.28 ? 153 ARG B CB   5  
ATOM 10015 C CG   . ARG B 2 9   ? 2.015   -11.064 -8.827  1.00 2.79 ? 153 ARG B CG   5  
ATOM 10016 C CD   . ARG B 2 9   ? 1.263   -12.131 -9.610  1.00 3.22 ? 153 ARG B CD   5  
ATOM 10017 N NE   . ARG B 2 9   ? -0.087  -12.356 -9.086  1.00 3.39 ? 153 ARG B NE   5  
ATOM 10018 C CZ   . ARG B 2 9   ? -0.771  -13.496 -9.250  1.00 3.88 ? 153 ARG B CZ   5  
ATOM 10019 N NH1  . ARG B 2 9   ? -0.212  -14.528 -9.863  1.00 4.32 ? 153 ARG B NH1  5  
ATOM 10020 N NH2  . ARG B 2 9   ? -2.011  -13.607 -8.794  1.00 4.17 ? 153 ARG B NH2  5  
ATOM 10021 H H    . ARG B 2 9   ? 4.249   -8.362  -10.744 1.00 2.05 ? 153 ARG B H    5  
ATOM 10022 H HE   . ARG B 2 9   ? -0.510  -11.612 -8.602  1.00 3.35 ? 153 ARG B HE   5  
ATOM 10023 H HH11 . ARG B 2 9   ? 0.727   -14.465 -10.206 1.00 4.33 ? 153 ARG B HH11 5  
ATOM 10024 H HH12 . ARG B 2 9   ? -0.728  -15.385 -9.980  1.00 4.80 ? 153 ARG B HH12 5  
ATOM 10025 H HH21 . ARG B 2 9   ? -2.454  -12.842 -8.319  1.00 4.15 ? 153 ARG B HH21 5  
ATOM 10026 H HH22 . ARG B 2 9   ? -2.527  -14.471 -8.929  1.00 4.58 ? 153 ARG B HH22 5  
ATOM 10027 N N    . ARG B 2 10  ? 6.174   -10.511 -9.381  1.00 1.01 ? 154 ARG B N    5  
ATOM 10028 C CA   . ARG B 2 10  ? 7.356   -11.304 -9.082  1.00 0.90 ? 154 ARG B CA   5  
ATOM 10029 C C    . ARG B 2 10  ? 8.229   -10.570 -8.071  1.00 1.04 ? 154 ARG B C    5  
ATOM 10030 O O    . ARG B 2 10  ? 8.800   -11.184 -7.180  1.00 1.02 ? 154 ARG B O    5  
ATOM 10031 C CB   . ARG B 2 10  ? 8.166   -11.586 -10.350 1.00 1.34 ? 154 ARG B CB   5  
ATOM 10032 C CG   . ARG B 2 10  ? 9.308   -12.568 -10.142 1.00 2.01 ? 154 ARG B CG   5  
ATOM 10033 C CD   . ARG B 2 10  ? 10.493  -12.253 -11.041 1.00 2.84 ? 154 ARG B CD   5  
ATOM 10034 N NE   . ARG B 2 10  ? 11.055  -10.928 -10.769 1.00 3.10 ? 154 ARG B NE   5  
ATOM 10035 C CZ   . ARG B 2 10  ? 11.856  -10.650 -9.737  1.00 3.57 ? 154 ARG B CZ   5  
ATOM 10036 N NH1  . ARG B 2 10  ? 12.193  -11.596 -8.868  1.00 3.71 ? 154 ARG B NH1  5  
ATOM 10037 N NH2  . ARG B 2 10  ? 12.321  -9.422  -9.564  1.00 4.07 ? 154 ARG B NH2  5  
ATOM 10038 H H    . ARG B 2 10  ? 6.103   -10.072 -10.257 1.00 1.06 ? 154 ARG B H    5  
ATOM 10039 H HE   . ARG B 2 10  ? 10.819  -10.196 -11.406 1.00 3.07 ? 154 ARG B HE   5  
ATOM 10040 H HH11 . ARG B 2 10  ? 11.851  -12.529 -8.977  1.00 3.54 ? 154 ARG B HH11 5  
ATOM 10041 H HH12 . ARG B 2 10  ? 12.794  -11.374 -8.091  1.00 4.08 ? 154 ARG B HH12 5  
ATOM 10042 H HH21 . ARG B 2 10  ? 12.075  -8.691  -10.207 1.00 4.11 ? 154 ARG B HH21 5  
ATOM 10043 H HH22 . ARG B 2 10  ? 12.926  -9.221  -8.780  1.00 4.49 ? 154 ARG B HH22 5  
ATOM 10044 N N    . ILE B 2 11  ? 8.320   -9.251  -8.210  1.00 1.56 ? 155 ILE B N    5  
ATOM 10045 C CA   . ILE B 2 11  ? 9.111   -8.444  -7.291  1.00 2.08 ? 155 ILE B CA   5  
ATOM 10046 C C    . ILE B 2 11  ? 8.479   -8.481  -5.901  1.00 2.01 ? 155 ILE B C    5  
ATOM 10047 O O    . ILE B 2 11  ? 9.172   -8.540  -4.884  1.00 2.10 ? 155 ILE B O    5  
ATOM 10048 C CB   . ILE B 2 11  ? 9.239   -6.981  -7.769  1.00 2.96 ? 155 ILE B CB   5  
ATOM 10049 C CG1  . ILE B 2 11  ? 9.726   -6.937  -9.221  1.00 3.16 ? 155 ILE B CG1  5  
ATOM 10050 C CG2  . ILE B 2 11  ? 10.191  -6.208  -6.867  1.00 3.62 ? 155 ILE B CG2  5  
ATOM 10051 C CD1  . ILE B 2 11  ? 9.682   -5.557  -9.843  1.00 3.96 ? 155 ILE B CD1  5  
ATOM 10052 H H    . ILE B 2 11  ? 7.846   -8.813  -8.950  1.00 1.71 ? 155 ILE B H    5  
ATOM 10053 N N    . GLY B 2 12  ? 7.151   -8.468  -5.868  1.00 2.07 ? 156 GLY B N    5  
ATOM 10054 C CA   . GLY B 2 12  ? 6.439   -8.531  -4.609  1.00 2.48 ? 156 GLY B CA   5  
ATOM 10055 C C    . GLY B 2 12  ? 6.574   -9.902  -3.977  1.00 2.14 ? 156 GLY B C    5  
ATOM 10056 O O    . GLY B 2 12  ? 6.482   -10.052 -2.761  1.00 2.57 ? 156 GLY B O    5  
ATOM 10057 H H    . GLY B 2 12  ? 6.650   -8.402  -6.710  1.00 2.00 ? 156 GLY B H    5  
ATOM 10058 N N    . ASP B 2 13  ? 6.786   -10.907 -4.816  1.00 1.53 ? 157 ASP B N    5  
ATOM 10059 C CA   . ASP B 2 13  ? 6.958   -12.280 -4.348  1.00 1.56 ? 157 ASP B CA   5  
ATOM 10060 C C    . ASP B 2 13  ? 8.414   -12.514 -3.970  1.00 1.01 ? 157 ASP B C    5  
ATOM 10061 O O    . ASP B 2 13  ? 8.723   -13.338 -3.111  1.00 1.21 ? 157 ASP B O    5  
ATOM 10062 C CB   . ASP B 2 13  ? 6.534   -13.271 -5.433  1.00 1.82 ? 157 ASP B CB   5  
ATOM 10063 C CG   . ASP B 2 13  ? 5.892   -14.520 -4.868  1.00 2.23 ? 157 ASP B CG   5  
ATOM 10064 O OD1  . ASP B 2 13  ? 4.818   -14.409 -4.240  1.00 2.73 ? 157 ASP B OD1  5  
ATOM 10065 O OD2  . ASP B 2 13  ? 6.444   -15.622 -5.066  1.00 2.40 ? 157 ASP B OD2  5  
ATOM 10066 H H    . ASP B 2 13  ? 6.813   -10.725 -5.779  1.00 1.27 ? 157 ASP B H    5  
ATOM 10067 N N    . GLU B 2 14  ? 9.294   -11.767 -4.625  1.00 0.71 ? 158 GLU B N    5  
ATOM 10068 C CA   . GLU B 2 14  ? 10.732  -11.829 -4.399  1.00 1.05 ? 158 GLU B CA   5  
ATOM 10069 C C    . GLU B 2 14  ? 11.046  -11.588 -2.926  1.00 1.29 ? 158 GLU B C    5  
ATOM 10070 O O    . GLU B 2 14  ? 11.718  -12.394 -2.277  1.00 1.29 ? 158 GLU B O    5  
ATOM 10071 C CB   . GLU B 2 14  ? 11.403  -10.760 -5.268  1.00 1.84 ? 158 GLU B CB   5  
ATOM 10072 C CG   . GLU B 2 14  ? 12.914  -10.685 -5.174  1.00 2.74 ? 158 GLU B CG   5  
ATOM 10073 C CD   . GLU B 2 14  ? 13.474  -9.574  -6.035  1.00 3.59 ? 158 GLU B CD   5  
ATOM 10074 O OE1  . GLU B 2 14  ? 13.653  -9.787  -7.251  1.00 3.85 ? 158 GLU B OE1  5  
ATOM 10075 O OE2  . GLU B 2 14  ? 13.732  -8.476  -5.506  1.00 4.27 ? 158 GLU B OE2  5  
ATOM 10076 H H    . GLU B 2 14  ? 8.960   -11.150 -5.313  1.00 0.77 ? 158 GLU B H    5  
ATOM 10077 N N    . PHE B 2 15  ? 10.537  -10.480 -2.401  1.00 1.81 ? 159 PHE B N    5  
ATOM 10078 C CA   . PHE B 2 15  ? 10.743  -10.134 -1.001  1.00 2.48 ? 159 PHE B CA   5  
ATOM 10079 C C    . PHE B 2 15  ? 9.881   -11.017 -0.109  1.00 2.47 ? 159 PHE B C    5  
ATOM 10080 O O    . PHE B 2 15  ? 10.276  -11.383 1.001   1.00 2.90 ? 159 PHE B O    5  
ATOM 10081 C CB   . PHE B 2 15  ? 10.413  -8.661  -0.757  1.00 3.29 ? 159 PHE B CB   5  
ATOM 10082 C CG   . PHE B 2 15  ? 11.546  -7.733  -1.078  1.00 3.63 ? 159 PHE B CG   5  
ATOM 10083 C CD1  . PHE B 2 15  ? 11.863  -7.433  -2.389  1.00 3.87 ? 159 PHE B CD1  5  
ATOM 10084 C CD2  . PHE B 2 15  ? 12.300  -7.169  -0.063  1.00 4.07 ? 159 PHE B CD2  5  
ATOM 10085 C CE1  . PHE B 2 15  ? 12.914  -6.588  -2.684  1.00 4.37 ? 159 PHE B CE1  5  
ATOM 10086 C CE2  . PHE B 2 15  ? 13.350  -6.321  -0.349  1.00 4.53 ? 159 PHE B CE2  5  
ATOM 10087 C CZ   . PHE B 2 15  ? 13.658  -6.031  -1.662  1.00 4.61 ? 159 PHE B CZ   5  
ATOM 10088 H H    . PHE B 2 15  ? 10.015  -9.879  -2.972  1.00 1.86 ? 159 PHE B H    5  
ATOM 10089 N N    . ASN B 2 16  ? 8.711   -11.379 -0.622  1.00 2.24 ? 160 ASN B N    5  
ATOM 10090 C CA   . ASN B 2 16  ? 7.768   -12.213 0.115   1.00 2.65 ? 160 ASN B CA   5  
ATOM 10091 C C    . ASN B 2 16  ? 8.370   -13.564 0.471   1.00 2.24 ? 160 ASN B C    5  
ATOM 10092 O O    . ASN B 2 16  ? 8.297   -13.997 1.615   1.00 2.59 ? 160 ASN B O    5  
ATOM 10093 C CB   . ASN B 2 16  ? 6.470   -12.401 -0.675  1.00 2.97 ? 160 ASN B CB   5  
ATOM 10094 C CG   . ASN B 2 16  ? 5.449   -13.260 0.049   1.00 3.76 ? 160 ASN B CG   5  
ATOM 10095 O OD1  . ASN B 2 16  ? 4.695   -12.773 0.891   1.00 4.03 ? 160 ASN B OD1  5  
ATOM 10096 N ND2  . ASN B 2 16  ? 5.407   -14.543 -0.285  1.00 4.32 ? 160 ASN B ND2  5  
ATOM 10097 H H    . ASN B 2 16  ? 8.475   -11.077 -1.523  1.00 1.99 ? 160 ASN B H    5  
ATOM 10098 H HD21 . ASN B 2 16  ? 6.028   -14.867 -0.974  1.00 4.25 ? 160 ASN B HD21 5  
ATOM 10099 H HD22 . ASN B 2 16  ? 4.764   -15.120 0.177   1.00 4.87 ? 160 ASN B HD22 5  
ATOM 10100 N N    . ALA B 2 17  ? 8.995   -14.200 -0.508  1.00 1.59 ? 161 ALA B N    5  
ATOM 10101 C CA   . ALA B 2 17  ? 9.604   -15.511 -0.315  1.00 1.42 ? 161 ALA B CA   5  
ATOM 10102 C C    . ALA B 2 17  ? 10.942  -15.426 0.414   1.00 1.04 ? 161 ALA B C    5  
ATOM 10103 O O    . ALA B 2 17  ? 11.595  -16.444 0.653   1.00 1.12 ? 161 ALA B O    5  
ATOM 10104 C CB   . ALA B 2 17  ? 9.779   -16.210 -1.654  1.00 1.66 ? 161 ALA B CB   5  
ATOM 10105 H H    . ALA B 2 17  ? 9.049   -13.776 -1.393  1.00 1.37 ? 161 ALA B H    5  
ATOM 10106 N N    . TYR B 2 18  ? 11.358  -14.217 0.758   1.00 1.36 ? 162 TYR B N    5  
ATOM 10107 C CA   . TYR B 2 18  ? 12.620  -14.035 1.460   1.00 1.82 ? 162 TYR B CA   5  
ATOM 10108 C C    . TYR B 2 18  ? 12.388  -13.785 2.945   1.00 2.42 ? 162 TYR B C    5  
ATOM 10109 O O    . TYR B 2 18  ? 13.084  -14.342 3.791   1.00 2.52 ? 162 TYR B O    5  
ATOM 10110 C CB   . TYR B 2 18  ? 13.431  -12.885 0.848   1.00 2.45 ? 162 TYR B CB   5  
ATOM 10111 C CG   . TYR B 2 18  ? 14.807  -12.709 1.459   1.00 3.23 ? 162 TYR B CG   5  
ATOM 10112 C CD1  . TYR B 2 18  ? 15.871  -13.516 1.075   1.00 3.36 ? 162 TYR B CD1  5  
ATOM 10113 C CD2  . TYR B 2 18  ? 15.042  -11.736 2.422   1.00 4.05 ? 162 TYR B CD2  5  
ATOM 10114 C CE1  . TYR B 2 18  ? 17.128  -13.357 1.632   1.00 4.18 ? 162 TYR B CE1  5  
ATOM 10115 C CE2  . TYR B 2 18  ? 16.293  -11.569 2.984   1.00 4.79 ? 162 TYR B CE2  5  
ATOM 10116 C CZ   . TYR B 2 18  ? 17.334  -12.382 2.588   1.00 4.82 ? 162 TYR B CZ   5  
ATOM 10117 O OH   . TYR B 2 18  ? 18.584  -12.219 3.145   1.00 5.64 ? 162 TYR B OH   5  
ATOM 10118 H H    . TYR B 2 18  ? 10.805  -13.436 0.541   1.00 1.62 ? 162 TYR B H    5  
ATOM 10119 H HH   . TYR B 2 18  ? 18.504  -12.165 4.109   1.00 5.90 ? 162 TYR B HH   5  
ATOM 10120 N N    . TYR B 2 19  ? 11.401  -12.958 3.252   1.00 3.05 ? 163 TYR B N    5  
ATOM 10121 C CA   . TYR B 2 19  ? 11.089  -12.615 4.637   1.00 3.89 ? 163 TYR B CA   5  
ATOM 10122 C C    . TYR B 2 19  ? 9.949   -13.457 5.203   1.00 4.14 ? 163 TYR B C    5  
ATOM 10123 O O    . TYR B 2 19  ? 9.540   -13.260 6.348   1.00 4.36 ? 163 TYR B O    5  
ATOM 10124 C CB   . TYR B 2 19  ? 10.759  -11.123 4.766   1.00 4.80 ? 163 TYR B CB   5  
ATOM 10125 C CG   . TYR B 2 19  ? 11.916  -10.201 4.451   1.00 5.20 ? 163 TYR B CG   5  
ATOM 10126 C CD1  . TYR B 2 19  ? 12.827  -9.837  5.434   1.00 5.67 ? 163 TYR B CD1  5  
ATOM 10127 C CD2  . TYR B 2 19  ? 12.100  -9.697  3.170   1.00 5.29 ? 163 TYR B CD2  5  
ATOM 10128 C CE1  . TYR B 2 19  ? 13.885  -8.996  5.151   1.00 6.11 ? 163 TYR B CE1  5  
ATOM 10129 C CE2  . TYR B 2 19  ? 13.157  -8.859  2.876   1.00 5.82 ? 163 TYR B CE2  5  
ATOM 10130 C CZ   . TYR B 2 19  ? 14.046  -8.510  3.870   1.00 6.18 ? 163 TYR B CZ   5  
ATOM 10131 O OH   . TYR B 2 19  ? 15.103  -7.680  3.581   1.00 6.75 ? 163 TYR B OH   5  
ATOM 10132 H H    . TYR B 2 19  ? 10.869  -12.563 2.530   1.00 3.03 ? 163 TYR B H    5  
ATOM 10133 H HH   . TYR B 2 19  ? 14.790  -6.925  3.077   1.00 7.02 ? 163 TYR B HH   5  
ATOM 10134 N N    . ALA B 2 20  ? 9.440   -14.390 4.408   1.00 4.36 ? 164 ALA B N    5  
ATOM 10135 C CA   . ALA B 2 20  ? 8.347   -15.250 4.842   1.00 4.99 ? 164 ALA B CA   5  
ATOM 10136 C C    . ALA B 2 20  ? 8.411   -16.586 4.114   1.00 5.11 ? 164 ALA B C    5  
ATOM 10137 O O    . ALA B 2 20  ? 9.182   -16.687 3.139   1.00 5.31 ? 164 ALA B O    5  
ATOM 10138 C CB   . ALA B 2 20  ? 7.004   -14.572 4.598   1.00 5.92 ? 164 ALA B CB   5  
ATOM 10139 O OXT  . ALA B 2 20  ? 7.691   -17.529 4.518   1.00 5.35 ? 164 ALA B OXT  5  
ATOM 10140 H H    . ALA B 2 20  ? 9.812   -14.520 3.511   1.00 4.24 ? 164 ALA B H    5  
ATOM 10141 N N    . MET A 1 1   ? 39.869  1.216   -3.079  1.00 1.33 ? 1   MET A N    6  
ATOM 10142 C CA   . MET A 1 1   ? 40.317  2.605   -2.820  1.00 1.17 ? 1   MET A CA   6  
ATOM 10143 C C    . MET A 1 1   ? 39.137  3.574   -2.756  1.00 1.10 ? 1   MET A C    6  
ATOM 10144 O O    . MET A 1 1   ? 39.122  4.483   -1.927  1.00 1.14 ? 1   MET A O    6  
ATOM 10145 C CB   . MET A 1 1   ? 41.317  3.061   -3.888  1.00 1.33 ? 1   MET A CB   6  
ATOM 10146 C CG   . MET A 1 1   ? 41.827  4.486   -3.704  1.00 1.59 ? 1   MET A CG   6  
ATOM 10147 S SD   . MET A 1 1   ? 42.719  5.104   -5.147  1.00 1.94 ? 1   MET A SD   6  
ATOM 10148 C CE   . MET A 1 1   ? 41.442  5.013   -6.399  1.00 2.23 ? 1   MET A CE   6  
ATOM 10149 H H1   . MET A 1 1   ? 40.661  0.556   -2.947  1.00 1.41 ? 1   MET A H1   6  
ATOM 10150 H H2   . MET A 1 1   ? 39.518  1.122   -4.054  1.00 1.51 ? 1   MET A H2   6  
ATOM 10151 H H3   . MET A 1 1   ? 39.106  0.958   -2.424  1.00 1.44 ? 1   MET A H3   6  
ATOM 10152 N N    . ASP A 1 2   ? 38.142  3.369   -3.616  1.00 1.05 ? 2   ASP A N    6  
ATOM 10153 C CA   . ASP A 1 2   ? 36.971  4.248   -3.665  1.00 1.04 ? 2   ASP A CA   6  
ATOM 10154 C C    . ASP A 1 2   ? 36.235  4.320   -2.327  1.00 1.05 ? 2   ASP A C    6  
ATOM 10155 O O    . ASP A 1 2   ? 35.717  5.371   -1.954  1.00 1.09 ? 2   ASP A O    6  
ATOM 10156 C CB   . ASP A 1 2   ? 36.023  3.865   -4.811  1.00 1.07 ? 2   ASP A CB   6  
ATOM 10157 C CG   . ASP A 1 2   ? 34.997  2.815   -4.432  1.00 1.10 ? 2   ASP A CG   6  
ATOM 10158 O OD1  . ASP A 1 2   ? 35.390  1.670   -4.114  1.00 1.21 ? 2   ASP A OD1  6  
ATOM 10159 O OD2  . ASP A 1 2   ? 33.788  3.126   -4.459  1.00 1.29 ? 2   ASP A OD2  6  
ATOM 10160 H H    . ASP A 1 2   ? 38.193  2.609   -4.236  1.00 1.07 ? 2   ASP A H    6  
ATOM 10161 N N    . GLY A 1 3   ? 36.228  3.215   -1.589  1.00 1.07 ? 3   GLY A N    6  
ATOM 10162 C CA   . GLY A 1 3   ? 35.558  3.187   -0.303  1.00 1.14 ? 3   GLY A CA   6  
ATOM 10163 C C    . GLY A 1 3   ? 36.387  3.824   0.800   1.00 1.16 ? 3   GLY A C    6  
ATOM 10164 O O    . GLY A 1 3   ? 35.942  3.931   1.942   1.00 1.23 ? 3   GLY A O    6  
ATOM 10165 H H    . GLY A 1 3   ? 36.674  2.408   -1.925  1.00 1.07 ? 3   GLY A H    6  
ATOM 10166 N N    . SER A 1 4   ? 37.597  4.246   0.460   1.00 1.16 ? 4   SER A N    6  
ATOM 10167 C CA   . SER A 1 4   ? 38.488  4.872   1.425   1.00 1.23 ? 4   SER A CA   6  
ATOM 10168 C C    . SER A 1 4   ? 38.836  6.299   1.003   1.00 1.23 ? 4   SER A C    6  
ATOM 10169 O O    . SER A 1 4   ? 39.653  6.967   1.639   1.00 1.35 ? 4   SER A O    6  
ATOM 10170 C CB   . SER A 1 4   ? 39.759  4.035   1.571   1.00 1.34 ? 4   SER A CB   6  
ATOM 10171 O OG   . SER A 1 4   ? 39.455  2.650   1.635   1.00 1.40 ? 4   SER A OG   6  
ATOM 10172 H H    . SER A 1 4   ? 37.899  4.134   -0.469  1.00 1.14 ? 4   SER A H    6  
ATOM 10173 H HG   . SER A 1 4   ? 38.497  2.530   1.637   1.00 1.44 ? 4   SER A HG   6  
ATOM 10174 N N    . GLY A 1 5   ? 38.204  6.759   -0.068  1.00 1.19 ? 5   GLY A N    6  
ATOM 10175 C CA   . GLY A 1 5   ? 38.459  8.097   -0.558  1.00 1.24 ? 5   GLY A CA   6  
ATOM 10176 C C    . GLY A 1 5   ? 37.396  9.079   -0.114  1.00 1.22 ? 5   GLY A C    6  
ATOM 10177 O O    . GLY A 1 5   ? 36.961  9.051   1.038   1.00 1.30 ? 5   GLY A O    6  
ATOM 10178 H H    . GLY A 1 5   ? 37.553  6.187   -0.525  1.00 1.17 ? 5   GLY A H    6  
ATOM 10179 N N    . GLU A 1 6   ? 36.974  9.938   -1.032  1.00 1.26 ? 6   GLU A N    6  
ATOM 10180 C CA   . GLU A 1 6   ? 35.952  10.937  -0.743  1.00 1.28 ? 6   GLU A CA   6  
ATOM 10181 C C    . GLU A 1 6   ? 34.599  10.283  -0.488  1.00 1.22 ? 6   GLU A C    6  
ATOM 10182 O O    . GLU A 1 6   ? 34.018  9.655   -1.377  1.00 1.34 ? 6   GLU A O    6  
ATOM 10183 C CB   . GLU A 1 6   ? 35.839  11.943  -1.888  1.00 1.49 ? 6   GLU A CB   6  
ATOM 10184 C CG   . GLU A 1 6   ? 36.952  12.979  -1.924  1.00 1.57 ? 6   GLU A CG   6  
ATOM 10185 C CD   . GLU A 1 6   ? 36.917  13.919  -0.736  1.00 1.62 ? 6   GLU A CD   6  
ATOM 10186 O OE1  . GLU A 1 6   ? 35.810  14.279  -0.284  1.00 1.87 ? 6   GLU A OE1  6  
ATOM 10187 O OE2  . GLU A 1 6   ? 37.998  14.307  -0.247  1.00 2.00 ? 6   GLU A OE2  6  
ATOM 10188 H H    . GLU A 1 6   ? 37.358  9.898   -1.930  1.00 1.37 ? 6   GLU A H    6  
ATOM 10189 N N    . GLN A 1 7   ? 34.108  10.428  0.729   1.00 1.15 ? 7   GLN A N    6  
ATOM 10190 C CA   . GLN A 1 7   ? 32.830  9.861   1.108   1.00 1.12 ? 7   GLN A CA   6  
ATOM 10191 C C    . GLN A 1 7   ? 32.061  10.830  1.996   1.00 1.11 ? 7   GLN A C    6  
ATOM 10192 O O    . GLN A 1 7   ? 32.445  11.075  3.144   1.00 1.15 ? 7   GLN A O    6  
ATOM 10193 C CB   . GLN A 1 7   ? 33.026  8.523   1.826   1.00 1.12 ? 7   GLN A CB   6  
ATOM 10194 C CG   . GLN A 1 7   ? 31.745  7.727   2.026   1.00 1.27 ? 7   GLN A CG   6  
ATOM 10195 C CD   . GLN A 1 7   ? 32.013  6.308   2.486   1.00 1.35 ? 7   GLN A CD   6  
ATOM 10196 O OE1  . GLN A 1 7   ? 32.984  6.043   3.193   1.00 1.63 ? 7   GLN A OE1  6  
ATOM 10197 N NE2  . GLN A 1 7   ? 31.159  5.384   2.083   1.00 1.60 ? 7   GLN A NE2  6  
ATOM 10198 H H    . GLN A 1 7   ? 34.620  10.932  1.395   1.00 1.20 ? 7   GLN A H    6  
ATOM 10199 H HE21 . GLN A 1 7   ? 30.406  5.661   1.519   1.00 1.78 ? 7   GLN A HE21 6  
ATOM 10200 H HE22 . GLN A 1 7   ? 31.314  4.453   2.359   1.00 1.81 ? 7   GLN A HE22 6  
ATOM 10201 N N    . PRO A 1 8   ? 30.972  11.407  1.472   1.00 1.13 ? 8   PRO A N    6  
ATOM 10202 C CA   . PRO A 1 8   ? 30.138  12.349  2.219   1.00 1.17 ? 8   PRO A CA   6  
ATOM 10203 C C    . PRO A 1 8   ? 29.186  11.618  3.165   1.00 1.11 ? 8   PRO A C    6  
ATOM 10204 O O    . PRO A 1 8   ? 27.965  11.744  3.051   1.00 1.12 ? 8   PRO A O    6  
ATOM 10205 C CB   . PRO A 1 8   ? 29.349  13.054  1.114   1.00 1.26 ? 8   PRO A CB   6  
ATOM 10206 C CG   . PRO A 1 8   ? 29.224  12.033  0.035   1.00 1.27 ? 8   PRO A CG   6  
ATOM 10207 C CD   . PRO A 1 8   ? 30.471  11.190  0.099   1.00 1.18 ? 8   PRO A CD   6  
ATOM 10208 N N    . ARG A 1 9   ? 29.767  10.853  4.091   1.00 1.09 ? 9   ARG A N    6  
ATOM 10209 C CA   . ARG A 1 9   ? 29.007  10.074  5.068   1.00 1.07 ? 9   ARG A CA   6  
ATOM 10210 C C    . ARG A 1 9   ? 28.300  8.891   4.407   1.00 1.00 ? 9   ARG A C    6  
ATOM 10211 O O    . ARG A 1 9   ? 28.668  7.734   4.617   1.00 1.16 ? 9   ARG A O    6  
ATOM 10212 C CB   . ARG A 1 9   ? 28.016  10.955  5.840   1.00 1.15 ? 9   ARG A CB   6  
ATOM 10213 C CG   . ARG A 1 9   ? 27.176  10.217  6.866   1.00 1.28 ? 9   ARG A CG   6  
ATOM 10214 C CD   . ARG A 1 9   ? 26.159  11.147  7.506   1.00 1.41 ? 9   ARG A CD   6  
ATOM 10215 N NE   . ARG A 1 9   ? 25.214  11.689  6.524   1.00 1.46 ? 9   ARG A NE   6  
ATOM 10216 C CZ   . ARG A 1 9   ? 24.438  12.749  6.737   1.00 1.62 ? 9   ARG A CZ   6  
ATOM 10217 N NH1  . ARG A 1 9   ? 24.502  13.400  7.891   1.00 1.92 ? 9   ARG A NH1  6  
ATOM 10218 N NH2  . ARG A 1 9   ? 23.600  13.159  5.791   1.00 1.99 ? 9   ARG A NH2  6  
ATOM 10219 H H    . ARG A 1 9   ? 30.748  10.815  4.120   1.00 1.13 ? 9   ARG A H    6  
ATOM 10220 H HE   . ARG A 1 9   ? 25.156  11.228  5.653   1.00 1.78 ? 9   ARG A HE   6  
ATOM 10221 H HH11 . ARG A 1 9   ? 25.137  13.099  8.603   1.00 2.02 ? 9   ARG A HH11 6  
ATOM 10222 H HH12 . ARG A 1 9   ? 23.907  14.191  8.063   1.00 2.32 ? 9   ARG A HH12 6  
ATOM 10223 H HH21 . ARG A 1 9   ? 23.549  12.667  4.914   1.00 2.25 ? 9   ARG A HH21 6  
ATOM 10224 H HH22 . ARG A 1 9   ? 23.019  13.963  5.941   1.00 2.24 ? 9   ARG A HH22 6  
ATOM 10225 N N    . GLY A 1 10  ? 27.306  9.188   3.591   1.00 0.97 ? 10  GLY A N    6  
ATOM 10226 C CA   . GLY A 1 10  ? 26.565  8.148   2.916   1.00 0.99 ? 10  GLY A CA   6  
ATOM 10227 C C    . GLY A 1 10  ? 26.421  8.420   1.437   1.00 0.97 ? 10  GLY A C    6  
ATOM 10228 O O    . GLY A 1 10  ? 25.784  9.398   1.038   1.00 1.29 ? 10  GLY A O    6  
ATOM 10229 H H    . GLY A 1 10  ? 27.084  10.134  3.427   1.00 1.08 ? 10  GLY A H    6  
ATOM 10230 N N    . GLY A 1 11  ? 27.014  7.560   0.624   1.00 0.95 ? 11  GLY A N    6  
ATOM 10231 C CA   . GLY A 1 11  ? 26.932  7.721   -0.815  1.00 0.94 ? 11  GLY A CA   6  
ATOM 10232 C C    . GLY A 1 11  ? 25.571  7.310   -1.339  1.00 0.92 ? 11  GLY A C    6  
ATOM 10233 O O    . GLY A 1 11  ? 24.912  6.453   -0.748  1.00 1.14 ? 11  GLY A O    6  
ATOM 10234 H H    . GLY A 1 11  ? 27.502  6.797   1.004   1.00 1.17 ? 11  GLY A H    6  
ATOM 10235 N N    . GLY A 1 12  ? 25.141  7.924   -2.434  1.00 0.92 ? 12  GLY A N    6  
ATOM 10236 C CA   . GLY A 1 12  ? 23.851  7.601   -3.003  1.00 0.92 ? 12  GLY A CA   6  
ATOM 10237 C C    . GLY A 1 12  ? 23.973  6.710   -4.217  1.00 0.84 ? 12  GLY A C    6  
ATOM 10238 O O    . GLY A 1 12  ? 24.451  7.150   -5.259  1.00 0.92 ? 12  GLY A O    6  
ATOM 10239 H H    . GLY A 1 12  ? 25.708  8.599   -2.866  1.00 1.07 ? 12  GLY A H    6  
ATOM 10240 N N    . PRO A 1 13  ? 23.556  5.442   -4.111  1.00 0.80 ? 13  PRO A N    6  
ATOM 10241 C CA   . PRO A 1 13  ? 23.619  4.494   -5.219  1.00 0.83 ? 13  PRO A CA   6  
ATOM 10242 C C    . PRO A 1 13  ? 22.368  4.580   -6.096  1.00 0.79 ? 13  PRO A C    6  
ATOM 10243 O O    . PRO A 1 13  ? 21.619  5.561   -6.030  1.00 0.91 ? 13  PRO A O    6  
ATOM 10244 C CB   . PRO A 1 13  ? 23.659  3.152   -4.489  1.00 0.94 ? 13  PRO A CB   6  
ATOM 10245 C CG   . PRO A 1 13  ? 22.847  3.372   -3.257  1.00 1.01 ? 13  PRO A CG   6  
ATOM 10246 C CD   . PRO A 1 13  ? 22.996  4.826   -2.893  1.00 0.87 ? 13  PRO A CD   6  
ATOM 10247 N N    . THR A 1 14  ? 22.154  3.561   -6.921  1.00 0.77 ? 14  THR A N    6  
ATOM 10248 C CA   . THR A 1 14  ? 20.988  3.522   -7.792  1.00 0.75 ? 14  THR A CA   6  
ATOM 10249 C C    . THR A 1 14  ? 19.699  3.417   -6.967  1.00 0.73 ? 14  THR A C    6  
ATOM 10250 O O    . THR A 1 14  ? 19.357  2.360   -6.437  1.00 0.98 ? 14  THR A O    6  
ATOM 10251 C CB   . THR A 1 14  ? 21.081  2.388   -8.845  1.00 0.85 ? 14  THR A CB   6  
ATOM 10252 O OG1  . THR A 1 14  ? 19.853  2.285   -9.581  1.00 0.86 ? 14  THR A OG1  6  
ATOM 10253 C CG2  . THR A 1 14  ? 21.421  1.045   -8.211  1.00 0.95 ? 14  THR A CG2  6  
ATOM 10254 H H    . THR A 1 14  ? 22.800  2.822   -6.950  1.00 0.89 ? 14  THR A H    6  
ATOM 10255 H HG1  . THR A 1 14  ? 19.927  2.798   -10.399 1.00 1.00 ? 14  THR A HG1  6  
ATOM 10256 N N    . SER A 1 15  ? 18.997  4.533   -6.847  1.00 0.62 ? 15  SER A N    6  
ATOM 10257 C CA   . SER A 1 15  ? 17.768  4.587   -6.073  1.00 0.65 ? 15  SER A CA   6  
ATOM 10258 C C    . SER A 1 15  ? 16.552  4.205   -6.911  1.00 0.60 ? 15  SER A C    6  
ATOM 10259 O O    . SER A 1 15  ? 15.473  3.955   -6.371  1.00 0.60 ? 15  SER A O    6  
ATOM 10260 C CB   . SER A 1 15  ? 17.599  5.996   -5.510  1.00 0.80 ? 15  SER A CB   6  
ATOM 10261 O OG   . SER A 1 15  ? 18.802  6.735   -5.675  1.00 0.99 ? 15  SER A OG   6  
ATOM 10262 H H    . SER A 1 15  ? 19.323  5.351   -7.278  1.00 0.69 ? 15  SER A H    6  
ATOM 10263 H HG   . SER A 1 15  ? 19.535  6.238   -5.289  1.00 0.99 ? 15  SER A HG   6  
ATOM 10264 N N    . SER A 1 16  ? 16.748  4.141   -8.225  1.00 0.61 ? 16  SER A N    6  
ATOM 10265 C CA   . SER A 1 16  ? 15.683  3.811   -9.165  1.00 0.62 ? 16  SER A CA   6  
ATOM 10266 C C    . SER A 1 16  ? 14.946  2.523   -8.791  1.00 0.55 ? 16  SER A C    6  
ATOM 10267 O O    . SER A 1 16  ? 13.762  2.554   -8.449  1.00 0.61 ? 16  SER A O    6  
ATOM 10268 C CB   . SER A 1 16  ? 16.275  3.705   -10.570 1.00 0.68 ? 16  SER A CB   6  
ATOM 10269 O OG   . SER A 1 16  ? 17.442  4.513   -10.673 1.00 0.85 ? 16  SER A OG   6  
ATOM 10270 H H    . SER A 1 16  ? 17.644  4.319   -8.581  1.00 0.66 ? 16  SER A H    6  
ATOM 10271 H HG   . SER A 1 16  ? 17.252  5.280   -11.232 1.00 1.04 ? 16  SER A HG   6  
ATOM 10272 N N    . GLU A 1 17  ? 15.646  1.396   -8.840  1.00 0.50 ? 17  GLU A N    6  
ATOM 10273 C CA   . GLU A 1 17  ? 15.036  0.116   -8.508  1.00 0.49 ? 17  GLU A CA   6  
ATOM 10274 C C    . GLU A 1 17  ? 14.926  -0.062  -6.996  1.00 0.49 ? 17  GLU A C    6  
ATOM 10275 O O    . GLU A 1 17  ? 14.056  -0.785  -6.510  1.00 0.51 ? 17  GLU A O    6  
ATOM 10276 C CB   . GLU A 1 17  ? 15.822  -1.037  -9.134  1.00 0.55 ? 17  GLU A CB   6  
ATOM 10277 C CG   . GLU A 1 17  ? 14.985  -2.267  -9.447  1.00 0.75 ? 17  GLU A CG   6  
ATOM 10278 C CD   . GLU A 1 17  ? 13.788  -1.952  -10.321 1.00 0.97 ? 17  GLU A CD   6  
ATOM 10279 O OE1  . GLU A 1 17  ? 13.981  -1.567  -11.495 1.00 1.23 ? 17  GLU A OE1  6  
ATOM 10280 O OE2  . GLU A 1 17  ? 12.647  -2.085  -9.838  1.00 1.11 ? 17  GLU A OE2  6  
ATOM 10281 H H    . GLU A 1 17  ? 16.588  1.424   -9.112  1.00 0.53 ? 17  GLU A H    6  
ATOM 10282 N N    . GLN A 1 18  ? 15.804  0.615   -6.258  1.00 0.52 ? 18  GLN A N    6  
ATOM 10283 C CA   . GLN A 1 18  ? 15.811  0.533   -4.797  1.00 0.58 ? 18  GLN A CA   6  
ATOM 10284 C C    . GLN A 1 18  ? 14.465  0.948   -4.204  1.00 0.60 ? 18  GLN A C    6  
ATOM 10285 O O    . GLN A 1 18  ? 13.889  0.224   -3.388  1.00 0.64 ? 18  GLN A O    6  
ATOM 10286 C CB   . GLN A 1 18  ? 16.943  1.379   -4.207  1.00 0.68 ? 18  GLN A CB   6  
ATOM 10287 C CG   . GLN A 1 18  ? 16.835  1.607   -2.705  1.00 0.82 ? 18  GLN A CG   6  
ATOM 10288 C CD   . GLN A 1 18  ? 16.579  3.059   -2.352  1.00 0.96 ? 18  GLN A CD   6  
ATOM 10289 O OE1  . GLN A 1 18  ? 17.149  3.968   -2.955  1.00 1.27 ? 18  GLN A OE1  6  
ATOM 10290 N NE2  . GLN A 1 18  ? 15.700  3.287   -1.390  1.00 1.14 ? 18  GLN A NE2  6  
ATOM 10291 H H    . GLN A 1 18  ? 16.464  1.183   -6.706  1.00 0.53 ? 18  GLN A H    6  
ATOM 10292 H HE21 . GLN A 1 18  ? 15.268  2.516   -0.967  1.00 1.15 ? 18  GLN A HE21 6  
ATOM 10293 H HE22 . GLN A 1 18  ? 15.515  4.218   -1.140  1.00 1.42 ? 18  GLN A HE22 6  
ATOM 10294 N N    . ILE A 1 19  ? 13.966  2.105   -4.627  1.00 0.60 ? 19  ILE A N    6  
ATOM 10295 C CA   . ILE A 1 19  ? 12.688  2.616   -4.140  1.00 0.66 ? 19  ILE A CA   6  
ATOM 10296 C C    . ILE A 1 19  ? 11.561  1.622   -4.421  1.00 0.63 ? 19  ILE A C    6  
ATOM 10297 O O    . ILE A 1 19  ? 10.695  1.388   -3.572  1.00 0.67 ? 19  ILE A O    6  
ATOM 10298 C CB   . ILE A 1 19  ? 12.352  3.982   -4.781  1.00 0.73 ? 19  ILE A CB   6  
ATOM 10299 C CG1  . ILE A 1 19  ? 13.312  5.057   -4.262  1.00 0.78 ? 19  ILE A CG1  6  
ATOM 10300 C CG2  . ILE A 1 19  ? 10.910  4.376   -4.504  1.00 0.77 ? 19  ILE A CG2  6  
ATOM 10301 C CD1  . ILE A 1 19  ? 13.207  6.383   -4.986  1.00 0.85 ? 19  ILE A CD1  6  
ATOM 10302 H H    . ILE A 1 19  ? 14.473  2.636   -5.286  1.00 0.58 ? 19  ILE A H    6  
ATOM 10303 N N    . MET A 1 20  ? 11.596  1.026   -5.605  1.00 0.59 ? 20  MET A N    6  
ATOM 10304 C CA   . MET A 1 20  ? 10.585  0.060   -6.006  1.00 0.60 ? 20  MET A CA   6  
ATOM 10305 C C    . MET A 1 20  ? 10.633  -1.183  -5.121  1.00 0.56 ? 20  MET A C    6  
ATOM 10306 O O    . MET A 1 20  ? 9.597   -1.688  -4.689  1.00 0.57 ? 20  MET A O    6  
ATOM 10307 C CB   . MET A 1 20  ? 10.774  -0.332  -7.471  1.00 0.61 ? 20  MET A CB   6  
ATOM 10308 C CG   . MET A 1 20  ? 9.607   -1.102  -8.067  1.00 0.71 ? 20  MET A CG   6  
ATOM 10309 S SD   . MET A 1 20  ? 8.236   -0.029  -8.546  1.00 0.96 ? 20  MET A SD   6  
ATOM 10310 C CE   . MET A 1 20  ? 7.287   0.030   -7.025  1.00 1.64 ? 20  MET A CE   6  
ATOM 10311 H H    . MET A 1 20  ? 12.323  1.243   -6.228  1.00 0.57 ? 20  MET A H    6  
ATOM 10312 N N    . LYS A 1 21  ? 11.843  -1.662  -4.848  1.00 0.55 ? 21  LYS A N    6  
ATOM 10313 C CA   . LYS A 1 21  ? 12.032  -2.844  -4.011  1.00 0.55 ? 21  LYS A CA   6  
ATOM 10314 C C    . LYS A 1 21  ? 11.523  -2.601  -2.594  1.00 0.51 ? 21  LYS A C    6  
ATOM 10315 O O    . LYS A 1 21  ? 11.040  -3.518  -1.935  1.00 0.51 ? 21  LYS A O    6  
ATOM 10316 C CB   . LYS A 1 21  ? 13.504  -3.265  -3.980  1.00 0.58 ? 21  LYS A CB   6  
ATOM 10317 C CG   . LYS A 1 21  ? 14.068  -3.703  -5.326  1.00 0.63 ? 21  LYS A CG   6  
ATOM 10318 C CD   . LYS A 1 21  ? 13.336  -4.919  -5.877  1.00 0.69 ? 21  LYS A CD   6  
ATOM 10319 C CE   . LYS A 1 21  ? 13.911  -5.336  -7.221  1.00 0.83 ? 21  LYS A CE   6  
ATOM 10320 N NZ   . LYS A 1 21  ? 13.243  -6.546  -7.768  1.00 1.15 ? 21  LYS A NZ   6  
ATOM 10321 H H    . LYS A 1 21  ? 12.633  -1.212  -5.226  1.00 0.55 ? 21  LYS A H    6  
ATOM 10322 H HZ1  . LYS A 1 21  ? 13.775  -6.913  -8.581  1.00 1.46 ? 21  LYS A HZ1  6  
ATOM 10323 H HZ2  . LYS A 1 21  ? 12.281  -6.317  -8.076  1.00 1.69 ? 21  LYS A HZ2  6  
ATOM 10324 H HZ3  . LYS A 1 21  ? 13.193  -7.296  -7.034  1.00 1.26 ? 21  LYS A HZ3  6  
ATOM 10325 N N    . THR A 1 22  ? 11.616  -1.353  -2.140  1.00 0.52 ? 22  THR A N    6  
ATOM 10326 C CA   . THR A 1 22  ? 11.160  -0.992  -0.803  1.00 0.51 ? 22  THR A CA   6  
ATOM 10327 C C    . THR A 1 22  ? 9.646   -1.190  -0.685  1.00 0.52 ? 22  THR A C    6  
ATOM 10328 O O    . THR A 1 22  ? 9.135   -1.593  0.364   1.00 0.52 ? 22  THR A O    6  
ATOM 10329 C CB   . THR A 1 22  ? 11.521  0.468   -0.459  1.00 0.56 ? 22  THR A CB   6  
ATOM 10330 O OG1  . THR A 1 22  ? 12.868  0.745   -0.872  1.00 0.63 ? 22  THR A OG1  6  
ATOM 10331 C CG2  . THR A 1 22  ? 11.398  0.717   1.038   1.00 0.71 ? 22  THR A CG2  6  
ATOM 10332 H H    . THR A 1 22  ? 11.990  -0.660  -2.724  1.00 0.55 ? 22  THR A H    6  
ATOM 10333 H HG1  . THR A 1 22  ? 13.121  0.146   -1.581  1.00 0.88 ? 22  THR A HG1  6  
ATOM 10334 N N    . GLY A 1 23  ? 8.938   -0.932  -1.781  1.00 0.55 ? 23  GLY A N    6  
ATOM 10335 C CA   . GLY A 1 23  ? 7.498   -1.090  -1.795  1.00 0.58 ? 23  GLY A CA   6  
ATOM 10336 C C    . GLY A 1 23  ? 7.089   -2.541  -1.632  1.00 0.56 ? 23  GLY A C    6  
ATOM 10337 O O    . GLY A 1 23  ? 6.047   -2.841  -1.047  1.00 0.58 ? 23  GLY A O    6  
ATOM 10338 H H    . GLY A 1 23  ? 9.402   -0.636  -2.595  1.00 0.55 ? 23  GLY A H    6  
ATOM 10339 N N    . ALA A 1 24  ? 7.930   -3.443  -2.126  1.00 0.56 ? 24  ALA A N    6  
ATOM 10340 C CA   . ALA A 1 24  ? 7.663   -4.873  -2.040  1.00 0.58 ? 24  ALA A CA   6  
ATOM 10341 C C    . ALA A 1 24  ? 7.773   -5.364  -0.599  1.00 0.55 ? 24  ALA A C    6  
ATOM 10342 O O    . ALA A 1 24  ? 7.297   -6.445  -0.263  1.00 0.73 ? 24  ALA A O    6  
ATOM 10343 C CB   . ALA A 1 24  ? 8.606   -5.649  -2.947  1.00 0.61 ? 24  ALA A CB   6  
ATOM 10344 H H    . ALA A 1 24  ? 8.757   -3.139  -2.559  1.00 0.58 ? 24  ALA A H    6  
ATOM 10345 N N    . LEU A 1 25  ? 8.409   -4.566  0.248   1.00 0.44 ? 25  LEU A N    6  
ATOM 10346 C CA   . LEU A 1 25  ? 8.564   -4.916  1.652   1.00 0.40 ? 25  LEU A CA   6  
ATOM 10347 C C    . LEU A 1 25  ? 7.467   -4.255  2.482   1.00 0.39 ? 25  LEU A C    6  
ATOM 10348 O O    . LEU A 1 25  ? 6.940   -4.849  3.422   1.00 0.40 ? 25  LEU A O    6  
ATOM 10349 C CB   . LEU A 1 25  ? 9.948   -4.507  2.163   1.00 0.40 ? 25  LEU A CB   6  
ATOM 10350 C CG   . LEU A 1 25  ? 10.233  -4.763  3.647   1.00 0.45 ? 25  LEU A CG   6  
ATOM 10351 C CD1  . LEU A 1 25  ? 9.938   -6.210  4.021   1.00 0.61 ? 25  LEU A CD1  6  
ATOM 10352 C CD2  . LEU A 1 25  ? 11.675  -4.414  3.975   1.00 0.48 ? 25  LEU A CD2  6  
ATOM 10353 H H    . LEU A 1 25  ? 8.789   -3.723  -0.080  1.00 0.48 ? 25  LEU A H    6  
ATOM 10354 N N    . LEU A 1 26  ? 7.114   -3.030  2.106   1.00 0.39 ? 26  LEU A N    6  
ATOM 10355 C CA   . LEU A 1 26  ? 6.078   -2.277  2.804   1.00 0.40 ? 26  LEU A CA   6  
ATOM 10356 C C    . LEU A 1 26  ? 4.747   -3.022  2.771   1.00 0.44 ? 26  LEU A C    6  
ATOM 10357 O O    . LEU A 1 26  ? 4.058   -3.131  3.789   1.00 0.45 ? 26  LEU A O    6  
ATOM 10358 C CB   . LEU A 1 26  ? 5.914   -0.884  2.185   1.00 0.43 ? 26  LEU A CB   6  
ATOM 10359 C CG   . LEU A 1 26  ? 7.101   0.069   2.343   1.00 0.42 ? 26  LEU A CG   6  
ATOM 10360 C CD1  . LEU A 1 26  ? 6.840   1.373   1.603   1.00 0.49 ? 26  LEU A CD1  6  
ATOM 10361 C CD2  . LEU A 1 26  ? 7.388   0.335   3.812   1.00 0.39 ? 26  LEU A CD2  6  
ATOM 10362 H H    . LEU A 1 26  ? 7.571   -2.616  1.341   1.00 0.40 ? 26  LEU A H    6  
ATOM 10363 N N    . LEU A 1 27  ? 4.400   -3.547  1.600   1.00 0.49 ? 27  LEU A N    6  
ATOM 10364 C CA   . LEU A 1 27  ? 3.155   -4.284  1.433   1.00 0.56 ? 27  LEU A CA   6  
ATOM 10365 C C    . LEU A 1 27  ? 3.172   -5.580  2.238   1.00 0.57 ? 27  LEU A C    6  
ATOM 10366 O O    . LEU A 1 27  ? 2.138   -6.024  2.735   1.00 0.61 ? 27  LEU A O    6  
ATOM 10367 C CB   . LEU A 1 27  ? 2.888   -4.583  -0.046  1.00 0.63 ? 27  LEU A CB   6  
ATOM 10368 C CG   . LEU A 1 27  ? 2.003   -3.584  -0.802  1.00 0.67 ? 27  LEU A CG   6  
ATOM 10369 C CD1  . LEU A 1 27  ? 0.640   -3.442  -0.137  1.00 0.71 ? 27  LEU A CD1  6  
ATOM 10370 C CD2  . LEU A 1 27  ? 2.690   -2.234  -0.939  1.00 0.64 ? 27  LEU A CD2  6  
ATOM 10371 H H    . LEU A 1 27  ? 4.994   -3.430  0.828   1.00 0.50 ? 27  LEU A H    6  
ATOM 10372 N N    . GLN A 1 28  ? 4.352   -6.173  2.372   1.00 0.56 ? 28  GLN A N    6  
ATOM 10373 C CA   . GLN A 1 28  ? 4.506   -7.418  3.117   1.00 0.59 ? 28  GLN A CA   6  
ATOM 10374 C C    . GLN A 1 28  ? 4.120   -7.239  4.583   1.00 0.56 ? 28  GLN A C    6  
ATOM 10375 O O    . GLN A 1 28  ? 3.256   -7.952  5.097   1.00 0.60 ? 28  GLN A O    6  
ATOM 10376 C CB   . GLN A 1 28  ? 5.941   -7.936  3.024   1.00 0.64 ? 28  GLN A CB   6  
ATOM 10377 C CG   . GLN A 1 28  ? 6.231   -8.784  1.798   1.00 0.99 ? 28  GLN A CG   6  
ATOM 10378 C CD   . GLN A 1 28  ? 7.641   -9.336  1.810   1.00 1.17 ? 28  GLN A CD   6  
ATOM 10379 O OE1  . GLN A 1 28  ? 7.901   -10.392 2.383   1.00 1.46 ? 28  GLN A OE1  6  
ATOM 10380 N NE2  . GLN A 1 28  ? 8.563   -8.632  1.174   1.00 1.53 ? 28  GLN A NE2  6  
ATOM 10381 H H    . GLN A 1 28  ? 5.143   -5.759  1.970   1.00 0.55 ? 28  GLN A H    6  
ATOM 10382 H HE21 . GLN A 1 28  ? 8.286   -7.799  0.730   1.00 1.80 ? 28  GLN A HE21 6  
ATOM 10383 H HE22 . GLN A 1 28  ? 9.483   -8.971  1.172   1.00 1.74 ? 28  GLN A HE22 6  
ATOM 10384 N N    . GLY A 1 29  ? 4.754   -6.271  5.240   1.00 0.54 ? 29  GLY A N    6  
ATOM 10385 C CA   . GLY A 1 29  ? 4.484   -6.018  6.641   1.00 0.54 ? 29  GLY A CA   6  
ATOM 10386 C C    . GLY A 1 29  ? 3.039   -5.649  6.906   1.00 0.51 ? 29  GLY A C    6  
ATOM 10387 O O    . GLY A 1 29  ? 2.425   -6.170  7.836   1.00 0.53 ? 29  GLY A O    6  
ATOM 10388 H H    . GLY A 1 29  ? 5.410   -5.717  4.762   1.00 0.56 ? 29  GLY A H    6  
ATOM 10389 N N    . PHE A 1 30  ? 2.499   -4.763  6.079   1.00 0.50 ? 30  PHE A N    6  
ATOM 10390 C CA   . PHE A 1 30  ? 1.120   -4.306  6.229   1.00 0.51 ? 30  PHE A CA   6  
ATOM 10391 C C    . PHE A 1 30  ? 0.121   -5.460  6.134   1.00 0.51 ? 30  PHE A C    6  
ATOM 10392 O O    . PHE A 1 30  ? -0.795  -5.571  6.954   1.00 0.55 ? 30  PHE A O    6  
ATOM 10393 C CB   . PHE A 1 30  ? 0.804   -3.229  5.185   1.00 0.54 ? 30  PHE A CB   6  
ATOM 10394 C CG   . PHE A 1 30  ? -0.399  -2.388  5.505   1.00 0.54 ? 30  PHE A CG   6  
ATOM 10395 C CD1  . PHE A 1 30  ? -0.670  -1.998  6.806   1.00 0.85 ? 30  PHE A CD1  6  
ATOM 10396 C CD2  . PHE A 1 30  ? -1.257  -1.980  4.496   1.00 0.83 ? 30  PHE A CD2  6  
ATOM 10397 C CE1  . PHE A 1 30  ? -1.772  -1.220  7.095   1.00 0.85 ? 30  PHE A CE1  6  
ATOM 10398 C CE2  . PHE A 1 30  ? -2.362  -1.201  4.777   1.00 0.90 ? 30  PHE A CE2  6  
ATOM 10399 C CZ   . PHE A 1 30  ? -2.619  -0.820  6.079   1.00 0.65 ? 30  PHE A CZ   6  
ATOM 10400 H H    . PHE A 1 30  ? 3.045   -4.398  5.351   1.00 0.51 ? 30  PHE A H    6  
ATOM 10401 N N    . ILE A 1 31  ? 0.308   -6.322  5.141   1.00 0.50 ? 31  ILE A N    6  
ATOM 10402 C CA   . ILE A 1 31  ? -0.586  -7.458  4.941   1.00 0.52 ? 31  ILE A CA   6  
ATOM 10403 C C    . ILE A 1 31  ? -0.416  -8.515  6.035   1.00 0.53 ? 31  ILE A C    6  
ATOM 10404 O O    . ILE A 1 31  ? -1.385  -8.914  6.675   1.00 0.56 ? 31  ILE A O    6  
ATOM 10405 C CB   . ILE A 1 31  ? -0.394  -8.105  3.550   1.00 0.54 ? 31  ILE A CB   6  
ATOM 10406 C CG1  . ILE A 1 31  ? -0.799  -7.124  2.445   1.00 0.54 ? 31  ILE A CG1  6  
ATOM 10407 C CG2  . ILE A 1 31  ? -1.193  -9.398  3.435   1.00 0.58 ? 31  ILE A CG2  6  
ATOM 10408 C CD1  . ILE A 1 31  ? -0.468  -7.597  1.044   1.00 0.57 ? 31  ILE A CD1  6  
ATOM 10409 H H    . ILE A 1 31  ? 1.065   -6.192  4.529   1.00 0.49 ? 31  ILE A H    6  
ATOM 10410 N N    . GLN A 1 32  ? 0.822   -8.933  6.268   1.00 0.53 ? 32  GLN A N    6  
ATOM 10411 C CA   . GLN A 1 32  ? 1.119   -9.964  7.262   1.00 0.55 ? 32  GLN A CA   6  
ATOM 10412 C C    . GLN A 1 32  ? 0.662   -9.587  8.670   1.00 0.54 ? 32  GLN A C    6  
ATOM 10413 O O    . GLN A 1 32  ? 0.167   -10.435 9.413   1.00 0.57 ? 32  GLN A O    6  
ATOM 10414 C CB   . GLN A 1 32  ? 2.607   -10.322 7.254   1.00 0.57 ? 32  GLN A CB   6  
ATOM 10415 C CG   . GLN A 1 32  ? 3.053   -11.091 6.018   1.00 0.68 ? 32  GLN A CG   6  
ATOM 10416 C CD   . GLN A 1 32  ? 2.335   -12.418 5.854   1.00 0.90 ? 32  GLN A CD   6  
ATOM 10417 O OE1  . GLN A 1 32  ? 1.937   -13.050 6.831   1.00 1.07 ? 32  GLN A OE1  6  
ATOM 10418 N NE2  . GLN A 1 32  ? 2.167   -12.849 4.616   1.00 1.12 ? 32  GLN A NE2  6  
ATOM 10419 H H    . GLN A 1 32  ? 1.564   -8.534  5.761   1.00 0.52 ? 32  GLN A H    6  
ATOM 10420 H HE21 . GLN A 1 32  ? 2.510   -12.298 3.885   1.00 1.19 ? 32  GLN A HE21 6  
ATOM 10421 H HE22 . GLN A 1 32  ? 1.705   -13.707 4.482   1.00 1.31 ? 32  GLN A HE22 6  
ATOM 10422 N N    . ASP A 1 33  ? 0.816   -8.316  9.025   1.00 0.53 ? 33  ASP A N    6  
ATOM 10423 C CA   . ASP A 1 33  ? 0.426   -7.836  10.351  1.00 0.55 ? 33  ASP A CA   6  
ATOM 10424 C C    . ASP A 1 33  ? -1.060  -8.051  10.626  1.00 0.58 ? 33  ASP A C    6  
ATOM 10425 O O    . ASP A 1 33  ? -1.453  -8.406  11.739  1.00 0.65 ? 33  ASP A O    6  
ATOM 10426 C CB   . ASP A 1 33  ? 0.778   -6.357  10.521  1.00 0.57 ? 33  ASP A CB   6  
ATOM 10427 C CG   . ASP A 1 33  ? 0.537   -5.862  11.932  1.00 0.61 ? 33  ASP A CG   6  
ATOM 10428 O OD1  . ASP A 1 33  ? 1.391   -6.107  12.809  1.00 0.73 ? 33  ASP A OD1  6  
ATOM 10429 O OD2  . ASP A 1 33  ? -0.502  -5.217  12.177  1.00 0.74 ? 33  ASP A OD2  6  
ATOM 10430 H H    . ASP A 1 33  ? 1.208   -7.683  8.383   1.00 0.53 ? 33  ASP A H    6  
ATOM 10431 N N    . ARG A 1 34  ? -1.883  -7.837  9.609   1.00 0.58 ? 34  ARG A N    6  
ATOM 10432 C CA   . ARG A 1 34  ? -3.321  -8.002  9.748   1.00 0.63 ? 34  ARG A CA   6  
ATOM 10433 C C    . ARG A 1 34  ? -3.756  -9.435  9.450   1.00 0.62 ? 34  ARG A C    6  
ATOM 10434 O O    . ARG A 1 34  ? -4.686  -9.947  10.072  1.00 0.67 ? 34  ARG A O    6  
ATOM 10435 C CB   . ARG A 1 34  ? -4.075  -7.005  8.863   1.00 0.67 ? 34  ARG A CB   6  
ATOM 10436 C CG   . ARG A 1 34  ? -4.847  -5.953  9.645   1.00 0.74 ? 34  ARG A CG   6  
ATOM 10437 C CD   . ARG A 1 34  ? -3.928  -5.142  10.548  1.00 0.73 ? 34  ARG A CD   6  
ATOM 10438 N NE   . ARG A 1 34  ? -4.668  -4.449  11.606  1.00 0.75 ? 34  ARG A NE   6  
ATOM 10439 C CZ   . ARG A 1 34  ? -4.217  -4.295  12.852  1.00 0.74 ? 34  ARG A CZ   6  
ATOM 10440 N NH1  . ARG A 1 34  ? -3.012  -4.740  13.192  1.00 0.77 ? 34  ARG A NH1  6  
ATOM 10441 N NH2  . ARG A 1 34  ? -4.963  -3.669  13.754  1.00 0.85 ? 34  ARG A NH2  6  
ATOM 10442 H H    . ARG A 1 34  ? -1.512  -7.560  8.745   1.00 0.56 ? 34  ARG A H    6  
ATOM 10443 H HE   . ARG A 1 34  ? -5.554  -4.086  11.376  1.00 0.86 ? 34  ARG A HE   6  
ATOM 10444 H HH11 . ARG A 1 34  ? -2.423  -5.192  12.510  1.00 0.74 ? 34  ARG A HH11 6  
ATOM 10445 H HH12 . ARG A 1 34  ? -2.675  -4.627  14.131  1.00 0.90 ? 34  ARG A HH12 6  
ATOM 10446 H HH21 . ARG A 1 34  ? -5.872  -3.301  13.500  1.00 0.91 ? 34  ARG A HH21 6  
ATOM 10447 H HH22 . ARG A 1 34  ? -4.637  -3.562  14.693  1.00 0.93 ? 34  ARG A HH22 6  
ATOM 10448 N N    . ALA A 1 35  ? -3.082  -10.081 8.501   1.00 0.61 ? 35  ALA A N    6  
ATOM 10449 C CA   . ALA A 1 35  ? -3.403  -11.456 8.131   1.00 0.64 ? 35  ALA A CA   6  
ATOM 10450 C C    . ALA A 1 35  ? -3.114  -12.413 9.282   1.00 0.66 ? 35  ALA A C    6  
ATOM 10451 O O    . ALA A 1 35  ? -3.785  -13.435 9.438   1.00 0.68 ? 35  ALA A O    6  
ATOM 10452 C CB   . ALA A 1 35  ? -2.628  -11.874 6.890   1.00 0.65 ? 35  ALA A CB   6  
ATOM 10453 H H    . ALA A 1 35  ? -2.353  -9.617  8.026   1.00 0.61 ? 35  ALA A H    6  
ATOM 10454 N N    . GLY A 1 36  ? -2.122  -12.065 10.094  1.00 0.69 ? 36  GLY A N    6  
ATOM 10455 C CA   . GLY A 1 36  ? -1.750  -12.891 11.226  1.00 0.76 ? 36  GLY A CA   6  
ATOM 10456 C C    . GLY A 1 36  ? -2.838  -12.981 12.279  1.00 0.78 ? 36  GLY A C    6  
ATOM 10457 O O    . GLY A 1 36  ? -2.789  -13.845 13.153  1.00 0.89 ? 36  GLY A O    6  
ATOM 10458 H H    . GLY A 1 36  ? -1.623  -11.239 9.912   1.00 0.70 ? 36  GLY A H    6  
ATOM 10459 N N    . ARG A 1 37  ? -3.830  -12.100 12.186  1.00 0.75 ? 37  ARG A N    6  
ATOM 10460 C CA   . ARG A 1 37  ? -4.932  -12.091 13.139  1.00 0.81 ? 37  ARG A CA   6  
ATOM 10461 C C    . ARG A 1 37  ? -5.915  -13.215 12.840  1.00 0.79 ? 37  ARG A C    6  
ATOM 10462 O O    . ARG A 1 37  ? -6.764  -13.543 13.665  1.00 0.88 ? 37  ARG A O    6  
ATOM 10463 C CB   . ARG A 1 37  ? -5.651  -10.738 13.138  1.00 0.86 ? 37  ARG A CB   6  
ATOM 10464 C CG   . ARG A 1 37  ? -6.441  -10.452 14.409  1.00 1.17 ? 37  ARG A CG   6  
ATOM 10465 C CD   . ARG A 1 37  ? -7.048  -9.056  14.392  1.00 1.23 ? 37  ARG A CD   6  
ATOM 10466 N NE   . ARG A 1 37  ? -8.248  -8.982  13.556  1.00 1.18 ? 37  ARG A NE   6  
ATOM 10467 C CZ   . ARG A 1 37  ? -8.740  -7.843  13.063  1.00 1.28 ? 37  ARG A CZ   6  
ATOM 10468 N NH1  . ARG A 1 37  ? -8.124  -6.691  13.298  1.00 1.35 ? 37  ARG A NH1  6  
ATOM 10469 N NH2  . ARG A 1 37  ? -9.848  -7.861  12.331  1.00 1.73 ? 37  ARG A NH2  6  
ATOM 10470 H H    . ARG A 1 37  ? -3.819  -11.441 11.457  1.00 0.71 ? 37  ARG A H    6  
ATOM 10471 H HE   . ARG A 1 37  ? -8.716  -9.827  13.365  1.00 1.43 ? 37  ARG A HE   6  
ATOM 10472 H HH11 . ARG A 1 37  ? -7.285  -6.670  13.852  1.00 1.52 ? 37  ARG A HH11 6  
ATOM 10473 H HH12 . ARG A 1 37  ? -8.490  -5.837  12.922  1.00 1.52 ? 37  ARG A HH12 6  
ATOM 10474 H HH21 . ARG A 1 37  ? -10.316 -8.731  12.145  1.00 2.07 ? 37  ARG A HH21 6  
ATOM 10475 H HH22 . ARG A 1 37  ? -10.224 -7.005  11.964  1.00 1.89 ? 37  ARG A HH22 6  
ATOM 10476 N N    . MET A 1 38  ? -5.796  -13.810 11.656  1.00 0.74 ? 38  MET A N    6  
ATOM 10477 C CA   . MET A 1 38  ? -6.680  -14.902 11.266  1.00 0.75 ? 38  MET A CA   6  
ATOM 10478 C C    . MET A 1 38  ? -6.208  -16.212 11.883  1.00 0.77 ? 38  MET A C    6  
ATOM 10479 O O    . MET A 1 38  ? -7.004  -17.115 12.141  1.00 1.03 ? 38  MET A O    6  
ATOM 10480 C CB   . MET A 1 38  ? -6.732  -15.041 9.744   1.00 0.76 ? 38  MET A CB   6  
ATOM 10481 C CG   . MET A 1 38  ? -7.369  -13.863 9.024   1.00 0.86 ? 38  MET A CG   6  
ATOM 10482 S SD   . MET A 1 38  ? -9.112  -13.649 9.435   1.00 1.19 ? 38  MET A SD   6  
ATOM 10483 C CE   . MET A 1 38  ? -9.519  -12.208 8.449   1.00 1.48 ? 38  MET A CE   6  
ATOM 10484 H H    . MET A 1 38  ? -5.094  -13.514 11.033  1.00 0.74 ? 38  MET A H    6  
ATOM 10485 N N    . GLY A 1 39  ? -4.909  -16.295 12.130  1.00 0.76 ? 39  GLY A N    6  
ATOM 10486 C CA   . GLY A 1 39  ? -4.335  -17.494 12.708  1.00 0.78 ? 39  GLY A CA   6  
ATOM 10487 C C    . GLY A 1 39  ? -3.423  -18.209 11.729  1.00 0.80 ? 39  GLY A C    6  
ATOM 10488 O O    . GLY A 1 39  ? -3.586  -18.075 10.515  1.00 1.17 ? 39  GLY A O    6  
ATOM 10489 H H    . GLY A 1 39  ? -4.333  -15.531 11.922  1.00 0.92 ? 39  GLY A H    6  
ATOM 10490 N N    . GLY A 1 40  ? -2.469  -18.967 12.250  1.00 0.84 ? 40  GLY A N    6  
ATOM 10491 C CA   . GLY A 1 40  ? -1.544  -19.684 11.396  1.00 0.88 ? 40  GLY A CA   6  
ATOM 10492 C C    . GLY A 1 40  ? -1.892  -21.152 11.279  1.00 0.88 ? 40  GLY A C    6  
ATOM 10493 O O    . GLY A 1 40  ? -2.357  -21.767 12.238  1.00 1.11 ? 40  GLY A O    6  
ATOM 10494 H H    . GLY A 1 40  ? -2.396  -19.053 13.227  1.00 1.11 ? 40  GLY A H    6  
ATOM 10495 N N    . GLU A 1 41  ? -1.660  -21.717 10.103  1.00 0.82 ? 41  GLU A N    6  
ATOM 10496 C CA   . GLU A 1 41  ? -1.955  -23.122 9.858   1.00 0.87 ? 41  GLU A CA   6  
ATOM 10497 C C    . GLU A 1 41  ? -0.786  -24.018 10.271  1.00 0.90 ? 41  GLU A C    6  
ATOM 10498 O O    . GLU A 1 41  ? -0.027  -24.498 9.426   1.00 1.06 ? 41  GLU A O    6  
ATOM 10499 C CB   . GLU A 1 41  ? -2.342  -23.353 8.393   1.00 0.98 ? 41  GLU A CB   6  
ATOM 10500 C CG   . GLU A 1 41  ? -1.500  -22.582 7.387   1.00 1.31 ? 41  GLU A CG   6  
ATOM 10501 C CD   . GLU A 1 41  ? -1.951  -22.815 5.960   1.00 1.55 ? 41  GLU A CD   6  
ATOM 10502 O OE1  . GLU A 1 41  ? -1.749  -23.931 5.445   1.00 1.89 ? 41  GLU A OE1  6  
ATOM 10503 O OE2  . GLU A 1 41  ? -2.500  -21.878 5.344   1.00 2.17 ? 41  GLU A OE2  6  
ATOM 10504 H H    . GLU A 1 41  ? -1.280  -21.177 9.381   1.00 0.89 ? 41  GLU A H    6  
ATOM 10505 N N    . ALA A 1 42  ? -0.652  -24.220 11.582  1.00 0.89 ? 42  ALA A N    6  
ATOM 10506 C CA   . ALA A 1 42  ? 0.409   -25.051 12.155  1.00 0.98 ? 42  ALA A CA   6  
ATOM 10507 C C    . ALA A 1 42  ? 1.801   -24.588 11.726  1.00 0.90 ? 42  ALA A C    6  
ATOM 10508 O O    . ALA A 1 42  ? 2.483   -25.263 10.951  1.00 0.99 ? 42  ALA A O    6  
ATOM 10509 C CB   . ALA A 1 42  ? 0.196   -26.527 11.843  1.00 1.21 ? 42  ALA A CB   6  
ATOM 10510 H H    . ALA A 1 42  ? -1.291  -23.788 12.191  1.00 0.92 ? 42  ALA A H    6  
ATOM 10511 N N    . PRO A 1 43  ? 2.246   -23.424 12.229  1.00 0.86 ? 43  PRO A N    6  
ATOM 10512 C CA   . PRO A 1 43  ? 3.559   -22.874 11.902  1.00 0.89 ? 43  PRO A CA   6  
ATOM 10513 C C    . PRO A 1 43  ? 4.660   -23.570 12.696  1.00 0.93 ? 43  PRO A C    6  
ATOM 10514 O O    . PRO A 1 43  ? 5.289   -22.968 13.565  1.00 1.08 ? 43  PRO A O    6  
ATOM 10515 C CB   . PRO A 1 43  ? 3.450   -21.395 12.321  1.00 1.03 ? 43  PRO A CB   6  
ATOM 10516 C CG   . PRO A 1 43  ? 2.041   -21.199 12.787  1.00 1.11 ? 43  PRO A CG   6  
ATOM 10517 C CD   . PRO A 1 43  ? 1.521   -22.555 13.159  1.00 0.96 ? 43  PRO A CD   6  
ATOM 10518 N N    . GLU A 1 44  ? 4.865   -24.848 12.401  1.00 0.91 ? 44  GLU A N    6  
ATOM 10519 C CA   . GLU A 1 44  ? 5.874   -25.646 13.082  1.00 0.98 ? 44  GLU A CA   6  
ATOM 10520 C C    . GLU A 1 44  ? 7.276   -25.104 12.823  1.00 0.98 ? 44  GLU A C    6  
ATOM 10521 O O    . GLU A 1 44  ? 7.913   -24.555 13.721  1.00 1.13 ? 44  GLU A O    6  
ATOM 10522 C CB   . GLU A 1 44  ? 5.773   -27.109 12.646  1.00 1.06 ? 44  GLU A CB   6  
ATOM 10523 C CG   . GLU A 1 44  ? 6.572   -28.073 13.503  1.00 1.34 ? 44  GLU A CG   6  
ATOM 10524 C CD   . GLU A 1 44  ? 6.217   -29.513 13.217  1.00 1.59 ? 44  GLU A CD   6  
ATOM 10525 O OE1  . GLU A 1 44  ? 5.258   -30.026 13.829  1.00 2.13 ? 44  GLU A OE1  6  
ATOM 10526 O OE2  . GLU A 1 44  ? 6.884   -30.139 12.369  1.00 1.91 ? 44  GLU A OE2  6  
ATOM 10527 H H    . GLU A 1 44  ? 4.314   -25.266 11.704  1.00 0.91 ? 44  GLU A H    6  
ATOM 10528 N N    . LEU A 1 45  ? 7.748   -25.248 11.594  1.00 0.93 ? 45  LEU A N    6  
ATOM 10529 C CA   . LEU A 1 45  ? 9.073   -24.768 11.234  1.00 0.99 ? 45  LEU A CA   6  
ATOM 10530 C C    . LEU A 1 45  ? 8.995   -23.316 10.784  1.00 0.93 ? 45  LEU A C    6  
ATOM 10531 O O    . LEU A 1 45  ? 9.635   -22.438 11.369  1.00 0.96 ? 45  LEU A O    6  
ATOM 10532 C CB   . LEU A 1 45  ? 9.686   -25.639 10.130  1.00 1.11 ? 45  LEU A CB   6  
ATOM 10533 C CG   . LEU A 1 45  ? 9.957   -27.104 10.486  1.00 1.39 ? 45  LEU A CG   6  
ATOM 10534 C CD1  . LEU A 1 45  ? 10.480  -27.860 9.276   1.00 1.65 ? 45  LEU A CD1  6  
ATOM 10535 C CD2  . LEU A 1 45  ? 10.936  -27.206 11.644  1.00 1.60 ? 45  LEU A CD2  6  
ATOM 10536 H H    . LEU A 1 45  ? 7.191   -25.681 10.911  1.00 0.92 ? 45  LEU A H    6  
ATOM 10537 N N    . ALA A 1 46  ? 8.188   -23.081 9.751   1.00 0.93 ? 46  ALA A N    6  
ATOM 10538 C CA   . ALA A 1 46  ? 7.987   -21.747 9.192   1.00 0.95 ? 46  ALA A CA   6  
ATOM 10539 C C    . ALA A 1 46  ? 9.305   -21.103 8.761   1.00 0.89 ? 46  ALA A C    6  
ATOM 10540 O O    . ALA A 1 46  ? 10.278  -21.798 8.451   1.00 1.04 ? 46  ALA A O    6  
ATOM 10541 C CB   . ALA A 1 46  ? 7.231   -20.854 10.169  1.00 1.03 ? 46  ALA A CB   6  
ATOM 10542 H H    . ALA A 1 46  ? 7.713   -23.836 9.346   1.00 0.98 ? 46  ALA A H    6  
ATOM 10543 N N    . LEU A 1 47  ? 9.323   -19.778 8.720   1.00 0.83 ? 47  LEU A N    6  
ATOM 10544 C CA   . LEU A 1 47  ? 10.507  -19.030 8.329   1.00 0.78 ? 47  LEU A CA   6  
ATOM 10545 C C    . LEU A 1 47  ? 10.462  -17.657 8.985   1.00 0.69 ? 47  LEU A C    6  
ATOM 10546 O O    . LEU A 1 47  ? 9.384   -17.087 9.151   1.00 0.75 ? 47  LEU A O    6  
ATOM 10547 C CB   . LEU A 1 47  ? 10.561  -18.882 6.803   1.00 0.89 ? 47  LEU A CB   6  
ATOM 10548 C CG   . LEU A 1 47  ? 11.844  -18.275 6.226   1.00 0.92 ? 47  LEU A CG   6  
ATOM 10549 C CD1  . LEU A 1 47  ? 13.034  -19.185 6.491   1.00 1.06 ? 47  LEU A CD1  6  
ATOM 10550 C CD2  . LEU A 1 47  ? 11.692  -18.014 4.734   1.00 1.09 ? 47  LEU A CD2  6  
ATOM 10551 H H    . LEU A 1 47  ? 8.516   -19.283 8.968   1.00 0.92 ? 47  LEU A H    6  
ATOM 10552 N N    . ASP A 1 48  ? 11.617  -17.144 9.383   1.00 0.69 ? 48  ASP A N    6  
ATOM 10553 C CA   . ASP A 1 48  ? 11.686  -15.838 10.023  1.00 0.67 ? 48  ASP A CA   6  
ATOM 10554 C C    . ASP A 1 48  ? 13.115  -15.311 10.029  1.00 0.61 ? 48  ASP A C    6  
ATOM 10555 O O    . ASP A 1 48  ? 13.946  -15.745 10.830  1.00 0.63 ? 48  ASP A O    6  
ATOM 10556 C CB   . ASP A 1 48  ? 11.152  -15.912 11.458  1.00 0.79 ? 48  ASP A CB   6  
ATOM 10557 C CG   . ASP A 1 48  ? 11.145  -14.568 12.163  1.00 1.00 ? 48  ASP A CG   6  
ATOM 10558 O OD1  . ASP A 1 48  ? 11.154  -13.524 11.475  1.00 1.31 ? 48  ASP A OD1  6  
ATOM 10559 O OD2  . ASP A 1 48  ? 11.116  -14.555 13.411  1.00 1.64 ? 48  ASP A OD2  6  
ATOM 10560 H H    . ASP A 1 48  ? 12.444  -17.659 9.254   1.00 0.81 ? 48  ASP A H    6  
ATOM 10561 N N    . PRO A 1 49  ? 13.435  -14.390 9.114   1.00 0.64 ? 49  PRO A N    6  
ATOM 10562 C CA   . PRO A 1 49  ? 14.767  -13.795 9.041   1.00 0.66 ? 49  PRO A CA   6  
ATOM 10563 C C    . PRO A 1 49  ? 14.916  -12.652 10.041  1.00 0.58 ? 49  PRO A C    6  
ATOM 10564 O O    . PRO A 1 49  ? 16.024  -12.162 10.273  1.00 0.63 ? 49  PRO A O    6  
ATOM 10565 C CB   . PRO A 1 49  ? 14.820  -13.253 7.613   1.00 0.80 ? 49  PRO A CB   6  
ATOM 10566 C CG   . PRO A 1 49  ? 13.404  -12.902 7.297   1.00 0.93 ? 49  PRO A CG   6  
ATOM 10567 C CD   . PRO A 1 49  ? 12.538  -13.871 8.065   1.00 0.76 ? 49  PRO A CD   6  
ATOM 10568 N N    . VAL A 1 50  ? 13.786  -12.252 10.635  1.00 0.56 ? 50  VAL A N    6  
ATOM 10569 C CA   . VAL A 1 50  ? 13.736  -11.164 11.613  1.00 0.58 ? 50  VAL A CA   6  
ATOM 10570 C C    . VAL A 1 50  ? 14.031  -9.809  10.964  1.00 0.57 ? 50  VAL A C    6  
ATOM 10571 O O    . VAL A 1 50  ? 15.122  -9.581  10.438  1.00 0.62 ? 50  VAL A O    6  
ATOM 10572 C CB   . VAL A 1 50  ? 14.661  -11.399 12.832  1.00 0.64 ? 50  VAL A CB   6  
ATOM 10573 C CG1  . VAL A 1 50  ? 14.512  -10.273 13.850  1.00 0.75 ? 50  VAL A CG1  6  
ATOM 10574 C CG2  . VAL A 1 50  ? 14.359  -12.744 13.479  1.00 0.75 ? 50  VAL A CG2  6  
ATOM 10575 H H    . VAL A 1 50  ? 12.951  -12.717 10.410  1.00 0.60 ? 50  VAL A H    6  
ATOM 10576 N N    . PRO A 1 51  ? 13.043  -8.901  10.965  1.00 0.60 ? 51  PRO A N    6  
ATOM 10577 C CA   . PRO A 1 51  ? 13.198  -7.562  10.386  1.00 0.65 ? 51  PRO A CA   6  
ATOM 10578 C C    . PRO A 1 51  ? 14.262  -6.758  11.127  1.00 0.66 ? 51  PRO A C    6  
ATOM 10579 O O    . PRO A 1 51  ? 14.062  -6.344  12.272  1.00 0.73 ? 51  PRO A O    6  
ATOM 10580 C CB   . PRO A 1 51  ? 11.819  -6.918  10.576  1.00 0.77 ? 51  PRO A CB   6  
ATOM 10581 C CG   . PRO A 1 51  ? 10.888  -8.060  10.804  1.00 0.92 ? 51  PRO A CG   6  
ATOM 10582 C CD   . PRO A 1 51  ? 11.694  -9.106  11.516  1.00 0.72 ? 51  PRO A CD   6  
ATOM 10583 N N    . GLN A 1 52  ? 15.399  -6.555  10.478  1.00 0.71 ? 52  GLN A N    6  
ATOM 10584 C CA   . GLN A 1 52  ? 16.496  -5.810  11.078  1.00 0.81 ? 52  GLN A CA   6  
ATOM 10585 C C    . GLN A 1 52  ? 16.332  -4.314  10.849  1.00 0.77 ? 52  GLN A C    6  
ATOM 10586 O O    . GLN A 1 52  ? 16.867  -3.499  11.602  1.00 0.91 ? 52  GLN A O    6  
ATOM 10587 C CB   . GLN A 1 52  ? 17.840  -6.285  10.524  1.00 0.97 ? 52  GLN A CB   6  
ATOM 10588 C CG   . GLN A 1 52  ? 18.046  -7.793  10.590  1.00 1.18 ? 52  GLN A CG   6  
ATOM 10589 C CD   . GLN A 1 52  ? 17.972  -8.344  12.002  1.00 1.30 ? 52  GLN A CD   6  
ATOM 10590 O OE1  . GLN A 1 52  ? 18.326  -7.672  12.967  1.00 1.40 ? 52  GLN A OE1  6  
ATOM 10591 N NE2  . GLN A 1 52  ? 17.499  -9.571  12.134  1.00 1.51 ? 52  GLN A NE2  6  
ATOM 10592 H H    . GLN A 1 52  ? 15.506  -6.922  9.573   1.00 0.75 ? 52  GLN A H    6  
ATOM 10593 H HE21 . GLN A 1 52  ? 17.221  -10.048 11.324  1.00 1.58 ? 52  GLN A HE21 6  
ATOM 10594 H HE22 . GLN A 1 52  ? 17.446  -9.954  13.037  1.00 1.68 ? 52  GLN A HE22 6  
ATOM 10595 N N    . ASP A 1 53  ? 15.601  -3.954  9.804   1.00 0.67 ? 53  ASP A N    6  
ATOM 10596 C CA   . ASP A 1 53  ? 15.375  -2.550  9.494   1.00 0.64 ? 53  ASP A CA   6  
ATOM 10597 C C    . ASP A 1 53  ? 14.220  -1.992  10.309  1.00 0.62 ? 53  ASP A C    6  
ATOM 10598 O O    . ASP A 1 53  ? 13.148  -2.595  10.382  1.00 0.63 ? 53  ASP A O    6  
ATOM 10599 C CB   . ASP A 1 53  ? 15.118  -2.327  8.005   1.00 0.64 ? 53  ASP A CB   6  
ATOM 10600 C CG   . ASP A 1 53  ? 14.742  -0.887  7.718   1.00 0.60 ? 53  ASP A CG   6  
ATOM 10601 O OD1  . ASP A 1 53  ? 15.515  0.017   8.100   1.00 0.78 ? 53  ASP A OD1  6  
ATOM 10602 O OD2  . ASP A 1 53  ? 13.662  -0.650  7.140   1.00 0.69 ? 53  ASP A OD2  6  
ATOM 10603 H H    . ASP A 1 53  ? 15.197  -4.644  9.240   1.00 0.69 ? 53  ASP A H    6  
ATOM 10604 N N    . ALA A 1 54  ? 14.442  -0.841  10.918  1.00 0.63 ? 54  ALA A N    6  
ATOM 10605 C CA   . ALA A 1 54  ? 13.422  -0.205  11.732  1.00 0.64 ? 54  ALA A CA   6  
ATOM 10606 C C    . ALA A 1 54  ? 12.631  0.826   10.935  1.00 0.60 ? 54  ALA A C    6  
ATOM 10607 O O    . ALA A 1 54  ? 11.559  1.256   11.363  1.00 0.60 ? 54  ALA A O    6  
ATOM 10608 C CB   . ALA A 1 54  ? 14.051  0.431   12.961  1.00 0.71 ? 54  ALA A CB   6  
ATOM 10609 H H    . ALA A 1 54  ? 15.317  -0.407  10.819  1.00 0.67 ? 54  ALA A H    6  
ATOM 10610 N N    . SER A 1 55  ? 13.153  1.212   9.776   1.00 0.58 ? 55  SER A N    6  
ATOM 10611 C CA   . SER A 1 55  ? 12.491  2.197   8.926   1.00 0.57 ? 55  SER A CA   6  
ATOM 10612 C C    . SER A 1 55  ? 11.181  1.645   8.367   1.00 0.52 ? 55  SER A C    6  
ATOM 10613 O O    . SER A 1 55  ? 10.113  2.228   8.566   1.00 0.51 ? 55  SER A O    6  
ATOM 10614 C CB   . SER A 1 55  ? 13.418  2.624   7.786   1.00 0.59 ? 55  SER A CB   6  
ATOM 10615 O OG   . SER A 1 55  ? 14.779  2.510   8.170   1.00 0.67 ? 55  SER A OG   6  
ATOM 10616 H H    . SER A 1 55  ? 14.004  0.822   9.481   1.00 0.60 ? 55  SER A H    6  
ATOM 10617 H HG   . SER A 1 55  ? 15.103  1.622   7.929   1.00 0.67 ? 55  SER A HG   6  
ATOM 10618 N N    . THR A 1 56  ? 11.267  0.511   7.686   1.00 0.51 ? 56  THR A N    6  
ATOM 10619 C CA   . THR A 1 56  ? 10.094  -0.119  7.102   1.00 0.49 ? 56  THR A CA   6  
ATOM 10620 C C    . THR A 1 56  ? 9.123   -0.569  8.188   1.00 0.48 ? 56  THR A C    6  
ATOM 10621 O O    . THR A 1 56  ? 7.903   -0.473  8.028   1.00 0.47 ? 56  THR A O    6  
ATOM 10622 C CB   . THR A 1 56  ? 10.486  -1.325  6.230   1.00 0.50 ? 56  THR A CB   6  
ATOM 10623 O OG1  . THR A 1 56  ? 11.493  -2.092  6.906   1.00 0.57 ? 56  THR A OG1  6  
ATOM 10624 C CG2  . THR A 1 56  ? 11.023  -0.856  4.884   1.00 0.63 ? 56  THR A CG2  6  
ATOM 10625 H H    . THR A 1 56  ? 12.152  0.082   7.570   1.00 0.52 ? 56  THR A H    6  
ATOM 10626 H HG1  . THR A 1 56  ? 12.352  -1.642  6.825   1.00 0.55 ? 56  THR A HG1  6  
ATOM 10627 N N    . LYS A 1 57  ? 9.676   -1.047  9.294   1.00 0.50 ? 57  LYS A N    6  
ATOM 10628 C CA   . LYS A 1 57  ? 8.869   -1.507  10.415  1.00 0.52 ? 57  LYS A CA   6  
ATOM 10629 C C    . LYS A 1 57  ? 8.081   -0.345  11.015  1.00 0.52 ? 57  LYS A C    6  
ATOM 10630 O O    . LYS A 1 57  ? 6.899   -0.483  11.331  1.00 0.53 ? 57  LYS A O    6  
ATOM 10631 C CB   . LYS A 1 57  ? 9.748   -2.172  11.474  1.00 0.56 ? 57  LYS A CB   6  
ATOM 10632 C CG   . LYS A 1 57  ? 9.013   -3.162  12.359  1.00 1.01 ? 57  LYS A CG   6  
ATOM 10633 C CD   . LYS A 1 57  ? 9.983   -4.131  13.013  1.00 1.09 ? 57  LYS A CD   6  
ATOM 10634 C CE   . LYS A 1 57  ? 9.255   -5.221  13.783  1.00 1.30 ? 57  LYS A CE   6  
ATOM 10635 N NZ   . LYS A 1 57  ? 8.615   -4.705  15.022  1.00 1.59 ? 57  LYS A NZ   6  
ATOM 10636 H H    . LYS A 1 57  ? 10.653  -1.105  9.351   1.00 0.52 ? 57  LYS A H    6  
ATOM 10637 H HZ1  . LYS A 1 57  ? 9.265   -4.070  15.526  1.00 1.92 ? 57  LYS A HZ1  6  
ATOM 10638 H HZ2  . LYS A 1 57  ? 8.370   -5.496  15.651  1.00 1.99 ? 57  LYS A HZ2  6  
ATOM 10639 H HZ3  . LYS A 1 57  ? 7.748   -4.183  14.789  1.00 1.99 ? 57  LYS A HZ3  6  
ATOM 10640 N N    . LYS A 1 58  ? 8.740   0.806   11.146  1.00 0.54 ? 58  LYS A N    6  
ATOM 10641 C CA   . LYS A 1 58  ? 8.099   2.000   11.687  1.00 0.56 ? 58  LYS A CA   6  
ATOM 10642 C C    . LYS A 1 58  ? 6.985   2.457   10.756  1.00 0.54 ? 58  LYS A C    6  
ATOM 10643 O O    . LYS A 1 58  ? 5.903   2.830   11.206  1.00 0.55 ? 58  LYS A O    6  
ATOM 10644 C CB   . LYS A 1 58  ? 9.113   3.132   11.880  1.00 0.60 ? 58  LYS A CB   6  
ATOM 10645 C CG   . LYS A 1 58  ? 8.560   4.336   12.626  1.00 0.70 ? 58  LYS A CG   6  
ATOM 10646 C CD   . LYS A 1 58  ? 9.612   5.417   12.796  1.00 0.76 ? 58  LYS A CD   6  
ATOM 10647 C CE   . LYS A 1 58  ? 9.097   6.553   13.664  1.00 1.16 ? 58  LYS A CE   6  
ATOM 10648 N NZ   . LYS A 1 58  ? 10.136  7.590   13.884  1.00 1.32 ? 58  LYS A NZ   6  
ATOM 10649 H H    . LYS A 1 58  ? 9.683   0.852   10.874  1.00 0.54 ? 58  LYS A H    6  
ATOM 10650 H HZ1  . LYS A 1 58  ? 10.991  7.162   14.291  1.00 1.74 ? 58  LYS A HZ1  6  
ATOM 10651 H HZ2  . LYS A 1 58  ? 9.785   8.322   14.534  1.00 1.67 ? 58  LYS A HZ2  6  
ATOM 10652 H HZ3  . LYS A 1 58  ? 10.387  8.042   12.983  1.00 1.54 ? 58  LYS A HZ3  6  
ATOM 10653 N N    . LEU A 1 59  ? 7.262   2.414   9.453   1.00 0.52 ? 59  LEU A N    6  
ATOM 10654 C CA   . LEU A 1 59  ? 6.283   2.808   8.446   1.00 0.51 ? 59  LEU A CA   6  
ATOM 10655 C C    . LEU A 1 59  ? 5.057   1.909   8.513   1.00 0.50 ? 59  LEU A C    6  
ATOM 10656 O O    . LEU A 1 59  ? 3.920   2.379   8.432   1.00 0.51 ? 59  LEU A O    6  
ATOM 10657 C CB   . LEU A 1 59  ? 6.900   2.767   7.044   1.00 0.50 ? 59  LEU A CB   6  
ATOM 10658 C CG   . LEU A 1 59  ? 7.860   3.907   6.699   1.00 0.56 ? 59  LEU A CG   6  
ATOM 10659 C CD1  . LEU A 1 59  ? 8.504   3.678   5.341   1.00 0.55 ? 59  LEU A CD1  6  
ATOM 10660 C CD2  . LEU A 1 59  ? 7.132   5.241   6.730   1.00 0.72 ? 59  LEU A CD2  6  
ATOM 10661 H H    . LEU A 1 59  ? 8.155   2.122   9.163   1.00 0.52 ? 59  LEU A H    6  
ATOM 10662 N N    . SER A 1 60  ? 5.296   0.616   8.679   1.00 0.50 ? 60  SER A N    6  
ATOM 10663 C CA   . SER A 1 60  ? 4.214   -0.349  8.774   1.00 0.50 ? 60  SER A CA   6  
ATOM 10664 C C    . SER A 1 60  ? 3.414   -0.118  10.056  1.00 0.51 ? 60  SER A C    6  
ATOM 10665 O O    . SER A 1 60  ? 2.200   -0.320  10.088  1.00 0.53 ? 60  SER A O    6  
ATOM 10666 C CB   . SER A 1 60  ? 4.774   -1.772  8.736   1.00 0.50 ? 60  SER A CB   6  
ATOM 10667 O OG   . SER A 1 60  ? 5.621   -1.955  7.612   1.00 0.50 ? 60  SER A OG   6  
ATOM 10668 H H    . SER A 1 60  ? 6.225   0.303   8.734   1.00 0.51 ? 60  SER A H    6  
ATOM 10669 H HG   . SER A 1 60  ? 6.438   -1.458  7.739   1.00 0.49 ? 60  SER A HG   6  
ATOM 10670 N N    . GLU A 1 61  ? 4.102   0.334   11.099  1.00 0.52 ? 61  GLU A N    6  
ATOM 10671 C CA   . GLU A 1 61  ? 3.472   0.607   12.384  1.00 0.55 ? 61  GLU A CA   6  
ATOM 10672 C C    . GLU A 1 61  ? 2.427   1.708   12.247  1.00 0.55 ? 61  GLU A C    6  
ATOM 10673 O O    . GLU A 1 61  ? 1.264   1.524   12.616  1.00 0.57 ? 61  GLU A O    6  
ATOM 10674 C CB   . GLU A 1 61  ? 4.528   1.019   13.412  1.00 0.60 ? 61  GLU A CB   6  
ATOM 10675 C CG   . GLU A 1 61  ? 4.270   0.521   14.826  1.00 0.81 ? 61  GLU A CG   6  
ATOM 10676 C CD   . GLU A 1 61  ? 2.979   1.043   15.423  1.00 1.12 ? 61  GLU A CD   6  
ATOM 10677 O OE1  . GLU A 1 61  ? 2.818   2.278   15.522  1.00 1.35 ? 61  GLU A OE1  6  
ATOM 10678 O OE2  . GLU A 1 61  ? 2.123   0.219   15.807  1.00 1.50 ? 61  GLU A OE2  6  
ATOM 10679 H H    . GLU A 1 61  ? 5.067   0.484   10.999  1.00 0.52 ? 61  GLU A H    6  
ATOM 10680 N N    . CYS A 1 62  ? 2.838   2.849   11.701  1.00 0.55 ? 62  CYS A N    6  
ATOM 10681 C CA   . CYS A 1 62  ? 1.926   3.968   11.525  1.00 0.57 ? 62  CYS A CA   6  
ATOM 10682 C C    . CYS A 1 62  ? 0.765   3.605   10.607  1.00 0.56 ? 62  CYS A C    6  
ATOM 10683 O O    . CYS A 1 62  ? -0.383  3.926   10.902  1.00 0.60 ? 62  CYS A O    6  
ATOM 10684 C CB   . CYS A 1 62  ? 2.651   5.231   11.047  1.00 0.60 ? 62  CYS A CB   6  
ATOM 10685 S SG   . CYS A 1 62  ? 4.056   4.946   9.947   1.00 0.59 ? 62  CYS A SG   6  
ATOM 10686 H H    . CYS A 1 62  ? 3.775   2.938   11.411  1.00 0.55 ? 62  CYS A H    6  
ATOM 10687 H HG   . CYS A 1 62  ? 3.754   3.939   9.135   1.00 0.98 ? 62  CYS A HG   6  
ATOM 10688 N N    . LEU A 1 63  ? 1.058   2.909   9.512   1.00 0.52 ? 63  LEU A N    6  
ATOM 10689 C CA   . LEU A 1 63  ? 0.018   2.507   8.570   1.00 0.53 ? 63  LEU A CA   6  
ATOM 10690 C C    . LEU A 1 63  ? -0.983  1.572   9.240   1.00 0.52 ? 63  LEU A C    6  
ATOM 10691 O O    . LEU A 1 63  ? -2.192  1.717   9.068   1.00 0.53 ? 63  LEU A O    6  
ATOM 10692 C CB   . LEU A 1 63  ? 0.631   1.830   7.341   1.00 0.53 ? 63  LEU A CB   6  
ATOM 10693 C CG   . LEU A 1 63  ? 1.389   2.744   6.376   1.00 0.55 ? 63  LEU A CG   6  
ATOM 10694 C CD1  . LEU A 1 63  ? 2.013   1.930   5.251   1.00 0.57 ? 63  LEU A CD1  6  
ATOM 10695 C CD2  . LEU A 1 63  ? 0.466   3.818   5.817   1.00 0.62 ? 63  LEU A CD2  6  
ATOM 10696 H H    . LEU A 1 63  ? 1.991   2.660   9.333   1.00 0.50 ? 63  LEU A H    6  
ATOM 10697 N N    . LYS A 1 64  ? -0.464  0.628   10.019  1.00 0.52 ? 64  LYS A N    6  
ATOM 10698 C CA   . LYS A 1 64  ? -1.290  -0.340  10.727  1.00 0.54 ? 64  LYS A CA   6  
ATOM 10699 C C    . LYS A 1 64  ? -2.227  0.339   11.722  1.00 0.54 ? 64  LYS A C    6  
ATOM 10700 O O    . LYS A 1 64  ? -3.434  0.092   11.720  1.00 0.54 ? 64  LYS A O    6  
ATOM 10701 C CB   . LYS A 1 64  ? -0.402  -1.371  11.441  1.00 0.59 ? 64  LYS A CB   6  
ATOM 10702 C CG   . LYS A 1 64  ? -1.073  -2.106  12.592  1.00 0.71 ? 64  LYS A CG   6  
ATOM 10703 C CD   . LYS A 1 64  ? -0.421  -1.765  13.925  1.00 0.88 ? 64  LYS A CD   6  
ATOM 10704 C CE   . LYS A 1 64  ? 0.888   -2.518  14.121  1.00 0.86 ? 64  LYS A CE   6  
ATOM 10705 N NZ   . LYS A 1 64  ? 0.665   -3.965  14.383  1.00 0.78 ? 64  LYS A NZ   6  
ATOM 10706 H H    . LYS A 1 64  ? 0.516   0.577   10.115  1.00 0.52 ? 64  LYS A H    6  
ATOM 10707 H HZ1  . LYS A 1 64  ? 0.226   -4.420  13.548  1.00 0.95 ? 64  LYS A HZ1  6  
ATOM 10708 H HZ2  . LYS A 1 64  ? 0.033   -4.090  15.198  1.00 1.03 ? 64  LYS A HZ2  6  
ATOM 10709 H HZ3  . LYS A 1 64  ? 1.567   -4.439  14.582  1.00 0.96 ? 64  LYS A HZ3  6  
ATOM 10710 N N    . ARG A 1 65  ? -1.675  1.208   12.564  1.00 0.57 ? 65  ARG A N    6  
ATOM 10711 C CA   . ARG A 1 65  ? -2.481  1.892   13.565  1.00 0.59 ? 65  ARG A CA   6  
ATOM 10712 C C    . ARG A 1 65  ? -3.464  2.882   12.947  1.00 0.57 ? 65  ARG A C    6  
ATOM 10713 O O    . ARG A 1 65  ? -4.607  2.973   13.386  1.00 0.60 ? 65  ARG A O    6  
ATOM 10714 C CB   . ARG A 1 65  ? -1.627  2.525   14.667  1.00 0.66 ? 65  ARG A CB   6  
ATOM 10715 C CG   . ARG A 1 65  ? -0.787  3.719   14.243  1.00 0.66 ? 65  ARG A CG   6  
ATOM 10716 C CD   . ARG A 1 65  ? 0.204   4.099   15.331  1.00 0.75 ? 65  ARG A CD   6  
ATOM 10717 N NE   . ARG A 1 65  ? -0.414  4.106   16.657  1.00 0.86 ? 65  ARG A NE   6  
ATOM 10718 C CZ   . ARG A 1 65  ? -0.010  3.338   17.674  1.00 1.00 ? 65  ARG A CZ   6  
ATOM 10719 N NH1  . ARG A 1 65  ? 1.021   2.513   17.528  1.00 1.05 ? 65  ARG A NH1  6  
ATOM 10720 N NH2  . ARG A 1 65  ? -0.642  3.392   18.839  1.00 1.19 ? 65  ARG A NH2  6  
ATOM 10721 H H    . ARG A 1 65  ? -0.709  1.391   12.509  1.00 0.58 ? 65  ARG A H    6  
ATOM 10722 H HE   . ARG A 1 65  ? -1.179  4.710   16.793  1.00 0.91 ? 65  ARG A HE   6  
ATOM 10723 H HH11 . ARG A 1 65  ? 1.514   2.459   16.647  1.00 0.95 ? 65  ARG A HH11 6  
ATOM 10724 H HH12 . ARG A 1 65  ? 1.308   1.930   18.288  1.00 1.24 ? 65  ARG A HH12 6  
ATOM 10725 H HH21 . ARG A 1 65  ? -1.425  4.008   18.965  1.00 1.21 ? 65  ARG A HH21 6  
ATOM 10726 H HH22 . ARG A 1 65  ? -0.346  2.808   19.598  1.00 1.36 ? 65  ARG A HH22 6  
ATOM 10727 N N    . ILE A 1 66  ? -3.031  3.599   11.915  1.00 0.53 ? 66  ILE A N    6  
ATOM 10728 C CA   . ILE A 1 66  ? -3.904  4.563   11.249  1.00 0.52 ? 66  ILE A CA   6  
ATOM 10729 C C    . ILE A 1 66  ? -5.059  3.830   10.572  1.00 0.48 ? 66  ILE A C    6  
ATOM 10730 O O    . ILE A 1 66  ? -6.210  4.264   10.636  1.00 0.48 ? 66  ILE A O    6  
ATOM 10731 C CB   . ILE A 1 66  ? -3.140  5.441   10.226  1.00 0.54 ? 66  ILE A CB   6  
ATOM 10732 C CG1  . ILE A 1 66  ? -2.222  6.425   10.960  1.00 0.59 ? 66  ILE A CG1  6  
ATOM 10733 C CG2  . ILE A 1 66  ? -4.107  6.194   9.319   1.00 0.55 ? 66  ILE A CG2  6  
ATOM 10734 C CD1  . ILE A 1 66  ? -1.299  7.209   10.051  1.00 0.62 ? 66  ILE A CD1  6  
ATOM 10735 H H    . ILE A 1 66  ? -2.113  3.474   11.588  1.00 0.54 ? 66  ILE A H    6  
ATOM 10736 N N    . GLY A 1 67  ? -4.746  2.696   9.954   1.00 0.47 ? 67  GLY A N    6  
ATOM 10737 C CA   . GLY A 1 67  ? -5.760  1.901   9.291   1.00 0.45 ? 67  GLY A CA   6  
ATOM 10738 C C    . GLY A 1 67  ? -6.789  1.376   10.274  1.00 0.45 ? 67  GLY A C    6  
ATOM 10739 O O    . GLY A 1 67  ? -7.981  1.325   9.968   1.00 0.44 ? 67  GLY A O    6  
ATOM 10740 H H    . GLY A 1 67  ? -3.811  2.397   9.941   1.00 0.49 ? 67  GLY A H    6  
ATOM 10741 N N    . ASP A 1 68  ? -6.327  0.999   11.465  1.00 0.50 ? 68  ASP A N    6  
ATOM 10742 C CA   . ASP A 1 68  ? -7.214  0.485   12.504  1.00 0.55 ? 68  ASP A CA   6  
ATOM 10743 C C    . ASP A 1 68  ? -8.126  1.593   13.025  1.00 0.54 ? 68  ASP A C    6  
ATOM 10744 O O    . ASP A 1 68  ? -9.275  1.348   13.400  1.00 0.55 ? 68  ASP A O    6  
ATOM 10745 C CB   . ASP A 1 68  ? -6.405  -0.124  13.653  1.00 0.65 ? 68  ASP A CB   6  
ATOM 10746 C CG   . ASP A 1 68  ? -7.082  -1.333  14.271  1.00 0.76 ? 68  ASP A CG   6  
ATOM 10747 O OD1  . ASP A 1 68  ? -7.263  -2.347  13.562  1.00 0.95 ? 68  ASP A OD1  6  
ATOM 10748 O OD2  . ASP A 1 68  ? -7.424  -1.289  15.473  1.00 1.13 ? 68  ASP A OD2  6  
ATOM 10749 H H    . ASP A 1 68  ? -5.363  1.062   11.646  1.00 0.53 ? 68  ASP A H    6  
ATOM 10750 N N    . GLU A 1 69  ? -7.612  2.818   13.027  1.00 0.55 ? 69  GLU A N    6  
ATOM 10751 C CA   . GLU A 1 69  ? -8.378  3.973   13.479  1.00 0.58 ? 69  GLU A CA   6  
ATOM 10752 C C    . GLU A 1 69  ? -9.467  4.310   12.465  1.00 0.53 ? 69  GLU A C    6  
ATOM 10753 O O    . GLU A 1 69  ? -10.484 4.918   12.798  1.00 0.58 ? 69  GLU A O    6  
ATOM 10754 C CB   . GLU A 1 69  ? -7.462  5.180   13.693  1.00 0.63 ? 69  GLU A CB   6  
ATOM 10755 C CG   . GLU A 1 69  ? -6.439  4.998   14.804  1.00 0.89 ? 69  GLU A CG   6  
ATOM 10756 C CD   . GLU A 1 69  ? -7.012  5.221   16.188  1.00 1.22 ? 69  GLU A CD   6  
ATOM 10757 O OE1  . GLU A 1 69  ? -8.188  4.871   16.423  1.00 1.81 ? 69  GLU A OE1  6  
ATOM 10758 O OE2  . GLU A 1 69  ? -6.282  5.748   17.055  1.00 1.90 ? 69  GLU A OE2  6  
ATOM 10759 H H    . GLU A 1 69  ? -6.688  2.948   12.716  1.00 0.56 ? 69  GLU A H    6  
ATOM 10760 N N    . LEU A 1 70  ? -9.247  3.892   11.223  1.00 0.48 ? 70  LEU A N    6  
ATOM 10761 C CA   . LEU A 1 70  ? -10.204 4.118   10.148  1.00 0.46 ? 70  LEU A CA   6  
ATOM 10762 C C    . LEU A 1 70  ? -11.175 2.947   10.066  1.00 0.41 ? 70  LEU A C    6  
ATOM 10763 O O    . LEU A 1 70  ? -11.954 2.826   9.117   1.00 0.38 ? 70  LEU A O    6  
ATOM 10764 C CB   . LEU A 1 70  ? -9.474  4.283   8.813   1.00 0.45 ? 70  LEU A CB   6  
ATOM 10765 C CG   . LEU A 1 70  ? -8.611  5.536   8.662   1.00 0.51 ? 70  LEU A CG   6  
ATOM 10766 C CD1  . LEU A 1 70  ? -7.653  5.377   7.494   1.00 0.51 ? 70  LEU A CD1  6  
ATOM 10767 C CD2  . LEU A 1 70  ? -9.484  6.767   8.474   1.00 0.59 ? 70  LEU A CD2  6  
ATOM 10768 H H    . LEU A 1 70  ? -8.411  3.418   11.022  1.00 0.48 ? 70  LEU A H    6  
ATOM 10769 N N    . ASP A 1 71  ? -11.109 2.072   11.057  1.00 0.43 ? 71  ASP A N    6  
ATOM 10770 C CA   . ASP A 1 71  ? -11.978 0.905   11.113  1.00 0.41 ? 71  ASP A CA   6  
ATOM 10771 C C    . ASP A 1 71  ? -13.000 1.054   12.235  1.00 0.43 ? 71  ASP A C    6  
ATOM 10772 O O    . ASP A 1 71  ? -13.995 0.329   12.288  1.00 0.48 ? 71  ASP A O    6  
ATOM 10773 C CB   . ASP A 1 71  ? -11.146 -0.366  11.313  1.00 0.46 ? 71  ASP A CB   6  
ATOM 10774 C CG   . ASP A 1 71  ? -11.934 -1.641  11.075  1.00 0.54 ? 71  ASP A CG   6  
ATOM 10775 O OD1  . ASP A 1 71  ? -12.440 -1.829  9.947   1.00 0.61 ? 71  ASP A OD1  6  
ATOM 10776 O OD2  . ASP A 1 71  ? -12.033 -2.468  12.006  1.00 1.07 ? 71  ASP A OD2  6  
ATOM 10777 H H    . ASP A 1 71  ? -10.443 2.208   11.765  1.00 0.48 ? 71  ASP A H    6  
ATOM 10778 N N    . SER A 1 72  ? -12.756 2.012   13.123  1.00 0.46 ? 72  SER A N    6  
ATOM 10779 C CA   . SER A 1 72  ? -13.648 2.264   14.248  1.00 0.50 ? 72  SER A CA   6  
ATOM 10780 C C    . SER A 1 72  ? -14.922 2.985   13.808  1.00 0.47 ? 72  SER A C    6  
ATOM 10781 O O    . SER A 1 72  ? -15.947 2.934   14.492  1.00 0.54 ? 72  SER A O    6  
ATOM 10782 C CB   . SER A 1 72  ? -12.917 3.076   15.317  1.00 0.58 ? 72  SER A CB   6  
ATOM 10783 O OG   . SER A 1 72  ? -11.584 3.343   14.910  1.00 0.65 ? 72  SER A OG   6  
ATOM 10784 H H    . SER A 1 72  ? -11.947 2.559   13.028  1.00 0.49 ? 72  SER A H    6  
ATOM 10785 H HG   . SER A 1 72  ? -11.446 4.297   14.882  1.00 1.14 ? 72  SER A HG   6  
ATOM 10786 N N    . ASN A 1 73  ? -14.858 3.654   12.665  1.00 0.47 ? 73  ASN A N    6  
ATOM 10787 C CA   . ASN A 1 73  ? -16.010 4.383   12.136  1.00 0.47 ? 73  ASN A CA   6  
ATOM 10788 C C    . ASN A 1 73  ? -16.996 3.435   11.460  1.00 0.45 ? 73  ASN A C    6  
ATOM 10789 O O    . ASN A 1 73  ? -16.687 2.831   10.429  1.00 0.45 ? 73  ASN A O    6  
ATOM 10790 C CB   . ASN A 1 73  ? -15.576 5.496   11.173  1.00 0.49 ? 73  ASN A CB   6  
ATOM 10791 C CG   . ASN A 1 73  ? -14.313 5.159   10.400  1.00 0.49 ? 73  ASN A CG   6  
ATOM 10792 O OD1  . ASN A 1 73  ? -13.336 5.905   10.436  1.00 0.70 ? 73  ASN A OD1  6  
ATOM 10793 N ND2  . ASN A 1 73  ? -14.321 4.031   9.707   1.00 0.62 ? 73  ASN A ND2  6  
ATOM 10794 H H    . ASN A 1 73  ? -14.019 3.654   12.160  1.00 0.53 ? 73  ASN A H    6  
ATOM 10795 H HD21 . ASN A 1 73  ? -15.134 3.480   9.727   1.00 0.86 ? 73  ASN A HD21 6  
ATOM 10796 H HD22 . ASN A 1 73  ? -13.511 3.789   9.200   1.00 0.63 ? 73  ASN A HD22 6  
ATOM 10797 N N    . MET A 1 74  ? -18.183 3.317   12.041  1.00 0.48 ? 74  MET A N    6  
ATOM 10798 C CA   . MET A 1 74  ? -19.219 2.434   11.512  1.00 0.49 ? 74  MET A CA   6  
ATOM 10799 C C    . MET A 1 74  ? -19.713 2.880   10.138  1.00 0.47 ? 74  MET A C    6  
ATOM 10800 O O    . MET A 1 74  ? -20.042 2.049   9.292   1.00 0.46 ? 74  MET A O    6  
ATOM 10801 C CB   . MET A 1 74  ? -20.396 2.323   12.491  1.00 0.57 ? 74  MET A CB   6  
ATOM 10802 C CG   . MET A 1 74  ? -21.107 3.643   12.770  1.00 0.78 ? 74  MET A CG   6  
ATOM 10803 S SD   . MET A 1 74  ? -22.610 3.439   13.748  1.00 0.95 ? 74  MET A SD   6  
ATOM 10804 C CE   . MET A 1 74  ? -23.620 2.489   12.615  1.00 1.32 ? 74  MET A CE   6  
ATOM 10805 H H    . MET A 1 74  ? -18.371 3.842   12.851  1.00 0.53 ? 74  MET A H    6  
ATOM 10806 N N    . GLU A 1 75  ? -19.746 4.188   9.916   1.00 0.49 ? 75  GLU A N    6  
ATOM 10807 C CA   . GLU A 1 75  ? -20.211 4.746   8.650   1.00 0.52 ? 75  GLU A CA   6  
ATOM 10808 C C    . GLU A 1 75  ? -19.360 4.262   7.483   1.00 0.48 ? 75  GLU A C    6  
ATOM 10809 O O    . GLU A 1 75  ? -19.876 3.700   6.516   1.00 0.51 ? 75  GLU A O    6  
ATOM 10810 C CB   . GLU A 1 75  ? -20.208 6.274   8.703   1.00 0.61 ? 75  GLU A CB   6  
ATOM 10811 C CG   . GLU A 1 75  ? -20.895 6.855   9.928   1.00 0.72 ? 75  GLU A CG   6  
ATOM 10812 C CD   . GLU A 1 75  ? -19.931 7.151   11.057  1.00 1.09 ? 75  GLU A CD   6  
ATOM 10813 O OE1  . GLU A 1 75  ? -19.159 6.249   11.445  1.00 1.49 ? 75  GLU A OE1  6  
ATOM 10814 O OE2  . GLU A 1 75  ? -19.950 8.287   11.569  1.00 1.63 ? 75  GLU A OE2  6  
ATOM 10815 H H    . GLU A 1 75  ? -19.449 4.804   10.629  1.00 0.51 ? 75  GLU A H    6  
ATOM 10816 N N    . LEU A 1 76  ? -18.054 4.474   7.585   1.00 0.45 ? 76  LEU A N    6  
ATOM 10817 C CA   . LEU A 1 76  ? -17.130 4.060   6.538   1.00 0.44 ? 76  LEU A CA   6  
ATOM 10818 C C    . LEU A 1 76  ? -17.114 2.543   6.410   1.00 0.40 ? 76  LEU A C    6  
ATOM 10819 O O    . LEU A 1 76  ? -17.003 2.006   5.309   1.00 0.39 ? 76  LEU A O    6  
ATOM 10820 C CB   . LEU A 1 76  ? -15.721 4.593   6.809   1.00 0.48 ? 76  LEU A CB   6  
ATOM 10821 C CG   . LEU A 1 76  ? -14.694 4.398   5.688   1.00 0.49 ? 76  LEU A CG   6  
ATOM 10822 C CD1  . LEU A 1 76  ? -15.072 5.218   4.462   1.00 0.53 ? 76  LEU A CD1  6  
ATOM 10823 C CD2  . LEU A 1 76  ? -13.298 4.761   6.169   1.00 0.53 ? 76  LEU A CD2  6  
ATOM 10824 H H    . LEU A 1 76  ? -17.707 4.921   8.382   1.00 0.48 ? 76  LEU A H    6  
ATOM 10825 N N    . GLN A 1 77  ? -17.243 1.857   7.542   1.00 0.39 ? 77  GLN A N    6  
ATOM 10826 C CA   . GLN A 1 77  ? -17.253 0.399   7.555   1.00 0.38 ? 77  GLN A CA   6  
ATOM 10827 C C    . GLN A 1 77  ? -18.448 -0.117  6.756   1.00 0.37 ? 77  GLN A C    6  
ATOM 10828 O O    . GLN A 1 77  ? -18.320 -1.040  5.948   1.00 0.38 ? 77  GLN A O    6  
ATOM 10829 C CB   . GLN A 1 77  ? -17.313 -0.119  8.991   1.00 0.40 ? 77  GLN A CB   6  
ATOM 10830 C CG   . GLN A 1 77  ? -16.553 -1.415  9.213   1.00 0.41 ? 77  GLN A CG   6  
ATOM 10831 C CD   . GLN A 1 77  ? -16.920 -2.085  10.520  1.00 0.47 ? 77  GLN A CD   6  
ATOM 10832 O OE1  . GLN A 1 77  ? -17.829 -2.909  10.573  1.00 0.54 ? 77  GLN A OE1  6  
ATOM 10833 N NE2  . GLN A 1 77  ? -16.219 -1.732  11.584  1.00 0.54 ? 77  GLN A NE2  6  
ATOM 10834 H H    . GLN A 1 77  ? -17.338 2.344   8.387   1.00 0.41 ? 77  GLN A H    6  
ATOM 10835 H HE21 . GLN A 1 77  ? -15.503 -1.068  11.474  1.00 0.57 ? 77  GLN A HE21 6  
ATOM 10836 H HE22 . GLN A 1 77  ? -16.436 -2.157  12.440  1.00 0.61 ? 77  GLN A HE22 6  
ATOM 10837 N N    . ARG A 1 78  ? -19.603 0.499   6.979   1.00 0.40 ? 78  ARG A N    6  
ATOM 10838 C CA   . ARG A 1 78  ? -20.822 0.129   6.278   1.00 0.42 ? 78  ARG A CA   6  
ATOM 10839 C C    . ARG A 1 78  ? -20.673 0.398   4.784   1.00 0.40 ? 78  ARG A C    6  
ATOM 10840 O O    . ARG A 1 78  ? -21.160 -0.367  3.953   1.00 0.42 ? 78  ARG A O    6  
ATOM 10841 C CB   . ARG A 1 78  ? -22.016 0.904   6.839   1.00 0.49 ? 78  ARG A CB   6  
ATOM 10842 C CG   . ARG A 1 78  ? -23.282 0.782   6.008   1.00 0.97 ? 78  ARG A CG   6  
ATOM 10843 C CD   . ARG A 1 78  ? -24.377 1.696   6.527   1.00 1.17 ? 78  ARG A CD   6  
ATOM 10844 N NE   . ARG A 1 78  ? -25.340 2.034   5.480   1.00 1.41 ? 78  ARG A NE   6  
ATOM 10845 C CZ   . ARG A 1 78  ? -26.460 1.348   5.245   1.00 1.68 ? 78  ARG A CZ   6  
ATOM 10846 N NH1  . ARG A 1 78  ? -26.783 0.309   6.008   1.00 1.85 ? 78  ARG A NH1  6  
ATOM 10847 N NH2  . ARG A 1 78  ? -27.265 1.710   4.255   1.00 2.19 ? 78  ARG A NH2  6  
ATOM 10848 H H    . ARG A 1 78  ? -19.639 1.222   7.645   1.00 0.41 ? 78  ARG A H    6  
ATOM 10849 H HE   . ARG A 1 78  ? -25.132 2.816   4.916   1.00 1.72 ? 78  ARG A HE   6  
ATOM 10850 H HH11 . ARG A 1 78  ? -26.189 0.035   6.769   1.00 1.82 ? 78  ARG A HH11 6  
ATOM 10851 H HH12 . ARG A 1 78  ? -27.626 -0.208  5.826   1.00 2.25 ? 78  ARG A HH12 6  
ATOM 10852 H HH21 . ARG A 1 78  ? -27.039 2.501   3.676   1.00 2.44 ? 78  ARG A HH21 6  
ATOM 10853 H HH22 . ARG A 1 78  ? -28.113 1.198   4.084   1.00 2.49 ? 78  ARG A HH22 6  
ATOM 10854 N N    . MET A 1 79  ? -19.993 1.492   4.452   1.00 0.41 ? 79  MET A N    6  
ATOM 10855 C CA   . MET A 1 79  ? -19.767 1.862   3.061   1.00 0.43 ? 79  MET A CA   6  
ATOM 10856 C C    . MET A 1 79  ? -18.907 0.819   2.360   1.00 0.40 ? 79  MET A C    6  
ATOM 10857 O O    . MET A 1 79  ? -19.200 0.411   1.237   1.00 0.41 ? 79  MET A O    6  
ATOM 10858 C CB   . MET A 1 79  ? -19.109 3.239   2.959   1.00 0.50 ? 79  MET A CB   6  
ATOM 10859 C CG   . MET A 1 79  ? -20.014 4.395   3.341   1.00 0.67 ? 79  MET A CG   6  
ATOM 10860 S SD   . MET A 1 79  ? -19.262 6.003   3.025   1.00 0.96 ? 79  MET A SD   6  
ATOM 10861 C CE   . MET A 1 79  ? -19.177 5.991   1.235   1.00 1.28 ? 79  MET A CE   6  
ATOM 10862 H H    . MET A 1 79  ? -19.640 2.065   5.165   1.00 0.42 ? 79  MET A H    6  
ATOM 10863 N N    . ILE A 1 80  ? -17.847 0.389   3.037   1.00 0.39 ? 80  ILE A N    6  
ATOM 10864 C CA   . ILE A 1 80  ? -16.942 -0.619  2.491   1.00 0.40 ? 80  ILE A CA   6  
ATOM 10865 C C    . ILE A 1 80  ? -17.685 -1.939  2.298   1.00 0.39 ? 80  ILE A C    6  
ATOM 10866 O O    . ILE A 1 80  ? -17.463 -2.659  1.330   1.00 0.44 ? 80  ILE A O    6  
ATOM 10867 C CB   . ILE A 1 80  ? -15.717 -0.841  3.410   1.00 0.43 ? 80  ILE A CB   6  
ATOM 10868 C CG1  . ILE A 1 80  ? -14.915 0.457   3.575   1.00 0.46 ? 80  ILE A CG1  6  
ATOM 10869 C CG2  . ILE A 1 80  ? -14.827 -1.964  2.890   1.00 0.47 ? 80  ILE A CG2  6  
ATOM 10870 C CD1  . ILE A 1 80  ? -14.359 1.016   2.281   1.00 0.49 ? 80  ILE A CD1  6  
ATOM 10871 H H    . ILE A 1 80  ? -17.664 0.765   3.926   1.00 0.40 ? 80  ILE A H    6  
ATOM 10872 N N    . ALA A 1 81  ? -18.598 -2.230  3.213   1.00 0.39 ? 81  ALA A N    6  
ATOM 10873 C CA   . ALA A 1 81  ? -19.385 -3.456  3.152   1.00 0.44 ? 81  ALA A CA   6  
ATOM 10874 C C    . ALA A 1 81  ? -20.523 -3.334  2.137   1.00 0.46 ? 81  ALA A C    6  
ATOM 10875 O O    . ALA A 1 81  ? -21.364 -4.228  2.017   1.00 0.56 ? 81  ALA A O    6  
ATOM 10876 C CB   . ALA A 1 81  ? -19.928 -3.802  4.528   1.00 0.48 ? 81  ALA A CB   6  
ATOM 10877 H H    . ALA A 1 81  ? -18.747 -1.605  3.957   1.00 0.40 ? 81  ALA A H    6  
ATOM 10878 N N    . ALA A 1 82  ? -20.548 -2.224  1.412   1.00 0.43 ? 82  ALA A N    6  
ATOM 10879 C CA   . ALA A 1 82  ? -21.575 -1.984  0.410   1.00 0.48 ? 82  ALA A CA   6  
ATOM 10880 C C    . ALA A 1 82  ? -20.962 -1.857  -0.981  1.00 0.45 ? 82  ALA A C    6  
ATOM 10881 O O    . ALA A 1 82  ? -21.648 -1.510  -1.944  1.00 0.49 ? 82  ALA A O    6  
ATOM 10882 C CB   . ALA A 1 82  ? -22.376 -0.739  0.756   1.00 0.55 ? 82  ALA A CB   6  
ATOM 10883 H H    . ALA A 1 82  ? -19.857 -1.541  1.561   1.00 0.44 ? 82  ALA A H    6  
ATOM 10884 N N    . VAL A 1 83  ? -19.669 -2.136  -1.082  1.00 0.43 ? 83  VAL A N    6  
ATOM 10885 C CA   . VAL A 1 83  ? -18.977 -2.054  -2.362  1.00 0.44 ? 83  VAL A CA   6  
ATOM 10886 C C    . VAL A 1 83  ? -19.277 -3.282  -3.223  1.00 0.42 ? 83  VAL A C    6  
ATOM 10887 O O    . VAL A 1 83  ? -19.302 -4.416  -2.730  1.00 0.52 ? 83  VAL A O    6  
ATOM 10888 C CB   . VAL A 1 83  ? -17.451 -1.846  -2.202  1.00 0.51 ? 83  VAL A CB   6  
ATOM 10889 C CG1  . VAL A 1 83  ? -16.755 -3.106  -1.704  1.00 0.54 ? 83  VAL A CG1  6  
ATOM 10890 C CG2  . VAL A 1 83  ? -16.827 -1.355  -3.499  1.00 0.58 ? 83  VAL A CG2  6  
ATOM 10891 H H    . VAL A 1 83  ? -19.169 -2.403  -0.280  1.00 0.45 ? 83  VAL A H    6  
ATOM 10892 N N    . ASP A 1 84  ? -19.527 -3.049  -4.503  1.00 0.49 ? 84  ASP A N    6  
ATOM 10893 C CA   . ASP A 1 84  ? -19.830 -4.131  -5.427  1.00 0.54 ? 84  ASP A CA   6  
ATOM 10894 C C    . ASP A 1 84  ? -18.560 -4.871  -5.814  1.00 0.45 ? 84  ASP A C    6  
ATOM 10895 O O    . ASP A 1 84  ? -17.741 -4.359  -6.576  1.00 0.49 ? 84  ASP A O    6  
ATOM 10896 C CB   . ASP A 1 84  ? -20.528 -3.601  -6.686  1.00 0.73 ? 84  ASP A CB   6  
ATOM 10897 C CG   . ASP A 1 84  ? -21.844 -2.909  -6.388  1.00 0.86 ? 84  ASP A CG   6  
ATOM 10898 O OD1  . ASP A 1 84  ? -22.881 -3.598  -6.295  1.00 1.14 ? 84  ASP A OD1  6  
ATOM 10899 O OD2  . ASP A 1 84  ? -21.847 -1.665  -6.235  1.00 0.91 ? 84  ASP A OD2  6  
ATOM 10900 H H    . ASP A 1 84  ? -19.504 -2.128  -4.837  1.00 0.60 ? 84  ASP A H    6  
ATOM 10901 N N    . THR A 1 85  ? -18.396 -6.074  -5.279  1.00 0.46 ? 85  THR A N    6  
ATOM 10902 C CA   . THR A 1 85  ? -17.226 -6.888  -5.579  1.00 0.48 ? 85  THR A CA   6  
ATOM 10903 C C    . THR A 1 85  ? -17.418 -7.572  -6.930  1.00 0.48 ? 85  THR A C    6  
ATOM 10904 O O    . THR A 1 85  ? -17.521 -8.796  -7.023  1.00 0.73 ? 85  THR A O    6  
ATOM 10905 C CB   . THR A 1 85  ? -16.983 -7.945  -4.482  1.00 0.64 ? 85  THR A CB   6  
ATOM 10906 O OG1  . THR A 1 85  ? -17.258 -7.365  -3.194  1.00 0.66 ? 85  THR A OG1  6  
ATOM 10907 C CG2  . THR A 1 85  ? -15.536 -8.422  -4.513  1.00 0.77 ? 85  THR A CG2  6  
ATOM 10908 H H    . THR A 1 85  ? -19.091 -6.431  -4.683  1.00 0.53 ? 85  THR A H    6  
ATOM 10909 H HG1  . THR A 1 85  ? -17.740 -6.537  -3.317  1.00 0.70 ? 85  THR A HG1  6  
ATOM 10910 N N    . ASP A 1 86  ? -17.486 -6.755  -7.970  1.00 0.40 ? 86  ASP A N    6  
ATOM 10911 C CA   . ASP A 1 86  ? -17.694 -7.243  -9.322  1.00 0.44 ? 86  ASP A CA   6  
ATOM 10912 C C    . ASP A 1 86  ? -16.378 -7.361  -10.086 1.00 0.41 ? 86  ASP A C    6  
ATOM 10913 O O    . ASP A 1 86  ? -15.908 -8.463  -10.363 1.00 0.57 ? 86  ASP A O    6  
ATOM 10914 C CB   . ASP A 1 86  ? -18.666 -6.318  -10.062 1.00 0.56 ? 86  ASP A CB   6  
ATOM 10915 C CG   . ASP A 1 86  ? -18.814 -6.671  -11.526 1.00 0.67 ? 86  ASP A CG   6  
ATOM 10916 O OD1  . ASP A 1 86  ? -19.388 -7.736  -11.830 1.00 0.86 ? 86  ASP A OD1  6  
ATOM 10917 O OD2  . ASP A 1 86  ? -18.350 -5.884  -12.378 1.00 0.90 ? 86  ASP A OD2  6  
ATOM 10918 H H    . ASP A 1 86  ? -17.393 -5.787  -7.816  1.00 0.49 ? 86  ASP A H    6  
ATOM 10919 N N    . SER A 1 87  ? -15.784 -6.225  -10.413 1.00 0.38 ? 87  SER A N    6  
ATOM 10920 C CA   . SER A 1 87  ? -14.530 -6.205  -11.152 1.00 0.45 ? 87  SER A CA   6  
ATOM 10921 C C    . SER A 1 87  ? -13.424 -5.534  -10.331 1.00 0.36 ? 87  SER A C    6  
ATOM 10922 O O    . SER A 1 87  ? -13.413 -4.315  -10.168 1.00 0.44 ? 87  SER A O    6  
ATOM 10923 C CB   . SER A 1 87  ? -14.733 -5.496  -12.489 1.00 0.69 ? 87  SER A CB   6  
ATOM 10924 O OG   . SER A 1 87  ? -15.822 -6.067  -13.204 1.00 1.31 ? 87  SER A OG   6  
ATOM 10925 H H    . SER A 1 87  ? -16.195 -5.377  -10.153 1.00 0.45 ? 87  SER A H    6  
ATOM 10926 H HG   . SER A 1 87  ? -16.652 -5.855  -12.752 1.00 1.60 ? 87  SER A HG   6  
ATOM 10927 N N    . PRO A 1 88  ? -12.490 -6.343  -9.803  1.00 0.46 ? 88  PRO A N    6  
ATOM 10928 C CA   . PRO A 1 88  ? -11.378 -5.861  -8.964  1.00 0.52 ? 88  PRO A CA   6  
ATOM 10929 C C    . PRO A 1 88  ? -10.507 -4.792  -9.624  1.00 0.42 ? 88  PRO A C    6  
ATOM 10930 O O    . PRO A 1 88  ? -10.397 -3.677  -9.108  1.00 0.37 ? 88  PRO A O    6  
ATOM 10931 C CB   . PRO A 1 88  ? -10.557 -7.126  -8.692  1.00 0.74 ? 88  PRO A CB   6  
ATOM 10932 C CG   . PRO A 1 88  ? -11.517 -8.247  -8.890  1.00 0.89 ? 88  PRO A CG   6  
ATOM 10933 C CD   . PRO A 1 88  ? -12.443 -7.803  -9.984  1.00 0.72 ? 88  PRO A CD   6  
ATOM 10934 N N    . ARG A 1 89  ? -9.892  -5.128  -10.755 1.00 0.44 ? 89  ARG A N    6  
ATOM 10935 C CA   . ARG A 1 89  ? -9.016  -4.188  -11.458 1.00 0.41 ? 89  ARG A CA   6  
ATOM 10936 C C    . ARG A 1 89  ? -9.725  -2.882  -11.799 1.00 0.37 ? 89  ARG A C    6  
ATOM 10937 O O    . ARG A 1 89  ? -9.166  -1.805  -11.602 1.00 0.36 ? 89  ARG A O    6  
ATOM 10938 C CB   . ARG A 1 89  ? -8.401  -4.818  -12.712 1.00 0.55 ? 89  ARG A CB   6  
ATOM 10939 C CG   . ARG A 1 89  ? -7.448  -3.906  -13.483 1.00 0.64 ? 89  ARG A CG   6  
ATOM 10940 C CD   . ARG A 1 89  ? -6.216  -3.528  -12.661 1.00 0.91 ? 89  ARG A CD   6  
ATOM 10941 N NE   . ARG A 1 89  ? -5.144  -2.985  -13.504 1.00 1.11 ? 89  ARG A NE   6  
ATOM 10942 C CZ   . ARG A 1 89  ? -3.997  -2.462  -13.045 1.00 1.40 ? 89  ARG A CZ   6  
ATOM 10943 N NH1  . ARG A 1 89  ? -3.783  -2.353  -11.737 1.00 1.83 ? 89  ARG A NH1  6  
ATOM 10944 N NH2  . ARG A 1 89  ? -3.071  -2.037  -13.897 1.00 1.64 ? 89  ARG A NH2  6  
ATOM 10945 H H    . ARG A 1 89  ? -10.026 -6.027  -11.128 1.00 0.53 ? 89  ARG A H    6  
ATOM 10946 H HE   . ARG A 1 89  ? -5.280  -3.027  -14.480 1.00 1.35 ? 89  ARG A HE   6  
ATOM 10947 H HH11 . ARG A 1 89  ? -4.476  -2.662  -11.089 1.00 1.95 ? 89  ARG A HH11 6  
ATOM 10948 H HH12 . ARG A 1 89  ? -2.924  -1.955  -11.399 1.00 2.22 ? 89  ARG A HH12 6  
ATOM 10949 H HH21 . ARG A 1 89  ? -3.229  -2.102  -14.884 1.00 1.80 ? 89  ARG A HH21 6  
ATOM 10950 H HH22 . ARG A 1 89  ? -2.189  -1.661  -13.559 1.00 1.87 ? 89  ARG A HH22 6  
ATOM 10951 N N    . GLU A 1 90  ? -10.946 -2.980  -12.310 1.00 0.38 ? 90  GLU A N    6  
ATOM 10952 C CA   . GLU A 1 90  ? -11.728 -1.806  -12.671 1.00 0.38 ? 90  GLU A CA   6  
ATOM 10953 C C    . GLU A 1 90  ? -11.914 -0.866  -11.484 1.00 0.36 ? 90  GLU A C    6  
ATOM 10954 O O    . GLU A 1 90  ? -11.625 0.326   -11.581 1.00 0.38 ? 90  GLU A O    6  
ATOM 10955 C CB   . GLU A 1 90  ? -13.087 -2.211  -13.248 1.00 0.41 ? 90  GLU A CB   6  
ATOM 10956 C CG   . GLU A 1 90  ? -13.051 -2.630  -14.712 1.00 0.55 ? 90  GLU A CG   6  
ATOM 10957 C CD   . GLU A 1 90  ? -12.498 -4.027  -14.931 1.00 0.76 ? 90  GLU A CD   6  
ATOM 10958 O OE1  . GLU A 1 90  ? -12.164 -4.712  -13.941 1.00 1.10 ? 90  GLU A OE1  6  
ATOM 10959 O OE2  . GLU A 1 90  ? -12.410 -4.454  -16.102 1.00 1.46 ? 90  GLU A OE2  6  
ATOM 10960 H H    . GLU A 1 90  ? -11.329 -3.874  -12.473 1.00 0.42 ? 90  GLU A H    6  
ATOM 10961 N N    . VAL A 1 91  ? -12.377 -1.405  -10.361 1.00 0.34 ? 91  VAL A N    6  
ATOM 10962 C CA   . VAL A 1 91  ? -12.593 -0.597  -9.163  1.00 0.36 ? 91  VAL A CA   6  
ATOM 10963 C C    . VAL A 1 91  ? -11.277 -0.004  -8.659  1.00 0.32 ? 91  VAL A C    6  
ATOM 10964 O O    . VAL A 1 91  ? -11.190 1.194   -8.382  1.00 0.34 ? 91  VAL A O    6  
ATOM 10965 C CB   . VAL A 1 91  ? -13.268 -1.402  -8.029  1.00 0.38 ? 91  VAL A CB   6  
ATOM 10966 C CG1  . VAL A 1 91  ? -13.458 -0.537  -6.791  1.00 0.44 ? 91  VAL A CG1  6  
ATOM 10967 C CG2  . VAL A 1 91  ? -14.603 -1.964  -8.488  1.00 0.45 ? 91  VAL A CG2  6  
ATOM 10968 H H    . VAL A 1 91  ? -12.578 -2.368  -10.335 1.00 0.34 ? 91  VAL A H    6  
ATOM 10969 N N    . PHE A 1 92  ? -10.256 -0.848  -8.572  1.00 0.30 ? 92  PHE A N    6  
ATOM 10970 C CA   . PHE A 1 92  ? -8.943  -0.430  -8.095  1.00 0.30 ? 92  PHE A CA   6  
ATOM 10971 C C    . PHE A 1 92  ? -8.335  0.662   -8.974  1.00 0.29 ? 92  PHE A C    6  
ATOM 10972 O O    . PHE A 1 92  ? -7.858  1.678   -8.470  1.00 0.29 ? 92  PHE A O    6  
ATOM 10973 C CB   . PHE A 1 92  ? -7.994  -1.629  -8.004  1.00 0.33 ? 92  PHE A CB   6  
ATOM 10974 C CG   . PHE A 1 92  ? -6.663  -1.309  -7.389  1.00 0.37 ? 92  PHE A CG   6  
ATOM 10975 C CD1  . PHE A 1 92  ? -6.554  -1.065  -6.031  1.00 0.45 ? 92  PHE A CD1  6  
ATOM 10976 C CD2  . PHE A 1 92  ? -5.518  -1.254  -8.169  1.00 0.46 ? 92  PHE A CD2  6  
ATOM 10977 C CE1  . PHE A 1 92  ? -5.332  -0.771  -5.458  1.00 0.53 ? 92  PHE A CE1  6  
ATOM 10978 C CE2  . PHE A 1 92  ? -4.291  -0.960  -7.605  1.00 0.54 ? 92  PHE A CE2  6  
ATOM 10979 C CZ   . PHE A 1 92  ? -4.199  -0.719  -6.246  1.00 0.55 ? 92  PHE A CZ   6  
ATOM 10980 H H    . PHE A 1 92  ? -10.391 -1.788  -8.834  1.00 0.30 ? 92  PHE A H    6  
ATOM 10981 N N    . PHE A 1 93  ? -8.364  0.456   -10.284 1.00 0.31 ? 93  PHE A N    6  
ATOM 10982 C CA   . PHE A 1 93  ? -7.800  1.428   -11.209 1.00 0.34 ? 93  PHE A CA   6  
ATOM 10983 C C    . PHE A 1 93  ? -8.610  2.717   -11.215 1.00 0.34 ? 93  PHE A C    6  
ATOM 10984 O O    . PHE A 1 93  ? -8.050  3.809   -11.293 1.00 0.35 ? 93  PHE A O    6  
ATOM 10985 C CB   . PHE A 1 93  ? -7.695  0.856   -12.626 1.00 0.42 ? 93  PHE A CB   6  
ATOM 10986 C CG   . PHE A 1 93  ? -6.740  1.610   -13.509 1.00 0.60 ? 93  PHE A CG   6  
ATOM 10987 C CD1  . PHE A 1 93  ? -5.373  1.410   -13.402 1.00 0.82 ? 93  PHE A CD1  6  
ATOM 10988 C CD2  . PHE A 1 93  ? -7.208  2.523   -14.441 1.00 0.78 ? 93  PHE A CD2  6  
ATOM 10989 C CE1  . PHE A 1 93  ? -4.490  2.106   -14.207 1.00 1.06 ? 93  PHE A CE1  6  
ATOM 10990 C CE2  . PHE A 1 93  ? -6.331  3.220   -15.250 1.00 1.02 ? 93  PHE A CE2  6  
ATOM 10991 C CZ   . PHE A 1 93  ? -4.969  3.011   -15.132 1.00 1.12 ? 93  PHE A CZ   6  
ATOM 10992 H H    . PHE A 1 93  ? -8.776  -0.366  -10.638 1.00 0.32 ? 93  PHE A H    6  
ATOM 10993 N N    . ARG A 1 94  ? -9.930  2.588   -11.110 1.00 0.35 ? 94  ARG A N    6  
ATOM 10994 C CA   . ARG A 1 94  ? -10.804 3.751   -11.104 1.00 0.37 ? 94  ARG A CA   6  
ATOM 10995 C C    . ARG A 1 94  ? -10.525 4.654   -9.913  1.00 0.33 ? 94  ARG A C    6  
ATOM 10996 O O    . ARG A 1 94  ? -10.291 5.844   -10.086 1.00 0.34 ? 94  ARG A O    6  
ATOM 10997 C CB   . ARG A 1 94  ? -12.278 3.352   -11.144 1.00 0.43 ? 94  ARG A CB   6  
ATOM 10998 C CG   . ARG A 1 94  ? -12.922 3.484   -12.516 1.00 0.55 ? 94  ARG A CG   6  
ATOM 10999 C CD   . ARG A 1 94  ? -12.895 4.922   -13.018 1.00 0.75 ? 94  ARG A CD   6  
ATOM 11000 N NE   . ARG A 1 94  ? -13.484 5.863   -12.057 1.00 0.81 ? 94  ARG A NE   6  
ATOM 11001 C CZ   . ARG A 1 94  ? -14.793 5.997   -11.844 1.00 1.17 ? 94  ARG A CZ   6  
ATOM 11002 N NH1  . ARG A 1 94  ? -15.662 5.282   -12.546 1.00 1.43 ? 94  ARG A NH1  6  
ATOM 11003 N NH2  . ARG A 1 94  ? -15.232 6.861   -10.935 1.00 1.33 ? 94  ARG A NH2  6  
ATOM 11004 H H    . ARG A 1 94  ? -10.323 1.687   -11.036 1.00 0.36 ? 94  ARG A H    6  
ATOM 11005 H HE   . ARG A 1 94  ? -12.856 6.436   -11.540 1.00 0.69 ? 94  ARG A HE   6  
ATOM 11006 H HH11 . ARG A 1 94  ? -15.337 4.638   -13.243 1.00 1.33 ? 94  ARG A HH11 6  
ATOM 11007 H HH12 . ARG A 1 94  ? -16.645 5.383   -12.386 1.00 1.75 ? 94  ARG A HH12 6  
ATOM 11008 H HH21 . ARG A 1 94  ? -14.569 7.422   -10.398 1.00 1.16 ? 94  ARG A HH21 6  
ATOM 11009 H HH22 . ARG A 1 94  ? -16.210 6.959   -10.765 1.00 1.66 ? 94  ARG A HH22 6  
ATOM 11010 N N    . VAL A 1 95  ? -10.525 4.090   -8.711  1.00 0.31 ? 95  VAL A N    6  
ATOM 11011 C CA   . VAL A 1 95  ? -10.268 4.883   -7.510  1.00 0.30 ? 95  VAL A CA   6  
ATOM 11012 C C    . VAL A 1 95  ? -8.849  5.451   -7.508  1.00 0.28 ? 95  VAL A C    6  
ATOM 11013 O O    . VAL A 1 95  ? -8.595  6.518   -6.948  1.00 0.30 ? 95  VAL A O    6  
ATOM 11014 C CB   . VAL A 1 95  ? -10.548 4.112   -6.200  1.00 0.31 ? 95  VAL A CB   6  
ATOM 11015 C CG1  . VAL A 1 95  ? -12.014 3.713   -6.116  1.00 0.37 ? 95  VAL A CG1  6  
ATOM 11016 C CG2  . VAL A 1 95  ? -9.647  2.893   -6.067  1.00 0.29 ? 95  VAL A CG2  6  
ATOM 11017 H H    . VAL A 1 95  ? -10.700 3.125   -8.628  1.00 0.32 ? 95  VAL A H    6  
ATOM 11018 N N    . ALA A 1 96  ? -7.928  4.740   -8.153  1.00 0.27 ? 96  ALA A N    6  
ATOM 11019 C CA   . ALA A 1 96  ? -6.547  5.180   -8.235  1.00 0.29 ? 96  ALA A CA   6  
ATOM 11020 C C    . ALA A 1 96  ? -6.433  6.402   -9.137  1.00 0.30 ? 96  ALA A C    6  
ATOM 11021 O O    . ALA A 1 96  ? -5.691  7.339   -8.839  1.00 0.32 ? 96  ALA A O    6  
ATOM 11022 C CB   . ALA A 1 96  ? -5.658  4.057   -8.747  1.00 0.33 ? 96  ALA A CB   6  
ATOM 11023 H H    . ALA A 1 96  ? -8.187  3.896   -8.581  1.00 0.28 ? 96  ALA A H    6  
ATOM 11024 N N    . ALA A 1 97  ? -7.184  6.389   -10.233 1.00 0.31 ? 97  ALA A N    6  
ATOM 11025 C CA   . ALA A 1 97  ? -7.171  7.491   -11.185 1.00 0.34 ? 97  ALA A CA   6  
ATOM 11026 C C    . ALA A 1 97  ? -8.068  8.635   -10.720 1.00 0.34 ? 97  ALA A C    6  
ATOM 11027 O O    . ALA A 1 97  ? -7.746  9.804   -10.921 1.00 0.38 ? 97  ALA A O    6  
ATOM 11028 C CB   . ALA A 1 97  ? -7.590  7.008   -12.565 1.00 0.38 ? 97  ALA A CB   6  
ATOM 11029 H H    . ALA A 1 97  ? -7.758  5.610   -10.412 1.00 0.30 ? 97  ALA A H    6  
ATOM 11030 N N    . ASP A 1 98  ? -9.186  8.287   -10.094 1.00 0.33 ? 98  ASP A N    6  
ATOM 11031 C CA   . ASP A 1 98  ? -10.144 9.279   -9.591  1.00 0.37 ? 98  ASP A CA   6  
ATOM 11032 C C    . ASP A 1 98  ? -9.477  10.252  -8.629  1.00 0.35 ? 98  ASP A C    6  
ATOM 11033 O O    . ASP A 1 98  ? -9.703  11.461  -8.692  1.00 0.37 ? 98  ASP A O    6  
ATOM 11034 C CB   . ASP A 1 98  ? -11.318 8.594   -8.884  1.00 0.45 ? 98  ASP A CB   6  
ATOM 11035 C CG   . ASP A 1 98  ? -12.471 8.259   -9.815  1.00 0.57 ? 98  ASP A CG   6  
ATOM 11036 O OD1  . ASP A 1 98  ? -12.229 8.018   -11.015 1.00 0.82 ? 98  ASP A OD1  6  
ATOM 11037 O OD2  . ASP A 1 98  ? -13.626 8.213   -9.343  1.00 1.16 ? 98  ASP A OD2  6  
ATOM 11038 H H    . ASP A 1 98  ? -9.390  7.330   -9.977  1.00 0.32 ? 98  ASP A H    6  
ATOM 11039 N N    . MET A 1 99  ? -8.629  9.723   -7.757  1.00 0.35 ? 99  MET A N    6  
ATOM 11040 C CA   . MET A 1 99  ? -7.925  10.546  -6.780  1.00 0.38 ? 99  MET A CA   6  
ATOM 11041 C C    . MET A 1 99  ? -6.725  11.251  -7.411  1.00 0.39 ? 99  MET A C    6  
ATOM 11042 O O    . MET A 1 99  ? -5.974  11.947  -6.733  1.00 0.48 ? 99  MET A O    6  
ATOM 11043 C CB   . MET A 1 99  ? -7.463  9.697   -5.595  1.00 0.39 ? 99  MET A CB   6  
ATOM 11044 C CG   . MET A 1 99  ? -8.582  9.011   -4.832  1.00 0.38 ? 99  MET A CG   6  
ATOM 11045 S SD   . MET A 1 99  ? -7.961  7.815   -3.633  1.00 0.40 ? 99  MET A SD   6  
ATOM 11046 C CE   . MET A 1 99  ? -9.501  7.138   -3.016  1.00 0.42 ? 99  MET A CE   6  
ATOM 11047 H H    . MET A 1 99  ? -8.478  8.752   -7.765  1.00 0.37 ? 99  MET A H    6  
ATOM 11048 N N    . PHE A 1 100 ? -6.541  11.057  -8.709  1.00 0.36 ? 100 PHE A N    6  
ATOM 11049 C CA   . PHE A 1 100 ? -5.432  11.674  -9.423  1.00 0.41 ? 100 PHE A CA   6  
ATOM 11050 C C    . PHE A 1 100 ? -5.943  12.471  -10.618 1.00 0.44 ? 100 PHE A C    6  
ATOM 11051 O O    . PHE A 1 100 ? -5.162  12.926  -11.454 1.00 0.54 ? 100 PHE A O    6  
ATOM 11052 C CB   . PHE A 1 100 ? -4.431  10.608  -9.884  1.00 0.46 ? 100 PHE A CB   6  
ATOM 11053 C CG   . PHE A 1 100 ? -3.012  11.102  -9.973  1.00 0.62 ? 100 PHE A CG   6  
ATOM 11054 C CD1  . PHE A 1 100 ? -2.359  11.583  -8.850  1.00 0.81 ? 100 PHE A CD1  6  
ATOM 11055 C CD2  . PHE A 1 100 ? -2.330  11.079  -11.181 1.00 0.80 ? 100 PHE A CD2  6  
ATOM 11056 C CE1  . PHE A 1 100 ? -1.055  12.033  -8.929  1.00 0.99 ? 100 PHE A CE1  6  
ATOM 11057 C CE2  . PHE A 1 100 ? -1.025  11.525  -11.264 1.00 1.00 ? 100 PHE A CE2  6  
ATOM 11058 C CZ   . PHE A 1 100 ? -0.387  12.003  -10.137 1.00 1.03 ? 100 PHE A CZ   6  
ATOM 11059 H H    . PHE A 1 100 ? -7.168  10.481  -9.203  1.00 0.35 ? 100 PHE A H    6  
ATOM 11060 N N    . SER A 1 101 ? -7.258  12.648  -10.680 1.00 0.53 ? 101 SER A N    6  
ATOM 11061 C CA   . SER A 1 101 ? -7.891  13.385  -11.766 1.00 0.58 ? 101 SER A CA   6  
ATOM 11062 C C    . SER A 1 101 ? -7.397  14.826  -11.793 1.00 0.42 ? 101 SER A C    6  
ATOM 11063 O O    . SER A 1 101 ? -7.039  15.360  -12.845 1.00 0.48 ? 101 SER A O    6  
ATOM 11064 C CB   . SER A 1 101 ? -9.407  13.354  -11.580 1.00 0.80 ? 101 SER A CB   6  
ATOM 11065 O OG   . SER A 1 101 ? -9.747  13.638  -10.231 1.00 1.20 ? 101 SER A OG   6  
ATOM 11066 H H    . SER A 1 101 ? -7.822  12.267  -9.974  1.00 0.65 ? 101 SER A H    6  
ATOM 11067 H HG   . SER A 1 101 ? -10.019 12.822  -9.785  1.00 1.33 ? 101 SER A HG   6  
ATOM 11068 N N    . ASP A 1 102 ? -7.376  15.443  -10.620 1.00 0.45 ? 102 ASP A N    6  
ATOM 11069 C CA   . ASP A 1 102 ? -6.923  16.822  -10.482 1.00 0.53 ? 102 ASP A CA   6  
ATOM 11070 C C    . ASP A 1 102 ? -5.405  16.863  -10.343 1.00 0.45 ? 102 ASP A C    6  
ATOM 11071 O O    . ASP A 1 102 ? -4.773  17.900  -10.541 1.00 0.63 ? 102 ASP A O    6  
ATOM 11072 C CB   . ASP A 1 102 ? -7.581  17.460  -9.255  1.00 0.78 ? 102 ASP A CB   6  
ATOM 11073 C CG   . ASP A 1 102 ? -7.701  18.965  -9.365  1.00 1.07 ? 102 ASP A CG   6  
ATOM 11074 O OD1  . ASP A 1 102 ? -8.533  19.443  -10.164 1.00 1.64 ? 102 ASP A OD1  6  
ATOM 11075 O OD2  . ASP A 1 102 ? -6.976  19.674  -8.643  1.00 1.62 ? 102 ASP A OD2  6  
ATOM 11076 H H    . ASP A 1 102 ? -7.694  14.962  -9.828  1.00 0.56 ? 102 ASP A H    6  
ATOM 11077 N N    . GLY A 1 103 ? -4.829  15.711  -10.009 1.00 0.40 ? 103 GLY A N    6  
ATOM 11078 C CA   . GLY A 1 103 ? -3.392  15.609  -9.839  1.00 0.53 ? 103 GLY A CA   6  
ATOM 11079 C C    . GLY A 1 103 ? -2.897  16.352  -8.614  1.00 0.53 ? 103 GLY A C    6  
ATOM 11080 O O    . GLY A 1 103 ? -1.778  16.865  -8.601  1.00 0.70 ? 103 GLY A O    6  
ATOM 11081 H H    . GLY A 1 103 ? -5.390  14.916  -9.898  1.00 0.46 ? 103 GLY A H    6  
ATOM 11082 N N    . ASN A 1 104 ? -3.731  16.407  -7.583  1.00 0.44 ? 104 ASN A N    6  
ATOM 11083 C CA   . ASN A 1 104 ? -3.377  17.104  -6.352  1.00 0.47 ? 104 ASN A CA   6  
ATOM 11084 C C    . ASN A 1 104 ? -2.565  16.213  -5.421  1.00 0.43 ? 104 ASN A C    6  
ATOM 11085 O O    . ASN A 1 104 ? -3.033  15.163  -4.975  1.00 0.45 ? 104 ASN A O    6  
ATOM 11086 C CB   . ASN A 1 104 ? -4.624  17.627  -5.635  1.00 0.55 ? 104 ASN A CB   6  
ATOM 11087 C CG   . ASN A 1 104 ? -4.289  18.648  -4.563  1.00 0.61 ? 104 ASN A CG   6  
ATOM 11088 O OD1  . ASN A 1 104 ? -4.064  18.303  -3.402  1.00 0.69 ? 104 ASN A OD1  6  
ATOM 11089 N ND2  . ASN A 1 104 ? -4.263  19.914  -4.944  1.00 0.91 ? 104 ASN A ND2  6  
ATOM 11090 H H    . ASN A 1 104 ? -4.602  15.969  -7.649  1.00 0.48 ? 104 ASN A H    6  
ATOM 11091 H HD21 . ASN A 1 104 ? -4.461  20.122  -5.884  1.00 1.15 ? 104 ASN A HD21 6  
ATOM 11092 H HD22 . ASN A 1 104 ? -4.046  20.597  -4.275  1.00 0.98 ? 104 ASN A HD22 6  
ATOM 11093 N N    . PHE A 1 105 ? -1.344  16.637  -5.141  1.00 0.45 ? 105 PHE A N    6  
ATOM 11094 C CA   . PHE A 1 105 ? -0.454  15.890  -4.260  1.00 0.48 ? 105 PHE A CA   6  
ATOM 11095 C C    . PHE A 1 105 ? -0.742  16.232  -2.801  1.00 0.50 ? 105 PHE A C    6  
ATOM 11096 O O    . PHE A 1 105 ? 0.080   16.833  -2.114  1.00 0.60 ? 105 PHE A O    6  
ATOM 11097 C CB   . PHE A 1 105 ? 1.011   16.181  -4.603  1.00 0.60 ? 105 PHE A CB   6  
ATOM 11098 C CG   . PHE A 1 105 ? 1.369   15.889  -6.031  1.00 0.66 ? 105 PHE A CG   6  
ATOM 11099 C CD1  . PHE A 1 105 ? 1.436   14.586  -6.492  1.00 0.66 ? 105 PHE A CD1  6  
ATOM 11100 C CD2  . PHE A 1 105 ? 1.635   16.923  -6.917  1.00 0.81 ? 105 PHE A CD2  6  
ATOM 11101 C CE1  . PHE A 1 105 ? 1.760   14.316  -7.807  1.00 0.75 ? 105 PHE A CE1  6  
ATOM 11102 C CE2  . PHE A 1 105 ? 1.960   16.662  -8.233  1.00 0.91 ? 105 PHE A CE2  6  
ATOM 11103 C CZ   . PHE A 1 105 ? 2.022   15.357  -8.680  1.00 0.86 ? 105 PHE A CZ   6  
ATOM 11104 H H    . PHE A 1 105 ? -1.031  17.482  -5.533  1.00 0.50 ? 105 PHE A H    6  
ATOM 11105 N N    . ASN A 1 106 ? -1.918  15.830  -2.336  1.00 0.45 ? 106 ASN A N    6  
ATOM 11106 C CA   . ASN A 1 106 ? -2.342  16.106  -0.965  1.00 0.48 ? 106 ASN A CA   6  
ATOM 11107 C C    . ASN A 1 106 ? -1.779  15.099  0.033   1.00 0.49 ? 106 ASN A C    6  
ATOM 11108 O O    . ASN A 1 106 ? -1.999  15.231  1.238   1.00 0.52 ? 106 ASN A O    6  
ATOM 11109 C CB   . ASN A 1 106 ? -3.874  16.152  -0.872  1.00 0.48 ? 106 ASN A CB   6  
ATOM 11110 C CG   . ASN A 1 106 ? -4.555  14.894  -1.391  1.00 0.43 ? 106 ASN A CG   6  
ATOM 11111 O OD1  . ASN A 1 106 ? -4.036  13.783  -1.266  1.00 0.44 ? 106 ASN A OD1  6  
ATOM 11112 N ND2  . ASN A 1 106 ? -5.727  15.063  -1.981  1.00 0.55 ? 106 ASN A ND2  6  
ATOM 11113 H H    . ASN A 1 106 ? -2.523  15.338  -2.931  1.00 0.42 ? 106 ASN A H    6  
ATOM 11114 H HD21 . ASN A 1 106 ? -6.085  15.975  -2.049  1.00 0.69 ? 106 ASN A HD21 6  
ATOM 11115 H HD22 . ASN A 1 106 ? -6.189  14.271  -2.326  1.00 0.55 ? 106 ASN A HD22 6  
ATOM 11116 N N    . TRP A 1 107 ? -1.077  14.084  -0.479  1.00 0.46 ? 107 TRP A N    6  
ATOM 11117 C CA   . TRP A 1 107 ? -0.469  13.033  0.351   1.00 0.48 ? 107 TRP A CA   6  
ATOM 11118 C C    . TRP A 1 107 ? -1.498  12.067  0.942   1.00 0.45 ? 107 TRP A C    6  
ATOM 11119 O O    . TRP A 1 107 ? -1.290  10.854  0.941   1.00 0.45 ? 107 TRP A O    6  
ATOM 11120 C CB   . TRP A 1 107 ? 0.438   13.607  1.448   1.00 0.54 ? 107 TRP A CB   6  
ATOM 11121 C CG   . TRP A 1 107 ? 1.900   13.552  1.122   1.00 0.72 ? 107 TRP A CG   6  
ATOM 11122 C CD1  . TRP A 1 107 ? 2.746   14.611  0.951   1.00 1.02 ? 107 TRP A CD1  6  
ATOM 11123 C CD2  . TRP A 1 107 ? 2.692   12.372  0.927   1.00 0.84 ? 107 TRP A CD2  6  
ATOM 11124 N NE1  . TRP A 1 107 ? 4.010   14.164  0.657   1.00 1.24 ? 107 TRP A NE1  6  
ATOM 11125 C CE2  . TRP A 1 107 ? 4.004   12.795  0.640   1.00 1.15 ? 107 TRP A CE2  6  
ATOM 11126 C CE3  . TRP A 1 107 ? 2.421   11.002  0.969   1.00 0.91 ? 107 TRP A CE3  6  
ATOM 11127 C CZ2  . TRP A 1 107 ? 5.040   11.897  0.393   1.00 1.42 ? 107 TRP A CZ2  6  
ATOM 11128 C CZ3  . TRP A 1 107 ? 3.449   10.113  0.725   1.00 1.24 ? 107 TRP A CZ3  6  
ATOM 11129 C CH2  . TRP A 1 107 ? 4.743   10.564  0.439   1.00 1.46 ? 107 TRP A CH2  6  
ATOM 11130 H H    . TRP A 1 107 ? -0.960  14.044  -1.450  1.00 0.45 ? 107 TRP A H    6  
ATOM 11131 H HE1  . TRP A 1 107 ? 4.792   14.736  0.489   1.00 1.49 ? 107 TRP A HE1  6  
ATOM 11132 N N    . GLY A 1 108 ? -2.611  12.606  1.432   1.00 0.46 ? 108 GLY A N    6  
ATOM 11133 C CA   . GLY A 1 108 ? -3.655  11.784  2.025   1.00 0.45 ? 108 GLY A CA   6  
ATOM 11134 C C    . GLY A 1 108 ? -4.203  10.735  1.075   1.00 0.41 ? 108 GLY A C    6  
ATOM 11135 O O    . GLY A 1 108 ? -4.640  9.668   1.505   1.00 0.41 ? 108 GLY A O    6  
ATOM 11136 H H    . GLY A 1 108 ? -2.720  13.582  1.398   1.00 0.47 ? 108 GLY A H    6  
ATOM 11137 N N    . ARG A 1 109 ? -4.163  11.028  -0.222  1.00 0.39 ? 109 ARG A N    6  
ATOM 11138 C CA   . ARG A 1 109 ? -4.656  10.100  -1.235  1.00 0.36 ? 109 ARG A CA   6  
ATOM 11139 C C    . ARG A 1 109 ? -3.806  8.828   -1.301  1.00 0.35 ? 109 ARG A C    6  
ATOM 11140 O O    . ARG A 1 109 ? -4.186  7.850   -1.948  1.00 0.35 ? 109 ARG A O    6  
ATOM 11141 C CB   . ARG A 1 109 ? -4.719  10.773  -2.611  1.00 0.36 ? 109 ARG A CB   6  
ATOM 11142 C CG   . ARG A 1 109 ? -3.376  10.887  -3.319  1.00 0.37 ? 109 ARG A CG   6  
ATOM 11143 C CD   . ARG A 1 109 ? -3.419  10.236  -4.693  1.00 0.36 ? 109 ARG A CD   6  
ATOM 11144 N NE   . ARG A 1 109 ? -3.966  8.876   -4.645  1.00 0.36 ? 109 ARG A NE   6  
ATOM 11145 C CZ   . ARG A 1 109 ? -4.374  8.199   -5.717  1.00 0.36 ? 109 ARG A CZ   6  
ATOM 11146 N NH1  . ARG A 1 109 ? -4.258  8.727   -6.928  1.00 0.35 ? 109 ARG A NH1  6  
ATOM 11147 N NH2  . ARG A 1 109 ? -4.899  6.987   -5.572  1.00 0.40 ? 109 ARG A NH2  6  
ATOM 11148 H H    . ARG A 1 109 ? -3.810  11.899  -0.505  1.00 0.39 ? 109 ARG A H    6  
ATOM 11149 H HE   . ARG A 1 109 ? -4.048  8.458   -3.756  1.00 0.38 ? 109 ARG A HE   6  
ATOM 11150 H HH11 . ARG A 1 109 ? -3.860  9.639   -7.045  1.00 0.35 ? 109 ARG A HH11 6  
ATOM 11151 H HH12 . ARG A 1 109 ? -4.583  8.218   -7.737  1.00 0.35 ? 109 ARG A HH12 6  
ATOM 11152 H HH21 . ARG A 1 109 ? -4.991  6.581   -4.659  1.00 0.43 ? 109 ARG A HH21 6  
ATOM 11153 H HH22 . ARG A 1 109 ? -5.215  6.477   -6.374  1.00 0.42 ? 109 ARG A HH22 6  
ATOM 11154 N N    . VAL A 1 110 ? -2.650  8.851   -0.652  1.00 0.37 ? 110 VAL A N    6  
ATOM 11155 C CA   . VAL A 1 110 ? -1.764  7.698   -0.635  1.00 0.38 ? 110 VAL A CA   6  
ATOM 11156 C C    . VAL A 1 110 ? -2.189  6.725   0.460   1.00 0.38 ? 110 VAL A C    6  
ATOM 11157 O O    . VAL A 1 110 ? -2.424  5.548   0.197   1.00 0.37 ? 110 VAL A O    6  
ATOM 11158 C CB   . VAL A 1 110 ? -0.293  8.112   -0.420  1.00 0.44 ? 110 VAL A CB   6  
ATOM 11159 C CG1  . VAL A 1 110 ? 0.612   6.890   -0.377  1.00 0.47 ? 110 VAL A CG1  6  
ATOM 11160 C CG2  . VAL A 1 110 ? 0.156   9.076   -1.508  1.00 0.46 ? 110 VAL A CG2  6  
ATOM 11161 H H    . VAL A 1 110 ? -2.384  9.667   -0.168  1.00 0.38 ? 110 VAL A H    6  
ATOM 11162 N N    . VAL A 1 111 ? -2.313  7.232   1.682   1.00 0.40 ? 111 VAL A N    6  
ATOM 11163 C CA   . VAL A 1 111 ? -2.717  6.403   2.813   1.00 0.41 ? 111 VAL A CA   6  
ATOM 11164 C C    . VAL A 1 111 ? -4.148  5.890   2.628   1.00 0.39 ? 111 VAL A C    6  
ATOM 11165 O O    . VAL A 1 111 ? -4.477  4.778   3.040   1.00 0.39 ? 111 VAL A O    6  
ATOM 11166 C CB   . VAL A 1 111 ? -2.553  7.135   4.168   1.00 0.46 ? 111 VAL A CB   6  
ATOM 11167 C CG1  . VAL A 1 111 ? -3.387  8.405   4.222   1.00 0.45 ? 111 VAL A CG1  6  
ATOM 11168 C CG2  . VAL A 1 111 ? -2.878  6.214   5.337   1.00 0.50 ? 111 VAL A CG2  6  
ATOM 11169 H H    . VAL A 1 111 ? -2.133  8.183   1.826   1.00 0.41 ? 111 VAL A H    6  
ATOM 11170 N N    . ALA A 1 112 ? -4.987  6.701   1.986   1.00 0.37 ? 112 ALA A N    6  
ATOM 11171 C CA   . ALA A 1 112 ? -6.369  6.319   1.725   1.00 0.36 ? 112 ALA A CA   6  
ATOM 11172 C C    . ALA A 1 112 ? -6.411  5.091   0.822   1.00 0.34 ? 112 ALA A C    6  
ATOM 11173 O O    . ALA A 1 112 ? -7.213  4.179   1.030   1.00 0.34 ? 112 ALA A O    6  
ATOM 11174 C CB   . ALA A 1 112 ? -7.122  7.475   1.083   1.00 0.36 ? 112 ALA A CB   6  
ATOM 11175 H H    . ALA A 1 112 ? -4.672  7.586   1.695   1.00 0.37 ? 112 ALA A H    6  
ATOM 11176 N N    . LEU A 1 113 ? -5.527  5.069   -0.170  1.00 0.34 ? 113 LEU A N    6  
ATOM 11177 C CA   . LEU A 1 113 ? -5.452  3.958   -1.103  1.00 0.33 ? 113 LEU A CA   6  
ATOM 11178 C C    . LEU A 1 113 ? -5.003  2.691   -0.380  1.00 0.33 ? 113 LEU A C    6  
ATOM 11179 O O    . LEU A 1 113 ? -5.503  1.600   -0.652  1.00 0.33 ? 113 LEU A O    6  
ATOM 11180 C CB   . LEU A 1 113 ? -4.489  4.288   -2.245  1.00 0.34 ? 113 LEU A CB   6  
ATOM 11181 C CG   . LEU A 1 113 ? -4.434  3.284   -3.398  1.00 0.35 ? 113 LEU A CG   6  
ATOM 11182 C CD1  . LEU A 1 113 ? -5.752  3.260   -4.158  1.00 0.35 ? 113 LEU A CD1  6  
ATOM 11183 C CD2  . LEU A 1 113 ? -3.282  3.612   -4.333  1.00 0.36 ? 113 LEU A CD2  6  
ATOM 11184 H H    . LEU A 1 113 ? -4.906  5.820   -0.273  1.00 0.35 ? 113 LEU A H    6  
ATOM 11185 N N    . PHE A 1 114 ? -4.067  2.854   0.555   1.00 0.34 ? 114 PHE A N    6  
ATOM 11186 C CA   . PHE A 1 114 ? -3.550  1.732   1.333   1.00 0.36 ? 114 PHE A CA   6  
ATOM 11187 C C    . PHE A 1 114 ? -4.655  1.074   2.149   1.00 0.35 ? 114 PHE A C    6  
ATOM 11188 O O    . PHE A 1 114 ? -4.734  -0.153  2.226   1.00 0.36 ? 114 PHE A O    6  
ATOM 11189 C CB   . PHE A 1 114 ? -2.407  2.178   2.253   1.00 0.38 ? 114 PHE A CB   6  
ATOM 11190 C CG   . PHE A 1 114 ? -1.038  2.003   1.653   1.00 0.42 ? 114 PHE A CG   6  
ATOM 11191 C CD1  . PHE A 1 114 ? -0.350  0.808   1.797   1.00 0.75 ? 114 PHE A CD1  6  
ATOM 11192 C CD2  . PHE A 1 114 ? -0.441  3.032   0.944   1.00 0.71 ? 114 PHE A CD2  6  
ATOM 11193 C CE1  . PHE A 1 114 ? 0.908   0.644   1.246   1.00 0.98 ? 114 PHE A CE1  6  
ATOM 11194 C CE2  . PHE A 1 114 ? 0.816   2.875   0.389   1.00 0.89 ? 114 PHE A CE2  6  
ATOM 11195 C CZ   . PHE A 1 114 ? 1.492   1.680   0.539   1.00 0.93 ? 114 PHE A CZ   6  
ATOM 11196 H H    . PHE A 1 114 ? -3.715  3.753   0.722   1.00 0.35 ? 114 PHE A H    6  
ATOM 11197 N N    . TYR A 1 115 ? -5.512  1.893   2.749   1.00 0.34 ? 115 TYR A N    6  
ATOM 11198 C CA   . TYR A 1 115 ? -6.619  1.387   3.554   1.00 0.34 ? 115 TYR A CA   6  
ATOM 11199 C C    . TYR A 1 115 ? -7.618  0.630   2.684   1.00 0.33 ? 115 TYR A C    6  
ATOM 11200 O O    . TYR A 1 115 ? -8.129  -0.422  3.070   1.00 0.33 ? 115 TYR A O    6  
ATOM 11201 C CB   . TYR A 1 115 ? -7.321  2.524   4.304   1.00 0.35 ? 115 TYR A CB   6  
ATOM 11202 C CG   . TYR A 1 115 ? -8.519  2.064   5.109   1.00 0.35 ? 115 TYR A CG   6  
ATOM 11203 C CD1  . TYR A 1 115 ? -8.358  1.471   6.354   1.00 0.37 ? 115 TYR A CD1  6  
ATOM 11204 C CD2  . TYR A 1 115 ? -9.811  2.217   4.619   1.00 0.35 ? 115 TYR A CD2  6  
ATOM 11205 C CE1  . TYR A 1 115 ? -9.448  1.039   7.086   1.00 0.39 ? 115 TYR A CE1  6  
ATOM 11206 C CE2  . TYR A 1 115 ? -10.906 1.788   5.345   1.00 0.37 ? 115 TYR A CE2  6  
ATOM 11207 C CZ   . TYR A 1 115 ? -10.718 1.201   6.578   1.00 0.39 ? 115 TYR A CZ   6  
ATOM 11208 O OH   . TYR A 1 115 ? -11.804 0.770   7.304   1.00 0.42 ? 115 TYR A OH   6  
ATOM 11209 H H    . TYR A 1 115 ? -5.396  2.863   2.648   1.00 0.34 ? 115 TYR A H    6  
ATOM 11210 H HH   . TYR A 1 115 ? -11.927 1.356   8.068   1.00 0.43 ? 115 TYR A HH   6  
ATOM 11211 N N    . PHE A 1 116 ? -7.889  1.173   1.507   1.00 0.32 ? 116 PHE A N    6  
ATOM 11212 C CA   . PHE A 1 116 ? -8.821  0.550   0.582   1.00 0.32 ? 116 PHE A CA   6  
ATOM 11213 C C    . PHE A 1 116 ? -8.262  -0.778  0.078   1.00 0.31 ? 116 PHE A C    6  
ATOM 11214 O O    . PHE A 1 116 ? -8.975  -1.780  0.011   1.00 0.31 ? 116 PHE A O    6  
ATOM 11215 C CB   . PHE A 1 116 ? -9.109  1.488   -0.593  1.00 0.32 ? 116 PHE A CB   6  
ATOM 11216 C CG   . PHE A 1 116 ? -10.303 1.091   -1.415  1.00 0.34 ? 116 PHE A CG   6  
ATOM 11217 C CD1  . PHE A 1 116 ? -11.579 1.142   -0.877  1.00 0.38 ? 116 PHE A CD1  6  
ATOM 11218 C CD2  . PHE A 1 116 ? -10.152 0.671   -2.726  1.00 0.34 ? 116 PHE A CD2  6  
ATOM 11219 C CE1  . PHE A 1 116 ? -12.682 0.784   -1.628  1.00 0.41 ? 116 PHE A CE1  6  
ATOM 11220 C CE2  . PHE A 1 116 ? -11.251 0.310   -3.484  1.00 0.37 ? 116 PHE A CE2  6  
ATOM 11221 C CZ   . PHE A 1 116 ? -12.517 0.366   -2.935  1.00 0.40 ? 116 PHE A CZ   6  
ATOM 11222 H H    . PHE A 1 116 ? -7.450  2.014   1.253   1.00 0.33 ? 116 PHE A H    6  
ATOM 11223 N N    . ALA A 1 117 ? -6.977  -0.778  -0.260  1.00 0.32 ? 117 ALA A N    6  
ATOM 11224 C CA   . ALA A 1 117 ? -6.312  -1.974  -0.761  1.00 0.32 ? 117 ALA A CA   6  
ATOM 11225 C C    . ALA A 1 117 ? -6.270  -3.080  0.291   1.00 0.33 ? 117 ALA A C    6  
ATOM 11226 O O    . ALA A 1 117 ? -6.551  -4.242  -0.011  1.00 0.33 ? 117 ALA A O    6  
ATOM 11227 C CB   . ALA A 1 117 ? -4.909  -1.649  -1.247  1.00 0.34 ? 117 ALA A CB   6  
ATOM 11228 H H    . ALA A 1 117 ? -6.463  0.054   -0.177  1.00 0.32 ? 117 ALA A H    6  
ATOM 11229 N N    . SER A 1 118 ? -5.932  -2.717  1.527   1.00 0.34 ? 118 SER A N    6  
ATOM 11230 C CA   . SER A 1 118 ? -5.853  -3.690  2.607   1.00 0.35 ? 118 SER A CA   6  
ATOM 11231 C C    . SER A 1 118 ? -7.210  -4.327  2.890   1.00 0.35 ? 118 SER A C    6  
ATOM 11232 O O    . SER A 1 118 ? -7.297  -5.524  3.166   1.00 0.35 ? 118 SER A O    6  
ATOM 11233 C CB   . SER A 1 118 ? -5.259  -3.070  3.873   1.00 0.37 ? 118 SER A CB   6  
ATOM 11234 O OG   . SER A 1 118 ? -5.775  -1.772  4.098   1.00 0.38 ? 118 SER A OG   6  
ATOM 11235 H H    . SER A 1 118 ? -5.733  -1.774  1.714   1.00 0.34 ? 118 SER A H    6  
ATOM 11236 H HG   . SER A 1 118 ? -5.287  -1.133  3.562   1.00 0.38 ? 118 SER A HG   6  
ATOM 11237 N N    . LYS A 1 119 ? -8.270  -3.527  2.808   1.00 0.34 ? 119 LYS A N    6  
ATOM 11238 C CA   . LYS A 1 119 ? -9.615  -4.030  3.041   1.00 0.35 ? 119 LYS A CA   6  
ATOM 11239 C C    . LYS A 1 119 ? -10.004 -5.028  1.955   1.00 0.34 ? 119 LYS A C    6  
ATOM 11240 O O    . LYS A 1 119 ? -10.693 -6.017  2.221   1.00 0.35 ? 119 LYS A O    6  
ATOM 11241 C CB   . LYS A 1 119 ? -10.631 -2.889  3.135   1.00 0.37 ? 119 LYS A CB   6  
ATOM 11242 C CG   . LYS A 1 119 ? -11.312 -2.783  4.493   1.00 0.40 ? 119 LYS A CG   6  
ATOM 11243 C CD   . LYS A 1 119 ? -10.328 -2.395  5.588   1.00 0.45 ? 119 LYS A CD   6  
ATOM 11244 C CE   . LYS A 1 119 ? -10.857 -2.750  6.973   1.00 0.62 ? 119 LYS A CE   6  
ATOM 11245 N NZ   . LYS A 1 119 ? -12.058 -1.953  7.344   1.00 0.44 ? 119 LYS A NZ   6  
ATOM 11246 H H    . LYS A 1 119 ? -8.139  -2.577  2.596   1.00 0.35 ? 119 LYS A H    6  
ATOM 11247 H HZ1  . LYS A 1 119 ? -12.879 -2.260  6.792   1.00 0.62 ? 119 LYS A HZ1  6  
ATOM 11248 H HZ2  . LYS A 1 119 ? -11.890 -0.939  7.165   1.00 0.46 ? 119 LYS A HZ2  6  
ATOM 11249 H HZ3  . LYS A 1 119 ? -12.270 -2.079  8.364   1.00 0.59 ? 119 LYS A HZ3  6  
ATOM 11250 N N    . LEU A 1 120 ? -9.546  -4.772  0.733   1.00 0.32 ? 120 LEU A N    6  
ATOM 11251 C CA   . LEU A 1 120 ? -9.819  -5.660  -0.386  1.00 0.32 ? 120 LEU A CA   6  
ATOM 11252 C C    . LEU A 1 120 ? -9.061  -6.968  -0.198  1.00 0.32 ? 120 LEU A C    6  
ATOM 11253 O O    . LEU A 1 120 ? -9.602  -8.051  -0.419  1.00 0.33 ? 120 LEU A O    6  
ATOM 11254 C CB   . LEU A 1 120 ? -9.407  -5.005  -1.706  1.00 0.32 ? 120 LEU A CB   6  
ATOM 11255 C CG   . LEU A 1 120 ? -10.206 -3.773  -2.133  1.00 0.32 ? 120 LEU A CG   6  
ATOM 11256 C CD1  . LEU A 1 120 ? -9.652  -3.201  -3.428  1.00 0.34 ? 120 LEU A CD1  6  
ATOM 11257 C CD2  . LEU A 1 120 ? -11.682 -4.111  -2.282  1.00 0.33 ? 120 LEU A CD2  6  
ATOM 11258 H H    . LEU A 1 120 ? -9.012  -3.963  0.584   1.00 0.32 ? 120 LEU A H    6  
ATOM 11259 N N    . VAL A 1 121 ? -7.803  -6.849  0.223   1.00 0.33 ? 121 VAL A N    6  
ATOM 11260 C CA   . VAL A 1 121 ? -6.959  -8.012  0.471   1.00 0.34 ? 121 VAL A CA   6  
ATOM 11261 C C    . VAL A 1 121 ? -7.568  -8.871  1.580   1.00 0.36 ? 121 VAL A C    6  
ATOM 11262 O O    . VAL A 1 121 ? -7.665  -10.092 1.455   1.00 0.37 ? 121 VAL A O    6  
ATOM 11263 C CB   . VAL A 1 121 ? -5.519  -7.592  0.859   1.00 0.36 ? 121 VAL A CB   6  
ATOM 11264 C CG1  . VAL A 1 121 ? -4.715  -8.781  1.369   1.00 0.36 ? 121 VAL A CG1  6  
ATOM 11265 C CG2  . VAL A 1 121 ? -4.816  -6.958  -0.334  1.00 0.37 ? 121 VAL A CG2  6  
ATOM 11266 H H    . VAL A 1 121 ? -7.432  -5.949  0.365   1.00 0.33 ? 121 VAL A H    6  
ATOM 11267 N N    . LEU A 1 122 ? -7.997  -8.217  2.653   1.00 0.37 ? 122 LEU A N    6  
ATOM 11268 C CA   . LEU A 1 122 ? -8.607  -8.909  3.782   1.00 0.40 ? 122 LEU A CA   6  
ATOM 11269 C C    . LEU A 1 122 ? -9.883  -9.626  3.342   1.00 0.39 ? 122 LEU A C    6  
ATOM 11270 O O    . LEU A 1 122 ? -10.167 -10.740 3.787   1.00 0.40 ? 122 LEU A O    6  
ATOM 11271 C CB   . LEU A 1 122 ? -8.911  -7.921  4.914   1.00 0.44 ? 122 LEU A CB   6  
ATOM 11272 C CG   . LEU A 1 122 ? -9.158  -8.534  6.297   1.00 0.85 ? 122 LEU A CG   6  
ATOM 11273 C CD1  . LEU A 1 122 ? -7.895  -9.204  6.819   1.00 1.31 ? 122 LEU A CD1  6  
ATOM 11274 C CD2  . LEU A 1 122 ? -9.647  -7.475  7.274   1.00 0.88 ? 122 LEU A CD2  6  
ATOM 11275 H H    . LEU A 1 122 ? -7.894  -7.239  2.689   1.00 0.37 ? 122 LEU A H    6  
ATOM 11276 N N    . LYS A 1 123 ? -10.638 -8.985  2.454   1.00 0.37 ? 123 LYS A N    6  
ATOM 11277 C CA   . LYS A 1 123 ? -11.876 -9.555  1.935   1.00 0.38 ? 123 LYS A CA   6  
ATOM 11278 C C    . LYS A 1 123 ? -11.579 -10.801 1.107   1.00 0.38 ? 123 LYS A C    6  
ATOM 11279 O O    . LYS A 1 123 ? -12.227 -11.839 1.269   1.00 0.40 ? 123 LYS A O    6  
ATOM 11280 C CB   . LYS A 1 123 ? -12.625 -8.519  1.090   1.00 0.40 ? 123 LYS A CB   6  
ATOM 11281 C CG   . LYS A 1 123 ? -14.085 -8.857  0.826   1.00 0.53 ? 123 LYS A CG   6  
ATOM 11282 C CD   . LYS A 1 123 ? -14.805 -7.699  0.149   1.00 0.61 ? 123 LYS A CD   6  
ATOM 11283 C CE   . LYS A 1 123 ? -16.309 -7.922  0.111   1.00 0.89 ? 123 LYS A CE   6  
ATOM 11284 N NZ   . LYS A 1 123 ? -16.710 -8.892  -0.943  1.00 1.13 ? 123 LYS A NZ   6  
ATOM 11285 H H    . LYS A 1 123 ? -10.356 -8.098  2.140   1.00 0.38 ? 123 LYS A H    6  
ATOM 11286 H HZ1  . LYS A 1 123 ? -16.012 -9.658  -1.013  1.00 1.50 ? 123 LYS A HZ1  6  
ATOM 11287 H HZ2  . LYS A 1 123 ? -16.784 -8.413  -1.865  1.00 1.50 ? 123 LYS A HZ2  6  
ATOM 11288 H HZ3  . LYS A 1 123 ? -17.635 -9.307  -0.708  1.00 1.55 ? 123 LYS A HZ3  6  
ATOM 11289 N N    . ALA A 1 124 ? -10.586 -10.694 0.231   1.00 0.37 ? 124 ALA A N    6  
ATOM 11290 C CA   . ALA A 1 124 ? -10.185 -11.811 -0.617  1.00 0.39 ? 124 ALA A CA   6  
ATOM 11291 C C    . ALA A 1 124 ? -9.628  -12.951 0.232   1.00 0.40 ? 124 ALA A C    6  
ATOM 11292 O O    . ALA A 1 124 ? -9.796  -14.131 -0.091  1.00 0.42 ? 124 ALA A O    6  
ATOM 11293 C CB   . ALA A 1 124 ? -9.165  -11.356 -1.648  1.00 0.40 ? 124 ALA A CB   6  
ATOM 11294 H H    . ALA A 1 124 ? -10.113 -9.836  0.146   1.00 0.36 ? 124 ALA A H    6  
ATOM 11295 N N    . LEU A 1 125 ? -8.973  -12.589 1.330   1.00 0.40 ? 125 LEU A N    6  
ATOM 11296 C CA   . LEU A 1 125 ? -8.412  -13.569 2.250   1.00 0.42 ? 125 LEU A CA   6  
ATOM 11297 C C    . LEU A 1 125 ? -9.533  -14.407 2.859   1.00 0.44 ? 125 LEU A C    6  
ATOM 11298 O O    . LEU A 1 125 ? -9.387  -15.613 3.064   1.00 0.47 ? 125 LEU A O    6  
ATOM 11299 C CB   . LEU A 1 125 ? -7.615  -12.867 3.353   1.00 0.43 ? 125 LEU A CB   6  
ATOM 11300 C CG   . LEU A 1 125 ? -6.860  -13.769 4.329   1.00 0.47 ? 125 LEU A CG   6  
ATOM 11301 C CD1  . LEU A 1 125 ? -5.770  -14.550 3.613   1.00 0.51 ? 125 LEU A CD1  6  
ATOM 11302 C CD2  . LEU A 1 125 ? -6.279  -12.953 5.472   1.00 0.50 ? 125 LEU A CD2  6  
ATOM 11303 H H    . LEU A 1 125 ? -8.850  -11.632 1.517   1.00 0.39 ? 125 LEU A H    6  
ATOM 11304 N N    . CYS A 1 126 ? -10.666 -13.759 3.110   1.00 0.44 ? 126 CYS A N    6  
ATOM 11305 C CA   . CYS A 1 126 ? -11.831 -14.430 3.678   1.00 0.47 ? 126 CYS A CA   6  
ATOM 11306 C C    . CYS A 1 126 ? -12.524 -15.294 2.618   1.00 0.49 ? 126 CYS A C    6  
ATOM 11307 O O    . CYS A 1 126 ? -13.421 -16.081 2.921   1.00 0.57 ? 126 CYS A O    6  
ATOM 11308 C CB   . CYS A 1 126 ? -12.809 -13.405 4.256   1.00 0.49 ? 126 CYS A CB   6  
ATOM 11309 S SG   . CYS A 1 126 ? -12.075 -12.284 5.472   1.00 0.53 ? 126 CYS A SG   6  
ATOM 11310 H H    . CYS A 1 126 ? -10.720 -12.801 2.910   1.00 0.44 ? 126 CYS A H    6  
ATOM 11311 H HG   . CYS A 1 126 ? -11.127 -11.580 4.859   1.00 0.48 ? 126 CYS A HG   6  
ATOM 11312 N N    . THR A 1 127 ? -12.099 -15.136 1.370   1.00 0.46 ? 127 THR A N    6  
ATOM 11313 C CA   . THR A 1 127 ? -12.654 -15.910 0.265   1.00 0.48 ? 127 THR A CA   6  
ATOM 11314 C C    . THR A 1 127 ? -11.728 -17.094 -0.039  1.00 0.49 ? 127 THR A C    6  
ATOM 11315 O O    . THR A 1 127 ? -11.975 -17.884 -0.952  1.00 0.55 ? 127 THR A O    6  
ATOM 11316 C CB   . THR A 1 127 ? -12.823 -15.037 -0.999  1.00 0.49 ? 127 THR A CB   6  
ATOM 11317 O OG1  . THR A 1 127 ? -13.262 -13.722 -0.620  1.00 0.53 ? 127 THR A OG1  6  
ATOM 11318 C CG2  . THR A 1 127 ? -13.852 -15.644 -1.943  1.00 0.56 ? 127 THR A CG2  6  
ATOM 11319 H H    . THR A 1 127 ? -11.387 -14.486 1.188   1.00 0.45 ? 127 THR A H    6  
ATOM 11320 H HG1  . THR A 1 127 ? -12.961 -13.525 0.273   1.00 0.87 ? 127 THR A HG1  6  
ATOM 11321 N N    . LYS A 1 128 ? -10.655 -17.195 0.753   1.00 0.47 ? 128 LYS A N    6  
ATOM 11322 C CA   . LYS A 1 128 ? -9.666  -18.266 0.630   1.00 0.50 ? 128 LYS A CA   6  
ATOM 11323 C C    . LYS A 1 128 ? -9.005  -18.317 -0.748  1.00 0.46 ? 128 LYS A C    6  
ATOM 11324 O O    . LYS A 1 128 ? -8.771  -19.395 -1.297  1.00 0.54 ? 128 LYS A O    6  
ATOM 11325 C CB   . LYS A 1 128 ? -10.251 -19.628 1.025   1.00 0.60 ? 128 LYS A CB   6  
ATOM 11326 C CG   . LYS A 1 128 ? -10.478 -19.797 2.523   1.00 0.67 ? 128 LYS A CG   6  
ATOM 11327 C CD   . LYS A 1 128 ? -9.194  -19.575 3.309   1.00 0.98 ? 128 LYS A CD   6  
ATOM 11328 C CE   . LYS A 1 128 ? -9.432  -19.680 4.808   1.00 1.15 ? 128 LYS A CE   6  
ATOM 11329 N NZ   . LYS A 1 128 ? -9.561  -21.091 5.257   1.00 1.40 ? 128 LYS A NZ   6  
ATOM 11330 H H    . LYS A 1 128 ? -10.523 -16.516 1.446   1.00 0.46 ? 128 LYS A H    6  
ATOM 11331 H HZ1  . LYS A 1 128 ? -8.627  -21.547 5.289   1.00 1.68 ? 128 LYS A HZ1  6  
ATOM 11332 H HZ2  . LYS A 1 128 ? -10.168 -21.623 4.603   1.00 1.63 ? 128 LYS A HZ2  6  
ATOM 11333 H HZ3  . LYS A 1 128 ? -9.983  -21.129 6.208   1.00 1.70 ? 128 LYS A HZ3  6  
ATOM 11334 N N    . VAL A 1 129 ? -8.696  -17.147 -1.295  1.00 0.42 ? 129 VAL A N    6  
ATOM 11335 C CA   . VAL A 1 129 ? -8.048  -17.065 -2.599  1.00 0.39 ? 129 VAL A CA   6  
ATOM 11336 C C    . VAL A 1 129 ? -6.722  -16.291 -2.508  1.00 0.35 ? 129 VAL A C    6  
ATOM 11337 O O    . VAL A 1 129 ? -6.671  -15.073 -2.695  1.00 0.34 ? 129 VAL A O    6  
ATOM 11338 C CB   . VAL A 1 129 ? -8.988  -16.492 -3.692  1.00 0.40 ? 129 VAL A CB   6  
ATOM 11339 C CG1  . VAL A 1 129 ? -9.608  -15.166 -3.273  1.00 0.39 ? 129 VAL A CG1  6  
ATOM 11340 C CG2  . VAL A 1 129 ? -8.281  -16.377 -5.035  1.00 0.40 ? 129 VAL A CG2  6  
ATOM 11341 H H    . VAL A 1 129 ? -8.903  -16.320 -0.812  1.00 0.46 ? 129 VAL A H    6  
ATOM 11342 N N    . PRO A 1 130 ? -5.628  -17.006 -2.194  1.00 0.37 ? 130 PRO A N    6  
ATOM 11343 C CA   . PRO A 1 130 ? -4.292  -16.410 -2.051  1.00 0.37 ? 130 PRO A CA   6  
ATOM 11344 C C    . PRO A 1 130 ? -3.759  -15.822 -3.355  1.00 0.33 ? 130 PRO A C    6  
ATOM 11345 O O    . PRO A 1 130 ? -3.008  -14.845 -3.341  1.00 0.32 ? 130 PRO A O    6  
ATOM 11346 C CB   . PRO A 1 130 ? -3.410  -17.584 -1.602  1.00 0.43 ? 130 PRO A CB   6  
ATOM 11347 C CG   . PRO A 1 130 ? -4.362  -18.629 -1.129  1.00 0.47 ? 130 PRO A CG   6  
ATOM 11348 C CD   . PRO A 1 130 ? -5.605  -18.453 -1.948  1.00 0.43 ? 130 PRO A CD   6  
ATOM 11349 N N    . GLU A 1 131 ? -4.158  -16.412 -4.478  1.00 0.34 ? 131 GLU A N    6  
ATOM 11350 C CA   . GLU A 1 131 ? -3.709  -15.943 -5.783  1.00 0.36 ? 131 GLU A CA   6  
ATOM 11351 C C    . GLU A 1 131 ? -4.158  -14.511 -6.047  1.00 0.32 ? 131 GLU A C    6  
ATOM 11352 O O    . GLU A 1 131 ? -3.386  -13.699 -6.557  1.00 0.34 ? 131 GLU A O    6  
ATOM 11353 C CB   . GLU A 1 131 ? -4.187  -16.878 -6.891  1.00 0.43 ? 131 GLU A CB   6  
ATOM 11354 C CG   . GLU A 1 131 ? -3.126  -17.858 -7.358  1.00 0.75 ? 131 GLU A CG   6  
ATOM 11355 C CD   . GLU A 1 131 ? -1.915  -17.158 -7.938  1.00 1.18 ? 131 GLU A CD   6  
ATOM 11356 O OE1  . GLU A 1 131 ? -2.084  -16.352 -8.877  1.00 1.55 ? 131 GLU A OE1  6  
ATOM 11357 O OE2  . GLU A 1 131 ? -0.789  -17.407 -7.461  1.00 1.54 ? 131 GLU A OE2  6  
ATOM 11358 H H    . GLU A 1 131 ? -4.768  -17.177 -4.429  1.00 0.37 ? 131 GLU A H    6  
ATOM 11359 N N    . LEU A 1 132 ? -5.396  -14.200 -5.674  1.00 0.32 ? 132 LEU A N    6  
ATOM 11360 C CA   . LEU A 1 132 ? -5.935  -12.856 -5.866  1.00 0.32 ? 132 LEU A CA   6  
ATOM 11361 C C    . LEU A 1 132 ? -5.117  -11.846 -5.071  1.00 0.31 ? 132 LEU A C    6  
ATOM 11362 O O    . LEU A 1 132 ? -4.865  -10.736 -5.536  1.00 0.34 ? 132 LEU A O    6  
ATOM 11363 C CB   . LEU A 1 132 ? -7.412  -12.792 -5.463  1.00 0.33 ? 132 LEU A CB   6  
ATOM 11364 C CG   . LEU A 1 132 ? -8.143  -11.480 -5.767  1.00 0.34 ? 132 LEU A CG   6  
ATOM 11365 C CD1  . LEU A 1 132 ? -8.038  -11.131 -7.244  1.00 0.36 ? 132 LEU A CD1  6  
ATOM 11366 C CD2  . LEU A 1 132 ? -9.600  -11.570 -5.343  1.00 0.36 ? 132 LEU A CD2  6  
ATOM 11367 H H    . LEU A 1 132 ? -5.960  -14.889 -5.262  1.00 0.34 ? 132 LEU A H    6  
ATOM 11368 N N    . ILE A 1 133 ? -4.675  -12.258 -3.887  1.00 0.31 ? 133 ILE A N    6  
ATOM 11369 C CA   . ILE A 1 133 ? -3.865  -11.405 -3.023  1.00 0.33 ? 133 ILE A CA   6  
ATOM 11370 C C    . ILE A 1 133 ? -2.580  -11.016 -3.745  1.00 0.34 ? 133 ILE A C    6  
ATOM 11371 O O    . ILE A 1 133 ? -2.132  -9.871  -3.675  1.00 0.38 ? 133 ILE A O    6  
ATOM 11372 C CB   . ILE A 1 133 ? -3.488  -12.131 -1.709  1.00 0.34 ? 133 ILE A CB   6  
ATOM 11373 C CG1  . ILE A 1 133 ? -4.725  -12.735 -1.032  1.00 0.36 ? 133 ILE A CG1  6  
ATOM 11374 C CG2  . ILE A 1 133 ? -2.752  -11.198 -0.757  1.00 0.38 ? 133 ILE A CG2  6  
ATOM 11375 C CD1  . ILE A 1 133 ? -5.775  -11.720 -0.641  1.00 0.39 ? 133 ILE A CD1  6  
ATOM 11376 H H    . ILE A 1 133 ? -4.901  -13.161 -3.584  1.00 0.31 ? 133 ILE A H    6  
ATOM 11377 N N    . ARG A 1 134 ? -2.006  -11.978 -4.462  1.00 0.32 ? 134 ARG A N    6  
ATOM 11378 C CA   . ARG A 1 134 ? -0.773  -11.749 -5.199  1.00 0.35 ? 134 ARG A CA   6  
ATOM 11379 C C    . ARG A 1 134 ? -1.029  -10.822 -6.383  1.00 0.37 ? 134 ARG A C    6  
ATOM 11380 O O    . ARG A 1 134 ? -0.225  -9.937  -6.675  1.00 0.40 ? 134 ARG A O    6  
ATOM 11381 C CB   . ARG A 1 134 ? -0.162  -13.071 -5.674  1.00 0.37 ? 134 ARG A CB   6  
ATOM 11382 C CG   . ARG A 1 134 ? -0.162  -14.179 -4.628  1.00 0.67 ? 134 ARG A CG   6  
ATOM 11383 C CD   . ARG A 1 134 ? 0.486   -13.727 -3.326  1.00 1.16 ? 134 ARG A CD   6  
ATOM 11384 N NE   . ARG A 1 134 ? 1.945   -13.731 -3.404  1.00 1.04 ? 134 ARG A NE   6  
ATOM 11385 C CZ   . ARG A 1 134 ? 2.726   -12.778 -2.900  1.00 1.20 ? 134 ARG A CZ   6  
ATOM 11386 N NH1  . ARG A 1 134 ? 2.193   -11.728 -2.283  1.00 1.47 ? 134 ARG A NH1  6  
ATOM 11387 N NH2  . ARG A 1 134 ? 4.041   -12.879 -3.018  1.00 1.35 ? 134 ARG A NH2  6  
ATOM 11388 H H    . ARG A 1 134 ? -2.432  -12.863 -4.501  1.00 0.32 ? 134 ARG A H    6  
ATOM 11389 H HE   . ARG A 1 134 ? 2.368   -14.500 -3.857  1.00 1.07 ? 134 ARG A HE   6  
ATOM 11390 H HH11 . ARG A 1 134 ? 1.200   -11.647 -2.192  1.00 1.53 ? 134 ARG A HH11 6  
ATOM 11391 H HH12 . ARG A 1 134 ? 2.785   -11.008 -1.908  1.00 1.73 ? 134 ARG A HH12 6  
ATOM 11392 H HH21 . ARG A 1 134 ? 4.446   -13.679 -3.490  1.00 1.37 ? 134 ARG A HH21 6  
ATOM 11393 H HH22 . ARG A 1 134 ? 4.640   -12.164 -2.646  1.00 1.59 ? 134 ARG A HH22 6  
ATOM 11394 N N    . THR A 1 135 ? -2.159  -11.021 -7.052  1.00 0.38 ? 135 THR A N    6  
ATOM 11395 C CA   . THR A 1 135 ? -2.524  -10.191 -8.192  1.00 0.42 ? 135 THR A CA   6  
ATOM 11396 C C    . THR A 1 135 ? -2.749  -8.741  -7.761  1.00 0.43 ? 135 THR A C    6  
ATOM 11397 O O    . THR A 1 135 ? -2.270  -7.814  -8.414  1.00 0.47 ? 135 THR A O    6  
ATOM 11398 C CB   . THR A 1 135 ? -3.778  -10.726 -8.908  1.00 0.45 ? 135 THR A CB   6  
ATOM 11399 O OG1  . THR A 1 135 ? -3.718  -12.158 -8.954  1.00 0.51 ? 135 THR A OG1  6  
ATOM 11400 C CG2  . THR A 1 135 ? -3.832  -10.196 -10.331 1.00 0.52 ? 135 THR A CG2  6  
ATOM 11401 H H    . THR A 1 135 ? -2.759  -11.754 -6.778  1.00 0.38 ? 135 THR A H    6  
ATOM 11402 H HG1  . THR A 1 135 ? -4.602  -12.508 -9.118  1.00 0.83 ? 135 THR A HG1  6  
ATOM 11403 N N    . ILE A 1 136 ? -3.462  -8.555  -6.653  1.00 0.42 ? 136 ILE A N    6  
ATOM 11404 C CA   . ILE A 1 136 ? -3.731  -7.217  -6.130  1.00 0.45 ? 136 ILE A CA   6  
ATOM 11405 C C    . ILE A 1 136 ? -2.418  -6.521  -5.783  1.00 0.46 ? 136 ILE A C    6  
ATOM 11406 O O    . ILE A 1 136 ? -2.241  -5.334  -6.065  1.00 0.49 ? 136 ILE A O    6  
ATOM 11407 C CB   . ILE A 1 136 ? -4.650  -7.259  -4.886  1.00 0.45 ? 136 ILE A CB   6  
ATOM 11408 C CG1  . ILE A 1 136 ? -6.010  -7.858  -5.253  1.00 0.44 ? 136 ILE A CG1  6  
ATOM 11409 C CG2  . ILE A 1 136 ? -4.827  -5.865  -4.298  1.00 0.49 ? 136 ILE A CG2  6  
ATOM 11410 C CD1  . ILE A 1 136 ? -6.901  -8.145  -4.059  1.00 0.46 ? 136 ILE A CD1  6  
ATOM 11411 H H    . ILE A 1 136 ? -3.821  -9.337  -6.173  1.00 0.40 ? 136 ILE A H    6  
ATOM 11412 N N    . MET A 1 137 ? -1.496  -7.275  -5.188  1.00 0.45 ? 137 MET A N    6  
ATOM 11413 C CA   . MET A 1 137 ? -0.188  -6.745  -4.822  1.00 0.47 ? 137 MET A CA   6  
ATOM 11414 C C    . MET A 1 137 ? 0.538   -6.256  -6.074  1.00 0.48 ? 137 MET A C    6  
ATOM 11415 O O    . MET A 1 137 ? 1.090   -5.154  -6.098  1.00 0.49 ? 137 MET A O    6  
ATOM 11416 C CB   . MET A 1 137 ? 0.639   -7.817  -4.103  1.00 0.48 ? 137 MET A CB   6  
ATOM 11417 C CG   . MET A 1 137 ? 1.921   -7.301  -3.466  1.00 0.46 ? 137 MET A CG   6  
ATOM 11418 S SD   . MET A 1 137 ? 2.800   -8.577  -2.541  1.00 0.49 ? 137 MET A SD   6  
ATOM 11419 C CE   . MET A 1 137 ? 4.153   -7.624  -1.854  1.00 0.57 ? 137 MET A CE   6  
ATOM 11420 H H    . MET A 1 137 ? -1.707  -8.212  -4.983  1.00 0.44 ? 137 MET A H    6  
ATOM 11421 N N    . GLY A 1 138 ? 0.509   -7.076  -7.120  1.00 0.49 ? 138 GLY A N    6  
ATOM 11422 C CA   . GLY A 1 138 ? 1.145   -6.712  -8.369  1.00 0.51 ? 138 GLY A CA   6  
ATOM 11423 C C    . GLY A 1 138 ? 0.474   -5.513  -9.005  1.00 0.52 ? 138 GLY A C    6  
ATOM 11424 O O    . GLY A 1 138 ? 1.144   -4.645  -9.559  1.00 0.53 ? 138 GLY A O    6  
ATOM 11425 H H    . GLY A 1 138 ? 0.051   -7.942  -7.038  1.00 0.50 ? 138 GLY A H    6  
ATOM 11426 N N    . TRP A 1 139 ? -0.854  -5.466  -8.909  1.00 0.53 ? 139 TRP A N    6  
ATOM 11427 C CA   . TRP A 1 139 ? -1.634  -4.357  -9.460  1.00 0.57 ? 139 TRP A CA   6  
ATOM 11428 C C    . TRP A 1 139 ? -1.280  -3.047  -8.772  1.00 0.53 ? 139 TRP A C    6  
ATOM 11429 O O    . TRP A 1 139 ? -1.209  -1.998  -9.413  1.00 0.54 ? 139 TRP A O    6  
ATOM 11430 C CB   . TRP A 1 139 ? -3.135  -4.613  -9.295  1.00 0.65 ? 139 TRP A CB   6  
ATOM 11431 C CG   . TRP A 1 139 ? -3.721  -5.540  -10.314 1.00 0.69 ? 139 TRP A CG   6  
ATOM 11432 C CD1  . TRP A 1 139 ? -3.209  -5.843  -11.542 1.00 0.72 ? 139 TRP A CD1  6  
ATOM 11433 C CD2  . TRP A 1 139 ? -4.940  -6.283  -10.192 1.00 0.78 ? 139 TRP A CD2  6  
ATOM 11434 N NE1  . TRP A 1 139 ? -4.033  -6.728  -12.190 1.00 0.81 ? 139 TRP A NE1  6  
ATOM 11435 C CE2  . TRP A 1 139 ? -5.104  -7.013  -11.385 1.00 0.84 ? 139 TRP A CE2  6  
ATOM 11436 C CE3  . TRP A 1 139 ? -5.909  -6.400  -9.191  1.00 0.84 ? 139 TRP A CE3  6  
ATOM 11437 C CZ2  . TRP A 1 139 ? -6.195  -7.849  -11.604 1.00 0.95 ? 139 TRP A CZ2  6  
ATOM 11438 C CZ3  . TRP A 1 139 ? -6.991  -7.231  -9.410  1.00 0.95 ? 139 TRP A CZ3  6  
ATOM 11439 C CH2  . TRP A 1 139 ? -7.125  -7.945  -10.606 1.00 1.00 ? 139 TRP A CH2  6  
ATOM 11440 H H    . TRP A 1 139 ? -1.324  -6.208  -8.466  1.00 0.55 ? 139 TRP A H    6  
ATOM 11441 H HE1  . TRP A 1 139 ? -3.877  -7.097  -13.090 1.00 0.86 ? 139 TRP A HE1  6  
ATOM 11442 N N    . THR A 1 140 ? -1.078  -3.116  -7.462  1.00 0.51 ? 140 THR A N    6  
ATOM 11443 C CA   . THR A 1 140 ? -0.722  -1.946  -6.682  1.00 0.51 ? 140 THR A CA   6  
ATOM 11444 C C    . THR A 1 140 ? 0.662   -1.455  -7.088  1.00 0.47 ? 140 THR A C    6  
ATOM 11445 O O    . THR A 1 140 ? 0.865   -0.263  -7.322  1.00 0.53 ? 140 THR A O    6  
ATOM 11446 C CB   . THR A 1 140 ? -0.731  -2.267  -5.175  1.00 0.53 ? 140 THR A CB   6  
ATOM 11447 O OG1  . THR A 1 140 ? -1.963  -2.922  -4.836  1.00 0.55 ? 140 THR A OG1  6  
ATOM 11448 C CG2  . THR A 1 140 ? -0.601  -0.991  -4.359  1.00 0.54 ? 140 THR A CG2  6  
ATOM 11449 H H    . THR A 1 140 ? -1.172  -3.979  -7.010  1.00 0.52 ? 140 THR A H    6  
ATOM 11450 H HG1  . THR A 1 140 ? -2.030  -3.759  -5.313  1.00 0.67 ? 140 THR A HG1  6  
ATOM 11451 N N    . LEU A 1 141 ? 1.602   -2.388  -7.196  1.00 0.41 ? 141 LEU A N    6  
ATOM 11452 C CA   . LEU A 1 141 ? 2.965   -2.056  -7.584  1.00 0.42 ? 141 LEU A CA   6  
ATOM 11453 C C    . LEU A 1 141 ? 3.000   -1.524  -9.013  1.00 0.42 ? 141 LEU A C    6  
ATOM 11454 O O    . LEU A 1 141 ? 3.767   -0.610  -9.322  1.00 0.41 ? 141 LEU A O    6  
ATOM 11455 C CB   . LEU A 1 141 ? 3.881   -3.277  -7.444  1.00 0.44 ? 141 LEU A CB   6  
ATOM 11456 C CG   . LEU A 1 141 ? 4.096   -3.805  -6.022  1.00 0.48 ? 141 LEU A CG   6  
ATOM 11457 C CD1  . LEU A 1 141 ? 4.851   -5.123  -6.048  1.00 0.55 ? 141 LEU A CD1  6  
ATOM 11458 C CD2  . LEU A 1 141 ? 4.838   -2.781  -5.174  1.00 0.53 ? 141 LEU A CD2  6  
ATOM 11459 H H    . LEU A 1 141 ? 1.373   -3.325  -7.006  1.00 0.40 ? 141 LEU A H    6  
ATOM 11460 N N    . ASP A 1 142 ? 2.158   -2.102  -9.870  1.00 0.51 ? 142 ASP A N    6  
ATOM 11461 C CA   . ASP A 1 142 ? 2.060   -1.699  -11.273 1.00 0.54 ? 142 ASP A CA   6  
ATOM 11462 C C    . ASP A 1 142 ? 1.808   -0.201  -11.389 1.00 0.51 ? 142 ASP A C    6  
ATOM 11463 O O    . ASP A 1 142 ? 2.566   0.516   -12.038 1.00 0.53 ? 142 ASP A O    6  
ATOM 11464 C CB   . ASP A 1 142 ? 0.941   -2.486  -11.972 1.00 0.62 ? 142 ASP A CB   6  
ATOM 11465 C CG   . ASP A 1 142 ? 0.565   -1.946  -13.343 1.00 0.82 ? 142 ASP A CG   6  
ATOM 11466 O OD1  . ASP A 1 142 ? 1.340   -2.137  -14.307 1.00 0.96 ? 142 ASP A OD1  6  
ATOM 11467 O OD2  . ASP A 1 142 ? -0.529  -1.350  -13.469 1.00 1.12 ? 142 ASP A OD2  6  
ATOM 11468 H H    . ASP A 1 142 ? 1.586   -2.832  -9.548  1.00 0.59 ? 142 ASP A H    6  
ATOM 11469 N N    . PHE A 1 143 ? 0.764   0.269   -10.713 1.00 0.52 ? 143 PHE A N    6  
ATOM 11470 C CA   . PHE A 1 143 ? 0.405   1.684   -10.734 1.00 0.54 ? 143 PHE A CA   6  
ATOM 11471 C C    . PHE A 1 143 ? 1.524   2.545   -10.147 1.00 0.48 ? 143 PHE A C    6  
ATOM 11472 O O    . PHE A 1 143 ? 1.724   3.694   -10.556 1.00 0.50 ? 143 PHE A O    6  
ATOM 11473 C CB   . PHE A 1 143 ? -0.908  1.915   -9.978  1.00 0.64 ? 143 PHE A CB   6  
ATOM 11474 C CG   . PHE A 1 143 ? -1.507  3.276   -10.195 1.00 0.66 ? 143 PHE A CG   6  
ATOM 11475 C CD1  . PHE A 1 143 ? -1.988  3.645   -11.441 1.00 0.70 ? 143 PHE A CD1  6  
ATOM 11476 C CD2  . PHE A 1 143 ? -1.582  4.188   -9.156  1.00 0.77 ? 143 PHE A CD2  6  
ATOM 11477 C CE1  . PHE A 1 143 ? -2.535  4.899   -11.647 1.00 0.81 ? 143 PHE A CE1  6  
ATOM 11478 C CE2  . PHE A 1 143 ? -2.126  5.443   -9.355  1.00 0.86 ? 143 PHE A CE2  6  
ATOM 11479 C CZ   . PHE A 1 143 ? -2.604  5.800   -10.603 1.00 0.86 ? 143 PHE A CZ   6  
ATOM 11480 H H    . PHE A 1 143 ? 0.218   -0.356  -10.189 1.00 0.56 ? 143 PHE A H    6  
ATOM 11481 N N    . LEU A 1 144 ? 2.256   1.980   -9.194  1.00 0.43 ? 144 LEU A N    6  
ATOM 11482 C CA   . LEU A 1 144 ? 3.355   2.690   -8.559  1.00 0.41 ? 144 LEU A CA   6  
ATOM 11483 C C    . LEU A 1 144 ? 4.466   2.969   -9.565  1.00 0.41 ? 144 LEU A C    6  
ATOM 11484 O O    . LEU A 1 144 ? 4.922   4.103   -9.697  1.00 0.43 ? 144 LEU A O    6  
ATOM 11485 C CB   . LEU A 1 144 ? 3.908   1.907   -7.364  1.00 0.41 ? 144 LEU A CB   6  
ATOM 11486 C CG   . LEU A 1 144 ? 2.954   1.688   -6.185  1.00 0.72 ? 144 LEU A CG   6  
ATOM 11487 C CD1  . LEU A 1 144 ? 3.615   0.833   -5.115  1.00 1.07 ? 144 LEU A CD1  6  
ATOM 11488 C CD2  . LEU A 1 144 ? 2.500   3.016   -5.600  1.00 1.34 ? 144 LEU A CD2  6  
ATOM 11489 H H    . LEU A 1 144 ? 2.053   1.062   -8.918  1.00 0.43 ? 144 LEU A H    6  
ATOM 11490 N N    . ARG A 1 145 ? 4.884   1.940   -10.292 1.00 0.42 ? 145 ARG A N    6  
ATOM 11491 C CA   . ARG A 1 145 ? 5.945   2.094   -11.284 1.00 0.46 ? 145 ARG A CA   6  
ATOM 11492 C C    . ARG A 1 145 ? 5.463   2.928   -12.468 1.00 0.46 ? 145 ARG A C    6  
ATOM 11493 O O    . ARG A 1 145 ? 6.252   3.626   -13.110 1.00 0.55 ? 145 ARG A O    6  
ATOM 11494 C CB   . ARG A 1 145 ? 6.448   0.729   -11.768 1.00 0.54 ? 145 ARG A CB   6  
ATOM 11495 C CG   . ARG A 1 145 ? 7.762   0.774   -12.535 1.00 0.66 ? 145 ARG A CG   6  
ATOM 11496 C CD   . ARG A 1 145 ? 8.876   1.354   -11.680 1.00 1.01 ? 145 ARG A CD   6  
ATOM 11497 N NE   . ARG A 1 145 ? 10.192  1.228   -12.306 1.00 1.10 ? 145 ARG A NE   6  
ATOM 11498 C CZ   . ARG A 1 145 ? 11.118  0.356   -11.913 1.00 1.24 ? 145 ARG A CZ   6  
ATOM 11499 N NH1  . ARG A 1 145 ? 10.844  -0.517  -10.955 1.00 1.40 ? 145 ARG A NH1  6  
ATOM 11500 N NH2  . ARG A 1 145 ? 12.311  0.345   -12.484 1.00 1.43 ? 145 ARG A NH2  6  
ATOM 11501 H H    . ARG A 1 145 ? 4.464   1.058   -10.165 1.00 0.42 ? 145 ARG A H    6  
ATOM 11502 H HE   . ARG A 1 145 ? 10.404  1.848   -13.044 1.00 1.24 ? 145 ARG A HE   6  
ATOM 11503 H HH11 . ARG A 1 145 ? 9.941   -0.525  -10.526 1.00 1.42 ? 145 ARG A HH11 6  
ATOM 11504 H HH12 . ARG A 1 145 ? 11.556  -1.171  -10.639 1.00 1.63 ? 145 ARG A HH12 6  
ATOM 11505 H HH21 . ARG A 1 145 ? 12.523  0.997   -13.218 1.00 1.54 ? 145 ARG A HH21 6  
ATOM 11506 H HH22 . ARG A 1 145 ? 13.013  -0.315  -12.178 1.00 1.57 ? 145 ARG A HH22 6  
ATOM 11507 N N    . GLU A 1 146 ? 4.166   2.855   -12.740 1.00 0.50 ? 146 GLU A N    6  
ATOM 11508 C CA   . GLU A 1 146 ? 3.567   3.592   -13.842 1.00 0.55 ? 146 GLU A CA   6  
ATOM 11509 C C    . GLU A 1 146 ? 3.666   5.104   -13.657 1.00 0.56 ? 146 GLU A C    6  
ATOM 11510 O O    . GLU A 1 146 ? 3.985   5.820   -14.606 1.00 0.74 ? 146 GLU A O    6  
ATOM 11511 C CB   . GLU A 1 146 ? 2.110   3.171   -14.060 1.00 0.62 ? 146 GLU A CB   6  
ATOM 11512 C CG   . GLU A 1 146 ? 1.947   1.821   -14.743 1.00 0.89 ? 146 GLU A CG   6  
ATOM 11513 C CD   . GLU A 1 146 ? 2.017   1.907   -16.255 1.00 1.31 ? 146 GLU A CD   6  
ATOM 11514 O OE1  . GLU A 1 146 ? 3.020   2.434   -16.785 1.00 1.61 ? 146 GLU A OE1  6  
ATOM 11515 O OE2  . GLU A 1 146 ? 1.059   1.450   -16.923 1.00 1.82 ? 146 GLU A OE2  6  
ATOM 11516 H H    . GLU A 1 146 ? 3.595   2.274   -12.191 1.00 0.58 ? 146 GLU A H    6  
ATOM 11517 N N    . ARG A 1 147 ? 3.417   5.596   -12.440 1.00 0.51 ? 147 ARG A N    6  
ATOM 11518 C CA   . ARG A 1 147 ? 3.467   7.040   -12.192 1.00 0.57 ? 147 ARG A CA   6  
ATOM 11519 C C    . ARG A 1 147 ? 4.054   7.421   -10.827 1.00 0.51 ? 147 ARG A C    6  
ATOM 11520 O O    . ARG A 1 147 ? 4.925   8.287   -10.747 1.00 0.53 ? 147 ARG A O    6  
ATOM 11521 C CB   . ARG A 1 147 ? 2.079   7.679   -12.358 1.00 0.73 ? 147 ARG A CB   6  
ATOM 11522 C CG   . ARG A 1 147 ? 1.620   7.859   -13.804 1.00 0.88 ? 147 ARG A CG   6  
ATOM 11523 C CD   . ARG A 1 147 ? 2.441   8.915   -14.535 1.00 1.01 ? 147 ARG A CD   6  
ATOM 11524 N NE   . ARG A 1 147 ? 3.822   8.487   -14.755 1.00 1.03 ? 147 ARG A NE   6  
ATOM 11525 C CZ   . ARG A 1 147 ? 4.889   9.251   -14.543 1.00 1.32 ? 147 ARG A CZ   6  
ATOM 11526 N NH1  . ARG A 1 147 ? 4.748   10.513  -14.152 1.00 1.56 ? 147 ARG A NH1  6  
ATOM 11527 N NH2  . ARG A 1 147 ? 6.104   8.750   -14.723 1.00 1.59 ? 147 ARG A NH2  6  
ATOM 11528 H H    . ARG A 1 147 ? 3.197   4.980   -11.707 1.00 0.55 ? 147 ARG A H    6  
ATOM 11529 H HE   . ARG A 1 147 ? 3.956   7.556   -15.063 1.00 1.04 ? 147 ARG A HE   6  
ATOM 11530 H HH11 . ARG A 1 147 ? 3.832   10.901  -14.019 1.00 1.52 ? 147 ARG A HH11 6  
ATOM 11531 H HH12 . ARG A 1 147 ? 5.554   11.085  -13.983 1.00 1.88 ? 147 ARG A HH12 6  
ATOM 11532 H HH21 . ARG A 1 147 ? 6.221   7.798   -15.019 1.00 1.57 ? 147 ARG A HH21 6  
ATOM 11533 H HH22 . ARG A 1 147 ? 6.910   9.322   -14.563 1.00 1.91 ? 147 ARG A HH22 6  
ATOM 11534 N N    . LEU A 1 148 ? 3.577   6.769   -9.771  1.00 0.48 ? 148 LEU A N    6  
ATOM 11535 C CA   . LEU A 1 148 ? 4.005   7.064   -8.397  1.00 0.47 ? 148 LEU A CA   6  
ATOM 11536 C C    . LEU A 1 148 ? 5.524   7.142   -8.198  1.00 0.41 ? 148 LEU A C    6  
ATOM 11537 O O    . LEU A 1 148 ? 6.006   7.993   -7.450  1.00 0.44 ? 148 LEU A O    6  
ATOM 11538 C CB   . LEU A 1 148 ? 3.374   6.088   -7.399  1.00 0.50 ? 148 LEU A CB   6  
ATOM 11539 C CG   . LEU A 1 148 ? 2.084   6.555   -6.711  1.00 0.59 ? 148 LEU A CG   6  
ATOM 11540 C CD1  . LEU A 1 148 ? 2.332   7.816   -5.895  1.00 0.81 ? 148 LEU A CD1  6  
ATOM 11541 C CD2  . LEU A 1 148 ? 0.970   6.773   -7.722  1.00 0.74 ? 148 LEU A CD2  6  
ATOM 11542 H H    . LEU A 1 148 ? 2.917   6.057   -9.916  1.00 0.51 ? 148 LEU A H    6  
ATOM 11543 N N    . LEU A 1 149 ? 6.267   6.267   -8.866  1.00 0.37 ? 149 LEU A N    6  
ATOM 11544 C CA   . LEU A 1 149 ? 7.723   6.238   -8.744  1.00 0.35 ? 149 LEU A CA   6  
ATOM 11545 C C    . LEU A 1 149 ? 8.347   7.604   -9.017  1.00 0.38 ? 149 LEU A C    6  
ATOM 11546 O O    . LEU A 1 149 ? 9.312   7.997   -8.361  1.00 0.39 ? 149 LEU A O    6  
ATOM 11547 C CB   . LEU A 1 149 ? 8.325   5.192   -9.684  1.00 0.39 ? 149 LEU A CB   6  
ATOM 11548 C CG   . LEU A 1 149 ? 9.825   4.931   -9.516  1.00 0.46 ? 149 LEU A CG   6  
ATOM 11549 C CD1  . LEU A 1 149 ? 10.081  3.913   -8.415  1.00 0.52 ? 149 LEU A CD1  6  
ATOM 11550 C CD2  . LEU A 1 149 ? 10.449  4.488   -10.829 1.00 0.57 ? 149 LEU A CD2  6  
ATOM 11551 H H    . LEU A 1 149 ? 5.822   5.610   -9.448  1.00 0.37 ? 149 LEU A H    6  
ATOM 11552 N N    . GLY A 1 150 ? 7.775   8.334   -9.968  1.00 0.41 ? 150 GLY A N    6  
ATOM 11553 C CA   . GLY A 1 150 ? 8.294   9.643   -10.320 1.00 0.46 ? 150 GLY A CA   6  
ATOM 11554 C C    . GLY A 1 150 ? 8.215   10.635  -9.175  1.00 0.46 ? 150 GLY A C    6  
ATOM 11555 O O    . GLY A 1 150 ? 9.092   11.487  -9.016  1.00 0.52 ? 150 GLY A O    6  
ATOM 11556 H H    . GLY A 1 150 ? 6.980   7.984   -10.427 1.00 0.43 ? 150 GLY A H    6  
ATOM 11557 N N    . TRP A 1 151 ? 7.176   10.514  -8.358  1.00 0.43 ? 151 TRP A N    6  
ATOM 11558 C CA   . TRP A 1 151 ? 6.992   11.413  -7.228  1.00 0.45 ? 151 TRP A CA   6  
ATOM 11559 C C    . TRP A 1 151 ? 7.865   10.999  -6.047  1.00 0.42 ? 151 TRP A C    6  
ATOM 11560 O O    . TRP A 1 151 ? 8.395   11.847  -5.326  1.00 0.44 ? 151 TRP A O    6  
ATOM 11561 C CB   . TRP A 1 151 ? 5.520   11.473  -6.813  1.00 0.50 ? 151 TRP A CB   6  
ATOM 11562 C CG   . TRP A 1 151 ? 5.209   12.591  -5.863  1.00 0.52 ? 151 TRP A CG   6  
ATOM 11563 C CD1  . TRP A 1 151 ? 5.774   13.833  -5.846  1.00 0.61 ? 151 TRP A CD1  6  
ATOM 11564 C CD2  . TRP A 1 151 ? 4.254   12.570  -4.797  1.00 0.52 ? 151 TRP A CD2  6  
ATOM 11565 N NE1  . TRP A 1 151 ? 5.237   14.585  -4.831  1.00 0.63 ? 151 TRP A NE1  6  
ATOM 11566 C CE2  . TRP A 1 151 ? 4.300   13.832  -4.173  1.00 0.57 ? 151 TRP A CE2  6  
ATOM 11567 C CE3  . TRP A 1 151 ? 3.365   11.605  -4.310  1.00 0.59 ? 151 TRP A CE3  6  
ATOM 11568 C CZ2  . TRP A 1 151 ? 3.491   14.154  -3.087  1.00 0.63 ? 151 TRP A CZ2  6  
ATOM 11569 C CZ3  . TRP A 1 151 ? 2.565   11.928  -3.232  1.00 0.70 ? 151 TRP A CZ3  6  
ATOM 11570 C CH2  . TRP A 1 151 ? 2.633   13.190  -2.633  1.00 0.70 ? 151 TRP A CH2  6  
ATOM 11571 H H    . TRP A 1 151 ? 6.524   9.797   -8.515  1.00 0.43 ? 151 TRP A H    6  
ATOM 11572 H HE1  . TRP A 1 151 ? 5.484   15.511  -4.616  1.00 0.71 ? 151 TRP A HE1  6  
ATOM 11573 N N    . ILE A 1 152 ? 8